data_1UJT
# 
_entry.id   1UJT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1UJT         
RCSB  RCSB005905   
WWPDB D_1000005905 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002001540.2 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1UJT 
_pdbx_database_status.recvd_initial_deposition_date   2003-08-11 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tochio, N.'                                             1 
'Koshiba, S.'                                            2 
'Kigawa, T.'                                             3 
'Yokoyama, S.'                                           4 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the second fibronectin Type III domain of human KIAA1568 protein' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tochio, N.'   1 
primary 'Koshiba, S.'  2 
primary 'Kigawa, T.'   3 
primary 'Yokoyama, S.' 4 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'KIAA1568 protein' 
_entity.formula_weight             13349.906 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'FN3 domain' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGRQVQKELGDVLVRLHNPVVLTPTTVQVTWTVDRQPQFIQGYRVMYRQTSGLQATSSWQNLDAKVPTERSAVLV
NLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEESGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGRQVQKELGDVLVRLHNPVVLTPTTVQVTWTVDRQPQFIQGYRVMYRQTSGLQATSSWQNLDAKVPTERSAVLV
NLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEESGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002001540.2 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   ARG n 
1 9   GLN n 
1 10  VAL n 
1 11  GLN n 
1 12  LYS n 
1 13  GLU n 
1 14  LEU n 
1 15  GLY n 
1 16  ASP n 
1 17  VAL n 
1 18  LEU n 
1 19  VAL n 
1 20  ARG n 
1 21  LEU n 
1 22  HIS n 
1 23  ASN n 
1 24  PRO n 
1 25  VAL n 
1 26  VAL n 
1 27  LEU n 
1 28  THR n 
1 29  PRO n 
1 30  THR n 
1 31  THR n 
1 32  VAL n 
1 33  GLN n 
1 34  VAL n 
1 35  THR n 
1 36  TRP n 
1 37  THR n 
1 38  VAL n 
1 39  ASP n 
1 40  ARG n 
1 41  GLN n 
1 42  PRO n 
1 43  GLN n 
1 44  PHE n 
1 45  ILE n 
1 46  GLN n 
1 47  GLY n 
1 48  TYR n 
1 49  ARG n 
1 50  VAL n 
1 51  MET n 
1 52  TYR n 
1 53  ARG n 
1 54  GLN n 
1 55  THR n 
1 56  SER n 
1 57  GLY n 
1 58  LEU n 
1 59  GLN n 
1 60  ALA n 
1 61  THR n 
1 62  SER n 
1 63  SER n 
1 64  TRP n 
1 65  GLN n 
1 66  ASN n 
1 67  LEU n 
1 68  ASP n 
1 69  ALA n 
1 70  LYS n 
1 71  VAL n 
1 72  PRO n 
1 73  THR n 
1 74  GLU n 
1 75  ARG n 
1 76  SER n 
1 77  ALA n 
1 78  VAL n 
1 79  LEU n 
1 80  VAL n 
1 81  ASN n 
1 82  LEU n 
1 83  LYS n 
1 84  LYS n 
1 85  GLY n 
1 86  VAL n 
1 87  THR n 
1 88  TYR n 
1 89  GLU n 
1 90  ILE n 
1 91  LYS n 
1 92  VAL n 
1 93  ARG n 
1 94  PRO n 
1 95  TYR n 
1 96  PHE n 
1 97  ASN n 
1 98  GLU n 
1 99  PHE n 
1 100 GLN n 
1 101 GLY n 
1 102 MET n 
1 103 ASP n 
1 104 SER n 
1 105 GLU n 
1 106 SER n 
1 107 LYS n 
1 108 THR n 
1 109 VAL n 
1 110 ARG n 
1 111 THR n 
1 112 THR n 
1 113 GLU n 
1 114 GLU n 
1 115 SER n 
1 116 GLY n 
1 117 PRO n 
1 118 SER n 
1 119 SER n 
1 120 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'Kazusa cDNA fh22308' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P021007-59 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ROBO2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RQVQKELGDVLVRLHNPVVLTPTTVQVTWTVDRQPQFIQGYRVMYRQTSGLQATSSWQNLDAKVPTERSAVLVNLKKGVT
YEIKVRPYFNEFQGMDSESKTVRTTEE
;
_struct_ref.pdbx_align_begin           630 
_struct_ref.pdbx_db_accession          Q9HCK4 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1UJT 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 114 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9HCK4 
_struct_ref_seq.db_align_beg                  630 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  736 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       114 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1UJT GLY A 1   ? UNP Q9HCK4 ? ? 'CLONING ARTIFACT' 1   1  
1 1UJT SER A 2   ? UNP Q9HCK4 ? ? 'CLONING ARTIFACT' 2   2  
1 1UJT SER A 3   ? UNP Q9HCK4 ? ? 'CLONING ARTIFACT' 3   3  
1 1UJT GLY A 4   ? UNP Q9HCK4 ? ? 'CLONING ARTIFACT' 4   4  
1 1UJT SER A 5   ? UNP Q9HCK4 ? ? 'CLONING ARTIFACT' 5   5  
1 1UJT SER A 6   ? UNP Q9HCK4 ? ? 'CLONING ARTIFACT' 6   6  
1 1UJT GLY A 7   ? UNP Q9HCK4 ? ? 'CLONING ARTIFACT' 7   7  
1 1UJT SER A 115 ? UNP Q9HCK4 ? ? 'CLONING ARTIFACT' 115 8  
1 1UJT GLY A 116 ? UNP Q9HCK4 ? ? 'CLONING ARTIFACT' 116 9  
1 1UJT PRO A 117 ? UNP Q9HCK4 ? ? 'CLONING ARTIFACT' 117 10 
1 1UJT SER A 118 ? UNP Q9HCK4 ? ? 'CLONING ARTIFACT' 118 11 
1 1UJT SER A 119 ? UNP Q9HCK4 ? ? 'CLONING ARTIFACT' 119 12 
1 1UJT GLY A 120 ? UNP Q9HCK4 ? ? 'CLONING ARTIFACT' 120 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
3 1 1 2D_TROSY_HNCO          
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1.0mM FN3 domain U-15N,13C; 20mM phosphate buffer NA; 100mM NaCl; 0.02% NaN3; 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker Avance 800 
2 ? Bruker Avance 600 
# 
_pdbx_nmr_refine.entry_id           1UJT 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1UJT 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1UJT 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XWINNMR 2.6       collection           Bruker          1 
XWINNMR 3.1       collection           Bruker          2 
NMRPipe 200204025 processing           'Delaglio, F.'  3 
NMRView 5.0.4     'data analysis'      'Johnson, B.A.' 4 
Kujira  0.816     'data analysis'      'Kobayashi, N.' 5 
CYANA   2.0.17    'structure solution' 'Guentert, P.'  6 
CYANA   2.0.17    refinement           'Guentert, P.'  7 
# 
_exptl.entry_id          1UJT 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1UJT 
_struct.title                     'Solution structure of the second fibronectin Type III domain of human KIAA1568 protein' 
_struct.pdbx_descriptor           'KIAA1568 protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UJT 
_struct_keywords.pdbx_keywords   'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' 
_struct_keywords.text            
'fibronectin type III domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       GLN 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        9 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       VAL 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        17 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        GLN 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         9 
_struct_conf.end_auth_comp_id        VAL 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         17 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 19  ? LEU A 21  ? VAL A 19  LEU A 21  
A 2 THR A 31  ? VAL A 38  ? THR A 31  VAL A 38  
A 3 SER A 76  ? VAL A 80  ? SER A 76  VAL A 80  
B 1 GLN A 65  ? ASP A 68  ? GLN A 65  ASP A 68  
B 2 GLY A 47  ? GLN A 54  ? GLY A 47  GLN A 54  
B 3 VAL A 86  ? TYR A 95  ? VAL A 86  TYR A 95  
B 4 LYS A 107 ? THR A 111 ? LYS A 107 THR A 111 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 20 ? N ARG A 20 O THR A 37  ? O THR A 37  
A 2 3 N VAL A 34 ? N VAL A 34 O ALA A 77  ? O ALA A 77  
B 1 2 O GLN A 65 ? O GLN A 65 N TYR A 52  ? N TYR A 52  
B 2 3 N ARG A 49 ? N ARG A 49 O ARG A 93  ? O ARG A 93  
B 3 4 N TYR A 88 ? N TYR A 88 O VAL A 109 ? O VAL A 109 
# 
_database_PDB_matrix.entry_id          1UJT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1UJT 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -35.294 18.990  16.109  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -34.751 18.697  17.423  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -33.583 17.732  17.365  1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -33.727 16.553  17.687  1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -36.217 19.309  16.023  1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -34.421 19.619  17.878  1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -35.530 18.264  18.033  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -32.423 18.234  16.952  1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -31.227 17.407  16.848  1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -30.504 17.324  18.189  1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -29.684 18.180  18.518  1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -30.284 17.969  15.782  1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -29.052 17.269  15.771  1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -32.372 19.182  16.710  1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -31.534 16.414  16.556  1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? -30.746 17.875  14.811  1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? -30.091 19.011  15.990  1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? -28.330 17.890  15.894  1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? -30.817 16.287  18.959  1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? -30.202 16.093  20.267  1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? -28.680 16.141  20.164  1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? -28.028 16.958  20.813  1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? -30.641 14.756  20.868  1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? -31.944 14.848  21.417  1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? -31.479 15.638  18.641  1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? -30.533 16.894  20.911  1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? -30.641 14.001  20.097  1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? -29.952 14.473  21.651  1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? -32.124 15.758  21.666  1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? -28.120 15.259  19.342  1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? -26.680 15.217  19.168  1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? -26.255 14.245  18.085  1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? -26.821 13.160  17.958  1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? -28.690 14.631  18.850  1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? -26.331 16.205  18.909  1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? -26.225 14.918  20.101  1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? -25.256 14.637  17.300  1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? -24.759 13.795  16.218  1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? -23.384 14.263  15.753  1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? -22.923 15.341  16.129  1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? -25.739 13.807  15.043  1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? -26.954 13.163  15.386  1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? -24.845 15.514  17.451  1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? -24.675 12.786  16.595  1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -25.952 14.828  14.766  1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? -25.296 13.290  14.204  1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? -27.363 12.807  14.594  1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -22.733 13.445  14.933  1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -21.408 13.772  14.418  1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -21.234 13.251  12.995  1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? -21.778 12.208  12.633  1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -20.326 13.184  15.325  1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -20.342 13.797  16.602  1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -23.153 12.599  14.669  1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -21.313 14.848  14.409  1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -20.498 12.125  15.445  1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -19.357 13.342  14.874  1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? -19.798 14.588  16.584  1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? -20.472 13.986  12.191  1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? -20.239 13.584  10.816  1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? -21.489 13.679  9.965   1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? -22.167 12.678  9.732   1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? -20.064 14.809  12.534  1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? -19.476 14.219  10.391  1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? -19.888 12.562  10.807  1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . ARG A 1 8   ? -21.796 14.885  9.500   1.00 0.00 ? 8   ARG A N    1  
ATOM 67    C CA   . ARG A 1 8   ? -22.975 15.108  8.672   1.00 0.00 ? 8   ARG A CA   1  
ATOM 68    C C    . ARG A 1 8   ? -22.705 14.708  7.224   1.00 0.00 ? 8   ARG A C    1  
ATOM 69    O O    . ARG A 1 8   ? -23.443 13.913  6.642   1.00 0.00 ? 8   ARG A O    1  
ATOM 70    C CB   . ARG A 1 8   ? -23.400 16.576  8.736   1.00 0.00 ? 8   ARG A CB   1  
ATOM 71    C CG   . ARG A 1 8   ? -23.976 16.985  10.082  1.00 0.00 ? 8   ARG A CG   1  
ATOM 72    C CD   . ARG A 1 8   ? -24.563 18.387  10.034  1.00 0.00 ? 8   ARG A CD   1  
ATOM 73    N NE   . ARG A 1 8   ? -24.982 18.850  11.354  1.00 0.00 ? 8   ARG A NE   1  
ATOM 74    C CZ   . ARG A 1 8   ? -25.549 20.031  11.573  1.00 0.00 ? 8   ARG A CZ   1  
ATOM 75    N NH1  . ARG A 1 8   ? -25.762 20.865  10.564  1.00 0.00 ? 8   ARG A NH1  1  
ATOM 76    N NH2  . ARG A 1 8   ? -25.903 20.381  12.803  1.00 0.00 ? 8   ARG A NH2  1  
ATOM 77    H H    . ARG A 1 8   ? -21.216 15.645  9.720   1.00 0.00 ? 8   ARG A H    1  
ATOM 78    H HA   . ARG A 1 8   ? -23.774 14.494  9.059   1.00 0.00 ? 8   ARG A HA   1  
ATOM 79    H HB2  . ARG A 1 8   ? -22.540 17.197  8.534   1.00 0.00 ? 8   ARG A HB2  1  
ATOM 80    H HB3  . ARG A 1 8   ? -24.149 16.755  7.979   1.00 0.00 ? 8   ARG A HB3  1  
ATOM 81    H HG2  . ARG A 1 8   ? -24.757 16.289  10.355  1.00 0.00 ? 8   ARG A HG2  1  
ATOM 82    H HG3  . ARG A 1 8   ? -23.191 16.957  10.822  1.00 0.00 ? 8   ARG A HG3  1  
ATOM 83    H HD2  . ARG A 1 8   ? -23.815 19.063  9.648   1.00 0.00 ? 8   ARG A HD2  1  
ATOM 84    H HD3  . ARG A 1 8   ? -25.418 18.383  9.375   1.00 0.00 ? 8   ARG A HD3  1  
ATOM 85    H HE   . ARG A 1 8   ? -24.834 18.250  12.114  1.00 0.00 ? 8   ARG A HE   1  
ATOM 86    H HH11 . ARG A 1 8   ? -25.497 20.603  9.636   1.00 0.00 ? 8   ARG A HH11 1  
ATOM 87    H HH12 . ARG A 1 8   ? -26.190 21.753  10.731  1.00 0.00 ? 8   ARG A HH12 1  
ATOM 88    H HH21 . ARG A 1 8   ? -25.744 19.755  13.566  1.00 0.00 ? 8   ARG A HH21 1  
ATOM 89    H HH22 . ARG A 1 8   ? -26.329 21.270  12.966  1.00 0.00 ? 8   ARG A HH22 1  
ATOM 90    N N    . GLN A 1 9   ? -21.645 15.266  6.649   1.00 0.00 ? 9   GLN A N    1  
ATOM 91    C CA   . GLN A 1 9   ? -21.280 14.969  5.269   1.00 0.00 ? 9   GLN A CA   1  
ATOM 92    C C    . GLN A 1 9   ? -20.454 13.689  5.188   1.00 0.00 ? 9   GLN A C    1  
ATOM 93    O O    . GLN A 1 9   ? -19.818 13.411  4.171   1.00 0.00 ? 9   GLN A O    1  
ATOM 94    C CB   . GLN A 1 9   ? -20.496 16.135  4.664   1.00 0.00 ? 9   GLN A CB   1  
ATOM 95    C CG   . GLN A 1 9   ? -20.386 16.073  3.149   1.00 0.00 ? 9   GLN A CG   1  
ATOM 96    C CD   . GLN A 1 9   ? -19.939 17.389  2.543   1.00 0.00 ? 9   GLN A CD   1  
ATOM 97    O OE1  . GLN A 1 9   ? -20.357 18.461  2.980   1.00 0.00 ? 9   GLN A OE1  1  
ATOM 98    N NE2  . GLN A 1 9   ? -19.085 17.313  1.529   1.00 0.00 ? 9   GLN A NE2  1  
ATOM 99    H H    . GLN A 1 9   ? -21.096 15.892  7.164   1.00 0.00 ? 9   GLN A H    1  
ATOM 100   H HA   . GLN A 1 9   ? -22.191 14.830  4.708   1.00 0.00 ? 9   GLN A HA   1  
ATOM 101   H HB2  . GLN A 1 9   ? -20.985 17.059  4.931   1.00 0.00 ? 9   GLN A HB2  1  
ATOM 102   H HB3  . GLN A 1 9   ? -19.497 16.133  5.075   1.00 0.00 ? 9   GLN A HB3  1  
ATOM 103   H HG2  . GLN A 1 9   ? -19.670 15.310  2.883   1.00 0.00 ? 9   GLN A HG2  1  
ATOM 104   H HG3  . GLN A 1 9   ? -21.353 15.816  2.742   1.00 0.00 ? 9   GLN A HG3  1  
ATOM 105   H HE21 . GLN A 1 9   ? -18.796 16.424  1.233   1.00 0.00 ? 9   GLN A HE21 1  
ATOM 106   H HE22 . GLN A 1 9   ? -18.780 18.148  1.118   1.00 0.00 ? 9   GLN A HE22 1  
ATOM 107   N N    . VAL A 1 10  ? -20.467 12.913  6.267   1.00 0.00 ? 10  VAL A N    1  
ATOM 108   C CA   . VAL A 1 10  ? -19.720 11.662  6.318   1.00 0.00 ? 10  VAL A CA   1  
ATOM 109   C C    . VAL A 1 10  ? -20.311 10.630  5.364   1.00 0.00 ? 10  VAL A C    1  
ATOM 110   O O    . VAL A 1 10  ? -19.584 9.971   4.621   1.00 0.00 ? 10  VAL A O    1  
ATOM 111   C CB   . VAL A 1 10  ? -19.702 11.077  7.743   1.00 0.00 ? 10  VAL A CB   1  
ATOM 112   C CG1  . VAL A 1 10  ? -21.098 10.635  8.157   1.00 0.00 ? 10  VAL A CG1  1  
ATOM 113   C CG2  . VAL A 1 10  ? -18.720 9.919   7.831   1.00 0.00 ? 10  VAL A CG2  1  
ATOM 114   H H    . VAL A 1 10  ? -20.993 13.188  7.047   1.00 0.00 ? 10  VAL A H    1  
ATOM 115   H HA   . VAL A 1 10  ? -18.702 11.869  6.024   1.00 0.00 ? 10  VAL A HA   1  
ATOM 116   H HB   . VAL A 1 10  ? -19.377 11.849  8.424   1.00 0.00 ? 10  VAL A HB   1  
ATOM 117   H HG11 . VAL A 1 10  ? -21.137 10.524  9.230   1.00 0.00 ? 10  VAL A HG11 1  
ATOM 118   H HG12 . VAL A 1 10  ? -21.818 11.376  7.843   1.00 0.00 ? 10  VAL A HG12 1  
ATOM 119   H HG13 . VAL A 1 10  ? -21.329 9.688   7.690   1.00 0.00 ? 10  VAL A HG13 1  
ATOM 120   H HG21 . VAL A 1 10  ? -19.217 9.056   8.249   1.00 0.00 ? 10  VAL A HG21 1  
ATOM 121   H HG22 . VAL A 1 10  ? -18.356 9.679   6.842   1.00 0.00 ? 10  VAL A HG22 1  
ATOM 122   H HG23 . VAL A 1 10  ? -17.889 10.198  8.462   1.00 0.00 ? 10  VAL A HG23 1  
ATOM 123   N N    . GLN A 1 11  ? -21.633 10.495  5.391   1.00 0.00 ? 11  GLN A N    1  
ATOM 124   C CA   . GLN A 1 11  ? -22.321 9.542   4.528   1.00 0.00 ? 11  GLN A CA   1  
ATOM 125   C C    . GLN A 1 11  ? -22.442 10.084  3.107   1.00 0.00 ? 11  GLN A C    1  
ATOM 126   O O    . GLN A 1 11  ? -23.005 9.431   2.228   1.00 0.00 ? 11  GLN A O    1  
ATOM 127   C CB   . GLN A 1 11  ? -23.709 9.227   5.086   1.00 0.00 ? 11  GLN A CB   1  
ATOM 128   C CG   . GLN A 1 11  ? -23.689 8.251   6.252   1.00 0.00 ? 11  GLN A CG   1  
ATOM 129   C CD   . GLN A 1 11  ? -25.077 7.930   6.768   1.00 0.00 ? 11  GLN A CD   1  
ATOM 130   O OE1  . GLN A 1 11  ? -25.860 7.253   6.099   1.00 0.00 ? 11  GLN A OE1  1  
ATOM 131   N NE2  . GLN A 1 11  ? -25.392 8.413   7.964   1.00 0.00 ? 11  GLN A NE2  1  
ATOM 132   H H    . GLN A 1 11  ? -22.157 11.049  6.006   1.00 0.00 ? 11  GLN A H    1  
ATOM 133   H HA   . GLN A 1 11  ? -21.737 8.635   4.505   1.00 0.00 ? 11  GLN A HA   1  
ATOM 134   H HB2  . GLN A 1 11  ? -24.167 10.145  5.421   1.00 0.00 ? 11  GLN A HB2  1  
ATOM 135   H HB3  . GLN A 1 11  ? -24.312 8.799   4.299   1.00 0.00 ? 11  GLN A HB3  1  
ATOM 136   H HG2  . GLN A 1 11  ? -23.220 7.333   5.929   1.00 0.00 ? 11  GLN A HG2  1  
ATOM 137   H HG3  . GLN A 1 11  ? -23.113 8.684   7.057   1.00 0.00 ? 11  GLN A HG3  1  
ATOM 138   H HE21 . GLN A 1 11  ? -24.719 8.945   8.439   1.00 0.00 ? 11  GLN A HE21 1  
ATOM 139   H HE22 . GLN A 1 11  ? -26.283 8.221   8.322   1.00 0.00 ? 11  GLN A HE22 1  
ATOM 140   N N    . LYS A 1 12  ? -21.910 11.282  2.889   1.00 0.00 ? 12  LYS A N    1  
ATOM 141   C CA   . LYS A 1 12  ? -21.958 11.912  1.575   1.00 0.00 ? 12  LYS A CA   1  
ATOM 142   C C    . LYS A 1 12  ? -20.578 11.917  0.924   1.00 0.00 ? 12  LYS A C    1  
ATOM 143   O O    . LYS A 1 12  ? -20.441 11.620  -0.262  1.00 0.00 ? 12  LYS A O    1  
ATOM 144   C CB   . LYS A 1 12  ? -22.482 13.345  1.693   1.00 0.00 ? 12  LYS A CB   1  
ATOM 145   C CG   . LYS A 1 12  ? -22.633 14.050  0.355   1.00 0.00 ? 12  LYS A CG   1  
ATOM 146   C CD   . LYS A 1 12  ? -24.013 13.829  -0.239  1.00 0.00 ? 12  LYS A CD   1  
ATOM 147   C CE   . LYS A 1 12  ? -24.991 14.906  0.206   1.00 0.00 ? 12  LYS A CE   1  
ATOM 148   N NZ   . LYS A 1 12  ? -24.696 16.219  -0.432  1.00 0.00 ? 12  LYS A NZ   1  
ATOM 149   H H    . LYS A 1 12  ? -21.475 11.754  3.630   1.00 0.00 ? 12  LYS A H    1  
ATOM 150   H HA   . LYS A 1 12  ? -22.633 11.340  0.957   1.00 0.00 ? 12  LYS A HA   1  
ATOM 151   H HB2  . LYS A 1 12  ? -23.448 13.324  2.175   1.00 0.00 ? 12  LYS A HB2  1  
ATOM 152   H HB3  . LYS A 1 12  ? -21.798 13.918  2.302   1.00 0.00 ? 12  LYS A HB3  1  
ATOM 153   H HG2  . LYS A 1 12  ? -22.479 15.109  0.497   1.00 0.00 ? 12  LYS A HG2  1  
ATOM 154   H HG3  . LYS A 1 12  ? -21.890 13.665  -0.329  1.00 0.00 ? 12  LYS A HG3  1  
ATOM 155   H HD2  . LYS A 1 12  ? -23.940 13.848  -1.316  1.00 0.00 ? 12  LYS A HD2  1  
ATOM 156   H HD3  . LYS A 1 12  ? -24.383 12.865  0.080   1.00 0.00 ? 12  LYS A HD3  1  
ATOM 157   H HE2  . LYS A 1 12  ? -25.990 14.601  -0.064  1.00 0.00 ? 12  LYS A HE2  1  
ATOM 158   H HE3  . LYS A 1 12  ? -24.924 15.013  1.278   1.00 0.00 ? 12  LYS A HE3  1  
ATOM 159   H HZ1  . LYS A 1 12  ? -24.711 16.974  0.283   1.00 0.00 ? 12  LYS A HZ1  1  
ATOM 160   H HZ2  . LYS A 1 12  ? -25.410 16.432  -1.158  1.00 0.00 ? 12  LYS A HZ2  1  
ATOM 161   H HZ3  . LYS A 1 12  ? -23.758 16.198  -0.879  1.00 0.00 ? 12  LYS A HZ3  1  
ATOM 162   N N    . GLU A 1 13  ? -19.559 12.254  1.708   1.00 0.00 ? 13  GLU A N    1  
ATOM 163   C CA   . GLU A 1 13  ? -18.191 12.296  1.206   1.00 0.00 ? 13  GLU A CA   1  
ATOM 164   C C    . GLU A 1 13  ? -17.552 10.911  1.252   1.00 0.00 ? 13  GLU A C    1  
ATOM 165   O O    . GLU A 1 13  ? -16.914 10.477  0.292   1.00 0.00 ? 13  GLU A O    1  
ATOM 166   C CB   . GLU A 1 13  ? -17.354 13.283  2.023   1.00 0.00 ? 13  GLU A CB   1  
ATOM 167   C CG   . GLU A 1 13  ? -15.857 13.053  1.908   1.00 0.00 ? 13  GLU A CG   1  
ATOM 168   C CD   . GLU A 1 13  ? -15.354 13.186  0.484   1.00 0.00 ? 13  GLU A CD   1  
ATOM 169   O OE1  . GLU A 1 13  ? -16.191 13.200  -0.442  1.00 0.00 ? 13  GLU A OE1  1  
ATOM 170   O OE2  . GLU A 1 13  ? -14.123 13.275  0.296   1.00 0.00 ? 13  GLU A OE2  1  
ATOM 171   H H    . GLU A 1 13  ? -19.732 12.481  2.646   1.00 0.00 ? 13  GLU A H    1  
ATOM 172   H HA   . GLU A 1 13  ? -18.224 12.630  0.180   1.00 0.00 ? 13  GLU A HA   1  
ATOM 173   H HB2  . GLU A 1 13  ? -17.571 14.286  1.686   1.00 0.00 ? 13  GLU A HB2  1  
ATOM 174   H HB3  . GLU A 1 13  ? -17.632 13.196  3.064   1.00 0.00 ? 13  GLU A HB3  1  
ATOM 175   H HG2  . GLU A 1 13  ? -15.346 13.778  2.523   1.00 0.00 ? 13  GLU A HG2  1  
ATOM 176   H HG3  . GLU A 1 13  ? -15.630 12.058  2.263   1.00 0.00 ? 13  GLU A HG3  1  
ATOM 177   N N    . LEU A 1 14  ? -17.727 10.223  2.375   1.00 0.00 ? 14  LEU A N    1  
ATOM 178   C CA   . LEU A 1 14  ? -17.168 8.886   2.548   1.00 0.00 ? 14  LEU A CA   1  
ATOM 179   C C    . LEU A 1 14  ? -17.155 8.126   1.225   1.00 0.00 ? 14  LEU A C    1  
ATOM 180   O O    . LEU A 1 14  ? -16.100 7.921   0.626   1.00 0.00 ? 14  LEU A O    1  
ATOM 181   C CB   . LEU A 1 14  ? -17.971 8.107   3.590   1.00 0.00 ? 14  LEU A CB   1  
ATOM 182   C CG   . LEU A 1 14  ? -17.664 6.612   3.694   1.00 0.00 ? 14  LEU A CG   1  
ATOM 183   C CD1  . LEU A 1 14  ? -16.521 6.369   4.667   1.00 0.00 ? 14  LEU A CD1  1  
ATOM 184   C CD2  . LEU A 1 14  ? -18.904 5.841   4.121   1.00 0.00 ? 14  LEU A CD2  1  
ATOM 185   H H    . LEU A 1 14  ? -18.244 10.621  3.105   1.00 0.00 ? 14  LEU A H    1  
ATOM 186   H HA   . LEU A 1 14  ? -16.151 8.995   2.896   1.00 0.00 ? 14  LEU A HA   1  
ATOM 187   H HB2  . LEU A 1 14  ? -17.781 8.551   4.554   1.00 0.00 ? 14  LEU A HB2  1  
ATOM 188   H HB3  . LEU A 1 14  ? -19.019 8.214   3.346   1.00 0.00 ? 14  LEU A HB3  1  
ATOM 189   H HG   . LEU A 1 14  ? -17.359 6.245   2.723   1.00 0.00 ? 14  LEU A HG   1  
ATOM 190   H HD11 . LEU A 1 14  ? -15.590 6.320   4.123   1.00 0.00 ? 14  LEU A HD11 1  
ATOM 191   H HD12 . LEU A 1 14  ? -16.683 5.436   5.187   1.00 0.00 ? 14  LEU A HD12 1  
ATOM 192   H HD13 . LEU A 1 14  ? -16.479 7.177   5.382   1.00 0.00 ? 14  LEU A HD13 1  
ATOM 193   H HD21 . LEU A 1 14  ? -19.262 6.230   5.063   1.00 0.00 ? 14  LEU A HD21 1  
ATOM 194   H HD22 . LEU A 1 14  ? -18.657 4.796   4.235   1.00 0.00 ? 14  LEU A HD22 1  
ATOM 195   H HD23 . LEU A 1 14  ? -19.673 5.951   3.371   1.00 0.00 ? 14  LEU A HD23 1  
ATOM 196   N N    . GLY A 1 15  ? -18.335 7.712   0.775   1.00 0.00 ? 15  GLY A N    1  
ATOM 197   C CA   . GLY A 1 15  ? -18.437 6.981   -0.474  1.00 0.00 ? 15  GLY A CA   1  
ATOM 198   C C    . GLY A 1 15  ? -17.775 7.708   -1.627  1.00 0.00 ? 15  GLY A C    1  
ATOM 199   O O    . GLY A 1 15  ? -17.023 7.110   -2.398  1.00 0.00 ? 15  GLY A O    1  
ATOM 200   H H    . GLY A 1 15  ? -19.143 7.904   1.296   1.00 0.00 ? 15  GLY A H    1  
ATOM 201   H HA2  . GLY A 1 15  ? -17.968 6.016   -0.354  1.00 0.00 ? 15  GLY A HA2  1  
ATOM 202   H HA3  . GLY A 1 15  ? -19.482 6.836   -0.709  1.00 0.00 ? 15  GLY A HA3  1  
ATOM 203   N N    . ASP A 1 16  ? -18.054 9.001   -1.748  1.00 0.00 ? 16  ASP A N    1  
ATOM 204   C CA   . ASP A 1 16  ? -17.480 9.811   -2.816  1.00 0.00 ? 16  ASP A CA   1  
ATOM 205   C C    . ASP A 1 16  ? -15.977 9.577   -2.928  1.00 0.00 ? 16  ASP A C    1  
ATOM 206   O O    . ASP A 1 16  ? -15.467 9.249   -3.999  1.00 0.00 ? 16  ASP A O    1  
ATOM 207   C CB   . ASP A 1 16  ? -17.761 11.294  -2.568  1.00 0.00 ? 16  ASP A CB   1  
ATOM 208   C CG   . ASP A 1 16  ? -19.173 11.688  -2.955  1.00 0.00 ? 16  ASP A CG   1  
ATOM 209   O OD1  . ASP A 1 16  ? -20.051 10.800  -2.984  1.00 0.00 ? 16  ASP A OD1  1  
ATOM 210   O OD2  . ASP A 1 16  ? -19.401 12.885  -3.227  1.00 0.00 ? 16  ASP A OD2  1  
ATOM 211   H H    . ASP A 1 16  ? -18.661 9.421   -1.103  1.00 0.00 ? 16  ASP A H    1  
ATOM 212   H HA   . ASP A 1 16  ? -17.947 9.516   -3.744  1.00 0.00 ? 16  ASP A HA   1  
ATOM 213   H HB2  . ASP A 1 16  ? -17.622 11.509  -1.519  1.00 0.00 ? 16  ASP A HB2  1  
ATOM 214   H HB3  . ASP A 1 16  ? -17.069 11.886  -3.148  1.00 0.00 ? 16  ASP A HB3  1  
ATOM 215   N N    . VAL A 1 17  ? -15.272 9.749   -1.814  1.00 0.00 ? 17  VAL A N    1  
ATOM 216   C CA   . VAL A 1 17  ? -13.827 9.556   -1.786  1.00 0.00 ? 17  VAL A CA   1  
ATOM 217   C C    . VAL A 1 17  ? -13.402 8.446   -2.740  1.00 0.00 ? 17  VAL A C    1  
ATOM 218   O O    . VAL A 1 17  ? -13.784 7.287   -2.570  1.00 0.00 ? 17  VAL A O    1  
ATOM 219   C CB   . VAL A 1 17  ? -13.333 9.216   -0.367  1.00 0.00 ? 17  VAL A CB   1  
ATOM 220   C CG1  . VAL A 1 17  ? -11.836 8.948   -0.373  1.00 0.00 ? 17  VAL A CG1  1  
ATOM 221   C CG2  . VAL A 1 17  ? -13.679 10.339  0.600   1.00 0.00 ? 17  VAL A CG2  1  
ATOM 222   H H    . VAL A 1 17  ? -15.735 10.010  -0.991  1.00 0.00 ? 17  VAL A H    1  
ATOM 223   H HA   . VAL A 1 17  ? -13.361 10.481  -2.095  1.00 0.00 ? 17  VAL A HA   1  
ATOM 224   H HB   . VAL A 1 17  ? -13.837 8.319   -0.038  1.00 0.00 ? 17  VAL A HB   1  
ATOM 225   H HG11 . VAL A 1 17  ? -11.615 8.134   0.302   1.00 0.00 ? 17  VAL A HG11 1  
ATOM 226   H HG12 . VAL A 1 17  ? -11.521 8.685   -1.372  1.00 0.00 ? 17  VAL A HG12 1  
ATOM 227   H HG13 . VAL A 1 17  ? -11.311 9.835   -0.050  1.00 0.00 ? 17  VAL A HG13 1  
ATOM 228   H HG21 . VAL A 1 17  ? -13.086 11.210  0.364   1.00 0.00 ? 17  VAL A HG21 1  
ATOM 229   H HG22 . VAL A 1 17  ? -14.728 10.582  0.510   1.00 0.00 ? 17  VAL A HG22 1  
ATOM 230   H HG23 . VAL A 1 17  ? -13.468 10.022  1.610   1.00 0.00 ? 17  VAL A HG23 1  
ATOM 231   N N    . LEU A 1 18  ? -12.610 8.806   -3.743  1.00 0.00 ? 18  LEU A N    1  
ATOM 232   C CA   . LEU A 1 18  ? -12.131 7.840   -4.726  1.00 0.00 ? 18  LEU A CA   1  
ATOM 233   C C    . LEU A 1 18  ? -10.661 7.509   -4.492  1.00 0.00 ? 18  LEU A C    1  
ATOM 234   O O    . LEU A 1 18  ? -9.772  8.188   -5.006  1.00 0.00 ? 18  LEU A O    1  
ATOM 235   C CB   . LEU A 1 18  ? -12.325 8.384   -6.142  1.00 0.00 ? 18  LEU A CB   1  
ATOM 236   C CG   . LEU A 1 18  ? -12.520 7.340   -7.242  1.00 0.00 ? 18  LEU A CG   1  
ATOM 237   C CD1  . LEU A 1 18  ? -13.168 7.969   -8.466  1.00 0.00 ? 18  LEU A CD1  1  
ATOM 238   C CD2  . LEU A 1 18  ? -11.191 6.698   -7.610  1.00 0.00 ? 18  LEU A CD2  1  
ATOM 239   H H    . LEU A 1 18  ? -12.340 9.744   -3.827  1.00 0.00 ? 18  LEU A H    1  
ATOM 240   H HA   . LEU A 1 18  ? -12.713 6.937   -4.613  1.00 0.00 ? 18  LEU A HA   1  
ATOM 241   H HB2  . LEU A 1 18  ? -13.194 9.023   -6.135  1.00 0.00 ? 18  LEU A HB2  1  
ATOM 242   H HB3  . LEU A 1 18  ? -11.452 8.970   -6.392  1.00 0.00 ? 18  LEU A HB3  1  
ATOM 243   H HG   . LEU A 1 18  ? -13.179 6.563   -6.879  1.00 0.00 ? 18  LEU A HG   1  
ATOM 244   H HD11 . LEU A 1 18  ? -14.240 7.973   -8.344  1.00 0.00 ? 18  LEU A HD11 1  
ATOM 245   H HD12 . LEU A 1 18  ? -12.908 7.397   -9.344  1.00 0.00 ? 18  LEU A HD12 1  
ATOM 246   H HD13 . LEU A 1 18  ? -12.813 8.983   -8.580  1.00 0.00 ? 18  LEU A HD13 1  
ATOM 247   H HD21 . LEU A 1 18  ? -10.550 6.673   -6.741  1.00 0.00 ? 18  LEU A HD21 1  
ATOM 248   H HD22 . LEU A 1 18  ? -10.716 7.275   -8.390  1.00 0.00 ? 18  LEU A HD22 1  
ATOM 249   H HD23 . LEU A 1 18  ? -11.362 5.691   -7.959  1.00 0.00 ? 18  LEU A HD23 1  
ATOM 250   N N    . VAL A 1 19  ? -10.412 6.459   -3.715  1.00 0.00 ? 19  VAL A N    1  
ATOM 251   C CA   . VAL A 1 19  ? -9.049  6.035   -3.416  1.00 0.00 ? 19  VAL A CA   1  
ATOM 252   C C    . VAL A 1 19  ? -8.407  5.358   -4.622  1.00 0.00 ? 19  VAL A C    1  
ATOM 253   O O    . VAL A 1 19  ? -8.914  4.356   -5.127  1.00 0.00 ? 19  VAL A O    1  
ATOM 254   C CB   . VAL A 1 19  ? -9.012  5.068   -2.218  1.00 0.00 ? 19  VAL A CB   1  
ATOM 255   C CG1  . VAL A 1 19  ? -7.581  4.847   -1.754  1.00 0.00 ? 19  VAL A CG1  1  
ATOM 256   C CG2  . VAL A 1 19  ? -9.875  5.596   -1.082  1.00 0.00 ? 19  VAL A CG2  1  
ATOM 257   H H    . VAL A 1 19  ? -11.163 5.958   -3.335  1.00 0.00 ? 19  VAL A H    1  
ATOM 258   H HA   . VAL A 1 19  ? -8.475  6.914   -3.161  1.00 0.00 ? 19  VAL A HA   1  
ATOM 259   H HB   . VAL A 1 19  ? -9.415  4.118   -2.537  1.00 0.00 ? 19  VAL A HB   1  
ATOM 260   H HG11 . VAL A 1 19  ? -7.367  5.502   -0.922  1.00 0.00 ? 19  VAL A HG11 1  
ATOM 261   H HG12 . VAL A 1 19  ? -7.456  3.819   -1.446  1.00 0.00 ? 19  VAL A HG12 1  
ATOM 262   H HG13 . VAL A 1 19  ? -6.902  5.065   -2.566  1.00 0.00 ? 19  VAL A HG13 1  
ATOM 263   H HG21 . VAL A 1 19  ? -9.292  5.625   -0.173  1.00 0.00 ? 19  VAL A HG21 1  
ATOM 264   H HG22 . VAL A 1 19  ? -10.218 6.592   -1.321  1.00 0.00 ? 19  VAL A HG22 1  
ATOM 265   H HG23 . VAL A 1 19  ? -10.726 4.946   -0.944  1.00 0.00 ? 19  VAL A HG23 1  
ATOM 266   N N    . ARG A 1 20  ? -7.289  5.912   -5.079  1.00 0.00 ? 20  ARG A N    1  
ATOM 267   C CA   . ARG A 1 20  ? -6.578  5.363   -6.227  1.00 0.00 ? 20  ARG A CA   1  
ATOM 268   C C    . ARG A 1 20  ? -5.388  4.519   -5.776  1.00 0.00 ? 20  ARG A C    1  
ATOM 269   O O    . ARG A 1 20  ? -4.350  5.052   -5.383  1.00 0.00 ? 20  ARG A O    1  
ATOM 270   C CB   . ARG A 1 20  ? -6.099  6.489   -7.145  1.00 0.00 ? 20  ARG A CB   1  
ATOM 271   C CG   . ARG A 1 20  ? -5.543  5.998   -8.472  1.00 0.00 ? 20  ARG A CG   1  
ATOM 272   C CD   . ARG A 1 20  ? -5.196  7.157   -9.393  1.00 0.00 ? 20  ARG A CD   1  
ATOM 273   N NE   . ARG A 1 20  ? -5.078  6.733   -10.785 1.00 0.00 ? 20  ARG A NE   1  
ATOM 274   C CZ   . ARG A 1 20  ? -4.054  6.031   -11.256 1.00 0.00 ? 20  ARG A CZ   1  
ATOM 275   N NH1  . ARG A 1 20  ? -3.064  5.675   -10.448 1.00 0.00 ? 20  ARG A NH1  1  
ATOM 276   N NH2  . ARG A 1 20  ? -4.018  5.682   -12.535 1.00 0.00 ? 20  ARG A NH2  1  
ATOM 277   H H    . ARG A 1 20  ? -6.934  6.711   -4.635  1.00 0.00 ? 20  ARG A H    1  
ATOM 278   H HA   . ARG A 1 20  ? -7.264  4.733   -6.772  1.00 0.00 ? 20  ARG A HA   1  
ATOM 279   H HB2  . ARG A 1 20  ? -6.930  7.148   -7.350  1.00 0.00 ? 20  ARG A HB2  1  
ATOM 280   H HB3  . ARG A 1 20  ? -5.325  7.045   -6.638  1.00 0.00 ? 20  ARG A HB3  1  
ATOM 281   H HG2  . ARG A 1 20  ? -4.649  5.421   -8.286  1.00 0.00 ? 20  ARG A HG2  1  
ATOM 282   H HG3  . ARG A 1 20  ? -6.283  5.376   -8.953  1.00 0.00 ? 20  ARG A HG3  1  
ATOM 283   H HD2  . ARG A 1 20  ? -5.973  7.904   -9.319  1.00 0.00 ? 20  ARG A HD2  1  
ATOM 284   H HD3  . ARG A 1 20  ? -4.257  7.583   -9.075  1.00 0.00 ? 20  ARG A HD3  1  
ATOM 285   H HE   . ARG A 1 20  ? -5.799  6.986   -11.399 1.00 0.00 ? 20  ARG A HE   1  
ATOM 286   H HH11 . ARG A 1 20  ? -3.089  5.935   -9.483  1.00 0.00 ? 20  ARG A HH11 1  
ATOM 287   H HH12 . ARG A 1 20  ? -2.294  5.144   -10.805 1.00 0.00 ? 20  ARG A HH12 1  
ATOM 288   H HH21 . ARG A 1 20  ? -4.763  5.949   -13.147 1.00 0.00 ? 20  ARG A HH21 1  
ATOM 289   H HH22 . ARG A 1 20  ? -3.247  5.154   -12.888 1.00 0.00 ? 20  ARG A HH22 1  
ATOM 290   N N    . LEU A 1 21  ? -5.547  3.202   -5.835  1.00 0.00 ? 21  LEU A N    1  
ATOM 291   C CA   . LEU A 1 21  ? -4.487  2.284   -5.433  1.00 0.00 ? 21  LEU A CA   1  
ATOM 292   C C    . LEU A 1 21  ? -3.525  2.023   -6.588  1.00 0.00 ? 21  LEU A C    1  
ATOM 293   O O    . LEU A 1 21  ? -3.892  1.403   -7.587  1.00 0.00 ? 21  LEU A O    1  
ATOM 294   C CB   . LEU A 1 21  ? -5.086  0.964   -4.945  1.00 0.00 ? 21  LEU A CB   1  
ATOM 295   C CG   . LEU A 1 21  ? -4.247  0.178   -3.938  1.00 0.00 ? 21  LEU A CG   1  
ATOM 296   C CD1  . LEU A 1 21  ? -3.944  1.029   -2.715  1.00 0.00 ? 21  LEU A CD1  1  
ATOM 297   C CD2  . LEU A 1 21  ? -4.960  -1.104  -3.534  1.00 0.00 ? 21  LEU A CD2  1  
ATOM 298   H H    . LEU A 1 21  ? -6.397  2.837   -6.157  1.00 0.00 ? 21  LEU A H    1  
ATOM 299   H HA   . LEU A 1 21  ? -3.941  2.744   -4.623  1.00 0.00 ? 21  LEU A HA   1  
ATOM 300   H HB2  . LEU A 1 21  ? -6.037  1.183   -4.483  1.00 0.00 ? 21  LEU A HB2  1  
ATOM 301   H HB3  . LEU A 1 21  ? -5.244  0.334   -5.809  1.00 0.00 ? 21  LEU A HB3  1  
ATOM 302   H HG   . LEU A 1 21  ? -3.305  -0.093  -4.397  1.00 0.00 ? 21  LEU A HG   1  
ATOM 303   H HD11 . LEU A 1 21  ? -3.238  1.801   -2.980  1.00 0.00 ? 21  LEU A HD11 1  
ATOM 304   H HD12 . LEU A 1 21  ? -3.523  0.407   -1.939  1.00 0.00 ? 21  LEU A HD12 1  
ATOM 305   H HD13 . LEU A 1 21  ? -4.857  1.482   -2.357  1.00 0.00 ? 21  LEU A HD13 1  
ATOM 306   H HD21 . LEU A 1 21  ? -4.231  -1.880  -3.354  1.00 0.00 ? 21  LEU A HD21 1  
ATOM 307   H HD22 . LEU A 1 21  ? -5.624  -1.412  -4.329  1.00 0.00 ? 21  LEU A HD22 1  
ATOM 308   H HD23 . LEU A 1 21  ? -5.531  -0.930  -2.635  1.00 0.00 ? 21  LEU A HD23 1  
ATOM 309   N N    . HIS A 1 22  ? -2.293  2.499   -6.443  1.00 0.00 ? 22  HIS A N    1  
ATOM 310   C CA   . HIS A 1 22  ? -1.276  2.315   -7.474  1.00 0.00 ? 22  HIS A CA   1  
ATOM 311   C C    . HIS A 1 22  ? -0.871  0.848   -7.580  1.00 0.00 ? 22  HIS A C    1  
ATOM 312   O O    . HIS A 1 22  ? -1.243  0.158   -8.529  1.00 0.00 ? 22  HIS A O    1  
ATOM 313   C CB   . HIS A 1 22  ? -0.049  3.175   -7.169  1.00 0.00 ? 22  HIS A CB   1  
ATOM 314   C CG   . HIS A 1 22  ? -0.354  4.637   -7.062  1.00 0.00 ? 22  HIS A CG   1  
ATOM 315   N ND1  . HIS A 1 22  ? 0.251   5.592   -7.852  1.00 0.00 ? 22  HIS A ND1  1  
ATOM 316   C CD2  . HIS A 1 22  ? -1.208  5.307   -6.252  1.00 0.00 ? 22  HIS A CD2  1  
ATOM 317   C CE1  . HIS A 1 22  ? -0.216  6.785   -7.532  1.00 0.00 ? 22  HIS A CE1  1  
ATOM 318   N NE2  . HIS A 1 22  ? -1.103  6.640   -6.564  1.00 0.00 ? 22  HIS A NE2  1  
ATOM 319   H H    . HIS A 1 22  ? -2.061  2.985   -5.625  1.00 0.00 ? 22  HIS A H    1  
ATOM 320   H HA   . HIS A 1 22  ? -1.699  2.628   -8.416  1.00 0.00 ? 22  HIS A HA   1  
ATOM 321   H HB2  . HIS A 1 22  ? 0.381   2.857   -6.231  1.00 0.00 ? 22  HIS A HB2  1  
ATOM 322   H HB3  . HIS A 1 22  ? 0.679   3.043   -7.956  1.00 0.00 ? 22  HIS A HB3  1  
ATOM 323   H HD1  . HIS A 1 22  ? 0.923   5.420   -8.543  1.00 0.00 ? 22  HIS A HD1  1  
ATOM 324   H HD2  . HIS A 1 22  ? -1.852  4.873   -5.500  1.00 0.00 ? 22  HIS A HD2  1  
ATOM 325   H HE1  . HIS A 1 22  ? 0.076   7.721   -7.984  1.00 0.00 ? 22  HIS A HE1  1  
ATOM 326   H HE2  . HIS A 1 22  ? -1.538  7.374   -6.083  1.00 0.00 ? 22  HIS A HE2  1  
ATOM 327   N N    . ASN A 1 23  ? -0.105  0.378   -6.601  1.00 0.00 ? 23  ASN A N    1  
ATOM 328   C CA   . ASN A 1 23  ? 0.353   -1.007  -6.586  1.00 0.00 ? 23  ASN A CA   1  
ATOM 329   C C    . ASN A 1 23  ? 1.109   -1.316  -5.297  1.00 0.00 ? 23  ASN A C    1  
ATOM 330   O O    . ASN A 1 23  ? 1.897   -0.509  -4.802  1.00 0.00 ? 23  ASN A O    1  
ATOM 331   C CB   . ASN A 1 23  ? 1.249   -1.283  -7.795  1.00 0.00 ? 23  ASN A CB   1  
ATOM 332   C CG   . ASN A 1 23  ? 2.577   -0.557  -7.708  1.00 0.00 ? 23  ASN A CG   1  
ATOM 333   O OD1  . ASN A 1 23  ? 3.479   -0.974  -6.983  1.00 0.00 ? 23  ASN A OD1  1  
ATOM 334   N ND2  . ASN A 1 23  ? 2.702   0.538   -8.450  1.00 0.00 ? 23  ASN A ND2  1  
ATOM 335   H H    . ASN A 1 23  ? 0.160   0.977   -5.871  1.00 0.00 ? 23  ASN A H    1  
ATOM 336   H HA   . ASN A 1 23  ? -0.517  -1.644  -6.640  1.00 0.00 ? 23  ASN A HA   1  
ATOM 337   H HB2  . ASN A 1 23  ? 1.444   -2.344  -7.856  1.00 0.00 ? 23  ASN A HB2  1  
ATOM 338   H HB3  . ASN A 1 23  ? 0.741   -0.963  -8.692  1.00 0.00 ? 23  ASN A HB3  1  
ATOM 339   H HD21 . ASN A 1 23  ? 1.942   0.811   -9.004  1.00 0.00 ? 23  ASN A HD21 1  
ATOM 340   H HD22 . ASN A 1 23  ? 3.551   1.026   -8.414  1.00 0.00 ? 23  ASN A HD22 1  
ATOM 341   N N    . PRO A 1 24  ? 0.865   -2.511  -4.740  1.00 0.00 ? 24  PRO A N    1  
ATOM 342   C CA   . PRO A 1 24  ? 1.514   -2.955  -3.503  1.00 0.00 ? 24  PRO A CA   1  
ATOM 343   C C    . PRO A 1 24  ? 3.000   -3.239  -3.697  1.00 0.00 ? 24  PRO A C    1  
ATOM 344   O O    . PRO A 1 24  ? 3.409   -4.391  -3.844  1.00 0.00 ? 24  PRO A O    1  
ATOM 345   C CB   . PRO A 1 24  ? 0.765   -4.243  -3.152  1.00 0.00 ? 24  PRO A CB   1  
ATOM 346   C CG   . PRO A 1 24  ? 0.243   -4.744  -4.454  1.00 0.00 ? 24  PRO A CG   1  
ATOM 347   C CD   . PRO A 1 24  ? -0.062  -3.522  -5.276  1.00 0.00 ? 24  PRO A CD   1  
ATOM 348   H HA   . PRO A 1 24  ? 1.387   -2.235  -2.708  1.00 0.00 ? 24  PRO A HA   1  
ATOM 349   H HB2  . PRO A 1 24  ? 1.450   -4.949  -2.702  1.00 0.00 ? 24  PRO A HB2  1  
ATOM 350   H HB3  . PRO A 1 24  ? -0.036  -4.022  -2.464  1.00 0.00 ? 24  PRO A HB3  1  
ATOM 351   H HG2  . PRO A 1 24  ? 0.992   -5.348  -4.943  1.00 0.00 ? 24  PRO A HG2  1  
ATOM 352   H HG3  . PRO A 1 24  ? -0.657  -5.319  -4.292  1.00 0.00 ? 24  PRO A HG3  1  
ATOM 353   H HD2  . PRO A 1 24  ? 0.136   -3.711  -6.321  1.00 0.00 ? 24  PRO A HD2  1  
ATOM 354   H HD3  . PRO A 1 24  ? -1.088  -3.217  -5.133  1.00 0.00 ? 24  PRO A HD3  1  
ATOM 355   N N    . VAL A 1 25  ? 3.805   -2.181  -3.696  1.00 0.00 ? 25  VAL A N    1  
ATOM 356   C CA   . VAL A 1 25  ? 5.246   -2.316  -3.870  1.00 0.00 ? 25  VAL A CA   1  
ATOM 357   C C    . VAL A 1 25  ? 5.812   -3.391  -2.949  1.00 0.00 ? 25  VAL A C    1  
ATOM 358   O O    . VAL A 1 25  ? 5.919   -3.194  -1.739  1.00 0.00 ? 25  VAL A O    1  
ATOM 359   C CB   . VAL A 1 25  ? 5.972   -0.986  -3.596  1.00 0.00 ? 25  VAL A CB   1  
ATOM 360   C CG1  . VAL A 1 25  ? 7.474   -1.152  -3.766  1.00 0.00 ? 25  VAL A CG1  1  
ATOM 361   C CG2  . VAL A 1 25  ? 5.442   0.109   -4.510  1.00 0.00 ? 25  VAL A CG2  1  
ATOM 362   H H    . VAL A 1 25  ? 3.420   -1.288  -3.575  1.00 0.00 ? 25  VAL A H    1  
ATOM 363   H HA   . VAL A 1 25  ? 5.433   -2.599  -4.896  1.00 0.00 ? 25  VAL A HA   1  
ATOM 364   H HB   . VAL A 1 25  ? 5.778   -0.697  -2.573  1.00 0.00 ? 25  VAL A HB   1  
ATOM 365   H HG11 . VAL A 1 25  ? 7.802   -0.597  -4.632  1.00 0.00 ? 25  VAL A HG11 1  
ATOM 366   H HG12 . VAL A 1 25  ? 7.980   -0.781  -2.887  1.00 0.00 ? 25  VAL A HG12 1  
ATOM 367   H HG13 . VAL A 1 25  ? 7.707   -2.198  -3.901  1.00 0.00 ? 25  VAL A HG13 1  
ATOM 368   H HG21 . VAL A 1 25  ? 5.644   -0.153  -5.538  1.00 0.00 ? 25  VAL A HG21 1  
ATOM 369   H HG22 . VAL A 1 25  ? 4.376   0.212   -4.368  1.00 0.00 ? 25  VAL A HG22 1  
ATOM 370   H HG23 . VAL A 1 25  ? 5.928   1.043   -4.273  1.00 0.00 ? 25  VAL A HG23 1  
ATOM 371   N N    . VAL A 1 26  ? 6.175   -4.530  -3.531  1.00 0.00 ? 26  VAL A N    1  
ATOM 372   C CA   . VAL A 1 26  ? 6.733   -5.637  -2.763  1.00 0.00 ? 26  VAL A CA   1  
ATOM 373   C C    . VAL A 1 26  ? 8.221   -5.432  -2.505  1.00 0.00 ? 26  VAL A C    1  
ATOM 374   O O    . VAL A 1 26  ? 9.048   -5.608  -3.400  1.00 0.00 ? 26  VAL A O    1  
ATOM 375   C CB   . VAL A 1 26  ? 6.529   -6.981  -3.487  1.00 0.00 ? 26  VAL A CB   1  
ATOM 376   C CG1  . VAL A 1 26  ? 6.870   -6.849  -4.964  1.00 0.00 ? 26  VAL A CG1  1  
ATOM 377   C CG2  . VAL A 1 26  ? 7.366   -8.070  -2.834  1.00 0.00 ? 26  VAL A CG2  1  
ATOM 378   H H    . VAL A 1 26  ? 6.066   -4.627  -4.500  1.00 0.00 ? 26  VAL A H    1  
ATOM 379   H HA   . VAL A 1 26  ? 6.215   -5.680  -1.816  1.00 0.00 ? 26  VAL A HA   1  
ATOM 380   H HB   . VAL A 1 26  ? 5.488   -7.258  -3.404  1.00 0.00 ? 26  VAL A HB   1  
ATOM 381   H HG11 . VAL A 1 26  ? 5.959   -6.746  -5.535  1.00 0.00 ? 26  VAL A HG11 1  
ATOM 382   H HG12 . VAL A 1 26  ? 7.491   -5.978  -5.114  1.00 0.00 ? 26  VAL A HG12 1  
ATOM 383   H HG13 . VAL A 1 26  ? 7.401   -7.731  -5.290  1.00 0.00 ? 26  VAL A HG13 1  
ATOM 384   H HG21 . VAL A 1 26  ? 7.554   -7.809  -1.803  1.00 0.00 ? 26  VAL A HG21 1  
ATOM 385   H HG22 . VAL A 1 26  ? 6.833   -9.009  -2.876  1.00 0.00 ? 26  VAL A HG22 1  
ATOM 386   H HG23 . VAL A 1 26  ? 8.306   -8.166  -3.358  1.00 0.00 ? 26  VAL A HG23 1  
ATOM 387   N N    . LEU A 1 27  ? 8.556   -5.058  -1.275  1.00 0.00 ? 27  LEU A N    1  
ATOM 388   C CA   . LEU A 1 27  ? 9.946   -4.829  -0.897  1.00 0.00 ? 27  LEU A CA   1  
ATOM 389   C C    . LEU A 1 27  ? 10.629  -6.137  -0.511  1.00 0.00 ? 27  LEU A C    1  
ATOM 390   O O    . LEU A 1 27  ? 11.666  -6.498  -1.067  1.00 0.00 ? 27  LEU A O    1  
ATOM 391   C CB   . LEU A 1 27  ? 10.023  -3.838  0.267   1.00 0.00 ? 27  LEU A CB   1  
ATOM 392   C CG   . LEU A 1 27  ? 9.267   -2.522  0.078   1.00 0.00 ? 27  LEU A CG   1  
ATOM 393   C CD1  . LEU A 1 27  ? 9.127   -1.793  1.405   1.00 0.00 ? 27  LEU A CD1  1  
ATOM 394   C CD2  . LEU A 1 27  ? 9.973   -1.643  -0.944  1.00 0.00 ? 27  LEU A CD2  1  
ATOM 395   H H    . LEU A 1 27  ? 7.853   -4.933  -0.604  1.00 0.00 ? 27  LEU A H    1  
ATOM 396   H HA   . LEU A 1 27  ? 10.457  -4.409  -1.750  1.00 0.00 ? 27  LEU A HA   1  
ATOM 397   H HB2  . LEU A 1 27  ? 9.624   -4.326  1.143   1.00 0.00 ? 27  LEU A HB2  1  
ATOM 398   H HB3  . LEU A 1 27  ? 11.064  -3.602  0.431   1.00 0.00 ? 27  LEU A HB3  1  
ATOM 399   H HG   . LEU A 1 27  ? 8.273   -2.735  -0.292  1.00 0.00 ? 27  LEU A HG   1  
ATOM 400   H HD11 . LEU A 1 27  ? 8.529   -2.386  2.081   1.00 0.00 ? 27  LEU A HD11 1  
ATOM 401   H HD12 . LEU A 1 27  ? 8.647   -0.839  1.243   1.00 0.00 ? 27  LEU A HD12 1  
ATOM 402   H HD13 . LEU A 1 27  ? 10.105  -1.634  1.834   1.00 0.00 ? 27  LEU A HD13 1  
ATOM 403   H HD21 . LEU A 1 27  ? 10.970  -1.416  -0.595  1.00 0.00 ? 27  LEU A HD21 1  
ATOM 404   H HD22 . LEU A 1 27  ? 9.419   -0.725  -1.072  1.00 0.00 ? 27  LEU A HD22 1  
ATOM 405   H HD23 . LEU A 1 27  ? 10.031  -2.165  -1.887  1.00 0.00 ? 27  LEU A HD23 1  
ATOM 406   N N    . THR A 1 28  ? 10.037  -6.848  0.445   1.00 0.00 ? 28  THR A N    1  
ATOM 407   C CA   . THR A 1 28  ? 10.587  -8.117  0.905   1.00 0.00 ? 28  THR A CA   1  
ATOM 408   C C    . THR A 1 28  ? 9.514   -9.198  0.945   1.00 0.00 ? 28  THR A C    1  
ATOM 409   O O    . THR A 1 28  ? 8.315   -8.917  0.953   1.00 0.00 ? 28  THR A O    1  
ATOM 410   C CB   . THR A 1 28  ? 11.216  -7.982  2.305   1.00 0.00 ? 28  THR A CB   1  
ATOM 411   O OG1  . THR A 1 28  ? 10.554  -6.949  3.043   1.00 0.00 ? 28  THR A OG1  1  
ATOM 412   C CG2  . THR A 1 28  ? 12.701  -7.667  2.202   1.00 0.00 ? 28  THR A CG2  1  
ATOM 413   H H    . THR A 1 28  ? 9.213   -6.508  0.851   1.00 0.00 ? 28  THR A H    1  
ATOM 414   H HA   . THR A 1 28  ? 11.360  -8.416  0.213   1.00 0.00 ? 28  THR A HA   1  
ATOM 415   H HB   . THR A 1 28  ? 11.098  -8.920  2.828   1.00 0.00 ? 28  THR A HB   1  
ATOM 416   H HG1  . THR A 1 28  ? 9.625   -6.927  2.799   1.00 0.00 ? 28  THR A HG1  1  
ATOM 417   H HG21 . THR A 1 28  ? 13.158  -7.767  3.175   1.00 0.00 ? 28  THR A HG21 1  
ATOM 418   H HG22 . THR A 1 28  ? 12.831  -6.656  1.845   1.00 0.00 ? 28  THR A HG22 1  
ATOM 419   H HG23 . THR A 1 28  ? 13.168  -8.355  1.513   1.00 0.00 ? 28  THR A HG23 1  
ATOM 420   N N    . PRO A 1 29  ? 9.951   -10.466 0.972   1.00 0.00 ? 29  PRO A N    1  
ATOM 421   C CA   . PRO A 1 29  ? 9.042   -11.616 1.013   1.00 0.00 ? 29  PRO A CA   1  
ATOM 422   C C    . PRO A 1 29  ? 8.317   -11.735 2.349   1.00 0.00 ? 29  PRO A C    1  
ATOM 423   O O    . PRO A 1 29  ? 7.462   -12.602 2.529   1.00 0.00 ? 29  PRO A O    1  
ATOM 424   C CB   . PRO A 1 29  ? 9.974   -12.812 0.802   1.00 0.00 ? 29  PRO A CB   1  
ATOM 425   C CG   . PRO A 1 29  ? 11.305  -12.344 1.280   1.00 0.00 ? 29  PRO A CG   1  
ATOM 426   C CD   . PRO A 1 29  ? 11.365  -10.875 0.964   1.00 0.00 ? 29  PRO A CD   1  
ATOM 427   H HA   . PRO A 1 29  ? 8.317   -11.577 0.213   1.00 0.00 ? 29  PRO A HA   1  
ATOM 428   H HB2  . PRO A 1 29  ? 9.619   -13.654 1.379   1.00 0.00 ? 29  PRO A HB2  1  
ATOM 429   H HB3  . PRO A 1 29  ? 10.000  -13.072 -0.246  1.00 0.00 ? 29  PRO A HB3  1  
ATOM 430   H HG2  . PRO A 1 29  ? 11.390  -12.503 2.344   1.00 0.00 ? 29  PRO A HG2  1  
ATOM 431   H HG3  . PRO A 1 29  ? 12.089  -12.871 0.756   1.00 0.00 ? 29  PRO A HG3  1  
ATOM 432   H HD2  . PRO A 1 29  ? 11.923  -10.348 1.725   1.00 0.00 ? 29  PRO A HD2  1  
ATOM 433   H HD3  . PRO A 1 29  ? 11.807  -10.715 -0.008  1.00 0.00 ? 29  PRO A HD3  1  
ATOM 434   N N    . THR A 1 30  ? 8.663   -10.856 3.285   1.00 0.00 ? 30  THR A N    1  
ATOM 435   C CA   . THR A 1 30  ? 8.046   -10.863 4.605   1.00 0.00 ? 30  THR A CA   1  
ATOM 436   C C    . THR A 1 30  ? 7.402   -9.517  4.918   1.00 0.00 ? 30  THR A C    1  
ATOM 437   O O    . THR A 1 30  ? 6.906   -9.296  6.023   1.00 0.00 ? 30  THR A O    1  
ATOM 438   C CB   . THR A 1 30  ? 9.073   -11.196 5.704   1.00 0.00 ? 30  THR A CB   1  
ATOM 439   O OG1  . THR A 1 30  ? 10.219  -10.346 5.577   1.00 0.00 ? 30  THR A OG1  1  
ATOM 440   C CG2  . THR A 1 30  ? 9.504   -12.653 5.619   1.00 0.00 ? 30  THR A CG2  1  
ATOM 441   H H    . THR A 1 30  ? 9.351   -10.189 3.081   1.00 0.00 ? 30  THR A H    1  
ATOM 442   H HA   . THR A 1 30  ? 7.282   -11.627 4.612   1.00 0.00 ? 30  THR A HA   1  
ATOM 443   H HB   . THR A 1 30  ? 8.614   -11.027 6.667   1.00 0.00 ? 30  THR A HB   1  
ATOM 444   H HG1  . THR A 1 30  ? 10.924  -10.673 6.141   1.00 0.00 ? 30  THR A HG1  1  
ATOM 445   H HG21 . THR A 1 30  ? 9.230   -13.053 4.654   1.00 0.00 ? 30  THR A HG21 1  
ATOM 446   H HG22 . THR A 1 30  ? 9.013   -13.219 6.396   1.00 0.00 ? 30  THR A HG22 1  
ATOM 447   H HG23 . THR A 1 30  ? 10.574  -12.719 5.746   1.00 0.00 ? 30  THR A HG23 1  
ATOM 448   N N    . THR A 1 31  ? 7.413   -8.619  3.938   1.00 0.00 ? 31  THR A N    1  
ATOM 449   C CA   . THR A 1 31  ? 6.830   -7.294  4.109   1.00 0.00 ? 31  THR A CA   1  
ATOM 450   C C    . THR A 1 31  ? 6.511   -6.656  2.762   1.00 0.00 ? 31  THR A C    1  
ATOM 451   O O    . THR A 1 31  ? 7.285   -6.770  1.811   1.00 0.00 ? 31  THR A O    1  
ATOM 452   C CB   . THR A 1 31  ? 7.772   -6.364  4.896   1.00 0.00 ? 31  THR A CB   1  
ATOM 453   O OG1  . THR A 1 31  ? 8.534   -7.123  5.840   1.00 0.00 ? 31  THR A OG1  1  
ATOM 454   C CG2  . THR A 1 31  ? 6.984   -5.285  5.623   1.00 0.00 ? 31  THR A CG2  1  
ATOM 455   H H    . THR A 1 31  ? 7.823   -8.855  3.080   1.00 0.00 ? 31  THR A H    1  
ATOM 456   H HA   . THR A 1 31  ? 5.914   -7.403  4.671   1.00 0.00 ? 31  THR A HA   1  
ATOM 457   H HB   . THR A 1 31  ? 8.448   -5.888  4.199   1.00 0.00 ? 31  THR A HB   1  
ATOM 458   H HG1  . THR A 1 31  ? 8.852   -6.542  6.536   1.00 0.00 ? 31  THR A HG1  1  
ATOM 459   H HG21 . THR A 1 31  ? 6.704   -4.511  4.923   1.00 0.00 ? 31  THR A HG21 1  
ATOM 460   H HG22 . THR A 1 31  ? 7.594   -4.859  6.406   1.00 0.00 ? 31  THR A HG22 1  
ATOM 461   H HG23 . THR A 1 31  ? 6.095   -5.718  6.054   1.00 0.00 ? 31  THR A HG23 1  
ATOM 462   N N    . VAL A 1 32  ? 5.368   -5.982  2.687   1.00 0.00 ? 32  VAL A N    1  
ATOM 463   C CA   . VAL A 1 32  ? 4.948   -5.323  1.457   1.00 0.00 ? 32  VAL A CA   1  
ATOM 464   C C    . VAL A 1 32  ? 4.474   -3.900  1.729   1.00 0.00 ? 32  VAL A C    1  
ATOM 465   O O    . VAL A 1 32  ? 3.692   -3.662  2.649   1.00 0.00 ? 32  VAL A O    1  
ATOM 466   C CB   . VAL A 1 32  ? 3.818   -6.103  0.759   1.00 0.00 ? 32  VAL A CB   1  
ATOM 467   C CG1  . VAL A 1 32  ? 3.252   -5.300  -0.401  1.00 0.00 ? 32  VAL A CG1  1  
ATOM 468   C CG2  . VAL A 1 32  ? 4.322   -7.458  0.285   1.00 0.00 ? 32  VAL A CG2  1  
ATOM 469   H H    . VAL A 1 32  ? 4.794   -5.926  3.480   1.00 0.00 ? 32  VAL A H    1  
ATOM 470   H HA   . VAL A 1 32  ? 5.798   -5.287  0.790   1.00 0.00 ? 32  VAL A HA   1  
ATOM 471   H HB   . VAL A 1 32  ? 3.027   -6.268  1.475   1.00 0.00 ? 32  VAL A HB   1  
ATOM 472   H HG11 . VAL A 1 32  ? 4.051   -5.029  -1.075  1.00 0.00 ? 32  VAL A HG11 1  
ATOM 473   H HG12 . VAL A 1 32  ? 2.521   -5.896  -0.929  1.00 0.00 ? 32  VAL A HG12 1  
ATOM 474   H HG13 . VAL A 1 32  ? 2.781   -4.404  -0.023  1.00 0.00 ? 32  VAL A HG13 1  
ATOM 475   H HG21 . VAL A 1 32  ? 4.303   -7.491  -0.794  1.00 0.00 ? 32  VAL A HG21 1  
ATOM 476   H HG22 . VAL A 1 32  ? 5.335   -7.608  0.631   1.00 0.00 ? 32  VAL A HG22 1  
ATOM 477   H HG23 . VAL A 1 32  ? 3.688   -8.237  0.681   1.00 0.00 ? 32  VAL A HG23 1  
ATOM 478   N N    . GLN A 1 33  ? 4.953   -2.958  0.923   1.00 0.00 ? 33  GLN A N    1  
ATOM 479   C CA   . GLN A 1 33  ? 4.577   -1.557  1.078   1.00 0.00 ? 33  GLN A CA   1  
ATOM 480   C C    . GLN A 1 33  ? 3.356   -1.223  0.228   1.00 0.00 ? 33  GLN A C    1  
ATOM 481   O O    . GLN A 1 33  ? 3.331   -1.492  -0.973  1.00 0.00 ? 33  GLN A O    1  
ATOM 482   C CB   . GLN A 1 33  ? 5.746   -0.648  0.693   1.00 0.00 ? 33  GLN A CB   1  
ATOM 483   C CG   . GLN A 1 33  ? 5.700   0.717   1.359   1.00 0.00 ? 33  GLN A CG   1  
ATOM 484   C CD   . GLN A 1 33  ? 6.526   1.754   0.623   1.00 0.00 ? 33  GLN A CD   1  
ATOM 485   O OE1  . GLN A 1 33  ? 7.557   1.436   0.030   1.00 0.00 ? 33  GLN A OE1  1  
ATOM 486   N NE2  . GLN A 1 33  ? 6.075   3.002   0.656   1.00 0.00 ? 33  GLN A NE2  1  
ATOM 487   H H    . GLN A 1 33  ? 5.572   -3.210  0.208   1.00 0.00 ? 33  GLN A H    1  
ATOM 488   H HA   . GLN A 1 33  ? 4.333   -1.393  2.117   1.00 0.00 ? 33  GLN A HA   1  
ATOM 489   H HB2  . GLN A 1 33  ? 6.670   -1.132  0.973   1.00 0.00 ? 33  GLN A HB2  1  
ATOM 490   H HB3  . GLN A 1 33  ? 5.735   -0.503  -0.377  1.00 0.00 ? 33  GLN A HB3  1  
ATOM 491   H HG2  . GLN A 1 33  ? 4.675   1.054   1.392   1.00 0.00 ? 33  GLN A HG2  1  
ATOM 492   H HG3  . GLN A 1 33  ? 6.080   0.624   2.366   1.00 0.00 ? 33  GLN A HG3  1  
ATOM 493   H HE21 . GLN A 1 33  ? 5.247   3.182   1.149   1.00 0.00 ? 33  GLN A HE21 1  
ATOM 494   H HE22 . GLN A 1 33  ? 6.589   3.693   0.190   1.00 0.00 ? 33  GLN A HE22 1  
ATOM 495   N N    . VAL A 1 34  ? 2.344   -0.636  0.859   1.00 0.00 ? 34  VAL A N    1  
ATOM 496   C CA   . VAL A 1 34  ? 1.120   -0.264  0.160   1.00 0.00 ? 34  VAL A CA   1  
ATOM 497   C C    . VAL A 1 34  ? 0.971   1.251   0.078   1.00 0.00 ? 34  VAL A C    1  
ATOM 498   O O    . VAL A 1 34  ? 1.021   1.946   1.093   1.00 0.00 ? 34  VAL A O    1  
ATOM 499   C CB   . VAL A 1 34  ? -0.123  -0.855  0.852   1.00 0.00 ? 34  VAL A CB   1  
ATOM 500   C CG1  . VAL A 1 34  ? -1.391  -0.429  0.128   1.00 0.00 ? 34  VAL A CG1  1  
ATOM 501   C CG2  . VAL A 1 34  ? -0.023  -2.371  0.922   1.00 0.00 ? 34  VAL A CG2  1  
ATOM 502   H H    . VAL A 1 34  ? 2.424   -0.447  1.817   1.00 0.00 ? 34  VAL A H    1  
ATOM 503   H HA   . VAL A 1 34  ? 1.172   -0.666  -0.842  1.00 0.00 ? 34  VAL A HA   1  
ATOM 504   H HB   . VAL A 1 34  ? -0.164  -0.471  1.861   1.00 0.00 ? 34  VAL A HB   1  
ATOM 505   H HG11 . VAL A 1 34  ? -1.869  0.368   0.679   1.00 0.00 ? 34  VAL A HG11 1  
ATOM 506   H HG12 . VAL A 1 34  ? -1.140  -0.083  -0.864  1.00 0.00 ? 34  VAL A HG12 1  
ATOM 507   H HG13 . VAL A 1 34  ? -2.064  -1.270  0.057   1.00 0.00 ? 34  VAL A HG13 1  
ATOM 508   H HG21 . VAL A 1 34  ? 1.015   -2.660  0.992   1.00 0.00 ? 34  VAL A HG21 1  
ATOM 509   H HG22 . VAL A 1 34  ? -0.554  -2.727  1.793   1.00 0.00 ? 34  VAL A HG22 1  
ATOM 510   H HG23 . VAL A 1 34  ? -0.459  -2.803  0.034   1.00 0.00 ? 34  VAL A HG23 1  
ATOM 511   N N    . THR A 1 35  ? 0.789   1.758   -1.137  1.00 0.00 ? 35  THR A N    1  
ATOM 512   C CA   . THR A 1 35  ? 0.633   3.191   -1.352  1.00 0.00 ? 35  THR A CA   1  
ATOM 513   C C    . THR A 1 35  ? -0.686  3.502   -2.050  1.00 0.00 ? 35  THR A C    1  
ATOM 514   O O    . THR A 1 35  ? -1.228  2.667   -2.773  1.00 0.00 ? 35  THR A O    1  
ATOM 515   C CB   . THR A 1 35  ? 1.792   3.762   -2.190  1.00 0.00 ? 35  THR A CB   1  
ATOM 516   O OG1  . THR A 1 35  ? 3.045   3.296   -1.677  1.00 0.00 ? 35  THR A OG1  1  
ATOM 517   C CG2  . THR A 1 35  ? 1.769   5.283   -2.180  1.00 0.00 ? 35  THR A CG2  1  
ATOM 518   H H    . THR A 1 35  ? 0.759   1.152   -1.907  1.00 0.00 ? 35  THR A H    1  
ATOM 519   H HA   . THR A 1 35  ? 0.642   3.676   -0.386  1.00 0.00 ? 35  THR A HA   1  
ATOM 520   H HB   . THR A 1 35  ? 1.681   3.422   -3.210  1.00 0.00 ? 35  THR A HB   1  
ATOM 521   H HG1  . THR A 1 35  ? 3.367   3.909   -1.012  1.00 0.00 ? 35  THR A HG1  1  
ATOM 522   H HG21 . THR A 1 35  ? 2.771   5.659   -2.325  1.00 0.00 ? 35  THR A HG21 1  
ATOM 523   H HG22 . THR A 1 35  ? 1.386   5.631   -1.233  1.00 0.00 ? 35  THR A HG22 1  
ATOM 524   H HG23 . THR A 1 35  ? 1.133   5.638   -2.978  1.00 0.00 ? 35  THR A HG23 1  
ATOM 525   N N    . TRP A 1 36  ? -1.196  4.708   -1.828  1.00 0.00 ? 36  TRP A N    1  
ATOM 526   C CA   . TRP A 1 36  ? -2.452  5.130   -2.438  1.00 0.00 ? 36  TRP A CA   1  
ATOM 527   C C    . TRP A 1 36  ? -2.620  6.643   -2.347  1.00 0.00 ? 36  TRP A C    1  
ATOM 528   O O    . TRP A 1 36  ? -1.839  7.326   -1.685  1.00 0.00 ? 36  TRP A O    1  
ATOM 529   C CB   . TRP A 1 36  ? -3.631  4.432   -1.759  1.00 0.00 ? 36  TRP A CB   1  
ATOM 530   C CG   . TRP A 1 36  ? -3.870  4.898   -0.355  1.00 0.00 ? 36  TRP A CG   1  
ATOM 531   C CD1  . TRP A 1 36  ? -4.616  5.973   0.037   1.00 0.00 ? 36  TRP A CD1  1  
ATOM 532   C CD2  . TRP A 1 36  ? -3.358  4.305   0.844   1.00 0.00 ? 36  TRP A CD2  1  
ATOM 533   N NE1  . TRP A 1 36  ? -4.599  6.084   1.406   1.00 0.00 ? 36  TRP A NE1  1  
ATOM 534   C CE2  . TRP A 1 36  ? -3.835  5.072   1.925   1.00 0.00 ? 36  TRP A CE2  1  
ATOM 535   C CE3  . TRP A 1 36  ? -2.545  3.200   1.109   1.00 0.00 ? 36  TRP A CE3  1  
ATOM 536   C CZ2  . TRP A 1 36  ? -3.523  4.768   3.247   1.00 0.00 ? 36  TRP A CZ2  1  
ATOM 537   C CZ3  . TRP A 1 36  ? -2.237  2.899   2.422   1.00 0.00 ? 36  TRP A CZ3  1  
ATOM 538   C CH2  . TRP A 1 36  ? -2.725  3.680   3.478   1.00 0.00 ? 36  TRP A CH2  1  
ATOM 539   H H    . TRP A 1 36  ? -0.716  5.331   -1.242  1.00 0.00 ? 36  TRP A H    1  
ATOM 540   H HA   . TRP A 1 36  ? -2.427  4.844   -3.479  1.00 0.00 ? 36  TRP A HA   1  
ATOM 541   H HB2  . TRP A 1 36  ? -4.529  4.618   -2.329  1.00 0.00 ? 36  TRP A HB2  1  
ATOM 542   H HB3  . TRP A 1 36  ? -3.442  3.368   -1.730  1.00 0.00 ? 36  TRP A HB3  1  
ATOM 543   H HD1  . TRP A 1 36  ? -5.136  6.631   -0.642  1.00 0.00 ? 36  TRP A HD1  1  
ATOM 544   H HE1  . TRP A 1 36  ? -5.060  6.774   1.926   1.00 0.00 ? 36  TRP A HE1  1  
ATOM 545   H HE3  . TRP A 1 36  ? -2.159  2.585   0.309   1.00 0.00 ? 36  TRP A HE3  1  
ATOM 546   H HZ2  . TRP A 1 36  ? -3.893  5.360   4.072   1.00 0.00 ? 36  TRP A HZ2  1  
ATOM 547   H HZ3  . TRP A 1 36  ? -1.609  2.049   2.647   1.00 0.00 ? 36  TRP A HZ3  1  
ATOM 548   H HH2  . TRP A 1 36  ? -2.459  3.409   4.488   1.00 0.00 ? 36  TRP A HH2  1  
ATOM 549   N N    . THR A 1 37  ? -3.646  7.161   -3.016  1.00 0.00 ? 37  THR A N    1  
ATOM 550   C CA   . THR A 1 37  ? -3.916  8.593   -3.011  1.00 0.00 ? 37  THR A CA   1  
ATOM 551   C C    . THR A 1 37  ? -5.407  8.872   -3.160  1.00 0.00 ? 37  THR A C    1  
ATOM 552   O O    . THR A 1 37  ? -6.144  8.072   -3.735  1.00 0.00 ? 37  THR A O    1  
ATOM 553   C CB   . THR A 1 37  ? -3.155  9.312   -4.142  1.00 0.00 ? 37  THR A CB   1  
ATOM 554   O OG1  . THR A 1 37  ? -3.206  10.729  -3.942  1.00 0.00 ? 37  THR A OG1  1  
ATOM 555   C CG2  . THR A 1 37  ? -3.749  8.965   -5.499  1.00 0.00 ? 37  THR A CG2  1  
ATOM 556   H H    . THR A 1 37  ? -4.233  6.565   -3.525  1.00 0.00 ? 37  THR A H    1  
ATOM 557   H HA   . THR A 1 37  ? -3.577  8.993   -2.067  1.00 0.00 ? 37  THR A HA   1  
ATOM 558   H HB   . THR A 1 37  ? -2.124  8.990   -4.123  1.00 0.00 ? 37  THR A HB   1  
ATOM 559   H HG1  . THR A 1 37  ? -3.223  10.920  -3.001  1.00 0.00 ? 37  THR A HG1  1  
ATOM 560   H HG21 . THR A 1 37  ? -4.818  9.114   -5.473  1.00 0.00 ? 37  THR A HG21 1  
ATOM 561   H HG22 . THR A 1 37  ? -3.534  7.932   -5.731  1.00 0.00 ? 37  THR A HG22 1  
ATOM 562   H HG23 . THR A 1 37  ? -3.315  9.602   -6.254  1.00 0.00 ? 37  THR A HG23 1  
ATOM 563   N N    . VAL A 1 38  ? -5.846  10.013  -2.638  1.00 0.00 ? 38  VAL A N    1  
ATOM 564   C CA   . VAL A 1 38  ? -7.250  10.399  -2.714  1.00 0.00 ? 38  VAL A CA   1  
ATOM 565   C C    . VAL A 1 38  ? -7.400  11.832  -3.213  1.00 0.00 ? 38  VAL A C    1  
ATOM 566   O O    . VAL A 1 38  ? -6.653  12.722  -2.808  1.00 0.00 ? 38  VAL A O    1  
ATOM 567   C CB   . VAL A 1 38  ? -7.943  10.268  -1.345  1.00 0.00 ? 38  VAL A CB   1  
ATOM 568   C CG1  . VAL A 1 38  ? -7.717  8.882   -0.762  1.00 0.00 ? 38  VAL A CG1  1  
ATOM 569   C CG2  . VAL A 1 38  ? -7.446  11.345  -0.392  1.00 0.00 ? 38  VAL A CG2  1  
ATOM 570   H H    . VAL A 1 38  ? -5.210  10.610  -2.191  1.00 0.00 ? 38  VAL A H    1  
ATOM 571   H HA   . VAL A 1 38  ? -7.742  9.733   -3.408  1.00 0.00 ? 38  VAL A HA   1  
ATOM 572   H HB   . VAL A 1 38  ? -9.005  10.406  -1.487  1.00 0.00 ? 38  VAL A HB   1  
ATOM 573   H HG11 . VAL A 1 38  ? -8.437  8.194   -1.180  1.00 0.00 ? 38  VAL A HG11 1  
ATOM 574   H HG12 . VAL A 1 38  ? -6.717  8.549   -1.001  1.00 0.00 ? 38  VAL A HG12 1  
ATOM 575   H HG13 . VAL A 1 38  ? -7.837  8.919   0.311   1.00 0.00 ? 38  VAL A HG13 1  
ATOM 576   H HG21 . VAL A 1 38  ? -8.129  12.180  -0.406  1.00 0.00 ? 38  VAL A HG21 1  
ATOM 577   H HG22 . VAL A 1 38  ? -7.390  10.942  0.609   1.00 0.00 ? 38  VAL A HG22 1  
ATOM 578   H HG23 . VAL A 1 38  ? -6.465  11.675  -0.701  1.00 0.00 ? 38  VAL A HG23 1  
ATOM 579   N N    . ASP A 1 39  ? -8.371  12.047  -4.094  1.00 0.00 ? 39  ASP A N    1  
ATOM 580   C CA   . ASP A 1 39  ? -8.621  13.372  -4.648  1.00 0.00 ? 39  ASP A CA   1  
ATOM 581   C C    . ASP A 1 39  ? -9.223  14.297  -3.594  1.00 0.00 ? 39  ASP A C    1  
ATOM 582   O O    . ASP A 1 39  ? -8.730  15.403  -3.370  1.00 0.00 ? 39  ASP A O    1  
ATOM 583   C CB   . ASP A 1 39  ? -9.556  13.277  -5.854  1.00 0.00 ? 39  ASP A CB   1  
ATOM 584   C CG   . ASP A 1 39  ? -9.525  14.526  -6.712  1.00 0.00 ? 39  ASP A CG   1  
ATOM 585   O OD1  . ASP A 1 39  ? -8.417  14.950  -7.101  1.00 0.00 ? 39  ASP A OD1  1  
ATOM 586   O OD2  . ASP A 1 39  ? -10.608 15.081  -6.993  1.00 0.00 ? 39  ASP A OD2  1  
ATOM 587   H H    . ASP A 1 39  ? -8.933  11.296  -4.378  1.00 0.00 ? 39  ASP A H    1  
ATOM 588   H HA   . ASP A 1 39  ? -7.675  13.781  -4.969  1.00 0.00 ? 39  ASP A HA   1  
ATOM 589   H HB2  . ASP A 1 39  ? -9.260  12.436  -6.465  1.00 0.00 ? 39  ASP A HB2  1  
ATOM 590   H HB3  . ASP A 1 39  ? -10.567 13.125  -5.506  1.00 0.00 ? 39  ASP A HB3  1  
ATOM 591   N N    . ARG A 1 40  ? -10.291 13.837  -2.951  1.00 0.00 ? 40  ARG A N    1  
ATOM 592   C CA   . ARG A 1 40  ? -10.961 14.623  -1.923  1.00 0.00 ? 40  ARG A CA   1  
ATOM 593   C C    . ARG A 1 40  ? -10.704 14.039  -0.537  1.00 0.00 ? 40  ARG A C    1  
ATOM 594   O O    . ARG A 1 40  ? -11.414 13.138  -0.092  1.00 0.00 ? 40  ARG A O    1  
ATOM 595   C CB   . ARG A 1 40  ? -12.466 14.678  -2.193  1.00 0.00 ? 40  ARG A CB   1  
ATOM 596   C CG   . ARG A 1 40  ? -12.828 15.413  -3.473  1.00 0.00 ? 40  ARG A CG   1  
ATOM 597   C CD   . ARG A 1 40  ? -14.273 15.157  -3.873  1.00 0.00 ? 40  ARG A CD   1  
ATOM 598   N NE   . ARG A 1 40  ? -14.498 15.397  -5.296  1.00 0.00 ? 40  ARG A NE   1  
ATOM 599   C CZ   . ARG A 1 40  ? -15.569 14.966  -5.954  1.00 0.00 ? 40  ARG A CZ   1  
ATOM 600   N NH1  . ARG A 1 40  ? -16.508 14.278  -5.319  1.00 0.00 ? 40  ARG A NH1  1  
ATOM 601   N NH2  . ARG A 1 40  ? -15.702 15.225  -7.248  1.00 0.00 ? 40  ARG A NH2  1  
ATOM 602   H H    . ARG A 1 40  ? -10.637 12.947  -3.174  1.00 0.00 ? 40  ARG A H    1  
ATOM 603   H HA   . ARG A 1 40  ? -10.561 15.625  -1.958  1.00 0.00 ? 40  ARG A HA   1  
ATOM 604   H HB2  . ARG A 1 40  ? -12.845 13.669  -2.264  1.00 0.00 ? 40  ARG A HB2  1  
ATOM 605   H HB3  . ARG A 1 40  ? -12.950 15.178  -1.368  1.00 0.00 ? 40  ARG A HB3  1  
ATOM 606   H HG2  . ARG A 1 40  ? -12.692 16.474  -3.320  1.00 0.00 ? 40  ARG A HG2  1  
ATOM 607   H HG3  . ARG A 1 40  ? -12.179 15.076  -4.267  1.00 0.00 ? 40  ARG A HG3  1  
ATOM 608   H HD2  . ARG A 1 40  ? -14.518 14.130  -3.648  1.00 0.00 ? 40  ARG A HD2  1  
ATOM 609   H HD3  . ARG A 1 40  ? -14.912 15.813  -3.301  1.00 0.00 ? 40  ARG A HD3  1  
ATOM 610   H HE   . ARG A 1 40  ? -13.817 15.904  -5.784  1.00 0.00 ? 40  ARG A HE   1  
ATOM 611   H HH11 . ARG A 1 40  ? -16.410 14.083  -4.344  1.00 0.00 ? 40  ARG A HH11 1  
ATOM 612   H HH12 . ARG A 1 40  ? -17.314 13.956  -5.817  1.00 0.00 ? 40  ARG A HH12 1  
ATOM 613   H HH21 . ARG A 1 40  ? -14.997 15.744  -7.729  1.00 0.00 ? 40  ARG A HH21 1  
ATOM 614   H HH22 . ARG A 1 40  ? -16.508 14.900  -7.742  1.00 0.00 ? 40  ARG A HH22 1  
ATOM 615   N N    . GLN A 1 41  ? -9.683  14.558  0.138   1.00 0.00 ? 41  GLN A N    1  
ATOM 616   C CA   . GLN A 1 41  ? -9.332  14.086  1.472   1.00 0.00 ? 41  GLN A CA   1  
ATOM 617   C C    . GLN A 1 41  ? -10.422 14.439  2.479   1.00 0.00 ? 41  GLN A C    1  
ATOM 618   O O    . GLN A 1 41  ? -10.713 15.608  2.732   1.00 0.00 ? 41  GLN A O    1  
ATOM 619   C CB   . GLN A 1 41  ? -7.998  14.690  1.915   1.00 0.00 ? 41  GLN A CB   1  
ATOM 620   C CG   . GLN A 1 41  ? -7.678  14.450  3.381   1.00 0.00 ? 41  GLN A CG   1  
ATOM 621   C CD   . GLN A 1 41  ? -6.419  15.166  3.829   1.00 0.00 ? 41  GLN A CD   1  
ATOM 622   O OE1  . GLN A 1 41  ? -5.327  14.900  3.325   1.00 0.00 ? 41  GLN A OE1  1  
ATOM 623   N NE2  . GLN A 1 41  ? -6.564  16.081  4.780   1.00 0.00 ? 41  GLN A NE2  1  
ATOM 624   H H    . GLN A 1 41  ? -9.155  15.274  -0.270  1.00 0.00 ? 41  GLN A H    1  
ATOM 625   H HA   . GLN A 1 41  ? -9.234  13.012  1.429   1.00 0.00 ? 41  GLN A HA   1  
ATOM 626   H HB2  . GLN A 1 41  ? -7.206  14.258  1.320   1.00 0.00 ? 41  GLN A HB2  1  
ATOM 627   H HB3  . GLN A 1 41  ? -8.025  15.756  1.744   1.00 0.00 ? 41  GLN A HB3  1  
ATOM 628   H HG2  . GLN A 1 41  ? -8.505  14.802  3.979   1.00 0.00 ? 41  GLN A HG2  1  
ATOM 629   H HG3  . GLN A 1 41  ? -7.547  13.390  3.539   1.00 0.00 ? 41  GLN A HG3  1  
ATOM 630   H HE21 . GLN A 1 41  ? -7.464  16.240  5.135   1.00 0.00 ? 41  GLN A HE21 1  
ATOM 631   H HE22 . GLN A 1 41  ? -5.767  16.559  5.088   1.00 0.00 ? 41  GLN A HE22 1  
ATOM 632   N N    . PRO A 1 42  ? -11.041 13.405  3.069   1.00 0.00 ? 42  PRO A N    1  
ATOM 633   C CA   . PRO A 1 42  ? -12.108 13.581  4.058   1.00 0.00 ? 42  PRO A CA   1  
ATOM 634   C C    . PRO A 1 42  ? -11.591 14.149  5.375   1.00 0.00 ? 42  PRO A C    1  
ATOM 635   O O    . PRO A 1 42  ? -10.531 13.751  5.858   1.00 0.00 ? 42  PRO A O    1  
ATOM 636   C CB   . PRO A 1 42  ? -12.642 12.161  4.260   1.00 0.00 ? 42  PRO A CB   1  
ATOM 637   C CG   . PRO A 1 42  ? -11.499 11.273  3.904   1.00 0.00 ? 42  PRO A CG   1  
ATOM 638   C CD   . PRO A 1 42  ? -10.745 11.985  2.816   1.00 0.00 ? 42  PRO A CD   1  
ATOM 639   H HA   . PRO A 1 42  ? -12.899 14.214  3.680   1.00 0.00 ? 42  PRO A HA   1  
ATOM 640   H HB2  . PRO A 1 42  ? -12.939 12.029  5.291   1.00 0.00 ? 42  PRO A HB2  1  
ATOM 641   H HB3  . PRO A 1 42  ? -13.488 11.994  3.611   1.00 0.00 ? 42  PRO A HB3  1  
ATOM 642   H HG2  . PRO A 1 42  ? -10.866 11.127  4.766   1.00 0.00 ? 42  PRO A HG2  1  
ATOM 643   H HG3  . PRO A 1 42  ? -11.870 10.325  3.544   1.00 0.00 ? 42  PRO A HG3  1  
ATOM 644   H HD2  . PRO A 1 42  ? -9.686  11.790  2.900   1.00 0.00 ? 42  PRO A HD2  1  
ATOM 645   H HD3  . PRO A 1 42  ? -11.110 11.683  1.845   1.00 0.00 ? 42  PRO A HD3  1  
ATOM 646   N N    . GLN A 1 43  ? -12.346 15.080  5.950   1.00 0.00 ? 43  GLN A N    1  
ATOM 647   C CA   . GLN A 1 43  ? -11.961 15.702  7.211   1.00 0.00 ? 43  GLN A CA   1  
ATOM 648   C C    . GLN A 1 43  ? -12.456 14.880  8.396   1.00 0.00 ? 43  GLN A C    1  
ATOM 649   O O    . GLN A 1 43  ? -11.807 14.824  9.441   1.00 0.00 ? 43  GLN A O    1  
ATOM 650   C CB   . GLN A 1 43  ? -12.519 17.124  7.293   1.00 0.00 ? 43  GLN A CB   1  
ATOM 651   C CG   . GLN A 1 43  ? -11.614 18.170  6.662   1.00 0.00 ? 43  GLN A CG   1  
ATOM 652   C CD   . GLN A 1 43  ? -12.195 19.568  6.740   1.00 0.00 ? 43  GLN A CD   1  
ATOM 653   O OE1  . GLN A 1 43  ? -13.412 19.745  6.791   1.00 0.00 ? 43  GLN A OE1  1  
ATOM 654   N NE2  . GLN A 1 43  ? -11.325 20.571  6.750   1.00 0.00 ? 43  GLN A NE2  1  
ATOM 655   H H    . GLN A 1 43  ? -13.179 15.355  5.515   1.00 0.00 ? 43  GLN A H    1  
ATOM 656   H HA   . GLN A 1 43  ? -10.883 15.745  7.245   1.00 0.00 ? 43  GLN A HA   1  
ATOM 657   H HB2  . GLN A 1 43  ? -13.474 17.153  6.790   1.00 0.00 ? 43  GLN A HB2  1  
ATOM 658   H HB3  . GLN A 1 43  ? -12.661 17.383  8.332   1.00 0.00 ? 43  GLN A HB3  1  
ATOM 659   H HG2  . GLN A 1 43  ? -10.664 18.162  7.175   1.00 0.00 ? 43  GLN A HG2  1  
ATOM 660   H HG3  . GLN A 1 43  ? -11.463 17.916  5.623   1.00 0.00 ? 43  GLN A HG3  1  
ATOM 661   H HE21 . GLN A 1 43  ? -10.369 20.355  6.706   1.00 0.00 ? 43  GLN A HE21 1  
ATOM 662   H HE22 . GLN A 1 43  ? -11.672 21.485  6.799   1.00 0.00 ? 43  GLN A HE22 1  
ATOM 663   N N    . PHE A 1 44  ? -13.611 14.243  8.228   1.00 0.00 ? 44  PHE A N    1  
ATOM 664   C CA   . PHE A 1 44  ? -14.194 13.424  9.284   1.00 0.00 ? 44  PHE A CA   1  
ATOM 665   C C    . PHE A 1 44  ? -13.398 12.136  9.476   1.00 0.00 ? 44  PHE A C    1  
ATOM 666   O O    . PHE A 1 44  ? -13.135 11.719  10.605  1.00 0.00 ? 44  PHE A O    1  
ATOM 667   C CB   . PHE A 1 44  ? -15.651 13.092  8.956   1.00 0.00 ? 44  PHE A CB   1  
ATOM 668   C CG   . PHE A 1 44  ? -15.833 12.469  7.602   1.00 0.00 ? 44  PHE A CG   1  
ATOM 669   C CD1  . PHE A 1 44  ? -15.886 13.258  6.463   1.00 0.00 ? 44  PHE A CD1  1  
ATOM 670   C CD2  . PHE A 1 44  ? -15.951 11.096  7.467   1.00 0.00 ? 44  PHE A CD2  1  
ATOM 671   C CE1  . PHE A 1 44  ? -16.055 12.687  5.216   1.00 0.00 ? 44  PHE A CE1  1  
ATOM 672   C CE2  . PHE A 1 44  ? -16.120 10.519  6.222   1.00 0.00 ? 44  PHE A CE2  1  
ATOM 673   C CZ   . PHE A 1 44  ? -16.171 11.316  5.095   1.00 0.00 ? 44  PHE A CZ   1  
ATOM 674   H H    . PHE A 1 44  ? -14.082 14.326  7.372   1.00 0.00 ? 44  PHE A H    1  
ATOM 675   H HA   . PHE A 1 44  ? -14.161 13.994  10.200  1.00 0.00 ? 44  PHE A HA   1  
ATOM 676   H HB2  . PHE A 1 44  ? -16.030 12.400  9.693   1.00 0.00 ? 44  PHE A HB2  1  
ATOM 677   H HB3  . PHE A 1 44  ? -16.235 14.000  8.987   1.00 0.00 ? 44  PHE A HB3  1  
ATOM 678   H HD1  . PHE A 1 44  ? -15.795 14.330  6.556   1.00 0.00 ? 44  PHE A HD1  1  
ATOM 679   H HD2  . PHE A 1 44  ? -15.911 10.471  8.348   1.00 0.00 ? 44  PHE A HD2  1  
ATOM 680   H HE1  . PHE A 1 44  ? -16.094 13.312  4.337   1.00 0.00 ? 44  PHE A HE1  1  
ATOM 681   H HE2  . PHE A 1 44  ? -16.210 9.447   6.131   1.00 0.00 ? 44  PHE A HE2  1  
ATOM 682   H HZ   . PHE A 1 44  ? -16.303 10.868  4.122   1.00 0.00 ? 44  PHE A HZ   1  
ATOM 683   N N    . ILE A 1 45  ? -13.018 11.512  8.367   1.00 0.00 ? 45  ILE A N    1  
ATOM 684   C CA   . ILE A 1 45  ? -12.253 10.272  8.413   1.00 0.00 ? 45  ILE A CA   1  
ATOM 685   C C    . ILE A 1 45  ? -11.307 10.254  9.609   1.00 0.00 ? 45  ILE A C    1  
ATOM 686   O O    . ILE A 1 45  ? -10.782 11.291  10.013  1.00 0.00 ? 45  ILE A O    1  
ATOM 687   C CB   . ILE A 1 45  ? -11.435 10.068  7.124   1.00 0.00 ? 45  ILE A CB   1  
ATOM 688   C CG1  . ILE A 1 45  ? -11.156 8.580   6.901   1.00 0.00 ? 45  ILE A CG1  1  
ATOM 689   C CG2  . ILE A 1 45  ? -10.132 10.851  7.193   1.00 0.00 ? 45  ILE A CG2  1  
ATOM 690   C CD1  . ILE A 1 45  ? -10.527 8.277   5.559   1.00 0.00 ? 45  ILE A CD1  1  
ATOM 691   H H    . ILE A 1 45  ? -13.258 11.894  7.497   1.00 0.00 ? 45  ILE A H    1  
ATOM 692   H HA   . ILE A 1 45  ? -12.951 9.453   8.506   1.00 0.00 ? 45  ILE A HA   1  
ATOM 693   H HB   . ILE A 1 45  ? -12.011 10.447  6.294   1.00 0.00 ? 45  ILE A HB   1  
ATOM 694   H HG12 . ILE A 1 45  ? -10.486 8.226   7.669   1.00 0.00 ? 45  ILE A HG12 1  
ATOM 695   H HG13 . ILE A 1 45  ? -12.087 8.034   6.962   1.00 0.00 ? 45  ILE A HG13 1  
ATOM 696   H HG21 . ILE A 1 45  ? -9.524  10.468  7.999   1.00 0.00 ? 45  ILE A HG21 1  
ATOM 697   H HG22 . ILE A 1 45  ? -9.599  10.746  6.260   1.00 0.00 ? 45  ILE A HG22 1  
ATOM 698   H HG23 . ILE A 1 45  ? -10.348 11.894  7.369   1.00 0.00 ? 45  ILE A HG23 1  
ATOM 699   H HD11 . ILE A 1 45  ? -10.180 7.255   5.547   1.00 0.00 ? 45  ILE A HD11 1  
ATOM 700   H HD12 . ILE A 1 45  ? -11.257 8.421   4.778   1.00 0.00 ? 45  ILE A HD12 1  
ATOM 701   H HD13 . ILE A 1 45  ? -9.690  8.942   5.396   1.00 0.00 ? 45  ILE A HD13 1  
ATOM 702   N N    . GLN A 1 46  ? -11.096 9.068   10.171  1.00 0.00 ? 46  GLN A N    1  
ATOM 703   C CA   . GLN A 1 46  ? -10.213 8.915   11.321  1.00 0.00 ? 46  GLN A CA   1  
ATOM 704   C C    . GLN A 1 46  ? -8.902  8.249   10.916  1.00 0.00 ? 46  GLN A C    1  
ATOM 705   O O    . GLN A 1 46  ? -7.881  8.406   11.585  1.00 0.00 ? 46  GLN A O    1  
ATOM 706   C CB   . GLN A 1 46  ? -10.900 8.092   12.413  1.00 0.00 ? 46  GLN A CB   1  
ATOM 707   C CG   . GLN A 1 46  ? -11.849 8.904   13.279  1.00 0.00 ? 46  GLN A CG   1  
ATOM 708   C CD   . GLN A 1 46  ? -11.184 10.120  13.893  1.00 0.00 ? 46  GLN A CD   1  
ATOM 709   O OE1  . GLN A 1 46  ? -10.460 10.012  14.883  1.00 0.00 ? 46  GLN A OE1  1  
ATOM 710   N NE2  . GLN A 1 46  ? -11.425 11.287  13.306  1.00 0.00 ? 46  GLN A NE2  1  
ATOM 711   H H    . GLN A 1 46  ? -11.544 8.278   9.804   1.00 0.00 ? 46  GLN A H    1  
ATOM 712   H HA   . GLN A 1 46  ? -9.997  9.899   11.707  1.00 0.00 ? 46  GLN A HA   1  
ATOM 713   H HB2  . GLN A 1 46  ? -11.462 7.297   11.947  1.00 0.00 ? 46  GLN A HB2  1  
ATOM 714   H HB3  . GLN A 1 46  ? -10.144 7.661   13.052  1.00 0.00 ? 46  GLN A HB3  1  
ATOM 715   H HG2  . GLN A 1 46  ? -12.678 9.236   12.670  1.00 0.00 ? 46  GLN A HG2  1  
ATOM 716   H HG3  . GLN A 1 46  ? -12.218 8.273   14.074  1.00 0.00 ? 46  GLN A HG3  1  
ATOM 717   H HE21 . GLN A 1 46  ? -12.013 11.297  12.522  1.00 0.00 ? 46  GLN A HE21 1  
ATOM 718   H HE22 . GLN A 1 46  ? -11.009 12.089  13.683  1.00 0.00 ? 46  GLN A HE22 1  
ATOM 719   N N    . GLY A 1 47  ? -8.937  7.504   9.815   1.00 0.00 ? 47  GLY A N    1  
ATOM 720   C CA   . GLY A 1 47  ? -7.746  6.825   9.340   1.00 0.00 ? 47  GLY A CA   1  
ATOM 721   C C    . GLY A 1 47  ? -8.001  6.016   8.084   1.00 0.00 ? 47  GLY A C    1  
ATOM 722   O O    . GLY A 1 47  ? -8.767  6.433   7.214   1.00 0.00 ? 47  GLY A O    1  
ATOM 723   H H    . GLY A 1 47  ? -9.779  7.415   9.321   1.00 0.00 ? 47  GLY A H    1  
ATOM 724   H HA2  . GLY A 1 47  ? -6.984  7.561   9.133   1.00 0.00 ? 47  GLY A HA2  1  
ATOM 725   H HA3  . GLY A 1 47  ? -7.390  6.162   10.115  1.00 0.00 ? 47  GLY A HA3  1  
ATOM 726   N N    . TYR A 1 48  ? -7.359  4.858   7.988   1.00 0.00 ? 48  TYR A N    1  
ATOM 727   C CA   . TYR A 1 48  ? -7.517  3.990   6.826   1.00 0.00 ? 48  TYR A CA   1  
ATOM 728   C C    . TYR A 1 48  ? -7.412  2.521   7.225   1.00 0.00 ? 48  TYR A C    1  
ATOM 729   O O    . TYR A 1 48  ? -6.600  2.154   8.075   1.00 0.00 ? 48  TYR A O    1  
ATOM 730   C CB   . TYR A 1 48  ? -6.462  4.320   5.769   1.00 0.00 ? 48  TYR A CB   1  
ATOM 731   C CG   . TYR A 1 48  ? -6.755  5.584   4.994   1.00 0.00 ? 48  TYR A CG   1  
ATOM 732   C CD1  . TYR A 1 48  ? -7.599  5.566   3.891   1.00 0.00 ? 48  TYR A CD1  1  
ATOM 733   C CD2  . TYR A 1 48  ? -6.188  6.797   5.365   1.00 0.00 ? 48  TYR A CD2  1  
ATOM 734   C CE1  . TYR A 1 48  ? -7.870  6.719   3.179   1.00 0.00 ? 48  TYR A CE1  1  
ATOM 735   C CE2  . TYR A 1 48  ? -6.454  7.955   4.660   1.00 0.00 ? 48  TYR A CE2  1  
ATOM 736   C CZ   . TYR A 1 48  ? -7.295  7.911   3.568   1.00 0.00 ? 48  TYR A CZ   1  
ATOM 737   O OH   . TYR A 1 48  ? -7.561  9.062   2.863   1.00 0.00 ? 48  TYR A OH   1  
ATOM 738   H H    . TYR A 1 48  ? -6.762  4.580   8.714   1.00 0.00 ? 48  TYR A H    1  
ATOM 739   H HA   . TYR A 1 48  ? -8.498  4.169   6.410   1.00 0.00 ? 48  TYR A HA   1  
ATOM 740   H HB2  . TYR A 1 48  ? -5.505  4.442   6.252   1.00 0.00 ? 48  TYR A HB2  1  
ATOM 741   H HB3  . TYR A 1 48  ? -6.402  3.504   5.064   1.00 0.00 ? 48  TYR A HB3  1  
ATOM 742   H HD1  . TYR A 1 48  ? -8.048  4.631   3.589   1.00 0.00 ? 48  TYR A HD1  1  
ATOM 743   H HD2  . TYR A 1 48  ? -5.529  6.828   6.221   1.00 0.00 ? 48  TYR A HD2  1  
ATOM 744   H HE1  . TYR A 1 48  ? -8.529  6.685   2.324   1.00 0.00 ? 48  TYR A HE1  1  
ATOM 745   H HE2  . TYR A 1 48  ? -6.003  8.889   4.964   1.00 0.00 ? 48  TYR A HE2  1  
ATOM 746   H HH   . TYR A 1 48  ? -7.263  9.822   3.367   1.00 0.00 ? 48  TYR A HH   1  
ATOM 747   N N    . ARG A 1 49  ? -8.239  1.686   6.606   1.00 0.00 ? 49  ARG A N    1  
ATOM 748   C CA   . ARG A 1 49  ? -8.241  0.257   6.895   1.00 0.00 ? 49  ARG A CA   1  
ATOM 749   C C    . ARG A 1 49  ? -7.691  -0.538  5.715   1.00 0.00 ? 49  ARG A C    1  
ATOM 750   O O    . ARG A 1 49  ? -8.358  -0.692  4.691   1.00 0.00 ? 49  ARG A O    1  
ATOM 751   C CB   . ARG A 1 49  ? -9.658  -0.216  7.227   1.00 0.00 ? 49  ARG A CB   1  
ATOM 752   C CG   . ARG A 1 49  ? -9.696  -1.469  8.086   1.00 0.00 ? 49  ARG A CG   1  
ATOM 753   C CD   . ARG A 1 49  ? -11.097 -1.741  8.612   1.00 0.00 ? 49  ARG A CD   1  
ATOM 754   N NE   . ARG A 1 49  ? -11.455 -0.842  9.706   1.00 0.00 ? 49  ARG A NE   1  
ATOM 755   C CZ   . ARG A 1 49  ? -12.686 -0.731  10.192  1.00 0.00 ? 49  ARG A CZ   1  
ATOM 756   N NH1  . ARG A 1 49  ? -13.671 -1.459  9.684   1.00 0.00 ? 49  ARG A NH1  1  
ATOM 757   N NH2  . ARG A 1 49  ? -12.934 0.109   11.189  1.00 0.00 ? 49  ARG A NH2  1  
ATOM 758   H H    . ARG A 1 49  ? -8.864  2.039   5.938   1.00 0.00 ? 49  ARG A H    1  
ATOM 759   H HA   . ARG A 1 49  ? -7.606  0.092   7.753   1.00 0.00 ? 49  ARG A HA   1  
ATOM 760   H HB2  . ARG A 1 49  ? -10.174 0.572   7.755   1.00 0.00 ? 49  ARG A HB2  1  
ATOM 761   H HB3  . ARG A 1 49  ? -10.180 -0.422  6.305   1.00 0.00 ? 49  ARG A HB3  1  
ATOM 762   H HG2  . ARG A 1 49  ? -9.377  -2.312  7.491   1.00 0.00 ? 49  ARG A HG2  1  
ATOM 763   H HG3  . ARG A 1 49  ? -9.025  -1.341  8.922   1.00 0.00 ? 49  ARG A HG3  1  
ATOM 764   H HD2  . ARG A 1 49  ? -11.802 -1.610  7.805   1.00 0.00 ? 49  ARG A HD2  1  
ATOM 765   H HD3  . ARG A 1 49  ? -11.142 -2.760  8.966   1.00 0.00 ? 49  ARG A HD3  1  
ATOM 766   H HE   . ARG A 1 49  ? -10.742 -0.295  10.096  1.00 0.00 ? 49  ARG A HE   1  
ATOM 767   H HH11 . ARG A 1 49  ? -13.488 -2.094  8.934   1.00 0.00 ? 49  ARG A HH11 1  
ATOM 768   H HH12 . ARG A 1 49  ? -14.597 -1.374  10.053  1.00 0.00 ? 49  ARG A HH12 1  
ATOM 769   H HH21 . ARG A 1 49  ? -12.193 0.659   11.574  1.00 0.00 ? 49  ARG A HH21 1  
ATOM 770   H HH22 . ARG A 1 49  ? -13.860 0.192   11.554  1.00 0.00 ? 49  ARG A HH22 1  
ATOM 771   N N    . VAL A 1 50  ? -6.470  -1.040  5.864   1.00 0.00 ? 50  VAL A N    1  
ATOM 772   C CA   . VAL A 1 50  ? -5.830  -1.820  4.811   1.00 0.00 ? 50  VAL A CA   1  
ATOM 773   C C    . VAL A 1 50  ? -6.061  -3.313  5.014   1.00 0.00 ? 50  VAL A C    1  
ATOM 774   O O    . VAL A 1 50  ? -5.398  -3.948  5.833   1.00 0.00 ? 50  VAL A O    1  
ATOM 775   C CB   . VAL A 1 50  ? -4.314  -1.550  4.755   1.00 0.00 ? 50  VAL A CB   1  
ATOM 776   C CG1  . VAL A 1 50  ? -3.661  -2.394  3.671   1.00 0.00 ? 50  VAL A CG1  1  
ATOM 777   C CG2  . VAL A 1 50  ? -4.046  -0.070  4.524   1.00 0.00 ? 50  VAL A CG2  1  
ATOM 778   H H    . VAL A 1 50  ? -5.988  -0.884  6.703   1.00 0.00 ? 50  VAL A H    1  
ATOM 779   H HA   . VAL A 1 50  ? -6.262  -1.523  3.866   1.00 0.00 ? 50  VAL A HA   1  
ATOM 780   H HB   . VAL A 1 50  ? -3.884  -1.828  5.705   1.00 0.00 ? 50  VAL A HB   1  
ATOM 781   H HG11 . VAL A 1 50  ? -3.614  -3.423  3.996   1.00 0.00 ? 50  VAL A HG11 1  
ATOM 782   H HG12 . VAL A 1 50  ? -4.243  -2.328  2.763   1.00 0.00 ? 50  VAL A HG12 1  
ATOM 783   H HG13 . VAL A 1 50  ? -2.661  -2.030  3.486   1.00 0.00 ? 50  VAL A HG13 1  
ATOM 784   H HG21 . VAL A 1 50  ? -4.984  0.452   4.413   1.00 0.00 ? 50  VAL A HG21 1  
ATOM 785   H HG22 . VAL A 1 50  ? -3.507  0.334   5.369   1.00 0.00 ? 50  VAL A HG22 1  
ATOM 786   H HG23 . VAL A 1 50  ? -3.455  0.054   3.628   1.00 0.00 ? 50  VAL A HG23 1  
ATOM 787   N N    . MET A 1 51  ? -7.007  -3.867  4.263   1.00 0.00 ? 51  MET A N    1  
ATOM 788   C CA   . MET A 1 51  ? -7.326  -5.287  4.359   1.00 0.00 ? 51  MET A CA   1  
ATOM 789   C C    . MET A 1 51  ? -6.435  -6.108  3.432   1.00 0.00 ? 51  MET A C    1  
ATOM 790   O O    . MET A 1 51  ? -6.243  -5.756  2.268   1.00 0.00 ? 51  MET A O    1  
ATOM 791   C CB   . MET A 1 51  ? -8.797  -5.526  4.016   1.00 0.00 ? 51  MET A CB   1  
ATOM 792   C CG   . MET A 1 51  ? -9.741  -5.279  5.182   1.00 0.00 ? 51  MET A CG   1  
ATOM 793   S SD   . MET A 1 51  ? -11.463 -5.611  4.763   1.00 0.00 ? 51  MET A SD   1  
ATOM 794   C CE   . MET A 1 51  ? -11.390 -7.361  4.389   1.00 0.00 ? 51  MET A CE   1  
ATOM 795   H H    . MET A 1 51  ? -7.503  -3.308  3.628   1.00 0.00 ? 51  MET A H    1  
ATOM 796   H HA   . MET A 1 51  ? -7.148  -5.597  5.378   1.00 0.00 ? 51  MET A HA   1  
ATOM 797   H HB2  . MET A 1 51  ? -9.078  -4.867  3.208   1.00 0.00 ? 51  MET A HB2  1  
ATOM 798   H HB3  . MET A 1 51  ? -8.918  -6.549  3.694   1.00 0.00 ? 51  MET A HB3  1  
ATOM 799   H HG2  . MET A 1 51  ? -9.456  -5.922  6.001   1.00 0.00 ? 51  MET A HG2  1  
ATOM 800   H HG3  . MET A 1 51  ? -9.651  -4.248  5.487   1.00 0.00 ? 51  MET A HG3  1  
ATOM 801   H HE1  . MET A 1 51  ? -11.639 -7.518  3.350   1.00 0.00 ? 51  MET A HE1  1  
ATOM 802   H HE2  . MET A 1 51  ? -10.393 -7.728  4.580   1.00 0.00 ? 51  MET A HE2  1  
ATOM 803   H HE3  . MET A 1 51  ? -12.095 -7.891  5.013   1.00 0.00 ? 51  MET A HE3  1  
ATOM 804   N N    . TYR A 1 52  ? -5.894  -7.202  3.956   1.00 0.00 ? 52  TYR A N    1  
ATOM 805   C CA   . TYR A 1 52  ? -5.022  -8.072  3.175   1.00 0.00 ? 52  TYR A CA   1  
ATOM 806   C C    . TYR A 1 52  ? -5.224  -9.534  3.561   1.00 0.00 ? 52  TYR A C    1  
ATOM 807   O O    . TYR A 1 52  ? -5.672  -9.840  4.666   1.00 0.00 ? 52  TYR A O    1  
ATOM 808   C CB   . TYR A 1 52  ? -3.558  -7.676  3.379   1.00 0.00 ? 52  TYR A CB   1  
ATOM 809   C CG   . TYR A 1 52  ? -3.060  -7.906  4.788   1.00 0.00 ? 52  TYR A CG   1  
ATOM 810   C CD1  . TYR A 1 52  ? -3.362  -7.011  5.807   1.00 0.00 ? 52  TYR A CD1  1  
ATOM 811   C CD2  . TYR A 1 52  ? -2.287  -9.017  5.100   1.00 0.00 ? 52  TYR A CD2  1  
ATOM 812   C CE1  . TYR A 1 52  ? -2.908  -7.217  7.096   1.00 0.00 ? 52  TYR A CE1  1  
ATOM 813   C CE2  . TYR A 1 52  ? -1.829  -9.232  6.386   1.00 0.00 ? 52  TYR A CE2  1  
ATOM 814   C CZ   . TYR A 1 52  ? -2.142  -8.328  7.380   1.00 0.00 ? 52  TYR A CZ   1  
ATOM 815   O OH   . TYR A 1 52  ? -1.689  -8.537  8.662   1.00 0.00 ? 52  TYR A OH   1  
ATOM 816   H H    . TYR A 1 52  ? -6.085  -7.431  4.889   1.00 0.00 ? 52  TYR A H    1  
ATOM 817   H HA   . TYR A 1 52  ? -5.276  -7.948  2.133   1.00 0.00 ? 52  TYR A HA   1  
ATOM 818   H HB2  . TYR A 1 52  ? -2.940  -8.255  2.711   1.00 0.00 ? 52  TYR A HB2  1  
ATOM 819   H HB3  . TYR A 1 52  ? -3.441  -6.627  3.152   1.00 0.00 ? 52  TYR A HB3  1  
ATOM 820   H HD1  . TYR A 1 52  ? -3.963  -6.142  5.582   1.00 0.00 ? 52  TYR A HD1  1  
ATOM 821   H HD2  . TYR A 1 52  ? -2.043  -9.723  4.319   1.00 0.00 ? 52  TYR A HD2  1  
ATOM 822   H HE1  . TYR A 1 52  ? -3.153  -6.510  7.875   1.00 0.00 ? 52  TYR A HE1  1  
ATOM 823   H HE2  . TYR A 1 52  ? -1.230  -10.102 6.609   1.00 0.00 ? 52  TYR A HE2  1  
ATOM 824   H HH   . TYR A 1 52  ? -2.099  -7.902  9.254   1.00 0.00 ? 52  TYR A HH   1  
ATOM 825   N N    . ARG A 1 53  ? -4.889  -10.433 2.641   1.00 0.00 ? 53  ARG A N    1  
ATOM 826   C CA   . ARG A 1 53  ? -5.033  -11.863 2.883   1.00 0.00 ? 53  ARG A CA   1  
ATOM 827   C C    . ARG A 1 53  ? -4.417  -12.672 1.745   1.00 0.00 ? 53  ARG A C    1  
ATOM 828   O O    . ARG A 1 53  ? -4.151  -12.141 0.667   1.00 0.00 ? 53  ARG A O    1  
ATOM 829   C CB   . ARG A 1 53  ? -6.510  -12.229 3.042   1.00 0.00 ? 53  ARG A CB   1  
ATOM 830   C CG   . ARG A 1 53  ? -7.276  -12.254 1.729   1.00 0.00 ? 53  ARG A CG   1  
ATOM 831   C CD   . ARG A 1 53  ? -8.510  -13.138 1.821   1.00 0.00 ? 53  ARG A CD   1  
ATOM 832   N NE   . ARG A 1 53  ? -9.173  -13.288 0.529   1.00 0.00 ? 53  ARG A NE   1  
ATOM 833   C CZ   . ARG A 1 53  ? -10.411 -13.747 0.387   1.00 0.00 ? 53  ARG A CZ   1  
ATOM 834   N NH1  . ARG A 1 53  ? -11.118 -14.098 1.453   1.00 0.00 ? 53  ARG A NH1  1  
ATOM 835   N NH2  . ARG A 1 53  ? -10.946 -13.855 -0.823  1.00 0.00 ? 53  ARG A NH2  1  
ATOM 836   H H    . ARG A 1 53  ? -4.537  -10.127 1.779   1.00 0.00 ? 53  ARG A H    1  
ATOM 837   H HA   . ARG A 1 53  ? -4.512  -12.099 3.799   1.00 0.00 ? 53  ARG A HA   1  
ATOM 838   H HB2  . ARG A 1 53  ? -6.580  -13.208 3.493   1.00 0.00 ? 53  ARG A HB2  1  
ATOM 839   H HB3  . ARG A 1 53  ? -6.979  -11.507 3.694   1.00 0.00 ? 53  ARG A HB3  1  
ATOM 840   H HG2  . ARG A 1 53  ? -7.584  -11.249 1.484   1.00 0.00 ? 53  ARG A HG2  1  
ATOM 841   H HG3  . ARG A 1 53  ? -6.628  -12.634 0.953   1.00 0.00 ? 53  ARG A HG3  1  
ATOM 842   H HD2  . ARG A 1 53  ? -8.213  -14.113 2.178   1.00 0.00 ? 53  ARG A HD2  1  
ATOM 843   H HD3  . ARG A 1 53  ? -9.202  -12.694 2.521   1.00 0.00 ? 53  ARG A HD3  1  
ATOM 844   H HE   . ARG A 1 53  ? -8.669  -13.034 -0.272  1.00 0.00 ? 53  ARG A HE   1  
ATOM 845   H HH11 . ARG A 1 53  ? -10.718 -14.017 2.365   1.00 0.00 ? 53  ARG A HH11 1  
ATOM 846   H HH12 . ARG A 1 53  ? -12.051 -14.442 1.343   1.00 0.00 ? 53  ARG A HH12 1  
ATOM 847   H HH21 . ARG A 1 53  ? -10.416 -13.591 -1.628  1.00 0.00 ? 53  ARG A HH21 1  
ATOM 848   H HH22 . ARG A 1 53  ? -11.878 -14.200 -0.928  1.00 0.00 ? 53  ARG A HH22 1  
ATOM 849   N N    . GLN A 1 54  ? -4.194  -13.959 1.994   1.00 0.00 ? 54  GLN A N    1  
ATOM 850   C CA   . GLN A 1 54  ? -3.608  -14.839 0.990   1.00 0.00 ? 54  GLN A CA   1  
ATOM 851   C C    . GLN A 1 54  ? -4.646  -15.242 -0.053  1.00 0.00 ? 54  GLN A C    1  
ATOM 852   O O    . GLN A 1 54  ? -5.850  -15.171 0.194   1.00 0.00 ? 54  GLN A O    1  
ATOM 853   C CB   . GLN A 1 54  ? -3.025  -16.088 1.654   1.00 0.00 ? 54  GLN A CB   1  
ATOM 854   C CG   . GLN A 1 54  ? -1.834  -16.672 0.912   1.00 0.00 ? 54  GLN A CG   1  
ATOM 855   C CD   . GLN A 1 54  ? -0.894  -17.434 1.825   1.00 0.00 ? 54  GLN A CD   1  
ATOM 856   O OE1  . GLN A 1 54  ? 0.290   -17.111 1.926   1.00 0.00 ? 54  GLN A OE1  1  
ATOM 857   N NE2  . GLN A 1 54  ? -1.418  -18.453 2.497   1.00 0.00 ? 54  GLN A NE2  1  
ATOM 858   H H    . GLN A 1 54  ? -4.427  -14.323 2.872   1.00 0.00 ? 54  GLN A H    1  
ATOM 859   H HA   . GLN A 1 54  ? -2.813  -14.300 0.499   1.00 0.00 ? 54  GLN A HA   1  
ATOM 860   H HB2  . GLN A 1 54  ? -2.709  -15.834 2.655   1.00 0.00 ? 54  GLN A HB2  1  
ATOM 861   H HB3  . GLN A 1 54  ? -3.794  -16.845 1.709   1.00 0.00 ? 54  GLN A HB3  1  
ATOM 862   H HG2  . GLN A 1 54  ? -2.196  -17.346 0.150   1.00 0.00 ? 54  GLN A HG2  1  
ATOM 863   H HG3  . GLN A 1 54  ? -1.286  -15.865 0.447   1.00 0.00 ? 54  GLN A HG3  1  
ATOM 864   H HE21 . GLN A 1 54  ? -2.369  -18.653 2.366   1.00 0.00 ? 54  GLN A HE21 1  
ATOM 865   H HE22 . GLN A 1 54  ? -0.833  -18.964 3.093   1.00 0.00 ? 54  GLN A HE22 1  
ATOM 866   N N    . THR A 1 55  ? -4.171  -15.665 -1.221  1.00 0.00 ? 55  THR A N    1  
ATOM 867   C CA   . THR A 1 55  ? -5.057  -16.077 -2.302  1.00 0.00 ? 55  THR A CA   1  
ATOM 868   C C    . THR A 1 55  ? -4.614  -17.408 -2.899  1.00 0.00 ? 55  THR A C    1  
ATOM 869   O O    . THR A 1 55  ? -5.439  -18.202 -3.350  1.00 0.00 ? 55  THR A O    1  
ATOM 870   C CB   . THR A 1 55  ? -5.110  -15.018 -3.419  1.00 0.00 ? 55  THR A CB   1  
ATOM 871   O OG1  . THR A 1 55  ? -3.797  -14.791 -3.942  1.00 0.00 ? 55  THR A OG1  1  
ATOM 872   C CG2  . THR A 1 55  ? -5.688  -13.711 -2.899  1.00 0.00 ? 55  THR A CG2  1  
ATOM 873   H H    . THR A 1 55  ? -3.201  -15.699 -1.357  1.00 0.00 ? 55  THR A H    1  
ATOM 874   H HA   . THR A 1 55  ? -6.051  -16.190 -1.894  1.00 0.00 ? 55  THR A HA   1  
ATOM 875   H HB   . THR A 1 55  ? -5.746  -15.385 -4.212  1.00 0.00 ? 55  THR A HB   1  
ATOM 876   H HG1  . THR A 1 55  ? -3.308  -14.221 -3.343  1.00 0.00 ? 55  THR A HG1  1  
ATOM 877   H HG21 . THR A 1 55  ? -6.631  -13.514 -3.386  1.00 0.00 ? 55  THR A HG21 1  
ATOM 878   H HG22 . THR A 1 55  ? -5.000  -12.905 -3.108  1.00 0.00 ? 55  THR A HG22 1  
ATOM 879   H HG23 . THR A 1 55  ? -5.842  -13.785 -1.833  1.00 0.00 ? 55  THR A HG23 1  
ATOM 880   N N    . SER A 1 56  ? -3.306  -17.645 -2.897  1.00 0.00 ? 56  SER A N    1  
ATOM 881   C CA   . SER A 1 56  ? -2.753  -18.880 -3.442  1.00 0.00 ? 56  SER A CA   1  
ATOM 882   C C    . SER A 1 56  ? -2.369  -19.843 -2.323  1.00 0.00 ? 56  SER A C    1  
ATOM 883   O O    . SER A 1 56  ? -2.662  -21.036 -2.388  1.00 0.00 ? 56  SER A O    1  
ATOM 884   C CB   . SER A 1 56  ? -1.531  -18.576 -4.311  1.00 0.00 ? 56  SER A CB   1  
ATOM 885   O OG   . SER A 1 56  ? -0.978  -19.766 -4.847  1.00 0.00 ? 56  SER A OG   1  
ATOM 886   H H    . SER A 1 56  ? -2.699  -16.973 -2.523  1.00 0.00 ? 56  SER A H    1  
ATOM 887   H HA   . SER A 1 56  ? -3.513  -19.342 -4.054  1.00 0.00 ? 56  SER A HA   1  
ATOM 888   H HB2  . SER A 1 56  ? -1.823  -17.930 -5.125  1.00 0.00 ? 56  SER A HB2  1  
ATOM 889   H HB3  . SER A 1 56  ? -0.780  -18.083 -3.711  1.00 0.00 ? 56  SER A HB3  1  
ATOM 890   H HG   . SER A 1 56  ? -1.228  -19.847 -5.770  1.00 0.00 ? 56  SER A HG   1  
ATOM 891   N N    . GLY A 1 57  ? -1.711  -19.315 -1.295  1.00 0.00 ? 57  GLY A N    1  
ATOM 892   C CA   . GLY A 1 57  ? -1.296  -20.141 -0.176  1.00 0.00 ? 57  GLY A CA   1  
ATOM 893   C C    . GLY A 1 57  ? -2.449  -20.917 0.429   1.00 0.00 ? 57  GLY A C    1  
ATOM 894   O O    . GLY A 1 57  ? -3.541  -20.966 -0.139  1.00 0.00 ? 57  GLY A O    1  
ATOM 895   H H    . GLY A 1 57  ? -1.504  -18.357 -1.298  1.00 0.00 ? 57  GLY A H    1  
ATOM 896   H HA2  . GLY A 1 57  ? -0.545  -20.838 -0.516  1.00 0.00 ? 57  GLY A HA2  1  
ATOM 897   H HA3  . GLY A 1 57  ? -0.866  -19.506 0.585   1.00 0.00 ? 57  GLY A HA3  1  
ATOM 898   N N    . LEU A 1 58  ? -2.207  -21.528 1.584   1.00 0.00 ? 58  LEU A N    1  
ATOM 899   C CA   . LEU A 1 58  ? -3.233  -22.308 2.266   1.00 0.00 ? 58  LEU A CA   1  
ATOM 900   C C    . LEU A 1 58  ? -4.203  -21.398 3.013   1.00 0.00 ? 58  LEU A C    1  
ATOM 901   O O    . LEU A 1 58  ? -5.415  -21.604 2.976   1.00 0.00 ? 58  LEU A O    1  
ATOM 902   C CB   . LEU A 1 58  ? -2.588  -23.294 3.242   1.00 0.00 ? 58  LEU A CB   1  
ATOM 903   C CG   . LEU A 1 58  ? -3.431  -24.511 3.623   1.00 0.00 ? 58  LEU A CG   1  
ATOM 904   C CD1  . LEU A 1 58  ? -4.729  -24.075 4.285   1.00 0.00 ? 58  LEU A CD1  1  
ATOM 905   C CD2  . LEU A 1 58  ? -3.718  -25.366 2.397   1.00 0.00 ? 58  LEU A CD2  1  
ATOM 906   H H    . LEU A 1 58  ? -1.317  -21.453 1.987   1.00 0.00 ? 58  LEU A H    1  
ATOM 907   H HA   . LEU A 1 58  ? -3.781  -22.861 1.518   1.00 0.00 ? 58  LEU A HA   1  
ATOM 908   H HB2  . LEU A 1 58  ? -1.674  -23.653 2.793   1.00 0.00 ? 58  LEU A HB2  1  
ATOM 909   H HB3  . LEU A 1 58  ? -2.353  -22.755 4.149   1.00 0.00 ? 58  LEU A HB3  1  
ATOM 910   H HG   . LEU A 1 58  ? -2.882  -25.115 4.332   1.00 0.00 ? 58  LEU A HG   1  
ATOM 911   H HD11 . LEU A 1 58  ? -5.495  -23.957 3.534   1.00 0.00 ? 58  LEU A HD11 1  
ATOM 912   H HD12 . LEU A 1 58  ? -4.575  -23.134 4.794   1.00 0.00 ? 58  LEU A HD12 1  
ATOM 913   H HD13 . LEU A 1 58  ? -5.037  -24.823 5.000   1.00 0.00 ? 58  LEU A HD13 1  
ATOM 914   H HD21 . LEU A 1 58  ? -3.287  -24.899 1.524   1.00 0.00 ? 58  LEU A HD21 1  
ATOM 915   H HD22 . LEU A 1 58  ? -4.786  -25.459 2.265   1.00 0.00 ? 58  LEU A HD22 1  
ATOM 916   H HD23 . LEU A 1 58  ? -3.284  -26.346 2.533   1.00 0.00 ? 58  LEU A HD23 1  
ATOM 917   N N    . GLN A 1 59  ? -3.659  -20.390 3.688   1.00 0.00 ? 59  GLN A N    1  
ATOM 918   C CA   . GLN A 1 59  ? -4.477  -19.447 4.442   1.00 0.00 ? 59  GLN A CA   1  
ATOM 919   C C    . GLN A 1 59  ? -5.399  -18.663 3.514   1.00 0.00 ? 59  GLN A C    1  
ATOM 920   O O    . GLN A 1 59  ? -6.260  -17.910 3.969   1.00 0.00 ? 59  GLN A O    1  
ATOM 921   C CB   . GLN A 1 59  ? -3.587  -18.483 5.229   1.00 0.00 ? 59  GLN A CB   1  
ATOM 922   C CG   . GLN A 1 59  ? -2.728  -19.168 6.279   1.00 0.00 ? 59  GLN A CG   1  
ATOM 923   C CD   . GLN A 1 59  ? -3.444  -19.329 7.605   1.00 0.00 ? 59  GLN A CD   1  
ATOM 924   O OE1  . GLN A 1 59  ? -4.342  -18.554 7.937   1.00 0.00 ? 59  GLN A OE1  1  
ATOM 925   N NE2  . GLN A 1 59  ? -3.051  -20.339 8.372   1.00 0.00 ? 59  GLN A NE2  1  
ATOM 926   H H    . GLN A 1 59  ? -2.686  -20.278 3.679   1.00 0.00 ? 59  GLN A H    1  
ATOM 927   H HA   . GLN A 1 59  ? -5.080  -20.013 5.135   1.00 0.00 ? 59  GLN A HA   1  
ATOM 928   H HB2  . GLN A 1 59  ? -2.934  -17.970 4.539   1.00 0.00 ? 59  GLN A HB2  1  
ATOM 929   H HB3  . GLN A 1 59  ? -4.214  -17.758 5.726   1.00 0.00 ? 59  GLN A HB3  1  
ATOM 930   H HG2  . GLN A 1 59  ? -2.451  -20.147 5.916   1.00 0.00 ? 59  GLN A HG2  1  
ATOM 931   H HG3  . GLN A 1 59  ? -1.837  -18.579 6.436   1.00 0.00 ? 59  GLN A HG3  1  
ATOM 932   H HE21 . GLN A 1 59  ? -2.329  -20.916 8.043   1.00 0.00 ? 59  GLN A HE21 1  
ATOM 933   H HE22 . GLN A 1 59  ? -3.496  -20.466 9.235   1.00 0.00 ? 59  GLN A HE22 1  
ATOM 934   N N    . ALA A 1 60  ? -5.214  -18.846 2.211   1.00 0.00 ? 60  ALA A N    1  
ATOM 935   C CA   . ALA A 1 60  ? -6.031  -18.158 1.219   1.00 0.00 ? 60  ALA A CA   1  
ATOM 936   C C    . ALA A 1 60  ? -7.510  -18.225 1.584   1.00 0.00 ? 60  ALA A C    1  
ATOM 937   O O    . ALA A 1 60  ? -7.977  -19.215 2.147   1.00 0.00 ? 60  ALA A O    1  
ATOM 938   C CB   . ALA A 1 60  ? -5.798  -18.753 -0.162  1.00 0.00 ? 60  ALA A CB   1  
ATOM 939   H H    . ALA A 1 60  ? -4.512  -19.460 1.909   1.00 0.00 ? 60  ALA A H    1  
ATOM 940   H HA   . ALA A 1 60  ? -5.723  -17.122 1.194   1.00 0.00 ? 60  ALA A HA   1  
ATOM 941   H HB1  . ALA A 1 60  ? -5.368  -19.739 -0.060  1.00 0.00 ? 60  ALA A HB1  1  
ATOM 942   H HB2  . ALA A 1 60  ? -6.739  -18.822 -0.687  1.00 0.00 ? 60  ALA A HB2  1  
ATOM 943   H HB3  . ALA A 1 60  ? -5.121  -18.121 -0.716  1.00 0.00 ? 60  ALA A HB3  1  
ATOM 944   N N    . THR A 1 61  ? -8.244  -17.165 1.260   1.00 0.00 ? 61  THR A N    1  
ATOM 945   C CA   . THR A 1 61  ? -9.669  -17.102 1.555   1.00 0.00 ? 61  THR A CA   1  
ATOM 946   C C    . THR A 1 61  ? -9.993  -17.821 2.860   1.00 0.00 ? 61  THR A C    1  
ATOM 947   O O    . THR A 1 61  ? -11.039 -18.457 2.987   1.00 0.00 ? 61  THR A O    1  
ATOM 948   C CB   . THR A 1 61  ? -10.506 -17.723 0.420   1.00 0.00 ? 61  THR A CB   1  
ATOM 949   O OG1  . THR A 1 61  ? -11.897 -17.679 0.756   1.00 0.00 ? 61  THR A OG1  1  
ATOM 950   C CG2  . THR A 1 61  ? -10.086 -19.162 0.162   1.00 0.00 ? 61  THR A CG2  1  
ATOM 951   H H    . THR A 1 61  ? -7.814  -16.406 0.812   1.00 0.00 ? 61  THR A H    1  
ATOM 952   H HA   . THR A 1 61  ? -9.945  -16.062 1.650   1.00 0.00 ? 61  THR A HA   1  
ATOM 953   H HB   . THR A 1 61  ? -10.343 -17.149 -0.482  1.00 0.00 ? 61  THR A HB   1  
ATOM 954   H HG1  . THR A 1 61  ? -12.328 -16.990 0.245   1.00 0.00 ? 61  THR A HG1  1  
ATOM 955   H HG21 . THR A 1 61  ? -10.237 -19.747 1.058   1.00 0.00 ? 61  THR A HG21 1  
ATOM 956   H HG22 . THR A 1 61  ? -9.042  -19.188 -0.114  1.00 0.00 ? 61  THR A HG22 1  
ATOM 957   H HG23 . THR A 1 61  ? -10.681 -19.572 -0.640  1.00 0.00 ? 61  THR A HG23 1  
ATOM 958   N N    . SER A 1 62  ? -9.088  -17.716 3.828   1.00 0.00 ? 62  SER A N    1  
ATOM 959   C CA   . SER A 1 62  ? -9.276  -18.359 5.123   1.00 0.00 ? 62  SER A CA   1  
ATOM 960   C C    . SER A 1 62  ? -9.751  -17.351 6.166   1.00 0.00 ? 62  SER A C    1  
ATOM 961   O O    . SER A 1 62  ? -10.689 -17.615 6.918   1.00 0.00 ? 62  SER A O    1  
ATOM 962   C CB   . SER A 1 62  ? -7.972  -19.013 5.586   1.00 0.00 ? 62  SER A CB   1  
ATOM 963   O OG   . SER A 1 62  ? -8.206  -19.919 6.650   1.00 0.00 ? 62  SER A OG   1  
ATOM 964   H H    . SER A 1 62  ? -8.274  -17.195 3.666   1.00 0.00 ? 62  SER A H    1  
ATOM 965   H HA   . SER A 1 62  ? -10.031 -19.122 5.008   1.00 0.00 ? 62  SER A HA   1  
ATOM 966   H HB2  . SER A 1 62  ? -7.530  -19.551 4.761   1.00 0.00 ? 62  SER A HB2  1  
ATOM 967   H HB3  . SER A 1 62  ? -7.289  -18.247 5.924   1.00 0.00 ? 62  SER A HB3  1  
ATOM 968   H HG   . SER A 1 62  ? -8.974  -19.634 7.150   1.00 0.00 ? 62  SER A HG   1  
ATOM 969   N N    . SER A 1 63  ? -9.095  -16.196 6.205   1.00 0.00 ? 63  SER A N    1  
ATOM 970   C CA   . SER A 1 63  ? -9.447  -15.149 7.157   1.00 0.00 ? 63  SER A CA   1  
ATOM 971   C C    . SER A 1 63  ? -8.830  -13.814 6.750   1.00 0.00 ? 63  SER A C    1  
ATOM 972   O O    . SER A 1 63  ? -7.609  -13.659 6.744   1.00 0.00 ? 63  SER A O    1  
ATOM 973   C CB   . SER A 1 63  ? -8.980  -15.532 8.563   1.00 0.00 ? 63  SER A CB   1  
ATOM 974   O OG   . SER A 1 63  ? -9.434  -16.827 8.916   1.00 0.00 ? 63  SER A OG   1  
ATOM 975   H H    . SER A 1 63  ? -8.356  -16.044 5.579   1.00 0.00 ? 63  SER A H    1  
ATOM 976   H HA   . SER A 1 63  ? -10.522 -15.050 7.159   1.00 0.00 ? 63  SER A HA   1  
ATOM 977   H HB2  . SER A 1 63  ? -7.901  -15.520 8.597   1.00 0.00 ? 63  SER A HB2  1  
ATOM 978   H HB3  . SER A 1 63  ? -9.370  -14.819 9.275   1.00 0.00 ? 63  SER A HB3  1  
ATOM 979   H HG   . SER A 1 63  ? -8.720  -17.458 8.803   1.00 0.00 ? 63  SER A HG   1  
ATOM 980   N N    . TRP A 1 64  ? -9.683  -12.855 6.410   1.00 0.00 ? 64  TRP A N    1  
ATOM 981   C CA   . TRP A 1 64  ? -9.223  -11.533 6.001   1.00 0.00 ? 64  TRP A CA   1  
ATOM 982   C C    . TRP A 1 64  ? -8.600  -10.786 7.175   1.00 0.00 ? 64  TRP A C    1  
ATOM 983   O O    . TRP A 1 64  ? -9.028  -10.942 8.318   1.00 0.00 ? 64  TRP A O    1  
ATOM 984   C CB   . TRP A 1 64  ? -10.385 -10.722 5.424   1.00 0.00 ? 64  TRP A CB   1  
ATOM 985   C CG   . TRP A 1 64  ? -10.549 -10.889 3.944   1.00 0.00 ? 64  TRP A CG   1  
ATOM 986   C CD1  . TRP A 1 64  ? -11.472 -11.666 3.304   1.00 0.00 ? 64  TRP A CD1  1  
ATOM 987   C CD2  . TRP A 1 64  ? -9.766  -10.266 2.920   1.00 0.00 ? 64  TRP A CD2  1  
ATOM 988   N NE1  . TRP A 1 64  ? -11.310 -11.564 1.943   1.00 0.00 ? 64  TRP A NE1  1  
ATOM 989   C CE2  . TRP A 1 64  ? -10.270 -10.711 1.682   1.00 0.00 ? 64  TRP A CE2  1  
ATOM 990   C CE3  . TRP A 1 64  ? -8.689  -9.376  2.927   1.00 0.00 ? 64  TRP A CE3  1  
ATOM 991   C CZ2  . TRP A 1 64  ? -9.733  -10.294 0.467   1.00 0.00 ? 64  TRP A CZ2  1  
ATOM 992   C CZ3  . TRP A 1 64  ? -8.157  -8.963  1.720   1.00 0.00 ? 64  TRP A CZ3  1  
ATOM 993   C CH2  . TRP A 1 64  ? -8.680  -9.422  0.504   1.00 0.00 ? 64  TRP A CH2  1  
ATOM 994   H H    . TRP A 1 64  ? -10.646 -13.040 6.435   1.00 0.00 ? 64  TRP A H    1  
ATOM 995   H HA   . TRP A 1 64  ? -8.474  -11.666 5.235   1.00 0.00 ? 64  TRP A HA   1  
ATOM 996   H HB2  . TRP A 1 64  ? -11.304 -11.033 5.899   1.00 0.00 ? 64  TRP A HB2  1  
ATOM 997   H HB3  . TRP A 1 64  ? -10.217 -9.674  5.626   1.00 0.00 ? 64  TRP A HB3  1  
ATOM 998   H HD1  . TRP A 1 64  ? -12.213 -12.269 3.807   1.00 0.00 ? 64  TRP A HD1  1  
ATOM 999   H HE1  . TRP A 1 64  ? -11.852 -12.026 1.270   1.00 0.00 ? 64  TRP A HE1  1  
ATOM 1000  H HE3  . TRP A 1 64  ? -8.273  -9.011  3.855   1.00 0.00 ? 64  TRP A HE3  1  
ATOM 1001  H HZ2  . TRP A 1 64  ? -10.125 -10.638 -0.479  1.00 0.00 ? 64  TRP A HZ2  1  
ATOM 1002  H HZ3  . TRP A 1 64  ? -7.325  -8.275  1.707   1.00 0.00 ? 64  TRP A HZ3  1  
ATOM 1003  H HH2  . TRP A 1 64  ? -8.233  -9.074  -0.414  1.00 0.00 ? 64  TRP A HH2  1  
ATOM 1004  N N    . GLN A 1 65  ? -7.587  -9.976  6.885   1.00 0.00 ? 65  GLN A N    1  
ATOM 1005  C CA   . GLN A 1 65  ? -6.905  -9.206  7.919   1.00 0.00 ? 65  GLN A CA   1  
ATOM 1006  C C    . GLN A 1 65  ? -7.196  -7.716  7.768   1.00 0.00 ? 65  GLN A C    1  
ATOM 1007  O O    . GLN A 1 65  ? -7.667  -7.268  6.724   1.00 0.00 ? 65  GLN A O    1  
ATOM 1008  C CB   . GLN A 1 65  ? -5.397  -9.452  7.856   1.00 0.00 ? 65  GLN A CB   1  
ATOM 1009  C CG   . GLN A 1 65  ? -4.991  -10.852 8.286   1.00 0.00 ? 65  GLN A CG   1  
ATOM 1010  C CD   . GLN A 1 65  ? -3.617  -11.244 7.777   1.00 0.00 ? 65  GLN A CD   1  
ATOM 1011  O OE1  . GLN A 1 65  ? -2.658  -11.326 8.545   1.00 0.00 ? 65  GLN A OE1  1  
ATOM 1012  N NE2  . GLN A 1 65  ? -3.516  -11.489 6.476   1.00 0.00 ? 65  GLN A NE2  1  
ATOM 1013  H H    . GLN A 1 65  ? -7.292  -9.894  5.955   1.00 0.00 ? 65  GLN A H    1  
ATOM 1014  H HA   . GLN A 1 65  ? -7.275  -9.537  8.877   1.00 0.00 ? 65  GLN A HA   1  
ATOM 1015  H HB2  . GLN A 1 65  ? -5.061  -9.299  6.841   1.00 0.00 ? 65  GLN A HB2  1  
ATOM 1016  H HB3  . GLN A 1 65  ? -4.901  -8.743  8.502   1.00 0.00 ? 65  GLN A HB3  1  
ATOM 1017  H HG2  . GLN A 1 65  ? -4.983  -10.896 9.365   1.00 0.00 ? 65  GLN A HG2  1  
ATOM 1018  H HG3  . GLN A 1 65  ? -5.715  -11.556 7.904   1.00 0.00 ? 65  GLN A HG3  1  
ATOM 1019  H HE21 . GLN A 1 65  ? -4.322  -11.403 5.925   1.00 0.00 ? 65  GLN A HE21 1  
ATOM 1020  H HE22 . GLN A 1 65  ? -2.640  -11.743 6.120   1.00 0.00 ? 65  GLN A HE22 1  
ATOM 1021  N N    . ASN A 1 66  ? -6.911  -6.954  8.819   1.00 0.00 ? 66  ASN A N    1  
ATOM 1022  C CA   . ASN A 1 66  ? -7.142  -5.514  8.804   1.00 0.00 ? 66  ASN A CA   1  
ATOM 1023  C C    . ASN A 1 66  ? -6.051  -4.779  9.576   1.00 0.00 ? 66  ASN A C    1  
ATOM 1024  O O    . ASN A 1 66  ? -5.733  -5.133  10.713  1.00 0.00 ? 66  ASN A O    1  
ATOM 1025  C CB   . ASN A 1 66  ? -8.512  -5.191  9.404   1.00 0.00 ? 66  ASN A CB   1  
ATOM 1026  C CG   . ASN A 1 66  ? -9.538  -6.271  9.118   1.00 0.00 ? 66  ASN A CG   1  
ATOM 1027  O OD1  . ASN A 1 66  ? -9.395  -7.410  9.563   1.00 0.00 ? 66  ASN A OD1  1  
ATOM 1028  N ND2  . ASN A 1 66  ? -10.578 -5.917  8.373   1.00 0.00 ? 66  ASN A ND2  1  
ATOM 1029  H H    . ASN A 1 66  ? -6.536  -7.369  9.624   1.00 0.00 ? 66  ASN A H    1  
ATOM 1030  H HA   . ASN A 1 66  ? -7.123  -5.186  7.776   1.00 0.00 ? 66  ASN A HA   1  
ATOM 1031  H HB2  . ASN A 1 66  ? -8.415  -5.088  10.475  1.00 0.00 ? 66  ASN A HB2  1  
ATOM 1032  H HB3  . ASN A 1 66  ? -8.871  -4.261  8.988   1.00 0.00 ? 66  ASN A HB3  1  
ATOM 1033  H HD21 . ASN A 1 66  ? -10.626 -4.992  8.053   1.00 0.00 ? 66  ASN A HD21 1  
ATOM 1034  H HD22 . ASN A 1 66  ? -11.257 -6.596  8.174   1.00 0.00 ? 66  ASN A HD22 1  
ATOM 1035  N N    . LEU A 1 67  ? -5.480  -3.754  8.952   1.00 0.00 ? 67  LEU A N    1  
ATOM 1036  C CA   . LEU A 1 67  ? -4.424  -2.968  9.581   1.00 0.00 ? 67  LEU A CA   1  
ATOM 1037  C C    . LEU A 1 67  ? -4.850  -1.512  9.738   1.00 0.00 ? 67  LEU A C    1  
ATOM 1038  O O    . LEU A 1 67  ? -4.713  -0.711  8.813   1.00 0.00 ? 67  LEU A O    1  
ATOM 1039  C CB   . LEU A 1 67  ? -3.140  -3.050  8.754   1.00 0.00 ? 67  LEU A CB   1  
ATOM 1040  C CG   . LEU A 1 67  ? -1.907  -2.378  9.360   1.00 0.00 ? 67  LEU A CG   1  
ATOM 1041  C CD1  . LEU A 1 67  ? -1.261  -3.284  10.396  1.00 0.00 ? 67  LEU A CD1  1  
ATOM 1042  C CD2  . LEU A 1 67  ? -0.909  -2.013  8.271   1.00 0.00 ? 67  LEU A CD2  1  
ATOM 1043  H H    . LEU A 1 67  ? -5.775  -3.520  8.048   1.00 0.00 ? 67  LEU A H    1  
ATOM 1044  H HA   . LEU A 1 67  ? -4.239  -3.384  10.560  1.00 0.00 ? 67  LEU A HA   1  
ATOM 1045  H HB2  . LEU A 1 67  ? -2.908  -4.093  8.605   1.00 0.00 ? 67  LEU A HB2  1  
ATOM 1046  H HB3  . LEU A 1 67  ? -3.334  -2.586  7.797   1.00 0.00 ? 67  LEU A HB3  1  
ATOM 1047  H HG   . LEU A 1 67  ? -2.210  -1.467  9.857   1.00 0.00 ? 67  LEU A HG   1  
ATOM 1048  H HD11 . LEU A 1 67  ? -0.440  -2.765  10.866  1.00 0.00 ? 67  LEU A HD11 1  
ATOM 1049  H HD12 . LEU A 1 67  ? -0.893  -4.178  9.913   1.00 0.00 ? 67  LEU A HD12 1  
ATOM 1050  H HD13 . LEU A 1 67  ? -1.992  -3.556  11.143  1.00 0.00 ? 67  LEU A HD13 1  
ATOM 1051  H HD21 . LEU A 1 67  ? 0.077   -1.924  8.703   1.00 0.00 ? 67  LEU A HD21 1  
ATOM 1052  H HD22 . LEU A 1 67  ? -1.192  -1.070  7.825   1.00 0.00 ? 67  LEU A HD22 1  
ATOM 1053  H HD23 . LEU A 1 67  ? -0.904  -2.783  7.515   1.00 0.00 ? 67  LEU A HD23 1  
ATOM 1054  N N    . ASP A 1 68  ? -5.364  -1.175  10.916  1.00 0.00 ? 68  ASP A N    1  
ATOM 1055  C CA   . ASP A 1 68  ? -5.807  0.186   11.196  1.00 0.00 ? 68  ASP A CA   1  
ATOM 1056  C C    . ASP A 1 68  ? -4.618  1.139   11.269  1.00 0.00 ? 68  ASP A C    1  
ATOM 1057  O O    . ASP A 1 68  ? -3.859  1.127   12.237  1.00 0.00 ? 68  ASP A O    1  
ATOM 1058  C CB   . ASP A 1 68  ? -6.593  0.229   12.507  1.00 0.00 ? 68  ASP A CB   1  
ATOM 1059  C CG   . ASP A 1 68  ? -6.005  -0.682  13.566  1.00 0.00 ? 68  ASP A CG   1  
ATOM 1060  O OD1  . ASP A 1 68  ? -4.785  -0.589  13.818  1.00 0.00 ? 68  ASP A OD1  1  
ATOM 1061  O OD2  . ASP A 1 68  ? -6.764  -1.489  14.142  1.00 0.00 ? 68  ASP A OD2  1  
ATOM 1062  H H    . ASP A 1 68  ? -5.448  -1.859  11.614  1.00 0.00 ? 68  ASP A H    1  
ATOM 1063  H HA   . ASP A 1 68  ? -6.453  0.497   10.389  1.00 0.00 ? 68  ASP A HA   1  
ATOM 1064  H HB2  . ASP A 1 68  ? -6.590  1.240   12.887  1.00 0.00 ? 68  ASP A HB2  1  
ATOM 1065  H HB3  . ASP A 1 68  ? -7.611  -0.077  12.319  1.00 0.00 ? 68  ASP A HB3  1  
ATOM 1066  N N    . ALA A 1 69  ? -4.464  1.964   10.238  1.00 0.00 ? 69  ALA A N    1  
ATOM 1067  C CA   . ALA A 1 69  ? -3.369  2.925   10.186  1.00 0.00 ? 69  ALA A CA   1  
ATOM 1068  C C    . ALA A 1 69  ? -3.437  3.899   11.358  1.00 0.00 ? 69  ALA A C    1  
ATOM 1069  O O    . ALA A 1 69  ? -2.411  4.284   11.919  1.00 0.00 ? 69  ALA A O    1  
ATOM 1070  C CB   . ALA A 1 69  ? -3.392  3.681   8.866   1.00 0.00 ? 69  ALA A CB   1  
ATOM 1071  H H    . ALA A 1 69  ? -5.102  1.926   9.496   1.00 0.00 ? 69  ALA A H    1  
ATOM 1072  H HA   . ALA A 1 69  ? -2.440  2.375   10.242  1.00 0.00 ? 69  ALA A HA   1  
ATOM 1073  H HB1  . ALA A 1 69  ? -2.536  4.338   8.814   1.00 0.00 ? 69  ALA A HB1  1  
ATOM 1074  H HB2  . ALA A 1 69  ? -3.358  2.978   8.048   1.00 0.00 ? 69  ALA A HB2  1  
ATOM 1075  H HB3  . ALA A 1 69  ? -4.298  4.265   8.803   1.00 0.00 ? 69  ALA A HB3  1  
ATOM 1076  N N    . LYS A 1 70  ? -4.652  4.295   11.722  1.00 0.00 ? 70  LYS A N    1  
ATOM 1077  C CA   . LYS A 1 70  ? -4.855  5.224   12.827  1.00 0.00 ? 70  LYS A CA   1  
ATOM 1078  C C    . LYS A 1 70  ? -4.195  6.568   12.536  1.00 0.00 ? 70  LYS A C    1  
ATOM 1079  O O    . LYS A 1 70  ? -3.748  7.262   13.450  1.00 0.00 ? 70  LYS A O    1  
ATOM 1080  C CB   . LYS A 1 70  ? -4.292  4.637   14.124  1.00 0.00 ? 70  LYS A CB   1  
ATOM 1081  C CG   . LYS A 1 70  ? -4.970  3.347   14.553  1.00 0.00 ? 70  LYS A CG   1  
ATOM 1082  C CD   . LYS A 1 70  ? -6.351  3.609   15.130  1.00 0.00 ? 70  LYS A CD   1  
ATOM 1083  C CE   . LYS A 1 70  ? -6.851  2.421   15.937  1.00 0.00 ? 70  LYS A CE   1  
ATOM 1084  N NZ   . LYS A 1 70  ? -8.187  2.684   16.541  1.00 0.00 ? 70  LYS A NZ   1  
ATOM 1085  H H    . LYS A 1 70  ? -5.431  3.953   11.236  1.00 0.00 ? 70  LYS A H    1  
ATOM 1086  H HA   . LYS A 1 70  ? -5.917  5.375   12.942  1.00 0.00 ? 70  LYS A HA   1  
ATOM 1087  H HB2  . LYS A 1 70  ? -3.239  4.438   13.987  1.00 0.00 ? 70  LYS A HB2  1  
ATOM 1088  H HB3  . LYS A 1 70  ? -4.412  5.363   14.915  1.00 0.00 ? 70  LYS A HB3  1  
ATOM 1089  H HG2  . LYS A 1 70  ? -5.067  2.700   13.694  1.00 0.00 ? 70  LYS A HG2  1  
ATOM 1090  H HG3  . LYS A 1 70  ? -4.361  2.864   15.304  1.00 0.00 ? 70  LYS A HG3  1  
ATOM 1091  H HD2  . LYS A 1 70  ? -6.305  4.474   15.774  1.00 0.00 ? 70  LYS A HD2  1  
ATOM 1092  H HD3  . LYS A 1 70  ? -7.040  3.798   14.319  1.00 0.00 ? 70  LYS A HD3  1  
ATOM 1093  H HE2  . LYS A 1 70  ? -6.923  1.564   15.285  1.00 0.00 ? 70  LYS A HE2  1  
ATOM 1094  H HE3  . LYS A 1 70  ? -6.143  2.214   16.726  1.00 0.00 ? 70  LYS A HE3  1  
ATOM 1095  H HZ1  . LYS A 1 70  ? -8.891  2.024   16.152  1.00 0.00 ? 70  LYS A HZ1  1  
ATOM 1096  H HZ2  . LYS A 1 70  ? -8.488  3.657   16.332  1.00 0.00 ? 70  LYS A HZ2  1  
ATOM 1097  H HZ3  . LYS A 1 70  ? -8.144  2.559   17.572  1.00 0.00 ? 70  LYS A HZ3  1  
ATOM 1098  N N    . VAL A 1 71  ? -4.138  6.930   11.259  1.00 0.00 ? 71  VAL A N    1  
ATOM 1099  C CA   . VAL A 1 71  ? -3.535  8.192   10.848  1.00 0.00 ? 71  VAL A CA   1  
ATOM 1100  C C    . VAL A 1 71  ? -4.094  8.659   9.509   1.00 0.00 ? 71  VAL A C    1  
ATOM 1101  O O    . VAL A 1 71  ? -3.803  8.093   8.455   1.00 0.00 ? 71  VAL A O    1  
ATOM 1102  C CB   . VAL A 1 71  ? -2.003  8.073   10.738  1.00 0.00 ? 71  VAL A CB   1  
ATOM 1103  C CG1  . VAL A 1 71  ? -1.378  9.435   10.478  1.00 0.00 ? 71  VAL A CG1  1  
ATOM 1104  C CG2  . VAL A 1 71  ? -1.426  7.444   11.997  1.00 0.00 ? 71  VAL A CG2  1  
ATOM 1105  H H    . VAL A 1 71  ? -4.510  6.334   10.576  1.00 0.00 ? 71  VAL A H    1  
ATOM 1106  H HA   . VAL A 1 71  ? -3.764  8.932   11.601  1.00 0.00 ? 71  VAL A HA   1  
ATOM 1107  H HB   . VAL A 1 71  ? -1.771  7.430   9.901   1.00 0.00 ? 71  VAL A HB   1  
ATOM 1108  H HG11 . VAL A 1 71  ? -1.007  9.474   9.465   1.00 0.00 ? 71  VAL A HG11 1  
ATOM 1109  H HG12 . VAL A 1 71  ? -2.122  10.206  10.620  1.00 0.00 ? 71  VAL A HG12 1  
ATOM 1110  H HG13 . VAL A 1 71  ? -0.561  9.593   11.167  1.00 0.00 ? 71  VAL A HG13 1  
ATOM 1111  H HG21 . VAL A 1 71  ? -0.349  7.418   11.924  1.00 0.00 ? 71  VAL A HG21 1  
ATOM 1112  H HG22 . VAL A 1 71  ? -1.714  8.031   12.858  1.00 0.00 ? 71  VAL A HG22 1  
ATOM 1113  H HG23 . VAL A 1 71  ? -1.805  6.439   12.104  1.00 0.00 ? 71  VAL A HG23 1  
ATOM 1114  N N    . PRO A 1 72  ? -4.918  9.717   9.548   1.00 0.00 ? 72  PRO A N    1  
ATOM 1115  C CA   . PRO A 1 72  ? -5.536  10.284  8.346   1.00 0.00 ? 72  PRO A CA   1  
ATOM 1116  C C    . PRO A 1 72  ? -4.522  10.984  7.448   1.00 0.00 ? 72  PRO A C    1  
ATOM 1117  O O    . PRO A 1 72  ? -4.876  11.542  6.409   1.00 0.00 ? 72  PRO A O    1  
ATOM 1118  C CB   . PRO A 1 72  ? -6.540  11.294  8.907   1.00 0.00 ? 72  PRO A CB   1  
ATOM 1119  C CG   . PRO A 1 72  ? -5.995  11.670  10.241  1.00 0.00 ? 72  PRO A CG   1  
ATOM 1120  C CD   . PRO A 1 72  ? -5.309  10.441  10.769  1.00 0.00 ? 72  PRO A CD   1  
ATOM 1121  H HA   . PRO A 1 72  ? -6.060  9.531   7.776   1.00 0.00 ? 72  PRO A HA   1  
ATOM 1122  H HB2  . PRO A 1 72  ? -6.600  12.149  8.248   1.00 0.00 ? 72  PRO A HB2  1  
ATOM 1123  H HB3  . PRO A 1 72  ? -7.512  10.831  8.993   1.00 0.00 ? 72  PRO A HB3  1  
ATOM 1124  H HG2  . PRO A 1 72  ? -5.287  12.478  10.134  1.00 0.00 ? 72  PRO A HG2  1  
ATOM 1125  H HG3  . PRO A 1 72  ? -6.801  11.961  10.898  1.00 0.00 ? 72  PRO A HG3  1  
ATOM 1126  H HD2  . PRO A 1 72  ? -4.441  10.713  11.351  1.00 0.00 ? 72  PRO A HD2  1  
ATOM 1127  H HD3  . PRO A 1 72  ? -5.994  9.852   11.363  1.00 0.00 ? 72  PRO A HD3  1  
ATOM 1128  N N    . THR A 1 73  ? -3.256  10.950  7.854   1.00 0.00 ? 73  THR A N    1  
ATOM 1129  C CA   . THR A 1 73  ? -2.190  11.582  7.087   1.00 0.00 ? 73  THR A CA   1  
ATOM 1130  C C    . THR A 1 73  ? -1.259  10.539  6.479   1.00 0.00 ? 73  THR A C    1  
ATOM 1131  O O    . THR A 1 73  ? -0.353  10.873  5.716   1.00 0.00 ? 73  THR A O    1  
ATOM 1132  C CB   . THR A 1 73  ? -1.364  12.545  7.960   1.00 0.00 ? 73  THR A CB   1  
ATOM 1133  O OG1  . THR A 1 73  ? -0.733  11.823  9.024   1.00 0.00 ? 73  THR A OG1  1  
ATOM 1134  C CG2  . THR A 1 73  ? -2.245  13.642  8.538   1.00 0.00 ? 73  THR A CG2  1  
ATOM 1135  H H    . THR A 1 73  ? -3.036  10.490  8.691   1.00 0.00 ? 73  THR A H    1  
ATOM 1136  H HA   . THR A 1 73  ? -2.645  12.152  6.290   1.00 0.00 ? 73  THR A HA   1  
ATOM 1137  H HB   . THR A 1 73  ? -0.603  13.002  7.344   1.00 0.00 ? 73  THR A HB   1  
ATOM 1138  H HG1  . THR A 1 73  ? -0.497  12.432  9.728   1.00 0.00 ? 73  THR A HG1  1  
ATOM 1139  H HG21 . THR A 1 73  ? -1.695  14.185  9.292   1.00 0.00 ? 73  THR A HG21 1  
ATOM 1140  H HG22 . THR A 1 73  ? -3.125  13.201  8.981   1.00 0.00 ? 73  THR A HG22 1  
ATOM 1141  H HG23 . THR A 1 73  ? -2.539  14.319  7.750   1.00 0.00 ? 73  THR A HG23 1  
ATOM 1142  N N    . GLU A 1 74  ? -1.488  9.275   6.822   1.00 0.00 ? 74  GLU A N    1  
ATOM 1143  C CA   . GLU A 1 74  ? -0.667  8.184   6.309   1.00 0.00 ? 74  GLU A CA   1  
ATOM 1144  C C    . GLU A 1 74  ? -1.350  7.499   5.129   1.00 0.00 ? 74  GLU A C    1  
ATOM 1145  O O    . GLU A 1 74  ? -2.189  6.616   5.311   1.00 0.00 ? 74  GLU A O    1  
ATOM 1146  C CB   . GLU A 1 74  ? -0.388  7.164   7.414   1.00 0.00 ? 74  GLU A CB   1  
ATOM 1147  C CG   . GLU A 1 74  ? 0.732   7.576   8.354   1.00 0.00 ? 74  GLU A CG   1  
ATOM 1148  C CD   . GLU A 1 74  ? 0.687   6.835   9.676   1.00 0.00 ? 74  GLU A CD   1  
ATOM 1149  O OE1  . GLU A 1 74  ? -0.075  5.850   9.778   1.00 0.00 ? 74  GLU A OE1  1  
ATOM 1150  O OE2  . GLU A 1 74  ? 1.413   7.238   10.609  1.00 0.00 ? 74  GLU A OE2  1  
ATOM 1151  H H    . GLU A 1 74  ? -2.225  9.072   7.435   1.00 0.00 ? 74  GLU A H    1  
ATOM 1152  H HA   . GLU A 1 74  ? 0.269   8.603   5.974   1.00 0.00 ? 74  GLU A HA   1  
ATOM 1153  H HB2  . GLU A 1 74  ? -1.287  7.026   7.996   1.00 0.00 ? 74  GLU A HB2  1  
ATOM 1154  H HB3  . GLU A 1 74  ? -0.118  6.223   6.958   1.00 0.00 ? 74  GLU A HB3  1  
ATOM 1155  H HG2  . GLU A 1 74  ? 1.679   7.372   7.877   1.00 0.00 ? 74  GLU A HG2  1  
ATOM 1156  H HG3  . GLU A 1 74  ? 0.650   8.635   8.549   1.00 0.00 ? 74  GLU A HG3  1  
ATOM 1157  N N    . ARG A 1 75  ? -0.985  7.912   3.920   1.00 0.00 ? 75  ARG A N    1  
ATOM 1158  C CA   . ARG A 1 75  ? -1.563  7.340   2.710   1.00 0.00 ? 75  ARG A CA   1  
ATOM 1159  C C    . ARG A 1 75  ? -0.777  6.112   2.260   1.00 0.00 ? 75  ARG A C    1  
ATOM 1160  O O    . ARG A 1 75  ? -0.841  5.712   1.098   1.00 0.00 ? 75  ARG A O    1  
ATOM 1161  C CB   . ARG A 1 75  ? -1.588  8.381   1.589   1.00 0.00 ? 75  ARG A CB   1  
ATOM 1162  C CG   . ARG A 1 75  ? -2.390  9.626   1.932   1.00 0.00 ? 75  ARG A CG   1  
ATOM 1163  C CD   . ARG A 1 75  ? -3.880  9.399   1.737   1.00 0.00 ? 75  ARG A CD   1  
ATOM 1164  N NE   . ARG A 1 75  ? -4.657  10.606  2.005   1.00 0.00 ? 75  ARG A NE   1  
ATOM 1165  C CZ   . ARG A 1 75  ? -4.638  11.681  1.225   1.00 0.00 ? 75  ARG A CZ   1  
ATOM 1166  N NH1  . ARG A 1 75  ? -3.886  11.698  0.133   1.00 0.00 ? 75  ARG A NH1  1  
ATOM 1167  N NH2  . ARG A 1 75  ? -5.373  12.741  1.535   1.00 0.00 ? 75  ARG A NH2  1  
ATOM 1168  H H    . ARG A 1 75  ? -0.311  8.619   3.839   1.00 0.00 ? 75  ARG A H    1  
ATOM 1169  H HA   . ARG A 1 75  ? -2.576  7.042   2.935   1.00 0.00 ? 75  ARG A HA   1  
ATOM 1170  H HB2  . ARG A 1 75  ? -0.574  8.682   1.371   1.00 0.00 ? 75  ARG A HB2  1  
ATOM 1171  H HB3  . ARG A 1 75  ? -2.019  7.932   0.708   1.00 0.00 ? 75  ARG A HB3  1  
ATOM 1172  H HG2  . ARG A 1 75  ? -2.208  9.887   2.964   1.00 0.00 ? 75  ARG A HG2  1  
ATOM 1173  H HG3  . ARG A 1 75  ? -2.070  10.435  1.293   1.00 0.00 ? 75  ARG A HG3  1  
ATOM 1174  H HD2  . ARG A 1 75  ? -4.054  9.090   0.717   1.00 0.00 ? 75  ARG A HD2  1  
ATOM 1175  H HD3  . ARG A 1 75  ? -4.203  8.618   2.409   1.00 0.00 ? 75  ARG A HD3  1  
ATOM 1176  H HE   . ARG A 1 75  ? -5.220  10.615  2.807   1.00 0.00 ? 75  ARG A HE   1  
ATOM 1177  H HH11 . ARG A 1 75  ? -3.332  10.900  -0.104  1.00 0.00 ? 75  ARG A HH11 1  
ATOM 1178  H HH12 . ARG A 1 75  ? -3.875  12.508  -0.454  1.00 0.00 ? 75  ARG A HH12 1  
ATOM 1179  H HH21 . ARG A 1 75  ? -5.942  12.732  2.358   1.00 0.00 ? 75  ARG A HH21 1  
ATOM 1180  H HH22 . ARG A 1 75  ? -5.358  13.549  0.948   1.00 0.00 ? 75  ARG A HH22 1  
ATOM 1181  N N    . SER A 1 76  ? -0.035  5.517   3.190   1.00 0.00 ? 76  SER A N    1  
ATOM 1182  C CA   . SER A 1 76  ? 0.767   4.337   2.888   1.00 0.00 ? 76  SER A CA   1  
ATOM 1183  C C    . SER A 1 76  ? 0.935   3.464   4.128   1.00 0.00 ? 76  SER A C    1  
ATOM 1184  O O    . SER A 1 76  ? 1.354   3.938   5.183   1.00 0.00 ? 76  SER A O    1  
ATOM 1185  C CB   . SER A 1 76  ? 2.139   4.750   2.352   1.00 0.00 ? 76  SER A CB   1  
ATOM 1186  O OG   . SER A 1 76  ? 2.930   5.336   3.372   1.00 0.00 ? 76  SER A OG   1  
ATOM 1187  H H    . SER A 1 76  ? -0.025  5.883   4.099   1.00 0.00 ? 76  SER A H    1  
ATOM 1188  H HA   . SER A 1 76  ? 0.249   3.770   2.129   1.00 0.00 ? 76  SER A HA   1  
ATOM 1189  H HB2  . SER A 1 76  ? 2.651   3.880   1.971   1.00 0.00 ? 76  SER A HB2  1  
ATOM 1190  H HB3  . SER A 1 76  ? 2.010   5.469   1.556   1.00 0.00 ? 76  SER A HB3  1  
ATOM 1191  H HG   . SER A 1 76  ? 3.806   4.944   3.362   1.00 0.00 ? 76  SER A HG   1  
ATOM 1192  N N    . ALA A 1 77  ? 0.604   2.184   3.991   1.00 0.00 ? 77  ALA A N    1  
ATOM 1193  C CA   . ALA A 1 77  ? 0.719   1.242   5.097   1.00 0.00 ? 77  ALA A CA   1  
ATOM 1194  C C    . ALA A 1 77  ? 1.678   0.107   4.755   1.00 0.00 ? 77  ALA A C    1  
ATOM 1195  O O    . ALA A 1 77  ? 1.870   -0.225  3.585   1.00 0.00 ? 77  ALA A O    1  
ATOM 1196  C CB   . ALA A 1 77  ? -0.650  0.687   5.463   1.00 0.00 ? 77  ALA A CB   1  
ATOM 1197  H H    . ALA A 1 77  ? 0.276   1.865   3.124   1.00 0.00 ? 77  ALA A H    1  
ATOM 1198  H HA   . ALA A 1 77  ? 1.103   1.778   5.953   1.00 0.00 ? 77  ALA A HA   1  
ATOM 1199  H HB1  . ALA A 1 77  ? -1.253  0.603   4.571   1.00 0.00 ? 77  ALA A HB1  1  
ATOM 1200  H HB2  . ALA A 1 77  ? -0.534  -0.287  5.914   1.00 0.00 ? 77  ALA A HB2  1  
ATOM 1201  H HB3  . ALA A 1 77  ? -1.132  1.353   6.163   1.00 0.00 ? 77  ALA A HB3  1  
ATOM 1202  N N    . VAL A 1 78  ? 2.278   -0.485  5.782   1.00 0.00 ? 78  VAL A N    1  
ATOM 1203  C CA   . VAL A 1 78  ? 3.217   -1.584  5.590   1.00 0.00 ? 78  VAL A CA   1  
ATOM 1204  C C    . VAL A 1 78  ? 2.725   -2.854  6.275   1.00 0.00 ? 78  VAL A C    1  
ATOM 1205  O O    . VAL A 1 78  ? 2.578   -2.896  7.498   1.00 0.00 ? 78  VAL A O    1  
ATOM 1206  C CB   . VAL A 1 78  ? 4.614   -1.230  6.132   1.00 0.00 ? 78  VAL A CB   1  
ATOM 1207  C CG1  . VAL A 1 78  ? 5.581   -2.383  5.910   1.00 0.00 ? 78  VAL A CG1  1  
ATOM 1208  C CG2  . VAL A 1 78  ? 5.131   0.044   5.480   1.00 0.00 ? 78  VAL A CG2  1  
ATOM 1209  H H    . VAL A 1 78  ? 2.084   -0.177  6.692   1.00 0.00 ? 78  VAL A H    1  
ATOM 1210  H HA   . VAL A 1 78  ? 3.301   -1.769  4.529   1.00 0.00 ? 78  VAL A HA   1  
ATOM 1211  H HB   . VAL A 1 78  ? 4.532   -1.057  7.195   1.00 0.00 ? 78  VAL A HB   1  
ATOM 1212  H HG11 . VAL A 1 78  ? 6.576   -1.992  5.753   1.00 0.00 ? 78  VAL A HG11 1  
ATOM 1213  H HG12 . VAL A 1 78  ? 5.579   -3.027  6.776   1.00 0.00 ? 78  VAL A HG12 1  
ATOM 1214  H HG13 . VAL A 1 78  ? 5.276   -2.946  5.040   1.00 0.00 ? 78  VAL A HG13 1  
ATOM 1215  H HG21 . VAL A 1 78  ? 5.569   -0.195  4.523   1.00 0.00 ? 78  VAL A HG21 1  
ATOM 1216  H HG22 . VAL A 1 78  ? 4.312   0.734   5.338   1.00 0.00 ? 78  VAL A HG22 1  
ATOM 1217  H HG23 . VAL A 1 78  ? 5.877   0.497   6.115   1.00 0.00 ? 78  VAL A HG23 1  
ATOM 1218  N N    . LEU A 1 79  ? 2.471   -3.888  5.481   1.00 0.00 ? 79  LEU A N    1  
ATOM 1219  C CA   . LEU A 1 79  ? 1.996   -5.161  6.011   1.00 0.00 ? 79  LEU A CA   1  
ATOM 1220  C C    . LEU A 1 79  ? 3.161   -6.105  6.288   1.00 0.00 ? 79  LEU A C    1  
ATOM 1221  O O    . LEU A 1 79  ? 3.838   -6.561  5.367   1.00 0.00 ? 79  LEU A O    1  
ATOM 1222  C CB   . LEU A 1 79  ? 1.020   -5.813  5.028   1.00 0.00 ? 79  LEU A CB   1  
ATOM 1223  C CG   . LEU A 1 79  ? -0.076  -4.905  4.470   1.00 0.00 ? 79  LEU A CG   1  
ATOM 1224  C CD1  . LEU A 1 79  ? -0.772  -5.571  3.293   1.00 0.00 ? 79  LEU A CD1  1  
ATOM 1225  C CD2  . LEU A 1 79  ? -1.081  -4.552  5.556   1.00 0.00 ? 79  LEU A CD2  1  
ATOM 1226  H H    . LEU A 1 79  ? 2.607   -3.794  4.515   1.00 0.00 ? 79  LEU A H    1  
ATOM 1227  H HA   . LEU A 1 79  ? 1.480   -4.962  6.938   1.00 0.00 ? 79  LEU A HA   1  
ATOM 1228  H HB2  . LEU A 1 79  ? 1.593   -6.190  4.195   1.00 0.00 ? 79  LEU A HB2  1  
ATOM 1229  H HB3  . LEU A 1 79  ? 0.541   -6.637  5.537   1.00 0.00 ? 79  LEU A HB3  1  
ATOM 1230  H HG   . LEU A 1 79  ? 0.372   -3.986  4.115   1.00 0.00 ? 79  LEU A HG   1  
ATOM 1231  H HD11 . LEU A 1 79  ? -0.048  -6.116  2.708   1.00 0.00 ? 79  LEU A HD11 1  
ATOM 1232  H HD12 . LEU A 1 79  ? -1.238  -4.816  2.676   1.00 0.00 ? 79  LEU A HD12 1  
ATOM 1233  H HD13 . LEU A 1 79  ? -1.526  -6.252  3.659   1.00 0.00 ? 79  LEU A HD13 1  
ATOM 1234  H HD21 . LEU A 1 79  ? -1.246  -3.484  5.560   1.00 0.00 ? 79  LEU A HD21 1  
ATOM 1235  H HD22 . LEU A 1 79  ? -0.695  -4.859  6.517   1.00 0.00 ? 79  LEU A HD22 1  
ATOM 1236  H HD23 . LEU A 1 79  ? -2.014  -5.060  5.362   1.00 0.00 ? 79  LEU A HD23 1  
ATOM 1237  N N    . VAL A 1 80  ? 3.389   -6.396  7.565   1.00 0.00 ? 80  VAL A N    1  
ATOM 1238  C CA   . VAL A 1 80  ? 4.471   -7.288  7.965   1.00 0.00 ? 80  VAL A CA   1  
ATOM 1239  C C    . VAL A 1 80  ? 3.953   -8.700  8.219   1.00 0.00 ? 80  VAL A C    1  
ATOM 1240  O O    . VAL A 1 80  ? 2.759   -8.965  8.094   1.00 0.00 ? 80  VAL A O    1  
ATOM 1241  C CB   . VAL A 1 80  ? 5.180   -6.778  9.233   1.00 0.00 ? 80  VAL A CB   1  
ATOM 1242  C CG1  . VAL A 1 80  ? 5.849   -5.437  8.968   1.00 0.00 ? 80  VAL A CG1  1  
ATOM 1243  C CG2  . VAL A 1 80  ? 4.195   -6.672  10.388  1.00 0.00 ? 80  VAL A CG2  1  
ATOM 1244  H H    . VAL A 1 80  ? 2.815   -6.002  8.255   1.00 0.00 ? 80  VAL A H    1  
ATOM 1245  H HA   . VAL A 1 80  ? 5.192   -7.319  7.162   1.00 0.00 ? 80  VAL A HA   1  
ATOM 1246  H HB   . VAL A 1 80  ? 5.946   -7.490  9.504   1.00 0.00 ? 80  VAL A HB   1  
ATOM 1247  H HG11 . VAL A 1 80  ? 6.363   -5.110  9.860   1.00 0.00 ? 80  VAL A HG11 1  
ATOM 1248  H HG12 . VAL A 1 80  ? 6.558   -5.542  8.160   1.00 0.00 ? 80  VAL A HG12 1  
ATOM 1249  H HG13 . VAL A 1 80  ? 5.099   -4.709  8.697   1.00 0.00 ? 80  VAL A HG13 1  
ATOM 1250  H HG21 . VAL A 1 80  ? 3.340   -7.300  10.189  1.00 0.00 ? 80  VAL A HG21 1  
ATOM 1251  H HG22 . VAL A 1 80  ? 4.674   -6.996  11.301  1.00 0.00 ? 80  VAL A HG22 1  
ATOM 1252  H HG23 . VAL A 1 80  ? 3.874   -5.647  10.495  1.00 0.00 ? 80  VAL A HG23 1  
ATOM 1253  N N    . ASN A 1 81  ? 4.862   -9.602  8.576   1.00 0.00 ? 81  ASN A N    1  
ATOM 1254  C CA   . ASN A 1 81  ? 4.497   -10.987 8.848   1.00 0.00 ? 81  ASN A CA   1  
ATOM 1255  C C    . ASN A 1 81  ? 3.770   -11.602 7.656   1.00 0.00 ? 81  ASN A C    1  
ATOM 1256  O O    . ASN A 1 81  ? 2.692   -12.180 7.803   1.00 0.00 ? 81  ASN A O    1  
ATOM 1257  C CB   . ASN A 1 81  ? 3.615   -11.069 10.095  1.00 0.00 ? 81  ASN A CB   1  
ATOM 1258  C CG   . ASN A 1 81  ? 4.072   -10.124 11.190  1.00 0.00 ? 81  ASN A CG   1  
ATOM 1259  O OD1  . ASN A 1 81  ? 3.277   -9.692  12.024  1.00 0.00 ? 81  ASN A OD1  1  
ATOM 1260  N ND2  . ASN A 1 81  ? 5.360   -9.798  11.190  1.00 0.00 ? 81  ASN A ND2  1  
ATOM 1261  H H    . ASN A 1 81  ? 5.800   -9.329  8.659   1.00 0.00 ? 81  ASN A H    1  
ATOM 1262  H HA   . ASN A 1 81  ? 5.407   -11.541 9.024   1.00 0.00 ? 81  ASN A HA   1  
ATOM 1263  H HB2  . ASN A 1 81  ? 2.600   -10.815 9.828   1.00 0.00 ? 81  ASN A HB2  1  
ATOM 1264  H HB3  . ASN A 1 81  ? 3.640   -12.077 10.481  1.00 0.00 ? 81  ASN A HB3  1  
ATOM 1265  H HD21 . ASN A 1 81  ? 5.934   -10.180 10.494  1.00 0.00 ? 81  ASN A HD21 1  
ATOM 1266  H HD22 . ASN A 1 81  ? 5.682   -9.189  11.886  1.00 0.00 ? 81  ASN A HD22 1  
ATOM 1267  N N    . LEU A 1 82  ? 4.367   -11.475 6.476   1.00 0.00 ? 82  LEU A N    1  
ATOM 1268  C CA   . LEU A 1 82  ? 3.777   -12.019 5.257   1.00 0.00 ? 82  LEU A CA   1  
ATOM 1269  C C    . LEU A 1 82  ? 4.538   -13.254 4.788   1.00 0.00 ? 82  LEU A C    1  
ATOM 1270  O O    . LEU A 1 82  ? 5.749   -13.362 4.983   1.00 0.00 ? 82  LEU A O    1  
ATOM 1271  C CB   . LEU A 1 82  ? 3.770   -10.959 4.154   1.00 0.00 ? 82  LEU A CB   1  
ATOM 1272  C CG   . LEU A 1 82  ? 3.046   -9.653  4.482   1.00 0.00 ? 82  LEU A CG   1  
ATOM 1273  C CD1  . LEU A 1 82  ? 3.267   -8.629  3.380   1.00 0.00 ? 82  LEU A CD1  1  
ATOM 1274  C CD2  . LEU A 1 82  ? 1.559   -9.904  4.689   1.00 0.00 ? 82  LEU A CD2  1  
ATOM 1275  H H    . LEU A 1 82  ? 5.224   -11.004 6.421   1.00 0.00 ? 82  LEU A H    1  
ATOM 1276  H HA   . LEU A 1 82  ? 2.759   -12.301 5.480   1.00 0.00 ? 82  LEU A HA   1  
ATOM 1277  H HB2  . LEU A 1 82  ? 4.795   -10.719 3.920   1.00 0.00 ? 82  LEU A HB2  1  
ATOM 1278  H HB3  . LEU A 1 82  ? 3.296   -11.392 3.284   1.00 0.00 ? 82  LEU A HB3  1  
ATOM 1279  H HG   . LEU A 1 82  ? 3.448   -9.247  5.400   1.00 0.00 ? 82  LEU A HG   1  
ATOM 1280  H HD11 . LEU A 1 82  ? 2.797   -8.971  2.471   1.00 0.00 ? 82  LEU A HD11 1  
ATOM 1281  H HD12 . LEU A 1 82  ? 4.327   -8.503  3.212   1.00 0.00 ? 82  LEU A HD12 1  
ATOM 1282  H HD13 . LEU A 1 82  ? 2.836   -7.683  3.675   1.00 0.00 ? 82  LEU A HD13 1  
ATOM 1283  H HD21 . LEU A 1 82  ? 1.111   -9.041  5.158   1.00 0.00 ? 82  LEU A HD21 1  
ATOM 1284  H HD22 . LEU A 1 82  ? 1.425   -10.769 5.323   1.00 0.00 ? 82  LEU A HD22 1  
ATOM 1285  H HD23 . LEU A 1 82  ? 1.088   -10.081 3.733   1.00 0.00 ? 82  LEU A HD23 1  
ATOM 1286  N N    . LYS A 1 83  ? 3.822   -14.183 4.165   1.00 0.00 ? 83  LYS A N    1  
ATOM 1287  C CA   . LYS A 1 83  ? 4.429   -15.410 3.663   1.00 0.00 ? 83  LYS A CA   1  
ATOM 1288  C C    . LYS A 1 83  ? 5.269   -15.132 2.420   1.00 0.00 ? 83  LYS A C    1  
ATOM 1289  O O    . LYS A 1 83  ? 4.969   -14.223 1.646   1.00 0.00 ? 83  LYS A O    1  
ATOM 1290  C CB   . LYS A 1 83  ? 3.348   -16.444 3.341   1.00 0.00 ? 83  LYS A CB   1  
ATOM 1291  C CG   . LYS A 1 83  ? 3.855   -17.876 3.349   1.00 0.00 ? 83  LYS A CG   1  
ATOM 1292  C CD   . LYS A 1 83  ? 2.733   -18.866 3.083   1.00 0.00 ? 83  LYS A CD   1  
ATOM 1293  C CE   . LYS A 1 83  ? 3.008   -20.209 3.741   1.00 0.00 ? 83  LYS A CE   1  
ATOM 1294  N NZ   . LYS A 1 83  ? 2.468   -20.269 5.127   1.00 0.00 ? 83  LYS A NZ   1  
ATOM 1295  H H    . LYS A 1 83  ? 2.860   -14.040 4.039   1.00 0.00 ? 83  LYS A H    1  
ATOM 1296  H HA   . LYS A 1 83  ? 5.072   -15.802 4.436   1.00 0.00 ? 83  LYS A HA   1  
ATOM 1297  H HB2  . LYS A 1 83  ? 2.557   -16.360 4.071   1.00 0.00 ? 83  LYS A HB2  1  
ATOM 1298  H HB3  . LYS A 1 83  ? 2.945   -16.232 2.361   1.00 0.00 ? 83  LYS A HB3  1  
ATOM 1299  H HG2  . LYS A 1 83  ? 4.607   -17.987 2.582   1.00 0.00 ? 83  LYS A HG2  1  
ATOM 1300  H HG3  . LYS A 1 83  ? 4.289   -18.089 4.315   1.00 0.00 ? 83  LYS A HG3  1  
ATOM 1301  H HD2  . LYS A 1 83  ? 1.811   -18.466 3.479   1.00 0.00 ? 83  LYS A HD2  1  
ATOM 1302  H HD3  . LYS A 1 83  ? 2.636   -19.010 2.016   1.00 0.00 ? 83  LYS A HD3  1  
ATOM 1303  H HE2  . LYS A 1 83  ? 2.546   -20.986 3.150   1.00 0.00 ? 83  LYS A HE2  1  
ATOM 1304  H HE3  . LYS A 1 83  ? 4.076   -20.368 3.772   1.00 0.00 ? 83  LYS A HE3  1  
ATOM 1305  H HZ1  . LYS A 1 83  ? 2.350   -21.260 5.422   1.00 0.00 ? 83  LYS A HZ1  1  
ATOM 1306  H HZ2  . LYS A 1 83  ? 1.544   -19.794 5.172   1.00 0.00 ? 83  LYS A HZ2  1  
ATOM 1307  H HZ3  . LYS A 1 83  ? 3.121   -19.798 5.786   1.00 0.00 ? 83  LYS A HZ3  1  
ATOM 1308  N N    . LYS A 1 84  ? 6.321   -15.922 2.234   1.00 0.00 ? 84  LYS A N    1  
ATOM 1309  C CA   . LYS A 1 84  ? 7.203   -15.764 1.084   1.00 0.00 ? 84  LYS A CA   1  
ATOM 1310  C C    . LYS A 1 84  ? 6.816   -16.726 -0.035  1.00 0.00 ? 84  LYS A C    1  
ATOM 1311  O O    . LYS A 1 84  ? 6.566   -17.906 0.207   1.00 0.00 ? 84  LYS A O    1  
ATOM 1312  C CB   . LYS A 1 84  ? 8.658   -16.001 1.494   1.00 0.00 ? 84  LYS A CB   1  
ATOM 1313  C CG   . LYS A 1 84  ? 8.924   -17.407 2.005   1.00 0.00 ? 84  LYS A CG   1  
ATOM 1314  C CD   . LYS A 1 84  ? 10.413  -17.704 2.069   1.00 0.00 ? 84  LYS A CD   1  
ATOM 1315  C CE   . LYS A 1 84  ? 11.084  -16.949 3.206   1.00 0.00 ? 84  LYS A CE   1  
ATOM 1316  N NZ   . LYS A 1 84  ? 12.340  -17.614 3.649   1.00 0.00 ? 84  LYS A NZ   1  
ATOM 1317  H H    . LYS A 1 84  ? 6.509   -16.630 2.886   1.00 0.00 ? 84  LYS A H    1  
ATOM 1318  H HA   . LYS A 1 84  ? 7.100   -14.752 0.723   1.00 0.00 ? 84  LYS A HA   1  
ATOM 1319  H HB2  . LYS A 1 84  ? 9.294   -15.825 0.639   1.00 0.00 ? 84  LYS A HB2  1  
ATOM 1320  H HB3  . LYS A 1 84  ? 8.918   -15.302 2.276   1.00 0.00 ? 84  LYS A HB3  1  
ATOM 1321  H HG2  . LYS A 1 84  ? 8.506   -17.505 2.996   1.00 0.00 ? 84  LYS A HG2  1  
ATOM 1322  H HG3  . LYS A 1 84  ? 8.452   -18.117 1.341   1.00 0.00 ? 84  LYS A HG3  1  
ATOM 1323  H HD2  . LYS A 1 84  ? 10.553  -18.764 2.224   1.00 0.00 ? 84  LYS A HD2  1  
ATOM 1324  H HD3  . LYS A 1 84  ? 10.870  -17.411 1.135   1.00 0.00 ? 84  LYS A HD3  1  
ATOM 1325  H HE2  . LYS A 1 84  ? 11.315  -15.950 2.870   1.00 0.00 ? 84  LYS A HE2  1  
ATOM 1326  H HE3  . LYS A 1 84  ? 10.400  -16.899 4.041   1.00 0.00 ? 84  LYS A HE3  1  
ATOM 1327  H HZ1  . LYS A 1 84  ? 12.158  -18.616 3.860   1.00 0.00 ? 84  LYS A HZ1  1  
ATOM 1328  H HZ2  . LYS A 1 84  ? 12.707  -17.152 4.505   1.00 0.00 ? 84  LYS A HZ2  1  
ATOM 1329  H HZ3  . LYS A 1 84  ? 13.060  -17.554 2.900   1.00 0.00 ? 84  LYS A HZ3  1  
ATOM 1330  N N    . GLY A 1 85  ? 6.770   -16.213 -1.261  1.00 0.00 ? 85  GLY A N    1  
ATOM 1331  C CA   . GLY A 1 85  ? 6.414   -17.041 -2.398  1.00 0.00 ? 85  GLY A CA   1  
ATOM 1332  C C    . GLY A 1 85  ? 4.925   -17.317 -2.472  1.00 0.00 ? 85  GLY A C    1  
ATOM 1333  O O    . GLY A 1 85  ? 4.502   -18.472 -2.529  1.00 0.00 ? 85  GLY A O    1  
ATOM 1334  H H    . GLY A 1 85  ? 6.979   -15.265 -1.394  1.00 0.00 ? 85  GLY A H    1  
ATOM 1335  H HA2  . GLY A 1 85  ? 6.721   -16.541 -3.304  1.00 0.00 ? 85  GLY A HA2  1  
ATOM 1336  H HA3  . GLY A 1 85  ? 6.939   -17.982 -2.322  1.00 0.00 ? 85  GLY A HA3  1  
ATOM 1337  N N    . VAL A 1 86  ? 4.127   -16.254 -2.468  1.00 0.00 ? 86  VAL A N    1  
ATOM 1338  C CA   . VAL A 1 86  ? 2.676   -16.387 -2.534  1.00 0.00 ? 86  VAL A CA   1  
ATOM 1339  C C    . VAL A 1 86  ? 2.012   -15.040 -2.797  1.00 0.00 ? 86  VAL A C    1  
ATOM 1340  O O    . VAL A 1 86  ? 2.438   -14.011 -2.271  1.00 0.00 ? 86  VAL A O    1  
ATOM 1341  C CB   . VAL A 1 86  ? 2.107   -16.981 -1.231  1.00 0.00 ? 86  VAL A CB   1  
ATOM 1342  C CG1  . VAL A 1 86  ? 2.597   -16.192 -0.026  1.00 0.00 ? 86  VAL A CG1  1  
ATOM 1343  C CG2  . VAL A 1 86  ? 0.587   -17.009 -1.278  1.00 0.00 ? 86  VAL A CG2  1  
ATOM 1344  H H    . VAL A 1 86  ? 4.523   -15.359 -2.421  1.00 0.00 ? 86  VAL A H    1  
ATOM 1345  H HA   . VAL A 1 86  ? 2.439   -17.059 -3.345  1.00 0.00 ? 86  VAL A HA   1  
ATOM 1346  H HB   . VAL A 1 86  ? 2.463   -17.996 -1.138  1.00 0.00 ? 86  VAL A HB   1  
ATOM 1347  H HG11 . VAL A 1 86  ? 3.408   -16.726 0.447   1.00 0.00 ? 86  VAL A HG11 1  
ATOM 1348  H HG12 . VAL A 1 86  ? 2.943   -15.221 -0.347  1.00 0.00 ? 86  VAL A HG12 1  
ATOM 1349  H HG13 . VAL A 1 86  ? 1.787   -16.072 0.678   1.00 0.00 ? 86  VAL A HG13 1  
ATOM 1350  H HG21 . VAL A 1 86  ? 0.216   -16.018 -1.494  1.00 0.00 ? 86  VAL A HG21 1  
ATOM 1351  H HG22 . VAL A 1 86  ? 0.263   -17.691 -2.051  1.00 0.00 ? 86  VAL A HG22 1  
ATOM 1352  H HG23 . VAL A 1 86  ? 0.203   -17.338 -0.325  1.00 0.00 ? 86  VAL A HG23 1  
ATOM 1353  N N    . THR A 1 87  ? 0.966   -15.052 -3.617  1.00 0.00 ? 87  THR A N    1  
ATOM 1354  C CA   . THR A 1 87  ? 0.242   -13.832 -3.952  1.00 0.00 ? 87  THR A CA   1  
ATOM 1355  C C    . THR A 1 87  ? -0.629  -13.373 -2.789  1.00 0.00 ? 87  THR A C    1  
ATOM 1356  O O    . THR A 1 87  ? -1.168  -14.191 -2.043  1.00 0.00 ? 87  THR A O    1  
ATOM 1357  C CB   . THR A 1 87  ? -0.644  -14.028 -5.197  1.00 0.00 ? 87  THR A CB   1  
ATOM 1358  O OG1  . THR A 1 87  ? 0.003   -14.906 -6.125  1.00 0.00 ? 87  THR A OG1  1  
ATOM 1359  C CG2  . THR A 1 87  ? -0.935  -12.695 -5.869  1.00 0.00 ? 87  THR A CG2  1  
ATOM 1360  H H    . THR A 1 87  ? 0.675   -15.904 -4.005  1.00 0.00 ? 87  THR A H    1  
ATOM 1361  H HA   . THR A 1 87  ? 0.969   -13.063 -4.171  1.00 0.00 ? 87  THR A HA   1  
ATOM 1362  H HB   . THR A 1 87  ? -1.580  -14.471 -4.887  1.00 0.00 ? 87  THR A HB   1  
ATOM 1363  H HG1  . THR A 1 87  ? 0.954   -14.793 -6.063  1.00 0.00 ? 87  THR A HG1  1  
ATOM 1364  H HG21 . THR A 1 87  ? -1.599  -12.852 -6.706  1.00 0.00 ? 87  THR A HG21 1  
ATOM 1365  H HG22 . THR A 1 87  ? -0.011  -12.259 -6.219  1.00 0.00 ? 87  THR A HG22 1  
ATOM 1366  H HG23 . THR A 1 87  ? -1.402  -12.029 -5.159  1.00 0.00 ? 87  THR A HG23 1  
ATOM 1367  N N    . TYR A 1 88  ? -0.764  -12.060 -2.640  1.00 0.00 ? 88  TYR A N    1  
ATOM 1368  C CA   . TYR A 1 88  ? -1.570  -11.491 -1.565  1.00 0.00 ? 88  TYR A CA   1  
ATOM 1369  C C    . TYR A 1 88  ? -2.430  -10.341 -2.079  1.00 0.00 ? 88  TYR A C    1  
ATOM 1370  O O    . TYR A 1 88  ? -1.917  -9.362  -2.620  1.00 0.00 ? 88  TYR A O    1  
ATOM 1371  C CB   . TYR A 1 88  ? -0.670  -11.002 -0.429  1.00 0.00 ? 88  TYR A CB   1  
ATOM 1372  C CG   . TYR A 1 88  ? -0.319  -12.078 0.573   1.00 0.00 ? 88  TYR A CG   1  
ATOM 1373  C CD1  . TYR A 1 88  ? -1.215  -12.444 1.570   1.00 0.00 ? 88  TYR A CD1  1  
ATOM 1374  C CD2  . TYR A 1 88  ? 0.907   -12.729 0.523   1.00 0.00 ? 88  TYR A CD2  1  
ATOM 1375  C CE1  . TYR A 1 88  ? -0.899  -13.427 2.488   1.00 0.00 ? 88  TYR A CE1  1  
ATOM 1376  C CE2  . TYR A 1 88  ? 1.231   -13.713 1.436   1.00 0.00 ? 88  TYR A CE2  1  
ATOM 1377  C CZ   . TYR A 1 88  ? 0.325   -14.059 2.417   1.00 0.00 ? 88  TYR A CZ   1  
ATOM 1378  O OH   . TYR A 1 88  ? 0.644   -15.038 3.329   1.00 0.00 ? 88  TYR A OH   1  
ATOM 1379  H H    . TYR A 1 88  ? -0.310  -11.458 -3.266  1.00 0.00 ? 88  TYR A H    1  
ATOM 1380  H HA   . TYR A 1 88  ? -2.217  -12.270 -1.189  1.00 0.00 ? 88  TYR A HA   1  
ATOM 1381  H HB2  . TYR A 1 88  ? 0.252   -10.625 -0.846  1.00 0.00 ? 88  TYR A HB2  1  
ATOM 1382  H HB3  . TYR A 1 88  ? -1.172  -10.206 0.100   1.00 0.00 ? 88  TYR A HB3  1  
ATOM 1383  H HD1  . TYR A 1 88  ? -2.173  -11.948 1.623   1.00 0.00 ? 88  TYR A HD1  1  
ATOM 1384  H HD2  . TYR A 1 88  ? 1.615   -12.455 -0.246  1.00 0.00 ? 88  TYR A HD2  1  
ATOM 1385  H HE1  . TYR A 1 88  ? -1.609  -13.698 3.256   1.00 0.00 ? 88  TYR A HE1  1  
ATOM 1386  H HE2  . TYR A 1 88  ? 2.190   -14.208 1.381   1.00 0.00 ? 88  TYR A HE2  1  
ATOM 1387  H HH   . TYR A 1 88  ? 0.167   -14.881 4.147   1.00 0.00 ? 88  TYR A HH   1  
ATOM 1388  N N    . GLU A 1 89  ? -3.742  -10.469 -1.905  1.00 0.00 ? 89  GLU A N    1  
ATOM 1389  C CA   . GLU A 1 89  ? -4.674  -9.440  -2.352  1.00 0.00 ? 89  GLU A CA   1  
ATOM 1390  C C    . GLU A 1 89  ? -4.869  -8.378  -1.274  1.00 0.00 ? 89  GLU A C    1  
ATOM 1391  O O    . GLU A 1 89  ? -5.210  -8.691  -0.133  1.00 0.00 ? 89  GLU A O    1  
ATOM 1392  C CB   . GLU A 1 89  ? -6.022  -10.066 -2.716  1.00 0.00 ? 89  GLU A CB   1  
ATOM 1393  C CG   . GLU A 1 89  ? -6.965  -9.110  -3.426  1.00 0.00 ? 89  GLU A CG   1  
ATOM 1394  C CD   . GLU A 1 89  ? -8.150  -9.818  -4.055  1.00 0.00 ? 89  GLU A CD   1  
ATOM 1395  O OE1  . GLU A 1 89  ? -8.863  -10.540 -3.327  1.00 0.00 ? 89  GLU A OE1  1  
ATOM 1396  O OE2  . GLU A 1 89  ? -8.364  -9.650  -5.274  1.00 0.00 ? 89  GLU A OE2  1  
ATOM 1397  H H    . GLU A 1 89  ? -4.090  -11.273 -1.467  1.00 0.00 ? 89  GLU A H    1  
ATOM 1398  H HA   . GLU A 1 89  ? -4.256  -8.972  -3.230  1.00 0.00 ? 89  GLU A HA   1  
ATOM 1399  H HB2  . GLU A 1 89  ? -5.849  -10.915 -3.361  1.00 0.00 ? 89  GLU A HB2  1  
ATOM 1400  H HB3  . GLU A 1 89  ? -6.503  -10.407 -1.811  1.00 0.00 ? 89  GLU A HB3  1  
ATOM 1401  H HG2  . GLU A 1 89  ? -7.334  -8.390  -2.711  1.00 0.00 ? 89  GLU A HG2  1  
ATOM 1402  H HG3  . GLU A 1 89  ? -6.418  -8.595  -4.203  1.00 0.00 ? 89  GLU A HG3  1  
ATOM 1403  N N    . ILE A 1 90  ? -4.649  -7.121  -1.644  1.00 0.00 ? 90  ILE A N    1  
ATOM 1404  C CA   . ILE A 1 90  ? -4.801  -6.012  -0.710  1.00 0.00 ? 90  ILE A CA   1  
ATOM 1405  C C    . ILE A 1 90  ? -5.566  -4.857  -1.348  1.00 0.00 ? 90  ILE A C    1  
ATOM 1406  O O    . ILE A 1 90  ? -5.450  -4.608  -2.548  1.00 0.00 ? 90  ILE A O    1  
ATOM 1407  C CB   . ILE A 1 90  ? -3.435  -5.499  -0.219  1.00 0.00 ? 90  ILE A CB   1  
ATOM 1408  C CG1  . ILE A 1 90  ? -2.514  -6.675  0.115   1.00 0.00 ? 90  ILE A CG1  1  
ATOM 1409  C CG2  . ILE A 1 90  ? -3.612  -4.598  0.994   1.00 0.00 ? 90  ILE A CG2  1  
ATOM 1410  C CD1  . ILE A 1 90  ? -1.043  -6.332  0.031   1.00 0.00 ? 90  ILE A CD1  1  
ATOM 1411  H H    . ILE A 1 90  ? -4.380  -6.935  -2.568  1.00 0.00 ? 90  ILE A H    1  
ATOM 1412  H HA   . ILE A 1 90  ? -5.357  -6.370  0.144   1.00 0.00 ? 90  ILE A HA   1  
ATOM 1413  H HB   . ILE A 1 90  ? -2.989  -4.915  -1.009  1.00 0.00 ? 90  ILE A HB   1  
ATOM 1414  H HG12 . ILE A 1 90  ? -2.719  -7.011  1.118   1.00 0.00 ? 90  ILE A HG12 1  
ATOM 1415  H HG13 . ILE A 1 90  ? -2.708  -7.481  -0.578  1.00 0.00 ? 90  ILE A HG13 1  
ATOM 1416  H HG21 . ILE A 1 90  ? -3.063  -5.006  1.829   1.00 0.00 ? 90  ILE A HG21 1  
ATOM 1417  H HG22 . ILE A 1 90  ? -3.239  -3.611  0.766   1.00 0.00 ? 90  ILE A HG22 1  
ATOM 1418  H HG23 . ILE A 1 90  ? -4.660  -4.537  1.247   1.00 0.00 ? 90  ILE A HG23 1  
ATOM 1419  H HD11 . ILE A 1 90  ? -0.804  -6.009  -0.971  1.00 0.00 ? 90  ILE A HD11 1  
ATOM 1420  H HD12 . ILE A 1 90  ? -0.817  -5.541  0.729   1.00 0.00 ? 90  ILE A HD12 1  
ATOM 1421  H HD13 . ILE A 1 90  ? -0.456  -7.206  0.276   1.00 0.00 ? 90  ILE A HD13 1  
ATOM 1422  N N    . LYS A 1 91  ? -6.348  -4.153  -0.536  1.00 0.00 ? 91  LYS A N    1  
ATOM 1423  C CA   . LYS A 1 91  ? -7.130  -3.021  -1.018  1.00 0.00 ? 91  LYS A CA   1  
ATOM 1424  C C    . LYS A 1 91  ? -7.228  -1.934  0.047   1.00 0.00 ? 91  LYS A C    1  
ATOM 1425  O O    . LYS A 1 91  ? -7.479  -2.219  1.218   1.00 0.00 ? 91  LYS A O    1  
ATOM 1426  C CB   . LYS A 1 91  ? -8.532  -3.480  -1.424  1.00 0.00 ? 91  LYS A CB   1  
ATOM 1427  C CG   . LYS A 1 91  ? -9.309  -4.135  -0.295  1.00 0.00 ? 91  LYS A CG   1  
ATOM 1428  C CD   . LYS A 1 91  ? -9.077  -5.636  -0.256  1.00 0.00 ? 91  LYS A CD   1  
ATOM 1429  C CE   . LYS A 1 91  ? -10.039 -6.324  0.701   1.00 0.00 ? 91  LYS A CE   1  
ATOM 1430  N NZ   . LYS A 1 91  ? -11.360 -6.589  0.065   1.00 0.00 ? 91  LYS A NZ   1  
ATOM 1431  H H    . LYS A 1 91  ? -6.399  -4.400  0.411   1.00 0.00 ? 91  LYS A H    1  
ATOM 1432  H HA   . LYS A 1 91  ? -6.629  -2.616  -1.884  1.00 0.00 ? 91  LYS A HA   1  
ATOM 1433  H HB2  . LYS A 1 91  ? -9.093  -2.624  -1.769  1.00 0.00 ? 91  LYS A HB2  1  
ATOM 1434  H HB3  . LYS A 1 91  ? -8.445  -4.192  -2.233  1.00 0.00 ? 91  LYS A HB3  1  
ATOM 1435  H HG2  . LYS A 1 91  ? -8.989  -3.708  0.644   1.00 0.00 ? 91  LYS A HG2  1  
ATOM 1436  H HG3  . LYS A 1 91  ? -10.363 -3.946  -0.438  1.00 0.00 ? 91  LYS A HG3  1  
ATOM 1437  H HD2  . LYS A 1 91  ? -9.223  -6.040  -1.247  1.00 0.00 ? 91  LYS A HD2  1  
ATOM 1438  H HD3  . LYS A 1 91  ? -8.064  -5.827  0.067   1.00 0.00 ? 91  LYS A HD3  1  
ATOM 1439  H HE2  . LYS A 1 91  ? -9.606  -7.261  1.014   1.00 0.00 ? 91  LYS A HE2  1  
ATOM 1440  H HE3  . LYS A 1 91  ? -10.185 -5.689  1.562   1.00 0.00 ? 91  LYS A HE3  1  
ATOM 1441  H HZ1  . LYS A 1 91  ? -12.036 -6.933  0.776   1.00 0.00 ? 91  LYS A HZ1  1  
ATOM 1442  H HZ2  . LYS A 1 91  ? -11.260 -7.308  -0.679  1.00 0.00 ? 91  LYS A HZ2  1  
ATOM 1443  H HZ3  . LYS A 1 91  ? -11.733 -5.716  -0.360  1.00 0.00 ? 91  LYS A HZ3  1  
ATOM 1444  N N    . VAL A 1 92  ? -7.030  -0.686  -0.367  1.00 0.00 ? 92  VAL A N    1  
ATOM 1445  C CA   . VAL A 1 92  ? -7.099  0.444   0.552   1.00 0.00 ? 92  VAL A CA   1  
ATOM 1446  C C    . VAL A 1 92  ? -8.485  1.078   0.541   1.00 0.00 ? 92  VAL A C    1  
ATOM 1447  O O    . VAL A 1 92  ? -9.060  1.319   -0.521  1.00 0.00 ? 92  VAL A O    1  
ATOM 1448  C CB   . VAL A 1 92  ? -6.052  1.518   0.200   1.00 0.00 ? 92  VAL A CB   1  
ATOM 1449  C CG1  . VAL A 1 92  ? -6.284  2.778   1.019   1.00 0.00 ? 92  VAL A CG1  1  
ATOM 1450  C CG2  . VAL A 1 92  ? -4.645  0.982   0.417   1.00 0.00 ? 92  VAL A CG2  1  
ATOM 1451  H H    . VAL A 1 92  ? -6.833  -0.522  -1.312  1.00 0.00 ? 92  VAL A H    1  
ATOM 1452  H HA   . VAL A 1 92  ? -6.888  0.079   1.547   1.00 0.00 ? 92  VAL A HA   1  
ATOM 1453  H HB   . VAL A 1 92  ? -6.162  1.769   -0.845  1.00 0.00 ? 92  VAL A HB   1  
ATOM 1454  H HG11 . VAL A 1 92  ? -5.633  3.563   0.663   1.00 0.00 ? 92  VAL A HG11 1  
ATOM 1455  H HG12 . VAL A 1 92  ? -7.313  3.088   0.920   1.00 0.00 ? 92  VAL A HG12 1  
ATOM 1456  H HG13 . VAL A 1 92  ? -6.067  2.576   2.058   1.00 0.00 ? 92  VAL A HG13 1  
ATOM 1457  H HG21 . VAL A 1 92  ? -4.618  -0.068  0.165   1.00 0.00 ? 92  VAL A HG21 1  
ATOM 1458  H HG22 . VAL A 1 92  ? -3.953  1.520   -0.214  1.00 0.00 ? 92  VAL A HG22 1  
ATOM 1459  H HG23 . VAL A 1 92  ? -4.365  1.112   1.451   1.00 0.00 ? 92  VAL A HG23 1  
ATOM 1460  N N    . ARG A 1 93  ? -9.017  1.345   1.729   1.00 0.00 ? 93  ARG A N    1  
ATOM 1461  C CA   . ARG A 1 93  ? -10.337 1.951   1.856   1.00 0.00 ? 93  ARG A CA   1  
ATOM 1462  C C    . ARG A 1 93  ? -10.428 2.797   3.122   1.00 0.00 ? 93  ARG A C    1  
ATOM 1463  O O    . ARG A 1 93  ? -10.013 2.384   4.205   1.00 0.00 ? 93  ARG A O    1  
ATOM 1464  C CB   . ARG A 1 93  ? -11.419 0.869   1.875   1.00 0.00 ? 93  ARG A CB   1  
ATOM 1465  C CG   . ARG A 1 93  ? -11.504 0.116   3.192   1.00 0.00 ? 93  ARG A CG   1  
ATOM 1466  C CD   . ARG A 1 93  ? -12.660 -0.873  3.195   1.00 0.00 ? 93  ARG A CD   1  
ATOM 1467  N NE   . ARG A 1 93  ? -12.301 -2.136  2.556   1.00 0.00 ? 93  ARG A NE   1  
ATOM 1468  C CZ   . ARG A 1 93  ? -13.167 -3.117  2.331   1.00 0.00 ? 93  ARG A CZ   1  
ATOM 1469  N NH1  . ARG A 1 93  ? -14.436 -2.982  2.691   1.00 0.00 ? 93  ARG A NH1  1  
ATOM 1470  N NH2  . ARG A 1 93  ? -12.765 -4.237  1.743   1.00 0.00 ? 93  ARG A NH2  1  
ATOM 1471  H H    . ARG A 1 93  ? -8.510  1.129   2.539   1.00 0.00 ? 93  ARG A H    1  
ATOM 1472  H HA   . ARG A 1 93  ? -10.494 2.588   0.999   1.00 0.00 ? 93  ARG A HA   1  
ATOM 1473  H HB2  . ARG A 1 93  ? -12.377 1.330   1.687   1.00 0.00 ? 93  ARG A HB2  1  
ATOM 1474  H HB3  . ARG A 1 93  ? -11.211 0.156   1.091   1.00 0.00 ? 93  ARG A HB3  1  
ATOM 1475  H HG2  . ARG A 1 93  ? -10.582 -0.425  3.348   1.00 0.00 ? 93  ARG A HG2  1  
ATOM 1476  H HG3  . ARG A 1 93  ? -11.647 0.826   3.993   1.00 0.00 ? 93  ARG A HG3  1  
ATOM 1477  H HD2  . ARG A 1 93  ? -12.947 -1.067  4.218   1.00 0.00 ? 93  ARG A HD2  1  
ATOM 1478  H HD3  . ARG A 1 93  ? -13.492 -0.434  2.665   1.00 0.00 ? 93  ARG A HD3  1  
ATOM 1479  H HE   . ARG A 1 93  ? -11.369 -2.257  2.281   1.00 0.00 ? 93  ARG A HE   1  
ATOM 1480  H HH11 . ARG A 1 93  ? -14.742 -2.139  3.133   1.00 0.00 ? 93  ARG A HH11 1  
ATOM 1481  H HH12 . ARG A 1 93  ? -15.087 -3.722  2.519   1.00 0.00 ? 93  ARG A HH12 1  
ATOM 1482  H HH21 . ARG A 1 93  ? -11.809 -4.343  1.470   1.00 0.00 ? 93  ARG A HH21 1  
ATOM 1483  H HH22 . ARG A 1 93  ? -13.417 -4.975  1.574   1.00 0.00 ? 93  ARG A HH22 1  
ATOM 1484  N N    . PRO A 1 94  ? -10.982 4.011   2.985   1.00 0.00 ? 94  PRO A N    1  
ATOM 1485  C CA   . PRO A 1 94  ? -11.140 4.940   4.107   1.00 0.00 ? 94  PRO A CA   1  
ATOM 1486  C C    . PRO A 1 94  ? -12.187 4.467   5.109   1.00 0.00 ? 94  PRO A C    1  
ATOM 1487  O O    . PRO A 1 94  ? -12.963 3.554   4.826   1.00 0.00 ? 94  PRO A O    1  
ATOM 1488  C CB   . PRO A 1 94  ? -11.593 6.237   3.432   1.00 0.00 ? 94  PRO A CB   1  
ATOM 1489  C CG   . PRO A 1 94  ? -12.242 5.798   2.165   1.00 0.00 ? 94  PRO A CG   1  
ATOM 1490  C CD   . PRO A 1 94  ? -11.498 4.568   1.724   1.00 0.00 ? 94  PRO A CD   1  
ATOM 1491  H HA   . PRO A 1 94  ? -10.203 5.107   4.619   1.00 0.00 ? 94  PRO A HA   1  
ATOM 1492  H HB2  . PRO A 1 94  ? -12.290 6.756   4.075   1.00 0.00 ? 94  PRO A HB2  1  
ATOM 1493  H HB3  . PRO A 1 94  ? -10.736 6.866   3.240   1.00 0.00 ? 94  PRO A HB3  1  
ATOM 1494  H HG2  . PRO A 1 94  ? -13.280 5.564   2.346   1.00 0.00 ? 94  PRO A HG2  1  
ATOM 1495  H HG3  . PRO A 1 94  ? -12.155 6.576   1.420   1.00 0.00 ? 94  PRO A HG3  1  
ATOM 1496  H HD2  . PRO A 1 94  ? -12.170 3.874   1.241   1.00 0.00 ? 94  PRO A HD2  1  
ATOM 1497  H HD3  . PRO A 1 94  ? -10.688 4.835   1.061   1.00 0.00 ? 94  PRO A HD3  1  
ATOM 1498  N N    . TYR A 1 95  ? -12.204 5.094   6.280   1.00 0.00 ? 95  TYR A N    1  
ATOM 1499  C CA   . TYR A 1 95  ? -13.156 4.736   7.325   1.00 0.00 ? 95  TYR A CA   1  
ATOM 1500  C C    . TYR A 1 95  ? -13.109 5.740   8.472   1.00 0.00 ? 95  TYR A C    1  
ATOM 1501  O O    . TYR A 1 95  ? -12.038 6.198   8.869   1.00 0.00 ? 95  TYR A O    1  
ATOM 1502  C CB   . TYR A 1 95  ? -12.862 3.330   7.851   1.00 0.00 ? 95  TYR A CB   1  
ATOM 1503  C CG   . TYR A 1 95  ? -11.833 3.301   8.959   1.00 0.00 ? 95  TYR A CG   1  
ATOM 1504  C CD1  . TYR A 1 95  ? -12.165 3.689   10.252  1.00 0.00 ? 95  TYR A CD1  1  
ATOM 1505  C CD2  . TYR A 1 95  ? -10.530 2.886   8.714   1.00 0.00 ? 95  TYR A CD2  1  
ATOM 1506  C CE1  . TYR A 1 95  ? -11.228 3.665   11.267  1.00 0.00 ? 95  TYR A CE1  1  
ATOM 1507  C CE2  . TYR A 1 95  ? -9.588  2.858   9.723   1.00 0.00 ? 95  TYR A CE2  1  
ATOM 1508  C CZ   . TYR A 1 95  ? -9.941  3.248   10.998  1.00 0.00 ? 95  TYR A CZ   1  
ATOM 1509  O OH   . TYR A 1 95  ? -9.005  3.222   12.006  1.00 0.00 ? 95  TYR A OH   1  
ATOM 1510  H H    . TYR A 1 95  ? -11.561 5.814   6.447   1.00 0.00 ? 95  TYR A H    1  
ATOM 1511  H HA   . TYR A 1 95  ? -14.145 4.747   6.891   1.00 0.00 ? 95  TYR A HA   1  
ATOM 1512  H HB2  . TYR A 1 95  ? -13.773 2.898   8.235   1.00 0.00 ? 95  TYR A HB2  1  
ATOM 1513  H HB3  . TYR A 1 95  ? -12.493 2.719   7.040   1.00 0.00 ? 95  TYR A HB3  1  
ATOM 1514  H HD1  . TYR A 1 95  ? -13.174 4.015   10.459  1.00 0.00 ? 95  TYR A HD1  1  
ATOM 1515  H HD2  . TYR A 1 95  ? -10.256 2.581   7.714   1.00 0.00 ? 95  TYR A HD2  1  
ATOM 1516  H HE1  . TYR A 1 95  ? -11.505 3.971   12.266  1.00 0.00 ? 95  TYR A HE1  1  
ATOM 1517  H HE2  . TYR A 1 95  ? -8.580  2.532   9.513   1.00 0.00 ? 95  TYR A HE2  1  
ATOM 1518  H HH   . TYR A 1 95  ? -8.768  4.121   12.245  1.00 0.00 ? 95  TYR A HH   1  
ATOM 1519  N N    . PHE A 1 96  ? -14.280 6.078   9.002   1.00 0.00 ? 96  PHE A N    1  
ATOM 1520  C CA   . PHE A 1 96  ? -14.375 7.029   10.104  1.00 0.00 ? 96  PHE A CA   1  
ATOM 1521  C C    . PHE A 1 96  ? -14.464 6.303   11.443  1.00 0.00 ? 96  PHE A C    1  
ATOM 1522  O O    . PHE A 1 96  ? -13.495 6.252   12.199  1.00 0.00 ? 96  PHE A O    1  
ATOM 1523  C CB   . PHE A 1 96  ? -15.595 7.935   9.920   1.00 0.00 ? 96  PHE A CB   1  
ATOM 1524  C CG   . PHE A 1 96  ? -15.732 8.979   10.990  1.00 0.00 ? 96  PHE A CG   1  
ATOM 1525  C CD1  . PHE A 1 96  ? -14.646 9.755   11.363  1.00 0.00 ? 96  PHE A CD1  1  
ATOM 1526  C CD2  . PHE A 1 96  ? -16.947 9.185   11.624  1.00 0.00 ? 96  PHE A CD2  1  
ATOM 1527  C CE1  . PHE A 1 96  ? -14.769 10.718  12.347  1.00 0.00 ? 96  PHE A CE1  1  
ATOM 1528  C CE2  . PHE A 1 96  ? -17.076 10.147  12.609  1.00 0.00 ? 96  PHE A CE2  1  
ATOM 1529  C CZ   . PHE A 1 96  ? -15.986 10.913  12.972  1.00 0.00 ? 96  PHE A CZ   1  
ATOM 1530  H H    . PHE A 1 96  ? -15.101 5.679   8.642   1.00 0.00 ? 96  PHE A H    1  
ATOM 1531  H HA   . PHE A 1 96  ? -13.483 7.635   10.095  1.00 0.00 ? 96  PHE A HA   1  
ATOM 1532  H HB2  . PHE A 1 96  ? -15.518 8.442   8.970   1.00 0.00 ? 96  PHE A HB2  1  
ATOM 1533  H HB3  . PHE A 1 96  ? -16.489 7.329   9.929   1.00 0.00 ? 96  PHE A HB3  1  
ATOM 1534  H HD1  . PHE A 1 96  ? -13.694 9.603   10.875  1.00 0.00 ? 96  PHE A HD1  1  
ATOM 1535  H HD2  . PHE A 1 96  ? -17.800 8.586   11.343  1.00 0.00 ? 96  PHE A HD2  1  
ATOM 1536  H HE1  . PHE A 1 96  ? -13.915 11.315  12.628  1.00 0.00 ? 96  PHE A HE1  1  
ATOM 1537  H HE2  . PHE A 1 96  ? -18.028 10.297  13.096  1.00 0.00 ? 96  PHE A HE2  1  
ATOM 1538  H HZ   . PHE A 1 96  ? -16.084 11.665  13.740  1.00 0.00 ? 96  PHE A HZ   1  
ATOM 1539  N N    . ASN A 1 97  ? -15.635 5.742   11.728  1.00 0.00 ? 97  ASN A N    1  
ATOM 1540  C CA   . ASN A 1 97  ? -15.852 5.019   12.976  1.00 0.00 ? 97  ASN A CA   1  
ATOM 1541  C C    . ASN A 1 97  ? -15.940 3.517   12.726  1.00 0.00 ? 97  ASN A C    1  
ATOM 1542  O O    . ASN A 1 97  ? -15.018 2.769   13.052  1.00 0.00 ? 97  ASN A O    1  
ATOM 1543  C CB   . ASN A 1 97  ? -17.130 5.510   13.658  1.00 0.00 ? 97  ASN A CB   1  
ATOM 1544  C CG   . ASN A 1 97  ? -16.992 6.919   14.201  1.00 0.00 ? 97  ASN A CG   1  
ATOM 1545  O OD1  . ASN A 1 97  ? -17.833 7.780   13.945  1.00 0.00 ? 97  ASN A OD1  1  
ATOM 1546  N ND2  . ASN A 1 97  ? -15.926 7.160   14.956  1.00 0.00 ? 97  ASN A ND2  1  
ATOM 1547  H H    . ASN A 1 97  ? -16.371 5.816   11.085  1.00 0.00 ? 97  ASN A H    1  
ATOM 1548  H HA   . ASN A 1 97  ? -15.011 5.216   13.624  1.00 0.00 ? 97  ASN A HA   1  
ATOM 1549  H HB2  . ASN A 1 97  ? -17.940 5.498   12.943  1.00 0.00 ? 97  ASN A HB2  1  
ATOM 1550  H HB3  . ASN A 1 97  ? -17.370 4.849   14.478  1.00 0.00 ? 97  ASN A HB3  1  
ATOM 1551  H HD21 . ASN A 1 97  ? -15.298 6.426   15.118  1.00 0.00 ? 97  ASN A HD21 1  
ATOM 1552  H HD22 . ASN A 1 97  ? -15.812 8.062   15.320  1.00 0.00 ? 97  ASN A HD22 1  
ATOM 1553  N N    . GLU A 1 98  ? -17.054 3.083   12.146  1.00 0.00 ? 98  GLU A N    1  
ATOM 1554  C CA   . GLU A 1 98  ? -17.262 1.670   11.853  1.00 0.00 ? 98  GLU A CA   1  
ATOM 1555  C C    . GLU A 1 98  ? -17.311 1.428   10.347  1.00 0.00 ? 98  GLU A C    1  
ATOM 1556  O O    . GLU A 1 98  ? -16.660 0.518   9.831   1.00 0.00 ? 98  GLU A O    1  
ATOM 1557  C CB   . GLU A 1 98  ? -18.557 1.176   12.502  1.00 0.00 ? 98  GLU A CB   1  
ATOM 1558  C CG   . GLU A 1 98  ? -19.216 0.032   11.751  1.00 0.00 ? 98  GLU A CG   1  
ATOM 1559  C CD   . GLU A 1 98  ? -18.410 -1.251  11.816  1.00 0.00 ? 98  GLU A CD   1  
ATOM 1560  O OE1  . GLU A 1 98  ? -17.903 -1.578  12.909  1.00 0.00 ? 98  GLU A OE1  1  
ATOM 1561  O OE2  . GLU A 1 98  ? -18.287 -1.927  10.774  1.00 0.00 ? 98  GLU A OE2  1  
ATOM 1562  H H    . GLU A 1 98  ? -17.753 3.728   11.910  1.00 0.00 ? 98  GLU A H    1  
ATOM 1563  H HA   . GLU A 1 98  ? -16.430 1.119   12.267  1.00 0.00 ? 98  GLU A HA   1  
ATOM 1564  H HB2  . GLU A 1 98  ? -18.338 0.842   13.505  1.00 0.00 ? 98  GLU A HB2  1  
ATOM 1565  H HB3  . GLU A 1 98  ? -19.256 1.998   12.550  1.00 0.00 ? 98  GLU A HB3  1  
ATOM 1566  H HG2  . GLU A 1 98  ? -20.190 -0.150  12.181  1.00 0.00 ? 98  GLU A HG2  1  
ATOM 1567  H HG3  . GLU A 1 98  ? -19.330 0.316   10.715  1.00 0.00 ? 98  GLU A HG3  1  
ATOM 1568  N N    . PHE A 1 99  ? -18.087 2.248   9.647   1.00 0.00 ? 99  PHE A N    1  
ATOM 1569  C CA   . PHE A 1 99  ? -18.223 2.123   8.200   1.00 0.00 ? 99  PHE A CA   1  
ATOM 1570  C C    . PHE A 1 99  ? -16.893 2.397   7.503   1.00 0.00 ? 99  PHE A C    1  
ATOM 1571  O O    . PHE A 1 99  ? -15.960 2.923   8.110   1.00 0.00 ? 99  PHE A O    1  
ATOM 1572  C CB   . PHE A 1 99  ? -19.291 3.089   7.682   1.00 0.00 ? 99  PHE A CB   1  
ATOM 1573  C CG   . PHE A 1 99  ? -19.219 4.453   8.306   1.00 0.00 ? 99  PHE A CG   1  
ATOM 1574  C CD1  . PHE A 1 99  ? -19.786 4.693   9.547   1.00 0.00 ? 99  PHE A CD1  1  
ATOM 1575  C CD2  . PHE A 1 99  ? -18.585 5.496   7.650   1.00 0.00 ? 99  PHE A CD2  1  
ATOM 1576  C CE1  . PHE A 1 99  ? -19.722 5.947   10.124  1.00 0.00 ? 99  PHE A CE1  1  
ATOM 1577  C CE2  . PHE A 1 99  ? -18.517 6.753   8.223   1.00 0.00 ? 99  PHE A CE2  1  
ATOM 1578  C CZ   . PHE A 1 99  ? -19.087 6.979   9.460   1.00 0.00 ? 99  PHE A CZ   1  
ATOM 1579  H H    . PHE A 1 99  ? -18.581 2.954   10.114  1.00 0.00 ? 99  PHE A H    1  
ATOM 1580  H HA   . PHE A 1 99  ? -18.528 1.112   7.983   1.00 0.00 ? 99  PHE A HA   1  
ATOM 1581  H HB2  . PHE A 1 99  ? -19.173 3.206   6.615   1.00 0.00 ? 99  PHE A HB2  1  
ATOM 1582  H HB3  . PHE A 1 99  ? -20.267 2.678   7.889   1.00 0.00 ? 99  PHE A HB3  1  
ATOM 1583  H HD1  . PHE A 1 99  ? -20.284 3.886   10.067  1.00 0.00 ? 99  PHE A HD1  1  
ATOM 1584  H HD2  . PHE A 1 99  ? -18.139 5.322   6.682   1.00 0.00 ? 99  PHE A HD2  1  
ATOM 1585  H HE1  . PHE A 1 99  ? -20.169 6.120   11.091  1.00 0.00 ? 99  PHE A HE1  1  
ATOM 1586  H HE2  . PHE A 1 99  ? -18.020 7.558   7.702   1.00 0.00 ? 99  PHE A HE2  1  
ATOM 1587  H HZ   . PHE A 1 99  ? -19.035 7.959   9.909   1.00 0.00 ? 99  PHE A HZ   1  
ATOM 1588  N N    . GLN A 1 100 ? -16.815 2.035   6.227   1.00 0.00 ? 100 GLN A N    1  
ATOM 1589  C CA   . GLN A 1 100 ? -15.600 2.239   5.448   1.00 0.00 ? 100 GLN A CA   1  
ATOM 1590  C C    . GLN A 1 100 ? -15.932 2.563   3.995   1.00 0.00 ? 100 GLN A C    1  
ATOM 1591  O O    . GLN A 1 100 ? -16.559 1.766   3.299   1.00 0.00 ? 100 GLN A O    1  
ATOM 1592  C CB   . GLN A 1 100 ? -14.710 0.997   5.515   1.00 0.00 ? 100 GLN A CB   1  
ATOM 1593  C CG   . GLN A 1 100 ? -15.397 -0.270  5.033   1.00 0.00 ? 100 GLN A CG   1  
ATOM 1594  C CD   . GLN A 1 100 ? -16.668 -0.574  5.801   1.00 0.00 ? 100 GLN A CD   1  
ATOM 1595  O OE1  . GLN A 1 100 ? -17.764 -0.198  5.384   1.00 0.00 ? 100 GLN A OE1  1  
ATOM 1596  N NE2  . GLN A 1 100 ? -16.529 -1.258  6.931   1.00 0.00 ? 100 GLN A NE2  1  
ATOM 1597  H H    . GLN A 1 100 ? -17.593 1.620   5.799   1.00 0.00 ? 100 GLN A H    1  
ATOM 1598  H HA   . GLN A 1 100 ? -15.068 3.075   5.877   1.00 0.00 ? 100 GLN A HA   1  
ATOM 1599  H HB2  . GLN A 1 100 ? -13.835 1.161   4.905   1.00 0.00 ? 100 GLN A HB2  1  
ATOM 1600  H HB3  . GLN A 1 100 ? -14.401 0.845   6.539   1.00 0.00 ? 100 GLN A HB3  1  
ATOM 1601  H HG2  . GLN A 1 100 ? -15.646 -0.154  3.988   1.00 0.00 ? 100 GLN A HG2  1  
ATOM 1602  H HG3  . GLN A 1 100 ? -14.716 -1.100  5.149   1.00 0.00 ? 100 GLN A HG3  1  
ATOM 1603  H HE21 . GLN A 1 100 ? -15.624 -1.523  7.201   1.00 0.00 ? 100 GLN A HE21 1  
ATOM 1604  H HE22 . GLN A 1 100 ? -17.333 -1.467  7.447   1.00 0.00 ? 100 GLN A HE22 1  
ATOM 1605  N N    . GLY A 1 101 ? -15.507 3.739   3.544   1.00 0.00 ? 101 GLY A N    1  
ATOM 1606  C CA   . GLY A 1 101 ? -15.770 4.148   2.176   1.00 0.00 ? 101 GLY A CA   1  
ATOM 1607  C C    . GLY A 1 101 ? -15.485 3.044   1.177   1.00 0.00 ? 101 GLY A C    1  
ATOM 1608  O O    . GLY A 1 101 ? -14.954 1.994   1.536   1.00 0.00 ? 101 GLY A O    1  
ATOM 1609  H H    . GLY A 1 101 ? -15.011 4.335   4.144   1.00 0.00 ? 101 GLY A H    1  
ATOM 1610  H HA2  . GLY A 1 101 ? -16.806 4.438   2.091   1.00 0.00 ? 101 GLY A HA2  1  
ATOM 1611  H HA3  . GLY A 1 101 ? -15.147 4.999   1.941   1.00 0.00 ? 101 GLY A HA3  1  
ATOM 1612  N N    . MET A 1 102 ? -15.842 3.281   -0.081  1.00 0.00 ? 102 MET A N    1  
ATOM 1613  C CA   . MET A 1 102 ? -15.622 2.298   -1.136  1.00 0.00 ? 102 MET A CA   1  
ATOM 1614  C C    . MET A 1 102 ? -14.170 1.831   -1.150  1.00 0.00 ? 102 MET A C    1  
ATOM 1615  O O    . MET A 1 102 ? -13.251 2.625   -0.945  1.00 0.00 ? 102 MET A O    1  
ATOM 1616  C CB   . MET A 1 102 ? -15.994 2.888   -2.498  1.00 0.00 ? 102 MET A CB   1  
ATOM 1617  C CG   . MET A 1 102 ? -17.488 3.096   -2.683  1.00 0.00 ? 102 MET A CG   1  
ATOM 1618  S SD   . MET A 1 102 ? -17.866 4.479   -3.777  1.00 0.00 ? 102 MET A SD   1  
ATOM 1619  C CE   . MET A 1 102 ? -16.856 4.071   -5.199  1.00 0.00 ? 102 MET A CE   1  
ATOM 1620  H H    . MET A 1 102 ? -16.262 4.138   -0.307  1.00 0.00 ? 102 MET A H    1  
ATOM 1621  H HA   . MET A 1 102 ? -16.259 1.450   -0.935  1.00 0.00 ? 102 MET A HA   1  
ATOM 1622  H HB2  . MET A 1 102 ? -15.502 3.842   -2.610  1.00 0.00 ? 102 MET A HB2  1  
ATOM 1623  H HB3  . MET A 1 102 ? -15.647 2.220   -3.273  1.00 0.00 ? 102 MET A HB3  1  
ATOM 1624  H HG2  . MET A 1 102 ? -17.915 2.197   -3.102  1.00 0.00 ? 102 MET A HG2  1  
ATOM 1625  H HG3  . MET A 1 102 ? -17.933 3.287   -1.717  1.00 0.00 ? 102 MET A HG3  1  
ATOM 1626  H HE1  . MET A 1 102 ? -17.368 4.369   -6.101  1.00 0.00 ? 102 MET A HE1  1  
ATOM 1627  H HE2  . MET A 1 102 ? -15.913 4.592   -5.131  1.00 0.00 ? 102 MET A HE2  1  
ATOM 1628  H HE3  . MET A 1 102 ? -16.679 3.006   -5.220  1.00 0.00 ? 102 MET A HE3  1  
ATOM 1629  N N    . ASP A 1 103 ? -13.971 0.540   -1.391  1.00 0.00 ? 103 ASP A N    1  
ATOM 1630  C CA   . ASP A 1 103 ? -12.630 -0.032  -1.433  1.00 0.00 ? 103 ASP A CA   1  
ATOM 1631  C C    . ASP A 1 103 ? -11.999 0.162   -2.808  1.00 0.00 ? 103 ASP A C    1  
ATOM 1632  O O    . ASP A 1 103 ? -12.688 0.133   -3.828  1.00 0.00 ? 103 ASP A O    1  
ATOM 1633  C CB   . ASP A 1 103 ? -12.677 -1.520  -1.084  1.00 0.00 ? 103 ASP A CB   1  
ATOM 1634  C CG   . ASP A 1 103 ? -13.649 -2.289  -1.957  1.00 0.00 ? 103 ASP A CG   1  
ATOM 1635  O OD1  . ASP A 1 103 ? -13.242 -2.730  -3.053  1.00 0.00 ? 103 ASP A OD1  1  
ATOM 1636  O OD2  . ASP A 1 103 ? -14.816 -2.452  -1.544  1.00 0.00 ? 103 ASP A OD2  1  
ATOM 1637  H H    . ASP A 1 103 ? -14.744 -0.042  -1.547  1.00 0.00 ? 103 ASP A H    1  
ATOM 1638  H HA   . ASP A 1 103 ? -12.028 0.482   -0.698  1.00 0.00 ? 103 ASP A HA   1  
ATOM 1639  H HB2  . ASP A 1 103 ? -11.692 -1.945  -1.214  1.00 0.00 ? 103 ASP A HB2  1  
ATOM 1640  H HB3  . ASP A 1 103 ? -12.979 -1.633  -0.053  1.00 0.00 ? 103 ASP A HB3  1  
ATOM 1641  N N    . SER A 1 104 ? -10.684 0.359   -2.827  1.00 0.00 ? 104 SER A N    1  
ATOM 1642  C CA   . SER A 1 104 ? -9.961  0.562   -4.077  1.00 0.00 ? 104 SER A CA   1  
ATOM 1643  C C    . SER A 1 104 ? -9.791  -0.755  -4.827  1.00 0.00 ? 104 SER A C    1  
ATOM 1644  O O    . SER A 1 104 ? -10.043 -1.829  -4.281  1.00 0.00 ? 104 SER A O    1  
ATOM 1645  C CB   . SER A 1 104 ? -8.591  1.185   -3.802  1.00 0.00 ? 104 SER A CB   1  
ATOM 1646  O OG   . SER A 1 104 ? -7.705  0.237   -3.231  1.00 0.00 ? 104 SER A OG   1  
ATOM 1647  H H    . SER A 1 104 ? -10.190 0.371   -1.981  1.00 0.00 ? 104 SER A H    1  
ATOM 1648  H HA   . SER A 1 104 ? -10.538 1.240   -4.688  1.00 0.00 ? 104 SER A HA   1  
ATOM 1649  H HB2  . SER A 1 104 ? -8.168  1.543   -4.728  1.00 0.00 ? 104 SER A HB2  1  
ATOM 1650  H HB3  . SER A 1 104 ? -8.705  2.012   -3.116  1.00 0.00 ? 104 SER A HB3  1  
ATOM 1651  H HG   . SER A 1 104 ? -7.301  -0.284  -3.928  1.00 0.00 ? 104 SER A HG   1  
ATOM 1652  N N    . GLU A 1 105 ? -9.363  -0.664  -6.082  1.00 0.00 ? 105 GLU A N    1  
ATOM 1653  C CA   . GLU A 1 105 ? -9.161  -1.848  -6.908  1.00 0.00 ? 105 GLU A CA   1  
ATOM 1654  C C    . GLU A 1 105 ? -8.155  -2.797  -6.262  1.00 0.00 ? 105 GLU A C    1  
ATOM 1655  O O    . GLU A 1 105 ? -6.947  -2.572  -6.322  1.00 0.00 ? 105 GLU A O    1  
ATOM 1656  C CB   . GLU A 1 105 ? -8.678  -1.448  -8.304  1.00 0.00 ? 105 GLU A CB   1  
ATOM 1657  C CG   . GLU A 1 105 ? -9.679  -0.606  -9.077  1.00 0.00 ? 105 GLU A CG   1  
ATOM 1658  C CD   . GLU A 1 105 ? -9.198  -0.263  -10.473 1.00 0.00 ? 105 GLU A CD   1  
ATOM 1659  O OE1  . GLU A 1 105 ? -9.387  -1.092  -11.387 1.00 0.00 ? 105 GLU A OE1  1  
ATOM 1660  O OE2  . GLU A 1 105 ? -8.633  0.837   -10.651 1.00 0.00 ? 105 GLU A OE2  1  
ATOM 1661  H H    . GLU A 1 105 ? -9.179  0.221   -6.462  1.00 0.00 ? 105 GLU A H    1  
ATOM 1662  H HA   . GLU A 1 105 ? -10.110 -2.356  -6.998  1.00 0.00 ? 105 GLU A HA   1  
ATOM 1663  H HB2  . GLU A 1 105 ? -7.763  -0.883  -8.206  1.00 0.00 ? 105 GLU A HB2  1  
ATOM 1664  H HB3  . GLU A 1 105 ? -8.478  -2.344  -8.873  1.00 0.00 ? 105 GLU A HB3  1  
ATOM 1665  H HG2  . GLU A 1 105 ? -10.605 -1.155  -9.157  1.00 0.00 ? 105 GLU A HG2  1  
ATOM 1666  H HG3  . GLU A 1 105 ? -9.852  0.312   -8.535  1.00 0.00 ? 105 GLU A HG3  1  
ATOM 1667  N N    . SER A 1 106 ? -8.664  -3.858  -5.644  1.00 0.00 ? 106 SER A N    1  
ATOM 1668  C CA   . SER A 1 106 ? -7.811  -4.839  -4.983  1.00 0.00 ? 106 SER A CA   1  
ATOM 1669  C C    . SER A 1 106 ? -6.649  -5.243  -5.884  1.00 0.00 ? 106 SER A C    1  
ATOM 1670  O O    . SER A 1 106 ? -6.849  -5.718  -7.002  1.00 0.00 ? 106 SER A O    1  
ATOM 1671  C CB   . SER A 1 106 ? -8.626  -6.075  -4.596  1.00 0.00 ? 106 SER A CB   1  
ATOM 1672  O OG   . SER A 1 106 ? -9.354  -6.574  -5.705  1.00 0.00 ? 106 SER A OG   1  
ATOM 1673  H H    . SER A 1 106 ? -9.636  -3.983  -5.631  1.00 0.00 ? 106 SER A H    1  
ATOM 1674  H HA   . SER A 1 106 ? -7.416  -4.384  -4.087  1.00 0.00 ? 106 SER A HA   1  
ATOM 1675  H HB2  . SER A 1 106 ? -7.958  -6.847  -4.243  1.00 0.00 ? 106 SER A HB2  1  
ATOM 1676  H HB3  . SER A 1 106 ? -9.321  -5.814  -3.812  1.00 0.00 ? 106 SER A HB3  1  
ATOM 1677  H HG   . SER A 1 106 ? -9.054  -6.139  -6.507  1.00 0.00 ? 106 SER A HG   1  
ATOM 1678  N N    . LYS A 1 107 ? -5.431  -5.052  -5.389  1.00 0.00 ? 107 LYS A N    1  
ATOM 1679  C CA   . LYS A 1 107 ? -4.233  -5.397  -6.146  1.00 0.00 ? 107 LYS A CA   1  
ATOM 1680  C C    . LYS A 1 107 ? -3.539  -6.613  -5.542  1.00 0.00 ? 107 LYS A C    1  
ATOM 1681  O O    . LYS A 1 107 ? -3.342  -6.690  -4.329  1.00 0.00 ? 107 LYS A O    1  
ATOM 1682  C CB   . LYS A 1 107 ? -3.268  -4.210  -6.181  1.00 0.00 ? 107 LYS A CB   1  
ATOM 1683  C CG   . LYS A 1 107 ? -3.687  -3.113  -7.144  1.00 0.00 ? 107 LYS A CG   1  
ATOM 1684  C CD   . LYS A 1 107 ? -3.366  -3.481  -8.583  1.00 0.00 ? 107 LYS A CD   1  
ATOM 1685  C CE   . LYS A 1 107 ? -3.516  -2.285  -9.511  1.00 0.00 ? 107 LYS A CE   1  
ATOM 1686  N NZ   . LYS A 1 107 ? -2.955  -2.558  -10.863 1.00 0.00 ? 107 LYS A NZ   1  
ATOM 1687  H H    . LYS A 1 107 ? -5.334  -4.670  -4.491  1.00 0.00 ? 107 LYS A H    1  
ATOM 1688  H HA   . LYS A 1 107 ? -4.536  -5.634  -7.155  1.00 0.00 ? 107 LYS A HA   1  
ATOM 1689  H HB2  . LYS A 1 107 ? -3.202  -3.785  -5.190  1.00 0.00 ? 107 LYS A HB2  1  
ATOM 1690  H HB3  . LYS A 1 107 ? -2.291  -4.565  -6.477  1.00 0.00 ? 107 LYS A HB3  1  
ATOM 1691  H HG2  . LYS A 1 107 ? -4.751  -2.954  -7.053  1.00 0.00 ? 107 LYS A HG2  1  
ATOM 1692  H HG3  . LYS A 1 107 ? -3.162  -2.203  -6.889  1.00 0.00 ? 107 LYS A HG3  1  
ATOM 1693  H HD2  . LYS A 1 107 ? -2.348  -3.837  -8.636  1.00 0.00 ? 107 LYS A HD2  1  
ATOM 1694  H HD3  . LYS A 1 107 ? -4.040  -4.262  -8.904  1.00 0.00 ? 107 LYS A HD3  1  
ATOM 1695  H HE2  . LYS A 1 107 ? -4.565  -2.050  -9.606  1.00 0.00 ? 107 LYS A HE2  1  
ATOM 1696  H HE3  . LYS A 1 107 ? -2.997  -1.443  -9.078  1.00 0.00 ? 107 LYS A HE3  1  
ATOM 1697  H HZ1  . LYS A 1 107 ? -2.820  -3.581  -10.993 1.00 0.00 ? 107 LYS A HZ1  1  
ATOM 1698  H HZ2  . LYS A 1 107 ? -2.037  -2.082  -10.971 1.00 0.00 ? 107 LYS A HZ2  1  
ATOM 1699  H HZ3  . LYS A 1 107 ? -3.604  -2.208  -11.596 1.00 0.00 ? 107 LYS A HZ3  1  
ATOM 1700  N N    . THR A 1 108 ? -3.168  -7.562  -6.396  1.00 0.00 ? 108 THR A N    1  
ATOM 1701  C CA   . THR A 1 108 ? -2.495  -8.774  -5.947  1.00 0.00 ? 108 THR A CA   1  
ATOM 1702  C C    . THR A 1 108 ? -0.980  -8.607  -5.979  1.00 0.00 ? 108 THR A C    1  
ATOM 1703  O O    . THR A 1 108 ? -0.407  -8.245  -7.006  1.00 0.00 ? 108 THR A O    1  
ATOM 1704  C CB   . THR A 1 108 ? -2.884  -9.987  -6.813  1.00 0.00 ? 108 THR A CB   1  
ATOM 1705  O OG1  . THR A 1 108 ? -2.985  -9.596  -8.187  1.00 0.00 ? 108 THR A OG1  1  
ATOM 1706  C CG2  . THR A 1 108 ? -4.207  -10.580 -6.351  1.00 0.00 ? 108 THR A CG2  1  
ATOM 1707  H H    . THR A 1 108 ? -3.352  -7.443  -7.351  1.00 0.00 ? 108 THR A H    1  
ATOM 1708  H HA   . THR A 1 108 ? -2.804  -8.970  -4.930  1.00 0.00 ? 108 THR A HA   1  
ATOM 1709  H HB   . THR A 1 108 ? -2.116  -10.741 -6.716  1.00 0.00 ? 108 THR A HB   1  
ATOM 1710  H HG1  . THR A 1 108 ? -3.810  -9.125  -8.326  1.00 0.00 ? 108 THR A HG1  1  
ATOM 1711  H HG21 . THR A 1 108 ? -4.035  -11.557 -5.926  1.00 0.00 ? 108 THR A HG21 1  
ATOM 1712  H HG22 . THR A 1 108 ? -4.876  -10.666 -7.194  1.00 0.00 ? 108 THR A HG22 1  
ATOM 1713  H HG23 . THR A 1 108 ? -4.648  -9.936  -5.605  1.00 0.00 ? 108 THR A HG23 1  
ATOM 1714  N N    . VAL A 1 109 ? -0.336  -8.872  -4.847  1.00 0.00 ? 109 VAL A N    1  
ATOM 1715  C CA   . VAL A 1 109 ? 1.114   -8.752  -4.746  1.00 0.00 ? 109 VAL A CA   1  
ATOM 1716  C C    . VAL A 1 109 ? 1.773   -10.123 -4.645  1.00 0.00 ? 109 VAL A C    1  
ATOM 1717  O O    . VAL A 1 109 ? 1.403   -10.941 -3.802  1.00 0.00 ? 109 VAL A O    1  
ATOM 1718  C CB   . VAL A 1 109 ? 1.524   -7.907  -3.525  1.00 0.00 ? 109 VAL A CB   1  
ATOM 1719  C CG1  . VAL A 1 109 ? 1.178   -8.632  -2.233  1.00 0.00 ? 109 VAL A CG1  1  
ATOM 1720  C CG2  . VAL A 1 109 ? 3.007   -7.576  -3.581  1.00 0.00 ? 109 VAL A CG2  1  
ATOM 1721  H H    . VAL A 1 109 ? -0.848  -9.157  -4.061  1.00 0.00 ? 109 VAL A H    1  
ATOM 1722  H HA   . VAL A 1 109 ? 1.471   -8.257  -5.637  1.00 0.00 ? 109 VAL A HA   1  
ATOM 1723  H HB   . VAL A 1 109 ? 0.969   -6.981  -3.552  1.00 0.00 ? 109 VAL A HB   1  
ATOM 1724  H HG11 . VAL A 1 109 ? 2.019   -9.235  -1.923  1.00 0.00 ? 109 VAL A HG11 1  
ATOM 1725  H HG12 . VAL A 1 109 ? 0.949   -7.908  -1.464  1.00 0.00 ? 109 VAL A HG12 1  
ATOM 1726  H HG13 . VAL A 1 109 ? 0.321   -9.268  -2.396  1.00 0.00 ? 109 VAL A HG13 1  
ATOM 1727  H HG21 . VAL A 1 109 ? 3.391   -7.812  -4.562  1.00 0.00 ? 109 VAL A HG21 1  
ATOM 1728  H HG22 . VAL A 1 109 ? 3.150   -6.524  -3.381  1.00 0.00 ? 109 VAL A HG22 1  
ATOM 1729  H HG23 . VAL A 1 109 ? 3.534   -8.158  -2.839  1.00 0.00 ? 109 VAL A HG23 1  
ATOM 1730  N N    . ARG A 1 110 ? 2.752   -10.368 -5.510  1.00 0.00 ? 110 ARG A N    1  
ATOM 1731  C CA   . ARG A 1 110 ? 3.463   -11.641 -5.519  1.00 0.00 ? 110 ARG A CA   1  
ATOM 1732  C C    . ARG A 1 110 ? 4.786   -11.530 -4.767  1.00 0.00 ? 110 ARG A C    1  
ATOM 1733  O O    . ARG A 1 110 ? 5.759   -10.974 -5.278  1.00 0.00 ? 110 ARG A O    1  
ATOM 1734  C CB   . ARG A 1 110 ? 3.718   -12.097 -6.957  1.00 0.00 ? 110 ARG A CB   1  
ATOM 1735  C CG   . ARG A 1 110 ? 3.922   -13.597 -7.093  1.00 0.00 ? 110 ARG A CG   1  
ATOM 1736  C CD   . ARG A 1 110 ? 4.135   -14.001 -8.543  1.00 0.00 ? 110 ARG A CD   1  
ATOM 1737  N NE   . ARG A 1 110 ? 4.520   -15.404 -8.670  1.00 0.00 ? 110 ARG A NE   1  
ATOM 1738  C CZ   . ARG A 1 110 ? 4.811   -15.985 -9.828  1.00 0.00 ? 110 ARG A CZ   1  
ATOM 1739  N NH1  . ARG A 1 110 ? 4.762   -15.286 -10.954 1.00 0.00 ? 110 ARG A NH1  1  
ATOM 1740  N NH2  . ARG A 1 110 ? 5.153   -17.266 -9.862  1.00 0.00 ? 110 ARG A NH2  1  
ATOM 1741  H H    . ARG A 1 110 ? 3.002   -9.677  -6.158  1.00 0.00 ? 110 ARG A H    1  
ATOM 1742  H HA   . ARG A 1 110 ? 2.841   -12.372 -5.023  1.00 0.00 ? 110 ARG A HA   1  
ATOM 1743  H HB2  . ARG A 1 110 ? 2.872   -11.815 -7.567  1.00 0.00 ? 110 ARG A HB2  1  
ATOM 1744  H HB3  . ARG A 1 110 ? 4.601   -11.600 -7.328  1.00 0.00 ? 110 ARG A HB3  1  
ATOM 1745  H HG2  . ARG A 1 110 ? 4.790   -13.886 -6.519  1.00 0.00 ? 110 ARG A HG2  1  
ATOM 1746  H HG3  . ARG A 1 110 ? 3.050   -14.106 -6.710  1.00 0.00 ? 110 ARG A HG3  1  
ATOM 1747  H HD2  . ARG A 1 110 ? 3.216   -13.840 -9.087  1.00 0.00 ? 110 ARG A HD2  1  
ATOM 1748  H HD3  . ARG A 1 110 ? 4.915   -13.384 -8.964  1.00 0.00 ? 110 ARG A HD3  1  
ATOM 1749  H HE   . ARG A 1 110 ? 4.563   -15.939 -7.850  1.00 0.00 ? 110 ARG A HE   1  
ATOM 1750  H HH11 . ARG A 1 110 ? 4.506   -14.320 -10.932 1.00 0.00 ? 110 ARG A HH11 1  
ATOM 1751  H HH12 . ARG A 1 110 ? 4.983   -15.726 -11.825 1.00 0.00 ? 110 ARG A HH12 1  
ATOM 1752  H HH21 . ARG A 1 110 ? 5.192   -17.796 -9.015  1.00 0.00 ? 110 ARG A HH21 1  
ATOM 1753  H HH22 . ARG A 1 110 ? 5.372   -17.702 -10.735 1.00 0.00 ? 110 ARG A HH22 1  
ATOM 1754  N N    . THR A 1 111 ? 4.815   -12.063 -3.549  1.00 0.00 ? 111 THR A N    1  
ATOM 1755  C CA   . THR A 1 111 ? 6.018   -12.022 -2.726  1.00 0.00 ? 111 THR A CA   1  
ATOM 1756  C C    . THR A 1 111 ? 7.047   -13.039 -3.206  1.00 0.00 ? 111 THR A C    1  
ATOM 1757  O O    . THR A 1 111 ? 6.902   -14.240 -2.979  1.00 0.00 ? 111 THR A O    1  
ATOM 1758  C CB   . THR A 1 111 ? 5.694   -12.297 -1.245  1.00 0.00 ? 111 THR A CB   1  
ATOM 1759  O OG1  . THR A 1 111 ? 5.216   -13.637 -1.089  1.00 0.00 ? 111 THR A OG1  1  
ATOM 1760  C CG2  . THR A 1 111 ? 4.651   -11.317 -0.729  1.00 0.00 ? 111 THR A CG2  1  
ATOM 1761  H H    . THR A 1 111 ? 4.008   -12.492 -3.197  1.00 0.00 ? 111 THR A H    1  
ATOM 1762  H HA   . THR A 1 111 ? 6.441   -11.031 -2.803  1.00 0.00 ? 111 THR A HA   1  
ATOM 1763  H HB   . THR A 1 111 ? 6.599   -12.175 -0.667  1.00 0.00 ? 111 THR A HB   1  
ATOM 1764  H HG1  . THR A 1 111 ? 4.296   -13.682 -1.360  1.00 0.00 ? 111 THR A HG1  1  
ATOM 1765  H HG21 . THR A 1 111 ? 4.208   -10.791 -1.561  1.00 0.00 ? 111 THR A HG21 1  
ATOM 1766  H HG22 . THR A 1 111 ? 5.121   -10.608 -0.064  1.00 0.00 ? 111 THR A HG22 1  
ATOM 1767  H HG23 . THR A 1 111 ? 3.884   -11.857 -0.196  1.00 0.00 ? 111 THR A HG23 1  
ATOM 1768  N N    . THR A 1 112 ? 8.089   -12.550 -3.872  1.00 0.00 ? 112 THR A N    1  
ATOM 1769  C CA   . THR A 1 112 ? 9.143   -13.416 -4.385  1.00 0.00 ? 112 THR A CA   1  
ATOM 1770  C C    . THR A 1 112 ? 9.565   -14.445 -3.342  1.00 0.00 ? 112 THR A C    1  
ATOM 1771  O O    . THR A 1 112 ? 9.177   -14.357 -2.178  1.00 0.00 ? 112 THR A O    1  
ATOM 1772  C CB   . THR A 1 112 ? 10.378  -12.602 -4.816  1.00 0.00 ? 112 THR A CB   1  
ATOM 1773  O OG1  . THR A 1 112 ? 11.302  -13.446 -5.513  1.00 0.00 ? 112 THR A OG1  1  
ATOM 1774  C CG2  . THR A 1 112 ? 11.064  -11.979 -3.610  1.00 0.00 ? 112 THR A CG2  1  
ATOM 1775  H H    . THR A 1 112 ? 8.148   -11.583 -4.022  1.00 0.00 ? 112 THR A H    1  
ATOM 1776  H HA   . THR A 1 112 ? 8.758   -13.933 -5.252  1.00 0.00 ? 112 THR A HA   1  
ATOM 1777  H HB   . THR A 1 112 ? 10.056  -11.811 -5.477  1.00 0.00 ? 112 THR A HB   1  
ATOM 1778  H HG1  . THR A 1 112 ? 10.855  -13.869 -6.251  1.00 0.00 ? 112 THR A HG1  1  
ATOM 1779  H HG21 . THR A 1 112 ? 10.651  -12.398 -2.704  1.00 0.00 ? 112 THR A HG21 1  
ATOM 1780  H HG22 . THR A 1 112 ? 10.905  -10.911 -3.617  1.00 0.00 ? 112 THR A HG22 1  
ATOM 1781  H HG23 . THR A 1 112 ? 12.123  -12.186 -3.651  1.00 0.00 ? 112 THR A HG23 1  
ATOM 1782  N N    . GLU A 1 113 ? 10.363  -15.419 -3.768  1.00 0.00 ? 113 GLU A N    1  
ATOM 1783  C CA   . GLU A 1 113 ? 10.837  -16.465 -2.870  1.00 0.00 ? 113 GLU A CA   1  
ATOM 1784  C C    . GLU A 1 113 ? 12.246  -16.157 -2.372  1.00 0.00 ? 113 GLU A C    1  
ATOM 1785  O O    . GLU A 1 113 ? 12.555  -16.348 -1.196  1.00 0.00 ? 113 GLU A O    1  
ATOM 1786  C CB   . GLU A 1 113 ? 10.819  -17.822 -3.576  1.00 0.00 ? 113 GLU A CB   1  
ATOM 1787  C CG   . GLU A 1 113 ? 9.421   -18.322 -3.899  1.00 0.00 ? 113 GLU A CG   1  
ATOM 1788  C CD   . GLU A 1 113 ? 9.429   -19.667 -4.599  1.00 0.00 ? 113 GLU A CD   1  
ATOM 1789  O OE1  . GLU A 1 113 ? 9.606   -19.693 -5.835  1.00 0.00 ? 113 GLU A OE1  1  
ATOM 1790  O OE2  . GLU A 1 113 ? 9.259   -20.695 -3.910  1.00 0.00 ? 113 GLU A OE2  1  
ATOM 1791  H H    . GLU A 1 113 ? 10.638  -15.435 -4.709  1.00 0.00 ? 113 GLU A H    1  
ATOM 1792  H HA   . GLU A 1 113 ? 10.169  -16.502 -2.022  1.00 0.00 ? 113 GLU A HA   1  
ATOM 1793  H HB2  . GLU A 1 113 ? 11.372  -17.741 -4.500  1.00 0.00 ? 113 GLU A HB2  1  
ATOM 1794  H HB3  . GLU A 1 113 ? 11.301  -18.551 -2.942  1.00 0.00 ? 113 GLU A HB3  1  
ATOM 1795  H HG2  . GLU A 1 113 ? 8.865   -18.416 -2.978  1.00 0.00 ? 113 GLU A HG2  1  
ATOM 1796  H HG3  . GLU A 1 113 ? 8.934   -17.602 -4.540  1.00 0.00 ? 113 GLU A HG3  1  
ATOM 1797  N N    . GLU A 1 114 ? 13.096  -15.681 -3.276  1.00 0.00 ? 114 GLU A N    1  
ATOM 1798  C CA   . GLU A 1 114 ? 14.472  -15.348 -2.929  1.00 0.00 ? 114 GLU A CA   1  
ATOM 1799  C C    . GLU A 1 114 ? 14.582  -13.896 -2.471  1.00 0.00 ? 114 GLU A C    1  
ATOM 1800  O O    . GLU A 1 114 ? 14.243  -12.973 -3.212  1.00 0.00 ? 114 GLU A O    1  
ATOM 1801  C CB   . GLU A 1 114 ? 15.396  -15.588 -4.125  1.00 0.00 ? 114 GLU A CB   1  
ATOM 1802  C CG   . GLU A 1 114 ? 15.096  -14.692 -5.315  1.00 0.00 ? 114 GLU A CG   1  
ATOM 1803  C CD   . GLU A 1 114 ? 15.709  -15.207 -6.603  1.00 0.00 ? 114 GLU A CD   1  
ATOM 1804  O OE1  . GLU A 1 114 ? 16.931  -15.463 -6.618  1.00 0.00 ? 114 GLU A OE1  1  
ATOM 1805  O OE2  . GLU A 1 114 ? 14.965  -15.355 -7.595  1.00 0.00 ? 114 GLU A OE2  1  
ATOM 1806  H H    . GLU A 1 114 ? 12.790  -15.550 -4.198  1.00 0.00 ? 114 GLU A H    1  
ATOM 1807  H HA   . GLU A 1 114 ? 14.775  -15.992 -2.118  1.00 0.00 ? 114 GLU A HA   1  
ATOM 1808  H HB2  . GLU A 1 114 ? 16.416  -15.415 -3.818  1.00 0.00 ? 114 GLU A HB2  1  
ATOM 1809  H HB3  . GLU A 1 114 ? 15.295  -16.616 -4.442  1.00 0.00 ? 114 GLU A HB3  1  
ATOM 1810  H HG2  . GLU A 1 114 ? 14.026  -14.630 -5.443  1.00 0.00 ? 114 GLU A HG2  1  
ATOM 1811  H HG3  . GLU A 1 114 ? 15.491  -13.706 -5.115  1.00 0.00 ? 114 GLU A HG3  1  
ATOM 1812  N N    . SER A 1 115 ? 15.058  -13.703 -1.245  1.00 0.00 ? 115 SER A N    1  
ATOM 1813  C CA   . SER A 1 115 ? 15.209  -12.365 -0.686  1.00 0.00 ? 115 SER A CA   1  
ATOM 1814  C C    . SER A 1 115 ? 16.297  -11.588 -1.421  1.00 0.00 ? 115 SER A C    1  
ATOM 1815  O O    . SER A 1 115 ? 17.398  -12.094 -1.637  1.00 0.00 ? 115 SER A O    1  
ATOM 1816  C CB   . SER A 1 115 ? 15.543  -12.447 0.805   1.00 0.00 ? 115 SER A CB   1  
ATOM 1817  O OG   . SER A 1 115 ? 14.382  -12.704 1.575   1.00 0.00 ? 115 SER A OG   1  
ATOM 1818  H H    . SER A 1 115 ? 15.311  -14.480 -0.703  1.00 0.00 ? 115 SER A H    1  
ATOM 1819  H HA   . SER A 1 115 ? 14.269  -11.847 -0.807  1.00 0.00 ? 115 SER A HA   1  
ATOM 1820  H HB2  . SER A 1 115 ? 16.252  -13.244 0.969   1.00 0.00 ? 115 SER A HB2  1  
ATOM 1821  H HB3  . SER A 1 115 ? 15.974  -11.510 1.126   1.00 0.00 ? 115 SER A HB3  1  
ATOM 1822  H HG   . SER A 1 115 ? 14.497  -12.345 2.458   1.00 0.00 ? 115 SER A HG   1  
ATOM 1823  N N    . GLY A 1 116 ? 15.980  -10.355 -1.802  1.00 0.00 ? 116 GLY A N    1  
ATOM 1824  C CA   . GLY A 1 116 ? 16.940  -9.527  -2.509  1.00 0.00 ? 116 GLY A CA   1  
ATOM 1825  C C    . GLY A 1 116 ? 17.768  -8.670  -1.572  1.00 0.00 ? 116 GLY A C    1  
ATOM 1826  O O    . GLY A 1 116 ? 17.611  -8.717  -0.352  1.00 0.00 ? 116 GLY A O    1  
ATOM 1827  H H    . GLY A 1 116 ? 15.087  -10.004 -1.602  1.00 0.00 ? 116 GLY A H    1  
ATOM 1828  H HA2  . GLY A 1 116 ? 17.602  -10.166 -3.075  1.00 0.00 ? 116 GLY A HA2  1  
ATOM 1829  H HA3  . GLY A 1 116 ? 16.408  -8.882  -3.192  1.00 0.00 ? 116 GLY A HA3  1  
ATOM 1830  N N    . PRO A 1 117 ? 18.676  -7.866  -2.145  1.00 0.00 ? 117 PRO A N    1  
ATOM 1831  C CA   . PRO A 1 117 ? 19.550  -6.981  -1.371  1.00 0.00 ? 117 PRO A CA   1  
ATOM 1832  C C    . PRO A 1 117 ? 18.787  -5.826  -0.732  1.00 0.00 ? 117 PRO A C    1  
ATOM 1833  O O    . PRO A 1 117 ? 18.600  -4.776  -1.347  1.00 0.00 ? 117 PRO A O    1  
ATOM 1834  C CB   . PRO A 1 117 ? 20.538  -6.455  -2.415  1.00 0.00 ? 117 PRO A CB   1  
ATOM 1835  C CG   . PRO A 1 117 ? 19.807  -6.553  -3.710  1.00 0.00 ? 117 PRO A CG   1  
ATOM 1836  C CD   . PRO A 1 117 ? 18.917  -7.759  -3.594  1.00 0.00 ? 117 PRO A CD   1  
ATOM 1837  H HA   . PRO A 1 117 ? 20.087  -7.523  -0.606  1.00 0.00 ? 117 PRO A HA   1  
ATOM 1838  H HB2  . PRO A 1 117 ? 20.800  -5.432  -2.184  1.00 0.00 ? 117 PRO A HB2  1  
ATOM 1839  H HB3  . PRO A 1 117 ? 21.426  -7.069  -2.417  1.00 0.00 ? 117 PRO A HB3  1  
ATOM 1840  H HG2  . PRO A 1 117 ? 19.216  -5.664  -3.866  1.00 0.00 ? 117 PRO A HG2  1  
ATOM 1841  H HG3  . PRO A 1 117 ? 20.511  -6.683  -4.519  1.00 0.00 ? 117 PRO A HG3  1  
ATOM 1842  H HD2  . PRO A 1 117 ? 17.993  -7.599  -4.128  1.00 0.00 ? 117 PRO A HD2  1  
ATOM 1843  H HD3  . PRO A 1 117 ? 19.423  -8.638  -3.966  1.00 0.00 ? 117 PRO A HD3  1  
ATOM 1844  N N    . SER A 1 118 ? 18.348  -6.026  0.507   1.00 0.00 ? 118 SER A N    1  
ATOM 1845  C CA   . SER A 1 118 ? 17.601  -5.002  1.228   1.00 0.00 ? 118 SER A CA   1  
ATOM 1846  C C    . SER A 1 118 ? 18.472  -4.345  2.294   1.00 0.00 ? 118 SER A C    1  
ATOM 1847  O O    . SER A 1 118 ? 19.367  -4.976  2.857   1.00 0.00 ? 118 SER A O    1  
ATOM 1848  C CB   . SER A 1 118 ? 16.355  -5.610  1.875   1.00 0.00 ? 118 SER A CB   1  
ATOM 1849  O OG   . SER A 1 118 ? 15.429  -4.603  2.243   1.00 0.00 ? 118 SER A OG   1  
ATOM 1850  H H    . SER A 1 118 ? 18.528  -6.885  0.945   1.00 0.00 ? 118 SER A H    1  
ATOM 1851  H HA   . SER A 1 118 ? 17.296  -4.251  0.516   1.00 0.00 ? 118 SER A HA   1  
ATOM 1852  H HB2  . SER A 1 118 ? 15.880  -6.281  1.176   1.00 0.00 ? 118 SER A HB2  1  
ATOM 1853  H HB3  . SER A 1 118 ? 16.644  -6.158  2.760   1.00 0.00 ? 118 SER A HB3  1  
ATOM 1854  H HG   . SER A 1 118 ? 15.234  -4.052  1.481   1.00 0.00 ? 118 SER A HG   1  
ATOM 1855  N N    . SER A 1 119 ? 18.203  -3.072  2.567   1.00 0.00 ? 119 SER A N    1  
ATOM 1856  C CA   . SER A 1 119 ? 18.964  -2.326  3.563   1.00 0.00 ? 119 SER A CA   1  
ATOM 1857  C C    . SER A 1 119 ? 18.051  -1.404  4.365   1.00 0.00 ? 119 SER A C    1  
ATOM 1858  O O    . SER A 1 119 ? 17.304  -0.606  3.800   1.00 0.00 ? 119 SER A O    1  
ATOM 1859  C CB   . SER A 1 119 ? 20.066  -1.509  2.886   1.00 0.00 ? 119 SER A CB   1  
ATOM 1860  O OG   . SER A 1 119 ? 19.517  -0.491  2.068   1.00 0.00 ? 119 SER A OG   1  
ATOM 1861  H H    . SER A 1 119 ? 17.477  -2.623  2.085   1.00 0.00 ? 119 SER A H    1  
ATOM 1862  H HA   . SER A 1 119 ? 19.417  -3.039  4.236   1.00 0.00 ? 119 SER A HA   1  
ATOM 1863  H HB2  . SER A 1 119 ? 20.687  -1.051  3.642   1.00 0.00 ? 119 SER A HB2  1  
ATOM 1864  H HB3  . SER A 1 119 ? 20.669  -2.162  2.272   1.00 0.00 ? 119 SER A HB3  1  
ATOM 1865  H HG   . SER A 1 119 ? 18.639  -0.750  1.780   1.00 0.00 ? 119 SER A HG   1  
ATOM 1866  N N    . GLY A 1 120 ? 18.118  -1.520  5.688   1.00 0.00 ? 120 GLY A N    1  
ATOM 1867  C CA   . GLY A 1 120 ? 17.293  -0.691  6.548   1.00 0.00 ? 120 GLY A CA   1  
ATOM 1868  C C    . GLY A 1 120 ? 16.820  -1.430  7.784   1.00 0.00 ? 120 GLY A C    1  
ATOM 1869  O O    . GLY A 1 120 ? 17.006  -2.641  7.901   1.00 0.00 ? 120 GLY A O    1  
ATOM 1870  H H    . GLY A 1 120 ? 18.732  -2.173  6.083   1.00 0.00 ? 120 GLY A H    1  
ATOM 1871  H HA2  . GLY A 1 120 ? 17.865  0.172   6.853   1.00 0.00 ? 120 GLY A HA2  1  
ATOM 1872  H HA3  . GLY A 1 120 ? 16.430  -0.360  5.989   1.00 0.00 ? 120 GLY A HA3  1  
ATOM 1873  N N    . GLY A 1 1   ? -9.204  23.043  15.588  1.00 0.00 ? 1   GLY A N    2  
ATOM 1874  C CA   . GLY A 1 1   ? -10.464 22.559  15.056  1.00 0.00 ? 1   GLY A CA   2  
ATOM 1875  C C    . GLY A 1 1   ? -10.840 21.196  15.603  1.00 0.00 ? 1   GLY A C    2  
ATOM 1876  O O    . GLY A 1 1   ? -11.272 20.318  14.857  1.00 0.00 ? 1   GLY A O    2  
ATOM 1877  H H1   . GLY A 1 1   ? -8.703  22.497  16.230  1.00 0.00 ? 1   GLY A H1   2  
ATOM 1878  H HA2  . GLY A 1 1   ? -11.243 23.264  15.308  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1879  H HA3  . GLY A 1 1   ? -10.386 22.494  13.981  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1880  N N    . SER A 1 2   ? -10.673 21.018  16.909  1.00 0.00 ? 2   SER A N    2  
ATOM 1881  C CA   . SER A 1 2   ? -10.992 19.750  17.555  1.00 0.00 ? 2   SER A CA   2  
ATOM 1882  C C    . SER A 1 2   ? -12.326 19.206  17.053  1.00 0.00 ? 2   SER A C    2  
ATOM 1883  O O    . SER A 1 2   ? -13.382 19.781  17.316  1.00 0.00 ? 2   SER A O    2  
ATOM 1884  C CB   . SER A 1 2   ? -11.039 19.925  19.074  1.00 0.00 ? 2   SER A CB   2  
ATOM 1885  O OG   . SER A 1 2   ? -11.630 18.799  19.699  1.00 0.00 ? 2   SER A OG   2  
ATOM 1886  H H    . SER A 1 2   ? -10.324 21.757  17.452  1.00 0.00 ? 2   SER A H    2  
ATOM 1887  H HA   . SER A 1 2   ? -10.213 19.046  17.306  1.00 0.00 ? 2   SER A HA   2  
ATOM 1888  H HB2  . SER A 1 2   ? -10.034 20.044  19.451  1.00 0.00 ? 2   SER A HB2  2  
ATOM 1889  H HB3  . SER A 1 2   ? -11.621 20.803  19.315  1.00 0.00 ? 2   SER A HB3  2  
ATOM 1890  H HG   . SER A 1 2   ? -11.546 18.880  20.652  1.00 0.00 ? 2   SER A HG   2  
ATOM 1891  N N    . SER A 1 3   ? -12.269 18.093  16.329  1.00 0.00 ? 3   SER A N    2  
ATOM 1892  C CA   . SER A 1 3   ? -13.471 17.471  15.786  1.00 0.00 ? 3   SER A CA   2  
ATOM 1893  C C    . SER A 1 3   ? -14.321 16.868  16.900  1.00 0.00 ? 3   SER A C    2  
ATOM 1894  O O    . SER A 1 3   ? -13.879 15.970  17.615  1.00 0.00 ? 3   SER A O    2  
ATOM 1895  C CB   . SER A 1 3   ? -13.097 16.390  14.770  1.00 0.00 ? 3   SER A CB   2  
ATOM 1896  O OG   . SER A 1 3   ? -12.288 16.920  13.735  1.00 0.00 ? 3   SER A OG   2  
ATOM 1897  H H    . SER A 1 3   ? -11.396 17.682  16.153  1.00 0.00 ? 3   SER A H    2  
ATOM 1898  H HA   . SER A 1 3   ? -14.044 18.239  15.287  1.00 0.00 ? 3   SER A HA   2  
ATOM 1899  H HB2  . SER A 1 3   ? -12.553 15.603  15.270  1.00 0.00 ? 3   SER A HB2  2  
ATOM 1900  H HB3  . SER A 1 3   ? -13.998 15.983  14.334  1.00 0.00 ? 3   SER A HB3  2  
ATOM 1901  H HG   . SER A 1 3   ? -11.701 16.235  13.405  1.00 0.00 ? 3   SER A HG   2  
ATOM 1902  N N    . GLY A 1 4   ? -15.544 17.369  17.040  1.00 0.00 ? 4   GLY A N    2  
ATOM 1903  C CA   . GLY A 1 4   ? -16.438 16.868  18.068  1.00 0.00 ? 4   GLY A CA   2  
ATOM 1904  C C    . GLY A 1 4   ? -17.769 16.408  17.506  1.00 0.00 ? 4   GLY A C    2  
ATOM 1905  O O    . GLY A 1 4   ? -17.836 15.407  16.794  1.00 0.00 ? 4   GLY A O    2  
ATOM 1906  H H    . GLY A 1 4   ? -15.843 18.084  16.440  1.00 0.00 ? 4   GLY A H    2  
ATOM 1907  H HA2  . GLY A 1 4   ? -15.963 16.037  18.568  1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1908  H HA3  . GLY A 1 4   ? -16.616 17.654  18.788  1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1909  N N    . SER A 1 5   ? -18.830 17.140  17.829  1.00 0.00 ? 5   SER A N    2  
ATOM 1910  C CA   . SER A 1 5   ? -20.167 16.799  17.357  1.00 0.00 ? 5   SER A CA   2  
ATOM 1911  C C    . SER A 1 5   ? -20.333 17.168  15.886  1.00 0.00 ? 5   SER A C    2  
ATOM 1912  O O    . SER A 1 5   ? -20.849 18.237  15.557  1.00 0.00 ? 5   SER A O    2  
ATOM 1913  C CB   . SER A 1 5   ? -21.226 17.514  18.197  1.00 0.00 ? 5   SER A CB   2  
ATOM 1914  O OG   . SER A 1 5   ? -21.048 18.919  18.153  1.00 0.00 ? 5   SER A OG   2  
ATOM 1915  H H    . SER A 1 5   ? -18.711 17.927  18.402  1.00 0.00 ? 5   SER A H    2  
ATOM 1916  H HA   . SER A 1 5   ? -20.294 15.732  17.464  1.00 0.00 ? 5   SER A HA   2  
ATOM 1917  H HB2  . SER A 1 5   ? -22.207 17.275  17.815  1.00 0.00 ? 5   SER A HB2  2  
ATOM 1918  H HB3  . SER A 1 5   ? -21.150 17.185  19.223  1.00 0.00 ? 5   SER A HB3  2  
ATOM 1919  H HG   . SER A 1 5   ? -20.950 19.202  17.241  1.00 0.00 ? 5   SER A HG   2  
ATOM 1920  N N    . SER A 1 6   ? -19.893 16.276  15.004  1.00 0.00 ? 6   SER A N    2  
ATOM 1921  C CA   . SER A 1 6   ? -19.989 16.508  13.568  1.00 0.00 ? 6   SER A CA   2  
ATOM 1922  C C    . SER A 1 6   ? -19.995 15.188  12.803  1.00 0.00 ? 6   SER A C    2  
ATOM 1923  O O    . SER A 1 6   ? -19.760 14.125  13.376  1.00 0.00 ? 6   SER A O    2  
ATOM 1924  C CB   . SER A 1 6   ? -18.827 17.381  13.092  1.00 0.00 ? 6   SER A CB   2  
ATOM 1925  O OG   . SER A 1 6   ? -19.126 18.758  13.247  1.00 0.00 ? 6   SER A OG   2  
ATOM 1926  H H    . SER A 1 6   ? -19.492 15.442  15.328  1.00 0.00 ? 6   SER A H    2  
ATOM 1927  H HA   . SER A 1 6   ? -20.918 17.025  13.377  1.00 0.00 ? 6   SER A HA   2  
ATOM 1928  H HB2  . SER A 1 6   ? -17.945 17.150  13.671  1.00 0.00 ? 6   SER A HB2  2  
ATOM 1929  H HB3  . SER A 1 6   ? -18.634 17.182  12.048  1.00 0.00 ? 6   SER A HB3  2  
ATOM 1930  H HG   . SER A 1 6   ? -18.626 19.113  13.986  1.00 0.00 ? 6   SER A HG   2  
ATOM 1931  N N    . GLY A 1 7   ? -20.266 15.265  11.504  1.00 0.00 ? 7   GLY A N    2  
ATOM 1932  C CA   . GLY A 1 7   ? -20.297 14.070  10.680  1.00 0.00 ? 7   GLY A CA   2  
ATOM 1933  C C    . GLY A 1 7   ? -21.620 13.897  9.961   1.00 0.00 ? 7   GLY A C    2  
ATOM 1934  O O    . GLY A 1 7   ? -22.229 12.829  10.015  1.00 0.00 ? 7   GLY A O    2  
ATOM 1935  H H    . GLY A 1 7   ? -20.445 16.140  11.101  1.00 0.00 ? 7   GLY A H    2  
ATOM 1936  H HA2  . GLY A 1 7   ? -19.506 14.130  9.948   1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1937  H HA3  . GLY A 1 7   ? -20.128 13.209  11.310  1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1938  N N    . ARG A 1 8   ? -22.067 14.951  9.286   1.00 0.00 ? 8   ARG A N    2  
ATOM 1939  C CA   . ARG A 1 8   ? -23.328 14.912  8.555   1.00 0.00 ? 8   ARG A CA   2  
ATOM 1940  C C    . ARG A 1 8   ? -23.098 14.537  7.094   1.00 0.00 ? 8   ARG A C    2  
ATOM 1941  O O    . ARG A 1 8   ? -23.795 13.685  6.545   1.00 0.00 ? 8   ARG A O    2  
ATOM 1942  C CB   . ARG A 1 8   ? -24.034 16.267  8.640   1.00 0.00 ? 8   ARG A CB   2  
ATOM 1943  C CG   . ARG A 1 8   ? -24.655 16.546  9.999   1.00 0.00 ? 8   ARG A CG   2  
ATOM 1944  C CD   . ARG A 1 8   ? -25.431 17.853  9.998   1.00 0.00 ? 8   ARG A CD   2  
ATOM 1945  N NE   . ARG A 1 8   ? -24.586 18.992  9.648   1.00 0.00 ? 8   ARG A NE   2  
ATOM 1946  C CZ   . ARG A 1 8   ? -24.901 20.253  9.923   1.00 0.00 ? 8   ARG A CZ   2  
ATOM 1947  N NH1  . ARG A 1 8   ? -26.035 20.535  10.549  1.00 0.00 ? 8   ARG A NH1  2  
ATOM 1948  N NH2  . ARG A 1 8   ? -24.080 21.234  9.572   1.00 0.00 ? 8   ARG A NH2  2  
ATOM 1949  H H    . ARG A 1 8   ? -21.537 15.776  9.280   1.00 0.00 ? 8   ARG A H    2  
ATOM 1950  H HA   . ARG A 1 8   ? -23.954 14.161  9.013   1.00 0.00 ? 8   ARG A HA   2  
ATOM 1951  H HB2  . ARG A 1 8   ? -23.317 17.047  8.429   1.00 0.00 ? 8   ARG A HB2  2  
ATOM 1952  H HB3  . ARG A 1 8   ? -24.816 16.298  7.897   1.00 0.00 ? 8   ARG A HB3  2  
ATOM 1953  H HG2  . ARG A 1 8   ? -25.329 15.740  10.249  1.00 0.00 ? 8   ARG A HG2  2  
ATOM 1954  H HG3  . ARG A 1 8   ? -23.869 16.604  10.737  1.00 0.00 ? 8   ARG A HG3  2  
ATOM 1955  H HD2  . ARG A 1 8   ? -26.234 17.779  9.280   1.00 0.00 ? 8   ARG A HD2  2  
ATOM 1956  H HD3  . ARG A 1 8   ? -25.843 18.012  10.983  1.00 0.00 ? 8   ARG A HD3  2  
ATOM 1957  H HE   . ARG A 1 8   ? -23.743 18.806  9.185   1.00 0.00 ? 8   ARG A HE   2  
ATOM 1958  H HH11 . ARG A 1 8   ? -26.655 19.797  10.815  1.00 0.00 ? 8   ARG A HH11 2  
ATOM 1959  H HH12 . ARG A 1 8   ? -26.269 21.485  10.756  1.00 0.00 ? 8   ARG A HH12 2  
ATOM 1960  H HH21 . ARG A 1 8   ? -23.223 21.025  9.101   1.00 0.00 ? 8   ARG A HH21 2  
ATOM 1961  H HH22 . ARG A 1 8   ? -24.317 22.183  9.780   1.00 0.00 ? 8   ARG A HH22 2  
ATOM 1962  N N    . GLN A 1 9   ? -22.115 15.180  6.471   1.00 0.00 ? 9   GLN A N    2  
ATOM 1963  C CA   . GLN A 1 9   ? -21.794 14.914  5.074   1.00 0.00 ? 9   GLN A CA   2  
ATOM 1964  C C    . GLN A 1 9   ? -20.864 13.712  4.948   1.00 0.00 ? 9   GLN A C    2  
ATOM 1965  O O    . GLN A 1 9   ? -20.232 13.509  3.911   1.00 0.00 ? 9   GLN A O    2  
ATOM 1966  C CB   . GLN A 1 9   ? -21.148 16.144  4.434   1.00 0.00 ? 9   GLN A CB   2  
ATOM 1967  C CG   . GLN A 1 9   ? -21.099 16.085  2.916   1.00 0.00 ? 9   GLN A CG   2  
ATOM 1968  C CD   . GLN A 1 9   ? -20.818 17.437  2.288   1.00 0.00 ? 9   GLN A CD   2  
ATOM 1969  O OE1  . GLN A 1 9   ? -21.626 18.360  2.388   1.00 0.00 ? 9   GLN A OE1  2  
ATOM 1970  N NE2  . GLN A 1 9   ? -19.667 17.559  1.637   1.00 0.00 ? 9   GLN A NE2  2  
ATOM 1971  H H    . GLN A 1 9   ? -21.594 15.848  6.962   1.00 0.00 ? 9   GLN A H    2  
ATOM 1972  H HA   . GLN A 1 9   ? -22.717 14.695  4.558   1.00 0.00 ? 9   GLN A HA   2  
ATOM 1973  H HB2  . GLN A 1 9   ? -21.708 17.021  4.721   1.00 0.00 ? 9   GLN A HB2  2  
ATOM 1974  H HB3  . GLN A 1 9   ? -20.136 16.236  4.802   1.00 0.00 ? 9   GLN A HB3  2  
ATOM 1975  H HG2  . GLN A 1 9   ? -20.319 15.400  2.620   1.00 0.00 ? 9   GLN A HG2  2  
ATOM 1976  H HG3  . GLN A 1 9   ? -22.050 15.726  2.552   1.00 0.00 ? 9   GLN A HG3  2  
ATOM 1977  H HE21 . GLN A 1 9   ? -19.073 16.781  1.598   1.00 0.00 ? 9   GLN A HE21 2  
ATOM 1978  H HE22 . GLN A 1 9   ? -19.461 18.421  1.221   1.00 0.00 ? 9   GLN A HE22 2  
ATOM 1979  N N    . VAL A 1 10  ? -20.784 12.918  6.010   1.00 0.00 ? 10  VAL A N    2  
ATOM 1980  C CA   . VAL A 1 10  ? -19.932 11.735  6.019   1.00 0.00 ? 10  VAL A CA   2  
ATOM 1981  C C    . VAL A 1 10  ? -20.450 10.677  5.052   1.00 0.00 ? 10  VAL A C    2  
ATOM 1982  O O    . VAL A 1 10  ? -19.678 10.061  4.318   1.00 0.00 ? 10  VAL A O    2  
ATOM 1983  C CB   . VAL A 1 10  ? -19.835 11.123  7.429   1.00 0.00 ? 10  VAL A CB   2  
ATOM 1984  C CG1  . VAL A 1 10  ? -21.191 10.599  7.878   1.00 0.00 ? 10  VAL A CG1  2  
ATOM 1985  C CG2  . VAL A 1 10  ? -18.791 10.017  7.458   1.00 0.00 ? 10  VAL A CG2  2  
ATOM 1986  H H    . VAL A 1 10  ? -21.312 13.132  6.808   1.00 0.00 ? 10  VAL A H    2  
ATOM 1987  H HA   . VAL A 1 10  ? -18.941 12.036  5.711   1.00 0.00 ? 10  VAL A HA   2  
ATOM 1988  H HB   . VAL A 1 10  ? -19.527 11.898  8.115   1.00 0.00 ? 10  VAL A HB   2  
ATOM 1989  H HG11 . VAL A 1 10  ? -21.963 11.284  7.561   1.00 0.00 ? 10  VAL A HG11 2  
ATOM 1990  H HG12 . VAL A 1 10  ? -21.366 9.628   7.439   1.00 0.00 ? 10  VAL A HG12 2  
ATOM 1991  H HG13 . VAL A 1 10  ? -21.205 10.516  8.955   1.00 0.00 ? 10  VAL A HG13 2  
ATOM 1992  H HG21 . VAL A 1 10  ? -18.228 10.029  6.537   1.00 0.00 ? 10  VAL A HG21 2  
ATOM 1993  H HG22 . VAL A 1 10  ? -18.121 10.175  8.291   1.00 0.00 ? 10  VAL A HG22 2  
ATOM 1994  H HG23 . VAL A 1 10  ? -19.281 9.061   7.568   1.00 0.00 ? 10  VAL A HG23 2  
ATOM 1995  N N    . GLN A 1 11  ? -21.763 10.472  5.056   1.00 0.00 ? 11  GLN A N    2  
ATOM 1996  C CA   . GLN A 1 11  ? -22.385 9.487   4.179   1.00 0.00 ? 11  GLN A CA   2  
ATOM 1997  C C    . GLN A 1 11  ? -22.352 9.953   2.727   1.00 0.00 ? 11  GLN A C    2  
ATOM 1998  O O    . GLN A 1 11  ? -22.636 9.183   1.809   1.00 0.00 ? 11  GLN A O    2  
ATOM 1999  C CB   . GLN A 1 11  ? -23.830 9.228   4.610   1.00 0.00 ? 11  GLN A CB   2  
ATOM 2000  C CG   . GLN A 1 11  ? -23.963 8.151   5.674   1.00 0.00 ? 11  GLN A CG   2  
ATOM 2001  C CD   . GLN A 1 11  ? -25.302 8.194   6.384   1.00 0.00 ? 11  GLN A CD   2  
ATOM 2002  O OE1  . GLN A 1 11  ? -26.089 9.122   6.193   1.00 0.00 ? 11  GLN A OE1  2  
ATOM 2003  N NE2  . GLN A 1 11  ? -25.568 7.188   7.208   1.00 0.00 ? 11  GLN A NE2  2  
ATOM 2004  H H    . GLN A 1 11  ? -22.327 10.994  5.664   1.00 0.00 ? 11  GLN A H    2  
ATOM 2005  H HA   . GLN A 1 11  ? -21.825 8.568   4.261   1.00 0.00 ? 11  GLN A HA   2  
ATOM 2006  H HB2  . GLN A 1 11  ? -24.246 10.145  5.002   1.00 0.00 ? 11  GLN A HB2  2  
ATOM 2007  H HB3  . GLN A 1 11  ? -24.402 8.923   3.746   1.00 0.00 ? 11  GLN A HB3  2  
ATOM 2008  H HG2  . GLN A 1 11  ? -23.853 7.184   5.206   1.00 0.00 ? 11  GLN A HG2  2  
ATOM 2009  H HG3  . GLN A 1 11  ? -23.180 8.287   6.405   1.00 0.00 ? 11  GLN A HG3  2  
ATOM 2010  H HE21 . GLN A 1 11  ? -24.893 6.484   7.312   1.00 0.00 ? 11  GLN A HE21 2  
ATOM 2011  H HE22 . GLN A 1 11  ? -26.426 7.190   7.680   1.00 0.00 ? 11  GLN A HE22 2  
ATOM 2012  N N    . LYS A 1 12  ? -22.002 11.219  2.525   1.00 0.00 ? 12  LYS A N    2  
ATOM 2013  C CA   . LYS A 1 12  ? -21.930 11.790  1.185   1.00 0.00 ? 12  LYS A CA   2  
ATOM 2014  C C    . LYS A 1 12  ? -20.502 11.746  0.652   1.00 0.00 ? 12  LYS A C    2  
ATOM 2015  O O    . LYS A 1 12  ? -20.273 11.394  -0.505  1.00 0.00 ? 12  LYS A O    2  
ATOM 2016  C CB   . LYS A 1 12  ? -22.438 13.233  1.195   1.00 0.00 ? 12  LYS A CB   2  
ATOM 2017  C CG   . LYS A 1 12  ? -22.600 13.830  -0.192  1.00 0.00 ? 12  LYS A CG   2  
ATOM 2018  C CD   . LYS A 1 12  ? -21.280 14.353  -0.732  1.00 0.00 ? 12  LYS A CD   2  
ATOM 2019  C CE   . LYS A 1 12  ? -21.496 15.387  -1.826  1.00 0.00 ? 12  LYS A CE   2  
ATOM 2020  N NZ   . LYS A 1 12  ? -22.059 16.656  -1.287  1.00 0.00 ? 12  LYS A NZ   2  
ATOM 2021  H H    . LYS A 1 12  ? -21.786 11.784  3.297   1.00 0.00 ? 12  LYS A H    2  
ATOM 2022  H HA   . LYS A 1 12  ? -22.561 11.199  0.539   1.00 0.00 ? 12  LYS A HA   2  
ATOM 2023  H HB2  . LYS A 1 12  ? -23.397 13.261  1.691   1.00 0.00 ? 12  LYS A HB2  2  
ATOM 2024  H HB3  . LYS A 1 12  ? -21.739 13.844  1.747   1.00 0.00 ? 12  LYS A HB3  2  
ATOM 2025  H HG2  . LYS A 1 12  ? -22.974 13.069  -0.860  1.00 0.00 ? 12  LYS A HG2  2  
ATOM 2026  H HG3  . LYS A 1 12  ? -23.307 14.646  -0.142  1.00 0.00 ? 12  LYS A HG3  2  
ATOM 2027  H HD2  . LYS A 1 12  ? -20.726 14.809  0.075   1.00 0.00 ? 12  LYS A HD2  2  
ATOM 2028  H HD3  . LYS A 1 12  ? -20.714 13.526  -1.137  1.00 0.00 ? 12  LYS A HD3  2  
ATOM 2029  H HE2  . LYS A 1 12  ? -20.548 15.597  -2.298  1.00 0.00 ? 12  LYS A HE2  2  
ATOM 2030  H HE3  . LYS A 1 12  ? -22.179 14.982  -2.557  1.00 0.00 ? 12  LYS A HE3  2  
ATOM 2031  H HZ1  . LYS A 1 12  ? -22.931 16.460  -0.753  1.00 0.00 ? 12  LYS A HZ1  2  
ATOM 2032  H HZ2  . LYS A 1 12  ? -22.283 17.307  -2.066  1.00 0.00 ? 12  LYS A HZ2  2  
ATOM 2033  H HZ3  . LYS A 1 12  ? -21.372 17.112  -0.654  1.00 0.00 ? 12  LYS A HZ3  2  
ATOM 2034  N N    . GLU A 1 13  ? -19.545 12.103  1.503   1.00 0.00 ? 13  GLU A N    2  
ATOM 2035  C CA   . GLU A 1 13  ? -18.139 12.104  1.115   1.00 0.00 ? 13  GLU A CA   2  
ATOM 2036  C C    . GLU A 1 13  ? -17.585 10.682  1.079   1.00 0.00 ? 13  GLU A C    2  
ATOM 2037  O O    . GLU A 1 13  ? -16.932 10.283  0.114   1.00 0.00 ? 13  GLU A O    2  
ATOM 2038  C CB   . GLU A 1 13  ? -17.320 12.958  2.085   1.00 0.00 ? 13  GLU A CB   2  
ATOM 2039  C CG   . GLU A 1 13  ? -15.829 12.672  2.037   1.00 0.00 ? 13  GLU A CG   2  
ATOM 2040  C CD   . GLU A 1 13  ? -15.192 13.113  0.733   1.00 0.00 ? 13  GLU A CD   2  
ATOM 2041  O OE1  . GLU A 1 13  ? -15.601 12.602  -0.330  1.00 0.00 ? 13  GLU A OE1  2  
ATOM 2042  O OE2  . GLU A 1 13  ? -14.285 13.971  0.777   1.00 0.00 ? 13  GLU A OE2  2  
ATOM 2043  H H    . GLU A 1 13  ? -19.791 12.374  2.412   1.00 0.00 ? 13  GLU A H    2  
ATOM 2044  H HA   . GLU A 1 13  ? -18.068 12.530  0.126   1.00 0.00 ? 13  GLU A HA   2  
ATOM 2045  H HB2  . GLU A 1 13  ? -17.475 14.000  1.847   1.00 0.00 ? 13  GLU A HB2  2  
ATOM 2046  H HB3  . GLU A 1 13  ? -17.668 12.772  3.091   1.00 0.00 ? 13  GLU A HB3  2  
ATOM 2047  H HG2  . GLU A 1 13  ? -15.348 13.197  2.849   1.00 0.00 ? 13  GLU A HG2  2  
ATOM 2048  H HG3  . GLU A 1 13  ? -15.674 11.610  2.154   1.00 0.00 ? 13  GLU A HG3  2  
ATOM 2049  N N    . LEU A 1 14  ? -17.849 9.923   2.136   1.00 0.00 ? 14  LEU A N    2  
ATOM 2050  C CA   . LEU A 1 14  ? -17.377 8.546   2.227   1.00 0.00 ? 14  LEU A CA   2  
ATOM 2051  C C    . LEU A 1 14  ? -17.321 7.898   0.847   1.00 0.00 ? 14  LEU A C    2  
ATOM 2052  O O    . LEU A 1 14  ? -16.243 7.619   0.324   1.00 0.00 ? 14  LEU A O    2  
ATOM 2053  C CB   . LEU A 1 14  ? -18.288 7.733   3.148   1.00 0.00 ? 14  LEU A CB   2  
ATOM 2054  C CG   . LEU A 1 14  ? -18.058 6.222   3.156   1.00 0.00 ? 14  LEU A CG   2  
ATOM 2055  C CD1  . LEU A 1 14  ? -17.012 5.846   4.194   1.00 0.00 ? 14  LEU A CD1  2  
ATOM 2056  C CD2  . LEU A 1 14  ? -19.363 5.485   3.421   1.00 0.00 ? 14  LEU A CD2  2  
ATOM 2057  H H    . LEU A 1 14  ? -18.374 10.297  2.874   1.00 0.00 ? 14  LEU A H    2  
ATOM 2058  H HA   . LEU A 1 14  ? -16.381 8.564   2.643   1.00 0.00 ? 14  LEU A HA   2  
ATOM 2059  H HB2  . LEU A 1 14  ? -18.146 8.094   4.155   1.00 0.00 ? 14  LEU A HB2  2  
ATOM 2060  H HB3  . LEU A 1 14  ? -19.309 7.912   2.844   1.00 0.00 ? 14  LEU A HB3  2  
ATOM 2061  H HG   . LEU A 1 14  ? -17.691 5.915   2.186   1.00 0.00 ? 14  LEU A HG   2  
ATOM 2062  H HD11 . LEU A 1 14  ? -17.033 4.779   4.356   1.00 0.00 ? 14  LEU A HD11 2  
ATOM 2063  H HD12 . LEU A 1 14  ? -17.227 6.355   5.122   1.00 0.00 ? 14  LEU A HD12 2  
ATOM 2064  H HD13 . LEU A 1 14  ? -16.034 6.139   3.842   1.00 0.00 ? 14  LEU A HD13 2  
ATOM 2065  H HD21 . LEU A 1 14  ? -19.344 4.529   2.919   1.00 0.00 ? 14  LEU A HD21 2  
ATOM 2066  H HD22 . LEU A 1 14  ? -20.190 6.072   3.046   1.00 0.00 ? 14  LEU A HD22 2  
ATOM 2067  H HD23 . LEU A 1 14  ? -19.482 5.333   4.483   1.00 0.00 ? 14  LEU A HD23 2  
ATOM 2068  N N    . GLY A 1 15  ? -18.491 7.662   0.262   1.00 0.00 ? 15  GLY A N    2  
ATOM 2069  C CA   . GLY A 1 15  ? -18.553 7.051   -1.053  1.00 0.00 ? 15  GLY A CA   2  
ATOM 2070  C C    . GLY A 1 15  ? -17.871 7.890   -2.115  1.00 0.00 ? 15  GLY A C    2  
ATOM 2071  O O    . GLY A 1 15  ? -17.016 7.396   -2.851  1.00 0.00 ? 15  GLY A O    2  
ATOM 2072  H H    . GLY A 1 15  ? -19.319 7.906   0.726   1.00 0.00 ? 15  GLY A H    2  
ATOM 2073  H HA2  . GLY A 1 15  ? -18.075 6.083   -1.011  1.00 0.00 ? 15  GLY A HA2  2  
ATOM 2074  H HA3  . GLY A 1 15  ? -19.590 6.918   -1.327  1.00 0.00 ? 15  GLY A HA3  2  
ATOM 2075  N N    . ASP A 1 16  ? -18.250 9.160   -2.198  1.00 0.00 ? 16  ASP A N    2  
ATOM 2076  C CA   . ASP A 1 16  ? -17.669 10.069  -3.179  1.00 0.00 ? 16  ASP A CA   2  
ATOM 2077  C C    . ASP A 1 16  ? -16.173 9.815   -3.336  1.00 0.00 ? 16  ASP A C    2  
ATOM 2078  O O    . ASP A 1 16  ? -15.708 9.428   -4.408  1.00 0.00 ? 16  ASP A O    2  
ATOM 2079  C CB   . ASP A 1 16  ? -17.912 11.522  -2.766  1.00 0.00 ? 16  ASP A CB   2  
ATOM 2080  C CG   . ASP A 1 16  ? -17.229 12.509  -3.692  1.00 0.00 ? 16  ASP A CG   2  
ATOM 2081  O OD1  . ASP A 1 16  ? -15.991 12.429  -3.835  1.00 0.00 ? 16  ASP A OD1  2  
ATOM 2082  O OD2  . ASP A 1 16  ? -17.933 13.362  -4.273  1.00 0.00 ? 16  ASP A OD2  2  
ATOM 2083  H H    . ASP A 1 16  ? -18.937 9.495   -1.583  1.00 0.00 ? 16  ASP A H    2  
ATOM 2084  H HA   . ASP A 1 16  ? -18.153 9.889   -4.126  1.00 0.00 ? 16  ASP A HA   2  
ATOM 2085  H HB2  . ASP A 1 16  ? -18.974 11.720  -2.778  1.00 0.00 ? 16  ASP A HB2  2  
ATOM 2086  H HB3  . ASP A 1 16  ? -17.533 11.673  -1.765  1.00 0.00 ? 16  ASP A HB3  2  
ATOM 2087  N N    . VAL A 1 17  ? -15.424 10.037  -2.260  1.00 0.00 ? 17  VAL A N    2  
ATOM 2088  C CA   . VAL A 1 17  ? -13.980 9.833   -2.279  1.00 0.00 ? 17  VAL A CA   2  
ATOM 2089  C C    . VAL A 1 17  ? -13.602 8.665   -3.183  1.00 0.00 ? 17  VAL A C    2  
ATOM 2090  O O    . VAL A 1 17  ? -14.063 7.540   -2.987  1.00 0.00 ? 17  VAL A O    2  
ATOM 2091  C CB   . VAL A 1 17  ? -13.433 9.571   -0.863  1.00 0.00 ? 17  VAL A CB   2  
ATOM 2092  C CG1  . VAL A 1 17  ? -11.934 9.315   -0.909  1.00 0.00 ? 17  VAL A CG1  2  
ATOM 2093  C CG2  . VAL A 1 17  ? -13.754 10.738  0.057   1.00 0.00 ? 17  VAL A CG2  2  
ATOM 2094  H H    . VAL A 1 17  ? -15.852 10.346  -1.435  1.00 0.00 ? 17  VAL A H    2  
ATOM 2095  H HA   . VAL A 1 17  ? -13.520 10.734  -2.659  1.00 0.00 ? 17  VAL A HA   2  
ATOM 2096  H HB   . VAL A 1 17  ? -13.914 8.687   -0.471  1.00 0.00 ? 17  VAL A HB   2  
ATOM 2097  H HG11 . VAL A 1 17  ? -11.406 10.242  -0.746  1.00 0.00 ? 17  VAL A HG11 2  
ATOM 2098  H HG12 . VAL A 1 17  ? -11.666 8.606   -0.140  1.00 0.00 ? 17  VAL A HG12 2  
ATOM 2099  H HG13 . VAL A 1 17  ? -11.667 8.914   -1.876  1.00 0.00 ? 17  VAL A HG13 2  
ATOM 2100  H HG21 . VAL A 1 17  ? -14.786 10.676  0.369   1.00 0.00 ? 17  VAL A HG21 2  
ATOM 2101  H HG22 . VAL A 1 17  ? -13.113 10.700  0.926   1.00 0.00 ? 17  VAL A HG22 2  
ATOM 2102  H HG23 . VAL A 1 17  ? -13.593 11.667  -0.469  1.00 0.00 ? 17  VAL A HG23 2  
ATOM 2103  N N    . LEU A 1 18  ? -12.760 8.939   -4.173  1.00 0.00 ? 18  LEU A N    2  
ATOM 2104  C CA   . LEU A 1 18  ? -12.318 7.910   -5.108  1.00 0.00 ? 18  LEU A CA   2  
ATOM 2105  C C    . LEU A 1 18  ? -10.874 7.507   -4.831  1.00 0.00 ? 18  LEU A C    2  
ATOM 2106  O O    . LEU A 1 18  ? -9.953  7.943   -5.522  1.00 0.00 ? 18  LEU A O    2  
ATOM 2107  C CB   . LEU A 1 18  ? -12.453 8.411   -6.548  1.00 0.00 ? 18  LEU A CB   2  
ATOM 2108  C CG   . LEU A 1 18  ? -12.737 7.343   -7.605  1.00 0.00 ? 18  LEU A CG   2  
ATOM 2109  C CD1  . LEU A 1 18  ? -13.329 7.975   -8.856  1.00 0.00 ? 18  LEU A CD1  2  
ATOM 2110  C CD2  . LEU A 1 18  ? -11.468 6.576   -7.943  1.00 0.00 ? 18  LEU A CD2  2  
ATOM 2111  H H    . LEU A 1 18  ? -12.427 9.854   -4.278  1.00 0.00 ? 18  LEU A H    2  
ATOM 2112  H HA   . LEU A 1 18  ? -12.953 7.047   -4.975  1.00 0.00 ? 18  LEU A HA   2  
ATOM 2113  H HB2  . LEU A 1 18  ? -13.261 9.126   -6.575  1.00 0.00 ? 18  LEU A HB2  2  
ATOM 2114  H HB3  . LEU A 1 18  ? -11.529 8.903   -6.813  1.00 0.00 ? 18  LEU A HB3  2  
ATOM 2115  H HG   . LEU A 1 18  ? -13.460 6.641   -7.213  1.00 0.00 ? 18  LEU A HG   2  
ATOM 2116  H HD11 . LEU A 1 18  ? -13.389 9.045   -8.724  1.00 0.00 ? 18  LEU A HD11 2  
ATOM 2117  H HD12 . LEU A 1 18  ? -14.318 7.577   -9.026  1.00 0.00 ? 18  LEU A HD12 2  
ATOM 2118  H HD13 . LEU A 1 18  ? -12.700 7.751   -9.704  1.00 0.00 ? 18  LEU A HD13 2  
ATOM 2119  H HD21 . LEU A 1 18  ? -11.702 5.528   -8.062  1.00 0.00 ? 18  LEU A HD21 2  
ATOM 2120  H HD22 . LEU A 1 18  ? -10.751 6.695   -7.143  1.00 0.00 ? 18  LEU A HD22 2  
ATOM 2121  H HD23 . LEU A 1 18  ? -11.049 6.958   -8.862  1.00 0.00 ? 18  LEU A HD23 2  
ATOM 2122  N N    . VAL A 1 19  ? -10.683 6.668   -3.817  1.00 0.00 ? 19  VAL A N    2  
ATOM 2123  C CA   . VAL A 1 19  ? -9.351  6.202   -3.451  1.00 0.00 ? 19  VAL A CA   2  
ATOM 2124  C C    . VAL A 1 19  ? -8.694  5.453   -4.605  1.00 0.00 ? 19  VAL A C    2  
ATOM 2125  O O    . VAL A 1 19  ? -9.320  4.609   -5.246  1.00 0.00 ? 19  VAL A O    2  
ATOM 2126  C CB   . VAL A 1 19  ? -9.399  5.282   -2.216  1.00 0.00 ? 19  VAL A CB   2  
ATOM 2127  C CG1  . VAL A 1 19  ? -7.995  4.852   -1.817  1.00 0.00 ? 19  VAL A CG1  2  
ATOM 2128  C CG2  . VAL A 1 19  ? -10.101 5.978   -1.060  1.00 0.00 ? 19  VAL A CG2  2  
ATOM 2129  H H    . VAL A 1 19  ? -11.457 6.355   -3.304  1.00 0.00 ? 19  VAL A H    2  
ATOM 2130  H HA   . VAL A 1 19  ? -8.751  7.067   -3.207  1.00 0.00 ? 19  VAL A HA   2  
ATOM 2131  H HB   . VAL A 1 19  ? -9.963  4.398   -2.473  1.00 0.00 ? 19  VAL A HB   2  
ATOM 2132  H HG11 . VAL A 1 19  ? -7.348  4.889   -2.681  1.00 0.00 ? 19  VAL A HG11 2  
ATOM 2133  H HG12 . VAL A 1 19  ? -7.618  5.516   -1.054  1.00 0.00 ? 19  VAL A HG12 2  
ATOM 2134  H HG13 . VAL A 1 19  ? -8.024  3.842   -1.434  1.00 0.00 ? 19  VAL A HG13 2  
ATOM 2135  H HG21 . VAL A 1 19  ? -10.826 6.677   -1.449  1.00 0.00 ? 19  VAL A HG21 2  
ATOM 2136  H HG22 . VAL A 1 19  ? -10.603 5.242   -0.448  1.00 0.00 ? 19  VAL A HG22 2  
ATOM 2137  H HG23 . VAL A 1 19  ? -9.374  6.507   -0.463  1.00 0.00 ? 19  VAL A HG23 2  
ATOM 2138  N N    . ARG A 1 20  ? -7.429  5.768   -4.863  1.00 0.00 ? 20  ARG A N    2  
ATOM 2139  C CA   . ARG A 1 20  ? -6.686  5.125   -5.940  1.00 0.00 ? 20  ARG A CA   2  
ATOM 2140  C C    . ARG A 1 20  ? -5.519  4.313   -5.387  1.00 0.00 ? 20  ARG A C    2  
ATOM 2141  O O    . ARG A 1 20  ? -4.546  4.871   -4.879  1.00 0.00 ? 20  ARG A O    2  
ATOM 2142  C CB   . ARG A 1 20  ? -6.170  6.173   -6.928  1.00 0.00 ? 20  ARG A CB   2  
ATOM 2143  C CG   . ARG A 1 20  ? -5.214  5.610   -7.968  1.00 0.00 ? 20  ARG A CG   2  
ATOM 2144  C CD   . ARG A 1 20  ? -5.963  5.055   -9.169  1.00 0.00 ? 20  ARG A CD   2  
ATOM 2145  N NE   . ARG A 1 20  ? -6.819  6.060   -9.794  1.00 0.00 ? 20  ARG A NE   2  
ATOM 2146  C CZ   . ARG A 1 20  ? -7.590  5.816   -10.848 1.00 0.00 ? 20  ARG A CZ   2  
ATOM 2147  N NH1  . ARG A 1 20  ? -7.612  4.607   -11.392 1.00 0.00 ? 20  ARG A NH1  2  
ATOM 2148  N NH2  . ARG A 1 20  ? -8.341  6.783   -11.360 1.00 0.00 ? 20  ARG A NH2  2  
ATOM 2149  H H    . ARG A 1 20  ? -6.984  6.449   -4.316  1.00 0.00 ? 20  ARG A H    2  
ATOM 2150  H HA   . ARG A 1 20  ? -7.361  4.458   -6.456  1.00 0.00 ? 20  ARG A HA   2  
ATOM 2151  H HB2  . ARG A 1 20  ? -7.012  6.610   -7.445  1.00 0.00 ? 20  ARG A HB2  2  
ATOM 2152  H HB3  . ARG A 1 20  ? -5.655  6.945   -6.378  1.00 0.00 ? 20  ARG A HB3  2  
ATOM 2153  H HG2  . ARG A 1 20  ? -4.556  6.398   -8.302  1.00 0.00 ? 20  ARG A HG2  2  
ATOM 2154  H HG3  . ARG A 1 20  ? -4.634  4.819   -7.519  1.00 0.00 ? 20  ARG A HG3  2  
ATOM 2155  H HD2  . ARG A 1 20  ? -5.243  4.707   -9.896  1.00 0.00 ? 20  ARG A HD2  2  
ATOM 2156  H HD3  . ARG A 1 20  ? -6.574  4.226   -8.844  1.00 0.00 ? 20  ARG A HD3  2  
ATOM 2157  H HE   . ARG A 1 20  ? -6.817  6.960   -9.408  1.00 0.00 ? 20  ARG A HE   2  
ATOM 2158  H HH11 . ARG A 1 20  ? -7.048  3.876   -11.008 1.00 0.00 ? 20  ARG A HH11 2  
ATOM 2159  H HH12 . ARG A 1 20  ? -8.195  4.426   -12.185 1.00 0.00 ? 20  ARG A HH12 2  
ATOM 2160  H HH21 . ARG A 1 20  ? -8.326  7.696   -10.953 1.00 0.00 ? 20  ARG A HH21 2  
ATOM 2161  H HH22 . ARG A 1 20  ? -8.920  6.599   -12.153 1.00 0.00 ? 20  ARG A HH22 2  
ATOM 2162  N N    . LEU A 1 21  ? -5.624  2.992   -5.488  1.00 0.00 ? 21  LEU A N    2  
ATOM 2163  C CA   . LEU A 1 21  ? -4.577  2.102   -4.997  1.00 0.00 ? 21  LEU A CA   2  
ATOM 2164  C C    . LEU A 1 21  ? -3.557  1.806   -6.092  1.00 0.00 ? 21  LEU A C    2  
ATOM 2165  O O    . LEU A 1 21  ? -3.915  1.370   -7.187  1.00 0.00 ? 21  LEU A O    2  
ATOM 2166  C CB   . LEU A 1 21  ? -5.189  0.797   -4.487  1.00 0.00 ? 21  LEU A CB   2  
ATOM 2167  C CG   . LEU A 1 21  ? -4.213  -0.204  -3.867  1.00 0.00 ? 21  LEU A CG   2  
ATOM 2168  C CD1  . LEU A 1 21  ? -3.303  0.488   -2.864  1.00 0.00 ? 21  LEU A CD1  2  
ATOM 2169  C CD2  . LEU A 1 21  ? -4.969  -1.346  -3.204  1.00 0.00 ? 21  LEU A CD2  2  
ATOM 2170  H H    . LEU A 1 21  ? -6.423  2.606   -5.902  1.00 0.00 ? 21  LEU A H    2  
ATOM 2171  H HA   . LEU A 1 21  ? -4.076  2.599   -4.180  1.00 0.00 ? 21  LEU A HA   2  
ATOM 2172  H HB2  . LEU A 1 21  ? -5.925  1.047   -3.739  1.00 0.00 ? 21  LEU A HB2  2  
ATOM 2173  H HB3  . LEU A 1 21  ? -5.676  0.312   -5.321  1.00 0.00 ? 21  LEU A HB3  2  
ATOM 2174  H HG   . LEU A 1 21  ? -3.591  -0.622  -4.647  1.00 0.00 ? 21  LEU A HG   2  
ATOM 2175  H HD11 . LEU A 1 21  ? -2.728  -0.252  -2.329  1.00 0.00 ? 21  LEU A HD11 2  
ATOM 2176  H HD12 . LEU A 1 21  ? -3.902  1.053   -2.165  1.00 0.00 ? 21  LEU A HD12 2  
ATOM 2177  H HD13 . LEU A 1 21  ? -2.634  1.156   -3.386  1.00 0.00 ? 21  LEU A HD13 2  
ATOM 2178  H HD21 . LEU A 1 21  ? -5.908  -1.500  -3.716  1.00 0.00 ? 21  LEU A HD21 2  
ATOM 2179  H HD22 . LEU A 1 21  ? -5.160  -1.099  -2.170  1.00 0.00 ? 21  LEU A HD22 2  
ATOM 2180  H HD23 . LEU A 1 21  ? -4.378  -2.248  -3.257  1.00 0.00 ? 21  LEU A HD23 2  
ATOM 2181  N N    . HIS A 1 22  ? -2.285  2.043   -5.789  1.00 0.00 ? 22  HIS A N    2  
ATOM 2182  C CA   . HIS A 1 22  ? -1.212  1.799   -6.746  1.00 0.00 ? 22  HIS A CA   2  
ATOM 2183  C C    . HIS A 1 22  ? -0.610  0.412   -6.544  1.00 0.00 ? 22  HIS A C    2  
ATOM 2184  O O    . HIS A 1 22  ? -0.817  -0.221  -5.510  1.00 0.00 ? 22  HIS A O    2  
ATOM 2185  C CB   . HIS A 1 22  ? -0.125  2.865   -6.609  1.00 0.00 ? 22  HIS A CB   2  
ATOM 2186  C CG   . HIS A 1 22  ? -0.644  4.266   -6.708  1.00 0.00 ? 22  HIS A CG   2  
ATOM 2187  N ND1  . HIS A 1 22  ? -0.134  5.197   -7.589  1.00 0.00 ? 22  HIS A ND1  2  
ATOM 2188  C CD2  . HIS A 1 22  ? -1.635  4.893   -6.033  1.00 0.00 ? 22  HIS A CD2  2  
ATOM 2189  C CE1  . HIS A 1 22  ? -0.788  6.336   -7.449  1.00 0.00 ? 22  HIS A CE1  2  
ATOM 2190  N NE2  . HIS A 1 22  ? -1.705  6.178   -6.511  1.00 0.00 ? 22  HIS A NE2  2  
ATOM 2191  H H    . HIS A 1 22  ? -2.063  2.390   -4.900  1.00 0.00 ? 22  HIS A H    2  
ATOM 2192  H HA   . HIS A 1 22  ? -1.634  1.853   -7.738  1.00 0.00 ? 22  HIS A HA   2  
ATOM 2193  H HB2  . HIS A 1 22  ? 0.356   2.757   -5.648  1.00 0.00 ? 22  HIS A HB2  2  
ATOM 2194  H HB3  . HIS A 1 22  ? 0.608   2.725   -7.391  1.00 0.00 ? 22  HIS A HB3  2  
ATOM 2195  H HD1  . HIS A 1 22  ? 0.599   5.046   -8.220  1.00 0.00 ? 22  HIS A HD1  2  
ATOM 2196  H HD2  . HIS A 1 22  ? -2.257  4.463   -5.260  1.00 0.00 ? 22  HIS A HD2  2  
ATOM 2197  H HE1  . HIS A 1 22  ? -0.605  7.243   -8.006  1.00 0.00 ? 22  HIS A HE1  2  
ATOM 2198  H HE2  . HIS A 1 22  ? -2.271  6.891   -6.150  1.00 0.00 ? 22  HIS A HE2  2  
ATOM 2199  N N    . ASN A 1 23  ? 0.137   -0.055  -7.541  1.00 0.00 ? 23  ASN A N    2  
ATOM 2200  C CA   . ASN A 1 23  ? 0.768   -1.368  -7.473  1.00 0.00 ? 23  ASN A CA   2  
ATOM 2201  C C    . ASN A 1 23  ? 1.605   -1.504  -6.204  1.00 0.00 ? 23  ASN A C    2  
ATOM 2202  O O    . ASN A 1 23  ? 2.533   -0.733  -5.957  1.00 0.00 ? 23  ASN A O    2  
ATOM 2203  C CB   . ASN A 1 23  ? 1.647   -1.598  -8.704  1.00 0.00 ? 23  ASN A CB   2  
ATOM 2204  C CG   . ASN A 1 23  ? 1.783   -3.069  -9.050  1.00 0.00 ? 23  ASN A CG   2  
ATOM 2205  O OD1  . ASN A 1 23  ? 0.851   -3.851  -8.861  1.00 0.00 ? 23  ASN A OD1  2  
ATOM 2206  N ND2  . ASN A 1 23  ? 2.948   -3.451  -9.559  1.00 0.00 ? 23  ASN A ND2  2  
ATOM 2207  H H    . ASN A 1 23  ? 0.265   0.496   -8.341  1.00 0.00 ? 23  ASN A H    2  
ATOM 2208  H HA   . ASN A 1 23  ? -0.014  -2.111  -7.456  1.00 0.00 ? 23  ASN A HA   2  
ATOM 2209  H HB2  . ASN A 1 23  ? 1.211   -1.088  -9.551  1.00 0.00 ? 23  ASN A HB2  2  
ATOM 2210  H HB3  . ASN A 1 23  ? 2.632   -1.199  -8.516  1.00 0.00 ? 23  ASN A HB3  2  
ATOM 2211  H HD21 . ASN A 1 23  ? 3.645   -2.773  -9.682  1.00 0.00 ? 23  ASN A HD21 2  
ATOM 2212  H HD22 . ASN A 1 23  ? 3.063   -4.396  -9.793  1.00 0.00 ? 23  ASN A HD22 2  
ATOM 2213  N N    . PRO A 1 24  ? 1.271   -2.508  -5.380  1.00 0.00 ? 24  PRO A N    2  
ATOM 2214  C CA   . PRO A 1 24  ? 1.980   -2.770  -4.124  1.00 0.00 ? 24  PRO A CA   2  
ATOM 2215  C C    . PRO A 1 24  ? 3.392   -3.298  -4.354  1.00 0.00 ? 24  PRO A C    2  
ATOM 2216  O O    . PRO A 1 24  ? 3.588   -4.487  -4.608  1.00 0.00 ? 24  PRO A O    2  
ATOM 2217  C CB   . PRO A 1 24  ? 1.115   -3.835  -3.445  1.00 0.00 ? 24  PRO A CB   2  
ATOM 2218  C CG   . PRO A 1 24  ? 0.407   -4.518  -4.563  1.00 0.00 ? 24  PRO A CG   2  
ATOM 2219  C CD   . PRO A 1 24  ? 0.177   -3.466  -5.612  1.00 0.00 ? 24  PRO A CD   2  
ATOM 2220  H HA   . PRO A 1 24  ? 2.024   -1.888  -3.502  1.00 0.00 ? 24  PRO A HA   2  
ATOM 2221  H HB2  . PRO A 1 24  ? 1.748   -4.521  -2.899  1.00 0.00 ? 24  PRO A HB2  2  
ATOM 2222  H HB3  . PRO A 1 24  ? 0.420   -3.361  -2.768  1.00 0.00 ? 24  PRO A HB3  2  
ATOM 2223  H HG2  . PRO A 1 24  ? 1.023   -5.312  -4.957  1.00 0.00 ? 24  PRO A HG2  2  
ATOM 2224  H HG3  . PRO A 1 24  ? -0.536  -4.912  -4.214  1.00 0.00 ? 24  PRO A HG3  2  
ATOM 2225  H HD2  . PRO A 1 24  ? 0.244   -3.896  -6.600  1.00 0.00 ? 24  PRO A HD2  2  
ATOM 2226  H HD3  . PRO A 1 24  ? -0.784  -2.994  -5.468  1.00 0.00 ? 24  PRO A HD3  2  
ATOM 2227  N N    . VAL A 1 25  ? 4.374   -2.407  -4.264  1.00 0.00 ? 25  VAL A N    2  
ATOM 2228  C CA   . VAL A 1 25  ? 5.769   -2.783  -4.461  1.00 0.00 ? 25  VAL A CA   2  
ATOM 2229  C C    . VAL A 1 25  ? 6.207   -3.825  -3.437  1.00 0.00 ? 25  VAL A C    2  
ATOM 2230  O O    . VAL A 1 25  ? 6.269   -3.546  -2.240  1.00 0.00 ? 25  VAL A O    2  
ATOM 2231  C CB   . VAL A 1 25  ? 6.700   -1.560  -4.362  1.00 0.00 ? 25  VAL A CB   2  
ATOM 2232  C CG1  . VAL A 1 25  ? 8.147   -1.970  -4.589  1.00 0.00 ? 25  VAL A CG1  2  
ATOM 2233  C CG2  . VAL A 1 25  ? 6.279   -0.489  -5.358  1.00 0.00 ? 25  VAL A CG2  2  
ATOM 2234  H H    . VAL A 1 25  ? 4.155   -1.474  -4.059  1.00 0.00 ? 25  VAL A H    2  
ATOM 2235  H HA   . VAL A 1 25  ? 5.865   -3.203  -5.451  1.00 0.00 ? 25  VAL A HA   2  
ATOM 2236  H HB   . VAL A 1 25  ? 6.617   -1.149  -3.367  1.00 0.00 ? 25  VAL A HB   2  
ATOM 2237  H HG11 . VAL A 1 25  ? 8.684   -1.155  -5.050  1.00 0.00 ? 25  VAL A HG11 2  
ATOM 2238  H HG12 . VAL A 1 25  ? 8.604   -2.215  -3.641  1.00 0.00 ? 25  VAL A HG12 2  
ATOM 2239  H HG13 . VAL A 1 25  ? 8.179   -2.834  -5.237  1.00 0.00 ? 25  VAL A HG13 2  
ATOM 2240  H HG21 . VAL A 1 25  ? 5.277   -0.158  -5.126  1.00 0.00 ? 25  VAL A HG21 2  
ATOM 2241  H HG22 . VAL A 1 25  ? 6.958   0.348   -5.295  1.00 0.00 ? 25  VAL A HG22 2  
ATOM 2242  H HG23 . VAL A 1 25  ? 6.302   -0.897  -6.357  1.00 0.00 ? 25  VAL A HG23 2  
ATOM 2243  N N    . VAL A 1 26  ? 6.509   -5.027  -3.917  1.00 0.00 ? 26  VAL A N    2  
ATOM 2244  C CA   . VAL A 1 26  ? 6.943   -6.111  -3.044  1.00 0.00 ? 26  VAL A CA   2  
ATOM 2245  C C    . VAL A 1 26  ? 8.400   -5.935  -2.632  1.00 0.00 ? 26  VAL A C    2  
ATOM 2246  O O    . VAL A 1 26  ? 9.315   -6.321  -3.362  1.00 0.00 ? 26  VAL A O    2  
ATOM 2247  C CB   . VAL A 1 26  ? 6.776   -7.482  -3.726  1.00 0.00 ? 26  VAL A CB   2  
ATOM 2248  C CG1  . VAL A 1 26  ? 7.366   -7.457  -5.128  1.00 0.00 ? 26  VAL A CG1  2  
ATOM 2249  C CG2  . VAL A 1 26  ? 7.420   -8.576  -2.888  1.00 0.00 ? 26  VAL A CG2  2  
ATOM 2250  H H    . VAL A 1 26  ? 6.440   -5.188  -4.881  1.00 0.00 ? 26  VAL A H    2  
ATOM 2251  H HA   . VAL A 1 26  ? 6.324   -6.096  -2.159  1.00 0.00 ? 26  VAL A HA   2  
ATOM 2252  H HB   . VAL A 1 26  ? 5.720   -7.695  -3.808  1.00 0.00 ? 26  VAL A HB   2  
ATOM 2253  H HG11 . VAL A 1 26  ? 6.584   -7.247  -5.843  1.00 0.00 ? 26  VAL A HG11 2  
ATOM 2254  H HG12 . VAL A 1 26  ? 8.124   -6.689  -5.186  1.00 0.00 ? 26  VAL A HG12 2  
ATOM 2255  H HG13 . VAL A 1 26  ? 7.808   -8.417  -5.350  1.00 0.00 ? 26  VAL A HG13 2  
ATOM 2256  H HG21 . VAL A 1 26  ? 7.722   -8.168  -1.935  1.00 0.00 ? 26  VAL A HG21 2  
ATOM 2257  H HG22 . VAL A 1 26  ? 6.708   -9.373  -2.728  1.00 0.00 ? 26  VAL A HG22 2  
ATOM 2258  H HG23 . VAL A 1 26  ? 8.284   -8.965  -3.404  1.00 0.00 ? 26  VAL A HG23 2  
ATOM 2259  N N    . LEU A 1 27  ? 8.611   -5.351  -1.458  1.00 0.00 ? 27  LEU A N    2  
ATOM 2260  C CA   . LEU A 1 27  ? 9.958   -5.124  -0.947  1.00 0.00 ? 27  LEU A CA   2  
ATOM 2261  C C    . LEU A 1 27  ? 10.613  -6.438  -0.534  1.00 0.00 ? 27  LEU A C    2  
ATOM 2262  O O    . LEU A 1 27  ? 11.760  -6.712  -0.888  1.00 0.00 ? 27  LEU A O    2  
ATOM 2263  C CB   . LEU A 1 27  ? 9.918   -4.164  0.244   1.00 0.00 ? 27  LEU A CB   2  
ATOM 2264  C CG   . LEU A 1 27  ? 9.255   -2.810  -0.008  1.00 0.00 ? 27  LEU A CG   2  
ATOM 2265  C CD1  . LEU A 1 27  ? 9.114   -2.035  1.293   1.00 0.00 ? 27  LEU A CD1  2  
ATOM 2266  C CD2  . LEU A 1 27  ? 10.051  -2.007  -1.025  1.00 0.00 ? 27  LEU A CD2  2  
ATOM 2267  H H    . LEU A 1 27  ? 7.843   -5.065  -0.921  1.00 0.00 ? 27  LEU A H    2  
ATOM 2268  H HA   . LEU A 1 27  ? 10.542  -4.678  -1.738  1.00 0.00 ? 27  LEU A HA   2  
ATOM 2269  H HB2  . LEU A 1 27  ? 9.382   -4.652  1.043   1.00 0.00 ? 27  LEU A HB2  2  
ATOM 2270  H HB3  . LEU A 1 27  ? 10.937  -3.982  0.555   1.00 0.00 ? 27  LEU A HB3  2  
ATOM 2271  H HG   . LEU A 1 27  ? 8.264   -2.970  -0.409  1.00 0.00 ? 27  LEU A HG   2  
ATOM 2272  H HD11 . LEU A 1 27  ? 8.243   -2.383  1.827   1.00 0.00 ? 27  LEU A HD11 2  
ATOM 2273  H HD12 . LEU A 1 27  ? 9.006   -0.983  1.075   1.00 0.00 ? 27  LEU A HD12 2  
ATOM 2274  H HD13 . LEU A 1 27  ? 9.994   -2.187  1.900   1.00 0.00 ? 27  LEU A HD13 2  
ATOM 2275  H HD21 . LEU A 1 27  ? 9.375   -1.560  -1.739  1.00 0.00 ? 27  LEU A HD21 2  
ATOM 2276  H HD22 . LEU A 1 27  ? 10.739  -2.661  -1.542  1.00 0.00 ? 27  LEU A HD22 2  
ATOM 2277  H HD23 . LEU A 1 27  ? 10.604  -1.230  -0.518  1.00 0.00 ? 27  LEU A HD23 2  
ATOM 2278  N N    . THR A 1 28  ? 9.875   -7.250  0.217   1.00 0.00 ? 28  THR A N    2  
ATOM 2279  C CA   . THR A 1 28  ? 10.383  -8.537  0.678   1.00 0.00 ? 28  THR A CA   2  
ATOM 2280  C C    . THR A 1 28  ? 9.274   -9.582  0.720   1.00 0.00 ? 28  THR A C    2  
ATOM 2281  O O    . THR A 1 28  ? 8.086   -9.261  0.762   1.00 0.00 ? 28  THR A O    2  
ATOM 2282  C CB   . THR A 1 28  ? 11.017  -8.422  2.077   1.00 0.00 ? 28  THR A CB   2  
ATOM 2283  O OG1  . THR A 1 28  ? 10.374  -7.382  2.823   1.00 0.00 ? 28  THR A OG1  2  
ATOM 2284  C CG2  . THR A 1 28  ? 12.507  -8.131  1.973   1.00 0.00 ? 28  THR A CG2  2  
ATOM 2285  H H    . THR A 1 28  ? 8.968   -6.976  0.467   1.00 0.00 ? 28  THR A H    2  
ATOM 2286  H HA   . THR A 1 28  ? 11.145  -8.862  -0.015  1.00 0.00 ? 28  THR A HA   2  
ATOM 2287  H HB   . THR A 1 28  ? 10.884  -9.361  2.594   1.00 0.00 ? 28  THR A HB   2  
ATOM 2288  H HG1  . THR A 1 28  ? 10.985  -7.030  3.474   1.00 0.00 ? 28  THR A HG1  2  
ATOM 2289  H HG21 . THR A 1 28  ? 12.676  -7.384  1.211   1.00 0.00 ? 28  THR A HG21 2  
ATOM 2290  H HG22 . THR A 1 28  ? 13.033  -9.037  1.712   1.00 0.00 ? 28  THR A HG22 2  
ATOM 2291  H HG23 . THR A 1 28  ? 12.869  -7.765  2.922   1.00 0.00 ? 28  THR A HG23 2  
ATOM 2292  N N    . PRO A 1 29  ? 9.668   -10.864 0.708   1.00 0.00 ? 29  PRO A N    2  
ATOM 2293  C CA   . PRO A 1 29  ? 8.722   -11.983 0.745   1.00 0.00 ? 29  PRO A CA   2  
ATOM 2294  C C    . PRO A 1 29  ? 8.024   -12.108 2.095   1.00 0.00 ? 29  PRO A C    2  
ATOM 2295  O O    . PRO A 1 29  ? 7.230   -13.023 2.314   1.00 0.00 ? 29  PRO A O    2  
ATOM 2296  C CB   . PRO A 1 29  ? 9.607   -13.205 0.486   1.00 0.00 ? 29  PRO A CB   2  
ATOM 2297  C CG   . PRO A 1 29  ? 10.964  -12.793 0.942   1.00 0.00 ? 29  PRO A CG   2  
ATOM 2298  C CD   . PRO A 1 29  ? 11.067  -11.320 0.658   1.00 0.00 ? 29  PRO A CD   2  
ATOM 2299  H HA   . PRO A 1 29  ? 7.980   -11.902 -0.036  1.00 0.00 ? 29  PRO A HA   2  
ATOM 2300  H HB2  . PRO A 1 29  ? 9.238   -14.047 1.053   1.00 0.00 ? 29  PRO A HB2  2  
ATOM 2301  H HB3  . PRO A 1 29  ? 9.600   -13.442 -0.567  1.00 0.00 ? 29  PRO A HB3  2  
ATOM 2302  H HG2  . PRO A 1 29  ? 11.068  -12.979 2.000   1.00 0.00 ? 29  PRO A HG2  2  
ATOM 2303  H HG3  . PRO A 1 29  ? 11.717  -13.335 0.389   1.00 0.00 ? 29  PRO A HG3  2  
ATOM 2304  H HD2  . PRO A 1 29  ? 11.660  -10.830 1.416   1.00 0.00 ? 29  PRO A HD2  2  
ATOM 2305  H HD3  . PRO A 1 29  ? 11.491  -11.153 -0.322  1.00 0.00 ? 29  PRO A HD3  2  
ATOM 2306  N N    . THR A 1 30  ? 8.326   -11.182 3.000   1.00 0.00 ? 30  THR A N    2  
ATOM 2307  C CA   . THR A 1 30  ? 7.728   -11.188 4.329   1.00 0.00 ? 30  THR A CA   2  
ATOM 2308  C C    . THR A 1 30  ? 7.037   -9.863  4.628   1.00 0.00 ? 30  THR A C    2  
ATOM 2309  O O    . THR A 1 30  ? 6.270   -9.752  5.585   1.00 0.00 ? 30  THR A O    2  
ATOM 2310  C CB   . THR A 1 30  ? 8.783   -11.461 5.418   1.00 0.00 ? 30  THR A CB   2  
ATOM 2311  O OG1  . THR A 1 30  ? 9.813   -10.468 5.361   1.00 0.00 ? 30  THR A OG1  2  
ATOM 2312  C CG2  . THR A 1 30  ? 9.394   -12.843 5.245   1.00 0.00 ? 30  THR A CG2  2  
ATOM 2313  H H    . THR A 1 30  ? 8.966   -10.478 2.766   1.00 0.00 ? 30  THR A H    2  
ATOM 2314  H HA   . THR A 1 30  ? 6.995   -11.981 4.361   1.00 0.00 ? 30  THR A HA   2  
ATOM 2315  H HB   . THR A 1 30  ? 8.301   -11.414 6.384   1.00 0.00 ? 30  THR A HB   2  
ATOM 2316  H HG1  . THR A 1 30  ? 10.341  -10.508 6.163   1.00 0.00 ? 30  THR A HG1  2  
ATOM 2317  H HG21 . THR A 1 30  ? 10.440  -12.745 4.993   1.00 0.00 ? 30  THR A HG21 2  
ATOM 2318  H HG22 . THR A 1 30  ? 8.880   -13.368 4.454   1.00 0.00 ? 30  THR A HG22 2  
ATOM 2319  H HG23 . THR A 1 30  ? 9.297   -13.397 6.167   1.00 0.00 ? 30  THR A HG23 2  
ATOM 2320  N N    . THR A 1 31  ? 7.311   -8.858  3.802   1.00 0.00 ? 31  THR A N    2  
ATOM 2321  C CA   . THR A 1 31  ? 6.716   -7.540  3.978   1.00 0.00 ? 31  THR A CA   2  
ATOM 2322  C C    . THR A 1 31  ? 6.525   -6.839  2.637   1.00 0.00 ? 31  THR A C    2  
ATOM 2323  O O    . THR A 1 31  ? 7.368   -6.941  1.746   1.00 0.00 ? 31  THR A O    2  
ATOM 2324  C CB   . THR A 1 31  ? 7.581   -6.650  4.890   1.00 0.00 ? 31  THR A CB   2  
ATOM 2325  O OG1  . THR A 1 31  ? 8.099   -7.423  5.979   1.00 0.00 ? 31  THR A OG1  2  
ATOM 2326  C CG2  . THR A 1 31  ? 6.771   -5.482  5.432   1.00 0.00 ? 31  THR A CG2  2  
ATOM 2327  H H    . THR A 1 31  ? 7.930   -9.009  3.057   1.00 0.00 ? 31  THR A H    2  
ATOM 2328  H HA   . THR A 1 31  ? 5.751   -7.669  4.446   1.00 0.00 ? 31  THR A HA   2  
ATOM 2329  H HB   . THR A 1 31  ? 8.405   -6.260  4.311   1.00 0.00 ? 31  THR A HB   2  
ATOM 2330  H HG1  . THR A 1 31  ? 8.686   -8.102  5.638   1.00 0.00 ? 31  THR A HG1  2  
ATOM 2331  H HG21 . THR A 1 31  ? 7.338   -4.976  6.200   1.00 0.00 ? 31  THR A HG21 2  
ATOM 2332  H HG22 . THR A 1 31  ? 5.845   -5.848  5.850   1.00 0.00 ? 31  THR A HG22 2  
ATOM 2333  H HG23 . THR A 1 31  ? 6.556   -4.791  4.630   1.00 0.00 ? 31  THR A HG23 2  
ATOM 2334  N N    . VAL A 1 32  ? 5.411   -6.126  2.501   1.00 0.00 ? 32  VAL A N    2  
ATOM 2335  C CA   . VAL A 1 32  ? 5.111   -5.407  1.269   1.00 0.00 ? 32  VAL A CA   2  
ATOM 2336  C C    . VAL A 1 32  ? 4.681   -3.973  1.560   1.00 0.00 ? 32  VAL A C    2  
ATOM 2337  O O    . VAL A 1 32  ? 3.992   -3.710  2.545   1.00 0.00 ? 32  VAL A O    2  
ATOM 2338  C CB   . VAL A 1 32  ? 4.001   -6.110  0.464   1.00 0.00 ? 32  VAL A CB   2  
ATOM 2339  C CG1  . VAL A 1 32  ? 3.667   -5.317  -0.791  1.00 0.00 ? 32  VAL A CG1  2  
ATOM 2340  C CG2  . VAL A 1 32  ? 4.417   -7.530  0.113   1.00 0.00 ? 32  VAL A CG2  2  
ATOM 2341  H H    . VAL A 1 32  ? 4.777   -6.083  3.246   1.00 0.00 ? 32  VAL A H    2  
ATOM 2342  H HA   . VAL A 1 32  ? 6.007   -5.388  0.665   1.00 0.00 ? 32  VAL A HA   2  
ATOM 2343  H HB   . VAL A 1 32  ? 3.114   -6.158  1.079   1.00 0.00 ? 32  VAL A HB   2  
ATOM 2344  H HG11 . VAL A 1 32  ? 4.418   -5.504  -1.544  1.00 0.00 ? 32  VAL A HG11 2  
ATOM 2345  H HG12 . VAL A 1 32  ? 2.700   -5.622  -1.162  1.00 0.00 ? 32  VAL A HG12 2  
ATOM 2346  H HG13 . VAL A 1 32  ? 3.648   -4.263  -0.556  1.00 0.00 ? 32  VAL A HG13 2  
ATOM 2347  H HG21 . VAL A 1 32  ? 5.072   -7.511  -0.745  1.00 0.00 ? 32  VAL A HG21 2  
ATOM 2348  H HG22 . VAL A 1 32  ? 4.936   -7.972  0.952   1.00 0.00 ? 32  VAL A HG22 2  
ATOM 2349  H HG23 . VAL A 1 32  ? 3.540   -8.117  -0.115  1.00 0.00 ? 32  VAL A HG23 2  
ATOM 2350  N N    . GLN A 1 33  ? 5.093   -3.050  0.697   1.00 0.00 ? 33  GLN A N    2  
ATOM 2351  C CA   . GLN A 1 33  ? 4.751   -1.643  0.863   1.00 0.00 ? 33  GLN A CA   2  
ATOM 2352  C C    . GLN A 1 33  ? 3.454   -1.308  0.133   1.00 0.00 ? 33  GLN A C    2  
ATOM 2353  O O    . GLN A 1 33  ? 3.261   -1.694  -1.020  1.00 0.00 ? 33  GLN A O    2  
ATOM 2354  C CB   . GLN A 1 33  ? 5.885   -0.756  0.345   1.00 0.00 ? 33  GLN A CB   2  
ATOM 2355  C CG   . GLN A 1 33  ? 5.851   0.660   0.898   1.00 0.00 ? 33  GLN A CG   2  
ATOM 2356  C CD   . GLN A 1 33  ? 4.823   1.533   0.206   1.00 0.00 ? 33  GLN A CD   2  
ATOM 2357  O OE1  . GLN A 1 33  ? 4.500   1.323   -0.964  1.00 0.00 ? 33  GLN A OE1  2  
ATOM 2358  N NE2  . GLN A 1 33  ? 4.302   2.519   0.926   1.00 0.00 ? 33  GLN A NE2  2  
ATOM 2359  H H    . GLN A 1 33  ? 5.641   -3.322  -0.068  1.00 0.00 ? 33  GLN A H    2  
ATOM 2360  H HA   . GLN A 1 33  ? 4.614   -1.457  1.917   1.00 0.00 ? 33  GLN A HA   2  
ATOM 2361  H HB2  . GLN A 1 33  ? 6.829   -1.204  0.617   1.00 0.00 ? 33  GLN A HB2  2  
ATOM 2362  H HB3  . GLN A 1 33  ? 5.818   -0.700  -0.732  1.00 0.00 ? 33  GLN A HB3  2  
ATOM 2363  H HG2  . GLN A 1 33  ? 5.613   0.616   1.951   1.00 0.00 ? 33  GLN A HG2  2  
ATOM 2364  H HG3  . GLN A 1 33  ? 6.826   1.105   0.770   1.00 0.00 ? 33  GLN A HG3  2  
ATOM 2365  H HE21 . GLN A 1 33  ? 4.608   2.627   1.852   1.00 0.00 ? 33  GLN A HE21 2  
ATOM 2366  H HE22 . GLN A 1 33  ? 3.636   3.099   0.504   1.00 0.00 ? 33  GLN A HE22 2  
ATOM 2367  N N    . VAL A 1 34  ? 2.567   -0.589  0.813   1.00 0.00 ? 34  VAL A N    2  
ATOM 2368  C CA   . VAL A 1 34  ? 1.288   -0.202  0.230   1.00 0.00 ? 34  VAL A CA   2  
ATOM 2369  C C    . VAL A 1 34  ? 1.165   1.314   0.131   1.00 0.00 ? 34  VAL A C    2  
ATOM 2370  O O    . VAL A 1 34  ? 1.477   2.037   1.078   1.00 0.00 ? 34  VAL A O    2  
ATOM 2371  C CB   . VAL A 1 34  ? 0.107   -0.749  1.053   1.00 0.00 ? 34  VAL A CB   2  
ATOM 2372  C CG1  . VAL A 1 34  ? -1.213  -0.449  0.358   1.00 0.00 ? 34  VAL A CG1  2  
ATOM 2373  C CG2  . VAL A 1 34  ? 0.268   -2.244  1.286   1.00 0.00 ? 34  VAL A CG2  2  
ATOM 2374  H H    . VAL A 1 34  ? 2.778   -0.311  1.729   1.00 0.00 ? 34  VAL A H    2  
ATOM 2375  H HA   . VAL A 1 34  ? 1.233   -0.623  -0.764  1.00 0.00 ? 34  VAL A HA   2  
ATOM 2376  H HB   . VAL A 1 34  ? 0.103   -0.254  2.013   1.00 0.00 ? 34  VAL A HB   2  
ATOM 2377  H HG11 . VAL A 1 34  ? -1.580  -1.346  -0.120  1.00 0.00 ? 34  VAL A HG11 2  
ATOM 2378  H HG12 . VAL A 1 34  ? -1.934  -0.107  1.086   1.00 0.00 ? 34  VAL A HG12 2  
ATOM 2379  H HG13 . VAL A 1 34  ? -1.061  0.318   -0.387  1.00 0.00 ? 34  VAL A HG13 2  
ATOM 2380  H HG21 . VAL A 1 34  ? 0.974   -2.408  2.086   1.00 0.00 ? 34  VAL A HG21 2  
ATOM 2381  H HG22 . VAL A 1 34  ? -0.687  -2.671  1.556   1.00 0.00 ? 34  VAL A HG22 2  
ATOM 2382  H HG23 . VAL A 1 34  ? 0.630   -2.713  0.384   1.00 0.00 ? 34  VAL A HG23 2  
ATOM 2383  N N    . THR A 1 35  ? 0.708   1.792   -1.022  1.00 0.00 ? 35  THR A N    2  
ATOM 2384  C CA   . THR A 1 35  ? 0.544   3.223   -1.246  1.00 0.00 ? 35  THR A CA   2  
ATOM 2385  C C    . THR A 1 35  ? -0.762  3.520   -1.973  1.00 0.00 ? 35  THR A C    2  
ATOM 2386  O O    . THR A 1 35  ? -1.190  2.754   -2.837  1.00 0.00 ? 35  THR A O    2  
ATOM 2387  C CB   . THR A 1 35  ? 1.716   3.802   -2.062  1.00 0.00 ? 35  THR A CB   2  
ATOM 2388  O OG1  . THR A 1 35  ? 2.959   3.304   -1.554  1.00 0.00 ? 35  THR A OG1  2  
ATOM 2389  C CG2  . THR A 1 35  ? 1.713   5.322   -2.009  1.00 0.00 ? 35  THR A CG2  2  
ATOM 2390  H H    . THR A 1 35  ? 0.476   1.166   -1.739  1.00 0.00 ? 35  THR A H    2  
ATOM 2391  H HA   . THR A 1 35  ? 0.528   3.711   -0.282  1.00 0.00 ? 35  THR A HA   2  
ATOM 2392  H HB   . THR A 1 35  ? 1.606   3.491   -3.091  1.00 0.00 ? 35  THR A HB   2  
ATOM 2393  H HG1  . THR A 1 35  ? 3.661   3.925   -1.763  1.00 0.00 ? 35  THR A HG1  2  
ATOM 2394  H HG21 . THR A 1 35  ? 1.730   5.717   -3.014  1.00 0.00 ? 35  THR A HG21 2  
ATOM 2395  H HG22 . THR A 1 35  ? 2.584   5.665   -1.472  1.00 0.00 ? 35  THR A HG22 2  
ATOM 2396  H HG23 . THR A 1 35  ? 0.821   5.662   -1.505  1.00 0.00 ? 35  THR A HG23 2  
ATOM 2397  N N    . TRP A 1 36  ? -1.390  4.635   -1.619  1.00 0.00 ? 36  TRP A N    2  
ATOM 2398  C CA   . TRP A 1 36  ? -2.649  5.033   -2.239  1.00 0.00 ? 36  TRP A CA   2  
ATOM 2399  C C    . TRP A 1 36  ? -2.822  6.547   -2.196  1.00 0.00 ? 36  TRP A C    2  
ATOM 2400  O O    . TRP A 1 36  ? -2.214  7.229   -1.371  1.00 0.00 ? 36  TRP A O    2  
ATOM 2401  C CB   . TRP A 1 36  ? -3.825  4.352   -1.537  1.00 0.00 ? 36  TRP A CB   2  
ATOM 2402  C CG   . TRP A 1 36  ? -4.023  4.815   -0.126  1.00 0.00 ? 36  TRP A CG   2  
ATOM 2403  C CD1  . TRP A 1 36  ? -4.779  5.874   0.291   1.00 0.00 ? 36  TRP A CD1  2  
ATOM 2404  C CD2  . TRP A 1 36  ? -3.455  4.236   1.054   1.00 0.00 ? 36  TRP A CD2  2  
ATOM 2405  N NE1  . TRP A 1 36  ? -4.715  5.988   1.659   1.00 0.00 ? 36  TRP A NE1  2  
ATOM 2406  C CE2  . TRP A 1 36  ? -3.910  4.994   2.151   1.00 0.00 ? 36  TRP A CE2  2  
ATOM 2407  C CE3  . TRP A 1 36  ? -2.609  3.150   1.291   1.00 0.00 ? 36  TRP A CE3  2  
ATOM 2408  C CZ2  . TRP A 1 36  ? -3.544  4.700   3.461   1.00 0.00 ? 36  TRP A CZ2  2  
ATOM 2409  C CZ3  . TRP A 1 36  ? -2.246  2.859   2.592   1.00 0.00 ? 36  TRP A CZ3  2  
ATOM 2410  C CH2  . TRP A 1 36  ? -2.714  3.631   3.664   1.00 0.00 ? 36  TRP A CH2  2  
ATOM 2411  H H    . TRP A 1 36  ? -0.999  5.204   -0.924  1.00 0.00 ? 36  TRP A H    2  
ATOM 2412  H HA   . TRP A 1 36  ? -2.624  4.714   -3.271  1.00 0.00 ? 36  TRP A HA   2  
ATOM 2413  H HB2  . TRP A 1 36  ? -4.732  4.558   -2.086  1.00 0.00 ? 36  TRP A HB2  2  
ATOM 2414  H HB3  . TRP A 1 36  ? -3.655  3.285   -1.518  1.00 0.00 ? 36  TRP A HB3  2  
ATOM 2415  H HD1  . TRP A 1 36  ? -5.338  6.519   -0.369  1.00 0.00 ? 36  TRP A HD1  2  
ATOM 2416  H HE1  . TRP A 1 36  ? -5.173  6.669   2.195   1.00 0.00 ? 36  TRP A HE1  2  
ATOM 2417  H HE3  . TRP A 1 36  ? -2.238  2.543   0.478   1.00 0.00 ? 36  TRP A HE3  2  
ATOM 2418  H HZ2  . TRP A 1 36  ? -3.897  5.285   4.298   1.00 0.00 ? 36  TRP A HZ2  2  
ATOM 2419  H HZ3  . TRP A 1 36  ? -1.592  2.024   2.795   1.00 0.00 ? 36  TRP A HZ3  2  
ATOM 2420  H HH2  . TRP A 1 36  ? -2.405  3.368   4.664   1.00 0.00 ? 36  TRP A HH2  2  
ATOM 2421  N N    . THR A 1 37  ? -3.656  7.069   -3.090  1.00 0.00 ? 37  THR A N    2  
ATOM 2422  C CA   . THR A 1 37  ? -3.909  8.503   -3.154  1.00 0.00 ? 37  THR A CA   2  
ATOM 2423  C C    . THR A 1 37  ? -5.388  8.791   -3.384  1.00 0.00 ? 37  THR A C    2  
ATOM 2424  O O    . THR A 1 37  ? -6.051  8.105   -4.163  1.00 0.00 ? 37  THR A O    2  
ATOM 2425  C CB   . THR A 1 37  ? -3.088  9.168   -4.275  1.00 0.00 ? 37  THR A CB   2  
ATOM 2426  O OG1  . THR A 1 37  ? -3.076  10.589  -4.096  1.00 0.00 ? 37  THR A OG1  2  
ATOM 2427  C CG2  . THR A 1 37  ? -3.663  8.829   -5.642  1.00 0.00 ? 37  THR A CG2  2  
ATOM 2428  H H    . THR A 1 37  ? -4.112  6.474   -3.722  1.00 0.00 ? 37  THR A H    2  
ATOM 2429  H HA   . THR A 1 37  ? -3.610  8.937   -2.211  1.00 0.00 ? 37  THR A HA   2  
ATOM 2430  H HB   . THR A 1 37  ? -2.074  8.798   -4.226  1.00 0.00 ? 37  THR A HB   2  
ATOM 2431  H HG1  . THR A 1 37  ? -2.172  10.910  -4.147  1.00 0.00 ? 37  THR A HG1  2  
ATOM 2432  H HG21 . THR A 1 37  ? -3.892  7.775   -5.685  1.00 0.00 ? 37  THR A HG21 2  
ATOM 2433  H HG22 . THR A 1 37  ? -2.941  9.073   -6.407  1.00 0.00 ? 37  THR A HG22 2  
ATOM 2434  H HG23 . THR A 1 37  ? -4.565  9.400   -5.804  1.00 0.00 ? 37  THR A HG23 2  
ATOM 2435  N N    . VAL A 1 38  ? -5.900  9.810   -2.702  1.00 0.00 ? 38  VAL A N    2  
ATOM 2436  C CA   . VAL A 1 38  ? -7.302  10.191  -2.834  1.00 0.00 ? 38  VAL A CA   2  
ATOM 2437  C C    . VAL A 1 38  ? -7.440  11.575  -3.458  1.00 0.00 ? 38  VAL A C    2  
ATOM 2438  O O    . VAL A 1 38  ? -6.627  12.464  -3.206  1.00 0.00 ? 38  VAL A O    2  
ATOM 2439  C CB   . VAL A 1 38  ? -8.016  10.182  -1.469  1.00 0.00 ? 38  VAL A CB   2  
ATOM 2440  C CG1  . VAL A 1 38  ? -7.873  8.823   -0.800  1.00 0.00 ? 38  VAL A CG1  2  
ATOM 2441  C CG2  . VAL A 1 38  ? -7.471  11.286  -0.576  1.00 0.00 ? 38  VAL A CG2  2  
ATOM 2442  H H    . VAL A 1 38  ? -5.322  10.320  -2.097  1.00 0.00 ? 38  VAL A H    2  
ATOM 2443  H HA   . VAL A 1 38  ? -7.785  9.468   -3.475  1.00 0.00 ? 38  VAL A HA   2  
ATOM 2444  H HB   . VAL A 1 38  ? -9.067  10.367  -1.635  1.00 0.00 ? 38  VAL A HB   2  
ATOM 2445  H HG11 . VAL A 1 38  ? -8.804  8.558   -0.321  1.00 0.00 ? 38  VAL A HG11 2  
ATOM 2446  H HG12 . VAL A 1 38  ? -7.624  8.080   -1.543  1.00 0.00 ? 38  VAL A HG12 2  
ATOM 2447  H HG13 . VAL A 1 38  ? -7.088  8.869   -0.059  1.00 0.00 ? 38  VAL A HG13 2  
ATOM 2448  H HG21 . VAL A 1 38  ? -6.493  11.580  -0.925  1.00 0.00 ? 38  VAL A HG21 2  
ATOM 2449  H HG22 . VAL A 1 38  ? -8.136  12.137  -0.609  1.00 0.00 ? 38  VAL A HG22 2  
ATOM 2450  H HG23 . VAL A 1 38  ? -7.399  10.925  0.439   1.00 0.00 ? 38  VAL A HG23 2  
ATOM 2451  N N    . ASP A 1 39  ? -8.473  11.750  -4.274  1.00 0.00 ? 39  ASP A N    2  
ATOM 2452  C CA   . ASP A 1 39  ? -8.719  13.026  -4.934  1.00 0.00 ? 39  ASP A CA   2  
ATOM 2453  C C    . ASP A 1 39  ? -9.138  14.089  -3.923  1.00 0.00 ? 39  ASP A C    2  
ATOM 2454  O O    . ASP A 1 39  ? -8.528  15.155  -3.840  1.00 0.00 ? 39  ASP A O    2  
ATOM 2455  C CB   . ASP A 1 39  ? -9.799  12.871  -6.005  1.00 0.00 ? 39  ASP A CB   2  
ATOM 2456  C CG   . ASP A 1 39  ? -9.249  12.322  -7.307  1.00 0.00 ? 39  ASP A CG   2  
ATOM 2457  O OD1  . ASP A 1 39  ? -8.437  11.375  -7.254  1.00 0.00 ? 39  ASP A OD1  2  
ATOM 2458  O OD2  . ASP A 1 39  ? -9.629  12.840  -8.378  1.00 0.00 ? 39  ASP A OD2  2  
ATOM 2459  H H    . ASP A 1 39  ? -9.087  11.002  -4.435  1.00 0.00 ? 39  ASP A H    2  
ATOM 2460  H HA   . ASP A 1 39  ? -7.800  13.339  -5.405  1.00 0.00 ? 39  ASP A HA   2  
ATOM 2461  H HB2  . ASP A 1 39  ? -10.561 12.195  -5.645  1.00 0.00 ? 39  ASP A HB2  2  
ATOM 2462  H HB3  . ASP A 1 39  ? -10.244 13.836  -6.202  1.00 0.00 ? 39  ASP A HB3  2  
ATOM 2463  N N    . ARG A 1 40  ? -10.182 13.791  -3.156  1.00 0.00 ? 40  ARG A N    2  
ATOM 2464  C CA   . ARG A 1 40  ? -10.683 14.722  -2.152  1.00 0.00 ? 40  ARG A CA   2  
ATOM 2465  C C    . ARG A 1 40  ? -10.584 14.118  -0.754  1.00 0.00 ? 40  ARG A C    2  
ATOM 2466  O O    . ARG A 1 40  ? -11.567 13.605  -0.219  1.00 0.00 ? 40  ARG A O    2  
ATOM 2467  C CB   . ARG A 1 40  ? -12.134 15.099  -2.455  1.00 0.00 ? 40  ARG A CB   2  
ATOM 2468  C CG   . ARG A 1 40  ? -12.296 15.935  -3.714  1.00 0.00 ? 40  ARG A CG   2  
ATOM 2469  C CD   . ARG A 1 40  ? -13.700 15.813  -4.287  1.00 0.00 ? 40  ARG A CD   2  
ATOM 2470  N NE   . ARG A 1 40  ? -14.106 17.020  -5.002  1.00 0.00 ? 40  ARG A NE   2  
ATOM 2471  C CZ   . ARG A 1 40  ? -15.052 17.039  -5.934  1.00 0.00 ? 40  ARG A CZ   2  
ATOM 2472  N NH1  . ARG A 1 40  ? -15.686 15.922  -6.263  1.00 0.00 ? 40  ARG A NH1  2  
ATOM 2473  N NH2  . ARG A 1 40  ? -15.365 18.178  -6.540  1.00 0.00 ? 40  ARG A NH2  2  
ATOM 2474  H H    . ARG A 1 40  ? -10.627 12.925  -3.269  1.00 0.00 ? 40  ARG A H    2  
ATOM 2475  H HA   . ARG A 1 40  ? -10.074 15.612  -2.191  1.00 0.00 ? 40  ARG A HA   2  
ATOM 2476  H HB2  . ARG A 1 40  ? -12.712 14.194  -2.574  1.00 0.00 ? 40  ARG A HB2  2  
ATOM 2477  H HB3  . ARG A 1 40  ? -12.529 15.662  -1.623  1.00 0.00 ? 40  ARG A HB3  2  
ATOM 2478  H HG2  . ARG A 1 40  ? -12.106 16.971  -3.475  1.00 0.00 ? 40  ARG A HG2  2  
ATOM 2479  H HG3  . ARG A 1 40  ? -11.585 15.598  -4.453  1.00 0.00 ? 40  ARG A HG3  2  
ATOM 2480  H HD2  . ARG A 1 40  ? -13.724 14.977  -4.970  1.00 0.00 ? 40  ARG A HD2  2  
ATOM 2481  H HD3  . ARG A 1 40  ? -14.391 15.636  -3.476  1.00 0.00 ? 40  ARG A HD3  2  
ATOM 2482  H HE   . ARG A 1 40  ? -13.650 17.857  -4.774  1.00 0.00 ? 40  ARG A HE   2  
ATOM 2483  H HH11 . ARG A 1 40  ? -15.452 15.063  -5.807  1.00 0.00 ? 40  ARG A HH11 2  
ATOM 2484  H HH12 . ARG A 1 40  ? -16.398 15.940  -6.965  1.00 0.00 ? 40  ARG A HH12 2  
ATOM 2485  H HH21 . ARG A 1 40  ? -14.890 19.022  -6.294  1.00 0.00 ? 40  ARG A HH21 2  
ATOM 2486  H HH22 . ARG A 1 40  ? -16.077 18.191  -7.241  1.00 0.00 ? 40  ARG A HH22 2  
ATOM 2487  N N    . GLN A 1 41  ? -9.393  14.185  -0.170  1.00 0.00 ? 41  GLN A N    2  
ATOM 2488  C CA   . GLN A 1 41  ? -9.166  13.644  1.165   1.00 0.00 ? 41  GLN A CA   2  
ATOM 2489  C C    . GLN A 1 41  ? -10.221 14.149  2.144   1.00 0.00 ? 41  GLN A C    2  
ATOM 2490  O O    . GLN A 1 41  ? -10.388 15.352  2.347   1.00 0.00 ? 41  GLN A O    2  
ATOM 2491  C CB   . GLN A 1 41  ? -7.769  14.022  1.662   1.00 0.00 ? 41  GLN A CB   2  
ATOM 2492  C CG   . GLN A 1 41  ? -7.505  13.615  3.102   1.00 0.00 ? 41  GLN A CG   2  
ATOM 2493  C CD   . GLN A 1 41  ? -7.894  14.694  4.094   1.00 0.00 ? 41  GLN A CD   2  
ATOM 2494  O OE1  . GLN A 1 41  ? -8.297  15.792  3.708   1.00 0.00 ? 41  GLN A OE1  2  
ATOM 2495  N NE2  . GLN A 1 41  ? -7.776  14.386  5.380   1.00 0.00 ? 41  GLN A NE2  2  
ATOM 2496  H H    . GLN A 1 41  ? -8.649  14.606  -0.647  1.00 0.00 ? 41  GLN A H    2  
ATOM 2497  H HA   . GLN A 1 41  ? -9.237  12.568  1.103   1.00 0.00 ? 41  GLN A HA   2  
ATOM 2498  H HB2  . GLN A 1 41  ? -7.035  13.541  1.033   1.00 0.00 ? 41  GLN A HB2  2  
ATOM 2499  H HB3  . GLN A 1 41  ? -7.651  15.093  1.585   1.00 0.00 ? 41  GLN A HB3  2  
ATOM 2500  H HG2  . GLN A 1 41  ? -8.074  12.724  3.322   1.00 0.00 ? 41  GLN A HG2  2  
ATOM 2501  H HG3  . GLN A 1 41  ? -6.452  13.405  3.216   1.00 0.00 ? 41  GLN A HG3  2  
ATOM 2502  H HE21 . GLN A 1 41  ? -7.447  13.493  5.614   1.00 0.00 ? 41  GLN A HE21 2  
ATOM 2503  H HE22 . GLN A 1 41  ? -8.020  15.065  6.043   1.00 0.00 ? 41  GLN A HE22 2  
ATOM 2504  N N    . PRO A 1 42  ? -10.951 13.211  2.765   1.00 0.00 ? 42  PRO A N    2  
ATOM 2505  C CA   . PRO A 1 42  ? -12.002 13.538  3.733   1.00 0.00 ? 42  PRO A CA   2  
ATOM 2506  C C    . PRO A 1 42  ? -11.438 14.100  5.033   1.00 0.00 ? 42  PRO A C    2  
ATOM 2507  O O    . PRO A 1 42  ? -10.314 13.782  5.421   1.00 0.00 ? 42  PRO A O    2  
ATOM 2508  C CB   . PRO A 1 42  ? -12.685 12.191  3.984   1.00 0.00 ? 42  PRO A CB   2  
ATOM 2509  C CG   . PRO A 1 42  ? -11.640 11.174  3.677   1.00 0.00 ? 42  PRO A CG   2  
ATOM 2510  C CD   . PRO A 1 42  ? -10.806 11.759  2.571   1.00 0.00 ? 42  PRO A CD   2  
ATOM 2511  H HA   . PRO A 1 42  ? -12.717 14.235  3.321   1.00 0.00 ? 42  PRO A HA   2  
ATOM 2512  H HB2  . PRO A 1 42  ? -13.003 12.133  5.015   1.00 0.00 ? 42  PRO A HB2  2  
ATOM 2513  H HB3  . PRO A 1 42  ? -13.539 12.090  3.331   1.00 0.00 ? 42  PRO A HB3  2  
ATOM 2514  H HG2  . PRO A 1 42  ? -11.033 10.996  4.551   1.00 0.00 ? 42  PRO A HG2  2  
ATOM 2515  H HG3  . PRO A 1 42  ? -12.107 10.257  3.349   1.00 0.00 ? 42  PRO A HG3  2  
ATOM 2516  H HD2  . PRO A 1 42  ? -9.774  11.457  2.676   1.00 0.00 ? 42  PRO A HD2  2  
ATOM 2517  H HD3  . PRO A 1 42  ? -11.192 11.459  1.608   1.00 0.00 ? 42  PRO A HD3  2  
ATOM 2518  N N    . GLN A 1 43  ? -12.226 14.936  5.702   1.00 0.00 ? 43  GLN A N    2  
ATOM 2519  C CA   . GLN A 1 43  ? -11.803 15.542  6.959   1.00 0.00 ? 43  GLN A CA   2  
ATOM 2520  C C    . GLN A 1 43  ? -12.313 14.737  8.150   1.00 0.00 ? 43  GLN A C    2  
ATOM 2521  O O    . GLN A 1 43  ? -11.568 14.459  9.089   1.00 0.00 ? 43  GLN A O    2  
ATOM 2522  C CB   . GLN A 1 43  ? -12.307 16.984  7.050   1.00 0.00 ? 43  GLN A CB   2  
ATOM 2523  C CG   . GLN A 1 43  ? -11.400 17.989  6.359   1.00 0.00 ? 43  GLN A CG   2  
ATOM 2524  C CD   . GLN A 1 43  ? -10.081 18.179  7.082   1.00 0.00 ? 43  GLN A CD   2  
ATOM 2525  O OE1  . GLN A 1 43  ? -9.748  17.427  7.998   1.00 0.00 ? 43  GLN A OE1  2  
ATOM 2526  N NE2  . GLN A 1 43  ? -9.321  19.188  6.672   1.00 0.00 ? 43  GLN A NE2  2  
ATOM 2527  H H    . GLN A 1 43  ? -13.110 15.151  5.341   1.00 0.00 ? 43  GLN A H    2  
ATOM 2528  H HA   . GLN A 1 43  ? -10.724 15.546  6.979   1.00 0.00 ? 43  GLN A HA   2  
ATOM 2529  H HB2  . GLN A 1 43  ? -13.284 17.040  6.595   1.00 0.00 ? 43  GLN A HB2  2  
ATOM 2530  H HB3  . GLN A 1 43  ? -12.386 17.260  8.091   1.00 0.00 ? 43  GLN A HB3  2  
ATOM 2531  H HG2  . GLN A 1 43  ? -11.196 17.642  5.357   1.00 0.00 ? 43  GLN A HG2  2  
ATOM 2532  H HG3  . GLN A 1 43  ? -11.909 18.941  6.312   1.00 0.00 ? 43  GLN A HG3  2  
ATOM 2533  H HE21 . GLN A 1 43  ? -9.651  19.747  5.937   1.00 0.00 ? 43  GLN A HE21 2  
ATOM 2534  H HE22 . GLN A 1 43  ? -8.464  19.334  7.122   1.00 0.00 ? 43  GLN A HE22 2  
ATOM 2535  N N    . PHE A 1 44  ? -13.589 14.367  8.104   1.00 0.00 ? 44  PHE A N    2  
ATOM 2536  C CA   . PHE A 1 44  ? -14.199 13.595  9.180   1.00 0.00 ? 44  PHE A CA   2  
ATOM 2537  C C    . PHE A 1 44  ? -13.466 12.273  9.385   1.00 0.00 ? 44  PHE A C    2  
ATOM 2538  O O    . PHE A 1 44  ? -13.275 11.826  10.517  1.00 0.00 ? 44  PHE A O    2  
ATOM 2539  C CB   . PHE A 1 44  ? -15.675 13.330  8.873   1.00 0.00 ? 44  PHE A CB   2  
ATOM 2540  C CG   . PHE A 1 44  ? -15.911 12.784  7.494   1.00 0.00 ? 44  PHE A CG   2  
ATOM 2541  C CD1  . PHE A 1 44  ? -15.908 11.417  7.266   1.00 0.00 ? 44  PHE A CD1  2  
ATOM 2542  C CD2  . PHE A 1 44  ? -16.135 13.637  6.425   1.00 0.00 ? 44  PHE A CD2  2  
ATOM 2543  C CE1  . PHE A 1 44  ? -16.125 10.911  5.998   1.00 0.00 ? 44  PHE A CE1  2  
ATOM 2544  C CE2  . PHE A 1 44  ? -16.354 13.137  5.156   1.00 0.00 ? 44  PHE A CE2  2  
ATOM 2545  C CZ   . PHE A 1 44  ? -16.347 11.773  4.941   1.00 0.00 ? 44  PHE A CZ   2  
ATOM 2546  H H    . PHE A 1 44  ? -14.133 14.619  7.329   1.00 0.00 ? 44  PHE A H    2  
ATOM 2547  H HA   . PHE A 1 44  ? -14.128 14.177  10.086  1.00 0.00 ? 44  PHE A HA   2  
ATOM 2548  H HB2  . PHE A 1 44  ? -16.060 12.614  9.583   1.00 0.00 ? 44  PHE A HB2  2  
ATOM 2549  H HB3  . PHE A 1 44  ? -16.225 14.254  8.964   1.00 0.00 ? 44  PHE A HB3  2  
ATOM 2550  H HD1  . PHE A 1 44  ? -15.734 10.742  8.092   1.00 0.00 ? 44  PHE A HD1  2  
ATOM 2551  H HD2  . PHE A 1 44  ? -16.139 14.704  6.591   1.00 0.00 ? 44  PHE A HD2  2  
ATOM 2552  H HE1  . PHE A 1 44  ? -16.120 9.844   5.834   1.00 0.00 ? 44  PHE A HE1  2  
ATOM 2553  H HE2  . PHE A 1 44  ? -16.527 13.813  4.331   1.00 0.00 ? 44  PHE A HE2  2  
ATOM 2554  H HZ   . PHE A 1 44  ? -16.518 11.380  3.950   1.00 0.00 ? 44  PHE A HZ   2  
ATOM 2555  N N    . ILE A 1 45  ? -13.058 11.652  8.283   1.00 0.00 ? 45  ILE A N    2  
ATOM 2556  C CA   . ILE A 1 45  ? -12.345 10.382  8.342   1.00 0.00 ? 45  ILE A CA   2  
ATOM 2557  C C    . ILE A 1 45  ? -11.465 10.303  9.584   1.00 0.00 ? 45  ILE A C    2  
ATOM 2558  O O    . ILE A 1 45  ? -10.870 11.297  9.999   1.00 0.00 ? 45  ILE A O    2  
ATOM 2559  C CB   . ILE A 1 45  ? -11.470 10.170  7.092   1.00 0.00 ? 45  ILE A CB   2  
ATOM 2560  C CG1  . ILE A 1 45  ? -11.185 8.680   6.890   1.00 0.00 ? 45  ILE A CG1  2  
ATOM 2561  C CG2  . ILE A 1 45  ? -10.171 10.951  7.216   1.00 0.00 ? 45  ILE A CG2  2  
ATOM 2562  C CD1  . ILE A 1 45  ? -10.235 8.397   5.747   1.00 0.00 ? 45  ILE A CD1  2  
ATOM 2563  H H    . ILE A 1 45  ? -13.240 12.059  7.411   1.00 0.00 ? 45  ILE A H    2  
ATOM 2564  H HA   . ILE A 1 45  ? -13.079 9.590   8.382   1.00 0.00 ? 45  ILE A HA   2  
ATOM 2565  H HB   . ILE A 1 45  ? -12.008 10.546  6.235   1.00 0.00 ? 45  ILE A HB   2  
ATOM 2566  H HG12 . ILE A 1 45  ? -10.750 8.278   7.790   1.00 0.00 ? 45  ILE A HG12 2  
ATOM 2567  H HG13 . ILE A 1 45  ? -12.114 8.168   6.684   1.00 0.00 ? 45  ILE A HG13 2  
ATOM 2568  H HG21 . ILE A 1 45  ? -9.651  10.938  6.269   1.00 0.00 ? 45  ILE A HG21 2  
ATOM 2569  H HG22 . ILE A 1 45  ? -10.390 11.972  7.490   1.00 0.00 ? 45  ILE A HG22 2  
ATOM 2570  H HG23 . ILE A 1 45  ? -9.550  10.499  7.974   1.00 0.00 ? 45  ILE A HG23 2  
ATOM 2571  H HD11 . ILE A 1 45  ? -10.233 9.233   5.064   1.00 0.00 ? 45  ILE A HD11 2  
ATOM 2572  H HD12 . ILE A 1 45  ? -9.239  8.246   6.136   1.00 0.00 ? 45  ILE A HD12 2  
ATOM 2573  H HD13 . ILE A 1 45  ? -10.556 7.506   5.225   1.00 0.00 ? 45  ILE A HD13 2  
ATOM 2574  N N    . GLN A 1 46  ? -11.385 9.113   10.171  1.00 0.00 ? 46  GLN A N    2  
ATOM 2575  C CA   . GLN A 1 46  ? -10.576 8.904   11.366  1.00 0.00 ? 46  GLN A CA   2  
ATOM 2576  C C    . GLN A 1 46  ? -9.236  8.268   11.011  1.00 0.00 ? 46  GLN A C    2  
ATOM 2577  O O    . GLN A 1 46  ? -8.226  8.518   11.667  1.00 0.00 ? 46  GLN A O    2  
ATOM 2578  C CB   . GLN A 1 46  ? -11.324 8.021   12.366  1.00 0.00 ? 46  GLN A CB   2  
ATOM 2579  C CG   . GLN A 1 46  ? -12.185 8.804   13.344  1.00 0.00 ? 46  GLN A CG   2  
ATOM 2580  C CD   . GLN A 1 46  ? -11.394 9.332   14.524  1.00 0.00 ? 46  GLN A CD   2  
ATOM 2581  O OE1  . GLN A 1 46  ? -10.631 10.290  14.396  1.00 0.00 ? 46  GLN A OE1  2  
ATOM 2582  N NE2  . GLN A 1 46  ? -11.573 8.710   15.684  1.00 0.00 ? 46  GLN A NE2  2  
ATOM 2583  H H    . GLN A 1 46  ? -11.883 8.359   9.793   1.00 0.00 ? 46  GLN A H    2  
ATOM 2584  H HA   . GLN A 1 46  ? -10.395 9.868   11.816  1.00 0.00 ? 46  GLN A HA   2  
ATOM 2585  H HB2  . GLN A 1 46  ? -11.963 7.341   11.821  1.00 0.00 ? 46  GLN A HB2  2  
ATOM 2586  H HB3  . GLN A 1 46  ? -10.604 7.449   12.933  1.00 0.00 ? 46  GLN A HB3  2  
ATOM 2587  H HG2  . GLN A 1 46  ? -12.628 9.640   12.824  1.00 0.00 ? 46  GLN A HG2  2  
ATOM 2588  H HG3  . GLN A 1 46  ? -12.967 8.157   13.714  1.00 0.00 ? 46  GLN A HG3  2  
ATOM 2589  H HE21 . GLN A 1 46  ? -12.197 7.953   15.711  1.00 0.00 ? 46  GLN A HE21 2  
ATOM 2590  H HE22 . GLN A 1 46  ? -11.074 9.030   16.463  1.00 0.00 ? 46  GLN A HE22 2  
ATOM 2591  N N    . GLY A 1 47  ? -9.236  7.442   9.969   1.00 0.00 ? 47  GLY A N    2  
ATOM 2592  C CA   . GLY A 1 47  ? -8.014  6.783   9.545   1.00 0.00 ? 47  GLY A CA   2  
ATOM 2593  C C    . GLY A 1 47  ? -8.195  5.997   8.262   1.00 0.00 ? 47  GLY A C    2  
ATOM 2594  O O    . GLY A 1 47  ? -9.061  6.316   7.447   1.00 0.00 ? 47  GLY A O    2  
ATOM 2595  H H    . GLY A 1 47  ? -10.072 7.280   9.483   1.00 0.00 ? 47  GLY A H    2  
ATOM 2596  H HA2  . GLY A 1 47  ? -7.249  7.529   9.394   1.00 0.00 ? 47  GLY A HA2  2  
ATOM 2597  H HA3  . GLY A 1 47  ? -7.695  6.107   10.325  1.00 0.00 ? 47  GLY A HA3  2  
ATOM 2598  N N    . TYR A 1 48  ? -7.375  4.968   8.079   1.00 0.00 ? 48  TYR A N    2  
ATOM 2599  C CA   . TYR A 1 48  ? -7.445  4.137   6.884   1.00 0.00 ? 48  TYR A CA   2  
ATOM 2600  C C    . TYR A 1 48  ? -7.193  2.671   7.223   1.00 0.00 ? 48  TYR A C    2  
ATOM 2601  O O    . TYR A 1 48  ? -6.180  2.330   7.835   1.00 0.00 ? 48  TYR A O    2  
ATOM 2602  C CB   . TYR A 1 48  ? -6.428  4.614   5.845   1.00 0.00 ? 48  TYR A CB   2  
ATOM 2603  C CG   . TYR A 1 48  ? -6.835  5.887   5.139   1.00 0.00 ? 48  TYR A CG   2  
ATOM 2604  C CD1  . TYR A 1 48  ? -7.750  5.862   4.093   1.00 0.00 ? 48  TYR A CD1  2  
ATOM 2605  C CD2  . TYR A 1 48  ? -6.306  7.115   5.516   1.00 0.00 ? 48  TYR A CD2  2  
ATOM 2606  C CE1  . TYR A 1 48  ? -8.124  7.023   3.444   1.00 0.00 ? 48  TYR A CE1  2  
ATOM 2607  C CE2  . TYR A 1 48  ? -6.676  8.280   4.874   1.00 0.00 ? 48  TYR A CE2  2  
ATOM 2608  C CZ   . TYR A 1 48  ? -7.585  8.229   3.838   1.00 0.00 ? 48  TYR A CZ   2  
ATOM 2609  O OH   . TYR A 1 48  ? -7.956  9.388   3.195   1.00 0.00 ? 48  TYR A OH   2  
ATOM 2610  H H    . TYR A 1 48  ? -6.705  4.763   8.765   1.00 0.00 ? 48  TYR A H    2  
ATOM 2611  H HA   . TYR A 1 48  ? -8.438  4.233   6.471   1.00 0.00 ? 48  TYR A HA   2  
ATOM 2612  H HB2  . TYR A 1 48  ? -5.483  4.794   6.333   1.00 0.00 ? 48  TYR A HB2  2  
ATOM 2613  H HB3  . TYR A 1 48  ? -6.300  3.845   5.097   1.00 0.00 ? 48  TYR A HB3  2  
ATOM 2614  H HD1  . TYR A 1 48  ? -8.170  4.915   3.786   1.00 0.00 ? 48  TYR A HD1  2  
ATOM 2615  H HD2  . TYR A 1 48  ? -5.593  7.151   6.328   1.00 0.00 ? 48  TYR A HD2  2  
ATOM 2616  H HE1  . TYR A 1 48  ? -8.837  6.983   2.633   1.00 0.00 ? 48  TYR A HE1  2  
ATOM 2617  H HE2  . TYR A 1 48  ? -6.253  9.225   5.183   1.00 0.00 ? 48  TYR A HE2  2  
ATOM 2618  H HH   . TYR A 1 48  ? -8.782  9.709   3.564   1.00 0.00 ? 48  TYR A HH   2  
ATOM 2619  N N    . ARG A 1 49  ? -8.121  1.809   6.821   1.00 0.00 ? 49  ARG A N    2  
ATOM 2620  C CA   . ARG A 1 49  ? -8.001  0.380   7.082   1.00 0.00 ? 49  ARG A CA   2  
ATOM 2621  C C    . ARG A 1 49  ? -7.395  -0.343  5.882   1.00 0.00 ? 49  ARG A C    2  
ATOM 2622  O O    . ARG A 1 49  ? -7.973  -0.355  4.795   1.00 0.00 ? 49  ARG A O    2  
ATOM 2623  C CB   . ARG A 1 49  ? -9.370  -0.216  7.413   1.00 0.00 ? 49  ARG A CB   2  
ATOM 2624  C CG   . ARG A 1 49  ? -9.294  -1.539  8.157   1.00 0.00 ? 49  ARG A CG   2  
ATOM 2625  C CD   . ARG A 1 49  ? -9.263  -1.331  9.663   1.00 0.00 ? 49  ARG A CD   2  
ATOM 2626  N NE   . ARG A 1 49  ? -10.579 -0.987  10.195  1.00 0.00 ? 49  ARG A NE   2  
ATOM 2627  C CZ   . ARG A 1 49  ? -10.916 -1.132  11.472  1.00 0.00 ? 49  ARG A CZ   2  
ATOM 2628  N NH1  . ARG A 1 49  ? -10.039 -1.612  12.342  1.00 0.00 ? 49  ARG A NH1  2  
ATOM 2629  N NH2  . ARG A 1 49  ? -12.134 -0.796  11.880  1.00 0.00 ? 49  ARG A NH2  2  
ATOM 2630  H H    . ARG A 1 49  ? -8.905  2.142   6.337   1.00 0.00 ? 49  ARG A H    2  
ATOM 2631  H HA   . ARG A 1 49  ? -7.347  0.252   7.932   1.00 0.00 ? 49  ARG A HA   2  
ATOM 2632  H HB2  . ARG A 1 49  ? -9.917  0.485   8.026   1.00 0.00 ? 49  ARG A HB2  2  
ATOM 2633  H HB3  . ARG A 1 49  ? -9.911  -0.376  6.493   1.00 0.00 ? 49  ARG A HB3  2  
ATOM 2634  H HG2  . ARG A 1 49  ? -10.160 -2.134  7.905   1.00 0.00 ? 49  ARG A HG2  2  
ATOM 2635  H HG3  . ARG A 1 49  ? -8.398  -2.060  7.856   1.00 0.00 ? 49  ARG A HG3  2  
ATOM 2636  H HD2  . ARG A 1 49  ? -8.923  -2.242  10.133  1.00 0.00 ? 49  ARG A HD2  2  
ATOM 2637  H HD3  . ARG A 1 49  ? -8.573  -0.531  9.888   1.00 0.00 ? 49  ARG A HD3  2  
ATOM 2638  H HE   . ARG A 1 49  ? -11.242 -0.630  9.569   1.00 0.00 ? 49  ARG A HE   2  
ATOM 2639  H HH11 . ARG A 1 49  ? -9.121  -1.865  12.038  1.00 0.00 ? 49  ARG A HH11 2  
ATOM 2640  H HH12 . ARG A 1 49  ? -10.296 -1.719  13.303  1.00 0.00 ? 49  ARG A HH12 2  
ATOM 2641  H HH21 . ARG A 1 49  ? -12.797 -0.433  11.226  1.00 0.00 ? 49  ARG A HH21 2  
ATOM 2642  H HH22 . ARG A 1 49  ? -12.387 -0.906  12.840  1.00 0.00 ? 49  ARG A HH22 2  
ATOM 2643  N N    . VAL A 1 50  ? -6.228  -0.945  6.088   1.00 0.00 ? 50  VAL A N    2  
ATOM 2644  C CA   . VAL A 1 50  ? -5.545  -1.671  5.024   1.00 0.00 ? 50  VAL A CA   2  
ATOM 2645  C C    . VAL A 1 50  ? -5.774  -3.173  5.148   1.00 0.00 ? 50  VAL A C    2  
ATOM 2646  O O    . VAL A 1 50  ? -5.134  -3.844  5.957   1.00 0.00 ? 50  VAL A O    2  
ATOM 2647  C CB   . VAL A 1 50  ? -4.030  -1.391  5.037   1.00 0.00 ? 50  VAL A CB   2  
ATOM 2648  C CG1  . VAL A 1 50  ? -3.352  -2.064  3.853   1.00 0.00 ? 50  VAL A CG1  2  
ATOM 2649  C CG2  . VAL A 1 50  ? -3.765  0.107   5.033   1.00 0.00 ? 50  VAL A CG2  2  
ATOM 2650  H H    . VAL A 1 50  ? -5.817  -0.901  6.976   1.00 0.00 ? 50  VAL A H    2  
ATOM 2651  H HA   . VAL A 1 50  ? -5.944  -1.332  4.079   1.00 0.00 ? 50  VAL A HA   2  
ATOM 2652  H HB   . VAL A 1 50  ? -3.616  -1.807  5.944   1.00 0.00 ? 50  VAL A HB   2  
ATOM 2653  H HG11 . VAL A 1 50  ? -3.480  -1.454  2.971   1.00 0.00 ? 50  VAL A HG11 2  
ATOM 2654  H HG12 . VAL A 1 50  ? -2.299  -2.184  4.061   1.00 0.00 ? 50  VAL A HG12 2  
ATOM 2655  H HG13 . VAL A 1 50  ? -3.799  -3.034  3.687   1.00 0.00 ? 50  VAL A HG13 2  
ATOM 2656  H HG21 . VAL A 1 50  ? -4.682  0.633   4.811   1.00 0.00 ? 50  VAL A HG21 2  
ATOM 2657  H HG22 . VAL A 1 50  ? -3.401  0.411   6.004   1.00 0.00 ? 50  VAL A HG22 2  
ATOM 2658  H HG23 . VAL A 1 50  ? -3.025  0.340   4.282   1.00 0.00 ? 50  VAL A HG23 2  
ATOM 2659  N N    . MET A 1 51  ? -6.692  -3.694  4.341   1.00 0.00 ? 51  MET A N    2  
ATOM 2660  C CA   . MET A 1 51  ? -7.005  -5.119  4.359   1.00 0.00 ? 51  MET A CA   2  
ATOM 2661  C C    . MET A 1 51  ? -5.969  -5.913  3.570   1.00 0.00 ? 51  MET A C    2  
ATOM 2662  O O    . MET A 1 51  ? -5.349  -5.393  2.642   1.00 0.00 ? 51  MET A O    2  
ATOM 2663  C CB   . MET A 1 51  ? -8.401  -5.363  3.782   1.00 0.00 ? 51  MET A CB   2  
ATOM 2664  C CG   . MET A 1 51  ? -9.524  -4.854  4.670   1.00 0.00 ? 51  MET A CG   2  
ATOM 2665  S SD   . MET A 1 51  ? -11.145 -5.452  4.153   1.00 0.00 ? 51  MET A SD   2  
ATOM 2666  C CE   . MET A 1 51  ? -11.005 -7.193  4.548   1.00 0.00 ? 51  MET A CE   2  
ATOM 2667  H H    . MET A 1 51  ? -7.170  -3.108  3.717   1.00 0.00 ? 51  MET A H    2  
ATOM 2668  H HA   . MET A 1 51  ? -6.988  -5.448  5.387   1.00 0.00 ? 51  MET A HA   2  
ATOM 2669  H HB2  . MET A 1 51  ? -8.474  -4.867  2.825   1.00 0.00 ? 51  MET A HB2  2  
ATOM 2670  H HB3  . MET A 1 51  ? -8.538  -6.425  3.639   1.00 0.00 ? 51  MET A HB3  2  
ATOM 2671  H HG2  . MET A 1 51  ? -9.342  -5.182  5.682   1.00 0.00 ? 51  MET A HG2  2  
ATOM 2672  H HG3  . MET A 1 51  ? -9.527  -3.774  4.639   1.00 0.00 ? 51  MET A HG3  2  
ATOM 2673  H HE1  . MET A 1 51  ? -11.911 -7.702  4.256   1.00 0.00 ? 51  MET A HE1  2  
ATOM 2674  H HE2  . MET A 1 51  ? -10.167 -7.617  4.015   1.00 0.00 ? 51  MET A HE2  2  
ATOM 2675  H HE3  . MET A 1 51  ? -10.852 -7.309  5.611   1.00 0.00 ? 51  MET A HE3  2  
ATOM 2676  N N    . TYR A 1 52  ? -5.787  -7.174  3.945   1.00 0.00 ? 52  TYR A N    2  
ATOM 2677  C CA   . TYR A 1 52  ? -4.824  -8.039  3.274   1.00 0.00 ? 52  TYR A CA   2  
ATOM 2678  C C    . TYR A 1 52  ? -5.046  -9.500  3.655   1.00 0.00 ? 52  TYR A C    2  
ATOM 2679  O O    . TYR A 1 52  ? -5.495  -9.804  4.760   1.00 0.00 ? 52  TYR A O    2  
ATOM 2680  C CB   . TYR A 1 52  ? -3.396  -7.620  3.629   1.00 0.00 ? 52  TYR A CB   2  
ATOM 2681  C CG   . TYR A 1 52  ? -3.081  -7.732  5.104   1.00 0.00 ? 52  TYR A CG   2  
ATOM 2682  C CD1  . TYR A 1 52  ? -3.535  -6.778  6.006   1.00 0.00 ? 52  TYR A CD1  2  
ATOM 2683  C CD2  . TYR A 1 52  ? -2.330  -8.793  5.595   1.00 0.00 ? 52  TYR A CD2  2  
ATOM 2684  C CE1  . TYR A 1 52  ? -3.249  -6.876  7.354   1.00 0.00 ? 52  TYR A CE1  2  
ATOM 2685  C CE2  . TYR A 1 52  ? -2.040  -8.900  6.942   1.00 0.00 ? 52  TYR A CE2  2  
ATOM 2686  C CZ   . TYR A 1 52  ? -2.501  -7.939  7.817   1.00 0.00 ? 52  TYR A CZ   2  
ATOM 2687  O OH   . TYR A 1 52  ? -2.215  -8.041  9.159   1.00 0.00 ? 52  TYR A OH   2  
ATOM 2688  H H    . TYR A 1 52  ? -6.311  -7.532  4.692   1.00 0.00 ? 52  TYR A H    2  
ATOM 2689  H HA   . TYR A 1 52  ? -4.966  -7.931  2.209   1.00 0.00 ? 52  TYR A HA   2  
ATOM 2690  H HB2  . TYR A 1 52  ? -2.700  -8.247  3.094   1.00 0.00 ? 52  TYR A HB2  2  
ATOM 2691  H HB3  . TYR A 1 52  ? -3.247  -6.592  3.335   1.00 0.00 ? 52  TYR A HB3  2  
ATOM 2692  H HD1  . TYR A 1 52  ? -4.120  -5.947  5.640   1.00 0.00 ? 52  TYR A HD1  2  
ATOM 2693  H HD2  . TYR A 1 52  ? -1.970  -9.544  4.907   1.00 0.00 ? 52  TYR A HD2  2  
ATOM 2694  H HE1  . TYR A 1 52  ? -3.610  -6.124  8.039   1.00 0.00 ? 52  TYR A HE1  2  
ATOM 2695  H HE2  . TYR A 1 52  ? -1.455  -9.732  7.305   1.00 0.00 ? 52  TYR A HE2  2  
ATOM 2696  H HH   . TYR A 1 52  ? -1.265  -8.097  9.280   1.00 0.00 ? 52  TYR A HH   2  
ATOM 2697  N N    . ARG A 1 53  ? -4.729  -10.400 2.730   1.00 0.00 ? 53  ARG A N    2  
ATOM 2698  C CA   . ARG A 1 53  ? -4.894  -11.829 2.966   1.00 0.00 ? 53  ARG A CA   2  
ATOM 2699  C C    . ARG A 1 53  ? -4.192  -12.644 1.884   1.00 0.00 ? 53  ARG A C    2  
ATOM 2700  O O    . ARG A 1 53  ? -3.653  -12.088 0.927   1.00 0.00 ? 53  ARG A O    2  
ATOM 2701  C CB   . ARG A 1 53  ? -6.379  -12.192 3.010   1.00 0.00 ? 53  ARG A CB   2  
ATOM 2702  C CG   . ARG A 1 53  ? -7.054  -12.160 1.649   1.00 0.00 ? 53  ARG A CG   2  
ATOM 2703  C CD   . ARG A 1 53  ? -8.224  -13.130 1.584   1.00 0.00 ? 53  ARG A CD   2  
ATOM 2704  N NE   . ARG A 1 53  ? -8.803  -13.201 0.246   1.00 0.00 ? 53  ARG A NE   2  
ATOM 2705  C CZ   . ARG A 1 53  ? -9.998  -13.722 -0.012  1.00 0.00 ? 53  ARG A CZ   2  
ATOM 2706  N NH1  . ARG A 1 53  ? -10.736 -14.215 0.973   1.00 0.00 ? 53  ARG A NH1  2  
ATOM 2707  N NH2  . ARG A 1 53  ? -10.456 -13.751 -1.257  1.00 0.00 ? 53  ARG A NH2  2  
ATOM 2708  H H    . ARG A 1 53  ? -4.375  -10.096 1.868   1.00 0.00 ? 53  ARG A H    2  
ATOM 2709  H HA   . ARG A 1 53  ? -4.447  -12.061 3.921   1.00 0.00 ? 53  ARG A HA   2  
ATOM 2710  H HB2  . ARG A 1 53  ? -6.483  -13.188 3.415   1.00 0.00 ? 53  ARG A HB2  2  
ATOM 2711  H HB3  . ARG A 1 53  ? -6.889  -11.494 3.657   1.00 0.00 ? 53  ARG A HB3  2  
ATOM 2712  H HG2  . ARG A 1 53  ? -7.419  -11.161 1.462   1.00 0.00 ? 53  ARG A HG2  2  
ATOM 2713  H HG3  . ARG A 1 53  ? -6.332  -12.430 0.893   1.00 0.00 ? 53  ARG A HG3  2  
ATOM 2714  H HD2  . ARG A 1 53  ? -7.876  -14.112 1.868   1.00 0.00 ? 53  ARG A HD2  2  
ATOM 2715  H HD3  . ARG A 1 53  ? -8.984  -12.803 2.279   1.00 0.00 ? 53  ARG A HD3  2  
ATOM 2716  H HE   . ARG A 1 53  ? -8.274  -12.843 -0.497  1.00 0.00 ? 53  ARG A HE   2  
ATOM 2717  H HH11 . ARG A 1 53  ? -10.393 -14.194 1.912   1.00 0.00 ? 53  ARG A HH11 2  
ATOM 2718  H HH12 . ARG A 1 53  ? -11.635 -14.606 0.777   1.00 0.00 ? 53  ARG A HH12 2  
ATOM 2719  H HH21 . ARG A 1 53  ? -9.902  -13.380 -2.002  1.00 0.00 ? 53  ARG A HH21 2  
ATOM 2720  H HH22 . ARG A 1 53  ? -11.355 -14.143 -1.450  1.00 0.00 ? 53  ARG A HH22 2  
ATOM 2721  N N    . GLN A 1 54  ? -4.203  -13.963 2.043   1.00 0.00 ? 54  GLN A N    2  
ATOM 2722  C CA   . GLN A 1 54  ? -3.566  -14.854 1.079   1.00 0.00 ? 54  GLN A CA   2  
ATOM 2723  C C    . GLN A 1 54  ? -4.566  -15.322 0.027   1.00 0.00 ? 54  GLN A C    2  
ATOM 2724  O O    . GLN A 1 54  ? -5.712  -15.644 0.343   1.00 0.00 ? 54  GLN A O    2  
ATOM 2725  C CB   . GLN A 1 54  ? -2.958  -16.062 1.794   1.00 0.00 ? 54  GLN A CB   2  
ATOM 2726  C CG   . GLN A 1 54  ? -1.792  -16.688 1.045   1.00 0.00 ? 54  GLN A CG   2  
ATOM 2727  C CD   . GLN A 1 54  ? -0.902  -17.522 1.945   1.00 0.00 ? 54  GLN A CD   2  
ATOM 2728  O OE1  . GLN A 1 54  ? -0.528  -17.095 3.037   1.00 0.00 ? 54  GLN A OE1  2  
ATOM 2729  N NE2  . GLN A 1 54  ? -0.557  -18.721 1.489   1.00 0.00 ? 54  GLN A NE2  2  
ATOM 2730  H H    . GLN A 1 54  ? -4.649  -14.347 2.826   1.00 0.00 ? 54  GLN A H    2  
ATOM 2731  H HA   . GLN A 1 54  ? -2.778  -14.303 0.589   1.00 0.00 ? 54  GLN A HA   2  
ATOM 2732  H HB2  . GLN A 1 54  ? -2.607  -15.750 2.767   1.00 0.00 ? 54  GLN A HB2  2  
ATOM 2733  H HB3  . GLN A 1 54  ? -3.723  -16.814 1.919   1.00 0.00 ? 54  GLN A HB3  2  
ATOM 2734  H HG2  . GLN A 1 54  ? -2.183  -17.322 0.263   1.00 0.00 ? 54  GLN A HG2  2  
ATOM 2735  H HG3  . GLN A 1 54  ? -1.199  -15.900 0.606   1.00 0.00 ? 54  GLN A HG3  2  
ATOM 2736  H HE21 . GLN A 1 54  ? -0.892  -18.995 0.609   1.00 0.00 ? 54  GLN A HE21 2  
ATOM 2737  H HE22 . GLN A 1 54  ? 0.018   -19.281 2.049   1.00 0.00 ? 54  GLN A HE22 2  
ATOM 2738  N N    . THR A 1 55  ? -4.126  -15.357 -1.227  1.00 0.00 ? 55  THR A N    2  
ATOM 2739  C CA   . THR A 1 55  ? -4.982  -15.783 -2.326  1.00 0.00 ? 55  THR A CA   2  
ATOM 2740  C C    . THR A 1 55  ? -5.003  -17.303 -2.449  1.00 0.00 ? 55  THR A C    2  
ATOM 2741  O O    . THR A 1 55  ? -6.068  -17.912 -2.544  1.00 0.00 ? 55  THR A O    2  
ATOM 2742  C CB   . THR A 1 55  ? -4.520  -15.178 -3.665  1.00 0.00 ? 55  THR A CB   2  
ATOM 2743  O OG1  . THR A 1 55  ? -3.174  -15.579 -3.946  1.00 0.00 ? 55  THR A OG1  2  
ATOM 2744  C CG2  . THR A 1 55  ? -4.606  -13.660 -3.631  1.00 0.00 ? 55  THR A CG2  2  
ATOM 2745  H H    . THR A 1 55  ? -3.202  -15.088 -1.416  1.00 0.00 ? 55  THR A H    2  
ATOM 2746  H HA   . THR A 1 55  ? -5.984  -15.434 -2.124  1.00 0.00 ? 55  THR A HA   2  
ATOM 2747  H HB   . THR A 1 55  ? -5.167  -15.543 -4.450  1.00 0.00 ? 55  THR A HB   2  
ATOM 2748  H HG1  . THR A 1 55  ? -2.573  -15.116 -3.356  1.00 0.00 ? 55  THR A HG1  2  
ATOM 2749  H HG21 . THR A 1 55  ? -3.623  -13.247 -3.463  1.00 0.00 ? 55  THR A HG21 2  
ATOM 2750  H HG22 . THR A 1 55  ? -5.267  -13.355 -2.834  1.00 0.00 ? 55  THR A HG22 2  
ATOM 2751  H HG23 . THR A 1 55  ? -4.990  -13.300 -4.574  1.00 0.00 ? 55  THR A HG23 2  
ATOM 2752  N N    . SER A 1 56  ? -3.820  -17.909 -2.444  1.00 0.00 ? 56  SER A N    2  
ATOM 2753  C CA   . SER A 1 56  ? -3.704  -19.358 -2.558  1.00 0.00 ? 56  SER A CA   2  
ATOM 2754  C C    . SER A 1 56  ? -2.929  -19.935 -1.377  1.00 0.00 ? 56  SER A C    2  
ATOM 2755  O O    . SER A 1 56  ? -2.080  -19.265 -0.791  1.00 0.00 ? 56  SER A O    2  
ATOM 2756  C CB   . SER A 1 56  ? -3.011  -19.734 -3.870  1.00 0.00 ? 56  SER A CB   2  
ATOM 2757  O OG   . SER A 1 56  ? -2.979  -21.139 -4.045  1.00 0.00 ? 56  SER A OG   2  
ATOM 2758  H H    . SER A 1 56  ? -3.007  -17.368 -2.365  1.00 0.00 ? 56  SER A H    2  
ATOM 2759  H HA   . SER A 1 56  ? -4.701  -19.772 -2.556  1.00 0.00 ? 56  SER A HA   2  
ATOM 2760  H HB2  . SER A 1 56  ? -3.547  -19.292 -4.696  1.00 0.00 ? 56  SER A HB2  2  
ATOM 2761  H HB3  . SER A 1 56  ? -1.997  -19.361 -3.858  1.00 0.00 ? 56  SER A HB3  2  
ATOM 2762  H HG   . SER A 1 56  ? -3.266  -21.358 -4.935  1.00 0.00 ? 56  SER A HG   2  
ATOM 2763  N N    . GLY A 1 57  ? -3.228  -21.184 -1.034  1.00 0.00 ? 57  GLY A N    2  
ATOM 2764  C CA   . GLY A 1 57  ? -2.552  -21.831 0.074   1.00 0.00 ? 57  GLY A CA   2  
ATOM 2765  C C    . GLY A 1 57  ? -3.486  -22.126 1.231   1.00 0.00 ? 57  GLY A C    2  
ATOM 2766  O O    . GLY A 1 57  ? -4.707  -22.044 1.089   1.00 0.00 ? 57  GLY A O    2  
ATOM 2767  H H    . GLY A 1 57  ? -3.914  -21.670 -1.538  1.00 0.00 ? 57  GLY A H    2  
ATOM 2768  H HA2  . GLY A 1 57  ? -2.121  -22.759 -0.272  1.00 0.00 ? 57  GLY A HA2  2  
ATOM 2769  H HA3  . GLY A 1 57  ? -1.759  -21.186 0.423   1.00 0.00 ? 57  GLY A HA3  2  
ATOM 2770  N N    . LEU A 1 58  ? -2.913  -22.471 2.379   1.00 0.00 ? 58  LEU A N    2  
ATOM 2771  C CA   . LEU A 1 58  ? -3.704  -22.781 3.565   1.00 0.00 ? 58  LEU A CA   2  
ATOM 2772  C C    . LEU A 1 58  ? -4.455  -21.548 4.056   1.00 0.00 ? 58  LEU A C    2  
ATOM 2773  O O    . LEU A 1 58  ? -5.686  -21.521 4.061   1.00 0.00 ? 58  LEU A O    2  
ATOM 2774  C CB   . LEU A 1 58  ? -2.801  -23.319 4.677   1.00 0.00 ? 58  LEU A CB   2  
ATOM 2775  C CG   . LEU A 1 58  ? -3.474  -24.226 5.708   1.00 0.00 ? 58  LEU A CG   2  
ATOM 2776  C CD1  . LEU A 1 58  ? -4.683  -23.535 6.318   1.00 0.00 ? 58  LEU A CD1  2  
ATOM 2777  C CD2  . LEU A 1 58  ? -3.877  -25.549 5.073   1.00 0.00 ? 58  LEU A CD2  2  
ATOM 2778  H H    . LEU A 1 58  ? -1.936  -22.519 2.431   1.00 0.00 ? 58  LEU A H    2  
ATOM 2779  H HA   . LEU A 1 58  ? -4.421  -23.542 3.296   1.00 0.00 ? 58  LEU A HA   2  
ATOM 2780  H HB2  . LEU A 1 58  ? -2.004  -23.880 4.214   1.00 0.00 ? 58  LEU A HB2  2  
ATOM 2781  H HB3  . LEU A 1 58  ? -2.384  -22.471 5.202   1.00 0.00 ? 58  LEU A HB3  2  
ATOM 2782  H HG   . LEU A 1 58  ? -2.773  -24.436 6.505   1.00 0.00 ? 58  LEU A HG   2  
ATOM 2783  H HD11 . LEU A 1 58  ? -4.536  -22.466 6.297   1.00 0.00 ? 58  LEU A HD11 2  
ATOM 2784  H HD12 . LEU A 1 58  ? -4.807  -23.861 7.340   1.00 0.00 ? 58  LEU A HD12 2  
ATOM 2785  H HD13 . LEU A 1 58  ? -5.567  -23.789 5.751   1.00 0.00 ? 58  LEU A HD13 2  
ATOM 2786  H HD21 . LEU A 1 58  ? -3.882  -25.444 3.998   1.00 0.00 ? 58  LEU A HD21 2  
ATOM 2787  H HD22 . LEU A 1 58  ? -4.864  -25.825 5.413   1.00 0.00 ? 58  LEU A HD22 2  
ATOM 2788  H HD23 . LEU A 1 58  ? -3.170  -26.314 5.357   1.00 0.00 ? 58  LEU A HD23 2  
ATOM 2789  N N    . GLN A 1 59  ? -3.707  -20.530 4.467   1.00 0.00 ? 59  GLN A N    2  
ATOM 2790  C CA   . GLN A 1 59  ? -4.303  -19.294 4.959   1.00 0.00 ? 59  GLN A CA   2  
ATOM 2791  C C    . GLN A 1 59  ? -5.144  -18.627 3.875   1.00 0.00 ? 59  GLN A C    2  
ATOM 2792  O O    . GLN A 1 59  ? -5.866  -17.666 4.140   1.00 0.00 ? 59  GLN A O    2  
ATOM 2793  C CB   . GLN A 1 59  ? -3.214  -18.333 5.439   1.00 0.00 ? 59  GLN A CB   2  
ATOM 2794  C CG   . GLN A 1 59  ? -2.667  -18.673 6.816   1.00 0.00 ? 59  GLN A CG   2  
ATOM 2795  C CD   . GLN A 1 59  ? -3.723  -18.589 7.900   1.00 0.00 ? 59  GLN A CD   2  
ATOM 2796  O OE1  . GLN A 1 59  ? -3.924  -17.536 8.507   1.00 0.00 ? 59  GLN A OE1  2  
ATOM 2797  N NE2  . GLN A 1 59  ? -4.404  -19.701 8.150   1.00 0.00 ? 59  GLN A NE2  2  
ATOM 2798  H H    . GLN A 1 59  ? -2.731  -20.612 4.440   1.00 0.00 ? 59  GLN A H    2  
ATOM 2799  H HA   . GLN A 1 59  ? -4.943  -19.543 5.791   1.00 0.00 ? 59  GLN A HA   2  
ATOM 2800  H HB2  . GLN A 1 59  ? -2.396  -18.354 4.734   1.00 0.00 ? 59  GLN A HB2  2  
ATOM 2801  H HB3  . GLN A 1 59  ? -3.623  -17.333 5.475   1.00 0.00 ? 59  GLN A HB3  2  
ATOM 2802  H HG2  . GLN A 1 59  ? -2.274  -19.678 6.795   1.00 0.00 ? 59  GLN A HG2  2  
ATOM 2803  H HG3  . GLN A 1 59  ? -1.872  -17.981 7.053   1.00 0.00 ? 59  GLN A HG3  2  
ATOM 2804  H HE21 . GLN A 1 59  ? -4.189  -20.503 7.628   1.00 0.00 ? 59  GLN A HE21 2  
ATOM 2805  H HE22 . GLN A 1 59  ? -5.092  -19.675 8.847   1.00 0.00 ? 59  GLN A HE22 2  
ATOM 2806  N N    . ALA A 1 60  ? -5.046  -19.143 2.655   1.00 0.00 ? 60  ALA A N    2  
ATOM 2807  C CA   . ALA A 1 60  ? -5.799  -18.599 1.532   1.00 0.00 ? 60  ALA A CA   2  
ATOM 2808  C C    . ALA A 1 60  ? -7.299  -18.659 1.796   1.00 0.00 ? 60  ALA A C    2  
ATOM 2809  O O    . ALA A 1 60  ? -7.807  -19.643 2.334   1.00 0.00 ? 60  ALA A O    2  
ATOM 2810  C CB   . ALA A 1 60  ? -5.456  -19.349 0.253   1.00 0.00 ? 60  ALA A CB   2  
ATOM 2811  H H    . ALA A 1 60  ? -4.453  -19.910 2.507   1.00 0.00 ? 60  ALA A H    2  
ATOM 2812  H HA   . ALA A 1 60  ? -5.507  -17.567 1.403   1.00 0.00 ? 60  ALA A HA   2  
ATOM 2813  H HB1  . ALA A 1 60  ? -4.497  -19.833 0.367   1.00 0.00 ? 60  ALA A HB1  2  
ATOM 2814  H HB2  . ALA A 1 60  ? -6.214  -20.093 0.058   1.00 0.00 ? 60  ALA A HB2  2  
ATOM 2815  H HB3  . ALA A 1 60  ? -5.413  -18.654 -0.572  1.00 0.00 ? 60  ALA A HB3  2  
ATOM 2816  N N    . THR A 1 61  ? -8.006  -17.599 1.415   1.00 0.00 ? 61  THR A N    2  
ATOM 2817  C CA   . THR A 1 61  ? -9.448  -17.530 1.613   1.00 0.00 ? 61  THR A CA   2  
ATOM 2818  C C    . THR A 1 61  ? -9.845  -18.103 2.969   1.00 0.00 ? 61  THR A C    2  
ATOM 2819  O O    . THR A 1 61  ? -10.882 -18.753 3.099   1.00 0.00 ? 61  THR A O    2  
ATOM 2820  C CB   . THR A 1 61  ? -10.204 -18.290 0.506   1.00 0.00 ? 61  THR A CB   2  
ATOM 2821  O OG1  . THR A 1 61  ? -11.613 -18.073 0.638   1.00 0.00 ? 61  THR A OG1  2  
ATOM 2822  C CG2  . THR A 1 61  ? -9.906  -19.780 0.573   1.00 0.00 ? 61  THR A CG2  2  
ATOM 2823  H H    . THR A 1 61  ? -7.544  -16.845 0.992   1.00 0.00 ? 61  THR A H    2  
ATOM 2824  H HA   . THR A 1 61  ? -9.741  -16.491 1.572   1.00 0.00 ? 61  THR A HA   2  
ATOM 2825  H HB   . THR A 1 61  ? -9.878  -17.915 -0.453  1.00 0.00 ? 61  THR A HB   2  
ATOM 2826  H HG1  . THR A 1 61  ? -11.997 -17.930 -0.230  1.00 0.00 ? 61  THR A HG1  2  
ATOM 2827  H HG21 . THR A 1 61  ? -10.156 -20.154 1.555   1.00 0.00 ? 61  THR A HG21 2  
ATOM 2828  H HG22 . THR A 1 61  ? -8.857  -19.946 0.380   1.00 0.00 ? 61  THR A HG22 2  
ATOM 2829  H HG23 . THR A 1 61  ? -10.495 -20.297 -0.170  1.00 0.00 ? 61  THR A HG23 2  
ATOM 2830  N N    . SER A 1 62  ? -9.013  -17.858 3.976   1.00 0.00 ? 62  SER A N    2  
ATOM 2831  C CA   . SER A 1 62  ? -9.276  -18.353 5.322   1.00 0.00 ? 62  SER A CA   2  
ATOM 2832  C C    . SER A 1 62  ? -9.883  -17.258 6.194   1.00 0.00 ? 62  SER A C    2  
ATOM 2833  O O    . SER A 1 62  ? -10.938 -17.446 6.801   1.00 0.00 ? 62  SER A O    2  
ATOM 2834  C CB   . SER A 1 62  ? -7.985  -18.871 5.959   1.00 0.00 ? 62  SER A CB   2  
ATOM 2835  O OG   . SER A 1 62  ? -8.262  -19.660 7.104   1.00 0.00 ? 62  SER A OG   2  
ATOM 2836  H H    . SER A 1 62  ? -8.202  -17.334 3.809   1.00 0.00 ? 62  SER A H    2  
ATOM 2837  H HA   . SER A 1 62  ? -9.981  -19.167 5.244   1.00 0.00 ? 62  SER A HA   2  
ATOM 2838  H HB2  . SER A 1 62  ? -7.450  -19.475 5.242   1.00 0.00 ? 62  SER A HB2  2  
ATOM 2839  H HB3  . SER A 1 62  ? -7.371  -18.033 6.254   1.00 0.00 ? 62  SER A HB3  2  
ATOM 2840  H HG   . SER A 1 62  ? -8.018  -19.174 7.895   1.00 0.00 ? 62  SER A HG   2  
ATOM 2841  N N    . SER A 1 63  ? -9.209  -16.114 6.252   1.00 0.00 ? 63  SER A N    2  
ATOM 2842  C CA   . SER A 1 63  ? -9.678  -14.989 7.052   1.00 0.00 ? 63  SER A CA   2  
ATOM 2843  C C    . SER A 1 63  ? -8.950  -13.706 6.665   1.00 0.00 ? 63  SER A C    2  
ATOM 2844  O O    . SER A 1 63  ? -7.724  -13.629 6.736   1.00 0.00 ? 63  SER A O    2  
ATOM 2845  C CB   . SER A 1 63  ? -9.474  -15.275 8.541   1.00 0.00 ? 63  SER A CB   2  
ATOM 2846  O OG   . SER A 1 63  ? -8.100  -15.243 8.884   1.00 0.00 ? 63  SER A OG   2  
ATOM 2847  H H    . SER A 1 63  ? -8.374  -16.026 5.746   1.00 0.00 ? 63  SER A H    2  
ATOM 2848  H HA   . SER A 1 63  ? -10.733 -14.863 6.860   1.00 0.00 ? 63  SER A HA   2  
ATOM 2849  H HB2  . SER A 1 63  ? -9.995  -14.530 9.123   1.00 0.00 ? 63  SER A HB2  2  
ATOM 2850  H HB3  . SER A 1 63  ? -9.868  -16.254 8.774   1.00 0.00 ? 63  SER A HB3  2  
ATOM 2851  H HG   . SER A 1 63  ? -7.572  -15.442 8.107   1.00 0.00 ? 63  SER A HG   2  
ATOM 2852  N N    . TRP A 1 64  ? -9.715  -12.700 6.256   1.00 0.00 ? 64  TRP A N    2  
ATOM 2853  C CA   . TRP A 1 64  ? -9.144  -11.419 5.857   1.00 0.00 ? 64  TRP A CA   2  
ATOM 2854  C C    . TRP A 1 64  ? -8.575  -10.678 7.062   1.00 0.00 ? 64  TRP A C    2  
ATOM 2855  O O    . TRP A 1 64  ? -9.090  -10.796 8.174   1.00 0.00 ? 64  TRP A O    2  
ATOM 2856  C CB   . TRP A 1 64  ? -10.203 -10.558 5.167   1.00 0.00 ? 64  TRP A CB   2  
ATOM 2857  C CG   . TRP A 1 64  ? -10.246 -10.747 3.681   1.00 0.00 ? 64  TRP A CG   2  
ATOM 2858  C CD1  . TRP A 1 64  ? -11.078 -11.577 2.985   1.00 0.00 ? 64  TRP A CD1  2  
ATOM 2859  C CD2  . TRP A 1 64  ? -9.421  -10.095 2.709   1.00 0.00 ? 64  TRP A CD2  2  
ATOM 2860  N NE1  . TRP A 1 64  ? -10.820 -11.480 1.638   1.00 0.00 ? 64  TRP A NE1  2  
ATOM 2861  C CE2  . TRP A 1 64  ? -9.809  -10.577 1.443   1.00 0.00 ? 64  TRP A CE2  2  
ATOM 2862  C CE3  . TRP A 1 64  ? -8.395  -9.150  2.785   1.00 0.00 ? 64  TRP A CE3  2  
ATOM 2863  C CZ2  . TRP A 1 64  ? -9.204  -10.145 0.266   1.00 0.00 ? 64  TRP A CZ2  2  
ATOM 2864  C CZ3  . TRP A 1 64  ? -7.795  -8.722  1.616   1.00 0.00 ? 64  TRP A CZ3  2  
ATOM 2865  C CH2  . TRP A 1 64  ? -8.201  -9.219  0.370   1.00 0.00 ? 64  TRP A CH2  2  
ATOM 2866  H H    . TRP A 1 64  ? -10.687 -12.822 6.221   1.00 0.00 ? 64  TRP A H    2  
ATOM 2867  H HA   . TRP A 1 64  ? -8.343  -11.616 5.160   1.00 0.00 ? 64  TRP A HA   2  
ATOM 2868  H HB2  . TRP A 1 64  ? -11.176 -10.807 5.563   1.00 0.00 ? 64  TRP A HB2  2  
ATOM 2869  H HB3  . TRP A 1 64  ? -9.994  -9.516  5.365   1.00 0.00 ? 64  TRP A HB3  2  
ATOM 2870  H HD1  . TRP A 1 64  ? -11.823 -12.212 3.439   1.00 0.00 ? 64  TRP A HD1  2  
ATOM 2871  H HE1  . TRP A 1 64  ? -11.286 -11.975 0.933   1.00 0.00 ? 64  TRP A HE1  2  
ATOM 2872  H HE3  . TRP A 1 64  ? -8.068  -8.755  3.736   1.00 0.00 ? 64  TRP A HE3  2  
ATOM 2873  H HZ2  . TRP A 1 64  ? -9.506  -10.517 -0.702  1.00 0.00 ? 64  TRP A HZ2  2  
ATOM 2874  H HZ3  . TRP A 1 64  ? -7.000  -7.993  1.655   1.00 0.00 ? 64  TRP A HZ3  2  
ATOM 2875  H HH2  . TRP A 1 64  ? -7.705  -8.857  -0.517  1.00 0.00 ? 64  TRP A HH2  2  
ATOM 2876  N N    . GLN A 1 65  ? -7.511  -9.914  6.834   1.00 0.00 ? 65  GLN A N    2  
ATOM 2877  C CA   . GLN A 1 65  ? -6.873  -9.155  7.902   1.00 0.00 ? 65  GLN A CA   2  
ATOM 2878  C C    . GLN A 1 65  ? -7.135  -7.661  7.740   1.00 0.00 ? 65  GLN A C    2  
ATOM 2879  O O    . GLN A 1 65  ? -7.800  -7.237  6.796   1.00 0.00 ? 65  GLN A O    2  
ATOM 2880  C CB   . GLN A 1 65  ? -5.367  -9.421  7.917   1.00 0.00 ? 65  GLN A CB   2  
ATOM 2881  C CG   . GLN A 1 65  ? -4.986  -10.720 8.608   1.00 0.00 ? 65  GLN A CG   2  
ATOM 2882  C CD   . GLN A 1 65  ? -3.547  -11.121 8.345   1.00 0.00 ? 65  GLN A CD   2  
ATOM 2883  O OE1  . GLN A 1 65  ? -2.684  -10.983 9.212   1.00 0.00 ? 65  GLN A OE1  2  
ATOM 2884  N NE2  . GLN A 1 65  ? -3.282  -11.622 7.144   1.00 0.00 ? 65  GLN A NE2  2  
ATOM 2885  H H    . GLN A 1 65  ? -7.147  -9.861  5.926   1.00 0.00 ? 65  GLN A H    2  
ATOM 2886  H HA   . GLN A 1 65  ? -7.296  -9.482  8.840   1.00 0.00 ? 65  GLN A HA   2  
ATOM 2887  H HB2  . GLN A 1 65  ? -5.011  -9.462  6.898   1.00 0.00 ? 65  GLN A HB2  2  
ATOM 2888  H HB3  . GLN A 1 65  ? -4.874  -8.608  8.430   1.00 0.00 ? 65  GLN A HB3  2  
ATOM 2889  H HG2  . GLN A 1 65  ? -5.120  -10.600 9.673   1.00 0.00 ? 65  GLN A HG2  2  
ATOM 2890  H HG3  . GLN A 1 65  ? -5.634  -11.507 8.252   1.00 0.00 ? 65  GLN A HG3  2  
ATOM 2891  H HE21 . GLN A 1 65  ? -4.020  -11.702 6.504   1.00 0.00 ? 65  GLN A HE21 2  
ATOM 2892  H HE22 . GLN A 1 65  ? -2.361  -11.888 6.947   1.00 0.00 ? 65  GLN A HE22 2  
ATOM 2893  N N    . ASN A 1 66  ? -6.609  -6.869  8.669   1.00 0.00 ? 66  ASN A N    2  
ATOM 2894  C CA   . ASN A 1 66  ? -6.788  -5.422  8.629   1.00 0.00 ? 66  ASN A CA   2  
ATOM 2895  C C    . ASN A 1 66  ? -5.701  -4.717  9.435   1.00 0.00 ? 66  ASN A C    2  
ATOM 2896  O O    . ASN A 1 66  ? -5.396  -5.109  10.563  1.00 0.00 ? 66  ASN A O    2  
ATOM 2897  C CB   . ASN A 1 66  ? -8.167  -5.042  9.171   1.00 0.00 ? 66  ASN A CB   2  
ATOM 2898  C CG   . ASN A 1 66  ? -8.543  -5.840  10.405  1.00 0.00 ? 66  ASN A CG   2  
ATOM 2899  O OD1  . ASN A 1 66  ? -7.676  -6.291  11.154  1.00 0.00 ? 66  ASN A OD1  2  
ATOM 2900  N ND2  . ASN A 1 66  ? -9.841  -6.017  10.622  1.00 0.00 ? 66  ASN A ND2  2  
ATOM 2901  H H    . ASN A 1 66  ? -6.089  -7.266  9.398   1.00 0.00 ? 66  ASN A H    2  
ATOM 2902  H HA   . ASN A 1 66  ? -6.717  -5.107  7.599   1.00 0.00 ? 66  ASN A HA   2  
ATOM 2903  H HB2  . ASN A 1 66  ? -8.169  -3.993  9.430   1.00 0.00 ? 66  ASN A HB2  2  
ATOM 2904  H HB3  . ASN A 1 66  ? -8.910  -5.222  8.409   1.00 0.00 ? 66  ASN A HB3  2  
ATOM 2905  H HD21 . ASN A 1 66  ? -10.475 -5.629  9.983   1.00 0.00 ? 66  ASN A HD21 2  
ATOM 2906  H HD22 . ASN A 1 66  ? -10.112 -6.529  11.413  1.00 0.00 ? 66  ASN A HD22 2  
ATOM 2907  N N    . LEU A 1 67  ? -5.119  -3.677  8.850   1.00 0.00 ? 67  LEU A N    2  
ATOM 2908  C CA   . LEU A 1 67  ? -4.065  -2.916  9.513   1.00 0.00 ? 67  LEU A CA   2  
ATOM 2909  C C    . LEU A 1 67  ? -4.518  -1.486  9.790   1.00 0.00 ? 67  LEU A C    2  
ATOM 2910  O O    . LEU A 1 67  ? -4.427  -0.616  8.923   1.00 0.00 ? 67  LEU A O    2  
ATOM 2911  C CB   . LEU A 1 67  ? -2.799  -2.905  8.655   1.00 0.00 ? 67  LEU A CB   2  
ATOM 2912  C CG   . LEU A 1 67  ? -1.515  -2.467  9.359   1.00 0.00 ? 67  LEU A CG   2  
ATOM 2913  C CD1  . LEU A 1 67  ? -0.941  -3.611  10.182  1.00 0.00 ? 67  LEU A CD1  2  
ATOM 2914  C CD2  . LEU A 1 67  ? -0.493  -1.972  8.346   1.00 0.00 ? 67  LEU A CD2  2  
ATOM 2915  H H    . LEU A 1 67  ? -5.404  -3.412  7.950   1.00 0.00 ? 67  LEU A H    2  
ATOM 2916  H HA   . LEU A 1 67  ? -3.849  -3.400  10.453  1.00 0.00 ? 67  LEU A HA   2  
ATOM 2917  H HB2  . LEU A 1 67  ? -2.646  -3.905  8.279   1.00 0.00 ? 67  LEU A HB2  2  
ATOM 2918  H HB3  . LEU A 1 67  ? -2.969  -2.233  7.825   1.00 0.00 ? 67  LEU A HB3  2  
ATOM 2919  H HG   . LEU A 1 67  ? -1.741  -1.653  10.033  1.00 0.00 ? 67  LEU A HG   2  
ATOM 2920  H HD11 . LEU A 1 67  ? -1.645  -3.889  10.951  1.00 0.00 ? 67  LEU A HD11 2  
ATOM 2921  H HD12 . LEU A 1 67  ? -0.014  -3.296  10.638  1.00 0.00 ? 67  LEU A HD12 2  
ATOM 2922  H HD13 . LEU A 1 67  ? -0.755  -4.459  9.539   1.00 0.00 ? 67  LEU A HD13 2  
ATOM 2923  H HD21 . LEU A 1 67  ? -0.137  -2.805  7.757   1.00 0.00 ? 67  LEU A HD21 2  
ATOM 2924  H HD22 . LEU A 1 67  ? 0.338   -1.518  8.866   1.00 0.00 ? 67  LEU A HD22 2  
ATOM 2925  H HD23 . LEU A 1 67  ? -0.955  -1.243  7.697   1.00 0.00 ? 67  LEU A HD23 2  
ATOM 2926  N N    . ASP A 1 68  ? -5.005  -1.249  11.003  1.00 0.00 ? 68  ASP A N    2  
ATOM 2927  C CA   . ASP A 1 68  ? -5.468  0.077   11.395  1.00 0.00 ? 68  ASP A CA   2  
ATOM 2928  C C    . ASP A 1 68  ? -4.307  1.064   11.451  1.00 0.00 ? 68  ASP A C    2  
ATOM 2929  O O    . ASP A 1 68  ? -3.484  1.019   12.365  1.00 0.00 ? 68  ASP A O    2  
ATOM 2930  C CB   . ASP A 1 68  ? -6.167  0.014   12.755  1.00 0.00 ? 68  ASP A CB   2  
ATOM 2931  C CG   . ASP A 1 68  ? -5.211  -0.324  13.882  1.00 0.00 ? 68  ASP A CG   2  
ATOM 2932  O OD1  . ASP A 1 68  ? -4.201  -1.009  13.617  1.00 0.00 ? 68  ASP A OD1  2  
ATOM 2933  O OD2  . ASP A 1 68  ? -5.473  0.096   15.028  1.00 0.00 ? 68  ASP A OD2  2  
ATOM 2934  H H    . ASP A 1 68  ? -5.052  -1.983  11.650  1.00 0.00 ? 68  ASP A H    2  
ATOM 2935  H HA   . ASP A 1 68  ? -6.176  0.414   10.653  1.00 0.00 ? 68  ASP A HA   2  
ATOM 2936  H HB2  . ASP A 1 68  ? -6.617  0.974   12.965  1.00 0.00 ? 68  ASP A HB2  2  
ATOM 2937  H HB3  . ASP A 1 68  ? -6.938  -0.741  12.721  1.00 0.00 ? 68  ASP A HB3  2  
ATOM 2938  N N    . ALA A 1 69  ? -4.247  1.955   10.466  1.00 0.00 ? 69  ALA A N    2  
ATOM 2939  C CA   . ALA A 1 69  ? -3.187  2.954   10.404  1.00 0.00 ? 69  ALA A CA   2  
ATOM 2940  C C    . ALA A 1 69  ? -3.249  3.895   11.602  1.00 0.00 ? 69  ALA A C    2  
ATOM 2941  O O    . ALA A 1 69  ? -2.233  4.174   12.239  1.00 0.00 ? 69  ALA A O    2  
ATOM 2942  C CB   . ALA A 1 69  ? -3.281  3.742   9.106   1.00 0.00 ? 69  ALA A CB   2  
ATOM 2943  H H    . ALA A 1 69  ? -4.932  1.941   9.766   1.00 0.00 ? 69  ALA A H    2  
ATOM 2944  H HA   . ALA A 1 69  ? -2.239  2.436   10.415  1.00 0.00 ? 69  ALA A HA   2  
ATOM 2945  H HB1  . ALA A 1 69  ? -2.939  4.753   9.274   1.00 0.00 ? 69  ALA A HB1  2  
ATOM 2946  H HB2  . ALA A 1 69  ? -2.662  3.273   8.355   1.00 0.00 ? 69  ALA A HB2  2  
ATOM 2947  H HB3  . ALA A 1 69  ? -4.306  3.760   8.769   1.00 0.00 ? 69  ALA A HB3  2  
ATOM 2948  N N    . LYS A 1 70  ? -4.447  4.384   11.903  1.00 0.00 ? 70  LYS A N    2  
ATOM 2949  C CA   . LYS A 1 70  ? -4.643  5.294   13.026  1.00 0.00 ? 70  LYS A CA   2  
ATOM 2950  C C    . LYS A 1 70  ? -4.021  6.657   12.736  1.00 0.00 ? 70  LYS A C    2  
ATOM 2951  O O    . LYS A 1 70  ? -3.548  7.340   13.644  1.00 0.00 ? 70  LYS A O    2  
ATOM 2952  C CB   . LYS A 1 70  ? -4.034  4.704   14.300  1.00 0.00 ? 70  LYS A CB   2  
ATOM 2953  C CG   . LYS A 1 70  ? -4.420  3.256   14.544  1.00 0.00 ? 70  LYS A CG   2  
ATOM 2954  C CD   . LYS A 1 70  ? -3.774  2.712   15.807  1.00 0.00 ? 70  LYS A CD   2  
ATOM 2955  C CE   . LYS A 1 70  ? -2.418  2.088   15.516  1.00 0.00 ? 70  LYS A CE   2  
ATOM 2956  N NZ   . LYS A 1 70  ? -1.601  1.935   16.751  1.00 0.00 ? 70  LYS A NZ   2  
ATOM 2957  H H    . LYS A 1 70  ? -5.220  4.125   11.358  1.00 0.00 ? 70  LYS A H    2  
ATOM 2958  H HA   . LYS A 1 70  ? -5.705  5.420   13.169  1.00 0.00 ? 70  LYS A HA   2  
ATOM 2959  H HB2  . LYS A 1 70  ? -2.958  4.762   14.230  1.00 0.00 ? 70  LYS A HB2  2  
ATOM 2960  H HB3  . LYS A 1 70  ? -4.363  5.290   15.146  1.00 0.00 ? 70  LYS A HB3  2  
ATOM 2961  H HG2  . LYS A 1 70  ? -5.493  3.191   14.645  1.00 0.00 ? 70  LYS A HG2  2  
ATOM 2962  H HG3  . LYS A 1 70  ? -4.099  2.660   13.701  1.00 0.00 ? 70  LYS A HG3  2  
ATOM 2963  H HD2  . LYS A 1 70  ? -3.642  3.521   16.510  1.00 0.00 ? 70  LYS A HD2  2  
ATOM 2964  H HD3  . LYS A 1 70  ? -4.421  1.961   16.237  1.00 0.00 ? 70  LYS A HD3  2  
ATOM 2965  H HE2  . LYS A 1 70  ? -2.571  1.116   15.073  1.00 0.00 ? 70  LYS A HE2  2  
ATOM 2966  H HE3  . LYS A 1 70  ? -1.888  2.721   14.819  1.00 0.00 ? 70  LYS A HE3  2  
ATOM 2967  H HZ1  . LYS A 1 70  ? -1.006  2.776   16.892  1.00 0.00 ? 70  LYS A HZ1  2  
ATOM 2968  H HZ2  . LYS A 1 70  ? -0.986  1.100   16.671  1.00 0.00 ? 70  LYS A HZ2  2  
ATOM 2969  H HZ3  . LYS A 1 70  ? -2.221  1.818   17.578  1.00 0.00 ? 70  LYS A HZ3  2  
ATOM 2970  N N    . VAL A 1 71  ? -4.025  7.046   11.465  1.00 0.00 ? 71  VAL A N    2  
ATOM 2971  C CA   . VAL A 1 71  ? -3.463  8.328   11.056  1.00 0.00 ? 71  VAL A CA   2  
ATOM 2972  C C    . VAL A 1 71  ? -4.049  8.785   9.725   1.00 0.00 ? 71  VAL A C    2  
ATOM 2973  O O    . VAL A 1 71  ? -3.716  8.264   8.660   1.00 0.00 ? 71  VAL A O    2  
ATOM 2974  C CB   . VAL A 1 71  ? -1.930  8.255   10.932  1.00 0.00 ? 71  VAL A CB   2  
ATOM 2975  C CG1  . VAL A 1 71  ? -1.310  9.625   11.158  1.00 0.00 ? 71  VAL A CG1  2  
ATOM 2976  C CG2  . VAL A 1 71  ? -1.364  7.236   11.910  1.00 0.00 ? 71  VAL A CG2  2  
ATOM 2977  H H    . VAL A 1 71  ? -4.416  6.457   10.786  1.00 0.00 ? 71  VAL A H    2  
ATOM 2978  H HA   . VAL A 1 71  ? -3.708  9.057   11.815  1.00 0.00 ? 71  VAL A HA   2  
ATOM 2979  H HB   . VAL A 1 71  ? -1.685  7.934   9.930   1.00 0.00 ? 71  VAL A HB   2  
ATOM 2980  H HG11 . VAL A 1 71  ? -0.676  9.593   12.033  1.00 0.00 ? 71  VAL A HG11 2  
ATOM 2981  H HG12 . VAL A 1 71  ? -0.721  9.901   10.296  1.00 0.00 ? 71  VAL A HG12 2  
ATOM 2982  H HG13 . VAL A 1 71  ? -2.093  10.354  11.308  1.00 0.00 ? 71  VAL A HG13 2  
ATOM 2983  H HG21 . VAL A 1 71  ? -1.484  7.603   12.919  1.00 0.00 ? 71  VAL A HG21 2  
ATOM 2984  H HG22 . VAL A 1 71  ? -1.893  6.300   11.802  1.00 0.00 ? 71  VAL A HG22 2  
ATOM 2985  H HG23 . VAL A 1 71  ? -0.316  7.083   11.705  1.00 0.00 ? 71  VAL A HG23 2  
ATOM 2986  N N    . PRO A 1 72  ? -4.943  9.783   9.783   1.00 0.00 ? 72  PRO A N    2  
ATOM 2987  C CA   . PRO A 1 72  ? -5.594  10.333  8.590   1.00 0.00 ? 72  PRO A CA   2  
ATOM 2988  C C    . PRO A 1 72  ? -4.626  11.121  7.714   1.00 0.00 ? 72  PRO A C    2  
ATOM 2989  O O    . PRO A 1 72  ? -5.020  11.699  6.700   1.00 0.00 ? 72  PRO A O    2  
ATOM 2990  C CB   . PRO A 1 72  ? -6.667  11.260  9.168   1.00 0.00 ? 72  PRO A CB   2  
ATOM 2991  C CG   . PRO A 1 72  ? -6.154  11.642  10.513  1.00 0.00 ? 72  PRO A CG   2  
ATOM 2992  C CD   . PRO A 1 72  ? -5.388  10.451  11.018  1.00 0.00 ? 72  PRO A CD   2  
ATOM 2993  H HA   . PRO A 1 72  ? -6.063  9.559   8.001   1.00 0.00 ? 72  PRO A HA   2  
ATOM 2994  H HB2  . PRO A 1 72  ? -6.783  12.123  8.528   1.00 0.00 ? 72  PRO A HB2  2  
ATOM 2995  H HB3  . PRO A 1 72  ? -7.605  10.730  9.239   1.00 0.00 ? 72  PRO A HB3  2  
ATOM 2996  H HG2  . PRO A 1 72  ? -5.502  12.498  10.428  1.00 0.00 ? 72  PRO A HG2  2  
ATOM 2997  H HG3  . PRO A 1 72  ? -6.980  11.862  11.172  1.00 0.00 ? 72  PRO A HG3  2  
ATOM 2998  H HD2  . PRO A 1 72  ? -4.542  10.769  11.610  1.00 0.00 ? 72  PRO A HD2  2  
ATOM 2999  H HD3  . PRO A 1 72  ? -6.032  9.804   11.595  1.00 0.00 ? 72  PRO A HD3  2  
ATOM 3000  N N    . THR A 1 73  ? -3.357  11.139  8.109   1.00 0.00 ? 73  THR A N    2  
ATOM 3001  C CA   . THR A 1 73  ? -2.333  11.855  7.359   1.00 0.00 ? 73  THR A CA   2  
ATOM 3002  C C    . THR A 1 73  ? -1.373  10.888  6.676   1.00 0.00 ? 73  THR A C    2  
ATOM 3003  O O    . THR A 1 73  ? -0.475  11.304  5.946   1.00 0.00 ? 73  THR A O    2  
ATOM 3004  C CB   . THR A 1 73  ? -1.529  12.802  8.270   1.00 0.00 ? 73  THR A CB   2  
ATOM 3005  O OG1  . THR A 1 73  ? -0.915  12.058  9.329   1.00 0.00 ? 73  THR A OG1  2  
ATOM 3006  C CG2  . THR A 1 73  ? -2.426  13.881  8.857   1.00 0.00 ? 73  THR A CG2  2  
ATOM 3007  H H    . THR A 1 73  ? -3.105  10.658  8.925   1.00 0.00 ? 73  THR A H    2  
ATOM 3008  H HA   . THR A 1 73  ? -2.827  12.450  6.605   1.00 0.00 ? 73  THR A HA   2  
ATOM 3009  H HB   . THR A 1 73  ? -0.758  13.276  7.680   1.00 0.00 ? 73  THR A HB   2  
ATOM 3010  H HG1  . THR A 1 73  ? -1.568  11.866  10.006  1.00 0.00 ? 73  THR A HG1  2  
ATOM 3011  H HG21 . THR A 1 73  ? -3.381  13.868  8.353   1.00 0.00 ? 73  THR A HG21 2  
ATOM 3012  H HG22 . THR A 1 73  ? -1.962  14.847  8.723   1.00 0.00 ? 73  THR A HG22 2  
ATOM 3013  H HG23 . THR A 1 73  ? -2.572  13.694  9.910   1.00 0.00 ? 73  THR A HG23 2  
ATOM 3014  N N    . GLU A 1 74  ? -1.570  9.596   6.919   1.00 0.00 ? 74  GLU A N    2  
ATOM 3015  C CA   . GLU A 1 74  ? -0.720  8.570   6.326   1.00 0.00 ? 74  GLU A CA   2  
ATOM 3016  C C    . GLU A 1 74  ? -1.436  7.869   5.175   1.00 0.00 ? 74  GLU A C    2  
ATOM 3017  O O    . GLU A 1 74  ? -2.538  7.347   5.341   1.00 0.00 ? 74  GLU A O    2  
ATOM 3018  C CB   . GLU A 1 74  ? -0.308  7.544   7.384   1.00 0.00 ? 74  GLU A CB   2  
ATOM 3019  C CG   . GLU A 1 74  ? 0.939   7.937   8.159   1.00 0.00 ? 74  GLU A CG   2  
ATOM 3020  C CD   . GLU A 1 74  ? 2.212   7.425   7.514   1.00 0.00 ? 74  GLU A CD   2  
ATOM 3021  O OE1  . GLU A 1 74  ? 2.340   6.195   7.348   1.00 0.00 ? 74  GLU A OE1  2  
ATOM 3022  O OE2  . GLU A 1 74  ? 3.080   8.257   7.176   1.00 0.00 ? 74  GLU A OE2  2  
ATOM 3023  H H    . GLU A 1 74  ? -2.303  9.327   7.510   1.00 0.00 ? 74  GLU A H    2  
ATOM 3024  H HA   . GLU A 1 74  ? 0.165   9.053   5.943   1.00 0.00 ? 74  GLU A HA   2  
ATOM 3025  H HB2  . GLU A 1 74  ? -1.120  7.422   8.086   1.00 0.00 ? 74  GLU A HB2  2  
ATOM 3026  H HB3  . GLU A 1 74  ? -0.120  6.599   6.897   1.00 0.00 ? 74  GLU A HB3  2  
ATOM 3027  H HG2  . GLU A 1 74  ? 0.989   9.014   8.214   1.00 0.00 ? 74  GLU A HG2  2  
ATOM 3028  H HG3  . GLU A 1 74  ? 0.869   7.530   9.158   1.00 0.00 ? 74  GLU A HG3  2  
ATOM 3029  N N    . ARG A 1 75  ? -0.800  7.863   4.007   1.00 0.00 ? 75  ARG A N    2  
ATOM 3030  C CA   . ARG A 1 75  ? -1.376  7.229   2.827   1.00 0.00 ? 75  ARG A CA   2  
ATOM 3031  C C    . ARG A 1 75  ? -0.596  5.973   2.450   1.00 0.00 ? 75  ARG A C    2  
ATOM 3032  O O    . ARG A 1 75  ? -0.582  5.564   1.289   1.00 0.00 ? 75  ARG A O    2  
ATOM 3033  C CB   . ARG A 1 75  ? -1.388  8.208   1.651   1.00 0.00 ? 75  ARG A CB   2  
ATOM 3034  C CG   . ARG A 1 75  ? -1.939  9.579   2.005   1.00 0.00 ? 75  ARG A CG   2  
ATOM 3035  C CD   . ARG A 1 75  ? -3.457  9.608   1.920   1.00 0.00 ? 75  ARG A CD   2  
ATOM 3036  N NE   . ARG A 1 75  ? -3.960  10.931  1.560   1.00 0.00 ? 75  ARG A NE   2  
ATOM 3037  C CZ   . ARG A 1 75  ? -4.024  11.950  2.410   1.00 0.00 ? 75  ARG A CZ   2  
ATOM 3038  N NH1  . ARG A 1 75  ? -3.620  11.798  3.663   1.00 0.00 ? 75  ARG A NH1  2  
ATOM 3039  N NH2  . ARG A 1 75  ? -4.494  13.124  2.007   1.00 0.00 ? 75  ARG A NH2  2  
ATOM 3040  H H    . ARG A 1 75  ? 0.076   8.296   3.938   1.00 0.00 ? 75  ARG A H    2  
ATOM 3041  H HA   . ARG A 1 75  ? -2.392  6.951   3.063   1.00 0.00 ? 75  ARG A HA   2  
ATOM 3042  H HB2  . ARG A 1 75  ? -0.377  8.332   1.291   1.00 0.00 ? 75  ARG A HB2  2  
ATOM 3043  H HB3  . ARG A 1 75  ? -1.995  7.793   0.860   1.00 0.00 ? 75  ARG A HB3  2  
ATOM 3044  H HG2  . ARG A 1 75  ? -1.642  9.827   3.014   1.00 0.00 ? 75  ARG A HG2  2  
ATOM 3045  H HG3  . ARG A 1 75  ? -1.534  10.307  1.319   1.00 0.00 ? 75  ARG A HG3  2  
ATOM 3046  H HD2  . ARG A 1 75  ? -3.776  8.897   1.173   1.00 0.00 ? 75  ARG A HD2  2  
ATOM 3047  H HD3  . ARG A 1 75  ? -3.864  9.328   2.880   1.00 0.00 ? 75  ARG A HD3  2  
ATOM 3048  H HE   . ARG A 1 75  ? -4.264  11.066  0.638   1.00 0.00 ? 75  ARG A HE   2  
ATOM 3049  H HH11 . ARG A 1 75  ? -3.264  10.915  3.970   1.00 0.00 ? 75  ARG A HH11 2  
ATOM 3050  H HH12 . ARG A 1 75  ? -3.668  12.567  4.301   1.00 0.00 ? 75  ARG A HH12 2  
ATOM 3051  H HH21 . ARG A 1 75  ? -4.800  13.242  1.063   1.00 0.00 ? 75  ARG A HH21 2  
ATOM 3052  H HH22 . ARG A 1 75  ? -4.542  13.889  2.648   1.00 0.00 ? 75  ARG A HH22 2  
ATOM 3053  N N    . SER A 1 76  ? 0.052   5.366   3.439   1.00 0.00 ? 76  SER A N    2  
ATOM 3054  C CA   . SER A 1 76  ? 0.838   4.159   3.211   1.00 0.00 ? 76  SER A CA   2  
ATOM 3055  C C    . SER A 1 76  ? 0.800   3.247   4.433   1.00 0.00 ? 76  SER A C    2  
ATOM 3056  O O    . SER A 1 76  ? 0.480   3.684   5.538   1.00 0.00 ? 76  SER A O    2  
ATOM 3057  C CB   . SER A 1 76  ? 2.286   4.523   2.876   1.00 0.00 ? 76  SER A CB   2  
ATOM 3058  O OG   . SER A 1 76  ? 2.919   5.157   3.974   1.00 0.00 ? 76  SER A OG   2  
ATOM 3059  H H    . SER A 1 76  ? 0.002   5.741   4.344   1.00 0.00 ? 76  SER A H    2  
ATOM 3060  H HA   . SER A 1 76  ? 0.404   3.635   2.372   1.00 0.00 ? 76  SER A HA   2  
ATOM 3061  H HB2  . SER A 1 76  ? 2.832   3.626   2.630   1.00 0.00 ? 76  SER A HB2  2  
ATOM 3062  H HB3  . SER A 1 76  ? 2.298   5.196   2.031   1.00 0.00 ? 76  SER A HB3  2  
ATOM 3063  H HG   . SER A 1 76  ? 3.720   5.592   3.674   1.00 0.00 ? 76  SER A HG   2  
ATOM 3064  N N    . ALA A 1 77  ? 1.131   1.976   4.226   1.00 0.00 ? 77  ALA A N    2  
ATOM 3065  C CA   . ALA A 1 77  ? 1.138   1.002   5.310   1.00 0.00 ? 77  ALA A CA   2  
ATOM 3066  C C    . ALA A 1 77  ? 2.098   -0.144  5.011   1.00 0.00 ? 77  ALA A C    2  
ATOM 3067  O O    . ALA A 1 77  ? 2.376   -0.449  3.852   1.00 0.00 ? 77  ALA A O    2  
ATOM 3068  C CB   . ALA A 1 77  ? -0.267  0.468   5.548   1.00 0.00 ? 77  ALA A CB   2  
ATOM 3069  H H    . ALA A 1 77  ? 1.378   1.688   3.322   1.00 0.00 ? 77  ALA A H    2  
ATOM 3070  H HA   . ALA A 1 77  ? 1.462   1.506   6.209   1.00 0.00 ? 77  ALA A HA   2  
ATOM 3071  H HB1  . ALA A 1 77  ? -0.222  -0.597  5.723   1.00 0.00 ? 77  ALA A HB1  2  
ATOM 3072  H HB2  . ALA A 1 77  ? -0.696  0.957   6.410   1.00 0.00 ? 77  ALA A HB2  2  
ATOM 3073  H HB3  . ALA A 1 77  ? -0.879  0.665   4.680   1.00 0.00 ? 77  ALA A HB3  2  
ATOM 3074  N N    . VAL A 1 78  ? 2.602   -0.777  6.066   1.00 0.00 ? 78  VAL A N    2  
ATOM 3075  C CA   . VAL A 1 78  ? 3.531   -1.891  5.917   1.00 0.00 ? 78  VAL A CA   2  
ATOM 3076  C C    . VAL A 1 78  ? 2.959   -3.169  6.520   1.00 0.00 ? 78  VAL A C    2  
ATOM 3077  O O    . VAL A 1 78  ? 2.769   -3.265  7.733   1.00 0.00 ? 78  VAL A O    2  
ATOM 3078  C CB   . VAL A 1 78  ? 4.886   -1.585  6.582   1.00 0.00 ? 78  VAL A CB   2  
ATOM 3079  C CG1  . VAL A 1 78  ? 5.850   -2.745  6.389   1.00 0.00 ? 78  VAL A CG1  2  
ATOM 3080  C CG2  . VAL A 1 78  ? 5.472   -0.296  6.026   1.00 0.00 ? 78  VAL A CG2  2  
ATOM 3081  H H    . VAL A 1 78  ? 2.342   -0.489  6.966   1.00 0.00 ? 78  VAL A H    2  
ATOM 3082  H HA   . VAL A 1 78  ? 3.699   -2.047  4.861   1.00 0.00 ? 78  VAL A HA   2  
ATOM 3083  H HB   . VAL A 1 78  ? 4.723   -1.454  7.642   1.00 0.00 ? 78  VAL A HB   2  
ATOM 3084  H HG11 . VAL A 1 78  ? 6.852   -2.424  6.633   1.00 0.00 ? 78  VAL A HG11 2  
ATOM 3085  H HG12 . VAL A 1 78  ? 5.565   -3.562  7.036   1.00 0.00 ? 78  VAL A HG12 2  
ATOM 3086  H HG13 . VAL A 1 78  ? 5.819   -3.072  5.360   1.00 0.00 ? 78  VAL A HG13 2  
ATOM 3087  H HG21 . VAL A 1 78  ? 4.806   0.525   6.244   1.00 0.00 ? 78  VAL A HG21 2  
ATOM 3088  H HG22 . VAL A 1 78  ? 6.433   -0.110  6.485   1.00 0.00 ? 78  VAL A HG22 2  
ATOM 3089  H HG23 . VAL A 1 78  ? 5.596   -0.387  4.958   1.00 0.00 ? 78  VAL A HG23 2  
ATOM 3090  N N    . LEU A 1 79  ? 2.686   -4.149  5.666   1.00 0.00 ? 79  LEU A N    2  
ATOM 3091  C CA   . LEU A 1 79  ? 2.135   -5.423  6.114   1.00 0.00 ? 79  LEU A CA   2  
ATOM 3092  C C    . LEU A 1 79  ? 3.244   -6.443  6.350   1.00 0.00 ? 79  LEU A C    2  
ATOM 3093  O O    . LEU A 1 79  ? 3.931   -6.856  5.415   1.00 0.00 ? 79  LEU A O    2  
ATOM 3094  C CB   . LEU A 1 79  ? 1.141   -5.962  5.084   1.00 0.00 ? 79  LEU A CB   2  
ATOM 3095  C CG   . LEU A 1 79  ? 0.104   -4.965  4.566   1.00 0.00 ? 79  LEU A CG   2  
ATOM 3096  C CD1  . LEU A 1 79  ? -0.538  -5.479  3.287   1.00 0.00 ? 79  LEU A CD1  2  
ATOM 3097  C CD2  . LEU A 1 79  ? -0.954  -4.696  5.625   1.00 0.00 ? 79  LEU A CD2  2  
ATOM 3098  H H    . LEU A 1 79  ? 2.858   -4.014  4.711   1.00 0.00 ? 79  LEU A H    2  
ATOM 3099  H HA   . LEU A 1 79  ? 1.617   -5.251  7.046   1.00 0.00 ? 79  LEU A HA   2  
ATOM 3100  H HB2  . LEU A 1 79  ? 1.705   -6.323  4.238   1.00 0.00 ? 79  LEU A HB2  2  
ATOM 3101  H HB3  . LEU A 1 79  ? 0.610   -6.787  5.538   1.00 0.00 ? 79  LEU A HB3  2  
ATOM 3102  H HG   . LEU A 1 79  ? 0.597   -4.029  4.338   1.00 0.00 ? 79  LEU A HG   2  
ATOM 3103  H HD11 . LEU A 1 79  ? 0.223   -5.624  2.535   1.00 0.00 ? 79  LEU A HD11 2  
ATOM 3104  H HD12 . LEU A 1 79  ? -1.262  -4.760  2.933   1.00 0.00 ? 79  LEU A HD12 2  
ATOM 3105  H HD13 . LEU A 1 79  ? -1.032  -6.419  3.485   1.00 0.00 ? 79  LEU A HD13 2  
ATOM 3106  H HD21 . LEU A 1 79  ? -0.647  -5.141  6.561   1.00 0.00 ? 79  LEU A HD21 2  
ATOM 3107  H HD22 . LEU A 1 79  ? -1.894  -5.127  5.313   1.00 0.00 ? 79  LEU A HD22 2  
ATOM 3108  H HD23 . LEU A 1 79  ? -1.071  -3.630  5.754   1.00 0.00 ? 79  LEU A HD23 2  
ATOM 3109  N N    . VAL A 1 80  ? 3.413   -6.848  7.605   1.00 0.00 ? 80  VAL A N    2  
ATOM 3110  C CA   . VAL A 1 80  ? 4.436   -7.822  7.963   1.00 0.00 ? 80  VAL A CA   2  
ATOM 3111  C C    . VAL A 1 80  ? 3.823   -9.195  8.215   1.00 0.00 ? 80  VAL A C    2  
ATOM 3112  O O    . VAL A 1 80  ? 2.604   -9.355  8.196   1.00 0.00 ? 80  VAL A O    2  
ATOM 3113  C CB   . VAL A 1 80  ? 5.215   -7.383  9.217   1.00 0.00 ? 80  VAL A CB   2  
ATOM 3114  C CG1  . VAL A 1 80  ? 6.023   -6.126  8.930   1.00 0.00 ? 80  VAL A CG1  2  
ATOM 3115  C CG2  . VAL A 1 80  ? 4.265   -7.162  10.384  1.00 0.00 ? 80  VAL A CG2  2  
ATOM 3116  H H    . VAL A 1 80  ? 2.834   -6.482  8.306   1.00 0.00 ? 80  VAL A H    2  
ATOM 3117  H HA   . VAL A 1 80  ? 5.132   -7.894  7.139   1.00 0.00 ? 80  VAL A HA   2  
ATOM 3118  H HB   . VAL A 1 80  ? 5.903   -8.172  9.484   1.00 0.00 ? 80  VAL A HB   2  
ATOM 3119  H HG11 . VAL A 1 80  ? 6.120   -5.546  9.837   1.00 0.00 ? 80  VAL A HG11 2  
ATOM 3120  H HG12 . VAL A 1 80  ? 7.003   -6.401  8.571   1.00 0.00 ? 80  VAL A HG12 2  
ATOM 3121  H HG13 . VAL A 1 80  ? 5.516   -5.536  8.181   1.00 0.00 ? 80  VAL A HG13 2  
ATOM 3122  H HG21 . VAL A 1 80  ? 4.506   -7.852  11.178  1.00 0.00 ? 80  VAL A HG21 2  
ATOM 3123  H HG22 . VAL A 1 80  ? 4.367   -6.148  10.745  1.00 0.00 ? 80  VAL A HG22 2  
ATOM 3124  H HG23 . VAL A 1 80  ? 3.249   -7.327  10.058  1.00 0.00 ? 80  VAL A HG23 2  
ATOM 3125  N N    . ASN A 1 81  ? 4.679   -10.185 8.450   1.00 0.00 ? 81  ASN A N    2  
ATOM 3126  C CA   . ASN A 1 81  ? 4.222   -11.546 8.705   1.00 0.00 ? 81  ASN A CA   2  
ATOM 3127  C C    . ASN A 1 81  ? 3.432   -12.087 7.517   1.00 0.00 ? 81  ASN A C    2  
ATOM 3128  O O    . ASN A 1 81  ? 2.293   -12.533 7.666   1.00 0.00 ? 81  ASN A O    2  
ATOM 3129  C CB   . ASN A 1 81  ? 3.358   -11.588 9.968   1.00 0.00 ? 81  ASN A CB   2  
ATOM 3130  C CG   . ASN A 1 81  ? 4.181   -11.795 11.225  1.00 0.00 ? 81  ASN A CG   2  
ATOM 3131  O OD1  . ASN A 1 81  ? 3.967   -12.751 11.970  1.00 0.00 ? 81  ASN A OD1  2  
ATOM 3132  N ND2  . ASN A 1 81  ? 5.128   -10.896 11.466  1.00 0.00 ? 81  ASN A ND2  2  
ATOM 3133  H H    . ASN A 1 81  ? 5.641   -9.996  8.451   1.00 0.00 ? 81  ASN A H    2  
ATOM 3134  H HA   . ASN A 1 81  ? 5.093   -12.166 8.855   1.00 0.00 ? 81  ASN A HA   2  
ATOM 3135  H HB2  . ASN A 1 81  ? 2.823   -10.654 10.061  1.00 0.00 ? 81  ASN A HB2  2  
ATOM 3136  H HB3  . ASN A 1 81  ? 2.649   -12.398 9.886   1.00 0.00 ? 81  ASN A HB3  2  
ATOM 3137  H HD21 . ASN A 1 81  ? 5.242   -10.160 10.829  1.00 0.00 ? 81  ASN A HD21 2  
ATOM 3138  H HD22 . ASN A 1 81  ? 5.676   -11.005 12.271  1.00 0.00 ? 81  ASN A HD22 2  
ATOM 3139  N N    . LEU A 1 82  ? 4.043   -12.044 6.339   1.00 0.00 ? 82  LEU A N    2  
ATOM 3140  C CA   . LEU A 1 82  ? 3.398   -12.529 5.124   1.00 0.00 ? 82  LEU A CA   2  
ATOM 3141  C C    . LEU A 1 82  ? 4.049   -13.821 4.641   1.00 0.00 ? 82  LEU A C    2  
ATOM 3142  O O    . LEU A 1 82  ? 5.244   -14.040 4.842   1.00 0.00 ? 82  LEU A O    2  
ATOM 3143  C CB   . LEU A 1 82  ? 3.469   -11.467 4.025   1.00 0.00 ? 82  LEU A CB   2  
ATOM 3144  C CG   . LEU A 1 82  ? 2.830   -10.118 4.354   1.00 0.00 ? 82  LEU A CG   2  
ATOM 3145  C CD1  . LEU A 1 82  ? 3.049   -9.132  3.217   1.00 0.00 ? 82  LEU A CD1  2  
ATOM 3146  C CD2  . LEU A 1 82  ? 1.344   -10.286 4.637   1.00 0.00 ? 82  LEU A CD2  2  
ATOM 3147  H H    . LEU A 1 82  ? 4.950   -11.677 6.283   1.00 0.00 ? 82  LEU A H    2  
ATOM 3148  H HA   . LEU A 1 82  ? 2.362   -12.727 5.356   1.00 0.00 ? 82  LEU A HA   2  
ATOM 3149  H HB2  . LEU A 1 82  ? 4.510   -11.294 3.800   1.00 0.00 ? 82  LEU A HB2  2  
ATOM 3150  H HB3  . LEU A 1 82  ? 2.974   -11.865 3.150   1.00 0.00 ? 82  LEU A HB3  2  
ATOM 3151  H HG   . LEU A 1 82  ? 3.296   -9.712  5.241   1.00 0.00 ? 82  LEU A HG   2  
ATOM 3152  H HD11 . LEU A 1 82  ? 2.168   -9.100  2.594   1.00 0.00 ? 82  LEU A HD11 2  
ATOM 3153  H HD12 . LEU A 1 82  ? 3.897   -9.447  2.627   1.00 0.00 ? 82  LEU A HD12 2  
ATOM 3154  H HD13 . LEU A 1 82  ? 3.239   -8.150  3.624   1.00 0.00 ? 82  LEU A HD13 2  
ATOM 3155  H HD21 . LEU A 1 82  ? 0.828   -10.526 3.719   1.00 0.00 ? 82  LEU A HD21 2  
ATOM 3156  H HD22 . LEU A 1 82  ? 0.949   -9.366  5.043   1.00 0.00 ? 82  LEU A HD22 2  
ATOM 3157  H HD23 . LEU A 1 82  ? 1.202   -11.085 5.350   1.00 0.00 ? 82  LEU A HD23 2  
ATOM 3158  N N    . LYS A 1 83  ? 3.256   -14.674 4.001   1.00 0.00 ? 83  LYS A N    2  
ATOM 3159  C CA   . LYS A 1 83  ? 3.755   -15.944 3.485   1.00 0.00 ? 83  LYS A CA   2  
ATOM 3160  C C    . LYS A 1 83  ? 4.677   -15.721 2.291   1.00 0.00 ? 83  LYS A C    2  
ATOM 3161  O O    . LYS A 1 83  ? 4.540   -14.738 1.562   1.00 0.00 ? 83  LYS A O    2  
ATOM 3162  C CB   . LYS A 1 83  ? 2.588   -16.847 3.080   1.00 0.00 ? 83  LYS A CB   2  
ATOM 3163  C CG   . LYS A 1 83  ? 2.895   -18.329 3.204   1.00 0.00 ? 83  LYS A CG   2  
ATOM 3164  C CD   . LYS A 1 83  ? 3.480   -18.887 1.918   1.00 0.00 ? 83  LYS A CD   2  
ATOM 3165  C CE   . LYS A 1 83  ? 3.211   -20.378 1.784   1.00 0.00 ? 83  LYS A CE   2  
ATOM 3166  N NZ   . LYS A 1 83  ? 3.693   -20.914 0.480   1.00 0.00 ? 83  LYS A NZ   2  
ATOM 3167  H H    . LYS A 1 83  ? 2.312   -14.444 3.871   1.00 0.00 ? 83  LYS A H    2  
ATOM 3168  H HA   . LYS A 1 83  ? 4.315   -16.425 4.273   1.00 0.00 ? 83  LYS A HA   2  
ATOM 3169  H HB2  . LYS A 1 83  ? 1.739   -16.622 3.709   1.00 0.00 ? 83  LYS A HB2  2  
ATOM 3170  H HB3  . LYS A 1 83  ? 2.328   -16.640 2.052   1.00 0.00 ? 83  LYS A HB3  2  
ATOM 3171  H HG2  . LYS A 1 83  ? 3.606   -18.475 4.004   1.00 0.00 ? 83  LYS A HG2  2  
ATOM 3172  H HG3  . LYS A 1 83  ? 1.981   -18.859 3.433   1.00 0.00 ? 83  LYS A HG3  2  
ATOM 3173  H HD2  . LYS A 1 83  ? 3.034   -18.376 1.078   1.00 0.00 ? 83  LYS A HD2  2  
ATOM 3174  H HD3  . LYS A 1 83  ? 4.548   -18.721 1.917   1.00 0.00 ? 83  LYS A HD3  2  
ATOM 3175  H HE2  . LYS A 1 83  ? 3.718   -20.895 2.585   1.00 0.00 ? 83  LYS A HE2  2  
ATOM 3176  H HE3  . LYS A 1 83  ? 2.148   -20.547 1.862   1.00 0.00 ? 83  LYS A HE3  2  
ATOM 3177  H HZ1  . LYS A 1 83  ? 3.081   -20.578 -0.291  1.00 0.00 ? 83  LYS A HZ1  2  
ATOM 3178  H HZ2  . LYS A 1 83  ? 3.676   -21.953 0.493   1.00 0.00 ? 83  LYS A HZ2  2  
ATOM 3179  H HZ3  . LYS A 1 83  ? 4.666   -20.595 0.300   1.00 0.00 ? 83  LYS A HZ3  2  
ATOM 3180  N N    . LYS A 1 84  ? 5.617   -16.640 2.095   1.00 0.00 ? 84  LYS A N    2  
ATOM 3181  C CA   . LYS A 1 84  ? 6.560   -16.546 0.988   1.00 0.00 ? 84  LYS A CA   2  
ATOM 3182  C C    . LYS A 1 84  ? 6.125   -17.434 -0.174  1.00 0.00 ? 84  LYS A C    2  
ATOM 3183  O O    . LYS A 1 84  ? 5.786   -18.601 0.016   1.00 0.00 ? 84  LYS A O    2  
ATOM 3184  C CB   . LYS A 1 84  ? 7.963   -16.946 1.451   1.00 0.00 ? 84  LYS A CB   2  
ATOM 3185  C CG   . LYS A 1 84  ? 8.474   -16.125 2.622   1.00 0.00 ? 84  LYS A CG   2  
ATOM 3186  C CD   . LYS A 1 84  ? 8.128   -16.775 3.952   1.00 0.00 ? 84  LYS A CD   2  
ATOM 3187  C CE   . LYS A 1 84  ? 8.051   -15.748 5.071   1.00 0.00 ? 84  LYS A CE   2  
ATOM 3188  N NZ   . LYS A 1 84  ? 7.739   -16.379 6.383   1.00 0.00 ? 84  LYS A NZ   2  
ATOM 3189  H H    . LYS A 1 84  ? 5.676   -17.401 2.711   1.00 0.00 ? 84  LYS A H    2  
ATOM 3190  H HA   . LYS A 1 84  ? 6.579   -15.520 0.654   1.00 0.00 ? 84  LYS A HA   2  
ATOM 3191  H HB2  . LYS A 1 84  ? 7.950   -17.985 1.745   1.00 0.00 ? 84  LYS A HB2  2  
ATOM 3192  H HB3  . LYS A 1 84  ? 8.650   -16.823 0.626   1.00 0.00 ? 84  LYS A HB3  2  
ATOM 3193  H HG2  . LYS A 1 84  ? 9.547   -16.035 2.547   1.00 0.00 ? 84  LYS A HG2  2  
ATOM 3194  H HG3  . LYS A 1 84  ? 8.024   -15.143 2.585   1.00 0.00 ? 84  LYS A HG3  2  
ATOM 3195  H HD2  . LYS A 1 84  ? 7.171   -17.267 3.864   1.00 0.00 ? 84  LYS A HD2  2  
ATOM 3196  H HD3  . LYS A 1 84  ? 8.889   -17.503 4.195   1.00 0.00 ? 84  LYS A HD3  2  
ATOM 3197  H HE2  . LYS A 1 84  ? 9.000   -15.240 5.142   1.00 0.00 ? 84  LYS A HE2  2  
ATOM 3198  H HE3  . LYS A 1 84  ? 7.277   -15.032 4.832   1.00 0.00 ? 84  LYS A HE3  2  
ATOM 3199  H HZ1  . LYS A 1 84  ? 8.619   -16.619 6.882   1.00 0.00 ? 84  LYS A HZ1  2  
ATOM 3200  H HZ2  . LYS A 1 84  ? 7.188   -17.250 6.238   1.00 0.00 ? 84  LYS A HZ2  2  
ATOM 3201  H HZ3  . LYS A 1 84  ? 7.185   -15.725 6.972   1.00 0.00 ? 84  LYS A HZ3  2  
ATOM 3202  N N    . GLY A 1 85  ? 6.139   -16.872 -1.380  1.00 0.00 ? 85  GLY A N    2  
ATOM 3203  C CA   . GLY A 1 85  ? 5.745   -17.628 -2.554  1.00 0.00 ? 85  GLY A CA   2  
ATOM 3204  C C    . GLY A 1 85  ? 4.240   -17.721 -2.706  1.00 0.00 ? 85  GLY A C    2  
ATOM 3205  O O    . GLY A 1 85  ? 3.685   -18.816 -2.795  1.00 0.00 ? 85  GLY A O    2  
ATOM 3206  H H    . GLY A 1 85  ? 6.419   -15.937 -1.472  1.00 0.00 ? 85  GLY A H    2  
ATOM 3207  H HA2  . GLY A 1 85  ? 6.156   -17.149 -3.431  1.00 0.00 ? 85  GLY A HA2  2  
ATOM 3208  H HA3  . GLY A 1 85  ? 6.150   -18.626 -2.479  1.00 0.00 ? 85  GLY A HA3  2  
ATOM 3209  N N    . VAL A 1 86  ? 3.577   -16.569 -2.734  1.00 0.00 ? 86  VAL A N    2  
ATOM 3210  C CA   . VAL A 1 86  ? 2.126   -16.526 -2.875  1.00 0.00 ? 86  VAL A CA   2  
ATOM 3211  C C    . VAL A 1 86  ? 1.640   -15.100 -3.108  1.00 0.00 ? 86  VAL A C    2  
ATOM 3212  O O    . VAL A 1 86  ? 2.259   -14.138 -2.653  1.00 0.00 ? 86  VAL A O    2  
ATOM 3213  C CB   . VAL A 1 86  ? 1.424   -17.099 -1.630  1.00 0.00 ? 86  VAL A CB   2  
ATOM 3214  C CG1  . VAL A 1 86  ? 1.429   -16.082 -0.498  1.00 0.00 ? 86  VAL A CG1  2  
ATOM 3215  C CG2  . VAL A 1 86  ? 0.003   -17.524 -1.969  1.00 0.00 ? 86  VAL A CG2  2  
ATOM 3216  H H    . VAL A 1 86  ? 4.075   -15.729 -2.659  1.00 0.00 ? 86  VAL A H    2  
ATOM 3217  H HA   . VAL A 1 86  ? 1.855   -17.132 -3.727  1.00 0.00 ? 86  VAL A HA   2  
ATOM 3218  H HB   . VAL A 1 86  ? 1.970   -17.971 -1.303  1.00 0.00 ? 86  VAL A HB   2  
ATOM 3219  H HG11 . VAL A 1 86  ? 0.947   -15.174 -0.829  1.00 0.00 ? 86  VAL A HG11 2  
ATOM 3220  H HG12 . VAL A 1 86  ? 0.897   -16.486 0.351   1.00 0.00 ? 86  VAL A HG12 2  
ATOM 3221  H HG13 . VAL A 1 86  ? 2.449   -15.865 -0.214  1.00 0.00 ? 86  VAL A HG13 2  
ATOM 3222  H HG21 . VAL A 1 86  ? -0.118  -18.575 -1.752  1.00 0.00 ? 86  VAL A HG21 2  
ATOM 3223  H HG22 . VAL A 1 86  ? -0.696  -16.952 -1.376  1.00 0.00 ? 86  VAL A HG22 2  
ATOM 3224  H HG23 . VAL A 1 86  ? -0.185  -17.348 -3.017  1.00 0.00 ? 86  VAL A HG23 2  
ATOM 3225  N N    . THR A 1 87  ? 0.525   -14.970 -3.821  1.00 0.00 ? 87  THR A N    2  
ATOM 3226  C CA   . THR A 1 87  ? -0.046  -13.662 -4.116  1.00 0.00 ? 87  THR A CA   2  
ATOM 3227  C C    . THR A 1 87  ? -0.872  -13.145 -2.943  1.00 0.00 ? 87  THR A C    2  
ATOM 3228  O O    . THR A 1 87  ? -1.507  -13.921 -2.229  1.00 0.00 ? 87  THR A O    2  
ATOM 3229  C CB   . THR A 1 87  ? -0.933  -13.707 -5.374  1.00 0.00 ? 87  THR A CB   2  
ATOM 3230  O OG1  . THR A 1 87  ? -0.314  -14.513 -6.382  1.00 0.00 ? 87  THR A OG1  2  
ATOM 3231  C CG2  . THR A 1 87  ? -1.176  -12.306 -5.916  1.00 0.00 ? 87  THR A CG2  2  
ATOM 3232  H H    . THR A 1 87  ? 0.077   -15.775 -4.156  1.00 0.00 ? 87  THR A H    2  
ATOM 3233  H HA   . THR A 1 87  ? 0.769   -12.976 -4.300  1.00 0.00 ? 87  THR A HA   2  
ATOM 3234  H HB   . THR A 1 87  ? -1.886  -14.144 -5.109  1.00 0.00 ? 87  THR A HB   2  
ATOM 3235  H HG1  . THR A 1 87  ? -0.621  -14.235 -7.248  1.00 0.00 ? 87  THR A HG1  2  
ATOM 3236  H HG21 . THR A 1 87  ? -0.300  -11.971 -6.452  1.00 0.00 ? 87  THR A HG21 2  
ATOM 3237  H HG22 . THR A 1 87  ? -1.376  -11.633 -5.096  1.00 0.00 ? 87  THR A HG22 2  
ATOM 3238  H HG23 . THR A 1 87  ? -2.023  -12.321 -6.585  1.00 0.00 ? 87  THR A HG23 2  
ATOM 3239  N N    . TYR A 1 88  ? -0.860  -11.831 -2.751  1.00 0.00 ? 88  TYR A N    2  
ATOM 3240  C CA   . TYR A 1 88  ? -1.607  -11.211 -1.663  1.00 0.00 ? 88  TYR A CA   2  
ATOM 3241  C C    . TYR A 1 88  ? -2.454  -10.051 -2.177  1.00 0.00 ? 88  TYR A C    2  
ATOM 3242  O O    . TYR A 1 88  ? -1.946  -9.134  -2.821  1.00 0.00 ? 88  TYR A O    2  
ATOM 3243  C CB   . TYR A 1 88  ? -0.650  -10.716 -0.577  1.00 0.00 ? 88  TYR A CB   2  
ATOM 3244  C CG   . TYR A 1 88  ? -0.362  -11.747 0.491   1.00 0.00 ? 88  TYR A CG   2  
ATOM 3245  C CD1  . TYR A 1 88  ? 0.658   -12.677 0.330   1.00 0.00 ? 88  TYR A CD1  2  
ATOM 3246  C CD2  . TYR A 1 88  ? -1.109  -11.791 1.662   1.00 0.00 ? 88  TYR A CD2  2  
ATOM 3247  C CE1  . TYR A 1 88  ? 0.924   -13.621 1.303   1.00 0.00 ? 88  TYR A CE1  2  
ATOM 3248  C CE2  . TYR A 1 88  ? -0.849  -12.730 2.641   1.00 0.00 ? 88  TYR A CE2  2  
ATOM 3249  C CZ   . TYR A 1 88  ? 0.168   -13.644 2.456   1.00 0.00 ? 88  TYR A CZ   2  
ATOM 3250  O OH   . TYR A 1 88  ? 0.430   -14.582 3.428   1.00 0.00 ? 88  TYR A OH   2  
ATOM 3251  H H    . TYR A 1 88  ? -0.334  -11.264 -3.354  1.00 0.00 ? 88  TYR A H    2  
ATOM 3252  H HA   . TYR A 1 88  ? -2.260  -11.960 -1.240  1.00 0.00 ? 88  TYR A HA   2  
ATOM 3253  H HB2  . TYR A 1 88  ? 0.288   -10.440 -1.031  1.00 0.00 ? 88  TYR A HB2  2  
ATOM 3254  H HB3  . TYR A 1 88  ? -1.080  -9.850  -0.095  1.00 0.00 ? 88  TYR A HB3  2  
ATOM 3255  H HD1  . TYR A 1 88  ? 1.248   -12.656 -0.574  1.00 0.00 ? 88  TYR A HD1  2  
ATOM 3256  H HD2  . TYR A 1 88  ? -1.905  -11.074 1.803   1.00 0.00 ? 88  TYR A HD2  2  
ATOM 3257  H HE1  . TYR A 1 88  ? 1.720   -14.336 1.159   1.00 0.00 ? 88  TYR A HE1  2  
ATOM 3258  H HE2  . TYR A 1 88  ? -1.441  -12.749 3.544   1.00 0.00 ? 88  TYR A HE2  2  
ATOM 3259  H HH   . TYR A 1 88  ? 0.216   -15.456 3.095   1.00 0.00 ? 88  TYR A HH   2  
ATOM 3260  N N    . GLU A 1 89  ? -3.750  -10.099 -1.885  1.00 0.00 ? 89  GLU A N    2  
ATOM 3261  C CA   . GLU A 1 89  ? -4.669  -9.052  -2.317  1.00 0.00 ? 89  GLU A CA   2  
ATOM 3262  C C    . GLU A 1 89  ? -4.869  -8.015  -1.215  1.00 0.00 ? 89  GLU A C    2  
ATOM 3263  O O    . GLU A 1 89  ? -5.239  -8.353  -0.090  1.00 0.00 ? 89  GLU A O    2  
ATOM 3264  C CB   . GLU A 1 89  ? -6.017  -9.658  -2.713  1.00 0.00 ? 89  GLU A CB   2  
ATOM 3265  C CG   . GLU A 1 89  ? -6.903  -8.709  -3.502  1.00 0.00 ? 89  GLU A CG   2  
ATOM 3266  C CD   . GLU A 1 89  ? -8.062  -9.417  -4.177  1.00 0.00 ? 89  GLU A CD   2  
ATOM 3267  O OE1  . GLU A 1 89  ? -9.122  -9.563  -3.533  1.00 0.00 ? 89  GLU A OE1  2  
ATOM 3268  O OE2  . GLU A 1 89  ? -7.909  -9.824  -5.347  1.00 0.00 ? 89  GLU A OE2  2  
ATOM 3269  H H    . GLU A 1 89  ? -4.096  -10.855 -1.367  1.00 0.00 ? 89  GLU A H    2  
ATOM 3270  H HA   . GLU A 1 89  ? -4.237  -8.566  -3.178  1.00 0.00 ? 89  GLU A HA   2  
ATOM 3271  H HB2  . GLU A 1 89  ? -5.840  -10.537 -3.314  1.00 0.00 ? 89  GLU A HB2  2  
ATOM 3272  H HB3  . GLU A 1 89  ? -6.545  -9.947  -1.816  1.00 0.00 ? 89  GLU A HB3  2  
ATOM 3273  H HG2  . GLU A 1 89  ? -7.299  -7.963  -2.829  1.00 0.00 ? 89  GLU A HG2  2  
ATOM 3274  H HG3  . GLU A 1 89  ? -6.305  -8.225  -4.261  1.00 0.00 ? 89  GLU A HG3  2  
ATOM 3275  N N    . ILE A 1 90  ? -4.622  -6.753  -1.547  1.00 0.00 ? 90  ILE A N    2  
ATOM 3276  C CA   . ILE A 1 90  ? -4.775  -5.667  -0.588  1.00 0.00 ? 90  ILE A CA   2  
ATOM 3277  C C    . ILE A 1 90  ? -5.589  -4.521  -1.179  1.00 0.00 ? 90  ILE A C    2  
ATOM 3278  O O    . ILE A 1 90  ? -5.482  -4.217  -2.367  1.00 0.00 ? 90  ILE A O    2  
ATOM 3279  C CB   . ILE A 1 90  ? -3.409  -5.126  -0.127  1.00 0.00 ? 90  ILE A CB   2  
ATOM 3280  C CG1  . ILE A 1 90  ? -2.546  -6.262  0.426   1.00 0.00 ? 90  ILE A CG1  2  
ATOM 3281  C CG2  . ILE A 1 90  ? -3.596  -4.038  0.921   1.00 0.00 ? 90  ILE A CG2  2  
ATOM 3282  C CD1  . ILE A 1 90  ? -1.697  -6.942  -0.626  1.00 0.00 ? 90  ILE A CD1  2  
ATOM 3283  H H    . ILE A 1 90  ? -4.330  -6.547  -2.460  1.00 0.00 ? 90  ILE A H    2  
ATOM 3284  H HA   . ILE A 1 90  ? -5.296  -6.056  0.276   1.00 0.00 ? 90  ILE A HA   2  
ATOM 3285  H HB   . ILE A 1 90  ? -2.913  -4.689  -0.980  1.00 0.00 ? 90  ILE A HB   2  
ATOM 3286  H HG12 . ILE A 1 90  ? -1.885  -5.869  1.182   1.00 0.00 ? 90  ILE A HG12 2  
ATOM 3287  H HG13 . ILE A 1 90  ? -3.189  -7.009  0.869   1.00 0.00 ? 90  ILE A HG13 2  
ATOM 3288  H HG21 . ILE A 1 90  ? -3.225  -3.100  0.535   1.00 0.00 ? 90  ILE A HG21 2  
ATOM 3289  H HG22 . ILE A 1 90  ? -4.645  -3.941  1.155   1.00 0.00 ? 90  ILE A HG22 2  
ATOM 3290  H HG23 . ILE A 1 90  ? -3.049  -4.301  1.814   1.00 0.00 ? 90  ILE A HG23 2  
ATOM 3291  H HD11 . ILE A 1 90  ? -1.511  -6.256  -1.438  1.00 0.00 ? 90  ILE A HD11 2  
ATOM 3292  H HD12 . ILE A 1 90  ? -0.759  -7.248  -0.189  1.00 0.00 ? 90  ILE A HD12 2  
ATOM 3293  H HD13 . ILE A 1 90  ? -2.218  -7.811  -1.002  1.00 0.00 ? 90  ILE A HD13 2  
ATOM 3294  N N    . LYS A 1 91  ? -6.403  -3.886  -0.342  1.00 0.00 ? 91  LYS A N    2  
ATOM 3295  C CA   . LYS A 1 91  ? -7.234  -2.771  -0.779  1.00 0.00 ? 91  LYS A CA   2  
ATOM 3296  C C    . LYS A 1 91  ? -7.462  -1.783  0.360   1.00 0.00 ? 91  LYS A C    2  
ATOM 3297  O O    . LYS A 1 91  ? -7.664  -2.179  1.508   1.00 0.00 ? 91  LYS A O    2  
ATOM 3298  C CB   . LYS A 1 91  ? -8.578  -3.284  -1.300  1.00 0.00 ? 91  LYS A CB   2  
ATOM 3299  C CG   . LYS A 1 91  ? -9.422  -3.967  -0.238  1.00 0.00 ? 91  LYS A CG   2  
ATOM 3300  C CD   . LYS A 1 91  ? -9.059  -5.436  -0.097  1.00 0.00 ? 91  LYS A CD   2  
ATOM 3301  C CE   . LYS A 1 91  ? -9.920  -6.124  0.952   1.00 0.00 ? 91  LYS A CE   2  
ATOM 3302  N NZ   . LYS A 1 91  ? -11.229 -6.563  0.393   1.00 0.00 ? 91  LYS A NZ   2  
ATOM 3303  H H    . LYS A 1 91  ? -6.444  -4.175  0.595   1.00 0.00 ? 91  LYS A H    2  
ATOM 3304  H HA   . LYS A 1 91  ? -6.716  -2.266  -1.580  1.00 0.00 ? 91  LYS A HA   2  
ATOM 3305  H HB2  . LYS A 1 91  ? -9.139  -2.450  -1.695  1.00 0.00 ? 91  LYS A HB2  2  
ATOM 3306  H HB3  . LYS A 1 91  ? -8.396  -3.993  -2.095  1.00 0.00 ? 91  LYS A HB3  2  
ATOM 3307  H HG2  . LYS A 1 91  ? -9.260  -3.474  0.710   1.00 0.00 ? 91  LYS A HG2  2  
ATOM 3308  H HG3  . LYS A 1 91  ? -10.464 -3.887  -0.513  1.00 0.00 ? 91  LYS A HG3  2  
ATOM 3309  H HD2  . LYS A 1 91  ? -9.207  -5.927  -1.047  1.00 0.00 ? 91  LYS A HD2  2  
ATOM 3310  H HD3  . LYS A 1 91  ? -8.021  -5.515  0.194   1.00 0.00 ? 91  LYS A HD3  2  
ATOM 3311  H HE2  . LYS A 1 91  ? -9.390  -6.987  1.324   1.00 0.00 ? 91  LYS A HE2  2  
ATOM 3312  H HE3  . LYS A 1 91  ? -10.098 -5.433  1.763   1.00 0.00 ? 91  LYS A HE3  2  
ATOM 3313  H HZ1  . LYS A 1 91  ? -11.980 -6.435  1.101   1.00 0.00 ? 91  LYS A HZ1  2  
ATOM 3314  H HZ2  . LYS A 1 91  ? -11.186 -7.567  0.128   1.00 0.00 ? 91  LYS A HZ2  2  
ATOM 3315  H HZ3  . LYS A 1 91  ? -11.464 -6.002  -0.451  1.00 0.00 ? 91  LYS A HZ3  2  
ATOM 3316  N N    . VAL A 1 92  ? -7.430  -0.494  0.035   1.00 0.00 ? 92  VAL A N    2  
ATOM 3317  C CA   . VAL A 1 92  ? -7.635  0.551   1.031   1.00 0.00 ? 92  VAL A CA   2  
ATOM 3318  C C    . VAL A 1 92  ? -9.116  0.884   1.180   1.00 0.00 ? 92  VAL A C    2  
ATOM 3319  O O    . VAL A 1 92  ? -9.876  0.825   0.213   1.00 0.00 ? 92  VAL A O    2  
ATOM 3320  C CB   . VAL A 1 92  ? -6.866  1.834   0.665   1.00 0.00 ? 92  VAL A CB   2  
ATOM 3321  C CG1  . VAL A 1 92  ? -7.179  2.945   1.655   1.00 0.00 ? 92  VAL A CG1  2  
ATOM 3322  C CG2  . VAL A 1 92  ? -5.370  1.561   0.614   1.00 0.00 ? 92  VAL A CG2  2  
ATOM 3323  H H    . VAL A 1 92  ? -7.264  -0.240  -0.897  1.00 0.00 ? 92  VAL A H    2  
ATOM 3324  H HA   . VAL A 1 92  ? -7.261  0.189   1.977   1.00 0.00 ? 92  VAL A HA   2  
ATOM 3325  H HB   . VAL A 1 92  ? -7.186  2.155   -0.315  1.00 0.00 ? 92  VAL A HB   2  
ATOM 3326  H HG11 . VAL A 1 92  ? -6.575  3.811   1.427   1.00 0.00 ? 92  VAL A HG11 2  
ATOM 3327  H HG12 . VAL A 1 92  ? -8.225  3.206   1.585   1.00 0.00 ? 92  VAL A HG12 2  
ATOM 3328  H HG13 . VAL A 1 92  ? -6.959  2.607   2.657   1.00 0.00 ? 92  VAL A HG13 2  
ATOM 3329  H HG21 . VAL A 1 92  ? -5.008  1.733   -0.389  1.00 0.00 ? 92  VAL A HG21 2  
ATOM 3330  H HG22 . VAL A 1 92  ? -4.859  2.222   1.299   1.00 0.00 ? 92  VAL A HG22 2  
ATOM 3331  H HG23 . VAL A 1 92  ? -5.181  0.536   0.895   1.00 0.00 ? 92  VAL A HG23 2  
ATOM 3332  N N    . ARG A 1 93  ? -9.518  1.235   2.397   1.00 0.00 ? 93  ARG A N    2  
ATOM 3333  C CA   . ARG A 1 93  ? -10.908 1.578   2.673   1.00 0.00 ? 93  ARG A CA   2  
ATOM 3334  C C    . ARG A 1 93  ? -10.998 2.669   3.736   1.00 0.00 ? 93  ARG A C    2  
ATOM 3335  O O    . ARG A 1 93  ? -10.742 2.440   4.918   1.00 0.00 ? 93  ARG A O    2  
ATOM 3336  C CB   . ARG A 1 93  ? -11.679 0.339   3.131   1.00 0.00 ? 93  ARG A CB   2  
ATOM 3337  C CG   . ARG A 1 93  ? -11.233 -0.191  4.484   1.00 0.00 ? 93  ARG A CG   2  
ATOM 3338  C CD   . ARG A 1 93  ? -11.753 -1.598  4.731   1.00 0.00 ? 93  ARG A CD   2  
ATOM 3339  N NE   . ARG A 1 93  ? -13.041 -1.593  5.419   1.00 0.00 ? 93  ARG A NE   2  
ATOM 3340  C CZ   . ARG A 1 93  ? -13.487 -2.608  6.151   1.00 0.00 ? 93  ARG A CZ   2  
ATOM 3341  N NH1  . ARG A 1 93  ? -12.753 -3.703  6.290   1.00 0.00 ? 93  ARG A NH1  2  
ATOM 3342  N NH2  . ARG A 1 93  ? -14.670 -2.528  6.747   1.00 0.00 ? 93  ARG A NH2  2  
ATOM 3343  H H    . ARG A 1 93  ? -8.865  1.264   3.127   1.00 0.00 ? 93  ARG A H    2  
ATOM 3344  H HA   . ARG A 1 93  ? -11.347 1.946   1.758   1.00 0.00 ? 93  ARG A HA   2  
ATOM 3345  H HB2  . ARG A 1 93  ? -12.729 0.585   3.195   1.00 0.00 ? 93  ARG A HB2  2  
ATOM 3346  H HB3  . ARG A 1 93  ? -11.545 -0.445  2.400   1.00 0.00 ? 93  ARG A HB3  2  
ATOM 3347  H HG2  . ARG A 1 93  ? -10.153 -0.207  4.516   1.00 0.00 ? 93  ARG A HG2  2  
ATOM 3348  H HG3  . ARG A 1 93  ? -11.608 0.463   5.257   1.00 0.00 ? 93  ARG A HG3  2  
ATOM 3349  H HD2  . ARG A 1 93  ? -11.866 -2.098  3.780   1.00 0.00 ? 93  ARG A HD2  2  
ATOM 3350  H HD3  . ARG A 1 93  ? -11.034 -2.132  5.335   1.00 0.00 ? 93  ARG A HD3  2  
ATOM 3351  H HE   . ARG A 1 93  ? -13.600 -0.793  5.330   1.00 0.00 ? 93  ARG A HE   2  
ATOM 3352  H HH11 . ARG A 1 93  ? -11.860 -3.765  5.843   1.00 0.00 ? 93  ARG A HH11 2  
ATOM 3353  H HH12 . ARG A 1 93  ? -13.090 -4.465  6.843   1.00 0.00 ? 93  ARG A HH12 2  
ATOM 3354  H HH21 . ARG A 1 93  ? -15.226 -1.704  6.645   1.00 0.00 ? 93  ARG A HH21 2  
ATOM 3355  H HH22 . ARG A 1 93  ? -15.005 -3.292  7.298   1.00 0.00 ? 93  ARG A HH22 2  
ATOM 3356  N N    . PRO A 1 94  ? -11.370 3.884   3.307   1.00 0.00 ? 94  PRO A N    2  
ATOM 3357  C CA   . PRO A 1 94  ? -11.503 5.034   4.206   1.00 0.00 ? 94  PRO A CA   2  
ATOM 3358  C C    . PRO A 1 94  ? -12.691 4.896   5.152   1.00 0.00 ? 94  PRO A C    2  
ATOM 3359  O O    . PRO A 1 94  ? -13.834 5.146   4.769   1.00 0.00 ? 94  PRO A O    2  
ATOM 3360  C CB   . PRO A 1 94  ? -11.715 6.210   3.249   1.00 0.00 ? 94  PRO A CB   2  
ATOM 3361  C CG   . PRO A 1 94  ? -12.300 5.599   2.022   1.00 0.00 ? 94  PRO A CG   2  
ATOM 3362  C CD   . PRO A 1 94  ? -11.691 4.228   1.912   1.00 0.00 ? 94  PRO A CD   2  
ATOM 3363  H HA   . PRO A 1 94  ? -10.603 5.194   4.781   1.00 0.00 ? 94  PRO A HA   2  
ATOM 3364  H HB2  . PRO A 1 94  ? -12.392 6.924   3.697   1.00 0.00 ? 94  PRO A HB2  2  
ATOM 3365  H HB3  . PRO A 1 94  ? -10.769 6.684   3.040   1.00 0.00 ? 94  PRO A HB3  2  
ATOM 3366  H HG2  . PRO A 1 94  ? -13.372 5.525   2.124   1.00 0.00 ? 94  PRO A HG2  2  
ATOM 3367  H HG3  . PRO A 1 94  ? -12.043 6.193   1.158   1.00 0.00 ? 94  PRO A HG3  2  
ATOM 3368  H HD2  . PRO A 1 94  ? -12.403 3.531   1.496   1.00 0.00 ? 94  PRO A HD2  2  
ATOM 3369  H HD3  . PRO A 1 94  ? -10.796 4.261   1.308   1.00 0.00 ? 94  PRO A HD3  2  
ATOM 3370  N N    . TYR A 1 95  ? -12.413 4.498   6.389   1.00 0.00 ? 95  TYR A N    2  
ATOM 3371  C CA   . TYR A 1 95  ? -13.460 4.325   7.389   1.00 0.00 ? 95  TYR A CA   2  
ATOM 3372  C C    . TYR A 1 95  ? -13.436 5.464   8.404   1.00 0.00 ? 95  TYR A C    2  
ATOM 3373  O O    . TYR A 1 95  ? -12.373 5.971   8.762   1.00 0.00 ? 95  TYR A O    2  
ATOM 3374  C CB   . TYR A 1 95  ? -13.293 2.985   8.106   1.00 0.00 ? 95  TYR A CB   2  
ATOM 3375  C CG   . TYR A 1 95  ? -12.375 3.050   9.306   1.00 0.00 ? 95  TYR A CG   2  
ATOM 3376  C CD1  . TYR A 1 95  ? -12.844 3.484   10.540  1.00 0.00 ? 95  TYR A CD1  2  
ATOM 3377  C CD2  . TYR A 1 95  ? -11.040 2.679   9.206   1.00 0.00 ? 95  TYR A CD2  2  
ATOM 3378  C CE1  . TYR A 1 95  ? -12.009 3.546   11.640  1.00 0.00 ? 95  TYR A CE1  2  
ATOM 3379  C CE2  . TYR A 1 95  ? -10.199 2.736   10.300  1.00 0.00 ? 95  TYR A CE2  2  
ATOM 3380  C CZ   . TYR A 1 95  ? -10.688 3.171   11.515  1.00 0.00 ? 95  TYR A CZ   2  
ATOM 3381  O OH   . TYR A 1 95  ? -9.852  3.231   12.607  1.00 0.00 ? 95  TYR A OH   2  
ATOM 3382  H H    . TYR A 1 95  ? -11.483 4.314   6.634   1.00 0.00 ? 95  TYR A H    2  
ATOM 3383  H HA   . TYR A 1 95  ? -14.412 4.333   6.879   1.00 0.00 ? 95  TYR A HA   2  
ATOM 3384  H HB2  . TYR A 1 95  ? -14.258 2.643   8.446   1.00 0.00 ? 95  TYR A HB2  2  
ATOM 3385  H HB3  . TYR A 1 95  ? -12.884 2.263   7.415   1.00 0.00 ? 95  TYR A HB3  2  
ATOM 3386  H HD1  . TYR A 1 95  ? -13.879 3.778   10.635  1.00 0.00 ? 95  TYR A HD1  2  
ATOM 3387  H HD2  . TYR A 1 95  ? -10.660 2.339   8.253   1.00 0.00 ? 95  TYR A HD2  2  
ATOM 3388  H HE1  . TYR A 1 95  ? -12.391 3.886   12.591  1.00 0.00 ? 95  TYR A HE1  2  
ATOM 3389  H HE2  . TYR A 1 95  ? -9.164  2.443   10.203  1.00 0.00 ? 95  TYR A HE2  2  
ATOM 3390  H HH   . TYR A 1 95  ? -9.177  2.552   12.531  1.00 0.00 ? 95  TYR A HH   2  
ATOM 3391  N N    . PHE A 1 96  ? -14.618 5.862   8.865   1.00 0.00 ? 96  PHE A N    2  
ATOM 3392  C CA   . PHE A 1 96  ? -14.735 6.941   9.839   1.00 0.00 ? 96  PHE A CA   2  
ATOM 3393  C C    . PHE A 1 96  ? -14.883 6.384   11.252  1.00 0.00 ? 96  PHE A C    2  
ATOM 3394  O O    . PHE A 1 96  ? -13.943 6.420   12.046  1.00 0.00 ? 96  PHE A O    2  
ATOM 3395  C CB   . PHE A 1 96  ? -15.931 7.833   9.502   1.00 0.00 ? 96  PHE A CB   2  
ATOM 3396  C CG   . PHE A 1 96  ? -16.231 8.858   10.558  1.00 0.00 ? 96  PHE A CG   2  
ATOM 3397  C CD1  . PHE A 1 96  ? -15.347 9.897   10.804  1.00 0.00 ? 96  PHE A CD1  2  
ATOM 3398  C CD2  . PHE A 1 96  ? -17.395 8.783   11.305  1.00 0.00 ? 96  PHE A CD2  2  
ATOM 3399  C CE1  . PHE A 1 96  ? -15.620 10.842  11.775  1.00 0.00 ? 96  PHE A CE1  2  
ATOM 3400  C CE2  . PHE A 1 96  ? -17.673 9.726   12.276  1.00 0.00 ? 96  PHE A CE2  2  
ATOM 3401  C CZ   . PHE A 1 96  ? -16.784 10.756  12.513  1.00 0.00 ? 96  PHE A CZ   2  
ATOM 3402  H H    . PHE A 1 96  ? -15.430 5.419   8.541   1.00 0.00 ? 96  PHE A H    2  
ATOM 3403  H HA   . PHE A 1 96  ? -13.832 7.530   9.789   1.00 0.00 ? 96  PHE A HA   2  
ATOM 3404  H HB2  . PHE A 1 96  ? -15.732 8.356   8.579   1.00 0.00 ? 96  PHE A HB2  2  
ATOM 3405  H HB3  . PHE A 1 96  ? -16.808 7.215   9.379   1.00 0.00 ? 96  PHE A HB3  2  
ATOM 3406  H HD1  . PHE A 1 96  ? -14.435 9.965   10.227  1.00 0.00 ? 96  PHE A HD1  2  
ATOM 3407  H HD2  . PHE A 1 96  ? -18.091 7.978   11.122  1.00 0.00 ? 96  PHE A HD2  2  
ATOM 3408  H HE1  . PHE A 1 96  ? -14.922 11.646  11.957  1.00 0.00 ? 96  PHE A HE1  2  
ATOM 3409  H HE2  . PHE A 1 96  ? -18.584 9.656   12.852  1.00 0.00 ? 96  PHE A HE2  2  
ATOM 3410  H HZ   . PHE A 1 96  ? -16.999 11.494  13.271  1.00 0.00 ? 96  PHE A HZ   2  
ATOM 3411  N N    . ASN A 1 97  ? -16.070 5.872   11.558  1.00 0.00 ? 97  ASN A N    2  
ATOM 3412  C CA   . ASN A 1 97  ? -16.342 5.308   12.876  1.00 0.00 ? 97  ASN A CA   2  
ATOM 3413  C C    . ASN A 1 97  ? -16.467 3.790   12.803  1.00 0.00 ? 97  ASN A C    2  
ATOM 3414  O O    . ASN A 1 97  ? -15.709 3.064   13.445  1.00 0.00 ? 97  ASN A O    2  
ATOM 3415  C CB   . ASN A 1 97  ? -17.625 5.910   13.455  1.00 0.00 ? 97  ASN A CB   2  
ATOM 3416  C CG   . ASN A 1 97  ? -17.367 7.192   14.222  1.00 0.00 ? 97  ASN A CG   2  
ATOM 3417  O OD1  . ASN A 1 97  ? -16.224 7.633   14.349  1.00 0.00 ? 97  ASN A OD1  2  
ATOM 3418  N ND2  . ASN A 1 97  ? -18.430 7.798   14.737  1.00 0.00 ? 97  ASN A ND2  2  
ATOM 3419  H H    . ASN A 1 97  ? -16.780 5.872   10.883  1.00 0.00 ? 97  ASN A H    2  
ATOM 3420  H HA   . ASN A 1 97  ? -15.514 5.559   13.521  1.00 0.00 ? 97  ASN A HA   2  
ATOM 3421  H HB2  . ASN A 1 97  ? -18.309 6.127   12.648  1.00 0.00 ? 97  ASN A HB2  2  
ATOM 3422  H HB3  . ASN A 1 97  ? -18.079 5.196   14.125  1.00 0.00 ? 97  ASN A HB3  2  
ATOM 3423  H HD21 . ASN A 1 97  ? -19.310 7.389   14.596  1.00 0.00 ? 97  ASN A HD21 2  
ATOM 3424  H HD22 . ASN A 1 97  ? -18.293 8.629   15.237  1.00 0.00 ? 97  ASN A HD22 2  
ATOM 3425  N N    . GLU A 1 98  ? -17.429 3.317   12.015  1.00 0.00 ? 98  GLU A N    2  
ATOM 3426  C CA   . GLU A 1 98  ? -17.652 1.885   11.859  1.00 0.00 ? 98  GLU A CA   2  
ATOM 3427  C C    . GLU A 1 98  ? -17.819 1.518   10.387  1.00 0.00 ? 98  GLU A C    2  
ATOM 3428  O O    . GLU A 1 98  ? -17.427 0.432   9.958   1.00 0.00 ? 98  GLU A O    2  
ATOM 3429  C CB   . GLU A 1 98  ? -18.889 1.450   12.648  1.00 0.00 ? 98  GLU A CB   2  
ATOM 3430  C CG   . GLU A 1 98  ? -20.180 2.081   12.152  1.00 0.00 ? 98  GLU A CG   2  
ATOM 3431  C CD   . GLU A 1 98  ? -20.508 3.377   12.868  1.00 0.00 ? 98  GLU A CD   2  
ATOM 3432  O OE1  . GLU A 1 98  ? -19.929 3.621   13.948  1.00 0.00 ? 98  GLU A OE1  2  
ATOM 3433  O OE2  . GLU A 1 98  ? -21.343 4.147   12.350  1.00 0.00 ? 98  GLU A OE2  2  
ATOM 3434  H H    . GLU A 1 98  ? -18.001 3.947   11.529  1.00 0.00 ? 98  GLU A H    2  
ATOM 3435  H HA   . GLU A 1 98  ? -16.788 1.370   12.250  1.00 0.00 ? 98  GLU A HA   2  
ATOM 3436  H HB2  . GLU A 1 98  ? -18.987 0.377   12.578  1.00 0.00 ? 98  GLU A HB2  2  
ATOM 3437  H HB3  . GLU A 1 98  ? -18.755 1.724   13.684  1.00 0.00 ? 98  GLU A HB3  2  
ATOM 3438  H HG2  . GLU A 1 98  ? -20.083 2.286   11.097  1.00 0.00 ? 98  GLU A HG2  2  
ATOM 3439  H HG3  . GLU A 1 98  ? -20.990 1.385   12.310  1.00 0.00 ? 98  GLU A HG3  2  
ATOM 3440  N N    . PHE A 1 99  ? -18.404 2.430   9.619   1.00 0.00 ? 99  PHE A N    2  
ATOM 3441  C CA   . PHE A 1 99  ? -18.625 2.203   8.195   1.00 0.00 ? 99  PHE A CA   2  
ATOM 3442  C C    . PHE A 1 99  ? -17.325 2.356   7.412   1.00 0.00 ? 99  PHE A C    2  
ATOM 3443  O O    . PHE A 1 99  ? -16.364 2.954   7.896   1.00 0.00 ? 99  PHE A O    2  
ATOM 3444  C CB   . PHE A 1 99  ? -19.675 3.178   7.658   1.00 0.00 ? 99  PHE A CB   2  
ATOM 3445  C CG   . PHE A 1 99  ? -19.481 4.589   8.133   1.00 0.00 ? 99  PHE A CG   2  
ATOM 3446  C CD1  . PHE A 1 99  ? -19.983 4.997   9.359   1.00 0.00 ? 99  PHE A CD1  2  
ATOM 3447  C CD2  . PHE A 1 99  ? -18.797 5.509   7.355   1.00 0.00 ? 99  PHE A CD2  2  
ATOM 3448  C CE1  . PHE A 1 99  ? -19.807 6.295   9.799   1.00 0.00 ? 99  PHE A CE1  2  
ATOM 3449  C CE2  . PHE A 1 99  ? -18.617 6.808   7.790   1.00 0.00 ? 99  PHE A CE2  2  
ATOM 3450  C CZ   . PHE A 1 99  ? -19.123 7.202   9.013   1.00 0.00 ? 99  PHE A CZ   2  
ATOM 3451  H H    . PHE A 1 99  ? -18.695 3.277   10.018  1.00 0.00 ? 99  PHE A H    2  
ATOM 3452  H HA   . PHE A 1 99  ? -18.988 1.194   8.074   1.00 0.00 ? 99  PHE A HA   2  
ATOM 3453  H HB2  . PHE A 1 99  ? -19.633 3.183   6.579   1.00 0.00 ? 99  PHE A HB2  2  
ATOM 3454  H HB3  . PHE A 1 99  ? -20.654 2.851   7.975   1.00 0.00 ? 99  PHE A HB3  2  
ATOM 3455  H HD1  . PHE A 1 99  ? -20.519 4.288   9.975   1.00 0.00 ? 99  PHE A HD1  2  
ATOM 3456  H HD2  . PHE A 1 99  ? -18.402 5.203   6.397   1.00 0.00 ? 99  PHE A HD2  2  
ATOM 3457  H HE1  . PHE A 1 99  ? -20.204 6.599   10.756  1.00 0.00 ? 99  PHE A HE1  2  
ATOM 3458  H HE2  . PHE A 1 99  ? -18.082 7.515   7.174   1.00 0.00 ? 99  PHE A HE2  2  
ATOM 3459  H HZ   . PHE A 1 99  ? -18.983 8.216   9.356   1.00 0.00 ? 99  PHE A HZ   2  
ATOM 3460  N N    . GLN A 1 100 ? -17.303 1.811   6.200   1.00 0.00 ? 100 GLN A N    2  
ATOM 3461  C CA   . GLN A 1 100 ? -16.121 1.886   5.350   1.00 0.00 ? 100 GLN A CA   2  
ATOM 3462  C C    . GLN A 1 100 ? -16.473 2.441   3.974   1.00 0.00 ? 100 GLN A C    2  
ATOM 3463  O O    . GLN A 1 100 ? -17.539 2.151   3.431   1.00 0.00 ? 100 GLN A O    2  
ATOM 3464  C CB   . GLN A 1 100 ? -15.481 0.504   5.207   1.00 0.00 ? 100 GLN A CB   2  
ATOM 3465  C CG   . GLN A 1 100 ? -16.435 -0.556  4.680   1.00 0.00 ? 100 GLN A CG   2  
ATOM 3466  C CD   . GLN A 1 100 ? -16.608 -0.490  3.175   1.00 0.00 ? 100 GLN A CD   2  
ATOM 3467  O OE1  . GLN A 1 100 ? -15.632 -0.394  2.430   1.00 0.00 ? 100 GLN A OE1  2  
ATOM 3468  N NE2  . GLN A 1 100 ? -17.854 -0.540  2.719   1.00 0.00 ? 100 GLN A NE2  2  
ATOM 3469  H H    . GLN A 1 100 ? -18.100 1.347   5.870   1.00 0.00 ? 100 GLN A H    2  
ATOM 3470  H HA   . GLN A 1 100 ? -15.415 2.552   5.822   1.00 0.00 ? 100 GLN A HA   2  
ATOM 3471  H HB2  . GLN A 1 100 ? -14.645 0.575   4.527   1.00 0.00 ? 100 GLN A HB2  2  
ATOM 3472  H HB3  . GLN A 1 100 ? -15.122 0.184   6.174   1.00 0.00 ? 100 GLN A HB3  2  
ATOM 3473  H HG2  . GLN A 1 100 ? -16.049 -1.531  4.939   1.00 0.00 ? 100 GLN A HG2  2  
ATOM 3474  H HG3  . GLN A 1 100 ? -17.399 -0.417  5.145   1.00 0.00 ? 100 GLN A HG3  2  
ATOM 3475  H HE21 . GLN A 1 100 ? -18.582 -0.616  3.372   1.00 0.00 ? 100 GLN A HE21 2  
ATOM 3476  H HE22 . GLN A 1 100 ? -17.995 -0.498  1.751   1.00 0.00 ? 100 GLN A HE22 2  
ATOM 3477  N N    . GLY A 1 101 ? -15.571 3.241   3.415   1.00 0.00 ? 101 GLY A N    2  
ATOM 3478  C CA   . GLY A 1 101 ? -15.806 3.825   2.107   1.00 0.00 ? 101 GLY A CA   2  
ATOM 3479  C C    . GLY A 1 101 ? -15.482 2.866   0.978   1.00 0.00 ? 101 GLY A C    2  
ATOM 3480  O O    . GLY A 1 101 ? -14.759 1.890   1.172   1.00 0.00 ? 101 GLY A O    2  
ATOM 3481  H H    . GLY A 1 101 ? -14.739 3.437   3.894   1.00 0.00 ? 101 GLY A H    2  
ATOM 3482  H HA2  . GLY A 1 101 ? -16.844 4.112   2.034   1.00 0.00 ? 101 GLY A HA2  2  
ATOM 3483  H HA3  . GLY A 1 101 ? -15.190 4.706   2.003   1.00 0.00 ? 101 GLY A HA3  2  
ATOM 3484  N N    . MET A 1 102 ? -16.021 3.144   -0.205  1.00 0.00 ? 102 MET A N    2  
ATOM 3485  C CA   . MET A 1 102 ? -15.785 2.298   -1.369  1.00 0.00 ? 102 MET A CA   2  
ATOM 3486  C C    . MET A 1 102 ? -14.359 1.757   -1.368  1.00 0.00 ? 102 MET A C    2  
ATOM 3487  O O    . MET A 1 102 ? -13.396 2.519   -1.291  1.00 0.00 ? 102 MET A O    2  
ATOM 3488  C CB   . MET A 1 102 ? -16.044 3.083   -2.657  1.00 0.00 ? 102 MET A CB   2  
ATOM 3489  C CG   . MET A 1 102 ? -17.519 3.324   -2.936  1.00 0.00 ? 102 MET A CG   2  
ATOM 3490  S SD   . MET A 1 102 ? -17.804 4.790   -3.946  1.00 0.00 ? 102 MET A SD   2  
ATOM 3491  C CE   . MET A 1 102 ? -16.820 4.403   -5.391  1.00 0.00 ? 102 MET A CE   2  
ATOM 3492  H H    . MET A 1 102 ? -16.590 3.937   -0.298  1.00 0.00 ? 102 MET A H    2  
ATOM 3493  H HA   . MET A 1 102 ? -16.473 1.468   -1.320  1.00 0.00 ? 102 MET A HA   2  
ATOM 3494  H HB2  . MET A 1 102 ? -15.552 4.041   -2.586  1.00 0.00 ? 102 MET A HB2  2  
ATOM 3495  H HB3  . MET A 1 102 ? -15.628 2.535   -3.489  1.00 0.00 ? 102 MET A HB3  2  
ATOM 3496  H HG2  . MET A 1 102 ? -17.919 2.465   -3.454  1.00 0.00 ? 102 MET A HG2  2  
ATOM 3497  H HG3  . MET A 1 102 ? -18.033 3.446   -1.994  1.00 0.00 ? 102 MET A HG3  2  
ATOM 3498  H HE1  . MET A 1 102 ? -17.383 3.757   -6.048  1.00 0.00 ? 102 MET A HE1  2  
ATOM 3499  H HE2  . MET A 1 102 ? -16.569 5.316   -5.911  1.00 0.00 ? 102 MET A HE2  2  
ATOM 3500  H HE3  . MET A 1 102 ? -15.913 3.902   -5.085  1.00 0.00 ? 102 MET A HE3  2  
ATOM 3501  N N    . ASP A 1 103 ? -14.233 0.437   -1.454  1.00 0.00 ? 103 ASP A N    2  
ATOM 3502  C CA   . ASP A 1 103 ? -12.924 -0.206  -1.463  1.00 0.00 ? 103 ASP A CA   2  
ATOM 3503  C C    . ASP A 1 103 ? -12.165 0.124   -2.745  1.00 0.00 ? 103 ASP A C    2  
ATOM 3504  O O    . ASP A 1 103 ? -12.655 -0.117  -3.848  1.00 0.00 ? 103 ASP A O    2  
ATOM 3505  C CB   . ASP A 1 103 ? -13.076 -1.722  -1.323  1.00 0.00 ? 103 ASP A CB   2  
ATOM 3506  C CG   . ASP A 1 103 ? -14.048 -2.107  -0.224  1.00 0.00 ? 103 ASP A CG   2  
ATOM 3507  O OD1  . ASP A 1 103 ? -15.257 -1.838  -0.381  1.00 0.00 ? 103 ASP A OD1  2  
ATOM 3508  O OD2  . ASP A 1 103 ? -13.599 -2.677  0.791   1.00 0.00 ? 103 ASP A OD2  2  
ATOM 3509  H H    . ASP A 1 103 ? -15.039 -0.118  -1.513  1.00 0.00 ? 103 ASP A H    2  
ATOM 3510  H HA   . ASP A 1 103 ? -12.363 0.170   -0.621  1.00 0.00 ? 103 ASP A HA   2  
ATOM 3511  H HB2  . ASP A 1 103 ? -13.437 -2.129  -2.256  1.00 0.00 ? 103 ASP A HB2  2  
ATOM 3512  H HB3  . ASP A 1 103 ? -12.113 -2.154  -1.094  1.00 0.00 ? 103 ASP A HB3  2  
ATOM 3513  N N    . SER A 1 104 ? -10.967 0.679   -2.591  1.00 0.00 ? 104 SER A N    2  
ATOM 3514  C CA   . SER A 1 104 ? -10.142 1.047   -3.735  1.00 0.00 ? 104 SER A CA   2  
ATOM 3515  C C    . SER A 1 104 ? -9.848  -0.170  -4.607  1.00 0.00 ? 104 SER A C    2  
ATOM 3516  O O    . SER A 1 104 ? -10.097 -1.307  -4.208  1.00 0.00 ? 104 SER A O    2  
ATOM 3517  C CB   . SER A 1 104 ? -8.831  1.680   -3.264  1.00 0.00 ? 104 SER A CB   2  
ATOM 3518  O OG   . SER A 1 104 ? -8.182  2.358   -4.325  1.00 0.00 ? 104 SER A OG   2  
ATOM 3519  H H    . SER A 1 104 ? -10.631 0.846   -1.685  1.00 0.00 ? 104 SER A H    2  
ATOM 3520  H HA   . SER A 1 104 ? -10.691 1.770   -4.320  1.00 0.00 ? 104 SER A HA   2  
ATOM 3521  H HB2  . SER A 1 104 ? -9.039  2.386   -2.475  1.00 0.00 ? 104 SER A HB2  2  
ATOM 3522  H HB3  . SER A 1 104 ? -8.175  0.906   -2.891  1.00 0.00 ? 104 SER A HB3  2  
ATOM 3523  H HG   . SER A 1 104 ? -8.833  2.828   -4.851  1.00 0.00 ? 104 SER A HG   2  
ATOM 3524  N N    . GLU A 1 105 ? -9.317  0.079   -5.800  1.00 0.00 ? 105 GLU A N    2  
ATOM 3525  C CA   . GLU A 1 105 ? -8.989  -0.996  -6.729  1.00 0.00 ? 105 GLU A CA   2  
ATOM 3526  C C    . GLU A 1 105 ? -7.991  -1.968  -6.107  1.00 0.00 ? 105 GLU A C    2  
ATOM 3527  O O    . GLU A 1 105 ? -6.789  -1.705  -6.079  1.00 0.00 ? 105 GLU A O    2  
ATOM 3528  C CB   . GLU A 1 105 ? -8.418  -0.422  -8.027  1.00 0.00 ? 105 GLU A CB   2  
ATOM 3529  C CG   . GLU A 1 105 ? -9.386  0.484   -8.771  1.00 0.00 ? 105 GLU A CG   2  
ATOM 3530  C CD   . GLU A 1 105 ? -8.898  0.842   -10.161 1.00 0.00 ? 105 GLU A CD   2  
ATOM 3531  O OE1  . GLU A 1 105 ? -8.152  0.037   -10.755 1.00 0.00 ? 105 GLU A OE1  2  
ATOM 3532  O OE2  . GLU A 1 105 ? -9.264  1.930   -10.655 1.00 0.00 ? 105 GLU A OE2  2  
ATOM 3533  H H    . GLU A 1 105 ? -9.141  1.007   -6.061  1.00 0.00 ? 105 GLU A H    2  
ATOM 3534  H HA   . GLU A 1 105 ? -9.901  -1.529  -6.953  1.00 0.00 ? 105 GLU A HA   2  
ATOM 3535  H HB2  . GLU A 1 105 ? -7.530  0.148   -7.795  1.00 0.00 ? 105 GLU A HB2  2  
ATOM 3536  H HB3  . GLU A 1 105 ? -8.149  -1.239  -8.680  1.00 0.00 ? 105 GLU A HB3  2  
ATOM 3537  H HG2  . GLU A 1 105 ? -10.336 -0.022  -8.858  1.00 0.00 ? 105 GLU A HG2  2  
ATOM 3538  H HG3  . GLU A 1 105 ? -9.514  1.394   -8.204  1.00 0.00 ? 105 GLU A HG3  2  
ATOM 3539  N N    . SER A 1 106 ? -8.498  -3.091  -5.609  1.00 0.00 ? 106 SER A N    2  
ATOM 3540  C CA   . SER A 1 106 ? -7.653  -4.100  -4.983  1.00 0.00 ? 106 SER A CA   2  
ATOM 3541  C C    . SER A 1 106 ? -6.480  -4.464  -5.889  1.00 0.00 ? 106 SER A C    2  
ATOM 3542  O O    . SER A 1 106 ? -6.639  -4.612  -7.101  1.00 0.00 ? 106 SER A O    2  
ATOM 3543  C CB   . SER A 1 106 ? -8.471  -5.352  -4.660  1.00 0.00 ? 106 SER A CB   2  
ATOM 3544  O OG   . SER A 1 106 ? -9.206  -5.787  -5.791  1.00 0.00 ? 106 SER A OG   2  
ATOM 3545  H H    . SER A 1 106 ? -9.466  -3.242  -5.662  1.00 0.00 ? 106 SER A H    2  
ATOM 3546  H HA   . SER A 1 106 ? -7.267  -3.686  -4.064  1.00 0.00 ? 106 SER A HA   2  
ATOM 3547  H HB2  . SER A 1 106 ? -7.805  -6.144  -4.353  1.00 0.00 ? 106 SER A HB2  2  
ATOM 3548  H HB3  . SER A 1 106 ? -9.162  -5.131  -3.860  1.00 0.00 ? 106 SER A HB3  2  
ATOM 3549  H HG   . SER A 1 106 ? -8.601  -6.130  -6.454  1.00 0.00 ? 106 SER A HG   2  
ATOM 3550  N N    . LYS A 1 107 ? -5.302  -4.608  -5.292  1.00 0.00 ? 107 LYS A N    2  
ATOM 3551  C CA   . LYS A 1 107 ? -4.101  -4.956  -6.042  1.00 0.00 ? 107 LYS A CA   2  
ATOM 3552  C C    . LYS A 1 107 ? -3.473  -6.235  -5.499  1.00 0.00 ? 107 LYS A C    2  
ATOM 3553  O O    . LYS A 1 107 ? -3.472  -6.476  -4.291  1.00 0.00 ? 107 LYS A O    2  
ATOM 3554  C CB   . LYS A 1 107 ? -3.087  -3.811  -5.981  1.00 0.00 ? 107 LYS A CB   2  
ATOM 3555  C CG   . LYS A 1 107 ? -3.493  -2.595  -6.795  1.00 0.00 ? 107 LYS A CG   2  
ATOM 3556  C CD   . LYS A 1 107 ? -3.102  -2.747  -8.256  1.00 0.00 ? 107 LYS A CD   2  
ATOM 3557  C CE   . LYS A 1 107 ? -3.253  -1.436  -9.012  1.00 0.00 ? 107 LYS A CE   2  
ATOM 3558  N NZ   . LYS A 1 107 ? -4.622  -1.274  -9.575  1.00 0.00 ? 107 LYS A NZ   2  
ATOM 3559  H H    . LYS A 1 107 ? -5.239  -4.477  -4.322  1.00 0.00 ? 107 LYS A H    2  
ATOM 3560  H HA   . LYS A 1 107 ? -4.387  -5.117  -7.070  1.00 0.00 ? 107 LYS A HA   2  
ATOM 3561  H HB2  . LYS A 1 107 ? -2.969  -3.506  -4.952  1.00 0.00 ? 107 LYS A HB2  2  
ATOM 3562  H HB3  . LYS A 1 107 ? -2.137  -4.167  -6.353  1.00 0.00 ? 107 LYS A HB3  2  
ATOM 3563  H HG2  . LYS A 1 107 ? -4.564  -2.471  -6.732  1.00 0.00 ? 107 LYS A HG2  2  
ATOM 3564  H HG3  . LYS A 1 107 ? -3.003  -1.721  -6.390  1.00 0.00 ? 107 LYS A HG3  2  
ATOM 3565  H HD2  . LYS A 1 107 ? -2.072  -3.066  -8.313  1.00 0.00 ? 107 LYS A HD2  2  
ATOM 3566  H HD3  . LYS A 1 107 ? -3.738  -3.492  -8.714  1.00 0.00 ? 107 LYS A HD3  2  
ATOM 3567  H HE2  . LYS A 1 107 ? -3.053  -0.620  -8.335  1.00 0.00 ? 107 LYS A HE2  2  
ATOM 3568  H HE3  . LYS A 1 107 ? -2.536  -1.417  -9.820  1.00 0.00 ? 107 LYS A HE3  2  
ATOM 3569  H HZ1  . LYS A 1 107 ? -5.328  -1.646  -8.908  1.00 0.00 ? 107 LYS A HZ1  2  
ATOM 3570  H HZ2  . LYS A 1 107 ? -4.703  -1.793  -10.473 1.00 0.00 ? 107 LYS A HZ2  2  
ATOM 3571  H HZ3  . LYS A 1 107 ? -4.820  -0.268  -9.749  1.00 0.00 ? 107 LYS A HZ3  2  
ATOM 3572  N N    . THR A 1 108 ? -2.936  -7.054  -6.399  1.00 0.00 ? 108 THR A N    2  
ATOM 3573  C CA   . THR A 1 108 ? -2.304  -8.308  -6.011  1.00 0.00 ? 108 THR A CA   2  
ATOM 3574  C C    . THR A 1 108 ? -0.786  -8.176  -5.992  1.00 0.00 ? 108 THR A C    2  
ATOM 3575  O O    . THR A 1 108 ? -0.186  -7.656  -6.934  1.00 0.00 ? 108 THR A O    2  
ATOM 3576  C CB   . THR A 1 108 ? -2.697  -9.454  -6.963  1.00 0.00 ? 108 THR A CB   2  
ATOM 3577  O OG1  . THR A 1 108 ? -2.685  -8.991  -8.318  1.00 0.00 ? 108 THR A OG1  2  
ATOM 3578  C CG2  . THR A 1 108 ? -4.077  -9.994  -6.618  1.00 0.00 ? 108 THR A CG2  2  
ATOM 3579  H H    . THR A 1 108 ? -2.968  -6.807  -7.347  1.00 0.00 ? 108 THR A H    2  
ATOM 3580  H HA   . THR A 1 108 ? -2.646  -8.560  -5.017  1.00 0.00 ? 108 THR A HA   2  
ATOM 3581  H HB   . THR A 1 108 ? -1.977  -10.252 -6.857  1.00 0.00 ? 108 THR A HB   2  
ATOM 3582  H HG1  . THR A 1 108 ? -3.564  -8.689  -8.561  1.00 0.00 ? 108 THR A HG1  2  
ATOM 3583  H HG21 . THR A 1 108 ? -4.832  -9.333  -7.017  1.00 0.00 ? 108 THR A HG21 2  
ATOM 3584  H HG22 . THR A 1 108 ? -4.182  -10.056 -5.545  1.00 0.00 ? 108 THR A HG22 2  
ATOM 3585  H HG23 . THR A 1 108 ? -4.196  -10.977 -7.049  1.00 0.00 ? 108 THR A HG23 2  
ATOM 3586  N N    . VAL A 1 109 ? -0.168  -8.651  -4.915  1.00 0.00 ? 109 VAL A N    2  
ATOM 3587  C CA   . VAL A 1 109 ? 1.282   -8.587  -4.776  1.00 0.00 ? 109 VAL A CA   2  
ATOM 3588  C C    . VAL A 1 109 ? 1.887   -9.983  -4.686  1.00 0.00 ? 109 VAL A C    2  
ATOM 3589  O O    . VAL A 1 109 ? 1.723   -10.679 -3.684  1.00 0.00 ? 109 VAL A O    2  
ATOM 3590  C CB   . VAL A 1 109 ? 1.691   -7.782  -3.528  1.00 0.00 ? 109 VAL A CB   2  
ATOM 3591  C CG1  . VAL A 1 109 ? 1.097   -8.402  -2.273  1.00 0.00 ? 109 VAL A CG1  2  
ATOM 3592  C CG2  . VAL A 1 109 ? 3.206   -7.694  -3.424  1.00 0.00 ? 109 VAL A CG2  2  
ATOM 3593  H H    . VAL A 1 109 ? -0.700  -9.054  -4.198  1.00 0.00 ? 109 VAL A H    2  
ATOM 3594  H HA   . VAL A 1 109 ? 1.680   -8.088  -5.647  1.00 0.00 ? 109 VAL A HA   2  
ATOM 3595  H HB   . VAL A 1 109 ? 1.300   -6.780  -3.627  1.00 0.00 ? 109 VAL A HB   2  
ATOM 3596  H HG11 . VAL A 1 109 ? 1.834   -9.036  -1.802  1.00 0.00 ? 109 VAL A HG11 2  
ATOM 3597  H HG12 . VAL A 1 109 ? 0.802   -7.620  -1.589  1.00 0.00 ? 109 VAL A HG12 2  
ATOM 3598  H HG13 . VAL A 1 109 ? 0.232   -8.993  -2.539  1.00 0.00 ? 109 VAL A HG13 2  
ATOM 3599  H HG21 . VAL A 1 109 ? 3.473   -6.925  -2.714  1.00 0.00 ? 109 VAL A HG21 2  
ATOM 3600  H HG22 . VAL A 1 109 ? 3.600   -8.644  -3.091  1.00 0.00 ? 109 VAL A HG22 2  
ATOM 3601  H HG23 . VAL A 1 109 ? 3.621   -7.453  -4.391  1.00 0.00 ? 109 VAL A HG23 2  
ATOM 3602  N N    . ARG A 1 110 ? 2.589   -10.387 -5.740  1.00 0.00 ? 110 ARG A N    2  
ATOM 3603  C CA   . ARG A 1 110 ? 3.218   -11.701 -5.782  1.00 0.00 ? 110 ARG A CA   2  
ATOM 3604  C C    . ARG A 1 110 ? 4.518   -11.707 -4.982  1.00 0.00 ? 110 ARG A C    2  
ATOM 3605  O O    . ARG A 1 110 ? 5.490   -11.047 -5.351  1.00 0.00 ? 110 ARG A O    2  
ATOM 3606  C CB   . ARG A 1 110 ? 3.496   -12.112 -7.229  1.00 0.00 ? 110 ARG A CB   2  
ATOM 3607  C CG   . ARG A 1 110 ? 3.501   -13.617 -7.444  1.00 0.00 ? 110 ARG A CG   2  
ATOM 3608  C CD   . ARG A 1 110 ? 4.046   -13.981 -8.816  1.00 0.00 ? 110 ARG A CD   2  
ATOM 3609  N NE   . ARG A 1 110 ? 5.503   -14.080 -8.818  1.00 0.00 ? 110 ARG A NE   2  
ATOM 3610  C CZ   . ARG A 1 110 ? 6.238   -14.071 -9.924  1.00 0.00 ? 110 ARG A CZ   2  
ATOM 3611  N NH1  . ARG A 1 110 ? 5.656   -13.966 -11.111 1.00 0.00 ? 110 ARG A NH1  2  
ATOM 3612  N NH2  . ARG A 1 110 ? 7.560   -14.165 -9.845  1.00 0.00 ? 110 ARG A NH2  2  
ATOM 3613  H H    . ARG A 1 110 ? 2.684   -9.787  -6.510  1.00 0.00 ? 110 ARG A H    2  
ATOM 3614  H HA   . ARG A 1 110 ? 2.535   -12.411 -5.340  1.00 0.00 ? 110 ARG A HA   2  
ATOM 3615  H HB2  . ARG A 1 110 ? 2.736   -11.683 -7.865  1.00 0.00 ? 110 ARG A HB2  2  
ATOM 3616  H HB3  . ARG A 1 110 ? 4.460   -11.725 -7.521  1.00 0.00 ? 110 ARG A HB3  2  
ATOM 3617  H HG2  . ARG A 1 110 ? 4.121   -14.077 -6.689  1.00 0.00 ? 110 ARG A HG2  2  
ATOM 3618  H HG3  . ARG A 1 110 ? 2.490   -13.987 -7.357  1.00 0.00 ? 110 ARG A HG3  2  
ATOM 3619  H HD2  . ARG A 1 110 ? 3.629   -14.932 -9.113  1.00 0.00 ? 110 ARG A HD2  2  
ATOM 3620  H HD3  . ARG A 1 110 ? 3.745   -13.221 -9.522  1.00 0.00 ? 110 ARG A HD3  2  
ATOM 3621  H HE   . ARG A 1 110 ? 5.954   -14.158 -7.952  1.00 0.00 ? 110 ARG A HE   2  
ATOM 3622  H HH11 . ARG A 1 110 ? 4.661   -13.894 -11.174 1.00 0.00 ? 110 ARG A HH11 2  
ATOM 3623  H HH12 . ARG A 1 110 ? 6.213   -13.958 -11.942 1.00 0.00 ? 110 ARG A HH12 2  
ATOM 3624  H HH21 . ARG A 1 110 ? 8.002   -14.243 -8.952  1.00 0.00 ? 110 ARG A HH21 2  
ATOM 3625  H HH22 . ARG A 1 110 ? 8.112   -14.158 -10.677 1.00 0.00 ? 110 ARG A HH22 2  
ATOM 3626  N N    . THR A 1 111 ? 4.528   -12.455 -3.883  1.00 0.00 ? 111 THR A N    2  
ATOM 3627  C CA   . THR A 1 111 ? 5.706   -12.545 -3.030  1.00 0.00 ? 111 THR A CA   2  
ATOM 3628  C C    . THR A 1 111 ? 6.652   -13.638 -3.513  1.00 0.00 ? 111 THR A C    2  
ATOM 3629  O O    . THR A 1 111 ? 6.392   -14.827 -3.323  1.00 0.00 ? 111 THR A O    2  
ATOM 3630  C CB   . THR A 1 111 ? 5.319   -12.826 -1.566  1.00 0.00 ? 111 THR A CB   2  
ATOM 3631  O OG1  . THR A 1 111 ? 4.634   -14.080 -1.472  1.00 0.00 ? 111 THR A OG1  2  
ATOM 3632  C CG2  . THR A 1 111 ? 4.435   -11.716 -1.017  1.00 0.00 ? 111 THR A CG2  2  
ATOM 3633  H H    . THR A 1 111 ? 3.722   -12.957 -3.641  1.00 0.00 ? 111 THR A H    2  
ATOM 3634  H HA   . THR A 1 111 ? 6.219   -11.595 -3.069  1.00 0.00 ? 111 THR A HA   2  
ATOM 3635  H HB   . THR A 1 111 ? 6.222   -12.873 -0.974  1.00 0.00 ? 111 THR A HB   2  
ATOM 3636  H HG1  . THR A 1 111 ? 4.960   -14.567 -0.711  1.00 0.00 ? 111 THR A HG1  2  
ATOM 3637  H HG21 . THR A 1 111 ? 3.464   -11.764 -1.487  1.00 0.00 ? 111 THR A HG21 2  
ATOM 3638  H HG22 . THR A 1 111 ? 4.889   -10.759 -1.225  1.00 0.00 ? 111 THR A HG22 2  
ATOM 3639  H HG23 . THR A 1 111 ? 4.325   -11.839 0.050   1.00 0.00 ? 111 THR A HG23 2  
ATOM 3640  N N    . THR A 1 112 ? 7.752   -13.230 -4.138  1.00 0.00 ? 112 THR A N    2  
ATOM 3641  C CA   . THR A 1 112 ? 8.737   -14.175 -4.649  1.00 0.00 ? 112 THR A CA   2  
ATOM 3642  C C    . THR A 1 112 ? 8.985   -15.302 -3.653  1.00 0.00 ? 112 THR A C    2  
ATOM 3643  O O    . THR A 1 112 ? 8.642   -15.189 -2.476  1.00 0.00 ? 112 THR A O    2  
ATOM 3644  C CB   . THR A 1 112 ? 10.074  -13.478 -4.963  1.00 0.00 ? 112 THR A CB   2  
ATOM 3645  O OG1  . THR A 1 112 ? 11.049  -14.447 -5.365  1.00 0.00 ? 112 THR A OG1  2  
ATOM 3646  C CG2  . THR A 1 112 ? 10.583  -12.712 -3.751  1.00 0.00 ? 112 THR A CG2  2  
ATOM 3647  H H    . THR A 1 112 ? 7.903   -12.269 -4.259  1.00 0.00 ? 112 THR A H    2  
ATOM 3648  H HA   . THR A 1 112 ? 8.350   -14.596 -5.565  1.00 0.00 ? 112 THR A HA   2  
ATOM 3649  H HB   . THR A 1 112 ? 9.917   -12.779 -5.772  1.00 0.00 ? 112 THR A HB   2  
ATOM 3650  H HG1  . THR A 1 112 ? 10.711  -14.950 -6.111  1.00 0.00 ? 112 THR A HG1  2  
ATOM 3651  H HG21 . THR A 1 112 ? 11.347  -12.015 -4.061  1.00 0.00 ? 112 THR A HG21 2  
ATOM 3652  H HG22 . THR A 1 112 ? 10.997  -13.406 -3.035  1.00 0.00 ? 112 THR A HG22 2  
ATOM 3653  H HG23 . THR A 1 112 ? 9.765   -12.172 -3.298  1.00 0.00 ? 112 THR A HG23 2  
ATOM 3654  N N    . GLU A 1 113 ? 9.585   -16.387 -4.131  1.00 0.00 ? 113 GLU A N    2  
ATOM 3655  C CA   . GLU A 1 113 ? 9.880   -17.534 -3.281  1.00 0.00 ? 113 GLU A CA   2  
ATOM 3656  C C    . GLU A 1 113 ? 11.342  -17.528 -2.845  1.00 0.00 ? 113 GLU A C    2  
ATOM 3657  O O    . GLU A 1 113 ? 11.645  -17.474 -1.654  1.00 0.00 ? 113 GLU A O    2  
ATOM 3658  C CB   . GLU A 1 113 ? 9.561   -18.838 -4.016  1.00 0.00 ? 113 GLU A CB   2  
ATOM 3659  C CG   . GLU A 1 113 ? 10.260  -20.053 -3.431  1.00 0.00 ? 113 GLU A CG   2  
ATOM 3660  C CD   . GLU A 1 113 ? 9.475   -21.334 -3.639  1.00 0.00 ? 113 GLU A CD   2  
ATOM 3661  O OE1  . GLU A 1 113 ? 8.319   -21.405 -3.173  1.00 0.00 ? 113 GLU A OE1  2  
ATOM 3662  O OE2  . GLU A 1 113 ? 10.017  -22.266 -4.270  1.00 0.00 ? 113 GLU A OE2  2  
ATOM 3663  H H    . GLU A 1 113 ? 9.835   -16.417 -5.078  1.00 0.00 ? 113 GLU A H    2  
ATOM 3664  H HA   . GLU A 1 113 ? 9.255   -17.465 -2.403  1.00 0.00 ? 113 GLU A HA   2  
ATOM 3665  H HB2  . GLU A 1 113 ? 8.495   -19.007 -3.978  1.00 0.00 ? 113 GLU A HB2  2  
ATOM 3666  H HB3  . GLU A 1 113 ? 9.863   -18.737 -5.048  1.00 0.00 ? 113 GLU A HB3  2  
ATOM 3667  H HG2  . GLU A 1 113 ? 11.225  -20.160 -3.903  1.00 0.00 ? 113 GLU A HG2  2  
ATOM 3668  H HG3  . GLU A 1 113 ? 10.394  -19.899 -2.370  1.00 0.00 ? 113 GLU A HG3  2  
ATOM 3669  N N    . GLU A 1 114 ? 12.244  -17.584 -3.820  1.00 0.00 ? 114 GLU A N    2  
ATOM 3670  C CA   . GLU A 1 114 ? 13.675  -17.586 -3.537  1.00 0.00 ? 114 GLU A CA   2  
ATOM 3671  C C    . GLU A 1 114 ? 14.219  -16.162 -3.475  1.00 0.00 ? 114 GLU A C    2  
ATOM 3672  O O    . GLU A 1 114 ? 14.035  -15.374 -4.403  1.00 0.00 ? 114 GLU A O    2  
ATOM 3673  C CB   . GLU A 1 114 ? 14.427  -18.385 -4.604  1.00 0.00 ? 114 GLU A CB   2  
ATOM 3674  C CG   . GLU A 1 114 ? 15.814  -18.826 -4.168  1.00 0.00 ? 114 GLU A CG   2  
ATOM 3675  C CD   . GLU A 1 114 ? 16.647  -19.353 -5.320  1.00 0.00 ? 114 GLU A CD   2  
ATOM 3676  O OE1  . GLU A 1 114 ? 16.191  -20.297 -6.000  1.00 0.00 ? 114 GLU A OE1  2  
ATOM 3677  O OE2  . GLU A 1 114 ? 17.755  -18.822 -5.542  1.00 0.00 ? 114 GLU A OE2  2  
ATOM 3678  H H    . GLU A 1 114 ? 11.941  -17.625 -4.751  1.00 0.00 ? 114 GLU A H    2  
ATOM 3679  H HA   . GLU A 1 114 ? 13.822  -18.057 -2.577  1.00 0.00 ? 114 GLU A HA   2  
ATOM 3680  H HB2  . GLU A 1 114 ? 13.851  -19.265 -4.850  1.00 0.00 ? 114 GLU A HB2  2  
ATOM 3681  H HB3  . GLU A 1 114 ? 14.528  -17.773 -5.488  1.00 0.00 ? 114 GLU A HB3  2  
ATOM 3682  H HG2  . GLU A 1 114 ? 16.326  -17.982 -3.731  1.00 0.00 ? 114 GLU A HG2  2  
ATOM 3683  H HG3  . GLU A 1 114 ? 15.713  -19.607 -3.429  1.00 0.00 ? 114 GLU A HG3  2  
ATOM 3684  N N    . SER A 1 115 ? 14.889  -15.838 -2.373  1.00 0.00 ? 115 SER A N    2  
ATOM 3685  C CA   . SER A 1 115 ? 15.456  -14.508 -2.186  1.00 0.00 ? 115 SER A CA   2  
ATOM 3686  C C    . SER A 1 115 ? 16.511  -14.214 -3.248  1.00 0.00 ? 115 SER A C    2  
ATOM 3687  O O    . SER A 1 115 ? 17.656  -14.653 -3.141  1.00 0.00 ? 115 SER A O    2  
ATOM 3688  C CB   . SER A 1 115 ? 16.071  -14.384 -0.791  1.00 0.00 ? 115 SER A CB   2  
ATOM 3689  O OG   . SER A 1 115 ? 16.518  -13.062 -0.546  1.00 0.00 ? 115 SER A OG   2  
ATOM 3690  H H    . SER A 1 115 ? 15.001  -16.510 -1.668  1.00 0.00 ? 115 SER A H    2  
ATOM 3691  H HA   . SER A 1 115 ? 14.656  -13.790 -2.282  1.00 0.00 ? 115 SER A HA   2  
ATOM 3692  H HB2  . SER A 1 115 ? 15.331  -14.644 -0.050  1.00 0.00 ? 115 SER A HB2  2  
ATOM 3693  H HB3  . SER A 1 115 ? 16.913  -15.057 -0.711  1.00 0.00 ? 115 SER A HB3  2  
ATOM 3694  H HG   . SER A 1 115 ? 16.904  -12.700 -1.348  1.00 0.00 ? 115 SER A HG   2  
ATOM 3695  N N    . GLY A 1 116 ? 16.117  -13.466 -4.274  1.00 0.00 ? 116 GLY A N    2  
ATOM 3696  C CA   . GLY A 1 116 ? 17.039  -13.125 -5.342  1.00 0.00 ? 116 GLY A CA   2  
ATOM 3697  C C    . GLY A 1 116 ? 16.340  -12.929 -6.672  1.00 0.00 ? 116 GLY A C    2  
ATOM 3698  O O    . GLY A 1 116 ? 16.496  -13.721 -7.602  1.00 0.00 ? 116 GLY A O    2  
ATOM 3699  H H    . GLY A 1 116 ? 15.192  -13.144 -4.307  1.00 0.00 ? 116 GLY A H    2  
ATOM 3700  H HA2  . GLY A 1 116 ? 17.555  -12.213 -5.080  1.00 0.00 ? 116 GLY A HA2  2  
ATOM 3701  H HA3  . GLY A 1 116 ? 17.764  -13.920 -5.443  1.00 0.00 ? 116 GLY A HA3  2  
ATOM 3702  N N    . PRO A 1 117 ? 15.547  -11.853 -6.775  1.00 0.00 ? 117 PRO A N    2  
ATOM 3703  C CA   . PRO A 1 117 ? 14.804  -11.531 -7.997  1.00 0.00 ? 117 PRO A CA   2  
ATOM 3704  C C    . PRO A 1 117 ? 15.720  -11.086 -9.132  1.00 0.00 ? 117 PRO A C    2  
ATOM 3705  O O    . PRO A 1 117 ? 16.154  -9.935  -9.177  1.00 0.00 ? 117 PRO A O    2  
ATOM 3706  C CB   . PRO A 1 117 ? 13.891  -10.380 -7.565  1.00 0.00 ? 117 PRO A CB   2  
ATOM 3707  C CG   . PRO A 1 117 ? 14.595  -9.750  -6.413  1.00 0.00 ? 117 PRO A CG   2  
ATOM 3708  C CD   . PRO A 1 117 ? 15.314  -10.866 -5.706  1.00 0.00 ? 117 PRO A CD   2  
ATOM 3709  H HA   . PRO A 1 117 ? 14.203  -12.365 -8.327  1.00 0.00 ? 117 PRO A HA   2  
ATOM 3710  H HB2  . PRO A 1 117 ? 13.771  -9.685  -8.384  1.00 0.00 ? 117 PRO A HB2  2  
ATOM 3711  H HB3  . PRO A 1 117 ? 12.928  -10.771 -7.272  1.00 0.00 ? 117 PRO A HB3  2  
ATOM 3712  H HG2  . PRO A 1 117 ? 15.301  -9.017  -6.771  1.00 0.00 ? 117 PRO A HG2  2  
ATOM 3713  H HG3  . PRO A 1 117 ? 13.876  -9.290  -5.751  1.00 0.00 ? 117 PRO A HG3  2  
ATOM 3714  H HD2  . PRO A 1 117 ? 16.249  -10.513 -5.297  1.00 0.00 ? 117 PRO A HD2  2  
ATOM 3715  H HD3  . PRO A 1 117 ? 14.692  -11.282 -4.927  1.00 0.00 ? 117 PRO A HD3  2  
ATOM 3716  N N    . SER A 1 118 ? 16.009  -12.005 -10.048 1.00 0.00 ? 118 SER A N    2  
ATOM 3717  C CA   . SER A 1 118 ? 16.876  -11.707 -11.182 1.00 0.00 ? 118 SER A CA   2  
ATOM 3718  C C    . SER A 1 118 ? 18.153  -11.010 -10.721 1.00 0.00 ? 118 SER A C    2  
ATOM 3719  O O    . SER A 1 118 ? 18.598  -10.039 -11.333 1.00 0.00 ? 118 SER A O    2  
ATOM 3720  C CB   . SER A 1 118 ? 16.141  -10.831 -12.197 1.00 0.00 ? 118 SER A CB   2  
ATOM 3721  O OG   . SER A 1 118 ? 15.277  -11.607 -13.009 1.00 0.00 ? 118 SER A OG   2  
ATOM 3722  H H    . SER A 1 118 ? 15.632  -12.905 -9.957  1.00 0.00 ? 118 SER A H    2  
ATOM 3723  H HA   . SER A 1 118 ? 17.141  -12.643 -11.651 1.00 0.00 ? 118 SER A HA   2  
ATOM 3724  H HB2  . SER A 1 118 ? 15.555  -10.091 -11.674 1.00 0.00 ? 118 SER A HB2  2  
ATOM 3725  H HB3  . SER A 1 118 ? 16.863  -10.336 -12.831 1.00 0.00 ? 118 SER A HB3  2  
ATOM 3726  H HG   . SER A 1 118 ? 14.364  -11.400 -12.795 1.00 0.00 ? 118 SER A HG   2  
ATOM 3727  N N    . SER A 1 119 ? 18.736  -11.513 -9.638  1.00 0.00 ? 119 SER A N    2  
ATOM 3728  C CA   . SER A 1 119 ? 19.959  -10.937 -9.091  1.00 0.00 ? 119 SER A CA   2  
ATOM 3729  C C    . SER A 1 119 ? 20.716  -11.963 -8.254  1.00 0.00 ? 119 SER A C    2  
ATOM 3730  O O    . SER A 1 119 ? 20.119  -12.861 -7.663  1.00 0.00 ? 119 SER A O    2  
ATOM 3731  C CB   . SER A 1 119 ? 19.634  -9.708  -8.240  1.00 0.00 ? 119 SER A CB   2  
ATOM 3732  O OG   . SER A 1 119 ? 20.775  -9.264  -7.527  1.00 0.00 ? 119 SER A OG   2  
ATOM 3733  H H    . SER A 1 119 ? 18.333  -12.288 -9.194  1.00 0.00 ? 119 SER A H    2  
ATOM 3734  H HA   . SER A 1 119 ? 20.583  -10.635 -9.920  1.00 0.00 ? 119 SER A HA   2  
ATOM 3735  H HB2  . SER A 1 119 ? 19.292  -8.910  -8.881  1.00 0.00 ? 119 SER A HB2  2  
ATOM 3736  H HB3  . SER A 1 119 ? 18.857  -9.960  -7.532  1.00 0.00 ? 119 SER A HB3  2  
ATOM 3737  H HG   . SER A 1 119 ? 20.834  -9.733  -6.692  1.00 0.00 ? 119 SER A HG   2  
ATOM 3738  N N    . GLY A 1 120 ? 22.038  -11.823 -8.209  1.00 0.00 ? 120 GLY A N    2  
ATOM 3739  C CA   . GLY A 1 120 ? 22.856  -12.744 -7.443  1.00 0.00 ? 120 GLY A CA   2  
ATOM 3740  C C    . GLY A 1 120 ? 24.201  -13.004 -8.093  1.00 0.00 ? 120 GLY A C    2  
ATOM 3741  O O    . GLY A 1 120 ? 24.382  -12.747 -9.283  1.00 0.00 ? 120 GLY A O    2  
ATOM 3742  H H    . GLY A 1 120 ? 22.460  -11.088 -8.701  1.00 0.00 ? 120 GLY A H    2  
ATOM 3743  H HA2  . GLY A 1 120 ? 23.018  -12.331 -6.458  1.00 0.00 ? 120 GLY A HA2  2  
ATOM 3744  H HA3  . GLY A 1 120 ? 22.329  -13.682 -7.347  1.00 0.00 ? 120 GLY A HA3  2  
ATOM 3745  N N    . GLY A 1 1   ? -23.866 32.420  18.835  1.00 0.00 ? 1   GLY A N    3  
ATOM 3746  C CA   . GLY A 1 1   ? -22.824 31.409  18.831  1.00 0.00 ? 1   GLY A CA   3  
ATOM 3747  C C    . GLY A 1 1   ? -22.893 30.511  17.613  1.00 0.00 ? 1   GLY A C    3  
ATOM 3748  O O    . GLY A 1 1   ? -23.487 30.874  16.598  1.00 0.00 ? 1   GLY A O    3  
ATOM 3749  H H1   . GLY A 1 1   ? -23.909 33.073  19.565  1.00 0.00 ? 1   GLY A H1   3  
ATOM 3750  H HA2  . GLY A 1 1   ? -21.862 31.899  18.851  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3751  H HA3  . GLY A 1 1   ? -22.925 30.801  19.719  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3752  N N    . SER A 1 2   ? -22.282 29.334  17.712  1.00 0.00 ? 2   SER A N    3  
ATOM 3753  C CA   . SER A 1 2   ? -22.272 28.383  16.606  1.00 0.00 ? 2   SER A CA   3  
ATOM 3754  C C    . SER A 1 2   ? -23.160 27.182  16.915  1.00 0.00 ? 2   SER A C    3  
ATOM 3755  O O    . SER A 1 2   ? -23.269 26.755  18.065  1.00 0.00 ? 2   SER A O    3  
ATOM 3756  C CB   . SER A 1 2   ? -20.843 27.915  16.321  1.00 0.00 ? 2   SER A CB   3  
ATOM 3757  O OG   . SER A 1 2   ? -20.437 26.923  17.248  1.00 0.00 ? 2   SER A OG   3  
ATOM 3758  H H    . SER A 1 2   ? -21.826 29.102  18.547  1.00 0.00 ? 2   SER A H    3  
ATOM 3759  H HA   . SER A 1 2   ? -22.658 28.886  15.732  1.00 0.00 ? 2   SER A HA   3  
ATOM 3760  H HB2  . SER A 1 2   ? -20.794 27.503  15.325  1.00 0.00 ? 2   SER A HB2  3  
ATOM 3761  H HB3  . SER A 1 2   ? -20.170 28.758  16.396  1.00 0.00 ? 2   SER A HB3  3  
ATOM 3762  H HG   . SER A 1 2   ? -20.387 26.073  16.805  1.00 0.00 ? 2   SER A HG   3  
ATOM 3763  N N    . SER A 1 3   ? -23.793 26.640  15.879  1.00 0.00 ? 3   SER A N    3  
ATOM 3764  C CA   . SER A 1 3   ? -24.675 25.490  16.039  1.00 0.00 ? 3   SER A CA   3  
ATOM 3765  C C    . SER A 1 3   ? -24.815 24.726  14.726  1.00 0.00 ? 3   SER A C    3  
ATOM 3766  O O    . SER A 1 3   ? -24.523 25.254  13.654  1.00 0.00 ? 3   SER A O    3  
ATOM 3767  C CB   . SER A 1 3   ? -26.053 25.941  16.529  1.00 0.00 ? 3   SER A CB   3  
ATOM 3768  O OG   . SER A 1 3   ? -26.000 26.363  17.881  1.00 0.00 ? 3   SER A OG   3  
ATOM 3769  H H    . SER A 1 3   ? -23.666 27.025  14.987  1.00 0.00 ? 3   SER A H    3  
ATOM 3770  H HA   . SER A 1 3   ? -24.237 24.836  16.778  1.00 0.00 ? 3   SER A HA   3  
ATOM 3771  H HB2  . SER A 1 3   ? -26.396 26.764  15.921  1.00 0.00 ? 3   SER A HB2  3  
ATOM 3772  H HB3  . SER A 1 3   ? -26.748 25.118  16.447  1.00 0.00 ? 3   SER A HB3  3  
ATOM 3773  H HG   . SER A 1 3   ? -25.290 25.902  18.333  1.00 0.00 ? 3   SER A HG   3  
ATOM 3774  N N    . GLY A 1 4   ? -25.265 23.478  14.819  1.00 0.00 ? 4   GLY A N    3  
ATOM 3775  C CA   . GLY A 1 4   ? -25.436 22.661  13.632  1.00 0.00 ? 4   GLY A CA   3  
ATOM 3776  C C    . GLY A 1 4   ? -25.315 21.179  13.927  1.00 0.00 ? 4   GLY A C    3  
ATOM 3777  O O    . GLY A 1 4   ? -26.047 20.642  14.757  1.00 0.00 ? 4   GLY A O    3  
ATOM 3778  H H    . GLY A 1 4   ? -25.483 23.110  15.701  1.00 0.00 ? 4   GLY A H    3  
ATOM 3779  H HA2  . GLY A 1 4   ? -26.412 22.855  13.212  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3780  H HA3  . GLY A 1 4   ? -24.683 22.935  12.909  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3781  N N    . SER A 1 5   ? -24.387 20.515  13.243  1.00 0.00 ? 5   SER A N    3  
ATOM 3782  C CA   . SER A 1 5   ? -24.176 19.085  13.432  1.00 0.00 ? 5   SER A CA   3  
ATOM 3783  C C    . SER A 1 5   ? -22.978 18.601  12.621  1.00 0.00 ? 5   SER A C    3  
ATOM 3784  O O    . SER A 1 5   ? -22.974 18.678  11.392  1.00 0.00 ? 5   SER A O    3  
ATOM 3785  C CB   . SER A 1 5   ? -25.428 18.305  13.027  1.00 0.00 ? 5   SER A CB   3  
ATOM 3786  O OG   . SER A 1 5   ? -25.455 17.028  13.640  1.00 0.00 ? 5   SER A OG   3  
ATOM 3787  H H    . SER A 1 5   ? -23.834 21.000  12.595  1.00 0.00 ? 5   SER A H    3  
ATOM 3788  H HA   . SER A 1 5   ? -23.979 18.914  14.480  1.00 0.00 ? 5   SER A HA   3  
ATOM 3789  H HB2  . SER A 1 5   ? -26.306 18.855  13.331  1.00 0.00 ? 5   SER A HB2  3  
ATOM 3790  H HB3  . SER A 1 5   ? -25.438 18.177  11.954  1.00 0.00 ? 5   SER A HB3  3  
ATOM 3791  H HG   . SER A 1 5   ? -26.300 16.899  14.076  1.00 0.00 ? 5   SER A HG   3  
ATOM 3792  N N    . SER A 1 6   ? -21.962 18.103  13.318  1.00 0.00 ? 6   SER A N    3  
ATOM 3793  C CA   . SER A 1 6   ? -20.755 17.610  12.664  1.00 0.00 ? 6   SER A CA   3  
ATOM 3794  C C    . SER A 1 6   ? -20.914 16.147  12.263  1.00 0.00 ? 6   SER A C    3  
ATOM 3795  O O    . SER A 1 6   ? -21.732 15.422  12.827  1.00 0.00 ? 6   SER A O    3  
ATOM 3796  C CB   . SER A 1 6   ? -19.547 17.768  13.590  1.00 0.00 ? 6   SER A CB   3  
ATOM 3797  O OG   . SER A 1 6   ? -19.046 19.093  13.553  1.00 0.00 ? 6   SER A OG   3  
ATOM 3798  H H    . SER A 1 6   ? -22.024 18.069  14.296  1.00 0.00 ? 6   SER A H    3  
ATOM 3799  H HA   . SER A 1 6   ? -20.595 18.200  11.774  1.00 0.00 ? 6   SER A HA   3  
ATOM 3800  H HB2  . SER A 1 6   ? -19.840 17.535  14.602  1.00 0.00 ? 6   SER A HB2  3  
ATOM 3801  H HB3  . SER A 1 6   ? -18.766 17.091  13.276  1.00 0.00 ? 6   SER A HB3  3  
ATOM 3802  H HG   . SER A 1 6   ? -18.595 19.289  14.378  1.00 0.00 ? 6   SER A HG   3  
ATOM 3803  N N    . GLY A 1 7   ? -20.125 15.720  11.281  1.00 0.00 ? 7   GLY A N    3  
ATOM 3804  C CA   . GLY A 1 7   ? -20.193 14.346  10.820  1.00 0.00 ? 7   GLY A CA   3  
ATOM 3805  C C    . GLY A 1 7   ? -21.459 14.059  10.037  1.00 0.00 ? 7   GLY A C    3  
ATOM 3806  O O    . GLY A 1 7   ? -22.029 12.973  10.142  1.00 0.00 ? 7   GLY A O    3  
ATOM 3807  H H    . GLY A 1 7   ? -19.491 16.343  10.868  1.00 0.00 ? 7   GLY A H    3  
ATOM 3808  H HA2  . GLY A 1 7   ? -19.339 14.147  10.189  1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3809  H HA3  . GLY A 1 7   ? -20.156 13.688  11.676  1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3810  N N    . ARG A 1 8   ? -21.901 15.036  9.252   1.00 0.00 ? 8   ARG A N    3  
ATOM 3811  C CA   . ARG A 1 8   ? -23.110 14.884  8.451   1.00 0.00 ? 8   ARG A CA   3  
ATOM 3812  C C    . ARG A 1 8   ? -22.772 14.398  7.044   1.00 0.00 ? 8   ARG A C    3  
ATOM 3813  O O    . ARG A 1 8   ? -23.412 13.485  6.523   1.00 0.00 ? 8   ARG A O    3  
ATOM 3814  C CB   . ARG A 1 8   ? -23.867 16.211  8.376   1.00 0.00 ? 8   ARG A CB   3  
ATOM 3815  C CG   . ARG A 1 8   ? -24.698 16.367  7.112   1.00 0.00 ? 8   ARG A CG   3  
ATOM 3816  C CD   . ARG A 1 8   ? -25.925 17.232  7.356   1.00 0.00 ? 8   ARG A CD   3  
ATOM 3817  N NE   . ARG A 1 8   ? -26.875 17.157  6.249   1.00 0.00 ? 8   ARG A NE   3  
ATOM 3818  C CZ   . ARG A 1 8   ? -27.973 17.902  6.172   1.00 0.00 ? 8   ARG A CZ   3  
ATOM 3819  N NH1  . ARG A 1 8   ? -28.256 18.772  7.131   1.00 0.00 ? 8   ARG A NH1  3  
ATOM 3820  N NH2  . ARG A 1 8   ? -28.789 17.776  5.133   1.00 0.00 ? 8   ARG A NH2  3  
ATOM 3821  H H    . ARG A 1 8   ? -21.403 15.879  9.210   1.00 0.00 ? 8   ARG A H    3  
ATOM 3822  H HA   . ARG A 1 8   ? -23.736 14.148  8.932   1.00 0.00 ? 8   ARG A HA   3  
ATOM 3823  H HB2  . ARG A 1 8   ? -24.529 16.282  9.226   1.00 0.00 ? 8   ARG A HB2  3  
ATOM 3824  H HB3  . ARG A 1 8   ? -23.155 17.021  8.415   1.00 0.00 ? 8   ARG A HB3  3  
ATOM 3825  H HG2  . ARG A 1 8   ? -24.091 16.830  6.348   1.00 0.00 ? 8   ARG A HG2  3  
ATOM 3826  H HG3  . ARG A 1 8   ? -25.017 15.391  6.779   1.00 0.00 ? 8   ARG A HG3  3  
ATOM 3827  H HD2  . ARG A 1 8   ? -26.412 16.896  8.259   1.00 0.00 ? 8   ARG A HD2  3  
ATOM 3828  H HD3  . ARG A 1 8   ? -25.608 18.257  7.477   1.00 0.00 ? 8   ARG A HD3  3  
ATOM 3829  H HE   . ARG A 1 8   ? -26.685 16.520  5.530   1.00 0.00 ? 8   ARG A HE   3  
ATOM 3830  H HH11 . ARG A 1 8   ? -27.643 18.870  7.914   1.00 0.00 ? 8   ARG A HH11 3  
ATOM 3831  H HH12 . ARG A 1 8   ? -29.083 19.333  7.070   1.00 0.00 ? 8   ARG A HH12 3  
ATOM 3832  H HH21 . ARG A 1 8   ? -28.578 17.121  4.408   1.00 0.00 ? 8   ARG A HH21 3  
ATOM 3833  H HH22 . ARG A 1 8   ? -29.615 18.337  5.076   1.00 0.00 ? 8   ARG A HH22 3  
ATOM 3834  N N    . GLN A 1 9   ? -21.764 15.016  6.436   1.00 0.00 ? 9   GLN A N    3  
ATOM 3835  C CA   . GLN A 1 9   ? -21.343 14.647  5.090   1.00 0.00 ? 9   GLN A CA   3  
ATOM 3836  C C    . GLN A 1 9   ? -20.397 13.451  5.124   1.00 0.00 ? 9   GLN A C    3  
ATOM 3837  O O    . GLN A 1 9   ? -19.663 13.200  4.168   1.00 0.00 ? 9   GLN A O    3  
ATOM 3838  C CB   . GLN A 1 9   ? -20.663 15.832  4.403   1.00 0.00 ? 9   GLN A CB   3  
ATOM 3839  C CG   . GLN A 1 9   ? -20.546 15.677  2.895   1.00 0.00 ? 9   GLN A CG   3  
ATOM 3840  C CD   . GLN A 1 9   ? -19.858 16.857  2.238   1.00 0.00 ? 9   GLN A CD   3  
ATOM 3841  O OE1  . GLN A 1 9   ? -20.085 18.008  2.609   1.00 0.00 ? 9   GLN A OE1  3  
ATOM 3842  N NE2  . GLN A 1 9   ? -19.010 16.576  1.256   1.00 0.00 ? 9   GLN A NE2  3  
ATOM 3843  H H    . GLN A 1 9   ? -21.293 15.736  6.904   1.00 0.00 ? 9   GLN A H    3  
ATOM 3844  H HA   . GLN A 1 9   ? -22.225 14.376  4.530   1.00 0.00 ? 9   GLN A HA   3  
ATOM 3845  H HB2  . GLN A 1 9   ? -21.231 16.727  4.608   1.00 0.00 ? 9   GLN A HB2  3  
ATOM 3846  H HB3  . GLN A 1 9   ? -19.668 15.945  4.809   1.00 0.00 ? 9   GLN A HB3  3  
ATOM 3847  H HG2  . GLN A 1 9   ? -19.978 14.784  2.681   1.00 0.00 ? 9   GLN A HG2  3  
ATOM 3848  H HG3  . GLN A 1 9   ? -21.538 15.579  2.479   1.00 0.00 ? 9   GLN A HG3  3  
ATOM 3849  H HE21 . GLN A 1 9   ? -18.879 15.635  1.012   1.00 0.00 ? 9   GLN A HE21 3  
ATOM 3850  H HE22 . GLN A 1 9   ? -18.552 17.319  0.813   1.00 0.00 ? 9   GLN A HE22 3  
ATOM 3851  N N    . VAL A 1 10  ? -20.419 12.717  6.231   1.00 0.00 ? 10  VAL A N    3  
ATOM 3852  C CA   . VAL A 1 10  ? -19.564 11.547  6.389   1.00 0.00 ? 10  VAL A CA   3  
ATOM 3853  C C    . VAL A 1 10  ? -19.984 10.426  5.445   1.00 0.00 ? 10  VAL A C    3  
ATOM 3854  O O    . VAL A 1 10  ? -19.145 9.799   4.799   1.00 0.00 ? 10  VAL A O    3  
ATOM 3855  C CB   . VAL A 1 10  ? -19.594 11.021  7.837   1.00 0.00 ? 10  VAL A CB   3  
ATOM 3856  C CG1  . VAL A 1 10  ? -21.009 10.626  8.232   1.00 0.00 ? 10  VAL A CG1  3  
ATOM 3857  C CG2  . VAL A 1 10  ? -18.640 9.847   7.997   1.00 0.00 ? 10  VAL A CG2  3  
ATOM 3858  H H    . VAL A 1 10  ? -21.026 12.967  6.959   1.00 0.00 ? 10  VAL A H    3  
ATOM 3859  H HA   . VAL A 1 10  ? -18.550 11.840  6.156   1.00 0.00 ? 10  VAL A HA   3  
ATOM 3860  H HB   . VAL A 1 10  ? -19.268 11.814  8.494   1.00 0.00 ? 10  VAL A HB   3  
ATOM 3861  H HG11 . VAL A 1 10  ? -21.712 11.308  7.778   1.00 0.00 ? 10  VAL A HG11 3  
ATOM 3862  H HG12 . VAL A 1 10  ? -21.210 9.621   7.893   1.00 0.00 ? 10  VAL A HG12 3  
ATOM 3863  H HG13 . VAL A 1 10  ? -21.108 10.671  9.307   1.00 0.00 ? 10  VAL A HG13 3  
ATOM 3864  H HG21 . VAL A 1 10  ? -19.190 8.980   8.331   1.00 0.00 ? 10  VAL A HG21 3  
ATOM 3865  H HG22 . VAL A 1 10  ? -18.170 9.632   7.048   1.00 0.00 ? 10  VAL A HG22 3  
ATOM 3866  H HG23 . VAL A 1 10  ? -17.882 10.095  8.725   1.00 0.00 ? 10  VAL A HG23 3  
ATOM 3867  N N    . GLN A 1 11  ? -21.288 10.182  5.369   1.00 0.00 ? 11  GLN A N    3  
ATOM 3868  C CA   . GLN A 1 11  ? -21.820 9.136   4.503   1.00 0.00 ? 11  GLN A CA   3  
ATOM 3869  C C    . GLN A 1 11  ? -21.871 9.605   3.052   1.00 0.00 ? 11  GLN A C    3  
ATOM 3870  O O    . GLN A 1 11  ? -22.298 8.867   2.164   1.00 0.00 ? 11  GLN A O    3  
ATOM 3871  C CB   . GLN A 1 11  ? -23.217 8.721   4.967   1.00 0.00 ? 11  GLN A CB   3  
ATOM 3872  C CG   . GLN A 1 11  ? -23.208 7.796   6.173   1.00 0.00 ? 11  GLN A CG   3  
ATOM 3873  C CD   . GLN A 1 11  ? -24.479 6.979   6.291   1.00 0.00 ? 11  GLN A CD   3  
ATOM 3874  O OE1  . GLN A 1 11  ? -25.466 7.427   6.875   1.00 0.00 ? 11  GLN A OE1  3  
ATOM 3875  N NE2  . GLN A 1 11  ? -24.462 5.773   5.736   1.00 0.00 ? 11  GLN A NE2  3  
ATOM 3876  H H    . GLN A 1 11  ? -21.907 10.716  5.909   1.00 0.00 ? 11  GLN A H    3  
ATOM 3877  H HA   . GLN A 1 11  ? -21.161 8.284   4.569   1.00 0.00 ? 11  GLN A HA   3  
ATOM 3878  H HB2  . GLN A 1 11  ? -23.776 9.609   5.224   1.00 0.00 ? 11  GLN A HB2  3  
ATOM 3879  H HB3  . GLN A 1 11  ? -23.717 8.214   4.155   1.00 0.00 ? 11  GLN A HB3  3  
ATOM 3880  H HG2  . GLN A 1 11  ? -22.371 7.120   6.085   1.00 0.00 ? 11  GLN A HG2  3  
ATOM 3881  H HG3  . GLN A 1 11  ? -23.095 8.392   7.066   1.00 0.00 ? 11  GLN A HG3  3  
ATOM 3882  H HE21 . GLN A 1 11  ? -23.639 5.482   5.289   1.00 0.00 ? 11  GLN A HE21 3  
ATOM 3883  H HE22 . GLN A 1 11  ? -25.270 5.223   5.799   1.00 0.00 ? 11  GLN A HE22 3  
ATOM 3884  N N    . LYS A 1 12  ? -21.434 10.838  2.819   1.00 0.00 ? 12  LYS A N    3  
ATOM 3885  C CA   . LYS A 1 12  ? -21.429 11.407  1.476   1.00 0.00 ? 12  LYS A CA   3  
ATOM 3886  C C    . LYS A 1 12  ? -20.005 11.530  0.943   1.00 0.00 ? 12  LYS A C    3  
ATOM 3887  O O    . LYS A 1 12  ? -19.643 10.881  -0.038  1.00 0.00 ? 12  LYS A O    3  
ATOM 3888  C CB   . LYS A 1 12  ? -22.104 12.780  1.479   1.00 0.00 ? 12  LYS A CB   3  
ATOM 3889  C CG   . LYS A 1 12  ? -22.761 13.138  0.157   1.00 0.00 ? 12  LYS A CG   3  
ATOM 3890  C CD   . LYS A 1 12  ? -23.521 14.451  0.249   1.00 0.00 ? 12  LYS A CD   3  
ATOM 3891  C CE   . LYS A 1 12  ? -24.388 14.680  -0.979  1.00 0.00 ? 12  LYS A CE   3  
ATOM 3892  N NZ   . LYS A 1 12  ? -23.570 14.982  -2.187  1.00 0.00 ? 12  LYS A NZ   3  
ATOM 3893  H H    . LYS A 1 12  ? -21.106 11.379  3.568   1.00 0.00 ? 12  LYS A H    3  
ATOM 3894  H HA   . LYS A 1 12  ? -21.986 10.743  0.832   1.00 0.00 ? 12  LYS A HA   3  
ATOM 3895  H HB2  . LYS A 1 12  ? -22.861 12.794  2.249   1.00 0.00 ? 12  LYS A HB2  3  
ATOM 3896  H HB3  . LYS A 1 12  ? -21.361 13.532  1.703   1.00 0.00 ? 12  LYS A HB3  3  
ATOM 3897  H HG2  . LYS A 1 12  ? -21.997 13.229  -0.601  1.00 0.00 ? 12  LYS A HG2  3  
ATOM 3898  H HG3  . LYS A 1 12  ? -23.450 12.352  -0.116  1.00 0.00 ? 12  LYS A HG3  3  
ATOM 3899  H HD2  . LYS A 1 12  ? -24.154 14.430  1.124   1.00 0.00 ? 12  LYS A HD2  3  
ATOM 3900  H HD3  . LYS A 1 12  ? -22.812 15.262  0.336   1.00 0.00 ? 12  LYS A HD3  3  
ATOM 3901  H HE2  . LYS A 1 12  ? -24.971 13.791  -1.163  1.00 0.00 ? 12  LYS A HE2  3  
ATOM 3902  H HE3  . LYS A 1 12  ? -25.049 15.512  -0.786  1.00 0.00 ? 12  LYS A HE3  3  
ATOM 3903  H HZ1  . LYS A 1 12  ? -22.995 14.154  -2.444  1.00 0.00 ? 12  LYS A HZ1  3  
ATOM 3904  H HZ2  . LYS A 1 12  ? -22.936 15.784  -1.998  1.00 0.00 ? 12  LYS A HZ2  3  
ATOM 3905  H HZ3  . LYS A 1 12  ? -24.189 15.224  -2.986  1.00 0.00 ? 12  LYS A HZ3  3  
ATOM 3906  N N    . GLU A 1 13  ? -19.203 12.365  1.596   1.00 0.00 ? 13  GLU A N    3  
ATOM 3907  C CA   . GLU A 1 13  ? -17.819 12.571  1.186   1.00 0.00 ? 13  GLU A CA   3  
ATOM 3908  C C    . GLU A 1 13  ? -17.023 11.272  1.286   1.00 0.00 ? 13  GLU A C    3  
ATOM 3909  O O    . GLU A 1 13  ? -16.044 11.074  0.566   1.00 0.00 ? 13  GLU A O    3  
ATOM 3910  C CB   . GLU A 1 13  ? -17.164 13.651  2.050   1.00 0.00 ? 13  GLU A CB   3  
ATOM 3911  C CG   . GLU A 1 13  ? -15.650 13.535  2.125   1.00 0.00 ? 13  GLU A CG   3  
ATOM 3912  C CD   . GLU A 1 13  ? -15.009 14.714  2.830   1.00 0.00 ? 13  GLU A CD   3  
ATOM 3913  O OE1  . GLU A 1 13  ? -15.516 15.112  3.900   1.00 0.00 ? 13  GLU A OE1  3  
ATOM 3914  O OE2  . GLU A 1 13  ? -14.002 15.240  2.312   1.00 0.00 ? 13  GLU A OE2  3  
ATOM 3915  H H    . GLU A 1 13  ? -19.550 12.854  2.371   1.00 0.00 ? 13  GLU A H    3  
ATOM 3916  H HA   . GLU A 1 13  ? -17.823 12.898  0.158   1.00 0.00 ? 13  GLU A HA   3  
ATOM 3917  H HB2  . GLU A 1 13  ? -17.411 14.620  1.641   1.00 0.00 ? 13  GLU A HB2  3  
ATOM 3918  H HB3  . GLU A 1 13  ? -17.559 13.582  3.052   1.00 0.00 ? 13  GLU A HB3  3  
ATOM 3919  H HG2  . GLU A 1 13  ? -15.397 12.633  2.662   1.00 0.00 ? 13  GLU A HG2  3  
ATOM 3920  H HG3  . GLU A 1 13  ? -15.256 13.477  1.121   1.00 0.00 ? 13  GLU A HG3  3  
ATOM 3921  N N    . LEU A 1 14  ? -17.450 10.391  2.184   1.00 0.00 ? 14  LEU A N    3  
ATOM 3922  C CA   . LEU A 1 14  ? -16.778 9.111   2.380   1.00 0.00 ? 14  LEU A CA   3  
ATOM 3923  C C    . LEU A 1 14  ? -16.689 8.337   1.069   1.00 0.00 ? 14  LEU A C    3  
ATOM 3924  O O    . LEU A 1 14  ? -15.599 8.038   0.585   1.00 0.00 ? 14  LEU A O    3  
ATOM 3925  C CB   . LEU A 1 14  ? -17.518 8.279   3.428   1.00 0.00 ? 14  LEU A CB   3  
ATOM 3926  C CG   . LEU A 1 14  ? -17.177 6.789   3.465   1.00 0.00 ? 14  LEU A CG   3  
ATOM 3927  C CD1  . LEU A 1 14  ? -16.006 6.533   4.401   1.00 0.00 ? 14  LEU A CD1  3  
ATOM 3928  C CD2  . LEU A 1 14  ? -18.390 5.975   3.891   1.00 0.00 ? 14  LEU A CD2  3  
ATOM 3929  H H    . LEU A 1 14  ? -18.236 10.605  2.729   1.00 0.00 ? 14  LEU A H    3  
ATOM 3930  H HA   . LEU A 1 14  ? -15.778 9.313   2.733   1.00 0.00 ? 14  LEU A HA   3  
ATOM 3931  H HB2  . LEU A 1 14  ? -17.293 8.694   4.398   1.00 0.00 ? 14  LEU A HB2  3  
ATOM 3932  H HB3  . LEU A 1 14  ? -18.578 8.372   3.235   1.00 0.00 ? 14  LEU A HB3  3  
ATOM 3933  H HG   . LEU A 1 14  ? -16.889 6.467   2.474   1.00 0.00 ? 14  LEU A HG   3  
ATOM 3934  H HD11 . LEU A 1 14  ? -16.083 5.537   4.809   1.00 0.00 ? 14  LEU A HD11 3  
ATOM 3935  H HD12 . LEU A 1 14  ? -16.022 7.254   5.204   1.00 0.00 ? 14  LEU A HD12 3  
ATOM 3936  H HD13 . LEU A 1 14  ? -15.080 6.627   3.852   1.00 0.00 ? 14  LEU A HD13 3  
ATOM 3937  H HD21 . LEU A 1 14  ? -19.111 5.956   3.088   1.00 0.00 ? 14  LEU A HD21 3  
ATOM 3938  H HD22 . LEU A 1 14  ? -18.837 6.426   4.766   1.00 0.00 ? 14  LEU A HD22 3  
ATOM 3939  H HD23 . LEU A 1 14  ? -18.083 4.966   4.123   1.00 0.00 ? 14  LEU A HD23 3  
ATOM 3940  N N    . GLY A 1 15  ? -17.847 8.016   0.497   1.00 0.00 ? 15  GLY A N    3  
ATOM 3941  C CA   . GLY A 1 15  ? -17.878 7.281   -0.754  1.00 0.00 ? 15  GLY A CA   3  
ATOM 3942  C C    . GLY A 1 15  ? -17.593 8.165   -1.953  1.00 0.00 ? 15  GLY A C    3  
ATOM 3943  O O    . GLY A 1 15  ? -16.801 7.804   -2.823  1.00 0.00 ? 15  GLY A O    3  
ATOM 3944  H H    . GLY A 1 15  ? -18.686 8.281   0.928   1.00 0.00 ? 15  GLY A H    3  
ATOM 3945  H HA2  . GLY A 1 15  ? -17.139 6.495   -0.715  1.00 0.00 ? 15  GLY A HA2  3  
ATOM 3946  H HA3  . GLY A 1 15  ? -18.855 6.837   -0.873  1.00 0.00 ? 15  GLY A HA3  3  
ATOM 3947  N N    . ASP A 1 16  ? -18.241 9.323   -1.999  1.00 0.00 ? 16  ASP A N    3  
ATOM 3948  C CA   . ASP A 1 16  ? -18.054 10.261  -3.100  1.00 0.00 ? 16  ASP A CA   3  
ATOM 3949  C C    . ASP A 1 16  ? -16.614 10.227  -3.604  1.00 0.00 ? 16  ASP A C    3  
ATOM 3950  O O    . ASP A 1 16  ? -16.362 9.949   -4.777  1.00 0.00 ? 16  ASP A O    3  
ATOM 3951  C CB   . ASP A 1 16  ? -18.419 11.679  -2.659  1.00 0.00 ? 16  ASP A CB   3  
ATOM 3952  C CG   . ASP A 1 16  ? -17.788 12.740  -3.539  1.00 0.00 ? 16  ASP A CG   3  
ATOM 3953  O OD1  . ASP A 1 16  ? -16.601 13.062  -3.320  1.00 0.00 ? 16  ASP A OD1  3  
ATOM 3954  O OD2  . ASP A 1 16  ? -18.480 13.248  -4.446  1.00 0.00 ? 16  ASP A OD2  3  
ATOM 3955  H H    . ASP A 1 16  ? -18.860 9.554   -1.274  1.00 0.00 ? 16  ASP A H    3  
ATOM 3956  H HA   . ASP A 1 16  ? -18.710 9.963   -3.904  1.00 0.00 ? 16  ASP A HA   3  
ATOM 3957  H HB2  . ASP A 1 16  ? -19.492 11.796  -2.700  1.00 0.00 ? 16  ASP A HB2  3  
ATOM 3958  H HB3  . ASP A 1 16  ? -18.083 11.831  -1.644  1.00 0.00 ? 16  ASP A HB3  3  
ATOM 3959  N N    . VAL A 1 17  ? -15.673 10.512  -2.710  1.00 0.00 ? 17  VAL A N    3  
ATOM 3960  C CA   . VAL A 1 17  ? -14.258 10.514  -3.063  1.00 0.00 ? 17  VAL A CA   3  
ATOM 3961  C C    . VAL A 1 17  ? -13.822 9.152   -3.592  1.00 0.00 ? 17  VAL A C    3  
ATOM 3962  O O    . VAL A 1 17  ? -14.385 8.121   -3.223  1.00 0.00 ? 17  VAL A O    3  
ATOM 3963  C CB   . VAL A 1 17  ? -13.378 10.889  -1.856  1.00 0.00 ? 17  VAL A CB   3  
ATOM 3964  C CG1  . VAL A 1 17  ? -13.449 9.809   -0.787  1.00 0.00 ? 17  VAL A CG1  3  
ATOM 3965  C CG2  . VAL A 1 17  ? -11.941 11.122  -2.296  1.00 0.00 ? 17  VAL A CG2  3  
ATOM 3966  H H    . VAL A 1 17  ? -15.936 10.725  -1.790  1.00 0.00 ? 17  VAL A H    3  
ATOM 3967  H HA   . VAL A 1 17  ? -14.108 11.254  -3.835  1.00 0.00 ? 17  VAL A HA   3  
ATOM 3968  H HB   . VAL A 1 17  ? -13.756 11.808  -1.433  1.00 0.00 ? 17  VAL A HB   3  
ATOM 3969  H HG11 . VAL A 1 17  ? -12.449 9.540   -0.481  1.00 0.00 ? 17  VAL A HG11 3  
ATOM 3970  H HG12 . VAL A 1 17  ? -14.000 10.180  0.065   1.00 0.00 ? 17  VAL A HG12 3  
ATOM 3971  H HG13 . VAL A 1 17  ? -13.948 8.939   -1.188  1.00 0.00 ? 17  VAL A HG13 3  
ATOM 3972  H HG21 . VAL A 1 17  ? -11.919 11.327  -3.356  1.00 0.00 ? 17  VAL A HG21 3  
ATOM 3973  H HG22 . VAL A 1 17  ? -11.531 11.964  -1.758  1.00 0.00 ? 17  VAL A HG22 3  
ATOM 3974  H HG23 . VAL A 1 17  ? -11.353 10.241  -2.087  1.00 0.00 ? 17  VAL A HG23 3  
ATOM 3975  N N    . LEU A 1 18  ? -12.815 9.155   -4.458  1.00 0.00 ? 18  LEU A N    3  
ATOM 3976  C CA   . LEU A 1 18  ? -12.301 7.919   -5.039  1.00 0.00 ? 18  LEU A CA   3  
ATOM 3977  C C    . LEU A 1 18  ? -10.868 7.660   -4.586  1.00 0.00 ? 18  LEU A C    3  
ATOM 3978  O O    . LEU A 1 18  ? -10.000 8.524   -4.710  1.00 0.00 ? 18  LEU A O    3  
ATOM 3979  C CB   . LEU A 1 18  ? -12.361 7.986   -6.566  1.00 0.00 ? 18  LEU A CB   3  
ATOM 3980  C CG   . LEU A 1 18  ? -12.436 6.644   -7.294  1.00 0.00 ? 18  LEU A CG   3  
ATOM 3981  C CD1  . LEU A 1 18  ? -13.161 6.797   -8.622  1.00 0.00 ? 18  LEU A CD1  3  
ATOM 3982  C CD2  . LEU A 1 18  ? -11.041 6.075   -7.508  1.00 0.00 ? 18  LEU A CD2  3  
ATOM 3983  H H    . LEU A 1 18  ? -12.406 10.008  -4.714  1.00 0.00 ? 18  LEU A H    3  
ATOM 3984  H HA   . LEU A 1 18  ? -12.926 7.108   -4.697  1.00 0.00 ? 18  LEU A HA   3  
ATOM 3985  H HB2  . LEU A 1 18  ? -13.235 8.558   -6.837  1.00 0.00 ? 18  LEU A HB2  3  
ATOM 3986  H HB3  . LEU A 1 18  ? -11.475 8.501   -6.909  1.00 0.00 ? 18  LEU A HB3  3  
ATOM 3987  H HG   . LEU A 1 18  ? -12.995 5.944   -6.688  1.00 0.00 ? 18  LEU A HG   3  
ATOM 3988  H HD11 . LEU A 1 18  ? -14.208 6.569   -8.489  1.00 0.00 ? 18  LEU A HD11 3  
ATOM 3989  H HD12 . LEU A 1 18  ? -12.734 6.118   -9.346  1.00 0.00 ? 18  LEU A HD12 3  
ATOM 3990  H HD13 . LEU A 1 18  ? -13.055 7.812   -8.975  1.00 0.00 ? 18  LEU A HD13 3  
ATOM 3991  H HD21 . LEU A 1 18  ? -10.356 6.878   -7.735  1.00 0.00 ? 18  LEU A HD21 3  
ATOM 3992  H HD22 . LEU A 1 18  ? -11.061 5.375   -8.331  1.00 0.00 ? 18  LEU A HD22 3  
ATOM 3993  H HD23 . LEU A 1 18  ? -10.718 5.568   -6.611  1.00 0.00 ? 18  LEU A HD23 3  
ATOM 3994  N N    . VAL A 1 19  ? -10.625 6.462   -4.063  1.00 0.00 ? 19  VAL A N    3  
ATOM 3995  C CA   . VAL A 1 19  ? -9.296  6.087   -3.595  1.00 0.00 ? 19  VAL A CA   3  
ATOM 3996  C C    . VAL A 1 19  ? -8.611  5.148   -4.582  1.00 0.00 ? 19  VAL A C    3  
ATOM 3997  O O    . VAL A 1 19  ? -9.161  4.112   -4.953  1.00 0.00 ? 19  VAL A O    3  
ATOM 3998  C CB   . VAL A 1 19  ? -9.359  5.406   -2.215  1.00 0.00 ? 19  VAL A CB   3  
ATOM 3999  C CG1  . VAL A 1 19  ? -7.994  4.857   -1.828  1.00 0.00 ? 19  VAL A CG1  3  
ATOM 4000  C CG2  . VAL A 1 19  ? -9.869  6.380   -1.163  1.00 0.00 ? 19  VAL A CG2  3  
ATOM 4001  H H    . VAL A 1 19  ? -11.358 5.815   -3.991  1.00 0.00 ? 19  VAL A H    3  
ATOM 4002  H HA   . VAL A 1 19  ? -8.708  6.988   -3.502  1.00 0.00 ? 19  VAL A HA   3  
ATOM 4003  H HB   . VAL A 1 19  ? -10.051 4.579   -2.275  1.00 0.00 ? 19  VAL A HB   3  
ATOM 4004  H HG11 . VAL A 1 19  ? -7.760  5.156   -0.817  1.00 0.00 ? 19  VAL A HG11 3  
ATOM 4005  H HG12 . VAL A 1 19  ? -8.008  3.779   -1.892  1.00 0.00 ? 19  VAL A HG12 3  
ATOM 4006  H HG13 . VAL A 1 19  ? -7.245  5.248   -2.500  1.00 0.00 ? 19  VAL A HG13 3  
ATOM 4007  H HG21 . VAL A 1 19  ? -10.279 7.252   -1.651  1.00 0.00 ? 19  VAL A HG21 3  
ATOM 4008  H HG22 . VAL A 1 19  ? -10.637 5.903   -0.573  1.00 0.00 ? 19  VAL A HG22 3  
ATOM 4009  H HG23 . VAL A 1 19  ? -9.053  6.676   -0.521  1.00 0.00 ? 19  VAL A HG23 3  
ATOM 4010  N N    . ARG A 1 20  ? -7.406  5.519   -5.003  1.00 0.00 ? 20  ARG A N    3  
ATOM 4011  C CA   . ARG A 1 20  ? -6.645  4.711   -5.948  1.00 0.00 ? 20  ARG A CA   3  
ATOM 4012  C C    . ARG A 1 20  ? -5.400  4.128   -5.285  1.00 0.00 ? 20  ARG A C    3  
ATOM 4013  O O    . ARG A 1 20  ? -4.429  4.841   -5.028  1.00 0.00 ? 20  ARG A O    3  
ATOM 4014  C CB   . ARG A 1 20  ? -6.244  5.550   -7.163  1.00 0.00 ? 20  ARG A CB   3  
ATOM 4015  C CG   . ARG A 1 20  ? -7.310  5.602   -8.245  1.00 0.00 ? 20  ARG A CG   3  
ATOM 4016  C CD   . ARG A 1 20  ? -7.245  4.382   -9.150  1.00 0.00 ? 20  ARG A CD   3  
ATOM 4017  N NE   . ARG A 1 20  ? -7.930  4.606   -10.420 1.00 0.00 ? 20  ARG A NE   3  
ATOM 4018  C CZ   . ARG A 1 20  ? -7.790  3.816   -11.480 1.00 0.00 ? 20  ARG A CZ   3  
ATOM 4019  N NH1  . ARG A 1 20  ? -6.996  2.757   -11.420 1.00 0.00 ? 20  ARG A NH1  3  
ATOM 4020  N NH2  . ARG A 1 20  ? -8.447  4.086   -12.601 1.00 0.00 ? 20  ARG A NH2  3  
ATOM 4021  H H    . ARG A 1 20  ? -7.020  6.357   -4.671  1.00 0.00 ? 20  ARG A H    3  
ATOM 4022  H HA   . ARG A 1 20  ? -7.277  3.899   -6.275  1.00 0.00 ? 20  ARG A HA   3  
ATOM 4023  H HB2  . ARG A 1 20  ? -6.043  6.560   -6.837  1.00 0.00 ? 20  ARG A HB2  3  
ATOM 4024  H HB3  . ARG A 1 20  ? -5.346  5.133   -7.592  1.00 0.00 ? 20  ARG A HB3  3  
ATOM 4025  H HG2  . ARG A 1 20  ? -8.283  5.639   -7.778  1.00 0.00 ? 20  ARG A HG2  3  
ATOM 4026  H HG3  . ARG A 1 20  ? -7.161  6.490   -8.841  1.00 0.00 ? 20  ARG A HG3  3  
ATOM 4027  H HD2  . ARG A 1 20  ? -6.209  4.150   -9.346  1.00 0.00 ? 20  ARG A HD2  3  
ATOM 4028  H HD3  . ARG A 1 20  ? -7.710  3.550   -8.643  1.00 0.00 ? 20  ARG A HD3  3  
ATOM 4029  H HE   . ARG A 1 20  ? -8.522  5.383   -10.486 1.00 0.00 ? 20  ARG A HE   3  
ATOM 4030  H HH11 . ARG A 1 20  ? -6.501  2.550   -10.577 1.00 0.00 ? 20  ARG A HH11 3  
ATOM 4031  H HH12 . ARG A 1 20  ? -6.893  2.163   -12.219 1.00 0.00 ? 20  ARG A HH12 3  
ATOM 4032  H HH21 . ARG A 1 20  ? -9.047  4.884   -12.649 1.00 0.00 ? 20  ARG A HH21 3  
ATOM 4033  H HH22 . ARG A 1 20  ? -8.341  3.492   -13.397 1.00 0.00 ? 20  ARG A HH22 3  
ATOM 4034  N N    . LEU A 1 21  ? -5.435  2.829   -5.012  1.00 0.00 ? 21  LEU A N    3  
ATOM 4035  C CA   . LEU A 1 21  ? -4.310  2.150   -4.378  1.00 0.00 ? 21  LEU A CA   3  
ATOM 4036  C C    . LEU A 1 21  ? -3.259  1.757   -5.412  1.00 0.00 ? 21  LEU A C    3  
ATOM 4037  O O    . LEU A 1 21  ? -3.530  0.971   -6.321  1.00 0.00 ? 21  LEU A O    3  
ATOM 4038  C CB   . LEU A 1 21  ? -4.794  0.907   -3.630  1.00 0.00 ? 21  LEU A CB   3  
ATOM 4039  C CG   . LEU A 1 21  ? -3.750  -0.186  -3.396  1.00 0.00 ? 21  LEU A CG   3  
ATOM 4040  C CD1  . LEU A 1 21  ? -2.652  0.315   -2.471  1.00 0.00 ? 21  LEU A CD1  3  
ATOM 4041  C CD2  . LEU A 1 21  ? -4.404  -1.435  -2.824  1.00 0.00 ? 21  LEU A CD2  3  
ATOM 4042  H H    . LEU A 1 21  ? -6.236  2.313   -5.240  1.00 0.00 ? 21  LEU A H    3  
ATOM 4043  H HA   . LEU A 1 21  ? -3.864  2.834   -3.672  1.00 0.00 ? 21  LEU A HA   3  
ATOM 4044  H HB2  . LEU A 1 21  ? -5.162  1.224   -2.666  1.00 0.00 ? 21  LEU A HB2  3  
ATOM 4045  H HB3  . LEU A 1 21  ? -5.605  0.475   -4.199  1.00 0.00 ? 21  LEU A HB3  3  
ATOM 4046  H HG   . LEU A 1 21  ? -3.296  -0.449  -4.342  1.00 0.00 ? 21  LEU A HG   3  
ATOM 4047  H HD11 . LEU A 1 21  ? -2.570  -0.344  -1.620  1.00 0.00 ? 21  LEU A HD11 3  
ATOM 4048  H HD12 . LEU A 1 21  ? -2.892  1.312   -2.134  1.00 0.00 ? 21  LEU A HD12 3  
ATOM 4049  H HD13 . LEU A 1 21  ? -1.713  0.333   -3.005  1.00 0.00 ? 21  LEU A HD13 3  
ATOM 4050  H HD21 . LEU A 1 21  ? -5.121  -1.822  -3.533  1.00 0.00 ? 21  LEU A HD21 3  
ATOM 4051  H HD22 . LEU A 1 21  ? -4.908  -1.186  -1.901  1.00 0.00 ? 21  LEU A HD22 3  
ATOM 4052  H HD23 . LEU A 1 21  ? -3.648  -2.181  -2.632  1.00 0.00 ? 21  LEU A HD23 3  
ATOM 4053  N N    . HIS A 1 22  ? -2.058  2.308   -5.266  1.00 0.00 ? 22  HIS A N    3  
ATOM 4054  C CA   . HIS A 1 22  ? -0.965  2.014   -6.186  1.00 0.00 ? 22  HIS A CA   3  
ATOM 4055  C C    . HIS A 1 22  ? -0.451  0.592   -5.981  1.00 0.00 ? 22  HIS A C    3  
ATOM 4056  O O    . HIS A 1 22  ? -0.386  0.101   -4.855  1.00 0.00 ? 22  HIS A O    3  
ATOM 4057  C CB   . HIS A 1 22  ? 0.176   3.013   -5.992  1.00 0.00 ? 22  HIS A CB   3  
ATOM 4058  C CG   . HIS A 1 22  ? -0.240  4.440   -6.180  1.00 0.00 ? 22  HIS A CG   3  
ATOM 4059  N ND1  . HIS A 1 22  ? 0.561   5.384   -6.787  1.00 0.00 ? 22  HIS A ND1  3  
ATOM 4060  C CD2  . HIS A 1 22  ? -1.381  5.082   -5.837  1.00 0.00 ? 22  HIS A CD2  3  
ATOM 4061  C CE1  . HIS A 1 22  ? -0.068  6.545   -6.808  1.00 0.00 ? 22  HIS A CE1  3  
ATOM 4062  N NE2  . HIS A 1 22  ? -1.250  6.389   -6.239  1.00 0.00 ? 22  HIS A NE2  3  
ATOM 4063  H H    . HIS A 1 22  ? -1.904  2.927   -4.523  1.00 0.00 ? 22  HIS A H    3  
ATOM 4064  H HA   . HIS A 1 22  ? -1.345  2.105   -7.192  1.00 0.00 ? 22  HIS A HA   3  
ATOM 4065  H HB2  . HIS A 1 22  ? 0.569   2.912   -4.992  1.00 0.00 ? 22  HIS A HB2  3  
ATOM 4066  H HB3  . HIS A 1 22  ? 0.959   2.799   -6.705  1.00 0.00 ? 22  HIS A HB3  3  
ATOM 4067  H HD1  . HIS A 1 22  ? 1.459   5.226   -7.147  1.00 0.00 ? 22  HIS A HD1  3  
ATOM 4068  H HD2  . HIS A 1 22  ? -2.237  4.648   -5.340  1.00 0.00 ? 22  HIS A HD2  3  
ATOM 4069  H HE1  . HIS A 1 22  ? 0.316   7.465   -7.222  1.00 0.00 ? 22  HIS A HE1  3  
ATOM 4070  H HE2  . HIS A 1 22  ? -1.884  7.111   -6.046  1.00 0.00 ? 22  HIS A HE2  3  
ATOM 4071  N N    . ASN A 1 23  ? -0.088  -0.065  -7.078  1.00 0.00 ? 23  ASN A N    3  
ATOM 4072  C CA   . ASN A 1 23  ? 0.419   -1.431  -7.019  1.00 0.00 ? 23  ASN A CA   3  
ATOM 4073  C C    . ASN A 1 23  ? 1.305   -1.630  -5.793  1.00 0.00 ? 23  ASN A C    3  
ATOM 4074  O O    . ASN A 1 23  ? 2.179   -0.817  -5.489  1.00 0.00 ? 23  ASN A O    3  
ATOM 4075  C CB   . ASN A 1 23  ? 1.205   -1.761  -8.289  1.00 0.00 ? 23  ASN A CB   3  
ATOM 4076  C CG   . ASN A 1 23  ? 0.383   -1.557  -9.547  1.00 0.00 ? 23  ASN A CG   3  
ATOM 4077  O OD1  . ASN A 1 23  ? -0.827  -1.339  -9.483  1.00 0.00 ? 23  ASN A OD1  3  
ATOM 4078  N ND2  . ASN A 1 23  ? 1.039   -1.626  -10.700 1.00 0.00 ? 23  ASN A ND2  3  
ATOM 4079  H H    . ASN A 1 23  ? -0.163  0.380   -7.949  1.00 0.00 ? 23  ASN A H    3  
ATOM 4080  H HA   . ASN A 1 23  ? -0.429  -2.096  -6.948  1.00 0.00 ? 23  ASN A HA   3  
ATOM 4081  H HB2  . ASN A 1 23  ? 2.075   -1.122  -8.343  1.00 0.00 ? 23  ASN A HB2  3  
ATOM 4082  H HB3  . ASN A 1 23  ? 1.522   -2.792  -8.252  1.00 0.00 ? 23  ASN A HB3  3  
ATOM 4083  H HD21 . ASN A 1 23  ? 2.003   -1.803  -10.675 1.00 0.00 ? 23  ASN A HD21 3  
ATOM 4084  H HD22 . ASN A 1 23  ? 0.532   -1.497  -11.529 1.00 0.00 ? 23  ASN A HD22 3  
ATOM 4085  N N    . PRO A 1 24  ? 1.076   -2.737  -5.071  1.00 0.00 ? 24  PRO A N    3  
ATOM 4086  C CA   . PRO A 1 24  ? 1.844   -3.069  -3.867  1.00 0.00 ? 24  PRO A CA   3  
ATOM 4087  C C    . PRO A 1 24  ? 3.283   -3.457  -4.187  1.00 0.00 ? 24  PRO A C    3  
ATOM 4088  O O    . PRO A 1 24  ? 3.578   -4.621  -4.456  1.00 0.00 ? 24  PRO A O    3  
ATOM 4089  C CB   . PRO A 1 24  ? 1.086   -4.263  -3.282  1.00 0.00 ? 24  PRO A CB   3  
ATOM 4090  C CG   . PRO A 1 24  ? 0.395   -4.882  -4.448  1.00 0.00 ? 24  PRO A CG   3  
ATOM 4091  C CD   . PRO A 1 24  ? 0.051   -3.749  -5.374  1.00 0.00 ? 24  PRO A CD   3  
ATOM 4092  H HA   . PRO A 1 24  ? 1.840   -2.255  -3.157  1.00 0.00 ? 24  PRO A HA   3  
ATOM 4093  H HB2  . PRO A 1 24  ? 1.786   -4.950  -2.827  1.00 0.00 ? 24  PRO A HB2  3  
ATOM 4094  H HB3  . PRO A 1 24  ? 0.379   -3.918  -2.542  1.00 0.00 ? 24  PRO A HB3  3  
ATOM 4095  H HG2  . PRO A 1 24  ? 1.057   -5.580  -4.938  1.00 0.00 ? 24  PRO A HG2  3  
ATOM 4096  H HG3  . PRO A 1 24  ? -0.503  -5.383  -4.118  1.00 0.00 ? 24  PRO A HG3  3  
ATOM 4097  H HD2  . PRO A 1 24  ? 0.118   -4.070  -6.403  1.00 0.00 ? 24  PRO A HD2  3  
ATOM 4098  H HD3  . PRO A 1 24  ? -0.938  -3.372  -5.158  1.00 0.00 ? 24  PRO A HD3  3  
ATOM 4099  N N    . VAL A 1 25  ? 4.177   -2.474  -4.154  1.00 0.00 ? 25  VAL A N    3  
ATOM 4100  C CA   . VAL A 1 25  ? 5.587   -2.712  -4.439  1.00 0.00 ? 25  VAL A CA   3  
ATOM 4101  C C    . VAL A 1 25  ? 6.180   -3.725  -3.466  1.00 0.00 ? 25  VAL A C    3  
ATOM 4102  O O    . VAL A 1 25  ? 6.427   -3.413  -2.301  1.00 0.00 ? 25  VAL A O    3  
ATOM 4103  C CB   . VAL A 1 25  ? 6.403   -1.408  -4.365  1.00 0.00 ? 25  VAL A CB   3  
ATOM 4104  C CG1  . VAL A 1 25  ? 7.878   -1.686  -4.614  1.00 0.00 ? 25  VAL A CG1  3  
ATOM 4105  C CG2  . VAL A 1 25  ? 5.869   -0.389  -5.361  1.00 0.00 ? 25  VAL A CG2  3  
ATOM 4106  H H    . VAL A 1 25  ? 3.882   -1.566  -3.933  1.00 0.00 ? 25  VAL A H    3  
ATOM 4107  H HA   . VAL A 1 25  ? 5.664   -3.104  -5.442  1.00 0.00 ? 25  VAL A HA   3  
ATOM 4108  H HB   . VAL A 1 25  ? 6.300   -0.998  -3.371  1.00 0.00 ? 25  VAL A HB   3  
ATOM 4109  H HG11 . VAL A 1 25  ? 7.978   -2.548  -5.256  1.00 0.00 ? 25  VAL A HG11 3  
ATOM 4110  H HG12 . VAL A 1 25  ? 8.332   -0.828  -5.088  1.00 0.00 ? 25  VAL A HG12 3  
ATOM 4111  H HG13 . VAL A 1 25  ? 8.371   -1.881  -3.673  1.00 0.00 ? 25  VAL A HG13 3  
ATOM 4112  H HG21 . VAL A 1 25  ? 6.150   -0.683  -6.361  1.00 0.00 ? 25  VAL A HG21 3  
ATOM 4113  H HG22 . VAL A 1 25  ? 4.792   -0.345  -5.288  1.00 0.00 ? 25  VAL A HG22 3  
ATOM 4114  H HG23 . VAL A 1 25  ? 6.285   0.582   -5.140  1.00 0.00 ? 25  VAL A HG23 3  
ATOM 4115  N N    . VAL A 1 26  ? 6.407   -4.942  -3.952  1.00 0.00 ? 26  VAL A N    3  
ATOM 4116  C CA   . VAL A 1 26  ? 6.973   -6.001  -3.126  1.00 0.00 ? 26  VAL A CA   3  
ATOM 4117  C C    . VAL A 1 26  ? 8.434   -5.718  -2.793  1.00 0.00 ? 26  VAL A C    3  
ATOM 4118  O O    . VAL A 1 26  ? 9.339   -6.136  -3.517  1.00 0.00 ? 26  VAL A O    3  
ATOM 4119  C CB   . VAL A 1 26  ? 6.874   -7.371  -3.824  1.00 0.00 ? 26  VAL A CB   3  
ATOM 4120  C CG1  . VAL A 1 26  ? 7.698   -7.380  -5.103  1.00 0.00 ? 26  VAL A CG1  3  
ATOM 4121  C CG2  . VAL A 1 26  ? 7.320   -8.481  -2.885  1.00 0.00 ? 26  VAL A CG2  3  
ATOM 4122  H H    . VAL A 1 26  ? 6.190   -5.130  -4.889  1.00 0.00 ? 26  VAL A H    3  
ATOM 4123  H HA   . VAL A 1 26  ? 6.407   -6.047  -2.207  1.00 0.00 ? 26  VAL A HA   3  
ATOM 4124  H HB   . VAL A 1 26  ? 5.840   -7.544  -4.087  1.00 0.00 ? 26  VAL A HB   3  
ATOM 4125  H HG11 . VAL A 1 26  ? 7.201   -7.986  -5.846  1.00 0.00 ? 26  VAL A HG11 3  
ATOM 4126  H HG12 . VAL A 1 26  ? 7.802   -6.370  -5.471  1.00 0.00 ? 26  VAL A HG12 3  
ATOM 4127  H HG13 . VAL A 1 26  ? 8.675   -7.791  -4.898  1.00 0.00 ? 26  VAL A HG13 3  
ATOM 4128  H HG21 . VAL A 1 26  ? 6.542   -9.227  -2.816  1.00 0.00 ? 26  VAL A HG21 3  
ATOM 4129  H HG22 . VAL A 1 26  ? 8.222   -8.936  -3.267  1.00 0.00 ? 26  VAL A HG22 3  
ATOM 4130  H HG23 . VAL A 1 26  ? 7.512   -8.069  -1.906  1.00 0.00 ? 26  VAL A HG23 3  
ATOM 4131  N N    . LEU A 1 27  ? 8.657   -5.007  -1.694  1.00 0.00 ? 27  LEU A N    3  
ATOM 4132  C CA   . LEU A 1 27  ? 10.009  -4.667  -1.263  1.00 0.00 ? 27  LEU A CA   3  
ATOM 4133  C C    . LEU A 1 27  ? 10.774  -5.916  -0.836  1.00 0.00 ? 27  LEU A C    3  
ATOM 4134  O O    . LEU A 1 27  ? 11.921  -6.121  -1.233  1.00 0.00 ? 27  LEU A O    3  
ATOM 4135  C CB   . LEU A 1 27  ? 9.961   -3.664  -0.110  1.00 0.00 ? 27  LEU A CB   3  
ATOM 4136  C CG   . LEU A 1 27  ? 9.301   -2.320  -0.416  1.00 0.00 ? 27  LEU A CG   3  
ATOM 4137  C CD1  . LEU A 1 27  ? 9.122   -1.510  0.859   1.00 0.00 ? 27  LEU A CD1  3  
ATOM 4138  C CD2  . LEU A 1 27  ? 10.122  -1.542  -1.434  1.00 0.00 ? 27  LEU A CD2  3  
ATOM 4139  H H    . LEU A 1 27  ? 7.896   -4.702  -1.158  1.00 0.00 ? 27  LEU A H    3  
ATOM 4140  H HA   . LEU A 1 27  ? 10.520  -4.216  -2.101  1.00 0.00 ? 27  LEU A HA   3  
ATOM 4141  H HB2  . LEU A 1 27  ? 9.419   -4.121  0.703   1.00 0.00 ? 27  LEU A HB2  3  
ATOM 4142  H HB3  . LEU A 1 27  ? 10.978  -3.471  0.202   1.00 0.00 ? 27  LEU A HB3  3  
ATOM 4143  H HG   . LEU A 1 27  ? 8.321   -2.495  -0.839  1.00 0.00 ? 27  LEU A HG   3  
ATOM 4144  H HD11 . LEU A 1 27  ? 8.914   -0.482  0.606   1.00 0.00 ? 27  LEU A HD11 3  
ATOM 4145  H HD12 . LEU A 1 27  ? 10.027  -1.560  1.447   1.00 0.00 ? 27  LEU A HD12 3  
ATOM 4146  H HD13 . LEU A 1 27  ? 8.299   -1.915  1.430   1.00 0.00 ? 27  LEU A HD13 3  
ATOM 4147  H HD21 . LEU A 1 27  ? 10.794  -0.873  -0.917  1.00 0.00 ? 27  LEU A HD21 3  
ATOM 4148  H HD22 . LEU A 1 27  ? 9.460   -0.968  -2.067  1.00 0.00 ? 27  LEU A HD22 3  
ATOM 4149  H HD23 . LEU A 1 27  ? 10.692  -2.231  -2.038  1.00 0.00 ? 27  LEU A HD23 3  
ATOM 4150  N N    . THR A 1 28  ? 10.130  -6.749  -0.024  1.00 0.00 ? 28  THR A N    3  
ATOM 4151  C CA   . THR A 1 28  ? 10.748  -7.978  0.456   1.00 0.00 ? 28  THR A CA   3  
ATOM 4152  C C    . THR A 1 28  ? 9.740   -9.121  0.500   1.00 0.00 ? 28  THR A C    3  
ATOM 4153  O O    . THR A 1 28  ? 8.527   -8.910  0.506   1.00 0.00 ? 28  THR A O    3  
ATOM 4154  C CB   . THR A 1 28  ? 11.355  -7.790  1.860   1.00 0.00 ? 28  THR A CB   3  
ATOM 4155  O OG1  . THR A 1 28  ? 10.615  -6.801  2.584   1.00 0.00 ? 28  THR A OG1  3  
ATOM 4156  C CG2  . THR A 1 28  ? 12.815  -7.372  1.767   1.00 0.00 ? 28  THR A CG2  3  
ATOM 4157  H H    . THR A 1 28  ? 9.217   -6.531  0.257   1.00 0.00 ? 28  THR A H    3  
ATOM 4158  H HA   . THR A 1 28  ? 11.545  -8.239  -0.225  1.00 0.00 ? 28  THR A HA   3  
ATOM 4159  H HB   . THR A 1 28  ? 11.298  -8.731  2.389   1.00 0.00 ? 28  THR A HB   3  
ATOM 4160  H HG1  . THR A 1 28  ? 10.517  -7.080  3.498   1.00 0.00 ? 28  THR A HG1  3  
ATOM 4161  H HG21 . THR A 1 28  ? 13.097  -6.848  2.668   1.00 0.00 ? 28  THR A HG21 3  
ATOM 4162  H HG22 . THR A 1 28  ? 12.950  -6.723  0.915   1.00 0.00 ? 28  THR A HG22 3  
ATOM 4163  H HG23 . THR A 1 28  ? 13.433  -8.250  1.654   1.00 0.00 ? 28  THR A HG23 3  
ATOM 4164  N N    . PRO A 1 29  ? 10.251  -10.361 0.531   1.00 0.00 ? 29  PRO A N    3  
ATOM 4165  C CA   . PRO A 1 29  ? 9.411   -11.562 0.575   1.00 0.00 ? 29  PRO A CA   3  
ATOM 4166  C C    . PRO A 1 29  ? 8.694   -11.718 1.912   1.00 0.00 ? 29  PRO A C    3  
ATOM 4167  O O    . PRO A 1 29  ? 7.848   -12.598 2.075   1.00 0.00 ? 29  PRO A O    3  
ATOM 4168  C CB   . PRO A 1 29  ? 10.412  -12.701 0.368   1.00 0.00 ? 29  PRO A CB   3  
ATOM 4169  C CG   . PRO A 1 29  ? 11.713  -12.155 0.845   1.00 0.00 ? 29  PRO A CG   3  
ATOM 4170  C CD   . PRO A 1 29  ? 11.687  -10.686 0.525   1.00 0.00 ? 29  PRO A CD   3  
ATOM 4171  H HA   . PRO A 1 29  ? 8.685   -11.568 -0.225  1.00 0.00 ? 29  PRO A HA   3  
ATOM 4172  H HB2  . PRO A 1 29  ? 10.107  -13.561 0.949   1.00 0.00 ? 29  PRO A HB2  3  
ATOM 4173  H HB3  . PRO A 1 29  ? 10.453  -12.963 -0.678  1.00 0.00 ? 29  PRO A HB3  3  
ATOM 4174  H HG2  . PRO A 1 29  ? 11.806  -12.305 1.910   1.00 0.00 ? 29  PRO A HG2  3  
ATOM 4175  H HG3  . PRO A 1 29  ? 12.526  -12.637 0.324   1.00 0.00 ? 29  PRO A HG3  3  
ATOM 4176  H HD2  . PRO A 1 29  ? 12.212  -10.125 1.284   1.00 0.00 ? 29  PRO A HD2  3  
ATOM 4177  H HD3  . PRO A 1 29  ? 12.119  -10.504 -0.448  1.00 0.00 ? 29  PRO A HD3  3  
ATOM 4178  N N    . THR A 1 30  ? 9.037   -10.859 2.866   1.00 0.00 ? 30  THR A N    3  
ATOM 4179  C CA   . THR A 1 30  ? 8.426   -10.902 4.189   1.00 0.00 ? 30  THR A CA   3  
ATOM 4180  C C    . THR A 1 30  ? 7.703   -9.598  4.504   1.00 0.00 ? 30  THR A C    3  
ATOM 4181  O O    . THR A 1 30  ? 7.071   -9.463  5.552   1.00 0.00 ? 30  THR A O    3  
ATOM 4182  C CB   . THR A 1 30  ? 9.476   -11.171 5.284   1.00 0.00 ? 30  THR A CB   3  
ATOM 4183  O OG1  . THR A 1 30  ? 10.559  -10.242 5.163   1.00 0.00 ? 30  THR A OG1  3  
ATOM 4184  C CG2  . THR A 1 30  ? 10.007  -12.593 5.186   1.00 0.00 ? 30  THR A CG2  3  
ATOM 4185  H H    . THR A 1 30  ? 9.718   -10.180 2.675   1.00 0.00 ? 30  THR A H    3  
ATOM 4186  H HA   . THR A 1 30  ? 7.710   -11.711 4.199   1.00 0.00 ? 30  THR A HA   3  
ATOM 4187  H HB   . THR A 1 30  ? 9.007   -11.044 6.249   1.00 0.00 ? 30  THR A HB   3  
ATOM 4188  H HG1  . THR A 1 30  ? 10.460  -9.549  5.820   1.00 0.00 ? 30  THR A HG1  3  
ATOM 4189  H HG21 . THR A 1 30  ? 11.080  -12.586 5.309   1.00 0.00 ? 30  THR A HG21 3  
ATOM 4190  H HG22 . THR A 1 30  ? 9.758   -13.005 4.219   1.00 0.00 ? 30  THR A HG22 3  
ATOM 4191  H HG23 . THR A 1 30  ? 9.561   -13.198 5.961   1.00 0.00 ? 30  THR A HG23 3  
ATOM 4192  N N    . THR A 1 31  ? 7.798   -8.638  3.589   1.00 0.00 ? 31  THR A N    3  
ATOM 4193  C CA   . THR A 1 31  ? 7.154   -7.343  3.769   1.00 0.00 ? 31  THR A CA   3  
ATOM 4194  C C    . THR A 1 31  ? 6.851   -6.688  2.427   1.00 0.00 ? 31  THR A C    3  
ATOM 4195  O O    . THR A 1 31  ? 7.591   -6.863  1.458   1.00 0.00 ? 31  THR A O    3  
ATOM 4196  C CB   . THR A 1 31  ? 8.029   -6.392  4.607   1.00 0.00 ? 31  THR A CB   3  
ATOM 4197  O OG1  . THR A 1 31  ? 8.548   -7.081  5.749   1.00 0.00 ? 31  THR A OG1  3  
ATOM 4198  C CG2  . THR A 1 31  ? 7.229   -5.179  5.060   1.00 0.00 ? 31  THR A CG2  3  
ATOM 4199  H H    . THR A 1 31  ? 8.316   -8.805  2.774   1.00 0.00 ? 31  THR A H    3  
ATOM 4200  H HA   . THR A 1 31  ? 6.225   -7.504  4.298   1.00 0.00 ? 31  THR A HA   3  
ATOM 4201  H HB   . THR A 1 31  ? 8.853   -6.053  3.995   1.00 0.00 ? 31  THR A HB   3  
ATOM 4202  H HG1  . THR A 1 31  ? 7.864   -7.150  6.420   1.00 0.00 ? 31  THR A HG1  3  
ATOM 4203  H HG21 . THR A 1 31  ? 7.748   -4.688  5.870   1.00 0.00 ? 31  THR A HG21 3  
ATOM 4204  H HG22 . THR A 1 31  ? 6.254   -5.497  5.397   1.00 0.00 ? 31  THR A HG22 3  
ATOM 4205  H HG23 . THR A 1 31  ? 7.119   -4.492  4.235   1.00 0.00 ? 31  THR A HG23 3  
ATOM 4206  N N    . VAL A 1 32  ? 5.760   -5.931  2.375   1.00 0.00 ? 32  VAL A N    3  
ATOM 4207  C CA   . VAL A 1 32  ? 5.361   -5.247  1.151   1.00 0.00 ? 32  VAL A CA   3  
ATOM 4208  C C    . VAL A 1 32  ? 4.828   -3.851  1.450   1.00 0.00 ? 32  VAL A C    3  
ATOM 4209  O O    . VAL A 1 32  ? 4.079   -3.654  2.407   1.00 0.00 ? 32  VAL A O    3  
ATOM 4210  C CB   . VAL A 1 32  ? 4.284   -6.043  0.389   1.00 0.00 ? 32  VAL A CB   3  
ATOM 4211  C CG1  . VAL A 1 32  ? 3.839   -5.286  -0.853  1.00 0.00 ? 32  VAL A CG1  3  
ATOM 4212  C CG2  . VAL A 1 32  ? 4.804   -7.425  0.023   1.00 0.00 ? 32  VAL A CG2  3  
ATOM 4213  H H    . VAL A 1 32  ? 5.210   -5.830  3.180   1.00 0.00 ? 32  VAL A H    3  
ATOM 4214  H HA   . VAL A 1 32  ? 6.231   -5.162  0.517   1.00 0.00 ? 32  VAL A HA   3  
ATOM 4215  H HB   . VAL A 1 32  ? 3.428   -6.163  1.036   1.00 0.00 ? 32  VAL A HB   3  
ATOM 4216  H HG11 . VAL A 1 32  ? 4.575   -5.411  -1.634  1.00 0.00 ? 32  VAL A HG11 3  
ATOM 4217  H HG12 . VAL A 1 32  ? 2.887   -5.671  -1.188  1.00 0.00 ? 32  VAL A HG12 3  
ATOM 4218  H HG13 . VAL A 1 32  ? 3.741   -4.236  -0.618  1.00 0.00 ? 32  VAL A HG13 3  
ATOM 4219  H HG21 . VAL A 1 32  ? 5.559   -7.725  0.734   1.00 0.00 ? 32  VAL A HG21 3  
ATOM 4220  H HG22 . VAL A 1 32  ? 3.988   -8.134  0.043   1.00 0.00 ? 32  VAL A HG22 3  
ATOM 4221  H HG23 . VAL A 1 32  ? 5.232   -7.398  -0.968  1.00 0.00 ? 32  VAL A HG23 3  
ATOM 4222  N N    . GLN A 1 33  ? 5.219   -2.885  0.625   1.00 0.00 ? 33  GLN A N    3  
ATOM 4223  C CA   . GLN A 1 33  ? 4.780   -1.505  0.802   1.00 0.00 ? 33  GLN A CA   3  
ATOM 4224  C C    . GLN A 1 33  ? 3.395   -1.293  0.199   1.00 0.00 ? 33  GLN A C    3  
ATOM 4225  O O    . GLN A 1 33  ? 2.996   -1.997  -0.729  1.00 0.00 ? 33  GLN A O    3  
ATOM 4226  C CB   . GLN A 1 33  ? 5.782   -0.543  0.162   1.00 0.00 ? 33  GLN A CB   3  
ATOM 4227  C CG   . GLN A 1 33  ? 5.788   0.839   0.796   1.00 0.00 ? 33  GLN A CG   3  
ATOM 4228  C CD   . GLN A 1 33  ? 6.186   1.927   -0.182  1.00 0.00 ? 33  GLN A CD   3  
ATOM 4229  O OE1  . GLN A 1 33  ? 7.082   1.741   -1.006  1.00 0.00 ? 33  GLN A OE1  3  
ATOM 4230  N NE2  . GLN A 1 33  ? 5.520   3.073   -0.095  1.00 0.00 ? 33  GLN A NE2  3  
ATOM 4231  H H    . GLN A 1 33  ? 5.816   -3.104  -0.119  1.00 0.00 ? 33  GLN A H    3  
ATOM 4232  H HA   . GLN A 1 33  ? 4.731   -1.307  1.862   1.00 0.00 ? 33  GLN A HA   3  
ATOM 4233  H HB2  . GLN A 1 33  ? 6.773   -0.962  0.251   1.00 0.00 ? 33  GLN A HB2  3  
ATOM 4234  H HB3  . GLN A 1 33  ? 5.539   -0.433  -0.885  1.00 0.00 ? 33  GLN A HB3  3  
ATOM 4235  H HG2  . GLN A 1 33  ? 4.798   1.055   1.168   1.00 0.00 ? 33  GLN A HG2  3  
ATOM 4236  H HG3  . GLN A 1 33  ? 6.489   0.840   1.618   1.00 0.00 ? 33  GLN A HG3  3  
ATOM 4237  H HE21 . GLN A 1 33  ? 4.820   3.150   0.587   1.00 0.00 ? 33  GLN A HE21 3  
ATOM 4238  H HE22 . GLN A 1 33  ? 5.757   3.794   -0.714  1.00 0.00 ? 33  GLN A HE22 3  
ATOM 4239  N N    . VAL A 1 34  ? 2.666   -0.317  0.732   1.00 0.00 ? 34  VAL A N    3  
ATOM 4240  C CA   . VAL A 1 34  ? 1.326   -0.011  0.245   1.00 0.00 ? 34  VAL A CA   3  
ATOM 4241  C C    . VAL A 1 34  ? 1.093   1.494   0.187   1.00 0.00 ? 34  VAL A C    3  
ATOM 4242  O O    . VAL A 1 34  ? 1.341   2.210   1.158   1.00 0.00 ? 34  VAL A O    3  
ATOM 4243  C CB   . VAL A 1 34  ? 0.246   -0.653  1.136   1.00 0.00 ? 34  VAL A CB   3  
ATOM 4244  C CG1  . VAL A 1 34  ? -1.143  -0.338  0.602   1.00 0.00 ? 34  VAL A CG1  3  
ATOM 4245  C CG2  . VAL A 1 34  ? 0.460   -2.156  1.233   1.00 0.00 ? 34  VAL A CG2  3  
ATOM 4246  H H    . VAL A 1 34  ? 3.039   0.210   1.469   1.00 0.00 ? 34  VAL A H    3  
ATOM 4247  H HA   . VAL A 1 34  ? 1.231   -0.419  -0.751  1.00 0.00 ? 34  VAL A HA   3  
ATOM 4248  H HB   . VAL A 1 34  ? 0.330   -0.234  2.128   1.00 0.00 ? 34  VAL A HB   3  
ATOM 4249  H HG11 . VAL A 1 34  ? -1.674  0.271   1.319   1.00 0.00 ? 34  VAL A HG11 3  
ATOM 4250  H HG12 . VAL A 1 34  ? -1.057  0.197   -0.333  1.00 0.00 ? 34  VAL A HG12 3  
ATOM 4251  H HG13 . VAL A 1 34  ? -1.684  -1.259  0.441   1.00 0.00 ? 34  VAL A HG13 3  
ATOM 4252  H HG21 . VAL A 1 34  ? -0.033  -2.533  2.117   1.00 0.00 ? 34  VAL A HG21 3  
ATOM 4253  H HG22 . VAL A 1 34  ? 0.046   -2.637  0.358   1.00 0.00 ? 34  VAL A HG22 3  
ATOM 4254  H HG23 . VAL A 1 34  ? 1.517   -2.367  1.292   1.00 0.00 ? 34  VAL A HG23 3  
ATOM 4255  N N    . THR A 1 35  ? 0.614   1.970   -0.958  1.00 0.00 ? 35  THR A N    3  
ATOM 4256  C CA   . THR A 1 35  ? 0.348   3.390   -1.144  1.00 0.00 ? 35  THR A CA   3  
ATOM 4257  C C    . THR A 1 35  ? -0.950  3.610   -1.913  1.00 0.00 ? 35  THR A C    3  
ATOM 4258  O O    . THR A 1 35  ? -1.309  2.817   -2.783  1.00 0.00 ? 35  THR A O    3  
ATOM 4259  C CB   . THR A 1 35  ? 1.500   4.085   -1.895  1.00 0.00 ? 35  THR A CB   3  
ATOM 4260  O OG1  . THR A 1 35  ? 2.757   3.558   -1.457  1.00 0.00 ? 35  THR A OG1  3  
ATOM 4261  C CG2  . THR A 1 35  ? 1.466   5.588   -1.666  1.00 0.00 ? 35  THR A CG2  3  
ATOM 4262  H H    . THR A 1 35  ? 0.437   1.349   -1.695  1.00 0.00 ? 35  THR A H    3  
ATOM 4263  H HA   . THR A 1 35  ? 0.258   3.843   -0.167  1.00 0.00 ? 35  THR A HA   3  
ATOM 4264  H HB   . THR A 1 35  ? 1.387   3.894   -2.952  1.00 0.00 ? 35  THR A HB   3  
ATOM 4265  H HG1  . THR A 1 35  ? 2.801   2.621   -1.663  1.00 0.00 ? 35  THR A HG1  3  
ATOM 4266  H HG21 . THR A 1 35  ? 0.878   5.806   -0.787  1.00 0.00 ? 35  THR A HG21 3  
ATOM 4267  H HG22 . THR A 1 35  ? 1.025   6.073   -2.524  1.00 0.00 ? 35  THR A HG22 3  
ATOM 4268  H HG23 . THR A 1 35  ? 2.473   5.953   -1.525  1.00 0.00 ? 35  THR A HG23 3  
ATOM 4269  N N    . TRP A 1 36  ? -1.649  4.691   -1.586  1.00 0.00 ? 36  TRP A N    3  
ATOM 4270  C CA   . TRP A 1 36  ? -2.908  5.016   -2.248  1.00 0.00 ? 36  TRP A CA   3  
ATOM 4271  C C    . TRP A 1 36  ? -3.127  6.524   -2.291  1.00 0.00 ? 36  TRP A C    3  
ATOM 4272  O O    . TRP A 1 36  ? -2.569  7.267   -1.483  1.00 0.00 ? 36  TRP A O    3  
ATOM 4273  C CB   . TRP A 1 36  ? -4.075  4.339   -1.527  1.00 0.00 ? 36  TRP A CB   3  
ATOM 4274  C CG   . TRP A 1 36  ? -4.241  4.793   -0.109  1.00 0.00 ? 36  TRP A CG   3  
ATOM 4275  C CD1  . TRP A 1 36  ? -5.079  5.772   0.346   1.00 0.00 ? 36  TRP A CD1  3  
ATOM 4276  C CD2  . TRP A 1 36  ? -3.551  4.288   1.040   1.00 0.00 ? 36  TRP A CD2  3  
ATOM 4277  N NE1  . TRP A 1 36  ? -4.950  5.905   1.708   1.00 0.00 ? 36  TRP A NE1  3  
ATOM 4278  C CE2  . TRP A 1 36  ? -4.020  5.005   2.157   1.00 0.00 ? 36  TRP A CE2  3  
ATOM 4279  C CE3  . TRP A 1 36  ? -2.584  3.298   1.233   1.00 0.00 ? 36  TRP A CE3  3  
ATOM 4280  C CZ2  . TRP A 1 36  ? -3.554  4.763   3.446   1.00 0.00 ? 36  TRP A CZ2  3  
ATOM 4281  C CZ3  . TRP A 1 36  ? -2.122  3.059   2.513   1.00 0.00 ? 36  TRP A CZ3  3  
ATOM 4282  C CH2  . TRP A 1 36  ? -2.607  3.788   3.606   1.00 0.00 ? 36  TRP A CH2  3  
ATOM 4283  H H    . TRP A 1 36  ? -1.311  5.286   -0.884  1.00 0.00 ? 36  TRP A H    3  
ATOM 4284  H HA   . TRP A 1 36  ? -2.856  4.642   -3.259  1.00 0.00 ? 36  TRP A HA   3  
ATOM 4285  H HB2  . TRP A 1 36  ? -4.991  4.556   -2.056  1.00 0.00 ? 36  TRP A HB2  3  
ATOM 4286  H HB3  . TRP A 1 36  ? -3.913  3.271   -1.519  1.00 0.00 ? 36  TRP A HB3  3  
ATOM 4287  H HD1  . TRP A 1 36  ? -5.737  6.349   -0.284  1.00 0.00 ? 36  TRP A HD1  3  
ATOM 4288  H HE1  . TRP A 1 36  ? -5.446  6.540   2.266   1.00 0.00 ? 36  TRP A HE1  3  
ATOM 4289  H HE3  . TRP A 1 36  ? -2.198  2.725   0.402   1.00 0.00 ? 36  TRP A HE3  3  
ATOM 4290  H HZ2  . TRP A 1 36  ? -3.918  5.317   4.300   1.00 0.00 ? 36  TRP A HZ2  3  
ATOM 4291  H HZ3  . TRP A 1 36  ? -1.374  2.298   2.681   1.00 0.00 ? 36  TRP A HZ3  3  
ATOM 4292  H HH2  . TRP A 1 36  ? -2.217  3.568   4.588   1.00 0.00 ? 36  TRP A HH2  3  
ATOM 4293  N N    . THR A 1 37  ? -3.944  6.972   -3.240  1.00 0.00 ? 37  THR A N    3  
ATOM 4294  C CA   . THR A 1 37  ? -4.236  8.392   -3.390  1.00 0.00 ? 37  THR A CA   3  
ATOM 4295  C C    . THR A 1 37  ? -5.737  8.653   -3.339  1.00 0.00 ? 37  THR A C    3  
ATOM 4296  O O    . THR A 1 37  ? -6.542  7.735   -3.496  1.00 0.00 ? 37  THR A O    3  
ATOM 4297  C CB   . THR A 1 37  ? -3.674  8.945   -4.713  1.00 0.00 ? 37  THR A CB   3  
ATOM 4298  O OG1  . THR A 1 37  ? -3.817  10.369  -4.749  1.00 0.00 ? 37  THR A OG1  3  
ATOM 4299  C CG2  . THR A 1 37  ? -4.391  8.328   -5.905  1.00 0.00 ? 37  THR A CG2  3  
ATOM 4300  H H    . THR A 1 37  ? -4.358  6.331   -3.854  1.00 0.00 ? 37  THR A H    3  
ATOM 4301  H HA   . THR A 1 37  ? -3.761  8.918   -2.574  1.00 0.00 ? 37  THR A HA   3  
ATOM 4302  H HB   . THR A 1 37  ? -2.625  8.694   -4.774  1.00 0.00 ? 37  THR A HB   3  
ATOM 4303  H HG1  . THR A 1 37  ? -3.515  10.700  -5.599  1.00 0.00 ? 37  THR A HG1  3  
ATOM 4304  H HG21 . THR A 1 37  ? -4.520  9.075   -6.674  1.00 0.00 ? 37  THR A HG21 3  
ATOM 4305  H HG22 . THR A 1 37  ? -5.358  7.962   -5.593  1.00 0.00 ? 37  THR A HG22 3  
ATOM 4306  H HG23 . THR A 1 37  ? -3.804  7.510   -6.293  1.00 0.00 ? 37  THR A HG23 3  
ATOM 4307  N N    . VAL A 1 38  ? -6.107  9.911   -3.121  1.00 0.00 ? 38  VAL A N    3  
ATOM 4308  C CA   . VAL A 1 38  ? -7.512  10.293  -3.052  1.00 0.00 ? 38  VAL A CA   3  
ATOM 4309  C C    . VAL A 1 38  ? -7.738  11.670  -3.665  1.00 0.00 ? 38  VAL A C    3  
ATOM 4310  O O    . VAL A 1 38  ? -7.038  12.629  -3.338  1.00 0.00 ? 38  VAL A O    3  
ATOM 4311  C CB   . VAL A 1 38  ? -8.021  10.301  -1.598  1.00 0.00 ? 38  VAL A CB   3  
ATOM 4312  C CG1  . VAL A 1 38  ? -7.875  8.921   -0.974  1.00 0.00 ? 38  VAL A CG1  3  
ATOM 4313  C CG2  . VAL A 1 38  ? -7.279  11.347  -0.780  1.00 0.00 ? 38  VAL A CG2  3  
ATOM 4314  H H    . VAL A 1 38  ? -5.418  10.598  -3.004  1.00 0.00 ? 38  VAL A H    3  
ATOM 4315  H HA   . VAL A 1 38  ? -8.084  9.564   -3.607  1.00 0.00 ? 38  VAL A HA   3  
ATOM 4316  H HB   . VAL A 1 38  ? -9.070  10.558  -1.606  1.00 0.00 ? 38  VAL A HB   3  
ATOM 4317  H HG11 . VAL A 1 38  ? -8.549  8.834   -0.134  1.00 0.00 ? 38  VAL A HG11 3  
ATOM 4318  H HG12 . VAL A 1 38  ? -8.113  8.166   -1.708  1.00 0.00 ? 38  VAL A HG12 3  
ATOM 4319  H HG13 . VAL A 1 38  ? -6.859  8.786   -0.634  1.00 0.00 ? 38  VAL A HG13 3  
ATOM 4320  H HG21 . VAL A 1 38  ? -7.090  10.960  0.211   1.00 0.00 ? 38  VAL A HG21 3  
ATOM 4321  H HG22 . VAL A 1 38  ? -6.339  11.580  -1.260  1.00 0.00 ? 38  VAL A HG22 3  
ATOM 4322  H HG23 . VAL A 1 38  ? -7.879  12.242  -0.709  1.00 0.00 ? 38  VAL A HG23 3  
ATOM 4323  N N    . ASP A 1 39  ? -8.719  11.762  -4.555  1.00 0.00 ? 39  ASP A N    3  
ATOM 4324  C CA   . ASP A 1 39  ? -9.039  13.023  -5.214  1.00 0.00 ? 39  ASP A CA   3  
ATOM 4325  C C    . ASP A 1 39  ? -9.444  14.082  -4.193  1.00 0.00 ? 39  ASP A C    3  
ATOM 4326  O O    . ASP A 1 39  ? -8.966  15.216  -4.238  1.00 0.00 ? 39  ASP A O    3  
ATOM 4327  C CB   . ASP A 1 39  ? -10.164 12.821  -6.231  1.00 0.00 ? 39  ASP A CB   3  
ATOM 4328  C CG   . ASP A 1 39  ? -10.080 13.797  -7.388  1.00 0.00 ? 39  ASP A CG   3  
ATOM 4329  O OD1  . ASP A 1 39  ? -9.268  13.560  -8.306  1.00 0.00 ? 39  ASP A OD1  3  
ATOM 4330  O OD2  . ASP A 1 39  ? -10.826 14.799  -7.374  1.00 0.00 ? 39  ASP A OD2  3  
ATOM 4331  H H    . ASP A 1 39  ? -9.242  10.962  -4.774  1.00 0.00 ? 39  ASP A H    3  
ATOM 4332  H HA   . ASP A 1 39  ? -8.154  13.360  -5.732  1.00 0.00 ? 39  ASP A HA   3  
ATOM 4333  H HB2  . ASP A 1 39  ? -10.106 11.817  -6.627  1.00 0.00 ? 39  ASP A HB2  3  
ATOM 4334  H HB3  . ASP A 1 39  ? -11.115 12.955  -5.737  1.00 0.00 ? 39  ASP A HB3  3  
ATOM 4335  N N    . ARG A 1 40  ? -10.327 13.704  -3.275  1.00 0.00 ? 40  ARG A N    3  
ATOM 4336  C CA   . ARG A 1 40  ? -10.798 14.622  -2.245  1.00 0.00 ? 40  ARG A CA   3  
ATOM 4337  C C    . ARG A 1 40  ? -10.657 14.001  -0.858  1.00 0.00 ? 40  ARG A C    3  
ATOM 4338  O O    . ARG A 1 40  ? -11.641 13.574  -0.256  1.00 0.00 ? 40  ARG A O    3  
ATOM 4339  C CB   . ARG A 1 40  ? -12.258 15.002  -2.499  1.00 0.00 ? 40  ARG A CB   3  
ATOM 4340  C CG   . ARG A 1 40  ? -12.465 15.813  -3.767  1.00 0.00 ? 40  ARG A CG   3  
ATOM 4341  C CD   . ARG A 1 40  ? -13.920 16.221  -3.937  1.00 0.00 ? 40  ARG A CD   3  
ATOM 4342  N NE   . ARG A 1 40  ? -14.225 16.597  -5.315  1.00 0.00 ? 40  ARG A NE   3  
ATOM 4343  C CZ   . ARG A 1 40  ? -15.408 17.059  -5.706  1.00 0.00 ? 40  ARG A CZ   3  
ATOM 4344  N NH1  . ARG A 1 40  ? -16.391 17.201  -4.827  1.00 0.00 ? 40  ARG A NH1  3  
ATOM 4345  N NH2  . ARG A 1 40  ? -15.609 17.380  -6.977  1.00 0.00 ? 40  ARG A NH2  3  
ATOM 4346  H H    . ARG A 1 40  ? -10.672 12.787  -3.291  1.00 0.00 ? 40  ARG A H    3  
ATOM 4347  H HA   . ARG A 1 40  ? -10.190 15.513  -2.291  1.00 0.00 ? 40  ARG A HA   3  
ATOM 4348  H HB2  . ARG A 1 40  ? -12.845 14.099  -2.576  1.00 0.00 ? 40  ARG A HB2  3  
ATOM 4349  H HB3  . ARG A 1 40  ? -12.616 15.584  -1.663  1.00 0.00 ? 40  ARG A HB3  3  
ATOM 4350  H HG2  . ARG A 1 40  ? -11.857 16.705  -3.716  1.00 0.00 ? 40  ARG A HG2  3  
ATOM 4351  H HG3  . ARG A 1 40  ? -12.164 15.218  -4.617  1.00 0.00 ? 40  ARG A HG3  3  
ATOM 4352  H HD2  . ARG A 1 40  ? -14.548 15.390  -3.654  1.00 0.00 ? 40  ARG A HD2  3  
ATOM 4353  H HD3  . ARG A 1 40  ? -14.122 17.061  -3.291  1.00 0.00 ? 40  ARG A HD3  3  
ATOM 4354  H HE   . ARG A 1 40  ? -13.513 16.500  -5.980  1.00 0.00 ? 40  ARG A HE   3  
ATOM 4355  H HH11 . ARG A 1 40  ? -16.242 16.960  -3.868  1.00 0.00 ? 40  ARG A HH11 3  
ATOM 4356  H HH12 . ARG A 1 40  ? -17.280 17.550  -5.124  1.00 0.00 ? 40  ARG A HH12 3  
ATOM 4357  H HH21 . ARG A 1 40  ? -14.871 17.274  -7.642  1.00 0.00 ? 40  ARG A HH21 3  
ATOM 4358  H HH22 . ARG A 1 40  ? -16.500 17.727  -7.270  1.00 0.00 ? 40  ARG A HH22 3  
ATOM 4359  N N    . GLN A 1 41  ? -9.426  13.955  -0.359  1.00 0.00 ? 41  GLN A N    3  
ATOM 4360  C CA   . GLN A 1 41  ? -9.156  13.386  0.956   1.00 0.00 ? 41  GLN A CA   3  
ATOM 4361  C C    . GLN A 1 41  ? -10.171 13.880  1.982   1.00 0.00 ? 41  GLN A C    3  
ATOM 4362  O O    . GLN A 1 41  ? -10.390 15.080  2.147   1.00 0.00 ? 41  GLN A O    3  
ATOM 4363  C CB   . GLN A 1 41  ? -7.740  13.744  1.410   1.00 0.00 ? 41  GLN A CB   3  
ATOM 4364  C CG   . GLN A 1 41  ? -7.253  12.921  2.592   1.00 0.00 ? 41  GLN A CG   3  
ATOM 4365  C CD   . GLN A 1 41  ? -5.932  13.418  3.145   1.00 0.00 ? 41  GLN A CD   3  
ATOM 4366  O OE1  . GLN A 1 41  ? -5.491  14.524  2.830   1.00 0.00 ? 41  GLN A OE1  3  
ATOM 4367  N NE2  . GLN A 1 41  ? -5.292  12.602  3.974   1.00 0.00 ? 41  GLN A NE2  3  
ATOM 4368  H H    . GLN A 1 41  ? -8.682  14.312  -0.887  1.00 0.00 ? 41  GLN A H    3  
ATOM 4369  H HA   . GLN A 1 41  ? -9.238  12.313  0.875   1.00 0.00 ? 41  GLN A HA   3  
ATOM 4370  H HB2  . GLN A 1 41  ? -7.060  13.587  0.585   1.00 0.00 ? 41  GLN A HB2  3  
ATOM 4371  H HB3  . GLN A 1 41  ? -7.717  14.786  1.691   1.00 0.00 ? 41  GLN A HB3  3  
ATOM 4372  H HG2  . GLN A 1 41  ? -7.994  12.968  3.376   1.00 0.00 ? 41  GLN A HG2  3  
ATOM 4373  H HG3  . GLN A 1 41  ? -7.132  11.896  2.275   1.00 0.00 ? 41  GLN A HG3  3  
ATOM 4374  H HE21 . GLN A 1 41  ? -5.704  11.736  4.179   1.00 0.00 ? 41  GLN A HE21 3  
ATOM 4375  H HE22 . GLN A 1 41  ? -4.436  12.897  4.345   1.00 0.00 ? 41  GLN A HE22 3  
ATOM 4376  N N    . PRO A 1 42  ? -10.807 12.933  2.689   1.00 0.00 ? 42  PRO A N    3  
ATOM 4377  C CA   . PRO A 1 42  ? -11.809 13.249  3.711   1.00 0.00 ? 42  PRO A CA   3  
ATOM 4378  C C    . PRO A 1 42  ? -11.193 13.896  4.947   1.00 0.00 ? 42  PRO A C    3  
ATOM 4379  O O    . PRO A 1 42  ? -10.071 13.573  5.333   1.00 0.00 ? 42  PRO A O    3  
ATOM 4380  C CB   . PRO A 1 42  ? -12.399 11.881  4.063   1.00 0.00 ? 42  PRO A CB   3  
ATOM 4381  C CG   . PRO A 1 42  ? -11.323 10.906  3.728   1.00 0.00 ? 42  PRO A CG   3  
ATOM 4382  C CD   . PRO A 1 42  ? -10.595 11.483  2.545   1.00 0.00 ? 42  PRO A CD   3  
ATOM 4383  H HA   . PRO A 1 42  ? -12.587 13.888  3.320   1.00 0.00 ? 42  PRO A HA   3  
ATOM 4384  H HB2  . PRO A 1 42  ? -12.646 11.852  5.115   1.00 0.00 ? 42  PRO A HB2  3  
ATOM 4385  H HB3  . PRO A 1 42  ? -13.287 11.705  3.474   1.00 0.00 ? 42  PRO A HB3  3  
ATOM 4386  H HG2  . PRO A 1 42  ? -10.651 10.799  4.566   1.00 0.00 ? 42  PRO A HG2  3  
ATOM 4387  H HG3  . PRO A 1 42  ? -11.759 9.952   3.470   1.00 0.00 ? 42  PRO A HG3  3  
ATOM 4388  H HD2  . PRO A 1 42  ? -9.544  11.240  2.594   1.00 0.00 ? 42  PRO A HD2  3  
ATOM 4389  H HD3  . PRO A 1 42  ? -11.026 11.121  1.624   1.00 0.00 ? 42  PRO A HD3  3  
ATOM 4390  N N    . GLN A 1 43  ? -11.936 14.812  5.561   1.00 0.00 ? 43  GLN A N    3  
ATOM 4391  C CA   . GLN A 1 43  ? -11.461 15.505  6.753   1.00 0.00 ? 43  GLN A CA   3  
ATOM 4392  C C    . GLN A 1 43  ? -11.930 14.795  8.019   1.00 0.00 ? 43  GLN A C    3  
ATOM 4393  O O    . GLN A 1 43  ? -11.195 14.707  9.002   1.00 0.00 ? 43  GLN A O    3  
ATOM 4394  C CB   . GLN A 1 43  ? -11.952 16.954  6.755   1.00 0.00 ? 43  GLN A CB   3  
ATOM 4395  C CG   . GLN A 1 43  ? -11.353 17.801  5.644   1.00 0.00 ? 43  GLN A CG   3  
ATOM 4396  C CD   . GLN A 1 43  ? -11.532 19.287  5.882   1.00 0.00 ? 43  GLN A CD   3  
ATOM 4397  O OE1  . GLN A 1 43  ? -12.351 19.702  6.703   1.00 0.00 ? 43  GLN A OE1  3  
ATOM 4398  N NE2  . GLN A 1 43  ? -10.765 20.098  5.164   1.00 0.00 ? 43  GLN A NE2  3  
ATOM 4399  H H    . GLN A 1 43  ? -12.822 15.026  5.205   1.00 0.00 ? 43  GLN A H    3  
ATOM 4400  H HA   . GLN A 1 43  ? -10.382 15.500  6.732   1.00 0.00 ? 43  GLN A HA   3  
ATOM 4401  H HB2  . GLN A 1 43  ? -13.026 16.958  6.644   1.00 0.00 ? 43  GLN A HB2  3  
ATOM 4402  H HB3  . GLN A 1 43  ? -11.694 17.407  7.702   1.00 0.00 ? 43  GLN A HB3  3  
ATOM 4403  H HG2  . GLN A 1 43  ? -10.297 17.588  5.576   1.00 0.00 ? 43  GLN A HG2  3  
ATOM 4404  H HG3  . GLN A 1 43  ? -11.833 17.539  4.712   1.00 0.00 ? 43  GLN A HG3  3  
ATOM 4405  H HE21 . GLN A 1 43  ? -10.136 19.697  4.528   1.00 0.00 ? 43  GLN A HE21 3  
ATOM 4406  H HE22 . GLN A 1 43  ? -10.860 21.064  5.296   1.00 0.00 ? 43  GLN A HE22 3  
ATOM 4407  N N    . PHE A 1 44  ? -13.159 14.289  7.987   1.00 0.00 ? 44  PHE A N    3  
ATOM 4408  C CA   . PHE A 1 44  ? -13.727 13.588  9.132   1.00 0.00 ? 44  PHE A CA   3  
ATOM 4409  C C    . PHE A 1 44  ? -13.045 12.238  9.336   1.00 0.00 ? 44  PHE A C    3  
ATOM 4410  O O    . PHE A 1 44  ? -12.779 11.829  10.466  1.00 0.00 ? 44  PHE A O    3  
ATOM 4411  C CB   . PHE A 1 44  ? -15.232 13.388  8.940   1.00 0.00 ? 44  PHE A CB   3  
ATOM 4412  C CG   . PHE A 1 44  ? -15.581 12.619  7.698   1.00 0.00 ? 44  PHE A CG   3  
ATOM 4413  C CD1  . PHE A 1 44  ? -15.746 13.271  6.487   1.00 0.00 ? 44  PHE A CD1  3  
ATOM 4414  C CD2  . PHE A 1 44  ? -15.743 11.243  7.742   1.00 0.00 ? 44  PHE A CD2  3  
ATOM 4415  C CE1  . PHE A 1 44  ? -16.068 12.565  5.343   1.00 0.00 ? 44  PHE A CE1  3  
ATOM 4416  C CE2  . PHE A 1 44  ? -16.064 10.532  6.601   1.00 0.00 ? 44  PHE A CE2  3  
ATOM 4417  C CZ   . PHE A 1 44  ? -16.226 11.194  5.400   1.00 0.00 ? 44  PHE A CZ   3  
ATOM 4418  H H    . PHE A 1 44  ? -13.697 14.391  7.174   1.00 0.00 ? 44  PHE A H    3  
ATOM 4419  H HA   . PHE A 1 44  ? -13.562 14.196  10.008  1.00 0.00 ? 44  PHE A HA   3  
ATOM 4420  H HB2  . PHE A 1 44  ? -15.627 12.847  9.787   1.00 0.00 ? 44  PHE A HB2  3  
ATOM 4421  H HB3  . PHE A 1 44  ? -15.710 14.354  8.879   1.00 0.00 ? 44  PHE A HB3  3  
ATOM 4422  H HD1  . PHE A 1 44  ? -15.622 14.343  6.440   1.00 0.00 ? 44  PHE A HD1  3  
ATOM 4423  H HD2  . PHE A 1 44  ? -15.616 10.724  8.682   1.00 0.00 ? 44  PHE A HD2  3  
ATOM 4424  H HE1  . PHE A 1 44  ? -16.193 13.085  4.405   1.00 0.00 ? 44  PHE A HE1  3  
ATOM 4425  H HE2  . PHE A 1 44  ? -16.187 9.461   6.649   1.00 0.00 ? 44  PHE A HE2  3  
ATOM 4426  H HZ   . PHE A 1 44  ? -16.478 10.641  4.508   1.00 0.00 ? 44  PHE A HZ   3  
ATOM 4427  N N    . ILE A 1 45  ? -12.767 11.550  8.233   1.00 0.00 ? 45  ILE A N    3  
ATOM 4428  C CA   . ILE A 1 45  ? -12.116 10.247  8.290   1.00 0.00 ? 45  ILE A CA   3  
ATOM 4429  C C    . ILE A 1 45  ? -11.170 10.157  9.483   1.00 0.00 ? 45  ILE A C    3  
ATOM 4430  O O    . ILE A 1 45  ? -10.429 11.096  9.771   1.00 0.00 ? 45  ILE A O    3  
ATOM 4431  C CB   . ILE A 1 45  ? -11.327 9.955   7.000   1.00 0.00 ? 45  ILE A CB   3  
ATOM 4432  C CG1  . ILE A 1 45  ? -11.118 8.449   6.834   1.00 0.00 ? 45  ILE A CG1  3  
ATOM 4433  C CG2  . ILE A 1 45  ? -9.991  10.682  7.021   1.00 0.00 ? 45  ILE A CG2  3  
ATOM 4434  C CD1  . ILE A 1 45  ? -10.580 8.059   5.475   1.00 0.00 ? 45  ILE A CD1  3  
ATOM 4435  H H    . ILE A 1 45  ? -13.003 11.929  7.361   1.00 0.00 ? 45  ILE A H    3  
ATOM 4436  H HA   . ILE A 1 45  ? -12.885 9.496   8.396   1.00 0.00 ? 45  ILE A HA   3  
ATOM 4437  H HB   . ILE A 1 45  ? -11.899 10.326  6.163   1.00 0.00 ? 45  ILE A HB   3  
ATOM 4438  H HG12 . ILE A 1 45  ? -10.417 8.105   7.579   1.00 0.00 ? 45  ILE A HG12 3  
ATOM 4439  H HG13 . ILE A 1 45  ? -12.063 7.944   6.975   1.00 0.00 ? 45  ILE A HG13 3  
ATOM 4440  H HG21 . ILE A 1 45  ? -9.431  10.382  7.894   1.00 0.00 ? 45  ILE A HG21 3  
ATOM 4441  H HG22 . ILE A 1 45  ? -9.431  10.430  6.132   1.00 0.00 ? 45  ILE A HG22 3  
ATOM 4442  H HG23 . ILE A 1 45  ? -10.160 11.748  7.050   1.00 0.00 ? 45  ILE A HG23 3  
ATOM 4443  H HD11 . ILE A 1 45  ? -11.249 8.418   4.707   1.00 0.00 ? 45  ILE A HD11 3  
ATOM 4444  H HD12 . ILE A 1 45  ? -9.602  8.495   5.336   1.00 0.00 ? 45  ILE A HD12 3  
ATOM 4445  H HD13 . ILE A 1 45  ? -10.507 6.983   5.412   1.00 0.00 ? 45  ILE A HD13 3  
ATOM 4446  N N    . GLN A 1 46  ? -11.201 9.020   10.171  1.00 0.00 ? 46  GLN A N    3  
ATOM 4447  C CA   . GLN A 1 46  ? -10.345 8.806   11.331  1.00 0.00 ? 46  GLN A CA   3  
ATOM 4448  C C    . GLN A 1 46  ? -9.028  8.154   10.924  1.00 0.00 ? 46  GLN A C    3  
ATOM 4449  O O    . GLN A 1 46  ? -8.026  8.262   11.630  1.00 0.00 ? 46  GLN A O    3  
ATOM 4450  C CB   . GLN A 1 46  ? -11.060 7.936   12.366  1.00 0.00 ? 46  GLN A CB   3  
ATOM 4451  C CG   . GLN A 1 46  ? -11.952 8.724   13.312  1.00 0.00 ? 46  GLN A CG   3  
ATOM 4452  C CD   . GLN A 1 46  ? -11.168 9.424   14.405  1.00 0.00 ? 46  GLN A CD   3  
ATOM 4453  O OE1  . GLN A 1 46  ? -10.262 10.211  14.128  1.00 0.00 ? 46  GLN A OE1  3  
ATOM 4454  N NE2  . GLN A 1 46  ? -11.512 9.141   15.655  1.00 0.00 ? 46  GLN A NE2  3  
ATOM 4455  H H    . GLN A 1 46  ? -11.814 8.309   9.891   1.00 0.00 ? 46  GLN A H    3  
ATOM 4456  H HA   . GLN A 1 46  ? -10.135 9.770   11.770  1.00 0.00 ? 46  GLN A HA   3  
ATOM 4457  H HB2  . GLN A 1 46  ? -11.672 7.212   11.848  1.00 0.00 ? 46  GLN A HB2  3  
ATOM 4458  H HB3  . GLN A 1 46  ? -10.320 7.415   12.954  1.00 0.00 ? 46  GLN A HB3  3  
ATOM 4459  H HG2  . GLN A 1 46  ? -12.490 9.468   12.744  1.00 0.00 ? 46  GLN A HG2  3  
ATOM 4460  H HG3  . GLN A 1 46  ? -12.655 8.045   13.772  1.00 0.00 ? 46  GLN A HG3  3  
ATOM 4461  H HE21 . GLN A 1 46  ? -12.243 8.503   15.801  1.00 0.00 ? 46  GLN A HE21 3  
ATOM 4462  H HE22 . GLN A 1 46  ? -11.022 9.578   16.381  1.00 0.00 ? 46  GLN A HE22 3  
ATOM 4463  N N    . GLY A 1 47  ? -9.037  7.477   9.780   1.00 0.00 ? 47  GLY A N    3  
ATOM 4464  C CA   . GLY A 1 47  ? -7.838  6.817   9.299   1.00 0.00 ? 47  GLY A CA   3  
ATOM 4465  C C    . GLY A 1 47  ? -8.076  6.043   8.017   1.00 0.00 ? 47  GLY A C    3  
ATOM 4466  O O    . GLY A 1 47  ? -8.839  6.478   7.155   1.00 0.00 ? 47  GLY A O    3  
ATOM 4467  H H    . GLY A 1 47  ? -9.865  7.425   9.258   1.00 0.00 ? 47  GLY A H    3  
ATOM 4468  H HA2  . GLY A 1 47  ? -7.077  7.562   9.122   1.00 0.00 ? 47  GLY A HA2  3  
ATOM 4469  H HA3  . GLY A 1 47  ? -7.488  6.133   10.058  1.00 0.00 ? 47  GLY A HA3  3  
ATOM 4470  N N    . TYR A 1 48  ? -7.420  4.895   7.891   1.00 0.00 ? 48  TYR A N    3  
ATOM 4471  C CA   . TYR A 1 48  ? -7.561  4.061   6.703   1.00 0.00 ? 48  TYR A CA   3  
ATOM 4472  C C    . TYR A 1 48  ? -7.384  2.586   7.049   1.00 0.00 ? 48  TYR A C    3  
ATOM 4473  O O    . TYR A 1 48  ? -6.365  2.187   7.614   1.00 0.00 ? 48  TYR A O    3  
ATOM 4474  C CB   . TYR A 1 48  ? -6.541  4.474   5.641   1.00 0.00 ? 48  TYR A CB   3  
ATOM 4475  C CG   . TYR A 1 48  ? -6.852  5.800   4.985   1.00 0.00 ? 48  TYR A CG   3  
ATOM 4476  C CD1  . TYR A 1 48  ? -7.947  5.940   4.140   1.00 0.00 ? 48  TYR A CD1  3  
ATOM 4477  C CD2  . TYR A 1 48  ? -6.052  6.913   5.211   1.00 0.00 ? 48  TYR A CD2  3  
ATOM 4478  C CE1  . TYR A 1 48  ? -8.234  7.150   3.539   1.00 0.00 ? 48  TYR A CE1  3  
ATOM 4479  C CE2  . TYR A 1 48  ? -6.333  8.128   4.615   1.00 0.00 ? 48  TYR A CE2  3  
ATOM 4480  C CZ   . TYR A 1 48  ? -7.425  8.241   3.780   1.00 0.00 ? 48  TYR A CZ   3  
ATOM 4481  O OH   . TYR A 1 48  ? -7.708  9.448   3.183   1.00 0.00 ? 48  TYR A OH   3  
ATOM 4482  H H    . TYR A 1 48  ? -6.826  4.601   8.613   1.00 0.00 ? 48  TYR A H    3  
ATOM 4483  H HA   . TYR A 1 48  ? -8.556  4.210   6.310   1.00 0.00 ? 48  TYR A HA   3  
ATOM 4484  H HB2  . TYR A 1 48  ? -5.567  4.551   6.097   1.00 0.00 ? 48  TYR A HB2  3  
ATOM 4485  H HB3  . TYR A 1 48  ? -6.513  3.720   4.867   1.00 0.00 ? 48  TYR A HB3  3  
ATOM 4486  H HD1  . TYR A 1 48  ? -8.579  5.084   3.954   1.00 0.00 ? 48  TYR A HD1  3  
ATOM 4487  H HD2  . TYR A 1 48  ? -5.197  6.821   5.865   1.00 0.00 ? 48  TYR A HD2  3  
ATOM 4488  H HE1  . TYR A 1 48  ? -9.089  7.240   2.885   1.00 0.00 ? 48  TYR A HE1  3  
ATOM 4489  H HE2  . TYR A 1 48  ? -5.699  8.982   4.803   1.00 0.00 ? 48  TYR A HE2  3  
ATOM 4490  H HH   . TYR A 1 48  ? -7.199  9.532   2.373   1.00 0.00 ? 48  TYR A HH   3  
ATOM 4491  N N    . ARG A 1 49  ? -8.383  1.780   6.705   1.00 0.00 ? 49  ARG A N    3  
ATOM 4492  C CA   . ARG A 1 49  ? -8.339  0.349   6.979   1.00 0.00 ? 49  ARG A CA   3  
ATOM 4493  C C    . ARG A 1 49  ? -7.794  -0.418  5.778   1.00 0.00 ? 49  ARG A C    3  
ATOM 4494  O O    . ARG A 1 49  ? -8.365  -0.373  4.688   1.00 0.00 ? 49  ARG A O    3  
ATOM 4495  C CB   . ARG A 1 49  ? -9.734  -0.167  7.337   1.00 0.00 ? 49  ARG A CB   3  
ATOM 4496  C CG   . ARG A 1 49  ? -9.723  -1.504  8.060   1.00 0.00 ? 49  ARG A CG   3  
ATOM 4497  C CD   . ARG A 1 49  ? -11.117 -2.106  8.140   1.00 0.00 ? 49  ARG A CD   3  
ATOM 4498  N NE   . ARG A 1 49  ? -11.876 -1.579  9.271   1.00 0.00 ? 49  ARG A NE   3  
ATOM 4499  C CZ   . ARG A 1 49  ? -13.163 -1.836  9.476   1.00 0.00 ? 49  ARG A CZ   3  
ATOM 4500  N NH1  . ARG A 1 49  ? -13.831 -2.609  8.631   1.00 0.00 ? 49  ARG A NH1  3  
ATOM 4501  N NH2  . ARG A 1 49  ? -13.784 -1.319  10.529  1.00 0.00 ? 49  ARG A NH2  3  
ATOM 4502  H H    . ARG A 1 49  ? -9.169  2.157   6.257   1.00 0.00 ? 49  ARG A H    3  
ATOM 4503  H HA   . ARG A 1 49  ? -7.681  0.192   7.820   1.00 0.00 ? 49  ARG A HA   3  
ATOM 4504  H HB2  . ARG A 1 49  ? -10.221 0.557   7.973   1.00 0.00 ? 49  ARG A HB2  3  
ATOM 4505  H HB3  . ARG A 1 49  ? -10.307 -0.279  6.428   1.00 0.00 ? 49  ARG A HB3  3  
ATOM 4506  H HG2  . ARG A 1 49  ? -9.079  -2.187  7.525   1.00 0.00 ? 49  ARG A HG2  3  
ATOM 4507  H HG3  . ARG A 1 49  ? -9.344  -1.358  9.060   1.00 0.00 ? 49  ARG A HG3  3  
ATOM 4508  H HD2  . ARG A 1 49  ? -11.646 -1.878  7.227   1.00 0.00 ? 49  ARG A HD2  3  
ATOM 4509  H HD3  . ARG A 1 49  ? -11.026 -3.176  8.247   1.00 0.00 ? 49  ARG A HD3  3  
ATOM 4510  H HE   . ARG A 1 49  ? -11.402 -1.005  9.908   1.00 0.00 ? 49  ARG A HE   3  
ATOM 4511  H HH11 . ARG A 1 49  ? -13.365 -3.000  7.838   1.00 0.00 ? 49  ARG A HH11 3  
ATOM 4512  H HH12 . ARG A 1 49  ? -14.800 -2.802  8.789   1.00 0.00 ? 49  ARG A HH12 3  
ATOM 4513  H HH21 . ARG A 1 49  ? -13.284 -0.736  11.168  1.00 0.00 ? 49  ARG A HH21 3  
ATOM 4514  H HH22 . ARG A 1 49  ? -14.753 -1.513  10.682  1.00 0.00 ? 49  ARG A HH22 3  
ATOM 4515  N N    . VAL A 1 50  ? -6.685  -1.121  5.985   1.00 0.00 ? 50  VAL A N    3  
ATOM 4516  C CA   . VAL A 1 50  ? -6.063  -1.899  4.919   1.00 0.00 ? 50  VAL A CA   3  
ATOM 4517  C C    . VAL A 1 50  ? -6.298  -3.392  5.119   1.00 0.00 ? 50  VAL A C    3  
ATOM 4518  O O    . VAL A 1 50  ? -5.679  -4.018  5.980   1.00 0.00 ? 50  VAL A O    3  
ATOM 4519  C CB   . VAL A 1 50  ? -4.547  -1.634  4.843   1.00 0.00 ? 50  VAL A CB   3  
ATOM 4520  C CG1  . VAL A 1 50  ? -3.911  -2.482  3.753   1.00 0.00 ? 50  VAL A CG1  3  
ATOM 4521  C CG2  . VAL A 1 50  ? -4.276  -0.156  4.607   1.00 0.00 ? 50  VAL A CG2  3  
ATOM 4522  H H    . VAL A 1 50  ? -6.276  -1.118  6.875   1.00 0.00 ? 50  VAL A H    3  
ATOM 4523  H HA   . VAL A 1 50  ? -6.507  -1.596  3.982   1.00 0.00 ? 50  VAL A HA   3  
ATOM 4524  H HB   . VAL A 1 50  ? -4.106  -1.913  5.789   1.00 0.00 ? 50  VAL A HB   3  
ATOM 4525  H HG11 . VAL A 1 50  ? -4.455  -2.348  2.829   1.00 0.00 ? 50  VAL A HG11 3  
ATOM 4526  H HG12 . VAL A 1 50  ? -2.884  -2.179  3.614   1.00 0.00 ? 50  VAL A HG12 3  
ATOM 4527  H HG13 . VAL A 1 50  ? -3.944  -3.523  4.041   1.00 0.00 ? 50  VAL A HG13 3  
ATOM 4528  H HG21 . VAL A 1 50  ? -3.597  0.210   5.362   1.00 0.00 ? 50  VAL A HG21 3  
ATOM 4529  H HG22 . VAL A 1 50  ? -3.834  -0.022  3.630   1.00 0.00 ? 50  VAL A HG22 3  
ATOM 4530  H HG23 . VAL A 1 50  ? -5.204  0.394   4.659   1.00 0.00 ? 50  VAL A HG23 3  
ATOM 4531  N N    . MET A 1 51  ? -7.195  -3.957  4.318   1.00 0.00 ? 51  MET A N    3  
ATOM 4532  C CA   . MET A 1 51  ? -7.510  -5.378  4.406   1.00 0.00 ? 51  MET A CA   3  
ATOM 4533  C C    . MET A 1 51  ? -6.603  -6.193  3.491   1.00 0.00 ? 51  MET A C    3  
ATOM 4534  O O    . MET A 1 51  ? -6.389  -5.835  2.332   1.00 0.00 ? 51  MET A O    3  
ATOM 4535  C CB   . MET A 1 51  ? -8.975  -5.621  4.040   1.00 0.00 ? 51  MET A CB   3  
ATOM 4536  C CG   . MET A 1 51  ? -9.952  -5.193  5.123   1.00 0.00 ? 51  MET A CG   3  
ATOM 4537  S SD   . MET A 1 51  ? -11.670 -5.497  4.669   1.00 0.00 ? 51  MET A SD   3  
ATOM 4538  C CE   . MET A 1 51  ? -11.757 -7.278  4.844   1.00 0.00 ? 51  MET A CE   3  
ATOM 4539  H H    . MET A 1 51  ? -7.656  -3.406  3.651   1.00 0.00 ? 51  MET A H    3  
ATOM 4540  H HA   . MET A 1 51  ? -7.347  -5.690  5.427   1.00 0.00 ? 51  MET A HA   3  
ATOM 4541  H HB2  . MET A 1 51  ? -9.205  -5.069  3.140   1.00 0.00 ? 51  MET A HB2  3  
ATOM 4542  H HB3  . MET A 1 51  ? -9.118  -6.675  3.853   1.00 0.00 ? 51  MET A HB3  3  
ATOM 4543  H HG2  . MET A 1 51  ? -9.731  -5.743  6.026   1.00 0.00 ? 51  MET A HG2  3  
ATOM 4544  H HG3  . MET A 1 51  ? -9.824  -4.137  5.307   1.00 0.00 ? 51  MET A HG3  3  
ATOM 4545  H HE1  . MET A 1 51  ? -11.996 -7.528  5.867   1.00 0.00 ? 51  MET A HE1  3  
ATOM 4546  H HE2  . MET A 1 51  ? -12.522 -7.666  4.190   1.00 0.00 ? 51  MET A HE2  3  
ATOM 4547  H HE3  . MET A 1 51  ? -10.803 -7.711  4.581   1.00 0.00 ? 51  MET A HE3  3  
ATOM 4548  N N    . TYR A 1 52  ? -6.072  -7.291  4.017   1.00 0.00 ? 52  TYR A N    3  
ATOM 4549  C CA   . TYR A 1 52  ? -5.185  -8.156  3.248   1.00 0.00 ? 52  TYR A CA   3  
ATOM 4550  C C    . TYR A 1 52  ? -5.378  -9.619  3.638   1.00 0.00 ? 52  TYR A C    3  
ATOM 4551  O O    . TYR A 1 52  ? -5.799  -9.925  4.753   1.00 0.00 ? 52  TYR A O    3  
ATOM 4552  C CB   . TYR A 1 52  ? -3.727  -7.747  3.463   1.00 0.00 ? 52  TYR A CB   3  
ATOM 4553  C CG   . TYR A 1 52  ? -3.245  -7.947  4.882   1.00 0.00 ? 52  TYR A CG   3  
ATOM 4554  C CD1  . TYR A 1 52  ? -3.624  -7.075  5.894   1.00 0.00 ? 52  TYR A CD1  3  
ATOM 4555  C CD2  . TYR A 1 52  ? -2.410  -9.008  5.210   1.00 0.00 ? 52  TYR A CD2  3  
ATOM 4556  C CE1  . TYR A 1 52  ? -3.185  -7.253  7.192   1.00 0.00 ? 52  TYR A CE1  3  
ATOM 4557  C CE2  . TYR A 1 52  ? -1.968  -9.195  6.505   1.00 0.00 ? 52  TYR A CE2  3  
ATOM 4558  C CZ   . TYR A 1 52  ? -2.357  -8.314  7.493   1.00 0.00 ? 52  TYR A CZ   3  
ATOM 4559  O OH   . TYR A 1 52  ? -1.919  -8.496  8.784   1.00 0.00 ? 52  TYR A OH   3  
ATOM 4560  H H    . TYR A 1 52  ? -6.279  -7.525  4.946   1.00 0.00 ? 52  TYR A H    3  
ATOM 4561  H HA   . TYR A 1 52  ? -5.431  -8.038  2.203   1.00 0.00 ? 52  TYR A HA   3  
ATOM 4562  H HB2  . TYR A 1 52  ? -3.096  -8.334  2.813   1.00 0.00 ? 52  TYR A HB2  3  
ATOM 4563  H HB3  . TYR A 1 52  ? -3.613  -6.701  3.217   1.00 0.00 ? 52  TYR A HB3  3  
ATOM 4564  H HD1  . TYR A 1 52  ? -4.273  -6.244  5.656   1.00 0.00 ? 52  TYR A HD1  3  
ATOM 4565  H HD2  . TYR A 1 52  ? -2.107  -9.697  4.434   1.00 0.00 ? 52  TYR A HD2  3  
ATOM 4566  H HE1  . TYR A 1 52  ? -3.490  -6.564  7.966   1.00 0.00 ? 52  TYR A HE1  3  
ATOM 4567  H HE2  . TYR A 1 52  ? -1.319  -10.026 6.741   1.00 0.00 ? 52  TYR A HE2  3  
ATOM 4568  H HH   . TYR A 1 52  ? -2.521  -8.058  9.391   1.00 0.00 ? 52  TYR A HH   3  
ATOM 4569  N N    . ARG A 1 53  ? -5.065  -10.517 2.710   1.00 0.00 ? 53  ARG A N    3  
ATOM 4570  C CA   . ARG A 1 53  ? -5.204  -11.948 2.955   1.00 0.00 ? 53  ARG A CA   3  
ATOM 4571  C C    . ARG A 1 53  ? -4.588  -12.756 1.817   1.00 0.00 ? 53  ARG A C    3  
ATOM 4572  O O    . ARG A 1 53  ? -4.348  -12.232 0.729   1.00 0.00 ? 53  ARG A O    3  
ATOM 4573  C CB   . ARG A 1 53  ? -6.679  -12.318 3.117   1.00 0.00 ? 53  ARG A CB   3  
ATOM 4574  C CG   . ARG A 1 53  ? -7.453  -12.329 1.809   1.00 0.00 ? 53  ARG A CG   3  
ATOM 4575  C CD   . ARG A 1 53  ? -8.641  -13.275 1.872   1.00 0.00 ? 53  ARG A CD   3  
ATOM 4576  N NE   . ARG A 1 53  ? -9.227  -13.506 0.554   1.00 0.00 ? 53  ARG A NE   3  
ATOM 4577  C CZ   . ARG A 1 53  ? -10.440 -14.015 0.368   1.00 0.00 ? 53  ARG A CZ   3  
ATOM 4578  N NH1  . ARG A 1 53  ? -11.192 -14.343 1.410   1.00 0.00 ? 53  ARG A NH1  3  
ATOM 4579  N NH2  . ARG A 1 53  ? -10.904 -14.195 -0.862  1.00 0.00 ? 53  ARG A NH2  3  
ATOM 4580  H H    . ARG A 1 53  ? -4.735  -10.211 1.839   1.00 0.00 ? 53  ARG A H    3  
ATOM 4581  H HA   . ARG A 1 53  ? -4.681  -12.180 3.870   1.00 0.00 ? 53  ARG A HA   3  
ATOM 4582  H HB2  . ARG A 1 53  ? -6.745  -13.303 3.556   1.00 0.00 ? 53  ARG A HB2  3  
ATOM 4583  H HB3  . ARG A 1 53  ? -7.146  -11.606 3.780   1.00 0.00 ? 53  ARG A HB3  3  
ATOM 4584  H HG2  . ARG A 1 53  ? -7.812  -11.331 1.605   1.00 0.00 ? 53  ARG A HG2  3  
ATOM 4585  H HG3  . ARG A 1 53  ? -6.793  -12.645 1.014   1.00 0.00 ? 53  ARG A HG3  3  
ATOM 4586  H HD2  . ARG A 1 53  ? -8.312  -14.219 2.279   1.00 0.00 ? 53  ARG A HD2  3  
ATOM 4587  H HD3  . ARG A 1 53  ? -9.391  -12.847 2.519   1.00 0.00 ? 53  ARG A HD3  3  
ATOM 4588  H HE   . ARG A 1 53  ? -8.689  -13.271 -0.230  1.00 0.00 ? 53  ARG A HE   3  
ATOM 4589  H HH11 . ARG A 1 53  ? -10.846 -14.207 2.338   1.00 0.00 ? 53  ARG A HH11 3  
ATOM 4590  H HH12 . ARG A 1 53  ? -12.106 -14.724 1.267   1.00 0.00 ? 53  ARG A HH12 3  
ATOM 4591  H HH21 . ARG A 1 53  ? -10.340 -13.949 -1.650  1.00 0.00 ? 53  ARG A HH21 3  
ATOM 4592  H HH22 . ARG A 1 53  ? -11.817 -14.578 -1.001  1.00 0.00 ? 53  ARG A HH22 3  
ATOM 4593  N N    . GLN A 1 54  ? -4.335  -14.035 2.076   1.00 0.00 ? 54  GLN A N    3  
ATOM 4594  C CA   . GLN A 1 54  ? -3.745  -14.915 1.073   1.00 0.00 ? 54  GLN A CA   3  
ATOM 4595  C C    . GLN A 1 54  ? -4.766  -15.276 -0.002  1.00 0.00 ? 54  GLN A C    3  
ATOM 4596  O O    . GLN A 1 54  ? -5.961  -15.385 0.273   1.00 0.00 ? 54  GLN A O    3  
ATOM 4597  C CB   . GLN A 1 54  ? -3.210  -16.187 1.732   1.00 0.00 ? 54  GLN A CB   3  
ATOM 4598  C CG   . GLN A 1 54  ? -2.028  -16.801 0.999   1.00 0.00 ? 54  GLN A CG   3  
ATOM 4599  C CD   . GLN A 1 54  ? -1.370  -17.918 1.784   1.00 0.00 ? 54  GLN A CD   3  
ATOM 4600  O OE1  . GLN A 1 54  ? -0.444  -17.683 2.562   1.00 0.00 ? 54  GLN A OE1  3  
ATOM 4601  N NE2  . GLN A 1 54  ? -1.844  -19.142 1.586   1.00 0.00 ? 54  GLN A NE2  3  
ATOM 4602  H H    . GLN A 1 54  ? -4.548  -14.395 2.961   1.00 0.00 ? 54  GLN A H    3  
ATOM 4603  H HA   . GLN A 1 54  ? -2.925  -14.387 0.610   1.00 0.00 ? 54  GLN A HA   3  
ATOM 4604  H HB2  . GLN A 1 54  ? -2.899  -15.953 2.739   1.00 0.00 ? 54  GLN A HB2  3  
ATOM 4605  H HB3  . GLN A 1 54  ? -4.002  -16.920 1.770   1.00 0.00 ? 54  GLN A HB3  3  
ATOM 4606  H HG2  . GLN A 1 54  ? -2.374  -17.200 0.057   1.00 0.00 ? 54  GLN A HG2  3  
ATOM 4607  H HG3  . GLN A 1 54  ? -1.295  -16.029 0.814   1.00 0.00 ? 54  GLN A HG3  3  
ATOM 4608  H HE21 . GLN A 1 54  ? -2.583  -19.254 0.950   1.00 0.00 ? 54  GLN A HE21 3  
ATOM 4609  H HE22 . GLN A 1 54  ? -1.437  -19.882 2.080   1.00 0.00 ? 54  GLN A HE22 3  
ATOM 4610  N N    . THR A 1 55  ? -4.286  -15.459 -1.228  1.00 0.00 ? 55  THR A N    3  
ATOM 4611  C CA   . THR A 1 55  ? -5.156  -15.806 -2.345  1.00 0.00 ? 55  THR A CA   3  
ATOM 4612  C C    . THR A 1 55  ? -4.931  -17.247 -2.790  1.00 0.00 ? 55  THR A C    3  
ATOM 4613  O O    . THR A 1 55  ? -5.828  -17.883 -3.343  1.00 0.00 ? 55  THR A O    3  
ATOM 4614  C CB   . THR A 1 55  ? -4.931  -14.868 -3.545  1.00 0.00 ? 55  THR A CB   3  
ATOM 4615  O OG1  . THR A 1 55  ? -3.676  -15.164 -4.169  1.00 0.00 ? 55  THR A OG1  3  
ATOM 4616  C CG2  . THR A 1 55  ? -4.953  -13.412 -3.105  1.00 0.00 ? 55  THR A CG2  3  
ATOM 4617  H H    . THR A 1 55  ? -3.324  -15.358 -1.384  1.00 0.00 ? 55  THR A H    3  
ATOM 4618  H HA   . THR A 1 55  ? -6.180  -15.697 -2.016  1.00 0.00 ? 55  THR A HA   3  
ATOM 4619  H HB   . THR A 1 55  ? -5.726  -15.025 -4.260  1.00 0.00 ? 55  THR A HB   3  
ATOM 4620  H HG1  . THR A 1 55  ? -3.035  -15.409 -3.498  1.00 0.00 ? 55  THR A HG1  3  
ATOM 4621  H HG21 . THR A 1 55  ? -4.039  -13.181 -2.578  1.00 0.00 ? 55  THR A HG21 3  
ATOM 4622  H HG22 . THR A 1 55  ? -5.797  -13.246 -2.453  1.00 0.00 ? 55  THR A HG22 3  
ATOM 4623  H HG23 . THR A 1 55  ? -5.038  -12.776 -3.973  1.00 0.00 ? 55  THR A HG23 3  
ATOM 4624  N N    . SER A 1 56  ? -3.727  -17.755 -2.546  1.00 0.00 ? 56  SER A N    3  
ATOM 4625  C CA   . SER A 1 56  ? -3.383  -19.120 -2.926  1.00 0.00 ? 56  SER A CA   3  
ATOM 4626  C C    . SER A 1 56  ? -2.690  -19.845 -1.776  1.00 0.00 ? 56  SER A C    3  
ATOM 4627  O O    . SER A 1 56  ? -2.147  -19.217 -0.868  1.00 0.00 ? 56  SER A O    3  
ATOM 4628  C CB   . SER A 1 56  ? -2.479  -19.117 -4.160  1.00 0.00 ? 56  SER A CB   3  
ATOM 4629  O OG   . SER A 1 56  ? -2.522  -20.366 -4.827  1.00 0.00 ? 56  SER A OG   3  
ATOM 4630  H H    . SER A 1 56  ? -3.054  -17.198 -2.102  1.00 0.00 ? 56  SER A H    3  
ATOM 4631  H HA   . SER A 1 56  ? -4.300  -19.640 -3.163  1.00 0.00 ? 56  SER A HA   3  
ATOM 4632  H HB2  . SER A 1 56  ? -2.808  -18.347 -4.841  1.00 0.00 ? 56  SER A HB2  3  
ATOM 4633  H HB3  . SER A 1 56  ? -1.461  -18.918 -3.857  1.00 0.00 ? 56  SER A HB3  3  
ATOM 4634  H HG   . SER A 1 56  ? -2.294  -20.244 -5.751  1.00 0.00 ? 56  SER A HG   3  
ATOM 4635  N N    . GLY A 1 57  ? -2.713  -21.174 -1.823  1.00 0.00 ? 57  GLY A N    3  
ATOM 4636  C CA   . GLY A 1 57  ? -2.084  -21.964 -0.780  1.00 0.00 ? 57  GLY A CA   3  
ATOM 4637  C C    . GLY A 1 57  ? -3.095  -22.622 0.138   1.00 0.00 ? 57  GLY A C    3  
ATOM 4638  O O    . GLY A 1 57  ? -4.127  -23.117 -0.315  1.00 0.00 ? 57  GLY A O    3  
ATOM 4639  H H    . GLY A 1 57  ? -3.160  -21.622 -2.571  1.00 0.00 ? 57  GLY A H    3  
ATOM 4640  H HA2  . GLY A 1 57  ? -1.479  -22.731 -1.241  1.00 0.00 ? 57  GLY A HA2  3  
ATOM 4641  H HA3  . GLY A 1 57  ? -1.446  -21.321 -0.192  1.00 0.00 ? 57  GLY A HA3  3  
ATOM 4642  N N    . LEU A 1 58  ? -2.798  -22.629 1.433   1.00 0.00 ? 58  LEU A N    3  
ATOM 4643  C CA   . LEU A 1 58  ? -3.688  -23.232 2.419   1.00 0.00 ? 58  LEU A CA   3  
ATOM 4644  C C    . LEU A 1 58  ? -4.514  -22.166 3.132   1.00 0.00 ? 58  LEU A C    3  
ATOM 4645  O O    . LEU A 1 58  ? -5.714  -22.335 3.341   1.00 0.00 ? 58  LEU A O    3  
ATOM 4646  C CB   . LEU A 1 58  ? -2.881  -24.036 3.439   1.00 0.00 ? 58  LEU A CB   3  
ATOM 4647  C CG   . LEU A 1 58  ? -3.596  -25.233 4.068   1.00 0.00 ? 58  LEU A CG   3  
ATOM 4648  C CD1  . LEU A 1 58  ? -4.555  -24.772 5.153   1.00 0.00 ? 58  LEU A CD1  3  
ATOM 4649  C CD2  . LEU A 1 58  ? -4.335  -26.032 3.004   1.00 0.00 ? 58  LEU A CD2  3  
ATOM 4650  H H    . LEU A 1 58  ? -1.961  -22.219 1.734   1.00 0.00 ? 58  LEU A H    3  
ATOM 4651  H HA   . LEU A 1 58  ? -4.358  -23.899 1.896   1.00 0.00 ? 58  LEU A HA   3  
ATOM 4652  H HB2  . LEU A 1 58  ? -1.995  -24.403 2.945   1.00 0.00 ? 58  LEU A HB2  3  
ATOM 4653  H HB3  . LEU A 1 58  ? -2.595  -23.365 4.236   1.00 0.00 ? 58  LEU A HB3  3  
ATOM 4654  H HG   . LEU A 1 58  ? -2.862  -25.883 4.525   1.00 0.00 ? 58  LEU A HG   3  
ATOM 4655  H HD11 . LEU A 1 58  ? -5.177  -23.977 4.771   1.00 0.00 ? 58  LEU A HD11 3  
ATOM 4656  H HD12 . LEU A 1 58  ? -3.993  -24.413 6.002   1.00 0.00 ? 58  LEU A HD12 3  
ATOM 4657  H HD13 . LEU A 1 58  ? -5.177  -25.601 5.459   1.00 0.00 ? 58  LEU A HD13 3  
ATOM 4658  H HD21 . LEU A 1 58  ? -4.309  -27.081 3.259   1.00 0.00 ? 58  LEU A HD21 3  
ATOM 4659  H HD22 . LEU A 1 58  ? -3.858  -25.883 2.046   1.00 0.00 ? 58  LEU A HD22 3  
ATOM 4660  H HD23 . LEU A 1 58  ? -5.361  -25.698 2.951   1.00 0.00 ? 58  LEU A HD23 3  
ATOM 4661  N N    . GLN A 1 59  ? -3.861  -21.069 3.501   1.00 0.00 ? 59  GLN A N    3  
ATOM 4662  C CA   . GLN A 1 59  ? -4.536  -19.974 4.189   1.00 0.00 ? 59  GLN A CA   3  
ATOM 4663  C C    . GLN A 1 59  ? -5.204  -19.033 3.192   1.00 0.00 ? 59  GLN A C    3  
ATOM 4664  O O    . GLN A 1 59  ? -5.477  -17.875 3.504   1.00 0.00 ? 59  GLN A O    3  
ATOM 4665  C CB   . GLN A 1 59  ? -3.541  -19.198 5.054   1.00 0.00 ? 59  GLN A CB   3  
ATOM 4666  C CG   . GLN A 1 59  ? -3.231  -19.874 6.380   1.00 0.00 ? 59  GLN A CG   3  
ATOM 4667  C CD   . GLN A 1 59  ? -2.281  -19.063 7.240   1.00 0.00 ? 59  GLN A CD   3  
ATOM 4668  O OE1  . GLN A 1 59  ? -2.707  -18.321 8.125   1.00 0.00 ? 59  GLN A OE1  3  
ATOM 4669  N NE2  . GLN A 1 59  ? -0.986  -19.201 6.984   1.00 0.00 ? 59  GLN A NE2  3  
ATOM 4670  H H    . GLN A 1 59  ? -2.904  -20.993 3.306   1.00 0.00 ? 59  GLN A H    3  
ATOM 4671  H HA   . GLN A 1 59  ? -5.295  -20.402 4.826   1.00 0.00 ? 59  GLN A HA   3  
ATOM 4672  H HB2  . GLN A 1 59  ? -2.618  -19.085 4.507   1.00 0.00 ? 59  GLN A HB2  3  
ATOM 4673  H HB3  . GLN A 1 59  ? -3.950  -18.220 5.261   1.00 0.00 ? 59  GLN A HB3  3  
ATOM 4674  H HG2  . GLN A 1 59  ? -4.153  -20.013 6.923   1.00 0.00 ? 59  GLN A HG2  3  
ATOM 4675  H HG3  . GLN A 1 59  ? -2.782  -20.836 6.182   1.00 0.00 ? 59  GLN A HG3  3  
ATOM 4676  H HE21 . GLN A 1 59  ? -0.719  -19.809 6.262   1.00 0.00 ? 59  GLN A HE21 3  
ATOM 4677  H HE22 . GLN A 1 59  ? -0.350  -18.688 7.523   1.00 0.00 ? 59  GLN A HE22 3  
ATOM 4678  N N    . ALA A 1 60  ? -5.464  -19.540 1.991   1.00 0.00 ? 60  ALA A N    3  
ATOM 4679  C CA   . ALA A 1 60  ? -6.101  -18.745 0.949   1.00 0.00 ? 60  ALA A CA   3  
ATOM 4680  C C    . ALA A 1 60  ? -7.581  -18.533 1.247   1.00 0.00 ? 60  ALA A C    3  
ATOM 4681  O O    . ALA A 1 60  ? -8.301  -19.478 1.574   1.00 0.00 ? 60  ALA A O    3  
ATOM 4682  C CB   . ALA A 1 60  ? -5.924  -19.413 -0.407  1.00 0.00 ? 60  ALA A CB   3  
ATOM 4683  H H    . ALA A 1 60  ? -5.222  -20.470 1.802   1.00 0.00 ? 60  ALA A H    3  
ATOM 4684  H HA   . ALA A 1 60  ? -5.610  -17.783 0.915   1.00 0.00 ? 60  ALA A HA   3  
ATOM 4685  H HB1  . ALA A 1 60  ? -6.890  -19.535 -0.876  1.00 0.00 ? 60  ALA A HB1  3  
ATOM 4686  H HB2  . ALA A 1 60  ? -5.295  -18.797 -1.032  1.00 0.00 ? 60  ALA A HB2  3  
ATOM 4687  H HB3  . ALA A 1 60  ? -5.463  -20.380 -0.274  1.00 0.00 ? 60  ALA A HB3  3  
ATOM 4688  N N    . THR A 1 61  ? -8.031  -17.287 1.134   1.00 0.00 ? 61  THR A N    3  
ATOM 4689  C CA   . THR A 1 61  ? -9.425  -16.951 1.394   1.00 0.00 ? 61  THR A CA   3  
ATOM 4690  C C    . THR A 1 61  ? -9.950  -17.693 2.618   1.00 0.00 ? 61  THR A C    3  
ATOM 4691  O O    . THR A 1 61  ? -11.131 -18.033 2.690   1.00 0.00 ? 61  THR A O    3  
ATOM 4692  C CB   . THR A 1 61  ? -10.318 -17.284 0.184   1.00 0.00 ? 61  THR A CB   3  
ATOM 4693  O OG1  . THR A 1 61  ? -11.637 -16.767 0.391   1.00 0.00 ? 61  THR A OG1  3  
ATOM 4694  C CG2  . THR A 1 61  ? -10.387 -18.787 -0.040  1.00 0.00 ? 61  THR A CG2  3  
ATOM 4695  H H    . THR A 1 61  ? -7.409  -16.578 0.870   1.00 0.00 ? 61  THR A H    3  
ATOM 4696  H HA   . THR A 1 61  ? -9.484  -15.888 1.577   1.00 0.00 ? 61  THR A HA   3  
ATOM 4697  H HB   . THR A 1 61  ? -9.893  -16.823 -0.696  1.00 0.00 ? 61  THR A HB   3  
ATOM 4698  H HG1  . THR A 1 61  ? -12.182 -16.963 -0.374  1.00 0.00 ? 61  THR A HG1  3  
ATOM 4699  H HG21 . THR A 1 61  ? -9.462  -19.129 -0.480  1.00 0.00 ? 61  THR A HG21 3  
ATOM 4700  H HG22 . THR A 1 61  ? -11.208 -19.015 -0.705  1.00 0.00 ? 61  THR A HG22 3  
ATOM 4701  H HG23 . THR A 1 61  ? -10.541 -19.285 0.905   1.00 0.00 ? 61  THR A HG23 3  
ATOM 4702  N N    . SER A 1 62  ? -9.066  -17.940 3.579   1.00 0.00 ? 62  SER A N    3  
ATOM 4703  C CA   . SER A 1 62  ? -9.440  -18.644 4.800   1.00 0.00 ? 62  SER A CA   3  
ATOM 4704  C C    . SER A 1 62  ? -9.894  -17.663 5.876   1.00 0.00 ? 62  SER A C    3  
ATOM 4705  O O    . SER A 1 62  ? -10.744 -17.984 6.707   1.00 0.00 ? 62  SER A O    3  
ATOM 4706  C CB   . SER A 1 62  ? -8.264  -19.476 5.315   1.00 0.00 ? 62  SER A CB   3  
ATOM 4707  O OG   . SER A 1 62  ? -8.627  -20.210 6.472   1.00 0.00 ? 62  SER A OG   3  
ATOM 4708  H H    . SER A 1 62  ? -8.139  -17.644 3.463   1.00 0.00 ? 62  SER A H    3  
ATOM 4709  H HA   . SER A 1 62  ? -10.261 -19.305 4.563   1.00 0.00 ? 62  SER A HA   3  
ATOM 4710  H HB2  . SER A 1 62  ? -7.953  -20.168 4.547   1.00 0.00 ? 62  SER A HB2  3  
ATOM 4711  H HB3  . SER A 1 62  ? -7.443  -18.819 5.563   1.00 0.00 ? 62  SER A HB3  3  
ATOM 4712  H HG   . SER A 1 62  ? -7.918  -20.815 6.703   1.00 0.00 ? 62  SER A HG   3  
ATOM 4713  N N    . SER A 1 63  ? -9.320  -16.464 5.854   1.00 0.00 ? 63  SER A N    3  
ATOM 4714  C CA   . SER A 1 63  ? -9.661  -15.435 6.830   1.00 0.00 ? 63  SER A CA   3  
ATOM 4715  C C    . SER A 1 63  ? -9.012  -14.104 6.465   1.00 0.00 ? 63  SER A C    3  
ATOM 4716  O O    . SER A 1 63  ? -7.789  -14.002 6.371   1.00 0.00 ? 63  SER A O    3  
ATOM 4717  C CB   . SER A 1 63  ? -9.219  -15.864 8.231   1.00 0.00 ? 63  SER A CB   3  
ATOM 4718  O OG   . SER A 1 63  ? -10.200 -16.680 8.848   1.00 0.00 ? 63  SER A OG   3  
ATOM 4719  H H    . SER A 1 63  ? -8.649  -16.268 5.167   1.00 0.00 ? 63  SER A H    3  
ATOM 4720  H HA   . SER A 1 63  ? -10.734 -15.314 6.822   1.00 0.00 ? 63  SER A HA   3  
ATOM 4721  H HB2  . SER A 1 63  ? -8.298  -16.422 8.160   1.00 0.00 ? 63  SER A HB2  3  
ATOM 4722  H HB3  . SER A 1 63  ? -9.063  -14.986 8.840   1.00 0.00 ? 63  SER A HB3  3  
ATOM 4723  H HG   . SER A 1 63  ? -9.771  -17.321 9.418   1.00 0.00 ? 63  SER A HG   3  
ATOM 4724  N N    . TRP A 1 64  ? -9.840  -13.086 6.261   1.00 0.00 ? 64  TRP A N    3  
ATOM 4725  C CA   . TRP A 1 64  ? -9.348  -11.760 5.906   1.00 0.00 ? 64  TRP A CA   3  
ATOM 4726  C C    . TRP A 1 64  ? -8.752  -11.057 7.121   1.00 0.00 ? 64  TRP A C    3  
ATOM 4727  O O    . TRP A 1 64  ? -9.087  -11.378 8.261   1.00 0.00 ? 64  TRP A O    3  
ATOM 4728  C CB   . TRP A 1 64  ? -10.478 -10.914 5.317   1.00 0.00 ? 64  TRP A CB   3  
ATOM 4729  C CG   . TRP A 1 64  ? -10.600 -11.040 3.828   1.00 0.00 ? 64  TRP A CG   3  
ATOM 4730  C CD1  . TRP A 1 64  ? -11.484 -11.822 3.141   1.00 0.00 ? 64  TRP A CD1  3  
ATOM 4731  C CD2  . TRP A 1 64  ? -9.809  -10.365 2.844   1.00 0.00 ? 64  TRP A CD2  3  
ATOM 4732  N NE1  . TRP A 1 64  ? -11.291 -11.674 1.789   1.00 0.00 ? 64  TRP A NE1  3  
ATOM 4733  C CE2  . TRP A 1 64  ? -10.269 -10.785 1.580   1.00 0.00 ? 64  TRP A CE2  3  
ATOM 4734  C CE3  . TRP A 1 64  ? -8.758  -9.446  2.906   1.00 0.00 ? 64  TRP A CE3  3  
ATOM 4735  C CZ2  . TRP A 1 64  ? -9.714  -10.316 0.393   1.00 0.00 ? 64  TRP A CZ2  3  
ATOM 4736  C CZ3  . TRP A 1 64  ? -8.208  -8.982  1.727   1.00 0.00 ? 64  TRP A CZ3  3  
ATOM 4737  C CH2  . TRP A 1 64  ? -8.686  -9.417  0.484   1.00 0.00 ? 64  TRP A CH2  3  
ATOM 4738  H H    . TRP A 1 64  ? -10.806 -13.229 6.351   1.00 0.00 ? 64  TRP A H    3  
ATOM 4739  H HA   . TRP A 1 64  ? -8.576  -11.882 5.161   1.00 0.00 ? 64  TRP A HA   3  
ATOM 4740  H HB2  . TRP A 1 64  ? -11.416 -11.222 5.755   1.00 0.00 ? 64  TRP A HB2  3  
ATOM 4741  H HB3  . TRP A 1 64  ? -10.300 -9.875  5.551   1.00 0.00 ? 64  TRP A HB3  3  
ATOM 4742  H HD1  . TRP A 1 64  ? -12.220 -12.460 3.606   1.00 0.00 ? 64  TRP A HD1  3  
ATOM 4743  H HE1  . TRP A 1 64  ? -11.803 -12.129 1.088   1.00 0.00 ? 64  TRP A HE1  3  
ATOM 4744  H HE3  . TRP A 1 64  ? -8.376  -9.099  3.855   1.00 0.00 ? 64  TRP A HE3  3  
ATOM 4745  H HZ2  . TRP A 1 64  ? -10.072 -10.641 -0.573  1.00 0.00 ? 64  TRP A HZ2  3  
ATOM 4746  H HZ3  . TRP A 1 64  ? -7.395  -8.272  1.755   1.00 0.00 ? 64  TRP A HZ3  3  
ATOM 4747  H HH2  . TRP A 1 64  ? -8.226  -9.029  -0.412  1.00 0.00 ? 64  TRP A HH2  3  
ATOM 4748  N N    . GLN A 1 65  ? -7.867  -10.098 6.870   1.00 0.00 ? 65  GLN A N    3  
ATOM 4749  C CA   . GLN A 1 65  ? -7.225  -9.351  7.945   1.00 0.00 ? 65  GLN A CA   3  
ATOM 4750  C C    . GLN A 1 65  ? -7.489  -7.856  7.802   1.00 0.00 ? 65  GLN A C    3  
ATOM 4751  O O    . GLN A 1 65  ? -7.916  -7.389  6.747   1.00 0.00 ? 65  GLN A O    3  
ATOM 4752  C CB   . GLN A 1 65  ? -5.718  -9.617  7.949   1.00 0.00 ? 65  GLN A CB   3  
ATOM 4753  C CG   . GLN A 1 65  ? -5.350  -11.022 8.396   1.00 0.00 ? 65  GLN A CG   3  
ATOM 4754  C CD   . GLN A 1 65  ? -3.852  -11.251 8.426   1.00 0.00 ? 65  GLN A CD   3  
ATOM 4755  O OE1  . GLN A 1 65  ? -3.269  -11.754 7.464   1.00 0.00 ? 65  GLN A OE1  3  
ATOM 4756  N NE2  . GLN A 1 65  ? -3.218  -10.883 9.533   1.00 0.00 ? 65  GLN A NE2  3  
ATOM 4757  H H    . GLN A 1 65  ? -7.641  -9.888  5.940   1.00 0.00 ? 65  GLN A H    3  
ATOM 4758  H HA   . GLN A 1 65  ? -7.644  -9.690  8.880   1.00 0.00 ? 65  GLN A HA   3  
ATOM 4759  H HB2  . GLN A 1 65  ? -5.335  -9.467  6.951   1.00 0.00 ? 65  GLN A HB2  3  
ATOM 4760  H HB3  . GLN A 1 65  ? -5.243  -8.914  8.618   1.00 0.00 ? 65  GLN A HB3  3  
ATOM 4761  H HG2  . GLN A 1 65  ? -5.743  -11.186 9.388   1.00 0.00 ? 65  GLN A HG2  3  
ATOM 4762  H HG3  . GLN A 1 65  ? -5.795  -11.731 7.713   1.00 0.00 ? 65  GLN A HG3  3  
ATOM 4763  H HE21 . GLN A 1 65  ? -3.747  -10.491 10.260  1.00 0.00 ? 65  GLN A HE21 3  
ATOM 4764  H HE22 . GLN A 1 65  ? -2.250  -11.021 9.580   1.00 0.00 ? 65  GLN A HE22 3  
ATOM 4765  N N    . ASN A 1 66  ? -7.231  -7.109  8.871   1.00 0.00 ? 66  ASN A N    3  
ATOM 4766  C CA   . ASN A 1 66  ? -7.441  -5.666  8.865   1.00 0.00 ? 66  ASN A CA   3  
ATOM 4767  C C    . ASN A 1 66  ? -6.282  -4.944  9.546   1.00 0.00 ? 66  ASN A C    3  
ATOM 4768  O O    . ASN A 1 66  ? -5.872  -5.308  10.649  1.00 0.00 ? 66  ASN A O    3  
ATOM 4769  C CB   . ASN A 1 66  ? -8.756  -5.319  9.567   1.00 0.00 ? 66  ASN A CB   3  
ATOM 4770  C CG   . ASN A 1 66  ? -9.870  -6.287  9.219   1.00 0.00 ? 66  ASN A CG   3  
ATOM 4771  O OD1  . ASN A 1 66  ? -9.876  -6.884  8.142   1.00 0.00 ? 66  ASN A OD1  3  
ATOM 4772  N ND2  . ASN A 1 66  ? -10.821 -6.447  10.132  1.00 0.00 ? 66  ASN A ND2  3  
ATOM 4773  H H    . ASN A 1 66  ? -6.891  -7.539  9.684   1.00 0.00 ? 66  ASN A H    3  
ATOM 4774  H HA   . ASN A 1 66  ? -7.497  -5.344  7.836   1.00 0.00 ? 66  ASN A HA   3  
ATOM 4775  H HB2  . ASN A 1 66  ? -8.604  -5.345  10.636  1.00 0.00 ? 66  ASN A HB2  3  
ATOM 4776  H HB3  . ASN A 1 66  ? -9.062  -4.326  9.274   1.00 0.00 ? 66  ASN A HB3  3  
ATOM 4777  H HD21 . ASN A 1 66  ? -10.751 -5.939  10.967  1.00 0.00 ? 66  ASN A HD21 3  
ATOM 4778  H HD22 . ASN A 1 66  ? -11.553 -7.068  9.934   1.00 0.00 ? 66  ASN A HD22 3  
ATOM 4779  N N    . LEU A 1 67  ? -5.760  -3.919  8.882   1.00 0.00 ? 67  LEU A N    3  
ATOM 4780  C CA   . LEU A 1 67  ? -4.648  -3.145  9.422   1.00 0.00 ? 67  LEU A CA   3  
ATOM 4781  C C    . LEU A 1 67  ? -5.013  -1.668  9.526   1.00 0.00 ? 67  LEU A C    3  
ATOM 4782  O O    . LEU A 1 67  ? -4.858  -0.911  8.567   1.00 0.00 ? 67  LEU A O    3  
ATOM 4783  C CB   . LEU A 1 67  ? -3.407  -3.315  8.544   1.00 0.00 ? 67  LEU A CB   3  
ATOM 4784  C CG   . LEU A 1 67  ? -2.218  -2.414  8.880   1.00 0.00 ? 67  LEU A CG   3  
ATOM 4785  C CD1  . LEU A 1 67  ? -1.354  -3.051  9.957   1.00 0.00 ? 67  LEU A CD1  3  
ATOM 4786  C CD2  . LEU A 1 67  ? -1.395  -2.129  7.632   1.00 0.00 ? 67  LEU A CD2  3  
ATOM 4787  H H    . LEU A 1 67  ? -6.129  -3.677  8.007   1.00 0.00 ? 67  LEU A H    3  
ATOM 4788  H HA   . LEU A 1 67  ? -4.433  -3.520  10.412  1.00 0.00 ? 67  LEU A HA   3  
ATOM 4789  H HB2  . LEU A 1 67  ? -3.080  -4.340  8.629   1.00 0.00 ? 67  LEU A HB2  3  
ATOM 4790  H HB3  . LEU A 1 67  ? -3.697  -3.115  7.522   1.00 0.00 ? 67  LEU A HB3  3  
ATOM 4791  H HG   . LEU A 1 67  ? -2.585  -1.471  9.262   1.00 0.00 ? 67  LEU A HG   3  
ATOM 4792  H HD11 . LEU A 1 67  ? -1.959  -3.265  10.824  1.00 0.00 ? 67  LEU A HD11 3  
ATOM 4793  H HD12 . LEU A 1 67  ? -0.560  -2.371  10.230  1.00 0.00 ? 67  LEU A HD12 3  
ATOM 4794  H HD13 . LEU A 1 67  ? -0.926  -3.968  9.579   1.00 0.00 ? 67  LEU A HD13 3  
ATOM 4795  H HD21 . LEU A 1 67  ? -2.057  -1.893  6.811   1.00 0.00 ? 67  LEU A HD21 3  
ATOM 4796  H HD22 . LEU A 1 67  ? -0.808  -3.001  7.381   1.00 0.00 ? 67  LEU A HD22 3  
ATOM 4797  H HD23 . LEU A 1 67  ? -0.738  -1.293  7.817   1.00 0.00 ? 67  LEU A HD23 3  
ATOM 4798  N N    . ASP A 1 68  ? -5.497  -1.264  10.695  1.00 0.00 ? 68  ASP A N    3  
ATOM 4799  C CA   . ASP A 1 68  ? -5.881  0.124   10.925  1.00 0.00 ? 68  ASP A CA   3  
ATOM 4800  C C    . ASP A 1 68  ? -4.649  1.013   11.065  1.00 0.00 ? 68  ASP A C    3  
ATOM 4801  O O    . ASP A 1 68  ? -3.909  0.915   12.044  1.00 0.00 ? 68  ASP A O    3  
ATOM 4802  C CB   . ASP A 1 68  ? -6.749  0.234   12.180  1.00 0.00 ? 68  ASP A CB   3  
ATOM 4803  C CG   . ASP A 1 68  ? -7.033  1.673   12.563  1.00 0.00 ? 68  ASP A CG   3  
ATOM 4804  O OD1  . ASP A 1 68  ? -6.911  2.556   11.688  1.00 0.00 ? 68  ASP A OD1  3  
ATOM 4805  O OD2  . ASP A 1 68  ? -7.379  1.916   13.738  1.00 0.00 ? 68  ASP A OD2  3  
ATOM 4806  H H    . ASP A 1 68  ? -5.597  -1.914  11.421  1.00 0.00 ? 68  ASP A H    3  
ATOM 4807  H HA   . ASP A 1 68  ? -6.453  0.456   10.072  1.00 0.00 ? 68  ASP A HA   3  
ATOM 4808  H HB2  . ASP A 1 68  ? -7.692  -0.264  12.002  1.00 0.00 ? 68  ASP A HB2  3  
ATOM 4809  H HB3  . ASP A 1 68  ? -6.243  -0.247  13.004  1.00 0.00 ? 68  ASP A HB3  3  
ATOM 4810  N N    . ALA A 1 69  ? -4.435  1.879   10.080  1.00 0.00 ? 69  ALA A N    3  
ATOM 4811  C CA   . ALA A 1 69  ? -3.294  2.785   10.094  1.00 0.00 ? 69  ALA A CA   3  
ATOM 4812  C C    . ALA A 1 69  ? -3.357  3.729   11.290  1.00 0.00 ? 69  ALA A C    3  
ATOM 4813  O O    . ALA A 1 69  ? -2.336  4.258   11.731  1.00 0.00 ? 69  ALA A O    3  
ATOM 4814  C CB   . ALA A 1 69  ? -3.233  3.578   8.796   1.00 0.00 ? 69  ALA A CB   3  
ATOM 4815  H H    . ALA A 1 69  ? -5.061  1.909   9.327   1.00 0.00 ? 69  ALA A H    3  
ATOM 4816  H HA   . ALA A 1 69  ? -2.395  2.189   10.165  1.00 0.00 ? 69  ALA A HA   3  
ATOM 4817  H HB1  . ALA A 1 69  ? -3.477  2.929   7.968   1.00 0.00 ? 69  ALA A HB1  3  
ATOM 4818  H HB2  . ALA A 1 69  ? -3.943  4.391   8.838   1.00 0.00 ? 69  ALA A HB2  3  
ATOM 4819  H HB3  . ALA A 1 69  ? -2.238  3.974   8.663   1.00 0.00 ? 69  ALA A HB3  3  
ATOM 4820  N N    . LYS A 1 70  ? -4.561  3.937   11.811  1.00 0.00 ? 70  LYS A N    3  
ATOM 4821  C CA   . LYS A 1 70  ? -4.758  4.817   12.957  1.00 0.00 ? 70  LYS A CA   3  
ATOM 4822  C C    . LYS A 1 70  ? -4.134  6.186   12.706  1.00 0.00 ? 70  LYS A C    3  
ATOM 4823  O O    . LYS A 1 70  ? -3.608  6.817   13.623  1.00 0.00 ? 70  LYS A O    3  
ATOM 4824  C CB   . LYS A 1 70  ? -4.154  4.192   14.216  1.00 0.00 ? 70  LYS A CB   3  
ATOM 4825  C CG   . LYS A 1 70  ? -4.977  3.048   14.783  1.00 0.00 ? 70  LYS A CG   3  
ATOM 4826  C CD   . LYS A 1 70  ? -4.427  2.572   16.117  1.00 0.00 ? 70  LYS A CD   3  
ATOM 4827  C CE   . LYS A 1 70  ? -5.500  1.888   16.950  1.00 0.00 ? 70  LYS A CE   3  
ATOM 4828  N NZ   . LYS A 1 70  ? -6.455  2.868   17.538  1.00 0.00 ? 70  LYS A NZ   3  
ATOM 4829  H H    . LYS A 1 70  ? -5.337  3.487   11.415  1.00 0.00 ? 70  LYS A H    3  
ATOM 4830  H HA   . LYS A 1 70  ? -5.821  4.941   13.101  1.00 0.00 ? 70  LYS A HA   3  
ATOM 4831  H HB2  . LYS A 1 70  ? -3.169  3.816   13.979  1.00 0.00 ? 70  LYS A HB2  3  
ATOM 4832  H HB3  . LYS A 1 70  ? -4.066  4.955   14.975  1.00 0.00 ? 70  LYS A HB3  3  
ATOM 4833  H HG2  . LYS A 1 70  ? -5.994  3.384   14.924  1.00 0.00 ? 70  LYS A HG2  3  
ATOM 4834  H HG3  . LYS A 1 70  ? -4.962  2.224   14.083  1.00 0.00 ? 70  LYS A HG3  3  
ATOM 4835  H HD2  . LYS A 1 70  ? -3.626  1.871   15.937  1.00 0.00 ? 70  LYS A HD2  3  
ATOM 4836  H HD3  . LYS A 1 70  ? -4.047  3.424   16.664  1.00 0.00 ? 70  LYS A HD3  3  
ATOM 4837  H HE2  . LYS A 1 70  ? -6.044  1.202   16.319  1.00 0.00 ? 70  LYS A HE2  3  
ATOM 4838  H HE3  . LYS A 1 70  ? -5.022  1.340   17.749  1.00 0.00 ? 70  LYS A HE3  3  
ATOM 4839  H HZ1  . LYS A 1 70  ? -6.404  3.770   17.022  1.00 0.00 ? 70  LYS A HZ1  3  
ATOM 4840  H HZ2  . LYS A 1 70  ? -6.221  3.040   18.536  1.00 0.00 ? 70  LYS A HZ2  3  
ATOM 4841  H HZ3  . LYS A 1 70  ? -7.426  2.501   17.478  1.00 0.00 ? 70  LYS A HZ3  3  
ATOM 4842  N N    . VAL A 1 71  ? -4.195  6.639   11.458  1.00 0.00 ? 71  VAL A N    3  
ATOM 4843  C CA   . VAL A 1 71  ? -3.638  7.935   11.087  1.00 0.00 ? 71  VAL A CA   3  
ATOM 4844  C C    . VAL A 1 71  ? -4.255  8.448   9.791   1.00 0.00 ? 71  VAL A C    3  
ATOM 4845  O O    . VAL A 1 71  ? -4.024  7.909   8.708   1.00 0.00 ? 71  VAL A O    3  
ATOM 4846  C CB   . VAL A 1 71  ? -2.109  7.860   10.920  1.00 0.00 ? 71  VAL A CB   3  
ATOM 4847  C CG1  . VAL A 1 71  ? -1.562  9.185   10.409  1.00 0.00 ? 71  VAL A CG1  3  
ATOM 4848  C CG2  . VAL A 1 71  ? -1.448  7.474   12.235  1.00 0.00 ? 71  VAL A CG2  3  
ATOM 4849  H H    . VAL A 1 71  ? -4.627  6.090   10.770  1.00 0.00 ? 71  VAL A H    3  
ATOM 4850  H HA   . VAL A 1 71  ? -3.859  8.633   11.881  1.00 0.00 ? 71  VAL A HA   3  
ATOM 4851  H HB   . VAL A 1 71  ? -1.883  7.097   10.190  1.00 0.00 ? 71  VAL A HB   3  
ATOM 4852  H HG11 . VAL A 1 71  ? -1.096  9.033   9.446   1.00 0.00 ? 71  VAL A HG11 3  
ATOM 4853  H HG12 . VAL A 1 71  ? -2.371  9.894   10.311  1.00 0.00 ? 71  VAL A HG12 3  
ATOM 4854  H HG13 . VAL A 1 71  ? -0.831  9.565   11.106  1.00 0.00 ? 71  VAL A HG13 3  
ATOM 4855  H HG21 . VAL A 1 71  ? -1.766  8.154   13.011  1.00 0.00 ? 71  VAL A HG21 3  
ATOM 4856  H HG22 . VAL A 1 71  ? -1.735  6.466   12.500  1.00 0.00 ? 71  VAL A HG22 3  
ATOM 4857  H HG23 . VAL A 1 71  ? -0.375  7.526   12.128  1.00 0.00 ? 71  VAL A HG23 3  
ATOM 4858  N N    . PRO A 1 72  ? -5.060  9.515   9.901   1.00 0.00 ? 72  PRO A N    3  
ATOM 4859  C CA   . PRO A 1 72  ? -5.727  10.126  8.747   1.00 0.00 ? 72  PRO A CA   3  
ATOM 4860  C C    . PRO A 1 72  ? -4.747  10.838  7.821   1.00 0.00 ? 72  PRO A C    3  
ATOM 4861  O O    . PRO A 1 72  ? -5.009  11.001  6.629   1.00 0.00 ? 72  PRO A O    3  
ATOM 4862  C CB   . PRO A 1 72  ? -6.687  11.133  9.385   1.00 0.00 ? 72  PRO A CB   3  
ATOM 4863  C CG   . PRO A 1 72  ? -6.072  11.462  10.701  1.00 0.00 ? 72  PRO A CG   3  
ATOM 4864  C CD   . PRO A 1 72  ? -5.380  10.208  11.160  1.00 0.00 ? 72  PRO A CD   3  
ATOM 4865  H HA   . PRO A 1 72  ? -6.289  9.397   8.182   1.00 0.00 ? 72  PRO A HA   3  
ATOM 4866  H HB2  . PRO A 1 72  ? -6.766  12.008  8.754   1.00 0.00 ? 72  PRO A HB2  3  
ATOM 4867  H HB3  . PRO A 1 72  ? -7.660  10.681  9.506   1.00 0.00 ? 72  PRO A HB3  3  
ATOM 4868  H HG2  . PRO A 1 72  ? -5.358  12.263  10.583  1.00 0.00 ? 72  PRO A HG2  3  
ATOM 4869  H HG3  . PRO A 1 72  ? -6.841  11.744  11.405  1.00 0.00 ? 72  PRO A HG3  3  
ATOM 4870  H HD2  . PRO A 1 72  ? -4.481  10.452  11.706  1.00 0.00 ? 72  PRO A HD2  3  
ATOM 4871  H HD3  . PRO A 1 72  ? -6.044  9.612   11.769  1.00 0.00 ? 72  PRO A HD3  3  
ATOM 4872  N N    . THR A 1 73  ? -3.615  11.261  8.376   1.00 0.00 ? 73  THR A N    3  
ATOM 4873  C CA   . THR A 1 73  ? -2.596  11.955  7.600   1.00 0.00 ? 73  THR A CA   3  
ATOM 4874  C C    . THR A 1 73  ? -1.720  10.970  6.835   1.00 0.00 ? 73  THR A C    3  
ATOM 4875  O O    . THR A 1 73  ? -0.987  11.355  5.925   1.00 0.00 ? 73  THR A O    3  
ATOM 4876  C CB   . THR A 1 73  ? -1.701  12.827  8.501   1.00 0.00 ? 73  THR A CB   3  
ATOM 4877  O OG1  . THR A 1 73  ? -1.062  12.014  9.491   1.00 0.00 ? 73  THR A OG1  3  
ATOM 4878  C CG2  . THR A 1 73  ? -2.516  13.917  9.182   1.00 0.00 ? 73  THR A CG2  3  
ATOM 4879  H H    . THR A 1 73  ? -3.464  11.101  9.331   1.00 0.00 ? 73  THR A H    3  
ATOM 4880  H HA   . THR A 1 73  ? -3.097  12.601  6.894   1.00 0.00 ? 73  THR A HA   3  
ATOM 4881  H HB   . THR A 1 73  ? -0.945  13.295  7.887   1.00 0.00 ? 73  THR A HB   3  
ATOM 4882  H HG1  . THR A 1 73  ? -0.658  11.253  9.067   1.00 0.00 ? 73  THR A HG1  3  
ATOM 4883  H HG21 . THR A 1 73  ? -3.568  13.734  9.019   1.00 0.00 ? 73  THR A HG21 3  
ATOM 4884  H HG22 . THR A 1 73  ? -2.249  14.878  8.768   1.00 0.00 ? 73  THR A HG22 3  
ATOM 4885  H HG23 . THR A 1 73  ? -2.310  13.911  10.242  1.00 0.00 ? 73  THR A HG23 3  
ATOM 4886  N N    . GLU A 1 74  ? -1.803  9.697   7.210   1.00 0.00 ? 74  GLU A N    3  
ATOM 4887  C CA   . GLU A 1 74  ? -1.016  8.657   6.557   1.00 0.00 ? 74  GLU A CA   3  
ATOM 4888  C C    . GLU A 1 74  ? -1.751  8.103   5.340   1.00 0.00 ? 74  GLU A C    3  
ATOM 4889  O O    . GLU A 1 74  ? -2.903  7.680   5.436   1.00 0.00 ? 74  GLU A O    3  
ATOM 4890  C CB   . GLU A 1 74  ? -0.711  7.525   7.541   1.00 0.00 ? 74  GLU A CB   3  
ATOM 4891  C CG   . GLU A 1 74  ? 0.574   7.732   8.326   1.00 0.00 ? 74  GLU A CG   3  
ATOM 4892  C CD   . GLU A 1 74  ? 1.788   7.165   7.618   1.00 0.00 ? 74  GLU A CD   3  
ATOM 4893  O OE1  . GLU A 1 74  ? 1.803   5.945   7.349   1.00 0.00 ? 74  GLU A OE1  3  
ATOM 4894  O OE2  . GLU A 1 74  ? 2.724   7.941   7.333   1.00 0.00 ? 74  GLU A OE2  3  
ATOM 4895  H H    . GLU A 1 74  ? -2.406  9.452   7.942   1.00 0.00 ? 74  GLU A H    3  
ATOM 4896  H HA   . GLU A 1 74  ? -0.087  9.099   6.231   1.00 0.00 ? 74  GLU A HA   3  
ATOM 4897  H HB2  . GLU A 1 74  ? -1.528  7.443   8.242   1.00 0.00 ? 74  GLU A HB2  3  
ATOM 4898  H HB3  . GLU A 1 74  ? -0.626  6.600   6.990   1.00 0.00 ? 74  GLU A HB3  3  
ATOM 4899  H HG2  . GLU A 1 74  ? 0.724   8.791   8.473   1.00 0.00 ? 74  GLU A HG2  3  
ATOM 4900  H HG3  . GLU A 1 74  ? 0.475   7.247   9.286   1.00 0.00 ? 74  GLU A HG3  3  
ATOM 4901  N N    . ARG A 1 75  ? -1.076  8.109   4.195   1.00 0.00 ? 75  ARG A N    3  
ATOM 4902  C CA   . ARG A 1 75  ? -1.664  7.609   2.959   1.00 0.00 ? 75  ARG A CA   3  
ATOM 4903  C C    . ARG A 1 75  ? -0.911  6.380   2.456   1.00 0.00 ? 75  ARG A C    3  
ATOM 4904  O O    . ARG A 1 75  ? -0.975  6.041   1.275   1.00 0.00 ? 75  ARG A O    3  
ATOM 4905  C CB   . ARG A 1 75  ? -1.653  8.700   1.886   1.00 0.00 ? 75  ARG A CB   3  
ATOM 4906  C CG   . ARG A 1 75  ? -2.664  9.808   2.135   1.00 0.00 ? 75  ARG A CG   3  
ATOM 4907  C CD   . ARG A 1 75  ? -3.116  10.453  0.834   1.00 0.00 ? 75  ARG A CD   3  
ATOM 4908  N NE   . ARG A 1 75  ? -2.095  11.336  0.278   1.00 0.00 ? 75  ARG A NE   3  
ATOM 4909  C CZ   . ARG A 1 75  ? -2.202  11.930  -0.906  1.00 0.00 ? 75  ARG A CZ   3  
ATOM 4910  N NH1  . ARG A 1 75  ? -3.279  11.735  -1.654  1.00 0.00 ? 75  ARG A NH1  3  
ATOM 4911  N NH2  . ARG A 1 75  ? -1.230  12.720  -1.343  1.00 0.00 ? 75  ARG A NH2  3  
ATOM 4912  H H    . ARG A 1 75  ? -0.160  8.459   4.182   1.00 0.00 ? 75  ARG A H    3  
ATOM 4913  H HA   . ARG A 1 75  ? -2.686  7.330   3.166   1.00 0.00 ? 75  ARG A HA   3  
ATOM 4914  H HB2  . ARG A 1 75  ? -0.669  9.143   1.849   1.00 0.00 ? 75  ARG A HB2  3  
ATOM 4915  H HB3  . ARG A 1 75  ? -1.873  8.250   0.930   1.00 0.00 ? 75  ARG A HB3  3  
ATOM 4916  H HG2  . ARG A 1 75  ? -3.526  9.391   2.635   1.00 0.00 ? 75  ARG A HG2  3  
ATOM 4917  H HG3  . ARG A 1 75  ? -2.211  10.561  2.762   1.00 0.00 ? 75  ARG A HG3  3  
ATOM 4918  H HD2  . ARG A 1 75  ? -3.332  9.674   0.118   1.00 0.00 ? 75  ARG A HD2  3  
ATOM 4919  H HD3  . ARG A 1 75  ? -4.010  11.026  1.024   1.00 0.00 ? 75  ARG A HD3  3  
ATOM 4920  H HE   . ARG A 1 75  ? -1.290  11.494  0.814   1.00 0.00 ? 75  ARG A HE   3  
ATOM 4921  H HH11 . ARG A 1 75  ? -4.013  11.140  -1.326  1.00 0.00 ? 75  ARG A HH11 3  
ATOM 4922  H HH12 . ARG A 1 75  ? -3.357  12.184  -2.544  1.00 0.00 ? 75  ARG A HH12 3  
ATOM 4923  H HH21 . ARG A 1 75  ? -0.416  12.870  -0.782  1.00 0.00 ? 75  ARG A HH21 3  
ATOM 4924  H HH22 . ARG A 1 75  ? -1.311  13.166  -2.234  1.00 0.00 ? 75  ARG A HH22 3  
ATOM 4925  N N    . SER A 1 76  ? -0.198  5.718   3.362   1.00 0.00 ? 76  SER A N    3  
ATOM 4926  C CA   . SER A 1 76  ? 0.570   4.530   3.010   1.00 0.00 ? 76  SER A CA   3  
ATOM 4927  C C    . SER A 1 76  ? 0.681   3.583   4.201   1.00 0.00 ? 76  SER A C    3  
ATOM 4928  O O    . SER A 1 76  ? 0.419   3.967   5.340   1.00 0.00 ? 76  SER A O    3  
ATOM 4929  C CB   . SER A 1 76  ? 1.967   4.925   2.526   1.00 0.00 ? 76  SER A CB   3  
ATOM 4930  O OG   . SER A 1 76  ? 2.662   5.658   3.519   1.00 0.00 ? 76  SER A OG   3  
ATOM 4931  H H    . SER A 1 76  ? -0.188  6.038   4.289   1.00 0.00 ? 76  SER A H    3  
ATOM 4932  H HA   . SER A 1 76  ? 0.051   4.024   2.210   1.00 0.00 ? 76  SER A HA   3  
ATOM 4933  H HB2  . SER A 1 76  ? 2.530   4.034   2.294   1.00 0.00 ? 76  SER A HB2  3  
ATOM 4934  H HB3  . SER A 1 76  ? 1.878   5.536   1.640   1.00 0.00 ? 76  SER A HB3  3  
ATOM 4935  H HG   . SER A 1 76  ? 2.469   6.594   3.421   1.00 0.00 ? 76  SER A HG   3  
ATOM 4936  N N    . ALA A 1 77  ? 1.073   2.342   3.928   1.00 0.00 ? 77  ALA A N    3  
ATOM 4937  C CA   . ALA A 1 77  ? 1.221   1.340   4.976   1.00 0.00 ? 77  ALA A CA   3  
ATOM 4938  C C    . ALA A 1 77  ? 2.143   0.211   4.529   1.00 0.00 ? 77  ALA A C    3  
ATOM 4939  O O    . ALA A 1 77  ? 2.317   -0.026  3.333   1.00 0.00 ? 77  ALA A O    3  
ATOM 4940  C CB   . ALA A 1 77  ? -0.140  0.786   5.373   1.00 0.00 ? 77  ALA A CB   3  
ATOM 4941  H H    . ALA A 1 77  ? 1.268   2.096   3.000   1.00 0.00 ? 77  ALA A H    3  
ATOM 4942  H HA   . ALA A 1 77  ? 1.653   1.822   5.841   1.00 0.00 ? 77  ALA A HA   3  
ATOM 4943  H HB1  . ALA A 1 77  ? -0.416  -0.008  4.695   1.00 0.00 ? 77  ALA A HB1  3  
ATOM 4944  H HB2  . ALA A 1 77  ? -0.091  0.401   6.380   1.00 0.00 ? 77  ALA A HB2  3  
ATOM 4945  H HB3  . ALA A 1 77  ? -0.876  1.574   5.324   1.00 0.00 ? 77  ALA A HB3  3  
ATOM 4946  N N    . VAL A 1 78  ? 2.734   -0.483  5.496   1.00 0.00 ? 78  VAL A N    3  
ATOM 4947  C CA   . VAL A 1 78  ? 3.639   -1.588  5.202   1.00 0.00 ? 78  VAL A CA   3  
ATOM 4948  C C    . VAL A 1 78  ? 3.201   -2.862  5.916   1.00 0.00 ? 78  VAL A C    3  
ATOM 4949  O O    . VAL A 1 78  ? 3.252   -2.947  7.144   1.00 0.00 ? 78  VAL A O    3  
ATOM 4950  C CB   . VAL A 1 78  ? 5.085   -1.254  5.612   1.00 0.00 ? 78  VAL A CB   3  
ATOM 4951  C CG1  . VAL A 1 78  ? 6.012   -2.418  5.299   1.00 0.00 ? 78  VAL A CG1  3  
ATOM 4952  C CG2  . VAL A 1 78  ? 5.555   0.015   4.917   1.00 0.00 ? 78  VAL A CG2  3  
ATOM 4953  H H    . VAL A 1 78  ? 2.556   -0.247  6.431   1.00 0.00 ? 78  VAL A H    3  
ATOM 4954  H HA   . VAL A 1 78  ? 3.620   -1.760  4.136   1.00 0.00 ? 78  VAL A HA   3  
ATOM 4955  H HB   . VAL A 1 78  ? 5.105   -1.083  6.679   1.00 0.00 ? 78  VAL A HB   3  
ATOM 4956  H HG11 . VAL A 1 78  ? 5.719   -2.869  4.362   1.00 0.00 ? 78  VAL A HG11 3  
ATOM 4957  H HG12 . VAL A 1 78  ? 7.028   -2.060  5.225   1.00 0.00 ? 78  VAL A HG12 3  
ATOM 4958  H HG13 . VAL A 1 78  ? 5.945   -3.153  6.088   1.00 0.00 ? 78  VAL A HG13 3  
ATOM 4959  H HG21 . VAL A 1 78  ? 4.791   0.355   4.234   1.00 0.00 ? 78  VAL A HG21 3  
ATOM 4960  H HG22 . VAL A 1 78  ? 5.745   0.781   5.655   1.00 0.00 ? 78  VAL A HG22 3  
ATOM 4961  H HG23 . VAL A 1 78  ? 6.463   -0.189  4.370   1.00 0.00 ? 78  VAL A HG23 3  
ATOM 4962  N N    . LEU A 1 79  ? 2.772   -3.851  5.141   1.00 0.00 ? 79  LEU A N    3  
ATOM 4963  C CA   . LEU A 1 79  ? 2.325   -5.123  5.699   1.00 0.00 ? 79  LEU A CA   3  
ATOM 4964  C C    . LEU A 1 79  ? 3.509   -6.050  5.957   1.00 0.00 ? 79  LEU A C    3  
ATOM 4965  O O    . LEU A 1 79  ? 4.177   -6.494  5.024   1.00 0.00 ? 79  LEU A O    3  
ATOM 4966  C CB   . LEU A 1 79  ? 1.331   -5.797  4.751   1.00 0.00 ? 79  LEU A CB   3  
ATOM 4967  C CG   . LEU A 1 79  ? 0.155   -4.936  4.288   1.00 0.00 ? 79  LEU A CG   3  
ATOM 4968  C CD1  . LEU A 1 79  ? -0.439  -5.492  3.003   1.00 0.00 ? 79  LEU A CD1  3  
ATOM 4969  C CD2  . LEU A 1 79  ? -0.905  -4.852  5.376   1.00 0.00 ? 79  LEU A CD2  3  
ATOM 4970  H H    . LEU A 1 79  ? 2.754   -3.724  4.169   1.00 0.00 ? 79  LEU A H    3  
ATOM 4971  H HA   . LEU A 1 79  ? 1.833   -4.918  6.638   1.00 0.00 ? 79  LEU A HA   3  
ATOM 4972  H HB2  . LEU A 1 79  ? 1.874   -6.115  3.875   1.00 0.00 ? 79  LEU A HB2  3  
ATOM 4973  H HB3  . LEU A 1 79  ? 0.929   -6.664  5.257   1.00 0.00 ? 79  LEU A HB3  3  
ATOM 4974  H HG   . LEU A 1 79  ? 0.509   -3.934  4.086   1.00 0.00 ? 79  LEU A HG   3  
ATOM 4975  H HD11 . LEU A 1 79  ? -1.162  -6.256  3.243   1.00 0.00 ? 79  LEU A HD11 3  
ATOM 4976  H HD12 . LEU A 1 79  ? 0.347   -5.916  2.397   1.00 0.00 ? 79  LEU A HD12 3  
ATOM 4977  H HD13 . LEU A 1 79  ? -0.923  -4.695  2.457   1.00 0.00 ? 79  LEU A HD13 3  
ATOM 4978  H HD21 . LEU A 1 79  ? -1.502  -5.753  5.366   1.00 0.00 ? 79  LEU A HD21 3  
ATOM 4979  H HD22 . LEU A 1 79  ? -1.541  -3.998  5.194   1.00 0.00 ? 79  LEU A HD22 3  
ATOM 4980  H HD23 . LEU A 1 79  ? -0.427  -4.748  6.338   1.00 0.00 ? 79  LEU A HD23 3  
ATOM 4981  N N    . VAL A 1 80  ? 3.761   -6.339  7.229   1.00 0.00 ? 80  VAL A N    3  
ATOM 4982  C CA   . VAL A 1 80  ? 4.861   -7.216  7.611   1.00 0.00 ? 80  VAL A CA   3  
ATOM 4983  C C    . VAL A 1 80  ? 4.356   -8.610  7.963   1.00 0.00 ? 80  VAL A C    3  
ATOM 4984  O O    . VAL A 1 80  ? 3.156   -8.878  7.913   1.00 0.00 ? 80  VAL A O    3  
ATOM 4985  C CB   . VAL A 1 80  ? 5.643   -6.647  8.809   1.00 0.00 ? 80  VAL A CB   3  
ATOM 4986  C CG1  . VAL A 1 80  ? 6.209   -5.275  8.475   1.00 0.00 ? 80  VAL A CG1  3  
ATOM 4987  C CG2  . VAL A 1 80  ? 4.754   -6.580  10.042  1.00 0.00 ? 80  VAL A CG2  3  
ATOM 4988  H H    . VAL A 1 80  ? 3.192   -5.954  7.929   1.00 0.00 ? 80  VAL A H    3  
ATOM 4989  H HA   . VAL A 1 80  ? 5.536   -7.290  6.770   1.00 0.00 ? 80  VAL A HA   3  
ATOM 4990  H HB   . VAL A 1 80  ? 6.469   -7.310  9.022   1.00 0.00 ? 80  VAL A HB   3  
ATOM 4991  H HG11 . VAL A 1 80  ? 5.798   -4.936  7.535   1.00 0.00 ? 80  VAL A HG11 3  
ATOM 4992  H HG12 . VAL A 1 80  ? 5.948   -4.577  9.257   1.00 0.00 ? 80  VAL A HG12 3  
ATOM 4993  H HG13 . VAL A 1 80  ? 7.284   -5.339  8.394   1.00 0.00 ? 80  VAL A HG13 3  
ATOM 4994  H HG21 . VAL A 1 80  ? 3.947   -5.885  9.865   1.00 0.00 ? 80  VAL A HG21 3  
ATOM 4995  H HG22 . VAL A 1 80  ? 4.348   -7.560  10.247  1.00 0.00 ? 80  VAL A HG22 3  
ATOM 4996  H HG23 . VAL A 1 80  ? 5.336   -6.248  10.888  1.00 0.00 ? 80  VAL A HG23 3  
ATOM 4997  N N    . ASN A 1 81  ? 5.280   -9.496  8.321   1.00 0.00 ? 81  ASN A N    3  
ATOM 4998  C CA   . ASN A 1 81  ? 4.929   -10.864 8.683   1.00 0.00 ? 81  ASN A CA   3  
ATOM 4999  C C    . ASN A 1 81  ? 4.180   -11.552 7.546   1.00 0.00 ? 81  ASN A C    3  
ATOM 5000  O O    . ASN A 1 81  ? 3.093   -12.097 7.743   1.00 0.00 ? 81  ASN A O    3  
ATOM 5001  C CB   . ASN A 1 81  ? 4.073   -10.874 9.951   1.00 0.00 ? 81  ASN A CB   3  
ATOM 5002  C CG   . ASN A 1 81  ? 4.910   -10.808 11.214  1.00 0.00 ? 81  ASN A CG   3  
ATOM 5003  O OD1  . ASN A 1 81  ? 5.854   -11.579 11.388  1.00 0.00 ? 81  ASN A OD1  3  
ATOM 5004  N ND2  . ASN A 1 81  ? 4.567   -9.883  12.103  1.00 0.00 ? 81  ASN A ND2  3  
ATOM 5005  H H    . ASN A 1 81  ? 6.221   -9.223  8.342   1.00 0.00 ? 81  ASN A H    3  
ATOM 5006  H HA   . ASN A 1 81  ? 5.845   -11.402 8.873   1.00 0.00 ? 81  ASN A HA   3  
ATOM 5007  H HB2  . ASN A 1 81  ? 3.409   -10.022 9.938   1.00 0.00 ? 81  ASN A HB2  3  
ATOM 5008  H HB3  . ASN A 1 81  ? 3.487   -11.781 9.977   1.00 0.00 ? 81  ASN A HB3  3  
ATOM 5009  H HD21 . ASN A 1 81  ? 3.804   -9.303  11.898  1.00 0.00 ? 81  ASN A HD21 3  
ATOM 5010  H HD22 . ASN A 1 81  ? 5.092   -9.818  12.928  1.00 0.00 ? 81  ASN A HD22 3  
ATOM 5011  N N    . LEU A 1 82  ? 4.769   -11.525 6.355   1.00 0.00 ? 82  LEU A N    3  
ATOM 5012  C CA   . LEU A 1 82  ? 4.159   -12.146 5.185   1.00 0.00 ? 82  LEU A CA   3  
ATOM 5013  C C    . LEU A 1 82  ? 4.951   -13.374 4.746   1.00 0.00 ? 82  LEU A C    3  
ATOM 5014  O O    . LEU A 1 82  ? 6.158   -13.462 4.971   1.00 0.00 ? 82  LEU A O    3  
ATOM 5015  C CB   . LEU A 1 82  ? 4.075   -11.142 4.035   1.00 0.00 ? 82  LEU A CB   3  
ATOM 5016  C CG   . LEU A 1 82  ? 3.314   -9.848  4.328   1.00 0.00 ? 82  LEU A CG   3  
ATOM 5017  C CD1  . LEU A 1 82  ? 3.627   -8.795  3.276   1.00 0.00 ? 82  LEU A CD1  3  
ATOM 5018  C CD2  . LEU A 1 82  ? 1.817   -10.113 4.391   1.00 0.00 ? 82  LEU A CD2  3  
ATOM 5019  H H    . LEU A 1 82  ? 5.635   -11.076 6.260   1.00 0.00 ? 82  LEU A H    3  
ATOM 5020  H HA   . LEU A 1 82  ? 3.161   -12.455 5.457   1.00 0.00 ? 82  LEU A HA   3  
ATOM 5021  H HB2  . LEU A 1 82  ? 5.083   -10.876 3.754   1.00 0.00 ? 82  LEU A HB2  3  
ATOM 5022  H HB3  . LEU A 1 82  ? 3.589   -11.632 3.204   1.00 0.00 ? 82  LEU A HB3  3  
ATOM 5023  H HG   . LEU A 1 82  ? 3.628   -9.463  5.289   1.00 0.00 ? 82  LEU A HG   3  
ATOM 5024  H HD11 . LEU A 1 82  ? 3.096   -7.885  3.510   1.00 0.00 ? 82  LEU A HD11 3  
ATOM 5025  H HD12 . LEU A 1 82  ? 3.318   -9.153  2.305   1.00 0.00 ? 82  LEU A HD12 3  
ATOM 5026  H HD13 . LEU A 1 82  ? 4.689   -8.601  3.266   1.00 0.00 ? 82  LEU A HD13 3  
ATOM 5027  H HD21 . LEU A 1 82  ? 1.626   -10.937 5.063   1.00 0.00 ? 82  LEU A HD21 3  
ATOM 5028  H HD22 . LEU A 1 82  ? 1.453   -10.361 3.405   1.00 0.00 ? 82  LEU A HD22 3  
ATOM 5029  H HD23 . LEU A 1 82  ? 1.310   -9.230  4.751   1.00 0.00 ? 82  LEU A HD23 3  
ATOM 5030  N N    . LYS A 1 83  ? 4.263   -14.321 4.116   1.00 0.00 ? 83  LYS A N    3  
ATOM 5031  C CA   . LYS A 1 83  ? 4.901   -15.543 3.641   1.00 0.00 ? 83  LYS A CA   3  
ATOM 5032  C C    . LYS A 1 83  ? 5.749   -15.269 2.404   1.00 0.00 ? 83  LYS A C    3  
ATOM 5033  O O    . LYS A 1 83  ? 5.716   -14.171 1.846   1.00 0.00 ? 83  LYS A O    3  
ATOM 5034  C CB   . LYS A 1 83  ? 3.845   -16.604 3.324   1.00 0.00 ? 83  LYS A CB   3  
ATOM 5035  C CG   . LYS A 1 83  ? 3.257   -17.266 4.558   1.00 0.00 ? 83  LYS A CG   3  
ATOM 5036  C CD   . LYS A 1 83  ? 2.659   -18.624 4.231   1.00 0.00 ? 83  LYS A CD   3  
ATOM 5037  C CE   . LYS A 1 83  ? 3.738   -19.682 4.059   1.00 0.00 ? 83  LYS A CE   3  
ATOM 5038  N NZ   . LYS A 1 83  ? 3.209   -21.055 4.285   1.00 0.00 ? 83  LYS A NZ   3  
ATOM 5039  H H    . LYS A 1 83  ? 3.302   -14.194 3.966   1.00 0.00 ? 83  LYS A H    3  
ATOM 5040  H HA   . LYS A 1 83  ? 5.542   -15.910 4.429   1.00 0.00 ? 83  LYS A HA   3  
ATOM 5041  H HB2  . LYS A 1 83  ? 3.040   -16.140 2.772   1.00 0.00 ? 83  LYS A HB2  3  
ATOM 5042  H HB3  . LYS A 1 83  ? 4.295   -17.370 2.710   1.00 0.00 ? 83  LYS A HB3  3  
ATOM 5043  H HG2  . LYS A 1 83  ? 4.038   -17.396 5.292   1.00 0.00 ? 83  LYS A HG2  3  
ATOM 5044  H HG3  . LYS A 1 83  ? 2.482   -16.629 4.962   1.00 0.00 ? 83  LYS A HG3  3  
ATOM 5045  H HD2  . LYS A 1 83  ? 2.003   -18.922 5.035   1.00 0.00 ? 83  LYS A HD2  3  
ATOM 5046  H HD3  . LYS A 1 83  ? 2.093   -18.546 3.313   1.00 0.00 ? 83  LYS A HD3  3  
ATOM 5047  H HE2  . LYS A 1 83  ? 4.131   -19.617 3.056   1.00 0.00 ? 83  LYS A HE2  3  
ATOM 5048  H HE3  . LYS A 1 83  ? 4.529   -19.488 4.769   1.00 0.00 ? 83  LYS A HE3  3  
ATOM 5049  H HZ1  . LYS A 1 83  ? 3.023   -21.204 5.297   1.00 0.00 ? 83  LYS A HZ1  3  
ATOM 5050  H HZ2  . LYS A 1 83  ? 3.901   -21.762 3.963   1.00 0.00 ? 83  LYS A HZ2  3  
ATOM 5051  H HZ3  . LYS A 1 83  ? 2.323   -21.188 3.757   1.00 0.00 ? 83  LYS A HZ3  3  
ATOM 5052  N N    . LYS A 1 84  ? 6.508   -16.273 1.978   1.00 0.00 ? 84  LYS A N    3  
ATOM 5053  C CA   . LYS A 1 84  ? 7.364   -16.141 0.805   1.00 0.00 ? 84  LYS A CA   3  
ATOM 5054  C C    . LYS A 1 84  ? 6.915   -17.087 -0.305  1.00 0.00 ? 84  LYS A C    3  
ATOM 5055  O O    . LYS A 1 84  ? 6.716   -18.279 -0.075  1.00 0.00 ? 84  LYS A O    3  
ATOM 5056  C CB   . LYS A 1 84  ? 8.821   -16.428 1.175   1.00 0.00 ? 84  LYS A CB   3  
ATOM 5057  C CG   . LYS A 1 84  ? 9.368   -15.506 2.251   1.00 0.00 ? 84  LYS A CG   3  
ATOM 5058  C CD   . LYS A 1 84  ? 9.135   -16.072 3.642   1.00 0.00 ? 84  LYS A CD   3  
ATOM 5059  C CE   . LYS A 1 84  ? 10.270  -16.991 4.066   1.00 0.00 ? 84  LYS A CE   3  
ATOM 5060  N NZ   . LYS A 1 84  ? 9.904   -17.812 5.253   1.00 0.00 ? 84  LYS A NZ   3  
ATOM 5061  H H    . LYS A 1 84  ? 6.492   -17.124 2.465   1.00 0.00 ? 84  LYS A H    3  
ATOM 5062  H HA   . LYS A 1 84  ? 7.285   -15.125 0.449   1.00 0.00 ? 84  LYS A HA   3  
ATOM 5063  H HB2  . LYS A 1 84  ? 8.895   -17.445 1.531   1.00 0.00 ? 84  LYS A HB2  3  
ATOM 5064  H HB3  . LYS A 1 84  ? 9.433   -16.319 0.292   1.00 0.00 ? 84  LYS A HB3  3  
ATOM 5065  H HG2  . LYS A 1 84  ? 10.429  -15.379 2.098   1.00 0.00 ? 84  LYS A HG2  3  
ATOM 5066  H HG3  . LYS A 1 84  ? 8.874   -14.547 2.175   1.00 0.00 ? 84  LYS A HG3  3  
ATOM 5067  H HD2  . LYS A 1 84  ? 9.066   -15.256 4.346   1.00 0.00 ? 84  LYS A HD2  3  
ATOM 5068  H HD3  . LYS A 1 84  ? 8.210   -16.631 3.644   1.00 0.00 ? 84  LYS A HD3  3  
ATOM 5069  H HE2  . LYS A 1 84  ? 10.510  -17.648 3.245   1.00 0.00 ? 84  LYS A HE2  3  
ATOM 5070  H HE3  . LYS A 1 84  ? 11.133  -16.388 4.308   1.00 0.00 ? 84  LYS A HE3  3  
ATOM 5071  H HZ1  . LYS A 1 84  ? 8.907   -17.654 5.504   1.00 0.00 ? 84  LYS A HZ1  3  
ATOM 5072  H HZ2  . LYS A 1 84  ? 10.499  -17.552 6.065   1.00 0.00 ? 84  LYS A HZ2  3  
ATOM 5073  H HZ3  . LYS A 1 84  ? 10.042  -18.822 5.046   1.00 0.00 ? 84  LYS A HZ3  3  
ATOM 5074  N N    . GLY A 1 85  ? 6.758   -16.547 -1.510  1.00 0.00 ? 85  GLY A N    3  
ATOM 5075  C CA   . GLY A 1 85  ? 6.335   -17.357 -2.637  1.00 0.00 ? 85  GLY A CA   3  
ATOM 5076  C C    . GLY A 1 85  ? 4.830   -17.525 -2.698  1.00 0.00 ? 85  GLY A C    3  
ATOM 5077  O O    . GLY A 1 85  ? 4.324   -18.646 -2.762  1.00 0.00 ? 85  GLY A O    3  
ATOM 5078  H H    . GLY A 1 85  ? 6.931   -15.590 -1.634  1.00 0.00 ? 85  GLY A H    3  
ATOM 5079  H HA2  . GLY A 1 85  ? 6.672   -16.889 -3.549  1.00 0.00 ? 85  GLY A HA2  3  
ATOM 5080  H HA3  . GLY A 1 85  ? 6.791   -18.333 -2.555  1.00 0.00 ? 85  GLY A HA3  3  
ATOM 5081  N N    . VAL A 1 86  ? 4.110   -16.407 -2.676  1.00 0.00 ? 86  VAL A N    3  
ATOM 5082  C CA   . VAL A 1 86  ? 2.653   -16.435 -2.729  1.00 0.00 ? 86  VAL A CA   3  
ATOM 5083  C C    . VAL A 1 86  ? 2.087   -15.047 -3.005  1.00 0.00 ? 86  VAL A C    3  
ATOM 5084  O O    . VAL A 1 86  ? 2.705   -14.034 -2.675  1.00 0.00 ? 86  VAL A O    3  
ATOM 5085  C CB   . VAL A 1 86  ? 2.054   -16.970 -1.414  1.00 0.00 ? 86  VAL A CB   3  
ATOM 5086  C CG1  . VAL A 1 86  ? 2.239   -15.959 -0.293  1.00 0.00 ? 86  VAL A CG1  3  
ATOM 5087  C CG2  . VAL A 1 86  ? 0.583   -17.310 -1.599  1.00 0.00 ? 86  VAL A CG2  3  
ATOM 5088  H H    . VAL A 1 86  ? 4.570   -15.544 -2.624  1.00 0.00 ? 86  VAL A H    3  
ATOM 5089  H HA   . VAL A 1 86  ? 2.360   -17.099 -3.529  1.00 0.00 ? 86  VAL A HA   3  
ATOM 5090  H HB   . VAL A 1 86  ? 2.580   -17.874 -1.144  1.00 0.00 ? 86  VAL A HB   3  
ATOM 5091  H HG11 . VAL A 1 86  ? 1.653   -15.077 -0.504  1.00 0.00 ? 86  VAL A HG11 3  
ATOM 5092  H HG12 . VAL A 1 86  ? 1.914   -16.394 0.641   1.00 0.00 ? 86  VAL A HG12 3  
ATOM 5093  H HG13 . VAL A 1 86  ? 3.282   -15.689 -0.221  1.00 0.00 ? 86  VAL A HG13 3  
ATOM 5094  H HG21 . VAL A 1 86  ? 0.001   -16.401 -1.596  1.00 0.00 ? 86  VAL A HG21 3  
ATOM 5095  H HG22 . VAL A 1 86  ? 0.447   -17.821 -2.542  1.00 0.00 ? 86  VAL A HG22 3  
ATOM 5096  H HG23 . VAL A 1 86  ? 0.257   -17.950 -0.794  1.00 0.00 ? 86  VAL A HG23 3  
ATOM 5097  N N    . THR A 1 87  ? 0.904   -15.006 -3.611  1.00 0.00 ? 87  THR A N    3  
ATOM 5098  C CA   . THR A 1 87  ? 0.254   -13.742 -3.933  1.00 0.00 ? 87  THR A CA   3  
ATOM 5099  C C    . THR A 1 87  ? -0.639  -13.277 -2.788  1.00 0.00 ? 87  THR A C    3  
ATOM 5100  O O    . THR A 1 87  ? -1.198  -14.091 -2.053  1.00 0.00 ? 87  THR A O    3  
ATOM 5101  C CB   . THR A 1 87  ? -0.593  -13.856 -5.215  1.00 0.00 ? 87  THR A CB   3  
ATOM 5102  O OG1  . THR A 1 87  ? 0.001   -14.802 -6.111  1.00 0.00 ? 87  THR A OG1  3  
ATOM 5103  C CG2  . THR A 1 87  ? -0.716  -12.505 -5.903  1.00 0.00 ? 87  THR A CG2  3  
ATOM 5104  H H    . THR A 1 87  ? 0.461   -15.847 -3.849  1.00 0.00 ? 87  THR A H    3  
ATOM 5105  H HA   . THR A 1 87  ? 1.024   -13.003 -4.099  1.00 0.00 ? 87  THR A HA   3  
ATOM 5106  H HB   . THR A 1 87  ? -1.582  -14.198 -4.946  1.00 0.00 ? 87  THR A HB   3  
ATOM 5107  H HG1  . THR A 1 87  ? -0.225  -15.692 -5.832  1.00 0.00 ? 87  THR A HG1  3  
ATOM 5108  H HG21 . THR A 1 87  ? 0.257   -12.042 -5.965  1.00 0.00 ? 87  THR A HG21 3  
ATOM 5109  H HG22 . THR A 1 87  ? -1.381  -11.871 -5.336  1.00 0.00 ? 87  THR A HG22 3  
ATOM 5110  H HG23 . THR A 1 87  ? -1.112  -12.644 -6.898  1.00 0.00 ? 87  THR A HG23 3  
ATOM 5111  N N    . TYR A 1 88  ? -0.768  -11.963 -2.642  1.00 0.00 ? 88  TYR A N    3  
ATOM 5112  C CA   . TYR A 1 88  ? -1.592  -11.389 -1.585  1.00 0.00 ? 88  TYR A CA   3  
ATOM 5113  C C    . TYR A 1 88  ? -2.462  -10.258 -2.125  1.00 0.00 ? 88  TYR A C    3  
ATOM 5114  O O    . TYR A 1 88  ? -1.980  -9.372  -2.830  1.00 0.00 ? 88  TYR A O    3  
ATOM 5115  C CB   . TYR A 1 88  ? -0.711  -10.870 -0.447  1.00 0.00 ? 88  TYR A CB   3  
ATOM 5116  C CG   . TYR A 1 88  ? -0.323  -11.935 0.553   1.00 0.00 ? 88  TYR A CG   3  
ATOM 5117  C CD1  . TYR A 1 88  ? -1.190  -12.308 1.572   1.00 0.00 ? 88  TYR A CD1  3  
ATOM 5118  C CD2  . TYR A 1 88  ? 0.912   -12.569 0.479   1.00 0.00 ? 88  TYR A CD2  3  
ATOM 5119  C CE1  . TYR A 1 88  ? -0.840  -13.280 2.489   1.00 0.00 ? 88  TYR A CE1  3  
ATOM 5120  C CE2  . TYR A 1 88  ? 1.270   -13.544 1.390   1.00 0.00 ? 88  TYR A CE2  3  
ATOM 5121  C CZ   . TYR A 1 88  ? 0.391   -13.896 2.393   1.00 0.00 ? 88  TYR A CZ   3  
ATOM 5122  O OH   . TYR A 1 88  ? 0.745   -14.865 3.303   1.00 0.00 ? 88  TYR A OH   3  
ATOM 5123  H H    . TYR A 1 88  ? -0.298  -11.364 -3.258  1.00 0.00 ? 88  TYR A H    3  
ATOM 5124  H HA   . TYR A 1 88  ? -2.233  -12.170 -1.202  1.00 0.00 ? 88  TYR A HA   3  
ATOM 5125  H HB2  . TYR A 1 88  ? 0.197   -10.459 -0.863  1.00 0.00 ? 88  TYR A HB2  3  
ATOM 5126  H HB3  . TYR A 1 88  ? -1.241  -10.093 0.084   1.00 0.00 ? 88  TYR A HB3  3  
ATOM 5127  H HD1  . TYR A 1 88  ? -2.154  -11.824 1.645   1.00 0.00 ? 88  TYR A HD1  3  
ATOM 5128  H HD2  . TYR A 1 88  ? 1.598   -12.290 -0.308  1.00 0.00 ? 88  TYR A HD2  3  
ATOM 5129  H HE1  . TYR A 1 88  ? -1.528  -13.557 3.274   1.00 0.00 ? 88  TYR A HE1  3  
ATOM 5130  H HE2  . TYR A 1 88  ? 2.234   -14.025 1.315   1.00 0.00 ? 88  TYR A HE2  3  
ATOM 5131  H HH   . TYR A 1 88  ? 0.426   -15.719 3.001   1.00 0.00 ? 88  TYR A HH   3  
ATOM 5132  N N    . GLU A 1 89  ? -3.748  -10.297 -1.788  1.00 0.00 ? 89  GLU A N    3  
ATOM 5133  C CA   . GLU A 1 89  ? -4.686  -9.276  -2.240  1.00 0.00 ? 89  GLU A CA   3  
ATOM 5134  C C    . GLU A 1 89  ? -4.943  -8.249  -1.141  1.00 0.00 ? 89  GLU A C    3  
ATOM 5135  O O    . GLU A 1 89  ? -5.250  -8.605  -0.003  1.00 0.00 ? 89  GLU A O    3  
ATOM 5136  C CB   . GLU A 1 89  ? -6.006  -9.919  -2.670  1.00 0.00 ? 89  GLU A CB   3  
ATOM 5137  C CG   . GLU A 1 89  ? -7.058  -8.915  -3.109  1.00 0.00 ? 89  GLU A CG   3  
ATOM 5138  C CD   . GLU A 1 89  ? -8.363  -9.575  -3.512  1.00 0.00 ? 89  GLU A CD   3  
ATOM 5139  O OE1  . GLU A 1 89  ? -8.703  -10.622 -2.923  1.00 0.00 ? 89  GLU A OE1  3  
ATOM 5140  O OE2  . GLU A 1 89  ? -9.043  -9.045  -4.415  1.00 0.00 ? 89  GLU A OE2  3  
ATOM 5141  H H    . GLU A 1 89  ? -4.073  -11.029 -1.224  1.00 0.00 ? 89  GLU A H    3  
ATOM 5142  H HA   . GLU A 1 89  ? -4.247  -8.775  -3.089  1.00 0.00 ? 89  GLU A HA   3  
ATOM 5143  H HB2  . GLU A 1 89  ? -5.814  -10.592 -3.492  1.00 0.00 ? 89  GLU A HB2  3  
ATOM 5144  H HB3  . GLU A 1 89  ? -6.404  -10.485 -1.840  1.00 0.00 ? 89  GLU A HB3  3  
ATOM 5145  H HG2  . GLU A 1 89  ? -7.253  -8.236  -2.293  1.00 0.00 ? 89  GLU A HG2  3  
ATOM 5146  H HG3  . GLU A 1 89  ? -6.677  -8.360  -3.954  1.00 0.00 ? 89  GLU A HG3  3  
ATOM 5147  N N    . ILE A 1 90  ? -4.813  -6.973  -1.490  1.00 0.00 ? 90  ILE A N    3  
ATOM 5148  C CA   . ILE A 1 90  ? -5.031  -5.894  -0.534  1.00 0.00 ? 90  ILE A CA   3  
ATOM 5149  C C    . ILE A 1 90  ? -5.781  -4.733  -1.178  1.00 0.00 ? 90  ILE A C    3  
ATOM 5150  O O    . ILE A 1 90  ? -5.612  -4.451  -2.364  1.00 0.00 ? 90  ILE A O    3  
ATOM 5151  C CB   . ILE A 1 90  ? -3.700  -5.375  0.042   1.00 0.00 ? 90  ILE A CB   3  
ATOM 5152  C CG1  . ILE A 1 90  ? -2.854  -6.540  0.560   1.00 0.00 ? 90  ILE A CG1  3  
ATOM 5153  C CG2  . ILE A 1 90  ? -3.960  -4.368  1.152   1.00 0.00 ? 90  ILE A CG2  3  
ATOM 5154  C CD1  . ILE A 1 90  ? -1.947  -7.142  -0.491  1.00 0.00 ? 90  ILE A CD1  3  
ATOM 5155  H H    . ILE A 1 90  ? -4.565  -6.752  -2.412  1.00 0.00 ? 90  ILE A H    3  
ATOM 5156  H HA   . ILE A 1 90  ? -5.624  -6.285  0.280   1.00 0.00 ? 90  ILE A HA   3  
ATOM 5157  H HB   . ILE A 1 90  ? -3.163  -4.873  -0.749  1.00 0.00 ? 90  ILE A HB   3  
ATOM 5158  H HG12 . ILE A 1 90  ? -2.235  -6.194  1.372   1.00 0.00 ? 90  ILE A HG12 3  
ATOM 5159  H HG13 . ILE A 1 90  ? -3.510  -7.319  0.919   1.00 0.00 ? 90  ILE A HG13 3  
ATOM 5160  H HG21 . ILE A 1 90  ? -3.364  -4.621  2.015   1.00 0.00 ? 90  ILE A HG21 3  
ATOM 5161  H HG22 . ILE A 1 90  ? -3.694  -3.379  0.809   1.00 0.00 ? 90  ILE A HG22 3  
ATOM 5162  H HG23 . ILE A 1 90  ? -5.006  -4.388  1.418   1.00 0.00 ? 90  ILE A HG23 3  
ATOM 5163  H HD11 . ILE A 1 90  ? -1.871  -6.468  -1.331  1.00 0.00 ? 90  ILE A HD11 3  
ATOM 5164  H HD12 . ILE A 1 90  ? -0.967  -7.306  -0.070  1.00 0.00 ? 90  ILE A HD12 3  
ATOM 5165  H HD13 . ILE A 1 90  ? -2.358  -8.085  -0.823  1.00 0.00 ? 90  ILE A HD13 3  
ATOM 5166  N N    . LYS A 1 91  ? -6.610  -4.060  -0.387  1.00 0.00 ? 91  LYS A N    3  
ATOM 5167  C CA   . LYS A 1 91  ? -7.385  -2.927  -0.877  1.00 0.00 ? 91  LYS A CA   3  
ATOM 5168  C C    . LYS A 1 91  ? -7.544  -1.867  0.209   1.00 0.00 ? 91  LYS A C    3  
ATOM 5169  O O    . LYS A 1 91  ? -7.899  -2.177  1.346   1.00 0.00 ? 91  LYS A O    3  
ATOM 5170  C CB   . LYS A 1 91  ? -8.761  -3.392  -1.356  1.00 0.00 ? 91  LYS A CB   3  
ATOM 5171  C CG   . LYS A 1 91  ? -9.557  -4.132  -0.294  1.00 0.00 ? 91  LYS A CG   3  
ATOM 5172  C CD   . LYS A 1 91  ? -9.287  -5.627  -0.335  1.00 0.00 ? 91  LYS A CD   3  
ATOM 5173  C CE   . LYS A 1 91  ? -10.179 -6.381  0.639   1.00 0.00 ? 91  LYS A CE   3  
ATOM 5174  N NZ   . LYS A 1 91  ? -11.525 -6.651  0.062   1.00 0.00 ? 91  LYS A NZ   3  
ATOM 5175  H H    . LYS A 1 91  ? -6.702  -4.333  0.551   1.00 0.00 ? 91  LYS A H    3  
ATOM 5176  H HA   . LYS A 1 91  ? -6.850  -2.495  -1.709  1.00 0.00 ? 91  LYS A HA   3  
ATOM 5177  H HB2  . LYS A 1 91  ? -9.332  -2.530  -1.667  1.00 0.00 ? 91  LYS A HB2  3  
ATOM 5178  H HB3  . LYS A 1 91  ? -8.631  -4.052  -2.202  1.00 0.00 ? 91  LYS A HB3  3  
ATOM 5179  H HG2  . LYS A 1 91  ? -9.280  -3.754  0.679   1.00 0.00 ? 91  LYS A HG2  3  
ATOM 5180  H HG3  . LYS A 1 91  ? -10.611 -3.961  -0.462  1.00 0.00 ? 91  LYS A HG3  3  
ATOM 5181  H HD2  . LYS A 1 91  ? -9.475  -5.991  -1.334  1.00 0.00 ? 91  LYS A HD2  3  
ATOM 5182  H HD3  . LYS A 1 91  ? -8.253  -5.804  -0.073  1.00 0.00 ? 91  LYS A HD3  3  
ATOM 5183  H HE2  . LYS A 1 91  ? -9.708  -7.320  0.886   1.00 0.00 ? 91  LYS A HE2  3  
ATOM 5184  H HE3  . LYS A 1 91  ? -10.293 -5.789  1.535   1.00 0.00 ? 91  LYS A HE3  3  
ATOM 5185  H HZ1  . LYS A 1 91  ? -11.646 -6.122  -0.825  1.00 0.00 ? 91  LYS A HZ1  3  
ATOM 5186  H HZ2  . LYS A 1 91  ? -12.266 -6.358  0.730   1.00 0.00 ? 91  LYS A HZ2  3  
ATOM 5187  H HZ3  . LYS A 1 91  ? -11.633 -7.667  -0.135  1.00 0.00 ? 91  LYS A HZ3  3  
ATOM 5188  N N    . VAL A 1 92  ? -7.280  -0.614  -0.150  1.00 0.00 ? 92  VAL A N    3  
ATOM 5189  C CA   . VAL A 1 92  ? -7.397  0.492   0.793   1.00 0.00 ? 92  VAL A CA   3  
ATOM 5190  C C    . VAL A 1 92  ? -8.836  0.987   0.883   1.00 0.00 ? 92  VAL A C    3  
ATOM 5191  O O    . VAL A 1 92  ? -9.451  1.326   -0.128  1.00 0.00 ? 92  VAL A O    3  
ATOM 5192  C CB   . VAL A 1 92  ? -6.485  1.667   0.394   1.00 0.00 ? 92  VAL A CB   3  
ATOM 5193  C CG1  . VAL A 1 92  ? -6.736  2.867   1.296   1.00 0.00 ? 92  VAL A CG1  3  
ATOM 5194  C CG2  . VAL A 1 92  ? -5.024  1.248   0.444   1.00 0.00 ? 92  VAL A CG2  3  
ATOM 5195  H H    . VAL A 1 92  ? -7.001  -0.430  -1.071  1.00 0.00 ? 92  VAL A H    3  
ATOM 5196  H HA   . VAL A 1 92  ? -7.087  0.136   1.765   1.00 0.00 ? 92  VAL A HA   3  
ATOM 5197  H HB   . VAL A 1 92  ? -6.722  1.952   -0.620  1.00 0.00 ? 92  VAL A HB   3  
ATOM 5198  H HG11 . VAL A 1 92  ? -6.134  3.700   0.962   1.00 0.00 ? 92  VAL A HG11 3  
ATOM 5199  H HG12 . VAL A 1 92  ? -7.781  3.136   1.255   1.00 0.00 ? 92  VAL A HG12 3  
ATOM 5200  H HG13 . VAL A 1 92  ? -6.468  2.615   2.311   1.00 0.00 ? 92  VAL A HG13 3  
ATOM 5201  H HG21 . VAL A 1 92  ? -4.479  1.921   1.090   1.00 0.00 ? 92  VAL A HG21 3  
ATOM 5202  H HG22 . VAL A 1 92  ? -4.951  0.242   0.830   1.00 0.00 ? 92  VAL A HG22 3  
ATOM 5203  H HG23 . VAL A 1 92  ? -4.604  1.284   -0.550  1.00 0.00 ? 92  VAL A HG23 3  
ATOM 5204  N N    . ARG A 1 93  ? -9.367  1.026   2.101   1.00 0.00 ? 93  ARG A N    3  
ATOM 5205  C CA   . ARG A 1 93  ? -10.735 1.480   2.324   1.00 0.00 ? 93  ARG A CA   3  
ATOM 5206  C C    . ARG A 1 93  ? -10.806 2.425   3.519   1.00 0.00 ? 93  ARG A C    3  
ATOM 5207  O O    . ARG A 1 93  ? -10.433 2.078   4.640   1.00 0.00 ? 93  ARG A O    3  
ATOM 5208  C CB   . ARG A 1 93  ? -11.661 0.283   2.550   1.00 0.00 ? 93  ARG A CB   3  
ATOM 5209  C CG   . ARG A 1 93  ? -11.105 -0.741  3.526   1.00 0.00 ? 93  ARG A CG   3  
ATOM 5210  C CD   . ARG A 1 93  ? -12.169 -1.741  3.951   1.00 0.00 ? 93  ARG A CD   3  
ATOM 5211  N NE   . ARG A 1 93  ? -12.405 -2.757  2.928   1.00 0.00 ? 93  ARG A NE   3  
ATOM 5212  C CZ   . ARG A 1 93  ? -13.245 -2.596  1.912   1.00 0.00 ? 93  ARG A CZ   3  
ATOM 5213  N NH1  . ARG A 1 93  ? -13.925 -1.465  1.783   1.00 0.00 ? 93  ARG A NH1  3  
ATOM 5214  N NH2  . ARG A 1 93  ? -13.405 -3.567  1.022   1.00 0.00 ? 93  ARG A NH2  3  
ATOM 5215  H H    . ARG A 1 93  ? -8.827  0.743   2.868   1.00 0.00 ? 93  ARG A H    3  
ATOM 5216  H HA   . ARG A 1 93  ? -11.057 2.010   1.440   1.00 0.00 ? 93  ARG A HA   3  
ATOM 5217  H HB2  . ARG A 1 93  ? -12.604 0.641   2.937   1.00 0.00 ? 93  ARG A HB2  3  
ATOM 5218  H HB3  . ARG A 1 93  ? -11.831 -0.208  1.604   1.00 0.00 ? 93  ARG A HB3  3  
ATOM 5219  H HG2  . ARG A 1 93  ? -10.295 -1.275  3.051   1.00 0.00 ? 93  ARG A HG2  3  
ATOM 5220  H HG3  . ARG A 1 93  ? -10.736 -0.227  4.401   1.00 0.00 ? 93  ARG A HG3  3  
ATOM 5221  H HD2  . ARG A 1 93  ? -11.846 -2.227  4.859   1.00 0.00 ? 93  ARG A HD2  3  
ATOM 5222  H HD3  . ARG A 1 93  ? -13.090 -1.209  4.135   1.00 0.00 ? 93  ARG A HD3  3  
ATOM 5223  H HE   . ARG A 1 93  ? -11.912 -3.600  3.004   1.00 0.00 ? 93  ARG A HE   3  
ATOM 5224  H HH11 . ARG A 1 93  ? -13.805 -0.731  2.451   1.00 0.00 ? 93  ARG A HH11 3  
ATOM 5225  H HH12 . ARG A 1 93  ? -14.556 -1.346  1.015   1.00 0.00 ? 93  ARG A HH12 3  
ATOM 5226  H HH21 . ARG A 1 93  ? -12.894 -4.420  1.116   1.00 0.00 ? 93  ARG A HH21 3  
ATOM 5227  H HH22 . ARG A 1 93  ? -14.037 -3.444  0.257   1.00 0.00 ? 93  ARG A HH22 3  
ATOM 5228  N N    . PRO A 1 94  ? -11.296 3.650   3.277   1.00 0.00 ? 94  PRO A N    3  
ATOM 5229  C CA   . PRO A 1 94  ? -11.428 4.671   4.321   1.00 0.00 ? 94  PRO A CA   3  
ATOM 5230  C C    . PRO A 1 94  ? -12.517 4.328   5.332   1.00 0.00 ? 94  PRO A C    3  
ATOM 5231  O O    . PRO A 1 94  ? -13.462 3.604   5.020   1.00 0.00 ? 94  PRO A O    3  
ATOM 5232  C CB   . PRO A 1 94  ? -11.802 5.932   3.538   1.00 0.00 ? 94  PRO A CB   3  
ATOM 5233  C CG   . PRO A 1 94  ? -12.449 5.428   2.294   1.00 0.00 ? 94  PRO A CG   3  
ATOM 5234  C CD   . PRO A 1 94  ? -11.760 4.133   1.965   1.00 0.00 ? 94  PRO A CD   3  
ATOM 5235  H HA   . PRO A 1 94  ? -10.494 4.831   4.839   1.00 0.00 ? 94  PRO A HA   3  
ATOM 5236  H HB2  . PRO A 1 94  ? -12.484 6.533   4.124   1.00 0.00 ? 94  PRO A HB2  3  
ATOM 5237  H HB3  . PRO A 1 94  ? -10.911 6.501   3.318   1.00 0.00 ? 94  PRO A HB3  3  
ATOM 5238  H HG2  . PRO A 1 94  ? -13.500 5.260   2.469   1.00 0.00 ? 94  PRO A HG2  3  
ATOM 5239  H HG3  . PRO A 1 94  ? -12.309 6.140   1.494   1.00 0.00 ? 94  PRO A HG3  3  
ATOM 5240  H HD2  . PRO A 1 94  ? -12.457 3.437   1.522   1.00 0.00 ? 94  PRO A HD2  3  
ATOM 5241  H HD3  . PRO A 1 94  ? -10.925 4.307   1.302   1.00 0.00 ? 94  PRO A HD3  3  
ATOM 5242  N N    . TYR A 1 95  ? -12.378 4.854   6.544   1.00 0.00 ? 95  TYR A N    3  
ATOM 5243  C CA   . TYR A 1 95  ? -13.349 4.602   7.602   1.00 0.00 ? 95  TYR A CA   3  
ATOM 5244  C C    . TYR A 1 95  ? -13.281 5.686   8.673   1.00 0.00 ? 95  TYR A C    3  
ATOM 5245  O O    . TYR A 1 95  ? -12.209 6.207   8.980   1.00 0.00 ? 95  TYR A O    3  
ATOM 5246  C CB   . TYR A 1 95  ? -13.103 3.230   8.233   1.00 0.00 ? 95  TYR A CB   3  
ATOM 5247  C CG   . TYR A 1 95  ? -12.092 3.254   9.357   1.00 0.00 ? 95  TYR A CG   3  
ATOM 5248  C CD1  . TYR A 1 95  ? -12.453 3.666   10.634  1.00 0.00 ? 95  TYR A CD1  3  
ATOM 5249  C CD2  . TYR A 1 95  ? -10.776 2.865   9.143   1.00 0.00 ? 95  TYR A CD2  3  
ATOM 5250  C CE1  . TYR A 1 95  ? -11.533 3.690   11.664  1.00 0.00 ? 95  TYR A CE1  3  
ATOM 5251  C CE2  . TYR A 1 95  ? -9.849  2.884   10.167  1.00 0.00 ? 95  TYR A CE2  3  
ATOM 5252  C CZ   . TYR A 1 95  ? -10.233 3.297   11.426  1.00 0.00 ? 95  TYR A CZ   3  
ATOM 5253  O OH   . TYR A 1 95  ? -9.312  3.319   12.449  1.00 0.00 ? 95  TYR A OH   3  
ATOM 5254  H H    . TYR A 1 95  ? -11.603 5.423   6.733   1.00 0.00 ? 95  TYR A H    3  
ATOM 5255  H HA   . TYR A 1 95  ? -14.333 4.611   7.158   1.00 0.00 ? 95  TYR A HA   3  
ATOM 5256  H HB2  . TYR A 1 95  ? -14.032 2.853   8.631   1.00 0.00 ? 95  TYR A HB2  3  
ATOM 5257  H HB3  . TYR A 1 95  ? -12.740 2.552   7.475   1.00 0.00 ? 95  TYR A HB3  3  
ATOM 5258  H HD1  . TYR A 1 95  ? -13.473 3.973   10.818  1.00 0.00 ? 95  TYR A HD1  3  
ATOM 5259  H HD2  . TYR A 1 95  ? -10.479 2.542   8.155   1.00 0.00 ? 95  TYR A HD2  3  
ATOM 5260  H HE1  . TYR A 1 95  ? -11.833 4.013   12.650  1.00 0.00 ? 95  TYR A HE1  3  
ATOM 5261  H HE2  . TYR A 1 95  ? -8.831  2.577   9.981   1.00 0.00 ? 95  TYR A HE2  3  
ATOM 5262  H HH   . TYR A 1 95  ? -9.287  4.196   12.838  1.00 0.00 ? 95  TYR A HH   3  
ATOM 5263  N N    . PHE A 1 96  ? -14.436 6.022   9.239   1.00 0.00 ? 96  PHE A N    3  
ATOM 5264  C CA   . PHE A 1 96  ? -14.510 7.045   10.276  1.00 0.00 ? 96  PHE A CA   3  
ATOM 5265  C C    . PHE A 1 96  ? -14.690 6.411   11.653  1.00 0.00 ? 96  PHE A C    3  
ATOM 5266  O O    . PHE A 1 96  ? -13.754 6.354   12.449  1.00 0.00 ? 96  PHE A O    3  
ATOM 5267  C CB   . PHE A 1 96  ? -15.664 8.008   9.991   1.00 0.00 ? 96  PHE A CB   3  
ATOM 5268  C CG   . PHE A 1 96  ? -15.788 9.111   11.003  1.00 0.00 ? 96  PHE A CG   3  
ATOM 5269  C CD1  . PHE A 1 96  ? -14.763 10.026  11.180  1.00 0.00 ? 96  PHE A CD1  3  
ATOM 5270  C CD2  . PHE A 1 96  ? -16.931 9.232   11.778  1.00 0.00 ? 96  PHE A CD2  3  
ATOM 5271  C CE1  . PHE A 1 96  ? -14.875 11.042  12.110  1.00 0.00 ? 96  PHE A CE1  3  
ATOM 5272  C CE2  . PHE A 1 96  ? -17.048 10.246  12.709  1.00 0.00 ? 96  PHE A CE2  3  
ATOM 5273  C CZ   . PHE A 1 96  ? -16.019 11.152  12.876  1.00 0.00 ? 96  PHE A CZ   3  
ATOM 5274  H H    . PHE A 1 96  ? -15.258 5.571   8.953   1.00 0.00 ? 96  PHE A H    3  
ATOM 5275  H HA   . PHE A 1 96  ? -13.582 7.595   10.265  1.00 0.00 ? 96  PHE A HA   3  
ATOM 5276  H HB2  . PHE A 1 96  ? -15.513 8.462   9.023   1.00 0.00 ? 96  PHE A HB2  3  
ATOM 5277  H HB3  . PHE A 1 96  ? -16.591 7.456   9.984   1.00 0.00 ? 96  PHE A HB3  3  
ATOM 5278  H HD1  . PHE A 1 96  ? -13.868 9.941   10.580  1.00 0.00 ? 96  PHE A HD1  3  
ATOM 5279  H HD2  . PHE A 1 96  ? -17.736 8.524   11.649  1.00 0.00 ? 96  PHE A HD2  3  
ATOM 5280  H HE1  . PHE A 1 96  ? -14.068 11.748  12.238  1.00 0.00 ? 96  PHE A HE1  3  
ATOM 5281  H HE2  . PHE A 1 96  ? -17.943 10.329  13.307  1.00 0.00 ? 96  PHE A HE2  3  
ATOM 5282  H HZ   . PHE A 1 96  ? -16.108 11.945  13.603  1.00 0.00 ? 96  PHE A HZ   3  
ATOM 5283  N N    . ASN A 1 97  ? -15.902 5.938   11.926  1.00 0.00 ? 97  ASN A N    3  
ATOM 5284  C CA   . ASN A 1 97  ? -16.206 5.310   13.206  1.00 0.00 ? 97  ASN A CA   3  
ATOM 5285  C C    . ASN A 1 97  ? -16.239 3.790   13.073  1.00 0.00 ? 97  ASN A C    3  
ATOM 5286  O O    . ASN A 1 97  ? -15.446 3.086   13.697  1.00 0.00 ? 97  ASN A O    3  
ATOM 5287  C CB   . ASN A 1 97  ? -17.549 5.815   13.739  1.00 0.00 ? 97  ASN A CB   3  
ATOM 5288  C CG   . ASN A 1 97  ? -17.480 7.255   14.208  1.00 0.00 ? 97  ASN A CG   3  
ATOM 5289  O OD1  . ASN A 1 97  ? -18.256 8.102   13.764  1.00 0.00 ? 97  ASN A OD1  3  
ATOM 5290  N ND2  . ASN A 1 97  ? -16.547 7.540   15.109  1.00 0.00 ? 97  ASN A ND2  3  
ATOM 5291  H H    . ASN A 1 97  ? -16.608 6.013   11.250  1.00 0.00 ? 97  ASN A H    3  
ATOM 5292  H HA   . ASN A 1 97  ? -15.428 5.582   13.902  1.00 0.00 ? 97  ASN A HA   3  
ATOM 5293  H HB2  . ASN A 1 97  ? -18.289 5.747   12.955  1.00 0.00 ? 97  ASN A HB2  3  
ATOM 5294  H HB3  . ASN A 1 97  ? -17.854 5.198   14.571  1.00 0.00 ? 97  ASN A HB3  3  
ATOM 5295  H HD21 . ASN A 1 97  ? -15.964 6.815   15.417  1.00 0.00 ? 97  ASN A HD21 3  
ATOM 5296  H HD22 . ASN A 1 97  ? -16.481 8.464   15.430  1.00 0.00 ? 97  ASN A HD22 3  
ATOM 5297  N N    . GLU A 1 98  ? -17.160 3.293   12.254  1.00 0.00 ? 98  GLU A N    3  
ATOM 5298  C CA   . GLU A 1 98  ? -17.295 1.857   12.039  1.00 0.00 ? 98  GLU A CA   3  
ATOM 5299  C C    . GLU A 1 98  ? -17.417 1.539   10.552  1.00 0.00 ? 98  GLU A C    3  
ATOM 5300  O O    . GLU A 1 98  ? -16.732 0.655   10.036  1.00 0.00 ? 98  GLU A O    3  
ATOM 5301  C CB   . GLU A 1 98  ? -18.516 1.319   12.789  1.00 0.00 ? 98  GLU A CB   3  
ATOM 5302  C CG   . GLU A 1 98  ? -19.753 2.189   12.641  1.00 0.00 ? 98  GLU A CG   3  
ATOM 5303  C CD   . GLU A 1 98  ? -20.924 1.682   13.460  1.00 0.00 ? 98  GLU A CD   3  
ATOM 5304  O OE1  . GLU A 1 98  ? -21.027 2.059   14.646  1.00 0.00 ? 98  GLU A OE1  3  
ATOM 5305  O OE2  . GLU A 1 98  ? -21.737 0.907   12.915  1.00 0.00 ? 98  GLU A OE2  3  
ATOM 5306  H H    . GLU A 1 98  ? -17.764 3.906   11.784  1.00 0.00 ? 98  GLU A H    3  
ATOM 5307  H HA   . GLU A 1 98  ? -16.408 1.379   12.425  1.00 0.00 ? 98  GLU A HA   3  
ATOM 5308  H HB2  . GLU A 1 98  ? -18.747 0.333   12.415  1.00 0.00 ? 98  GLU A HB2  3  
ATOM 5309  H HB3  . GLU A 1 98  ? -18.275 1.249   13.839  1.00 0.00 ? 98  GLU A HB3  3  
ATOM 5310  H HG2  . GLU A 1 98  ? -19.514 3.191   12.964  1.00 0.00 ? 98  GLU A HG2  3  
ATOM 5311  H HG3  . GLU A 1 98  ? -20.042 2.207   11.600  1.00 0.00 ? 98  GLU A HG3  3  
ATOM 5312  N N    . PHE A 1 99  ? -18.296 2.264   9.867   1.00 0.00 ? 99  PHE A N    3  
ATOM 5313  C CA   . PHE A 1 99  ? -18.510 2.059   8.440   1.00 0.00 ? 99  PHE A CA   3  
ATOM 5314  C C    . PHE A 1 99  ? -17.188 2.106   7.679   1.00 0.00 ? 99  PHE A C    3  
ATOM 5315  O O    . PHE A 1 99  ? -16.128 2.313   8.269   1.00 0.00 ? 99  PHE A O    3  
ATOM 5316  C CB   . PHE A 1 99  ? -19.466 3.119   7.888   1.00 0.00 ? 99  PHE A CB   3  
ATOM 5317  C CG   . PHE A 1 99  ? -19.253 4.484   8.479   1.00 0.00 ? 99  PHE A CG   3  
ATOM 5318  C CD1  . PHE A 1 99  ? -19.904 4.858   9.643   1.00 0.00 ? 99  PHE A CD1  3  
ATOM 5319  C CD2  . PHE A 1 99  ? -18.403 5.392   7.869   1.00 0.00 ? 99  PHE A CD2  3  
ATOM 5320  C CE1  . PHE A 1 99  ? -19.710 6.113   10.189  1.00 0.00 ? 99  PHE A CE1  3  
ATOM 5321  C CE2  . PHE A 1 99  ? -18.205 6.648   8.411   1.00 0.00 ? 99  PHE A CE2  3  
ATOM 5322  C CZ   . PHE A 1 99  ? -18.860 7.009   9.571   1.00 0.00 ? 99  PHE A CZ   3  
ATOM 5323  H H    . PHE A 1 99  ? -18.813 2.954   10.334  1.00 0.00 ? 99  PHE A H    3  
ATOM 5324  H HA   . PHE A 1 99  ? -18.953 1.084   8.309   1.00 0.00 ? 99  PHE A HA   3  
ATOM 5325  H HB2  . PHE A 1 99  ? -19.330 3.195   6.820   1.00 0.00 ? 99  PHE A HB2  3  
ATOM 5326  H HB3  . PHE A 1 99  ? -20.482 2.820   8.097   1.00 0.00 ? 99  PHE A HB3  3  
ATOM 5327  H HD1  . PHE A 1 99  ? -20.570 4.158   10.127  1.00 0.00 ? 99  PHE A HD1  3  
ATOM 5328  H HD2  . PHE A 1 99  ? -17.890 5.111   6.961   1.00 0.00 ? 99  PHE A HD2  3  
ATOM 5329  H HE1  . PHE A 1 99  ? -20.225 6.393   11.097  1.00 0.00 ? 99  PHE A HE1  3  
ATOM 5330  H HE2  . PHE A 1 99  ? -17.540 7.347   7.926   1.00 0.00 ? 99  PHE A HE2  3  
ATOM 5331  H HZ   . PHE A 1 99  ? -18.707 7.990   9.997   1.00 0.00 ? 99  PHE A HZ   3  
ATOM 5332  N N    . GLN A 1 100 ? -17.260 1.911   6.366   1.00 0.00 ? 100 GLN A N    3  
ATOM 5333  C CA   . GLN A 1 100 ? -16.069 1.929   5.525   1.00 0.00 ? 100 GLN A CA   3  
ATOM 5334  C C    . GLN A 1 100 ? -16.411 2.376   4.107   1.00 0.00 ? 100 GLN A C    3  
ATOM 5335  O O    . GLN A 1 100 ? -17.198 1.731   3.416   1.00 0.00 ? 100 GLN A O    3  
ATOM 5336  C CB   . GLN A 1 100 ? -15.420 0.545   5.494   1.00 0.00 ? 100 GLN A CB   3  
ATOM 5337  C CG   . GLN A 1 100 ? -16.215 -0.483  4.704   1.00 0.00 ? 100 GLN A CG   3  
ATOM 5338  C CD   . GLN A 1 100 ? -15.879 -1.908  5.097   1.00 0.00 ? 100 GLN A CD   3  
ATOM 5339  O OE1  . GLN A 1 100 ? -15.212 -2.628  4.354   1.00 0.00 ? 100 GLN A OE1  3  
ATOM 5340  N NE2  . GLN A 1 100 ? -16.341 -2.323  6.271   1.00 0.00 ? 100 GLN A NE2  3  
ATOM 5341  H H    . GLN A 1 100 ? -18.134 1.751   5.954   1.00 0.00 ? 100 GLN A H    3  
ATOM 5342  H HA   . GLN A 1 100 ? -15.372 2.634   5.953   1.00 0.00 ? 100 GLN A HA   3  
ATOM 5343  H HB2  . GLN A 1 100 ? -14.440 0.630   5.049   1.00 0.00 ? 100 GLN A HB2  3  
ATOM 5344  H HB3  . GLN A 1 100 ? -15.316 0.186   6.507   1.00 0.00 ? 100 GLN A HB3  3  
ATOM 5345  H HG2  . GLN A 1 100 ? -17.267 -0.316  4.879   1.00 0.00 ? 100 GLN A HG2  3  
ATOM 5346  H HG3  . GLN A 1 100 ? -16.001 -0.354  3.654   1.00 0.00 ? 100 GLN A HG3  3  
ATOM 5347  H HE21 . GLN A 1 100 ? -16.866 -1.695  6.810   1.00 0.00 ? 100 GLN A HE21 3  
ATOM 5348  H HE22 . GLN A 1 100 ? -16.139 -3.240  6.549   1.00 0.00 ? 100 GLN A HE22 3  
ATOM 5349  N N    . GLY A 1 101 ? -15.813 3.484   3.681   1.00 0.00 ? 101 GLY A N    3  
ATOM 5350  C CA   . GLY A 1 101 ? -16.068 3.998   2.348   1.00 0.00 ? 101 GLY A CA   3  
ATOM 5351  C C    . GLY A 1 101 ? -15.825 2.960   1.270   1.00 0.00 ? 101 GLY A C    3  
ATOM 5352  O O    . GLY A 1 101 ? -15.652 1.778   1.565   1.00 0.00 ? 101 GLY A O    3  
ATOM 5353  H H    . GLY A 1 101 ? -15.195 3.957   4.276   1.00 0.00 ? 101 GLY A H    3  
ATOM 5354  H HA2  . GLY A 1 101 ? -17.095 4.327   2.291   1.00 0.00 ? 101 GLY A HA2  3  
ATOM 5355  H HA3  . GLY A 1 101 ? -15.419 4.843   2.170   1.00 0.00 ? 101 GLY A HA3  3  
ATOM 5356  N N    . MET A 1 102 ? -15.812 3.402   0.017   1.00 0.00 ? 102 MET A N    3  
ATOM 5357  C CA   . MET A 1 102 ? -15.589 2.502   -1.109  1.00 0.00 ? 102 MET A CA   3  
ATOM 5358  C C    . MET A 1 102 ? -14.169 1.946   -1.086  1.00 0.00 ? 102 MET A C    3  
ATOM 5359  O O    . MET A 1 102 ? -13.237 2.616   -0.642  1.00 0.00 ? 102 MET A O    3  
ATOM 5360  C CB   . MET A 1 102 ? -15.844 3.230   -2.430  1.00 0.00 ? 102 MET A CB   3  
ATOM 5361  C CG   . MET A 1 102 ? -17.317 3.356   -2.780  1.00 0.00 ? 102 MET A CG   3  
ATOM 5362  S SD   . MET A 1 102 ? -17.588 3.711   -4.527  1.00 0.00 ? 102 MET A SD   3  
ATOM 5363  C CE   . MET A 1 102 ? -16.813 5.319   -4.670  1.00 0.00 ? 102 MET A CE   3  
ATOM 5364  H H    . MET A 1 102 ? -15.956 4.356   -0.156  1.00 0.00 ? 102 MET A H    3  
ATOM 5365  H HA   . MET A 1 102 ? -16.286 1.682   -1.020  1.00 0.00 ? 102 MET A HA   3  
ATOM 5366  H HB2  . MET A 1 102 ? -15.424 4.223   -2.367  1.00 0.00 ? 102 MET A HB2  3  
ATOM 5367  H HB3  . MET A 1 102 ? -15.352 2.690   -3.225  1.00 0.00 ? 102 MET A HB3  3  
ATOM 5368  H HG2  . MET A 1 102 ? -17.813 2.428   -2.535  1.00 0.00 ? 102 MET A HG2  3  
ATOM 5369  H HG3  . MET A 1 102 ? -17.745 4.156   -2.194  1.00 0.00 ? 102 MET A HG3  3  
ATOM 5370  H HE1  . MET A 1 102 ? -16.537 5.496   -5.699  1.00 0.00 ? 102 MET A HE1  3  
ATOM 5371  H HE2  . MET A 1 102 ? -17.505 6.082   -4.347  1.00 0.00 ? 102 MET A HE2  3  
ATOM 5372  H HE3  . MET A 1 102 ? -15.929 5.349   -4.050  1.00 0.00 ? 102 MET A HE3  3  
ATOM 5373  N N    . ASP A 1 103 ? -14.012 0.717   -1.567  1.00 0.00 ? 103 ASP A N    3  
ATOM 5374  C CA   . ASP A 1 103 ? -12.705 0.072   -1.603  1.00 0.00 ? 103 ASP A CA   3  
ATOM 5375  C C    . ASP A 1 103 ? -12.050 0.246   -2.970  1.00 0.00 ? 103 ASP A C    3  
ATOM 5376  O O    . ASP A 1 103 ? -12.679 0.023   -4.004  1.00 0.00 ? 103 ASP A O    3  
ATOM 5377  C CB   . ASP A 1 103 ? -12.838 -1.416  -1.274  1.00 0.00 ? 103 ASP A CB   3  
ATOM 5378  C CG   . ASP A 1 103 ? -14.150 -2.001  -1.760  1.00 0.00 ? 103 ASP A CG   3  
ATOM 5379  O OD1  . ASP A 1 103 ? -15.211 -1.571  -1.263  1.00 0.00 ? 103 ASP A OD1  3  
ATOM 5380  O OD2  . ASP A 1 103 ? -14.115 -2.890  -2.637  1.00 0.00 ? 103 ASP A OD2  3  
ATOM 5381  H H    . ASP A 1 103 ? -14.794 0.234   -1.907  1.00 0.00 ? 103 ASP A H    3  
ATOM 5382  H HA   . ASP A 1 103 ? -12.082 0.541   -0.857  1.00 0.00 ? 103 ASP A HA   3  
ATOM 5383  H HB2  . ASP A 1 103 ? -12.029 -1.956  -1.744  1.00 0.00 ? 103 ASP A HB2  3  
ATOM 5384  H HB3  . ASP A 1 103 ? -12.780 -1.548  -0.204  1.00 0.00 ? 103 ASP A HB3  3  
ATOM 5385  N N    . SER A 1 104 ? -10.783 0.648   -2.966  1.00 0.00 ? 104 SER A N    3  
ATOM 5386  C CA   . SER A 1 104 ? -10.044 0.858   -4.205  1.00 0.00 ? 104 SER A CA   3  
ATOM 5387  C C    . SER A 1 104 ? -9.853  -0.458  -4.953  1.00 0.00 ? 104 SER A C    3  
ATOM 5388  O O    . SER A 1 104 ? -10.269 -1.517  -4.484  1.00 0.00 ? 104 SER A O    3  
ATOM 5389  C CB   . SER A 1 104 ? -8.683  1.492   -3.911  1.00 0.00 ? 104 SER A CB   3  
ATOM 5390  O OG   . SER A 1 104 ? -7.930  0.693   -3.015  1.00 0.00 ? 104 SER A OG   3  
ATOM 5391  H H    . SER A 1 104 ? -10.335 0.809   -2.109  1.00 0.00 ? 104 SER A H    3  
ATOM 5392  H HA   . SER A 1 104 ? -10.618 1.530   -4.825  1.00 0.00 ? 104 SER A HA   3  
ATOM 5393  H HB2  . SER A 1 104 ? -8.130  1.596   -4.833  1.00 0.00 ? 104 SER A HB2  3  
ATOM 5394  H HB3  . SER A 1 104 ? -8.831  2.466   -3.468  1.00 0.00 ? 104 SER A HB3  3  
ATOM 5395  H HG   . SER A 1 104 ? -7.182  1.197   -2.688  1.00 0.00 ? 104 SER A HG   3  
ATOM 5396  N N    . GLU A 1 105 ? -9.220  -0.382  -6.120  1.00 0.00 ? 105 GLU A N    3  
ATOM 5397  C CA   . GLU A 1 105 ? -8.975  -1.567  -6.934  1.00 0.00 ? 105 GLU A CA   3  
ATOM 5398  C C    . GLU A 1 105 ? -8.056  -2.545  -6.208  1.00 0.00 ? 105 GLU A C    3  
ATOM 5399  O O    . GLU A 1 105 ? -6.898  -2.235  -5.929  1.00 0.00 ? 105 GLU A O    3  
ATOM 5400  C CB   . GLU A 1 105 ? -8.358  -1.172  -8.277  1.00 0.00 ? 105 GLU A CB   3  
ATOM 5401  C CG   . GLU A 1 105 ? -6.992  -0.519  -8.150  1.00 0.00 ? 105 GLU A CG   3  
ATOM 5402  C CD   . GLU A 1 105 ? -6.592  0.245   -9.398  1.00 0.00 ? 105 GLU A CD   3  
ATOM 5403  O OE1  . GLU A 1 105 ? -6.918  -0.223  -10.509 1.00 0.00 ? 105 GLU A OE1  3  
ATOM 5404  O OE2  . GLU A 1 105 ? -5.954  1.310   -9.263  1.00 0.00 ? 105 GLU A OE2  3  
ATOM 5405  H H    . GLU A 1 105 ? -8.912  0.491   -6.441  1.00 0.00 ? 105 GLU A H    3  
ATOM 5406  H HA   . GLU A 1 105 ? -9.924  -2.049  -7.113  1.00 0.00 ? 105 GLU A HA   3  
ATOM 5407  H HB2  . GLU A 1 105 ? -8.256  -2.057  -8.887  1.00 0.00 ? 105 GLU A HB2  3  
ATOM 5408  H HB3  . GLU A 1 105 ? -9.020  -0.478  -8.773  1.00 0.00 ? 105 GLU A HB3  3  
ATOM 5409  H HG2  . GLU A 1 105 ? -7.011  0.168   -7.317  1.00 0.00 ? 105 GLU A HG2  3  
ATOM 5410  H HG3  . GLU A 1 105 ? -6.255  -1.287  -7.965  1.00 0.00 ? 105 GLU A HG3  3  
ATOM 5411  N N    . SER A 1 106 ? -8.582  -3.727  -5.903  1.00 0.00 ? 106 SER A N    3  
ATOM 5412  C CA   . SER A 1 106 ? -7.812  -4.750  -5.205  1.00 0.00 ? 106 SER A CA   3  
ATOM 5413  C C    . SER A 1 106 ? -6.560  -5.121  -5.995  1.00 0.00 ? 106 SER A C    3  
ATOM 5414  O O    . SER A 1 106 ? -6.644  -5.698  -7.079  1.00 0.00 ? 106 SER A O    3  
ATOM 5415  C CB   . SER A 1 106 ? -8.670  -5.995  -4.973  1.00 0.00 ? 106 SER A CB   3  
ATOM 5416  O OG   . SER A 1 106 ? -9.974  -5.643  -4.546  1.00 0.00 ? 106 SER A OG   3  
ATOM 5417  H H    . SER A 1 106 ? -9.512  -3.915  -6.152  1.00 0.00 ? 106 SER A H    3  
ATOM 5418  H HA   . SER A 1 106 ? -7.513  -4.345  -4.250  1.00 0.00 ? 106 SER A HA   3  
ATOM 5419  H HB2  . SER A 1 106 ? -8.744  -6.555  -5.892  1.00 0.00 ? 106 SER A HB2  3  
ATOM 5420  H HB3  . SER A 1 106 ? -8.209  -6.610  -4.213  1.00 0.00 ? 106 SER A HB3  3  
ATOM 5421  H HG   . SER A 1 106 ? -10.105 -5.935  -3.641  1.00 0.00 ? 106 SER A HG   3  
ATOM 5422  N N    . LYS A 1 107 ? -5.399  -4.785  -5.444  1.00 0.00 ? 107 LYS A N    3  
ATOM 5423  C CA   . LYS A 1 107 ? -4.128  -5.083  -6.094  1.00 0.00 ? 107 LYS A CA   3  
ATOM 5424  C C    . LYS A 1 107 ? -3.477  -6.316  -5.477  1.00 0.00 ? 107 LYS A C    3  
ATOM 5425  O O    . LYS A 1 107 ? -3.539  -6.524  -4.265  1.00 0.00 ? 107 LYS A O    3  
ATOM 5426  C CB   . LYS A 1 107 ? -3.183  -3.884  -5.984  1.00 0.00 ? 107 LYS A CB   3  
ATOM 5427  C CG   . LYS A 1 107 ? -3.728  -2.619  -6.623  1.00 0.00 ? 107 LYS A CG   3  
ATOM 5428  C CD   . LYS A 1 107 ? -3.462  -2.590  -8.119  1.00 0.00 ? 107 LYS A CD   3  
ATOM 5429  C CE   . LYS A 1 107 ? -3.542  -1.175  -8.672  1.00 0.00 ? 107 LYS A CE   3  
ATOM 5430  N NZ   . LYS A 1 107 ? -3.726  -1.167  -10.150 1.00 0.00 ? 107 LYS A NZ   3  
ATOM 5431  H H    . LYS A 1 107 ? -5.396  -4.326  -4.578  1.00 0.00 ? 107 LYS A H    3  
ATOM 5432  H HA   . LYS A 1 107 ? -4.327  -5.279  -7.137  1.00 0.00 ? 107 LYS A HA   3  
ATOM 5433  H HB2  . LYS A 1 107 ? -2.995  -3.684  -4.940  1.00 0.00 ? 107 LYS A HB2  3  
ATOM 5434  H HB3  . LYS A 1 107 ? -2.249  -4.133  -6.468  1.00 0.00 ? 107 LYS A HB3  3  
ATOM 5435  H HG2  . LYS A 1 107 ? -4.794  -2.573  -6.457  1.00 0.00 ? 107 LYS A HG2  3  
ATOM 5436  H HG3  . LYS A 1 107 ? -3.253  -1.762  -6.165  1.00 0.00 ? 107 LYS A HG3  3  
ATOM 5437  H HD2  . LYS A 1 107 ? -2.474  -2.982  -8.308  1.00 0.00 ? 107 LYS A HD2  3  
ATOM 5438  H HD3  . LYS A 1 107 ? -4.197  -3.205  -8.618  1.00 0.00 ? 107 LYS A HD3  3  
ATOM 5439  H HE2  . LYS A 1 107 ? -4.377  -0.669  -8.211  1.00 0.00 ? 107 LYS A HE2  3  
ATOM 5440  H HE3  . LYS A 1 107 ? -2.627  -0.655  -8.428  1.00 0.00 ? 107 LYS A HE3  3  
ATOM 5441  H HZ1  . LYS A 1 107 ? -3.622  -2.131  -10.528 1.00 0.00 ? 107 LYS A HZ1  3  
ATOM 5442  H HZ2  . LYS A 1 107 ? -3.013  -0.554  -10.595 1.00 0.00 ? 107 LYS A HZ2  3  
ATOM 5443  H HZ3  . LYS A 1 107 ? -4.673  -0.812  -10.390 1.00 0.00 ? 107 LYS A HZ3  3  
ATOM 5444  N N    . THR A 1 108 ? -2.850  -7.133  -6.318  1.00 0.00 ? 108 THR A N    3  
ATOM 5445  C CA   . THR A 1 108 ? -2.187  -8.345  -5.855  1.00 0.00 ? 108 THR A CA   3  
ATOM 5446  C C    . THR A 1 108 ? -0.679  -8.145  -5.761  1.00 0.00 ? 108 THR A C    3  
ATOM 5447  O O    . THR A 1 108 ? -0.067  -7.535  -6.638  1.00 0.00 ? 108 THR A O    3  
ATOM 5448  C CB   . THR A 1 108 ? -2.478  -9.536  -6.788  1.00 0.00 ? 108 THR A CB   3  
ATOM 5449  O OG1  . THR A 1 108 ? -2.464  -9.104  -8.153  1.00 0.00 ? 108 THR A OG1  3  
ATOM 5450  C CG2  . THR A 1 108 ? -3.826  -10.161 -6.463  1.00 0.00 ? 108 THR A CG2  3  
ATOM 5451  H H    . THR A 1 108 ? -2.835  -6.913  -7.273  1.00 0.00 ? 108 THR A H    3  
ATOM 5452  H HA   . THR A 1 108 ? -2.572  -8.581  -4.874  1.00 0.00 ? 108 THR A HA   3  
ATOM 5453  H HB   . THR A 1 108 ? -1.708  -10.281 -6.646  1.00 0.00 ? 108 THR A HB   3  
ATOM 5454  H HG1  . THR A 1 108 ? -1.709  -8.528  -8.299  1.00 0.00 ? 108 THR A HG1  3  
ATOM 5455  H HG21 . THR A 1 108 ? -4.286  -9.622  -5.648  1.00 0.00 ? 108 THR A HG21 3  
ATOM 5456  H HG22 . THR A 1 108 ? -3.685  -11.193 -6.179  1.00 0.00 ? 108 THR A HG22 3  
ATOM 5457  H HG23 . THR A 1 108 ? -4.465  -10.111 -7.332  1.00 0.00 ? 108 THR A HG23 3  
ATOM 5458  N N    . VAL A 1 109 ? -0.084  -8.664  -4.692  1.00 0.00 ? 109 VAL A N    3  
ATOM 5459  C CA   . VAL A 1 109 ? 1.355   -8.543  -4.483  1.00 0.00 ? 109 VAL A CA   3  
ATOM 5460  C C    . VAL A 1 109 ? 2.016   -9.915  -4.413  1.00 0.00 ? 109 VAL A C    3  
ATOM 5461  O O    . VAL A 1 109 ? 1.810   -10.667 -3.460  1.00 0.00 ? 109 VAL A O    3  
ATOM 5462  C CB   . VAL A 1 109 ? 1.672   -7.765  -3.192  1.00 0.00 ? 109 VAL A CB   3  
ATOM 5463  C CG1  . VAL A 1 109 ? 1.161   -8.521  -1.975  1.00 0.00 ? 109 VAL A CG1  3  
ATOM 5464  C CG2  . VAL A 1 109 ? 3.166   -7.506  -3.081  1.00 0.00 ? 109 VAL A CG2  3  
ATOM 5465  H H    . VAL A 1 109 ? -0.625  -9.139  -4.027  1.00 0.00 ? 109 VAL A H    3  
ATOM 5466  H HA   . VAL A 1 109 ? 1.768   -7.997  -5.319  1.00 0.00 ? 109 VAL A HA   3  
ATOM 5467  H HB   . VAL A 1 109 ? 1.164   -6.813  -3.236  1.00 0.00 ? 109 VAL A HB   3  
ATOM 5468  H HG11 . VAL A 1 109 ? 0.203   -8.964  -2.202  1.00 0.00 ? 109 VAL A HG11 3  
ATOM 5469  H HG12 . VAL A 1 109 ? 1.865   -9.296  -1.711  1.00 0.00 ? 109 VAL A HG12 3  
ATOM 5470  H HG13 . VAL A 1 109 ? 1.052   -7.836  -1.146  1.00 0.00 ? 109 VAL A HG13 3  
ATOM 5471  H HG21 . VAL A 1 109 ? 3.547   -7.975  -2.186  1.00 0.00 ? 109 VAL A HG21 3  
ATOM 5472  H HG22 . VAL A 1 109 ? 3.669   -7.917  -3.944  1.00 0.00 ? 109 VAL A HG22 3  
ATOM 5473  H HG23 . VAL A 1 109 ? 3.345   -6.442  -3.034  1.00 0.00 ? 109 VAL A HG23 3  
ATOM 5474  N N    . ARG A 1 110 ? 2.813   -10.234 -5.428  1.00 0.00 ? 110 ARG A N    3  
ATOM 5475  C CA   . ARG A 1 110 ? 3.505   -11.516 -5.481  1.00 0.00 ? 110 ARG A CA   3  
ATOM 5476  C C    . ARG A 1 110 ? 4.824   -11.454 -4.717  1.00 0.00 ? 110 ARG A C    3  
ATOM 5477  O O    . ARG A 1 110 ? 5.737   -10.717 -5.090  1.00 0.00 ? 110 ARG A O    3  
ATOM 5478  C CB   . ARG A 1 110 ? 3.763   -11.920 -6.934  1.00 0.00 ? 110 ARG A CB   3  
ATOM 5479  C CG   . ARG A 1 110 ? 3.874   -13.422 -7.138  1.00 0.00 ? 110 ARG A CG   3  
ATOM 5480  C CD   . ARG A 1 110 ? 4.138   -13.769 -8.595  1.00 0.00 ? 110 ARG A CD   3  
ATOM 5481  N NE   . ARG A 1 110 ? 4.855   -15.033 -8.736  1.00 0.00 ? 110 ARG A NE   3  
ATOM 5482  C CZ   . ARG A 1 110 ? 4.969   -15.689 -9.886  1.00 0.00 ? 110 ARG A CZ   3  
ATOM 5483  N NH1  . ARG A 1 110 ? 4.417   -15.202 -10.988 1.00 0.00 ? 110 ARG A NH1  3  
ATOM 5484  N NH2  . ARG A 1 110 ? 5.638   -16.834 -9.934  1.00 0.00 ? 110 ARG A NH2  3  
ATOM 5485  H H    . ARG A 1 110 ? 2.937   -9.593  -6.158  1.00 0.00 ? 110 ARG A H    3  
ATOM 5486  H HA   . ARG A 1 110 ? 2.869   -12.256 -5.019  1.00 0.00 ? 110 ARG A HA   3  
ATOM 5487  H HB2  . ARG A 1 110 ? 2.952   -11.555 -7.547  1.00 0.00 ? 110 ARG A HB2  3  
ATOM 5488  H HB3  . ARG A 1 110 ? 4.685   -11.465 -7.263  1.00 0.00 ? 110 ARG A HB3  3  
ATOM 5489  H HG2  . ARG A 1 110 ? 4.689   -13.799 -6.537  1.00 0.00 ? 110 ARG A HG2  3  
ATOM 5490  H HG3  . ARG A 1 110 ? 2.951   -13.888 -6.827  1.00 0.00 ? 110 ARG A HG3  3  
ATOM 5491  H HD2  . ARG A 1 110 ? 3.192   -13.844 -9.110  1.00 0.00 ? 110 ARG A HD2  3  
ATOM 5492  H HD3  . ARG A 1 110 ? 4.727   -12.979 -9.038  1.00 0.00 ? 110 ARG A HD3  3  
ATOM 5493  H HE   . ARG A 1 110 ? 5.272   -15.410 -7.934  1.00 0.00 ? 110 ARG A HE   3  
ATOM 5494  H HH11 . ARG A 1 110 ? 3.913   -14.339 -10.955 1.00 0.00 ? 110 ARG A HH11 3  
ATOM 5495  H HH12 . ARG A 1 110 ? 4.505   -15.698 -11.853 1.00 0.00 ? 110 ARG A HH12 3  
ATOM 5496  H HH21 . ARG A 1 110 ? 6.057   -17.204 -9.105  1.00 0.00 ? 110 ARG A HH21 3  
ATOM 5497  H HH22 . ARG A 1 110 ? 5.724   -17.327 -10.799 1.00 0.00 ? 110 ARG A HH22 3  
ATOM 5498  N N    . THR A 1 111 ? 4.918   -12.234 -3.644  1.00 0.00 ? 111 THR A N    3  
ATOM 5499  C CA   . THR A 1 111 ? 6.124   -12.267 -2.827  1.00 0.00 ? 111 THR A CA   3  
ATOM 5500  C C    . THR A 1 111 ? 7.139   -13.259 -3.383  1.00 0.00 ? 111 THR A C    3  
ATOM 5501  O O    . THR A 1 111 ? 6.989   -14.471 -3.227  1.00 0.00 ? 111 THR A O    3  
ATOM 5502  C CB   . THR A 1 111 ? 5.803   -12.643 -1.368  1.00 0.00 ? 111 THR A CB   3  
ATOM 5503  O OG1  . THR A 1 111 ? 5.084   -13.880 -1.327  1.00 0.00 ? 111 THR A OG1  3  
ATOM 5504  C CG2  . THR A 1 111 ? 4.983   -11.551 -0.696  1.00 0.00 ? 111 THR A CG2  3  
ATOM 5505  H H    . THR A 1 111 ? 4.157   -12.800 -3.398  1.00 0.00 ? 111 THR A H    3  
ATOM 5506  H HA   . THR A 1 111 ? 6.559   -11.278 -2.834  1.00 0.00 ? 111 THR A HA   3  
ATOM 5507  H HB   . THR A 1 111 ? 6.733   -12.757 -0.829  1.00 0.00 ? 111 THR A HB   3  
ATOM 5508  H HG1  . THR A 1 111 ? 5.431   -14.429 -0.619  1.00 0.00 ? 111 THR A HG1  3  
ATOM 5509  H HG21 . THR A 1 111 ? 3.935   -11.804 -0.750  1.00 0.00 ? 111 THR A HG21 3  
ATOM 5510  H HG22 . THR A 1 111 ? 5.154   -10.612 -1.199  1.00 0.00 ? 111 THR A HG22 3  
ATOM 5511  H HG23 . THR A 1 111 ? 5.280   -11.465 0.339   1.00 0.00 ? 111 THR A HG23 3  
ATOM 5512  N N    . THR A 1 112 ? 8.174   -12.737 -4.034  1.00 0.00 ? 112 THR A N    3  
ATOM 5513  C CA   . THR A 1 112 ? 9.214   -13.577 -4.615  1.00 0.00 ? 112 THR A CA   3  
ATOM 5514  C C    . THR A 1 112 ? 9.770   -14.554 -3.586  1.00 0.00 ? 112 THR A C    3  
ATOM 5515  O O    . THR A 1 112 ? 9.388   -14.521 -2.416  1.00 0.00 ? 112 THR A O    3  
ATOM 5516  C CB   . THR A 1 112 ? 10.371  -12.729 -5.178  1.00 0.00 ? 112 THR A CB   3  
ATOM 5517  O OG1  . THR A 1 112 ? 11.271  -13.561 -5.919  1.00 0.00 ? 112 THR A OG1  3  
ATOM 5518  C CG2  . THR A 1 112 ? 11.124  -12.029 -4.058  1.00 0.00 ? 112 THR A CG2  3  
ATOM 5519  H H    . THR A 1 112 ? 8.238   -11.763 -4.126  1.00 0.00 ? 112 THR A H    3  
ATOM 5520  H HA   . THR A 1 112 ? 8.776   -14.136 -5.428  1.00 0.00 ? 112 THR A HA   3  
ATOM 5521  H HB   . THR A 1 112 ? 9.959   -11.980 -5.839  1.00 0.00 ? 112 THR A HB   3  
ATOM 5522  H HG1  . THR A 1 112 ? 10.890  -13.761 -6.777  1.00 0.00 ? 112 THR A HG1  3  
ATOM 5523  H HG21 . THR A 1 112 ? 11.945  -12.651 -3.732  1.00 0.00 ? 112 THR A HG21 3  
ATOM 5524  H HG22 . THR A 1 112 ? 10.455  -11.853 -3.229  1.00 0.00 ? 112 THR A HG22 3  
ATOM 5525  H HG23 . THR A 1 112 ? 11.509  -11.087 -4.417  1.00 0.00 ? 112 THR A HG23 3  
ATOM 5526  N N    . GLU A 1 113 ? 10.673  -15.423 -4.029  1.00 0.00 ? 113 GLU A N    3  
ATOM 5527  C CA   . GLU A 1 113 ? 11.281  -16.410 -3.144  1.00 0.00 ? 113 GLU A CA   3  
ATOM 5528  C C    . GLU A 1 113 ? 12.803  -16.305 -3.175  1.00 0.00 ? 113 GLU A C    3  
ATOM 5529  O O    . GLU A 1 113 ? 13.450  -16.212 -2.133  1.00 0.00 ? 113 GLU A O    3  
ATOM 5530  C CB   . GLU A 1 113 ? 10.848  -17.822 -3.545  1.00 0.00 ? 113 GLU A CB   3  
ATOM 5531  C CG   . GLU A 1 113 ? 9.341   -17.990 -3.649  1.00 0.00 ? 113 GLU A CG   3  
ATOM 5532  C CD   . GLU A 1 113 ? 8.810   -17.649 -5.027  1.00 0.00 ? 113 GLU A CD   3  
ATOM 5533  O OE1  . GLU A 1 113 ? 8.848   -18.530 -5.912  1.00 0.00 ? 113 GLU A OE1  3  
ATOM 5534  O OE2  . GLU A 1 113 ? 8.356   -16.503 -5.222  1.00 0.00 ? 113 GLU A OE2  3  
ATOM 5535  H H    . GLU A 1 113 ? 10.936  -15.400 -4.972  1.00 0.00 ? 113 GLU A H    3  
ATOM 5536  H HA   . GLU A 1 113 ? 10.939  -16.211 -2.140  1.00 0.00 ? 113 GLU A HA   3  
ATOM 5537  H HB2  . GLU A 1 113 ? 11.283  -18.060 -4.504  1.00 0.00 ? 113 GLU A HB2  3  
ATOM 5538  H HB3  . GLU A 1 113 ? 11.217  -18.521 -2.809  1.00 0.00 ? 113 GLU A HB3  3  
ATOM 5539  H HG2  . GLU A 1 113 ? 9.090   -19.017 -3.427  1.00 0.00 ? 113 GLU A HG2  3  
ATOM 5540  H HG3  . GLU A 1 113 ? 8.869   -17.341 -2.926  1.00 0.00 ? 113 GLU A HG3  3  
ATOM 5541  N N    . GLU A 1 114 ? 13.367  -16.321 -4.379  1.00 0.00 ? 114 GLU A N    3  
ATOM 5542  C CA   . GLU A 1 114 ? 14.812  -16.229 -4.546  1.00 0.00 ? 114 GLU A CA   3  
ATOM 5543  C C    . GLU A 1 114 ? 15.180  -15.078 -5.477  1.00 0.00 ? 114 GLU A C    3  
ATOM 5544  O O    . GLU A 1 114 ? 16.084  -15.198 -6.304  1.00 0.00 ? 114 GLU A O    3  
ATOM 5545  C CB   . GLU A 1 114 ? 15.369  -17.543 -5.097  1.00 0.00 ? 114 GLU A CB   3  
ATOM 5546  C CG   . GLU A 1 114 ? 16.793  -17.834 -4.654  1.00 0.00 ? 114 GLU A CG   3  
ATOM 5547  C CD   . GLU A 1 114 ? 17.207  -19.268 -4.925  1.00 0.00 ? 114 GLU A CD   3  
ATOM 5548  O OE1  . GLU A 1 114 ? 17.614  -19.561 -6.069  1.00 0.00 ? 114 GLU A OE1  3  
ATOM 5549  O OE2  . GLU A 1 114 ? 17.124  -20.096 -3.994  1.00 0.00 ? 114 GLU A OE2  3  
ATOM 5550  H H    . GLU A 1 114 ? 12.798  -16.397 -5.173  1.00 0.00 ? 114 GLU A H    3  
ATOM 5551  H HA   . GLU A 1 114 ? 15.247  -16.044 -3.575  1.00 0.00 ? 114 GLU A HA   3  
ATOM 5552  H HB2  . GLU A 1 114 ? 14.738  -18.355 -4.767  1.00 0.00 ? 114 GLU A HB2  3  
ATOM 5553  H HB3  . GLU A 1 114 ? 15.352  -17.502 -6.176  1.00 0.00 ? 114 GLU A HB3  3  
ATOM 5554  H HG2  . GLU A 1 114 ? 17.464  -17.176 -5.185  1.00 0.00 ? 114 GLU A HG2  3  
ATOM 5555  H HG3  . GLU A 1 114 ? 16.872  -17.647 -3.593  1.00 0.00 ? 114 GLU A HG3  3  
ATOM 5556  N N    . SER A 1 115 ? 14.472  -13.961 -5.337  1.00 0.00 ? 115 SER A N    3  
ATOM 5557  C CA   . SER A 1 115 ? 14.720  -12.789 -6.168  1.00 0.00 ? 115 SER A CA   3  
ATOM 5558  C C    . SER A 1 115 ? 14.400  -11.506 -5.408  1.00 0.00 ? 115 SER A C    3  
ATOM 5559  O O    . SER A 1 115 ? 13.929  -11.546 -4.272  1.00 0.00 ? 115 SER A O    3  
ATOM 5560  C CB   . SER A 1 115 ? 13.885  -12.859 -7.448  1.00 0.00 ? 115 SER A CB   3  
ATOM 5561  O OG   . SER A 1 115 ? 14.452  -12.059 -8.471  1.00 0.00 ? 115 SER A OG   3  
ATOM 5562  H H    . SER A 1 115 ? 13.764  -13.927 -4.660  1.00 0.00 ? 115 SER A H    3  
ATOM 5563  H HA   . SER A 1 115 ? 15.768  -12.785 -6.431  1.00 0.00 ? 115 SER A HA   3  
ATOM 5564  H HB2  . SER A 1 115 ? 13.842  -13.882 -7.791  1.00 0.00 ? 115 SER A HB2  3  
ATOM 5565  H HB3  . SER A 1 115 ? 12.886  -12.505 -7.242  1.00 0.00 ? 115 SER A HB3  3  
ATOM 5566  H HG   . SER A 1 115 ? 13.751  -11.684 -9.010  1.00 0.00 ? 115 SER A HG   3  
ATOM 5567  N N    . GLY A 1 116 ? 14.658  -10.368 -6.044  1.00 0.00 ? 116 GLY A N    3  
ATOM 5568  C CA   . GLY A 1 116 ? 14.391  -9.088  -5.414  1.00 0.00 ? 116 GLY A CA   3  
ATOM 5569  C C    . GLY A 1 116 ? 15.591  -8.163  -5.450  1.00 0.00 ? 116 GLY A C    3  
ATOM 5570  O O    . GLY A 1 116 ? 16.666  -8.485  -4.945  1.00 0.00 ? 116 GLY A O    3  
ATOM 5571  H H    . GLY A 1 116 ? 15.033  -10.397 -6.950  1.00 0.00 ? 116 GLY A H    3  
ATOM 5572  H HA2  . GLY A 1 116 ? 13.567  -8.612  -5.924  1.00 0.00 ? 116 GLY A HA2  3  
ATOM 5573  H HA3  . GLY A 1 116 ? 14.113  -9.258  -4.384  1.00 0.00 ? 116 GLY A HA3  3  
ATOM 5574  N N    . PRO A 1 117 ? 15.414  -6.982  -6.061  1.00 0.00 ? 117 PRO A N    3  
ATOM 5575  C CA   . PRO A 1 117 ? 16.480  -5.983  -6.176  1.00 0.00 ? 117 PRO A CA   3  
ATOM 5576  C C    . PRO A 1 117 ? 16.828  -5.347  -4.834  1.00 0.00 ? 117 PRO A C    3  
ATOM 5577  O O    . PRO A 1 117 ? 15.948  -5.088  -4.013  1.00 0.00 ? 117 PRO A O    3  
ATOM 5578  C CB   . PRO A 1 117 ? 15.886  -4.938  -7.125  1.00 0.00 ? 117 PRO A CB   3  
ATOM 5579  C CG   . PRO A 1 117 ? 14.412  -5.074  -6.963  1.00 0.00 ? 117 PRO A CG   3  
ATOM 5580  C CD   . PRO A 1 117 ? 14.159  -6.530  -6.685  1.00 0.00 ? 117 PRO A CD   3  
ATOM 5581  H HA   . PRO A 1 117 ? 17.373  -6.404  -6.616  1.00 0.00 ? 117 PRO A HA   3  
ATOM 5582  H HB2  . PRO A 1 117 ? 16.227  -3.953  -6.838  1.00 0.00 ? 117 PRO A HB2  3  
ATOM 5583  H HB3  . PRO A 1 117 ? 16.193  -5.150  -8.138  1.00 0.00 ? 117 PRO A HB3  3  
ATOM 5584  H HG2  . PRO A 1 117 ? 14.076  -4.470  -6.134  1.00 0.00 ? 117 PRO A HG2  3  
ATOM 5585  H HG3  . PRO A 1 117 ? 13.914  -4.775  -7.873  1.00 0.00 ? 117 PRO A HG3  3  
ATOM 5586  H HD2  . PRO A 1 117 ? 13.327  -6.646  -6.005  1.00 0.00 ? 117 PRO A HD2  3  
ATOM 5587  H HD3  . PRO A 1 117 ? 13.973  -7.064  -7.605  1.00 0.00 ? 117 PRO A HD3  3  
ATOM 5588  N N    . SER A 1 118 ? 18.116  -5.098  -4.619  1.00 0.00 ? 118 SER A N    3  
ATOM 5589  C CA   . SER A 1 118 ? 18.579  -4.496  -3.374  1.00 0.00 ? 118 SER A CA   3  
ATOM 5590  C C    . SER A 1 118 ? 18.962  -3.035  -3.587  1.00 0.00 ? 118 SER A C    3  
ATOM 5591  O O    . SER A 1 118 ? 20.085  -2.728  -3.987  1.00 0.00 ? 118 SER A O    3  
ATOM 5592  C CB   . SER A 1 118 ? 19.776  -5.273  -2.822  1.00 0.00 ? 118 SER A CB   3  
ATOM 5593  O OG   . SER A 1 118 ? 19.421  -6.613  -2.525  1.00 0.00 ? 118 SER A OG   3  
ATOM 5594  H H    . SER A 1 118 ? 18.769  -5.328  -5.312  1.00 0.00 ? 118 SER A H    3  
ATOM 5595  H HA   . SER A 1 118 ? 17.770  -4.544  -2.661  1.00 0.00 ? 118 SER A HA   3  
ATOM 5596  H HB2  . SER A 1 118 ? 20.568  -5.277  -3.555  1.00 0.00 ? 118 SER A HB2  3  
ATOM 5597  H HB3  . SER A 1 118 ? 20.125  -4.796  -1.917  1.00 0.00 ? 118 SER A HB3  3  
ATOM 5598  H HG   . SER A 1 118 ? 19.986  -6.946  -1.824  1.00 0.00 ? 118 SER A HG   3  
ATOM 5599  N N    . SER A 1 119 ? 18.019  -2.137  -3.318  1.00 0.00 ? 119 SER A N    3  
ATOM 5600  C CA   . SER A 1 119 ? 18.255  -0.708  -3.483  1.00 0.00 ? 119 SER A CA   3  
ATOM 5601  C C    . SER A 1 119 ? 19.176  -0.179  -2.389  1.00 0.00 ? 119 SER A C    3  
ATOM 5602  O O    . SER A 1 119 ? 19.283  -0.767  -1.314  1.00 0.00 ? 119 SER A O    3  
ATOM 5603  C CB   . SER A 1 119 ? 16.929  0.055   -3.462  1.00 0.00 ? 119 SER A CB   3  
ATOM 5604  O OG   . SER A 1 119 ? 17.115  1.411   -3.829  1.00 0.00 ? 119 SER A OG   3  
ATOM 5605  H H    . SER A 1 119 ? 17.144  -2.445  -3.002  1.00 0.00 ? 119 SER A H    3  
ATOM 5606  H HA   . SER A 1 119 ? 18.731  -0.559  -4.441  1.00 0.00 ? 119 SER A HA   3  
ATOM 5607  H HB2  . SER A 1 119 ? 16.242  -0.403  -4.158  1.00 0.00 ? 119 SER A HB2  3  
ATOM 5608  H HB3  . SER A 1 119 ? 16.511  0.017   -2.467  1.00 0.00 ? 119 SER A HB3  3  
ATOM 5609  H HG   . SER A 1 119 ? 17.762  1.815   -3.246  1.00 0.00 ? 119 SER A HG   3  
ATOM 5610  N N    . GLY A 1 120 ? 19.841  0.938   -2.671  1.00 0.00 ? 120 GLY A N    3  
ATOM 5611  C CA   . GLY A 1 120 ? 20.745  1.529   -1.702  1.00 0.00 ? 120 GLY A CA   3  
ATOM 5612  C C    . GLY A 1 120 ? 20.147  1.585   -0.310  1.00 0.00 ? 120 GLY A C    3  
ATOM 5613  O O    . GLY A 1 120 ? 19.044  2.097   -0.122  1.00 0.00 ? 120 GLY A O    3  
ATOM 5614  H H    . GLY A 1 120 ? 19.716  1.364   -3.545  1.00 0.00 ? 120 GLY A H    3  
ATOM 5615  H HA2  . GLY A 1 120 ? 21.652  0.944   -1.669  1.00 0.00 ? 120 GLY A HA2  3  
ATOM 5616  H HA3  . GLY A 1 120 ? 20.987  2.533   -2.018  1.00 0.00 ? 120 GLY A HA3  3  
ATOM 5617  N N    . GLY A 1 1   ? -23.192 8.463   20.543  1.00 0.00 ? 1   GLY A N    4  
ATOM 5618  C CA   . GLY A 1 1   ? -22.926 9.775   19.981  1.00 0.00 ? 1   GLY A CA   4  
ATOM 5619  C C    . GLY A 1 1   ? -23.567 10.890  20.783  1.00 0.00 ? 1   GLY A C    4  
ATOM 5620  O O    . GLY A 1 1   ? -24.788 10.933  20.933  1.00 0.00 ? 1   GLY A O    4  
ATOM 5621  H H1   . GLY A 1 1   ? -23.860 7.880   20.125  1.00 0.00 ? 1   GLY A H1   4  
ATOM 5622  H HA2  . GLY A 1 1   ? -21.858 9.933   19.954  1.00 0.00 ? 1   GLY A HA2  4  
ATOM 5623  H HA3  . GLY A 1 1   ? -23.311 9.806   18.972  1.00 0.00 ? 1   GLY A HA3  4  
ATOM 5624  N N    . SER A 1 2   ? -22.742 11.793  21.302  1.00 0.00 ? 2   SER A N    4  
ATOM 5625  C CA   . SER A 1 2   ? -23.235 12.911  22.099  1.00 0.00 ? 2   SER A CA   4  
ATOM 5626  C C    . SER A 1 2   ? -22.620 14.226  21.629  1.00 0.00 ? 2   SER A C    4  
ATOM 5627  O O    . SER A 1 2   ? -21.881 14.261  20.645  1.00 0.00 ? 2   SER A O    4  
ATOM 5628  C CB   . SER A 1 2   ? -22.921 12.688  23.579  1.00 0.00 ? 2   SER A CB   4  
ATOM 5629  O OG   . SER A 1 2   ? -23.478 11.469  24.041  1.00 0.00 ? 2   SER A OG   4  
ATOM 5630  H H    . SER A 1 2   ? -21.778 11.704  21.148  1.00 0.00 ? 2   SER A H    4  
ATOM 5631  H HA   . SER A 1 2   ? -24.306 12.962  21.971  1.00 0.00 ? 2   SER A HA   4  
ATOM 5632  H HB2  . SER A 1 2   ? -21.851 12.655  23.716  1.00 0.00 ? 2   SER A HB2  4  
ATOM 5633  H HB3  . SER A 1 2   ? -23.333 13.501  24.158  1.00 0.00 ? 2   SER A HB3  4  
ATOM 5634  H HG   . SER A 1 2   ? -24.226 11.230  23.489  1.00 0.00 ? 2   SER A HG   4  
ATOM 5635  N N    . SER A 1 3   ? -22.932 15.305  22.340  1.00 0.00 ? 3   SER A N    4  
ATOM 5636  C CA   . SER A 1 3   ? -22.413 16.623  21.995  1.00 0.00 ? 3   SER A CA   4  
ATOM 5637  C C    . SER A 1 3   ? -22.613 16.914  20.510  1.00 0.00 ? 3   SER A C    4  
ATOM 5638  O O    . SER A 1 3   ? -21.699 17.373  19.828  1.00 0.00 ? 3   SER A O    4  
ATOM 5639  C CB   . SER A 1 3   ? -20.928 16.720  22.350  1.00 0.00 ? 3   SER A CB   4  
ATOM 5640  O OG   . SER A 1 3   ? -20.751 17.058  23.714  1.00 0.00 ? 3   SER A OG   4  
ATOM 5641  H H    . SER A 1 3   ? -23.526 15.212  23.114  1.00 0.00 ? 3   SER A H    4  
ATOM 5642  H HA   . SER A 1 3   ? -22.961 17.355  22.570  1.00 0.00 ? 3   SER A HA   4  
ATOM 5643  H HB2  . SER A 1 3   ? -20.453 15.769  22.163  1.00 0.00 ? 3   SER A HB2  4  
ATOM 5644  H HB3  . SER A 1 3   ? -20.464 17.481  21.739  1.00 0.00 ? 3   SER A HB3  4  
ATOM 5645  H HG   . SER A 1 3   ? -21.229 17.868  23.908  1.00 0.00 ? 3   SER A HG   4  
ATOM 5646  N N    . GLY A 1 4   ? -23.818 16.642  20.017  1.00 0.00 ? 4   GLY A N    4  
ATOM 5647  C CA   . GLY A 1 4   ? -24.117 16.879  18.617  1.00 0.00 ? 4   GLY A CA   4  
ATOM 5648  C C    . GLY A 1 4   ? -23.755 15.699  17.738  1.00 0.00 ? 4   GLY A C    4  
ATOM 5649  O O    . GLY A 1 4   ? -22.855 14.925  18.066  1.00 0.00 ? 4   GLY A O    4  
ATOM 5650  H H    . GLY A 1 4   ? -24.508 16.276  20.609  1.00 0.00 ? 4   GLY A H    4  
ATOM 5651  H HA2  . GLY A 1 4   ? -25.173 17.080  18.515  1.00 0.00 ? 4   GLY A HA2  4  
ATOM 5652  H HA3  . GLY A 1 4   ? -23.562 17.744  18.284  1.00 0.00 ? 4   GLY A HA3  4  
ATOM 5653  N N    . SER A 1 5   ? -24.458 15.558  16.619  1.00 0.00 ? 5   SER A N    4  
ATOM 5654  C CA   . SER A 1 5   ? -24.210 14.460  15.693  1.00 0.00 ? 5   SER A CA   4  
ATOM 5655  C C    . SER A 1 5   ? -22.820 14.574  15.075  1.00 0.00 ? 5   SER A C    4  
ATOM 5656  O O    . SER A 1 5   ? -22.058 13.607  15.049  1.00 0.00 ? 5   SER A O    4  
ATOM 5657  C CB   . SER A 1 5   ? -25.271 14.444  14.591  1.00 0.00 ? 5   SER A CB   4  
ATOM 5658  O OG   . SER A 1 5   ? -26.524 14.018  15.095  1.00 0.00 ? 5   SER A OG   4  
ATOM 5659  H H    . SER A 1 5   ? -25.163 16.208  16.413  1.00 0.00 ? 5   SER A H    4  
ATOM 5660  H HA   . SER A 1 5   ? -24.269 13.536  16.250  1.00 0.00 ? 5   SER A HA   4  
ATOM 5661  H HB2  . SER A 1 5   ? -25.379 15.438  14.185  1.00 0.00 ? 5   SER A HB2  4  
ATOM 5662  H HB3  . SER A 1 5   ? -24.962 13.767  13.807  1.00 0.00 ? 5   SER A HB3  4  
ATOM 5663  H HG   . SER A 1 5   ? -26.586 14.237  16.028  1.00 0.00 ? 5   SER A HG   4  
ATOM 5664  N N    . SER A 1 6   ? -22.496 15.763  14.578  1.00 0.00 ? 6   SER A N    4  
ATOM 5665  C CA   . SER A 1 6   ? -21.200 16.005  13.956  1.00 0.00 ? 6   SER A CA   4  
ATOM 5666  C C    . SER A 1 6   ? -20.888 14.934  12.915  1.00 0.00 ? 6   SER A C    4  
ATOM 5667  O O    . SER A 1 6   ? -19.767 14.433  12.839  1.00 0.00 ? 6   SER A O    4  
ATOM 5668  C CB   . SER A 1 6   ? -20.099 16.035  15.018  1.00 0.00 ? 6   SER A CB   4  
ATOM 5669  O OG   . SER A 1 6   ? -18.957 16.732  14.549  1.00 0.00 ? 6   SER A OG   4  
ATOM 5670  H H    . SER A 1 6   ? -23.146 16.495  14.628  1.00 0.00 ? 6   SER A H    4  
ATOM 5671  H HA   . SER A 1 6   ? -21.241 16.966  13.465  1.00 0.00 ? 6   SER A HA   4  
ATOM 5672  H HB2  . SER A 1 6   ? -20.469 16.530  15.903  1.00 0.00 ? 6   SER A HB2  4  
ATOM 5673  H HB3  . SER A 1 6   ? -19.812 15.023  15.264  1.00 0.00 ? 6   SER A HB3  4  
ATOM 5674  H HG   . SER A 1 6   ? -18.491 17.120  15.293  1.00 0.00 ? 6   SER A HG   4  
ATOM 5675  N N    . GLY A 1 7   ? -21.891 14.587  12.113  1.00 0.00 ? 7   GLY A N    4  
ATOM 5676  C CA   . GLY A 1 7   ? -21.706 13.578  11.087  1.00 0.00 ? 7   GLY A CA   4  
ATOM 5677  C C    . GLY A 1 7   ? -22.734 13.683  9.978   1.00 0.00 ? 7   GLY A C    4  
ATOM 5678  O O    . GLY A 1 7   ? -23.593 12.814  9.835   1.00 0.00 ? 7   GLY A O    4  
ATOM 5679  H H    . GLY A 1 7   ? -22.764 15.021  12.220  1.00 0.00 ? 7   GLY A H    4  
ATOM 5680  H HA2  . GLY A 1 7   ? -20.720 13.689  10.662  1.00 0.00 ? 7   GLY A HA2  4  
ATOM 5681  H HA3  . GLY A 1 7   ? -21.783 12.601  11.542  1.00 0.00 ? 7   GLY A HA3  4  
ATOM 5682  N N    . ARG A 1 8   ? -22.646 14.751  9.192   1.00 0.00 ? 8   ARG A N    4  
ATOM 5683  C CA   . ARG A 1 8   ? -23.578 14.968  8.092   1.00 0.00 ? 8   ARG A CA   4  
ATOM 5684  C C    . ARG A 1 8   ? -22.914 14.673  6.750   1.00 0.00 ? 8   ARG A C    4  
ATOM 5685  O O    . ARG A 1 8   ? -23.536 14.109  5.851   1.00 0.00 ? 8   ARG A O    4  
ATOM 5686  C CB   . ARG A 1 8   ? -24.096 16.408  8.111   1.00 0.00 ? 8   ARG A CB   4  
ATOM 5687  C CG   . ARG A 1 8   ? -24.521 16.920  6.744   1.00 0.00 ? 8   ARG A CG   4  
ATOM 5688  C CD   . ARG A 1 8   ? -25.611 17.975  6.859   1.00 0.00 ? 8   ARG A CD   4  
ATOM 5689  N NE   . ARG A 1 8   ? -26.843 17.430  7.422   1.00 0.00 ? 8   ARG A NE   4  
ATOM 5690  C CZ   . ARG A 1 8   ? -28.019 18.042  7.346   1.00 0.00 ? 8   ARG A CZ   4  
ATOM 5691  N NH1  . ARG A 1 8   ? -28.123 19.213  6.734   1.00 0.00 ? 8   ARG A NH1  4  
ATOM 5692  N NH2  . ARG A 1 8   ? -29.096 17.482  7.883   1.00 0.00 ? 8   ARG A NH2  4  
ATOM 5693  H H    . ARG A 1 8   ? -21.939 15.410  9.356   1.00 0.00 ? 8   ARG A H    4  
ATOM 5694  H HA   . ARG A 1 8   ? -24.411 14.294  8.224   1.00 0.00 ? 8   ARG A HA   4  
ATOM 5695  H HB2  . ARG A 1 8   ? -24.948 16.463  8.772   1.00 0.00 ? 8   ARG A HB2  4  
ATOM 5696  H HB3  . ARG A 1 8   ? -23.316 17.053  8.486   1.00 0.00 ? 8   ARG A HB3  4  
ATOM 5697  H HG2  . ARG A 1 8   ? -23.665 17.355  6.251   1.00 0.00 ? 8   ARG A HG2  4  
ATOM 5698  H HG3  . ARG A 1 8   ? -24.894 16.092  6.160   1.00 0.00 ? 8   ARG A HG3  4  
ATOM 5699  H HD2  . ARG A 1 8   ? -25.257 18.771  7.496   1.00 0.00 ? 8   ARG A HD2  4  
ATOM 5700  H HD3  . ARG A 1 8   ? -25.818 18.367  5.875   1.00 0.00 ? 8   ARG A HD3  4  
ATOM 5701  H HE   . ARG A 1 8   ? -26.790 16.565  7.879   1.00 0.00 ? 8   ARG A HE   4  
ATOM 5702  H HH11 . ARG A 1 8   ? -27.313 19.637  6.327   1.00 0.00 ? 8   ARG A HH11 4  
ATOM 5703  H HH12 . ARG A 1 8   ? -29.010 19.672  6.677   1.00 0.00 ? 8   ARG A HH12 4  
ATOM 5704  H HH21 . ARG A 1 8   ? -29.022 16.599  8.346   1.00 0.00 ? 8   ARG A HH21 4  
ATOM 5705  H HH22 . ARG A 1 8   ? -29.981 17.944  7.826   1.00 0.00 ? 8   ARG A HH22 4  
ATOM 5706  N N    . GLN A 1 9   ? -21.648 15.059  6.625   1.00 0.00 ? 9   GLN A N    4  
ATOM 5707  C CA   . GLN A 1 9   ? -20.901 14.836  5.393   1.00 0.00 ? 9   GLN A CA   4  
ATOM 5708  C C    . GLN A 1 9   ? -20.410 13.394  5.307   1.00 0.00 ? 9   GLN A C    4  
ATOM 5709  O O    . GLN A 1 9   ? -19.800 12.994  4.316   1.00 0.00 ? 9   GLN A O    4  
ATOM 5710  C CB   . GLN A 1 9   ? -19.713 15.797  5.311   1.00 0.00 ? 9   GLN A CB   4  
ATOM 5711  C CG   . GLN A 1 9   ? -18.676 15.395  4.276   1.00 0.00 ? 9   GLN A CG   4  
ATOM 5712  C CD   . GLN A 1 9   ? -17.676 16.499  3.992   1.00 0.00 ? 9   GLN A CD   4  
ATOM 5713  O OE1  . GLN A 1 9   ? -16.510 16.410  4.376   1.00 0.00 ? 9   GLN A OE1  4  
ATOM 5714  N NE2  . GLN A 1 9   ? -18.129 17.548  3.316   1.00 0.00 ? 9   GLN A NE2  4  
ATOM 5715  H H    . GLN A 1 9   ? -21.207 15.504  7.378   1.00 0.00 ? 9   GLN A H    4  
ATOM 5716  H HA   . GLN A 1 9   ? -21.565 15.027  4.564   1.00 0.00 ? 9   GLN A HA   4  
ATOM 5717  H HB2  . GLN A 1 9   ? -20.079 16.781  5.060   1.00 0.00 ? 9   GLN A HB2  4  
ATOM 5718  H HB3  . GLN A 1 9   ? -19.230 15.836  6.276   1.00 0.00 ? 9   GLN A HB3  4  
ATOM 5719  H HG2  . GLN A 1 9   ? -18.140 14.530  4.638   1.00 0.00 ? 9   GLN A HG2  4  
ATOM 5720  H HG3  . GLN A 1 9   ? -19.183 15.143  3.356   1.00 0.00 ? 9   GLN A HG3  4  
ATOM 5721  H HE21 . GLN A 1 9   ? -19.071 17.551  3.043   1.00 0.00 ? 9   GLN A HE21 4  
ATOM 5722  H HE22 . GLN A 1 9   ? -17.505 18.277  3.120   1.00 0.00 ? 9   GLN A HE22 4  
ATOM 5723  N N    . VAL A 1 10  ? -20.681 12.619  6.352   1.00 0.00 ? 10  VAL A N    4  
ATOM 5724  C CA   . VAL A 1 10  ? -20.268 11.221  6.394   1.00 0.00 ? 10  VAL A CA   4  
ATOM 5725  C C    . VAL A 1 10  ? -20.771 10.462  5.171   1.00 0.00 ? 10  VAL A C    4  
ATOM 5726  O O    . VAL A 1 10  ? -19.984 10.036  4.327   1.00 0.00 ? 10  VAL A O    4  
ATOM 5727  C CB   . VAL A 1 10  ? -20.783 10.522  7.666   1.00 0.00 ? 10  VAL A CB   4  
ATOM 5728  C CG1  . VAL A 1 10  ? -20.105 9.173   7.846   1.00 0.00 ? 10  VAL A CG1  4  
ATOM 5729  C CG2  . VAL A 1 10  ? -20.564 11.405  8.885   1.00 0.00 ? 10  VAL A CG2  4  
ATOM 5730  H H    . VAL A 1 10  ? -21.171 12.996  7.113   1.00 0.00 ? 10  VAL A H    4  
ATOM 5731  H HA   . VAL A 1 10  ? -19.188 11.192  6.405   1.00 0.00 ? 10  VAL A HA   4  
ATOM 5732  H HB   . VAL A 1 10  ? -21.845 10.354  7.556   1.00 0.00 ? 10  VAL A HB   4  
ATOM 5733  H HG11 . VAL A 1 10  ? -19.169 9.166   7.306   1.00 0.00 ? 10  VAL A HG11 4  
ATOM 5734  H HG12 . VAL A 1 10  ? -19.916 9.001   8.896   1.00 0.00 ? 10  VAL A HG12 4  
ATOM 5735  H HG13 . VAL A 1 10  ? -20.747 8.393   7.463   1.00 0.00 ? 10  VAL A HG13 4  
ATOM 5736  H HG21 . VAL A 1 10  ? -19.840 12.171  8.648   1.00 0.00 ? 10  VAL A HG21 4  
ATOM 5737  H HG22 . VAL A 1 10  ? -21.498 11.868  9.168   1.00 0.00 ? 10  VAL A HG22 4  
ATOM 5738  H HG23 . VAL A 1 10  ? -20.198 10.804  9.705   1.00 0.00 ? 10  VAL A HG23 4  
ATOM 5739  N N    . GLN A 1 11  ? -22.087 10.299  5.083   1.00 0.00 ? 11  GLN A N    4  
ATOM 5740  C CA   . GLN A 1 11  ? -22.695 9.591   3.963   1.00 0.00 ? 11  GLN A CA   4  
ATOM 5741  C C    . GLN A 1 11  ? -22.857 10.513  2.759   1.00 0.00 ? 11  GLN A C    4  
ATOM 5742  O O    . GLN A 1 11  ? -23.631 10.229  1.845   1.00 0.00 ? 11  GLN A O    4  
ATOM 5743  C CB   . GLN A 1 11  ? -24.055 9.020   4.370   1.00 0.00 ? 11  GLN A CB   4  
ATOM 5744  C CG   . GLN A 1 11  ? -23.959 7.843   5.328   1.00 0.00 ? 11  GLN A CG   4  
ATOM 5745  C CD   . GLN A 1 11  ? -25.288 7.142   5.526   1.00 0.00 ? 11  GLN A CD   4  
ATOM 5746  O OE1  . GLN A 1 11  ? -25.446 5.975   5.167   1.00 0.00 ? 11  GLN A OE1  4  
ATOM 5747  N NE2  . GLN A 1 11  ? -26.252 7.852   6.100   1.00 0.00 ? 11  GLN A NE2  4  
ATOM 5748  H H    . GLN A 1 11  ? -22.662 10.662  5.788   1.00 0.00 ? 11  GLN A H    4  
ATOM 5749  H HA   . GLN A 1 11  ? -22.040 8.777   3.691   1.00 0.00 ? 11  GLN A HA   4  
ATOM 5750  H HB2  . GLN A 1 11  ? -24.630 9.799   4.847   1.00 0.00 ? 11  GLN A HB2  4  
ATOM 5751  H HB3  . GLN A 1 11  ? -24.574 8.692   3.482   1.00 0.00 ? 11  GLN A HB3  4  
ATOM 5752  H HG2  . GLN A 1 11  ? -23.249 7.131   4.933   1.00 0.00 ? 11  GLN A HG2  4  
ATOM 5753  H HG3  . GLN A 1 11  ? -23.611 8.203   6.285   1.00 0.00 ? 11  GLN A HG3  4  
ATOM 5754  H HE21 . GLN A 1 11  ? -26.054 8.777   6.358   1.00 0.00 ? 11  GLN A HE21 4  
ATOM 5755  H HE22 . GLN A 1 11  ? -27.122 7.424   6.239   1.00 0.00 ? 11  GLN A HE22 4  
ATOM 5756  N N    . LYS A 1 12  ? -22.122 11.620  2.766   1.00 0.00 ? 12  LYS A N    4  
ATOM 5757  C CA   . LYS A 1 12  ? -22.183 12.586  1.675   1.00 0.00 ? 12  LYS A CA   4  
ATOM 5758  C C    . LYS A 1 12  ? -20.808 12.782  1.044   1.00 0.00 ? 12  LYS A C    4  
ATOM 5759  O O    . LYS A 1 12  ? -20.691 13.324  -0.054  1.00 0.00 ? 12  LYS A O    4  
ATOM 5760  C CB   . LYS A 1 12  ? -22.719 13.926  2.182   1.00 0.00 ? 12  LYS A CB   4  
ATOM 5761  C CG   . LYS A 1 12  ? -23.254 14.824  1.079   1.00 0.00 ? 12  LYS A CG   4  
ATOM 5762  C CD   . LYS A 1 12  ? -23.195 16.290  1.475   1.00 0.00 ? 12  LYS A CD   4  
ATOM 5763  C CE   . LYS A 1 12  ? -24.415 16.697  2.287   1.00 0.00 ? 12  LYS A CE   4  
ATOM 5764  N NZ   . LYS A 1 12  ? -24.439 16.037  3.621   1.00 0.00 ? 12  LYS A NZ   4  
ATOM 5765  H H    . LYS A 1 12  ? -21.523 11.792  3.523   1.00 0.00 ? 12  LYS A H    4  
ATOM 5766  H HA   . LYS A 1 12  ? -22.857 12.198  0.926   1.00 0.00 ? 12  LYS A HA   4  
ATOM 5767  H HB2  . LYS A 1 12  ? -23.519 13.738  2.883   1.00 0.00 ? 12  LYS A HB2  4  
ATOM 5768  H HB3  . LYS A 1 12  ? -21.922 14.451  2.689   1.00 0.00 ? 12  LYS A HB3  4  
ATOM 5769  H HG2  . LYS A 1 12  ? -22.660 14.679  0.189   1.00 0.00 ? 12  LYS A HG2  4  
ATOM 5770  H HG3  . LYS A 1 12  ? -24.281 14.556  0.876   1.00 0.00 ? 12  LYS A HG3  4  
ATOM 5771  H HD2  . LYS A 1 12  ? -22.309 16.458  2.069   1.00 0.00 ? 12  LYS A HD2  4  
ATOM 5772  H HD3  . LYS A 1 12  ? -23.150 16.894  0.580   1.00 0.00 ? 12  LYS A HD3  4  
ATOM 5773  H HE2  . LYS A 1 12  ? -24.398 17.767  2.424   1.00 0.00 ? 12  LYS A HE2  4  
ATOM 5774  H HE3  . LYS A 1 12  ? -25.304 16.419  1.740   1.00 0.00 ? 12  LYS A HE3  4  
ATOM 5775  H HZ1  . LYS A 1 12  ? -24.724 16.720  4.352   1.00 0.00 ? 12  LYS A HZ1  4  
ATOM 5776  H HZ2  . LYS A 1 12  ? -23.495 15.670  3.856   1.00 0.00 ? 12  LYS A HZ2  4  
ATOM 5777  H HZ3  . LYS A 1 12  ? -25.115 15.247  3.617   1.00 0.00 ? 12  LYS A HZ3  4  
ATOM 5778  N N    . GLU A 1 13  ? -19.771 12.336  1.747   1.00 0.00 ? 13  GLU A N    4  
ATOM 5779  C CA   . GLU A 1 13  ? -18.404 12.463  1.255   1.00 0.00 ? 13  GLU A CA   4  
ATOM 5780  C C    . GLU A 1 13  ? -17.746 11.093  1.118   1.00 0.00 ? 13  GLU A C    4  
ATOM 5781  O O    . GLU A 1 13  ? -17.061 10.817  0.132   1.00 0.00 ? 13  GLU A O    4  
ATOM 5782  C CB   . GLU A 1 13  ? -17.580 13.346  2.194   1.00 0.00 ? 13  GLU A CB   4  
ATOM 5783  C CG   . GLU A 1 13  ? -16.082 13.111  2.092   1.00 0.00 ? 13  GLU A CG   4  
ATOM 5784  C CD   . GLU A 1 13  ? -15.509 13.563  0.763   1.00 0.00 ? 13  GLU A CD   4  
ATOM 5785  O OE1  . GLU A 1 13  ? -15.956 13.047  -0.282  1.00 0.00 ? 13  GLU A OE1  4  
ATOM 5786  O OE2  . GLU A 1 13  ? -14.614 14.433  0.769   1.00 0.00 ? 13  GLU A OE2  4  
ATOM 5787  H H    . GLU A 1 13  ? -19.929 11.913  2.617   1.00 0.00 ? 13  GLU A H    4  
ATOM 5788  H HA   . GLU A 1 13  ? -18.444 12.928  0.281   1.00 0.00 ? 13  GLU A HA   4  
ATOM 5789  H HB2  . GLU A 1 13  ? -17.778 14.382  1.961   1.00 0.00 ? 13  GLU A HB2  4  
ATOM 5790  H HB3  . GLU A 1 13  ? -17.886 13.151  3.211   1.00 0.00 ? 13  GLU A HB3  4  
ATOM 5791  H HG2  . GLU A 1 13  ? -15.590 13.657  2.883   1.00 0.00 ? 13  GLU A HG2  4  
ATOM 5792  H HG3  . GLU A 1 13  ? -15.888 12.055  2.211   1.00 0.00 ? 13  GLU A HG3  4  
ATOM 5793  N N    . LEU A 1 14  ? -17.958 10.240  2.114   1.00 0.00 ? 14  LEU A N    4  
ATOM 5794  C CA   . LEU A 1 14  ? -17.385 8.898   2.106   1.00 0.00 ? 14  LEU A CA   4  
ATOM 5795  C C    . LEU A 1 14  ? -17.300 8.350   0.685   1.00 0.00 ? 14  LEU A C    4  
ATOM 5796  O O    . LEU A 1 14  ? -16.220 8.275   0.102   1.00 0.00 ? 14  LEU A O    4  
ATOM 5797  C CB   . LEU A 1 14  ? -18.222 7.960   2.978   1.00 0.00 ? 14  LEU A CB   4  
ATOM 5798  C CG   . LEU A 1 14  ? -17.780 6.497   3.006   1.00 0.00 ? 14  LEU A CG   4  
ATOM 5799  C CD1  . LEU A 1 14  ? -16.389 6.371   3.608   1.00 0.00 ? 14  LEU A CD1  4  
ATOM 5800  C CD2  . LEU A 1 14  ? -18.778 5.653   3.784   1.00 0.00 ? 14  LEU A CD2  4  
ATOM 5801  H H    . LEU A 1 14  ? -18.512 10.517  2.872   1.00 0.00 ? 14  LEU A H    4  
ATOM 5802  H HA   . LEU A 1 14  ? -16.387 8.962   2.515   1.00 0.00 ? 14  LEU A HA   4  
ATOM 5803  H HB2  . LEU A 1 14  ? -18.191 8.334   3.990   1.00 0.00 ? 14  LEU A HB2  4  
ATOM 5804  H HB3  . LEU A 1 14  ? -19.239 7.993   2.615   1.00 0.00 ? 14  LEU A HB3  4  
ATOM 5805  H HG   . LEU A 1 14  ? -17.740 6.120   1.993   1.00 0.00 ? 14  LEU A HG   4  
ATOM 5806  H HD11 . LEU A 1 14  ? -15.649 6.602   2.856   1.00 0.00 ? 14  LEU A HD11 4  
ATOM 5807  H HD12 . LEU A 1 14  ? -16.240 5.361   3.961   1.00 0.00 ? 14  LEU A HD12 4  
ATOM 5808  H HD13 . LEU A 1 14  ? -16.291 7.059   4.434   1.00 0.00 ? 14  LEU A HD13 4  
ATOM 5809  H HD21 . LEU A 1 14  ? -18.321 4.712   4.054   1.00 0.00 ? 14  LEU A HD21 4  
ATOM 5810  H HD22 . LEU A 1 14  ? -19.648 5.467   3.171   1.00 0.00 ? 14  LEU A HD22 4  
ATOM 5811  H HD23 . LEU A 1 14  ? -19.074 6.179   4.679   1.00 0.00 ? 14  LEU A HD23 4  
ATOM 5812  N N    . GLY A 1 15  ? -18.449 7.970   0.133   1.00 0.00 ? 15  GLY A N    4  
ATOM 5813  C CA   . GLY A 1 15  ? -18.482 7.436   -1.216  1.00 0.00 ? 15  GLY A CA   4  
ATOM 5814  C C    . GLY A 1 15  ? -17.863 8.379   -2.228  1.00 0.00 ? 15  GLY A C    4  
ATOM 5815  O O    . GLY A 1 15  ? -17.011 7.977   -3.020  1.00 0.00 ? 15  GLY A O    4  
ATOM 5816  H H    . GLY A 1 15  ? -19.280 8.054   0.646   1.00 0.00 ? 15  GLY A H    4  
ATOM 5817  H HA2  . GLY A 1 15  ? -17.944 6.500   -1.234  1.00 0.00 ? 15  GLY A HA2  4  
ATOM 5818  H HA3  . GLY A 1 15  ? -19.510 7.254   -1.493  1.00 0.00 ? 15  GLY A HA3  4  
ATOM 5819  N N    . ASP A 1 16  ? -18.293 9.636   -2.204  1.00 0.00 ? 16  ASP A N    4  
ATOM 5820  C CA   . ASP A 1 16  ? -17.776 10.639  -3.128  1.00 0.00 ? 16  ASP A CA   4  
ATOM 5821  C C    . ASP A 1 16  ? -16.271 10.477  -3.319  1.00 0.00 ? 16  ASP A C    4  
ATOM 5822  O O    . ASP A 1 16  ? -15.797 10.239  -4.430  1.00 0.00 ? 16  ASP A O    4  
ATOM 5823  C CB   . ASP A 1 16  ? -18.088 12.045  -2.614  1.00 0.00 ? 16  ASP A CB   4  
ATOM 5824  C CG   . ASP A 1 16  ? -17.781 13.118  -3.641  1.00 0.00 ? 16  ASP A CG   4  
ATOM 5825  O OD1  . ASP A 1 16  ? -16.856 12.912  -4.454  1.00 0.00 ? 16  ASP A OD1  4  
ATOM 5826  O OD2  . ASP A 1 16  ? -18.465 14.163  -3.630  1.00 0.00 ? 16  ASP A OD2  4  
ATOM 5827  H H    . ASP A 1 16  ? -18.974 9.895   -1.549  1.00 0.00 ? 16  ASP A H    4  
ATOM 5828  H HA   . ASP A 1 16  ? -18.264 10.496  -4.080  1.00 0.00 ? 16  ASP A HA   4  
ATOM 5829  H HB2  . ASP A 1 16  ? -19.137 12.105  -2.363  1.00 0.00 ? 16  ASP A HB2  4  
ATOM 5830  H HB3  . ASP A 1 16  ? -17.499 12.238  -1.731  1.00 0.00 ? 16  ASP A HB3  4  
ATOM 5831  N N    . VAL A 1 17  ? -15.523 10.608  -2.227  1.00 0.00 ? 17  VAL A N    4  
ATOM 5832  C CA   . VAL A 1 17  ? -14.072 10.476  -2.274  1.00 0.00 ? 17  VAL A CA   4  
ATOM 5833  C C    . VAL A 1 17  ? -13.649 9.410   -3.280  1.00 0.00 ? 17  VAL A C    4  
ATOM 5834  O O    . VAL A 1 17  ? -14.279 8.358   -3.387  1.00 0.00 ? 17  VAL A O    4  
ATOM 5835  C CB   . VAL A 1 17  ? -13.496 10.118  -0.891  1.00 0.00 ? 17  VAL A CB   4  
ATOM 5836  C CG1  . VAL A 1 17  ? -11.987 9.943   -0.970  1.00 0.00 ? 17  VAL A CG1  4  
ATOM 5837  C CG2  . VAL A 1 17  ? -13.864 11.183  0.130   1.00 0.00 ? 17  VAL A CG2  4  
ATOM 5838  H H    . VAL A 1 17  ? -15.958 10.797  -1.370  1.00 0.00 ? 17  VAL A H    4  
ATOM 5839  H HA   . VAL A 1 17  ? -13.660 11.427  -2.578  1.00 0.00 ? 17  VAL A HA   4  
ATOM 5840  H HB   . VAL A 1 17  ? -13.929 9.181   -0.575  1.00 0.00 ? 17  VAL A HB   4  
ATOM 5841  H HG11 . VAL A 1 17  ? -11.754 9.133   -1.647  1.00 0.00 ? 17  VAL A HG11 4  
ATOM 5842  H HG12 . VAL A 1 17  ? -11.536 10.856  -1.331  1.00 0.00 ? 17  VAL A HG12 4  
ATOM 5843  H HG13 . VAL A 1 17  ? -11.600 9.713   0.011   1.00 0.00 ? 17  VAL A HG13 4  
ATOM 5844  H HG21 . VAL A 1 17  ? -14.894 11.056  0.427   1.00 0.00 ? 17  VAL A HG21 4  
ATOM 5845  H HG22 . VAL A 1 17  ? -13.226 11.088  0.997   1.00 0.00 ? 17  VAL A HG22 4  
ATOM 5846  H HG23 . VAL A 1 17  ? -13.733 12.162  -0.306  1.00 0.00 ? 17  VAL A HG23 4  
ATOM 5847  N N    . LEU A 1 18  ? -12.578 9.690   -4.014  1.00 0.00 ? 18  LEU A N    4  
ATOM 5848  C CA   . LEU A 1 18  ? -12.070 8.755   -5.012  1.00 0.00 ? 18  LEU A CA   4  
ATOM 5849  C C    . LEU A 1 18  ? -10.688 8.241   -4.622  1.00 0.00 ? 18  LEU A C    4  
ATOM 5850  O O    . LEU A 1 18  ? -9.673  8.873   -4.914  1.00 0.00 ? 18  LEU A O    4  
ATOM 5851  C CB   . LEU A 1 18  ? -12.007 9.428   -6.385  1.00 0.00 ? 18  LEU A CB   4  
ATOM 5852  C CG   . LEU A 1 18  ? -12.164 8.504   -7.593  1.00 0.00 ? 18  LEU A CG   4  
ATOM 5853  C CD1  . LEU A 1 18  ? -13.635 8.241   -7.876  1.00 0.00 ? 18  LEU A CD1  4  
ATOM 5854  C CD2  . LEU A 1 18  ? -11.482 9.102   -8.814  1.00 0.00 ? 18  LEU A CD2  4  
ATOM 5855  H H    . LEU A 1 18  ? -12.118 10.545  -3.884  1.00 0.00 ? 18  LEU A H    4  
ATOM 5856  H HA   . LEU A 1 18  ? -12.751 7.919   -5.061  1.00 0.00 ? 18  LEU A HA   4  
ATOM 5857  H HB2  . LEU A 1 18  ? -12.794 10.165  -6.428  1.00 0.00 ? 18  LEU A HB2  4  
ATOM 5858  H HB3  . LEU A 1 18  ? -11.049 9.922   -6.467  1.00 0.00 ? 18  LEU A HB3  4  
ATOM 5859  H HG   . LEU A 1 18  ? -11.692 7.555   -7.376  1.00 0.00 ? 18  LEU A HG   4  
ATOM 5860  H HD11 . LEU A 1 18  ? -14.086 7.762   -7.021  1.00 0.00 ? 18  LEU A HD11 4  
ATOM 5861  H HD12 . LEU A 1 18  ? -13.726 7.598   -8.739  1.00 0.00 ? 18  LEU A HD12 4  
ATOM 5862  H HD13 . LEU A 1 18  ? -14.136 9.178   -8.072  1.00 0.00 ? 18  LEU A HD13 4  
ATOM 5863  H HD21 . LEU A 1 18  ? -10.415 8.951   -8.740  1.00 0.00 ? 18  LEU A HD21 4  
ATOM 5864  H HD22 . LEU A 1 18  ? -11.692 10.161  -8.861  1.00 0.00 ? 18  LEU A HD22 4  
ATOM 5865  H HD23 . LEU A 1 18  ? -11.853 8.620   -9.706  1.00 0.00 ? 18  LEU A HD23 4  
ATOM 5866  N N    . VAL A 1 19  ? -10.656 7.088   -3.961  1.00 0.00 ? 19  VAL A N    4  
ATOM 5867  C CA   . VAL A 1 19  ? -9.398  6.487   -3.533  1.00 0.00 ? 19  VAL A CA   4  
ATOM 5868  C C    . VAL A 1 19  ? -8.879  5.501   -4.573  1.00 0.00 ? 19  VAL A C    4  
ATOM 5869  O O    . VAL A 1 19  ? -9.641  4.706   -5.125  1.00 0.00 ? 19  VAL A O    4  
ATOM 5870  C CB   . VAL A 1 19  ? -9.554  5.759   -2.185  1.00 0.00 ? 19  VAL A CB   4  
ATOM 5871  C CG1  . VAL A 1 19  ? -8.243  5.106   -1.775  1.00 0.00 ? 19  VAL A CG1  4  
ATOM 5872  C CG2  . VAL A 1 19  ? -10.037 6.723   -1.112  1.00 0.00 ? 19  VAL A CG2  4  
ATOM 5873  H H    . VAL A 1 19  ? -11.498 6.631   -3.756  1.00 0.00 ? 19  VAL A H    4  
ATOM 5874  H HA   . VAL A 1 19  ? -8.674  7.279   -3.409  1.00 0.00 ? 19  VAL A HA   4  
ATOM 5875  H HB   . VAL A 1 19  ? -10.297 4.983   -2.301  1.00 0.00 ? 19  VAL A HB   4  
ATOM 5876  H HG11 . VAL A 1 19  ? -7.969  5.438   -0.785  1.00 0.00 ? 19  VAL A HG11 4  
ATOM 5877  H HG12 . VAL A 1 19  ? -8.360  4.032   -1.777  1.00 0.00 ? 19  VAL A HG12 4  
ATOM 5878  H HG13 . VAL A 1 19  ? -7.469  5.385   -2.475  1.00 0.00 ? 19  VAL A HG13 4  
ATOM 5879  H HG21 . VAL A 1 19  ? -9.991  6.240   -0.147  1.00 0.00 ? 19  VAL A HG21 4  
ATOM 5880  H HG22 . VAL A 1 19  ? -9.405  7.600   -1.105  1.00 0.00 ? 19  VAL A HG22 4  
ATOM 5881  H HG23 . VAL A 1 19  ? -11.055 7.015   -1.321  1.00 0.00 ? 19  VAL A HG23 4  
ATOM 5882  N N    . ARG A 1 20  ? -7.578  5.557   -4.836  1.00 0.00 ? 20  ARG A N    4  
ATOM 5883  C CA   . ARG A 1 20  ? -6.956  4.669   -5.811  1.00 0.00 ? 20  ARG A CA   4  
ATOM 5884  C C    . ARG A 1 20  ? -5.804  3.891   -5.182  1.00 0.00 ? 20  ARG A C    4  
ATOM 5885  O O    . ARG A 1 20  ? -5.059  4.423   -4.357  1.00 0.00 ? 20  ARG A O    4  
ATOM 5886  C CB   . ARG A 1 20  ? -6.449  5.470   -7.012  1.00 0.00 ? 20  ARG A CB   4  
ATOM 5887  C CG   . ARG A 1 20  ? -6.450  4.684   -8.313  1.00 0.00 ? 20  ARG A CG   4  
ATOM 5888  C CD   . ARG A 1 20  ? -6.004  5.545   -9.484  1.00 0.00 ? 20  ARG A CD   4  
ATOM 5889  N NE   . ARG A 1 20  ? -5.900  4.775   -10.721 1.00 0.00 ? 20  ARG A NE   4  
ATOM 5890  C CZ   . ARG A 1 20  ? -5.767  5.328   -11.921 1.00 0.00 ? 20  ARG A CZ   4  
ATOM 5891  N NH1  . ARG A 1 20  ? -5.722  6.647   -12.046 1.00 0.00 ? 20  ARG A NH1  4  
ATOM 5892  N NH2  . ARG A 1 20  ? -5.679  4.561   -13.000 1.00 0.00 ? 20  ARG A NH2  4  
ATOM 5893  H H    . ARG A 1 20  ? -7.022  6.212   -4.364  1.00 0.00 ? 20  ARG A H    4  
ATOM 5894  H HA   . ARG A 1 20  ? -7.706  3.969   -6.148  1.00 0.00 ? 20  ARG A HA   4  
ATOM 5895  H HB2  . ARG A 1 20  ? -7.077  6.339   -7.142  1.00 0.00 ? 20  ARG A HB2  4  
ATOM 5896  H HB3  . ARG A 1 20  ? -5.438  5.793   -6.812  1.00 0.00 ? 20  ARG A HB3  4  
ATOM 5897  H HG2  . ARG A 1 20  ? -5.773  3.847   -8.217  1.00 0.00 ? 20  ARG A HG2  4  
ATOM 5898  H HG3  . ARG A 1 20  ? -7.449  4.321   -8.503  1.00 0.00 ? 20  ARG A HG3  4  
ATOM 5899  H HD2  . ARG A 1 20  ? -6.723  6.338   -9.625  1.00 0.00 ? 20  ARG A HD2  4  
ATOM 5900  H HD3  . ARG A 1 20  ? -5.039  5.971   -9.254  1.00 0.00 ? 20  ARG A HD3  4  
ATOM 5901  H HE   . ARG A 1 20  ? -5.931  3.799   -10.652 1.00 0.00 ? 20  ARG A HE   4  
ATOM 5902  H HH11 . ARG A 1 20  ? -5.788  7.228   -11.235 1.00 0.00 ? 20  ARG A HH11 4  
ATOM 5903  H HH12 . ARG A 1 20  ? -5.621  7.061   -12.952 1.00 0.00 ? 20  ARG A HH12 4  
ATOM 5904  H HH21 . ARG A 1 20  ? -5.712  3.566   -12.910 1.00 0.00 ? 20  ARG A HH21 4  
ATOM 5905  H HH22 . ARG A 1 20  ? -5.579  4.977   -13.903 1.00 0.00 ? 20  ARG A HH22 4  
ATOM 5906  N N    . LEU A 1 21  ? -5.664  2.630   -5.574  1.00 0.00 ? 21  LEU A N    4  
ATOM 5907  C CA   . LEU A 1 21  ? -4.603  1.778   -5.048  1.00 0.00 ? 21  LEU A CA   4  
ATOM 5908  C C    . LEU A 1 21  ? -3.607  1.410   -6.144  1.00 0.00 ? 21  LEU A C    4  
ATOM 5909  O O    . LEU A 1 21  ? -3.966  0.777   -7.137  1.00 0.00 ? 21  LEU A O    4  
ATOM 5910  C CB   . LEU A 1 21  ? -5.197  0.509   -4.436  1.00 0.00 ? 21  LEU A CB   4  
ATOM 5911  C CG   . LEU A 1 21  ? -4.197  -0.478  -3.834  1.00 0.00 ? 21  LEU A CG   4  
ATOM 5912  C CD1  . LEU A 1 21  ? -3.325  0.211   -2.796  1.00 0.00 ? 21  LEU A CD1  4  
ATOM 5913  C CD2  . LEU A 1 21  ? -4.923  -1.666  -3.220  1.00 0.00 ? 21  LEU A CD2  4  
ATOM 5914  H H    . LEU A 1 21  ? -6.288  2.262   -6.234  1.00 0.00 ? 21  LEU A H    4  
ATOM 5915  H HA   . LEU A 1 21  ? -4.085  2.331   -4.279  1.00 0.00 ? 21  LEU A HA   4  
ATOM 5916  H HB2  . LEU A 1 21  ? -5.879  0.807   -3.654  1.00 0.00 ? 21  LEU A HB2  4  
ATOM 5917  H HB3  . LEU A 1 21  ? -5.746  -0.006  -5.212  1.00 0.00 ? 21  LEU A HB3  4  
ATOM 5918  H HG   . LEU A 1 21  ? -3.550  -0.849  -4.618  1.00 0.00 ? 21  LEU A HG   4  
ATOM 5919  H HD11 . LEU A 1 21  ? -2.555  -0.468  -2.464  1.00 0.00 ? 21  LEU A HD11 4  
ATOM 5920  H HD12 . LEU A 1 21  ? -3.934  0.505   -1.953  1.00 0.00 ? 21  LEU A HD12 4  
ATOM 5921  H HD13 . LEU A 1 21  ? -2.870  1.088   -3.233  1.00 0.00 ? 21  LEU A HD13 4  
ATOM 5922  H HD21 . LEU A 1 21  ? -4.696  -2.558  -3.786  1.00 0.00 ? 21  LEU A HD21 4  
ATOM 5923  H HD22 . LEU A 1 21  ? -5.988  -1.487  -3.242  1.00 0.00 ? 21  LEU A HD22 4  
ATOM 5924  H HD23 . LEU A 1 21  ? -4.600  -1.796  -2.198  1.00 0.00 ? 21  LEU A HD23 4  
ATOM 5925  N N    . HIS A 1 22  ? -2.353  1.809   -5.955  1.00 0.00 ? 22  HIS A N    4  
ATOM 5926  C CA   . HIS A 1 22  ? -1.304  1.518   -6.925  1.00 0.00 ? 22  HIS A CA   4  
ATOM 5927  C C    . HIS A 1 22  ? -0.640  0.178   -6.623  1.00 0.00 ? 22  HIS A C    4  
ATOM 5928  O O    . HIS A 1 22  ? -0.737  -0.336  -5.510  1.00 0.00 ? 22  HIS A O    4  
ATOM 5929  C CB   . HIS A 1 22  ? -0.256  2.631   -6.924  1.00 0.00 ? 22  HIS A CB   4  
ATOM 5930  C CG   . HIS A 1 22  ? -0.845  4.008   -6.944  1.00 0.00 ? 22  HIS A CG   4  
ATOM 5931  N ND1  . HIS A 1 22  ? -0.647  4.897   -7.980  1.00 0.00 ? 22  HIS A ND1  4  
ATOM 5932  C CD2  . HIS A 1 22  ? -1.632  4.647   -6.047  1.00 0.00 ? 22  HIS A CD2  4  
ATOM 5933  C CE1  . HIS A 1 22  ? -1.286  6.023   -7.718  1.00 0.00 ? 22  HIS A CE1  4  
ATOM 5934  N NE2  . HIS A 1 22  ? -1.892  5.898   -6.552  1.00 0.00 ? 22  HIS A NE2  4  
ATOM 5935  H H    . HIS A 1 22  ? -2.128  2.310   -5.143  1.00 0.00 ? 22  HIS A H    4  
ATOM 5936  H HA   . HIS A 1 22  ? -1.761  1.467   -7.902  1.00 0.00 ? 22  HIS A HA   4  
ATOM 5937  H HB2  . HIS A 1 22  ? 0.352   2.544   -6.035  1.00 0.00 ? 22  HIS A HB2  4  
ATOM 5938  H HB3  . HIS A 1 22  ? 0.373   2.526   -7.796  1.00 0.00 ? 22  HIS A HB3  4  
ATOM 5939  H HD1  . HIS A 1 22  ? -0.116  4.727   -8.785  1.00 0.00 ? 22  HIS A HD1  4  
ATOM 5940  H HD2  . HIS A 1 22  ? -1.989  4.249   -5.108  1.00 0.00 ? 22  HIS A HD2  4  
ATOM 5941  H HE1  . HIS A 1 22  ? -1.309  6.898   -8.351  1.00 0.00 ? 22  HIS A HE1  4  
ATOM 5942  H HE2  . HIS A 1 22  ? -2.364  6.616   -6.081  1.00 0.00 ? 22  HIS A HE2  4  
ATOM 5943  N N    . ASN A 1 23  ? 0.033   -0.382  -7.623  1.00 0.00 ? 23  ASN A N    4  
ATOM 5944  C CA   . ASN A 1 23  ? 0.712   -1.664  -7.464  1.00 0.00 ? 23  ASN A CA   4  
ATOM 5945  C C    . ASN A 1 23  ? 1.512   -1.698  -6.165  1.00 0.00 ? 23  ASN A C    4  
ATOM 5946  O O    . ASN A 1 23  ? 2.345   -0.832  -5.897  1.00 0.00 ? 23  ASN A O    4  
ATOM 5947  C CB   . ASN A 1 23  ? 1.638   -1.925  -8.653  1.00 0.00 ? 23  ASN A CB   4  
ATOM 5948  C CG   . ASN A 1 23  ? 0.910   -2.553  -9.826  1.00 0.00 ? 23  ASN A CG   4  
ATOM 5949  O OD1  . ASN A 1 23  ? 0.047   -3.413  -9.647  1.00 0.00 ? 23  ASN A OD1  4  
ATOM 5950  N ND2  . ASN A 1 23  ? 1.255   -2.125  -11.034 1.00 0.00 ? 23  ASN A ND2  4  
ATOM 5951  H H    . ASN A 1 23  ? 0.075   0.076   -8.488  1.00 0.00 ? 23  ASN A H    4  
ATOM 5952  H HA   . ASN A 1 23  ? -0.042  -2.436  -7.429  1.00 0.00 ? 23  ASN A HA   4  
ATOM 5953  H HB2  . ASN A 1 23  ? 2.066   -0.988  -8.980  1.00 0.00 ? 23  ASN A HB2  4  
ATOM 5954  H HB3  . ASN A 1 23  ? 2.430   -2.591  -8.346  1.00 0.00 ? 23  ASN A HB3  4  
ATOM 5955  H HD21 . ASN A 1 23  ? 1.951   -1.437  -11.101 1.00 0.00 ? 23  ASN A HD21 4  
ATOM 5956  H HD22 . ASN A 1 23  ? 0.800   -2.514  -11.810 1.00 0.00 ? 23  ASN A HD22 4  
ATOM 5957  N N    . PRO A 1 24  ? 1.254   -2.722  -5.338  1.00 0.00 ? 24  PRO A N    4  
ATOM 5958  C CA   . PRO A 1 24  ? 1.940   -2.895  -4.054  1.00 0.00 ? 24  PRO A CA   4  
ATOM 5959  C C    . PRO A 1 24  ? 3.407   -3.276  -4.227  1.00 0.00 ? 24  PRO A C    4  
ATOM 5960  O O    . PRO A 1 24  ? 3.754   -4.457  -4.251  1.00 0.00 ? 24  PRO A O    4  
ATOM 5961  C CB   . PRO A 1 24  ? 1.167   -4.037  -3.390  1.00 0.00 ? 24  PRO A CB   4  
ATOM 5962  C CG   . PRO A 1 24  ? 0.574   -4.803  -4.522  1.00 0.00 ? 24  PRO A CG   4  
ATOM 5963  C CD   . PRO A 1 24  ? 0.274   -3.791  -5.594  1.00 0.00 ? 24  PRO A CD   4  
ATOM 5964  H HA   . PRO A 1 24  ? 1.870   -2.007  -3.444  1.00 0.00 ? 24  PRO A HA   4  
ATOM 5965  H HB2  . PRO A 1 24  ? 1.846   -4.647  -2.812  1.00 0.00 ? 24  PRO A HB2  4  
ATOM 5966  H HB3  . PRO A 1 24  ? 0.402   -3.631  -2.745  1.00 0.00 ? 24  PRO A HB3  4  
ATOM 5967  H HG2  . PRO A 1 24  ? 1.283   -5.532  -4.883  1.00 0.00 ? 24  PRO A HG2  4  
ATOM 5968  H HG3  . PRO A 1 24  ? -0.335  -5.288  -4.200  1.00 0.00 ? 24  PRO A HG3  4  
ATOM 5969  H HD2  . PRO A 1 24  ? 0.421   -4.223  -6.572  1.00 0.00 ? 24  PRO A HD2  4  
ATOM 5970  H HD3  . PRO A 1 24  ? -0.735  -3.420  -5.491  1.00 0.00 ? 24  PRO A HD3  4  
ATOM 5971  N N    . VAL A 1 25  ? 4.265   -2.267  -4.348  1.00 0.00 ? 25  VAL A N    4  
ATOM 5972  C CA   . VAL A 1 25  ? 5.695   -2.496  -4.517  1.00 0.00 ? 25  VAL A CA   4  
ATOM 5973  C C    . VAL A 1 25  ? 6.225   -3.463  -3.464  1.00 0.00 ? 25  VAL A C    4  
ATOM 5974  O O    . VAL A 1 25  ? 6.391   -3.099  -2.299  1.00 0.00 ? 25  VAL A O    4  
ATOM 5975  C CB   . VAL A 1 25  ? 6.488   -1.179  -4.434  1.00 0.00 ? 25  VAL A CB   4  
ATOM 5976  C CG1  . VAL A 1 25  ? 7.967   -1.429  -4.683  1.00 0.00 ? 25  VAL A CG1  4  
ATOM 5977  C CG2  . VAL A 1 25  ? 5.937   -0.163  -5.424  1.00 0.00 ? 25  VAL A CG2  4  
ATOM 5978  H H    . VAL A 1 25  ? 3.928   -1.348  -4.321  1.00 0.00 ? 25  VAL A H    4  
ATOM 5979  H HA   . VAL A 1 25  ? 5.851   -2.925  -5.496  1.00 0.00 ? 25  VAL A HA   4  
ATOM 5980  H HB   . VAL A 1 25  ? 6.376   -0.777  -3.438  1.00 0.00 ? 25  VAL A HB   4  
ATOM 5981  H HG11 . VAL A 1 25  ? 8.276   -0.904  -5.575  1.00 0.00 ? 25  VAL A HG11 4  
ATOM 5982  H HG12 . VAL A 1 25  ? 8.540   -1.074  -3.839  1.00 0.00 ? 25  VAL A HG12 4  
ATOM 5983  H HG13 . VAL A 1 25  ? 8.136   -2.488  -4.813  1.00 0.00 ? 25  VAL A HG13 4  
ATOM 5984  H HG21 . VAL A 1 25  ? 6.637   0.652   -5.529  1.00 0.00 ? 25  VAL A HG21 4  
ATOM 5985  H HG22 . VAL A 1 25  ? 5.789   -0.637  -6.383  1.00 0.00 ? 25  VAL A HG22 4  
ATOM 5986  H HG23 . VAL A 1 25  ? 4.993   0.217   -5.062  1.00 0.00 ? 25  VAL A HG23 4  
ATOM 5987  N N    . VAL A 1 26  ? 6.490   -4.697  -3.880  1.00 0.00 ? 26  VAL A N    4  
ATOM 5988  C CA   . VAL A 1 26  ? 7.003   -5.717  -2.974  1.00 0.00 ? 26  VAL A CA   4  
ATOM 5989  C C    . VAL A 1 26  ? 8.462   -5.451  -2.618  1.00 0.00 ? 26  VAL A C    4  
ATOM 5990  O O    . VAL A 1 26  ? 9.341   -5.496  -3.480  1.00 0.00 ? 26  VAL A O    4  
ATOM 5991  C CB   . VAL A 1 26  ? 6.884   -7.125  -3.586  1.00 0.00 ? 26  VAL A CB   4  
ATOM 5992  C CG1  . VAL A 1 26  ? 7.716   -7.227  -4.856  1.00 0.00 ? 26  VAL A CG1  4  
ATOM 5993  C CG2  . VAL A 1 26  ? 7.304   -8.182  -2.577  1.00 0.00 ? 26  VAL A CG2  4  
ATOM 5994  H H    . VAL A 1 26  ? 6.337   -4.927  -4.821  1.00 0.00 ? 26  VAL A H    4  
ATOM 5995  H HA   . VAL A 1 26  ? 6.412   -5.688  -2.070  1.00 0.00 ? 26  VAL A HA   4  
ATOM 5996  H HB   . VAL A 1 26  ? 5.849   -7.295  -3.846  1.00 0.00 ? 26  VAL A HB   4  
ATOM 5997  H HG11 . VAL A 1 26  ? 7.374   -8.067  -5.443  1.00 0.00 ? 26  VAL A HG11 4  
ATOM 5998  H HG12 . VAL A 1 26  ? 7.611   -6.318  -5.430  1.00 0.00 ? 26  VAL A HG12 4  
ATOM 5999  H HG13 . VAL A 1 26  ? 8.754   -7.371  -4.594  1.00 0.00 ? 26  VAL A HG13 4  
ATOM 6000  H HG21 . VAL A 1 26  ? 7.612   -7.701  -1.661  1.00 0.00 ? 26  VAL A HG21 4  
ATOM 6001  H HG22 . VAL A 1 26  ? 6.470   -8.839  -2.375  1.00 0.00 ? 26  VAL A HG22 4  
ATOM 6002  H HG23 . VAL A 1 26  ? 8.125   -8.757  -2.977  1.00 0.00 ? 26  VAL A HG23 4  
ATOM 6003  N N    . LEU A 1 27  ? 8.713   -5.176  -1.343  1.00 0.00 ? 27  LEU A N    4  
ATOM 6004  C CA   . LEU A 1 27  ? 10.067  -4.904  -0.871  1.00 0.00 ? 27  LEU A CA   4  
ATOM 6005  C C    . LEU A 1 27  ? 10.750  -6.186  -0.409  1.00 0.00 ? 27  LEU A C    4  
ATOM 6006  O O    . LEU A 1 27  ? 11.910  -6.439  -0.739  1.00 0.00 ? 27  LEU A O    4  
ATOM 6007  C CB   . LEU A 1 27  ? 10.035  -3.888  0.273   1.00 0.00 ? 27  LEU A CB   4  
ATOM 6008  C CG   . LEU A 1 27  ? 9.339   -2.560  -0.028  1.00 0.00 ? 27  LEU A CG   4  
ATOM 6009  C CD1  . LEU A 1 27  ? 9.145   -1.759  1.250   1.00 0.00 ? 27  LEU A CD1  4  
ATOM 6010  C CD2  . LEU A 1 27  ? 10.137  -1.759  -1.046  1.00 0.00 ? 27  LEU A CD2  4  
ATOM 6011  H H    . LEU A 1 27  ? 7.972   -5.155  -0.703  1.00 0.00 ? 27  LEU A H    4  
ATOM 6012  H HA   . LEU A 1 27  ? 10.627  -4.488  -1.695  1.00 0.00 ? 27  LEU A HA   4  
ATOM 6013  H HB2  . LEU A 1 27  ? 9.526   -4.346  1.107   1.00 0.00 ? 27  LEU A HB2  4  
ATOM 6014  H HB3  . LEU A 1 27  ? 11.057  -3.673  0.551   1.00 0.00 ? 27  LEU A HB3  4  
ATOM 6015  H HG   . LEU A 1 27  ? 8.363   -2.759  -0.448  1.00 0.00 ? 27  LEU A HG   4  
ATOM 6016  H HD11 . LEU A 1 27  ? 8.333   -2.183  1.821   1.00 0.00 ? 27  LEU A HD11 4  
ATOM 6017  H HD12 . LEU A 1 27  ? 8.912   -0.734  1.000   1.00 0.00 ? 27  LEU A HD12 4  
ATOM 6018  H HD13 . LEU A 1 27  ? 10.052  -1.789  1.835   1.00 0.00 ? 27  LEU A HD13 4  
ATOM 6019  H HD21 . LEU A 1 27  ? 10.986  -2.340  -1.375  1.00 0.00 ? 27  LEU A HD21 4  
ATOM 6020  H HD22 . LEU A 1 27  ? 10.483  -0.842  -0.592  1.00 0.00 ? 27  LEU A HD22 4  
ATOM 6021  H HD23 . LEU A 1 27  ? 9.509   -1.527  -1.893  1.00 0.00 ? 27  LEU A HD23 4  
ATOM 6022  N N    . THR A 1 28  ? 10.024  -6.995  0.356   1.00 0.00 ? 28  THR A N    4  
ATOM 6023  C CA   . THR A 1 28  ? 10.560  -8.253  0.863   1.00 0.00 ? 28  THR A CA   4  
ATOM 6024  C C    . THR A 1 28  ? 9.498   -9.346  0.853   1.00 0.00 ? 28  THR A C    4  
ATOM 6025  O O    . THR A 1 28  ? 8.298   -9.079  0.794   1.00 0.00 ? 28  THR A O    4  
ATOM 6026  C CB   . THR A 1 28  ? 11.105  -8.094  2.295   1.00 0.00 ? 28  THR A CB   4  
ATOM 6027  O OG1  . THR A 1 28  ? 10.385  -7.065  2.982   1.00 0.00 ? 28  THR A OG1  4  
ATOM 6028  C CG2  . THR A 1 28  ? 12.588  -7.756  2.275   1.00 0.00 ? 28  THR A CG2  4  
ATOM 6029  H H    . THR A 1 28  ? 9.107   -6.739  0.585   1.00 0.00 ? 28  THR A H    4  
ATOM 6030  H HA   . THR A 1 28  ? 11.376  -8.551  0.220   1.00 0.00 ? 28  THR A HA   4  
ATOM 6031  H HB   . THR A 1 28  ? 10.971  -9.029  2.820   1.00 0.00 ? 28  THR A HB   4  
ATOM 6032  H HG1  . THR A 1 28  ? 10.093  -6.403  2.351   1.00 0.00 ? 28  THR A HG1  4  
ATOM 6033  H HG21 . THR A 1 28  ? 13.131  -8.484  2.859   1.00 0.00 ? 28  THR A HG21 4  
ATOM 6034  H HG22 . THR A 1 28  ? 12.738  -6.773  2.696   1.00 0.00 ? 28  THR A HG22 4  
ATOM 6035  H HG23 . THR A 1 28  ? 12.947  -7.771  1.257   1.00 0.00 ? 28  THR A HG23 4  
ATOM 6036  N N    . PRO A 1 29  ? 9.947   -10.609 0.914   1.00 0.00 ? 29  PRO A N    4  
ATOM 6037  C CA   . PRO A 1 29  ? 9.051   -11.769 0.915   1.00 0.00 ? 29  PRO A CA   4  
ATOM 6038  C C    . PRO A 1 29  ? 8.256   -11.886 2.211   1.00 0.00 ? 29  PRO A C    4  
ATOM 6039  O O    . PRO A 1 29  ? 7.379   -12.741 2.339   1.00 0.00 ? 29  PRO A O    4  
ATOM 6040  C CB   . PRO A 1 29  ? 10.006  -12.955 0.765   1.00 0.00 ? 29  PRO A CB   4  
ATOM 6041  C CG   . PRO A 1 29  ? 11.304  -12.468 1.310   1.00 0.00 ? 29  PRO A CG   4  
ATOM 6042  C CD   . PRO A 1 29  ? 11.365  -11.001 0.987   1.00 0.00 ? 29  PRO A CD   4  
ATOM 6043  H HA   . PRO A 1 29  ? 8.370   -11.744 0.077   1.00 0.00 ? 29  PRO A HA   4  
ATOM 6044  H HB2  . PRO A 1 29  ? 9.630   -13.797 1.329   1.00 0.00 ? 29  PRO A HB2  4  
ATOM 6045  H HB3  . PRO A 1 29  ? 10.092  -13.223 -0.278  1.00 0.00 ? 29  PRO A HB3  4  
ATOM 6046  H HG2  . PRO A 1 29  ? 11.332  -12.618 2.379   1.00 0.00 ? 29  PRO A HG2  4  
ATOM 6047  H HG3  . PRO A 1 29  ? 12.121  -12.991 0.835   1.00 0.00 ? 29  PRO A HG3  4  
ATOM 6048  H HD2  . PRO A 1 29  ? 11.874  -10.462 1.772   1.00 0.00 ? 29  PRO A HD2  4  
ATOM 6049  H HD3  . PRO A 1 29  ? 11.857  -10.844 0.038   1.00 0.00 ? 29  PRO A HD3  4  
ATOM 6050  N N    . THR A 1 30  ? 8.566   -11.020 3.171   1.00 0.00 ? 30  THR A N    4  
ATOM 6051  C CA   . THR A 1 30  ? 7.881   -11.027 4.457   1.00 0.00 ? 30  THR A CA   4  
ATOM 6052  C C    . THR A 1 30  ? 7.214   -9.684  4.732   1.00 0.00 ? 30  THR A C    4  
ATOM 6053  O O    . THR A 1 30  ? 6.404   -9.557  5.651   1.00 0.00 ? 30  THR A O    4  
ATOM 6054  C CB   . THR A 1 30  ? 8.852   -11.350 5.609   1.00 0.00 ? 30  THR A CB   4  
ATOM 6055  O OG1  . THR A 1 30  ? 9.991   -10.485 5.547   1.00 0.00 ? 30  THR A OG1  4  
ATOM 6056  C CG2  . THR A 1 30  ? 9.306   -12.800 5.542   1.00 0.00 ? 30  THR A CG2  4  
ATOM 6057  H H    . THR A 1 30  ? 9.274   -10.362 3.009   1.00 0.00 ? 30  THR A H    4  
ATOM 6058  H HA   . THR A 1 30  ? 7.123   -11.795 4.427   1.00 0.00 ? 30  THR A HA   4  
ATOM 6059  H HB   . THR A 1 30  ? 8.339   -11.191 6.547   1.00 0.00 ? 30  THR A HB   4  
ATOM 6060  H HG1  . THR A 1 30  ? 10.662  -10.794 6.160   1.00 0.00 ? 30  THR A HG1  4  
ATOM 6061  H HG21 . THR A 1 30  ? 8.570   -13.431 6.019   1.00 0.00 ? 30  THR A HG21 4  
ATOM 6062  H HG22 . THR A 1 30  ? 10.253  -12.904 6.051   1.00 0.00 ? 30  THR A HG22 4  
ATOM 6063  H HG23 . THR A 1 30  ? 9.417   -13.095 4.510   1.00 0.00 ? 30  THR A HG23 4  
ATOM 6064  N N    . THR A 1 31  ? 7.558   -8.682  3.929   1.00 0.00 ? 31  THR A N    4  
ATOM 6065  C CA   . THR A 1 31  ? 6.993   -7.348  4.086   1.00 0.00 ? 31  THR A CA   4  
ATOM 6066  C C    . THR A 1 31  ? 6.769   -6.683  2.732   1.00 0.00 ? 31  THR A C    4  
ATOM 6067  O O    . THR A 1 31  ? 7.584   -6.818  1.820   1.00 0.00 ? 31  THR A O    4  
ATOM 6068  C CB   . THR A 1 31  ? 7.904   -6.449  4.942   1.00 0.00 ? 31  THR A CB   4  
ATOM 6069  O OG1  . THR A 1 31  ? 8.423   -7.191  6.051   1.00 0.00 ? 31  THR A OG1  4  
ATOM 6070  C CG2  . THR A 1 31  ? 7.143   -5.234  5.451   1.00 0.00 ? 31  THR A CG2  4  
ATOM 6071  H H    . THR A 1 31  ? 8.209   -8.845  3.214   1.00 0.00 ? 31  THR A H    4  
ATOM 6072  H HA   . THR A 1 31  ? 6.042   -7.446  4.590   1.00 0.00 ? 31  THR A HA   4  
ATOM 6073  H HB   . THR A 1 31  ? 8.727   -6.108  4.329   1.00 0.00 ? 31  THR A HB   4  
ATOM 6074  H HG1  . THR A 1 31  ? 9.344   -7.410  5.887   1.00 0.00 ? 31  THR A HG1  4  
ATOM 6075  H HG21 . THR A 1 31  ? 6.723   -5.453  6.422   1.00 0.00 ? 31  THR A HG21 4  
ATOM 6076  H HG22 . THR A 1 31  ? 6.348   -4.993  4.761   1.00 0.00 ? 31  THR A HG22 4  
ATOM 6077  H HG23 . THR A 1 31  ? 7.817   -4.395  5.531   1.00 0.00 ? 31  THR A HG23 4  
ATOM 6078  N N    . VAL A 1 32  ? 5.658   -5.964  2.608   1.00 0.00 ? 32  VAL A N    4  
ATOM 6079  C CA   . VAL A 1 32  ? 5.327   -5.276  1.366   1.00 0.00 ? 32  VAL A CA   4  
ATOM 6080  C C    . VAL A 1 32  ? 4.824   -3.862  1.638   1.00 0.00 ? 32  VAL A C    4  
ATOM 6081  O O    . VAL A 1 32  ? 4.156   -3.613  2.641   1.00 0.00 ? 32  VAL A O    4  
ATOM 6082  C CB   . VAL A 1 32  ? 4.258   -6.044  0.566   1.00 0.00 ? 32  VAL A CB   4  
ATOM 6083  C CG1  . VAL A 1 32  ? 3.783   -5.219  -0.620  1.00 0.00 ? 32  VAL A CG1  4  
ATOM 6084  C CG2  . VAL A 1 32  ? 4.801   -7.389  0.107   1.00 0.00 ? 32  VAL A CG2  4  
ATOM 6085  H H    . VAL A 1 32  ? 5.046   -5.893  3.371   1.00 0.00 ? 32  VAL A H    4  
ATOM 6086  H HA   . VAL A 1 32  ? 6.224   -5.219  0.767   1.00 0.00 ? 32  VAL A HA   4  
ATOM 6087  H HB   . VAL A 1 32  ? 3.413   -6.223  1.214   1.00 0.00 ? 32  VAL A HB   4  
ATOM 6088  H HG11 . VAL A 1 32  ? 2.922   -5.694  -1.066  1.00 0.00 ? 32  VAL A HG11 4  
ATOM 6089  H HG12 . VAL A 1 32  ? 3.516   -4.227  -0.285  1.00 0.00 ? 32  VAL A HG12 4  
ATOM 6090  H HG13 . VAL A 1 32  ? 4.575   -5.151  -1.351  1.00 0.00 ? 32  VAL A HG13 4  
ATOM 6091  H HG21 . VAL A 1 32  ? 5.227   -7.286  -0.880  1.00 0.00 ? 32  VAL A HG21 4  
ATOM 6092  H HG22 . VAL A 1 32  ? 5.565   -7.723  0.795   1.00 0.00 ? 32  VAL A HG22 4  
ATOM 6093  H HG23 . VAL A 1 32  ? 4.000   -8.111  0.081   1.00 0.00 ? 32  VAL A HG23 4  
ATOM 6094  N N    . GLN A 1 33  ? 5.151   -2.941  0.737   1.00 0.00 ? 33  GLN A N    4  
ATOM 6095  C CA   . GLN A 1 33  ? 4.732   -1.551  0.880   1.00 0.00 ? 33  GLN A CA   4  
ATOM 6096  C C    . GLN A 1 33  ? 3.467   -1.278  0.073   1.00 0.00 ? 33  GLN A C    4  
ATOM 6097  O O    . GLN A 1 33  ? 3.404   -1.575  -1.120  1.00 0.00 ? 33  GLN A O    4  
ATOM 6098  C CB   . GLN A 1 33  ? 5.851   -0.610  0.432   1.00 0.00 ? 33  GLN A CB   4  
ATOM 6099  C CG   . GLN A 1 33  ? 5.622   0.840   0.826   1.00 0.00 ? 33  GLN A CG   4  
ATOM 6100  C CD   . GLN A 1 33  ? 4.526   1.499   0.013   1.00 0.00 ? 33  GLN A CD   4  
ATOM 6101  O OE1  . GLN A 1 33  ? 4.574   1.516   -1.217  1.00 0.00 ? 33  GLN A OE1  4  
ATOM 6102  N NE2  . GLN A 1 33  ? 3.529   2.048   0.698   1.00 0.00 ? 33  GLN A NE2  4  
ATOM 6103  H H    . GLN A 1 33  ? 5.685   -3.201  -0.041  1.00 0.00 ? 33  GLN A H    4  
ATOM 6104  H HA   . GLN A 1 33  ? 4.522   -1.374  1.924   1.00 0.00 ? 33  GLN A HA   4  
ATOM 6105  H HB2  . GLN A 1 33  ? 6.780   -0.939  0.874   1.00 0.00 ? 33  GLN A HB2  4  
ATOM 6106  H HB3  . GLN A 1 33  ? 5.936   -0.659  -0.644  1.00 0.00 ? 33  GLN A HB3  4  
ATOM 6107  H HG2  . GLN A 1 33  ? 5.346   0.876   1.870   1.00 0.00 ? 33  GLN A HG2  4  
ATOM 6108  H HG3  . GLN A 1 33  ? 6.540   1.389   0.679   1.00 0.00 ? 33  GLN A HG3  4  
ATOM 6109  H HE21 . GLN A 1 33  ? 3.558   1.998   1.677   1.00 0.00 ? 33  GLN A HE21 4  
ATOM 6110  H HE22 . GLN A 1 33  ? 2.808   2.482   0.198   1.00 0.00 ? 33  GLN A HE22 4  
ATOM 6111  N N    . VAL A 1 34  ? 2.462   -0.710  0.731   1.00 0.00 ? 34  VAL A N    4  
ATOM 6112  C CA   . VAL A 1 34  ? 1.199   -0.396  0.074   1.00 0.00 ? 34  VAL A CA   4  
ATOM 6113  C C    . VAL A 1 34  ? 0.938   1.106   0.073   1.00 0.00 ? 34  VAL A C    4  
ATOM 6114  O O    . VAL A 1 34  ? 0.908   1.743   1.127   1.00 0.00 ? 34  VAL A O    4  
ATOM 6115  C CB   . VAL A 1 34  ? 0.017   -1.111  0.757   1.00 0.00 ? 34  VAL A CB   4  
ATOM 6116  C CG1  . VAL A 1 34  ? -1.286  -0.794  0.040   1.00 0.00 ? 34  VAL A CG1  4  
ATOM 6117  C CG2  . VAL A 1 34  ? 0.259   -2.612  0.805   1.00 0.00 ? 34  VAL A CG2  4  
ATOM 6118  H H    . VAL A 1 34  ? 2.572   -0.498  1.681   1.00 0.00 ? 34  VAL A H    4  
ATOM 6119  H HA   . VAL A 1 34  ? 1.259   -0.742  -0.948  1.00 0.00 ? 34  VAL A HA   4  
ATOM 6120  H HB   . VAL A 1 34  ? -0.059  -0.747  1.772   1.00 0.00 ? 34  VAL A HB   4  
ATOM 6121  H HG11 . VAL A 1 34  ? -1.777  0.032   0.533   1.00 0.00 ? 34  VAL A HG11 4  
ATOM 6122  H HG12 . VAL A 1 34  ? -1.077  -0.530  -0.987  1.00 0.00 ? 34  VAL A HG12 4  
ATOM 6123  H HG13 . VAL A 1 34  ? -1.930  -1.661  0.065   1.00 0.00 ? 34  VAL A HG13 4  
ATOM 6124  H HG21 . VAL A 1 34  ? 0.037   -2.980  1.795   1.00 0.00 ? 34  VAL A HG21 4  
ATOM 6125  H HG22 . VAL A 1 34  ? -0.382  -3.103  0.087   1.00 0.00 ? 34  VAL A HG22 4  
ATOM 6126  H HG23 . VAL A 1 34  ? 1.291   -2.819  0.566   1.00 0.00 ? 34  VAL A HG23 4  
ATOM 6127  N N    . THR A 1 35  ? 0.750   1.668   -1.117  1.00 0.00 ? 35  THR A N    4  
ATOM 6128  C CA   . THR A 1 35  ? 0.492   3.096   -1.255  1.00 0.00 ? 35  THR A CA   4  
ATOM 6129  C C    . THR A 1 35  ? -0.836  3.349   -1.959  1.00 0.00 ? 35  THR A C    4  
ATOM 6130  O O    . THR A 1 35  ? -1.283  2.540   -2.772  1.00 0.00 ? 35  THR A O    4  
ATOM 6131  C CB   . THR A 1 35  ? 1.618   3.796   -2.040  1.00 0.00 ? 35  THR A CB   4  
ATOM 6132  O OG1  . THR A 1 35  ? 2.879   3.561   -1.404  1.00 0.00 ? 35  THR A OG1  4  
ATOM 6133  C CG2  . THR A 1 35  ? 1.362   5.292   -2.134  1.00 0.00 ? 35  THR A CG2  4  
ATOM 6134  H H    . THR A 1 35  ? 0.786   1.108   -1.920  1.00 0.00 ? 35  THR A H    4  
ATOM 6135  H HA   . THR A 1 35  ? 0.452   3.525   -0.265  1.00 0.00 ? 35  THR A HA   4  
ATOM 6136  H HB   . THR A 1 35  ? 1.646   3.387   -3.040  1.00 0.00 ? 35  THR A HB   4  
ATOM 6137  H HG1  . THR A 1 35  ? 3.175   4.367   -0.973  1.00 0.00 ? 35  THR A HG1  4  
ATOM 6138  H HG21 . THR A 1 35  ? 0.911   5.639   -1.216  1.00 0.00 ? 35  THR A HG21 4  
ATOM 6139  H HG22 . THR A 1 35  ? 0.697   5.493   -2.961  1.00 0.00 ? 35  THR A HG22 4  
ATOM 6140  H HG23 . THR A 1 35  ? 2.298   5.808   -2.292  1.00 0.00 ? 35  THR A HG23 4  
ATOM 6141  N N    . TRP A 1 36  ? -1.462  4.477   -1.642  1.00 0.00 ? 36  TRP A N    4  
ATOM 6142  C CA   . TRP A 1 36  ? -2.740  4.837   -2.245  1.00 0.00 ? 36  TRP A CA   4  
ATOM 6143  C C    . TRP A 1 36  ? -2.936  6.349   -2.243  1.00 0.00 ? 36  TRP A C    4  
ATOM 6144  O O    . TRP A 1 36  ? -2.684  7.017   -1.240  1.00 0.00 ? 36  TRP A O    4  
ATOM 6145  C CB   . TRP A 1 36  ? -3.889  4.160   -1.495  1.00 0.00 ? 36  TRP A CB   4  
ATOM 6146  C CG   . TRP A 1 36  ? -3.974  4.558   -0.053  1.00 0.00 ? 36  TRP A CG   4  
ATOM 6147  C CD1  . TRP A 1 36  ? -4.503  5.713   0.449   1.00 0.00 ? 36  TRP A CD1  4  
ATOM 6148  C CD2  . TRP A 1 36  ? -3.513  3.803   1.073   1.00 0.00 ? 36  TRP A CD2  4  
ATOM 6149  N NE1  . TRP A 1 36  ? -4.399  5.721   1.819   1.00 0.00 ? 36  TRP A NE1  4  
ATOM 6150  C CE2  . TRP A 1 36  ? -3.796  4.560   2.226   1.00 0.00 ? 36  TRP A CE2  4  
ATOM 6151  C CE3  . TRP A 1 36  ? -2.891  2.560   1.219   1.00 0.00 ? 36  TRP A CE3  4  
ATOM 6152  C CZ2  . TRP A 1 36  ? -3.477  4.114   3.506   1.00 0.00 ? 36  TRP A CZ2  4  
ATOM 6153  C CZ3  . TRP A 1 36  ? -2.575  2.119   2.489   1.00 0.00 ? 36  TRP A CZ3  4  
ATOM 6154  C CH2  . TRP A 1 36  ? -2.868  2.894   3.620   1.00 0.00 ? 36  TRP A CH2  4  
ATOM 6155  H H    . TRP A 1 36  ? -1.055  5.082   -0.986  1.00 0.00 ? 36  TRP A H    4  
ATOM 6156  H HA   . TRP A 1 36  ? -2.734  4.487   -3.267  1.00 0.00 ? 36  TRP A HA   4  
ATOM 6157  H HB2  . TRP A 1 36  ? -4.824  4.423   -1.969  1.00 0.00 ? 36  TRP A HB2  4  
ATOM 6158  H HB3  . TRP A 1 36  ? -3.756  3.089   -1.539  1.00 0.00 ? 36  TRP A HB3  4  
ATOM 6159  H HD1  . TRP A 1 36  ? -4.935  6.496   -0.155  1.00 0.00 ? 36  TRP A HD1  4  
ATOM 6160  H HE1  . TRP A 1 36  ? -4.708  6.440   2.409   1.00 0.00 ? 36  TRP A HE1  4  
ATOM 6161  H HE3  . TRP A 1 36  ? -2.657  1.949   0.360   1.00 0.00 ? 36  TRP A HE3  4  
ATOM 6162  H HZ2  . TRP A 1 36  ? -3.697  4.699   4.387   1.00 0.00 ? 36  TRP A HZ2  4  
ATOM 6163  H HZ3  . TRP A 1 36  ? -2.093  1.161   2.622   1.00 0.00 ? 36  TRP A HZ3  4  
ATOM 6164  H HH2  . TRP A 1 36  ? -2.603  2.509   4.592   1.00 0.00 ? 36  TRP A HH2  4  
ATOM 6165  N N    . THR A 1 37  ? -3.389  6.884   -3.373  1.00 0.00 ? 37  THR A N    4  
ATOM 6166  C CA   . THR A 1 37  ? -3.618  8.317   -3.502  1.00 0.00 ? 37  THR A CA   4  
ATOM 6167  C C    . THR A 1 37  ? -5.090  8.659   -3.304  1.00 0.00 ? 37  THR A C    4  
ATOM 6168  O O    . THR A 1 37  ? -5.973  7.919   -3.739  1.00 0.00 ? 37  THR A O    4  
ATOM 6169  C CB   . THR A 1 37  ? -3.162  8.838   -4.878  1.00 0.00 ? 37  THR A CB   4  
ATOM 6170  O OG1  . THR A 1 37  ? -3.168  10.269  -4.887  1.00 0.00 ? 37  THR A OG1  4  
ATOM 6171  C CG2  . THR A 1 37  ? -4.069  8.314   -5.982  1.00 0.00 ? 37  THR A CG2  4  
ATOM 6172  H H    . THR A 1 37  ? -3.572  6.299   -4.138  1.00 0.00 ? 37  THR A H    4  
ATOM 6173  H HA   . THR A 1 37  ? -3.037  8.818   -2.741  1.00 0.00 ? 37  THR A HA   4  
ATOM 6174  H HB   . THR A 1 37  ? -2.156  8.488   -5.063  1.00 0.00 ? 37  THR A HB   4  
ATOM 6175  H HG1  . THR A 1 37  ? -2.822  10.586  -5.725  1.00 0.00 ? 37  THR A HG1  4  
ATOM 6176  H HG21 . THR A 1 37  ? -4.500  7.372   -5.678  1.00 0.00 ? 37  THR A HG21 4  
ATOM 6177  H HG22 . THR A 1 37  ? -3.493  8.173   -6.884  1.00 0.00 ? 37  THR A HG22 4  
ATOM 6178  H HG23 . THR A 1 37  ? -4.858  9.027   -6.167  1.00 0.00 ? 37  THR A HG23 4  
ATOM 6179  N N    . VAL A 1 38  ? -5.349  9.784   -2.646  1.00 0.00 ? 38  VAL A N    4  
ATOM 6180  C CA   . VAL A 1 38  ? -6.715  10.225  -2.392  1.00 0.00 ? 38  VAL A CA   4  
ATOM 6181  C C    . VAL A 1 38  ? -6.964  11.610  -2.978  1.00 0.00 ? 38  VAL A C    4  
ATOM 6182  O O    . VAL A 1 38  ? -6.311  12.582  -2.599  1.00 0.00 ? 38  VAL A O    4  
ATOM 6183  C CB   . VAL A 1 38  ? -7.024  10.255  -0.883  1.00 0.00 ? 38  VAL A CB   4  
ATOM 6184  C CG1  . VAL A 1 38  ? -6.549  8.974   -0.215  1.00 0.00 ? 38  VAL A CG1  4  
ATOM 6185  C CG2  . VAL A 1 38  ? -6.386  11.473  -0.234  1.00 0.00 ? 38  VAL A CG2  4  
ATOM 6186  H H    . VAL A 1 38  ? -4.602  10.331  -2.323  1.00 0.00 ? 38  VAL A H    4  
ATOM 6187  H HA   . VAL A 1 38  ? -7.386  9.520   -2.862  1.00 0.00 ? 38  VAL A HA   4  
ATOM 6188  H HB   . VAL A 1 38  ? -8.095  10.325  -0.757  1.00 0.00 ? 38  VAL A HB   4  
ATOM 6189  H HG11 . VAL A 1 38  ? -7.262  8.677   0.541   1.00 0.00 ? 38  VAL A HG11 4  
ATOM 6190  H HG12 . VAL A 1 38  ? -6.462  8.192   -0.955  1.00 0.00 ? 38  VAL A HG12 4  
ATOM 6191  H HG13 . VAL A 1 38  ? -5.587  9.144   0.245   1.00 0.00 ? 38  VAL A HG13 4  
ATOM 6192  H HG21 . VAL A 1 38  ? -6.954  12.356  -0.489  1.00 0.00 ? 38  VAL A HG21 4  
ATOM 6193  H HG22 . VAL A 1 38  ? -6.379  11.348  0.840   1.00 0.00 ? 38  VAL A HG22 4  
ATOM 6194  H HG23 . VAL A 1 38  ? -5.372  11.582  -0.589  1.00 0.00 ? 38  VAL A HG23 4  
ATOM 6195  N N    . ASP A 1 39  ? -7.912  11.692  -3.905  1.00 0.00 ? 39  ASP A N    4  
ATOM 6196  C CA   . ASP A 1 39  ? -8.248  12.959  -4.544  1.00 0.00 ? 39  ASP A CA   4  
ATOM 6197  C C    . ASP A 1 39  ? -8.986  13.878  -3.575  1.00 0.00 ? 39  ASP A C    4  
ATOM 6198  O O    . ASP A 1 39  ? -8.742  15.084  -3.540  1.00 0.00 ? 39  ASP A O    4  
ATOM 6199  C CB   . ASP A 1 39  ? -9.106  12.716  -5.787  1.00 0.00 ? 39  ASP A CB   4  
ATOM 6200  C CG   . ASP A 1 39  ? -8.293  12.203  -6.960  1.00 0.00 ? 39  ASP A CG   4  
ATOM 6201  O OD1  . ASP A 1 39  ? -8.017  10.986  -7.003  1.00 0.00 ? 39  ASP A OD1  4  
ATOM 6202  O OD2  . ASP A 1 39  ? -7.932  13.019  -7.834  1.00 0.00 ? 39  ASP A OD2  4  
ATOM 6203  H H    . ASP A 1 39  ? -8.397  10.881  -4.166  1.00 0.00 ? 39  ASP A H    4  
ATOM 6204  H HA   . ASP A 1 39  ? -7.327  13.436  -4.841  1.00 0.00 ? 39  ASP A HA   4  
ATOM 6205  H HB2  . ASP A 1 39  ? -9.867  11.986  -5.555  1.00 0.00 ? 39  ASP A HB2  4  
ATOM 6206  H HB3  . ASP A 1 39  ? -9.578  13.643  -6.078  1.00 0.00 ? 39  ASP A HB3  4  
ATOM 6207  N N    . ARG A 1 40  ? -9.888  13.299  -2.790  1.00 0.00 ? 40  ARG A N    4  
ATOM 6208  C CA   . ARG A 1 40  ? -10.663 14.065  -1.821  1.00 0.00 ? 40  ARG A CA   4  
ATOM 6209  C C    . ARG A 1 40  ? -10.439 13.539  -0.407  1.00 0.00 ? 40  ARG A C    4  
ATOM 6210  O O    . ARG A 1 40  ? -11.224 12.736  0.098   1.00 0.00 ? 40  ARG A O    4  
ATOM 6211  C CB   . ARG A 1 40  ? -12.152 14.010  -2.168  1.00 0.00 ? 40  ARG A CB   4  
ATOM 6212  C CG   . ARG A 1 40  ? -12.456 14.385  -3.609  1.00 0.00 ? 40  ARG A CG   4  
ATOM 6213  C CD   . ARG A 1 40  ? -12.748 15.871  -3.748  1.00 0.00 ? 40  ARG A CD   4  
ATOM 6214  N NE   . ARG A 1 40  ? -12.485 16.356  -5.100  1.00 0.00 ? 40  ARG A NE   4  
ATOM 6215  C CZ   . ARG A 1 40  ? -11.286 16.744  -5.522  1.00 0.00 ? 40  ARG A CZ   4  
ATOM 6216  N NH1  . ARG A 1 40  ? -10.246 16.704  -4.701  1.00 0.00 ? 40  ARG A NH1  4  
ATOM 6217  N NH2  . ARG A 1 40  ? -11.126 17.174  -6.767  1.00 0.00 ? 40  ARG A NH2  4  
ATOM 6218  H H    . ARG A 1 40  ? -10.038 12.333  -2.864  1.00 0.00 ? 40  ARG A H    4  
ATOM 6219  H HA   . ARG A 1 40  ? -10.330 15.091  -1.867  1.00 0.00 ? 40  ARG A HA   4  
ATOM 6220  H HB2  . ARG A 1 40  ? -12.512 13.006  -1.997  1.00 0.00 ? 40  ARG A HB2  4  
ATOM 6221  H HB3  . ARG A 1 40  ? -12.685 14.690  -1.521  1.00 0.00 ? 40  ARG A HB3  4  
ATOM 6222  H HG2  . ARG A 1 40  ? -11.603 14.138  -4.224  1.00 0.00 ? 40  ARG A HG2  4  
ATOM 6223  H HG3  . ARG A 1 40  ? -13.317 13.825  -3.943  1.00 0.00 ? 40  ARG A HG3  4  
ATOM 6224  H HD2  . ARG A 1 40  ? -13.786 16.044  -3.509  1.00 0.00 ? 40  ARG A HD2  4  
ATOM 6225  H HD3  . ARG A 1 40  ? -12.124 16.413  -3.053  1.00 0.00 ? 40  ARG A HD3  4  
ATOM 6226  H HE   . ARG A 1 40  ? -13.239 16.395  -5.723  1.00 0.00 ? 40  ARG A HE   4  
ATOM 6227  H HH11 . ARG A 1 40  ? -10.363 16.380  -3.762  1.00 0.00 ? 40  ARG A HH11 4  
ATOM 6228  H HH12 . ARG A 1 40  ? -9.344  16.995  -5.021  1.00 0.00 ? 40  ARG A HH12 4  
ATOM 6229  H HH21 . ARG A 1 40  ? -11.908 17.206  -7.389  1.00 0.00 ? 40  ARG A HH21 4  
ATOM 6230  H HH22 . ARG A 1 40  ? -10.224 17.466  -7.083  1.00 0.00 ? 40  ARG A HH22 4  
ATOM 6231  N N    . GLN A 1 41  ? -9.363  13.995  0.226   1.00 0.00 ? 41  GLN A N    4  
ATOM 6232  C CA   . GLN A 1 41  ? -9.036  13.569  1.581   1.00 0.00 ? 41  GLN A CA   4  
ATOM 6233  C C    . GLN A 1 41  ? -10.180 13.880  2.541   1.00 0.00 ? 41  GLN A C    4  
ATOM 6234  O O    . GLN A 1 41  ? -10.470 15.037  2.845   1.00 0.00 ? 41  GLN A O    4  
ATOM 6235  C CB   . GLN A 1 41  ? -7.754  14.253  2.059   1.00 0.00 ? 41  GLN A CB   4  
ATOM 6236  C CG   . GLN A 1 41  ? -7.258  13.745  3.403   1.00 0.00 ? 41  GLN A CG   4  
ATOM 6237  C CD   . GLN A 1 41  ? -5.988  14.438  3.856   1.00 0.00 ? 41  GLN A CD   4  
ATOM 6238  O OE1  . GLN A 1 41  ? -4.963  13.795  4.083   1.00 0.00 ? 41  GLN A OE1  4  
ATOM 6239  N NE2  . GLN A 1 41  ? -6.048  15.758  3.989   1.00 0.00 ? 41  GLN A NE2  4  
ATOM 6240  H H    . GLN A 1 41  ? -8.776  14.633  -0.229  1.00 0.00 ? 41  GLN A H    4  
ATOM 6241  H HA   . GLN A 1 41  ? -8.878  12.501  1.564   1.00 0.00 ? 41  GLN A HA   4  
ATOM 6242  H HB2  . GLN A 1 41  ? -6.978  14.087  1.326   1.00 0.00 ? 41  GLN A HB2  4  
ATOM 6243  H HB3  . GLN A 1 41  ? -7.936  15.314  2.144   1.00 0.00 ? 41  GLN A HB3  4  
ATOM 6244  H HG2  . GLN A 1 41  ? -8.025  13.915  4.143   1.00 0.00 ? 41  GLN A HG2  4  
ATOM 6245  H HG3  . GLN A 1 41  ? -7.064  12.686  3.324   1.00 0.00 ? 41  GLN A HG3  4  
ATOM 6246  H HE21 . GLN A 1 41  ? -6.899  16.204  3.791   1.00 0.00 ? 41  GLN A HE21 4  
ATOM 6247  H HE22 . GLN A 1 41  ? -5.242  16.231  4.281   1.00 0.00 ? 41  GLN A HE22 4  
ATOM 6248  N N    . PRO A 1 42  ? -10.847 12.824  3.030   1.00 0.00 ? 42  PRO A N    4  
ATOM 6249  C CA   . PRO A 1 42  ? -11.969 12.960  3.963   1.00 0.00 ? 42  PRO A CA   4  
ATOM 6250  C C    . PRO A 1 42  ? -11.524 13.441  5.340   1.00 0.00 ? 42  PRO A C    4  
ATOM 6251  O O    . PRO A 1 42  ? -10.490 13.014  5.851   1.00 0.00 ? 42  PRO A O    4  
ATOM 6252  C CB   . PRO A 1 42  ? -12.532 11.539  4.049   1.00 0.00 ? 42  PRO A CB   4  
ATOM 6253  C CG   . PRO A 1 42  ? -11.383 10.654  3.709   1.00 0.00 ? 42  PRO A CG   4  
ATOM 6254  C CD   . PRO A 1 42  ? -10.555 11.416  2.711   1.00 0.00 ? 42  PRO A CD   4  
ATOM 6255  H HA   . PRO A 1 42  ? -12.727 13.626  3.578   1.00 0.00 ? 42  PRO A HA   4  
ATOM 6256  H HB2  . PRO A 1 42  ? -12.893 11.352  5.051   1.00 0.00 ? 42  PRO A HB2  4  
ATOM 6257  H HB3  . PRO A 1 42  ? -13.340 11.424  3.343   1.00 0.00 ? 42  PRO A HB3  4  
ATOM 6258  H HG2  . PRO A 1 42  ? -10.804 10.448  4.597   1.00 0.00 ? 42  PRO A HG2  4  
ATOM 6259  H HG3  . PRO A 1 42  ? -11.744 9.735   3.272   1.00 0.00 ? 42  PRO A HG3  4  
ATOM 6260  H HD2  . PRO A 1 42  ? -9.506  11.199  2.847   1.00 0.00 ? 42  PRO A HD2  4  
ATOM 6261  H HD3  . PRO A 1 42  ? -10.865 11.178  1.704   1.00 0.00 ? 42  PRO A HD3  4  
ATOM 6262  N N    . GLN A 1 43  ? -12.313 14.331  5.934   1.00 0.00 ? 43  GLN A N    4  
ATOM 6263  C CA   . GLN A 1 43  ? -11.999 14.869  7.252   1.00 0.00 ? 43  GLN A CA   4  
ATOM 6264  C C    . GLN A 1 43  ? -12.618 14.013  8.352   1.00 0.00 ? 43  GLN A C    4  
ATOM 6265  O O    . GLN A 1 43  ? -11.949 13.647  9.318   1.00 0.00 ? 43  GLN A O    4  
ATOM 6266  C CB   . GLN A 1 43  ? -12.498 16.310  7.370   1.00 0.00 ? 43  GLN A CB   4  
ATOM 6267  C CG   . GLN A 1 43  ? -11.491 17.344  6.891   1.00 0.00 ? 43  GLN A CG   4  
ATOM 6268  C CD   . GLN A 1 43  ? -10.983 17.060  5.491   1.00 0.00 ? 43  GLN A CD   4  
ATOM 6269  O OE1  . GLN A 1 43  ? -9.831  16.668  5.304   1.00 0.00 ? 43  GLN A OE1  4  
ATOM 6270  N NE2  . GLN A 1 43  ? -11.843 17.256  4.498   1.00 0.00 ? 43  GLN A NE2  4  
ATOM 6271  H H    . GLN A 1 43  ? -13.124 14.632  5.475   1.00 0.00 ? 43  GLN A H    4  
ATOM 6272  H HA   . GLN A 1 43  ? -10.925 14.860  7.367   1.00 0.00 ? 43  GLN A HA   4  
ATOM 6273  H HB2  . GLN A 1 43  ? -13.398 16.416  6.782   1.00 0.00 ? 43  GLN A HB2  4  
ATOM 6274  H HB3  . GLN A 1 43  ? -12.728 16.516  8.405   1.00 0.00 ? 43  GLN A HB3  4  
ATOM 6275  H HG2  . GLN A 1 43  ? -11.962 18.316  6.895   1.00 0.00 ? 43  GLN A HG2  4  
ATOM 6276  H HG3  . GLN A 1 43  ? -10.651 17.350  7.569   1.00 0.00 ? 43  GLN A HG3  4  
ATOM 6277  H HE21 . GLN A 1 43  ? -12.744 17.571  4.722   1.00 0.00 ? 43  GLN A HE21 4  
ATOM 6278  H HE22 . GLN A 1 43  ? -11.541 17.081  3.583   1.00 0.00 ? 43  GLN A HE22 4  
ATOM 6279  N N    . PHE A 1 44  ? -13.899 13.697  8.198   1.00 0.00 ? 44  PHE A N    4  
ATOM 6280  C CA   . PHE A 1 44  ? -14.609 12.884  9.179   1.00 0.00 ? 44  PHE A CA   4  
ATOM 6281  C C    . PHE A 1 44  ? -13.904 11.548  9.391   1.00 0.00 ? 44  PHE A C    4  
ATOM 6282  O O    . PHE A 1 44  ? -13.957 10.972  10.478  1.00 0.00 ? 44  PHE A O    4  
ATOM 6283  C CB   . PHE A 1 44  ? -16.051 12.646  8.728   1.00 0.00 ? 44  PHE A CB   4  
ATOM 6284  C CG   . PHE A 1 44  ? -16.169 11.693  7.573   1.00 0.00 ? 44  PHE A CG   4  
ATOM 6285  C CD1  . PHE A 1 44  ? -15.808 12.086  6.294   1.00 0.00 ? 44  PHE A CD1  4  
ATOM 6286  C CD2  . PHE A 1 44  ? -16.639 10.404  7.766   1.00 0.00 ? 44  PHE A CD2  4  
ATOM 6287  C CE1  . PHE A 1 44  ? -15.915 11.211  5.230   1.00 0.00 ? 44  PHE A CE1  4  
ATOM 6288  C CE2  . PHE A 1 44  ? -16.748 9.524   6.706   1.00 0.00 ? 44  PHE A CE2  4  
ATOM 6289  C CZ   . PHE A 1 44  ? -16.385 9.928   5.436   1.00 0.00 ? 44  PHE A CZ   4  
ATOM 6290  H H    . PHE A 1 44  ? -14.379 14.018  7.406   1.00 0.00 ? 44  PHE A H    4  
ATOM 6291  H HA   . PHE A 1 44  ? -14.618 13.425  10.113  1.00 0.00 ? 44  PHE A HA   4  
ATOM 6292  H HB2  . PHE A 1 44  ? -16.617 12.239  9.552   1.00 0.00 ? 44  PHE A HB2  4  
ATOM 6293  H HB3  . PHE A 1 44  ? -16.487 13.588  8.428   1.00 0.00 ? 44  PHE A HB3  4  
ATOM 6294  H HD1  . PHE A 1 44  ? -15.439 13.088  6.131   1.00 0.00 ? 44  PHE A HD1  4  
ATOM 6295  H HD2  . PHE A 1 44  ? -16.923 10.087  8.760   1.00 0.00 ? 44  PHE A HD2  4  
ATOM 6296  H HE1  . PHE A 1 44  ? -15.630 11.529  4.238   1.00 0.00 ? 44  PHE A HE1  4  
ATOM 6297  H HE2  . PHE A 1 44  ? -17.116 8.523   6.871   1.00 0.00 ? 44  PHE A HE2  4  
ATOM 6298  H HZ   . PHE A 1 44  ? -16.470 9.243   4.606   1.00 0.00 ? 44  PHE A HZ   4  
ATOM 6299  N N    . ILE A 1 45  ? -13.243 11.062  8.346   1.00 0.00 ? 45  ILE A N    4  
ATOM 6300  C CA   . ILE A 1 45  ? -12.527 9.795   8.417   1.00 0.00 ? 45  ILE A CA   4  
ATOM 6301  C C    . ILE A 1 45  ? -11.712 9.695   9.702   1.00 0.00 ? 45  ILE A C    4  
ATOM 6302  O O    . ILE A 1 45  ? -11.282 10.707  10.255  1.00 0.00 ? 45  ILE A O    4  
ATOM 6303  C CB   . ILE A 1 45  ? -11.587 9.610   7.211   1.00 0.00 ? 45  ILE A CB   4  
ATOM 6304  C CG1  . ILE A 1 45  ? -11.337 8.123   6.955   1.00 0.00 ? 45  ILE A CG1  4  
ATOM 6305  C CG2  . ILE A 1 45  ? -10.274 10.341  7.446   1.00 0.00 ? 45  ILE A CG2  4  
ATOM 6306  C CD1  . ILE A 1 45  ? -10.715 7.838   5.605   1.00 0.00 ? 45  ILE A CD1  4  
ATOM 6307  H H    . ILE A 1 45  ? -13.237 11.568  7.507   1.00 0.00 ? 45  ILE A H    4  
ATOM 6308  H HA   . ILE A 1 45  ? -13.257 8.998   8.404   1.00 0.00 ? 45  ILE A HA   4  
ATOM 6309  H HB   . ILE A 1 45  ? -12.062 10.043  6.344   1.00 0.00 ? 45  ILE A HB   4  
ATOM 6310  H HG12 . ILE A 1 45  ? -10.672 7.740   7.713   1.00 0.00 ? 45  ILE A HG12 4  
ATOM 6311  H HG13 . ILE A 1 45  ? -12.277 7.593   7.006   1.00 0.00 ? 45  ILE A HG13 4  
ATOM 6312  H HG21 . ILE A 1 45  ? -9.689  10.330  6.538   1.00 0.00 ? 45  ILE A HG21 4  
ATOM 6313  H HG22 . ILE A 1 45  ? -10.477 11.363  7.730   1.00 0.00 ? 45  ILE A HG22 4  
ATOM 6314  H HG23 . ILE A 1 45  ? -9.724  9.850   8.235   1.00 0.00 ? 45  ILE A HG23 4  
ATOM 6315  H HD11 . ILE A 1 45  ? -11.412 8.105   4.824   1.00 0.00 ? 45  ILE A HD11 4  
ATOM 6316  H HD12 . ILE A 1 45  ? -9.811  8.417   5.496   1.00 0.00 ? 45  ILE A HD12 4  
ATOM 6317  H HD13 . ILE A 1 45  ? -10.480 6.786   5.532   1.00 0.00 ? 45  ILE A HD13 4  
ATOM 6318  N N    . GLN A 1 46  ? -11.502 8.469   10.170  1.00 0.00 ? 46  GLN A N    4  
ATOM 6319  C CA   . GLN A 1 46  ? -10.737 8.238   11.390  1.00 0.00 ? 46  GLN A CA   4  
ATOM 6320  C C    . GLN A 1 46  ? -9.390  7.598   11.074  1.00 0.00 ? 46  GLN A C    4  
ATOM 6321  O O    . GLN A 1 46  ? -8.439  7.714   11.847  1.00 0.00 ? 46  GLN A O    4  
ATOM 6322  C CB   . GLN A 1 46  ? -11.526 7.348   12.351  1.00 0.00 ? 46  GLN A CB   4  
ATOM 6323  C CG   . GLN A 1 46  ? -12.433 8.123   13.293  1.00 0.00 ? 46  GLN A CG   4  
ATOM 6324  C CD   . GLN A 1 46  ? -11.701 8.639   14.516  1.00 0.00 ? 46  GLN A CD   4  
ATOM 6325  O OE1  . GLN A 1 46  ? -10.799 7.981   15.037  1.00 0.00 ? 46  GLN A OE1  4  
ATOM 6326  N NE2  . GLN A 1 46  ? -12.085 9.821   14.982  1.00 0.00 ? 46  GLN A NE2  4  
ATOM 6327  H H    . GLN A 1 46  ? -11.871 7.703   9.685   1.00 0.00 ? 46  GLN A H    4  
ATOM 6328  H HA   . GLN A 1 46  ? -10.565 9.195   11.859  1.00 0.00 ? 46  GLN A HA   4  
ATOM 6329  H HB2  . GLN A 1 46  ? -12.137 6.669   11.775  1.00 0.00 ? 46  GLN A HB2  4  
ATOM 6330  H HB3  . GLN A 1 46  ? -10.830 6.776   12.947  1.00 0.00 ? 46  GLN A HB3  4  
ATOM 6331  H HG2  . GLN A 1 46  ? -12.849 8.965   12.760  1.00 0.00 ? 46  GLN A HG2  4  
ATOM 6332  H HG3  . GLN A 1 46  ? -13.233 7.473   13.617  1.00 0.00 ? 46  GLN A HG3  4  
ATOM 6333  H HE21 . GLN A 1 46  ? -12.812 10.288  14.516  1.00 0.00 ? 46  GLN A HE21 4  
ATOM 6334  H HE22 . GLN A 1 46  ? -11.630 10.178  15.771  1.00 0.00 ? 46  GLN A HE22 4  
ATOM 6335  N N    . GLY A 1 47  ? -9.315  6.919   9.933   1.00 0.00 ? 47  GLY A N    4  
ATOM 6336  C CA   . GLY A 1 47  ? -8.080  6.269   9.536   1.00 0.00 ? 47  GLY A CA   4  
ATOM 6337  C C    . GLY A 1 47  ? -8.222  5.497   8.239   1.00 0.00 ? 47  GLY A C    4  
ATOM 6338  O O    . GLY A 1 47  ? -9.091  5.799   7.421   1.00 0.00 ? 47  GLY A O    4  
ATOM 6339  H H    . GLY A 1 47  ? -10.106 6.860   9.356   1.00 0.00 ? 47  GLY A H    4  
ATOM 6340  H HA2  . GLY A 1 47  ? -7.314  7.021   9.413   1.00 0.00 ? 47  GLY A HA2  4  
ATOM 6341  H HA3  . GLY A 1 47  ? -7.779  5.587   10.317  1.00 0.00 ? 47  GLY A HA3  4  
ATOM 6342  N N    . TYR A 1 48  ? -7.367  4.498   8.051   1.00 0.00 ? 48  TYR A N    4  
ATOM 6343  C CA   . TYR A 1 48  ? -7.399  3.683   6.843   1.00 0.00 ? 48  TYR A CA   4  
ATOM 6344  C C    . TYR A 1 48  ? -7.175  2.210   7.173   1.00 0.00 ? 48  TYR A C    4  
ATOM 6345  O O    . TYR A 1 48  ? -6.119  1.829   7.678   1.00 0.00 ? 48  TYR A O    4  
ATOM 6346  C CB   . TYR A 1 48  ? -6.336  4.161   5.851   1.00 0.00 ? 48  TYR A CB   4  
ATOM 6347  C CG   . TYR A 1 48  ? -6.725  5.418   5.107   1.00 0.00 ? 48  TYR A CG   4  
ATOM 6348  C CD1  . TYR A 1 48  ? -7.800  5.423   4.226   1.00 0.00 ? 48  TYR A CD1  4  
ATOM 6349  C CD2  . TYR A 1 48  ? -6.017  6.601   5.282   1.00 0.00 ? 48  TYR A CD2  4  
ATOM 6350  C CE1  . TYR A 1 48  ? -8.159  6.569   3.543   1.00 0.00 ? 48  TYR A CE1  4  
ATOM 6351  C CE2  . TYR A 1 48  ? -6.370  7.752   4.604   1.00 0.00 ? 48  TYR A CE2  4  
ATOM 6352  C CZ   . TYR A 1 48  ? -7.441  7.731   3.736   1.00 0.00 ? 48  TYR A CZ   4  
ATOM 6353  O OH   . TYR A 1 48  ? -7.795  8.875   3.058   1.00 0.00 ? 48  TYR A OH   4  
ATOM 6354  H H    . TYR A 1 48  ? -6.697  4.306   8.740   1.00 0.00 ? 48  TYR A H    4  
ATOM 6355  H HA   . TYR A 1 48  ? -8.374  3.795   6.392   1.00 0.00 ? 48  TYR A HA   4  
ATOM 6356  H HB2  . TYR A 1 48  ? -5.420  4.363   6.385   1.00 0.00 ? 48  TYR A HB2  4  
ATOM 6357  H HB3  . TYR A 1 48  ? -6.159  3.384   5.122   1.00 0.00 ? 48  TYR A HB3  4  
ATOM 6358  H HD1  . TYR A 1 48  ? -8.361  4.511   4.077   1.00 0.00 ? 48  TYR A HD1  4  
ATOM 6359  H HD2  . TYR A 1 48  ? -5.179  6.614   5.963   1.00 0.00 ? 48  TYR A HD2  4  
ATOM 6360  H HE1  . TYR A 1 48  ? -8.998  6.553   2.863   1.00 0.00 ? 48  TYR A HE1  4  
ATOM 6361  H HE2  . TYR A 1 48  ? -5.808  8.661   4.755   1.00 0.00 ? 48  TYR A HE2  4  
ATOM 6362  H HH   . TYR A 1 48  ? -7.684  9.635   3.634   1.00 0.00 ? 48  TYR A HH   4  
ATOM 6363  N N    . ARG A 1 49  ? -8.178  1.387   6.884   1.00 0.00 ? 49  ARG A N    4  
ATOM 6364  C CA   . ARG A 1 49  ? -8.093  -0.044  7.151   1.00 0.00 ? 49  ARG A CA   4  
ATOM 6365  C C    . ARG A 1 49  ? -7.568  -0.794  5.930   1.00 0.00 ? 49  ARG A C    4  
ATOM 6366  O O    . ARG A 1 49  ? -8.303  -1.032  4.972   1.00 0.00 ? 49  ARG A O    4  
ATOM 6367  C CB   . ARG A 1 49  ? -9.464  -0.592  7.549   1.00 0.00 ? 49  ARG A CB   4  
ATOM 6368  C CG   . ARG A 1 49  ? -9.394  -1.811  8.454   1.00 0.00 ? 49  ARG A CG   4  
ATOM 6369  C CD   . ARG A 1 49  ? -10.716 -2.055  9.164   1.00 0.00 ? 49  ARG A CD   4  
ATOM 6370  N NE   . ARG A 1 49  ? -10.549 -2.865  10.368  1.00 0.00 ? 49  ARG A NE   4  
ATOM 6371  C CZ   . ARG A 1 49  ? -10.066 -2.391  11.512  1.00 0.00 ? 49  ARG A CZ   4  
ATOM 6372  N NH1  . ARG A 1 49  ? -9.705  -1.118  11.605  1.00 0.00 ? 49  ARG A NH1  4  
ATOM 6373  N NH2  . ARG A 1 49  ? -9.944  -3.190  12.564  1.00 0.00 ? 49  ARG A NH2  4  
ATOM 6374  H H    . ARG A 1 49  ? -8.995  1.751   6.483   1.00 0.00 ? 49  ARG A H    4  
ATOM 6375  H HA   . ARG A 1 49  ? -7.406  -0.188  7.971   1.00 0.00 ? 49  ARG A HA   4  
ATOM 6376  H HB2  . ARG A 1 49  ? -10.013 0.181   8.066   1.00 0.00 ? 49  ARG A HB2  4  
ATOM 6377  H HB3  . ARG A 1 49  ? -10.003 -0.866  6.654   1.00 0.00 ? 49  ARG A HB3  4  
ATOM 6378  H HG2  . ARG A 1 49  ? -9.153  -2.678  7.857   1.00 0.00 ? 49  ARG A HG2  4  
ATOM 6379  H HG3  . ARG A 1 49  ? -8.621  -1.655  9.192   1.00 0.00 ? 49  ARG A HG3  4  
ATOM 6380  H HD2  . ARG A 1 49  ? -11.143 -1.102  9.439   1.00 0.00 ? 49  ARG A HD2  4  
ATOM 6381  H HD3  . ARG A 1 49  ? -11.383 -2.567  8.487   1.00 0.00 ? 49  ARG A HD3  4  
ATOM 6382  H HE   . ARG A 1 49  ? -10.810 -3.808  10.321  1.00 0.00 ? 49  ARG A HE   4  
ATOM 6383  H HH11 . ARG A 1 49  ? -9.797  -0.514  10.814  1.00 0.00 ? 49  ARG A HH11 4  
ATOM 6384  H HH12 . ARG A 1 49  ? -9.343  -0.764  12.468  1.00 0.00 ? 49  ARG A HH12 4  
ATOM 6385  H HH21 . ARG A 1 49  ? -10.216 -4.149  12.497  1.00 0.00 ? 49  ARG A HH21 4  
ATOM 6386  H HH22 . ARG A 1 49  ? -9.581  -2.832  13.423  1.00 0.00 ? 49  ARG A HH22 4  
ATOM 6387  N N    . VAL A 1 50  ? -6.292  -1.162  5.973   1.00 0.00 ? 50  VAL A N    4  
ATOM 6388  C CA   . VAL A 1 50  ? -5.668  -1.886  4.871   1.00 0.00 ? 50  VAL A CA   4  
ATOM 6389  C C    . VAL A 1 50  ? -5.899  -3.387  4.999   1.00 0.00 ? 50  VAL A C    4  
ATOM 6390  O O    . VAL A 1 50  ? -5.091  -4.101  5.594   1.00 0.00 ? 50  VAL A O    4  
ATOM 6391  C CB   . VAL A 1 50  ? -4.153  -1.614  4.807   1.00 0.00 ? 50  VAL A CB   4  
ATOM 6392  C CG1  . VAL A 1 50  ? -3.518  -2.393  3.665   1.00 0.00 ? 50  VAL A CG1  4  
ATOM 6393  C CG2  . VAL A 1 50  ? -3.886  -0.123  4.660   1.00 0.00 ? 50  VAL A CG2  4  
ATOM 6394  H H    . VAL A 1 50  ? -5.757  -0.943  6.764   1.00 0.00 ? 50  VAL A H    4  
ATOM 6395  H HA   . VAL A 1 50  ? -6.114  -1.540  3.949   1.00 0.00 ? 50  VAL A HA   4  
ATOM 6396  H HB   . VAL A 1 50  ? -3.708  -1.948  5.733   1.00 0.00 ? 50  VAL A HB   4  
ATOM 6397  H HG11 . VAL A 1 50  ? -3.795  -3.434  3.743   1.00 0.00 ? 50  VAL A HG11 4  
ATOM 6398  H HG12 . VAL A 1 50  ? -3.864  -1.996  2.722   1.00 0.00 ? 50  VAL A HG12 4  
ATOM 6399  H HG13 . VAL A 1 50  ? -2.443  -2.302  3.722   1.00 0.00 ? 50  VAL A HG13 4  
ATOM 6400  H HG21 . VAL A 1 50  ? -2.863  0.029   4.348   1.00 0.00 ? 50  VAL A HG21 4  
ATOM 6401  H HG22 . VAL A 1 50  ? -4.554  0.292   3.919   1.00 0.00 ? 50  VAL A HG22 4  
ATOM 6402  H HG23 . VAL A 1 50  ? -4.050  0.367   5.608   1.00 0.00 ? 50  VAL A HG23 4  
ATOM 6403  N N    . MET A 1 51  ? -7.006  -3.860  4.436   1.00 0.00 ? 51  MET A N    4  
ATOM 6404  C CA   . MET A 1 51  ? -7.342  -5.279  4.486   1.00 0.00 ? 51  MET A CA   4  
ATOM 6405  C C    . MET A 1 51  ? -6.447  -6.083  3.548   1.00 0.00 ? 51  MET A C    4  
ATOM 6406  O O    . MET A 1 51  ? -6.097  -5.621  2.461   1.00 0.00 ? 51  MET A O    4  
ATOM 6407  C CB   . MET A 1 51  ? -8.811  -5.490  4.114   1.00 0.00 ? 51  MET A CB   4  
ATOM 6408  C CG   . MET A 1 51  ? -9.760  -5.373  5.296   1.00 0.00 ? 51  MET A CG   4  
ATOM 6409  S SD   . MET A 1 51  ? -11.451 -5.836  4.877   1.00 0.00 ? 51  MET A SD   4  
ATOM 6410  C CE   . MET A 1 51  ? -11.275 -7.606  4.669   1.00 0.00 ? 51  MET A CE   4  
ATOM 6411  H H    . MET A 1 51  ? -7.611  -3.242  3.975   1.00 0.00 ? 51  MET A H    4  
ATOM 6412  H HA   . MET A 1 51  ? -7.183  -5.621  5.497   1.00 0.00 ? 51  MET A HA   4  
ATOM 6413  H HB2  . MET A 1 51  ? -9.094  -4.751  3.379   1.00 0.00 ? 51  MET A HB2  4  
ATOM 6414  H HB3  . MET A 1 51  ? -8.924  -6.474  3.686   1.00 0.00 ? 51  MET A HB3  4  
ATOM 6415  H HG2  . MET A 1 51  ? -9.410  -6.019  6.087   1.00 0.00 ? 51  MET A HG2  4  
ATOM 6416  H HG3  . MET A 1 51  ? -9.756  -4.350  5.642   1.00 0.00 ? 51  MET A HG3  4  
ATOM 6417  H HE1  . MET A 1 51  ? -11.478 -7.870  3.641   1.00 0.00 ? 51  MET A HE1  4  
ATOM 6418  H HE2  . MET A 1 51  ? -10.267 -7.900  4.924   1.00 0.00 ? 51  MET A HE2  4  
ATOM 6419  H HE3  . MET A 1 51  ? -11.974 -8.116  5.316   1.00 0.00 ? 51  MET A HE3  4  
ATOM 6420  N N    . TYR A 1 52  ? -6.081  -7.286  3.974   1.00 0.00 ? 52  TYR A N    4  
ATOM 6421  C CA   . TYR A 1 52  ? -5.225  -8.153  3.173   1.00 0.00 ? 52  TYR A CA   4  
ATOM 6422  C C    . TYR A 1 52  ? -5.373  -9.610  3.599   1.00 0.00 ? 52  TYR A C    4  
ATOM 6423  O O    . TYR A 1 52  ? -5.721  -9.901  4.744   1.00 0.00 ? 52  TYR A O    4  
ATOM 6424  C CB   . TYR A 1 52  ? -3.763  -7.719  3.299   1.00 0.00 ? 52  TYR A CB   4  
ATOM 6425  C CG   . TYR A 1 52  ? -3.184  -7.936  4.679   1.00 0.00 ? 52  TYR A CG   4  
ATOM 6426  C CD1  . TYR A 1 52  ? -3.374  -7.001  5.689   1.00 0.00 ? 52  TYR A CD1  4  
ATOM 6427  C CD2  . TYR A 1 52  ? -2.448  -9.077  4.973   1.00 0.00 ? 52  TYR A CD2  4  
ATOM 6428  C CE1  . TYR A 1 52  ? -2.846  -7.195  6.951   1.00 0.00 ? 52  TYR A CE1  4  
ATOM 6429  C CE2  . TYR A 1 52  ? -1.918  -9.280  6.232   1.00 0.00 ? 52  TYR A CE2  4  
ATOM 6430  C CZ   . TYR A 1 52  ? -2.119  -8.336  7.218   1.00 0.00 ? 52  TYR A CZ   4  
ATOM 6431  O OH   . TYR A 1 52  ? -1.593  -8.534  8.474   1.00 0.00 ? 52  TYR A OH   4  
ATOM 6432  H H    . TYR A 1 52  ? -6.392  -7.599  4.849   1.00 0.00 ? 52  TYR A H    4  
ATOM 6433  H HA   . TYR A 1 52  ? -5.530  -8.058  2.141   1.00 0.00 ? 52  TYR A HA   4  
ATOM 6434  H HB2  . TYR A 1 52  ? -3.166  -8.281  2.598   1.00 0.00 ? 52  TYR A HB2  4  
ATOM 6435  H HB3  . TYR A 1 52  ? -3.686  -6.666  3.068   1.00 0.00 ? 52  TYR A HB3  4  
ATOM 6436  H HD1  . TYR A 1 52  ? -3.945  -6.108  5.476   1.00 0.00 ? 52  TYR A HD1  4  
ATOM 6437  H HD2  . TYR A 1 52  ? -2.292  -9.815  4.199   1.00 0.00 ? 52  TYR A HD2  4  
ATOM 6438  H HE1  . TYR A 1 52  ? -3.004  -6.456  7.722   1.00 0.00 ? 52  TYR A HE1  4  
ATOM 6439  H HE2  . TYR A 1 52  ? -1.348  -10.174 6.442   1.00 0.00 ? 52  TYR A HE2  4  
ATOM 6440  H HH   . TYR A 1 52  ? -2.174  -8.141  9.129   1.00 0.00 ? 52  TYR A HH   4  
ATOM 6441  N N    . ARG A 1 53  ? -5.106  -10.522 2.670   1.00 0.00 ? 53  ARG A N    4  
ATOM 6442  C CA   . ARG A 1 53  ? -5.210  -11.949 2.948   1.00 0.00 ? 53  ARG A CA   4  
ATOM 6443  C C    . ARG A 1 53  ? -4.523  -12.767 1.858   1.00 0.00 ? 53  ARG A C    4  
ATOM 6444  O O    . ARG A 1 53  ? -4.287  -12.273 0.755   1.00 0.00 ? 53  ARG A O    4  
ATOM 6445  C CB   . ARG A 1 53  ? -6.678  -12.363 3.062   1.00 0.00 ? 53  ARG A CB   4  
ATOM 6446  C CG   . ARG A 1 53  ? -7.404  -12.408 1.727   1.00 0.00 ? 53  ARG A CG   4  
ATOM 6447  C CD   . ARG A 1 53  ? -8.535  -13.424 1.743   1.00 0.00 ? 53  ARG A CD   4  
ATOM 6448  N NE   . ARG A 1 53  ? -8.979  -13.769 0.395   1.00 0.00 ? 53  ARG A NE   4  
ATOM 6449  C CZ   . ARG A 1 53  ? -10.189 -14.241 0.118   1.00 0.00 ? 53  ARG A CZ   4  
ATOM 6450  N NH1  . ARG A 1 53  ? -11.072 -14.423 1.090   1.00 0.00 ? 53  ARG A NH1  4  
ATOM 6451  N NH2  . ARG A 1 53  ? -10.519 -14.533 -1.134  1.00 0.00 ? 53  ARG A NH2  4  
ATOM 6452  H H    . ARG A 1 53  ? -4.833  -10.228 1.776   1.00 0.00 ? 53  ARG A H    4  
ATOM 6453  H HA   . ARG A 1 53  ? -4.717  -12.141 3.889   1.00 0.00 ? 53  ARG A HA   4  
ATOM 6454  H HB2  . ARG A 1 53  ? -6.730  -13.345 3.508   1.00 0.00 ? 53  ARG A HB2  4  
ATOM 6455  H HB3  . ARG A 1 53  ? -7.189  -11.658 3.701   1.00 0.00 ? 53  ARG A HB3  4  
ATOM 6456  H HG2  . ARG A 1 53  ? -7.814  -11.431 1.518   1.00 0.00 ? 53  ARG A HG2  4  
ATOM 6457  H HG3  . ARG A 1 53  ? -6.699  -12.678 0.955   1.00 0.00 ? 53  ARG A HG3  4  
ATOM 6458  H HD2  . ARG A 1 53  ? -8.191  -14.319 2.238   1.00 0.00 ? 53  ARG A HD2  4  
ATOM 6459  H HD3  . ARG A 1 53  ? -9.368  -13.007 2.290   1.00 0.00 ? 53  ARG A HD3  4  
ATOM 6460  H HE   . ARG A 1 53  ? -8.342  -13.643 -0.339  1.00 0.00 ? 53  ARG A HE   4  
ATOM 6461  H HH11 . ARG A 1 53  ? -10.827 -14.203 2.034   1.00 0.00 ? 53  ARG A HH11 4  
ATOM 6462  H HH12 . ARG A 1 53  ? -11.983 -14.777 0.879   1.00 0.00 ? 53  ARG A HH12 4  
ATOM 6463  H HH21 . ARG A 1 53  ? -9.856  -14.397 -1.870  1.00 0.00 ? 53  ARG A HH21 4  
ATOM 6464  H HH22 . ARG A 1 53  ? -11.430 -14.888 -1.341  1.00 0.00 ? 53  ARG A HH22 4  
ATOM 6465  N N    . GLN A 1 54  ? -4.206  -14.018 2.175   1.00 0.00 ? 54  GLN A N    4  
ATOM 6466  C CA   . GLN A 1 54  ? -3.545  -14.902 1.222   1.00 0.00 ? 54  GLN A CA   4  
ATOM 6467  C C    . GLN A 1 54  ? -4.528  -15.397 0.167   1.00 0.00 ? 54  GLN A C    4  
ATOM 6468  O O    . GLN A 1 54  ? -5.705  -15.621 0.454   1.00 0.00 ? 54  GLN A O    4  
ATOM 6469  C CB   . GLN A 1 54  ? -2.918  -16.093 1.950   1.00 0.00 ? 54  GLN A CB   4  
ATOM 6470  C CG   . GLN A 1 54  ? -1.677  -16.641 1.264   1.00 0.00 ? 54  GLN A CG   4  
ATOM 6471  C CD   . GLN A 1 54  ? -0.856  -17.536 2.170   1.00 0.00 ? 54  GLN A CD   4  
ATOM 6472  O OE1  . GLN A 1 54  ? -0.711  -17.266 3.363   1.00 0.00 ? 54  GLN A OE1  4  
ATOM 6473  N NE2  . GLN A 1 54  ? -0.314  -18.611 1.608   1.00 0.00 ? 54  GLN A NE2  4  
ATOM 6474  H H    . GLN A 1 54  ? -4.420  -14.353 3.070   1.00 0.00 ? 54  GLN A H    4  
ATOM 6475  H HA   . GLN A 1 54  ? -2.765  -14.339 0.733   1.00 0.00 ? 54  GLN A HA   4  
ATOM 6476  H HB2  . GLN A 1 54  ? -2.646  -15.786 2.949   1.00 0.00 ? 54  GLN A HB2  4  
ATOM 6477  H HB3  . GLN A 1 54  ? -3.648  -16.886 2.012   1.00 0.00 ? 54  GLN A HB3  4  
ATOM 6478  H HG2  . GLN A 1 54  ? -1.982  -17.212 0.399   1.00 0.00 ? 54  GLN A HG2  4  
ATOM 6479  H HG3  . GLN A 1 54  ? -1.062  -15.812 0.947   1.00 0.00 ? 54  GLN A HG3  4  
ATOM 6480  H HE21 . GLN A 1 54  ? -0.472  -18.761 0.652   1.00 0.00 ? 54  GLN A HE21 4  
ATOM 6481  H HE22 . GLN A 1 54  ? 0.222   -19.206 2.171   1.00 0.00 ? 54  GLN A HE22 4  
ATOM 6482  N N    . THR A 1 55  ? -4.039  -15.565 -1.058  1.00 0.00 ? 55  THR A N    4  
ATOM 6483  C CA   . THR A 1 55  ? -4.875  -16.032 -2.157  1.00 0.00 ? 55  THR A CA   4  
ATOM 6484  C C    . THR A 1 55  ? -4.645  -17.514 -2.432  1.00 0.00 ? 55  THR A C    4  
ATOM 6485  O O    . THR A 1 55  ? -5.589  -18.261 -2.689  1.00 0.00 ? 55  THR A O    4  
ATOM 6486  C CB   . THR A 1 55  ? -4.603  -15.234 -3.447  1.00 0.00 ? 55  THR A CB   4  
ATOM 6487  O OG1  . THR A 1 55  ? -3.278  -15.501 -3.918  1.00 0.00 ? 55  THR A OG1  4  
ATOM 6488  C CG2  . THR A 1 55  ? -4.770  -13.741 -3.205  1.00 0.00 ? 55  THR A CG2  4  
ATOM 6489  H H    . THR A 1 55  ? -3.094  -15.370 -1.225  1.00 0.00 ? 55  THR A H    4  
ATOM 6490  H HA   . THR A 1 55  ? -5.908  -15.883 -1.878  1.00 0.00 ? 55  THR A HA   4  
ATOM 6491  H HB   . THR A 1 55  ? -5.314  -15.543 -4.200  1.00 0.00 ? 55  THR A HB   4  
ATOM 6492  H HG1  . THR A 1 55  ? -3.317  -15.810 -4.827  1.00 0.00 ? 55  THR A HG1  4  
ATOM 6493  H HG21 . THR A 1 55  ? -5.787  -13.453 -3.425  1.00 0.00 ? 55  THR A HG21 4  
ATOM 6494  H HG22 . THR A 1 55  ? -4.094  -13.195 -3.845  1.00 0.00 ? 55  THR A HG22 4  
ATOM 6495  H HG23 . THR A 1 55  ? -4.549  -13.518 -2.172  1.00 0.00 ? 55  THR A HG23 4  
ATOM 6496  N N    . SER A 1 56  ? -3.385  -17.933 -2.377  1.00 0.00 ? 56  SER A N    4  
ATOM 6497  C CA   . SER A 1 56  ? -3.031  -19.326 -2.623  1.00 0.00 ? 56  SER A CA   4  
ATOM 6498  C C    . SER A 1 56  ? -2.251  -19.904 -1.446  1.00 0.00 ? 56  SER A C    4  
ATOM 6499  O O    . SER A 1 56  ? -1.589  -19.177 -0.707  1.00 0.00 ? 56  SER A O    4  
ATOM 6500  C CB   . SER A 1 56  ? -2.204  -19.445 -3.904  1.00 0.00 ? 56  SER A CB   4  
ATOM 6501  O OG   . SER A 1 56  ? -2.149  -20.788 -4.352  1.00 0.00 ? 56  SER A OG   4  
ATOM 6502  H H    . SER A 1 56  ? -2.676  -17.288 -2.167  1.00 0.00 ? 56  SER A H    4  
ATOM 6503  H HA   . SER A 1 56  ? -3.947  -19.884 -2.742  1.00 0.00 ? 56  SER A HA   4  
ATOM 6504  H HB2  . SER A 1 56  ? -2.652  -18.839 -4.677  1.00 0.00 ? 56  SER A HB2  4  
ATOM 6505  H HB3  . SER A 1 56  ? -1.198  -19.099 -3.714  1.00 0.00 ? 56  SER A HB3  4  
ATOM 6506  H HG   . SER A 1 56  ? -1.243  -21.104 -4.306  1.00 0.00 ? 56  SER A HG   4  
ATOM 6507  N N    . GLY A 1 57  ? -2.336  -21.221 -1.277  1.00 0.00 ? 57  GLY A N    4  
ATOM 6508  C CA   . GLY A 1 57  ? -1.635  -21.876 -0.189  1.00 0.00 ? 57  GLY A CA   4  
ATOM 6509  C C    . GLY A 1 57  ? -2.581  -22.481 0.829   1.00 0.00 ? 57  GLY A C    4  
ATOM 6510  O O    . GLY A 1 57  ? -3.624  -23.030 0.470   1.00 0.00 ? 57  GLY A O    4  
ATOM 6511  H H    . GLY A 1 57  ? -2.879  -21.751 -1.898  1.00 0.00 ? 57  GLY A H    4  
ATOM 6512  H HA2  . GLY A 1 57  ? -1.012  -22.659 -0.596  1.00 0.00 ? 57  GLY A HA2  4  
ATOM 6513  H HA3  . GLY A 1 57  ? -1.006  -21.151 0.307   1.00 0.00 ? 57  GLY A HA3  4  
ATOM 6514  N N    . LEU A 1 58  ? -2.218  -22.382 2.103   1.00 0.00 ? 58  LEU A N    4  
ATOM 6515  C CA   . LEU A 1 58  ? -3.041  -22.926 3.178   1.00 0.00 ? 58  LEU A CA   4  
ATOM 6516  C C    . LEU A 1 58  ? -3.913  -21.839 3.799   1.00 0.00 ? 58  LEU A C    4  
ATOM 6517  O O    . LEU A 1 58  ? -5.115  -22.025 3.984   1.00 0.00 ? 58  LEU A O    4  
ATOM 6518  C CB   . LEU A 1 58  ? -2.158  -23.562 4.252   1.00 0.00 ? 58  LEU A CB   4  
ATOM 6519  C CG   . LEU A 1 58  ? -2.763  -24.750 5.002   1.00 0.00 ? 58  LEU A CG   4  
ATOM 6520  C CD1  . LEU A 1 58  ? -3.891  -24.288 5.911   1.00 0.00 ? 58  LEU A CD1  4  
ATOM 6521  C CD2  . LEU A 1 58  ? -3.262  -25.801 4.021   1.00 0.00 ? 58  LEU A CD2  4  
ATOM 6522  H H    . LEU A 1 58  ? -1.376  -21.934 2.328   1.00 0.00 ? 58  LEU A H    4  
ATOM 6523  H HA   . LEU A 1 58  ? -3.681  -23.684 2.753   1.00 0.00 ? 58  LEU A HA   4  
ATOM 6524  H HB2  . LEU A 1 58  ? -1.250  -23.900 3.776   1.00 0.00 ? 58  LEU A HB2  4  
ATOM 6525  H HB3  . LEU A 1 58  ? -1.919  -22.798 4.978   1.00 0.00 ? 58  LEU A HB3  4  
ATOM 6526  H HG   . LEU A 1 58  ? -2.001  -25.203 5.621   1.00 0.00 ? 58  LEU A HG   4  
ATOM 6527  H HD11 . LEU A 1 58  ? -4.249  -23.325 5.580   1.00 0.00 ? 58  LEU A HD11 4  
ATOM 6528  H HD12 . LEU A 1 58  ? -3.528  -24.209 6.924   1.00 0.00 ? 58  LEU A HD12 4  
ATOM 6529  H HD13 . LEU A 1 58  ? -4.699  -25.005 5.873   1.00 0.00 ? 58  LEU A HD13 4  
ATOM 6530  H HD21 . LEU A 1 58  ? -4.315  -25.651 3.838   1.00 0.00 ? 58  LEU A HD21 4  
ATOM 6531  H HD22 . LEU A 1 58  ? -3.106  -26.786 4.439   1.00 0.00 ? 58  LEU A HD22 4  
ATOM 6532  H HD23 . LEU A 1 58  ? -2.718  -25.714 3.092   1.00 0.00 ? 58  LEU A HD23 4  
ATOM 6533  N N    . GLN A 1 59  ? -3.298  -20.704 4.117   1.00 0.00 ? 59  GLN A N    4  
ATOM 6534  C CA   . GLN A 1 59  ? -4.019  -19.587 4.715   1.00 0.00 ? 59  GLN A CA   4  
ATOM 6535  C C    . GLN A 1 59  ? -4.692  -18.736 3.643   1.00 0.00 ? 59  GLN A C    4  
ATOM 6536  O O    . GLN A 1 59  ? -4.810  -17.519 3.786   1.00 0.00 ? 59  GLN A O    4  
ATOM 6537  C CB   . GLN A 1 59  ? -3.066  -18.724 5.545   1.00 0.00 ? 59  GLN A CB   4  
ATOM 6538  C CG   . GLN A 1 59  ? -2.381  -19.482 6.670   1.00 0.00 ? 59  GLN A CG   4  
ATOM 6539  C CD   . GLN A 1 59  ? -3.365  -20.041 7.680   1.00 0.00 ? 59  GLN A CD   4  
ATOM 6540  O OE1  . GLN A 1 59  ? -4.234  -19.326 8.178   1.00 0.00 ? 59  GLN A OE1  4  
ATOM 6541  N NE2  . GLN A 1 59  ? -3.232  -21.326 7.987   1.00 0.00 ? 59  GLN A NE2  4  
ATOM 6542  H H    . GLN A 1 59  ? -2.338  -20.616 3.945   1.00 0.00 ? 59  GLN A H    4  
ATOM 6543  H HA   . GLN A 1 59  ? -4.779  -19.993 5.365   1.00 0.00 ? 59  GLN A HA   4  
ATOM 6544  H HB2  . GLN A 1 59  ? -2.304  -18.322 4.894   1.00 0.00 ? 59  GLN A HB2  4  
ATOM 6545  H HB3  . GLN A 1 59  ? -3.625  -17.907 5.978   1.00 0.00 ? 59  GLN A HB3  4  
ATOM 6546  H HG2  . GLN A 1 59  ? -1.821  -20.302 6.246   1.00 0.00 ? 59  GLN A HG2  4  
ATOM 6547  H HG3  . GLN A 1 59  ? -1.706  -18.811 7.180   1.00 0.00 ? 59  GLN A HG3  4  
ATOM 6548  H HE21 . GLN A 1 59  ? -2.515  -21.834 7.551   1.00 0.00 ? 59  GLN A HE21 4  
ATOM 6549  H HE22 . GLN A 1 59  ? -3.853  -21.713 8.637   1.00 0.00 ? 59  GLN A HE22 4  
ATOM 6550  N N    . ALA A 1 60  ? -5.131  -19.384 2.569   1.00 0.00 ? 60  ALA A N    4  
ATOM 6551  C CA   . ALA A 1 60  ? -5.793  -18.688 1.474   1.00 0.00 ? 60  ALA A CA   4  
ATOM 6552  C C    . ALA A 1 60  ? -7.295  -18.583 1.718   1.00 0.00 ? 60  ALA A C    4  
ATOM 6553  O O    . ALA A 1 60  ? -7.929  -19.538 2.168   1.00 0.00 ? 60  ALA A O    4  
ATOM 6554  C CB   . ALA A 1 60  ? -5.519  -19.395 0.155   1.00 0.00 ? 60  ALA A CB   4  
ATOM 6555  H H    . ALA A 1 60  ? -5.007  -20.355 2.513   1.00 0.00 ? 60  ALA A H    4  
ATOM 6556  H HA   . ALA A 1 60  ? -5.379  -17.692 1.413   1.00 0.00 ? 60  ALA A HA   4  
ATOM 6557  H HB1  . ALA A 1 60  ? -4.866  -18.784 -0.451  1.00 0.00 ? 60  ALA A HB1  4  
ATOM 6558  H HB2  . ALA A 1 60  ? -5.045  -20.346 0.349   1.00 0.00 ? 60  ALA A HB2  4  
ATOM 6559  H HB3  . ALA A 1 60  ? -6.450  -19.556 -0.367  1.00 0.00 ? 60  ALA A HB3  4  
ATOM 6560  N N    . THR A 1 61  ? -7.859  -17.417 1.419   1.00 0.00 ? 61  THR A N    4  
ATOM 6561  C CA   . THR A 1 61  ? -9.286  -17.188 1.608   1.00 0.00 ? 61  THR A CA   4  
ATOM 6562  C C    . THR A 1 61  ? -9.777  -17.816 2.907   1.00 0.00 ? 61  THR A C    4  
ATOM 6563  O O    . THR A 1 61  ? -10.944 -18.189 3.025   1.00 0.00 ? 61  THR A O    4  
ATOM 6564  C CB   . THR A 1 61  ? -10.106 -17.756 0.434   1.00 0.00 ? 61  THR A CB   4  
ATOM 6565  O OG1  . THR A 1 61  ? -11.482 -17.385 0.574   1.00 0.00 ? 61  THR A OG1  4  
ATOM 6566  C CG2  . THR A 1 61  ? -9.988  -19.271 0.375   1.00 0.00 ? 61  THR A CG2  4  
ATOM 6567  H H    . THR A 1 61  ? -7.301  -16.695 1.064   1.00 0.00 ? 61  THR A H    4  
ATOM 6568  H HA   . THR A 1 61  ? -9.449  -16.121 1.651   1.00 0.00 ? 61  THR A HA   4  
ATOM 6569  H HB   . THR A 1 61  ? -9.721  -17.343 -0.487  1.00 0.00 ? 61  THR A HB   4  
ATOM 6570  H HG1  . THR A 1 61  ? -12.011 -17.869 -0.065  1.00 0.00 ? 61  THR A HG1  4  
ATOM 6571  H HG21 . THR A 1 61  ? -10.621 -19.651 -0.414  1.00 0.00 ? 61  THR A HG21 4  
ATOM 6572  H HG22 . THR A 1 61  ? -10.296 -19.694 1.319   1.00 0.00 ? 61  THR A HG22 4  
ATOM 6573  H HG23 . THR A 1 61  ? -8.962  -19.544 0.175   1.00 0.00 ? 61  THR A HG23 4  
ATOM 6574  N N    . SER A 1 62  ? -8.878  -17.930 3.880   1.00 0.00 ? 62  SER A N    4  
ATOM 6575  C CA   . SER A 1 62  ? -9.220  -18.516 5.171   1.00 0.00 ? 62  SER A CA   4  
ATOM 6576  C C    . SER A 1 62  ? -9.765  -17.455 6.122   1.00 0.00 ? 62  SER A C    4  
ATOM 6577  O O    . SER A 1 62  ? -10.851 -17.606 6.682   1.00 0.00 ? 62  SER A O    4  
ATOM 6578  C CB   . SER A 1 62  ? -7.993  -19.191 5.789   1.00 0.00 ? 62  SER A CB   4  
ATOM 6579  O OG   . SER A 1 62  ? -8.347  -19.933 6.943   1.00 0.00 ? 62  SER A OG   4  
ATOM 6580  H H    . SER A 1 62  ? -7.963  -17.614 3.725   1.00 0.00 ? 62  SER A H    4  
ATOM 6581  H HA   . SER A 1 62  ? -9.984  -19.261 5.005   1.00 0.00 ? 62  SER A HA   4  
ATOM 6582  H HB2  . SER A 1 62  ? -7.552  -19.860 5.067   1.00 0.00 ? 62  SER A HB2  4  
ATOM 6583  H HB3  . SER A 1 62  ? -7.273  -18.435 6.068   1.00 0.00 ? 62  SER A HB3  4  
ATOM 6584  H HG   . SER A 1 62  ? -9.120  -20.470 6.754   1.00 0.00 ? 62  SER A HG   4  
ATOM 6585  N N    . SER A 1 63  ? -9.002  -16.382 6.301   1.00 0.00 ? 63  SER A N    4  
ATOM 6586  C CA   . SER A 1 63  ? -9.405  -15.296 7.187   1.00 0.00 ? 63  SER A CA   4  
ATOM 6587  C C    . SER A 1 63  ? -8.789  -13.973 6.741   1.00 0.00 ? 63  SER A C    4  
ATOM 6588  O O    . SER A 1 63  ? -7.573  -13.863 6.588   1.00 0.00 ? 63  SER A O    4  
ATOM 6589  C CB   . SER A 1 63  ? -8.990  -15.605 8.627   1.00 0.00 ? 63  SER A CB   4  
ATOM 6590  O OG   . SER A 1 63  ? -7.582  -15.708 8.741   1.00 0.00 ? 63  SER A OG   4  
ATOM 6591  H H    . SER A 1 63  ? -8.146  -16.319 5.826   1.00 0.00 ? 63  SER A H    4  
ATOM 6592  H HA   . SER A 1 63  ? -10.480 -15.213 7.141   1.00 0.00 ? 63  SER A HA   4  
ATOM 6593  H HB2  . SER A 1 63  ? -9.335  -14.814 9.276   1.00 0.00 ? 63  SER A HB2  4  
ATOM 6594  H HB3  . SER A 1 63  ? -9.434  -16.541 8.934   1.00 0.00 ? 63  SER A HB3  4  
ATOM 6595  H HG   . SER A 1 63  ? -7.330  -15.649 9.666   1.00 0.00 ? 63  SER A HG   4  
ATOM 6596  N N    . TRP A 1 64  ? -9.639  -12.974 6.534   1.00 0.00 ? 64  TRP A N    4  
ATOM 6597  C CA   . TRP A 1 64  ? -9.179  -11.657 6.105   1.00 0.00 ? 64  TRP A CA   4  
ATOM 6598  C C    . TRP A 1 64  ? -8.547  -10.897 7.265   1.00 0.00 ? 64  TRP A C    4  
ATOM 6599  O O    . TRP A 1 64  ? -8.993  -11.008 8.407   1.00 0.00 ? 64  TRP A O    4  
ATOM 6600  C CB   . TRP A 1 64  ? -10.343 -10.852 5.525   1.00 0.00 ? 64  TRP A CB   4  
ATOM 6601  C CG   . TRP A 1 64  ? -10.514 -11.036 4.047   1.00 0.00 ? 64  TRP A CG   4  
ATOM 6602  C CD1  . TRP A 1 64  ? -11.374 -11.893 3.422   1.00 0.00 ? 64  TRP A CD1  4  
ATOM 6603  C CD2  . TRP A 1 64  ? -9.806  -10.348 3.010   1.00 0.00 ? 64  TRP A CD2  4  
ATOM 6604  N NE1  . TRP A 1 64  ? -11.243 -11.779 2.059   1.00 0.00 ? 64  TRP A NE1  4  
ATOM 6605  C CE2  . TRP A 1 64  ? -10.288 -10.837 1.781   1.00 0.00 ? 64  TRP A CE2  4  
ATOM 6606  C CE3  . TRP A 1 64  ? -8.813  -9.365  3.001   1.00 0.00 ? 64  TRP A CE3  4  
ATOM 6607  C CZ2  . TRP A 1 64  ? -9.809  -10.377 0.557   1.00 0.00 ? 64  TRP A CZ2  4  
ATOM 6608  C CZ3  . TRP A 1 64  ? -8.338  -8.909  1.786   1.00 0.00 ? 64  TRP A CZ3  4  
ATOM 6609  C CH2  . TRP A 1 64  ? -8.837  -9.415  0.578   1.00 0.00 ? 64  TRP A CH2  4  
ATOM 6610  H H    . TRP A 1 64  ? -10.597 -13.124 6.672   1.00 0.00 ? 64  TRP A H    4  
ATOM 6611  H HA   . TRP A 1 64  ? -8.434  -11.802 5.336   1.00 0.00 ? 64  TRP A HA   4  
ATOM 6612  H HB2  . TRP A 1 64  ? -11.259 -11.158 6.007   1.00 0.00 ? 64  TRP A HB2  4  
ATOM 6613  H HB3  . TRP A 1 64  ? -10.174 -9.802  5.714   1.00 0.00 ? 64  TRP A HB3  4  
ATOM 6614  H HD1  . TRP A 1 64  ? -12.051 -12.558 3.936   1.00 0.00 ? 64  TRP A HD1  4  
ATOM 6615  H HE1  . TRP A 1 64  ? -11.753 -12.289 1.394   1.00 0.00 ? 64  TRP A HE1  4  
ATOM 6616  H HE3  . TRP A 1 64  ? -8.415  -8.963  3.921   1.00 0.00 ? 64  TRP A HE3  4  
ATOM 6617  H HZ2  . TRP A 1 64  ? -10.184 -10.756 -0.383  1.00 0.00 ? 64  TRP A HZ2  4  
ATOM 6618  H HZ3  . TRP A 1 64  ? -7.570  -8.150  1.759   1.00 0.00 ? 64  TRP A HZ3  4  
ATOM 6619  H HH2  . TRP A 1 64  ? -8.437  -9.030  -0.348  1.00 0.00 ? 64  TRP A HH2  4  
ATOM 6620  N N    . GLN A 1 65  ? -7.508  -10.125 6.965   1.00 0.00 ? 65  GLN A N    4  
ATOM 6621  C CA   . GLN A 1 65  ? -6.815  -9.346  7.985   1.00 0.00 ? 65  GLN A CA   4  
ATOM 6622  C C    . GLN A 1 65  ? -6.982  -7.851  7.735   1.00 0.00 ? 65  GLN A C    4  
ATOM 6623  O O    . GLN A 1 65  ? -7.591  -7.441  6.749   1.00 0.00 ? 65  GLN A O    4  
ATOM 6624  C CB   . GLN A 1 65  ? -5.329  -9.708  8.011   1.00 0.00 ? 65  GLN A CB   4  
ATOM 6625  C CG   . GLN A 1 65  ? -5.036  -11.026 8.711   1.00 0.00 ? 65  GLN A CG   4  
ATOM 6626  C CD   . GLN A 1 65  ? -3.737  -11.656 8.249   1.00 0.00 ? 65  GLN A CD   4  
ATOM 6627  O OE1  . GLN A 1 65  ? -3.601  -12.045 7.089   1.00 0.00 ? 65  GLN A OE1  4  
ATOM 6628  N NE2  . GLN A 1 65  ? -2.773  -11.759 9.157   1.00 0.00 ? 65  GLN A NE2  4  
ATOM 6629  H H    . GLN A 1 65  ? -7.199  -10.078 6.037   1.00 0.00 ? 65  GLN A H    4  
ATOM 6630  H HA   . GLN A 1 65  ? -7.252  -9.590  8.941   1.00 0.00 ? 65  GLN A HA   4  
ATOM 6631  H HB2  . GLN A 1 65  ? -4.969  -9.777  6.996   1.00 0.00 ? 65  GLN A HB2  4  
ATOM 6632  H HB3  . GLN A 1 65  ? -4.789  -8.926  8.524   1.00 0.00 ? 65  GLN A HB3  4  
ATOM 6633  H HG2  . GLN A 1 65  ? -4.973  -10.848 9.774   1.00 0.00 ? 65  GLN A HG2  4  
ATOM 6634  H HG3  . GLN A 1 65  ? -5.845  -11.713 8.509   1.00 0.00 ? 65  GLN A HG3  4  
ATOM 6635  H HE21 . GLN A 1 65  ? -2.953  -11.428 10.062  1.00 0.00 ? 65  GLN A HE21 4  
ATOM 6636  H HE22 . GLN A 1 65  ? -1.923  -12.163 8.886   1.00 0.00 ? 65  GLN A HE22 4  
ATOM 6637  N N    . ASN A 1 66  ? -6.436  -7.041  8.637   1.00 0.00 ? 66  ASN A N    4  
ATOM 6638  C CA   . ASN A 1 66  ? -6.525  -5.590  8.514   1.00 0.00 ? 66  ASN A CA   4  
ATOM 6639  C C    . ASN A 1 66  ? -5.452  -4.906  9.356   1.00 0.00 ? 66  ASN A C    4  
ATOM 6640  O O    . ASN A 1 66  ? -5.165  -5.328  10.478  1.00 0.00 ? 66  ASN A O    4  
ATOM 6641  C CB   . ASN A 1 66  ? -7.912  -5.106  8.944   1.00 0.00 ? 66  ASN A CB   4  
ATOM 6642  C CG   . ASN A 1 66  ? -8.452  -5.879  10.131  1.00 0.00 ? 66  ASN A CG   4  
ATOM 6643  O OD1  . ASN A 1 66  ? -7.742  -6.114  11.108  1.00 0.00 ? 66  ASN A OD1  4  
ATOM 6644  N ND2  . ASN A 1 66  ? -9.716  -6.279  10.051  1.00 0.00 ? 66  ASN A ND2  4  
ATOM 6645  H H    . ASN A 1 66  ? -5.962  -7.428  9.403   1.00 0.00 ? 66  ASN A H    4  
ATOM 6646  H HA   . ASN A 1 66  ? -6.370  -5.335  7.477   1.00 0.00 ? 66  ASN A HA   4  
ATOM 6647  H HB2  . ASN A 1 66  ? -7.853  -4.062  9.215   1.00 0.00 ? 66  ASN A HB2  4  
ATOM 6648  H HB3  . ASN A 1 66  ? -8.599  -5.222  8.119   1.00 0.00 ? 66  ASN A HB3  4  
ATOM 6649  H HD21 . ASN A 1 66  ? -10.222 -6.055  9.242   1.00 0.00 ? 66  ASN A HD21 4  
ATOM 6650  H HD22 . ASN A 1 66  ? -10.092 -6.780  10.805  1.00 0.00 ? 66  ASN A HD22 4  
ATOM 6651  N N    . LEU A 1 67  ? -4.863  -3.849  8.808   1.00 0.00 ? 67  LEU A N    4  
ATOM 6652  C CA   . LEU A 1 67  ? -3.822  -3.105  9.509   1.00 0.00 ? 67  LEU A CA   4  
ATOM 6653  C C    . LEU A 1 67  ? -4.274  -1.677  9.798   1.00 0.00 ? 67  LEU A C    4  
ATOM 6654  O O    . LEU A 1 67  ? -4.177  -0.799  8.941   1.00 0.00 ? 67  LEU A O    4  
ATOM 6655  C CB   . LEU A 1 67  ? -2.536  -3.087  8.681   1.00 0.00 ? 67  LEU A CB   4  
ATOM 6656  C CG   . LEU A 1 67  ? -1.345  -2.361  9.306   1.00 0.00 ? 67  LEU A CG   4  
ATOM 6657  C CD1  . LEU A 1 67  ? -0.676  -3.238  10.354  1.00 0.00 ? 67  LEU A CD1  4  
ATOM 6658  C CD2  . LEU A 1 67  ? -0.345  -1.953  8.234   1.00 0.00 ? 67  LEU A CD2  4  
ATOM 6659  H H    . LEU A 1 67  ? -5.135  -3.561  7.912   1.00 0.00 ? 67  LEU A H    4  
ATOM 6660  H HA   . LEU A 1 67  ? -3.630  -3.606  10.446  1.00 0.00 ? 67  LEU A HA   4  
ATOM 6661  H HB2  . LEU A 1 67  ? -2.243  -4.111  8.503   1.00 0.00 ? 67  LEU A HB2  4  
ATOM 6662  H HB3  . LEU A 1 67  ? -2.758  -2.609  7.737   1.00 0.00 ? 67  LEU A HB3  4  
ATOM 6663  H HG   . LEU A 1 67  ? -1.695  -1.464  9.797   1.00 0.00 ? 67  LEU A HG   4  
ATOM 6664  H HD11 . LEU A 1 67  ? -0.451  -4.203  9.926   1.00 0.00 ? 67  LEU A HD11 4  
ATOM 6665  H HD12 . LEU A 1 67  ? -1.342  -3.363  11.196  1.00 0.00 ? 67  LEU A HD12 4  
ATOM 6666  H HD13 . LEU A 1 67  ? 0.238   -2.768  10.686  1.00 0.00 ? 67  LEU A HD13 4  
ATOM 6667  H HD21 . LEU A 1 67  ? 0.563   -1.604  8.703   1.00 0.00 ? 67  LEU A HD21 4  
ATOM 6668  H HD22 . LEU A 1 67  ? -0.767  -1.161  7.632   1.00 0.00 ? 67  LEU A HD22 4  
ATOM 6669  H HD23 . LEU A 1 67  ? -0.123  -2.803  7.606   1.00 0.00 ? 67  LEU A HD23 4  
ATOM 6670  N N    . ASP A 1 68  ? -4.766  -1.453  11.011  1.00 0.00 ? 68  ASP A N    4  
ATOM 6671  C CA   . ASP A 1 68  ? -5.229  -0.130  11.415  1.00 0.00 ? 68  ASP A CA   4  
ATOM 6672  C C    . ASP A 1 68  ? -4.077  0.870   11.427  1.00 0.00 ? 68  ASP A C    4  
ATOM 6673  O O    . ASP A 1 68  ? -3.292  0.915   12.374  1.00 0.00 ? 68  ASP A O    4  
ATOM 6674  C CB   . ASP A 1 68  ? -5.879  -0.195  12.799  1.00 0.00 ? 68  ASP A CB   4  
ATOM 6675  C CG   . ASP A 1 68  ? -5.109  -1.079  13.759  1.00 0.00 ? 68  ASP A CG   4  
ATOM 6676  O OD1  . ASP A 1 68  ? -3.865  -0.975  13.794  1.00 0.00 ? 68  ASP A OD1  4  
ATOM 6677  O OD2  . ASP A 1 68  ? -5.750  -1.874  14.477  1.00 0.00 ? 68  ASP A OD2  4  
ATOM 6678  H H    . ASP A 1 68  ? -4.817  -2.194  11.651  1.00 0.00 ? 68  ASP A H    4  
ATOM 6679  H HA   . ASP A 1 68  ? -5.966  0.197   10.697  1.00 0.00 ? 68  ASP A HA   4  
ATOM 6680  H HB2  . ASP A 1 68  ? -5.926  0.801   13.214  1.00 0.00 ? 68  ASP A HB2  4  
ATOM 6681  H HB3  . ASP A 1 68  ? -6.881  -0.587  12.700  1.00 0.00 ? 68  ASP A HB3  4  
ATOM 6682  N N    . ALA A 1 69  ? -3.983  1.668   10.370  1.00 0.00 ? 69  ALA A N    4  
ATOM 6683  C CA   . ALA A 1 69  ? -2.928  2.668   10.259  1.00 0.00 ? 69  ALA A CA   4  
ATOM 6684  C C    . ALA A 1 69  ? -2.971  3.643   11.430  1.00 0.00 ? 69  ALA A C    4  
ATOM 6685  O O    . ALA A 1 69  ? -1.937  4.151   11.868  1.00 0.00 ? 69  ALA A O    4  
ATOM 6686  C CB   . ALA A 1 69  ? -3.047  3.418   8.941   1.00 0.00 ? 69  ALA A CB   4  
ATOM 6687  H H    . ALA A 1 69  ? -4.639  1.585   9.647   1.00 0.00 ? 69  ALA A H    4  
ATOM 6688  H HA   . ALA A 1 69  ? -1.978  2.153   10.267  1.00 0.00 ? 69  ALA A HA   4  
ATOM 6689  H HB1  . ALA A 1 69  ? -2.985  2.716   8.121   1.00 0.00 ? 69  ALA A HB1  4  
ATOM 6690  H HB2  . ALA A 1 69  ? -3.996  3.932   8.904   1.00 0.00 ? 69  ALA A HB2  4  
ATOM 6691  H HB3  . ALA A 1 69  ? -2.245  4.136   8.861   1.00 0.00 ? 69  ALA A HB3  4  
ATOM 6692  N N    . LYS A 1 70  ? -4.172  3.903   11.935  1.00 0.00 ? 70  LYS A N    4  
ATOM 6693  C CA   . LYS A 1 70  ? -4.351  4.817   13.056  1.00 0.00 ? 70  LYS A CA   4  
ATOM 6694  C C    . LYS A 1 70  ? -3.920  6.231   12.679  1.00 0.00 ? 70  LYS A C    4  
ATOM 6695  O O    . LYS A 1 70  ? -3.556  7.031   13.542  1.00 0.00 ? 70  LYS A O    4  
ATOM 6696  C CB   . LYS A 1 70  ? -3.550  4.334   14.267  1.00 0.00 ? 70  LYS A CB   4  
ATOM 6697  C CG   . LYS A 1 70  ? -4.314  3.370   15.157  1.00 0.00 ? 70  LYS A CG   4  
ATOM 6698  C CD   . LYS A 1 70  ? -5.366  4.089   15.984  1.00 0.00 ? 70  LYS A CD   4  
ATOM 6699  C CE   . LYS A 1 70  ? -5.934  3.188   17.070  1.00 0.00 ? 70  LYS A CE   4  
ATOM 6700  N NZ   . LYS A 1 70  ? -6.542  3.973   18.180  1.00 0.00 ? 70  LYS A NZ   4  
ATOM 6701  H H    . LYS A 1 70  ? -4.959  3.467   11.543  1.00 0.00 ? 70  LYS A H    4  
ATOM 6702  H HA   . LYS A 1 70  ? -5.400  4.830   13.311  1.00 0.00 ? 70  LYS A HA   4  
ATOM 6703  H HB2  . LYS A 1 70  ? -2.656  3.838   13.918  1.00 0.00 ? 70  LYS A HB2  4  
ATOM 6704  H HB3  . LYS A 1 70  ? -3.266  5.191   14.861  1.00 0.00 ? 70  LYS A HB3  4  
ATOM 6705  H HG2  . LYS A 1 70  ? -4.802  2.632   14.537  1.00 0.00 ? 70  LYS A HG2  4  
ATOM 6706  H HG3  . LYS A 1 70  ? -3.618  2.880   15.823  1.00 0.00 ? 70  LYS A HG3  4  
ATOM 6707  H HD2  . LYS A 1 70  ? -4.917  4.955   16.449  1.00 0.00 ? 70  LYS A HD2  4  
ATOM 6708  H HD3  . LYS A 1 70  ? -6.170  4.405   15.334  1.00 0.00 ? 70  LYS A HD3  4  
ATOM 6709  H HE2  . LYS A 1 70  ? -6.689  2.553   16.634  1.00 0.00 ? 70  LYS A HE2  4  
ATOM 6710  H HE3  . LYS A 1 70  ? -5.136  2.578   17.467  1.00 0.00 ? 70  LYS A HE3  4  
ATOM 6711  H HZ1  . LYS A 1 70  ? -7.403  4.452   17.849  1.00 0.00 ? 70  LYS A HZ1  4  
ATOM 6712  H HZ2  . LYS A 1 70  ? -5.870  4.689   18.522  1.00 0.00 ? 70  LYS A HZ2  4  
ATOM 6713  H HZ3  . LYS A 1 70  ? -6.791  3.342   18.969  1.00 0.00 ? 70  LYS A HZ3  4  
ATOM 6714  N N    . VAL A 1 71  ? -3.964  6.533   11.385  1.00 0.00 ? 71  VAL A N    4  
ATOM 6715  C CA   . VAL A 1 71  ? -3.580  7.852   10.895  1.00 0.00 ? 71  VAL A CA   4  
ATOM 6716  C C    . VAL A 1 71  ? -4.329  8.201   9.614   1.00 0.00 ? 71  VAL A C    4  
ATOM 6717  O O    . VAL A 1 71  ? -4.035  7.688   8.534   1.00 0.00 ? 71  VAL A O    4  
ATOM 6718  C CB   . VAL A 1 71  ? -2.065  7.933   10.629  1.00 0.00 ? 71  VAL A CB   4  
ATOM 6719  C CG1  . VAL A 1 71  ? -1.670  9.342   10.214  1.00 0.00 ? 71  VAL A CG1  4  
ATOM 6720  C CG2  . VAL A 1 71  ? -1.285  7.491   11.858  1.00 0.00 ? 71  VAL A CG2  4  
ATOM 6721  H H    . VAL A 1 71  ? -4.262  5.854   10.746  1.00 0.00 ? 71  VAL A H    4  
ATOM 6722  H HA   . VAL A 1 71  ? -3.830  8.577   11.655  1.00 0.00 ? 71  VAL A HA   4  
ATOM 6723  H HB   . VAL A 1 71  ? -1.826  7.262   9.817   1.00 0.00 ? 71  VAL A HB   4  
ATOM 6724  H HG11 . VAL A 1 71  ? -2.397  9.728   9.515   1.00 0.00 ? 71  VAL A HG11 4  
ATOM 6725  H HG12 . VAL A 1 71  ? -1.635  9.978   11.087  1.00 0.00 ? 71  VAL A HG12 4  
ATOM 6726  H HG13 . VAL A 1 71  ? -0.698  9.320   9.745   1.00 0.00 ? 71  VAL A HG13 4  
ATOM 6727  H HG21 . VAL A 1 71  ? -1.528  8.137   12.688  1.00 0.00 ? 71  VAL A HG21 4  
ATOM 6728  H HG22 . VAL A 1 71  ? -1.547  6.473   12.105  1.00 0.00 ? 71  VAL A HG22 4  
ATOM 6729  H HG23 . VAL A 1 71  ? -0.226  7.550   11.653  1.00 0.00 ? 71  VAL A HG23 4  
ATOM 6730  N N    . PRO A 1 72  ? -5.322  9.095   9.733   1.00 0.00 ? 72  PRO A N    4  
ATOM 6731  C CA   . PRO A 1 72  ? -6.134  9.533   8.595   1.00 0.00 ? 72  PRO A CA   4  
ATOM 6732  C C    . PRO A 1 72  ? -5.343  10.396  7.617   1.00 0.00 ? 72  PRO A C    4  
ATOM 6733  O O    . PRO A 1 72  ? -5.756  10.597  6.475   1.00 0.00 ? 72  PRO A O    4  
ATOM 6734  C CB   . PRO A 1 72  ? -7.250  10.352  9.249   1.00 0.00 ? 72  PRO A CB   4  
ATOM 6735  C CG   . PRO A 1 72  ? -6.666  10.830  10.533  1.00 0.00 ? 72  PRO A CG   4  
ATOM 6736  C CD   . PRO A 1 72  ? -5.728  9.746   10.990  1.00 0.00 ? 72  PRO A CD   4  
ATOM 6737  H HA   . PRO A 1 72  ? -6.563  8.695   8.066   1.00 0.00 ? 72  PRO A HA   4  
ATOM 6738  H HB2  . PRO A 1 72  ? -7.518  11.178  8.605   1.00 0.00 ? 72  PRO A HB2  4  
ATOM 6739  H HB3  . PRO A 1 72  ? -8.111  9.724   9.416   1.00 0.00 ? 72  PRO A HB3  4  
ATOM 6740  H HG2  . PRO A 1 72  ? -6.125  11.750  10.372  1.00 0.00 ? 72  PRO A HG2  4  
ATOM 6741  H HG3  . PRO A 1 72  ? -7.450  10.977  11.261  1.00 0.00 ? 72  PRO A HG3  4  
ATOM 6742  H HD2  . PRO A 1 72  ? -4.875  10.174  11.496  1.00 0.00 ? 72  PRO A HD2  4  
ATOM 6743  H HD3  . PRO A 1 72  ? -6.242  9.050   11.636  1.00 0.00 ? 72  PRO A HD3  4  
ATOM 6744  N N    . THR A 1 73  ? -4.202  10.905  8.073   1.00 0.00 ? 73  THR A N    4  
ATOM 6745  C CA   . THR A 1 73  ? -3.354  11.747  7.239   1.00 0.00 ? 73  THR A CA   4  
ATOM 6746  C C    . THR A 1 73  ? -2.354  10.909  6.449   1.00 0.00 ? 73  THR A C    4  
ATOM 6747  O O    . THR A 1 73  ? -1.732  11.395  5.506   1.00 0.00 ? 73  THR A O    4  
ATOM 6748  C CB   . THR A 1 73  ? -2.586  12.781  8.083   1.00 0.00 ? 73  THR A CB   4  
ATOM 6749  O OG1  . THR A 1 73  ? -1.890  12.125  9.148   1.00 0.00 ? 73  THR A OG1  4  
ATOM 6750  C CG2  . THR A 1 73  ? -3.534  13.823  8.656   1.00 0.00 ? 73  THR A CG2  4  
ATOM 6751  H H    . THR A 1 73  ? -3.926  10.709  8.992   1.00 0.00 ? 73  THR A H    4  
ATOM 6752  H HA   . THR A 1 73  ? -3.989  12.278  6.546   1.00 0.00 ? 73  THR A HA   4  
ATOM 6753  H HB   . THR A 1 73  ? -1.868  13.280  7.447   1.00 0.00 ? 73  THR A HB   4  
ATOM 6754  H HG1  . THR A 1 73  ? -1.277  12.741  9.557   1.00 0.00 ? 73  THR A HG1  4  
ATOM 6755  H HG21 . THR A 1 73  ? -3.549  14.690  8.012   1.00 0.00 ? 73  THR A HG21 4  
ATOM 6756  H HG22 . THR A 1 73  ? -3.199  14.112  9.641   1.00 0.00 ? 73  THR A HG22 4  
ATOM 6757  H HG23 . THR A 1 73  ? -4.528  13.407  8.722   1.00 0.00 ? 73  THR A HG23 4  
ATOM 6758  N N    . GLU A 1 74  ? -2.206  9.647   6.842   1.00 0.00 ? 74  GLU A N    4  
ATOM 6759  C CA   . GLU A 1 74  ? -1.281  8.743   6.169   1.00 0.00 ? 74  GLU A CA   4  
ATOM 6760  C C    . GLU A 1 74  ? -1.993  7.948   5.078   1.00 0.00 ? 74  GLU A C    4  
ATOM 6761  O O    . GLU A 1 74  ? -3.181  7.644   5.192   1.00 0.00 ? 74  GLU A O    4  
ATOM 6762  C CB   . GLU A 1 74  ? -0.644  7.786   7.179   1.00 0.00 ? 74  GLU A CB   4  
ATOM 6763  C CG   . GLU A 1 74  ? 0.535   8.386   7.927   1.00 0.00 ? 74  GLU A CG   4  
ATOM 6764  C CD   . GLU A 1 74  ? 1.856   8.145   7.223   1.00 0.00 ? 74  GLU A CD   4  
ATOM 6765  O OE1  . GLU A 1 74  ? 2.390   7.021   7.330   1.00 0.00 ? 74  GLU A OE1  4  
ATOM 6766  O OE2  . GLU A 1 74  ? 2.357   9.081   6.565   1.00 0.00 ? 74  GLU A OE2  4  
ATOM 6767  H H    . GLU A 1 74  ? -2.730  9.318   7.601   1.00 0.00 ? 74  GLU A H    4  
ATOM 6768  H HA   . GLU A 1 74  ? -0.505  9.340   5.714   1.00 0.00 ? 74  GLU A HA   4  
ATOM 6769  H HB2  . GLU A 1 74  ? -1.392  7.494   7.902   1.00 0.00 ? 74  GLU A HB2  4  
ATOM 6770  H HB3  . GLU A 1 74  ? -0.300  6.906   6.655   1.00 0.00 ? 74  GLU A HB3  4  
ATOM 6771  H HG2  . GLU A 1 74  ? 0.382   9.451   8.018   1.00 0.00 ? 74  GLU A HG2  4  
ATOM 6772  H HG3  . GLU A 1 74  ? 0.583   7.945   8.911   1.00 0.00 ? 74  GLU A HG3  4  
ATOM 6773  N N    . ARG A 1 75  ? -1.259  7.616   4.021   1.00 0.00 ? 75  ARG A N    4  
ATOM 6774  C CA   . ARG A 1 75  ? -1.820  6.859   2.909   1.00 0.00 ? 75  ARG A CA   4  
ATOM 6775  C C    . ARG A 1 75  ? -0.942  5.658   2.571   1.00 0.00 ? 75  ARG A C    4  
ATOM 6776  O O    . ARG A 1 75  ? -1.230  4.907   1.639   1.00 0.00 ? 75  ARG A O    4  
ATOM 6777  C CB   . ARG A 1 75  ? -1.972  7.755   1.679   1.00 0.00 ? 75  ARG A CB   4  
ATOM 6778  C CG   . ARG A 1 75  ? -0.959  8.887   1.622   1.00 0.00 ? 75  ARG A CG   4  
ATOM 6779  C CD   . ARG A 1 75  ? -1.497  10.150  2.276   1.00 0.00 ? 75  ARG A CD   4  
ATOM 6780  N NE   . ARG A 1 75  ? -0.939  11.358  1.675   1.00 0.00 ? 75  ARG A NE   4  
ATOM 6781  C CZ   . ARG A 1 75  ? -1.047  12.566  2.218   1.00 0.00 ? 75  ARG A CZ   4  
ATOM 6782  N NH1  . ARG A 1 75  ? -1.687  12.725  3.367   1.00 0.00 ? 75  ARG A NH1  4  
ATOM 6783  N NH2  . ARG A 1 75  ? -0.512  13.618  1.610   1.00 0.00 ? 75  ARG A NH2  4  
ATOM 6784  H H    . ARG A 1 75  ? -0.318  7.887   3.988   1.00 0.00 ? 75  ARG A H    4  
ATOM 6785  H HA   . ARG A 1 75  ? -2.795  6.504   3.207   1.00 0.00 ? 75  ARG A HA   4  
ATOM 6786  H HB2  . ARG A 1 75  ? -1.854  7.152   0.791   1.00 0.00 ? 75  ARG A HB2  4  
ATOM 6787  H HB3  . ARG A 1 75  ? -2.961  8.187   1.683   1.00 0.00 ? 75  ARG A HB3  4  
ATOM 6788  H HG2  . ARG A 1 75  ? -0.062  8.582   2.139   1.00 0.00 ? 75  ARG A HG2  4  
ATOM 6789  H HG3  . ARG A 1 75  ? -0.727  9.098   0.588   1.00 0.00 ? 75  ARG A HG3  4  
ATOM 6790  H HD2  . ARG A 1 75  ? -2.571  10.167  2.165   1.00 0.00 ? 75  ARG A HD2  4  
ATOM 6791  H HD3  . ARG A 1 75  ? -1.245  10.131  3.325   1.00 0.00 ? 75  ARG A HD3  4  
ATOM 6792  H HE   . ARG A 1 75  ? -0.461  11.264  0.825   1.00 0.00 ? 75  ARG A HE   4  
ATOM 6793  H HH11 . ARG A 1 75  ? -2.090  11.935  3.828   1.00 0.00 ? 75  ARG A HH11 4  
ATOM 6794  H HH12 . ARG A 1 75  ? -1.766  13.636  3.774   1.00 0.00 ? 75  ARG A HH12 4  
ATOM 6795  H HH21 . ARG A 1 75  ? -0.028  13.501  0.743   1.00 0.00 ? 75  ARG A HH21 4  
ATOM 6796  H HH22 . ARG A 1 75  ? -0.593  14.526  2.019   1.00 0.00 ? 75  ARG A HH22 4  
ATOM 6797  N N    . SER A 1 76  ? 0.132   5.482   3.335   1.00 0.00 ? 76  SER A N    4  
ATOM 6798  C CA   . SER A 1 76  ? 1.055   4.375   3.115   1.00 0.00 ? 76  SER A CA   4  
ATOM 6799  C C    . SER A 1 76  ? 1.138   3.482   4.349   1.00 0.00 ? 76  SER A C    4  
ATOM 6800  O O    . SER A 1 76  ? 1.045   3.958   5.480   1.00 0.00 ? 76  SER A O    4  
ATOM 6801  C CB   . SER A 1 76  ? 2.445   4.906   2.761   1.00 0.00 ? 76  SER A CB   4  
ATOM 6802  O OG   . SER A 1 76  ? 3.457   4.007   3.183   1.00 0.00 ? 76  SER A OG   4  
ATOM 6803  H H    . SER A 1 76  ? 0.308   6.114   4.064   1.00 0.00 ? 76  SER A H    4  
ATOM 6804  H HA   . SER A 1 76  ? 0.680   3.791   2.287   1.00 0.00 ? 76  SER A HA   4  
ATOM 6805  H HB2  . SER A 1 76  ? 2.518   5.034   1.691   1.00 0.00 ? 76  SER A HB2  4  
ATOM 6806  H HB3  . SER A 1 76  ? 2.599   5.858   3.248   1.00 0.00 ? 76  SER A HB3  4  
ATOM 6807  H HG   . SER A 1 76  ? 4.113   3.915   2.489   1.00 0.00 ? 76  SER A HG   4  
ATOM 6808  N N    . ALA A 1 77  ? 1.312   2.185   4.122   1.00 0.00 ? 77  ALA A N    4  
ATOM 6809  C CA   . ALA A 1 77  ? 1.409   1.225   5.215   1.00 0.00 ? 77  ALA A CA   4  
ATOM 6810  C C    . ALA A 1 77  ? 2.431   0.137   4.900   1.00 0.00 ? 77  ALA A C    4  
ATOM 6811  O O    . ALA A 1 77  ? 2.932   0.047   3.779   1.00 0.00 ? 77  ALA A O    4  
ATOM 6812  C CB   . ALA A 1 77  ? 0.048   0.606   5.497   1.00 0.00 ? 77  ALA A CB   4  
ATOM 6813  H H    . ALA A 1 77  ? 1.378   1.866   3.198   1.00 0.00 ? 77  ALA A H    4  
ATOM 6814  H HA   . ALA A 1 77  ? 1.726   1.757   6.100   1.00 0.00 ? 77  ALA A HA   4  
ATOM 6815  H HB1  . ALA A 1 77  ? -0.564  1.316   6.034   1.00 0.00 ? 77  ALA A HB1  4  
ATOM 6816  H HB2  . ALA A 1 77  ? -0.431  0.350   4.564   1.00 0.00 ? 77  ALA A HB2  4  
ATOM 6817  H HB3  . ALA A 1 77  ? 0.174   -0.284  6.094   1.00 0.00 ? 77  ALA A HB3  4  
ATOM 6818  N N    . VAL A 1 78  ? 2.738   -0.687  5.898   1.00 0.00 ? 78  VAL A N    4  
ATOM 6819  C CA   . VAL A 1 78  ? 3.700   -1.769  5.727   1.00 0.00 ? 78  VAL A CA   4  
ATOM 6820  C C    . VAL A 1 78  ? 3.181   -3.067  6.335   1.00 0.00 ? 78  VAL A C    4  
ATOM 6821  O O    . VAL A 1 78  ? 3.146   -3.223  7.556   1.00 0.00 ? 78  VAL A O    4  
ATOM 6822  C CB   . VAL A 1 78  ? 5.056   -1.420  6.369   1.00 0.00 ? 78  VAL A CB   4  
ATOM 6823  C CG1  . VAL A 1 78  ? 6.026   -2.584  6.234   1.00 0.00 ? 78  VAL A CG1  4  
ATOM 6824  C CG2  . VAL A 1 78  ? 5.633   -0.159  5.744   1.00 0.00 ? 78  VAL A CG2  4  
ATOM 6825  H H    . VAL A 1 78  ? 2.305   -0.564  6.768   1.00 0.00 ? 78  VAL A H    4  
ATOM 6826  H HA   . VAL A 1 78  ? 3.854   -1.915  4.668   1.00 0.00 ? 78  VAL A HA   4  
ATOM 6827  H HB   . VAL A 1 78  ? 4.896   -1.234  7.421   1.00 0.00 ? 78  VAL A HB   4  
ATOM 6828  H HG11 . VAL A 1 78  ? 5.504   -3.443  5.839   1.00 0.00 ? 78  VAL A HG11 4  
ATOM 6829  H HG12 . VAL A 1 78  ? 6.828   -2.309  5.565   1.00 0.00 ? 78  VAL A HG12 4  
ATOM 6830  H HG13 . VAL A 1 78  ? 6.434   -2.827  7.205   1.00 0.00 ? 78  VAL A HG13 4  
ATOM 6831  H HG21 . VAL A 1 78  ? 5.316   -0.092  4.714   1.00 0.00 ? 78  VAL A HG21 4  
ATOM 6832  H HG22 . VAL A 1 78  ? 5.279   0.706   6.286   1.00 0.00 ? 78  VAL A HG22 4  
ATOM 6833  H HG23 . VAL A 1 78  ? 6.711   -0.196  5.788   1.00 0.00 ? 78  VAL A HG23 4  
ATOM 6834  N N    . LEU A 1 79  ? 2.778   -3.996  5.476   1.00 0.00 ? 79  LEU A N    4  
ATOM 6835  C CA   . LEU A 1 79  ? 2.261   -5.283  5.927   1.00 0.00 ? 79  LEU A CA   4  
ATOM 6836  C C    . LEU A 1 79  ? 3.399   -6.258  6.213   1.00 0.00 ? 79  LEU A C    4  
ATOM 6837  O O    . LEU A 1 79  ? 4.096   -6.700  5.299   1.00 0.00 ? 79  LEU A O    4  
ATOM 6838  C CB   . LEU A 1 79  ? 1.319   -5.874  4.876   1.00 0.00 ? 79  LEU A CB   4  
ATOM 6839  C CG   . LEU A 1 79  ? 0.259   -4.926  4.316   1.00 0.00 ? 79  LEU A CG   4  
ATOM 6840  C CD1  . LEU A 1 79  ? -0.411  -5.536  3.095   1.00 0.00 ? 79  LEU A CD1  4  
ATOM 6841  C CD2  . LEU A 1 79  ? -0.774  -4.590  5.382   1.00 0.00 ? 79  LEU A CD2  4  
ATOM 6842  H H    . LEU A 1 79  ? 2.830   -3.814  4.515   1.00 0.00 ? 79  LEU A H    4  
ATOM 6843  H HA   . LEU A 1 79  ? 1.708   -5.116  6.840   1.00 0.00 ? 79  LEU A HA   4  
ATOM 6844  H HB2  . LEU A 1 79  ? 1.922   -6.221  4.051   1.00 0.00 ? 79  LEU A HB2  4  
ATOM 6845  H HB3  . LEU A 1 79  ? 0.809   -6.714  5.326   1.00 0.00 ? 79  LEU A HB3  4  
ATOM 6846  H HG   . LEU A 1 79  ? 0.736   -4.004  4.009   1.00 0.00 ? 79  LEU A HG   4  
ATOM 6847  H HD11 . LEU A 1 79  ? 0.344   -5.874  2.401   1.00 0.00 ? 79  LEU A HD11 4  
ATOM 6848  H HD12 . LEU A 1 79  ? -1.032  -4.793  2.616   1.00 0.00 ? 79  LEU A HD12 4  
ATOM 6849  H HD13 . LEU A 1 79  ? -1.022  -6.373  3.400   1.00 0.00 ? 79  LEU A HD13 4  
ATOM 6850  H HD21 . LEU A 1 79  ? -0.978  -3.530  5.364   1.00 0.00 ? 79  LEU A HD21 4  
ATOM 6851  H HD22 . LEU A 1 79  ? -0.391  -4.867  6.353   1.00 0.00 ? 79  LEU A HD22 4  
ATOM 6852  H HD23 . LEU A 1 79  ? -1.684  -5.136  5.184   1.00 0.00 ? 79  LEU A HD23 4  
ATOM 6853  N N    . VAL A 1 80  ? 3.580   -6.591  7.487   1.00 0.00 ? 80  VAL A N    4  
ATOM 6854  C CA   . VAL A 1 80  ? 4.631   -7.517  7.893   1.00 0.00 ? 80  VAL A CA   4  
ATOM 6855  C C    . VAL A 1 80  ? 4.063   -8.902  8.180   1.00 0.00 ? 80  VAL A C    4  
ATOM 6856  O O    . VAL A 1 80  ? 2.851   -9.109  8.130   1.00 0.00 ? 80  VAL A O    4  
ATOM 6857  C CB   . VAL A 1 80  ? 5.374   -7.009  9.143   1.00 0.00 ? 80  VAL A CB   4  
ATOM 6858  C CG1  . VAL A 1 80  ? 5.956   -5.626  8.894   1.00 0.00 ? 80  VAL A CG1  4  
ATOM 6859  C CG2  . VAL A 1 80  ? 4.443   -6.995  10.346  1.00 0.00 ? 80  VAL A CG2  4  
ATOM 6860  H H    . VAL A 1 80  ? 2.992   -6.206  8.170   1.00 0.00 ? 80  VAL A H    4  
ATOM 6861  H HA   . VAL A 1 80  ? 5.342   -7.590  7.083   1.00 0.00 ? 80  VAL A HA   4  
ATOM 6862  H HB   . VAL A 1 80  ? 6.188   -7.686  9.353   1.00 0.00 ? 80  VAL A HB   4  
ATOM 6863  H HG11 . VAL A 1 80  ? 5.943   -5.059  9.814   1.00 0.00 ? 80  VAL A HG11 4  
ATOM 6864  H HG12 . VAL A 1 80  ? 6.973   -5.722  8.542   1.00 0.00 ? 80  VAL A HG12 4  
ATOM 6865  H HG13 . VAL A 1 80  ? 5.364   -5.115  8.149   1.00 0.00 ? 80  VAL A HG13 4  
ATOM 6866  H HG21 . VAL A 1 80  ? 4.701   -7.807  11.010  1.00 0.00 ? 80  VAL A HG21 4  
ATOM 6867  H HG22 . VAL A 1 80  ? 4.544   -6.056  10.870  1.00 0.00 ? 80  VAL A HG22 4  
ATOM 6868  H HG23 . VAL A 1 80  ? 3.422   -7.113  10.014  1.00 0.00 ? 80  VAL A HG23 4  
ATOM 6869  N N    . ASN A 1 81  ? 4.947   -9.847  8.482   1.00 0.00 ? 81  ASN A N    4  
ATOM 6870  C CA   . ASN A 1 81  ? 4.534   -11.214 8.777   1.00 0.00 ? 81  ASN A CA   4  
ATOM 6871  C C    . ASN A 1 81  ? 3.764   -11.815 7.605   1.00 0.00 ? 81  ASN A C    4  
ATOM 6872  O O    . ASN A 1 81  ? 2.689   -12.390 7.783   1.00 0.00 ? 81  ASN A O    4  
ATOM 6873  C CB   . ASN A 1 81  ? 3.670   -11.246 10.039  1.00 0.00 ? 81  ASN A CB   4  
ATOM 6874  C CG   . ASN A 1 81  ? 4.439   -10.829 11.278  1.00 0.00 ? 81  ASN A CG   4  
ATOM 6875  O OD1  . ASN A 1 81  ? 5.670   -10.796 11.275  1.00 0.00 ? 81  ASN A OD1  4  
ATOM 6876  N ND2  . ASN A 1 81  ? 3.716   -10.508 12.344  1.00 0.00 ? 81  ASN A ND2  4  
ATOM 6877  H H    . ASN A 1 81  ? 5.900   -9.621  8.506   1.00 0.00 ? 81  ASN A H    4  
ATOM 6878  H HA   . ASN A 1 81  ? 5.424   -11.800 8.946   1.00 0.00 ? 81  ASN A HA   4  
ATOM 6879  H HB2  . ASN A 1 81  ? 2.835   -10.572 9.914   1.00 0.00 ? 81  ASN A HB2  4  
ATOM 6880  H HB3  . ASN A 1 81  ? 3.298   -12.249 10.189  1.00 0.00 ? 81  ASN A HB3  4  
ATOM 6881  H HD21 . ASN A 1 81  ? 2.739   -10.558 12.273  1.00 0.00 ? 81  ASN A HD21 4  
ATOM 6882  H HD22 . ASN A 1 81  ? 4.188   -10.234 13.158  1.00 0.00 ? 81  ASN A HD22 4  
ATOM 6883  N N    . LEU A 1 82  ? 4.321   -11.679 6.407   1.00 0.00 ? 82  LEU A N    4  
ATOM 6884  C CA   . LEU A 1 82  ? 3.687   -12.209 5.204   1.00 0.00 ? 82  LEU A CA   4  
ATOM 6885  C C    . LEU A 1 82  ? 4.384   -13.483 4.738   1.00 0.00 ? 82  LEU A C    4  
ATOM 6886  O O    . LEU A 1 82  ? 5.539   -13.734 5.084   1.00 0.00 ? 82  LEU A O    4  
ATOM 6887  C CB   . LEU A 1 82  ? 3.712   -11.163 4.088   1.00 0.00 ? 82  LEU A CB   4  
ATOM 6888  C CG   . LEU A 1 82  ? 2.921   -9.881  4.352   1.00 0.00 ? 82  LEU A CG   4  
ATOM 6889  C CD1  . LEU A 1 82  ? 3.186   -8.856  3.260   1.00 0.00 ? 82  LEU A CD1  4  
ATOM 6890  C CD2  . LEU A 1 82  ? 1.433   -10.184 4.452   1.00 0.00 ? 82  LEU A CD2  4  
ATOM 6891  H H    . LEU A 1 82  ? 5.178   -11.212 6.328   1.00 0.00 ? 82  LEU A H    4  
ATOM 6892  H HA   . LEU A 1 82  ? 2.661   -12.442 5.446   1.00 0.00 ? 82  LEU A HA   4  
ATOM 6893  H HB2  . LEU A 1 82  ? 4.741   -10.887 3.916   1.00 0.00 ? 82  LEU A HB2  4  
ATOM 6894  H HB3  . LEU A 1 82  ? 3.310   -11.623 3.196   1.00 0.00 ? 82  LEU A HB3  4  
ATOM 6895  H HG   . LEU A 1 82  ? 3.241   -9.456  5.293   1.00 0.00 ? 82  LEU A HG   4  
ATOM 6896  H HD11 . LEU A 1 82  ? 2.493   -9.008  2.448   1.00 0.00 ? 82  LEU A HD11 4  
ATOM 6897  H HD12 . LEU A 1 82  ? 4.197   -8.970  2.898   1.00 0.00 ? 82  LEU A HD12 4  
ATOM 6898  H HD13 . LEU A 1 82  ? 3.059   -7.862  3.662   1.00 0.00 ? 82  LEU A HD13 4  
ATOM 6899  H HD21 . LEU A 1 82  ? 1.275   -11.247 4.353   1.00 0.00 ? 82  LEU A HD21 4  
ATOM 6900  H HD22 . LEU A 1 82  ? 0.907   -9.667  3.662   1.00 0.00 ? 82  LEU A HD22 4  
ATOM 6901  H HD23 . LEU A 1 82  ? 1.062   -9.852  5.410   1.00 0.00 ? 82  LEU A HD23 4  
ATOM 6902  N N    . LYS A 1 83  ? 3.676   -14.284 3.949   1.00 0.00 ? 83  LYS A N    4  
ATOM 6903  C CA   . LYS A 1 83  ? 4.227   -15.531 3.431   1.00 0.00 ? 83  LYS A CA   4  
ATOM 6904  C C    . LYS A 1 83  ? 5.152   -15.267 2.248   1.00 0.00 ? 83  LYS A C    4  
ATOM 6905  O O    . LYS A 1 83  ? 4.972   -14.299 1.509   1.00 0.00 ? 83  LYS A O    4  
ATOM 6906  C CB   . LYS A 1 83  ? 3.098   -16.474 3.009   1.00 0.00 ? 83  LYS A CB   4  
ATOM 6907  C CG   . LYS A 1 83  ? 2.452   -17.208 4.172   1.00 0.00 ? 83  LYS A CG   4  
ATOM 6908  C CD   . LYS A 1 83  ? 3.169   -18.513 4.475   1.00 0.00 ? 83  LYS A CD   4  
ATOM 6909  C CE   . LYS A 1 83  ? 2.583   -19.669 3.678   1.00 0.00 ? 83  LYS A CE   4  
ATOM 6910  N NZ   . LYS A 1 83  ? 3.002   -20.989 4.226   1.00 0.00 ? 83  LYS A NZ   4  
ATOM 6911  H H    . LYS A 1 83  ? 2.760   -14.029 3.708   1.00 0.00 ? 83  LYS A H    4  
ATOM 6912  H HA   . LYS A 1 83  ? 4.796   -15.996 4.222   1.00 0.00 ? 83  LYS A HA   4  
ATOM 6913  H HB2  . LYS A 1 83  ? 2.335   -15.900 2.504   1.00 0.00 ? 83  LYS A HB2  4  
ATOM 6914  H HB3  . LYS A 1 83  ? 3.496   -17.209 2.324   1.00 0.00 ? 83  LYS A HB3  4  
ATOM 6915  H HG2  . LYS A 1 83  ? 2.488   -16.578 5.048   1.00 0.00 ? 83  LYS A HG2  4  
ATOM 6916  H HG3  . LYS A 1 83  ? 1.423   -17.423 3.922   1.00 0.00 ? 83  LYS A HG3  4  
ATOM 6917  H HD2  . LYS A 1 83  ? 4.213   -18.408 4.220   1.00 0.00 ? 83  LYS A HD2  4  
ATOM 6918  H HD3  . LYS A 1 83  ? 3.074   -18.729 5.530   1.00 0.00 ? 83  LYS A HD3  4  
ATOM 6919  H HE2  . LYS A 1 83  ? 1.506   -19.601 3.709   1.00 0.00 ? 83  LYS A HE2  4  
ATOM 6920  H HE3  . LYS A 1 83  ? 2.919   -19.590 2.655   1.00 0.00 ? 83  LYS A HE3  4  
ATOM 6921  H HZ1  . LYS A 1 83  ? 3.672   -21.448 3.577   1.00 0.00 ? 83  LYS A HZ1  4  
ATOM 6922  H HZ2  . LYS A 1 83  ? 2.173   -21.606 4.343   1.00 0.00 ? 83  LYS A HZ2  4  
ATOM 6923  H HZ3  . LYS A 1 83  ? 3.461   -20.863 5.150   1.00 0.00 ? 83  LYS A HZ3  4  
ATOM 6924  N N    . LYS A 1 84  ? 6.143   -16.135 2.072   1.00 0.00 ? 84  LYS A N    4  
ATOM 6925  C CA   . LYS A 1 84  ? 7.096   -15.999 0.977   1.00 0.00 ? 84  LYS A CA   4  
ATOM 6926  C C    . LYS A 1 84  ? 6.711   -16.897 -0.194  1.00 0.00 ? 84  LYS A C    4  
ATOM 6927  O O    . LYS A 1 84  ? 6.339   -18.054 -0.005  1.00 0.00 ? 84  LYS A O    4  
ATOM 6928  C CB   . LYS A 1 84  ? 8.508   -16.343 1.456   1.00 0.00 ? 84  LYS A CB   4  
ATOM 6929  C CG   . LYS A 1 84  ? 8.783   -15.923 2.889   1.00 0.00 ? 84  LYS A CG   4  
ATOM 6930  C CD   . LYS A 1 84  ? 10.069  -16.540 3.414   1.00 0.00 ? 84  LYS A CD   4  
ATOM 6931  C CE   . LYS A 1 84  ? 10.427  -15.998 4.789   1.00 0.00 ? 84  LYS A CE   4  
ATOM 6932  N NZ   . LYS A 1 84  ? 9.656   -16.674 5.870   1.00 0.00 ? 84  LYS A NZ   4  
ATOM 6933  H H    . LYS A 1 84  ? 6.235   -16.887 2.695   1.00 0.00 ? 84  LYS A H    4  
ATOM 6934  H HA   . LYS A 1 84  ? 7.077   -14.971 0.648   1.00 0.00 ? 84  LYS A HA   4  
ATOM 6935  H HB2  . LYS A 1 84  ? 8.649   -17.412 1.383   1.00 0.00 ? 84  LYS A HB2  4  
ATOM 6936  H HB3  . LYS A 1 84  ? 9.223   -15.850 0.814   1.00 0.00 ? 84  LYS A HB3  4  
ATOM 6937  H HG2  . LYS A 1 84  ? 8.871   -14.847 2.928   1.00 0.00 ? 84  LYS A HG2  4  
ATOM 6938  H HG3  . LYS A 1 84  ? 7.960   -16.242 3.513   1.00 0.00 ? 84  LYS A HG3  4  
ATOM 6939  H HD2  . LYS A 1 84  ? 9.942   -17.610 3.483   1.00 0.00 ? 84  LYS A HD2  4  
ATOM 6940  H HD3  . LYS A 1 84  ? 10.873  -16.315 2.727   1.00 0.00 ? 84  LYS A HD3  4  
ATOM 6941  H HE2  . LYS A 1 84  ? 11.481  -16.153 4.960   1.00 0.00 ? 84  LYS A HE2  4  
ATOM 6942  H HE3  . LYS A 1 84  ? 10.210  -14.940 4.812   1.00 0.00 ? 84  LYS A HE3  4  
ATOM 6943  H HZ1  . LYS A 1 84  ? 9.176   -15.966 6.462   1.00 0.00 ? 84  LYS A HZ1  4  
ATOM 6944  H HZ2  . LYS A 1 84  ? 10.296  -17.233 6.468   1.00 0.00 ? 84  LYS A HZ2  4  
ATOM 6945  H HZ3  . LYS A 1 84  ? 8.942   -17.307 5.457   1.00 0.00 ? 84  LYS A HZ3  4  
ATOM 6946  N N    . GLY A 1 85  ? 6.805   -16.356 -1.405  1.00 0.00 ? 85  GLY A N    4  
ATOM 6947  C CA   . GLY A 1 85  ? 6.465   -17.124 -2.589  1.00 0.00 ? 85  GLY A CA   4  
ATOM 6948  C C    . GLY A 1 85  ? 4.971   -17.340 -2.730  1.00 0.00 ? 85  GLY A C    4  
ATOM 6949  O O    . GLY A 1 85  ? 4.516   -18.465 -2.940  1.00 0.00 ? 85  GLY A O    4  
ATOM 6950  H H    . GLY A 1 85  ? 7.108   -15.429 -1.496  1.00 0.00 ? 85  GLY A H    4  
ATOM 6951  H HA2  . GLY A 1 85  ? 6.826   -16.600 -3.461  1.00 0.00 ? 85  GLY A HA2  4  
ATOM 6952  H HA3  . GLY A 1 85  ? 6.952   -18.086 -2.532  1.00 0.00 ? 85  GLY A HA3  4  
ATOM 6953  N N    . VAL A 1 86  ? 4.205   -16.260 -2.614  1.00 0.00 ? 86  VAL A N    4  
ATOM 6954  C CA   . VAL A 1 86  ? 2.753   -16.337 -2.729  1.00 0.00 ? 86  VAL A CA   4  
ATOM 6955  C C    . VAL A 1 86  ? 2.148   -14.959 -2.971  1.00 0.00 ? 86  VAL A C    4  
ATOM 6956  O O    . VAL A 1 86  ? 2.712   -13.941 -2.568  1.00 0.00 ? 86  VAL A O    4  
ATOM 6957  C CB   . VAL A 1 86  ? 2.121   -16.949 -1.465  1.00 0.00 ? 86  VAL A CB   4  
ATOM 6958  C CG1  . VAL A 1 86  ? 2.364   -16.054 -0.260  1.00 0.00 ? 86  VAL A CG1  4  
ATOM 6959  C CG2  . VAL A 1 86  ? 0.633   -17.184 -1.674  1.00 0.00 ? 86  VAL A CG2  4  
ATOM 6960  H H    . VAL A 1 86  ? 4.626   -15.391 -2.447  1.00 0.00 ? 86  VAL A H    4  
ATOM 6961  H HA   . VAL A 1 86  ? 2.518   -16.975 -3.569  1.00 0.00 ? 86  VAL A HA   4  
ATOM 6962  H HB   . VAL A 1 86  ? 2.592   -17.903 -1.278  1.00 0.00 ? 86  VAL A HB   4  
ATOM 6963  H HG11 . VAL A 1 86  ? 3.030   -15.250 -0.537  1.00 0.00 ? 86  VAL A HG11 4  
ATOM 6964  H HG12 . VAL A 1 86  ? 1.424   -15.643 0.079   1.00 0.00 ? 86  VAL A HG12 4  
ATOM 6965  H HG13 . VAL A 1 86  ? 2.811   -16.633 0.534   1.00 0.00 ? 86  VAL A HG13 4  
ATOM 6966  H HG21 . VAL A 1 86  ? 0.329   -18.067 -1.133  1.00 0.00 ? 86  VAL A HG21 4  
ATOM 6967  H HG22 . VAL A 1 86  ? 0.079   -16.330 -1.311  1.00 0.00 ? 86  VAL A HG22 4  
ATOM 6968  H HG23 . VAL A 1 86  ? 0.434   -17.320 -2.727  1.00 0.00 ? 86  VAL A HG23 4  
ATOM 6969  N N    . THR A 1 87  ? 0.995   -14.932 -3.631  1.00 0.00 ? 87  THR A N    4  
ATOM 6970  C CA   . THR A 1 87  ? 0.312   -13.679 -3.927  1.00 0.00 ? 87  THR A CA   4  
ATOM 6971  C C    . THR A 1 87  ? -0.515  -13.209 -2.736  1.00 0.00 ? 87  THR A C    4  
ATOM 6972  O O    . THR A 1 87  ? -0.789  -13.979 -1.815  1.00 0.00 ? 87  THR A O    4  
ATOM 6973  C CB   . THR A 1 87  ? -0.609  -13.817 -5.155  1.00 0.00 ? 87  THR A CB   4  
ATOM 6974  O OG1  . THR A 1 87  ? -0.047  -14.749 -6.086  1.00 0.00 ? 87  THR A OG1  4  
ATOM 6975  C CG2  . THR A 1 87  ? -0.809  -12.472 -5.835  1.00 0.00 ? 87  THR A CG2  4  
ATOM 6976  H H    . THR A 1 87  ? 0.595   -15.777 -3.927  1.00 0.00 ? 87  THR A H    4  
ATOM 6977  H HA   . THR A 1 87  ? 1.063   -12.934 -4.149  1.00 0.00 ? 87  THR A HA   4  
ATOM 6978  H HB   . THR A 1 87  ? -1.570  -14.184 -4.825  1.00 0.00 ? 87  THR A HB   4  
ATOM 6979  H HG1  . THR A 1 87  ? 0.906   -14.782 -5.971  1.00 0.00 ? 87  THR A HG1  4  
ATOM 6980  H HG21 . THR A 1 87  ? -1.236  -12.624 -6.815  1.00 0.00 ? 87  THR A HG21 4  
ATOM 6981  H HG22 . THR A 1 87  ? 0.143   -11.971 -5.930  1.00 0.00 ? 87  THR A HG22 4  
ATOM 6982  H HG23 . THR A 1 87  ? -1.478  -11.865 -5.242  1.00 0.00 ? 87  THR A HG23 4  
ATOM 6983  N N    . TYR A 1 88  ? -0.912  -11.941 -2.761  1.00 0.00 ? 88  TYR A N    4  
ATOM 6984  C CA   . TYR A 1 88  ? -1.707  -11.368 -1.682  1.00 0.00 ? 88  TYR A CA   4  
ATOM 6985  C C    . TYR A 1 88  ? -2.591  -10.237 -2.198  1.00 0.00 ? 88  TYR A C    4  
ATOM 6986  O O    . TYR A 1 88  ? -2.123  -9.340  -2.898  1.00 0.00 ? 88  TYR A O    4  
ATOM 6987  C CB   . TYR A 1 88  ? -0.795  -10.850 -0.568  1.00 0.00 ? 88  TYR A CB   4  
ATOM 6988  C CG   . TYR A 1 88  ? -0.468  -11.890 0.480   1.00 0.00 ? 88  TYR A CG   4  
ATOM 6989  C CD1  . TYR A 1 88  ? -1.339  -12.141 1.533   1.00 0.00 ? 88  TYR A CD1  4  
ATOM 6990  C CD2  . TYR A 1 88  ? 0.711   -12.622 0.417   1.00 0.00 ? 88  TYR A CD2  4  
ATOM 6991  C CE1  . TYR A 1 88  ? -1.044  -13.089 2.493   1.00 0.00 ? 88  TYR A CE1  4  
ATOM 6992  C CE2  . TYR A 1 88  ? 1.013   -13.574 1.371   1.00 0.00 ? 88  TYR A CE2  4  
ATOM 6993  C CZ   . TYR A 1 88  ? 0.133   -13.804 2.408   1.00 0.00 ? 88  TYR A CZ   4  
ATOM 6994  O OH   . TYR A 1 88  ? 0.431   -14.750 3.361   1.00 0.00 ? 88  TYR A OH   4  
ATOM 6995  H H    . TYR A 1 88  ? -0.662  -11.377 -3.522  1.00 0.00 ? 88  TYR A H    4  
ATOM 6996  H HA   . TYR A 1 88  ? -2.338  -12.149 -1.283  1.00 0.00 ? 88  TYR A HA   4  
ATOM 6997  H HB2  . TYR A 1 88  ? 0.134   -10.513 -1.000  1.00 0.00 ? 88  TYR A HB2  4  
ATOM 6998  H HB3  . TYR A 1 88  ? -1.279  -10.021 -0.073  1.00 0.00 ? 88  TYR A HB3  4  
ATOM 6999  H HD1  . TYR A 1 88  ? -2.260  -11.580 1.598   1.00 0.00 ? 88  TYR A HD1  4  
ATOM 7000  H HD2  . TYR A 1 88  ? 1.399   -12.439 -0.396  1.00 0.00 ? 88  TYR A HD2  4  
ATOM 7001  H HE1  . TYR A 1 88  ? -1.734  -13.270 3.305   1.00 0.00 ? 88  TYR A HE1  4  
ATOM 7002  H HE2  . TYR A 1 88  ? 1.935   -14.133 1.304   1.00 0.00 ? 88  TYR A HE2  4  
ATOM 7003  H HH   . TYR A 1 88  ? -0.294  -14.812 3.988   1.00 0.00 ? 88  TYR A HH   4  
ATOM 7004  N N    . GLU A 1 89  ? -3.872  -10.288 -1.846  1.00 0.00 ? 89  GLU A N    4  
ATOM 7005  C CA   . GLU A 1 89  ? -4.822  -9.268  -2.273  1.00 0.00 ? 89  GLU A CA   4  
ATOM 7006  C C    . GLU A 1 89  ? -5.037  -8.230  -1.175  1.00 0.00 ? 89  GLU A C    4  
ATOM 7007  O O    . GLU A 1 89  ? -5.252  -8.577  -0.013  1.00 0.00 ? 89  GLU A O    4  
ATOM 7008  C CB   . GLU A 1 89  ? -6.158  -9.910  -2.652  1.00 0.00 ? 89  GLU A CB   4  
ATOM 7009  C CG   . GLU A 1 89  ? -7.115  -8.958  -3.350  1.00 0.00 ? 89  GLU A CG   4  
ATOM 7010  C CD   . GLU A 1 89  ? -8.043  -9.668  -4.316  1.00 0.00 ? 89  GLU A CD   4  
ATOM 7011  O OE1  . GLU A 1 89  ? -7.546  -10.453 -5.150  1.00 0.00 ? 89  GLU A OE1  4  
ATOM 7012  O OE2  . GLU A 1 89  ? -9.269  -9.440  -4.236  1.00 0.00 ? 89  GLU A OE2  4  
ATOM 7013  H H    . GLU A 1 89  ? -4.185  -11.029 -1.286  1.00 0.00 ? 89  GLU A H    4  
ATOM 7014  H HA   . GLU A 1 89  ? -4.411  -8.775  -3.141  1.00 0.00 ? 89  GLU A HA   4  
ATOM 7015  H HB2  . GLU A 1 89  ? -5.968  -10.745 -3.311  1.00 0.00 ? 89  GLU A HB2  4  
ATOM 7016  H HB3  . GLU A 1 89  ? -6.636  -10.274 -1.755  1.00 0.00 ? 89  GLU A HB3  4  
ATOM 7017  H HG2  . GLU A 1 89  ? -7.712  -8.457  -2.603  1.00 0.00 ? 89  GLU A HG2  4  
ATOM 7018  H HG3  . GLU A 1 89  ? -6.539  -8.227  -3.899  1.00 0.00 ? 89  GLU A HG3  4  
ATOM 7019  N N    . ILE A 1 90  ? -4.979  -6.958  -1.552  1.00 0.00 ? 90  ILE A N    4  
ATOM 7020  C CA   . ILE A 1 90  ? -5.168  -5.870  -0.600  1.00 0.00 ? 90  ILE A CA   4  
ATOM 7021  C C    . ILE A 1 90  ? -5.907  -4.701  -1.241  1.00 0.00 ? 90  ILE A C    4  
ATOM 7022  O O    . ILE A 1 90  ? -5.710  -4.397  -2.417  1.00 0.00 ? 90  ILE A O    4  
ATOM 7023  C CB   . ILE A 1 90  ? -3.822  -5.369  -0.043  1.00 0.00 ? 90  ILE A CB   4  
ATOM 7024  C CG1  . ILE A 1 90  ? -2.946  -6.552  0.374   1.00 0.00 ? 90  ILE A CG1  4  
ATOM 7025  C CG2  . ILE A 1 90  ? -4.052  -4.432  1.134   1.00 0.00 ? 90  ILE A CG2  4  
ATOM 7026  C CD1  . ILE A 1 90  ? -2.106  -7.109  -0.755  1.00 0.00 ? 90  ILE A CD1  4  
ATOM 7027  H H    . ILE A 1 90  ? -4.805  -6.745  -2.492  1.00 0.00 ? 90  ILE A H    4  
ATOM 7028  H HA   . ILE A 1 90  ? -5.757  -6.247  0.224   1.00 0.00 ? 90  ILE A HA   4  
ATOM 7029  H HB   . ILE A 1 90  ? -3.320  -4.814  -0.821  1.00 0.00 ? 90  ILE A HB   4  
ATOM 7030  H HG12 . ILE A 1 90  ? -2.277  -6.237  1.160   1.00 0.00 ? 90  ILE A HG12 4  
ATOM 7031  H HG13 . ILE A 1 90  ? -3.578  -7.347  0.741   1.00 0.00 ? 90  ILE A HG13 4  
ATOM 7032  H HG21 . ILE A 1 90  ? -3.805  -4.943  2.053   1.00 0.00 ? 90  ILE A HG21 4  
ATOM 7033  H HG22 . ILE A 1 90  ? -3.424  -3.561  1.028   1.00 0.00 ? 90  ILE A HG22 4  
ATOM 7034  H HG23 . ILE A 1 90  ? -5.088  -4.129  1.157   1.00 0.00 ? 90  ILE A HG23 4  
ATOM 7035  H HD11 . ILE A 1 90  ? -2.698  -7.798  -1.338  1.00 0.00 ? 90  ILE A HD11 4  
ATOM 7036  H HD12 . ILE A 1 90  ? -1.767  -6.300  -1.385  1.00 0.00 ? 90  ILE A HD12 4  
ATOM 7037  H HD13 . ILE A 1 90  ? -1.251  -7.627  -0.345  1.00 0.00 ? 90  ILE A HD13 4  
ATOM 7038  N N    . LYS A 1 91  ? -6.759  -4.046  -0.459  1.00 0.00 ? 91  LYS A N    4  
ATOM 7039  C CA   . LYS A 1 91  ? -7.527  -2.907  -0.947  1.00 0.00 ? 91  LYS A CA   4  
ATOM 7040  C C    . LYS A 1 91  ? -7.690  -1.853  0.143   1.00 0.00 ? 91  LYS A C    4  
ATOM 7041  O O    . LYS A 1 91  ? -7.872  -2.181  1.315   1.00 0.00 ? 91  LYS A O    4  
ATOM 7042  C CB   . LYS A 1 91  ? -8.901  -3.365  -1.439  1.00 0.00 ? 91  LYS A CB   4  
ATOM 7043  C CG   . LYS A 1 91  ? -9.751  -4.007  -0.356  1.00 0.00 ? 91  LYS A CG   4  
ATOM 7044  C CD   . LYS A 1 91  ? -9.532  -5.509  -0.292  1.00 0.00 ? 91  LYS A CD   4  
ATOM 7045  C CE   . LYS A 1 91  ? -10.257 -6.129  0.893   1.00 0.00 ? 91  LYS A CE   4  
ATOM 7046  N NZ   . LYS A 1 91  ? -11.730 -6.182  0.675   1.00 0.00 ? 91  LYS A NZ   4  
ATOM 7047  H H    . LYS A 1 91  ? -6.873  -4.336  0.471   1.00 0.00 ? 91  LYS A H    4  
ATOM 7048  H HA   . LYS A 1 91  ? -6.985  -2.472  -1.774  1.00 0.00 ? 91  LYS A HA   4  
ATOM 7049  H HB2  . LYS A 1 91  ? -9.435  -2.510  -1.826  1.00 0.00 ? 91  LYS A HB2  4  
ATOM 7050  H HB3  . LYS A 1 91  ? -8.765  -4.084  -2.233  1.00 0.00 ? 91  LYS A HB3  4  
ATOM 7051  H HG2  . LYS A 1 91  ? -9.489  -3.575  0.599   1.00 0.00 ? 91  LYS A HG2  4  
ATOM 7052  H HG3  . LYS A 1 91  ? -10.793 -3.813  -0.566  1.00 0.00 ? 91  LYS A HG3  4  
ATOM 7053  H HD2  . LYS A 1 91  ? -9.903  -5.958  -1.201  1.00 0.00 ? 91  LYS A HD2  4  
ATOM 7054  H HD3  . LYS A 1 91  ? -8.473  -5.706  -0.198  1.00 0.00 ? 91  LYS A HD3  4  
ATOM 7055  H HE2  . LYS A 1 91  ? -9.888  -7.132  1.040   1.00 0.00 ? 91  LYS A HE2  4  
ATOM 7056  H HE3  . LYS A 1 91  ? -10.053 -5.537  1.773   1.00 0.00 ? 91  LYS A HE3  4  
ATOM 7057  H HZ1  . LYS A 1 91  ? -12.203 -5.463  1.259   1.00 0.00 ? 91  LYS A HZ1  4  
ATOM 7058  H HZ2  . LYS A 1 91  ? -12.096 -7.119  0.937   1.00 0.00 ? 91  LYS A HZ2  4  
ATOM 7059  H HZ3  . LYS A 1 91  ? -11.950 -6.001  -0.325  1.00 0.00 ? 91  LYS A HZ3  4  
ATOM 7060  N N    . VAL A 1 92  ? -7.624  -0.585  -0.251  1.00 0.00 ? 92  VAL A N    4  
ATOM 7061  C CA   . VAL A 1 92  ? -7.768  0.518   0.692   1.00 0.00 ? 92  VAL A CA   4  
ATOM 7062  C C    . VAL A 1 92  ? -9.200  1.040   0.713   1.00 0.00 ? 92  VAL A C    4  
ATOM 7063  O O    . VAL A 1 92  ? -9.782  1.326   -0.333  1.00 0.00 ? 92  VAL A O    4  
ATOM 7064  C CB   . VAL A 1 92  ? -6.815  1.678   0.349   1.00 0.00 ? 92  VAL A CB   4  
ATOM 7065  C CG1  . VAL A 1 92  ? -6.982  2.818   1.341   1.00 0.00 ? 92  VAL A CG1  4  
ATOM 7066  C CG2  . VAL A 1 92  ? -5.373  1.192   0.321   1.00 0.00 ? 92  VAL A CG2  4  
ATOM 7067  H H    . VAL A 1 92  ? -7.477  -0.386  -1.200  1.00 0.00 ? 92  VAL A H    4  
ATOM 7068  H HA   . VAL A 1 92  ? -7.514  0.150   1.676   1.00 0.00 ? 92  VAL A HA   4  
ATOM 7069  H HB   . VAL A 1 92  ? -7.067  2.046   -0.635  1.00 0.00 ? 92  VAL A HB   4  
ATOM 7070  H HG11 . VAL A 1 92  ? -6.423  2.599   2.239   1.00 0.00 ? 92  VAL A HG11 4  
ATOM 7071  H HG12 . VAL A 1 92  ? -6.616  3.735   0.902   1.00 0.00 ? 92  VAL A HG12 4  
ATOM 7072  H HG13 . VAL A 1 92  ? -8.028  2.930   1.588   1.00 0.00 ? 92  VAL A HG13 4  
ATOM 7073  H HG21 . VAL A 1 92  ? -4.828  1.729   -0.441  1.00 0.00 ? 92  VAL A HG21 4  
ATOM 7074  H HG22 . VAL A 1 92  ? -4.915  1.368   1.283   1.00 0.00 ? 92  VAL A HG22 4  
ATOM 7075  H HG23 . VAL A 1 92  ? -5.353  0.135   0.101   1.00 0.00 ? 92  VAL A HG23 4  
ATOM 7076  N N    . ARG A 1 93  ? -9.761  1.163   1.911   1.00 0.00 ? 93  ARG A N    4  
ATOM 7077  C CA   . ARG A 1 93  ? -11.126 1.651   2.069   1.00 0.00 ? 93  ARG A CA   4  
ATOM 7078  C C    . ARG A 1 93  ? -11.212 2.669   3.202   1.00 0.00 ? 93  ARG A C    4  
ATOM 7079  O O    . ARG A 1 93  ? -10.903 2.377   4.357   1.00 0.00 ? 93  ARG A O    4  
ATOM 7080  C CB   . ARG A 1 93  ? -12.079 0.485   2.343   1.00 0.00 ? 93  ARG A CB   4  
ATOM 7081  C CG   . ARG A 1 93  ? -11.587 -0.461  3.426   1.00 0.00 ? 93  ARG A CG   4  
ATOM 7082  C CD   . ARG A 1 93  ? -12.528 -1.643  3.602   1.00 0.00 ? 93  ARG A CD   4  
ATOM 7083  N NE   . ARG A 1 93  ? -12.243 -2.392  4.824   1.00 0.00 ? 93  ARG A NE   4  
ATOM 7084  C CZ   . ARG A 1 93  ? -13.119 -3.198  5.412   1.00 0.00 ? 93  ARG A CZ   4  
ATOM 7085  N NH1  . ARG A 1 93  ? -14.329 -3.359  4.894   1.00 0.00 ? 93  ARG A NH1  4  
ATOM 7086  N NH2  . ARG A 1 93  ? -12.786 -3.845  6.522   1.00 0.00 ? 93  ARG A NH2  4  
ATOM 7087  H H    . ARG A 1 93  ? -9.246  0.919   2.708   1.00 0.00 ? 93  ARG A H    4  
ATOM 7088  H HA   . ARG A 1 93  ? -11.416 2.131   1.146   1.00 0.00 ? 93  ARG A HA   4  
ATOM 7089  H HB2  . ARG A 1 93  ? -13.035 0.882   2.650   1.00 0.00 ? 93  ARG A HB2  4  
ATOM 7090  H HB3  . ARG A 1 93  ? -12.208 -0.080  1.433   1.00 0.00 ? 93  ARG A HB3  4  
ATOM 7091  H HG2  . ARG A 1 93  ? -10.610 -0.832  3.151   1.00 0.00 ? 93  ARG A HG2  4  
ATOM 7092  H HG3  . ARG A 1 93  ? -11.520 0.078   4.359   1.00 0.00 ? 93  ARG A HG3  4  
ATOM 7093  H HD2  . ARG A 1 93  ? -13.542 -1.275  3.646   1.00 0.00 ? 93  ARG A HD2  4  
ATOM 7094  H HD3  . ARG A 1 93  ? -12.420 -2.301  2.754   1.00 0.00 ? 93  ARG A HD3  4  
ATOM 7095  H HE   . ARG A 1 93  ? -11.355 -2.287  5.223   1.00 0.00 ? 93  ARG A HE   4  
ATOM 7096  H HH11 . ARG A 1 93  ? -14.583 -2.873  4.058   1.00 0.00 ? 93  ARG A HH11 4  
ATOM 7097  H HH12 . ARG A 1 93  ? -14.987 -3.967  5.339   1.00 0.00 ? 93  ARG A HH12 4  
ATOM 7098  H HH21 . ARG A 1 93  ? -11.875 -3.726  6.915   1.00 0.00 ? 93  ARG A HH21 4  
ATOM 7099  H HH22 . ARG A 1 93  ? -13.446 -4.451  6.964   1.00 0.00 ? 93  ARG A HH22 4  
ATOM 7100  N N    . PRO A 1 94  ? -11.642 3.894   2.865   1.00 0.00 ? 94  PRO A N    4  
ATOM 7101  C CA   . PRO A 1 94  ? -11.778 4.981   3.840   1.00 0.00 ? 94  PRO A CA   4  
ATOM 7102  C C    . PRO A 1 94  ? -12.923 4.742   4.818   1.00 0.00 ? 94  PRO A C    4  
ATOM 7103  O O    . PRO A 1 94  ? -14.095 4.840   4.454   1.00 0.00 ? 94  PRO A O    4  
ATOM 7104  C CB   . PRO A 1 94  ? -12.067 6.205   2.968   1.00 0.00 ? 94  PRO A CB   4  
ATOM 7105  C CG   . PRO A 1 94  ? -12.678 5.651   1.727   1.00 0.00 ? 94  PRO A CG   4  
ATOM 7106  C CD   . PRO A 1 94  ? -12.027 4.313   1.508   1.00 0.00 ? 94  PRO A CD   4  
ATOM 7107  H HA   . PRO A 1 94  ? -10.862 5.137   4.391   1.00 0.00 ? 94  PRO A HA   4  
ATOM 7108  H HB2  . PRO A 1 94  ? -12.749 6.865   3.485   1.00 0.00 ? 94  PRO A HB2  4  
ATOM 7109  H HB3  . PRO A 1 94  ? -11.145 6.726   2.756   1.00 0.00 ? 94  PRO A HB3  4  
ATOM 7110  H HG2  . PRO A 1 94  ? -13.742 5.533   1.863   1.00 0.00 ? 94  PRO A HG2  4  
ATOM 7111  H HG3  . PRO A 1 94  ? -12.475 6.308   0.894   1.00 0.00 ? 94  PRO A HG3  4  
ATOM 7112  H HD2  . PRO A 1 94  ? -12.732 3.618   1.075   1.00 0.00 ? 94  PRO A HD2  4  
ATOM 7113  H HD3  . PRO A 1 94  ? -11.158 4.416   0.875   1.00 0.00 ? 94  PRO A HD3  4  
ATOM 7114  N N    . TYR A 1 95  ? -12.576 4.427   6.062   1.00 0.00 ? 95  TYR A N    4  
ATOM 7115  C CA   . TYR A 1 95  ? -13.576 4.172   7.092   1.00 0.00 ? 95  TYR A CA   4  
ATOM 7116  C C    . TYR A 1 95  ? -13.554 5.266   8.155   1.00 0.00 ? 95  TYR A C    4  
ATOM 7117  O O    . TYR A 1 95  ? -12.511 5.858   8.432   1.00 0.00 ? 95  TYR A O    4  
ATOM 7118  C CB   . TYR A 1 95  ? -13.331 2.809   7.743   1.00 0.00 ? 95  TYR A CB   4  
ATOM 7119  C CG   . TYR A 1 95  ? -12.408 2.866   8.939   1.00 0.00 ? 95  TYR A CG   4  
ATOM 7120  C CD1  . TYR A 1 95  ? -12.861 3.326   10.169  1.00 0.00 ? 95  TYR A CD1  4  
ATOM 7121  C CD2  . TYR A 1 95  ? -11.083 2.460   8.839   1.00 0.00 ? 95  TYR A CD2  4  
ATOM 7122  C CE1  . TYR A 1 95  ? -12.021 3.380   11.265  1.00 0.00 ? 95  TYR A CE1  4  
ATOM 7123  C CE2  . TYR A 1 95  ? -10.237 2.510   9.929   1.00 0.00 ? 95  TYR A CE2  4  
ATOM 7124  C CZ   . TYR A 1 95  ? -10.710 2.971   11.140  1.00 0.00 ? 95  TYR A CZ   4  
ATOM 7125  O OH   . TYR A 1 95  ? -9.870  3.023   12.228  1.00 0.00 ? 95  TYR A OH   4  
ATOM 7126  H H    . TYR A 1 95  ? -11.626 4.363   6.292   1.00 0.00 ? 95  TYR A H    4  
ATOM 7127  H HA   . TYR A 1 95  ? -14.546 4.165   6.618   1.00 0.00 ? 95  TYR A HA   4  
ATOM 7128  H HB2  . TYR A 1 95  ? -14.274 2.400   8.071   1.00 0.00 ? 95  TYR A HB2  4  
ATOM 7129  H HB3  . TYR A 1 95  ? -12.891 2.144   7.014   1.00 0.00 ? 95  TYR A HB3  4  
ATOM 7130  H HD1  . TYR A 1 95  ? -13.889 3.647   10.264  1.00 0.00 ? 95  TYR A HD1  4  
ATOM 7131  H HD2  . TYR A 1 95  ? -10.716 2.100   7.889   1.00 0.00 ? 95  TYR A HD2  4  
ATOM 7132  H HE1  . TYR A 1 95  ? -12.392 3.741   12.213  1.00 0.00 ? 95  TYR A HE1  4  
ATOM 7133  H HE2  . TYR A 1 95  ? -9.210  2.189   9.831   1.00 0.00 ? 95  TYR A HE2  4  
ATOM 7134  H HH   . TYR A 1 95  ? -9.379  2.200   12.293  1.00 0.00 ? 95  TYR A HH   4  
ATOM 7135  N N    . PHE A 1 96  ? -14.714 5.529   8.747   1.00 0.00 ? 96  PHE A N    4  
ATOM 7136  C CA   . PHE A 1 96  ? -14.831 6.553   9.780   1.00 0.00 ? 96  PHE A CA   4  
ATOM 7137  C C    . PHE A 1 96  ? -15.058 5.920   11.149  1.00 0.00 ? 96  PHE A C    4  
ATOM 7138  O O    . PHE A 1 96  ? -14.243 6.073   12.058  1.00 0.00 ? 96  PHE A O    4  
ATOM 7139  C CB   . PHE A 1 96  ? -15.978 7.510   9.452   1.00 0.00 ? 96  PHE A CB   4  
ATOM 7140  C CG   . PHE A 1 96  ? -16.278 8.487   10.553  1.00 0.00 ? 96  PHE A CG   4  
ATOM 7141  C CD1  . PHE A 1 96  ? -15.273 8.926   11.400  1.00 0.00 ? 96  PHE A CD1  4  
ATOM 7142  C CD2  . PHE A 1 96  ? -17.564 8.965   10.741  1.00 0.00 ? 96  PHE A CD2  4  
ATOM 7143  C CE1  . PHE A 1 96  ? -15.545 9.825   12.414  1.00 0.00 ? 96  PHE A CE1  4  
ATOM 7144  C CE2  . PHE A 1 96  ? -17.842 9.864   11.754  1.00 0.00 ? 96  PHE A CE2  4  
ATOM 7145  C CZ   . PHE A 1 96  ? -16.832 10.294  12.592  1.00 0.00 ? 96  PHE A CZ   4  
ATOM 7146  H H    . PHE A 1 96  ? -15.512 5.024   8.483   1.00 0.00 ? 96  PHE A H    4  
ATOM 7147  H HA   . PHE A 1 96  ? -13.906 7.107   9.801   1.00 0.00 ? 96  PHE A HA   4  
ATOM 7148  H HB2  . PHE A 1 96  ? -15.724 8.075   8.568   1.00 0.00 ? 96  PHE A HB2  4  
ATOM 7149  H HB3  . PHE A 1 96  ? -16.873 6.936   9.262   1.00 0.00 ? 96  PHE A HB3  4  
ATOM 7150  H HD1  . PHE A 1 96  ? -14.265 8.559   11.261  1.00 0.00 ? 96  PHE A HD1  4  
ATOM 7151  H HD2  . PHE A 1 96  ? -18.356 8.629   10.088  1.00 0.00 ? 96  PHE A HD2  4  
ATOM 7152  H HE1  . PHE A 1 96  ? -14.752 10.158  13.067  1.00 0.00 ? 96  PHE A HE1  4  
ATOM 7153  H HE2  . PHE A 1 96  ? -18.849 10.229  11.891  1.00 0.00 ? 96  PHE A HE2  4  
ATOM 7154  H HZ   . PHE A 1 96  ? -17.046 10.996  13.383  1.00 0.00 ? 96  PHE A HZ   4  
ATOM 7155  N N    . ASN A 1 97  ? -16.172 5.208   11.289  1.00 0.00 ? 97  ASN A N    4  
ATOM 7156  C CA   . ASN A 1 97  ? -16.507 4.552   12.548  1.00 0.00 ? 97  ASN A CA   4  
ATOM 7157  C C    . ASN A 1 97  ? -16.659 3.047   12.353  1.00 0.00 ? 97  ASN A C    4  
ATOM 7158  O O    . ASN A 1 97  ? -15.862 2.262   12.866  1.00 0.00 ? 97  ASN A O    4  
ATOM 7159  C CB   . ASN A 1 97  ? -17.799 5.137   13.122  1.00 0.00 ? 97  ASN A CB   4  
ATOM 7160  C CG   . ASN A 1 97  ? -17.548 6.363   13.979  1.00 0.00 ? 97  ASN A CG   4  
ATOM 7161  O OD1  . ASN A 1 97  ? -16.465 6.947   13.944  1.00 0.00 ? 97  ASN A OD1  4  
ATOM 7162  N ND2  . ASN A 1 97  ? -18.551 6.758   14.754  1.00 0.00 ? 97  ASN A ND2  4  
ATOM 7163  H H    . ASN A 1 97  ? -16.783 5.122   10.528  1.00 0.00 ? 97  ASN A H    4  
ATOM 7164  H HA   . ASN A 1 97  ? -15.700 4.734   13.241  1.00 0.00 ? 97  ASN A HA   4  
ATOM 7165  H HB2  . ASN A 1 97  ? -18.453 5.417   12.309  1.00 0.00 ? 97  ASN A HB2  4  
ATOM 7166  H HB3  . ASN A 1 97  ? -18.287 4.389   13.730  1.00 0.00 ? 97  ASN A HB3  4  
ATOM 7167  H HD21 . ASN A 1 97  ? -19.385 6.244   14.731  1.00 0.00 ? 97  ASN A HD21 4  
ATOM 7168  H HD22 . ASN A 1 97  ? -18.416 7.548   15.318  1.00 0.00 ? 97  ASN A HD22 4  
ATOM 7169  N N    . GLU A 1 98  ? -17.688 2.653   11.609  1.00 0.00 ? 98  GLU A N    4  
ATOM 7170  C CA   . GLU A 1 98  ? -17.944 1.241   11.347  1.00 0.00 ? 98  GLU A CA   4  
ATOM 7171  C C    . GLU A 1 98  ? -18.087 0.983   9.850   1.00 0.00 ? 98  GLU A C    4  
ATOM 7172  O O    . GLU A 1 98  ? -17.655 -0.053  9.343   1.00 0.00 ? 98  GLU A O    4  
ATOM 7173  C CB   . GLU A 1 98  ? -19.209 0.785   12.078  1.00 0.00 ? 98  GLU A CB   4  
ATOM 7174  C CG   . GLU A 1 98  ? -20.461 1.530   11.648  1.00 0.00 ? 98  GLU A CG   4  
ATOM 7175  C CD   . GLU A 1 98  ? -21.726 0.929   12.230  1.00 0.00 ? 98  GLU A CD   4  
ATOM 7176  O OE1  . GLU A 1 98  ? -21.694 0.497   13.402  1.00 0.00 ? 98  GLU A OE1  4  
ATOM 7177  O OE2  . GLU A 1 98  ? -22.748 0.891   11.514  1.00 0.00 ? 98  GLU A OE2  4  
ATOM 7178  H H    . GLU A 1 98  ? -18.288 3.327   11.227  1.00 0.00 ? 98  GLU A H    4  
ATOM 7179  H HA   . GLU A 1 98  ? -17.102 0.677   11.718  1.00 0.00 ? 98  GLU A HA   4  
ATOM 7180  H HB2  . GLU A 1 98  ? -19.358 -0.268  11.891  1.00 0.00 ? 98  GLU A HB2  4  
ATOM 7181  H HB3  . GLU A 1 98  ? -19.071 0.937   13.138  1.00 0.00 ? 98  GLU A HB3  4  
ATOM 7182  H HG2  . GLU A 1 98  ? -20.385 2.556   11.976  1.00 0.00 ? 98  GLU A HG2  4  
ATOM 7183  H HG3  . GLU A 1 98  ? -20.530 1.502   10.571  1.00 0.00 ? 98  GLU A HG3  4  
ATOM 7184  N N    . PHE A 1 99  ? -18.698 1.931   9.148   1.00 0.00 ? 99  PHE A N    4  
ATOM 7185  C CA   . PHE A 1 99  ? -18.900 1.807   7.709   1.00 0.00 ? 99  PHE A CA   4  
ATOM 7186  C C    . PHE A 1 99  ? -17.582 1.972   6.958   1.00 0.00 ? 99  PHE A C    4  
ATOM 7187  O O    . PHE A 1 99  ? -16.617 2.516   7.492   1.00 0.00 ? 99  PHE A O    4  
ATOM 7188  C CB   . PHE A 1 99  ? -19.912 2.847   7.223   1.00 0.00 ? 99  PHE A CB   4  
ATOM 7189  C CG   . PHE A 1 99  ? -19.908 4.111   8.034   1.00 0.00 ? 99  PHE A CG   4  
ATOM 7190  C CD1  . PHE A 1 99  ? -20.673 4.214   9.184   1.00 0.00 ? 99  PHE A CD1  4  
ATOM 7191  C CD2  . PHE A 1 99  ? -19.140 5.197   7.645   1.00 0.00 ? 99  PHE A CD2  4  
ATOM 7192  C CE1  . PHE A 1 99  ? -20.672 5.375   9.933   1.00 0.00 ? 99  PHE A CE1  4  
ATOM 7193  C CE2  . PHE A 1 99  ? -19.135 6.361   8.390   1.00 0.00 ? 99  PHE A CE2  4  
ATOM 7194  C CZ   . PHE A 1 99  ? -19.902 6.451   9.535   1.00 0.00 ? 99  PHE A CZ   4  
ATOM 7195  H H    . PHE A 1 99  ? -19.021 2.734   9.608   1.00 0.00 ? 99  PHE A H    4  
ATOM 7196  H HA   . PHE A 1 99  ? -19.290 0.819   7.514   1.00 0.00 ? 99  PHE A HA   4  
ATOM 7197  H HB2  . PHE A 1 99  ? -19.685 3.109   6.200   1.00 0.00 ? 99  PHE A HB2  4  
ATOM 7198  H HB3  . PHE A 1 99  ? -20.904 2.423   7.270   1.00 0.00 ? 99  PHE A HB3  4  
ATOM 7199  H HD1  . PHE A 1 99  ? -21.276 3.372   9.497   1.00 0.00 ? 99  PHE A HD1  4  
ATOM 7200  H HD2  . PHE A 1 99  ? -18.541 5.129   6.749   1.00 0.00 ? 99  PHE A HD2  4  
ATOM 7201  H HE1  . PHE A 1 99  ? -21.273 5.442   10.828  1.00 0.00 ? 99  PHE A HE1  4  
ATOM 7202  H HE2  . PHE A 1 99  ? -18.533 7.201   8.076   1.00 0.00 ? 99  PHE A HE2  4  
ATOM 7203  H HZ   . PHE A 1 99  ? -19.899 7.359   10.119  1.00 0.00 ? 99  PHE A HZ   4  
ATOM 7204  N N    . GLN A 1 100 ? -17.552 1.498   5.716   1.00 0.00 ? 100 GLN A N    4  
ATOM 7205  C CA   . GLN A 1 100 ? -16.353 1.593   4.892   1.00 0.00 ? 100 GLN A CA   4  
ATOM 7206  C C    . GLN A 1 100 ? -16.679 2.175   3.521   1.00 0.00 ? 100 GLN A C    4  
ATOM 7207  O O    . GLN A 1 100 ? -17.548 1.671   2.812   1.00 0.00 ? 100 GLN A O    4  
ATOM 7208  C CB   . GLN A 1 100 ? -15.708 0.215   4.733   1.00 0.00 ? 100 GLN A CB   4  
ATOM 7209  C CG   . GLN A 1 100 ? -16.681 -0.864  4.286   1.00 0.00 ? 100 GLN A CG   4  
ATOM 7210  C CD   . GLN A 1 100 ? -17.766 -1.133  5.310   1.00 0.00 ? 100 GLN A CD   4  
ATOM 7211  O OE1  . GLN A 1 100 ? -17.481 -1.461  6.462   1.00 0.00 ? 100 GLN A OE1  4  
ATOM 7212  N NE2  . GLN A 1 100 ? -19.019 -0.996  4.894   1.00 0.00 ? 100 GLN A NE2  4  
ATOM 7213  H H    . GLN A 1 100 ? -18.354 1.075   5.347   1.00 0.00 ? 100 GLN A H    4  
ATOM 7214  H HA   . GLN A 1 100 ? -15.658 2.250   5.393   1.00 0.00 ? 100 GLN A HA   4  
ATOM 7215  H HB2  . GLN A 1 100 ? -14.917 0.283   4.002   1.00 0.00 ? 100 GLN A HB2  4  
ATOM 7216  H HB3  . GLN A 1 100 ? -15.286 -0.083  5.682   1.00 0.00 ? 100 GLN A HB3  4  
ATOM 7217  H HG2  . GLN A 1 100 ? -17.147 -0.550  3.364   1.00 0.00 ? 100 GLN A HG2  4  
ATOM 7218  H HG3  . GLN A 1 100 ? -16.131 -1.778  4.116   1.00 0.00 ? 100 GLN A HG3  4  
ATOM 7219  H HE21 . GLN A 1 100 ? -19.171 -0.733  3.962   1.00 0.00 ? 100 GLN A HE21 4  
ATOM 7220  H HE22 . GLN A 1 100 ? -19.741 -1.164  5.535   1.00 0.00 ? 100 GLN A HE22 4  
ATOM 7221  N N    . GLY A 1 101 ? -15.975 3.243   3.155   1.00 0.00 ? 101 GLY A N    4  
ATOM 7222  C CA   . GLY A 1 101 ? -16.205 3.877   1.870   1.00 0.00 ? 101 GLY A CA   4  
ATOM 7223  C C    . GLY A 1 101 ? -15.894 2.958   0.705   1.00 0.00 ? 101 GLY A C    4  
ATOM 7224  O O    . GLY A 1 101 ? -15.389 1.852   0.897   1.00 0.00 ? 101 GLY A O    4  
ATOM 7225  H H    . GLY A 1 101 ? -15.295 3.602   3.762   1.00 0.00 ? 101 GLY A H    4  
ATOM 7226  H HA2  . GLY A 1 101 ? -17.240 4.179   1.810   1.00 0.00 ? 101 GLY A HA2  4  
ATOM 7227  H HA3  . GLY A 1 101 ? -15.580 4.755   1.798   1.00 0.00 ? 101 GLY A HA3  4  
ATOM 7228  N N    . MET A 1 102 ? -16.196 3.416   -0.505  1.00 0.00 ? 102 MET A N    4  
ATOM 7229  C CA   . MET A 1 102 ? -15.945 2.626   -1.705  1.00 0.00 ? 102 MET A CA   4  
ATOM 7230  C C    . MET A 1 102 ? -14.531 2.053   -1.693  1.00 0.00 ? 102 MET A C    4  
ATOM 7231  O O    . MET A 1 102 ? -13.551 2.792   -1.793  1.00 0.00 ? 102 MET A O    4  
ATOM 7232  C CB   . MET A 1 102 ? -16.151 3.481   -2.957  1.00 0.00 ? 102 MET A CB   4  
ATOM 7233  C CG   . MET A 1 102 ? -15.368 4.784   -2.938  1.00 0.00 ? 102 MET A CG   4  
ATOM 7234  S SD   . MET A 1 102 ? -15.682 5.804   -4.391  1.00 0.00 ? 102 MET A SD   4  
ATOM 7235  C CE   . MET A 1 102 ? -15.216 4.678   -5.703  1.00 0.00 ? 102 MET A CE   4  
ATOM 7236  H H    . MET A 1 102 ? -16.597 4.306   -0.594  1.00 0.00 ? 102 MET A H    4  
ATOM 7237  H HA   . MET A 1 102 ? -16.651 1.810   -1.718  1.00 0.00 ? 102 MET A HA   4  
ATOM 7238  H HB2  . MET A 1 102 ? -15.842 2.913   -3.821  1.00 0.00 ? 102 MET A HB2  4  
ATOM 7239  H HB3  . MET A 1 102 ? -17.200 3.719   -3.048  1.00 0.00 ? 102 MET A HB3  4  
ATOM 7240  H HG2  . MET A 1 102 ? -15.645 5.343   -2.057  1.00 0.00 ? 102 MET A HG2  4  
ATOM 7241  H HG3  . MET A 1 102 ? -14.313 4.553   -2.899  1.00 0.00 ? 102 MET A HG3  4  
ATOM 7242  H HE1  . MET A 1 102 ? -14.579 5.191   -6.409  1.00 0.00 ? 102 MET A HE1  4  
ATOM 7243  H HE2  . MET A 1 102 ? -14.684 3.837   -5.284  1.00 0.00 ? 102 MET A HE2  4  
ATOM 7244  H HE3  . MET A 1 102 ? -16.104 4.327   -6.209  1.00 0.00 ? 102 MET A HE3  4  
ATOM 7245  N N    . ASP A 1 103 ? -14.433 0.734   -1.571  1.00 0.00 ? 103 ASP A N    4  
ATOM 7246  C CA   . ASP A 1 103 ? -13.139 0.063   -1.546  1.00 0.00 ? 103 ASP A CA   4  
ATOM 7247  C C    . ASP A 1 103 ? -12.401 0.258   -2.867  1.00 0.00 ? 103 ASP A C    4  
ATOM 7248  O O    . ASP A 1 103 ? -12.928 -0.051  -3.936  1.00 0.00 ? 103 ASP A O    4  
ATOM 7249  C CB   . ASP A 1 103 ? -13.320 -1.430  -1.265  1.00 0.00 ? 103 ASP A CB   4  
ATOM 7250  C CG   . ASP A 1 103 ? -14.371 -1.695  -0.205  1.00 0.00 ? 103 ASP A CG   4  
ATOM 7251  O OD1  . ASP A 1 103 ? -15.571 -1.507  -0.499  1.00 0.00 ? 103 ASP A OD1  4  
ATOM 7252  O OD2  . ASP A 1 103 ? -13.995 -2.092  0.917   1.00 0.00 ? 103 ASP A OD2  4  
ATOM 7253  H H    . ASP A 1 103 ? -15.251 0.199   -1.495  1.00 0.00 ? 103 ASP A H    4  
ATOM 7254  H HA   . ASP A 1 103 ? -12.553 0.501   -0.753  1.00 0.00 ? 103 ASP A HA   4  
ATOM 7255  H HB2  . ASP A 1 103 ? -13.619 -1.928  -2.175  1.00 0.00 ? 103 ASP A HB2  4  
ATOM 7256  H HB3  . ASP A 1 103 ? -12.381 -1.842  -0.926  1.00 0.00 ? 103 ASP A HB3  4  
ATOM 7257  N N    . SER A 1 104 ? -11.178 0.773   -2.786  1.00 0.00 ? 104 SER A N    4  
ATOM 7258  C CA   . SER A 1 104 ? -10.369 1.014   -3.975  1.00 0.00 ? 104 SER A CA   4  
ATOM 7259  C C    . SER A 1 104 ? -10.057 -0.295  -4.694  1.00 0.00 ? 104 SER A C    4  
ATOM 7260  O O    . SER A 1 104 ? -10.332 -1.379  -4.180  1.00 0.00 ? 104 SER A O    4  
ATOM 7261  C CB   . SER A 1 104 ? -9.068  1.724   -3.597  1.00 0.00 ? 104 SER A CB   4  
ATOM 7262  O OG   . SER A 1 104 ? -8.358  0.997   -2.609  1.00 0.00 ? 104 SER A OG   4  
ATOM 7263  H H    . SER A 1 104 ? -10.812 0.998   -1.904  1.00 0.00 ? 104 SER A H    4  
ATOM 7264  H HA   . SER A 1 104 ? -10.936 1.649   -4.638  1.00 0.00 ? 104 SER A HA   4  
ATOM 7265  H HB2  . SER A 1 104 ? -8.445  1.819   -4.473  1.00 0.00 ? 104 SER A HB2  4  
ATOM 7266  H HB3  . SER A 1 104 ? -9.297  2.706   -3.209  1.00 0.00 ? 104 SER A HB3  4  
ATOM 7267  H HG   . SER A 1 104 ? -8.625  1.297   -1.737  1.00 0.00 ? 104 SER A HG   4  
ATOM 7268  N N    . GLU A 1 105 ? -9.481  -0.185  -5.887  1.00 0.00 ? 105 GLU A N    4  
ATOM 7269  C CA   . GLU A 1 105 ? -9.132  -1.359  -6.678  1.00 0.00 ? 105 GLU A CA   4  
ATOM 7270  C C    . GLU A 1 105 ? -8.207  -2.287  -5.895  1.00 0.00 ? 105 GLU A C    4  
ATOM 7271  O O    . GLU A 1 105 ? -7.189  -1.854  -5.355  1.00 0.00 ? 105 GLU A O    4  
ATOM 7272  C CB   . GLU A 1 105 ? -8.463  -0.939  -7.988  1.00 0.00 ? 105 GLU A CB   4  
ATOM 7273  C CG   . GLU A 1 105 ? -9.271  0.068   -8.788  1.00 0.00 ? 105 GLU A CG   4  
ATOM 7274  C CD   . GLU A 1 105 ? -10.229 -0.593  -9.761  1.00 0.00 ? 105 GLU A CD   4  
ATOM 7275  O OE1  . GLU A 1 105 ? -11.359 -0.926  -9.348  1.00 0.00 ? 105 GLU A OE1  4  
ATOM 7276  O OE2  . GLU A 1 105 ? -9.847  -0.777  -10.936 1.00 0.00 ? 105 GLU A OE2  4  
ATOM 7277  H H    . GLU A 1 105 ? -9.286  0.707   -6.244  1.00 0.00 ? 105 GLU A H    4  
ATOM 7278  H HA   . GLU A 1 105 ? -10.045 -1.889  -6.904  1.00 0.00 ? 105 GLU A HA   4  
ATOM 7279  H HB2  . GLU A 1 105 ? -7.501  -0.502  -7.763  1.00 0.00 ? 105 GLU A HB2  4  
ATOM 7280  H HB3  . GLU A 1 105 ? -8.314  -1.817  -8.599  1.00 0.00 ? 105 GLU A HB3  4  
ATOM 7281  H HG2  . GLU A 1 105 ? -9.842  0.678   -8.104  1.00 0.00 ? 105 GLU A HG2  4  
ATOM 7282  H HG3  . GLU A 1 105 ? -8.591  0.695   -9.346  1.00 0.00 ? 105 GLU A HG3  4  
ATOM 7283  N N    . SER A 1 106 ? -8.568  -3.564  -5.839  1.00 0.00 ? 106 SER A N    4  
ATOM 7284  C CA   . SER A 1 106 ? -7.773  -4.553  -5.120  1.00 0.00 ? 106 SER A CA   4  
ATOM 7285  C C    . SER A 1 106 ? -6.578  -5.002  -5.956  1.00 0.00 ? 106 SER A C    4  
ATOM 7286  O O    . SER A 1 106 ? -6.739  -5.574  -7.034  1.00 0.00 ? 106 SER A O    4  
ATOM 7287  C CB   . SER A 1 106 ? -8.635  -5.762  -4.752  1.00 0.00 ? 106 SER A CB   4  
ATOM 7288  O OG   . SER A 1 106 ? -9.039  -6.472  -5.910  1.00 0.00 ? 106 SER A OG   4  
ATOM 7289  H H    . SER A 1 106 ? -9.390  -3.848  -6.291  1.00 0.00 ? 106 SER A H    4  
ATOM 7290  H HA   . SER A 1 106 ? -7.410  -4.091  -4.214  1.00 0.00 ? 106 SER A HA   4  
ATOM 7291  H HB2  . SER A 1 106 ? -8.068  -6.425  -4.117  1.00 0.00 ? 106 SER A HB2  4  
ATOM 7292  H HB3  . SER A 1 106 ? -9.516  -5.425  -4.225  1.00 0.00 ? 106 SER A HB3  4  
ATOM 7293  H HG   . SER A 1 106 ? -9.995  -6.558  -5.916  1.00 0.00 ? 106 SER A HG   4  
ATOM 7294  N N    . LYS A 1 107 ? -5.378  -4.737  -5.450  1.00 0.00 ? 107 LYS A N    4  
ATOM 7295  C CA   . LYS A 1 107 ? -4.154  -5.114  -6.147  1.00 0.00 ? 107 LYS A CA   4  
ATOM 7296  C C    . LYS A 1 107 ? -3.542  -6.369  -5.533  1.00 0.00 ? 107 LYS A C    4  
ATOM 7297  O O    . LYS A 1 107 ? -3.649  -6.599  -4.328  1.00 0.00 ? 107 LYS A O    4  
ATOM 7298  C CB   . LYS A 1 107 ? -3.143  -3.966  -6.100  1.00 0.00 ? 107 LYS A CB   4  
ATOM 7299  C CG   . LYS A 1 107 ? -3.584  -2.735  -6.873  1.00 0.00 ? 107 LYS A CG   4  
ATOM 7300  C CD   . LYS A 1 107 ? -3.157  -2.808  -8.330  1.00 0.00 ? 107 LYS A CD   4  
ATOM 7301  C CE   . LYS A 1 107 ? -3.417  -1.496  -9.054  1.00 0.00 ? 107 LYS A CE   4  
ATOM 7302  N NZ   . LYS A 1 107 ? -3.431  -1.672  -10.533 1.00 0.00 ? 107 LYS A NZ   4  
ATOM 7303  H H    . LYS A 1 107 ? -5.314  -4.278  -4.586  1.00 0.00 ? 107 LYS A H    4  
ATOM 7304  H HA   . LYS A 1 107 ? -4.407  -5.317  -7.176  1.00 0.00 ? 107 LYS A HA   4  
ATOM 7305  H HB2  . LYS A 1 107 ? -2.986  -3.682  -5.070  1.00 0.00 ? 107 LYS A HB2  4  
ATOM 7306  H HB3  . LYS A 1 107 ? -2.206  -4.310  -6.516  1.00 0.00 ? 107 LYS A HB3  4  
ATOM 7307  H HG2  . LYS A 1 107 ? -4.660  -2.659  -6.828  1.00 0.00 ? 107 LYS A HG2  4  
ATOM 7308  H HG3  . LYS A 1 107 ? -3.140  -1.859  -6.421  1.00 0.00 ? 107 LYS A HG3  4  
ATOM 7309  H HD2  . LYS A 1 107 ? -2.101  -3.028  -8.376  1.00 0.00 ? 107 LYS A HD2  4  
ATOM 7310  H HD3  . LYS A 1 107 ? -3.712  -3.596  -8.819  1.00 0.00 ? 107 LYS A HD3  4  
ATOM 7311  H HE2  . LYS A 1 107 ? -4.373  -1.109  -8.737  1.00 0.00 ? 107 LYS A HE2  4  
ATOM 7312  H HE3  . LYS A 1 107 ? -2.640  -0.795  -8.790  1.00 0.00 ? 107 LYS A HE3  4  
ATOM 7313  H HZ1  . LYS A 1 107 ? -2.979  -0.857  -10.993 1.00 0.00 ? 107 LYS A HZ1  4  
ATOM 7314  H HZ2  . LYS A 1 107 ? -4.410  -1.749  -10.874 1.00 0.00 ? 107 LYS A HZ2  4  
ATOM 7315  H HZ3  . LYS A 1 107 ? -2.915  -2.536  -10.795 1.00 0.00 ? 107 LYS A HZ3  4  
ATOM 7316  N N    . THR A 1 108 ? -2.900  -7.179  -6.369  1.00 0.00 ? 108 THR A N    4  
ATOM 7317  C CA   . THR A 1 108 ? -2.271  -8.410  -5.909  1.00 0.00 ? 108 THR A CA   4  
ATOM 7318  C C    . THR A 1 108 ? -0.754  -8.269  -5.863  1.00 0.00 ? 108 THR A C    4  
ATOM 7319  O O    . THR A 1 108 ? -0.135  -7.800  -6.819  1.00 0.00 ? 108 THR A O    4  
ATOM 7320  C CB   . THR A 1 108 ? -2.638  -9.601  -6.815  1.00 0.00 ? 108 THR A CB   4  
ATOM 7321  O OG1  . THR A 1 108 ? -2.640  -9.190  -8.187  1.00 0.00 ? 108 THR A OG1  4  
ATOM 7322  C CG2  . THR A 1 108 ? -4.003  -10.162 -6.445  1.00 0.00 ? 108 THR A CG2  4  
ATOM 7323  H H    . THR A 1 108 ? -2.849  -6.941  -7.319  1.00 0.00 ? 108 THR A H    4  
ATOM 7324  H HA   . THR A 1 108 ? -2.634  -8.618  -4.913  1.00 0.00 ? 108 THR A HA   4  
ATOM 7325  H HB   . THR A 1 108 ? -1.898  -10.377 -6.681  1.00 0.00 ? 108 THR A HB   4  
ATOM 7326  H HG1  . THR A 1 108 ? -1.793  -9.402  -8.586  1.00 0.00 ? 108 THR A HG1  4  
ATOM 7327  H HG21 . THR A 1 108 ? -4.661  -10.098 -7.299  1.00 0.00 ? 108 THR A HG21 4  
ATOM 7328  H HG22 . THR A 1 108 ? -4.417  -9.591  -5.628  1.00 0.00 ? 108 THR A HG22 4  
ATOM 7329  H HG23 . THR A 1 108 ? -3.899  -11.194 -6.148  1.00 0.00 ? 108 THR A HG23 4  
ATOM 7330  N N    . VAL A 1 109 ? -0.159  -8.679  -4.748  1.00 0.00 ? 109 VAL A N    4  
ATOM 7331  C CA   . VAL A 1 109 ? 1.287   -8.600  -4.578  1.00 0.00 ? 109 VAL A CA   4  
ATOM 7332  C C    . VAL A 1 109 ? 1.912   -9.990  -4.534  1.00 0.00 ? 109 VAL A C    4  
ATOM 7333  O O    . VAL A 1 109 ? 1.572   -10.807 -3.678  1.00 0.00 ? 109 VAL A O    4  
ATOM 7334  C CB   . VAL A 1 109 ? 1.661   -7.840  -3.292  1.00 0.00 ? 109 VAL A CB   4  
ATOM 7335  C CG1  . VAL A 1 109 ? 1.081   -8.537  -2.071  1.00 0.00 ? 109 VAL A CG1  4  
ATOM 7336  C CG2  . VAL A 1 109 ? 3.171   -7.706  -3.173  1.00 0.00 ? 109 VAL A CG2  4  
ATOM 7337  H H    . VAL A 1 109 ? -0.706  -9.044  -4.021  1.00 0.00 ? 109 VAL A H    4  
ATOM 7338  H HA   . VAL A 1 109 ? 1.693   -8.061  -5.422  1.00 0.00 ? 109 VAL A HA   4  
ATOM 7339  H HB   . VAL A 1 109 ? 1.236   -6.848  -3.349  1.00 0.00 ? 109 VAL A HB   4  
ATOM 7340  H HG11 . VAL A 1 109 ? 1.690   -9.394  -1.823  1.00 0.00 ? 109 VAL A HG11 4  
ATOM 7341  H HG12 . VAL A 1 109 ? 1.065   -7.851  -1.238  1.00 0.00 ? 109 VAL A HG12 4  
ATOM 7342  H HG13 . VAL A 1 109 ? 0.074   -8.863  -2.288  1.00 0.00 ? 109 VAL A HG13 4  
ATOM 7343  H HG21 . VAL A 1 109 ? 3.627   -8.680  -3.278  1.00 0.00 ? 109 VAL A HG21 4  
ATOM 7344  H HG22 . VAL A 1 109 ? 3.538   -7.051  -3.950  1.00 0.00 ? 109 VAL A HG22 4  
ATOM 7345  H HG23 . VAL A 1 109 ? 3.422   -7.293  -2.207  1.00 0.00 ? 109 VAL A HG23 4  
ATOM 7346  N N    . ARG A 1 110 ? 2.827   -10.251 -5.461  1.00 0.00 ? 110 ARG A N    4  
ATOM 7347  C CA   . ARG A 1 110 ? 3.500   -11.543 -5.528  1.00 0.00 ? 110 ARG A CA   4  
ATOM 7348  C C    . ARG A 1 110 ? 4.824   -11.507 -4.771  1.00 0.00 ? 110 ARG A C    4  
ATOM 7349  O O    . ARG A 1 110 ? 5.809   -10.943 -5.247  1.00 0.00 ? 110 ARG A O    4  
ATOM 7350  C CB   . ARG A 1 110 ? 3.744   -11.940 -6.985  1.00 0.00 ? 110 ARG A CB   4  
ATOM 7351  C CG   . ARG A 1 110 ? 3.864   -13.441 -7.195  1.00 0.00 ? 110 ARG A CG   4  
ATOM 7352  C CD   . ARG A 1 110 ? 3.819   -13.802 -8.672  1.00 0.00 ? 110 ARG A CD   4  
ATOM 7353  N NE   . ARG A 1 110 ? 4.244   -15.178 -8.912  1.00 0.00 ? 110 ARG A NE   4  
ATOM 7354  C CZ   . ARG A 1 110 ? 4.103   -15.798 -10.078 1.00 0.00 ? 110 ARG A CZ   4  
ATOM 7355  N NH1  . ARG A 1 110 ? 3.551   -15.167 -11.106 1.00 0.00 ? 110 ARG A NH1  4  
ATOM 7356  N NH2  . ARG A 1 110 ? 4.515   -17.051 -10.219 1.00 0.00 ? 110 ARG A NH2  4  
ATOM 7357  H H    . ARG A 1 110 ? 3.056   -9.559  -6.116  1.00 0.00 ? 110 ARG A H    4  
ATOM 7358  H HA   . ARG A 1 110 ? 2.855   -12.277 -5.067  1.00 0.00 ? 110 ARG A HA   4  
ATOM 7359  H HB2  . ARG A 1 110 ? 2.922   -11.580 -7.586  1.00 0.00 ? 110 ARG A HB2  4  
ATOM 7360  H HB3  . ARG A 1 110 ? 4.658   -11.477 -7.323  1.00 0.00 ? 110 ARG A HB3  4  
ATOM 7361  H HG2  . ARG A 1 110 ? 4.803   -13.779 -6.782  1.00 0.00 ? 110 ARG A HG2  4  
ATOM 7362  H HG3  . ARG A 1 110 ? 3.047   -13.933 -6.688  1.00 0.00 ? 110 ARG A HG3  4  
ATOM 7363  H HD2  . ARG A 1 110 ? 2.807   -13.681 -9.028  1.00 0.00 ? 110 ARG A HD2  4  
ATOM 7364  H HD3  . ARG A 1 110 ? 4.473   -13.133 -9.212  1.00 0.00 ? 110 ARG A HD3  4  
ATOM 7365  H HE   . ARG A 1 110 ? 4.655   -15.663 -8.166  1.00 0.00 ? 110 ARG A HE   4  
ATOM 7366  H HH11 . ARG A 1 110 ? 3.241   -14.222 -11.003 1.00 0.00 ? 110 ARG A HH11 4  
ATOM 7367  H HH12 . ARG A 1 110 ? 3.447   -15.635 -11.983 1.00 0.00 ? 110 ARG A HH12 4  
ATOM 7368  H HH21 . ARG A 1 110 ? 4.932   -17.530 -9.447  1.00 0.00 ? 110 ARG A HH21 4  
ATOM 7369  H HH22 . ARG A 1 110 ? 4.408   -17.517 -11.097 1.00 0.00 ? 110 ARG A HH22 4  
ATOM 7370  N N    . THR A 1 111 ? 4.840   -12.112 -3.587  1.00 0.00 ? 111 THR A N    4  
ATOM 7371  C CA   . THR A 1 111 ? 6.042   -12.147 -2.763  1.00 0.00 ? 111 THR A CA   4  
ATOM 7372  C C    . THR A 1 111 ? 7.060   -13.136 -3.318  1.00 0.00 ? 111 THR A C    4  
ATOM 7373  O O    . THR A 1 111 ? 6.891   -14.350 -3.200  1.00 0.00 ? 111 THR A O    4  
ATOM 7374  C CB   . THR A 1 111 ? 5.714   -12.528 -1.307  1.00 0.00 ? 111 THR A CB   4  
ATOM 7375  O OG1  . THR A 1 111 ? 5.118   -13.830 -1.264  1.00 0.00 ? 111 THR A OG1  4  
ATOM 7376  C CG2  . THR A 1 111 ? 4.770   -11.513 -0.681  1.00 0.00 ? 111 THR A CG2  4  
ATOM 7377  H H    . THR A 1 111 ? 4.023   -12.544 -3.261  1.00 0.00 ? 111 THR A H    4  
ATOM 7378  H HA   . THR A 1 111 ? 6.477   -11.158 -2.765  1.00 0.00 ? 111 THR A HA   4  
ATOM 7379  H HB   . THR A 1 111 ? 6.633   -12.542 -0.738  1.00 0.00 ? 111 THR A HB   4  
ATOM 7380  H HG1  . THR A 1 111 ? 5.331   -14.252 -0.427  1.00 0.00 ? 111 THR A HG1  4  
ATOM 7381  H HG21 . THR A 1 111 ? 4.580   -11.783 0.347   1.00 0.00 ? 111 THR A HG21 4  
ATOM 7382  H HG22 . THR A 1 111 ? 3.839   -11.501 -1.229  1.00 0.00 ? 111 THR A HG22 4  
ATOM 7383  H HG23 . THR A 1 111 ? 5.221   -10.533 -0.717  1.00 0.00 ? 111 THR A HG23 4  
ATOM 7384  N N    . THR A 1 112 ? 8.120   -12.610 -3.924  1.00 0.00 ? 112 THR A N    4  
ATOM 7385  C CA   . THR A 1 112 ? 9.166   -13.447 -4.498  1.00 0.00 ? 112 THR A CA   4  
ATOM 7386  C C    . THR A 1 112 ? 9.545   -14.580 -3.551  1.00 0.00 ? 112 THR A C    4  
ATOM 7387  O O    . THR A 1 112 ? 9.175   -14.570 -2.377  1.00 0.00 ? 112 THR A O    4  
ATOM 7388  C CB   . THR A 1 112 ? 10.426  -12.625 -4.826  1.00 0.00 ? 112 THR A CB   4  
ATOM 7389  O OG1  . THR A 1 112 ? 11.532  -13.500 -5.075  1.00 0.00 ? 112 THR A OG1  4  
ATOM 7390  C CG2  . THR A 1 112 ? 10.769  -11.679 -3.685  1.00 0.00 ? 112 THR A CG2  4  
ATOM 7391  H H    . THR A 1 112 ? 8.199   -11.635 -3.986  1.00 0.00 ? 112 THR A H    4  
ATOM 7392  H HA   . THR A 1 112 ? 8.788   -13.870 -5.417  1.00 0.00 ? 112 THR A HA   4  
ATOM 7393  H HB   . THR A 1 112 ? 10.234  -12.039 -5.714  1.00 0.00 ? 112 THR A HB   4  
ATOM 7394  H HG1  . THR A 1 112 ? 12.350  -12.998 -5.049  1.00 0.00 ? 112 THR A HG1  4  
ATOM 7395  H HG21 . THR A 1 112 ? 11.638  -11.095 -3.949  1.00 0.00 ? 112 THR A HG21 4  
ATOM 7396  H HG22 . THR A 1 112 ? 10.977  -12.252 -2.793  1.00 0.00 ? 112 THR A HG22 4  
ATOM 7397  H HG23 . THR A 1 112 ? 9.934   -11.020 -3.502  1.00 0.00 ? 112 THR A HG23 4  
ATOM 7398  N N    . GLU A 1 113 ? 10.286  -15.555 -4.069  1.00 0.00 ? 113 GLU A N    4  
ATOM 7399  C CA   . GLU A 1 113 ? 10.714  -16.696 -3.268  1.00 0.00 ? 113 GLU A CA   4  
ATOM 7400  C C    . GLU A 1 113 ? 12.103  -16.458 -2.682  1.00 0.00 ? 113 GLU A C    4  
ATOM 7401  O O    . GLU A 1 113 ? 12.368  -16.798 -1.529  1.00 0.00 ? 113 GLU A O    4  
ATOM 7402  C CB   . GLU A 1 113 ? 10.717  -17.970 -4.115  1.00 0.00 ? 113 GLU A CB   4  
ATOM 7403  C CG   . GLU A 1 113 ? 9.336   -18.570 -4.316  1.00 0.00 ? 113 GLU A CG   4  
ATOM 7404  C CD   . GLU A 1 113 ? 9.380   -19.914 -5.016  1.00 0.00 ? 113 GLU A CD   4  
ATOM 7405  O OE1  . GLU A 1 113 ? 9.825   -20.897 -4.386  1.00 0.00 ? 113 GLU A OE1  4  
ATOM 7406  O OE2  . GLU A 1 113 ? 8.971   -19.985 -6.194  1.00 0.00 ? 113 GLU A OE2  4  
ATOM 7407  H H    . GLU A 1 113 ? 10.549  -15.507 -5.011  1.00 0.00 ? 113 GLU A H    4  
ATOM 7408  H HA   . GLU A 1 113 ? 10.011  -16.815 -2.457  1.00 0.00 ? 113 GLU A HA   4  
ATOM 7409  H HB2  . GLU A 1 113 ? 11.133  -17.742 -5.085  1.00 0.00 ? 113 GLU A HB2  4  
ATOM 7410  H HB3  . GLU A 1 113 ? 11.340  -18.708 -3.630  1.00 0.00 ? 113 GLU A HB3  4  
ATOM 7411  H HG2  . GLU A 1 113 ? 8.869   -18.700 -3.351  1.00 0.00 ? 113 GLU A HG2  4  
ATOM 7412  H HG3  . GLU A 1 113 ? 8.745   -17.890 -4.912  1.00 0.00 ? 113 GLU A HG3  4  
ATOM 7413  N N    . GLU A 1 114 ? 12.985  -15.872 -3.485  1.00 0.00 ? 114 GLU A N    4  
ATOM 7414  C CA   . GLU A 1 114 ? 14.347  -15.591 -3.047  1.00 0.00 ? 114 GLU A CA   4  
ATOM 7415  C C    . GLU A 1 114 ? 15.015  -16.850 -2.503  1.00 0.00 ? 114 GLU A C    4  
ATOM 7416  O O    . GLU A 1 114 ? 15.581  -16.843 -1.410  1.00 0.00 ? 114 GLU A O    4  
ATOM 7417  C CB   . GLU A 1 114 ? 14.346  -14.498 -1.976  1.00 0.00 ? 114 GLU A CB   4  
ATOM 7418  C CG   . GLU A 1 114 ? 13.451  -13.317 -2.312  1.00 0.00 ? 114 GLU A CG   4  
ATOM 7419  C CD   . GLU A 1 114 ? 14.168  -12.251 -3.118  1.00 0.00 ? 114 GLU A CD   4  
ATOM 7420  O OE1  . GLU A 1 114 ? 15.182  -12.582 -3.767  1.00 0.00 ? 114 GLU A OE1  4  
ATOM 7421  O OE2  . GLU A 1 114 ? 13.715  -11.088 -3.099  1.00 0.00 ? 114 GLU A OE2  4  
ATOM 7422  H H    . GLU A 1 114 ? 12.714  -15.624 -4.394  1.00 0.00 ? 114 GLU A H    4  
ATOM 7423  H HA   . GLU A 1 114 ? 14.906  -15.242 -3.903  1.00 0.00 ? 114 GLU A HA   4  
ATOM 7424  H HB2  . GLU A 1 114 ? 14.010  -14.925 -1.043  1.00 0.00 ? 114 GLU A HB2  4  
ATOM 7425  H HB3  . GLU A 1 114 ? 15.355  -14.133 -1.851  1.00 0.00 ? 114 GLU A HB3  4  
ATOM 7426  H HG2  . GLU A 1 114 ? 12.607  -13.673 -2.885  1.00 0.00 ? 114 GLU A HG2  4  
ATOM 7427  H HG3  . GLU A 1 114 ? 13.098  -12.875 -1.391  1.00 0.00 ? 114 GLU A HG3  4  
ATOM 7428  N N    . SER A 1 115 ? 14.945  -17.930 -3.275  1.00 0.00 ? 115 SER A N    4  
ATOM 7429  C CA   . SER A 1 115 ? 15.539  -19.199 -2.870  1.00 0.00 ? 115 SER A CA   4  
ATOM 7430  C C    . SER A 1 115 ? 16.168  -19.910 -4.064  1.00 0.00 ? 115 SER A C    4  
ATOM 7431  O O    . SER A 1 115 ? 15.607  -19.924 -5.158  1.00 0.00 ? 115 SER A O    4  
ATOM 7432  C CB   . SER A 1 115 ? 14.482  -20.098 -2.224  1.00 0.00 ? 115 SER A CB   4  
ATOM 7433  O OG   . SER A 1 115 ? 15.077  -21.236 -1.626  1.00 0.00 ? 115 SER A OG   4  
ATOM 7434  H H    . SER A 1 115 ? 14.481  -17.873 -4.136  1.00 0.00 ? 115 SER A H    4  
ATOM 7435  H HA   . SER A 1 115 ? 16.310  -18.987 -2.144  1.00 0.00 ? 115 SER A HA   4  
ATOM 7436  H HB2  . SER A 1 115 ? 13.955  -19.541 -1.465  1.00 0.00 ? 115 SER A HB2  4  
ATOM 7437  H HB3  . SER A 1 115 ? 13.784  -20.427 -2.980  1.00 0.00 ? 115 SER A HB3  4  
ATOM 7438  H HG   . SER A 1 115 ? 14.800  -22.026 -2.095  1.00 0.00 ? 115 SER A HG   4  
ATOM 7439  N N    . GLY A 1 116 ? 17.338  -20.501 -3.844  1.00 0.00 ? 116 GLY A N    4  
ATOM 7440  C CA   . GLY A 1 116 ? 18.025  -21.207 -4.910  1.00 0.00 ? 116 GLY A CA   4  
ATOM 7441  C C    . GLY A 1 116 ? 19.083  -20.354 -5.582  1.00 0.00 ? 116 GLY A C    4  
ATOM 7442  O O    . GLY A 1 116 ? 18.974  -19.129 -5.647  1.00 0.00 ? 116 GLY A O    4  
ATOM 7443  H H    . GLY A 1 116 ? 17.739  -20.458 -2.950  1.00 0.00 ? 116 GLY A H    4  
ATOM 7444  H HA2  . GLY A 1 116 ? 18.496  -22.087 -4.499  1.00 0.00 ? 116 GLY A HA2  4  
ATOM 7445  H HA3  . GLY A 1 116 ? 17.300  -21.511 -5.650  1.00 0.00 ? 116 GLY A HA3  4  
ATOM 7446  N N    . PRO A 1 117 ? 20.136  -21.006 -6.096  1.00 0.00 ? 117 PRO A N    4  
ATOM 7447  C CA   . PRO A 1 117 ? 21.238  -20.318 -6.776  1.00 0.00 ? 117 PRO A CA   4  
ATOM 7448  C C    . PRO A 1 117 ? 20.817  -19.736 -8.121  1.00 0.00 ? 117 PRO A C    4  
ATOM 7449  O O    . PRO A 1 117 ? 21.456  -18.820 -8.638  1.00 0.00 ? 117 PRO A O    4  
ATOM 7450  C CB   . PRO A 1 117 ? 22.278  -21.424 -6.973  1.00 0.00 ? 117 PRO A CB   4  
ATOM 7451  C CG   . PRO A 1 117 ? 21.489  -22.688 -6.989  1.00 0.00 ? 117 PRO A CG   4  
ATOM 7452  C CD   . PRO A 1 117 ? 20.331  -22.465 -6.055  1.00 0.00 ? 117 PRO A CD   4  
ATOM 7453  H HA   . PRO A 1 117 ? 21.656  -19.535 -6.160  1.00 0.00 ? 117 PRO A HA   4  
ATOM 7454  H HB2  . PRO A 1 117 ? 22.798  -21.270 -7.908  1.00 0.00 ? 117 PRO A HB2  4  
ATOM 7455  H HB3  . PRO A 1 117 ? 22.983  -21.410 -6.156  1.00 0.00 ? 117 PRO A HB3  4  
ATOM 7456  H HG2  . PRO A 1 117 ? 21.132  -22.885 -7.988  1.00 0.00 ? 117 PRO A HG2  4  
ATOM 7457  H HG3  . PRO A 1 117 ? 22.100  -23.506 -6.639  1.00 0.00 ? 117 PRO A HG3  4  
ATOM 7458  H HD2  . PRO A 1 117 ? 19.453  -22.982 -6.413  1.00 0.00 ? 117 PRO A HD2  4  
ATOM 7459  H HD3  . PRO A 1 117 ? 20.584  -22.791 -5.057  1.00 0.00 ? 117 PRO A HD3  4  
ATOM 7460  N N    . SER A 1 118 ? 19.739  -20.274 -8.682  1.00 0.00 ? 118 SER A N    4  
ATOM 7461  C CA   . SER A 1 118 ? 19.235  -19.809 -9.969  1.00 0.00 ? 118 SER A CA   4  
ATOM 7462  C C    . SER A 1 118 ? 18.577  -18.440 -9.833  1.00 0.00 ? 118 SER A C    4  
ATOM 7463  O O    . SER A 1 118 ? 17.680  -18.248 -9.011  1.00 0.00 ? 118 SER A O    4  
ATOM 7464  C CB   . SER A 1 118 ? 18.233  -20.814 -10.540 1.00 0.00 ? 118 SER A CB   4  
ATOM 7465  O OG   . SER A 1 118 ? 17.167  -21.043 -9.635  1.00 0.00 ? 118 SER A OG   4  
ATOM 7466  H H    . SER A 1 118 ? 19.273  -21.002 -8.220  1.00 0.00 ? 118 SER A H    4  
ATOM 7467  H HA   . SER A 1 118 ? 20.074  -19.728 -10.643 1.00 0.00 ? 118 SER A HA   4  
ATOM 7468  H HB2  . SER A 1 118 ? 17.828  -20.429 -11.464 1.00 0.00 ? 118 SER A HB2  4  
ATOM 7469  H HB3  . SER A 1 118 ? 18.736  -21.751 -10.730 1.00 0.00 ? 118 SER A HB3  4  
ATOM 7470  H HG   . SER A 1 118 ? 16.997  -20.243 -9.132  1.00 0.00 ? 118 SER A HG   4  
ATOM 7471  N N    . SER A 1 119 ? 19.031  -17.489 -10.644 1.00 0.00 ? 119 SER A N    4  
ATOM 7472  C CA   . SER A 1 119 ? 18.490  -16.135 -10.612 1.00 0.00 ? 119 SER A CA   4  
ATOM 7473  C C    . SER A 1 119 ? 18.697  -15.436 -11.952 1.00 0.00 ? 119 SER A C    4  
ATOM 7474  O O    . SER A 1 119 ? 19.799  -15.432 -12.499 1.00 0.00 ? 119 SER A O    4  
ATOM 7475  C CB   . SER A 1 119 ? 19.150  -15.326 -9.494  1.00 0.00 ? 119 SER A CB   4  
ATOM 7476  O OG   . SER A 1 119 ? 20.536  -15.159 -9.736  1.00 0.00 ? 119 SER A OG   4  
ATOM 7477  H H    . SER A 1 119 ? 19.748  -17.704 -11.277 1.00 0.00 ? 119 SER A H    4  
ATOM 7478  H HA   . SER A 1 119 ? 17.430  -16.206 -10.417 1.00 0.00 ? 119 SER A HA   4  
ATOM 7479  H HB2  . SER A 1 119 ? 18.687  -14.353 -9.437  1.00 0.00 ? 119 SER A HB2  4  
ATOM 7480  H HB3  . SER A 1 119 ? 19.020  -15.843 -8.555  1.00 0.00 ? 119 SER A HB3  4  
ATOM 7481  H HG   . SER A 1 119 ? 20.805  -14.278 -9.465  1.00 0.00 ? 119 SER A HG   4  
ATOM 7482  N N    . GLY A 1 120 ? 17.628  -14.845 -12.476 1.00 0.00 ? 120 GLY A N    4  
ATOM 7483  C CA   . GLY A 1 120 ? 17.712  -14.151 -13.748 1.00 0.00 ? 120 GLY A CA   4  
ATOM 7484  C C    . GLY A 1 120 ? 18.287  -12.755 -13.609 1.00 0.00 ? 120 GLY A C    4  
ATOM 7485  O O    . GLY A 1 120 ? 17.886  -11.996 -12.728 1.00 0.00 ? 120 GLY A O    4  
ATOM 7486  H H    . GLY A 1 120 ? 16.775  -14.880 -11.995 1.00 0.00 ? 120 GLY A H    4  
ATOM 7487  H HA2  . GLY A 1 120 ? 18.338  -14.722 -14.417 1.00 0.00 ? 120 GLY A HA2  4  
ATOM 7488  H HA3  . GLY A 1 120 ? 16.721  -14.078 -14.172 1.00 0.00 ? 120 GLY A HA3  4  
ATOM 7489  N N    . GLY A 1 1   ? -12.584 33.316  13.020  1.00 0.00 ? 1   GLY A N    5  
ATOM 7490  C CA   . GLY A 1 1   ? -13.701 32.609  13.618  1.00 0.00 ? 1   GLY A CA   5  
ATOM 7491  C C    . GLY A 1 1   ? -14.083 31.365  12.839  1.00 0.00 ? 1   GLY A C    5  
ATOM 7492  O O    . GLY A 1 1   ? -14.044 31.359  11.609  1.00 0.00 ? 1   GLY A O    5  
ATOM 7493  H H1   . GLY A 1 1   ? -12.097 33.989  13.541  1.00 0.00 ? 1   GLY A H1   5  
ATOM 7494  H HA2  . GLY A 1 1   ? -13.435 32.323  14.624  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 7495  H HA3  . GLY A 1 1   ? -14.553 33.271  13.656  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 7496  N N    . SER A 1 2   ? -14.452 30.310  13.557  1.00 0.00 ? 2   SER A N    5  
ATOM 7497  C CA   . SER A 1 2   ? -14.838 29.053  12.926  1.00 0.00 ? 2   SER A CA   5  
ATOM 7498  C C    . SER A 1 2   ? -15.646 28.187  13.888  1.00 0.00 ? 2   SER A C    5  
ATOM 7499  O O    . SER A 1 2   ? -15.246 27.972  15.032  1.00 0.00 ? 2   SER A O    5  
ATOM 7500  C CB   . SER A 1 2   ? -13.596 28.292  12.456  1.00 0.00 ? 2   SER A CB   5  
ATOM 7501  O OG   . SER A 1 2   ? -13.925 26.968  12.072  1.00 0.00 ? 2   SER A OG   5  
ATOM 7502  H H    . SER A 1 2   ? -14.463 30.377  14.535  1.00 0.00 ? 2   SER A H    5  
ATOM 7503  H HA   . SER A 1 2   ? -15.451 29.287  12.069  1.00 0.00 ? 2   SER A HA   5  
ATOM 7504  H HB2  . SER A 1 2   ? -13.163 28.802  11.610  1.00 0.00 ? 2   SER A HB2  5  
ATOM 7505  H HB3  . SER A 1 2   ? -12.876 28.252  13.261  1.00 0.00 ? 2   SER A HB3  5  
ATOM 7506  H HG   . SER A 1 2   ? -14.312 26.504  12.818  1.00 0.00 ? 2   SER A HG   5  
ATOM 7507  N N    . SER A 1 3   ? -16.785 27.692  13.414  1.00 0.00 ? 3   SER A N    5  
ATOM 7508  C CA   . SER A 1 3   ? -17.652 26.853  14.232  1.00 0.00 ? 3   SER A CA   5  
ATOM 7509  C C    . SER A 1 3   ? -17.184 25.401  14.207  1.00 0.00 ? 3   SER A C    5  
ATOM 7510  O O    . SER A 1 3   ? -17.072 24.755  15.248  1.00 0.00 ? 3   SER A O    5  
ATOM 7511  C CB   . SER A 1 3   ? -19.098 26.943  13.739  1.00 0.00 ? 3   SER A CB   5  
ATOM 7512  O OG   . SER A 1 3   ? -19.517 28.293  13.634  1.00 0.00 ? 3   SER A OG   5  
ATOM 7513  H H    . SER A 1 3   ? -17.049 27.899  12.493  1.00 0.00 ? 3   SER A H    5  
ATOM 7514  H HA   . SER A 1 3   ? -17.604 27.217  15.248  1.00 0.00 ? 3   SER A HA   5  
ATOM 7515  H HB2  . SER A 1 3   ? -19.174 26.478  12.768  1.00 0.00 ? 3   SER A HB2  5  
ATOM 7516  H HB3  . SER A 1 3   ? -19.745 26.431  14.436  1.00 0.00 ? 3   SER A HB3  5  
ATOM 7517  H HG   . SER A 1 3   ? -18.865 28.793  13.138  1.00 0.00 ? 3   SER A HG   5  
ATOM 7518  N N    . GLY A 1 4   ? -16.912 24.894  13.008  1.00 0.00 ? 4   GLY A N    5  
ATOM 7519  C CA   . GLY A 1 4   ? -16.459 23.523  12.868  1.00 0.00 ? 4   GLY A CA   5  
ATOM 7520  C C    . GLY A 1 4   ? -17.609 22.541  12.762  1.00 0.00 ? 4   GLY A C    5  
ATOM 7521  O O    . GLY A 1 4   ? -17.736 21.632  13.583  1.00 0.00 ? 4   GLY A O    5  
ATOM 7522  H H    . GLY A 1 4   ? -17.019 25.457  12.212  1.00 0.00 ? 4   GLY A H    5  
ATOM 7523  H HA2  . GLY A 1 4   ? -15.850 23.445  11.979  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 7524  H HA3  . GLY A 1 4   ? -15.859 23.264  13.727  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 7525  N N    . SER A 1 5   ? -18.451 22.724  11.750  1.00 0.00 ? 5   SER A N    5  
ATOM 7526  C CA   . SER A 1 5   ? -19.600 21.850  11.543  1.00 0.00 ? 5   SER A CA   5  
ATOM 7527  C C    . SER A 1 5   ? -19.257 20.722  10.575  1.00 0.00 ? 5   SER A C    5  
ATOM 7528  O O    . SER A 1 5   ? -19.481 20.834  9.370   1.00 0.00 ? 5   SER A O    5  
ATOM 7529  C CB   . SER A 1 5   ? -20.788 22.652  11.009  1.00 0.00 ? 5   SER A CB   5  
ATOM 7530  O OG   . SER A 1 5   ? -20.469 23.278  9.778   1.00 0.00 ? 5   SER A OG   5  
ATOM 7531  H H    . SER A 1 5   ? -18.297 23.467  11.129  1.00 0.00 ? 5   SER A H    5  
ATOM 7532  H HA   . SER A 1 5   ? -19.866 21.421  12.498  1.00 0.00 ? 5   SER A HA   5  
ATOM 7533  H HB2  . SER A 1 5   ? -21.627 21.990  10.856  1.00 0.00 ? 5   SER A HB2  5  
ATOM 7534  H HB3  . SER A 1 5   ? -21.057 23.414  11.727  1.00 0.00 ? 5   SER A HB3  5  
ATOM 7535  H HG   . SER A 1 5   ? -21.196 23.843  9.508   1.00 0.00 ? 5   SER A HG   5  
ATOM 7536  N N    . SER A 1 6   ? -18.712 19.635  11.112  1.00 0.00 ? 6   SER A N    5  
ATOM 7537  C CA   . SER A 1 6   ? -18.334 18.487  10.297  1.00 0.00 ? 6   SER A CA   5  
ATOM 7538  C C    . SER A 1 6   ? -18.830 17.188  10.924  1.00 0.00 ? 6   SER A C    5  
ATOM 7539  O O    . SER A 1 6   ? -19.231 17.161  12.087  1.00 0.00 ? 6   SER A O    5  
ATOM 7540  C CB   . SER A 1 6   ? -16.815 18.436  10.123  1.00 0.00 ? 6   SER A CB   5  
ATOM 7541  O OG   . SER A 1 6   ? -16.187 17.908  11.279  1.00 0.00 ? 6   SER A OG   5  
ATOM 7542  H H    . SER A 1 6   ? -18.558 19.606  12.080  1.00 0.00 ? 6   SER A H    5  
ATOM 7543  H HA   . SER A 1 6   ? -18.795 18.603  9.327   1.00 0.00 ? 6   SER A HA   5  
ATOM 7544  H HB2  . SER A 1 6   ? -16.572 17.809  9.279   1.00 0.00 ? 6   SER A HB2  5  
ATOM 7545  H HB3  . SER A 1 6   ? -16.441 19.435  9.950   1.00 0.00 ? 6   SER A HB3  5  
ATOM 7546  H HG   . SER A 1 6   ? -15.991 16.978  11.140  1.00 0.00 ? 6   SER A HG   5  
ATOM 7547  N N    . GLY A 1 7   ? -18.798 16.111  10.145  1.00 0.00 ? 7   GLY A N    5  
ATOM 7548  C CA   . GLY A 1 7   ? -19.247 14.823  10.640  1.00 0.00 ? 7   GLY A CA   5  
ATOM 7549  C C    . GLY A 1 7   ? -20.547 14.377  10.001  1.00 0.00 ? 7   GLY A C    5  
ATOM 7550  O O    . GLY A 1 7   ? -20.744 13.189  9.745   1.00 0.00 ? 7   GLY A O    5  
ATOM 7551  H H    . GLY A 1 7   ? -18.468 16.192  9.226   1.00 0.00 ? 7   GLY A H    5  
ATOM 7552  H HA2  . GLY A 1 7   ? -18.485 14.086  10.435  1.00 0.00 ? 7   GLY A HA2  5  
ATOM 7553  H HA3  . GLY A 1 7   ? -19.389 14.891  11.709  1.00 0.00 ? 7   GLY A HA3  5  
ATOM 7554  N N    . ARG A 1 8   ? -21.436 15.330  9.745   1.00 0.00 ? 8   ARG A N    5  
ATOM 7555  C CA   . ARG A 1 8   ? -22.725 15.028  9.135   1.00 0.00 ? 8   ARG A CA   5  
ATOM 7556  C C    . ARG A 1 8   ? -22.562 14.698  7.654   1.00 0.00 ? 8   ARG A C    5  
ATOM 7557  O O    . ARG A 1 8   ? -23.314 13.895  7.102   1.00 0.00 ? 8   ARG A O    5  
ATOM 7558  C CB   . ARG A 1 8   ? -23.682 16.210  9.302   1.00 0.00 ? 8   ARG A CB   5  
ATOM 7559  C CG   . ARG A 1 8   ? -23.203 17.482  8.622   1.00 0.00 ? 8   ARG A CG   5  
ATOM 7560  C CD   . ARG A 1 8   ? -23.708 17.572  7.190   1.00 0.00 ? 8   ARG A CD   5  
ATOM 7561  N NE   . ARG A 1 8   ? -25.166 17.567  7.122   1.00 0.00 ? 8   ARG A NE   5  
ATOM 7562  C CZ   . ARG A 1 8   ? -25.855 18.025  6.083   1.00 0.00 ? 8   ARG A CZ   5  
ATOM 7563  N NH1  . ARG A 1 8   ? -25.221 18.520  5.029   1.00 0.00 ? 8   ARG A NH1  5  
ATOM 7564  N NH2  . ARG A 1 8   ? -27.182 17.987  6.096   1.00 0.00 ? 8   ARG A NH2  5  
ATOM 7565  H H    . ARG A 1 8   ? -21.221 16.259  9.973   1.00 0.00 ? 8   ARG A H    5  
ATOM 7566  H HA   . ARG A 1 8   ? -23.139 14.168  9.640   1.00 0.00 ? 8   ARG A HA   5  
ATOM 7567  H HB2  . ARG A 1 8   ? -24.642 15.944  8.884   1.00 0.00 ? 8   ARG A HB2  5  
ATOM 7568  H HB3  . ARG A 1 8   ? -23.802 16.415  10.355  1.00 0.00 ? 8   ARG A HB3  5  
ATOM 7569  H HG2  . ARG A 1 8   ? -23.569 18.335  9.174   1.00 0.00 ? 8   ARG A HG2  5  
ATOM 7570  H HG3  . ARG A 1 8   ? -22.123 17.491  8.615   1.00 0.00 ? 8   ARG A HG3  5  
ATOM 7571  H HD2  . ARG A 1 8   ? -23.339 18.486  6.749   1.00 0.00 ? 8   ARG A HD2  5  
ATOM 7572  H HD3  . ARG A 1 8   ? -23.328 16.727  6.635   1.00 0.00 ? 8   ARG A HD3  5  
ATOM 7573  H HE   . ARG A 1 8   ? -25.655 17.206  7.890   1.00 0.00 ? 8   ARG A HE   5  
ATOM 7574  H HH11 . ARG A 1 8   ? -24.222 18.549  5.016   1.00 0.00 ? 8   ARG A HH11 5  
ATOM 7575  H HH12 . ARG A 1 8   ? -25.742 18.863  4.247   1.00 0.00 ? 8   ARG A HH12 5  
ATOM 7576  H HH21 . ARG A 1 8   ? -27.663 17.614  6.888   1.00 0.00 ? 8   ARG A HH21 5  
ATOM 7577  H HH22 . ARG A 1 8   ? -27.699 18.331  5.313   1.00 0.00 ? 8   ARG A HH22 5  
ATOM 7578  N N    . GLN A 1 9   ? -21.576 15.322  7.019   1.00 0.00 ? 9   GLN A N    5  
ATOM 7579  C CA   . GLN A 1 9   ? -21.315 15.094  5.603   1.00 0.00 ? 9   GLN A CA   5  
ATOM 7580  C C    . GLN A 1 9   ? -20.461 13.847  5.400   1.00 0.00 ? 9   GLN A C    5  
ATOM 7581  O O    . GLN A 1 9   ? -19.855 13.662  4.345   1.00 0.00 ? 9   GLN A O    5  
ATOM 7582  C CB   . GLN A 1 9   ? -20.617 16.310  4.989   1.00 0.00 ? 9   GLN A CB   5  
ATOM 7583  C CG   . GLN A 1 9   ? -20.543 16.267  3.472   1.00 0.00 ? 9   GLN A CG   5  
ATOM 7584  C CD   . GLN A 1 9   ? -20.150 17.601  2.869   1.00 0.00 ? 9   GLN A CD   5  
ATOM 7585  O OE1  . GLN A 1 9   ? -19.398 18.369  3.469   1.00 0.00 ? 9   GLN A OE1  5  
ATOM 7586  N NE2  . GLN A 1 9   ? -20.659 17.884  1.675   1.00 0.00 ? 9   GLN A NE2  5  
ATOM 7587  H H    . GLN A 1 9   ? -21.010 15.950  7.514   1.00 0.00 ? 9   GLN A H    5  
ATOM 7588  H HA   . GLN A 1 9   ? -22.265 14.949  5.110   1.00 0.00 ? 9   GLN A HA   5  
ATOM 7589  H HB2  . GLN A 1 9   ? -21.154 17.201  5.277   1.00 0.00 ? 9   GLN A HB2  5  
ATOM 7590  H HB3  . GLN A 1 9   ? -19.610 16.365  5.376   1.00 0.00 ? 9   GLN A HB3  5  
ATOM 7591  H HG2  . GLN A 1 9   ? -19.811 15.528  3.180   1.00 0.00 ? 9   GLN A HG2  5  
ATOM 7592  H HG3  . GLN A 1 9   ? -21.512 15.984  3.085   1.00 0.00 ? 9   GLN A HG3  5  
ATOM 7593  H HE21 . GLN A 1 9   ? -21.252 17.225  1.257   1.00 0.00 ? 9   GLN A HE21 5  
ATOM 7594  H HE22 . GLN A 1 9   ? -20.422 18.740  1.262   1.00 0.00 ? 9   GLN A HE22 5  
ATOM 7595  N N    . VAL A 1 10  ? -20.418 12.993  6.418   1.00 0.00 ? 10  VAL A N    5  
ATOM 7596  C CA   . VAL A 1 10  ? -19.639 11.763  6.351   1.00 0.00 ? 10  VAL A CA   5  
ATOM 7597  C C    . VAL A 1 10  ? -20.208 10.808  5.307   1.00 0.00 ? 10  VAL A C    5  
ATOM 7598  O O    . VAL A 1 10  ? -19.488 10.329  4.432   1.00 0.00 ? 10  VAL A O    5  
ATOM 7599  C CB   . VAL A 1 10  ? -19.598 11.049  7.715   1.00 0.00 ? 10  VAL A CB   5  
ATOM 7600  C CG1  . VAL A 1 10  ? -21.003 10.684  8.169   1.00 0.00 ? 10  VAL A CG1  5  
ATOM 7601  C CG2  . VAL A 1 10  ? -18.714 9.814   7.644   1.00 0.00 ? 10  VAL A CG2  5  
ATOM 7602  H H    . VAL A 1 10  ? -20.923 13.196  7.233   1.00 0.00 ? 10  VAL A H    5  
ATOM 7603  H HA   . VAL A 1 10  ? -18.628 12.022  6.074   1.00 0.00 ? 10  VAL A HA   5  
ATOM 7604  H HB   . VAL A 1 10  ? -19.175 11.728  8.441   1.00 0.00 ? 10  VAL A HB   5  
ATOM 7605  H HG11 . VAL A 1 10  ? -21.009 10.536  9.239   1.00 0.00 ? 10  VAL A HG11 5  
ATOM 7606  H HG12 . VAL A 1 10  ? -21.685 11.481  7.911   1.00 0.00 ? 10  VAL A HG12 5  
ATOM 7607  H HG13 . VAL A 1 10  ? -21.314 9.772   7.679   1.00 0.00 ? 10  VAL A HG13 5  
ATOM 7608  H HG21 . VAL A 1 10  ? -18.110 9.856   6.750   1.00 0.00 ? 10  VAL A HG21 5  
ATOM 7609  H HG22 . VAL A 1 10  ? -18.070 9.781   8.511   1.00 0.00 ? 10  VAL A HG22 5  
ATOM 7610  H HG23 . VAL A 1 10  ? -19.332 8.929   7.621   1.00 0.00 ? 10  VAL A HG23 5  
ATOM 7611  N N    . GLN A 1 11  ? -21.506 10.536  5.407   1.00 0.00 ? 11  GLN A N    5  
ATOM 7612  C CA   . GLN A 1 11  ? -22.172 9.638   4.471   1.00 0.00 ? 11  GLN A CA   5  
ATOM 7613  C C    . GLN A 1 11  ? -22.154 10.213  3.059   1.00 0.00 ? 11  GLN A C    5  
ATOM 7614  O O    . GLN A 1 11  ? -22.536 9.543   2.099   1.00 0.00 ? 11  GLN A O    5  
ATOM 7615  C CB   . GLN A 1 11  ? -23.614 9.385   4.913   1.00 0.00 ? 11  GLN A CB   5  
ATOM 7616  C CG   . GLN A 1 11  ? -23.753 8.244   5.909   1.00 0.00 ? 11  GLN A CG   5  
ATOM 7617  C CD   . GLN A 1 11  ? -25.176 7.730   6.011   1.00 0.00 ? 11  GLN A CD   5  
ATOM 7618  O OE1  . GLN A 1 11  ? -25.954 7.828   5.062   1.00 0.00 ? 11  GLN A OE1  5  
ATOM 7619  N NE2  . GLN A 1 11  ? -25.524 7.178   7.168   1.00 0.00 ? 11  GLN A NE2  5  
ATOM 7620  H H    . GLN A 1 11  ? -22.027 10.949  6.126   1.00 0.00 ? 11  GLN A H    5  
ATOM 7621  H HA   . GLN A 1 11  ? -21.635 8.702   4.472   1.00 0.00 ? 11  GLN A HA   5  
ATOM 7622  H HB2  . GLN A 1 11  ? -24.001 10.283  5.371   1.00 0.00 ? 11  GLN A HB2  5  
ATOM 7623  H HB3  . GLN A 1 11  ? -24.208 9.149   4.043   1.00 0.00 ? 11  GLN A HB3  5  
ATOM 7624  H HG2  . GLN A 1 11  ? -23.115 7.431   5.597   1.00 0.00 ? 11  GLN A HG2  5  
ATOM 7625  H HG3  . GLN A 1 11  ? -23.441 8.593   6.882   1.00 0.00 ? 11  GLN A HG3  5  
ATOM 7626  H HE21 . GLN A 1 11  ? -24.852 7.136   7.881   1.00 0.00 ? 11  GLN A HE21 5  
ATOM 7627  H HE22 . GLN A 1 11  ? -26.437 6.838   7.262   1.00 0.00 ? 11  GLN A HE22 5  
ATOM 7628  N N    . LYS A 1 12  ? -21.709 11.459  2.938   1.00 0.00 ? 12  LYS A N    5  
ATOM 7629  C CA   . LYS A 1 12  ? -21.640 12.126  1.643   1.00 0.00 ? 12  LYS A CA   5  
ATOM 7630  C C    . LYS A 1 12  ? -20.228 12.057  1.070   1.00 0.00 ? 12  LYS A C    5  
ATOM 7631  O O    . LYS A 1 12  ? -20.032 11.646  -0.073  1.00 0.00 ? 12  LYS A O    5  
ATOM 7632  C CB   . LYS A 1 12  ? -22.078 13.586  1.774   1.00 0.00 ? 12  LYS A CB   5  
ATOM 7633  C CG   . LYS A 1 12  ? -22.054 14.349  0.460   1.00 0.00 ? 12  LYS A CG   5  
ATOM 7634  C CD   . LYS A 1 12  ? -23.350 14.171  -0.312  1.00 0.00 ? 12  LYS A CD   5  
ATOM 7635  C CE   . LYS A 1 12  ? -23.340 14.966  -1.608  1.00 0.00 ? 12  LYS A CE   5  
ATOM 7636  N NZ   . LYS A 1 12  ? -22.284 14.489  -2.544  1.00 0.00 ? 12  LYS A NZ   5  
ATOM 7637  H H    . LYS A 1 12  ? -21.418 11.943  3.740   1.00 0.00 ? 12  LYS A H    5  
ATOM 7638  H HA   . LYS A 1 12  ? -22.313 11.615  0.971   1.00 0.00 ? 12  LYS A HA   5  
ATOM 7639  H HB2  . LYS A 1 12  ? -23.085 13.614  2.163   1.00 0.00 ? 12  LYS A HB2  5  
ATOM 7640  H HB3  . LYS A 1 12  ? -21.419 14.086  2.469   1.00 0.00 ? 12  LYS A HB3  5  
ATOM 7641  H HG2  . LYS A 1 12  ? -21.912 15.399  0.667   1.00 0.00 ? 12  LYS A HG2  5  
ATOM 7642  H HG3  . LYS A 1 12  ? -21.233 13.984  -0.141  1.00 0.00 ? 12  LYS A HG3  5  
ATOM 7643  H HD2  . LYS A 1 12  ? -23.479 13.124  -0.546  1.00 0.00 ? 12  LYS A HD2  5  
ATOM 7644  H HD3  . LYS A 1 12  ? -24.174 14.508  0.301   1.00 0.00 ? 12  LYS A HD3  5  
ATOM 7645  H HE2  . LYS A 1 12  ? -24.303 14.866  -2.085  1.00 0.00 ? 12  LYS A HE2  5  
ATOM 7646  H HE3  . LYS A 1 12  ? -23.160 16.006  -1.376  1.00 0.00 ? 12  LYS A HE3  5  
ATOM 7647  H HZ1  . LYS A 1 12  ? -22.169 15.164  -3.327  1.00 0.00 ? 12  LYS A HZ1  5  
ATOM 7648  H HZ2  . LYS A 1 12  ? -22.548 13.563  -2.937  1.00 0.00 ? 12  LYS A HZ2  5  
ATOM 7649  H HZ3  . LYS A 1 12  ? -21.378 14.396  -2.043  1.00 0.00 ? 12  LYS A HZ3  5  
ATOM 7650  N N    . GLU A 1 13  ? -19.248 12.461  1.873   1.00 0.00 ? 13  GLU A N    5  
ATOM 7651  C CA   . GLU A 1 13  ? -17.855 12.444  1.444   1.00 0.00 ? 13  GLU A CA   5  
ATOM 7652  C C    . GLU A 1 13  ? -17.328 11.014  1.363   1.00 0.00 ? 13  GLU A C    5  
ATOM 7653  O O    . GLU A 1 13  ? -16.729 10.617  0.363   1.00 0.00 ? 13  GLU A O    5  
ATOM 7654  C CB   . GLU A 1 13  ? -16.992 13.264  2.406   1.00 0.00 ? 13  GLU A CB   5  
ATOM 7655  C CG   . GLU A 1 13  ? -15.506 12.971  2.291   1.00 0.00 ? 13  GLU A CG   5  
ATOM 7656  C CD   . GLU A 1 13  ? -14.913 13.465  0.985   1.00 0.00 ? 13  GLU A CD   5  
ATOM 7657  O OE1  . GLU A 1 13  ? -15.367 13.006  -0.084  1.00 0.00 ? 13  GLU A OE1  5  
ATOM 7658  O OE2  . GLU A 1 13  ? -13.996 14.311  1.033   1.00 0.00 ? 13  GLU A OE2  5  
ATOM 7659  H H    . GLU A 1 13  ? -19.468 12.778  2.773   1.00 0.00 ? 13  GLU A H    5  
ATOM 7660  H HA   . GLU A 1 13  ? -17.804 12.890  0.462   1.00 0.00 ? 13  GLU A HA   5  
ATOM 7661  H HB2  . GLU A 1 13  ? -17.148 14.313  2.206   1.00 0.00 ? 13  GLU A HB2  5  
ATOM 7662  H HB3  . GLU A 1 13  ? -17.302 13.050  3.418   1.00 0.00 ? 13  GLU A HB3  5  
ATOM 7663  H HG2  . GLU A 1 13  ? -14.992 13.456  3.107   1.00 0.00 ? 13  GLU A HG2  5  
ATOM 7664  H HG3  . GLU A 1 13  ? -15.356 11.903  2.356   1.00 0.00 ? 13  GLU A HG3  5  
ATOM 7665  N N    . LEU A 1 14  ? -17.554 10.246  2.422   1.00 0.00 ? 14  LEU A N    5  
ATOM 7666  C CA   . LEU A 1 14  ? -17.103 8.860   2.473   1.00 0.00 ? 14  LEU A CA   5  
ATOM 7667  C C    . LEU A 1 14  ? -17.126 8.228   1.084   1.00 0.00 ? 14  LEU A C    5  
ATOM 7668  O O    . LEU A 1 14  ? -16.083 8.042   0.459   1.00 0.00 ? 14  LEU A O    5  
ATOM 7669  C CB   . LEU A 1 14  ? -17.981 8.051   3.428   1.00 0.00 ? 14  LEU A CB   5  
ATOM 7670  C CG   . LEU A 1 14  ? -17.810 6.532   3.375   1.00 0.00 ? 14  LEU A CG   5  
ATOM 7671  C CD1  . LEU A 1 14  ? -16.626 6.099   4.226   1.00 0.00 ? 14  LEU A CD1  5  
ATOM 7672  C CD2  . LEU A 1 14  ? -19.082 5.835   3.833   1.00 0.00 ? 14  LEU A CD2  5  
ATOM 7673  H H    . LEU A 1 14  ? -18.037 10.618  3.189   1.00 0.00 ? 14  LEU A H    5  
ATOM 7674  H HA   . LEU A 1 14  ? -16.087 8.855   2.840   1.00 0.00 ? 14  LEU A HA   5  
ATOM 7675  H HB2  . LEU A 1 14  ? -17.760 8.373   4.434   1.00 0.00 ? 14  LEU A HB2  5  
ATOM 7676  H HB3  . LEU A 1 14  ? -19.013 8.276   3.198   1.00 0.00 ? 14  LEU A HB3  5  
ATOM 7677  H HG   . LEU A 1 14  ? -17.613 6.234   2.354   1.00 0.00 ? 14  LEU A HG   5  
ATOM 7678  H HD11 . LEU A 1 14  ? -15.712 6.238   3.669   1.00 0.00 ? 14  LEU A HD11 5  
ATOM 7679  H HD12 . LEU A 1 14  ? -16.733 5.056   4.487   1.00 0.00 ? 14  LEU A HD12 5  
ATOM 7680  H HD13 . LEU A 1 14  ? -16.594 6.693   5.127   1.00 0.00 ? 14  LEU A HD13 5  
ATOM 7681  H HD21 . LEU A 1 14  ? -19.724 6.548   4.329   1.00 0.00 ? 14  LEU A HD21 5  
ATOM 7682  H HD22 . LEU A 1 14  ? -18.830 5.040   4.520   1.00 0.00 ? 14  LEU A HD22 5  
ATOM 7683  H HD23 . LEU A 1 14  ? -19.595 5.423   2.977   1.00 0.00 ? 14  LEU A HD23 5  
ATOM 7684  N N    . GLY A 1 15  ? -18.324 7.904   0.608   1.00 0.00 ? 15  GLY A N    5  
ATOM 7685  C CA   . GLY A 1 15  ? -18.461 7.299   -0.705  1.00 0.00 ? 15  GLY A CA   5  
ATOM 7686  C C    . GLY A 1 15  ? -17.769 8.102   -1.788  1.00 0.00 ? 15  GLY A C    5  
ATOM 7687  O O    . GLY A 1 15  ? -17.126 7.538   -2.673  1.00 0.00 ? 15  GLY A O    5  
ATOM 7688  H H    . GLY A 1 15  ? -19.121 8.076   1.151   1.00 0.00 ? 15  GLY A H    5  
ATOM 7689  H HA2  . GLY A 1 15  ? -18.035 6.307   -0.678  1.00 0.00 ? 15  GLY A HA2  5  
ATOM 7690  H HA3  . GLY A 1 15  ? -19.511 7.222   -0.945  1.00 0.00 ? 15  GLY A HA3  5  
ATOM 7691  N N    . ASP A 1 16  ? -17.903 9.422   -1.720  1.00 0.00 ? 16  ASP A N    5  
ATOM 7692  C CA   . ASP A 1 16  ? -17.286 10.305  -2.704  1.00 0.00 ? 16  ASP A CA   5  
ATOM 7693  C C    . ASP A 1 16  ? -15.799 9.998   -2.852  1.00 0.00 ? 16  ASP A C    5  
ATOM 7694  O O    . ASP A 1 16  ? -15.329 9.655   -3.937  1.00 0.00 ? 16  ASP A O    5  
ATOM 7695  C CB   . ASP A 1 16  ? -17.480 11.767  -2.301  1.00 0.00 ? 16  ASP A CB   5  
ATOM 7696  C CG   . ASP A 1 16  ? -17.143 12.727  -3.425  1.00 0.00 ? 16  ASP A CG   5  
ATOM 7697  O OD1  . ASP A 1 16  ? -16.004 12.667  -3.934  1.00 0.00 ? 16  ASP A OD1  5  
ATOM 7698  O OD2  . ASP A 1 16  ? -18.017 13.539  -3.795  1.00 0.00 ? 16  ASP A OD2  5  
ATOM 7699  H H    . ASP A 1 16  ? -18.428 9.812   -0.991  1.00 0.00 ? 16  ASP A H    5  
ATOM 7700  H HA   . ASP A 1 16  ? -17.771 10.134  -3.653  1.00 0.00 ? 16  ASP A HA   5  
ATOM 7701  H HB2  . ASP A 1 16  ? -18.512 11.922  -2.019  1.00 0.00 ? 16  ASP A HB2  5  
ATOM 7702  H HB3  . ASP A 1 16  ? -16.843 11.989  -1.458  1.00 0.00 ? 16  ASP A HB3  5  
ATOM 7703  N N    . VAL A 1 17  ? -15.061 10.125  -1.753  1.00 0.00 ? 17  VAL A N    5  
ATOM 7704  C CA   . VAL A 1 17  ? -13.627 9.862   -1.760  1.00 0.00 ? 17  VAL A CA   5  
ATOM 7705  C C    . VAL A 1 17  ? -13.278 8.745   -2.737  1.00 0.00 ? 17  VAL A C    5  
ATOM 7706  O O    . VAL A 1 17  ? -13.787 7.629   -2.628  1.00 0.00 ? 17  VAL A O    5  
ATOM 7707  C CB   . VAL A 1 17  ? -13.120 9.479   -0.357  1.00 0.00 ? 17  VAL A CB   5  
ATOM 7708  C CG1  . VAL A 1 17  ? -11.620 9.228   -0.381  1.00 0.00 ? 17  VAL A CG1  5  
ATOM 7709  C CG2  . VAL A 1 17  ? -13.471 10.564  0.651   1.00 0.00 ? 17  VAL A CG2  5  
ATOM 7710  H H    . VAL A 1 17  ? -15.493 10.402  -0.917  1.00 0.00 ? 17  VAL A H    5  
ATOM 7711  H HA   . VAL A 1 17  ? -13.123 10.767  -2.067  1.00 0.00 ? 17  VAL A HA   5  
ATOM 7712  H HB   . VAL A 1 17  ? -13.611 8.565   -0.056  1.00 0.00 ? 17  VAL A HB   5  
ATOM 7713  H HG11 . VAL A 1 17  ? -11.270 9.239   -1.403  1.00 0.00 ? 17  VAL A HG11 5  
ATOM 7714  H HG12 . VAL A 1 17  ? -11.116 10.001  0.182   1.00 0.00 ? 17  VAL A HG12 5  
ATOM 7715  H HG13 . VAL A 1 17  ? -11.410 8.265   0.061   1.00 0.00 ? 17  VAL A HG13 5  
ATOM 7716  H HG21 . VAL A 1 17  ? -13.060 10.305  1.615   1.00 0.00 ? 17  VAL A HG21 5  
ATOM 7717  H HG22 . VAL A 1 17  ? -13.057 11.507  0.324   1.00 0.00 ? 17  VAL A HG22 5  
ATOM 7718  H HG23 . VAL A 1 17  ? -14.545 10.650  0.728   1.00 0.00 ? 17  VAL A HG23 5  
ATOM 7719  N N    . LEU A 1 18  ? -12.407 9.053   -3.692  1.00 0.00 ? 18  LEU A N    5  
ATOM 7720  C CA   . LEU A 1 18  ? -11.989 8.075   -4.689  1.00 0.00 ? 18  LEU A CA   5  
ATOM 7721  C C    . LEU A 1 18  ? -10.531 7.675   -4.482  1.00 0.00 ? 18  LEU A C    5  
ATOM 7722  O O    . LEU A 1 18  ? -9.617  8.434   -4.802  1.00 0.00 ? 18  LEU A O    5  
ATOM 7723  C CB   . LEU A 1 18  ? -12.179 8.640   -6.098  1.00 0.00 ? 18  LEU A CB   5  
ATOM 7724  C CG   . LEU A 1 18  ? -12.207 7.617   -7.234  1.00 0.00 ? 18  LEU A CG   5  
ATOM 7725  C CD1  . LEU A 1 18  ? -13.082 8.111   -8.375  1.00 0.00 ? 18  LEU A CD1  5  
ATOM 7726  C CD2  . LEU A 1 18  ? -10.797 7.328   -7.727  1.00 0.00 ? 18  LEU A CD2  5  
ATOM 7727  H H    . LEU A 1 18  ? -12.037 9.959   -3.727  1.00 0.00 ? 18  LEU A H    5  
ATOM 7728  H HA   . LEU A 1 18  ? -12.610 7.199   -4.575  1.00 0.00 ? 18  LEU A HA   5  
ATOM 7729  H HB2  . LEU A 1 18  ? -13.114 9.178   -6.115  1.00 0.00 ? 18  LEU A HB2  5  
ATOM 7730  H HB3  . LEU A 1 18  ? -11.366 9.327   -6.290  1.00 0.00 ? 18  LEU A HB3  5  
ATOM 7731  H HG   . LEU A 1 18  ? -12.630 6.692   -6.866  1.00 0.00 ? 18  LEU A HG   5  
ATOM 7732  H HD11 . LEU A 1 18  ? -12.744 9.086   -8.692  1.00 0.00 ? 18  LEU A HD11 5  
ATOM 7733  H HD12 . LEU A 1 18  ? -14.107 8.176   -8.041  1.00 0.00 ? 18  LEU A HD12 5  
ATOM 7734  H HD13 . LEU A 1 18  ? -13.017 7.420   -9.203  1.00 0.00 ? 18  LEU A HD13 5  
ATOM 7735  H HD21 . LEU A 1 18  ? -10.554 6.293   -7.535  1.00 0.00 ? 18  LEU A HD21 5  
ATOM 7736  H HD22 . LEU A 1 18  ? -10.096 7.965   -7.206  1.00 0.00 ? 18  LEU A HD22 5  
ATOM 7737  H HD23 . LEU A 1 18  ? -10.740 7.521   -8.788  1.00 0.00 ? 18  LEU A HD23 5  
ATOM 7738  N N    . VAL A 1 19  ? -10.323 6.476   -3.946  1.00 0.00 ? 19  VAL A N    5  
ATOM 7739  C CA   . VAL A 1 19  ? -8.977  5.973   -3.698  1.00 0.00 ? 19  VAL A CA   5  
ATOM 7740  C C    . VAL A 1 19  ? -8.384  5.348   -4.956  1.00 0.00 ? 19  VAL A C    5  
ATOM 7741  O O    . VAL A 1 19  ? -9.058  4.604   -5.669  1.00 0.00 ? 19  VAL A O    5  
ATOM 7742  C CB   . VAL A 1 19  ? -8.967  4.930   -2.566  1.00 0.00 ? 19  VAL A CB   5  
ATOM 7743  C CG1  . VAL A 1 19  ? -7.539  4.578   -2.176  1.00 0.00 ? 19  VAL A CG1  5  
ATOM 7744  C CG2  . VAL A 1 19  ? -9.745  5.442   -1.363  1.00 0.00 ? 19  VAL A CG2  5  
ATOM 7745  H H    . VAL A 1 19  ? -11.092 5.917   -3.712  1.00 0.00 ? 19  VAL A H    5  
ATOM 7746  H HA   . VAL A 1 19  ? -8.359  6.807   -3.397  1.00 0.00 ? 19  VAL A HA   5  
ATOM 7747  H HB   . VAL A 1 19  ? -9.449  4.033   -2.926  1.00 0.00 ? 19  VAL A HB   5  
ATOM 7748  H HG11 . VAL A 1 19  ? -6.856  4.992   -2.903  1.00 0.00 ? 19  VAL A HG11 5  
ATOM 7749  H HG12 . VAL A 1 19  ? -7.320  4.986   -1.201  1.00 0.00 ? 19  VAL A HG12 5  
ATOM 7750  H HG13 . VAL A 1 19  ? -7.428  3.503   -2.151  1.00 0.00 ? 19  VAL A HG13 5  
ATOM 7751  H HG21 . VAL A 1 19  ? -9.432  4.907   -0.479  1.00 0.00 ? 19  VAL A HG21 5  
ATOM 7752  H HG22 . VAL A 1 19  ? -9.553  6.497   -1.232  1.00 0.00 ? 19  VAL A HG22 5  
ATOM 7753  H HG23 . VAL A 1 19  ? -10.801 5.285   -1.524  1.00 0.00 ? 19  VAL A HG23 5  
ATOM 7754  N N    . ARG A 1 20  ? -7.118  5.654   -5.223  1.00 0.00 ? 20  ARG A N    5  
ATOM 7755  C CA   . ARG A 1 20  ? -6.434  5.123   -6.395  1.00 0.00 ? 20  ARG A CA   5  
ATOM 7756  C C    . ARG A 1 20  ? -5.251  4.251   -5.986  1.00 0.00 ? 20  ARG A C    5  
ATOM 7757  O O    . ARG A 1 20  ? -4.156  4.754   -5.726  1.00 0.00 ? 20  ARG A O    5  
ATOM 7758  C CB   . ARG A 1 20  ? -5.954  6.264   -7.293  1.00 0.00 ? 20  ARG A CB   5  
ATOM 7759  C CG   . ARG A 1 20  ? -6.985  6.708   -8.318  1.00 0.00 ? 20  ARG A CG   5  
ATOM 7760  C CD   . ARG A 1 20  ? -6.324  7.274   -9.565  1.00 0.00 ? 20  ARG A CD   5  
ATOM 7761  N NE   . ARG A 1 20  ? -7.266  7.405   -10.673 1.00 0.00 ? 20  ARG A NE   5  
ATOM 7762  C CZ   . ARG A 1 20  ? -6.902  7.702   -11.916 1.00 0.00 ? 20  ARG A CZ   5  
ATOM 7763  N NH1  . ARG A 1 20  ? -5.623  7.897   -12.207 1.00 0.00 ? 20  ARG A NH1  5  
ATOM 7764  N NH2  . ARG A 1 20  ? -7.818  7.803   -12.870 1.00 0.00 ? 20  ARG A NH2  5  
ATOM 7765  H H    . ARG A 1 20  ? -6.633  6.253   -4.617  1.00 0.00 ? 20  ARG A H    5  
ATOM 7766  H HA   . ARG A 1 20  ? -7.139  4.517   -6.944  1.00 0.00 ? 20  ARG A HA   5  
ATOM 7767  H HB2  . ARG A 1 20  ? -5.706  7.114   -6.674  1.00 0.00 ? 20  ARG A HB2  5  
ATOM 7768  H HB3  . ARG A 1 20  ? -5.069  5.943   -7.821  1.00 0.00 ? 20  ARG A HB3  5  
ATOM 7769  H HG2  . ARG A 1 20  ? -7.589  5.858   -8.599  1.00 0.00 ? 20  ARG A HG2  5  
ATOM 7770  H HG3  . ARG A 1 20  ? -7.613  7.468   -7.878  1.00 0.00 ? 20  ARG A HG3  5  
ATOM 7771  H HD2  . ARG A 1 20  ? -5.920  8.248   -9.332  1.00 0.00 ? 20  ARG A HD2  5  
ATOM 7772  H HD3  . ARG A 1 20  ? -5.522  6.614   -9.862  1.00 0.00 ? 20  ARG A HD3  5  
ATOM 7773  H HE   . ARG A 1 20  ? -8.216  7.264   -10.480 1.00 0.00 ? 20  ARG A HE   5  
ATOM 7774  H HH11 . ARG A 1 20  ? -4.931  7.820   -11.490 1.00 0.00 ? 20  ARG A HH11 5  
ATOM 7775  H HH12 . ARG A 1 20  ? -5.352  8.119   -13.144 1.00 0.00 ? 20  ARG A HH12 5  
ATOM 7776  H HH21 . ARG A 1 20  ? -8.783  7.656   -12.654 1.00 0.00 ? 20  ARG A HH21 5  
ATOM 7777  H HH22 . ARG A 1 20  ? -7.544  8.027   -13.805 1.00 0.00 ? 20  ARG A HH22 5  
ATOM 7778  N N    . LEU A 1 21  ? -5.477  2.944   -5.930  1.00 0.00 ? 21  LEU A N    5  
ATOM 7779  C CA   . LEU A 1 21  ? -4.429  2.001   -5.551  1.00 0.00 ? 21  LEU A CA   5  
ATOM 7780  C C    . LEU A 1 21  ? -3.458  1.774   -6.705  1.00 0.00 ? 21  LEU A C    5  
ATOM 7781  O O    . LEU A 1 21  ? -3.742  1.010   -7.628  1.00 0.00 ? 21  LEU A O    5  
ATOM 7782  C CB   . LEU A 1 21  ? -5.046  0.670   -5.119  1.00 0.00 ? 21  LEU A CB   5  
ATOM 7783  C CG   . LEU A 1 21  ? -4.248  -0.138  -4.095  1.00 0.00 ? 21  LEU A CG   5  
ATOM 7784  C CD1  . LEU A 1 21  ? -3.809  0.749   -2.940  1.00 0.00 ? 21  LEU A CD1  5  
ATOM 7785  C CD2  . LEU A 1 21  ? -5.070  -1.313  -3.585  1.00 0.00 ? 21  LEU A CD2  5  
ATOM 7786  H H    . LEU A 1 21  ? -6.369  2.602   -6.148  1.00 0.00 ? 21  LEU A H    5  
ATOM 7787  H HA   . LEU A 1 21  ? -3.888  2.425   -4.719  1.00 0.00 ? 21  LEU A HA   5  
ATOM 7788  H HB2  . LEU A 1 21  ? -6.015  0.877   -4.693  1.00 0.00 ? 21  LEU A HB2  5  
ATOM 7789  H HB3  . LEU A 1 21  ? -5.166  0.059   -6.003  1.00 0.00 ? 21  LEU A HB3  5  
ATOM 7790  H HG   . LEU A 1 21  ? -3.359  -0.532  -4.569  1.00 0.00 ? 21  LEU A HG   5  
ATOM 7791  H HD11 . LEU A 1 21  ? -3.664  0.145   -2.057  1.00 0.00 ? 21  LEU A HD11 5  
ATOM 7792  H HD12 . LEU A 1 21  ? -4.568  1.492   -2.748  1.00 0.00 ? 21  LEU A HD12 5  
ATOM 7793  H HD13 . LEU A 1 21  ? -2.881  1.240   -3.197  1.00 0.00 ? 21  LEU A HD13 5  
ATOM 7794  H HD21 . LEU A 1 21  ? -5.965  -0.944  -3.107  1.00 0.00 ? 21  LEU A HD21 5  
ATOM 7795  H HD22 . LEU A 1 21  ? -4.487  -1.877  -2.871  1.00 0.00 ? 21  LEU A HD22 5  
ATOM 7796  H HD23 . LEU A 1 21  ? -5.340  -1.950  -4.413  1.00 0.00 ? 21  LEU A HD23 5  
ATOM 7797  N N    . HIS A 1 22  ? -2.310  2.442   -6.646  1.00 0.00 ? 22  HIS A N    5  
ATOM 7798  C CA   . HIS A 1 22  ? -1.295  2.310   -7.685  1.00 0.00 ? 22  HIS A CA   5  
ATOM 7799  C C    . HIS A 1 22  ? -0.825  0.864   -7.805  1.00 0.00 ? 22  HIS A C    5  
ATOM 7800  O O    . HIS A 1 22  ? -1.187  0.159   -8.746  1.00 0.00 ? 22  HIS A O    5  
ATOM 7801  C CB   . HIS A 1 22  ? -0.106  3.223   -7.384  1.00 0.00 ? 22  HIS A CB   5  
ATOM 7802  C CG   . HIS A 1 22  ? -0.466  4.675   -7.322  1.00 0.00 ? 22  HIS A CG   5  
ATOM 7803  N ND1  . HIS A 1 22  ? 0.073   5.621   -8.169  1.00 0.00 ? 22  HIS A ND1  5  
ATOM 7804  C CD2  . HIS A 1 22  ? -1.317  5.342   -6.508  1.00 0.00 ? 22  HIS A CD2  5  
ATOM 7805  C CE1  . HIS A 1 22  ? -0.430  6.807   -7.878  1.00 0.00 ? 22  HIS A CE1  5  
ATOM 7806  N NE2  . HIS A 1 22  ? -1.277  6.665   -6.874  1.00 0.00 ? 22  HIS A NE2  5  
ATOM 7807  H H    . HIS A 1 22  ? -2.142  3.036   -5.886  1.00 0.00 ? 22  HIS A H    5  
ATOM 7808  H HA   . HIS A 1 22  ? -1.739  2.610   -8.622  1.00 0.00 ? 22  HIS A HA   5  
ATOM 7809  H HB2  . HIS A 1 22  ? 0.319   2.946   -6.431  1.00 0.00 ? 22  HIS A HB2  5  
ATOM 7810  H HB3  . HIS A 1 22  ? 0.640   3.097   -8.156  1.00 0.00 ? 22  HIS A HB3  5  
ATOM 7811  H HD1  . HIS A 1 22  ? 0.728   5.448   -8.877  1.00 0.00 ? 22  HIS A HD1  5  
ATOM 7812  H HD2  . HIS A 1 22  ? -1.917  4.914   -5.717  1.00 0.00 ? 22  HIS A HD2  5  
ATOM 7813  H HE1  . HIS A 1 22  ? -0.191  7.735   -8.375  1.00 0.00 ? 22  HIS A HE1  5  
ATOM 7814  H HE2  . HIS A 1 22  ? -1.724  7.400   -6.405  1.00 0.00 ? 22  HIS A HE2  5  
ATOM 7815  N N    . ASN A 1 23  ? -0.014  0.429   -6.846  1.00 0.00 ? 23  ASN A N    5  
ATOM 7816  C CA   . ASN A 1 23  ? 0.507   -0.933  -6.845  1.00 0.00 ? 23  ASN A CA   5  
ATOM 7817  C C    . ASN A 1 23  ? 1.309   -1.208  -5.577  1.00 0.00 ? 23  ASN A C    5  
ATOM 7818  O O    . ASN A 1 23  ? 2.128   -0.399  -5.143  1.00 0.00 ? 23  ASN A O    5  
ATOM 7819  C CB   . ASN A 1 23  ? 1.385   -1.166  -8.077  1.00 0.00 ? 23  ASN A CB   5  
ATOM 7820  C CG   . ASN A 1 23  ? 2.834   -0.790  -7.834  1.00 0.00 ? 23  ASN A CG   5  
ATOM 7821  O OD1  . ASN A 1 23  ? 3.180   0.391   -7.786  1.00 0.00 ? 23  ASN A OD1  5  
ATOM 7822  N ND2  . ASN A 1 23  ? 3.688   -1.795  -7.680  1.00 0.00 ? 23  ASN A ND2  5  
ATOM 7823  H H    . ASN A 1 23  ? 0.240   1.038   -6.122  1.00 0.00 ? 23  ASN A H    5  
ATOM 7824  H HA   . ASN A 1 23  ? -0.333  -1.610  -6.880  1.00 0.00 ? 23  ASN A HA   5  
ATOM 7825  H HB2  . ASN A 1 23  ? 1.345   -2.211  -8.347  1.00 0.00 ? 23  ASN A HB2  5  
ATOM 7826  H HB3  . ASN A 1 23  ? 1.010   -0.572  -8.897  1.00 0.00 ? 23  ASN A HB3  5  
ATOM 7827  H HD21 . ASN A 1 23  ? 3.341   -2.710  -7.731  1.00 0.00 ? 23  ASN A HD21 5  
ATOM 7828  H HD22 . ASN A 1 23  ? 4.631   -1.580  -7.521  1.00 0.00 ? 23  ASN A HD22 5  
ATOM 7829  N N    . PRO A 1 24  ? 1.068   -2.378  -4.967  1.00 0.00 ? 24  PRO A N    5  
ATOM 7830  C CA   . PRO A 1 24  ? 1.757   -2.788  -3.740  1.00 0.00 ? 24  PRO A CA   5  
ATOM 7831  C C    . PRO A 1 24  ? 3.229   -3.105  -3.981  1.00 0.00 ? 24  PRO A C    5  
ATOM 7832  O O    . PRO A 1 24  ? 3.604   -4.263  -4.164  1.00 0.00 ? 24  PRO A O    5  
ATOM 7833  C CB   . PRO A 1 24  ? 1.002   -4.049  -3.313  1.00 0.00 ? 24  PRO A CB   5  
ATOM 7834  C CG   . PRO A 1 24  ? 0.420   -4.588  -4.574  1.00 0.00 ? 24  PRO A CG   5  
ATOM 7835  C CD   . PRO A 1 24  ? 0.104   -3.392  -5.428  1.00 0.00 ? 24  PRO A CD   5  
ATOM 7836  H HA   . PRO A 1 24  ? 1.673   -2.038  -2.968  1.00 0.00 ? 24  PRO A HA   5  
ATOM 7837  H HB2  . PRO A 1 24  ? 1.692   -4.750  -2.864  1.00 0.00 ? 24  PRO A HB2  5  
ATOM 7838  H HB3  . PRO A 1 24  ? 0.232   -3.789  -2.603  1.00 0.00 ? 24  PRO A HB3  5  
ATOM 7839  H HG2  . PRO A 1 24  ? 1.140   -5.222  -5.069  1.00 0.00 ? 24  PRO A HG2  5  
ATOM 7840  H HG3  . PRO A 1 24  ? -0.481  -5.141  -4.355  1.00 0.00 ? 24  PRO A HG3  5  
ATOM 7841  H HD2  . PRO A 1 24  ? 0.257   -3.622  -6.472  1.00 0.00 ? 24  PRO A HD2  5  
ATOM 7842  H HD3  . PRO A 1 24  ? -0.911  -3.063  -5.257  1.00 0.00 ? 24  PRO A HD3  5  
ATOM 7843  N N    . VAL A 1 25  ? 4.061   -2.068  -3.978  1.00 0.00 ? 25  VAL A N    5  
ATOM 7844  C CA   . VAL A 1 25  ? 5.493   -2.236  -4.195  1.00 0.00 ? 25  VAL A CA   5  
ATOM 7845  C C    . VAL A 1 25  ? 6.094   -3.199  -3.176  1.00 0.00 ? 25  VAL A C    5  
ATOM 7846  O O    . VAL A 1 25  ? 6.249   -2.860  -2.003  1.00 0.00 ? 25  VAL A O    5  
ATOM 7847  C CB   . VAL A 1 25  ? 6.235   -0.889  -4.112  1.00 0.00 ? 25  VAL A CB   5  
ATOM 7848  C CG1  . VAL A 1 25  ? 7.724   -1.083  -4.358  1.00 0.00 ? 25  VAL A CG1  5  
ATOM 7849  C CG2  . VAL A 1 25  ? 5.648   0.104   -5.103  1.00 0.00 ? 25  VAL A CG2  5  
ATOM 7850  H H    . VAL A 1 25  ? 3.703   -1.169  -3.827  1.00 0.00 ? 25  VAL A H    5  
ATOM 7851  H HA   . VAL A 1 25  ? 5.636   -2.642  -5.186  1.00 0.00 ? 25  VAL A HA   5  
ATOM 7852  H HB   . VAL A 1 25  ? 6.107   -0.491  -3.116  1.00 0.00 ? 25  VAL A HB   5  
ATOM 7853  H HG11 . VAL A 1 25  ? 7.869   -1.606  -5.293  1.00 0.00 ? 25  VAL A HG11 5  
ATOM 7854  H HG12 . VAL A 1 25  ? 8.210   -0.120  -4.403  1.00 0.00 ? 25  VAL A HG12 5  
ATOM 7855  H HG13 . VAL A 1 25  ? 8.149   -1.664  -3.553  1.00 0.00 ? 25  VAL A HG13 5  
ATOM 7856  H HG21 . VAL A 1 25  ? 5.014   -0.419  -5.803  1.00 0.00 ? 25  VAL A HG21 5  
ATOM 7857  H HG22 . VAL A 1 25  ? 5.064   0.842   -4.571  1.00 0.00 ? 25  VAL A HG22 5  
ATOM 7858  H HG23 . VAL A 1 25  ? 6.447   0.595   -5.638  1.00 0.00 ? 25  VAL A HG23 5  
ATOM 7859  N N    . VAL A 1 26  ? 6.431   -4.401  -3.633  1.00 0.00 ? 26  VAL A N    5  
ATOM 7860  C CA   . VAL A 1 26  ? 7.016   -5.413  -2.762  1.00 0.00 ? 26  VAL A CA   5  
ATOM 7861  C C    . VAL A 1 26  ? 8.453   -5.057  -2.395  1.00 0.00 ? 26  VAL A C    5  
ATOM 7862  O O    . VAL A 1 26  ? 9.340   -5.050  -3.249  1.00 0.00 ? 26  VAL A O    5  
ATOM 7863  C CB   . VAL A 1 26  ? 6.996   -6.803  -3.425  1.00 0.00 ? 26  VAL A CB   5  
ATOM 7864  C CG1  . VAL A 1 26  ? 7.356   -6.697  -4.899  1.00 0.00 ? 26  VAL A CG1  5  
ATOM 7865  C CG2  . VAL A 1 26  ? 7.943   -7.750  -2.703  1.00 0.00 ? 26  VAL A CG2  5  
ATOM 7866  H H    . VAL A 1 26  ? 6.283   -4.611  -4.578  1.00 0.00 ? 26  VAL A H    5  
ATOM 7867  H HA   . VAL A 1 26  ? 6.425   -5.459  -1.859  1.00 0.00 ? 26  VAL A HA   5  
ATOM 7868  H HB   . VAL A 1 26  ? 5.995   -7.201  -3.349  1.00 0.00 ? 26  VAL A HB   5  
ATOM 7869  H HG11 . VAL A 1 26  ? 6.452   -6.611  -5.484  1.00 0.00 ? 26  VAL A HG11 5  
ATOM 7870  H HG12 . VAL A 1 26  ? 7.974   -5.826  -5.057  1.00 0.00 ? 26  VAL A HG12 5  
ATOM 7871  H HG13 . VAL A 1 26  ? 7.896   -7.582  -5.201  1.00 0.00 ? 26  VAL A HG13 5  
ATOM 7872  H HG21 . VAL A 1 26  ? 7.649   -7.832  -1.667  1.00 0.00 ? 26  VAL A HG21 5  
ATOM 7873  H HG22 . VAL A 1 26  ? 7.901   -8.725  -3.167  1.00 0.00 ? 26  VAL A HG22 5  
ATOM 7874  H HG23 . VAL A 1 26  ? 8.951   -7.367  -2.762  1.00 0.00 ? 26  VAL A HG23 5  
ATOM 7875  N N    . LEU A 1 27  ? 8.676   -4.763  -1.119  1.00 0.00 ? 27  LEU A N    5  
ATOM 7876  C CA   . LEU A 1 27  ? 10.006  -4.407  -0.637  1.00 0.00 ? 27  LEU A CA   5  
ATOM 7877  C C    . LEU A 1 27  ? 10.784  -5.650  -0.217  1.00 0.00 ? 27  LEU A C    5  
ATOM 7878  O O    . LEU A 1 27  ? 11.970  -5.785  -0.519  1.00 0.00 ? 27  LEU A O    5  
ATOM 7879  C CB   . LEU A 1 27  ? 9.900   -3.436  0.541   1.00 0.00 ? 27  LEU A CB   5  
ATOM 7880  C CG   . LEU A 1 27  ? 9.150   -2.131  0.269   1.00 0.00 ? 27  LEU A CG   5  
ATOM 7881  C CD1  . LEU A 1 27  ? 8.942   -1.357  1.562   1.00 0.00 ? 27  LEU A CD1  5  
ATOM 7882  C CD2  . LEU A 1 27  ? 9.902   -1.285  -0.747  1.00 0.00 ? 27  LEU A CD2  5  
ATOM 7883  H H    . LEU A 1 27  ? 7.929   -4.786  -0.485  1.00 0.00 ? 27  LEU A H    5  
ATOM 7884  H HA   . LEU A 1 27  ? 10.533  -3.923  -1.446  1.00 0.00 ? 27  LEU A HA   5  
ATOM 7885  H HB2  . LEU A 1 27  ? 9.394   -3.946  1.346   1.00 0.00 ? 27  LEU A HB2  5  
ATOM 7886  H HB3  . LEU A 1 27  ? 10.904  -3.183  0.851   1.00 0.00 ? 27  LEU A HB3  5  
ATOM 7887  H HG   . LEU A 1 27  ? 8.176   -2.362  -0.141  1.00 0.00 ? 27  LEU A HG   5  
ATOM 7888  H HD11 . LEU A 1 27  ? 9.866   -1.333  2.119   1.00 0.00 ? 27  LEU A HD11 5  
ATOM 7889  H HD12 . LEU A 1 27  ? 8.177   -1.840  2.152   1.00 0.00 ? 27  LEU A HD12 5  
ATOM 7890  H HD13 . LEU A 1 27  ? 8.634   -0.347  1.330   1.00 0.00 ? 27  LEU A HD13 5  
ATOM 7891  H HD21 . LEU A 1 27  ? 10.385  -0.461  -0.242  1.00 0.00 ? 27  LEU A HD21 5  
ATOM 7892  H HD22 . LEU A 1 27  ? 9.207   -0.900  -1.480  1.00 0.00 ? 27  LEU A HD22 5  
ATOM 7893  H HD23 . LEU A 1 27  ? 10.647  -1.892  -1.240  1.00 0.00 ? 27  LEU A HD23 5  
ATOM 7894  N N    . THR A 1 28  ? 10.108  -6.558  0.479   1.00 0.00 ? 28  THR A N    5  
ATOM 7895  C CA   . THR A 1 28  ? 10.735  -7.791  0.939   1.00 0.00 ? 28  THR A CA   5  
ATOM 7896  C C    . THR A 1 28  ? 9.738   -8.944  0.950   1.00 0.00 ? 28  THR A C    5  
ATOM 7897  O O    . THR A 1 28  ? 8.523   -8.746  0.953   1.00 0.00 ? 28  THR A O    5  
ATOM 7898  C CB   . THR A 1 28  ? 11.327  -7.626  2.352   1.00 0.00 ? 28  THR A CB   5  
ATOM 7899  O OG1  . THR A 1 28  ? 10.562  -6.673  3.096   1.00 0.00 ? 28  THR A OG1  5  
ATOM 7900  C CG2  . THR A 1 28  ? 12.778  -7.175  2.280   1.00 0.00 ? 28  THR A CG2  5  
ATOM 7901  H H    . THR A 1 28  ? 9.165   -6.393  0.689   1.00 0.00 ? 28  THR A H    5  
ATOM 7902  H HA   . THR A 1 28  ? 11.539  -8.029  0.259   1.00 0.00 ? 28  THR A HA   5  
ATOM 7903  H HB   . THR A 1 28  ? 11.287  -8.581  2.856   1.00 0.00 ? 28  THR A HB   5  
ATOM 7904  H HG1  . THR A 1 28  ? 10.094  -6.093  2.490   1.00 0.00 ? 28  THR A HG1  5  
ATOM 7905  H HG21 . THR A 1 28  ? 12.816  -6.120  2.053   1.00 0.00 ? 28  THR A HG21 5  
ATOM 7906  H HG22 . THR A 1 28  ? 13.290  -7.729  1.508   1.00 0.00 ? 28  THR A HG22 5  
ATOM 7907  H HG23 . THR A 1 28  ? 13.258  -7.355  3.231   1.00 0.00 ? 28  THR A HG23 5  
ATOM 7908  N N    . PRO A 1 29  ? 10.260  -10.179 0.957   1.00 0.00 ? 29  PRO A N    5  
ATOM 7909  C CA   . PRO A 1 29  ? 9.433   -11.389 0.968   1.00 0.00 ? 29  PRO A CA   5  
ATOM 7910  C C    . PRO A 1 29  ? 8.708   -11.583 2.296   1.00 0.00 ? 29  PRO A C    5  
ATOM 7911  O O    . PRO A 1 29  ? 8.009   -12.577 2.495   1.00 0.00 ? 29  PRO A O    5  
ATOM 7912  C CB   . PRO A 1 29  ? 10.446  -12.514 0.743   1.00 0.00 ? 29  PRO A CB   5  
ATOM 7913  C CG   . PRO A 1 29  ? 11.739  -11.965 1.241   1.00 0.00 ? 29  PRO A CG   5  
ATOM 7914  C CD   . PRO A 1 29  ? 11.700  -10.490 0.953   1.00 0.00 ? 29  PRO A CD   5  
ATOM 7915  H HA   . PRO A 1 29  ? 8.712   -11.384 0.164   1.00 0.00 ? 29  PRO A HA   5  
ATOM 7916  H HB2  . PRO A 1 29  ? 10.146  -13.389 1.302   1.00 0.00 ? 29  PRO A HB2  5  
ATOM 7917  H HB3  . PRO A 1 29  ? 10.497  -12.752 -0.309  1.00 0.00 ? 29  PRO A HB3  5  
ATOM 7918  H HG2  . PRO A 1 29  ? 11.826  -12.138 2.302   1.00 0.00 ? 29  PRO A HG2  5  
ATOM 7919  H HG3  . PRO A 1 29  ? 12.560  -12.428 0.714   1.00 0.00 ? 29  PRO A HG3  5  
ATOM 7920  H HD2  . PRO A 1 29  ? 12.215  -9.941  1.728   1.00 0.00 ? 29  PRO A HD2  5  
ATOM 7921  H HD3  . PRO A 1 29  ? 12.136  -10.282 -0.012  1.00 0.00 ? 29  PRO A HD3  5  
ATOM 7922  N N    . THR A 1 30  ? 8.879   -10.626 3.203   1.00 0.00 ? 30  THR A N    5  
ATOM 7923  C CA   . THR A 1 30  ? 8.242   -10.692 4.513   1.00 0.00 ? 30  THR A CA   5  
ATOM 7924  C C    . THR A 1 30  ? 7.464   -9.415  4.810   1.00 0.00 ? 30  THR A C    5  
ATOM 7925  O O    . THR A 1 30  ? 6.814   -9.299  5.850   1.00 0.00 ? 30  THR A O    5  
ATOM 7926  C CB   . THR A 1 30  ? 9.277   -10.922 5.630   1.00 0.00 ? 30  THR A CB   5  
ATOM 7927  O OG1  . THR A 1 30  ? 10.380  -10.023 5.469   1.00 0.00 ? 30  THR A OG1  5  
ATOM 7928  C CG2  . THR A 1 30  ? 9.780   -12.357 5.615   1.00 0.00 ? 30  THR A CG2  5  
ATOM 7929  H H    . THR A 1 30  ? 9.448   -9.859  2.986   1.00 0.00 ? 30  THR A H    5  
ATOM 7930  H HA   . THR A 1 30  ? 7.556   -11.527 4.508   1.00 0.00 ? 30  THR A HA   5  
ATOM 7931  H HB   . THR A 1 30  ? 8.804   -10.731 6.583   1.00 0.00 ? 30  THR A HB   5  
ATOM 7932  H HG1  . THR A 1 30  ? 10.986  -10.374 4.812   1.00 0.00 ? 30  THR A HG1  5  
ATOM 7933  H HG21 . THR A 1 30  ? 9.247   -12.918 4.861   1.00 0.00 ? 30  THR A HG21 5  
ATOM 7934  H HG22 . THR A 1 30  ? 9.614   -12.807 6.583   1.00 0.00 ? 30  THR A HG22 5  
ATOM 7935  H HG23 . THR A 1 30  ? 10.836  -12.366 5.390   1.00 0.00 ? 30  THR A HG23 5  
ATOM 7936  N N    . THR A 1 31  ? 7.534   -8.457  3.891   1.00 0.00 ? 31  THR A N    5  
ATOM 7937  C CA   . THR A 1 31  ? 6.836   -7.188  4.056   1.00 0.00 ? 31  THR A CA   5  
ATOM 7938  C C    . THR A 1 31  ? 6.638   -6.492  2.714   1.00 0.00 ? 31  THR A C    5  
ATOM 7939  O O    . THR A 1 31  ? 7.495   -6.564  1.833   1.00 0.00 ? 31  THR A O    5  
ATOM 7940  C CB   . THR A 1 31  ? 7.602   -6.245  5.003   1.00 0.00 ? 31  THR A CB   5  
ATOM 7941  O OG1  . THR A 1 31  ? 8.060   -6.969  6.150   1.00 0.00 ? 31  THR A OG1  5  
ATOM 7942  C CG2  . THR A 1 31  ? 6.719   -5.088  5.445   1.00 0.00 ? 31  THR A CG2  5  
ATOM 7943  H H    . THR A 1 31  ? 8.068   -8.609  3.084   1.00 0.00 ? 31  THR A H    5  
ATOM 7944  H HA   . THR A 1 31  ? 5.869   -7.393  4.491   1.00 0.00 ? 31  THR A HA   5  
ATOM 7945  H HB   . THR A 1 31  ? 8.456   -5.845  4.474   1.00 0.00 ? 31  THR A HB   5  
ATOM 7946  H HG1  . THR A 1 31  ? 8.973   -7.236  6.017   1.00 0.00 ? 31  THR A HG1  5  
ATOM 7947  H HG21 . THR A 1 31  ? 6.174   -4.706  4.595   1.00 0.00 ? 31  THR A HG21 5  
ATOM 7948  H HG22 . THR A 1 31  ? 7.334   -4.305  5.862   1.00 0.00 ? 31  THR A HG22 5  
ATOM 7949  H HG23 . THR A 1 31  ? 6.021   -5.435  6.193   1.00 0.00 ? 31  THR A HG23 5  
ATOM 7950  N N    . VAL A 1 32  ? 5.503   -5.816  2.565   1.00 0.00 ? 32  VAL A N    5  
ATOM 7951  C CA   . VAL A 1 32  ? 5.193   -5.104  1.331   1.00 0.00 ? 32  VAL A CA   5  
ATOM 7952  C C    . VAL A 1 32  ? 4.650   -3.710  1.622   1.00 0.00 ? 32  VAL A C    5  
ATOM 7953  O O    . VAL A 1 32  ? 3.902   -3.512  2.579   1.00 0.00 ? 32  VAL A O    5  
ATOM 7954  C CB   . VAL A 1 32  ? 4.166   -5.876  0.481   1.00 0.00 ? 32  VAL A CB   5  
ATOM 7955  C CG1  . VAL A 1 32  ? 3.846   -5.111  -0.794  1.00 0.00 ? 32  VAL A CG1  5  
ATOM 7956  C CG2  . VAL A 1 32  ? 4.681   -7.271  0.161   1.00 0.00 ? 32  VAL A CG2  5  
ATOM 7957  H H    . VAL A 1 32  ? 4.859   -5.795  3.304   1.00 0.00 ? 32  VAL A H    5  
ATOM 7958  H HA   . VAL A 1 32  ? 6.106   -5.013  0.760   1.00 0.00 ? 32  VAL A HA   5  
ATOM 7959  H HB   . VAL A 1 32  ? 3.256   -5.974  1.054   1.00 0.00 ? 32  VAL A HB   5  
ATOM 7960  H HG11 . VAL A 1 32  ? 2.792   -4.875  -0.816  1.00 0.00 ? 32  VAL A HG11 5  
ATOM 7961  H HG12 . VAL A 1 32  ? 4.422   -4.198  -0.821  1.00 0.00 ? 32  VAL A HG12 5  
ATOM 7962  H HG13 . VAL A 1 32  ? 4.095   -5.720  -1.651  1.00 0.00 ? 32  VAL A HG13 5  
ATOM 7963  H HG21 . VAL A 1 32  ? 5.126   -7.272  -0.823  1.00 0.00 ? 32  VAL A HG21 5  
ATOM 7964  H HG22 . VAL A 1 32  ? 5.424   -7.558  0.891   1.00 0.00 ? 32  VAL A HG22 5  
ATOM 7965  H HG23 . VAL A 1 32  ? 3.861   -7.973  0.187   1.00 0.00 ? 32  VAL A HG23 5  
ATOM 7966  N N    . GLN A 1 33  ? 5.032   -2.747  0.790   1.00 0.00 ? 33  GLN A N    5  
ATOM 7967  C CA   . GLN A 1 33  ? 4.583   -1.370  0.958   1.00 0.00 ? 33  GLN A CA   5  
ATOM 7968  C C    . GLN A 1 33  ? 3.410   -1.062  0.033   1.00 0.00 ? 33  GLN A C    5  
ATOM 7969  O O    . GLN A 1 33  ? 3.486   -1.284  -1.176  1.00 0.00 ? 33  GLN A O    5  
ATOM 7970  C CB   . GLN A 1 33  ? 5.733   -0.399  0.685   1.00 0.00 ? 33  GLN A CB   5  
ATOM 7971  C CG   . GLN A 1 33  ? 5.638   0.895   1.477   1.00 0.00 ? 33  GLN A CG   5  
ATOM 7972  C CD   . GLN A 1 33  ? 6.262   2.071   0.752   1.00 0.00 ? 33  GLN A CD   5  
ATOM 7973  O OE1  . GLN A 1 33  ? 7.292   1.931   0.090   1.00 0.00 ? 33  GLN A OE1  5  
ATOM 7974  N NE2  . GLN A 1 33  ? 5.641   3.238   0.872   1.00 0.00 ? 33  GLN A NE2  5  
ATOM 7975  H H    . GLN A 1 33  ? 5.629   -2.967  0.045   1.00 0.00 ? 33  GLN A H    5  
ATOM 7976  H HA   . GLN A 1 33  ? 4.258   -1.250  1.981   1.00 0.00 ? 33  GLN A HA   5  
ATOM 7977  H HB2  . GLN A 1 33  ? 6.664   -0.883  0.936   1.00 0.00 ? 33  GLN A HB2  5  
ATOM 7978  H HB3  . GLN A 1 33  ? 5.737   -0.152  -0.367  1.00 0.00 ? 33  GLN A HB3  5  
ATOM 7979  H HG2  . GLN A 1 33  ? 4.597   1.116   1.659   1.00 0.00 ? 33  GLN A HG2  5  
ATOM 7980  H HG3  . GLN A 1 33  ? 6.147   0.762   2.421   1.00 0.00 ? 33  GLN A HG3  5  
ATOM 7981  H HE21 . GLN A 1 33  ? 4.826   3.275   1.416   1.00 0.00 ? 33  GLN A HE21 5  
ATOM 7982  H HE22 . GLN A 1 33  ? 6.023   4.015   0.414   1.00 0.00 ? 33  GLN A HE22 5  
ATOM 7983  N N    . VAL A 1 34  ? 2.327   -0.549  0.608   1.00 0.00 ? 34  VAL A N    5  
ATOM 7984  C CA   . VAL A 1 34  ? 1.139   -0.210  -0.166  1.00 0.00 ? 34  VAL A CA   5  
ATOM 7985  C C    . VAL A 1 34  ? 0.874   1.291   -0.137  1.00 0.00 ? 34  VAL A C    5  
ATOM 7986  O O    . VAL A 1 34  ? 0.772   1.894   0.932   1.00 0.00 ? 34  VAL A O    5  
ATOM 7987  C CB   . VAL A 1 34  ? -0.105  -0.950  0.362   1.00 0.00 ? 34  VAL A CB   5  
ATOM 7988  C CG1  . VAL A 1 34  ? -1.332  -0.587  -0.460  1.00 0.00 ? 34  VAL A CG1  5  
ATOM 7989  C CG2  . VAL A 1 34  ? 0.127   -2.454  0.353   1.00 0.00 ? 34  VAL A CG2  5  
ATOM 7990  H H    . VAL A 1 34  ? 2.327   -0.395  1.575   1.00 0.00 ? 34  VAL A H    5  
ATOM 7991  H HA   . VAL A 1 34  ? 1.307   -0.517  -1.188  1.00 0.00 ? 34  VAL A HA   5  
ATOM 7992  H HB   . VAL A 1 34  ? -0.277  -0.640  1.382   1.00 0.00 ? 34  VAL A HB   5  
ATOM 7993  H HG11 . VAL A 1 34  ? -1.939  -1.468  -0.609  1.00 0.00 ? 34  VAL A HG11 5  
ATOM 7994  H HG12 . VAL A 1 34  ? -1.906  0.164   0.062   1.00 0.00 ? 34  VAL A HG12 5  
ATOM 7995  H HG13 . VAL A 1 34  ? -1.020  -0.200  -1.419  1.00 0.00 ? 34  VAL A HG13 5  
ATOM 7996  H HG21 . VAL A 1 34  ? 0.029   -2.838  1.357   1.00 0.00 ? 34  VAL A HG21 5  
ATOM 7997  H HG22 . VAL A 1 34  ? -0.604  -2.927  -0.286  1.00 0.00 ? 34  VAL A HG22 5  
ATOM 7998  H HG23 . VAL A 1 34  ? 1.119   -2.664  -0.019  1.00 0.00 ? 34  VAL A HG23 5  
ATOM 7999  N N    . THR A 1 35  ? 0.763   1.890   -1.319  1.00 0.00 ? 35  THR A N    5  
ATOM 8000  C CA   . THR A 1 35  ? 0.510   3.321   -1.430  1.00 0.00 ? 35  THR A CA   5  
ATOM 8001  C C    . THR A 1 35  ? -0.776  3.594   -2.200  1.00 0.00 ? 35  THR A C    5  
ATOM 8002  O O    . THR A 1 35  ? -1.153  2.830   -3.089  1.00 0.00 ? 35  THR A O    5  
ATOM 8003  C CB   . THR A 1 35  ? 1.677   4.045   -2.128  1.00 0.00 ? 35  THR A CB   5  
ATOM 8004  O OG1  . THR A 1 35  ? 2.916   3.698   -1.498  1.00 0.00 ? 35  THR A OG1  5  
ATOM 8005  C CG2  . THR A 1 35  ? 1.483   5.553   -2.082  1.00 0.00 ? 35  THR A CG2  5  
ATOM 8006  H H    . THR A 1 35  ? 0.854   1.355   -2.135  1.00 0.00 ? 35  THR A H    5  
ATOM 8007  H HA   . THR A 1 35  ? 0.412   3.720   -0.431  1.00 0.00 ? 35  THR A HA   5  
ATOM 8008  H HB   . THR A 1 35  ? 1.707   3.732   -3.162  1.00 0.00 ? 35  THR A HB   5  
ATOM 8009  H HG1  . THR A 1 35  ? 3.026   2.744   -1.512  1.00 0.00 ? 35  THR A HG1  5  
ATOM 8010  H HG21 . THR A 1 35  ? 2.440   6.034   -1.942  1.00 0.00 ? 35  THR A HG21 5  
ATOM 8011  H HG22 . THR A 1 35  ? 0.829   5.806   -1.261  1.00 0.00 ? 35  THR A HG22 5  
ATOM 8012  H HG23 . THR A 1 35  ? 1.044   5.887   -3.009  1.00 0.00 ? 35  THR A HG23 5  
ATOM 8013  N N    . TRP A 1 36  ? -1.446  4.687   -1.855  1.00 0.00 ? 36  TRP A N    5  
ATOM 8014  C CA   . TRP A 1 36  ? -2.691  5.061   -2.516  1.00 0.00 ? 36  TRP A CA   5  
ATOM 8015  C C    . TRP A 1 36  ? -2.891  6.573   -2.486  1.00 0.00 ? 36  TRP A C    5  
ATOM 8016  O O    . TRP A 1 36  ? -2.328  7.267   -1.639  1.00 0.00 ? 36  TRP A O    5  
ATOM 8017  C CB   . TRP A 1 36  ? -3.877  4.365   -1.846  1.00 0.00 ? 36  TRP A CB   5  
ATOM 8018  C CG   . TRP A 1 36  ? -4.085  4.783   -0.422  1.00 0.00 ? 36  TRP A CG   5  
ATOM 8019  C CD1  . TRP A 1 36  ? -4.804  5.856   0.021   1.00 0.00 ? 36  TRP A CD1  5  
ATOM 8020  C CD2  . TRP A 1 36  ? -3.565  4.137   0.745   1.00 0.00 ? 36  TRP A CD2  5  
ATOM 8021  N NE1  . TRP A 1 36  ? -4.763  5.915   1.393   1.00 0.00 ? 36  TRP A NE1  5  
ATOM 8022  C CE2  . TRP A 1 36  ? -4.010  4.872   1.862   1.00 0.00 ? 36  TRP A CE2  5  
ATOM 8023  C CE3  . TRP A 1 36  ? -2.768  3.008   0.956   1.00 0.00 ? 36  TRP A CE3  5  
ATOM 8024  C CZ2  . TRP A 1 36  ? -3.683  4.513   3.167   1.00 0.00 ? 36  TRP A CZ2  5  
ATOM 8025  C CZ3  . TRP A 1 36  ? -2.445  2.654   2.252   1.00 0.00 ? 36  TRP A CZ3  5  
ATOM 8026  C CH2  . TRP A 1 36  ? -2.902  3.404   3.344   1.00 0.00 ? 36  TRP A CH2  5  
ATOM 8027  H H    . TRP A 1 36  ? -1.095  5.257   -1.138  1.00 0.00 ? 36  TRP A H    5  
ATOM 8028  H HA   . TRP A 1 36  ? -2.630  4.738   -3.544  1.00 0.00 ? 36  TRP A HA   5  
ATOM 8029  H HB2  . TRP A 1 36  ? -4.778  4.594   -2.395  1.00 0.00 ? 36  TRP A HB2  5  
ATOM 8030  H HB3  . TRP A 1 36  ? -3.713  3.297   -1.860  1.00 0.00 ? 36  TRP A HB3  5  
ATOM 8031  H HD1  . TRP A 1 36  ? -5.323  6.548   -0.624  1.00 0.00 ? 36  TRP A HD1  5  
ATOM 8032  H HE1  . TRP A 1 36  ? -5.204  6.594   1.946   1.00 0.00 ? 36  TRP A HE1  5  
ATOM 8033  H HE3  . TRP A 1 36  ? -2.406  2.417   0.128   1.00 0.00 ? 36  TRP A HE3  5  
ATOM 8034  H HZ2  . TRP A 1 36  ? -4.029  5.081   4.019   1.00 0.00 ? 36  TRP A HZ2  5  
ATOM 8035  H HZ3  . TRP A 1 36  ? -1.830  1.785   2.435   1.00 0.00 ? 36  TRP A HZ3  5  
ATOM 8036  H HH2  . TRP A 1 36  ? -2.625  3.090   4.339   1.00 0.00 ? 36  TRP A HH2  5  
ATOM 8037  N N    . THR A 1 37  ? -3.696  7.078   -3.416  1.00 0.00 ? 37  THR A N    5  
ATOM 8038  C CA   . THR A 1 37  ? -3.968  8.507   -3.497  1.00 0.00 ? 37  THR A CA   5  
ATOM 8039  C C    . THR A 1 37  ? -5.467  8.779   -3.551  1.00 0.00 ? 37  THR A C    5  
ATOM 8040  O O    . THR A 1 37  ? -6.181  8.218   -4.383  1.00 0.00 ? 37  THR A O    5  
ATOM 8041  C CB   . THR A 1 37  ? -3.299  9.138   -4.732  1.00 0.00 ? 37  THR A CB   5  
ATOM 8042  O OG1  . THR A 1 37  ? -3.620  8.379   -5.904  1.00 0.00 ? 37  THR A OG1  5  
ATOM 8043  C CG2  . THR A 1 37  ? -1.789  9.197   -4.559  1.00 0.00 ? 37  THR A CG2  5  
ATOM 8044  H H    . THR A 1 37  ? -4.115  6.473   -4.063  1.00 0.00 ? 37  THR A H    5  
ATOM 8045  H HA   . THR A 1 37  ? -3.559  8.975   -2.613  1.00 0.00 ? 37  THR A HA   5  
ATOM 8046  H HB   . THR A 1 37  ? -3.673  10.145  -4.851  1.00 0.00 ? 37  THR A HB   5  
ATOM 8047  H HG1  . THR A 1 37  ? -4.381  8.770   -6.339  1.00 0.00 ? 37  THR A HG1  5  
ATOM 8048  H HG21 . THR A 1 37  ? -1.554  9.615   -3.591  1.00 0.00 ? 37  THR A HG21 5  
ATOM 8049  H HG22 . THR A 1 37  ? -1.362  9.817   -5.332  1.00 0.00 ? 37  THR A HG22 5  
ATOM 8050  H HG23 . THR A 1 37  ? -1.380  8.201   -4.629  1.00 0.00 ? 37  THR A HG23 5  
ATOM 8051  N N    . VAL A 1 38  ? -5.940  9.643   -2.658  1.00 0.00 ? 38  VAL A N    5  
ATOM 8052  C CA   . VAL A 1 38  ? -7.355  9.990   -2.605  1.00 0.00 ? 38  VAL A CA   5  
ATOM 8053  C C    . VAL A 1 38  ? -7.582  11.436  -3.034  1.00 0.00 ? 38  VAL A C    5  
ATOM 8054  O O    . VAL A 1 38  ? -7.106  12.368  -2.387  1.00 0.00 ? 38  VAL A O    5  
ATOM 8055  C CB   . VAL A 1 38  ? -7.930  9.790   -1.190  1.00 0.00 ? 38  VAL A CB   5  
ATOM 8056  C CG1  . VAL A 1 38  ? -7.620  8.390   -0.681  1.00 0.00 ? 38  VAL A CG1  5  
ATOM 8057  C CG2  . VAL A 1 38  ? -7.385  10.845  -0.240  1.00 0.00 ? 38  VAL A CG2  5  
ATOM 8058  H H    . VAL A 1 38  ? -5.322  10.057  -2.020  1.00 0.00 ? 38  VAL A H    5  
ATOM 8059  H HA   . VAL A 1 38  ? -7.885  9.337   -3.283  1.00 0.00 ? 38  VAL A HA   5  
ATOM 8060  H HB   . VAL A 1 38  ? -9.003  9.901   -1.241  1.00 0.00 ? 38  VAL A HB   5  
ATOM 8061  H HG11 . VAL A 1 38  ? -8.144  8.221   0.248   1.00 0.00 ? 38  VAL A HG11 5  
ATOM 8062  H HG12 . VAL A 1 38  ? -7.937  7.662   -1.413  1.00 0.00 ? 38  VAL A HG12 5  
ATOM 8063  H HG13 . VAL A 1 38  ? -6.557  8.295   -0.516  1.00 0.00 ? 38  VAL A HG13 5  
ATOM 8064  H HG21 . VAL A 1 38  ? -7.893  11.781  -0.413  1.00 0.00 ? 38  VAL A HG21 5  
ATOM 8065  H HG22 . VAL A 1 38  ? -7.549  10.530  0.781   1.00 0.00 ? 38  VAL A HG22 5  
ATOM 8066  H HG23 . VAL A 1 38  ? -6.326  10.972  -0.411  1.00 0.00 ? 38  VAL A HG23 5  
ATOM 8067  N N    . ASP A 1 39  ? -8.313  11.614  -4.128  1.00 0.00 ? 39  ASP A N    5  
ATOM 8068  C CA   . ASP A 1 39  ? -8.606  12.947  -4.644  1.00 0.00 ? 39  ASP A CA   5  
ATOM 8069  C C    . ASP A 1 39  ? -9.286  13.803  -3.580  1.00 0.00 ? 39  ASP A C    5  
ATOM 8070  O O    . ASP A 1 39  ? -9.103  15.020  -3.539  1.00 0.00 ? 39  ASP A O    5  
ATOM 8071  C CB   . ASP A 1 39  ? -9.493  12.853  -5.886  1.00 0.00 ? 39  ASP A CB   5  
ATOM 8072  C CG   . ASP A 1 39  ? -9.869  14.216  -6.433  1.00 0.00 ? 39  ASP A CG   5  
ATOM 8073  O OD1  . ASP A 1 39  ? -9.078  14.777  -7.220  1.00 0.00 ? 39  ASP A OD1  5  
ATOM 8074  O OD2  . ASP A 1 39  ? -10.953 14.722  -6.074  1.00 0.00 ? 39  ASP A OD2  5  
ATOM 8075  H H    . ASP A 1 39  ? -8.666  10.831  -4.601  1.00 0.00 ? 39  ASP A H    5  
ATOM 8076  H HA   . ASP A 1 39  ? -7.670  13.410  -4.916  1.00 0.00 ? 39  ASP A HA   5  
ATOM 8077  H HB2  . ASP A 1 39  ? -8.967  12.309  -6.657  1.00 0.00 ? 39  ASP A HB2  5  
ATOM 8078  H HB3  . ASP A 1 39  ? -10.400 12.324  -5.633  1.00 0.00 ? 39  ASP A HB3  5  
ATOM 8079  N N    . ARG A 1 40  ? -10.073 13.160  -2.724  1.00 0.00 ? 40  ARG A N    5  
ATOM 8080  C CA   . ARG A 1 40  ? -10.783 13.863  -1.662  1.00 0.00 ? 40  ARG A CA   5  
ATOM 8081  C C    . ARG A 1 40  ? -10.212 13.500  -0.294  1.00 0.00 ? 40  ARG A C    5  
ATOM 8082  O O    . ARG A 1 40  ? -10.075 12.324  0.039   1.00 0.00 ? 40  ARG A O    5  
ATOM 8083  C CB   . ARG A 1 40  ? -12.275 13.529  -1.709  1.00 0.00 ? 40  ARG A CB   5  
ATOM 8084  C CG   . ARG A 1 40  ? -12.846 13.489  -3.117  1.00 0.00 ? 40  ARG A CG   5  
ATOM 8085  C CD   . ARG A 1 40  ? -13.040 14.888  -3.680  1.00 0.00 ? 40  ARG A CD   5  
ATOM 8086  N NE   . ARG A 1 40  ? -14.226 15.540  -3.130  1.00 0.00 ? 40  ARG A NE   5  
ATOM 8087  C CZ   . ARG A 1 40  ? -14.616 16.763  -3.470  1.00 0.00 ? 40  ARG A CZ   5  
ATOM 8088  N NH1  . ARG A 1 40  ? -13.918 17.464  -4.354  1.00 0.00 ? 40  ARG A NH1  5  
ATOM 8089  N NH2  . ARG A 1 40  ? -15.707 17.288  -2.927  1.00 0.00 ? 40  ARG A NH2  5  
ATOM 8090  H H    . ARG A 1 40  ? -10.179 12.189  -2.808  1.00 0.00 ? 40  ARG A H    5  
ATOM 8091  H HA   . ARG A 1 40  ? -10.655 14.923  -1.823  1.00 0.00 ? 40  ARG A HA   5  
ATOM 8092  H HB2  . ARG A 1 40  ? -12.430 12.562  -1.254  1.00 0.00 ? 40  ARG A HB2  5  
ATOM 8093  H HB3  . ARG A 1 40  ? -12.816 14.274  -1.146  1.00 0.00 ? 40  ARG A HB3  5  
ATOM 8094  H HG2  . ARG A 1 40  ? -12.165 12.947  -3.757  1.00 0.00 ? 40  ARG A HG2  5  
ATOM 8095  H HG3  . ARG A 1 40  ? -13.800 12.984  -3.094  1.00 0.00 ? 40  ARG A HG3  5  
ATOM 8096  H HD2  . ARG A 1 40  ? -12.171 15.482  -3.439  1.00 0.00 ? 40  ARG A HD2  5  
ATOM 8097  H HD3  . ARG A 1 40  ? -13.142 14.819  -4.752  1.00 0.00 ? 40  ARG A HD3  5  
ATOM 8098  H HE   . ARG A 1 40  ? -14.756 15.040  -2.476  1.00 0.00 ? 40  ARG A HE   5  
ATOM 8099  H HH11 . ARG A 1 40  ? -13.096 17.071  -4.765  1.00 0.00 ? 40  ARG A HH11 5  
ATOM 8100  H HH12 . ARG A 1 40  ? -14.215 18.384  -4.609  1.00 0.00 ? 40  ARG A HH12 5  
ATOM 8101  H HH21 . ARG A 1 40  ? -16.236 16.762  -2.261  1.00 0.00 ? 40  ARG A HH21 5  
ATOM 8102  H HH22 . ARG A 1 40  ? -16.000 18.208  -3.183  1.00 0.00 ? 40  ARG A HH22 5  
ATOM 8103  N N    . GLN A 1 41  ? -9.882  14.519  0.493   1.00 0.00 ? 41  GLN A N    5  
ATOM 8104  C CA   . GLN A 1 41  ? -9.325  14.307  1.823   1.00 0.00 ? 41  GLN A CA   5  
ATOM 8105  C C    . GLN A 1 41  ? -10.382 14.537  2.899   1.00 0.00 ? 41  GLN A C    5  
ATOM 8106  O O    . GLN A 1 41  ? -10.642 15.666  3.317   1.00 0.00 ? 41  GLN A O    5  
ATOM 8107  C CB   . GLN A 1 41  ? -8.134  15.238  2.055   1.00 0.00 ? 41  GLN A CB   5  
ATOM 8108  C CG   . GLN A 1 41  ? -7.435  15.011  3.386   1.00 0.00 ? 41  GLN A CG   5  
ATOM 8109  C CD   . GLN A 1 41  ? -6.065  15.658  3.443   1.00 0.00 ? 41  GLN A CD   5  
ATOM 8110  O OE1  . GLN A 1 41  ? -5.931  16.825  3.812   1.00 0.00 ? 41  GLN A OE1  5  
ATOM 8111  N NE2  . GLN A 1 41  ? -5.037  14.901  3.076   1.00 0.00 ? 41  GLN A NE2  5  
ATOM 8112  H H    . GLN A 1 41  ? -10.015 15.435  0.170   1.00 0.00 ? 41  GLN A H    5  
ATOM 8113  H HA   . GLN A 1 41  ? -8.987  13.284  1.882   1.00 0.00 ? 41  GLN A HA   5  
ATOM 8114  H HB2  . GLN A 1 41  ? -7.415  15.087  1.264   1.00 0.00 ? 41  GLN A HB2  5  
ATOM 8115  H HB3  . GLN A 1 41  ? -8.480  16.261  2.025   1.00 0.00 ? 41  GLN A HB3  5  
ATOM 8116  H HG2  . GLN A 1 41  ? -8.044  15.427  4.174   1.00 0.00 ? 41  GLN A HG2  5  
ATOM 8117  H HG3  . GLN A 1 41  ? -7.322  13.949  3.542   1.00 0.00 ? 41  GLN A HG3  5  
ATOM 8118  H HE21 . GLN A 1 41  ? -5.219  13.980  2.792   1.00 0.00 ? 41  GLN A HE21 5  
ATOM 8119  H HE22 . GLN A 1 41  ? -4.140  15.294  3.102   1.00 0.00 ? 41  GLN A HE22 5  
ATOM 8120  N N    . PRO A 1 42  ? -11.008 13.443  3.358   1.00 0.00 ? 42  PRO A N    5  
ATOM 8121  C CA   . PRO A 1 42  ? -12.047 13.500  4.391   1.00 0.00 ? 42  PRO A CA   5  
ATOM 8122  C C    . PRO A 1 42  ? -11.485 13.873  5.758   1.00 0.00 ? 42  PRO A C    5  
ATOM 8123  O O    . PRO A 1 42  ? -10.472 13.325  6.192   1.00 0.00 ? 42  PRO A O    5  
ATOM 8124  C CB   . PRO A 1 42  ? -12.604 12.075  4.412   1.00 0.00 ? 42  PRO A CB   5  
ATOM 8125  C CG   . PRO A 1 42  ? -11.490 11.225  3.906   1.00 0.00 ? 42  PRO A CG   5  
ATOM 8126  C CD   . PRO A 1 42  ? -10.749 12.066  2.905   1.00 0.00 ? 42  PRO A CD   5  
ATOM 8127  H HA   . PRO A 1 42  ? -12.833 14.192  4.125   1.00 0.00 ? 42  PRO A HA   5  
ATOM 8128  H HB2  . PRO A 1 42  ? -12.879 11.808  5.423   1.00 0.00 ? 42  PRO A HB2  5  
ATOM 8129  H HB3  . PRO A 1 42  ? -13.470 12.013  3.770   1.00 0.00 ? 42  PRO A HB3  5  
ATOM 8130  H HG2  . PRO A 1 42  ? -10.838 10.950  4.722   1.00 0.00 ? 42  PRO A HG2  5  
ATOM 8131  H HG3  . PRO A 1 42  ? -11.890 10.342  3.430   1.00 0.00 ? 42  PRO A HG3  5  
ATOM 8132  H HD2  . PRO A 1 42  ? -9.692  11.843  2.933   1.00 0.00 ? 42  PRO A HD2  5  
ATOM 8133  H HD3  . PRO A 1 42  ? -11.143 11.907  1.912   1.00 0.00 ? 42  PRO A HD3  5  
ATOM 8134  N N    . GLN A 1 43  ? -12.149 14.806  6.432   1.00 0.00 ? 43  GLN A N    5  
ATOM 8135  C CA   . GLN A 1 43  ? -11.715 15.251  7.750   1.00 0.00 ? 43  GLN A CA   5  
ATOM 8136  C C    . GLN A 1 43  ? -12.218 14.307  8.837   1.00 0.00 ? 43  GLN A C    5  
ATOM 8137  O O    . GLN A 1 43  ? -11.481 13.955  9.759   1.00 0.00 ? 43  GLN A O    5  
ATOM 8138  C CB   . GLN A 1 43  ? -12.213 16.672  8.022   1.00 0.00 ? 43  GLN A CB   5  
ATOM 8139  C CG   . GLN A 1 43  ? -11.510 17.732  7.190   1.00 0.00 ? 43  GLN A CG   5  
ATOM 8140  C CD   . GLN A 1 43  ? -11.960 19.138  7.536   1.00 0.00 ? 43  GLN A CD   5  
ATOM 8141  O OE1  . GLN A 1 43  ? -12.186 19.461  8.702   1.00 0.00 ? 43  GLN A OE1  5  
ATOM 8142  N NE2  . GLN A 1 43  ? -12.093 19.984  6.521   1.00 0.00 ? 43  GLN A NE2  5  
ATOM 8143  H H    . GLN A 1 43  ? -12.950 15.205  6.032   1.00 0.00 ? 43  GLN A H    5  
ATOM 8144  H HA   . GLN A 1 43  ? -10.635 15.250  7.761   1.00 0.00 ? 43  GLN A HA   5  
ATOM 8145  H HB2  . GLN A 1 43  ? -13.270 16.717  7.807   1.00 0.00 ? 43  GLN A HB2  5  
ATOM 8146  H HB3  . GLN A 1 43  ? -12.055 16.902  9.066   1.00 0.00 ? 43  GLN A HB3  5  
ATOM 8147  H HG2  . GLN A 1 43  ? -10.446 17.660  7.360   1.00 0.00 ? 43  GLN A HG2  5  
ATOM 8148  H HG3  . GLN A 1 43  ? -11.720 17.549  6.146   1.00 0.00 ? 43  GLN A HG3  5  
ATOM 8149  H HE21 . GLN A 1 43  ? -11.896 19.657  5.617   1.00 0.00 ? 43  GLN A HE21 5  
ATOM 8150  H HE22 . GLN A 1 43  ? -12.383 20.899  6.715   1.00 0.00 ? 43  GLN A HE22 5  
ATOM 8151  N N    . PHE A 1 44  ? -13.477 13.899  8.722   1.00 0.00 ? 44  PHE A N    5  
ATOM 8152  C CA   . PHE A 1 44  ? -14.080 12.995  9.696   1.00 0.00 ? 44  PHE A CA   5  
ATOM 8153  C C    . PHE A 1 44  ? -13.291 11.693  9.790   1.00 0.00 ? 44  PHE A C    5  
ATOM 8154  O O    . PHE A 1 44  ? -13.231 11.066  10.849  1.00 0.00 ? 44  PHE A O    5  
ATOM 8155  C CB   . PHE A 1 44  ? -15.533 12.699  9.317   1.00 0.00 ? 44  PHE A CB   5  
ATOM 8156  C CG   . PHE A 1 44  ? -15.708 12.298  7.880   1.00 0.00 ? 44  PHE A CG   5  
ATOM 8157  C CD1  . PHE A 1 44  ? -15.791 13.258  6.885   1.00 0.00 ? 44  PHE A CD1  5  
ATOM 8158  C CD2  . PHE A 1 44  ? -15.789 10.961  7.525   1.00 0.00 ? 44  PHE A CD2  5  
ATOM 8159  C CE1  . PHE A 1 44  ? -15.953 12.892  5.562   1.00 0.00 ? 44  PHE A CE1  5  
ATOM 8160  C CE2  . PHE A 1 44  ? -15.950 10.589  6.204   1.00 0.00 ? 44  PHE A CE2  5  
ATOM 8161  C CZ   . PHE A 1 44  ? -16.031 11.555  5.221   1.00 0.00 ? 44  PHE A CZ   5  
ATOM 8162  H H    . PHE A 1 44  ? -14.015 14.213  7.965   1.00 0.00 ? 44  PHE A H    5  
ATOM 8163  H HA   . PHE A 1 44  ? -14.060 13.485  10.657  1.00 0.00 ? 44  PHE A HA   5  
ATOM 8164  H HB2  . PHE A 1 44  ? -15.900 11.892  9.933   1.00 0.00 ? 44  PHE A HB2  5  
ATOM 8165  H HB3  . PHE A 1 44  ? -16.130 13.581  9.492   1.00 0.00 ? 44  PHE A HB3  5  
ATOM 8166  H HD1  . PHE A 1 44  ? -15.729 14.303  7.150   1.00 0.00 ? 44  PHE A HD1  5  
ATOM 8167  H HD2  . PHE A 1 44  ? -15.725 10.204  8.294   1.00 0.00 ? 44  PHE A HD2  5  
ATOM 8168  H HE1  . PHE A 1 44  ? -16.016 13.649  4.795   1.00 0.00 ? 44  PHE A HE1  5  
ATOM 8169  H HE2  . PHE A 1 44  ? -16.011 9.543   5.941   1.00 0.00 ? 44  PHE A HE2  5  
ATOM 8170  H HZ   . PHE A 1 44  ? -16.158 11.267  4.188   1.00 0.00 ? 44  PHE A HZ   5  
ATOM 8171  N N    . ILE A 1 45  ? -12.688 11.291  8.676   1.00 0.00 ? 45  ILE A N    5  
ATOM 8172  C CA   . ILE A 1 45  ? -11.903 10.064  8.633   1.00 0.00 ? 45  ILE A CA   5  
ATOM 8173  C C    . ILE A 1 45  ? -10.999 9.946   9.855   1.00 0.00 ? 45  ILE A C    5  
ATOM 8174  O O    . ILE A 1 45  ? -10.531 10.950  10.391  1.00 0.00 ? 45  ILE A O    5  
ATOM 8175  C CB   . ILE A 1 45  ? -11.038 9.994   7.360   1.00 0.00 ? 45  ILE A CB   5  
ATOM 8176  C CG1  . ILE A 1 45  ? -10.669 8.542   7.048   1.00 0.00 ? 45  ILE A CG1  5  
ATOM 8177  C CG2  . ILE A 1 45  ? -9.786  10.841  7.523   1.00 0.00 ? 45  ILE A CG2  5  
ATOM 8178  C CD1  . ILE A 1 45  ? -10.213 8.327   5.622   1.00 0.00 ? 45  ILE A CD1  5  
ATOM 8179  H H    . ILE A 1 45  ? -12.773 11.833  7.865   1.00 0.00 ? 45  ILE A H    5  
ATOM 8180  H HA   . ILE A 1 45  ? -12.589 9.229   8.625   1.00 0.00 ? 45  ILE A HA   5  
ATOM 8181  H HB   . ILE A 1 45  ? -11.612 10.396  6.540   1.00 0.00 ? 45  ILE A HB   5  
ATOM 8182  H HG12 . ILE A 1 45  ? -9.869  8.232   7.702   1.00 0.00 ? 45  ILE A HG12 5  
ATOM 8183  H HG13 . ILE A 1 45  ? -11.531 7.914   7.220   1.00 0.00 ? 45  ILE A HG13 5  
ATOM 8184  H HG21 . ILE A 1 45  ? -9.074  10.317  8.144   1.00 0.00 ? 45  ILE A HG21 5  
ATOM 8185  H HG22 . ILE A 1 45  ? -9.349  11.027  6.554   1.00 0.00 ? 45  ILE A HG22 5  
ATOM 8186  H HG23 . ILE A 1 45  ? -10.045 11.781  7.988   1.00 0.00 ? 45  ILE A HG23 5  
ATOM 8187  H HD11 . ILE A 1 45  ? -9.577  7.456   5.574   1.00 0.00 ? 45  ILE A HD11 5  
ATOM 8188  H HD12 . ILE A 1 45  ? -11.073 8.182   4.987   1.00 0.00 ? 45  ILE A HD12 5  
ATOM 8189  H HD13 . ILE A 1 45  ? -9.661  9.194   5.287   1.00 0.00 ? 45  ILE A HD13 5  
ATOM 8190  N N    . GLN A 1 46  ? -10.757 8.714   10.289  1.00 0.00 ? 46  GLN A N    5  
ATOM 8191  C CA   . GLN A 1 46  ? -9.908  8.465   11.448  1.00 0.00 ? 46  GLN A CA   5  
ATOM 8192  C C    . GLN A 1 46  ? -8.607  7.786   11.034  1.00 0.00 ? 46  GLN A C    5  
ATOM 8193  O O    . GLN A 1 46  ? -7.622  7.805   11.771  1.00 0.00 ? 46  GLN A O    5  
ATOM 8194  C CB   . GLN A 1 46  ? -10.645 7.600   12.472  1.00 0.00 ? 46  GLN A CB   5  
ATOM 8195  C CG   . GLN A 1 46  ? -11.471 8.403   13.464  1.00 0.00 ? 46  GLN A CG   5  
ATOM 8196  C CD   . GLN A 1 46  ? -10.636 8.961   14.600  1.00 0.00 ? 46  GLN A CD   5  
ATOM 8197  O OE1  . GLN A 1 46  ? -9.652  8.352   15.021  1.00 0.00 ? 46  GLN A OE1  5  
ATOM 8198  N NE2  . GLN A 1 46  ? -11.026 10.126  15.104  1.00 0.00 ? 46  GLN A NE2  5  
ATOM 8199  H H    . GLN A 1 46  ? -11.159 7.954   9.820   1.00 0.00 ? 46  GLN A H    5  
ATOM 8200  H HA   . GLN A 1 46  ? -9.674  9.418   11.898  1.00 0.00 ? 46  GLN A HA   5  
ATOM 8201  H HB2  . GLN A 1 46  ? -11.307 6.928   11.947  1.00 0.00 ? 46  GLN A HB2  5  
ATOM 8202  H HB3  . GLN A 1 46  ? -9.921  7.021   13.025  1.00 0.00 ? 46  GLN A HB3  5  
ATOM 8203  H HG2  . GLN A 1 46  ? -11.937 9.226   12.943  1.00 0.00 ? 46  GLN A HG2  5  
ATOM 8204  H HG3  . GLN A 1 46  ? -12.234 7.762   13.879  1.00 0.00 ? 46  GLN A HG3  5  
ATOM 8205  H HE21 . GLN A 1 46  ? -11.821 10.554  14.720  1.00 0.00 ? 46  GLN A HE21 5  
ATOM 8206  H HE22 . GLN A 1 46  ? -10.506 10.510  15.840  1.00 0.00 ? 46  GLN A HE22 5  
ATOM 8207  N N    . GLY A 1 47  ? -8.610  7.184   9.848   1.00 0.00 ? 47  GLY A N    5  
ATOM 8208  C CA   . GLY A 1 47  ? -7.425  6.506   9.357   1.00 0.00 ? 47  GLY A CA   5  
ATOM 8209  C C    . GLY A 1 47  ? -7.665  5.805   8.034   1.00 0.00 ? 47  GLY A C    5  
ATOM 8210  O O    . GLY A 1 47  ? -8.335  6.341   7.152   1.00 0.00 ? 47  GLY A O    5  
ATOM 8211  H H    . GLY A 1 47  ? -9.425  7.200   9.303   1.00 0.00 ? 47  GLY A H    5  
ATOM 8212  H HA2  . GLY A 1 47  ? -6.635  7.231   9.230   1.00 0.00 ? 47  GLY A HA2  5  
ATOM 8213  H HA3  . GLY A 1 47  ? -7.114  5.774   10.087  1.00 0.00 ? 47  GLY A HA3  5  
ATOM 8214  N N    . TYR A 1 48  ? -7.115  4.604   7.895   1.00 0.00 ? 48  TYR A N    5  
ATOM 8215  C CA   . TYR A 1 48  ? -7.269  3.830   6.669   1.00 0.00 ? 48  TYR A CA   5  
ATOM 8216  C C    . TYR A 1 48  ? -7.160  2.335   6.951   1.00 0.00 ? 48  TYR A C    5  
ATOM 8217  O O    . TYR A 1 48  ? -6.105  1.842   7.352   1.00 0.00 ? 48  TYR A O    5  
ATOM 8218  C CB   . TYR A 1 48  ? -6.212  4.245   5.643   1.00 0.00 ? 48  TYR A CB   5  
ATOM 8219  C CG   . TYR A 1 48  ? -6.553  5.520   4.906   1.00 0.00 ? 48  TYR A CG   5  
ATOM 8220  C CD1  . TYR A 1 48  ? -7.523  5.533   3.912   1.00 0.00 ? 48  TYR A CD1  5  
ATOM 8221  C CD2  . TYR A 1 48  ? -5.903  6.712   5.202   1.00 0.00 ? 48  TYR A CD2  5  
ATOM 8222  C CE1  . TYR A 1 48  ? -7.837  6.696   3.235   1.00 0.00 ? 48  TYR A CE1  5  
ATOM 8223  C CE2  . TYR A 1 48  ? -6.211  7.880   4.532   1.00 0.00 ? 48  TYR A CE2  5  
ATOM 8224  C CZ   . TYR A 1 48  ? -7.179  7.867   3.549   1.00 0.00 ? 48  TYR A CZ   5  
ATOM 8225  O OH   . TYR A 1 48  ? -7.488  9.027   2.877   1.00 0.00 ? 48  TYR A OH   5  
ATOM 8226  H H    . TYR A 1 48  ? -6.591  4.229   8.634   1.00 0.00 ? 48  TYR A H    5  
ATOM 8227  H HA   . TYR A 1 48  ? -8.249  4.038   6.266   1.00 0.00 ? 48  TYR A HA   5  
ATOM 8228  H HB2  . TYR A 1 48  ? -5.270  4.395   6.147   1.00 0.00 ? 48  TYR A HB2  5  
ATOM 8229  H HB3  . TYR A 1 48  ? -6.102  3.458   4.912   1.00 0.00 ? 48  TYR A HB3  5  
ATOM 8230  H HD1  . TYR A 1 48  ? -8.037  4.615   3.668   1.00 0.00 ? 48  TYR A HD1  5  
ATOM 8231  H HD2  . TYR A 1 48  ? -5.145  6.719   5.973   1.00 0.00 ? 48  TYR A HD2  5  
ATOM 8232  H HE1  . TYR A 1 48  ? -8.595  6.686   2.465   1.00 0.00 ? 48  TYR A HE1  5  
ATOM 8233  H HE2  . TYR A 1 48  ? -5.696  8.796   4.777   1.00 0.00 ? 48  TYR A HE2  5  
ATOM 8234  H HH   . TYR A 1 48  ? -7.327  8.907   1.939   1.00 0.00 ? 48  TYR A HH   5  
ATOM 8235  N N    . ARG A 1 49  ? -8.258  1.617   6.738   1.00 0.00 ? 49  ARG A N    5  
ATOM 8236  C CA   . ARG A 1 49  ? -8.288  0.178   6.969   1.00 0.00 ? 49  ARG A CA   5  
ATOM 8237  C C    . ARG A 1 49  ? -7.773  -0.579  5.749   1.00 0.00 ? 49  ARG A C    5  
ATOM 8238  O O    . ARG A 1 49  ? -8.422  -0.607  4.703   1.00 0.00 ? 49  ARG A O    5  
ATOM 8239  C CB   . ARG A 1 49  ? -9.710  -0.277  7.303   1.00 0.00 ? 49  ARG A CB   5  
ATOM 8240  C CG   . ARG A 1 49  ? -9.779  -1.677  7.890   1.00 0.00 ? 49  ARG A CG   5  
ATOM 8241  C CD   . ARG A 1 49  ? -9.683  -1.651  9.407   1.00 0.00 ? 49  ARG A CD   5  
ATOM 8242  N NE   . ARG A 1 49  ? -10.890 -1.106  10.022  1.00 0.00 ? 49  ARG A NE   5  
ATOM 8243  C CZ   . ARG A 1 49  ? -11.274 -1.386  11.263  1.00 0.00 ? 49  ARG A CZ   5  
ATOM 8244  N NH1  . ARG A 1 49  ? -10.548 -2.200  12.017  1.00 0.00 ? 49  ARG A NH1  5  
ATOM 8245  N NH2  . ARG A 1 49  ? -12.385 -0.851  11.752  1.00 0.00 ? 49  ARG A NH2  5  
ATOM 8246  H H    . ARG A 1 49  ? -9.068  2.067   6.418   1.00 0.00 ? 49  ARG A H    5  
ATOM 8247  H HA   . ARG A 1 49  ? -7.644  -0.036  7.809   1.00 0.00 ? 49  ARG A HA   5  
ATOM 8248  H HB2  . ARG A 1 49  ? -10.137 0.411   8.018   1.00 0.00 ? 49  ARG A HB2  5  
ATOM 8249  H HB3  . ARG A 1 49  ? -10.301 -0.259  6.400   1.00 0.00 ? 49  ARG A HB3  5  
ATOM 8250  H HG2  . ARG A 1 49  ? -10.718 -2.130  7.607   1.00 0.00 ? 49  ARG A HG2  5  
ATOM 8251  H HG3  . ARG A 1 49  ? -8.961  -2.263  7.496   1.00 0.00 ? 49  ARG A HG3  5  
ATOM 8252  H HD2  . ARG A 1 49  ? -9.534  -2.659  9.763   1.00 0.00 ? 49  ARG A HD2  5  
ATOM 8253  H HD3  . ARG A 1 49  ? -8.839  -1.040  9.690   1.00 0.00 ? 49  ARG A HD3  5  
ATOM 8254  H HE   . ARG A 1 49  ? -11.442 -0.502  9.483   1.00 0.00 ? 49  ARG A HE   5  
ATOM 8255  H HH11 . ARG A 1 49  ? -9.710  -2.604  11.651  1.00 0.00 ? 49  ARG A HH11 5  
ATOM 8256  H HH12 . ARG A 1 49  ? -10.839 -2.409  12.951  1.00 0.00 ? 49  ARG A HH12 5  
ATOM 8257  H HH21 . ARG A 1 49  ? -12.935 -0.236  11.187  1.00 0.00 ? 49  ARG A HH21 5  
ATOM 8258  H HH22 . ARG A 1 49  ? -12.673 -1.063  12.685  1.00 0.00 ? 49  ARG A HH22 5  
ATOM 8259  N N    . VAL A 1 50  ? -6.602  -1.192  5.890   1.00 0.00 ? 50  VAL A N    5  
ATOM 8260  C CA   . VAL A 1 50  ? -6.000  -1.951  4.800   1.00 0.00 ? 50  VAL A CA   5  
ATOM 8261  C C    . VAL A 1 50  ? -6.180  -3.450  5.008   1.00 0.00 ? 50  VAL A C    5  
ATOM 8262  O O    . VAL A 1 50  ? -5.438  -4.075  5.766   1.00 0.00 ? 50  VAL A O    5  
ATOM 8263  C CB   . VAL A 1 50  ? -4.498  -1.640  4.662   1.00 0.00 ? 50  VAL A CB   5  
ATOM 8264  C CG1  . VAL A 1 50  ? -3.898  -2.407  3.493   1.00 0.00 ? 50  VAL A CG1  5  
ATOM 8265  C CG2  . VAL A 1 50  ? -4.277  -0.143  4.498   1.00 0.00 ? 50  VAL A CG2  5  
ATOM 8266  H H    . VAL A 1 50  ? -6.132  -1.134  6.748   1.00 0.00 ? 50  VAL A H    5  
ATOM 8267  H HA   . VAL A 1 50  ? -6.491  -1.663  3.882   1.00 0.00 ? 50  VAL A HA   5  
ATOM 8268  H HB   . VAL A 1 50  ? -4.000  -1.958  5.566   1.00 0.00 ? 50  VAL A HB   5  
ATOM 8269  H HG11 . VAL A 1 50  ? -2.820  -2.370  3.554   1.00 0.00 ? 50  VAL A HG11 5  
ATOM 8270  H HG12 . VAL A 1 50  ? -4.227  -3.435  3.531   1.00 0.00 ? 50  VAL A HG12 5  
ATOM 8271  H HG13 . VAL A 1 50  ? -4.221  -1.958  2.565   1.00 0.00 ? 50  VAL A HG13 5  
ATOM 8272  H HG21 . VAL A 1 50  ? -3.904  0.268   5.424   1.00 0.00 ? 50  VAL A HG21 5  
ATOM 8273  H HG22 . VAL A 1 50  ? -3.557  0.031   3.711   1.00 0.00 ? 50  VAL A HG22 5  
ATOM 8274  H HG23 . VAL A 1 50  ? -5.211  0.333   4.242   1.00 0.00 ? 50  VAL A HG23 5  
ATOM 8275  N N    . MET A 1 51  ? -7.170  -4.022  4.331   1.00 0.00 ? 51  MET A N    5  
ATOM 8276  C CA   . MET A 1 51  ? -7.447  -5.449  4.441   1.00 0.00 ? 51  MET A CA   5  
ATOM 8277  C C    . MET A 1 51  ? -6.564  -6.249  3.488   1.00 0.00 ? 51  MET A C    5  
ATOM 8278  O O    . MET A 1 51  ? -6.419  -5.896  2.317   1.00 0.00 ? 51  MET A O    5  
ATOM 8279  C CB   . MET A 1 51  ? -8.921  -5.729  4.144   1.00 0.00 ? 51  MET A CB   5  
ATOM 8280  C CG   . MET A 1 51  ? -9.863  -5.242  5.234   1.00 0.00 ? 51  MET A CG   5  
ATOM 8281  S SD   . MET A 1 51  ? -11.569 -5.758  4.958   1.00 0.00 ? 51  MET A SD   5  
ATOM 8282  C CE   . MET A 1 51  ? -11.445 -7.518  5.266   1.00 0.00 ? 51  MET A CE   5  
ATOM 8283  H H    . MET A 1 51  ? -7.728  -3.471  3.742   1.00 0.00 ? 51  MET A H    5  
ATOM 8284  H HA   . MET A 1 51  ? -7.229  -5.752  5.454   1.00 0.00 ? 51  MET A HA   5  
ATOM 8285  H HB2  . MET A 1 51  ? -9.190  -5.239  3.221   1.00 0.00 ? 51  MET A HB2  5  
ATOM 8286  H HB3  . MET A 1 51  ? -9.058  -6.794  4.031   1.00 0.00 ? 51  MET A HB3  5  
ATOM 8287  H HG2  . MET A 1 51  ? -9.532  -5.638  6.182   1.00 0.00 ? 51  MET A HG2  5  
ATOM 8288  H HG3  . MET A 1 51  ? -9.828  -4.163  5.265   1.00 0.00 ? 51  MET A HG3  5  
ATOM 8289  H HE1  . MET A 1 51  ? -12.073 -7.783  6.103   1.00 0.00 ? 51  MET A HE1  5  
ATOM 8290  H HE2  . MET A 1 51  ? -11.766 -8.060  4.388   1.00 0.00 ? 51  MET A HE2  5  
ATOM 8291  H HE3  . MET A 1 51  ? -10.419 -7.772  5.491   1.00 0.00 ? 51  MET A HE3  5  
ATOM 8292  N N    . TYR A 1 52  ? -5.976  -7.326  3.997   1.00 0.00 ? 52  TYR A N    5  
ATOM 8293  C CA   . TYR A 1 52  ? -5.105  -8.174  3.192   1.00 0.00 ? 52  TYR A CA   5  
ATOM 8294  C C    . TYR A 1 52  ? -5.225  -9.635  3.614   1.00 0.00 ? 52  TYR A C    5  
ATOM 8295  O O    . TYR A 1 52  ? -5.585  -9.936  4.752   1.00 0.00 ? 52  TYR A O    5  
ATOM 8296  C CB   . TYR A 1 52  ? -3.652  -7.713  3.316   1.00 0.00 ? 52  TYR A CB   5  
ATOM 8297  C CG   . TYR A 1 52  ? -3.096  -7.834  4.717   1.00 0.00 ? 52  TYR A CG   5  
ATOM 8298  C CD1  . TYR A 1 52  ? -3.564  -7.024  5.744   1.00 0.00 ? 52  TYR A CD1  5  
ATOM 8299  C CD2  . TYR A 1 52  ? -2.104  -8.761  5.014   1.00 0.00 ? 52  TYR A CD2  5  
ATOM 8300  C CE1  . TYR A 1 52  ? -3.058  -7.131  7.025   1.00 0.00 ? 52  TYR A CE1  5  
ATOM 8301  C CE2  . TYR A 1 52  ? -1.593  -8.876  6.292   1.00 0.00 ? 52  TYR A CE2  5  
ATOM 8302  C CZ   . TYR A 1 52  ? -2.073  -8.059  7.294   1.00 0.00 ? 52  TYR A CZ   5  
ATOM 8303  O OH   . TYR A 1 52  ? -1.568  -8.170  8.569   1.00 0.00 ? 52  TYR A OH   5  
ATOM 8304  H H    . TYR A 1 52  ? -6.130  -7.556  4.937   1.00 0.00 ? 52  TYR A H    5  
ATOM 8305  H HA   . TYR A 1 52  ? -5.414  -8.083  2.161   1.00 0.00 ? 52  TYR A HA   5  
ATOM 8306  H HB2  . TYR A 1 52  ? -3.035  -8.309  2.662   1.00 0.00 ? 52  TYR A HB2  5  
ATOM 8307  H HB3  . TYR A 1 52  ? -3.584  -6.676  3.021   1.00 0.00 ? 52  TYR A HB3  5  
ATOM 8308  H HD1  . TYR A 1 52  ? -4.335  -6.299  5.530   1.00 0.00 ? 52  TYR A HD1  5  
ATOM 8309  H HD2  . TYR A 1 52  ? -1.730  -9.400  4.226   1.00 0.00 ? 52  TYR A HD2  5  
ATOM 8310  H HE1  . TYR A 1 52  ? -3.434  -6.492  7.810   1.00 0.00 ? 52  TYR A HE1  5  
ATOM 8311  H HE2  . TYR A 1 52  ? -0.822  -9.602  6.503   1.00 0.00 ? 52  TYR A HE2  5  
ATOM 8312  H HH   . TYR A 1 52  ? -2.260  -8.473  9.162   1.00 0.00 ? 52  TYR A HH   5  
ATOM 8313  N N    . ARG A 1 53  ? -4.919  -10.539 2.689   1.00 0.00 ? 53  ARG A N    5  
ATOM 8314  C CA   . ARG A 1 53  ? -4.993  -11.969 2.963   1.00 0.00 ? 53  ARG A CA   5  
ATOM 8315  C C    . ARG A 1 53  ? -4.318  -12.771 1.854   1.00 0.00 ? 53  ARG A C    5  
ATOM 8316  O O    . ARG A 1 53  ? -4.047  -12.247 0.774   1.00 0.00 ? 53  ARG A O    5  
ATOM 8317  C CB   . ARG A 1 53  ? -6.451  -12.407 3.110   1.00 0.00 ? 53  ARG A CB   5  
ATOM 8318  C CG   . ARG A 1 53  ? -7.199  -12.488 1.790   1.00 0.00 ? 53  ARG A CG   5  
ATOM 8319  C CD   . ARG A 1 53  ? -8.335  -13.497 1.853   1.00 0.00 ? 53  ARG A CD   5  
ATOM 8320  N NE   . ARG A 1 53  ? -8.885  -13.785 0.532   1.00 0.00 ? 53  ARG A NE   5  
ATOM 8321  C CZ   . ARG A 1 53  ? -10.080 -14.333 0.337   1.00 0.00 ? 53  ARG A CZ   5  
ATOM 8322  N NH1  . ARG A 1 53  ? -10.845 -14.648 1.372   1.00 0.00 ? 53  ARG A NH1  5  
ATOM 8323  N NH2  . ARG A 1 53  ? -10.511 -14.565 -0.897  1.00 0.00 ? 53  ARG A NH2  5  
ATOM 8324  H H    . ARG A 1 53  ? -4.639  -10.237 1.799   1.00 0.00 ? 53  ARG A H    5  
ATOM 8325  H HA   . ARG A 1 53  ? -4.475  -12.155 3.892   1.00 0.00 ? 53  ARG A HA   5  
ATOM 8326  H HB2  . ARG A 1 53  ? -6.477  -13.383 3.573   1.00 0.00 ? 53  ARG A HB2  5  
ATOM 8327  H HB3  . ARG A 1 53  ? -6.964  -11.702 3.747   1.00 0.00 ? 53  ARG A HB3  5  
ATOM 8328  H HG2  . ARG A 1 53  ? -7.608  -11.515 1.559   1.00 0.00 ? 53  ARG A HG2  5  
ATOM 8329  H HG3  . ARG A 1 53  ? -6.509  -12.784 1.014   1.00 0.00 ? 53  ARG A HG3  5  
ATOM 8330  H HD2  . ARG A 1 53  ? -7.961  -14.413 2.285   1.00 0.00 ? 53  ARG A HD2  5  
ATOM 8331  H HD3  . ARG A 1 53  ? -9.118  -13.097 2.480   1.00 0.00 ? 53  ARG A HD3  5  
ATOM 8332  H HE   . ARG A 1 53  ? -8.336  -13.560 -0.248  1.00 0.00 ? 53  ARG A HE   5  
ATOM 8333  H HH11 . ARG A 1 53  ? -10.523 -14.474 2.302   1.00 0.00 ? 53  ARG A HH11 5  
ATOM 8334  H HH12 . ARG A 1 53  ? -11.745 -15.059 1.222   1.00 0.00 ? 53  ARG A HH12 5  
ATOM 8335  H HH21 . ARG A 1 53  ? -9.937  -14.328 -1.680  1.00 0.00 ? 53  ARG A HH21 5  
ATOM 8336  H HH22 . ARG A 1 53  ? -11.410 -14.977 -1.042  1.00 0.00 ? 53  ARG A HH22 5  
ATOM 8337  N N    . GLN A 1 54  ? -4.051  -14.043 2.130   1.00 0.00 ? 54  GLN A N    5  
ATOM 8338  C CA   . GLN A 1 54  ? -3.407  -14.916 1.156   1.00 0.00 ? 54  GLN A CA   5  
ATOM 8339  C C    . GLN A 1 54  ? -4.412  -15.409 0.119   1.00 0.00 ? 54  GLN A C    5  
ATOM 8340  O O    . GLN A 1 54  ? -5.595  -15.578 0.416   1.00 0.00 ? 54  GLN A O    5  
ATOM 8341  C CB   . GLN A 1 54  ? -2.756  -16.108 1.860   1.00 0.00 ? 54  GLN A CB   5  
ATOM 8342  C CG   . GLN A 1 54  ? -1.606  -16.722 1.078   1.00 0.00 ? 54  GLN A CG   5  
ATOM 8343  C CD   . GLN A 1 54  ? -0.644  -17.491 1.963   1.00 0.00 ? 54  GLN A CD   5  
ATOM 8344  O OE1  . GLN A 1 54  ? -0.316  -17.056 3.067   1.00 0.00 ? 54  GLN A OE1  5  
ATOM 8345  N NE2  . GLN A 1 54  ? -0.186  -18.640 1.481   1.00 0.00 ? 54  GLN A NE2  5  
ATOM 8346  H H    . GLN A 1 54  ? -4.291  -14.402 3.009   1.00 0.00 ? 54  GLN A H    5  
ATOM 8347  H HA   . GLN A 1 54  ? -2.642  -14.345 0.653   1.00 0.00 ? 54  GLN A HA   5  
ATOM 8348  H HB2  . GLN A 1 54  ? -2.380  -15.784 2.818   1.00 0.00 ? 54  GLN A HB2  5  
ATOM 8349  H HB3  . GLN A 1 54  ? -3.504  -16.872 2.015   1.00 0.00 ? 54  GLN A HB3  5  
ATOM 8350  H HG2  . GLN A 1 54  ? -2.009  -17.398 0.339   1.00 0.00 ? 54  GLN A HG2  5  
ATOM 8351  H HG3  . GLN A 1 54  ? -1.062  -15.931 0.582   1.00 0.00 ? 54  GLN A HG3  5  
ATOM 8352  H HE21 . GLN A 1 54  ? -0.490  -18.923 0.593   1.00 0.00 ? 54  GLN A HE21 5  
ATOM 8353  H HE22 . GLN A 1 54  ? 0.437   -19.157 2.031   1.00 0.00 ? 54  GLN A HE22 5  
ATOM 8354  N N    . THR A 1 55  ? -3.933  -15.639 -1.099  1.00 0.00 ? 55  THR A N    5  
ATOM 8355  C CA   . THR A 1 55  ? -4.788  -16.111 -2.181  1.00 0.00 ? 55  THR A CA   5  
ATOM 8356  C C    . THR A 1 55  ? -4.410  -17.526 -2.604  1.00 0.00 ? 55  THR A C    5  
ATOM 8357  O O    . THR A 1 55  ? -5.252  -18.289 -3.074  1.00 0.00 ? 55  THR A O    5  
ATOM 8358  C CB   . THR A 1 55  ? -4.709  -15.182 -3.407  1.00 0.00 ? 55  THR A CB   5  
ATOM 8359  O OG1  . THR A 1 55  ? -3.348  -15.047 -3.831  1.00 0.00 ? 55  THR A OG1  5  
ATOM 8360  C CG2  . THR A 1 55  ? -5.283  -13.810 -3.084  1.00 0.00 ? 55  THR A CG2  5  
ATOM 8361  H H    . THR A 1 55  ? -2.980  -15.486 -1.274  1.00 0.00 ? 55  THR A H    5  
ATOM 8362  H HA   . THR A 1 55  ? -5.808  -16.113 -1.822  1.00 0.00 ? 55  THR A HA   5  
ATOM 8363  H HB   . THR A 1 55  ? -5.287  -15.619 -4.208  1.00 0.00 ? 55  THR A HB   5  
ATOM 8364  H HG1  . THR A 1 55  ? -3.041  -15.882 -4.194  1.00 0.00 ? 55  THR A HG1  5  
ATOM 8365  H HG21 . THR A 1 55  ? -5.886  -13.873 -2.191  1.00 0.00 ? 55  THR A HG21 5  
ATOM 8366  H HG22 . THR A 1 55  ? -5.893  -13.473 -3.909  1.00 0.00 ? 55  THR A HG22 5  
ATOM 8367  H HG23 . THR A 1 55  ? -4.476  -13.111 -2.925  1.00 0.00 ? 55  THR A HG23 5  
ATOM 8368  N N    . SER A 1 56  ? -3.137  -17.869 -2.433  1.00 0.00 ? 56  SER A N    5  
ATOM 8369  C CA   . SER A 1 56  ? -2.646  -19.192 -2.800  1.00 0.00 ? 56  SER A CA   5  
ATOM 8370  C C    . SER A 1 56  ? -2.261  -19.992 -1.560  1.00 0.00 ? 56  SER A C    5  
ATOM 8371  O O    . SER A 1 56  ? -1.946  -19.425 -0.515  1.00 0.00 ? 56  SER A O    5  
ATOM 8372  C CB   . SER A 1 56  ? -1.443  -19.070 -3.737  1.00 0.00 ? 56  SER A CB   5  
ATOM 8373  O OG   . SER A 1 56  ? -1.320  -20.217 -4.561  1.00 0.00 ? 56  SER A OG   5  
ATOM 8374  H H    . SER A 1 56  ? -2.513  -17.215 -2.053  1.00 0.00 ? 56  SER A H    5  
ATOM 8375  H HA   . SER A 1 56  ? -3.442  -19.709 -3.316  1.00 0.00 ? 56  SER A HA   5  
ATOM 8376  H HB2  . SER A 1 56  ? -1.565  -18.202 -4.366  1.00 0.00 ? 56  SER A HB2  5  
ATOM 8377  H HB3  . SER A 1 56  ? -0.542  -18.966 -3.150  1.00 0.00 ? 56  SER A HB3  5  
ATOM 8378  H HG   . SER A 1 56  ? -1.631  -20.010 -5.445  1.00 0.00 ? 56  SER A HG   5  
ATOM 8379  N N    . GLY A 1 57  ? -2.288  -21.316 -1.685  1.00 0.00 ? 57  GLY A N    5  
ATOM 8380  C CA   . GLY A 1 57  ? -1.940  -22.174 -0.568  1.00 0.00 ? 57  GLY A CA   5  
ATOM 8381  C C    . GLY A 1 57  ? -3.049  -22.262 0.463   1.00 0.00 ? 57  GLY A C    5  
ATOM 8382  O O    . GLY A 1 57  ? -4.114  -21.669 0.292   1.00 0.00 ? 57  GLY A O    5  
ATOM 8383  H H    . GLY A 1 57  ? -2.547  -21.713 -2.543  1.00 0.00 ? 57  GLY A H    5  
ATOM 8384  H HA2  . GLY A 1 57  ? -1.730  -23.165 -0.941  1.00 0.00 ? 57  GLY A HA2  5  
ATOM 8385  H HA3  . GLY A 1 57  ? -1.053  -21.783 -0.092  1.00 0.00 ? 57  GLY A HA3  5  
ATOM 8386  N N    . LEU A 1 58  ? -2.799  -23.005 1.535   1.00 0.00 ? 58  LEU A N    5  
ATOM 8387  C CA   . LEU A 1 58  ? -3.785  -23.171 2.597   1.00 0.00 ? 58  LEU A CA   5  
ATOM 8388  C C    . LEU A 1 58  ? -4.181  -21.822 3.189   1.00 0.00 ? 58  LEU A C    5  
ATOM 8389  O O    . LEU A 1 58  ? -5.364  -21.502 3.291   1.00 0.00 ? 58  LEU A O    5  
ATOM 8390  C CB   . LEU A 1 58  ? -3.232  -24.080 3.696   1.00 0.00 ? 58  LEU A CB   5  
ATOM 8391  C CG   . LEU A 1 58  ? -4.248  -24.989 4.389   1.00 0.00 ? 58  LEU A CG   5  
ATOM 8392  C CD1  . LEU A 1 58  ? -5.285  -24.162 5.132   1.00 0.00 ? 58  LEU A CD1  5  
ATOM 8393  C CD2  . LEU A 1 58  ? -4.919  -25.907 3.378   1.00 0.00 ? 58  LEU A CD2  5  
ATOM 8394  H H    . LEU A 1 58  ? -1.932  -23.454 1.616   1.00 0.00 ? 58  LEU A H    5  
ATOM 8395  H HA   . LEU A 1 58  ? -4.662  -23.632 2.167   1.00 0.00 ? 58  LEU A HA   5  
ATOM 8396  H HB2  . LEU A 1 58  ? -2.474  -24.708 3.255   1.00 0.00 ? 58  LEU A HB2  5  
ATOM 8397  H HB3  . LEU A 1 58  ? -2.782  -23.450 4.450   1.00 0.00 ? 58  LEU A HB3  5  
ATOM 8398  H HG   . LEU A 1 58  ? -3.734  -25.607 5.113   1.00 0.00 ? 58  LEU A HG   5  
ATOM 8399  H HD11 . LEU A 1 58  ? -6.243  -24.657 5.081   1.00 0.00 ? 58  LEU A HD11 5  
ATOM 8400  H HD12 . LEU A 1 58  ? -5.360  -23.185 4.678   1.00 0.00 ? 58  LEU A HD12 5  
ATOM 8401  H HD13 . LEU A 1 58  ? -4.988  -24.056 6.166   1.00 0.00 ? 58  LEU A HD13 5  
ATOM 8402  H HD21 . LEU A 1 58  ? -4.639  -25.607 2.379   1.00 0.00 ? 58  LEU A HD21 5  
ATOM 8403  H HD22 . LEU A 1 58  ? -5.992  -25.839 3.487   1.00 0.00 ? 58  LEU A HD22 5  
ATOM 8404  H HD23 . LEU A 1 58  ? -4.603  -26.925 3.551   1.00 0.00 ? 58  LEU A HD23 5  
ATOM 8405  N N    . GLN A 1 59  ? -3.181  -21.035 3.574   1.00 0.00 ? 59  GLN A N    5  
ATOM 8406  C CA   . GLN A 1 59  ? -3.425  -19.719 4.153   1.00 0.00 ? 59  GLN A CA   5  
ATOM 8407  C C    . GLN A 1 59  ? -4.368  -18.904 3.275   1.00 0.00 ? 59  GLN A C    5  
ATOM 8408  O O    . GLN A 1 59  ? -4.939  -17.907 3.718   1.00 0.00 ? 59  GLN A O    5  
ATOM 8409  C CB   . GLN A 1 59  ? -2.106  -18.968 4.340   1.00 0.00 ? 59  GLN A CB   5  
ATOM 8410  C CG   . GLN A 1 59  ? -1.298  -19.445 5.536   1.00 0.00 ? 59  GLN A CG   5  
ATOM 8411  C CD   . GLN A 1 59  ? -1.892  -18.998 6.857   1.00 0.00 ? 59  GLN A CD   5  
ATOM 8412  O OE1  . GLN A 1 59  ? -1.752  -17.841 7.255   1.00 0.00 ? 59  GLN A OE1  5  
ATOM 8413  N NE2  . GLN A 1 59  ? -2.561  -19.915 7.547   1.00 0.00 ? 59  GLN A NE2  5  
ATOM 8414  H H    . GLN A 1 59  ? -2.259  -21.346 3.466   1.00 0.00 ? 59  GLN A H    5  
ATOM 8415  H HA   . GLN A 1 59  ? -3.887  -19.863 5.118   1.00 0.00 ? 59  GLN A HA   5  
ATOM 8416  H HB2  . GLN A 1 59  ? -1.504  -19.095 3.453   1.00 0.00 ? 59  GLN A HB2  5  
ATOM 8417  H HB3  . GLN A 1 59  ? -2.319  -17.918 4.474   1.00 0.00 ? 59  GLN A HB3  5  
ATOM 8418  H HG2  . GLN A 1 59  ? -1.262  -20.525 5.523   1.00 0.00 ? 59  GLN A HG2  5  
ATOM 8419  H HG3  . GLN A 1 59  ? -0.296  -19.052 5.457   1.00 0.00 ? 59  GLN A HG3  5  
ATOM 8420  H HE21 . GLN A 1 59  ? -2.631  -20.817 7.169   1.00 0.00 ? 59  GLN A HE21 5  
ATOM 8421  H HE22 . GLN A 1 59  ? -2.954  -19.654 8.404   1.00 0.00 ? 59  GLN A HE22 5  
ATOM 8422  N N    . ALA A 1 60  ? -4.527  -19.333 2.027   1.00 0.00 ? 60  ALA A N    5  
ATOM 8423  C CA   . ALA A 1 60  ? -5.402  -18.644 1.087   1.00 0.00 ? 60  ALA A CA   5  
ATOM 8424  C C    . ALA A 1 60  ? -6.839  -18.613 1.596   1.00 0.00 ? 60  ALA A C    5  
ATOM 8425  O O    . ALA A 1 60  ? -7.195  -19.338 2.526   1.00 0.00 ? 60  ALA A O    5  
ATOM 8426  C CB   . ALA A 1 60  ? -5.338  -19.311 -0.279  1.00 0.00 ? 60  ALA A CB   5  
ATOM 8427  H H    . ALA A 1 60  ? -4.045  -20.134 1.733   1.00 0.00 ? 60  ALA A H    5  
ATOM 8428  H HA   . ALA A 1 60  ? -5.046  -17.629 0.982   1.00 0.00 ? 60  ALA A HA   5  
ATOM 8429  H HB1  . ALA A 1 60  ? -4.307  -19.390 -0.592  1.00 0.00 ? 60  ALA A HB1  5  
ATOM 8430  H HB2  . ALA A 1 60  ? -5.773  -20.297 -0.219  1.00 0.00 ? 60  ALA A HB2  5  
ATOM 8431  H HB3  . ALA A 1 60  ? -5.887  -18.717 -0.995  1.00 0.00 ? 60  ALA A HB3  5  
ATOM 8432  N N    . THR A 1 61  ? -7.661  -17.768 0.982   1.00 0.00 ? 61  THR A N    5  
ATOM 8433  C CA   . THR A 1 61  ? -9.059  -17.642 1.374   1.00 0.00 ? 61  THR A CA   5  
ATOM 8434  C C    . THR A 1 61  ? -9.229  -17.840 2.876   1.00 0.00 ? 61  THR A C    5  
ATOM 8435  O O    . THR A 1 61  ? -10.214 -18.426 3.327   1.00 0.00 ? 61  THR A O    5  
ATOM 8436  C CB   . THR A 1 61  ? -9.946  -18.657 0.629   1.00 0.00 ? 61  THR A CB   5  
ATOM 8437  O OG1  . THR A 1 61  ? -11.328 -18.357 0.852   1.00 0.00 ? 61  THR A OG1  5  
ATOM 8438  C CG2  . THR A 1 61  ? -9.649  -20.076 1.092   1.00 0.00 ? 61  THR A CG2  5  
ATOM 8439  H H    . THR A 1 61  ? -7.318  -17.217 0.248   1.00 0.00 ? 61  THR A H    5  
ATOM 8440  H HA   . THR A 1 61  ? -9.390  -16.647 1.113   1.00 0.00 ? 61  THR A HA   5  
ATOM 8441  H HB   . THR A 1 61  ? -9.736  -18.588 -0.428  1.00 0.00 ? 61  THR A HB   5  
ATOM 8442  H HG1  . THR A 1 61  ? -11.857 -19.141 0.685   1.00 0.00 ? 61  THR A HG1  5  
ATOM 8443  H HG21 . THR A 1 61  ? -9.228  -20.050 2.086   1.00 0.00 ? 61  THR A HG21 5  
ATOM 8444  H HG22 . THR A 1 61  ? -8.945  -20.535 0.414   1.00 0.00 ? 61  THR A HG22 5  
ATOM 8445  H HG23 . THR A 1 61  ? -10.564 -20.649 1.104   1.00 0.00 ? 61  THR A HG23 5  
ATOM 8446  N N    . SER A 1 62  ? -8.264  -17.349 3.646   1.00 0.00 ? 62  SER A N    5  
ATOM 8447  C CA   . SER A 1 62  ? -8.305  -17.476 5.098   1.00 0.00 ? 62  SER A CA   5  
ATOM 8448  C C    . SER A 1 62  ? -8.851  -16.204 5.739   1.00 0.00 ? 62  SER A C    5  
ATOM 8449  O O    . SER A 1 62  ? -8.905  -15.150 5.105   1.00 0.00 ? 62  SER A O    5  
ATOM 8450  C CB   . SER A 1 62  ? -6.909  -17.778 5.645   1.00 0.00 ? 62  SER A CB   5  
ATOM 8451  O OG   . SER A 1 62  ? -6.052  -16.659 5.500   1.00 0.00 ? 62  SER A OG   5  
ATOM 8452  H H    . SER A 1 62  ? -7.504  -16.893 3.227   1.00 0.00 ? 62  SER A H    5  
ATOM 8453  H HA   . SER A 1 62  ? -8.963  -18.298 5.340   1.00 0.00 ? 62  SER A HA   5  
ATOM 8454  H HB2  . SER A 1 62  ? -6.981  -18.027 6.693   1.00 0.00 ? 62  SER A HB2  5  
ATOM 8455  H HB3  . SER A 1 62  ? -6.486  -18.613 5.105   1.00 0.00 ? 62  SER A HB3  5  
ATOM 8456  H HG   . SER A 1 62  ? -5.955  -16.217 6.347   1.00 0.00 ? 62  SER A HG   5  
ATOM 8457  N N    . SER A 1 63  ? -9.255  -16.311 7.001   1.00 0.00 ? 63  SER A N    5  
ATOM 8458  C CA   . SER A 1 63  ? -9.800  -15.170 7.728   1.00 0.00 ? 63  SER A CA   5  
ATOM 8459  C C    . SER A 1 63  ? -9.111  -13.876 7.306   1.00 0.00 ? 63  SER A C    5  
ATOM 8460  O O    . SER A 1 63  ? -7.928  -13.674 7.576   1.00 0.00 ? 63  SER A O    5  
ATOM 8461  C CB   . SER A 1 63  ? -9.642  -15.377 9.236   1.00 0.00 ? 63  SER A CB   5  
ATOM 8462  O OG   . SER A 1 63  ? -8.274  -15.467 9.597   1.00 0.00 ? 63  SER A OG   5  
ATOM 8463  H H    . SER A 1 63  ? -9.186  -17.178 7.453   1.00 0.00 ? 63  SER A H    5  
ATOM 8464  H HA   . SER A 1 63  ? -10.851 -15.099 7.492   1.00 0.00 ? 63  SER A HA   5  
ATOM 8465  H HB2  . SER A 1 63  ? -10.086 -14.544 9.759   1.00 0.00 ? 63  SER A HB2  5  
ATOM 8466  H HB3  . SER A 1 63  ? -10.139 -16.291 9.525   1.00 0.00 ? 63  SER A HB3  5  
ATOM 8467  H HG   . SER A 1 63  ? -7.799  -15.970 8.932   1.00 0.00 ? 63  SER A HG   5  
ATOM 8468  N N    . TRP A 1 64  ? -9.861  -13.005 6.641   1.00 0.00 ? 64  TRP A N    5  
ATOM 8469  C CA   . TRP A 1 64  ? -9.323  -11.730 6.180   1.00 0.00 ? 64  TRP A CA   5  
ATOM 8470  C C    . TRP A 1 64  ? -8.731  -10.938 7.340   1.00 0.00 ? 64  TRP A C    5  
ATOM 8471  O O    . TRP A 1 64  ? -9.248  -10.976 8.456   1.00 0.00 ? 64  TRP A O    5  
ATOM 8472  C CB   . TRP A 1 64  ? -10.417 -10.911 5.492   1.00 0.00 ? 64  TRP A CB   5  
ATOM 8473  C CG   . TRP A 1 64  ? -10.492 -11.143 4.013   1.00 0.00 ? 64  TRP A CG   5  
ATOM 8474  C CD1  . TRP A 1 64  ? -11.304 -12.028 3.363   1.00 0.00 ? 64  TRP A CD1  5  
ATOM 8475  C CD2  . TRP A 1 64  ? -9.724  -10.482 3.002   1.00 0.00 ? 64  TRP A CD2  5  
ATOM 8476  N NE1  . TRP A 1 64  ? -11.087 -11.957 2.008   1.00 0.00 ? 64  TRP A NE1  5  
ATOM 8477  C CE2  . TRP A 1 64  ? -10.123 -11.016 1.761   1.00 0.00 ? 64  TRP A CE2  5  
ATOM 8478  C CE3  . TRP A 1 64  ? -8.740  -9.490  3.023   1.00 0.00 ? 64  TRP A CE3  5  
ATOM 8479  C CZ2  . TRP A 1 64  ? -9.571  -10.590 0.556   1.00 0.00 ? 64  TRP A CZ2  5  
ATOM 8480  C CZ3  . TRP A 1 64  ? -8.193  -9.069  1.826   1.00 0.00 ? 64  TRP A CZ3  5  
ATOM 8481  C CH2  . TRP A 1 64  ? -8.609  -9.617  0.606   1.00 0.00 ? 64  TRP A CH2  5  
ATOM 8482  H H    . TRP A 1 64  ? -10.798 -13.224 6.455   1.00 0.00 ? 64  TRP A H    5  
ATOM 8483  H HA   . TRP A 1 64  ? -8.541  -11.940 5.466   1.00 0.00 ? 64  TRP A HA   5  
ATOM 8484  H HB2  . TRP A 1 64  ? -11.374 -11.169 5.919   1.00 0.00 ? 64  TRP A HB2  5  
ATOM 8485  H HB3  . TRP A 1 64  ? -10.225 -9.860  5.656   1.00 0.00 ? 64  TRP A HB3  5  
ATOM 8486  H HD1  . TRP A 1 64  ? -12.006 -12.683 3.855   1.00 0.00 ? 64  TRP A HD1  5  
ATOM 8487  H HE1  . TRP A 1 64  ? -11.549 -12.493 1.329   1.00 0.00 ? 64  TRP A HE1  5  
ATOM 8488  H HE3  . TRP A 1 64  ? -8.406  -9.055  3.954   1.00 0.00 ? 64  TRP A HE3  5  
ATOM 8489  H HZ2  . TRP A 1 64  ? -9.882  -11.002 -0.393  1.00 0.00 ? 64  TRP A HZ2  5  
ATOM 8490  H HZ3  . TRP A 1 64  ? -7.431  -8.303  1.823   1.00 0.00 ? 64  TRP A HZ3  5  
ATOM 8491  H HH2  . TRP A 1 64  ? -8.154  -9.259  -0.304  1.00 0.00 ? 64  TRP A HH2  5  
ATOM 8492  N N    . GLN A 1 65  ? -7.645  -10.221 7.068   1.00 0.00 ? 65  GLN A N    5  
ATOM 8493  C CA   . GLN A 1 65  ? -6.984  -9.420  8.092   1.00 0.00 ? 65  GLN A CA   5  
ATOM 8494  C C    . GLN A 1 65  ? -7.217  -7.932  7.854   1.00 0.00 ? 65  GLN A C    5  
ATOM 8495  O O    . GLN A 1 65  ? -7.526  -7.512  6.739   1.00 0.00 ? 65  GLN A O    5  
ATOM 8496  C CB   . GLN A 1 65  ? -5.483  -9.716  8.110   1.00 0.00 ? 65  GLN A CB   5  
ATOM 8497  C CG   . GLN A 1 65  ? -5.154  -11.177 8.374   1.00 0.00 ? 65  GLN A CG   5  
ATOM 8498  C CD   . GLN A 1 65  ? -3.689  -11.494 8.154   1.00 0.00 ? 65  GLN A CD   5  
ATOM 8499  O OE1  . GLN A 1 65  ? -3.210  -11.515 7.019   1.00 0.00 ? 65  GLN A OE1  5  
ATOM 8500  N NE2  . GLN A 1 65  ? -2.967  -11.744 9.240   1.00 0.00 ? 65  GLN A NE2  5  
ATOM 8501  H H    . GLN A 1 65  ? -7.281  -10.231 6.160   1.00 0.00 ? 65  GLN A H    5  
ATOM 8502  H HA   . GLN A 1 65  ? -7.406  -9.689  9.048   1.00 0.00 ? 65  GLN A HA   5  
ATOM 8503  H HB2  . GLN A 1 65  ? -5.062  -9.442  7.154   1.00 0.00 ? 65  GLN A HB2  5  
ATOM 8504  H HB3  . GLN A 1 65  ? -5.020  -9.120  8.883   1.00 0.00 ? 65  GLN A HB3  5  
ATOM 8505  H HG2  . GLN A 1 65  ? -5.407  -11.410 9.398   1.00 0.00 ? 65  GLN A HG2  5  
ATOM 8506  H HG3  . GLN A 1 65  ? -5.745  -11.791 7.710   1.00 0.00 ? 65  GLN A HG3  5  
ATOM 8507  H HE21 . GLN A 1 65  ? -3.416  -11.711 10.111  1.00 0.00 ? 65  GLN A HE21 5  
ATOM 8508  H HE22 . GLN A 1 65  ? -2.017  -11.953 9.126   1.00 0.00 ? 65  GLN A HE22 5  
ATOM 8509  N N    . ASN A 1 66  ? -7.068  -7.138  8.909   1.00 0.00 ? 66  ASN A N    5  
ATOM 8510  C CA   . ASN A 1 66  ? -7.264  -5.696  8.815   1.00 0.00 ? 66  ASN A CA   5  
ATOM 8511  C C    . ASN A 1 66  ? -6.156  -4.947  9.549   1.00 0.00 ? 66  ASN A C    5  
ATOM 8512  O O    . ASN A 1 66  ? -5.813  -5.280  10.684  1.00 0.00 ? 66  ASN A O    5  
ATOM 8513  C CB   . ASN A 1 66  ? -8.627  -5.306  9.392   1.00 0.00 ? 66  ASN A CB   5  
ATOM 8514  C CG   . ASN A 1 66  ? -9.680  -6.371  9.156   1.00 0.00 ? 66  ASN A CG   5  
ATOM 8515  O OD1  . ASN A 1 66  ? -9.619  -7.115  8.177   1.00 0.00 ? 66  ASN A OD1  5  
ATOM 8516  N ND2  . ASN A 1 66  ? -10.654 -6.449  10.056  1.00 0.00 ? 66  ASN A ND2  5  
ATOM 8517  H H    . ASN A 1 66  ? -6.821  -7.531  9.772   1.00 0.00 ? 66  ASN A H    5  
ATOM 8518  H HA   . ASN A 1 66  ? -7.235  -5.425  7.770   1.00 0.00 ? 66  ASN A HA   5  
ATOM 8519  H HB2  . ASN A 1 66  ? -8.529  -5.154  10.457  1.00 0.00 ? 66  ASN A HB2  5  
ATOM 8520  H HB3  . ASN A 1 66  ? -8.958  -4.389  8.930   1.00 0.00 ? 66  ASN A HB3  5  
ATOM 8521  H HD21 . ASN A 1 66  ? -10.639 -5.824  10.810  1.00 0.00 ? 66  ASN A HD21 5  
ATOM 8522  H HD22 . ASN A 1 66  ? -11.348 -7.129  9.928   1.00 0.00 ? 66  ASN A HD22 5  
ATOM 8523  N N    . LEU A 1 67  ? -5.599  -3.935  8.894   1.00 0.00 ? 67  LEU A N    5  
ATOM 8524  C CA   . LEU A 1 67  ? -4.530  -3.137  9.484   1.00 0.00 ? 67  LEU A CA   5  
ATOM 8525  C C    . LEU A 1 67  ? -4.971  -1.689  9.673   1.00 0.00 ? 67  LEU A C    5  
ATOM 8526  O O    . LEU A 1 67  ? -4.937  -0.892  8.736   1.00 0.00 ? 67  LEU A O    5  
ATOM 8527  C CB   . LEU A 1 67  ? -3.281  -3.190  8.601   1.00 0.00 ? 67  LEU A CB   5  
ATOM 8528  C CG   . LEU A 1 67  ? -2.006  -2.602  9.207   1.00 0.00 ? 67  LEU A CG   5  
ATOM 8529  C CD1  . LEU A 1 67  ? -1.350  -3.603  10.145  1.00 0.00 ? 67  LEU A CD1  5  
ATOM 8530  C CD2  . LEU A 1 67  ? -1.038  -2.184  8.109   1.00 0.00 ? 67  LEU A CD2  5  
ATOM 8531  H H    . LEU A 1 67  ? -5.915  -3.717  7.992   1.00 0.00 ? 67  LEU A H    5  
ATOM 8532  H HA   . LEU A 1 67  ? -4.296  -3.559  10.450  1.00 0.00 ? 67  LEU A HA   5  
ATOM 8533  H HB2  . LEU A 1 67  ? -3.088  -4.225  8.365   1.00 0.00 ? 67  LEU A HB2  5  
ATOM 8534  H HB3  . LEU A 1 67  ? -3.497  -2.649  7.691   1.00 0.00 ? 67  LEU A HB3  5  
ATOM 8535  H HG   . LEU A 1 67  ? -2.261  -1.723  9.782   1.00 0.00 ? 67  LEU A HG   5  
ATOM 8536  H HD11 . LEU A 1 67  ? -0.687  -3.083  10.820  1.00 0.00 ? 67  LEU A HD11 5  
ATOM 8537  H HD12 . LEU A 1 67  ? -0.785  -4.321  9.568   1.00 0.00 ? 67  LEU A HD12 5  
ATOM 8538  H HD13 . LEU A 1 67  ? -2.112  -4.117  10.712  1.00 0.00 ? 67  LEU A HD13 5  
ATOM 8539  H HD21 . LEU A 1 67  ? -0.036  -2.478  8.382   1.00 0.00 ? 67  LEU A HD21 5  
ATOM 8540  H HD22 . LEU A 1 67  ? -1.077  -1.111  7.984   1.00 0.00 ? 67  LEU A HD22 5  
ATOM 8541  H HD23 . LEU A 1 67  ? -1.315  -2.665  7.183   1.00 0.00 ? 67  LEU A HD23 5  
ATOM 8542  N N    . ASP A 1 68  ? -5.382  -1.356  10.892  1.00 0.00 ? 68  ASP A N    5  
ATOM 8543  C CA   . ASP A 1 68  ? -5.827  -0.003  11.205  1.00 0.00 ? 68  ASP A CA   5  
ATOM 8544  C C    . ASP A 1 68  ? -4.645  0.960   11.250  1.00 0.00 ? 68  ASP A C    5  
ATOM 8545  O O    . ASP A 1 68  ? -3.970  1.084   12.272  1.00 0.00 ? 68  ASP A O    5  
ATOM 8546  C CB   . ASP A 1 68  ? -6.567  0.015   12.544  1.00 0.00 ? 68  ASP A CB   5  
ATOM 8547  C CG   . ASP A 1 68  ? -7.719  -0.970  12.582  1.00 0.00 ? 68  ASP A CG   5  
ATOM 8548  O OD1  . ASP A 1 68  ? -7.473  -2.179  12.388  1.00 0.00 ? 68  ASP A OD1  5  
ATOM 8549  O OD2  . ASP A 1 68  ? -8.866  -0.532  12.808  1.00 0.00 ? 68  ASP A OD2  5  
ATOM 8550  H H    . ASP A 1 68  ? -5.386  -2.037  11.597  1.00 0.00 ? 68  ASP A H    5  
ATOM 8551  H HA   . ASP A 1 68  ? -6.503  0.312   10.426  1.00 0.00 ? 68  ASP A HA   5  
ATOM 8552  H HB2  . ASP A 1 68  ? -5.875  -0.238  13.334  1.00 0.00 ? 68  ASP A HB2  5  
ATOM 8553  H HB3  . ASP A 1 68  ? -6.958  1.007   12.717  1.00 0.00 ? 68  ASP A HB3  5  
ATOM 8554  N N    . ALA A 1 69  ? -4.401  1.641   10.135  1.00 0.00 ? 69  ALA A N    5  
ATOM 8555  C CA   . ALA A 1 69  ? -3.301  2.594   10.047  1.00 0.00 ? 69  ALA A CA   5  
ATOM 8556  C C    . ALA A 1 69  ? -3.266  3.505   11.269  1.00 0.00 ? 69  ALA A C    5  
ATOM 8557  O O    . ALA A 1 69  ? -2.194  3.866   11.756  1.00 0.00 ? 69  ALA A O    5  
ATOM 8558  C CB   . ALA A 1 69  ? -3.419  3.419   8.774   1.00 0.00 ? 69  ALA A CB   5  
ATOM 8559  H H    . ALA A 1 69  ? -4.974  1.499   9.353   1.00 0.00 ? 69  ALA A H    5  
ATOM 8560  H HA   . ALA A 1 69  ? -2.378  2.035   10.000  1.00 0.00 ? 69  ALA A HA   5  
ATOM 8561  H HB1  . ALA A 1 69  ? -4.349  3.969   8.788   1.00 0.00 ? 69  ALA A HB1  5  
ATOM 8562  H HB2  . ALA A 1 69  ? -2.592  4.111   8.716   1.00 0.00 ? 69  ALA A HB2  5  
ATOM 8563  H HB3  . ALA A 1 69  ? -3.402  2.763   7.917   1.00 0.00 ? 69  ALA A HB3  5  
ATOM 8564  N N    . LYS A 1 70  ? -4.444  3.874   11.761  1.00 0.00 ? 70  LYS A N    5  
ATOM 8565  C CA   . LYS A 1 70  ? -4.548  4.743   12.927  1.00 0.00 ? 70  LYS A CA   5  
ATOM 8566  C C    . LYS A 1 70  ? -3.927  6.107   12.646  1.00 0.00 ? 70  LYS A C    5  
ATOM 8567  O O    . LYS A 1 70  ? -3.388  6.752   13.546  1.00 0.00 ? 70  LYS A O    5  
ATOM 8568  C CB   . LYS A 1 70  ? -3.862  4.097   14.133  1.00 0.00 ? 70  LYS A CB   5  
ATOM 8569  C CG   . LYS A 1 70  ? -4.726  3.074   14.849  1.00 0.00 ? 70  LYS A CG   5  
ATOM 8570  C CD   . LYS A 1 70  ? -5.839  3.741   15.641  1.00 0.00 ? 70  LYS A CD   5  
ATOM 8571  C CE   . LYS A 1 70  ? -6.988  2.780   15.906  1.00 0.00 ? 70  LYS A CE   5  
ATOM 8572  N NZ   . LYS A 1 70  ? -6.591  1.682   16.831  1.00 0.00 ? 70  LYS A NZ   5  
ATOM 8573  H H    . LYS A 1 70  ? -5.263  3.553   11.329  1.00 0.00 ? 70  LYS A H    5  
ATOM 8574  H HA   . LYS A 1 70  ? -5.596  4.876   13.149  1.00 0.00 ? 70  LYS A HA   5  
ATOM 8575  H HB2  . LYS A 1 70  ? -2.961  3.604   13.798  1.00 0.00 ? 70  LYS A HB2  5  
ATOM 8576  H HB3  . LYS A 1 70  ? -3.597  4.871   14.839  1.00 0.00 ? 70  LYS A HB3  5  
ATOM 8577  H HG2  . LYS A 1 70  ? -5.167  2.413   14.118  1.00 0.00 ? 70  LYS A HG2  5  
ATOM 8578  H HG3  . LYS A 1 70  ? -4.107  2.503   15.527  1.00 0.00 ? 70  LYS A HG3  5  
ATOM 8579  H HD2  . LYS A 1 70  ? -5.443  4.080   16.587  1.00 0.00 ? 70  LYS A HD2  5  
ATOM 8580  H HD3  . LYS A 1 70  ? -6.211  4.587   15.080  1.00 0.00 ? 70  LYS A HD3  5  
ATOM 8581  H HE2  . LYS A 1 70  ? -7.806  3.330   16.344  1.00 0.00 ? 70  LYS A HE2  5  
ATOM 8582  H HE3  . LYS A 1 70  ? -7.305  2.351   14.967  1.00 0.00 ? 70  LYS A HE3  5  
ATOM 8583  H HZ1  . LYS A 1 70  ? -6.875  0.763   16.436  1.00 0.00 ? 70  LYS A HZ1  5  
ATOM 8584  H HZ2  . LYS A 1 70  ? -7.053  1.808   17.754  1.00 0.00 ? 70  LYS A HZ2  5  
ATOM 8585  H HZ3  . LYS A 1 70  ? -5.560  1.685   16.968  1.00 0.00 ? 70  LYS A HZ3  5  
ATOM 8586  N N    . VAL A 1 71  ? -4.008  6.543   11.393  1.00 0.00 ? 71  VAL A N    5  
ATOM 8587  C CA   . VAL A 1 71  ? -3.457  7.832   10.994  1.00 0.00 ? 71  VAL A CA   5  
ATOM 8588  C C    . VAL A 1 71  ? -4.112  8.338   9.714   1.00 0.00 ? 71  VAL A C    5  
ATOM 8589  O O    . VAL A 1 71  ? -3.883  7.816   8.623   1.00 0.00 ? 71  VAL A O    5  
ATOM 8590  C CB   . VAL A 1 71  ? -1.934  7.750   10.781  1.00 0.00 ? 71  VAL A CB   5  
ATOM 8591  C CG1  . VAL A 1 71  ? -1.349  9.136   10.558  1.00 0.00 ? 71  VAL A CG1  5  
ATOM 8592  C CG2  . VAL A 1 71  ? -1.267  7.065   11.965  1.00 0.00 ? 71  VAL A CG2  5  
ATOM 8593  H H    . VAL A 1 71  ? -4.450  5.983   10.720  1.00 0.00 ? 71  VAL A H    5  
ATOM 8594  H HA   . VAL A 1 71  ? -3.650  8.538   11.789  1.00 0.00 ? 71  VAL A HA   5  
ATOM 8595  H HB   . VAL A 1 71  ? -1.746  7.157   9.897   1.00 0.00 ? 71  VAL A HB   5  
ATOM 8596  H HG11 . VAL A 1 71  ? -2.152  9.848   10.429  1.00 0.00 ? 71  VAL A HG11 5  
ATOM 8597  H HG12 . VAL A 1 71  ? -0.751  9.417   11.412  1.00 0.00 ? 71  VAL A HG12 5  
ATOM 8598  H HG13 . VAL A 1 71  ? -0.731  9.127   9.672   1.00 0.00 ? 71  VAL A HG13 5  
ATOM 8599  H HG21 . VAL A 1 71  ? -1.473  7.624   12.866  1.00 0.00 ? 71  VAL A HG21 5  
ATOM 8600  H HG22 . VAL A 1 71  ? -1.654  6.062   12.066  1.00 0.00 ? 71  VAL A HG22 5  
ATOM 8601  H HG23 . VAL A 1 71  ? -0.200  7.024   11.803  1.00 0.00 ? 71  VAL A HG23 5  
ATOM 8602  N N    . PRO A 1 72  ? -4.946  9.380   9.848   1.00 0.00 ? 72  PRO A N    5  
ATOM 8603  C CA   . PRO A 1 72  ? -5.651  9.980   8.711   1.00 0.00 ? 72  PRO A CA   5  
ATOM 8604  C C    . PRO A 1 72  ? -4.709  10.729  7.775   1.00 0.00 ? 72  PRO A C    5  
ATOM 8605  O O    . PRO A 1 72  ? -5.072  11.061  6.646   1.00 0.00 ? 72  PRO A O    5  
ATOM 8606  C CB   . PRO A 1 72  ? -6.630  10.952  9.374   1.00 0.00 ? 72  PRO A CB   5  
ATOM 8607  C CG   . PRO A 1 72  ? -6.002  11.288  10.683  1.00 0.00 ? 72  PRO A CG   5  
ATOM 8608  C CD   . PRO A 1 72  ? -5.265  10.052  11.118  1.00 0.00 ? 72  PRO A CD   5  
ATOM 8609  H HA   . PRO A 1 72  ? -6.201  9.240   8.150   1.00 0.00 ? 72  PRO A HA   5  
ATOM 8610  H HB2  . PRO A 1 72  ? -6.746  11.830  8.754   1.00 0.00 ? 72  PRO A HB2  5  
ATOM 8611  H HB3  . PRO A 1 72  ? -7.586  10.470  9.508   1.00 0.00 ? 72  PRO A HB3  5  
ATOM 8612  H HG2  . PRO A 1 72  ? -5.314  12.111  10.560  1.00 0.00 ? 72  PRO A HG2  5  
ATOM 8613  H HG3  . PRO A 1 72  ? -6.766  11.541  11.403  1.00 0.00 ? 72  PRO A HG3  5  
ATOM 8614  H HD2  . PRO A 1 72  ? -4.364  10.318  11.651  1.00 0.00 ? 72  PRO A HD2  5  
ATOM 8615  H HD3  . PRO A 1 72  ? -5.900  9.431   11.733  1.00 0.00 ? 72  PRO A HD3  5  
ATOM 8616  N N    . THR A 1 73  ? -3.495  10.993  8.250   1.00 0.00 ? 73  THR A N    5  
ATOM 8617  C CA   . THR A 1 73  ? -2.501  11.703  7.456   1.00 0.00 ? 73  THR A CA   5  
ATOM 8618  C C    . THR A 1 73  ? -1.627  10.731  6.672   1.00 0.00 ? 73  THR A C    5  
ATOM 8619  O O    . THR A 1 73  ? -0.846  11.139  5.813   1.00 0.00 ? 73  THR A O    5  
ATOM 8620  C CB   . THR A 1 73  ? -1.601  12.586  8.341   1.00 0.00 ? 73  THR A CB   5  
ATOM 8621  O OG1  . THR A 1 73  ? -1.033  11.803  9.397   1.00 0.00 ? 73  THR A OG1  5  
ATOM 8622  C CG2  . THR A 1 73  ? -2.391  13.744  8.930   1.00 0.00 ? 73  THR A CG2  5  
ATOM 8623  H H    . THR A 1 73  ? -3.265  10.702  9.157   1.00 0.00 ? 73  THR A H    5  
ATOM 8624  H HA   . THR A 1 73  ? -3.025  12.343  6.760   1.00 0.00 ? 73  THR A HA   5  
ATOM 8625  H HB   . THR A 1 73  ? -0.804  12.986  7.731   1.00 0.00 ? 73  THR A HB   5  
ATOM 8626  H HG1  . THR A 1 73  ? -0.519  11.084  9.021   1.00 0.00 ? 73  THR A HG1  5  
ATOM 8627  H HG21 . THR A 1 73  ? -1.748  14.607  9.027   1.00 0.00 ? 73  THR A HG21 5  
ATOM 8628  H HG22 . THR A 1 73  ? -2.768  13.465  9.903   1.00 0.00 ? 73  THR A HG22 5  
ATOM 8629  H HG23 . THR A 1 73  ? -3.218  13.984  8.279   1.00 0.00 ? 73  THR A HG23 5  
ATOM 8630  N N    . GLU A 1 74  ? -1.764  9.443   6.973   1.00 0.00 ? 74  GLU A N    5  
ATOM 8631  C CA   . GLU A 1 74  ? -0.986  8.414   6.295   1.00 0.00 ? 74  GLU A CA   5  
ATOM 8632  C C    . GLU A 1 74  ? -1.759  7.837   5.113   1.00 0.00 ? 74  GLU A C    5  
ATOM 8633  O O    . GLU A 1 74  ? -2.903  7.405   5.257   1.00 0.00 ? 74  GLU A O    5  
ATOM 8634  C CB   . GLU A 1 74  ? -0.617  7.295   7.272   1.00 0.00 ? 74  GLU A CB   5  
ATOM 8635  C CG   . GLU A 1 74  ? 0.616   7.598   8.107   1.00 0.00 ? 74  GLU A CG   5  
ATOM 8636  C CD   . GLU A 1 74  ? 1.894   7.102   7.460   1.00 0.00 ? 74  GLU A CD   5  
ATOM 8637  O OE1  . GLU A 1 74  ? 2.259   5.930   7.687   1.00 0.00 ? 74  GLU A OE1  5  
ATOM 8638  O OE2  . GLU A 1 74  ? 2.530   7.887   6.726   1.00 0.00 ? 74  GLU A OE2  5  
ATOM 8639  H H    . GLU A 1 74  ? -2.403  9.180   7.668   1.00 0.00 ? 74  GLU A H    5  
ATOM 8640  H HA   . GLU A 1 74  ? -0.079  8.871   5.928   1.00 0.00 ? 74  GLU A HA   5  
ATOM 8641  H HB2  . GLU A 1 74  ? -1.449  7.130   7.942   1.00 0.00 ? 74  GLU A HB2  5  
ATOM 8642  H HB3  . GLU A 1 74  ? -0.433  6.391   6.712   1.00 0.00 ? 74  GLU A HB3  5  
ATOM 8643  H HG2  . GLU A 1 74  ? 0.690   8.666   8.242   1.00 0.00 ? 74  GLU A HG2  5  
ATOM 8644  H HG3  . GLU A 1 74  ? 0.508   7.121   9.070   1.00 0.00 ? 74  GLU A HG3  5  
ATOM 8645  N N    . ARG A 1 75  ? -1.126  7.835   3.944   1.00 0.00 ? 75  ARG A N    5  
ATOM 8646  C CA   . ARG A 1 75  ? -1.754  7.313   2.736   1.00 0.00 ? 75  ARG A CA   5  
ATOM 8647  C C    . ARG A 1 75  ? -1.065  6.032   2.274   1.00 0.00 ? 75  ARG A C    5  
ATOM 8648  O O    . ARG A 1 75  ? -1.067  5.709   1.087   1.00 0.00 ? 75  ARG A O    5  
ATOM 8649  C CB   . ARG A 1 75  ? -1.711  8.359   1.621   1.00 0.00 ? 75  ARG A CB   5  
ATOM 8650  C CG   . ARG A 1 75  ? -2.421  9.656   1.974   1.00 0.00 ? 75  ARG A CG   5  
ATOM 8651  C CD   . ARG A 1 75  ? -3.002  10.327  0.739   1.00 0.00 ? 75  ARG A CD   5  
ATOM 8652  N NE   . ARG A 1 75  ? -2.037  11.211  0.091   1.00 0.00 ? 75  ARG A NE   5  
ATOM 8653  C CZ   . ARG A 1 75  ? -2.375  12.159  -0.775  1.00 0.00 ? 75  ARG A CZ   5  
ATOM 8654  N NH1  . ARG A 1 75  ? -3.648  12.346  -1.095  1.00 0.00 ? 75  ARG A NH1  5  
ATOM 8655  N NH2  . ARG A 1 75  ? -1.439  12.924  -1.323  1.00 0.00 ? 75  ARG A NH2  5  
ATOM 8656  H H    . ARG A 1 75  ? -0.215  8.193   3.892   1.00 0.00 ? 75  ARG A H    5  
ATOM 8657  H HA   . ARG A 1 75  ? -2.785  7.090   2.968   1.00 0.00 ? 75  ARG A HA   5  
ATOM 8658  H HB2  . ARG A 1 75  ? -0.679  8.588   1.398   1.00 0.00 ? 75  ARG A HB2  5  
ATOM 8659  H HB3  . ARG A 1 75  ? -2.178  7.947   0.739   1.00 0.00 ? 75  ARG A HB3  5  
ATOM 8660  H HG2  . ARG A 1 75  ? -3.223  9.440   2.664   1.00 0.00 ? 75  ARG A HG2  5  
ATOM 8661  H HG3  . ARG A 1 75  ? -1.714  10.327  2.439   1.00 0.00 ? 75  ARG A HG3  5  
ATOM 8662  H HD2  . ARG A 1 75  ? -3.303  9.562   0.038   1.00 0.00 ? 75  ARG A HD2  5  
ATOM 8663  H HD3  . ARG A 1 75  ? -3.865  10.905  1.033   1.00 0.00 ? 75  ARG A HD3  5  
ATOM 8664  H HE   . ARG A 1 75  ? -1.090  11.090  0.313   1.00 0.00 ? 75  ARG A HE   5  
ATOM 8665  H HH11 . ARG A 1 75  ? -4.356  11.772  -0.683  1.00 0.00 ? 75  ARG A HH11 5  
ATOM 8666  H HH12 . ARG A 1 75  ? -3.900  13.062  -1.747  1.00 0.00 ? 75  ARG A HH12 5  
ATOM 8667  H HH21 . ARG A 1 75  ? -0.478  12.786  -1.084  1.00 0.00 ? 75  ARG A HH21 5  
ATOM 8668  H HH22 . ARG A 1 75  ? -1.694  13.637  -1.975  1.00 0.00 ? 75  ARG A HH22 5  
ATOM 8669  N N    . SER A 1 76  ? -0.477  5.308   3.221   1.00 0.00 ? 76  SER A N    5  
ATOM 8670  C CA   . SER A 1 76  ? 0.219   4.065   2.912   1.00 0.00 ? 76  SER A CA   5  
ATOM 8671  C C    . SER A 1 76  ? 0.196   3.117   4.106   1.00 0.00 ? 76  SER A C    5  
ATOM 8672  O O    . SER A 1 76  ? -0.161  3.509   5.217   1.00 0.00 ? 76  SER A O    5  
ATOM 8673  C CB   . SER A 1 76  ? 1.665   4.354   2.504   1.00 0.00 ? 76  SER A CB   5  
ATOM 8674  O OG   . SER A 1 76  ? 2.455   4.691   3.631   1.00 0.00 ? 76  SER A OG   5  
ATOM 8675  H H    . SER A 1 76  ? -0.511  5.619   4.151   1.00 0.00 ? 76  SER A H    5  
ATOM 8676  H HA   . SER A 1 76  ? -0.292  3.596   2.084   1.00 0.00 ? 76  SER A HA   5  
ATOM 8677  H HB2  . SER A 1 76  ? 2.086   3.479   2.033   1.00 0.00 ? 76  SER A HB2  5  
ATOM 8678  H HB3  . SER A 1 76  ? 1.681   5.180   1.808   1.00 0.00 ? 76  SER A HB3  5  
ATOM 8679  H HG   . SER A 1 76  ? 3.302   4.243   3.574   1.00 0.00 ? 76  SER A HG   5  
ATOM 8680  N N    . ALA A 1 77  ? 0.579   1.867   3.869   1.00 0.00 ? 77  ALA A N    5  
ATOM 8681  C CA   . ALA A 1 77  ? 0.604   0.862   4.925   1.00 0.00 ? 77  ALA A CA   5  
ATOM 8682  C C    . ALA A 1 77  ? 1.709   -0.161  4.683   1.00 0.00 ? 77  ALA A C    5  
ATOM 8683  O O    . ALA A 1 77  ? 2.028   -0.487  3.539   1.00 0.00 ? 77  ALA A O    5  
ATOM 8684  C CB   . ALA A 1 77  ? -0.747  0.169   5.026   1.00 0.00 ? 77  ALA A CB   5  
ATOM 8685  H H    . ALA A 1 77  ? 0.852   1.615   2.963   1.00 0.00 ? 77  ALA A H    5  
ATOM 8686  H HA   . ALA A 1 77  ? 0.794   1.367   5.861   1.00 0.00 ? 77  ALA A HA   5  
ATOM 8687  H HB1  . ALA A 1 77  ? -0.648  -0.723  5.628   1.00 0.00 ? 77  ALA A HB1  5  
ATOM 8688  H HB2  . ALA A 1 77  ? -1.460  0.837   5.485   1.00 0.00 ? 77  ALA A HB2  5  
ATOM 8689  H HB3  . ALA A 1 77  ? -1.088  -0.100  4.038   1.00 0.00 ? 77  ALA A HB3  5  
ATOM 8690  N N    . VAL A 1 78  ? 2.291   -0.665  5.767   1.00 0.00 ? 78  VAL A N    5  
ATOM 8691  C CA   . VAL A 1 78  ? 3.360   -1.651  5.672   1.00 0.00 ? 78  VAL A CA   5  
ATOM 8692  C C    . VAL A 1 78  ? 2.919   -2.996  6.239   1.00 0.00 ? 78  VAL A C    5  
ATOM 8693  O O    . VAL A 1 78  ? 2.944   -3.209  7.452   1.00 0.00 ? 78  VAL A O    5  
ATOM 8694  C CB   . VAL A 1 78  ? 4.624   -1.182  6.416   1.00 0.00 ? 78  VAL A CB   5  
ATOM 8695  C CG1  . VAL A 1 78  ? 5.726   -2.225  6.307   1.00 0.00 ? 78  VAL A CG1  5  
ATOM 8696  C CG2  . VAL A 1 78  ? 5.093   0.160   5.875   1.00 0.00 ? 78  VAL A CG2  5  
ATOM 8697  H H    . VAL A 1 78  ? 1.993   -0.366  6.651   1.00 0.00 ? 78  VAL A H    5  
ATOM 8698  H HA   . VAL A 1 78  ? 3.608   -1.776  4.628   1.00 0.00 ? 78  VAL A HA   5  
ATOM 8699  H HB   . VAL A 1 78  ? 4.377   -1.059  7.461   1.00 0.00 ? 78  VAL A HB   5  
ATOM 8700  H HG11 . VAL A 1 78  ? 5.457   -2.956  5.559   1.00 0.00 ? 78  VAL A HG11 5  
ATOM 8701  H HG12 . VAL A 1 78  ? 6.651   -1.744  6.027   1.00 0.00 ? 78  VAL A HG12 5  
ATOM 8702  H HG13 . VAL A 1 78  ? 5.851   -2.717  7.261   1.00 0.00 ? 78  VAL A HG13 5  
ATOM 8703  H HG21 . VAL A 1 78  ? 5.249   0.844   6.696   1.00 0.00 ? 78  VAL A HG21 5  
ATOM 8704  H HG22 . VAL A 1 78  ? 6.021   0.027   5.337   1.00 0.00 ? 78  VAL A HG22 5  
ATOM 8705  H HG23 . VAL A 1 78  ? 4.345   0.561   5.207   1.00 0.00 ? 78  VAL A HG23 5  
ATOM 8706  N N    . LEU A 1 79  ? 2.515   -3.901  5.355   1.00 0.00 ? 79  LEU A N    5  
ATOM 8707  C CA   . LEU A 1 79  ? 2.069   -5.227  5.767   1.00 0.00 ? 79  LEU A CA   5  
ATOM 8708  C C    . LEU A 1 79  ? 3.257   -6.122  6.104   1.00 0.00 ? 79  LEU A C    5  
ATOM 8709  O O    . LEU A 1 79  ? 3.940   -6.627  5.213   1.00 0.00 ? 79  LEU A O    5  
ATOM 8710  C CB   . LEU A 1 79  ? 1.229   -5.871  4.662   1.00 0.00 ? 79  LEU A CB   5  
ATOM 8711  C CG   . LEU A 1 79  ? 0.060   -5.037  4.136   1.00 0.00 ? 79  LEU A CG   5  
ATOM 8712  C CD1  . LEU A 1 79  ? -0.509  -5.655  2.868   1.00 0.00 ? 79  LEU A CD1  5  
ATOM 8713  C CD2  . LEU A 1 79  ? -1.021  -4.905  5.199   1.00 0.00 ? 79  LEU A CD2  5  
ATOM 8714  H H    . LEU A 1 79  ? 2.518   -3.674  4.402   1.00 0.00 ? 79  LEU A H    5  
ATOM 8715  H HA   . LEU A 1 79  ? 1.459   -5.112  6.651   1.00 0.00 ? 79  LEU A HA   5  
ATOM 8716  H HB2  . LEU A 1 79  ? 1.884   -6.083  3.831   1.00 0.00 ? 79  LEU A HB2  5  
ATOM 8717  H HB3  . LEU A 1 79  ? 0.829   -6.797  5.049   1.00 0.00 ? 79  LEU A HB3  5  
ATOM 8718  H HG   . LEU A 1 79  ? 0.414   -4.045  3.893   1.00 0.00 ? 79  LEU A HG   5  
ATOM 8719  H HD11 . LEU A 1 79  ? -1.295  -6.348  3.127   1.00 0.00 ? 79  LEU A HD11 5  
ATOM 8720  H HD12 . LEU A 1 79  ? 0.274   -6.180  2.341   1.00 0.00 ? 79  LEU A HD12 5  
ATOM 8721  H HD13 . LEU A 1 79  ? -0.908  -4.876  2.236   1.00 0.00 ? 79  LEU A HD13 5  
ATOM 8722  H HD21 . LEU A 1 79  ? -0.573  -4.980  6.179   1.00 0.00 ? 79  LEU A HD21 5  
ATOM 8723  H HD22 . LEU A 1 79  ? -1.747  -5.695  5.073   1.00 0.00 ? 79  LEU A HD22 5  
ATOM 8724  H HD23 . LEU A 1 79  ? -1.509  -3.947  5.098   1.00 0.00 ? 79  LEU A HD23 5  
ATOM 8725  N N    . VAL A 1 80  ? 3.498   -6.316  7.397   1.00 0.00 ? 80  VAL A N    5  
ATOM 8726  C CA   . VAL A 1 80  ? 4.602   -7.152  7.853   1.00 0.00 ? 80  VAL A CA   5  
ATOM 8727  C C    . VAL A 1 80  ? 4.129   -8.570  8.155   1.00 0.00 ? 80  VAL A C    5  
ATOM 8728  O O    . VAL A 1 80  ? 2.971   -8.912  7.919   1.00 0.00 ? 80  VAL A O    5  
ATOM 8729  C CB   . VAL A 1 80  ? 5.268   -6.566  9.111   1.00 0.00 ? 80  VAL A CB   5  
ATOM 8730  C CG1  . VAL A 1 80  ? 5.798   -5.167  8.833   1.00 0.00 ? 80  VAL A CG1  5  
ATOM 8731  C CG2  . VAL A 1 80  ? 4.289   -6.552  10.275  1.00 0.00 ? 80  VAL A CG2  5  
ATOM 8732  H H    . VAL A 1 80  ? 2.918   -5.886  8.061   1.00 0.00 ? 80  VAL A H    5  
ATOM 8733  H HA   . VAL A 1 80  ? 5.339   -7.190  7.064   1.00 0.00 ? 80  VAL A HA   5  
ATOM 8734  H HB   . VAL A 1 80  ? 6.103   -7.196  9.379   1.00 0.00 ? 80  VAL A HB   5  
ATOM 8735  H HG11 . VAL A 1 80  ? 6.627   -5.228  8.143   1.00 0.00 ? 80  VAL A HG11 5  
ATOM 8736  H HG12 . VAL A 1 80  ? 5.013   -4.564  8.402   1.00 0.00 ? 80  VAL A HG12 5  
ATOM 8737  H HG13 . VAL A 1 80  ? 6.132   -4.719  9.757   1.00 0.00 ? 80  VAL A HG13 5  
ATOM 8738  H HG21 . VAL A 1 80  ? 4.523   -7.360  10.952  1.00 0.00 ? 80  VAL A HG21 5  
ATOM 8739  H HG22 . VAL A 1 80  ? 4.365   -5.610  10.799  1.00 0.00 ? 80  VAL A HG22 5  
ATOM 8740  H HG23 . VAL A 1 80  ? 3.283   -6.675  9.901   1.00 0.00 ? 80  VAL A HG23 5  
ATOM 8741  N N    . ASN A 1 81  ? 5.033   -9.390  8.680   1.00 0.00 ? 81  ASN A N    5  
ATOM 8742  C CA   . ASN A 1 81  ? 4.708   -10.772 9.016   1.00 0.00 ? 81  ASN A CA   5  
ATOM 8743  C C    . ASN A 1 81  ? 3.989   -11.458 7.858   1.00 0.00 ? 81  ASN A C    5  
ATOM 8744  O O    . ASN A 1 81  ? 3.059   -12.239 8.066   1.00 0.00 ? 81  ASN A O    5  
ATOM 8745  C CB   . ASN A 1 81  ? 3.838   -10.822 10.273  1.00 0.00 ? 81  ASN A CB   5  
ATOM 8746  C CG   . ASN A 1 81  ? 2.471   -10.201 10.056  1.00 0.00 ? 81  ASN A CG   5  
ATOM 8747  O OD1  . ASN A 1 81  ? 1.646   -10.735 9.315   1.00 0.00 ? 81  ASN A OD1  5  
ATOM 8748  N ND2  . ASN A 1 81  ? 2.227   -9.068  10.703  1.00 0.00 ? 81  ASN A ND2  5  
ATOM 8749  H H    . ASN A 1 81  ? 5.940   -9.059  8.846   1.00 0.00 ? 81  ASN A H    5  
ATOM 8750  H HA   . ASN A 1 81  ? 5.634   -11.292 9.208   1.00 0.00 ? 81  ASN A HA   5  
ATOM 8751  H HB2  . ASN A 1 81  ? 3.701   -11.852 10.568  1.00 0.00 ? 81  ASN A HB2  5  
ATOM 8752  H HB3  . ASN A 1 81  ? 4.334   -10.287 11.069  1.00 0.00 ? 81  ASN A HB3  5  
ATOM 8753  H HD21 . ASN A 1 81  ? 2.932   -8.700  11.276  1.00 0.00 ? 81  ASN A HD21 5  
ATOM 8754  H HD22 . ASN A 1 81  ? 1.351   -8.646  10.581  1.00 0.00 ? 81  ASN A HD22 5  
ATOM 8755  N N    . LEU A 1 82  ? 4.425   -11.161 6.639   1.00 0.00 ? 82  LEU A N    5  
ATOM 8756  C CA   . LEU A 1 82  ? 3.824   -11.750 5.447   1.00 0.00 ? 82  LEU A CA   5  
ATOM 8757  C C    . LEU A 1 82  ? 4.535   -13.042 5.060   1.00 0.00 ? 82  LEU A C    5  
ATOM 8758  O O    . LEU A 1 82  ? 5.595   -13.366 5.597   1.00 0.00 ? 82  LEU A O    5  
ATOM 8759  C CB   . LEU A 1 82  ? 3.874   -10.758 4.284   1.00 0.00 ? 82  LEU A CB   5  
ATOM 8760  C CG   . LEU A 1 82  ? 3.047   -9.483  4.453   1.00 0.00 ? 82  LEU A CG   5  
ATOM 8761  C CD1  . LEU A 1 82  ? 3.136   -8.619  3.205   1.00 0.00 ? 82  LEU A CD1  5  
ATOM 8762  C CD2  . LEU A 1 82  ? 1.597   -9.825  4.764   1.00 0.00 ? 82  LEU A CD2  5  
ATOM 8763  H H    . LEU A 1 82  ? 5.169   -10.532 6.537   1.00 0.00 ? 82  LEU A H    5  
ATOM 8764  H HA   . LEU A 1 82  ? 2.792   -11.975 5.674   1.00 0.00 ? 82  LEU A HA   5  
ATOM 8765  H HB2  . LEU A 1 82  ? 4.903   -10.468 4.141   1.00 0.00 ? 82  LEU A HB2  5  
ATOM 8766  H HB3  . LEU A 1 82  ? 3.520   -11.269 3.400   1.00 0.00 ? 82  LEU A HB3  5  
ATOM 8767  H HG   . LEU A 1 82  ? 3.442   -8.912  5.282   1.00 0.00 ? 82  LEU A HG   5  
ATOM 8768  H HD11 . LEU A 1 82  ? 3.964   -7.932  3.301   1.00 0.00 ? 82  LEU A HD11 5  
ATOM 8769  H HD12 . LEU A 1 82  ? 2.218   -8.063  3.085   1.00 0.00 ? 82  LEU A HD12 5  
ATOM 8770  H HD13 . LEU A 1 82  ? 3.289   -9.250  2.341   1.00 0.00 ? 82  LEU A HD13 5  
ATOM 8771  H HD21 . LEU A 1 82  ? 1.206   -10.470 3.992   1.00 0.00 ? 82  LEU A HD21 5  
ATOM 8772  H HD22 . LEU A 1 82  ? 1.014   -8.916  4.804   1.00 0.00 ? 82  LEU A HD22 5  
ATOM 8773  H HD23 . LEU A 1 82  ? 1.543   -10.330 5.717   1.00 0.00 ? 82  LEU A HD23 5  
ATOM 8774  N N    . LYS A 1 83  ? 3.948   -13.777 4.122   1.00 0.00 ? 83  LYS A N    5  
ATOM 8775  C CA   . LYS A 1 83  ? 4.526   -15.032 3.658   1.00 0.00 ? 83  LYS A CA   5  
ATOM 8776  C C    . LYS A 1 83  ? 5.457   -14.798 2.473   1.00 0.00 ? 83  LYS A C    5  
ATOM 8777  O O    . LYS A 1 83  ? 5.364   -13.778 1.789   1.00 0.00 ? 83  LYS A O    5  
ATOM 8778  C CB   . LYS A 1 83  ? 3.419   -16.013 3.264   1.00 0.00 ? 83  LYS A CB   5  
ATOM 8779  C CG   . LYS A 1 83  ? 3.852   -17.468 3.307   1.00 0.00 ? 83  LYS A CG   5  
ATOM 8780  C CD   . LYS A 1 83  ? 2.678   -18.392 3.584   1.00 0.00 ? 83  LYS A CD   5  
ATOM 8781  C CE   . LYS A 1 83  ? 3.124   -19.841 3.705   1.00 0.00 ? 83  LYS A CE   5  
ATOM 8782  N NZ   . LYS A 1 83  ? 3.286   -20.485 2.372   1.00 0.00 ? 83  LYS A NZ   5  
ATOM 8783  H H    . LYS A 1 83  ? 3.104   -13.466 3.731   1.00 0.00 ? 83  LYS A H    5  
ATOM 8784  H HA   . LYS A 1 83  ? 5.097   -15.455 4.471   1.00 0.00 ? 83  LYS A HA   5  
ATOM 8785  H HB2  . LYS A 1 83  ? 2.586   -15.887 3.940   1.00 0.00 ? 83  LYS A HB2  5  
ATOM 8786  H HB3  . LYS A 1 83  ? 3.094   -15.785 2.259   1.00 0.00 ? 83  LYS A HB3  5  
ATOM 8787  H HG2  . LYS A 1 83  ? 4.288   -17.733 2.355   1.00 0.00 ? 83  LYS A HG2  5  
ATOM 8788  H HG3  . LYS A 1 83  ? 4.588   -17.593 4.089   1.00 0.00 ? 83  LYS A HG3  5  
ATOM 8789  H HD2  . LYS A 1 83  ? 2.206   -18.094 4.508   1.00 0.00 ? 83  LYS A HD2  5  
ATOM 8790  H HD3  . LYS A 1 83  ? 1.968   -18.310 2.773   1.00 0.00 ? 83  LYS A HD3  5  
ATOM 8791  H HE2  . LYS A 1 83  ? 4.069   -19.870 4.226   1.00 0.00 ? 83  LYS A HE2  5  
ATOM 8792  H HE3  . LYS A 1 83  ? 2.384   -20.386 4.272   1.00 0.00 ? 83  LYS A HE3  5  
ATOM 8793  H HZ1  . LYS A 1 83  ? 4.154   -20.143 1.913   1.00 0.00 ? 83  LYS A HZ1  5  
ATOM 8794  H HZ2  . LYS A 1 83  ? 2.473   -20.257 1.764   1.00 0.00 ? 83  LYS A HZ2  5  
ATOM 8795  H HZ3  . LYS A 1 83  ? 3.346   -21.517 2.479   1.00 0.00 ? 83  LYS A HZ3  5  
ATOM 8796  N N    . LYS A 1 84  ? 6.354   -15.748 2.234   1.00 0.00 ? 84  LYS A N    5  
ATOM 8797  C CA   . LYS A 1 84  ? 7.301   -15.647 1.130   1.00 0.00 ? 84  LYS A CA   5  
ATOM 8798  C C    . LYS A 1 84  ? 6.881   -16.544 -0.031  1.00 0.00 ? 84  LYS A C    5  
ATOM 8799  O O    . LYS A 1 84  ? 6.449   -17.678 0.173   1.00 0.00 ? 84  LYS A O    5  
ATOM 8800  C CB   . LYS A 1 84  ? 8.707   -16.028 1.600   1.00 0.00 ? 84  LYS A CB   5  
ATOM 8801  C CG   . LYS A 1 84  ? 9.070   -15.455 2.959   1.00 0.00 ? 84  LYS A CG   5  
ATOM 8802  C CD   . LYS A 1 84  ? 10.300  -16.132 3.539   1.00 0.00 ? 84  LYS A CD   5  
ATOM 8803  C CE   . LYS A 1 84  ? 10.524  -15.733 4.989   1.00 0.00 ? 84  LYS A CE   5  
ATOM 8804  N NZ   . LYS A 1 84  ? 9.815   -16.643 5.931   1.00 0.00 ? 84  LYS A NZ   5  
ATOM 8805  H H    . LYS A 1 84  ? 6.380   -16.538 2.815   1.00 0.00 ? 84  LYS A H    5  
ATOM 8806  H HA   . LYS A 1 84  ? 7.309   -14.622 0.792   1.00 0.00 ? 84  LYS A HA   5  
ATOM 8807  H HB2  . LYS A 1 84  ? 8.776   -17.104 1.656   1.00 0.00 ? 84  LYS A HB2  5  
ATOM 8808  H HB3  . LYS A 1 84  ? 9.425   -15.667 0.877   1.00 0.00 ? 84  LYS A HB3  5  
ATOM 8809  H HG2  . LYS A 1 84  ? 9.269   -14.399 2.853   1.00 0.00 ? 84  LYS A HG2  5  
ATOM 8810  H HG3  . LYS A 1 84  ? 8.238   -15.600 3.634   1.00 0.00 ? 84  LYS A HG3  5  
ATOM 8811  H HD2  . LYS A 1 84  ? 10.170  -17.203 3.488   1.00 0.00 ? 84  LYS A HD2  5  
ATOM 8812  H HD3  . LYS A 1 84  ? 11.166  -15.845 2.958   1.00 0.00 ? 84  LYS A HD3  5  
ATOM 8813  H HE2  . LYS A 1 84  ? 11.583  -15.766 5.199   1.00 0.00 ? 84  LYS A HE2  5  
ATOM 8814  H HE3  . LYS A 1 84  ? 10.161  -14.726 5.132   1.00 0.00 ? 84  LYS A HE3  5  
ATOM 8815  H HZ1  . LYS A 1 84  ? 9.325   -17.393 5.401   1.00 0.00 ? 84  LYS A HZ1  5  
ATOM 8816  H HZ2  . LYS A 1 84  ? 9.114   -16.110 6.483   1.00 0.00 ? 84  LYS A HZ2  5  
ATOM 8817  H HZ3  . LYS A 1 84  ? 10.494  -17.082 6.584   1.00 0.00 ? 84  LYS A HZ3  5  
ATOM 8818  N N    . GLY A 1 85  ? 7.013   -16.028 -1.249  1.00 0.00 ? 85  GLY A N    5  
ATOM 8819  C CA   . GLY A 1 85  ? 6.644   -16.796 -2.424  1.00 0.00 ? 85  GLY A CA   5  
ATOM 8820  C C    . GLY A 1 85  ? 5.156   -17.081 -2.487  1.00 0.00 ? 85  GLY A C    5  
ATOM 8821  O O    . GLY A 1 85  ? 4.738   -18.238 -2.501  1.00 0.00 ? 85  GLY A O    5  
ATOM 8822  H H    . GLY A 1 85  ? 7.363   -15.118 -1.351  1.00 0.00 ? 85  GLY A H    5  
ATOM 8823  H HA2  . GLY A 1 85  ? 6.933   -16.245 -3.306  1.00 0.00 ? 85  GLY A HA2  5  
ATOM 8824  H HA3  . GLY A 1 85  ? 7.177   -17.736 -2.407  1.00 0.00 ? 85  GLY A HA3  5  
ATOM 8825  N N    . VAL A 1 86  ? 4.354   -16.021 -2.523  1.00 0.00 ? 86  VAL A N    5  
ATOM 8826  C CA   . VAL A 1 86  ? 2.904   -16.162 -2.585  1.00 0.00 ? 86  VAL A CA   5  
ATOM 8827  C C    . VAL A 1 86  ? 2.233   -14.821 -2.859  1.00 0.00 ? 86  VAL A C    5  
ATOM 8828  O O    . VAL A 1 86  ? 2.690   -13.778 -2.391  1.00 0.00 ? 86  VAL A O    5  
ATOM 8829  C CB   . VAL A 1 86  ? 2.341   -16.748 -1.276  1.00 0.00 ? 86  VAL A CB   5  
ATOM 8830  C CG1  . VAL A 1 86  ? 2.651   -15.830 -0.104  1.00 0.00 ? 86  VAL A CG1  5  
ATOM 8831  C CG2  . VAL A 1 86  ? 0.843   -16.983 -1.399  1.00 0.00 ? 86  VAL A CG2  5  
ATOM 8832  H H    . VAL A 1 86  ? 4.747   -15.124 -2.509  1.00 0.00 ? 86  VAL A H    5  
ATOM 8833  H HA   . VAL A 1 86  ? 2.668   -16.843 -3.390  1.00 0.00 ? 86  VAL A HA   5  
ATOM 8834  H HB   . VAL A 1 86  ? 2.820   -17.699 -1.096  1.00 0.00 ? 86  VAL A HB   5  
ATOM 8835  H HG11 . VAL A 1 86  ? 3.612   -16.091 0.313   1.00 0.00 ? 86  VAL A HG11 5  
ATOM 8836  H HG12 . VAL A 1 86  ? 2.670   -14.805 -0.444  1.00 0.00 ? 86  VAL A HG12 5  
ATOM 8837  H HG13 . VAL A 1 86  ? 1.888   -15.943 0.653   1.00 0.00 ? 86  VAL A HG13 5  
ATOM 8838  H HG21 . VAL A 1 86  ? 0.666   -17.876 -1.979  1.00 0.00 ? 86  VAL A HG21 5  
ATOM 8839  H HG22 . VAL A 1 86  ? 0.415   -17.102 -0.415  1.00 0.00 ? 86  VAL A HG22 5  
ATOM 8840  H HG23 . VAL A 1 86  ? 0.385   -16.138 -1.891  1.00 0.00 ? 86  VAL A HG23 5  
ATOM 8841  N N    . THR A 1 87  ? 1.144   -14.855 -3.621  1.00 0.00 ? 87  THR A N    5  
ATOM 8842  C CA   . THR A 1 87  ? 0.409   -13.643 -3.958  1.00 0.00 ? 87  THR A CA   5  
ATOM 8843  C C    . THR A 1 87  ? -0.466  -13.188 -2.795  1.00 0.00 ? 87  THR A C    5  
ATOM 8844  O O    . THR A 1 87  ? -0.980  -14.009 -2.035  1.00 0.00 ? 87  THR A O    5  
ATOM 8845  C CB   . THR A 1 87  ? -0.477  -13.850 -5.201  1.00 0.00 ? 87  THR A CB   5  
ATOM 8846  O OG1  . THR A 1 87  ? 0.212   -14.656 -6.164  1.00 0.00 ? 87  THR A OG1  5  
ATOM 8847  C CG2  . THR A 1 87  ? -0.854  -12.515 -5.825  1.00 0.00 ? 87  THR A CG2  5  
ATOM 8848  H H    . THR A 1 87  ? 0.829   -15.717 -3.964  1.00 0.00 ? 87  THR A H    5  
ATOM 8849  H HA   . THR A 1 87  ? 1.128   -12.867 -4.180  1.00 0.00 ? 87  THR A HA   5  
ATOM 8850  H HB   . THR A 1 87  ? -1.382  -14.358 -4.899  1.00 0.00 ? 87  THR A HB   5  
ATOM 8851  H HG1  . THR A 1 87  ? -0.235  -14.592 -7.012  1.00 0.00 ? 87  THR A HG1  5  
ATOM 8852  H HG21 . THR A 1 87  ? -1.552  -12.680 -6.634  1.00 0.00 ? 87  THR A HG21 5  
ATOM 8853  H HG22 . THR A 1 87  ? 0.033   -12.033 -6.208  1.00 0.00 ? 87  THR A HG22 5  
ATOM 8854  H HG23 . THR A 1 87  ? -1.313  -11.886 -5.078  1.00 0.00 ? 87  THR A HG23 5  
ATOM 8855  N N    . TYR A 1 88  ? -0.631  -11.877 -2.663  1.00 0.00 ? 88  TYR A N    5  
ATOM 8856  C CA   . TYR A 1 88  ? -1.442  -11.313 -1.590  1.00 0.00 ? 88  TYR A CA   5  
ATOM 8857  C C    . TYR A 1 88  ? -2.349  -10.205 -2.118  1.00 0.00 ? 88  TYR A C    5  
ATOM 8858  O O    . TYR A 1 88  ? -1.898  -9.305  -2.825  1.00 0.00 ? 88  TYR A O    5  
ATOM 8859  C CB   . TYR A 1 88  ? -0.546  -10.767 -0.477  1.00 0.00 ? 88  TYR A CB   5  
ATOM 8860  C CG   . TYR A 1 88  ? -0.190  -11.796 0.572   1.00 0.00 ? 88  TYR A CG   5  
ATOM 8861  C CD1  . TYR A 1 88  ? -1.084  -12.122 1.585   1.00 0.00 ? 88  TYR A CD1  5  
ATOM 8862  C CD2  . TYR A 1 88  ? 1.041   -12.441 0.552   1.00 0.00 ? 88  TYR A CD2  5  
ATOM 8863  C CE1  . TYR A 1 88  ? -0.762  -13.061 2.546   1.00 0.00 ? 88  TYR A CE1  5  
ATOM 8864  C CE2  . TYR A 1 88  ? 1.370   -13.381 1.508   1.00 0.00 ? 88  TYR A CE2  5  
ATOM 8865  C CZ   . TYR A 1 88  ? 0.465   -13.688 2.503   1.00 0.00 ? 88  TYR A CZ   5  
ATOM 8866  O OH   . TYR A 1 88  ? 0.790   -14.623 3.459   1.00 0.00 ? 88  TYR A OH   5  
ATOM 8867  H H    . TYR A 1 88  ? -0.195  -11.273 -3.300  1.00 0.00 ? 88  TYR A H    5  
ATOM 8868  H HA   . TYR A 1 88  ? -2.057  -12.105 -1.188  1.00 0.00 ? 88  TYR A HA   5  
ATOM 8869  H HB2  . TYR A 1 88  ? 0.373   -10.404 -0.910  1.00 0.00 ? 88  TYR A HB2  5  
ATOM 8870  H HB3  . TYR A 1 88  ? -1.054  -9.951  0.016   1.00 0.00 ? 88  TYR A HB3  5  
ATOM 8871  H HD1  . TYR A 1 88  ? -2.045  -11.629 1.616   1.00 0.00 ? 88  TYR A HD1  5  
ATOM 8872  H HD2  . TYR A 1 88  ? 1.747   -12.198 -0.229  1.00 0.00 ? 88  TYR A HD2  5  
ATOM 8873  H HE1  . TYR A 1 88  ? -1.470  -13.301 3.326   1.00 0.00 ? 88  TYR A HE1  5  
ATOM 8874  H HE2  . TYR A 1 88  ? 2.331   -13.872 1.475   1.00 0.00 ? 88  TYR A HE2  5  
ATOM 8875  H HH   . TYR A 1 88  ? -0.012  -15.031 3.793   1.00 0.00 ? 88  TYR A HH   5  
ATOM 8876  N N    . GLU A 1 89  ? -3.629  -10.280 -1.767  1.00 0.00 ? 89  GLU A N    5  
ATOM 8877  C CA   . GLU A 1 89  ? -4.599  -9.283  -2.206  1.00 0.00 ? 89  GLU A CA   5  
ATOM 8878  C C    . GLU A 1 89  ? -4.844  -8.245  -1.114  1.00 0.00 ? 89  GLU A C    5  
ATOM 8879  O O    . GLU A 1 89  ? -5.043  -8.589  0.051   1.00 0.00 ? 89  GLU A O    5  
ATOM 8880  C CB   . GLU A 1 89  ? -5.919  -9.958  -2.588  1.00 0.00 ? 89  GLU A CB   5  
ATOM 8881  C CG   . GLU A 1 89  ? -6.976  -8.988  -3.088  1.00 0.00 ? 89  GLU A CG   5  
ATOM 8882  C CD   . GLU A 1 89  ? -8.333  -9.642  -3.260  1.00 0.00 ? 89  GLU A CD   5  
ATOM 8883  O OE1  . GLU A 1 89  ? -9.021  -9.858  -2.240  1.00 0.00 ? 89  GLU A OE1  5  
ATOM 8884  O OE2  . GLU A 1 89  ? -8.707  -9.938  -4.414  1.00 0.00 ? 89  GLU A OE2  5  
ATOM 8885  H H    . GLU A 1 89  ? -3.928  -11.022 -1.202  1.00 0.00 ? 89  GLU A H    5  
ATOM 8886  H HA   . GLU A 1 89  ? -4.195  -8.786  -3.075  1.00 0.00 ? 89  GLU A HA   5  
ATOM 8887  H HB2  . GLU A 1 89  ? -5.727  -10.682 -3.366  1.00 0.00 ? 89  GLU A HB2  5  
ATOM 8888  H HB3  . GLU A 1 89  ? -6.311  -10.470 -1.722  1.00 0.00 ? 89  GLU A HB3  5  
ATOM 8889  H HG2  . GLU A 1 89  ? -7.070  -8.180  -2.377  1.00 0.00 ? 89  GLU A HG2  5  
ATOM 8890  H HG3  . GLU A 1 89  ? -6.660  -8.591  -4.042  1.00 0.00 ? 89  GLU A HG3  5  
ATOM 8891  N N    . ILE A 1 90  ? -4.827  -6.974  -1.501  1.00 0.00 ? 90  ILE A N    5  
ATOM 8892  C CA   . ILE A 1 90  ? -5.047  -5.886  -0.557  1.00 0.00 ? 90  ILE A CA   5  
ATOM 8893  C C    . ILE A 1 90  ? -5.822  -4.744  -1.205  1.00 0.00 ? 90  ILE A C    5  
ATOM 8894  O O    . ILE A 1 90  ? -5.641  -4.447  -2.386  1.00 0.00 ? 90  ILE A O    5  
ATOM 8895  C CB   . ILE A 1 90  ? -3.716  -5.340  -0.006  1.00 0.00 ? 90  ILE A CB   5  
ATOM 8896  C CG1  . ILE A 1 90  ? -2.787  -6.494  0.379   1.00 0.00 ? 90  ILE A CG1  5  
ATOM 8897  C CG2  . ILE A 1 90  ? -3.969  -4.435  1.190   1.00 0.00 ? 90  ILE A CG2  5  
ATOM 8898  C CD1  . ILE A 1 90  ? -1.938  -6.995  -0.768  1.00 0.00 ? 90  ILE A CD1  5  
ATOM 8899  H H    . ILE A 1 90  ? -4.663  -6.763  -2.444  1.00 0.00 ? 90  ILE A H    5  
ATOM 8900  H HA   . ILE A 1 90  ? -5.623  -6.274  0.270   1.00 0.00 ? 90  ILE A HA   5  
ATOM 8901  H HB   . ILE A 1 90  ? -3.246  -4.752  -0.779  1.00 0.00 ? 90  ILE A HB   5  
ATOM 8902  H HG12 . ILE A 1 90  ? -2.124  -6.167  1.164   1.00 0.00 ? 90  ILE A HG12 5  
ATOM 8903  H HG13 . ILE A 1 90  ? -3.383  -7.321  0.738   1.00 0.00 ? 90  ILE A HG13 5  
ATOM 8904  H HG21 . ILE A 1 90  ? -3.396  -4.786  2.035   1.00 0.00 ? 90  ILE A HG21 5  
ATOM 8905  H HG22 . ILE A 1 90  ? -3.669  -3.426  0.947   1.00 0.00 ? 90  ILE A HG22 5  
ATOM 8906  H HG23 . ILE A 1 90  ? -5.020  -4.448  1.436   1.00 0.00 ? 90  ILE A HG23 5  
ATOM 8907  H HD11 . ILE A 1 90  ? -2.412  -7.853  -1.220  1.00 0.00 ? 90  ILE A HD11 5  
ATOM 8908  H HD12 . ILE A 1 90  ? -1.829  -6.213  -1.504  1.00 0.00 ? 90  ILE A HD12 5  
ATOM 8909  H HD13 . ILE A 1 90  ? -0.963  -7.278  -0.396  1.00 0.00 ? 90  ILE A HD13 5  
ATOM 8910  N N    . LYS A 1 91  ? -6.686  -4.104  -0.424  1.00 0.00 ? 91  LYS A N    5  
ATOM 8911  C CA   . LYS A 1 91  ? -7.488  -2.992  -0.919  1.00 0.00 ? 91  LYS A CA   5  
ATOM 8912  C C    . LYS A 1 91  ? -7.647  -1.917  0.152   1.00 0.00 ? 91  LYS A C    5  
ATOM 8913  O O    . LYS A 1 91  ? -8.038  -2.206  1.283   1.00 0.00 ? 91  LYS A O    5  
ATOM 8914  C CB   . LYS A 1 91  ? -8.864  -3.488  -1.368  1.00 0.00 ? 91  LYS A CB   5  
ATOM 8915  C CG   . LYS A 1 91  ? -9.612  -4.260  -0.294  1.00 0.00 ? 91  LYS A CG   5  
ATOM 8916  C CD   . LYS A 1 91  ? -9.308  -5.747  -0.364  1.00 0.00 ? 91  LYS A CD   5  
ATOM 8917  C CE   . LYS A 1 91  ? -10.136 -6.533  0.642   1.00 0.00 ? 91  LYS A CE   5  
ATOM 8918  N NZ   . LYS A 1 91  ? -11.479 -6.883  0.102   1.00 0.00 ? 91  LYS A NZ   5  
ATOM 8919  H H    . LYS A 1 91  ? -6.786  -4.387  0.510   1.00 0.00 ? 91  LYS A H    5  
ATOM 8920  H HA   . LYS A 1 91  ? -6.974  -2.565  -1.767  1.00 0.00 ? 91  LYS A HA   5  
ATOM 8921  H HB2  . LYS A 1 91  ? -9.464  -2.637  -1.654  1.00 0.00 ? 91  LYS A HB2  5  
ATOM 8922  H HB3  . LYS A 1 91  ? -8.739  -4.134  -2.225  1.00 0.00 ? 91  LYS A HB3  5  
ATOM 8923  H HG2  . LYS A 1 91  ? -9.316  -3.888  0.676   1.00 0.00 ? 91  LYS A HG2  5  
ATOM 8924  H HG3  . LYS A 1 91  ? -10.674 -4.112  -0.431  1.00 0.00 ? 91  LYS A HG3  5  
ATOM 8925  H HD2  . LYS A 1 91  ? -9.534  -6.106  -1.357  1.00 0.00 ? 91  LYS A HD2  5  
ATOM 8926  H HD3  . LYS A 1 91  ? -8.259  -5.902  -0.153  1.00 0.00 ? 91  LYS A HD3  5  
ATOM 8927  H HE2  . LYS A 1 91  ? -9.609  -7.441  0.891   1.00 0.00 ? 91  LYS A HE2  5  
ATOM 8928  H HE3  . LYS A 1 91  ? -10.260 -5.934  1.532   1.00 0.00 ? 91  LYS A HE3  5  
ATOM 8929  H HZ1  . LYS A 1 91  ? -11.905 -6.053  -0.359  1.00 0.00 ? 91  LYS A HZ1  5  
ATOM 8930  H HZ2  . LYS A 1 91  ? -12.103 -7.195  0.873   1.00 0.00 ? 91  LYS A HZ2  5  
ATOM 8931  H HZ3  . LYS A 1 91  ? -11.395 -7.649  -0.595  1.00 0.00 ? 91  LYS A HZ3  5  
ATOM 8932  N N    . VAL A 1 92  ? -7.343  -0.675  -0.213  1.00 0.00 ? 92  VAL A N    5  
ATOM 8933  C CA   . VAL A 1 92  ? -7.456  0.443   0.716   1.00 0.00 ? 92  VAL A CA   5  
ATOM 8934  C C    . VAL A 1 92  ? -8.895  0.937   0.810   1.00 0.00 ? 92  VAL A C    5  
ATOM 8935  O O    . VAL A 1 92  ? -9.595  1.035   -0.198  1.00 0.00 ? 92  VAL A O    5  
ATOM 8936  C CB   . VAL A 1 92  ? -6.549  1.615   0.296   1.00 0.00 ? 92  VAL A CB   5  
ATOM 8937  C CG1  . VAL A 1 92  ? -6.829  2.841   1.152   1.00 0.00 ? 92  VAL A CG1  5  
ATOM 8938  C CG2  . VAL A 1 92  ? -5.084  1.214   0.387   1.00 0.00 ? 92  VAL A CG2  5  
ATOM 8939  H H    . VAL A 1 92  ? -7.037  -0.507  -1.128  1.00 0.00 ? 92  VAL A H    5  
ATOM 8940  H HA   . VAL A 1 92  ? -7.139  0.101   1.690   1.00 0.00 ? 92  VAL A HA   5  
ATOM 8941  H HB   . VAL A 1 92  ? -6.769  1.863   -0.732  1.00 0.00 ? 92  VAL A HB   5  
ATOM 8942  H HG11 . VAL A 1 92  ? -7.839  3.179   0.975   1.00 0.00 ? 92  VAL A HG11 5  
ATOM 8943  H HG12 . VAL A 1 92  ? -6.710  2.587   2.195   1.00 0.00 ? 92  VAL A HG12 5  
ATOM 8944  H HG13 . VAL A 1 92  ? -6.136  3.627   0.891   1.00 0.00 ? 92  VAL A HG13 5  
ATOM 8945  H HG21 . VAL A 1 92  ? -5.008  0.137   0.422   1.00 0.00 ? 92  VAL A HG21 5  
ATOM 8946  H HG22 . VAL A 1 92  ? -4.554  1.585   -0.478  1.00 0.00 ? 92  VAL A HG22 5  
ATOM 8947  H HG23 . VAL A 1 92  ? -4.651  1.635   1.282   1.00 0.00 ? 92  VAL A HG23 5  
ATOM 8948  N N    . ARG A 1 93  ? -9.330  1.248   2.026   1.00 0.00 ? 93  ARG A N    5  
ATOM 8949  C CA   . ARG A 1 93  ? -10.687 1.731   2.252   1.00 0.00 ? 93  ARG A CA   5  
ATOM 8950  C C    . ARG A 1 93  ? -10.717 2.757   3.381   1.00 0.00 ? 93  ARG A C    5  
ATOM 8951  O O    . ARG A 1 93  ? -10.392 2.461   4.531   1.00 0.00 ? 93  ARG A O    5  
ATOM 8952  C CB   . ARG A 1 93  ? -11.619 0.564   2.584   1.00 0.00 ? 93  ARG A CB   5  
ATOM 8953  C CG   . ARG A 1 93  ? -11.104 -0.328  3.701   1.00 0.00 ? 93  ARG A CG   5  
ATOM 8954  C CD   . ARG A 1 93  ? -12.124 -1.388  4.083   1.00 0.00 ? 93  ARG A CD   5  
ATOM 8955  N NE   . ARG A 1 93  ? -12.280 -2.399  3.040   1.00 0.00 ? 93  ARG A NE   5  
ATOM 8956  C CZ   . ARG A 1 93  ? -13.078 -3.455  3.153   1.00 0.00 ? 93  ARG A CZ   5  
ATOM 8957  N NH1  . ARG A 1 93  ? -13.790 -3.637  4.257   1.00 0.00 ? 93  ARG A NH1  5  
ATOM 8958  N NH2  . ARG A 1 93  ? -13.165 -4.331  2.160   1.00 0.00 ? 93  ARG A NH2  5  
ATOM 8959  H H    . ARG A 1 93  ? -8.725  1.149   2.791   1.00 0.00 ? 93  ARG A H    5  
ATOM 8960  H HA   . ARG A 1 93  ? -11.026 2.204   1.343   1.00 0.00 ? 93  ARG A HA   5  
ATOM 8961  H HB2  . ARG A 1 93  ? -12.579 0.959   2.882   1.00 0.00 ? 93  ARG A HB2  5  
ATOM 8962  H HB3  . ARG A 1 93  ? -11.746 -0.041  1.699   1.00 0.00 ? 93  ARG A HB3  5  
ATOM 8963  H HG2  . ARG A 1 93  ? -10.199 -0.817  3.371   1.00 0.00 ? 93  ARG A HG2  5  
ATOM 8964  H HG3  . ARG A 1 93  ? -10.890 0.282   4.566   1.00 0.00 ? 93  ARG A HG3  5  
ATOM 8965  H HD2  . ARG A 1 93  ? -11.800 -1.871  4.993   1.00 0.00 ? 93  ARG A HD2  5  
ATOM 8966  H HD3  . ARG A 1 93  ? -13.077 -0.908  4.250   1.00 0.00 ? 93  ARG A HD3  5  
ATOM 8967  H HE   . ARG A 1 93  ? -11.763 -2.284  2.216   1.00 0.00 ? 93  ARG A HE   5  
ATOM 8968  H HH11 . ARG A 1 93  ? -13.727 -2.978  5.006   1.00 0.00 ? 93  ARG A HH11 5  
ATOM 8969  H HH12 . ARG A 1 93  ? -14.391 -4.432  4.339   1.00 0.00 ? 93  ARG A HH12 5  
ATOM 8970  H HH21 . ARG A 1 93  ? -12.630 -4.197  1.327   1.00 0.00 ? 93  ARG A HH21 5  
ATOM 8971  H HH22 . ARG A 1 93  ? -13.766 -5.125  2.246   1.00 0.00 ? 93  ARG A HH22 5  
ATOM 8972  N N    . PRO A 1 94  ? -11.117 3.993   3.048   1.00 0.00 ? 94  PRO A N    5  
ATOM 8973  C CA   . PRO A 1 94  ? -11.200 5.088   4.019   1.00 0.00 ? 94  PRO A CA   5  
ATOM 8974  C C    . PRO A 1 94  ? -12.330 4.888   5.023   1.00 0.00 ? 94  PRO A C    5  
ATOM 8975  O O    . PRO A 1 94  ? -13.504 5.051   4.691   1.00 0.00 ? 94  PRO A O    5  
ATOM 8976  C CB   . PRO A 1 94  ? -11.470 6.317   3.147   1.00 0.00 ? 94  PRO A CB   5  
ATOM 8977  C CG   . PRO A 1 94  ? -12.124 5.775   1.923   1.00 0.00 ? 94  PRO A CG   5  
ATOM 8978  C CD   . PRO A 1 94  ? -11.519 4.418   1.696   1.00 0.00 ? 94  PRO A CD   5  
ATOM 8979  H HA   . PRO A 1 94  ? -10.268 5.219   4.549   1.00 0.00 ? 94  PRO A HA   5  
ATOM 8980  H HB2  . PRO A 1 94  ? -12.121 6.999   3.675   1.00 0.00 ? 94  PRO A HB2  5  
ATOM 8981  H HB3  . PRO A 1 94  ? -10.538 6.808   2.912   1.00 0.00 ? 94  PRO A HB3  5  
ATOM 8982  H HG2  . PRO A 1 94  ? -13.188 5.690   2.082   1.00 0.00 ? 94  PRO A HG2  5  
ATOM 8983  H HG3  . PRO A 1 94  ? -11.919 6.421   1.082   1.00 0.00 ? 94  PRO A HG3  5  
ATOM 8984  H HD2  . PRO A 1 94  ? -12.253 3.742   1.282   1.00 0.00 ? 94  PRO A HD2  5  
ATOM 8985  H HD3  . PRO A 1 94  ? -10.661 4.491   1.044   1.00 0.00 ? 94  PRO A HD3  5  
ATOM 8986  N N    . TYR A 1 95  ? -11.968 4.535   6.251   1.00 0.00 ? 95  TYR A N    5  
ATOM 8987  C CA   . TYR A 1 95  ? -12.952 4.310   7.303   1.00 0.00 ? 95  TYR A CA   5  
ATOM 8988  C C    . TYR A 1 95  ? -12.854 5.387   8.380   1.00 0.00 ? 95  TYR A C    5  
ATOM 8989  O O    . TYR A 1 95  ? -11.773 5.907   8.658   1.00 0.00 ? 95  TYR A O    5  
ATOM 8990  C CB   . TYR A 1 95  ? -12.755 2.929   7.929   1.00 0.00 ? 95  TYR A CB   5  
ATOM 8991  C CG   . TYR A 1 95  ? -11.821 2.931   9.118   1.00 0.00 ? 95  TYR A CG   5  
ATOM 8992  C CD1  . TYR A 1 95  ? -12.288 3.225   10.393  1.00 0.00 ? 95  TYR A CD1  5  
ATOM 8993  C CD2  . TYR A 1 95  ? -10.471 2.639   8.967   1.00 0.00 ? 95  TYR A CD2  5  
ATOM 8994  C CE1  . TYR A 1 95  ? -11.438 3.228   11.483  1.00 0.00 ? 95  TYR A CE1  5  
ATOM 8995  C CE2  . TYR A 1 95  ? -9.614  2.639   10.050  1.00 0.00 ? 95  TYR A CE2  5  
ATOM 8996  C CZ   . TYR A 1 95  ? -10.102 2.934   11.306  1.00 0.00 ? 95  TYR A CZ   5  
ATOM 8997  O OH   . TYR A 1 95  ? -9.252  2.936   12.388  1.00 0.00 ? 95  TYR A OH   5  
ATOM 8998  H H    . TYR A 1 95  ? -11.016 4.420   6.455   1.00 0.00 ? 95  TYR A H    5  
ATOM 8999  H HA   . TYR A 1 95  ? -13.934 4.354   6.854   1.00 0.00 ? 95  TYR A HA   5  
ATOM 9000  H HB2  . TYR A 1 95  ? -13.710 2.551   8.260   1.00 0.00 ? 95  TYR A HB2  5  
ATOM 9001  H HB3  . TYR A 1 95  ? -12.346 2.260   7.187   1.00 0.00 ? 95  TYR A HB3  5  
ATOM 9002  H HD1  . TYR A 1 95  ? -13.335 3.454   10.529  1.00 0.00 ? 95  TYR A HD1  5  
ATOM 9003  H HD2  . TYR A 1 95  ? -10.091 2.409   7.981   1.00 0.00 ? 95  TYR A HD2  5  
ATOM 9004  H HE1  . TYR A 1 95  ? -11.820 3.459   12.466  1.00 0.00 ? 95  TYR A HE1  5  
ATOM 9005  H HE2  . TYR A 1 95  ? -8.568  2.409   9.912   1.00 0.00 ? 95  TYR A HE2  5  
ATOM 9006  H HH   . TYR A 1 95  ? -9.709  3.292   13.153  1.00 0.00 ? 95  TYR A HH   5  
ATOM 9007  N N    . PHE A 1 96  ? -13.992 5.718   8.982   1.00 0.00 ? 96  PHE A N    5  
ATOM 9008  C CA   . PHE A 1 96  ? -14.036 6.733   10.028  1.00 0.00 ? 96  PHE A CA   5  
ATOM 9009  C C    . PHE A 1 96  ? -14.226 6.092   11.400  1.00 0.00 ? 96  PHE A C    5  
ATOM 9010  O O    . PHE A 1 96  ? -13.288 6.004   12.191  1.00 0.00 ? 96  PHE A O    5  
ATOM 9011  C CB   . PHE A 1 96  ? -15.167 7.727   9.756   1.00 0.00 ? 96  PHE A CB   5  
ATOM 9012  C CG   . PHE A 1 96  ? -15.371 8.721   10.863  1.00 0.00 ? 96  PHE A CG   5  
ATOM 9013  C CD1  . PHE A 1 96  ? -14.362 8.977   11.777  1.00 0.00 ? 96  PHE A CD1  5  
ATOM 9014  C CD2  . PHE A 1 96  ? -16.573 9.398   10.991  1.00 0.00 ? 96  PHE A CD2  5  
ATOM 9015  C CE1  . PHE A 1 96  ? -14.546 9.891   12.797  1.00 0.00 ? 96  PHE A CE1  5  
ATOM 9016  C CE2  . PHE A 1 96  ? -16.764 10.313  12.009  1.00 0.00 ? 96  PHE A CE2  5  
ATOM 9017  C CZ   . PHE A 1 96  ? -15.749 10.559  12.914  1.00 0.00 ? 96  PHE A CZ   5  
ATOM 9018  H H    . PHE A 1 96  ? -14.821 5.268   8.716   1.00 0.00 ? 96  PHE A H    5  
ATOM 9019  H HA   . PHE A 1 96  ? -13.095 7.260   10.017  1.00 0.00 ? 96  PHE A HA   5  
ATOM 9020  H HB2  . PHE A 1 96  ? -14.943 8.277   8.854   1.00 0.00 ? 96  PHE A HB2  5  
ATOM 9021  H HB3  . PHE A 1 96  ? -16.090 7.183   9.621   1.00 0.00 ? 96  PHE A HB3  5  
ATOM 9022  H HD1  . PHE A 1 96  ? -13.420 8.455   11.686  1.00 0.00 ? 96  PHE A HD1  5  
ATOM 9023  H HD2  . PHE A 1 96  ? -17.368 9.206   10.285  1.00 0.00 ? 96  PHE A HD2  5  
ATOM 9024  H HE1  . PHE A 1 96  ? -13.751 10.081  13.502  1.00 0.00 ? 96  PHE A HE1  5  
ATOM 9025  H HE2  . PHE A 1 96  ? -17.705 10.834  12.098  1.00 0.00 ? 96  PHE A HE2  5  
ATOM 9026  H HZ   . PHE A 1 96  ? -15.896 11.274  13.709  1.00 0.00 ? 96  PHE A HZ   5  
ATOM 9027  N N    . ASN A 1 97  ? -15.448 5.647   11.674  1.00 0.00 ? 97  ASN A N    5  
ATOM 9028  C CA   . ASN A 1 97  ? -15.763 5.016   12.950  1.00 0.00 ? 97  ASN A CA   5  
ATOM 9029  C C    . ASN A 1 97  ? -15.899 3.505   12.791  1.00 0.00 ? 97  ASN A C    5  
ATOM 9030  O O    . ASN A 1 97  ? -15.102 2.740   13.332  1.00 0.00 ? 97  ASN A O    5  
ATOM 9031  C CB   . ASN A 1 97  ? -17.056 5.598   13.526  1.00 0.00 ? 97  ASN A CB   5  
ATOM 9032  C CG   . ASN A 1 97  ? -16.803 6.794   14.423  1.00 0.00 ? 97  ASN A CG   5  
ATOM 9033  O OD1  . ASN A 1 97  ? -15.665 7.238   14.578  1.00 0.00 ? 97  ASN A OD1  5  
ATOM 9034  N ND2  . ASN A 1 97  ? -17.866 7.322   15.019  1.00 0.00 ? 97  ASN A ND2  5  
ATOM 9035  H H    . ASN A 1 97  ? -16.155 5.746   11.003  1.00 0.00 ? 97  ASN A H    5  
ATOM 9036  H HA   . ASN A 1 97  ? -14.952 5.223   13.632  1.00 0.00 ? 97  ASN A HA   5  
ATOM 9037  H HB2  . ASN A 1 97  ? -17.696 5.911   12.713  1.00 0.00 ? 97  ASN A HB2  5  
ATOM 9038  H HB3  . ASN A 1 97  ? -17.561 4.838   14.103  1.00 0.00 ? 97  ASN A HB3  5  
ATOM 9039  H HD21 . ASN A 1 97  ? -18.741 6.916   14.849  1.00 0.00 ? 97  ASN A HD21 5  
ATOM 9040  H HD22 . ASN A 1 97  ? -17.731 8.096   15.604  1.00 0.00 ? 97  ASN A HD22 5  
ATOM 9041  N N    . GLU A 1 98  ? -16.915 3.083   12.044  1.00 0.00 ? 98  GLU A N    5  
ATOM 9042  C CA   . GLU A 1 98  ? -17.156 1.663   11.814  1.00 0.00 ? 98  GLU A CA   5  
ATOM 9043  C C    . GLU A 1 98  ? -17.327 1.375   10.325  1.00 0.00 ? 98  GLU A C    5  
ATOM 9044  O O    . GLU A 1 98  ? -16.893 0.334   9.829   1.00 0.00 ? 98  GLU A O    5  
ATOM 9045  C CB   . GLU A 1 98  ? -18.398 1.203   12.580  1.00 0.00 ? 98  GLU A CB   5  
ATOM 9046  C CG   . GLU A 1 98  ? -19.072 -0.014  11.970  1.00 0.00 ? 98  GLU A CG   5  
ATOM 9047  C CD   . GLU A 1 98  ? -19.762 -0.880  13.006  1.00 0.00 ? 98  GLU A CD   5  
ATOM 9048  O OE1  . GLU A 1 98  ? -20.652 -0.364  13.714  1.00 0.00 ? 98  GLU A OE1  5  
ATOM 9049  O OE2  . GLU A 1 98  ? -19.412 -2.074  13.109  1.00 0.00 ? 98  GLU A OE2  5  
ATOM 9050  H H    . GLU A 1 98  ? -17.517 3.742   11.640  1.00 0.00 ? 98  GLU A H    5  
ATOM 9051  H HA   . GLU A 1 98  ? -16.297 1.119   12.178  1.00 0.00 ? 98  GLU A HA   5  
ATOM 9052  H HB2  . GLU A 1 98  ? -18.112 0.961   13.593  1.00 0.00 ? 98  GLU A HB2  5  
ATOM 9053  H HB3  . GLU A 1 98  ? -19.113 2.012   12.601  1.00 0.00 ? 98  GLU A HB3  5  
ATOM 9054  H HG2  . GLU A 1 98  ? -19.809 0.319   11.254  1.00 0.00 ? 98  GLU A HG2  5  
ATOM 9055  H HG3  . GLU A 1 98  ? -18.325 -0.609  11.465  1.00 0.00 ? 98  GLU A HG3  5  
ATOM 9056  N N    . PHE A 1 99  ? -17.962 2.303   9.618   1.00 0.00 ? 99  PHE A N    5  
ATOM 9057  C CA   . PHE A 1 99  ? -18.192 2.149   8.186   1.00 0.00 ? 99  PHE A CA   5  
ATOM 9058  C C    . PHE A 1 99  ? -16.895 2.333   7.404   1.00 0.00 ? 99  PHE A C    5  
ATOM 9059  O O    . PHE A 1 99  ? -15.906 2.841   7.932   1.00 0.00 ? 99  PHE A O    5  
ATOM 9060  C CB   . PHE A 1 99  ? -19.238 3.157   7.705   1.00 0.00 ? 99  PHE A CB   5  
ATOM 9061  C CG   . PHE A 1 99  ? -19.141 4.493   8.386   1.00 0.00 ? 99  PHE A CG   5  
ATOM 9062  C CD1  . PHE A 1 99  ? -19.715 4.694   9.631   1.00 0.00 ? 99  PHE A CD1  5  
ATOM 9063  C CD2  . PHE A 1 99  ? -18.477 5.547   7.780   1.00 0.00 ? 99  PHE A CD2  5  
ATOM 9064  C CE1  . PHE A 1 99  ? -19.627 5.921   10.260  1.00 0.00 ? 99  PHE A CE1  5  
ATOM 9065  C CE2  . PHE A 1 99  ? -18.386 6.777   8.405   1.00 0.00 ? 99  PHE A CE2  5  
ATOM 9066  C CZ   . PHE A 1 99  ? -18.963 6.964   9.645   1.00 0.00 ? 99  PHE A CZ   5  
ATOM 9067  H H    . PHE A 1 99  ? -18.284 3.112   10.070  1.00 0.00 ? 99  PHE A H    5  
ATOM 9068  H HA   . PHE A 1 99  ? -18.562 1.150   8.017   1.00 0.00 ? 99  PHE A HA   5  
ATOM 9069  H HB2  . PHE A 1 99  ? -19.113 3.316   6.645   1.00 0.00 ? 99  PHE A HB2  5  
ATOM 9070  H HB3  . PHE A 1 99  ? -20.224 2.759   7.892   1.00 0.00 ? 99  PHE A HB3  5  
ATOM 9071  H HD1  . PHE A 1 99  ? -20.236 3.878   10.112  1.00 0.00 ? 99  PHE A HD1  5  
ATOM 9072  H HD2  . PHE A 1 99  ? -18.026 5.402   6.809   1.00 0.00 ? 99  PHE A HD2  5  
ATOM 9073  H HE1  . PHE A 1 99  ? -20.080 6.064   11.230  1.00 0.00 ? 99  PHE A HE1  5  
ATOM 9074  H HE2  . PHE A 1 99  ? -17.866 7.591   7.922   1.00 0.00 ? 99  PHE A HE2  5  
ATOM 9075  H HZ   . PHE A 1 99  ? -18.893 7.924   10.135  1.00 0.00 ? 99  PHE A HZ   5  
ATOM 9076  N N    . GLN A 1 100 ? -16.908 1.915   6.142   1.00 0.00 ? 100 GLN A N    5  
ATOM 9077  C CA   . GLN A 1 100 ? -15.732 2.031   5.287   1.00 0.00 ? 100 GLN A CA   5  
ATOM 9078  C C    . GLN A 1 100 ? -16.118 2.518   3.894   1.00 0.00 ? 100 GLN A C    5  
ATOM 9079  O O    . GLN A 1 100 ? -17.027 1.976   3.267   1.00 0.00 ? 100 GLN A O    5  
ATOM 9080  C CB   . GLN A 1 100 ? -15.011 0.686   5.189   1.00 0.00 ? 100 GLN A CB   5  
ATOM 9081  C CG   . GLN A 1 100 ? -15.918 -0.461  4.773   1.00 0.00 ? 100 GLN A CG   5  
ATOM 9082  C CD   . GLN A 1 100 ? -16.217 -0.459  3.286   1.00 0.00 ? 100 GLN A CD   5  
ATOM 9083  O OE1  . GLN A 1 100 ? -17.376 -0.496  2.874   1.00 0.00 ? 100 GLN A OE1  5  
ATOM 9084  N NE2  . GLN A 1 100 ? -15.169 -0.416  2.472   1.00 0.00 ? 100 GLN A NE2  5  
ATOM 9085  H H    . GLN A 1 100 ? -17.726 1.518   5.778   1.00 0.00 ? 100 GLN A H    5  
ATOM 9086  H HA   . GLN A 1 100 ? -15.067 2.754   5.736   1.00 0.00 ? 100 GLN A HA   5  
ATOM 9087  H HB2  . GLN A 1 100 ? -14.216 0.769   4.464   1.00 0.00 ? 100 GLN A HB2  5  
ATOM 9088  H HB3  . GLN A 1 100 ? -14.586 0.448   6.152   1.00 0.00 ? 100 GLN A HB3  5  
ATOM 9089  H HG2  . GLN A 1 100 ? -15.437 -1.394  5.026   1.00 0.00 ? 100 GLN A HG2  5  
ATOM 9090  H HG3  . GLN A 1 100 ? -16.850 -0.380  5.312   1.00 0.00 ? 100 GLN A HG3  5  
ATOM 9091  H HE21 . GLN A 1 100 ? -14.273 -0.390  2.871   1.00 0.00 ? 100 GLN A HE21 5  
ATOM 9092  H HE22 . GLN A 1 100 ? -15.332 -0.415  1.507   1.00 0.00 ? 100 GLN A HE22 5  
ATOM 9093  N N    . GLY A 1 101 ? -15.421 3.545   3.417   1.00 0.00 ? 101 GLY A N    5  
ATOM 9094  C CA   . GLY A 1 101 ? -15.706 4.087   2.102   1.00 0.00 ? 101 GLY A CA   5  
ATOM 9095  C C    . GLY A 1 101 ? -15.563 3.052   1.004   1.00 0.00 ? 101 GLY A C    5  
ATOM 9096  O O    . GLY A 1 101 ? -15.513 1.853   1.275   1.00 0.00 ? 101 GLY A O    5  
ATOM 9097  H H    . GLY A 1 101 ? -14.707 3.937   3.963   1.00 0.00 ? 101 GLY A H    5  
ATOM 9098  H HA2  . GLY A 1 101 ? -16.716 4.469   2.093   1.00 0.00 ? 101 GLY A HA2  5  
ATOM 9099  H HA3  . GLY A 1 101 ? -15.023 4.901   1.905   1.00 0.00 ? 101 GLY A HA3  5  
ATOM 9100  N N    . MET A 1 102 ? -15.499 3.516   -0.240  1.00 0.00 ? 102 MET A N    5  
ATOM 9101  C CA   . MET A 1 102 ? -15.361 2.621   -1.383  1.00 0.00 ? 102 MET A CA   5  
ATOM 9102  C C    . MET A 1 102 ? -13.983 1.967   -1.399  1.00 0.00 ? 102 MET A C    5  
ATOM 9103  O O    . MET A 1 102 ? -12.967 2.634   -1.199  1.00 0.00 ? 102 MET A O    5  
ATOM 9104  C CB   . MET A 1 102 ? -15.590 3.385   -2.688  1.00 0.00 ? 102 MET A CB   5  
ATOM 9105  C CG   . MET A 1 102 ? -17.048 3.431   -3.117  1.00 0.00 ? 102 MET A CG   5  
ATOM 9106  S SD   . MET A 1 102 ? -17.258 4.057   -4.795  1.00 0.00 ? 102 MET A SD   5  
ATOM 9107  C CE   . MET A 1 102 ? -16.271 5.550   -4.726  1.00 0.00 ? 102 MET A CE   5  
ATOM 9108  H H    . MET A 1 102 ? -15.544 4.483   -0.394  1.00 0.00 ? 102 MET A H    5  
ATOM 9109  H HA   . MET A 1 102 ? -16.111 1.849   -1.292  1.00 0.00 ? 102 MET A HA   5  
ATOM 9110  H HB2  . MET A 1 102 ? -15.242 4.400   -2.562  1.00 0.00 ? 102 MET A HB2  5  
ATOM 9111  H HB3  . MET A 1 102 ? -15.021 2.912   -3.474  1.00 0.00 ? 102 MET A HB3  5  
ATOM 9112  H HG2  . MET A 1 102 ? -17.456 2.433   -3.068  1.00 0.00 ? 102 MET A HG2  5  
ATOM 9113  H HG3  . MET A 1 102 ? -17.589 4.073   -2.437  1.00 0.00 ? 102 MET A HG3  5  
ATOM 9114  H HE1  . MET A 1 102 ? -16.091 5.815   -3.695  1.00 0.00 ? 102 MET A HE1  5  
ATOM 9115  H HE2  . MET A 1 102 ? -15.327 5.380   -5.224  1.00 0.00 ? 102 MET A HE2  5  
ATOM 9116  H HE3  . MET A 1 102 ? -16.799 6.354   -5.218  1.00 0.00 ? 102 MET A HE3  5  
ATOM 9117  N N    . ASP A 1 103 ? -13.955 0.660   -1.637  1.00 0.00 ? 103 ASP A N    5  
ATOM 9118  C CA   . ASP A 1 103 ? -12.701 -0.083  -1.679  1.00 0.00 ? 103 ASP A CA   5  
ATOM 9119  C C    . ASP A 1 103 ? -12.096 -0.049  -3.079  1.00 0.00 ? 103 ASP A C    5  
ATOM 9120  O O    . ASP A 1 103 ? -12.751 -0.407  -4.058  1.00 0.00 ? 103 ASP A O    5  
ATOM 9121  C CB   . ASP A 1 103 ? -12.927 -1.531  -1.243  1.00 0.00 ? 103 ASP A CB   5  
ATOM 9122  C CG   . ASP A 1 103 ? -13.941 -1.647  -0.121  1.00 0.00 ? 103 ASP A CG   5  
ATOM 9123  O OD1  . ASP A 1 103 ? -15.097 -1.219  -0.320  1.00 0.00 ? 103 ASP A OD1  5  
ATOM 9124  O OD2  . ASP A 1 103 ? -13.577 -2.165  0.955   1.00 0.00 ? 103 ASP A OD2  5  
ATOM 9125  H H    . ASP A 1 103 ? -14.798 0.184   -1.788  1.00 0.00 ? 103 ASP A H    5  
ATOM 9126  H HA   . ASP A 1 103 ? -12.014 0.387   -0.992  1.00 0.00 ? 103 ASP A HA   5  
ATOM 9127  H HB2  . ASP A 1 103 ? -13.285 -2.103  -2.086  1.00 0.00 ? 103 ASP A HB2  5  
ATOM 9128  H HB3  . ASP A 1 103 ? -11.990 -1.948  -0.902  1.00 0.00 ? 103 ASP A HB3  5  
ATOM 9129  N N    . SER A 1 104 ? -10.843 0.386   -3.166  1.00 0.00 ? 104 SER A N    5  
ATOM 9130  C CA   . SER A 1 104 ? -10.151 0.472   -4.447  1.00 0.00 ? 104 SER A CA   5  
ATOM 9131  C C    . SER A 1 104 ? -10.037 -0.904  -5.096  1.00 0.00 ? 104 SER A C    5  
ATOM 9132  O O    . SER A 1 104 ? -10.309 -1.924  -4.464  1.00 0.00 ? 104 SER A O    5  
ATOM 9133  C CB   . SER A 1 104 ? -8.759  1.077   -4.259  1.00 0.00 ? 104 SER A CB   5  
ATOM 9134  O OG   . SER A 1 104 ? -8.223  1.516   -5.495  1.00 0.00 ? 104 SER A OG   5  
ATOM 9135  H H    . SER A 1 104 ? -10.374 0.658   -2.350  1.00 0.00 ? 104 SER A H    5  
ATOM 9136  H HA   . SER A 1 104 ? -10.730 1.115   -5.094  1.00 0.00 ? 104 SER A HA   5  
ATOM 9137  H HB2  . SER A 1 104 ? -8.823  1.921   -3.589  1.00 0.00 ? 104 SER A HB2  5  
ATOM 9138  H HB3  . SER A 1 104 ? -8.100  0.332   -3.838  1.00 0.00 ? 104 SER A HB3  5  
ATOM 9139  H HG   . SER A 1 104 ? -8.898  1.988   -5.988  1.00 0.00 ? 104 SER A HG   5  
ATOM 9140  N N    . GLU A 1 105 ? -9.632  -0.923  -6.362  1.00 0.00 ? 105 GLU A N    5  
ATOM 9141  C CA   . GLU A 1 105 ? -9.482  -2.174  -7.097  1.00 0.00 ? 105 GLU A CA   5  
ATOM 9142  C C    . GLU A 1 105 ? -8.444  -3.074  -6.433  1.00 0.00 ? 105 GLU A C    5  
ATOM 9143  O O    . GLU A 1 105 ? -7.241  -2.906  -6.634  1.00 0.00 ? 105 GLU A O    5  
ATOM 9144  C CB   . GLU A 1 105 ? -9.078  -1.894  -8.546  1.00 0.00 ? 105 GLU A CB   5  
ATOM 9145  C CG   . GLU A 1 105 ? -10.008 -0.929  -9.262  1.00 0.00 ? 105 GLU A CG   5  
ATOM 9146  C CD   . GLU A 1 105 ? -9.675  -0.780  -10.733 1.00 0.00 ? 105 GLU A CD   5  
ATOM 9147  O OE1  . GLU A 1 105 ? -8.720  -0.041  -11.053 1.00 0.00 ? 105 GLU A OE1  5  
ATOM 9148  O OE2  . GLU A 1 105 ? -10.367 -1.402  -11.565 1.00 0.00 ? 105 GLU A OE2  5  
ATOM 9149  H H    . GLU A 1 105 ? -9.430  -0.076  -6.812  1.00 0.00 ? 105 GLU A H    5  
ATOM 9150  H HA   . GLU A 1 105 ? -10.436 -2.679  -7.090  1.00 0.00 ? 105 GLU A HA   5  
ATOM 9151  H HB2  . GLU A 1 105 ? -8.082  -1.476  -8.556  1.00 0.00 ? 105 GLU A HB2  5  
ATOM 9152  H HB3  . GLU A 1 105 ? -9.072  -2.826  -9.091  1.00 0.00 ? 105 GLU A HB3  5  
ATOM 9153  H HG2  . GLU A 1 105 ? -11.021 -1.293  -9.173  1.00 0.00 ? 105 GLU A HG2  5  
ATOM 9154  H HG3  . GLU A 1 105 ? -9.933  0.040   -8.791  1.00 0.00 ? 105 GLU A HG3  5  
ATOM 9155  N N    . SER A 1 106 ? -8.919  -4.030  -5.641  1.00 0.00 ? 106 SER A N    5  
ATOM 9156  C CA   . SER A 1 106 ? -8.033  -4.954  -4.943  1.00 0.00 ? 106 SER A CA   5  
ATOM 9157  C C    . SER A 1 106 ? -6.843  -5.332  -5.820  1.00 0.00 ? 106 SER A C    5  
ATOM 9158  O O    . SER A 1 106 ? -7.009  -5.877  -6.911  1.00 0.00 ? 106 SER A O    5  
ATOM 9159  C CB   . SER A 1 106 ? -8.797  -6.214  -4.531  1.00 0.00 ? 106 SER A CB   5  
ATOM 9160  O OG   . SER A 1 106 ? -9.359  -6.862  -5.659  1.00 0.00 ? 106 SER A OG   5  
ATOM 9161  H H    . SER A 1 106 ? -9.888  -4.113  -5.521  1.00 0.00 ? 106 SER A H    5  
ATOM 9162  H HA   . SER A 1 106 ? -7.668  -4.458  -4.056  1.00 0.00 ? 106 SER A HA   5  
ATOM 9163  H HB2  . SER A 1 106 ? -8.123  -6.896  -4.037  1.00 0.00 ? 106 SER A HB2  5  
ATOM 9164  H HB3  . SER A 1 106 ? -9.594  -5.942  -3.853  1.00 0.00 ? 106 SER A HB3  5  
ATOM 9165  H HG   . SER A 1 106 ? -8.702  -7.438  -6.057  1.00 0.00 ? 106 SER A HG   5  
ATOM 9166  N N    . LYS A 1 107 ? -5.641  -5.040  -5.334  1.00 0.00 ? 107 LYS A N    5  
ATOM 9167  C CA   . LYS A 1 107 ? -4.421  -5.349  -6.070  1.00 0.00 ? 107 LYS A CA   5  
ATOM 9168  C C    . LYS A 1 107 ? -3.725  -6.572  -5.481  1.00 0.00 ? 107 LYS A C    5  
ATOM 9169  O O    . LYS A 1 107 ? -3.789  -6.815  -4.276  1.00 0.00 ? 107 LYS A O    5  
ATOM 9170  C CB   . LYS A 1 107 ? -3.471  -4.149  -6.050  1.00 0.00 ? 107 LYS A CB   5  
ATOM 9171  C CG   . LYS A 1 107 ? -4.074  -2.886  -6.638  1.00 0.00 ? 107 LYS A CG   5  
ATOM 9172  C CD   . LYS A 1 107 ? -4.127  -2.947  -8.156  1.00 0.00 ? 107 LYS A CD   5  
ATOM 9173  C CE   . LYS A 1 107 ? -2.856  -2.393  -8.780  1.00 0.00 ? 107 LYS A CE   5  
ATOM 9174  N NZ   . LYS A 1 107 ? -3.016  -2.150  -10.241 1.00 0.00 ? 107 LYS A NZ   5  
ATOM 9175  H H    . LYS A 1 107 ? -5.573  -4.605  -4.457  1.00 0.00 ? 107 LYS A H    5  
ATOM 9176  H HA   . LYS A 1 107 ? -4.696  -5.563  -7.092  1.00 0.00 ? 107 LYS A HA   5  
ATOM 9177  H HB2  . LYS A 1 107 ? -3.189  -3.946  -5.028  1.00 0.00 ? 107 LYS A HB2  5  
ATOM 9178  H HB3  . LYS A 1 107 ? -2.585  -4.398  -6.617  1.00 0.00 ? 107 LYS A HB3  5  
ATOM 9179  H HG2  . LYS A 1 107 ? -5.078  -2.766  -6.259  1.00 0.00 ? 107 LYS A HG2  5  
ATOM 9180  H HG3  . LYS A 1 107 ? -3.472  -2.038  -6.342  1.00 0.00 ? 107 LYS A HG3  5  
ATOM 9181  H HD2  . LYS A 1 107 ? -4.247  -3.976  -8.462  1.00 0.00 ? 107 LYS A HD2  5  
ATOM 9182  H HD3  . LYS A 1 107 ? -4.971  -2.366  -8.502  1.00 0.00 ? 107 LYS A HD3  5  
ATOM 9183  H HE2  . LYS A 1 107 ? -2.607  -1.462  -8.294  1.00 0.00 ? 107 LYS A HE2  5  
ATOM 9184  H HE3  . LYS A 1 107 ? -2.057  -3.103  -8.628  1.00 0.00 ? 107 LYS A HE3  5  
ATOM 9185  H HZ1  . LYS A 1 107 ? -3.481  -1.233  -10.401 1.00 0.00 ? 107 LYS A HZ1  5  
ATOM 9186  H HZ2  . LYS A 1 107 ? -3.597  -2.900  -10.666 1.00 0.00 ? 107 LYS A HZ2  5  
ATOM 9187  H HZ3  . LYS A 1 107 ? -2.086  -2.141  -10.706 1.00 0.00 ? 107 LYS A HZ3  5  
ATOM 9188  N N    . THR A 1 108 ? -3.059  -7.338  -6.339  1.00 0.00 ? 108 THR A N    5  
ATOM 9189  C CA   . THR A 1 108 ? -2.351  -8.536  -5.904  1.00 0.00 ? 108 THR A CA   5  
ATOM 9190  C C    . THR A 1 108 ? -0.844  -8.308  -5.888  1.00 0.00 ? 108 THR A C    5  
ATOM 9191  O O    . THR A 1 108 ? -0.290  -7.692  -6.799  1.00 0.00 ? 108 THR A O    5  
ATOM 9192  C CB   . THR A 1 108 ? -2.668  -9.737  -6.814  1.00 0.00 ? 108 THR A CB   5  
ATOM 9193  O OG1  . THR A 1 108 ? -2.688  -9.323  -8.184  1.00 0.00 ? 108 THR A OG1  5  
ATOM 9194  C CG2  . THR A 1 108 ? -4.008  -10.356 -6.446  1.00 0.00 ? 108 THR A CG2  5  
ATOM 9195  H H    . THR A 1 108 ? -3.045  -7.092  -7.288  1.00 0.00 ? 108 THR A H    5  
ATOM 9196  H HA   . THR A 1 108 ? -2.680  -8.772  -4.903  1.00 0.00 ? 108 THR A HA   5  
ATOM 9197  H HB   . THR A 1 108 ? -1.896  -10.482 -6.682  1.00 0.00 ? 108 THR A HB   5  
ATOM 9198  H HG1  . THR A 1 108 ? -2.006  -9.791  -8.671  1.00 0.00 ? 108 THR A HG1  5  
ATOM 9199  H HG21 . THR A 1 108 ? -4.614  -10.458 -7.334  1.00 0.00 ? 108 THR A HG21 5  
ATOM 9200  H HG22 . THR A 1 108 ? -4.516  -9.720  -5.736  1.00 0.00 ? 108 THR A HG22 5  
ATOM 9201  H HG23 . THR A 1 108 ? -3.847  -11.329 -6.007  1.00 0.00 ? 108 THR A HG23 5  
ATOM 9202  N N    . VAL A 1 109 ? -0.185  -8.809  -4.849  1.00 0.00 ? 109 VAL A N    5  
ATOM 9203  C CA   . VAL A 1 109 ? 1.259   -8.662  -4.716  1.00 0.00 ? 109 VAL A CA   5  
ATOM 9204  C C    . VAL A 1 109 ? 1.935   -10.016 -4.530  1.00 0.00 ? 109 VAL A C    5  
ATOM 9205  O O    . VAL A 1 109 ? 1.578   -10.782 -3.635  1.00 0.00 ? 109 VAL A O    5  
ATOM 9206  C CB   . VAL A 1 109 ? 1.624   -7.752  -3.528  1.00 0.00 ? 109 VAL A CB   5  
ATOM 9207  C CG1  . VAL A 1 109 ? 1.308   -8.442  -2.209  1.00 0.00 ? 109 VAL A CG1  5  
ATOM 9208  C CG2  . VAL A 1 109 ? 3.090   -7.353  -3.593  1.00 0.00 ? 109 VAL A CG2  5  
ATOM 9209  H H    . VAL A 1 109 ? -0.682  -9.291  -4.155  1.00 0.00 ? 109 VAL A H    5  
ATOM 9210  H HA   . VAL A 1 109 ? 1.633   -8.205  -5.620  1.00 0.00 ? 109 VAL A HA   5  
ATOM 9211  H HB   . VAL A 1 109 ? 1.025   -6.855  -3.591  1.00 0.00 ? 109 VAL A HB   5  
ATOM 9212  H HG11 . VAL A 1 109 ? 0.336   -8.909  -2.272  1.00 0.00 ? 109 VAL A HG11 5  
ATOM 9213  H HG12 . VAL A 1 109 ? 2.058   -9.194  -2.008  1.00 0.00 ? 109 VAL A HG12 5  
ATOM 9214  H HG13 . VAL A 1 109 ? 1.306   -7.713  -1.413  1.00 0.00 ? 109 VAL A HG13 5  
ATOM 9215  H HG21 . VAL A 1 109 ? 3.484   -7.591  -4.570  1.00 0.00 ? 109 VAL A HG21 5  
ATOM 9216  H HG22 . VAL A 1 109 ? 3.183   -6.291  -3.416  1.00 0.00 ? 109 VAL A HG22 5  
ATOM 9217  H HG23 . VAL A 1 109 ? 3.644   -7.893  -2.840  1.00 0.00 ? 109 VAL A HG23 5  
ATOM 9218  N N    . ARG A 1 110 ? 2.913   -10.304 -5.382  1.00 0.00 ? 110 ARG A N    5  
ATOM 9219  C CA   . ARG A 1 110 ? 3.639   -11.567 -5.313  1.00 0.00 ? 110 ARG A CA   5  
ATOM 9220  C C    . ARG A 1 110 ? 4.974   -11.388 -4.594  1.00 0.00 ? 110 ARG A C    5  
ATOM 9221  O O    . ARG A 1 110 ? 5.904   -10.783 -5.129  1.00 0.00 ? 110 ARG A O    5  
ATOM 9222  C CB   . ARG A 1 110 ? 3.876   -12.122 -6.719  1.00 0.00 ? 110 ARG A CB   5  
ATOM 9223  C CG   . ARG A 1 110 ? 4.062   -13.630 -6.755  1.00 0.00 ? 110 ARG A CG   5  
ATOM 9224  C CD   . ARG A 1 110 ? 4.576   -14.095 -8.108  1.00 0.00 ? 110 ARG A CD   5  
ATOM 9225  N NE   . ARG A 1 110 ? 6.012   -13.869 -8.255  1.00 0.00 ? 110 ARG A NE   5  
ATOM 9226  C CZ   . ARG A 1 110 ? 6.664   -14.008 -9.404  1.00 0.00 ? 110 ARG A CZ   5  
ATOM 9227  N NH1  . ARG A 1 110 ? 6.012   -14.370 -10.501 1.00 0.00 ? 110 ARG A NH1  5  
ATOM 9228  N NH2  . ARG A 1 110 ? 7.970   -13.784 -9.458  1.00 0.00 ? 110 ARG A NH2  5  
ATOM 9229  H H    . ARG A 1 110 ? 3.153   -9.653  -6.074  1.00 0.00 ? 110 ARG A H    5  
ATOM 9230  H HA   . ARG A 1 110 ? 3.035   -12.267 -4.756  1.00 0.00 ? 110 ARG A HA   5  
ATOM 9231  H HB2  . ARG A 1 110 ? 3.028   -11.871 -7.340  1.00 0.00 ? 110 ARG A HB2  5  
ATOM 9232  H HB3  . ARG A 1 110 ? 4.762   -11.661 -7.130  1.00 0.00 ? 110 ARG A HB3  5  
ATOM 9233  H HG2  . ARG A 1 110 ? 4.774   -13.914 -5.995  1.00 0.00 ? 110 ARG A HG2  5  
ATOM 9234  H HG3  . ARG A 1 110 ? 3.112   -14.105 -6.558  1.00 0.00 ? 110 ARG A HG3  5  
ATOM 9235  H HD2  . ARG A 1 110 ? 4.376   -15.151 -8.211  1.00 0.00 ? 110 ARG A HD2  5  
ATOM 9236  H HD3  . ARG A 1 110 ? 4.054   -13.553 -8.883  1.00 0.00 ? 110 ARG A HD3  5  
ATOM 9237  H HE   . ARG A 1 110 ? 6.513   -13.600 -7.458  1.00 0.00 ? 110 ARG A HE   5  
ATOM 9238  H HH11 . ARG A 1 110 ? 5.027   -14.539 -10.463 1.00 0.00 ? 110 ARG A HH11 5  
ATOM 9239  H HH12 . ARG A 1 110 ? 6.505   -14.473 -11.365 1.00 0.00 ? 110 ARG A HH12 5  
ATOM 9240  H HH21 . ARG A 1 110 ? 8.465   -13.510 -8.634  1.00 0.00 ? 110 ARG A HH21 5  
ATOM 9241  H HH22 . ARG A 1 110 ? 8.460   -13.889 -10.323 1.00 0.00 ? 110 ARG A HH22 5  
ATOM 9242  N N    . THR A 1 111 ? 5.060   -11.918 -3.378  1.00 0.00 ? 111 THR A N    5  
ATOM 9243  C CA   . THR A 1 111 ? 6.279   -11.816 -2.585  1.00 0.00 ? 111 THR A CA   5  
ATOM 9244  C C    . THR A 1 111 ? 7.322   -12.827 -3.047  1.00 0.00 ? 111 THR A C    5  
ATOM 9245  O O    . THR A 1 111 ? 7.197   -14.025 -2.792  1.00 0.00 ? 111 THR A O    5  
ATOM 9246  C CB   . THR A 1 111 ? 5.995   -12.036 -1.087  1.00 0.00 ? 111 THR A CB   5  
ATOM 9247  O OG1  . THR A 1 111 ? 5.438   -13.340 -0.881  1.00 0.00 ? 111 THR A OG1  5  
ATOM 9248  C CG2  . THR A 1 111 ? 5.037   -10.980 -0.557  1.00 0.00 ? 111 THR A CG2  5  
ATOM 9249  H H    . THR A 1 111 ? 4.285   -12.388 -3.006  1.00 0.00 ? 111 THR A H    5  
ATOM 9250  H HA   . THR A 1 111 ? 6.677   -10.819 -2.712  1.00 0.00 ? 111 THR A HA   5  
ATOM 9251  H HB   . THR A 1 111 ? 6.926   -11.961 -0.545  1.00 0.00 ? 111 THR A HB   5  
ATOM 9252  H HG1  . THR A 1 111 ? 4.705   -13.474 -1.487  1.00 0.00 ? 111 THR A HG1  5  
ATOM 9253  H HG21 . THR A 1 111 ? 4.998   -11.038 0.521   1.00 0.00 ? 111 THR A HG21 5  
ATOM 9254  H HG22 . THR A 1 111 ? 4.051   -11.152 -0.963  1.00 0.00 ? 111 THR A HG22 5  
ATOM 9255  H HG23 . THR A 1 111 ? 5.382   -10.001 -0.852  1.00 0.00 ? 111 THR A HG23 5  
ATOM 9256  N N    . THR A 1 112 ? 8.353   -12.337 -3.729  1.00 0.00 ? 112 THR A N    5  
ATOM 9257  C CA   . THR A 1 112 ? 9.418   -13.198 -4.227  1.00 0.00 ? 112 THR A CA   5  
ATOM 9258  C C    . THR A 1 112 ? 9.903   -14.155 -3.144  1.00 0.00 ? 112 THR A C    5  
ATOM 9259  O O    . THR A 1 112 ? 9.543   -14.018 -1.976  1.00 0.00 ? 112 THR A O    5  
ATOM 9260  C CB   . THR A 1 112 ? 10.613  -12.374 -4.741  1.00 0.00 ? 112 THR A CB   5  
ATOM 9261  O OG1  . THR A 1 112 ? 11.571  -13.236 -5.365  1.00 0.00 ? 112 THR A OG1  5  
ATOM 9262  C CG2  . THR A 1 112 ? 11.275  -11.613 -3.601  1.00 0.00 ? 112 THR A CG2  5  
ATOM 9263  H H    . THR A 1 112 ? 8.396   -11.374 -3.901  1.00 0.00 ? 112 THR A H    5  
ATOM 9264  H HA   . THR A 1 112 ? 9.023   -13.774 -5.052  1.00 0.00 ? 112 THR A HA   5  
ATOM 9265  H HB   . THR A 1 112 ? 10.253  -11.661 -5.469  1.00 0.00 ? 112 THR A HB   5  
ATOM 9266  H HG1  . THR A 1 112 ? 12.236  -12.705 -5.811  1.00 0.00 ? 112 THR A HG1  5  
ATOM 9267  H HG21 . THR A 1 112 ? 10.971  -12.041 -2.658  1.00 0.00 ? 112 THR A HG21 5  
ATOM 9268  H HG22 . THR A 1 112 ? 10.976  -10.576 -3.640  1.00 0.00 ? 112 THR A HG22 5  
ATOM 9269  H HG23 . THR A 1 112 ? 12.348  -11.682 -3.698  1.00 0.00 ? 112 THR A HG23 5  
ATOM 9270  N N    . GLU A 1 113 ? 10.723  -15.124 -3.541  1.00 0.00 ? 113 GLU A N    5  
ATOM 9271  C CA   . GLU A 1 113 ? 11.257  -16.104 -2.602  1.00 0.00 ? 113 GLU A CA   5  
ATOM 9272  C C    . GLU A 1 113 ? 12.745  -15.867 -2.356  1.00 0.00 ? 113 GLU A C    5  
ATOM 9273  O O    . GLU A 1 113 ? 13.185  -15.757 -1.212  1.00 0.00 ? 113 GLU A O    5  
ATOM 9274  C CB   . GLU A 1 113 ? 11.036  -17.522 -3.131  1.00 0.00 ? 113 GLU A CB   5  
ATOM 9275  C CG   . GLU A 1 113 ? 9.621   -18.035 -2.925  1.00 0.00 ? 113 GLU A CG   5  
ATOM 9276  C CD   . GLU A 1 113 ? 9.507   -19.533 -3.131  1.00 0.00 ? 113 GLU A CD   5  
ATOM 9277  O OE1  . GLU A 1 113 ? 9.312   -19.960 -4.288  1.00 0.00 ? 113 GLU A OE1  5  
ATOM 9278  O OE2  . GLU A 1 113 ? 9.613   -20.278 -2.135  1.00 0.00 ? 113 GLU A OE2  5  
ATOM 9279  H H    . GLU A 1 113 ? 10.974  -15.181 -4.486  1.00 0.00 ? 113 GLU A H    5  
ATOM 9280  H HA   . GLU A 1 113 ? 10.728  -15.991 -1.668  1.00 0.00 ? 113 GLU A HA   5  
ATOM 9281  H HB2  . GLU A 1 113 ? 11.253  -17.537 -4.189  1.00 0.00 ? 113 GLU A HB2  5  
ATOM 9282  H HB3  . GLU A 1 113 ? 11.716  -18.192 -2.624  1.00 0.00 ? 113 GLU A HB3  5  
ATOM 9283  H HG2  . GLU A 1 113 ? 9.309   -17.801 -1.918  1.00 0.00 ? 113 GLU A HG2  5  
ATOM 9284  H HG3  . GLU A 1 113 ? 8.966   -17.539 -3.627  1.00 0.00 ? 113 GLU A HG3  5  
ATOM 9285  N N    . GLU A 1 114 ? 13.513  -15.790 -3.438  1.00 0.00 ? 114 GLU A N    5  
ATOM 9286  C CA   . GLU A 1 114 ? 14.951  -15.568 -3.340  1.00 0.00 ? 114 GLU A CA   5  
ATOM 9287  C C    . GLU A 1 114 ? 15.250  -14.151 -2.860  1.00 0.00 ? 114 GLU A C    5  
ATOM 9288  O O    . GLU A 1 114 ? 14.788  -13.174 -3.450  1.00 0.00 ? 114 GLU A O    5  
ATOM 9289  C CB   . GLU A 1 114 ? 15.621  -15.813 -4.693  1.00 0.00 ? 114 GLU A CB   5  
ATOM 9290  C CG   . GLU A 1 114 ? 17.124  -16.019 -4.599  1.00 0.00 ? 114 GLU A CG   5  
ATOM 9291  C CD   . GLU A 1 114 ? 17.503  -17.107 -3.613  1.00 0.00 ? 114 GLU A CD   5  
ATOM 9292  O OE1  . GLU A 1 114 ? 17.582  -16.810 -2.403  1.00 0.00 ? 114 GLU A OE1  5  
ATOM 9293  O OE2  . GLU A 1 114 ? 17.721  -18.256 -4.053  1.00 0.00 ? 114 GLU A OE2  5  
ATOM 9294  H H    . GLU A 1 114 ? 13.103  -15.886 -4.323  1.00 0.00 ? 114 GLU A H    5  
ATOM 9295  H HA   . GLU A 1 114 ? 15.346  -16.269 -2.620  1.00 0.00 ? 114 GLU A HA   5  
ATOM 9296  H HB2  . GLU A 1 114 ? 15.185  -16.693 -5.143  1.00 0.00 ? 114 GLU A HB2  5  
ATOM 9297  H HB3  . GLU A 1 114 ? 15.435  -14.963 -5.332  1.00 0.00 ? 114 GLU A HB3  5  
ATOM 9298  H HG2  . GLU A 1 114 ? 17.498  -16.292 -5.575  1.00 0.00 ? 114 GLU A HG2  5  
ATOM 9299  H HG3  . GLU A 1 114 ? 17.582  -15.093 -4.285  1.00 0.00 ? 114 GLU A HG3  5  
ATOM 9300  N N    . SER A 1 115 ? 16.027  -14.047 -1.786  1.00 0.00 ? 115 SER A N    5  
ATOM 9301  C CA   . SER A 1 115 ? 16.385  -12.750 -1.224  1.00 0.00 ? 115 SER A CA   5  
ATOM 9302  C C    . SER A 1 115 ? 17.408  -12.040 -2.106  1.00 0.00 ? 115 SER A C    5  
ATOM 9303  O O    . SER A 1 115 ? 18.544  -12.490 -2.244  1.00 0.00 ? 115 SER A O    5  
ATOM 9304  C CB   . SER A 1 115 ? 16.945  -12.921 0.189   1.00 0.00 ? 115 SER A CB   5  
ATOM 9305  O OG   . SER A 1 115 ? 18.098  -13.745 0.186   1.00 0.00 ? 115 SER A OG   5  
ATOM 9306  H H    . SER A 1 115 ? 16.365  -14.863 -1.361  1.00 0.00 ? 115 SER A H    5  
ATOM 9307  H HA   . SER A 1 115 ? 15.489  -12.150 -1.178  1.00 0.00 ? 115 SER A HA   5  
ATOM 9308  H HB2  . SER A 1 115 ? 17.211  -11.953 0.587   1.00 0.00 ? 115 SER A HB2  5  
ATOM 9309  H HB3  . SER A 1 115 ? 16.194  -13.375 0.818   1.00 0.00 ? 115 SER A HB3  5  
ATOM 9310  H HG   . SER A 1 115 ? 17.836  -14.661 0.066   1.00 0.00 ? 115 SER A HG   5  
ATOM 9311  N N    . GLY A 1 116 ? 16.994  -10.926 -2.702  1.00 0.00 ? 116 GLY A N    5  
ATOM 9312  C CA   . GLY A 1 116 ? 17.885  -10.170 -3.563  1.00 0.00 ? 116 GLY A CA   5  
ATOM 9313  C C    . GLY A 1 116 ? 17.253  -8.888  -4.068  1.00 0.00 ? 116 GLY A C    5  
ATOM 9314  O O    . GLY A 1 116 ? 16.808  -8.799  -5.213  1.00 0.00 ? 116 GLY A O    5  
ATOM 9315  H H    . GLY A 1 116 ? 16.076  -10.614 -2.555  1.00 0.00 ? 116 GLY A H    5  
ATOM 9316  H HA2  . GLY A 1 116 ? 18.780  -9.925  -3.011  1.00 0.00 ? 116 GLY A HA2  5  
ATOM 9317  H HA3  . GLY A 1 116 ? 18.153  -10.784 -4.411  1.00 0.00 ? 116 GLY A HA3  5  
ATOM 9318  N N    . PRO A 1 117 ? 17.206  -7.865  -3.202  1.00 0.00 ? 117 PRO A N    5  
ATOM 9319  C CA   . PRO A 1 117 ? 16.625  -6.564  -3.544  1.00 0.00 ? 117 PRO A CA   5  
ATOM 9320  C C    . PRO A 1 117 ? 17.474  -5.798  -4.553  1.00 0.00 ? 117 PRO A C    5  
ATOM 9321  O O    . PRO A 1 117 ? 18.643  -6.118  -4.766  1.00 0.00 ? 117 PRO A O    5  
ATOM 9322  C CB   . PRO A 1 117 ? 16.593  -5.826  -2.203  1.00 0.00 ? 117 PRO A CB   5  
ATOM 9323  C CG   . PRO A 1 117 ? 17.674  -6.459  -1.397  1.00 0.00 ? 117 PRO A CG   5  
ATOM 9324  C CD   . PRO A 1 117 ? 17.718  -7.901  -1.821  1.00 0.00 ? 117 PRO A CD   5  
ATOM 9325  H HA   . PRO A 1 117 ? 15.620  -6.666  -3.924  1.00 0.00 ? 117 PRO A HA   5  
ATOM 9326  H HB2  . PRO A 1 117 ? 16.783  -4.774  -2.363  1.00 0.00 ? 117 PRO A HB2  5  
ATOM 9327  H HB3  . PRO A 1 117 ? 15.627  -5.957  -1.739  1.00 0.00 ? 117 PRO A HB3  5  
ATOM 9328  H HG2  . PRO A 1 117 ? 18.618  -5.978  -1.605  1.00 0.00 ? 117 PRO A HG2  5  
ATOM 9329  H HG3  . PRO A 1 117 ? 17.438  -6.385  -0.345  1.00 0.00 ? 117 PRO A HG3  5  
ATOM 9330  H HD2  . PRO A 1 117 ? 18.731  -8.272  -1.795  1.00 0.00 ? 117 PRO A HD2  5  
ATOM 9331  H HD3  . PRO A 1 117 ? 17.078  -8.500  -1.189  1.00 0.00 ? 117 PRO A HD3  5  
ATOM 9332  N N    . SER A 1 118 ? 16.877  -4.784  -5.172  1.00 0.00 ? 118 SER A N    5  
ATOM 9333  C CA   . SER A 1 118 ? 17.577  -3.974  -6.162  1.00 0.00 ? 118 SER A CA   5  
ATOM 9334  C C    . SER A 1 118 ? 17.523  -2.495  -5.790  1.00 0.00 ? 118 SER A C    5  
ATOM 9335  O O    . SER A 1 118 ? 16.447  -1.934  -5.587  1.00 0.00 ? 118 SER A O    5  
ATOM 9336  C CB   . SER A 1 118 ? 16.968  -4.186  -7.549  1.00 0.00 ? 118 SER A CB   5  
ATOM 9337  O OG   . SER A 1 118 ? 17.447  -3.221  -8.469  1.00 0.00 ? 118 SER A OG   5  
ATOM 9338  H H    . SER A 1 118 ? 15.943  -4.577  -4.959  1.00 0.00 ? 118 SER A H    5  
ATOM 9339  H HA   . SER A 1 118 ? 18.609  -4.291  -6.179  1.00 0.00 ? 118 SER A HA   5  
ATOM 9340  H HB2  . SER A 1 118 ? 17.230  -5.169  -7.908  1.00 0.00 ? 118 SER A HB2  5  
ATOM 9341  H HB3  . SER A 1 118 ? 15.893  -4.101  -7.483  1.00 0.00 ? 118 SER A HB3  5  
ATOM 9342  H HG   . SER A 1 118 ? 16.876  -3.202  -9.241  1.00 0.00 ? 118 SER A HG   5  
ATOM 9343  N N    . SER A 1 119 ? 18.693  -1.870  -5.705  1.00 0.00 ? 119 SER A N    5  
ATOM 9344  C CA   . SER A 1 119 ? 18.780  -0.457  -5.354  1.00 0.00 ? 119 SER A CA   5  
ATOM 9345  C C    . SER A 1 119 ? 19.935  0.215   -6.090  1.00 0.00 ? 119 SER A C    5  
ATOM 9346  O O    . SER A 1 119 ? 20.924  -0.430  -6.437  1.00 0.00 ? 119 SER A O    5  
ATOM 9347  C CB   . SER A 1 119 ? 18.960  -0.295  -3.843  1.00 0.00 ? 119 SER A CB   5  
ATOM 9348  O OG   . SER A 1 119 ? 20.294  -0.573  -3.456  1.00 0.00 ? 119 SER A OG   5  
ATOM 9349  H H    . SER A 1 119 ? 19.517  -2.371  -5.879  1.00 0.00 ? 119 SER A H    5  
ATOM 9350  H HA   . SER A 1 119 ? 17.856  0.016   -5.651  1.00 0.00 ? 119 SER A HA   5  
ATOM 9351  H HB2  . SER A 1 119 ? 18.721  0.719   -3.562  1.00 0.00 ? 119 SER A HB2  5  
ATOM 9352  H HB3  . SER A 1 119 ? 18.298  -0.977  -3.330  1.00 0.00 ? 119 SER A HB3  5  
ATOM 9353  H HG   . SER A 1 119 ? 20.726  -1.088  -4.141  1.00 0.00 ? 119 SER A HG   5  
ATOM 9354  N N    . GLY A 1 120 ? 19.802  1.517   -6.325  1.00 0.00 ? 120 GLY A N    5  
ATOM 9355  C CA   . GLY A 1 120 ? 20.841  2.256   -7.018  1.00 0.00 ? 120 GLY A CA   5  
ATOM 9356  C C    . GLY A 1 120 ? 20.341  3.574   -7.576  1.00 0.00 ? 120 GLY A C    5  
ATOM 9357  O O    . GLY A 1 120 ? 19.871  3.636   -8.712  1.00 0.00 ? 120 GLY A O    5  
ATOM 9358  H H    . GLY A 1 120 ? 18.992  1.979   -6.025  1.00 0.00 ? 120 GLY A H    5  
ATOM 9359  H HA2  . GLY A 1 120 ? 21.649  2.452   -6.330  1.00 0.00 ? 120 GLY A HA2  5  
ATOM 9360  H HA3  . GLY A 1 120 ? 21.214  1.652   -7.833  1.00 0.00 ? 120 GLY A HA3  5  
ATOM 9361  N N    . GLY A 1 1   ? -20.678 22.788  12.393  1.00 0.00 ? 1   GLY A N    6  
ATOM 9362  C CA   . GLY A 1 1   ? -21.509 22.112  13.372  1.00 0.00 ? 1   GLY A CA   6  
ATOM 9363  C C    . GLY A 1 1   ? -22.980 22.438  13.208  1.00 0.00 ? 1   GLY A C    6  
ATOM 9364  O O    . GLY A 1 1   ? -23.400 23.571  13.441  1.00 0.00 ? 1   GLY A O    6  
ATOM 9365  H H1   . GLY A 1 1   ? -19.871 23.263  12.683  1.00 0.00 ? 1   GLY A H1   6  
ATOM 9366  H HA2  . GLY A 1 1   ? -21.373 21.045  13.268  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 9367  H HA3  . GLY A 1 1   ? -21.194 22.409  14.361  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 9368  N N    . SER A 1 2   ? -23.764 21.444  12.805  1.00 0.00 ? 2   SER A N    6  
ATOM 9369  C CA   . SER A 1 2   ? -25.196 21.632  12.605  1.00 0.00 ? 2   SER A CA   6  
ATOM 9370  C C    . SER A 1 2   ? -25.983 21.145  13.817  1.00 0.00 ? 2   SER A C    6  
ATOM 9371  O O    . SER A 1 2   ? -25.667 20.107  14.399  1.00 0.00 ? 2   SER A O    6  
ATOM 9372  C CB   . SER A 1 2   ? -25.659 20.890  11.350  1.00 0.00 ? 2   SER A CB   6  
ATOM 9373  O OG   . SER A 1 2   ? -24.945 21.327  10.206  1.00 0.00 ? 2   SER A OG   6  
ATOM 9374  H H    . SER A 1 2   ? -23.369 20.562  12.636  1.00 0.00 ? 2   SER A H    6  
ATOM 9375  H HA   . SER A 1 2   ? -25.376 22.689  12.475  1.00 0.00 ? 2   SER A HA   6  
ATOM 9376  H HB2  . SER A 1 2   ? -25.493 19.831  11.479  1.00 0.00 ? 2   SER A HB2  6  
ATOM 9377  H HB3  . SER A 1 2   ? -26.712 21.074  11.194  1.00 0.00 ? 2   SER A HB3  6  
ATOM 9378  H HG   . SER A 1 2   ? -24.835 22.280  10.242  1.00 0.00 ? 2   SER A HG   6  
ATOM 9379  N N    . SER A 1 3   ? -27.009 21.901  14.192  1.00 0.00 ? 3   SER A N    6  
ATOM 9380  C CA   . SER A 1 3   ? -27.840 21.549  15.338  1.00 0.00 ? 3   SER A CA   6  
ATOM 9381  C C    . SER A 1 3   ? -28.866 20.485  14.958  1.00 0.00 ? 3   SER A C    6  
ATOM 9382  O O    . SER A 1 3   ? -30.028 20.792  14.696  1.00 0.00 ? 3   SER A O    6  
ATOM 9383  C CB   . SER A 1 3   ? -28.553 22.791  15.878  1.00 0.00 ? 3   SER A CB   6  
ATOM 9384  O OG   . SER A 1 3   ? -27.663 23.608  16.617  1.00 0.00 ? 3   SER A OG   6  
ATOM 9385  H H    . SER A 1 3   ? -27.211 22.717  13.687  1.00 0.00 ? 3   SER A H    6  
ATOM 9386  H HA   . SER A 1 3   ? -27.194 21.152  16.106  1.00 0.00 ? 3   SER A HA   6  
ATOM 9387  H HB2  . SER A 1 3   ? -28.948 23.364  15.053  1.00 0.00 ? 3   SER A HB2  6  
ATOM 9388  H HB3  . SER A 1 3   ? -29.363 22.484  16.524  1.00 0.00 ? 3   SER A HB3  6  
ATOM 9389  H HG   . SER A 1 3   ? -28.006 24.504  16.653  1.00 0.00 ? 3   SER A HG   6  
ATOM 9390  N N    . GLY A 1 4   ? -28.425 19.231  14.932  1.00 0.00 ? 4   GLY A N    6  
ATOM 9391  C CA   . GLY A 1 4   ? -29.316 18.139  14.584  1.00 0.00 ? 4   GLY A CA   6  
ATOM 9392  C C    . GLY A 1 4   ? -28.598 16.806  14.510  1.00 0.00 ? 4   GLY A C    6  
ATOM 9393  O O    . GLY A 1 4   ? -27.873 16.432  15.432  1.00 0.00 ? 4   GLY A O    6  
ATOM 9394  H H    . GLY A 1 4   ? -27.488 19.045  15.151  1.00 0.00 ? 4   GLY A H    6  
ATOM 9395  H HA2  . GLY A 1 4   ? -30.096 18.075  15.327  1.00 0.00 ? 4   GLY A HA2  6  
ATOM 9396  H HA3  . GLY A 1 4   ? -29.763 18.347  13.623  1.00 0.00 ? 4   GLY A HA3  6  
ATOM 9397  N N    . SER A 1 5   ? -28.800 16.087  13.411  1.00 0.00 ? 5   SER A N    6  
ATOM 9398  C CA   . SER A 1 5   ? -28.171 14.785  13.223  1.00 0.00 ? 5   SER A CA   6  
ATOM 9399  C C    . SER A 1 5   ? -26.692 14.941  12.882  1.00 0.00 ? 5   SER A C    6  
ATOM 9400  O O    . SER A 1 5   ? -26.339 15.405  11.798  1.00 0.00 ? 5   SER A O    6  
ATOM 9401  C CB   . SER A 1 5   ? -28.882 14.006  12.115  1.00 0.00 ? 5   SER A CB   6  
ATOM 9402  O OG   . SER A 1 5   ? -30.200 13.658  12.501  1.00 0.00 ? 5   SER A OG   6  
ATOM 9403  H H    . SER A 1 5   ? -29.389 16.439  12.711  1.00 0.00 ? 5   SER A H    6  
ATOM 9404  H HA   . SER A 1 5   ? -28.258 14.237  14.149  1.00 0.00 ? 5   SER A HA   6  
ATOM 9405  H HB2  . SER A 1 5   ? -28.930 14.614  11.224  1.00 0.00 ? 5   SER A HB2  6  
ATOM 9406  H HB3  . SER A 1 5   ? -28.330 13.101  11.903  1.00 0.00 ? 5   SER A HB3  6  
ATOM 9407  H HG   . SER A 1 5   ? -30.520 14.287  13.152  1.00 0.00 ? 5   SER A HG   6  
ATOM 9408  N N    . SER A 1 6   ? -25.831 14.549  13.816  1.00 0.00 ? 6   SER A N    6  
ATOM 9409  C CA   . SER A 1 6   ? -24.390 14.648  13.617  1.00 0.00 ? 6   SER A CA   6  
ATOM 9410  C C    . SER A 1 6   ? -23.957 13.868  12.379  1.00 0.00 ? 6   SER A C    6  
ATOM 9411  O O    . SER A 1 6   ? -24.693 13.020  11.878  1.00 0.00 ? 6   SER A O    6  
ATOM 9412  C CB   . SER A 1 6   ? -23.647 14.126  14.848  1.00 0.00 ? 6   SER A CB   6  
ATOM 9413  O OG   . SER A 1 6   ? -22.338 14.665  14.921  1.00 0.00 ? 6   SER A OG   6  
ATOM 9414  H H    . SER A 1 6   ? -26.174 14.187  14.660  1.00 0.00 ? 6   SER A H    6  
ATOM 9415  H HA   . SER A 1 6   ? -24.146 15.690  13.475  1.00 0.00 ? 6   SER A HA   6  
ATOM 9416  H HB2  . SER A 1 6   ? -24.188 14.407  15.739  1.00 0.00 ? 6   SER A HB2  6  
ATOM 9417  H HB3  . SER A 1 6   ? -23.577 13.049  14.794  1.00 0.00 ? 6   SER A HB3  6  
ATOM 9418  H HG   . SER A 1 6   ? -21.805 14.133  15.516  1.00 0.00 ? 6   SER A HG   6  
ATOM 9419  N N    . GLY A 1 7   ? -22.756 14.163  11.892  1.00 0.00 ? 7   GLY A N    6  
ATOM 9420  C CA   . GLY A 1 7   ? -22.244 13.481  10.717  1.00 0.00 ? 7   GLY A CA   6  
ATOM 9421  C C    . GLY A 1 7   ? -23.190 13.574  9.536   1.00 0.00 ? 7   GLY A C    6  
ATOM 9422  O O    . GLY A 1 7   ? -24.059 12.720  9.360   1.00 0.00 ? 7   GLY A O    6  
ATOM 9423  H H    . GLY A 1 7   ? -22.212 14.848  12.334  1.00 0.00 ? 7   GLY A H    6  
ATOM 9424  H HA2  . GLY A 1 7   ? -21.298 13.922  10.442  1.00 0.00 ? 7   GLY A HA2  6  
ATOM 9425  H HA3  . GLY A 1 7   ? -22.089 12.440  10.958  1.00 0.00 ? 7   GLY A HA3  6  
ATOM 9426  N N    . ARG A 1 8   ? -23.022 14.613  8.725   1.00 0.00 ? 8   ARG A N    6  
ATOM 9427  C CA   . ARG A 1 8   ? -23.869 14.815  7.556   1.00 0.00 ? 8   ARG A CA   6  
ATOM 9428  C C    . ARG A 1 8   ? -23.122 14.458  6.274   1.00 0.00 ? 8   ARG A C    6  
ATOM 9429  O O    . ARG A 1 8   ? -23.677 13.824  5.378   1.00 0.00 ? 8   ARG A O    6  
ATOM 9430  C CB   . ARG A 1 8   ? -24.349 16.266  7.492   1.00 0.00 ? 8   ARG A CB   6  
ATOM 9431  C CG   . ARG A 1 8   ? -25.343 16.628  8.583   1.00 0.00 ? 8   ARG A CG   6  
ATOM 9432  C CD   . ARG A 1 8   ? -26.757 16.214  8.208   1.00 0.00 ? 8   ARG A CD   6  
ATOM 9433  N NE   . ARG A 1 8   ? -27.761 16.883  9.031   1.00 0.00 ? 8   ARG A NE   6  
ATOM 9434  C CZ   . ARG A 1 8   ? -29.029 16.494  9.106   1.00 0.00 ? 8   ARG A CZ   6  
ATOM 9435  N NH1  . ARG A 1 8   ? -29.446 15.445  8.411   1.00 0.00 ? 8   ARG A NH1  6  
ATOM 9436  N NH2  . ARG A 1 8   ? -29.882 17.155  9.878   1.00 0.00 ? 8   ARG A NH2  6  
ATOM 9437  H H    . ARG A 1 8   ? -22.311 15.260  8.917   1.00 0.00 ? 8   ARG A H    6  
ATOM 9438  H HA   . ARG A 1 8   ? -24.727 14.166  7.651   1.00 0.00 ? 8   ARG A HA   6  
ATOM 9439  H HB2  . ARG A 1 8   ? -23.494 16.920  7.584   1.00 0.00 ? 8   ARG A HB2  6  
ATOM 9440  H HB3  . ARG A 1 8   ? -24.820 16.435  6.536   1.00 0.00 ? 8   ARG A HB3  6  
ATOM 9441  H HG2  . ARG A 1 8   ? -25.062 16.122  9.496   1.00 0.00 ? 8   ARG A HG2  6  
ATOM 9442  H HG3  . ARG A 1 8   ? -25.319 17.696  8.740   1.00 0.00 ? 8   ARG A HG3  6  
ATOM 9443  H HD2  . ARG A 1 8   ? -26.929 16.466  7.172   1.00 0.00 ? 8   ARG A HD2  6  
ATOM 9444  H HD3  . ARG A 1 8   ? -26.852 15.146  8.339   1.00 0.00 ? 8   ARG A HD3  6  
ATOM 9445  H HE   . ARG A 1 8   ? -27.474 17.661  9.553   1.00 0.00 ? 8   ARG A HE   6  
ATOM 9446  H HH11 . ARG A 1 8   ? -28.805 14.945  7.830   1.00 0.00 ? 8   ARG A HH11 6  
ATOM 9447  H HH12 . ARG A 1 8   ? -30.401 15.153  8.470   1.00 0.00 ? 8   ARG A HH12 6  
ATOM 9448  H HH21 . ARG A 1 8   ? -29.571 17.946  10.404  1.00 0.00 ? 8   ARG A HH21 6  
ATOM 9449  H HH22 . ARG A 1 8   ? -30.836 16.862  9.934   1.00 0.00 ? 8   ARG A HH22 6  
ATOM 9450  N N    . GLN A 1 9   ? -21.861 14.870  6.196   1.00 0.00 ? 9   GLN A N    6  
ATOM 9451  C CA   . GLN A 1 9   ? -21.039 14.595  5.024   1.00 0.00 ? 9   GLN A CA   6  
ATOM 9452  C C    . GLN A 1 9   ? -20.580 13.140  5.010   1.00 0.00 ? 9   GLN A C    6  
ATOM 9453  O O    . GLN A 1 9   ? -20.160 12.621  3.976   1.00 0.00 ? 9   GLN A O    6  
ATOM 9454  C CB   . GLN A 1 9   ? -19.825 15.525  4.996   1.00 0.00 ? 9   GLN A CB   6  
ATOM 9455  C CG   . GLN A 1 9   ? -18.946 15.342  3.770   1.00 0.00 ? 9   GLN A CG   6  
ATOM 9456  C CD   . GLN A 1 9   ? -19.562 15.931  2.517   1.00 0.00 ? 9   GLN A CD   6  
ATOM 9457  O OE1  . GLN A 1 9   ? -20.778 16.104  2.431   1.00 0.00 ? 9   GLN A OE1  6  
ATOM 9458  N NE2  . GLN A 1 9   ? -18.723 16.245  1.536   1.00 0.00 ? 9   GLN A NE2  6  
ATOM 9459  H H    . GLN A 1 9   ? -21.475 15.371  6.944   1.00 0.00 ? 9   GLN A H    6  
ATOM 9460  H HA   . GLN A 1 9   ? -21.641 14.778  4.147   1.00 0.00 ? 9   GLN A HA   6  
ATOM 9461  H HB2  . GLN A 1 9   ? -20.170 16.548  5.016   1.00 0.00 ? 9   GLN A HB2  6  
ATOM 9462  H HB3  . GLN A 1 9   ? -19.224 15.339  5.874   1.00 0.00 ? 9   GLN A HB3  6  
ATOM 9463  H HG2  . GLN A 1 9   ? -17.996 15.825  3.947   1.00 0.00 ? 9   GLN A HG2  6  
ATOM 9464  H HG3  . GLN A 1 9   ? -18.786 14.285  3.613   1.00 0.00 ? 9   GLN A HG3  6  
ATOM 9465  H HE21 . GLN A 1 9   ? -17.767 16.078  1.674   1.00 0.00 ? 9   GLN A HE21 6  
ATOM 9466  H HE22 . GLN A 1 9   ? -19.094 16.627  0.714   1.00 0.00 ? 9   GLN A HE22 6  
ATOM 9467  N N    . VAL A 1 10  ? -20.662 12.488  6.166   1.00 0.00 ? 10  VAL A N    6  
ATOM 9468  C CA   . VAL A 1 10  ? -20.256 11.093  6.287   1.00 0.00 ? 10  VAL A CA   6  
ATOM 9469  C C    . VAL A 1 10  ? -20.690 10.287  5.068   1.00 0.00 ? 10  VAL A C    6  
ATOM 9470  O O    . VAL A 1 10  ? -19.858 9.845   4.276   1.00 0.00 ? 10  VAL A O    6  
ATOM 9471  C CB   . VAL A 1 10  ? -20.846 10.445  7.553   1.00 0.00 ? 10  VAL A CB   6  
ATOM 9472  C CG1  . VAL A 1 10  ? -20.207 9.088   7.806   1.00 0.00 ? 10  VAL A CG1  6  
ATOM 9473  C CG2  . VAL A 1 10  ? -20.663 11.361  8.754   1.00 0.00 ? 10  VAL A CG2  6  
ATOM 9474  H H    . VAL A 1 10  ? -21.005 12.956  6.955   1.00 0.00 ? 10  VAL A H    6  
ATOM 9475  H HA   . VAL A 1 10  ? -19.179 11.064  6.361   1.00 0.00 ? 10  VAL A HA   6  
ATOM 9476  H HB   . VAL A 1 10  ? -21.904 10.296  7.398   1.00 0.00 ? 10  VAL A HB   6  
ATOM 9477  H HG11 . VAL A 1 10  ? -19.137 9.163   7.673   1.00 0.00 ? 10  VAL A HG11 6  
ATOM 9478  H HG12 . VAL A 1 10  ? -20.424 8.769   8.815   1.00 0.00 ? 10  VAL A HG12 6  
ATOM 9479  H HG13 . VAL A 1 10  ? -20.605 8.367   7.106   1.00 0.00 ? 10  VAL A HG13 6  
ATOM 9480  H HG21 . VAL A 1 10  ? -21.604 11.837  8.989   1.00 0.00 ? 10  VAL A HG21 6  
ATOM 9481  H HG22 . VAL A 1 10  ? -20.332 10.780  9.603   1.00 0.00 ? 10  VAL A HG22 6  
ATOM 9482  H HG23 . VAL A 1 10  ? -19.925 12.114  8.524   1.00 0.00 ? 10  VAL A HG23 6  
ATOM 9483  N N    . GLN A 1 11  ? -21.998 10.099  4.924   1.00 0.00 ? 11  GLN A N    6  
ATOM 9484  C CA   . GLN A 1 11  ? -22.542 9.346   3.800   1.00 0.00 ? 11  GLN A CA   6  
ATOM 9485  C C    . GLN A 1 11  ? -22.694 10.235  2.571   1.00 0.00 ? 11  GLN A C    6  
ATOM 9486  O O    . GLN A 1 11  ? -23.574 10.016  1.738   1.00 0.00 ? 11  GLN A O    6  
ATOM 9487  C CB   . GLN A 1 11  ? -23.895 8.737   4.175   1.00 0.00 ? 11  GLN A CB   6  
ATOM 9488  C CG   . GLN A 1 11  ? -23.846 7.863   5.417   1.00 0.00 ? 11  GLN A CG   6  
ATOM 9489  C CD   . GLN A 1 11  ? -24.969 6.846   5.460   1.00 0.00 ? 11  GLN A CD   6  
ATOM 9490  O OE1  . GLN A 1 11  ? -25.543 6.494   4.429   1.00 0.00 ? 11  GLN A OE1  6  
ATOM 9491  N NE2  . GLN A 1 11  ? -25.290 6.368   6.657   1.00 0.00 ? 11  GLN A NE2  6  
ATOM 9492  H H    . GLN A 1 11  ? -22.611 10.476  5.588   1.00 0.00 ? 11  GLN A H    6  
ATOM 9493  H HA   . GLN A 1 11  ? -21.851 8.549   3.570   1.00 0.00 ? 11  GLN A HA   6  
ATOM 9494  H HB2  . GLN A 1 11  ? -24.600 9.536   4.350   1.00 0.00 ? 11  GLN A HB2  6  
ATOM 9495  H HB3  . GLN A 1 11  ? -24.245 8.134   3.350   1.00 0.00 ? 11  GLN A HB3  6  
ATOM 9496  H HG2  . GLN A 1 11  ? -22.904 7.336   5.434   1.00 0.00 ? 11  GLN A HG2  6  
ATOM 9497  H HG3  . GLN A 1 11  ? -23.919 8.496   6.290   1.00 0.00 ? 11  GLN A HG3  6  
ATOM 9498  H HE21 . GLN A 1 11  ? -24.791 6.696   7.435   1.00 0.00 ? 11  GLN A HE21 6  
ATOM 9499  H HE22 . GLN A 1 11  ? -26.013 5.710   6.714   1.00 0.00 ? 11  GLN A HE22 6  
ATOM 9500  N N    . LYS A 1 12  ? -21.831 11.240  2.463   1.00 0.00 ? 12  LYS A N    6  
ATOM 9501  C CA   . LYS A 1 12  ? -21.868 12.163  1.335   1.00 0.00 ? 12  LYS A CA   6  
ATOM 9502  C C    . LYS A 1 12  ? -20.515 12.218  0.633   1.00 0.00 ? 12  LYS A C    6  
ATOM 9503  O O    . LYS A 1 12  ? -20.445 12.365  -0.587  1.00 0.00 ? 12  LYS A O    6  
ATOM 9504  C CB   . LYS A 1 12  ? -22.266 13.563  1.808   1.00 0.00 ? 12  LYS A CB   6  
ATOM 9505  C CG   . LYS A 1 12  ? -22.671 14.494  0.678   1.00 0.00 ? 12  LYS A CG   6  
ATOM 9506  C CD   . LYS A 1 12  ? -24.048 14.146  0.136   1.00 0.00 ? 12  LYS A CD   6  
ATOM 9507  C CE   . LYS A 1 12  ? -25.152 14.739  0.997   1.00 0.00 ? 12  LYS A CE   6  
ATOM 9508  N NZ   . LYS A 1 12  ? -26.488 14.181  0.648   1.00 0.00 ? 12  LYS A NZ   6  
ATOM 9509  H H    . LYS A 1 12  ? -21.152 11.363  3.160   1.00 0.00 ? 12  LYS A H    6  
ATOM 9510  H HA   . LYS A 1 12  ? -22.608 11.804  0.637   1.00 0.00 ? 12  LYS A HA   6  
ATOM 9511  H HB2  . LYS A 1 12  ? -23.098 13.476  2.491   1.00 0.00 ? 12  LYS A HB2  6  
ATOM 9512  H HB3  . LYS A 1 12  ? -21.429 14.006  2.328   1.00 0.00 ? 12  LYS A HB3  6  
ATOM 9513  H HG2  . LYS A 1 12  ? -22.688 15.508  1.048   1.00 0.00 ? 12  LYS A HG2  6  
ATOM 9514  H HG3  . LYS A 1 12  ? -21.948 14.412  -0.121  1.00 0.00 ? 12  LYS A HG3  6  
ATOM 9515  H HD2  . LYS A 1 12  ? -24.140 14.538  -0.866  1.00 0.00 ? 12  LYS A HD2  6  
ATOM 9516  H HD3  . LYS A 1 12  ? -24.156 13.071  0.116   1.00 0.00 ? 12  LYS A HD3  6  
ATOM 9517  H HE2  . LYS A 1 12  ? -24.940 14.521  2.033   1.00 0.00 ? 12  LYS A HE2  6  
ATOM 9518  H HE3  . LYS A 1 12  ? -25.169 15.809  0.852   1.00 0.00 ? 12  LYS A HE3  6  
ATOM 9519  H HZ1  . LYS A 1 12  ? -26.656 14.271  -0.375  1.00 0.00 ? 12  LYS A HZ1  6  
ATOM 9520  H HZ2  . LYS A 1 12  ? -27.235 14.696  1.157   1.00 0.00 ? 12  LYS A HZ2  6  
ATOM 9521  H HZ3  . LYS A 1 12  ? -26.535 13.176  0.910   1.00 0.00 ? 12  LYS A HZ3  6  
ATOM 9522  N N    . GLU A 1 13  ? -19.444 12.097  1.411   1.00 0.00 ? 13  GLU A N    6  
ATOM 9523  C CA   . GLU A 1 13  ? -18.094 12.132  0.862   1.00 0.00 ? 13  GLU A CA   6  
ATOM 9524  C C    . GLU A 1 13  ? -17.476 10.737  0.845   1.00 0.00 ? 13  GLU A C    6  
ATOM 9525  O O    . GLU A 1 13  ? -16.791 10.360  -0.106  1.00 0.00 ? 13  GLU A O    6  
ATOM 9526  C CB   . GLU A 1 13  ? -17.213 13.082  1.676   1.00 0.00 ? 13  GLU A CB   6  
ATOM 9527  C CG   . GLU A 1 13  ? -15.731 12.756  1.597   1.00 0.00 ? 13  GLU A CG   6  
ATOM 9528  C CD   . GLU A 1 13  ? -15.152 13.003  0.217   1.00 0.00 ? 13  GLU A CD   6  
ATOM 9529  O OE1  . GLU A 1 13  ? -15.787 12.591  -0.776  1.00 0.00 ? 13  GLU A OE1  6  
ATOM 9530  O OE2  . GLU A 1 13  ? -14.064 13.610  0.131   1.00 0.00 ? 13  GLU A OE2  6  
ATOM 9531  H H    . GLU A 1 13  ? -19.565 11.982  2.377   1.00 0.00 ? 13  GLU A H    6  
ATOM 9532  H HA   . GLU A 1 13  ? -18.158 12.496  -0.152  1.00 0.00 ? 13  GLU A HA   6  
ATOM 9533  H HB2  . GLU A 1 13  ? -17.359 14.089  1.314   1.00 0.00 ? 13  GLU A HB2  6  
ATOM 9534  H HB3  . GLU A 1 13  ? -17.515 13.034  2.712   1.00 0.00 ? 13  GLU A HB3  6  
ATOM 9535  H HG2  . GLU A 1 13  ? -15.201 13.372  2.308   1.00 0.00 ? 13  GLU A HG2  6  
ATOM 9536  H HG3  . GLU A 1 13  ? -15.590 11.715  1.849   1.00 0.00 ? 13  GLU A HG3  6  
ATOM 9537  N N    . LEU A 1 14  ? -17.723 9.974   1.905   1.00 0.00 ? 14  LEU A N    6  
ATOM 9538  C CA   . LEU A 1 14  ? -17.192 8.620   2.014   1.00 0.00 ? 14  LEU A CA   6  
ATOM 9539  C C    . LEU A 1 14  ? -17.137 7.945   0.647   1.00 0.00 ? 14  LEU A C    6  
ATOM 9540  O O    . LEU A 1 14  ? -16.060 7.708   0.103   1.00 0.00 ? 14  LEU A O    6  
ATOM 9541  C CB   . LEU A 1 14  ? -18.049 7.790   2.971   1.00 0.00 ? 14  LEU A CB   6  
ATOM 9542  C CG   . LEU A 1 14  ? -17.678 6.312   3.095   1.00 0.00 ? 14  LEU A CG   6  
ATOM 9543  C CD1  . LEU A 1 14  ? -16.558 6.127   4.107   1.00 0.00 ? 14  LEU A CD1  6  
ATOM 9544  C CD2  . LEU A 1 14  ? -18.895 5.487   3.487   1.00 0.00 ? 14  LEU A CD2  6  
ATOM 9545  H H    . LEU A 1 14  ? -18.276 10.330  2.632   1.00 0.00 ? 14  LEU A H    6  
ATOM 9546  H HA   . LEU A 1 14  ? -16.189 8.688   2.409   1.00 0.00 ? 14  LEU A HA   6  
ATOM 9547  H HB2  . LEU A 1 14  ? -17.973 8.234   3.952   1.00 0.00 ? 14  LEU A HB2  6  
ATOM 9548  H HB3  . LEU A 1 14  ? -19.074 7.848   2.631   1.00 0.00 ? 14  LEU A HB3  6  
ATOM 9549  H HG   . LEU A 1 14  ? -17.324 5.955   2.138   1.00 0.00 ? 14  LEU A HG   6  
ATOM 9550  H HD11 . LEU A 1 14  ? -15.665 6.618   3.751   1.00 0.00 ? 14  LEU A HD11 6  
ATOM 9551  H HD12 . LEU A 1 14  ? -16.362 5.073   4.237   1.00 0.00 ? 14  LEU A HD12 6  
ATOM 9552  H HD13 . LEU A 1 14  ? -16.853 6.557   5.053   1.00 0.00 ? 14  LEU A HD13 6  
ATOM 9553  H HD21 . LEU A 1 14  ? -19.790 6.073   3.335   1.00 0.00 ? 14  LEU A HD21 6  
ATOM 9554  H HD22 . LEU A 1 14  ? -18.821 5.208   4.528   1.00 0.00 ? 14  LEU A HD22 6  
ATOM 9555  H HD23 . LEU A 1 14  ? -18.938 4.598   2.877   1.00 0.00 ? 14  LEU A HD23 6  
ATOM 9556  N N    . GLY A 1 15  ? -18.308 7.639   0.096   1.00 0.00 ? 15  GLY A N    6  
ATOM 9557  C CA   . GLY A 1 15  ? -18.371 6.997   -1.203  1.00 0.00 ? 15  GLY A CA   6  
ATOM 9558  C C    . GLY A 1 15  ? -17.856 7.888   -2.316  1.00 0.00 ? 15  GLY A C    6  
ATOM 9559  O O    . GLY A 1 15  ? -17.060 7.454   -3.149  1.00 0.00 ? 15  GLY A O    6  
ATOM 9560  H H    . GLY A 1 15  ? -19.136 7.852   0.576   1.00 0.00 ? 15  GLY A H    6  
ATOM 9561  H HA2  . GLY A 1 15  ? -17.779 6.094   -1.176  1.00 0.00 ? 15  GLY A HA2  6  
ATOM 9562  H HA3  . GLY A 1 15  ? -19.398 6.735   -1.413  1.00 0.00 ? 15  GLY A HA3  6  
ATOM 9563  N N    . ASP A 1 16  ? -18.313 9.135   -2.332  1.00 0.00 ? 16  ASP A N    6  
ATOM 9564  C CA   . ASP A 1 16  ? -17.894 10.090  -3.352  1.00 0.00 ? 16  ASP A CA   6  
ATOM 9565  C C    . ASP A 1 16  ? -16.400 9.962   -3.635  1.00 0.00 ? 16  ASP A C    6  
ATOM 9566  O O    . ASP A 1 16  ? -15.996 9.427   -4.667  1.00 0.00 ? 16  ASP A O    6  
ATOM 9567  C CB   . ASP A 1 16  ? -18.222 11.517  -2.911  1.00 0.00 ? 16  ASP A CB   6  
ATOM 9568  C CG   . ASP A 1 16  ? -17.840 12.548  -3.955  1.00 0.00 ? 16  ASP A CG   6  
ATOM 9569  O OD1  . ASP A 1 16  ? -16.633 12.840  -4.085  1.00 0.00 ? 16  ASP A OD1  6  
ATOM 9570  O OD2  . ASP A 1 16  ? -18.747 13.063  -4.641  1.00 0.00 ? 16  ASP A OD2  6  
ATOM 9571  H H    . ASP A 1 16  ? -18.946 9.421   -1.641  1.00 0.00 ? 16  ASP A H    6  
ATOM 9572  H HA   . ASP A 1 16  ? -18.438 9.868   -4.258  1.00 0.00 ? 16  ASP A HA   6  
ATOM 9573  H HB2  . ASP A 1 16  ? -19.284 11.595  -2.728  1.00 0.00 ? 16  ASP A HB2  6  
ATOM 9574  H HB3  . ASP A 1 16  ? -17.686 11.737  -2.000  1.00 0.00 ? 16  ASP A HB3  6  
ATOM 9575  N N    . VAL A 1 17  ? -15.584 10.459  -2.710  1.00 0.00 ? 17  VAL A N    6  
ATOM 9576  C CA   . VAL A 1 17  ? -14.134 10.401  -2.859  1.00 0.00 ? 17  VAL A CA   6  
ATOM 9577  C C    . VAL A 1 17  ? -13.690 9.039   -3.381  1.00 0.00 ? 17  VAL A C    6  
ATOM 9578  O O    . VAL A 1 17  ? -14.290 8.013   -3.060  1.00 0.00 ? 17  VAL A O    6  
ATOM 9579  C CB   . VAL A 1 17  ? -13.421 10.684  -1.524  1.00 0.00 ? 17  VAL A CB   6  
ATOM 9580  C CG1  . VAL A 1 17  ? -13.695 9.570   -0.525  1.00 0.00 ? 17  VAL A CG1  6  
ATOM 9581  C CG2  . VAL A 1 17  ? -11.926 10.858  -1.746  1.00 0.00 ? 17  VAL A CG2  6  
ATOM 9582  H H    . VAL A 1 17  ? -15.965 10.873  -1.908  1.00 0.00 ? 17  VAL A H    6  
ATOM 9583  H HA   . VAL A 1 17  ? -13.841 11.161  -3.569  1.00 0.00 ? 17  VAL A HA   6  
ATOM 9584  H HB   . VAL A 1 17  ? -13.813 11.606  -1.118  1.00 0.00 ? 17  VAL A HB   6  
ATOM 9585  H HG11 . VAL A 1 17  ? -13.079 9.713   0.351   1.00 0.00 ? 17  VAL A HG11 6  
ATOM 9586  H HG12 . VAL A 1 17  ? -14.737 9.589   -0.241  1.00 0.00 ? 17  VAL A HG12 6  
ATOM 9587  H HG13 . VAL A 1 17  ? -13.461 8.617   -0.977  1.00 0.00 ? 17  VAL A HG13 6  
ATOM 9588  H HG21 . VAL A 1 17  ? -11.439 9.897   -1.677  1.00 0.00 ? 17  VAL A HG21 6  
ATOM 9589  H HG22 . VAL A 1 17  ? -11.753 11.280  -2.725  1.00 0.00 ? 17  VAL A HG22 6  
ATOM 9590  H HG23 . VAL A 1 17  ? -11.524 11.520  -0.993  1.00 0.00 ? 17  VAL A HG23 6  
ATOM 9591  N N    . LEU A 1 18  ? -12.634 9.037   -4.188  1.00 0.00 ? 18  LEU A N    6  
ATOM 9592  C CA   . LEU A 1 18  ? -12.107 7.801   -4.755  1.00 0.00 ? 18  LEU A CA   6  
ATOM 9593  C C    . LEU A 1 18  ? -10.658 7.582   -4.332  1.00 0.00 ? 18  LEU A C    6  
ATOM 9594  O O    . LEU A 1 18  ? -9.853  8.513   -4.333  1.00 0.00 ? 18  LEU A O    6  
ATOM 9595  C CB   . LEU A 1 18  ? -12.205 7.835   -6.281  1.00 0.00 ? 18  LEU A CB   6  
ATOM 9596  C CG   . LEU A 1 18  ? -12.387 6.483   -6.972  1.00 0.00 ? 18  LEU A CG   6  
ATOM 9597  C CD1  . LEU A 1 18  ? -13.856 6.088   -6.994  1.00 0.00 ? 18  LEU A CD1  6  
ATOM 9598  C CD2  . LEU A 1 18  ? -11.823 6.525   -8.385  1.00 0.00 ? 18  LEU A CD2  6  
ATOM 9599  H H    . LEU A 1 18  ? -12.198 9.886   -4.408  1.00 0.00 ? 18  LEU A H    6  
ATOM 9600  H HA   . LEU A 1 18  ? -12.706 6.984   -4.382  1.00 0.00 ? 18  LEU A HA   6  
ATOM 9601  H HB2  . LEU A 1 18  ? -13.047 8.456   -6.545  1.00 0.00 ? 18  LEU A HB2  6  
ATOM 9602  H HB3  . LEU A 1 18  ? -11.297 8.281   -6.661  1.00 0.00 ? 18  LEU A HB3  6  
ATOM 9603  H HG   . LEU A 1 18  ? -11.848 5.727   -6.418  1.00 0.00 ? 18  LEU A HG   6  
ATOM 9604  H HD11 . LEU A 1 18  ? -13.986 5.157   -6.465  1.00 0.00 ? 18  LEU A HD11 6  
ATOM 9605  H HD12 . LEU A 1 18  ? -14.181 5.969   -8.017  1.00 0.00 ? 18  LEU A HD12 6  
ATOM 9606  H HD13 . LEU A 1 18  ? -14.443 6.859   -6.518  1.00 0.00 ? 18  LEU A HD13 6  
ATOM 9607  H HD21 . LEU A 1 18  ? -10.818 6.131   -8.382  1.00 0.00 ? 18  LEU A HD21 6  
ATOM 9608  H HD22 . LEU A 1 18  ? -11.809 7.547   -8.736  1.00 0.00 ? 18  LEU A HD22 6  
ATOM 9609  H HD23 . LEU A 1 18  ? -12.442 5.928   -9.038  1.00 0.00 ? 18  LEU A HD23 6  
ATOM 9610  N N    . VAL A 1 19  ? -10.332 6.344   -3.973  1.00 0.00 ? 19  VAL A N    6  
ATOM 9611  C CA   . VAL A 1 19  ? -8.979  6.001   -3.551  1.00 0.00 ? 19  VAL A CA   6  
ATOM 9612  C C    . VAL A 1 19  ? -8.243  5.228   -4.640  1.00 0.00 ? 19  VAL A C    6  
ATOM 9613  O O    . VAL A 1 19  ? -8.772  4.267   -5.198  1.00 0.00 ? 19  VAL A O    6  
ATOM 9614  C CB   . VAL A 1 19  ? -8.990  5.163   -2.259  1.00 0.00 ? 19  VAL A CB   6  
ATOM 9615  C CG1  . VAL A 1 19  ? -7.581  4.713   -1.903  1.00 0.00 ? 19  VAL A CG1  6  
ATOM 9616  C CG2  . VAL A 1 19  ? -9.611  5.953   -1.117  1.00 0.00 ? 19  VAL A CG2  6  
ATOM 9617  H H    . VAL A 1 19  ? -11.018 5.644   -3.994  1.00 0.00 ? 19  VAL A H    6  
ATOM 9618  H HA   . VAL A 1 19  ? -8.448  6.921   -3.354  1.00 0.00 ? 19  VAL A HA   6  
ATOM 9619  H HB   . VAL A 1 19  ? -9.593  4.283   -2.430  1.00 0.00 ? 19  VAL A HB   6  
ATOM 9620  H HG11 . VAL A 1 19  ? -7.257  5.220   -1.007  1.00 0.00 ? 19  VAL A HG11 6  
ATOM 9621  H HG12 . VAL A 1 19  ? -7.576  3.645   -1.736  1.00 0.00 ? 19  VAL A HG12 6  
ATOM 9622  H HG13 . VAL A 1 19  ? -6.911  4.954   -2.715  1.00 0.00 ? 19  VAL A HG13 6  
ATOM 9623  H HG21 . VAL A 1 19  ? -9.348  5.492   -0.177  1.00 0.00 ? 19  VAL A HG21 6  
ATOM 9624  H HG22 . VAL A 1 19  ? -9.239  6.967   -1.137  1.00 0.00 ? 19  VAL A HG22 6  
ATOM 9625  H HG23 . VAL A 1 19  ? -10.685 5.961   -1.226  1.00 0.00 ? 19  VAL A HG23 6  
ATOM 9626  N N    . ARG A 1 20  ? -7.020  5.654   -4.936  1.00 0.00 ? 20  ARG A N    6  
ATOM 9627  C CA   . ARG A 1 20  ? -6.211  5.003   -5.959  1.00 0.00 ? 20  ARG A CA   6  
ATOM 9628  C C    . ARG A 1 20  ? -5.088  4.186   -5.325  1.00 0.00 ? 20  ARG A C    6  
ATOM 9629  O O    . ARG A 1 20  ? -4.182  4.738   -4.698  1.00 0.00 ? 20  ARG A O    6  
ATOM 9630  C CB   . ARG A 1 20  ? -5.623  6.043   -6.914  1.00 0.00 ? 20  ARG A CB   6  
ATOM 9631  C CG   . ARG A 1 20  ? -6.632  6.600   -7.904  1.00 0.00 ? 20  ARG A CG   6  
ATOM 9632  C CD   . ARG A 1 20  ? -5.945  7.275   -9.080  1.00 0.00 ? 20  ARG A CD   6  
ATOM 9633  N NE   . ARG A 1 20  ? -5.680  6.340   -10.170 1.00 0.00 ? 20  ARG A NE   6  
ATOM 9634  C CZ   . ARG A 1 20  ? -5.462  6.717   -11.425 1.00 0.00 ? 20  ARG A CZ   6  
ATOM 9635  N NH1  . ARG A 1 20  ? -5.477  8.003   -11.747 1.00 0.00 ? 20  ARG A NH1  6  
ATOM 9636  N NH2  . ARG A 1 20  ? -5.228  5.807   -12.362 1.00 0.00 ? 20  ARG A NH2  6  
ATOM 9637  H H    . ARG A 1 20  ? -6.653  6.426   -4.456  1.00 0.00 ? 20  ARG A H    6  
ATOM 9638  H HA   . ARG A 1 20  ? -6.853  4.337   -6.516  1.00 0.00 ? 20  ARG A HA   6  
ATOM 9639  H HB2  . ARG A 1 20  ? -5.229  6.865   -6.334  1.00 0.00 ? 20  ARG A HB2  6  
ATOM 9640  H HB3  . ARG A 1 20  ? -4.818  5.588   -7.471  1.00 0.00 ? 20  ARG A HB3  6  
ATOM 9641  H HG2  . ARG A 1 20  ? -7.243  5.790   -8.275  1.00 0.00 ? 20  ARG A HG2  6  
ATOM 9642  H HG3  . ARG A 1 20  ? -7.257  7.322   -7.399  1.00 0.00 ? 20  ARG A HG3  6  
ATOM 9643  H HD2  . ARG A 1 20  ? -6.581  8.068   -9.445  1.00 0.00 ? 20  ARG A HD2  6  
ATOM 9644  H HD3  . ARG A 1 20  ? -5.009  7.693   -8.741  1.00 0.00 ? 20  ARG A HD3  6  
ATOM 9645  H HE   . ARG A 1 20  ? -5.664  5.385   -9.955  1.00 0.00 ? 20  ARG A HE   6  
ATOM 9646  H HH11 . ARG A 1 20  ? -5.652  8.692   -11.043 1.00 0.00 ? 20  ARG A HH11 6  
ATOM 9647  H HH12 . ARG A 1 20  ? -5.311  8.285   -12.692 1.00 0.00 ? 20  ARG A HH12 6  
ATOM 9648  H HH21 . ARG A 1 20  ? -5.215  4.836   -12.123 1.00 0.00 ? 20  ARG A HH21 6  
ATOM 9649  H HH22 . ARG A 1 20  ? -5.064  6.091   -13.306 1.00 0.00 ? 20  ARG A HH22 6  
ATOM 9650  N N    . LEU A 1 21  ? -5.154  2.870   -5.492  1.00 0.00 ? 21  LEU A N    6  
ATOM 9651  C CA   . LEU A 1 21  ? -4.143  1.977   -4.936  1.00 0.00 ? 21  LEU A CA   6  
ATOM 9652  C C    . LEU A 1 21  ? -3.063  1.667   -5.968  1.00 0.00 ? 21  LEU A C    6  
ATOM 9653  O O    . LEU A 1 21  ? -3.300  0.935   -6.929  1.00 0.00 ? 21  LEU A O    6  
ATOM 9654  C CB   . LEU A 1 21  ? -4.792  0.678   -4.454  1.00 0.00 ? 21  LEU A CB   6  
ATOM 9655  C CG   . LEU A 1 21  ? -3.982  -0.144  -3.450  1.00 0.00 ? 21  LEU A CG   6  
ATOM 9656  C CD1  . LEU A 1 21  ? -3.688  0.676   -2.203  1.00 0.00 ? 21  LEU A CD1  6  
ATOM 9657  C CD2  . LEU A 1 21  ? -4.723  -1.423  -3.088  1.00 0.00 ? 21  LEU A CD2  6  
ATOM 9658  H H    . LEU A 1 21  ? -5.899  2.489   -6.001  1.00 0.00 ? 21  LEU A H    6  
ATOM 9659  H HA   . LEU A 1 21  ? -3.687  2.476   -4.094  1.00 0.00 ? 21  LEU A HA   6  
ATOM 9660  H HB2  . LEU A 1 21  ? -5.733  0.931   -3.992  1.00 0.00 ? 21  LEU A HB2  6  
ATOM 9661  H HB3  . LEU A 1 21  ? -4.973  0.059   -5.321  1.00 0.00 ? 21  LEU A HB3  6  
ATOM 9662  H HG   . LEU A 1 21  ? -3.038  -0.419  -3.898  1.00 0.00 ? 21  LEU A HG   6  
ATOM 9663  H HD11 . LEU A 1 21  ? -4.107  1.664   -2.315  1.00 0.00 ? 21  LEU A HD11 6  
ATOM 9664  H HD12 . LEU A 1 21  ? -2.620  0.750   -2.065  1.00 0.00 ? 21  LEU A HD12 6  
ATOM 9665  H HD13 . LEU A 1 21  ? -4.129  0.193   -1.343  1.00 0.00 ? 21  LEU A HD13 6  
ATOM 9666  H HD21 . LEU A 1 21  ? -5.445  -1.650  -3.858  1.00 0.00 ? 21  LEU A HD21 6  
ATOM 9667  H HD22 . LEU A 1 21  ? -5.233  -1.288  -2.145  1.00 0.00 ? 21  LEU A HD22 6  
ATOM 9668  H HD23 . LEU A 1 21  ? -4.018  -2.236  -3.004  1.00 0.00 ? 21  LEU A HD23 6  
ATOM 9669  N N    . HIS A 1 22  ? -1.876  2.228   -5.761  1.00 0.00 ? 22  HIS A N    6  
ATOM 9670  C CA   . HIS A 1 22  ? -0.758  2.009   -6.672  1.00 0.00 ? 22  HIS A CA   6  
ATOM 9671  C C    . HIS A 1 22  ? -0.118  0.646   -6.430  1.00 0.00 ? 22  HIS A C    6  
ATOM 9672  O O    . HIS A 1 22  ? -0.135  0.132   -5.312  1.00 0.00 ? 22  HIS A O    6  
ATOM 9673  C CB   . HIS A 1 22  ? 0.287   3.113   -6.506  1.00 0.00 ? 22  HIS A CB   6  
ATOM 9674  C CG   . HIS A 1 22  ? -0.269  4.494   -6.671  1.00 0.00 ? 22  HIS A CG   6  
ATOM 9675  N ND1  . HIS A 1 22  ? 0.290   5.436   -7.508  1.00 0.00 ? 22  HIS A ND1  6  
ATOM 9676  C CD2  . HIS A 1 22  ? -1.343  5.090   -6.101  1.00 0.00 ? 22  HIS A CD2  6  
ATOM 9677  C CE1  . HIS A 1 22  ? -0.414  6.552   -7.445  1.00 0.00 ? 22  HIS A CE1  6  
ATOM 9678  N NE2  . HIS A 1 22  ? -1.411  6.368   -6.598  1.00 0.00 ? 22  HIS A NE2  6  
ATOM 9679  H H    . HIS A 1 22  ? -1.749  2.802   -4.978  1.00 0.00 ? 22  HIS A H    6  
ATOM 9680  H HA   . HIS A 1 22  ? -1.142  2.038   -7.681  1.00 0.00 ? 22  HIS A HA   6  
ATOM 9681  H HB2  . HIS A 1 22  ? 0.718   3.045   -5.518  1.00 0.00 ? 22  HIS A HB2  6  
ATOM 9682  H HB3  . HIS A 1 22  ? 1.065   2.978   -7.243  1.00 0.00 ? 22  HIS A HB3  6  
ATOM 9683  H HD1  . HIS A 1 22  ? 1.086   5.306   -8.065  1.00 0.00 ? 22  HIS A HD1  6  
ATOM 9684  H HD2  . HIS A 1 22  ? -2.021  4.644   -5.387  1.00 0.00 ? 22  HIS A HD2  6  
ATOM 9685  H HE1  . HIS A 1 22  ? -0.210  7.460   -7.992  1.00 0.00 ? 22  HIS A HE1  6  
ATOM 9686  H HE2  . HIS A 1 22  ? -2.034  7.063   -6.302  1.00 0.00 ? 22  HIS A HE2  6  
ATOM 9687  N N    . ASN A 1 23  ? 0.445   0.066   -7.484  1.00 0.00 ? 23  ASN A N    6  
ATOM 9688  C CA   . ASN A 1 23  ? 1.090   -1.239  -7.385  1.00 0.00 ? 23  ASN A CA   6  
ATOM 9689  C C    . ASN A 1 23  ? 1.897   -1.351  -6.096  1.00 0.00 ? 23  ASN A C    6  
ATOM 9690  O O    . ASN A 1 23  ? 2.817   -0.573  -5.840  1.00 0.00 ? 23  ASN A O    6  
ATOM 9691  C CB   . ASN A 1 23  ? 2.001   -1.474  -8.592  1.00 0.00 ? 23  ASN A CB   6  
ATOM 9692  C CG   . ASN A 1 23  ? 1.242   -1.440  -9.905  1.00 0.00 ? 23  ASN A CG   6  
ATOM 9693  O OD1  . ASN A 1 23  ? 0.511   -2.374  -10.236 1.00 0.00 ? 23  ASN A OD1  6  
ATOM 9694  N ND2  . ASN A 1 23  ? 1.412   -0.361  -10.659 1.00 0.00 ? 23  ASN A ND2  6  
ATOM 9695  H H    . ASN A 1 23  ? 0.427   0.525   -8.350  1.00 0.00 ? 23  ASN A H    6  
ATOM 9696  H HA   . ASN A 1 23  ? 0.316   -1.991  -7.378  1.00 0.00 ? 23  ASN A HA   6  
ATOM 9697  H HB2  . ASN A 1 23  ? 2.759   -0.705  -8.618  1.00 0.00 ? 23  ASN A HB2  6  
ATOM 9698  H HB3  . ASN A 1 23  ? 2.475   -2.439  -8.496  1.00 0.00 ? 23  ASN A HB3  6  
ATOM 9699  H HD21 . ASN A 1 23  ? 2.009   0.344   -10.331 1.00 0.00 ? 23  ASN A HD21 6  
ATOM 9700  H HD22 . ASN A 1 23  ? 0.932   -0.312  -11.512 1.00 0.00 ? 23  ASN A HD22 6  
ATOM 9701  N N    . PRO A 1 24  ? 1.547   -2.341  -5.262  1.00 0.00 ? 24  PRO A N    6  
ATOM 9702  C CA   . PRO A 1 24  ? 2.226   -2.579  -3.985  1.00 0.00 ? 24  PRO A CA   6  
ATOM 9703  C C    . PRO A 1 24  ? 3.644   -3.107  -4.173  1.00 0.00 ? 24  PRO A C    6  
ATOM 9704  O O    . PRO A 1 24  ? 3.871   -4.317  -4.181  1.00 0.00 ? 24  PRO A O    6  
ATOM 9705  C CB   . PRO A 1 24  ? 1.348   -3.634  -3.307  1.00 0.00 ? 24  PRO A CB   6  
ATOM 9706  C CG   . PRO A 1 24  ? 0.668   -4.339  -4.430  1.00 0.00 ? 24  PRO A CG   6  
ATOM 9707  C CD   . PRO A 1 24  ? 0.460   -3.305  -5.502  1.00 0.00 ? 24  PRO A CD   6  
ATOM 9708  H HA   . PRO A 1 24  ? 2.253   -1.687  -3.378  1.00 0.00 ? 24  PRO A HA   6  
ATOM 9709  H HB2  . PRO A 1 24  ? 1.969   -4.309  -2.735  1.00 0.00 ? 24  PRO A HB2  6  
ATOM 9710  H HB3  . PRO A 1 24  ? 0.636   -3.151  -2.656  1.00 0.00 ? 24  PRO A HB3  6  
ATOM 9711  H HG2  . PRO A 1 24  ? 1.295   -5.138  -4.795  1.00 0.00 ? 24  PRO A HG2  6  
ATOM 9712  H HG3  . PRO A 1 24  ? -0.282  -4.728  -4.096  1.00 0.00 ? 24  PRO A HG3  6  
ATOM 9713  H HD2  . PRO A 1 24  ? 0.550   -3.753  -6.480  1.00 0.00 ? 24  PRO A HD2  6  
ATOM 9714  H HD3  . PRO A 1 24  ? -0.505  -2.834  -5.389  1.00 0.00 ? 24  PRO A HD3  6  
ATOM 9715  N N    . VAL A 1 25  ? 4.597   -2.192  -4.324  1.00 0.00 ? 25  VAL A N    6  
ATOM 9716  C CA   . VAL A 1 25  ? 5.994   -2.566  -4.510  1.00 0.00 ? 25  VAL A CA   6  
ATOM 9717  C C    . VAL A 1 25  ? 6.412   -3.642  -3.514  1.00 0.00 ? 25  VAL A C    6  
ATOM 9718  O O    . VAL A 1 25  ? 6.420   -3.414  -2.305  1.00 0.00 ? 25  VAL A O    6  
ATOM 9719  C CB   . VAL A 1 25  ? 6.925   -1.349  -4.357  1.00 0.00 ? 25  VAL A CB   6  
ATOM 9720  C CG1  . VAL A 1 25  ? 8.371   -1.748  -4.611  1.00 0.00 ? 25  VAL A CG1  6  
ATOM 9721  C CG2  . VAL A 1 25  ? 6.500   -0.231  -5.297  1.00 0.00 ? 25  VAL A CG2  6  
ATOM 9722  H H    . VAL A 1 25  ? 4.354   -1.243  -4.309  1.00 0.00 ? 25  VAL A H    6  
ATOM 9723  H HA   . VAL A 1 25  ? 6.105   -2.954  -5.513  1.00 0.00 ? 25  VAL A HA   6  
ATOM 9724  H HB   . VAL A 1 25  ? 6.848   -0.987  -3.342  1.00 0.00 ? 25  VAL A HB   6  
ATOM 9725  H HG11 . VAL A 1 25  ? 8.896   -0.924  -5.070  1.00 0.00 ? 25  VAL A HG11 6  
ATOM 9726  H HG12 . VAL A 1 25  ? 8.845   -2.001  -3.674  1.00 0.00 ? 25  VAL A HG12 6  
ATOM 9727  H HG13 . VAL A 1 25  ? 8.398   -2.603  -5.270  1.00 0.00 ? 25  VAL A HG13 6  
ATOM 9728  H HG21 . VAL A 1 25  ? 6.502   0.707   -4.762  1.00 0.00 ? 25  VAL A HG21 6  
ATOM 9729  H HG22 . VAL A 1 25  ? 7.190   -0.174  -6.126  1.00 0.00 ? 25  VAL A HG22 6  
ATOM 9730  H HG23 . VAL A 1 25  ? 5.506   -0.432  -5.669  1.00 0.00 ? 25  VAL A HG23 6  
ATOM 9731  N N    . VAL A 1 26  ? 6.761   -4.816  -4.031  1.00 0.00 ? 26  VAL A N    6  
ATOM 9732  C CA   . VAL A 1 26  ? 7.183   -5.927  -3.188  1.00 0.00 ? 26  VAL A CA   6  
ATOM 9733  C C    . VAL A 1 26  ? 8.622   -5.746  -2.718  1.00 0.00 ? 26  VAL A C    6  
ATOM 9734  O O    . VAL A 1 26  ? 9.546   -6.348  -3.267  1.00 0.00 ? 26  VAL A O    6  
ATOM 9735  C CB   . VAL A 1 26  ? 7.062   -7.272  -3.929  1.00 0.00 ? 26  VAL A CB   6  
ATOM 9736  C CG1  . VAL A 1 26  ? 7.762   -7.203  -5.277  1.00 0.00 ? 26  VAL A CG1  6  
ATOM 9737  C CG2  . VAL A 1 26  ? 7.629   -8.400  -3.081  1.00 0.00 ? 26  VAL A CG2  6  
ATOM 9738  H H    . VAL A 1 26  ? 6.734   -4.937  -5.003  1.00 0.00 ? 26  VAL A H    6  
ATOM 9739  H HA   . VAL A 1 26  ? 6.534   -5.957  -2.324  1.00 0.00 ? 26  VAL A HA   6  
ATOM 9740  H HB   . VAL A 1 26  ? 6.015   -7.472  -4.102  1.00 0.00 ? 26  VAL A HB   6  
ATOM 9741  H HG11 . VAL A 1 26  ? 8.430   -6.354  -5.293  1.00 0.00 ? 26  VAL A HG11 6  
ATOM 9742  H HG12 . VAL A 1 26  ? 8.327   -8.110  -5.437  1.00 0.00 ? 26  VAL A HG12 6  
ATOM 9743  H HG13 . VAL A 1 26  ? 7.026   -7.095  -6.060  1.00 0.00 ? 26  VAL A HG13 6  
ATOM 9744  H HG21 . VAL A 1 26  ? 7.920   -8.013  -2.116  1.00 0.00 ? 26  VAL A HG21 6  
ATOM 9745  H HG22 . VAL A 1 26  ? 6.877   -9.165  -2.950  1.00 0.00 ? 26  VAL A HG22 6  
ATOM 9746  H HG23 . VAL A 1 26  ? 8.491   -8.824  -3.575  1.00 0.00 ? 26  VAL A HG23 6  
ATOM 9747  N N    . LEU A 1 27  ? 8.805   -4.913  -1.700  1.00 0.00 ? 27  LEU A N    6  
ATOM 9748  C CA   . LEU A 1 27  ? 10.133  -4.652  -1.155  1.00 0.00 ? 27  LEU A CA   6  
ATOM 9749  C C    . LEU A 1 27  ? 10.856  -5.956  -0.833  1.00 0.00 ? 27  LEU A C    6  
ATOM 9750  O O    . LEU A 1 27  ? 12.023  -6.135  -1.183  1.00 0.00 ? 27  LEU A O    6  
ATOM 9751  C CB   . LEU A 1 27  ? 10.029  -3.789  0.104   1.00 0.00 ? 27  LEU A CB   6  
ATOM 9752  C CG   . LEU A 1 27  ? 9.386   -2.414  -0.076  1.00 0.00 ? 27  LEU A CG   6  
ATOM 9753  C CD1  . LEU A 1 27  ? 9.171   -1.744  1.272   1.00 0.00 ? 27  LEU A CD1  6  
ATOM 9754  C CD2  . LEU A 1 27  ? 10.244  -1.538  -0.978  1.00 0.00 ? 27  LEU A CD2  6  
ATOM 9755  H H    . LEU A 1 27  ? 8.031   -4.463  -1.304  1.00 0.00 ? 27  LEU A H    6  
ATOM 9756  H HA   . LEU A 1 27  ? 10.698  -4.116  -1.903  1.00 0.00 ? 27  LEU A HA   6  
ATOM 9757  H HB2  . LEU A 1 27  ? 9.445   -4.334  0.830   1.00 0.00 ? 27  LEU A HB2  6  
ATOM 9758  H HB3  . LEU A 1 27  ? 11.029  -3.641  0.486   1.00 0.00 ? 27  LEU A HB3  6  
ATOM 9759  H HG   . LEU A 1 27  ? 8.419   -2.534  -0.546  1.00 0.00 ? 27  LEU A HG   6  
ATOM 9760  H HD11 . LEU A 1 27  ? 8.932   -0.702  1.123   1.00 0.00 ? 27  LEU A HD11 6  
ATOM 9761  H HD12 . LEU A 1 27  ? 10.072  -1.825  1.862   1.00 0.00 ? 27  LEU A HD12 6  
ATOM 9762  H HD13 . LEU A 1 27  ? 8.358   -2.230  1.790   1.00 0.00 ? 27  LEU A HD13 6  
ATOM 9763  H HD21 . LEU A 1 27  ? 10.033  -1.772  -2.011  1.00 0.00 ? 27  LEU A HD21 6  
ATOM 9764  H HD22 . LEU A 1 27  ? 11.288  -1.724  -0.773  1.00 0.00 ? 27  LEU A HD22 6  
ATOM 9765  H HD23 . LEU A 1 27  ? 10.019  -0.499  -0.790  1.00 0.00 ? 27  LEU A HD23 6  
ATOM 9766  N N    . THR A 1 28  ? 10.154  -6.867  -0.166  1.00 0.00 ? 28  THR A N    6  
ATOM 9767  C CA   . THR A 1 28  ? 10.728  -8.155  0.202   1.00 0.00 ? 28  THR A CA   6  
ATOM 9768  C C    . THR A 1 28  ? 9.668   -9.251  0.195   1.00 0.00 ? 28  THR A C    6  
ATOM 9769  O O    . THR A 1 28  ? 8.468   -8.988  0.271   1.00 0.00 ? 28  THR A O    6  
ATOM 9770  C CB   . THR A 1 28  ? 11.385  -8.100  1.595   1.00 0.00 ? 28  THR A CB   6  
ATOM 9771  O OG1  . THR A 1 28  ? 10.711  -7.140  2.416   1.00 0.00 ? 28  THR A OG1  6  
ATOM 9772  C CG2  . THR A 1 28  ? 12.858  -7.737  1.484   1.00 0.00 ? 28  THR A CG2  6  
ATOM 9773  H H    . THR A 1 28  ? 9.228   -6.665  0.085   1.00 0.00 ? 28  THR A H    6  
ATOM 9774  H HA   . THR A 1 28  ? 11.490  -8.400  -0.523  1.00 0.00 ? 28  THR A HA   6  
ATOM 9775  H HB   . THR A 1 28  ? 11.303  -9.075  2.053   1.00 0.00 ? 28  THR A HB   6  
ATOM 9776  H HG1  . THR A 1 28  ? 10.201  -6.545  1.861   1.00 0.00 ? 28  THR A HG1  6  
ATOM 9777  H HG21 . THR A 1 28  ? 13.450  -8.640  1.459   1.00 0.00 ? 28  THR A HG21 6  
ATOM 9778  H HG22 . THR A 1 28  ? 13.146  -7.140  2.337   1.00 0.00 ? 28  THR A HG22 6  
ATOM 9779  H HG23 . THR A 1 28  ? 13.022  -7.174  0.578   1.00 0.00 ? 28  THR A HG23 6  
ATOM 9780  N N    . PRO A 1 29  ? 10.120  -10.510 0.103   1.00 0.00 ? 29  PRO A N    6  
ATOM 9781  C CA   . PRO A 1 29  ? 9.226   -11.672 0.085   1.00 0.00 ? 29  PRO A CA   6  
ATOM 9782  C C    . PRO A 1 29  ? 8.554   -11.907 1.434   1.00 0.00 ? 29  PRO A C    6  
ATOM 9783  O O    . PRO A 1 29  ? 7.783   -12.853 1.599   1.00 0.00 ? 29  PRO A O    6  
ATOM 9784  C CB   . PRO A 1 29  ? 10.161  -12.834 -0.256  1.00 0.00 ? 29  PRO A CB   6  
ATOM 9785  C CG   . PRO A 1 29  ? 11.505  -12.388 0.207   1.00 0.00 ? 29  PRO A CG   6  
ATOM 9786  C CD   . PRO A 1 29  ? 11.537  -10.898 0.010   1.00 0.00 ? 29  PRO A CD   6  
ATOM 9787  H HA   . PRO A 1 29  ? 8.470   -11.579 -0.681  1.00 0.00 ? 29  PRO A HA   6  
ATOM 9788  H HB2  . PRO A 1 29  ? 9.838   -13.725 0.265   1.00 0.00 ? 29  PRO A HB2  6  
ATOM 9789  H HB3  . PRO A 1 29  ? 10.150  -13.010 -1.321  1.00 0.00 ? 29  PRO A HB3  6  
ATOM 9790  H HG2  . PRO A 1 29  ? 11.632  -12.630 1.251   1.00 0.00 ? 29  PRO A HG2  6  
ATOM 9791  H HG3  . PRO A 1 29  ? 12.273  -12.861 -0.386  1.00 0.00 ? 29  PRO A HG3  6  
ATOM 9792  H HD2  . PRO A 1 29  ? 12.118  -10.426 0.788   1.00 0.00 ? 29  PRO A HD2  6  
ATOM 9793  H HD3  . PRO A 1 29  ? 11.939  -10.655 -0.963  1.00 0.00 ? 29  PRO A HD3  6  
ATOM 9794  N N    . THR A 1 30  ? 8.851   -11.041 2.397   1.00 0.00 ? 30  THR A N    6  
ATOM 9795  C CA   . THR A 1 30  ? 8.277   -11.154 3.732   1.00 0.00 ? 30  THR A CA   6  
ATOM 9796  C C    . THR A 1 30  ? 7.547   -9.876  4.127   1.00 0.00 ? 30  THR A C    6  
ATOM 9797  O O    . THR A 1 30  ? 6.818   -9.845  5.119   1.00 0.00 ? 30  THR A O    6  
ATOM 9798  C CB   . THR A 1 30  ? 9.358   -11.462 4.785   1.00 0.00 ? 30  THR A CB   6  
ATOM 9799  O OG1  . THR A 1 30  ? 10.461  -10.561 4.632   1.00 0.00 ? 30  THR A OG1  6  
ATOM 9800  C CG2  . THR A 1 30  ? 9.848   -12.896 4.655   1.00 0.00 ? 30  THR A CG2  6  
ATOM 9801  H H    . THR A 1 30  ? 9.472   -10.308 2.204   1.00 0.00 ? 30  THR A H    6  
ATOM 9802  H HA   . THR A 1 30  ? 7.571   -11.972 3.722   1.00 0.00 ? 30  THR A HA   6  
ATOM 9803  H HB   . THR A 1 30  ? 8.930   -11.330 5.768   1.00 0.00 ? 30  THR A HB   6  
ATOM 9804  H HG1  . THR A 1 30  ? 10.142  -9.656  4.671   1.00 0.00 ? 30  THR A HG1  6  
ATOM 9805  H HG21 . THR A 1 30  ? 9.411   -13.348 3.777   1.00 0.00 ? 30  THR A HG21 6  
ATOM 9806  H HG22 . THR A 1 30  ? 9.556   -13.456 5.531   1.00 0.00 ? 30  THR A HG22 6  
ATOM 9807  H HG23 . THR A 1 30  ? 10.923  -12.903 4.565   1.00 0.00 ? 30  THR A HG23 6  
ATOM 9808  N N    . THR A 1 31  ? 7.747   -8.820  3.345   1.00 0.00 ? 31  THR A N    6  
ATOM 9809  C CA   . THR A 1 31  ? 7.109   -7.537  3.614   1.00 0.00 ? 31  THR A CA   6  
ATOM 9810  C C    . THR A 1 31  ? 6.874   -6.759  2.325   1.00 0.00 ? 31  THR A C    6  
ATOM 9811  O O    . THR A 1 31  ? 7.744   -6.701  1.455   1.00 0.00 ? 31  THR A O    6  
ATOM 9812  C CB   . THR A 1 31  ? 7.955   -6.678  4.572   1.00 0.00 ? 31  THR A CB   6  
ATOM 9813  O OG1  . THR A 1 31  ? 8.463   -7.489  5.638   1.00 0.00 ? 31  THR A OG1  6  
ATOM 9814  C CG2  . THR A 1 31  ? 7.131   -5.536  5.146   1.00 0.00 ? 31  THR A CG2  6  
ATOM 9815  H H    . THR A 1 31  ? 8.339   -8.906  2.569   1.00 0.00 ? 31  THR A H    6  
ATOM 9816  H HA   . THR A 1 31  ? 6.156   -7.732  4.085   1.00 0.00 ? 31  THR A HA   6  
ATOM 9817  H HB   . THR A 1 31  ? 8.785   -6.262  4.020   1.00 0.00 ? 31  THR A HB   6  
ATOM 9818  H HG1  . THR A 1 31  ? 8.783   -6.924  6.346   1.00 0.00 ? 31  THR A HG1  6  
ATOM 9819  H HG21 . THR A 1 31  ? 6.844   -4.864  4.350   1.00 0.00 ? 31  THR A HG21 6  
ATOM 9820  H HG22 . THR A 1 31  ? 7.718   -4.999  5.876   1.00 0.00 ? 31  THR A HG22 6  
ATOM 9821  H HG23 . THR A 1 31  ? 6.245   -5.933  5.617   1.00 0.00 ? 31  THR A HG23 6  
ATOM 9822  N N    . VAL A 1 32  ? 5.693   -6.160  2.207   1.00 0.00 ? 32  VAL A N    6  
ATOM 9823  C CA   . VAL A 1 32  ? 5.345   -5.382  1.024   1.00 0.00 ? 32  VAL A CA   6  
ATOM 9824  C C    . VAL A 1 32  ? 4.863   -3.987  1.405   1.00 0.00 ? 32  VAL A C    6  
ATOM 9825  O O    . VAL A 1 32  ? 4.115   -3.821  2.368   1.00 0.00 ? 32  VAL A O    6  
ATOM 9826  C CB   . VAL A 1 32  ? 4.252   -6.082  0.194   1.00 0.00 ? 32  VAL A CB   6  
ATOM 9827  C CG1  . VAL A 1 32  ? 3.981   -5.312  -1.089  1.00 0.00 ? 32  VAL A CG1  6  
ATOM 9828  C CG2  . VAL A 1 32  ? 4.652   -7.518  -0.110  1.00 0.00 ? 32  VAL A CG2  6  
ATOM 9829  H H    . VAL A 1 32  ? 5.041   -6.242  2.934   1.00 0.00 ? 32  VAL A H    6  
ATOM 9830  H HA   . VAL A 1 32  ? 6.230   -5.292  0.411   1.00 0.00 ? 32  VAL A HA   6  
ATOM 9831  H HB   . VAL A 1 32  ? 3.342   -6.100  0.776   1.00 0.00 ? 32  VAL A HB   6  
ATOM 9832  H HG11 . VAL A 1 32  ? 4.572   -5.730  -1.891  1.00 0.00 ? 32  VAL A HG11 6  
ATOM 9833  H HG12 . VAL A 1 32  ? 2.932   -5.385  -1.338  1.00 0.00 ? 32  VAL A HG12 6  
ATOM 9834  H HG13 . VAL A 1 32  ? 4.247   -4.275  -0.950  1.00 0.00 ? 32  VAL A HG13 6  
ATOM 9835  H HG21 . VAL A 1 32  ? 4.188   -7.832  -1.033  1.00 0.00 ? 32  VAL A HG21 6  
ATOM 9836  H HG22 . VAL A 1 32  ? 5.726   -7.580  -0.208  1.00 0.00 ? 32  VAL A HG22 6  
ATOM 9837  H HG23 . VAL A 1 32  ? 4.327   -8.161  0.694   1.00 0.00 ? 32  VAL A HG23 6  
ATOM 9838  N N    . GLN A 1 33  ? 5.297   -2.988  0.643   1.00 0.00 ? 33  GLN A N    6  
ATOM 9839  C CA   . GLN A 1 33  ? 4.909   -1.607  0.902   1.00 0.00 ? 33  GLN A CA   6  
ATOM 9840  C C    . GLN A 1 33  ? 3.585   -1.276  0.221   1.00 0.00 ? 33  GLN A C    6  
ATOM 9841  O O    . GLN A 1 33  ? 3.378   -1.602  -0.948  1.00 0.00 ? 33  GLN A O    6  
ATOM 9842  C CB   . GLN A 1 33  ? 5.999   -0.650  0.417   1.00 0.00 ? 33  GLN A CB   6  
ATOM 9843  C CG   . GLN A 1 33  ? 6.023   0.674   1.164   1.00 0.00 ? 33  GLN A CG   6  
ATOM 9844  C CD   . GLN A 1 33  ? 6.561   1.812   0.318   1.00 0.00 ? 33  GLN A CD   6  
ATOM 9845  O OE1  . GLN A 1 33  ? 7.693   1.760   -0.164  1.00 0.00 ? 33  GLN A OE1  6  
ATOM 9846  N NE2  . GLN A 1 33  ? 5.751   2.848   0.134   1.00 0.00 ? 33  GLN A NE2  6  
ATOM 9847  H H    . GLN A 1 33  ? 5.891   -3.185  -0.110  1.00 0.00 ? 33  GLN A H    6  
ATOM 9848  H HA   . GLN A 1 33  ? 4.790   -1.490  1.969   1.00 0.00 ? 33  GLN A HA   6  
ATOM 9849  H HB2  . GLN A 1 33  ? 6.960   -1.125  0.539   1.00 0.00 ? 33  GLN A HB2  6  
ATOM 9850  H HB3  . GLN A 1 33  ? 5.840   -0.443  -0.632  1.00 0.00 ? 33  GLN A HB3  6  
ATOM 9851  H HG2  . GLN A 1 33  ? 5.016   0.919   1.469   1.00 0.00 ? 33  GLN A HG2  6  
ATOM 9852  H HG3  . GLN A 1 33  ? 6.648   0.568   2.038   1.00 0.00 ? 33  GLN A HG3  6  
ATOM 9853  H HE21 . GLN A 1 33  ? 4.864   2.820   0.550   1.00 0.00 ? 33  GLN A HE21 6  
ATOM 9854  H HE22 . GLN A 1 33  ? 6.074   3.597   -0.407  1.00 0.00 ? 33  GLN A HE22 6  
ATOM 9855  N N    . VAL A 1 34  ? 2.691   -0.627  0.960   1.00 0.00 ? 34  VAL A N    6  
ATOM 9856  C CA   . VAL A 1 34  ? 1.387   -0.251  0.427   1.00 0.00 ? 34  VAL A CA   6  
ATOM 9857  C C    . VAL A 1 34  ? 1.236   1.264   0.359   1.00 0.00 ? 34  VAL A C    6  
ATOM 9858  O O    . VAL A 1 34  ? 1.534   1.973   1.322   1.00 0.00 ? 34  VAL A O    6  
ATOM 9859  C CB   . VAL A 1 34  ? 0.243   -0.832  1.280   1.00 0.00 ? 34  VAL A CB   6  
ATOM 9860  C CG1  . VAL A 1 34  ? -1.107  -0.425  0.712   1.00 0.00 ? 34  VAL A CG1  6  
ATOM 9861  C CG2  . VAL A 1 34  ? 0.360   -2.346  1.367   1.00 0.00 ? 34  VAL A CG2  6  
ATOM 9862  H H    . VAL A 1 34  ? 2.914   -0.394  1.885   1.00 0.00 ? 34  VAL A H    6  
ATOM 9863  H HA   . VAL A 1 34  ? 1.304   -0.656  -0.571  1.00 0.00 ? 34  VAL A HA   6  
ATOM 9864  H HB   . VAL A 1 34  ? 0.325   -0.428  2.279   1.00 0.00 ? 34  VAL A HB   6  
ATOM 9865  H HG11 . VAL A 1 34  ? -1.182  0.653   0.700   1.00 0.00 ? 34  VAL A HG11 6  
ATOM 9866  H HG12 . VAL A 1 34  ? -1.204  -0.805  -0.295  1.00 0.00 ? 34  VAL A HG12 6  
ATOM 9867  H HG13 . VAL A 1 34  ? -1.895  -0.832  1.328   1.00 0.00 ? 34  VAL A HG13 6  
ATOM 9868  H HG21 . VAL A 1 34  ? 0.884   -2.716  0.498   1.00 0.00 ? 34  VAL A HG21 6  
ATOM 9869  H HG22 . VAL A 1 34  ? 0.907   -2.615  2.259   1.00 0.00 ? 34  VAL A HG22 6  
ATOM 9870  H HG23 . VAL A 1 34  ? -0.627  -2.782  1.406   1.00 0.00 ? 34  VAL A HG23 6  
ATOM 9871  N N    . THR A 1 35  ? 0.772   1.757   -0.785  1.00 0.00 ? 35  THR A N    6  
ATOM 9872  C CA   . THR A 1 35  ? 0.582   3.189   -0.979  1.00 0.00 ? 35  THR A CA   6  
ATOM 9873  C C    . THR A 1 35  ? -0.730  3.477   -1.700  1.00 0.00 ? 35  THR A C    6  
ATOM 9874  O O    . THR A 1 35  ? -1.177  2.688   -2.532  1.00 0.00 ? 35  THR A O    6  
ATOM 9875  C CB   . THR A 1 35  ? 1.743   3.805   -1.783  1.00 0.00 ? 35  THR A CB   6  
ATOM 9876  O OG1  . THR A 1 35  ? 2.997   3.368   -1.248  1.00 0.00 ? 35  THR A OG1  6  
ATOM 9877  C CG2  . THR A 1 35  ? 1.675   5.325   -1.753  1.00 0.00 ? 35  THR A CG2  6  
ATOM 9878  H H    . THR A 1 35  ? 0.553   1.141   -1.515  1.00 0.00 ? 35  THR A H    6  
ATOM 9879  H HA   . THR A 1 35  ? 0.558   3.657   -0.006  1.00 0.00 ? 35  THR A HA   6  
ATOM 9880  H HB   . THR A 1 35  ? 1.664   3.476   -2.810  1.00 0.00 ? 35  THR A HB   6  
ATOM 9881  H HG1  . THR A 1 35  ? 3.587   4.120   -1.158  1.00 0.00 ? 35  THR A HG1  6  
ATOM 9882  H HG21 . THR A 1 35  ? 1.729   5.667   -0.730  1.00 0.00 ? 35  THR A HG21 6  
ATOM 9883  H HG22 . THR A 1 35  ? 0.746   5.652   -2.195  1.00 0.00 ? 35  THR A HG22 6  
ATOM 9884  H HG23 . THR A 1 35  ? 2.503   5.733   -2.313  1.00 0.00 ? 35  THR A HG23 6  
ATOM 9885  N N    . TRP A 1 36  ? -1.341  4.611   -1.375  1.00 0.00 ? 36  TRP A N    6  
ATOM 9886  C CA   . TRP A 1 36  ? -2.602  5.003   -1.993  1.00 0.00 ? 36  TRP A CA   6  
ATOM 9887  C C    . TRP A 1 36  ? -2.776  6.517   -1.963  1.00 0.00 ? 36  TRP A C    6  
ATOM 9888  O O    . TRP A 1 36  ? -2.024  7.226   -1.292  1.00 0.00 ? 36  TRP A O    6  
ATOM 9889  C CB   . TRP A 1 36  ? -3.775  4.328   -1.279  1.00 0.00 ? 36  TRP A CB   6  
ATOM 9890  C CG   . TRP A 1 36  ? -3.981  4.822   0.121   1.00 0.00 ? 36  TRP A CG   6  
ATOM 9891  C CD1  . TRP A 1 36  ? -4.716  5.905   0.508   1.00 0.00 ? 36  TRP A CD1  6  
ATOM 9892  C CD2  . TRP A 1 36  ? -3.443  4.250   1.319   1.00 0.00 ? 36  TRP A CD2  6  
ATOM 9893  N NE1  . TRP A 1 36  ? -4.668  6.042   1.875   1.00 0.00 ? 36  TRP A NE1  6  
ATOM 9894  C CE2  . TRP A 1 36  ? -3.894  5.039   2.395   1.00 0.00 ? 36  TRP A CE2  6  
ATOM 9895  C CE3  . TRP A 1 36  ? -2.627  3.148   1.587   1.00 0.00 ? 36  TRP A CE3  6  
ATOM 9896  C CZ2  . TRP A 1 36  ? -3.554  4.759   3.716   1.00 0.00 ? 36  TRP A CZ2  6  
ATOM 9897  C CZ3  . TRP A 1 36  ? -2.290  2.872   2.898   1.00 0.00 ? 36  TRP A CZ3  6  
ATOM 9898  C CH2  . TRP A 1 36  ? -2.753  3.674   3.949   1.00 0.00 ? 36  TRP A CH2  6  
ATOM 9899  H H    . TRP A 1 36  ? -0.934  5.198   -0.704  1.00 0.00 ? 36  TRP A H    6  
ATOM 9900  H HA   . TRP A 1 36  ? -2.582  4.675   -3.022  1.00 0.00 ? 36  TRP A HA   6  
ATOM 9901  H HB2  . TRP A 1 36  ? -4.682  4.514   -1.835  1.00 0.00 ? 36  TRP A HB2  6  
ATOM 9902  H HB3  . TRP A 1 36  ? -3.596  3.264   -1.236  1.00 0.00 ? 36  TRP A HB3  6  
ATOM 9903  H HD1  . TRP A 1 36  ? -5.249  6.552   -0.171  1.00 0.00 ? 36  TRP A HD1  6  
ATOM 9904  H HE1  . TRP A 1 36  ? -5.116  6.744   2.392   1.00 0.00 ? 36  TRP A HE1  6  
ATOM 9905  H HE3  . TRP A 1 36  ? -2.260  2.518   0.790   1.00 0.00 ? 36  TRP A HE3  6  
ATOM 9906  H HZ2  . TRP A 1 36  ? -3.903  5.367   4.537   1.00 0.00 ? 36  TRP A HZ2  6  
ATOM 9907  H HZ3  . TRP A 1 36  ? -1.659  2.024   3.124   1.00 0.00 ? 36  TRP A HZ3  6  
ATOM 9908  H HH2  . TRP A 1 36  ? -2.465  3.421   4.958   1.00 0.00 ? 36  TRP A HH2  6  
ATOM 9909  N N    . THR A 1 37  ? -3.771  7.009   -2.694  1.00 0.00 ? 37  THR A N    6  
ATOM 9910  C CA   . THR A 1 37  ? -4.042  8.440   -2.752  1.00 0.00 ? 37  THR A CA   6  
ATOM 9911  C C    . THR A 1 37  ? -5.533  8.711   -2.920  1.00 0.00 ? 37  THR A C    6  
ATOM 9912  O O    . THR A 1 37  ? -6.255  7.913   -3.518  1.00 0.00 ? 37  THR A O    6  
ATOM 9913  C CB   . THR A 1 37  ? -3.276  9.111   -3.907  1.00 0.00 ? 37  THR A CB   6  
ATOM 9914  O OG1  . THR A 1 37  ? -3.564  10.514  -3.937  1.00 0.00 ? 37  THR A OG1  6  
ATOM 9915  C CG2  . THR A 1 37  ? -3.650  8.483   -5.241  1.00 0.00 ? 37  THR A CG2  6  
ATOM 9916  H H    . THR A 1 37  ? -4.336  6.394   -3.207  1.00 0.00 ? 37  THR A H    6  
ATOM 9917  H HA   . THR A 1 37  ? -3.709  8.880   -1.823  1.00 0.00 ? 37  THR A HA   6  
ATOM 9918  H HB   . THR A 1 37  ? -2.217  8.972   -3.745  1.00 0.00 ? 37  THR A HB   6  
ATOM 9919  H HG1  . THR A 1 37  ? -4.314  10.674  -4.514  1.00 0.00 ? 37  THR A HG1  6  
ATOM 9920  H HG21 . THR A 1 37  ? -3.658  7.408   -5.143  1.00 0.00 ? 37  THR A HG21 6  
ATOM 9921  H HG22 . THR A 1 37  ? -2.928  8.772   -5.990  1.00 0.00 ? 37  THR A HG22 6  
ATOM 9922  H HG23 . THR A 1 37  ? -4.631  8.824   -5.536  1.00 0.00 ? 37  THR A HG23 6  
ATOM 9923  N N    . VAL A 1 38  ? -5.988  9.842   -2.391  1.00 0.00 ? 38  VAL A N    6  
ATOM 9924  C CA   . VAL A 1 38  ? -7.393  10.219  -2.485  1.00 0.00 ? 38  VAL A CA   6  
ATOM 9925  C C    . VAL A 1 38  ? -7.558  11.548  -3.214  1.00 0.00 ? 38  VAL A C    6  
ATOM 9926  O O    . VAL A 1 38  ? -6.747  12.460  -3.055  1.00 0.00 ? 38  VAL A O    6  
ATOM 9927  C CB   . VAL A 1 38  ? -8.040  10.327  -1.091  1.00 0.00 ? 38  VAL A CB   6  
ATOM 9928  C CG1  . VAL A 1 38  ? -7.900  9.016   -0.334  1.00 0.00 ? 38  VAL A CG1  6  
ATOM 9929  C CG2  . VAL A 1 38  ? -7.422  11.474  -0.306  1.00 0.00 ? 38  VAL A CG2  6  
ATOM 9930  H H    . VAL A 1 38  ? -5.363  10.438  -1.927  1.00 0.00 ? 38  VAL A H    6  
ATOM 9931  H HA   . VAL A 1 38  ? -7.909  9.449   -3.039  1.00 0.00 ? 38  VAL A HA   6  
ATOM 9932  H HB   . VAL A 1 38  ? -9.092  10.533  -1.220  1.00 0.00 ? 38  VAL A HB   6  
ATOM 9933  H HG11 . VAL A 1 38  ? -7.577  8.241   -1.014  1.00 0.00 ? 38  VAL A HG11 6  
ATOM 9934  H HG12 . VAL A 1 38  ? -7.171  9.131   0.455   1.00 0.00 ? 38  VAL A HG12 6  
ATOM 9935  H HG13 . VAL A 1 38  ? -8.854  8.743   0.093   1.00 0.00 ? 38  VAL A HG13 6  
ATOM 9936  H HG21 . VAL A 1 38  ? -6.354  11.483  -0.462  1.00 0.00 ? 38  VAL A HG21 6  
ATOM 9937  H HG22 . VAL A 1 38  ? -7.843  12.411  -0.644  1.00 0.00 ? 38  VAL A HG22 6  
ATOM 9938  H HG23 . VAL A 1 38  ? -7.632  11.345  0.746   1.00 0.00 ? 38  VAL A HG23 6  
ATOM 9939  N N    . ASP A 1 39  ? -8.614  11.650  -4.014  1.00 0.00 ? 39  ASP A N    6  
ATOM 9940  C CA   . ASP A 1 39  ? -8.887  12.868  -4.767  1.00 0.00 ? 39  ASP A CA   6  
ATOM 9941  C C    . ASP A 1 39  ? -9.268  14.012  -3.832  1.00 0.00 ? 39  ASP A C    6  
ATOM 9942  O O    . ASP A 1 39  ? -8.662  15.083  -3.866  1.00 0.00 ? 39  ASP A O    6  
ATOM 9943  C CB   . ASP A 1 39  ? -10.008 12.627  -5.780  1.00 0.00 ? 39  ASP A CB   6  
ATOM 9944  C CG   . ASP A 1 39  ? -10.003 13.646  -6.902  1.00 0.00 ? 39  ASP A CG   6  
ATOM 9945  O OD1  . ASP A 1 39  ? -9.646  14.814  -6.642  1.00 0.00 ? 39  ASP A OD1  6  
ATOM 9946  O OD2  . ASP A 1 39  ? -10.357 13.275  -8.041  1.00 0.00 ? 39  ASP A OD2  6  
ATOM 9947  H H    . ASP A 1 39  ? -9.225  10.888  -4.099  1.00 0.00 ? 39  ASP A H    6  
ATOM 9948  H HA   . ASP A 1 39  ? -7.987  13.139  -5.298  1.00 0.00 ? 39  ASP A HA   6  
ATOM 9949  H HB2  . ASP A 1 39  ? -9.888  11.644  -6.211  1.00 0.00 ? 39  ASP A HB2  6  
ATOM 9950  H HB3  . ASP A 1 39  ? -10.960 12.680  -5.273  1.00 0.00 ? 39  ASP A HB3  6  
ATOM 9951  N N    . ARG A 1 40  ? -10.277 13.777  -2.999  1.00 0.00 ? 40  ARG A N    6  
ATOM 9952  C CA   . ARG A 1 40  ? -10.740 14.788  -2.056  1.00 0.00 ? 40  ARG A CA   6  
ATOM 9953  C C    . ARG A 1 40  ? -10.558 14.314  -0.617  1.00 0.00 ? 40  ARG A C    6  
ATOM 9954  O O    . ARG A 1 40  ? -11.447 13.682  -0.046  1.00 0.00 ? 40  ARG A O    6  
ATOM 9955  C CB   . ARG A 1 40  ? -12.211 15.120  -2.313  1.00 0.00 ? 40  ARG A CB   6  
ATOM 9956  C CG   . ARG A 1 40  ? -12.472 15.696  -3.695  1.00 0.00 ? 40  ARG A CG   6  
ATOM 9957  C CD   . ARG A 1 40  ? -13.961 15.857  -3.959  1.00 0.00 ? 40  ARG A CD   6  
ATOM 9958  N NE   . ARG A 1 40  ? -14.263 15.897  -5.387  1.00 0.00 ? 40  ARG A NE   6  
ATOM 9959  C CZ   . ARG A 1 40  ? -14.026 16.952  -6.159  1.00 0.00 ? 40  ARG A CZ   6  
ATOM 9960  N NH1  . ARG A 1 40  ? -13.486 18.048  -5.643  1.00 0.00 ? 40  ARG A NH1  6  
ATOM 9961  N NH2  . ARG A 1 40  ? -14.329 16.912  -7.450  1.00 0.00 ? 40  ARG A NH2  6  
ATOM 9962  H H    . ARG A 1 40  ? -10.720 12.904  -3.019  1.00 0.00 ? 40  ARG A H    6  
ATOM 9963  H HA   . ARG A 1 40  ? -10.147 15.678  -2.206  1.00 0.00 ? 40  ARG A HA   6  
ATOM 9964  H HB2  . ARG A 1 40  ? -12.795 14.218  -2.207  1.00 0.00 ? 40  ARG A HB2  6  
ATOM 9965  H HB3  . ARG A 1 40  ? -12.538 15.841  -1.579  1.00 0.00 ? 40  ARG A HB3  6  
ATOM 9966  H HG2  . ARG A 1 40  ? -11.999 16.664  -3.767  1.00 0.00 ? 40  ARG A HG2  6  
ATOM 9967  H HG3  . ARG A 1 40  ? -12.054 15.032  -4.437  1.00 0.00 ? 40  ARG A HG3  6  
ATOM 9968  H HD2  . ARG A 1 40  ? -14.484 15.024  -3.513  1.00 0.00 ? 40  ARG A HD2  6  
ATOM 9969  H HD3  . ARG A 1 40  ? -14.296 16.777  -3.503  1.00 0.00 ? 40  ARG A HD3  6  
ATOM 9970  H HE   . ARG A 1 40  ? -14.663 15.098  -5.789  1.00 0.00 ? 40  ARG A HE   6  
ATOM 9971  H HH11 . ARG A 1 40  ? -13.257 18.080  -4.671  1.00 0.00 ? 40  ARG A HH11 6  
ATOM 9972  H HH12 . ARG A 1 40  ? -13.308 18.840  -6.227  1.00 0.00 ? 40  ARG A HH12 6  
ATOM 9973  H HH21 . ARG A 1 40  ? -14.735 16.088  -7.843  1.00 0.00 ? 40  ARG A HH21 6  
ATOM 9974  H HH22 . ARG A 1 40  ? -14.150 17.706  -8.030  1.00 0.00 ? 40  ARG A HH22 6  
ATOM 9975  N N    . GLN A 1 41  ? -9.402  14.622  -0.039  1.00 0.00 ? 41  GLN A N    6  
ATOM 9976  C CA   . GLN A 1 41  ? -9.104  14.225  1.332   1.00 0.00 ? 41  GLN A CA   6  
ATOM 9977  C C    . GLN A 1 41  ? -10.276 14.540  2.256   1.00 0.00 ? 41  GLN A C    6  
ATOM 9978  O O    . GLN A 1 41  ? -10.553 15.697  2.575   1.00 0.00 ? 41  GLN A O    6  
ATOM 9979  C CB   . GLN A 1 41  ? -7.843  14.935  1.828   1.00 0.00 ? 41  GLN A CB   6  
ATOM 9980  C CG   . GLN A 1 41  ? -7.532  14.671  3.292   1.00 0.00 ? 41  GLN A CG   6  
ATOM 9981  C CD   . GLN A 1 41  ? -6.054  14.795  3.607   1.00 0.00 ? 41  GLN A CD   6  
ATOM 9982  O OE1  . GLN A 1 41  ? -5.370  13.797  3.835   1.00 0.00 ? 41  GLN A OE1  6  
ATOM 9983  N NE2  . GLN A 1 41  ? -5.553  16.025  3.621   1.00 0.00 ? 41  GLN A NE2  6  
ATOM 9984  H H    . GLN A 1 41  ? -8.733  15.127  -0.547  1.00 0.00 ? 41  GLN A H    6  
ATOM 9985  H HA   . GLN A 1 41  ? -8.933  13.160  1.339   1.00 0.00 ? 41  GLN A HA   6  
ATOM 9986  H HB2  . GLN A 1 41  ? -7.002  14.603  1.238   1.00 0.00 ? 41  GLN A HB2  6  
ATOM 9987  H HB3  . GLN A 1 41  ? -7.968  16.000  1.696   1.00 0.00 ? 41  GLN A HB3  6  
ATOM 9988  H HG2  . GLN A 1 41  ? -8.074  15.383  3.897   1.00 0.00 ? 41  GLN A HG2  6  
ATOM 9989  H HG3  . GLN A 1 41  ? -7.855  13.670  3.541   1.00 0.00 ? 41  GLN A HG3  6  
ATOM 9990  H HE21 . GLN A 1 41  ? -6.158  16.773  3.431   1.00 0.00 ? 41  GLN A HE21 6  
ATOM 9991  H HE22 . GLN A 1 41  ? -4.602  16.134  3.822   1.00 0.00 ? 41  GLN A HE22 6  
ATOM 9992  N N    . PRO A 1 42  ? -10.981 13.488  2.697   1.00 0.00 ? 42  PRO A N    6  
ATOM 9993  C CA   . PRO A 1 42  ? -12.134 13.628  3.592   1.00 0.00 ? 42  PRO A CA   6  
ATOM 9994  C C    . PRO A 1 42  ? -11.731 14.069  4.994   1.00 0.00 ? 42  PRO A C    6  
ATOM 9995  O O    . PRO A 1 42  ? -10.735 13.596  5.540   1.00 0.00 ? 42  PRO A O    6  
ATOM 9996  C CB   . PRO A 1 42  ? -12.729 12.217  3.626   1.00 0.00 ? 42  PRO A CB   6  
ATOM 9997  C CG   . PRO A 1 42  ? -11.586 11.316  3.308   1.00 0.00 ? 42  PRO A CG   6  
ATOM 9998  C CD   . PRO A 1 42  ? -10.707 12.082  2.358   1.00 0.00 ? 42  PRO A CD   6  
ATOM 9999  H HA   . PRO A 1 42  ? -12.864 14.318  3.194   1.00 0.00 ? 42  PRO A HA   6  
ATOM 10000 H HB2  . PRO A 1 42  ? -13.130 12.017  4.609   1.00 0.00 ? 42  PRO A HB2  6  
ATOM 10001 H HB3  . PRO A 1 42  ? -13.513 12.135  2.888   1.00 0.00 ? 42  PRO A HB3  6  
ATOM 10002 H HG2  . PRO A 1 42  ? -11.044 11.078  4.211   1.00 0.00 ? 42  PRO A HG2  6  
ATOM 10003 H HG3  . PRO A 1 42  ? -11.949 10.415  2.838   1.00 0.00 ? 42  PRO A HG3  6  
ATOM 10004 H HD2  . PRO A 1 42  ? -9.668  11.840  2.527   1.00 0.00 ? 42  PRO A HD2  6  
ATOM 10005 H HD3  . PRO A 1 42  ? -10.984 11.872  1.335   1.00 0.00 ? 42  PRO A HD3  6  
ATOM 10006 N N    . GLN A 1 43  ? -12.511 14.978  5.570   1.00 0.00 ? 43  GLN A N    6  
ATOM 10007 C CA   . GLN A 1 43  ? -12.233 15.484  6.910   1.00 0.00 ? 43  GLN A CA   6  
ATOM 10008 C C    . GLN A 1 43  ? -12.799 14.548  7.973   1.00 0.00 ? 43  GLN A C    6  
ATOM 10009 O O    . GLN A 1 43  ? -12.098 14.156  8.906   1.00 0.00 ? 43  GLN A O    6  
ATOM 10010 C CB   . GLN A 1 43  ? -12.821 16.885  7.081   1.00 0.00 ? 43  GLN A CB   6  
ATOM 10011 C CG   . GLN A 1 43  ? -12.022 17.971  6.379   1.00 0.00 ? 43  GLN A CG   6  
ATOM 10012 C CD   . GLN A 1 43  ? -12.570 19.360  6.639   1.00 0.00 ? 43  GLN A CD   6  
ATOM 10013 O OE1  . GLN A 1 43  ? -13.375 19.562  7.549   1.00 0.00 ? 43  GLN A OE1  6  
ATOM 10014 N NE2  . GLN A 1 43  ? -12.136 20.327  5.840   1.00 0.00 ? 43  GLN A NE2  6  
ATOM 10015 H H    . GLN A 1 43  ? -13.290 15.317  5.084   1.00 0.00 ? 43  GLN A H    6  
ATOM 10016 H HA   . GLN A 1 43  ? -11.161 15.536  7.028   1.00 0.00 ? 43  GLN A HA   6  
ATOM 10017 H HB2  . GLN A 1 43  ? -13.825 16.892  6.684   1.00 0.00 ? 43  GLN A HB2  6  
ATOM 10018 H HB3  . GLN A 1 43  ? -12.858 17.121  8.135   1.00 0.00 ? 43  GLN A HB3  6  
ATOM 10019 H HG2  . GLN A 1 43  ? -11.001 17.932  6.729   1.00 0.00 ? 43  GLN A HG2  6  
ATOM 10020 H HG3  . GLN A 1 43  ? -12.044 17.784  5.315   1.00 0.00 ? 43  GLN A HG3  6  
ATOM 10021 H HE21 . GLN A 1 43  ? -11.496 20.093  5.135   1.00 0.00 ? 43  GLN A HE21 6  
ATOM 10022 H HE22 . GLN A 1 43  ? -12.475 21.235  5.985   1.00 0.00 ? 43  GLN A HE22 6  
ATOM 10023 N N    . PHE A 1 44  ? -14.071 14.194  7.825   1.00 0.00 ? 44  PHE A N    6  
ATOM 10024 C CA   . PHE A 1 44  ? -14.732 13.305  8.774   1.00 0.00 ? 44  PHE A CA   6  
ATOM 10025 C C    . PHE A 1 44  ? -13.909 12.040  8.998   1.00 0.00 ? 44  PHE A C    6  
ATOM 10026 O O    . PHE A 1 44  ? -13.877 11.495  10.102  1.00 0.00 ? 44  PHE A O    6  
ATOM 10027 C CB   . PHE A 1 44  ? -16.129 12.935  8.271   1.00 0.00 ? 44  PHE A CB   6  
ATOM 10028 C CG   . PHE A 1 44  ? -16.120 11.896  7.186   1.00 0.00 ? 44  PHE A CG   6  
ATOM 10029 C CD1  . PHE A 1 44  ? -15.549 12.167  5.953   1.00 0.00 ? 44  PHE A CD1  6  
ATOM 10030 C CD2  . PHE A 1 44  ? -16.681 10.648  7.400   1.00 0.00 ? 44  PHE A CD2  6  
ATOM 10031 C CE1  . PHE A 1 44  ? -15.540 11.213  4.953   1.00 0.00 ? 44  PHE A CE1  6  
ATOM 10032 C CE2  . PHE A 1 44  ? -16.675 9.689   6.404   1.00 0.00 ? 44  PHE A CE2  6  
ATOM 10033 C CZ   . PHE A 1 44  ? -16.103 9.972   5.179   1.00 0.00 ? 44  PHE A CZ   6  
ATOM 10034 H H    . PHE A 1 44  ? -14.578 14.539  7.060   1.00 0.00 ? 44  PHE A H    6  
ATOM 10035 H HA   . PHE A 1 44  ? -14.824 13.831  9.711   1.00 0.00 ? 44  PHE A HA   6  
ATOM 10036 H HB2  . PHE A 1 44  ? -16.710 12.549  9.094   1.00 0.00 ? 44  PHE A HB2  6  
ATOM 10037 H HB3  . PHE A 1 44  ? -16.609 13.820  7.880   1.00 0.00 ? 44  PHE A HB3  6  
ATOM 10038 H HD1  . PHE A 1 44  ? -15.107 13.137  5.775   1.00 0.00 ? 44  PHE A HD1  6  
ATOM 10039 H HD2  . PHE A 1 44  ? -17.130 10.425  8.358   1.00 0.00 ? 44  PHE A HD2  6  
ATOM 10040 H HE1  . PHE A 1 44  ? -15.091 11.437  3.997   1.00 0.00 ? 44  PHE A HE1  6  
ATOM 10041 H HE2  . PHE A 1 44  ? -17.116 8.720   6.584   1.00 0.00 ? 44  PHE A HE2  6  
ATOM 10042 H HZ   . PHE A 1 44  ? -16.097 9.225   4.400   1.00 0.00 ? 44  PHE A HZ   6  
ATOM 10043 N N    . ILE A 1 45  ? -13.245 11.578  7.944   1.00 0.00 ? 45  ILE A N    6  
ATOM 10044 C CA   . ILE A 1 45  ? -12.421 10.379  8.025   1.00 0.00 ? 45  ILE A CA   6  
ATOM 10045 C C    . ILE A 1 45  ? -11.596 10.364  9.308   1.00 0.00 ? 45  ILE A C    6  
ATOM 10046 O O    . ILE A 1 45  ? -11.162 11.410  9.789   1.00 0.00 ? 45  ILE A O    6  
ATOM 10047 C CB   . ILE A 1 45  ? -11.473 10.263  6.817   1.00 0.00 ? 45  ILE A CB   6  
ATOM 10048 C CG1  . ILE A 1 45  ? -11.093 8.801   6.577   1.00 0.00 ? 45  ILE A CG1  6  
ATOM 10049 C CG2  . ILE A 1 45  ? -10.229 11.111  7.037   1.00 0.00 ? 45  ILE A CG2  6  
ATOM 10050 C CD1  . ILE A 1 45  ? -10.356 8.574   5.276   1.00 0.00 ? 45  ILE A CD1  6  
ATOM 10051 H H    . ILE A 1 45  ? -13.310 12.057  7.091   1.00 0.00 ? 45  ILE A H    6  
ATOM 10052 H HA   . ILE A 1 45  ? -13.080 9.522   8.024   1.00 0.00 ? 45  ILE A HA   6  
ATOM 10053 H HB   . ILE A 1 45  ? -11.987 10.642  5.947   1.00 0.00 ? 45  ILE A HB   6  
ATOM 10054 H HG12 . ILE A 1 45  ? -10.456 8.464   7.380   1.00 0.00 ? 45  ILE A HG12 6  
ATOM 10055 H HG13 . ILE A 1 45  ? -11.991 8.201   6.560   1.00 0.00 ? 45  ILE A HG13 6  
ATOM 10056 H HG21 . ILE A 1 45  ? -10.514 12.068  7.448   1.00 0.00 ? 45  ILE A HG21 6  
ATOM 10057 H HG22 . ILE A 1 45  ? -9.568  10.607  7.727   1.00 0.00 ? 45  ILE A HG22 6  
ATOM 10058 H HG23 . ILE A 1 45  ? -9.723  11.259  6.096   1.00 0.00 ? 45  ILE A HG23 6  
ATOM 10059 H HD11 . ILE A 1 45  ? -11.057 8.605   4.455   1.00 0.00 ? 45  ILE A HD11 6  
ATOM 10060 H HD12 . ILE A 1 45  ? -9.611  9.343   5.144   1.00 0.00 ? 45  ILE A HD12 6  
ATOM 10061 H HD13 . ILE A 1 45  ? -9.874  7.607   5.299   1.00 0.00 ? 45  ILE A HD13 6  
ATOM 10062 N N    . GLN A 1 46  ? -11.383 9.171   9.854   1.00 0.00 ? 46  GLN A N    6  
ATOM 10063 C CA   . GLN A 1 46  ? -10.608 9.021   11.080  1.00 0.00 ? 46  GLN A CA   6  
ATOM 10064 C C    . GLN A 1 46  ? -9.244  8.405   10.790  1.00 0.00 ? 46  GLN A C    6  
ATOM 10065 O O    . GLN A 1 46  ? -8.272  8.663   11.499  1.00 0.00 ? 46  GLN A O    6  
ATOM 10066 C CB   . GLN A 1 46  ? -11.369 8.154   12.085  1.00 0.00 ? 46  GLN A CB   6  
ATOM 10067 C CG   . GLN A 1 46  ? -12.375 8.931   12.919  1.00 0.00 ? 46  GLN A CG   6  
ATOM 10068 C CD   . GLN A 1 46  ? -11.775 9.477   14.200  1.00 0.00 ? 46  GLN A CD   6  
ATOM 10069 O OE1  . GLN A 1 46  ? -10.963 10.403  14.173  1.00 0.00 ? 46  GLN A OE1  6  
ATOM 10070 N NE2  . GLN A 1 46  ? -12.171 8.905   15.331  1.00 0.00 ? 46  GLN A NE2  6  
ATOM 10071 H H    . GLN A 1 46  ? -11.755 8.375   9.423   1.00 0.00 ? 46  GLN A H    6  
ATOM 10072 H HA   . GLN A 1 46  ? -10.464 10.004  11.503  1.00 0.00 ? 46  GLN A HA   6  
ATOM 10073 H HB2  . GLN A 1 46  ? -11.898 7.381   11.549  1.00 0.00 ? 46  GLN A HB2  6  
ATOM 10074 H HB3  . GLN A 1 46  ? -10.658 7.694   12.756  1.00 0.00 ? 46  GLN A HB3  6  
ATOM 10075 H HG2  . GLN A 1 46  ? -12.747 9.758   12.333  1.00 0.00 ? 46  GLN A HG2  6  
ATOM 10076 H HG3  . GLN A 1 46  ? -13.194 8.274   13.174  1.00 0.00 ? 46  GLN A HG3  6  
ATOM 10077 H HE21 . GLN A 1 46  ? -12.820 8.171   15.275  1.00 0.00 ? 46  GLN A HE21 6  
ATOM 10078 H HE22 . GLN A 1 46  ? -11.799 9.237   16.173  1.00 0.00 ? 46  GLN A HE22 6  
ATOM 10079 N N    . GLY A 1 47  ? -9.178  7.590   9.742   1.00 0.00 ? 47  GLY A N    6  
ATOM 10080 C CA   . GLY A 1 47  ? -7.928  6.949   9.377   1.00 0.00 ? 47  GLY A CA   6  
ATOM 10081 C C    . GLY A 1 47  ? -8.056  6.096   8.131   1.00 0.00 ? 47  GLY A C    6  
ATOM 10082 O O    . GLY A 1 47  ? -8.591  6.543   7.116   1.00 0.00 ? 47  GLY A O    6  
ATOM 10083 H H    . GLY A 1 47  ? -9.986  7.421   9.213   1.00 0.00 ? 47  GLY A H    6  
ATOM 10084 H HA2  . GLY A 1 47  ? -7.183  7.712   9.204   1.00 0.00 ? 47  GLY A HA2  6  
ATOM 10085 H HA3  . GLY A 1 47  ? -7.605  6.324   10.197  1.00 0.00 ? 47  GLY A HA3  6  
ATOM 10086 N N    . TYR A 1 48  ? -7.563  4.865   8.207   1.00 0.00 ? 48  TYR A N    6  
ATOM 10087 C CA   . TYR A 1 48  ? -7.620  3.947   7.075   1.00 0.00 ? 48  TYR A CA   6  
ATOM 10088 C C    . TYR A 1 48  ? -7.395  2.508   7.528   1.00 0.00 ? 48  TYR A C    6  
ATOM 10089 O O    . TYR A 1 48  ? -6.493  2.228   8.317   1.00 0.00 ? 48  TYR A O    6  
ATOM 10090 C CB   . TYR A 1 48  ? -6.576  4.333   6.026   1.00 0.00 ? 48  TYR A CB   6  
ATOM 10091 C CG   . TYR A 1 48  ? -6.909  5.605   5.280   1.00 0.00 ? 48  TYR A CG   6  
ATOM 10092 C CD1  . TYR A 1 48  ? -7.807  5.598   4.219   1.00 0.00 ? 48  TYR A CD1  6  
ATOM 10093 C CD2  . TYR A 1 48  ? -6.324  6.815   5.634   1.00 0.00 ? 48  TYR A CD2  6  
ATOM 10094 C CE1  . TYR A 1 48  ? -8.113  6.758   3.534   1.00 0.00 ? 48  TYR A CE1  6  
ATOM 10095 C CE2  . TYR A 1 48  ? -6.625  7.980   4.955   1.00 0.00 ? 48  TYR A CE2  6  
ATOM 10096 C CZ   . TYR A 1 48  ? -7.520  7.946   3.906   1.00 0.00 ? 48  TYR A CZ   6  
ATOM 10097 O OH   . TYR A 1 48  ? -7.822  9.104   3.227   1.00 0.00 ? 48  TYR A OH   6  
ATOM 10098 H H    . TYR A 1 48  ? -7.148  4.566   9.043   1.00 0.00 ? 48  TYR A H    6  
ATOM 10099 H HA   . TYR A 1 48  ? -8.604  4.025   6.635   1.00 0.00 ? 48  TYR A HA   6  
ATOM 10100 H HB2  . TYR A 1 48  ? -5.623  4.473   6.511   1.00 0.00 ? 48  TYR A HB2  6  
ATOM 10101 H HB3  . TYR A 1 48  ? -6.492  3.536   5.302   1.00 0.00 ? 48  TYR A HB3  6  
ATOM 10102 H HD1  . TYR A 1 48  ? -8.270  4.665   3.930   1.00 0.00 ? 48  TYR A HD1  6  
ATOM 10103 H HD2  . TYR A 1 48  ? -5.623  6.837   6.456   1.00 0.00 ? 48  TYR A HD2  6  
ATOM 10104 H HE1  . TYR A 1 48  ? -8.814  6.732   2.713   1.00 0.00 ? 48  TYR A HE1  6  
ATOM 10105 H HE2  . TYR A 1 48  ? -6.160  8.910   5.246   1.00 0.00 ? 48  TYR A HE2  6  
ATOM 10106 H HH   . TYR A 1 48  ? -7.258  9.177   2.453   1.00 0.00 ? 48  TYR A HH   6  
ATOM 10107 N N    . ARG A 1 49  ? -8.223  1.599   7.022   1.00 0.00 ? 49  ARG A N    6  
ATOM 10108 C CA   . ARG A 1 49  ? -8.115  0.189   7.374   1.00 0.00 ? 49  ARG A CA   6  
ATOM 10109 C C    . ARG A 1 49  ? -7.609  -0.630  6.190   1.00 0.00 ? 49  ARG A C    6  
ATOM 10110 O O    . ARG A 1 49  ? -8.340  -0.868  5.228   1.00 0.00 ? 49  ARG A O    6  
ATOM 10111 C CB   . ARG A 1 49  ? -9.471  -0.348  7.836   1.00 0.00 ? 49  ARG A CB   6  
ATOM 10112 C CG   . ARG A 1 49  ? -9.368  -1.560  8.748   1.00 0.00 ? 49  ARG A CG   6  
ATOM 10113 C CD   . ARG A 1 49  ? -10.546 -1.638  9.707   1.00 0.00 ? 49  ARG A CD   6  
ATOM 10114 N NE   . ARG A 1 49  ? -10.516 -2.855  10.512  1.00 0.00 ? 49  ARG A NE   6  
ATOM 10115 C CZ   . ARG A 1 49  ? -11.168 -2.992  11.661  1.00 0.00 ? 49  ARG A CZ   6  
ATOM 10116 N NH1  . ARG A 1 49  ? -11.897 -1.992  12.137  1.00 0.00 ? 49  ARG A NH1  6  
ATOM 10117 N NH2  . ARG A 1 49  ? -11.092 -4.132  12.337  1.00 0.00 ? 49  ARG A NH2  6  
ATOM 10118 H H    . ARG A 1 49  ? -8.922  1.884   6.397   1.00 0.00 ? 49  ARG A H    6  
ATOM 10119 H HA   . ARG A 1 49  ? -7.408  0.102   8.185   1.00 0.00 ? 49  ARG A HA   6  
ATOM 10120 H HB2  . ARG A 1 49  ? -9.992  0.433   8.371   1.00 0.00 ? 49  ARG A HB2  6  
ATOM 10121 H HB3  . ARG A 1 49  ? -10.050 -0.626  6.968   1.00 0.00 ? 49  ARG A HB3  6  
ATOM 10122 H HG2  . ARG A 1 49  ? -9.352  -2.454  8.142   1.00 0.00 ? 49  ARG A HG2  6  
ATOM 10123 H HG3  . ARG A 1 49  ? -8.454  -1.492  9.318   1.00 0.00 ? 49  ARG A HG3  6  
ATOM 10124 H HD2  . ARG A 1 49  ? -10.515 -0.782  10.364  1.00 0.00 ? 49  ARG A HD2  6  
ATOM 10125 H HD3  . ARG A 1 49  ? -11.461 -1.618  9.133   1.00 0.00 ? 49  ARG A HD3  6  
ATOM 10126 H HE   . ARG A 1 49  ? -9.984  -3.607  10.179  1.00 0.00 ? 49  ARG A HE   6  
ATOM 10127 H HH11 . ARG A 1 49  ? -11.957 -1.133  11.630  1.00 0.00 ? 49  ARG A HH11 6  
ATOM 10128 H HH12 . ARG A 1 49  ? -12.388 -2.098  13.002  1.00 0.00 ? 49  ARG A HH12 6  
ATOM 10129 H HH21 . ARG A 1 49  ? -10.544 -4.888  11.981  1.00 0.00 ? 49  ARG A HH21 6  
ATOM 10130 H HH22 . ARG A 1 49  ? -11.583 -4.234  13.202  1.00 0.00 ? 49  ARG A HH22 6  
ATOM 10131 N N    . VAL A 1 50  ? -6.353  -1.059  6.267   1.00 0.00 ? 50  VAL A N    6  
ATOM 10132 C CA   . VAL A 1 50  ? -5.749  -1.851  5.202   1.00 0.00 ? 50  VAL A CA   6  
ATOM 10133 C C    . VAL A 1 50  ? -6.040  -3.336  5.390   1.00 0.00 ? 50  VAL A C    6  
ATOM 10134 O O    . VAL A 1 50  ? -5.568  -3.956  6.343   1.00 0.00 ? 50  VAL A O    6  
ATOM 10135 C CB   . VAL A 1 50  ? -4.225  -1.642  5.143   1.00 0.00 ? 50  VAL A CB   6  
ATOM 10136 C CG1  . VAL A 1 50  ? -3.627  -2.400  3.967   1.00 0.00 ? 50  VAL A CG1  6  
ATOM 10137 C CG2  . VAL A 1 50  ? -3.894  -0.159  5.055   1.00 0.00 ? 50  VAL A CG2  6  
ATOM 10138 H H    . VAL A 1 50  ? -5.821  -0.837  7.059   1.00 0.00 ? 50  VAL A H    6  
ATOM 10139 H HA   . VAL A 1 50  ? -6.173  -1.527  4.263   1.00 0.00 ? 50  VAL A HA   6  
ATOM 10140 H HB   . VAL A 1 50  ? -3.792  -2.033  6.052   1.00 0.00 ? 50  VAL A HB   6  
ATOM 10141 H HG11 . VAL A 1 50  ? -2.641  -2.753  4.231   1.00 0.00 ? 50  VAL A HG11 6  
ATOM 10142 H HG12 . VAL A 1 50  ? -4.259  -3.241  3.722   1.00 0.00 ? 50  VAL A HG12 6  
ATOM 10143 H HG13 . VAL A 1 50  ? -3.555  -1.741  3.114   1.00 0.00 ? 50  VAL A HG13 6  
ATOM 10144 H HG21 . VAL A 1 50  ? -4.610  0.403   5.635   1.00 0.00 ? 50  VAL A HG21 6  
ATOM 10145 H HG22 . VAL A 1 50  ? -2.901  0.012   5.446   1.00 0.00 ? 50  VAL A HG22 6  
ATOM 10146 H HG23 . VAL A 1 50  ? -3.935  0.159   4.024   1.00 0.00 ? 50  VAL A HG23 6  
ATOM 10147 N N    . MET A 1 51  ? -6.820  -3.901  4.474   1.00 0.00 ? 51  MET A N    6  
ATOM 10148 C CA   . MET A 1 51  ? -7.173  -5.314  4.538   1.00 0.00 ? 51  MET A CA   6  
ATOM 10149 C C    . MET A 1 51  ? -6.303  -6.135  3.591   1.00 0.00 ? 51  MET A C    6  
ATOM 10150 O O    . MET A 1 51  ? -6.138  -5.784  2.422   1.00 0.00 ? 51  MET A O    6  
ATOM 10151 C CB   . MET A 1 51  ? -8.650  -5.510  4.190   1.00 0.00 ? 51  MET A CB   6  
ATOM 10152 C CG   . MET A 1 51  ? -9.596  -5.113  5.312   1.00 0.00 ? 51  MET A CG   6  
ATOM 10153 S SD   . MET A 1 51  ? -11.315 -5.514  4.945   1.00 0.00 ? 51  MET A SD   6  
ATOM 10154 C CE   . MET A 1 51  ? -11.197 -7.277  4.652   1.00 0.00 ? 51  MET A CE   6  
ATOM 10155 H H    . MET A 1 51  ? -7.167  -3.355  3.737   1.00 0.00 ? 51  MET A H    6  
ATOM 10156 H HA   . MET A 1 51  ? -7.003  -5.653  5.549   1.00 0.00 ? 51  MET A HA   6  
ATOM 10157 H HB2  . MET A 1 51  ? -8.885  -4.912  3.322   1.00 0.00 ? 51  MET A HB2  6  
ATOM 10158 H HB3  . MET A 1 51  ? -8.819  -6.550  3.957   1.00 0.00 ? 51  MET A HB3  6  
ATOM 10159 H HG2  . MET A 1 51  ? -9.305  -5.634  6.212   1.00 0.00 ? 51  MET A HG2  6  
ATOM 10160 H HG3  . MET A 1 51  ? -9.515  -4.048  5.473   1.00 0.00 ? 51  MET A HG3  6  
ATOM 10161 H HE1  . MET A 1 51  ? -10.758 -7.452  3.681   1.00 0.00 ? 51  MET A HE1  6  
ATOM 10162 H HE2  . MET A 1 51  ? -10.578 -7.727  5.414   1.00 0.00 ? 51  MET A HE2  6  
ATOM 10163 H HE3  . MET A 1 51  ? -12.184 -7.714  4.685   1.00 0.00 ? 51  MET A HE3  6  
ATOM 10164 N N    . TYR A 1 52  ? -5.748  -7.228  4.102   1.00 0.00 ? 52  TYR A N    6  
ATOM 10165 C CA   . TYR A 1 52  ? -4.893  -8.097  3.303   1.00 0.00 ? 52  TYR A CA   6  
ATOM 10166 C C    . TYR A 1 52  ? -5.045  -9.554  3.730   1.00 0.00 ? 52  TYR A C    6  
ATOM 10167 O O    . TYR A 1 52  ? -5.363  -9.844  4.883   1.00 0.00 ? 52  TYR A O    6  
ATOM 10168 C CB   . TYR A 1 52  ? -3.431  -7.666  3.431   1.00 0.00 ? 52  TYR A CB   6  
ATOM 10169 C CG   . TYR A 1 52  ? -2.875  -7.818  4.829   1.00 0.00 ? 52  TYR A CG   6  
ATOM 10170 C CD1  . TYR A 1 52  ? -3.210  -6.919  5.833   1.00 0.00 ? 52  TYR A CD1  6  
ATOM 10171 C CD2  . TYR A 1 52  ? -2.015  -8.863  5.145   1.00 0.00 ? 52  TYR A CD2  6  
ATOM 10172 C CE1  . TYR A 1 52  ? -2.704  -7.054  7.111   1.00 0.00 ? 52  TYR A CE1  6  
ATOM 10173 C CE2  . TYR A 1 52  ? -1.505  -9.007  6.421   1.00 0.00 ? 52  TYR A CE2  6  
ATOM 10174 C CZ   . TYR A 1 52  ? -1.852  -8.099  7.400   1.00 0.00 ? 52  TYR A CZ   6  
ATOM 10175 O OH   . TYR A 1 52  ? -1.346  -8.238  8.673   1.00 0.00 ? 52  TYR A OH   6  
ATOM 10176 H H    . TYR A 1 52  ? -5.917  -7.456  5.040   1.00 0.00 ? 52  TYR A H    6  
ATOM 10177 H HA   . TYR A 1 52  ? -5.196  -8.002  2.270   1.00 0.00 ? 52  TYR A HA   6  
ATOM 10178 H HB2  . TYR A 1 52  ? -2.826  -8.265  2.767   1.00 0.00 ? 52  TYR A HB2  6  
ATOM 10179 H HB3  . TYR A 1 52  ? -3.343  -6.627  3.150   1.00 0.00 ? 52  TYR A HB3  6  
ATOM 10180 H HD1  . TYR A 1 52  ? -3.878  -6.101  5.603   1.00 0.00 ? 52  TYR A HD1  6  
ATOM 10181 H HD2  . TYR A 1 52  ? -1.745  -9.572  4.376   1.00 0.00 ? 52  TYR A HD2  6  
ATOM 10182 H HE1  . TYR A 1 52  ? -2.976  -6.344  7.878   1.00 0.00 ? 52  TYR A HE1  6  
ATOM 10183 H HE2  . TYR A 1 52  ? -0.837  -9.825  6.648   1.00 0.00 ? 52  TYR A HE2  6  
ATOM 10184 H HH   . TYR A 1 52  ? -2.034  -8.042  9.313   1.00 0.00 ? 52  TYR A HH   6  
ATOM 10185 N N    . ARG A 1 53  ? -4.813  -10.466 2.791   1.00 0.00 ? 53  ARG A N    6  
ATOM 10186 C CA   . ARG A 1 53  ? -4.924  -11.893 3.068   1.00 0.00 ? 53  ARG A CA   6  
ATOM 10187 C C    . ARG A 1 53  ? -4.297  -12.715 1.946   1.00 0.00 ? 53  ARG A C    6  
ATOM 10188 O O    . ARG A 1 53  ? -4.027  -12.198 0.862   1.00 0.00 ? 53  ARG A O    6  
ATOM 10189 C CB   . ARG A 1 53  ? -6.392  -12.287 3.245   1.00 0.00 ? 53  ARG A CB   6  
ATOM 10190 C CG   . ARG A 1 53  ? -7.167  -12.350 1.939   1.00 0.00 ? 53  ARG A CG   6  
ATOM 10191 C CD   . ARG A 1 53  ? -8.365  -13.281 2.047   1.00 0.00 ? 53  ARG A CD   6  
ATOM 10192 N NE   . ARG A 1 53  ? -9.119  -13.350 0.798   1.00 0.00 ? 53  ARG A NE   6  
ATOM 10193 C CZ   . ARG A 1 53  ? -10.368 -13.795 0.717   1.00 0.00 ? 53  ARG A CZ   6  
ATOM 10194 N NH1  . ARG A 1 53  ? -11.000 -14.207 1.807   1.00 0.00 ? 53  ARG A NH1  6  
ATOM 10195 N NH2  . ARG A 1 53  ? -10.987 -13.827 -0.456  1.00 0.00 ? 53  ARG A NH2  6  
ATOM 10196 H H    . ARG A 1 53  ? -4.562  -10.172 1.890   1.00 0.00 ? 53  ARG A H    6  
ATOM 10197 H HA   . ARG A 1 53  ? -4.393  -12.095 3.986   1.00 0.00 ? 53  ARG A HA   6  
ATOM 10198 H HB2  . ARG A 1 53  ? -6.438  -13.259 3.713   1.00 0.00 ? 53  ARG A HB2  6  
ATOM 10199 H HB3  . ARG A 1 53  ? -6.871  -11.564 3.888   1.00 0.00 ? 53  ARG A HB3  6  
ATOM 10200 H HG2  . ARG A 1 53  ? -7.516  -11.359 1.690   1.00 0.00 ? 53  ARG A HG2  6  
ATOM 10201 H HG3  . ARG A 1 53  ? -6.512  -12.710 1.160   1.00 0.00 ? 53  ARG A HG3  6  
ATOM 10202 H HD2  . ARG A 1 53  ? -8.014  -14.270 2.300   1.00 0.00 ? 53  ARG A HD2  6  
ATOM 10203 H HD3  . ARG A 1 53  ? -9.015  -12.919 2.830   1.00 0.00 ? 53  ARG A HD3  6  
ATOM 10204 H HE   . ARG A 1 53  ? -8.670  -13.050 -0.019  1.00 0.00 ? 53  ARG A HE   6  
ATOM 10205 H HH11 . ARG A 1 53  ? -10.536 -14.183 2.693   1.00 0.00 ? 53  ARG A HH11 6  
ATOM 10206 H HH12 . ARG A 1 53  ? -11.941 -14.541 1.744   1.00 0.00 ? 53  ARG A HH12 6  
ATOM 10207 H HH21 . ARG A 1 53  ? -10.514 -13.517 -1.279  1.00 0.00 ? 53  ARG A HH21 6  
ATOM 10208 H HH22 . ARG A 1 53  ? -11.927 -14.163 -0.516  1.00 0.00 ? 53  ARG A HH22 6  
ATOM 10209 N N    . GLN A 1 54  ? -4.069  -13.996 2.215   1.00 0.00 ? 54  GLN A N    6  
ATOM 10210 C CA   . GLN A 1 54  ? -3.473  -14.889 1.228   1.00 0.00 ? 54  GLN A CA   6  
ATOM 10211 C C    . GLN A 1 54  ? -4.499  -15.301 0.177   1.00 0.00 ? 54  GLN A C    6  
ATOM 10212 O O    . GLN A 1 54  ? -5.692  -15.399 0.463   1.00 0.00 ? 54  GLN A O    6  
ATOM 10213 C CB   . GLN A 1 54  ? -2.901  -16.131 1.913   1.00 0.00 ? 54  GLN A CB   6  
ATOM 10214 C CG   . GLN A 1 54  ? -2.125  -17.041 0.973   1.00 0.00 ? 54  GLN A CG   6  
ATOM 10215 C CD   . GLN A 1 54  ? -2.075  -18.476 1.460   1.00 0.00 ? 54  GLN A CD   6  
ATOM 10216 O OE1  . GLN A 1 54  ? -3.089  -19.173 1.478   1.00 0.00 ? 54  GLN A OE1  6  
ATOM 10217 N NE2  . GLN A 1 54  ? -0.890  -18.925 1.857   1.00 0.00 ? 54  GLN A NE2  6  
ATOM 10218 H H    . GLN A 1 54  ? -4.307  -14.349 3.097   1.00 0.00 ? 54  GLN A H    6  
ATOM 10219 H HA   . GLN A 1 54  ? -2.671  -14.356 0.741   1.00 0.00 ? 54  GLN A HA   6  
ATOM 10220 H HB2  . GLN A 1 54  ? -2.238  -15.817 2.705   1.00 0.00 ? 54  GLN A HB2  6  
ATOM 10221 H HB3  . GLN A 1 54  ? -3.714  -16.700 2.339   1.00 0.00 ? 54  GLN A HB3  6  
ATOM 10222 H HG2  . GLN A 1 54  ? -2.598  -17.023 0.003   1.00 0.00 ? 54  GLN A HG2  6  
ATOM 10223 H HG3  . GLN A 1 54  ? -1.114  -16.669 0.887   1.00 0.00 ? 54  GLN A HG3  6  
ATOM 10224 H HE21 . GLN A 1 54  ? -0.125  -18.312 1.816   1.00 0.00 ? 54  GLN A HE21 6  
ATOM 10225 H HE22 . GLN A 1 54  ? -0.829  -19.848 2.177   1.00 0.00 ? 54  GLN A HE22 6  
ATOM 10226 N N    . THR A 1 55  ? -4.026  -15.540 -1.043  1.00 0.00 ? 55  THR A N    6  
ATOM 10227 C CA   . THR A 1 55  ? -4.901  -15.939 -2.137  1.00 0.00 ? 55  THR A CA   6  
ATOM 10228 C C    . THR A 1 55  ? -4.846  -17.446 -2.364  1.00 0.00 ? 55  THR A C    6  
ATOM 10229 O O    . THR A 1 55  ? -5.871  -18.085 -2.598  1.00 0.00 ? 55  THR A O    6  
ATOM 10230 C CB   . THR A 1 55  ? -4.526  -15.221 -3.447  1.00 0.00 ? 55  THR A CB   6  
ATOM 10231 O OG1  . THR A 1 55  ? -3.180  -15.541 -3.814  1.00 0.00 ? 55  THR A OG1  6  
ATOM 10232 C CG2  . THR A 1 55  ? -4.671  -13.714 -3.298  1.00 0.00 ? 55  THR A CG2  6  
ATOM 10233 H H    . THR A 1 55  ? -3.065  -15.444 -1.209  1.00 0.00 ? 55  THR A H    6  
ATOM 10234 H HA   . THR A 1 55  ? -5.911  -15.661 -1.875  1.00 0.00 ? 55  THR A HA   6  
ATOM 10235 H HB   . THR A 1 55  ? -5.194  -15.556 -4.228  1.00 0.00 ? 55  THR A HB   6  
ATOM 10236 H HG1  . THR A 1 55  ? -2.605  -15.427 -3.053  1.00 0.00 ? 55  THR A HG1  6  
ATOM 10237 H HG21 . THR A 1 55  ? -3.814  -13.319 -2.773  1.00 0.00 ? 55  THR A HG21 6  
ATOM 10238 H HG22 . THR A 1 55  ? -5.569  -13.492 -2.740  1.00 0.00 ? 55  THR A HG22 6  
ATOM 10239 H HG23 . THR A 1 55  ? -4.734  -13.260 -4.276  1.00 0.00 ? 55  THR A HG23 6  
ATOM 10240 N N    . SER A 1 56  ? -3.643  -18.007 -2.291  1.00 0.00 ? 56  SER A N    6  
ATOM 10241 C CA   . SER A 1 56  ? -3.455  -19.439 -2.492  1.00 0.00 ? 56  SER A CA   6  
ATOM 10242 C C    . SER A 1 56  ? -2.611  -20.038 -1.370  1.00 0.00 ? 56  SER A C    6  
ATOM 10243 O O    . SER A 1 56  ? -1.637  -19.435 -0.922  1.00 0.00 ? 56  SER A O    6  
ATOM 10244 C CB   . SER A 1 56  ? -2.788  -19.703 -3.843  1.00 0.00 ? 56  SER A CB   6  
ATOM 10245 O OG   . SER A 1 56  ? -3.609  -19.262 -4.911  1.00 0.00 ? 56  SER A OG   6  
ATOM 10246 H H    . SER A 1 56  ? -2.864  -17.443 -2.101  1.00 0.00 ? 56  SER A H    6  
ATOM 10247 H HA   . SER A 1 56  ? -4.428  -19.906 -2.482  1.00 0.00 ? 56  SER A HA   6  
ATOM 10248 H HB2  . SER A 1 56  ? -1.847  -19.176 -3.887  1.00 0.00 ? 56  SER A HB2  6  
ATOM 10249 H HB3  . SER A 1 56  ? -2.613  -20.763 -3.954  1.00 0.00 ? 56  SER A HB3  6  
ATOM 10250 H HG   . SER A 1 56  ? -3.752  -18.315 -4.836  1.00 0.00 ? 56  SER A HG   6  
ATOM 10251 N N    . GLY A 1 57  ? -2.993  -21.230 -0.922  1.00 0.00 ? 57  GLY A N    6  
ATOM 10252 C CA   . GLY A 1 57  ? -2.262  -21.891 0.143   1.00 0.00 ? 57  GLY A CA   6  
ATOM 10253 C C    . GLY A 1 57  ? -3.170  -22.368 1.259   1.00 0.00 ? 57  GLY A C    6  
ATOM 10254 O O    . GLY A 1 57  ? -4.312  -22.758 1.017   1.00 0.00 ? 57  GLY A O    6  
ATOM 10255 H H    . GLY A 1 57  ? -3.778  -21.663 -1.318  1.00 0.00 ? 57  GLY A H    6  
ATOM 10256 H HA2  . GLY A 1 57  ? -1.738  -22.741 -0.269  1.00 0.00 ? 57  GLY A HA2  6  
ATOM 10257 H HA3  . GLY A 1 57  ? -1.541  -21.199 0.552   1.00 0.00 ? 57  GLY A HA3  6  
ATOM 10258 N N    . LEU A 1 58  ? -2.661  -22.339 2.486   1.00 0.00 ? 58  LEU A N    6  
ATOM 10259 C CA   . LEU A 1 58  ? -3.433  -22.774 3.645   1.00 0.00 ? 58  LEU A CA   6  
ATOM 10260 C C    . LEU A 1 58  ? -4.347  -21.658 4.140   1.00 0.00 ? 58  LEU A C    6  
ATOM 10261 O O    . LEU A 1 58  ? -5.545  -21.864 4.332   1.00 0.00 ? 58  LEU A O    6  
ATOM 10262 C CB   . LEU A 1 58  ? -2.496  -23.218 4.769   1.00 0.00 ? 58  LEU A CB   6  
ATOM 10263 C CG   . LEU A 1 58  ? -3.139  -24.015 5.905   1.00 0.00 ? 58  LEU A CG   6  
ATOM 10264 C CD1  . LEU A 1 58  ? -4.003  -23.110 6.769   1.00 0.00 ? 58  LEU A CD1  6  
ATOM 10265 C CD2  . LEU A 1 58  ? -3.962  -25.167 5.347   1.00 0.00 ? 58  LEU A CD2  6  
ATOM 10266 H H    . LEU A 1 58  ? -1.744  -22.018 2.617   1.00 0.00 ? 58  LEU A H    6  
ATOM 10267 H HA   . LEU A 1 58  ? -4.041  -23.613 3.342   1.00 0.00 ? 58  LEU A HA   6  
ATOM 10268 H HB2  . LEU A 1 58  ? -1.722  -23.831 4.333   1.00 0.00 ? 58  LEU A HB2  6  
ATOM 10269 H HB3  . LEU A 1 58  ? -2.051  -22.331 5.197   1.00 0.00 ? 58  LEU A HB3  6  
ATOM 10270 H HG   . LEU A 1 58  ? -2.362  -24.430 6.531   1.00 0.00 ? 58  LEU A HG   6  
ATOM 10271 H HD11 . LEU A 1 58  ? -3.439  -22.234 7.049   1.00 0.00 ? 58  LEU A HD11 6  
ATOM 10272 H HD12 . LEU A 1 58  ? -4.306  -23.643 7.658   1.00 0.00 ? 58  LEU A HD12 6  
ATOM 10273 H HD13 . LEU A 1 58  ? -4.880  -22.811 6.213   1.00 0.00 ? 58  LEU A HD13 6  
ATOM 10274 H HD21 . LEU A 1 58  ? -3.458  -25.587 4.490   1.00 0.00 ? 58  LEU A HD21 6  
ATOM 10275 H HD22 . LEU A 1 58  ? -4.935  -24.804 5.050   1.00 0.00 ? 58  LEU A HD22 6  
ATOM 10276 H HD23 . LEU A 1 58  ? -4.077  -25.927 6.106   1.00 0.00 ? 58  LEU A HD23 6  
ATOM 10277 N N    . GLN A 1 59  ? -3.773  -20.476 4.343   1.00 0.00 ? 59  GLN A N    6  
ATOM 10278 C CA   . GLN A 1 59  ? -4.537  -19.327 4.814   1.00 0.00 ? 59  GLN A CA   6  
ATOM 10279 C C    . GLN A 1 59  ? -5.266  -18.648 3.660   1.00 0.00 ? 59  GLN A C    6  
ATOM 10280 O O    . GLN A 1 59  ? -5.726  -17.513 3.785   1.00 0.00 ? 59  GLN A O    6  
ATOM 10281 C CB   . GLN A 1 59  ? -3.614  -18.325 5.510   1.00 0.00 ? 59  GLN A CB   6  
ATOM 10282 C CG   . GLN A 1 59  ? -3.304  -18.685 6.954   1.00 0.00 ? 59  GLN A CG   6  
ATOM 10283 C CD   . GLN A 1 59  ? -2.089  -17.954 7.490   1.00 0.00 ? 59  GLN A CD   6  
ATOM 10284 O OE1  . GLN A 1 59  ? -2.052  -16.723 7.514   1.00 0.00 ? 59  GLN A OE1  6  
ATOM 10285 N NE2  . GLN A 1 59  ? -1.087  -18.709 7.923   1.00 0.00 ? 59  GLN A NE2  6  
ATOM 10286 H H    . GLN A 1 59  ? -2.814  -20.375 4.172   1.00 0.00 ? 59  GLN A H    6  
ATOM 10287 H HA   . GLN A 1 59  ? -5.267  -19.684 5.524   1.00 0.00 ? 59  GLN A HA   6  
ATOM 10288 H HB2  . GLN A 1 59  ? -2.683  -18.273 4.966   1.00 0.00 ? 59  GLN A HB2  6  
ATOM 10289 H HB3  . GLN A 1 59  ? -4.084  -17.353 5.498   1.00 0.00 ? 59  GLN A HB3  6  
ATOM 10290 H HG2  . GLN A 1 59  ? -4.157  -18.431 7.566   1.00 0.00 ? 59  GLN A HG2  6  
ATOM 10291 H HG3  . GLN A 1 59  ? -3.122  -19.748 7.015   1.00 0.00 ? 59  GLN A HG3  6  
ATOM 10292 H HE21 . GLN A 1 59  ? -1.186  -19.683 7.872   1.00 0.00 ? 59  GLN A HE21 6  
ATOM 10293 H HE22 . GLN A 1 59  ? -0.289  -18.262 8.274   1.00 0.00 ? 59  GLN A HE22 6  
ATOM 10294 N N    . ALA A 1 60  ? -5.369  -19.350 2.536   1.00 0.00 ? 60  ALA A N    6  
ATOM 10295 C CA   . ALA A 1 60  ? -6.043  -18.816 1.360   1.00 0.00 ? 60  ALA A CA   6  
ATOM 10296 C C    . ALA A 1 60  ? -7.510  -18.519 1.655   1.00 0.00 ? 60  ALA A C    6  
ATOM 10297 O O    . ALA A 1 60  ? -8.158  -19.237 2.418   1.00 0.00 ? 60  ALA A O    6  
ATOM 10298 C CB   . ALA A 1 60  ? -5.924  -19.787 0.195   1.00 0.00 ? 60  ALA A CB   6  
ATOM 10299 H H    . ALA A 1 60  ? -4.982  -20.250 2.498   1.00 0.00 ? 60  ALA A H    6  
ATOM 10300 H HA   . ALA A 1 60  ? -5.550  -17.896 1.081   1.00 0.00 ? 60  ALA A HA   6  
ATOM 10301 H HB1  . ALA A 1 60  ? -4.883  -20.029 0.035   1.00 0.00 ? 60  ALA A HB1  6  
ATOM 10302 H HB2  . ALA A 1 60  ? -6.473  -20.689 0.421   1.00 0.00 ? 60  ALA A HB2  6  
ATOM 10303 H HB3  . ALA A 1 60  ? -6.329  -19.332 -0.696  1.00 0.00 ? 60  ALA A HB3  6  
ATOM 10304 N N    . THR A 1 61  ? -8.028  -17.457 1.048   1.00 0.00 ? 61  THR A N    6  
ATOM 10305 C CA   . THR A 1 61  ? -9.418  -17.064 1.248   1.00 0.00 ? 61  THR A CA   6  
ATOM 10306 C C    . THR A 1 61  ? -9.851  -17.292 2.691   1.00 0.00 ? 61  THR A C    6  
ATOM 10307 O O    . THR A 1 61  ? -11.020 -17.567 2.962   1.00 0.00 ? 61  THR A O    6  
ATOM 10308 C CB   . THR A 1 61  ? -10.361 -17.843 0.311   1.00 0.00 ? 61  THR A CB   6  
ATOM 10309 O OG1  . THR A 1 61  ? -11.674 -17.273 0.355   1.00 0.00 ? 61  THR A OG1  6  
ATOM 10310 C CG2  . THR A 1 61  ? -10.426 -19.310 0.706   1.00 0.00 ? 61  THR A CG2  6  
ATOM 10311 H H    . THR A 1 61  ? -7.461  -16.924 0.452   1.00 0.00 ? 61  THR A H    6  
ATOM 10312 H HA   . THR A 1 61  ? -9.504  -16.012 1.018   1.00 0.00 ? 61  THR A HA   6  
ATOM 10313 H HB   . THR A 1 61  ? -9.980  -17.773 -0.698  1.00 0.00 ? 61  THR A HB   6  
ATOM 10314 H HG1  . THR A 1 61  ? -12.312 -17.955 0.583   1.00 0.00 ? 61  THR A HG1  6  
ATOM 10315 H HG21 . THR A 1 61  ? -10.835 -19.398 1.702   1.00 0.00 ? 61  THR A HG21 6  
ATOM 10316 H HG22 . THR A 1 61  ? -9.433  -19.732 0.686   1.00 0.00 ? 61  THR A HG22 6  
ATOM 10317 H HG23 . THR A 1 61  ? -11.057 -19.842 0.010   1.00 0.00 ? 61  THR A HG23 6  
ATOM 10318 N N    . SER A 1 62  ? -8.903  -17.176 3.615   1.00 0.00 ? 62  SER A N    6  
ATOM 10319 C CA   . SER A 1 62  ? -9.186  -17.372 5.031   1.00 0.00 ? 62  SER A CA   6  
ATOM 10320 C C    . SER A 1 62  ? -9.469  -16.040 5.719   1.00 0.00 ? 62  SER A C    6  
ATOM 10321 O O    . SER A 1 62  ? -9.428  -14.983 5.089   1.00 0.00 ? 62  SER A O    6  
ATOM 10322 C CB   . SER A 1 62  ? -8.012  -18.073 5.716   1.00 0.00 ? 62  SER A CB   6  
ATOM 10323 O OG   . SER A 1 62  ? -8.403  -18.626 6.961   1.00 0.00 ? 62  SER A OG   6  
ATOM 10324 H H    . SER A 1 62  ? -7.989  -16.955 3.336   1.00 0.00 ? 62  SER A H    6  
ATOM 10325 H HA   . SER A 1 62  ? -10.063 -17.998 5.110   1.00 0.00 ? 62  SER A HA   6  
ATOM 10326 H HB2  . SER A 1 62  ? -7.650  -18.867 5.081   1.00 0.00 ? 62  SER A HB2  6  
ATOM 10327 H HB3  . SER A 1 62  ? -7.219  -17.358 5.886   1.00 0.00 ? 62  SER A HB3  6  
ATOM 10328 H HG   . SER A 1 62  ? -8.030  -18.103 7.675   1.00 0.00 ? 62  SER A HG   6  
ATOM 10329 N N    . SER A 1 63  ? -9.756  -16.099 7.015   1.00 0.00 ? 63  SER A N    6  
ATOM 10330 C CA   . SER A 1 63  ? -10.050 -14.898 7.789   1.00 0.00 ? 63  SER A CA   6  
ATOM 10331 C C    . SER A 1 63  ? -9.188  -13.728 7.324   1.00 0.00 ? 63  SER A C    6  
ATOM 10332 O O    . SER A 1 63  ? -7.965  -13.750 7.464   1.00 0.00 ? 63  SER A O    6  
ATOM 10333 C CB   . SER A 1 63  ? -9.818  -15.157 9.279   1.00 0.00 ? 63  SER A CB   6  
ATOM 10334 O OG   . SER A 1 63  ? -10.548 -16.289 9.719   1.00 0.00 ? 63  SER A OG   6  
ATOM 10335 H H    . SER A 1 63  ? -9.773  -16.972 7.461   1.00 0.00 ? 63  SER A H    6  
ATOM 10336 H HA   . SER A 1 63  ? -11.089 -14.649 7.632   1.00 0.00 ? 63  SER A HA   6  
ATOM 10337 H HB2  . SER A 1 63  ? -8.768  -15.331 9.452   1.00 0.00 ? 63  SER A HB2  6  
ATOM 10338 H HB3  . SER A 1 63  ? -10.139 -14.294 9.845   1.00 0.00 ? 63  SER A HB3  6  
ATOM 10339 H HG   . SER A 1 63  ? -9.989  -16.832 10.279  1.00 0.00 ? 63  SER A HG   6  
ATOM 10340 N N    . TRP A 1 64  ? -9.835  -12.709 6.770   1.00 0.00 ? 64  TRP A N    6  
ATOM 10341 C CA   . TRP A 1 64  ? -9.128  -11.529 6.284   1.00 0.00 ? 64  TRP A CA   6  
ATOM 10342 C C    . TRP A 1 64  ? -8.384  -10.834 7.419   1.00 0.00 ? 64  TRP A C    6  
ATOM 10343 O O    . TRP A 1 64  ? -8.543  -11.190 8.586   1.00 0.00 ? 64  TRP A O    6  
ATOM 10344 C CB   . TRP A 1 64  ? -10.110 -10.555 5.630   1.00 0.00 ? 64  TRP A CB   6  
ATOM 10345 C CG   . TRP A 1 64  ? -10.294 -10.794 4.162   1.00 0.00 ? 64  TRP A CG   6  
ATOM 10346 C CD1  . TRP A 1 64  ? -11.223 -11.603 3.574   1.00 0.00 ? 64  TRP A CD1  6  
ATOM 10347 C CD2  . TRP A 1 64  ? -9.528  -10.219 3.098   1.00 0.00 ? 64  TRP A CD2  6  
ATOM 10348 N NE1  . TRP A 1 64  ? -11.081 -11.566 2.208   1.00 0.00 ? 64  TRP A NE1  6  
ATOM 10349 C CE2  . TRP A 1 64  ? -10.049 -10.724 1.890   1.00 0.00 ? 64  TRP A CE2  6  
ATOM 10350 C CE3  . TRP A 1 64  ? -8.454  -9.326  3.047   1.00 0.00 ? 64  TRP A CE3  6  
ATOM 10351 C CZ2  . TRP A 1 64  ? -9.530  -10.365 0.649   1.00 0.00 ? 64  TRP A CZ2  6  
ATOM 10352 C CZ3  . TRP A 1 64  ? -7.941  -8.971  1.814   1.00 0.00 ? 64  TRP A CZ3  6  
ATOM 10353 C CH2  . TRP A 1 64  ? -8.479  -9.489  0.629   1.00 0.00 ? 64  TRP A CH2  6  
ATOM 10354 H H    . TRP A 1 64  ? -10.811 -12.750 6.687   1.00 0.00 ? 64  TRP A H    6  
ATOM 10355 H HA   . TRP A 1 64  ? -8.411  -11.854 5.545   1.00 0.00 ? 64  TRP A HA   6  
ATOM 10356 H HB2  . TRP A 1 64  ? -11.074 -10.650 6.107   1.00 0.00 ? 64  TRP A HB2  6  
ATOM 10357 H HB3  . TRP A 1 64  ? -9.745  -9.546  5.762   1.00 0.00 ? 64  TRP A HB3  6  
ATOM 10358 H HD1  . TRP A 1 64  ? -11.955 -12.182 4.116   1.00 0.00 ? 64  TRP A HD1  6  
ATOM 10359 H HE1  . TRP A 1 64  ? -11.632 -12.061 1.565   1.00 0.00 ? 64  TRP A HE1  6  
ATOM 10360 H HE3  . TRP A 1 64  ? -8.026  -8.916  3.950   1.00 0.00 ? 64  TRP A HE3  6  
ATOM 10361 H HZ2  . TRP A 1 64  ? -9.935  -10.755 -0.274  1.00 0.00 ? 64  TRP A HZ2  6  
ATOM 10362 H HZ3  . TRP A 1 64  ? -7.111  -8.282  1.755   1.00 0.00 ? 64  TRP A HZ3  6  
ATOM 10363 H HH2  . TRP A 1 64  ? -8.047  -9.184  -0.312  1.00 0.00 ? 64  TRP A HH2  6  
ATOM 10364 N N    . GLN A 1 65  ? -7.571  -9.843  7.068   1.00 0.00 ? 65  GLN A N    6  
ATOM 10365 C CA   . GLN A 1 65  ? -6.801  -9.100  8.059   1.00 0.00 ? 65  GLN A CA   6  
ATOM 10366 C C    . GLN A 1 65  ? -7.061  -7.602  7.938   1.00 0.00 ? 65  GLN A C    6  
ATOM 10367 O O    . GLN A 1 65  ? -7.711  -7.149  6.997   1.00 0.00 ? 65  GLN A O    6  
ATOM 10368 C CB   . GLN A 1 65  ? -5.308  -9.386  7.896   1.00 0.00 ? 65  GLN A CB   6  
ATOM 10369 C CG   . GLN A 1 65  ? -4.947  -10.853 8.067   1.00 0.00 ? 65  GLN A CG   6  
ATOM 10370 C CD   . GLN A 1 65  ? -3.488  -11.057 8.426   1.00 0.00 ? 65  GLN A CD   6  
ATOM 10371 O OE1  . GLN A 1 65  ? -3.081  -10.833 9.567   1.00 0.00 ? 65  GLN A OE1  6  
ATOM 10372 N NE2  . GLN A 1 65  ? -2.692  -11.483 7.453   1.00 0.00 ? 65  GLN A NE2  6  
ATOM 10373 H H    . GLN A 1 65  ? -7.486  -9.607  6.122   1.00 0.00 ? 65  GLN A H    6  
ATOM 10374 H HA   . GLN A 1 65  ? -7.116  -9.429  9.038   1.00 0.00 ? 65  GLN A HA   6  
ATOM 10375 H HB2  . GLN A 1 65  ? -4.999  -9.074  6.909   1.00 0.00 ? 65  GLN A HB2  6  
ATOM 10376 H HB3  . GLN A 1 65  ? -4.761  -8.815  8.632   1.00 0.00 ? 65  GLN A HB3  6  
ATOM 10377 H HG2  . GLN A 1 65  ? -5.557  -11.271 8.854   1.00 0.00 ? 65  GLN A HG2  6  
ATOM 10378 H HG3  . GLN A 1 65  ? -5.150  -11.370 7.141   1.00 0.00 ? 65  GLN A HG3  6  
ATOM 10379 H HE21 . GLN A 1 65  ? -3.086  -11.639 6.568   1.00 0.00 ? 65  GLN A HE21 6  
ATOM 10380 H HE22 . GLN A 1 65  ? -1.745  -11.623 7.657   1.00 0.00 ? 65  GLN A HE22 6  
ATOM 10381 N N    . ASN A 1 66  ? -6.547  -6.838  8.897   1.00 0.00 ? 66  ASN A N    6  
ATOM 10382 C CA   . ASN A 1 66  ? -6.725  -5.390  8.898   1.00 0.00 ? 66  ASN A CA   6  
ATOM 10383 C C    . ASN A 1 66  ? -5.595  -4.704  9.660   1.00 0.00 ? 66  ASN A C    6  
ATOM 10384 O O    . ASN A 1 66  ? -5.253  -5.101  10.775  1.00 0.00 ? 66  ASN A O    6  
ATOM 10385 C CB   . ASN A 1 66  ? -8.073  -5.021  9.520   1.00 0.00 ? 66  ASN A CB   6  
ATOM 10386 C CG   . ASN A 1 66  ? -8.419  -5.895  10.710  1.00 0.00 ? 66  ASN A CG   6  
ATOM 10387 O OD1  . ASN A 1 66  ? -8.063  -5.584  11.847  1.00 0.00 ? 66  ASN A OD1  6  
ATOM 10388 N ND2  . ASN A 1 66  ? -9.117  -6.995  10.453  1.00 0.00 ? 66  ASN A ND2  6  
ATOM 10389 H H    . ASN A 1 66  ? -6.038  -7.257  9.621   1.00 0.00 ? 66  ASN A H    6  
ATOM 10390 H HA   . ASN A 1 66  ? -6.707  -5.054  7.872   1.00 0.00 ? 66  ASN A HA   6  
ATOM 10391 H HB2  . ASN A 1 66  ? -8.040  -3.993  9.850   1.00 0.00 ? 66  ASN A HB2  6  
ATOM 10392 H HB3  . ASN A 1 66  ? -8.848  -5.131  8.777   1.00 0.00 ? 66  ASN A HB3  6  
ATOM 10393 H HD21 . ASN A 1 66  ? -9.365  -7.179  9.523   1.00 0.00 ? 66  ASN A HD21 6  
ATOM 10394 H HD22 . ASN A 1 66  ? -9.355  -7.578  11.204  1.00 0.00 ? 66  ASN A HD22 6  
ATOM 10395 N N    . LEU A 1 67  ? -5.019  -3.673  9.052   1.00 0.00 ? 67  LEU A N    6  
ATOM 10396 C CA   . LEU A 1 67  ? -3.928  -2.930  9.673   1.00 0.00 ? 67  LEU A CA   6  
ATOM 10397 C C    . LEU A 1 67  ? -4.341  -1.489  9.954   1.00 0.00 ? 67  LEU A C    6  
ATOM 10398 O O    . LEU A 1 67  ? -4.234  -0.622  9.086   1.00 0.00 ? 67  LEU A O    6  
ATOM 10399 C CB   . LEU A 1 67  ? -2.692  -2.953  8.772   1.00 0.00 ? 67  LEU A CB   6  
ATOM 10400 C CG   . LEU A 1 67  ? -1.442  -2.273  9.331   1.00 0.00 ? 67  LEU A CG   6  
ATOM 10401 C CD1  . LEU A 1 67  ? -0.695  -3.214  10.264  1.00 0.00 ? 67  LEU A CD1  6  
ATOM 10402 C CD2  . LEU A 1 67  ? -0.535  -1.810  8.199   1.00 0.00 ? 67  LEU A CD2  6  
ATOM 10403 H H    . LEU A 1 67  ? -5.335  -3.404  8.164   1.00 0.00 ? 67  LEU A H    6  
ATOM 10404 H HA   . LEU A 1 67  ? -3.690  -3.413  10.609  1.00 0.00 ? 67  LEU A HA   6  
ATOM 10405 H HB2  . LEU A 1 67  ? -2.447  -3.984  8.573   1.00 0.00 ? 67  LEU A HB2  6  
ATOM 10406 H HB3  . LEU A 1 67  ? -2.951  -2.461  7.845   1.00 0.00 ? 67  LEU A HB3  6  
ATOM 10407 H HG   . LEU A 1 67  ? -1.737  -1.403  9.901   1.00 0.00 ? 67  LEU A HG   6  
ATOM 10408 H HD11 . LEU A 1 67  ? -0.483  -4.138  9.748   1.00 0.00 ? 67  LEU A HD11 6  
ATOM 10409 H HD12 . LEU A 1 67  ? -1.303  -3.417  11.132  1.00 0.00 ? 67  LEU A HD12 6  
ATOM 10410 H HD13 . LEU A 1 67  ? 0.232   -2.752  10.573  1.00 0.00 ? 67  LEU A HD13 6  
ATOM 10411 H HD21 . LEU A 1 67  ? -0.847  -0.831  7.867   1.00 0.00 ? 67  LEU A HD21 6  
ATOM 10412 H HD22 . LEU A 1 67  ? -0.602  -2.507  7.377   1.00 0.00 ? 67  LEU A HD22 6  
ATOM 10413 H HD23 . LEU A 1 67  ? 0.484   -1.764  8.551   1.00 0.00 ? 67  LEU A HD23 6  
ATOM 10414 N N    . ASP A 1 68  ? -4.810  -1.240  11.171  1.00 0.00 ? 68  ASP A N    6  
ATOM 10415 C CA   . ASP A 1 68  ? -5.236  0.097   11.568  1.00 0.00 ? 68  ASP A CA   6  
ATOM 10416 C C    . ASP A 1 68  ? -4.055  1.063   11.575  1.00 0.00 ? 68  ASP A C    6  
ATOM 10417 O O    . ASP A 1 68  ? -3.092  0.877   12.318  1.00 0.00 ? 68  ASP A O    6  
ATOM 10418 C CB   . ASP A 1 68  ? -5.887  0.058   12.952  1.00 0.00 ? 68  ASP A CB   6  
ATOM 10419 C CG   . ASP A 1 68  ? -5.254  -0.976  13.861  1.00 0.00 ? 68  ASP A CG   6  
ATOM 10420 O OD1  . ASP A 1 68  ? -4.035  -0.878  14.113  1.00 0.00 ? 68  ASP A OD1  6  
ATOM 10421 O OD2  . ASP A 1 68  ? -5.978  -1.883  14.321  1.00 0.00 ? 68  ASP A OD2  6  
ATOM 10422 H H    . ASP A 1 68  ? -4.871  -1.973  11.819  1.00 0.00 ? 68  ASP A H    6  
ATOM 10423 H HA   . ASP A 1 68  ? -5.962  0.441   10.848  1.00 0.00 ? 68  ASP A HA   6  
ATOM 10424 H HB2  . ASP A 1 68  ? -5.787  1.028   13.417  1.00 0.00 ? 68  ASP A HB2  6  
ATOM 10425 H HB3  . ASP A 1 68  ? -6.935  -0.177  12.842  1.00 0.00 ? 68  ASP A HB3  6  
ATOM 10426 N N    . ALA A 1 69  ? -4.137  2.095   10.741  1.00 0.00 ? 69  ALA A N    6  
ATOM 10427 C CA   . ALA A 1 69  ? -3.077  3.091   10.652  1.00 0.00 ? 69  ALA A CA   6  
ATOM 10428 C C    . ALA A 1 69  ? -3.186  4.112   11.779  1.00 0.00 ? 69  ALA A C    6  
ATOM 10429 O O    . ALA A 1 69  ? -2.177  4.594   12.295  1.00 0.00 ? 69  ALA A O    6  
ATOM 10430 C CB   . ALA A 1 69  ? -3.119  3.788   9.300   1.00 0.00 ? 69  ALA A CB   6  
ATOM 10431 H H    . ALA A 1 69  ? -4.931  2.189   10.174  1.00 0.00 ? 69  ALA A H    6  
ATOM 10432 H HA   . ALA A 1 69  ? -2.129  2.578   10.735  1.00 0.00 ? 69  ALA A HA   6  
ATOM 10433 H HB1  . ALA A 1 69  ? -2.374  4.570   9.275   1.00 0.00 ? 69  ALA A HB1  6  
ATOM 10434 H HB2  . ALA A 1 69  ? -2.915  3.070   8.519   1.00 0.00 ? 69  ALA A HB2  6  
ATOM 10435 H HB3  . ALA A 1 69  ? -4.098  4.218   9.148   1.00 0.00 ? 69  ALA A HB3  6  
ATOM 10436 N N    . LYS A 1 70  ? -4.417  4.440   12.157  1.00 0.00 ? 70  LYS A N    6  
ATOM 10437 C CA   . LYS A 1 70  ? -4.660  5.404   13.223  1.00 0.00 ? 70  LYS A CA   6  
ATOM 10438 C C    . LYS A 1 70  ? -4.123  6.781   12.845  1.00 0.00 ? 70  LYS A C    6  
ATOM 10439 O O    . LYS A 1 70  ? -3.747  7.571   13.711  1.00 0.00 ? 70  LYS A O    6  
ATOM 10440 C CB   . LYS A 1 70  ? -4.008  4.931   14.525  1.00 0.00 ? 70  LYS A CB   6  
ATOM 10441 C CG   . LYS A 1 70  ? -4.557  3.610   15.035  1.00 0.00 ? 70  LYS A CG   6  
ATOM 10442 C CD   . LYS A 1 70  ? -3.882  3.188   16.329  1.00 0.00 ? 70  LYS A CD   6  
ATOM 10443 C CE   . LYS A 1 70  ? -2.574  2.458   16.064  1.00 0.00 ? 70  LYS A CE   6  
ATOM 10444 N NZ   . LYS A 1 70  ? -2.780  0.992   15.900  1.00 0.00 ? 70  LYS A NZ   6  
ATOM 10445 H H    . LYS A 1 70  ? -5.182  4.022   11.707  1.00 0.00 ? 70  LYS A H    6  
ATOM 10446 H HA   . LYS A 1 70  ? -5.727  5.475   13.370  1.00 0.00 ? 70  LYS A HA   6  
ATOM 10447 H HB2  . LYS A 1 70  ? -2.947  4.816   14.360  1.00 0.00 ? 70  LYS A HB2  6  
ATOM 10448 H HB3  . LYS A 1 70  ? -4.167  5.681   15.286  1.00 0.00 ? 70  LYS A HB3  6  
ATOM 10449 H HG2  . LYS A 1 70  ? -5.617  3.715   15.212  1.00 0.00 ? 70  LYS A HG2  6  
ATOM 10450 H HG3  . LYS A 1 70  ? -4.389  2.848   14.287  1.00 0.00 ? 70  LYS A HG3  6  
ATOM 10451 H HD2  . LYS A 1 70  ? -3.677  4.067   16.921  1.00 0.00 ? 70  LYS A HD2  6  
ATOM 10452 H HD3  . LYS A 1 70  ? -4.546  2.532   16.874  1.00 0.00 ? 70  LYS A HD3  6  
ATOM 10453 H HE2  . LYS A 1 70  ? -2.133  2.854   15.162  1.00 0.00 ? 70  LYS A HE2  6  
ATOM 10454 H HE3  . LYS A 1 70  ? -1.907  2.629   16.896  1.00 0.00 ? 70  LYS A HE3  6  
ATOM 10455 H HZ1  . LYS A 1 70  ? -3.743  0.732   16.196  1.00 0.00 ? 70  LYS A HZ1  6  
ATOM 10456 H HZ2  . LYS A 1 70  ? -2.098  0.468   16.484  1.00 0.00 ? 70  LYS A HZ2  6  
ATOM 10457 H HZ3  . LYS A 1 70  ? -2.649  0.722   14.905  1.00 0.00 ? 70  LYS A HZ3  6  
ATOM 10458 N N    . VAL A 1 71  ? -4.092  7.062   11.546  1.00 0.00 ? 71  VAL A N    6  
ATOM 10459 C CA   . VAL A 1 71  ? -3.604  8.345   11.053  1.00 0.00 ? 71  VAL A CA   6  
ATOM 10460 C C    . VAL A 1 71  ? -4.233  8.692   9.709   1.00 0.00 ? 71  VAL A C    6  
ATOM 10461 O O    . VAL A 1 71  ? -3.918  8.100   8.676   1.00 0.00 ? 71  VAL A O    6  
ATOM 10462 C CB   . VAL A 1 71  ? -2.071  8.343   10.906  1.00 0.00 ? 71  VAL A CB   6  
ATOM 10463 C CG1  . VAL A 1 71  ? -1.579  9.699   10.424  1.00 0.00 ? 71  VAL A CG1  6  
ATOM 10464 C CG2  . VAL A 1 71  ? -1.410  7.963   12.222  1.00 0.00 ? 71  VAL A CG2  6  
ATOM 10465 H H    . VAL A 1 71  ? -4.406  6.392   10.904  1.00 0.00 ? 71  VAL A H    6  
ATOM 10466 H HA   . VAL A 1 71  ? -3.875  9.104   11.773  1.00 0.00 ? 71  VAL A HA   6  
ATOM 10467 H HB   . VAL A 1 71  ? -1.802  7.603   10.165  1.00 0.00 ? 71  VAL A HB   6  
ATOM 10468 H HG11 . VAL A 1 71  ? -2.029  10.478  11.023  1.00 0.00 ? 71  VAL A HG11 6  
ATOM 10469 H HG12 . VAL A 1 71  ? -0.504  9.746   10.518  1.00 0.00 ? 71  VAL A HG12 6  
ATOM 10470 H HG13 . VAL A 1 71  ? -1.857  9.836   9.389   1.00 0.00 ? 71  VAL A HG13 6  
ATOM 10471 H HG21 . VAL A 1 71  ? -1.645  8.706   12.969  1.00 0.00 ? 71  VAL A HG21 6  
ATOM 10472 H HG22 . VAL A 1 71  ? -1.777  7.000   12.545  1.00 0.00 ? 71  VAL A HG22 6  
ATOM 10473 H HG23 . VAL A 1 71  ? -0.340  7.913   12.087  1.00 0.00 ? 71  VAL A HG23 6  
ATOM 10474 N N    . PRO A 1 72  ? -5.144  9.676   9.718   1.00 0.00 ? 72  PRO A N    6  
ATOM 10475 C CA   . PRO A 1 72  ? -5.836  10.126  8.507   1.00 0.00 ? 72  PRO A CA   6  
ATOM 10476 C C    . PRO A 1 72  ? -4.907  10.863  7.548   1.00 0.00 ? 72  PRO A C    6  
ATOM 10477 O O    . PRO A 1 72  ? -5.297  11.210  6.432   1.00 0.00 ? 72  PRO A O    6  
ATOM 10478 C CB   . PRO A 1 72  ? -6.912  11.074  9.044   1.00 0.00 ? 72  PRO A CB   6  
ATOM 10479 C CG   . PRO A 1 72  ? -6.371  11.564  10.342  1.00 0.00 ? 72  PRO A CG   6  
ATOM 10480 C CD   . PRO A 1 72  ? -5.569  10.426  10.912  1.00 0.00 ? 72  PRO A CD   6  
ATOM 10481 H HA   . PRO A 1 72  ? -6.306  9.302   7.989   1.00 0.00 ? 72  PRO A HA   6  
ATOM 10482 H HB2  . PRO A 1 72  ? -7.060  11.886  8.345   1.00 0.00 ? 72  PRO A HB2  6  
ATOM 10483 H HB3  . PRO A 1 72  ? -7.837  10.535  9.180   1.00 0.00 ? 72  PRO A HB3  6  
ATOM 10484 H HG2  . PRO A 1 72  ? -5.738  12.422  10.177  1.00 0.00 ? 72  PRO A HG2  6  
ATOM 10485 H HG3  . PRO A 1 72  ? -7.184  11.818  11.006  1.00 0.00 ? 72  PRO A HG3  6  
ATOM 10486 H HD2  . PRO A 1 72  ? -4.715  10.801  11.456  1.00 0.00 ? 72  PRO A HD2  6  
ATOM 10487 H HD3  . PRO A 1 72  ? -6.186  9.813   11.552  1.00 0.00 ? 72  PRO A HD3  6  
ATOM 10488 N N    . THR A 1 73  ? -3.675  11.098  7.989   1.00 0.00 ? 73  THR A N    6  
ATOM 10489 C CA   . THR A 1 73  ? -2.691  11.794  7.170   1.00 0.00 ? 73  THR A CA   6  
ATOM 10490 C C    . THR A 1 73  ? -1.707  10.814  6.542   1.00 0.00 ? 73  THR A C    6  
ATOM 10491 O O    . THR A 1 73  ? -0.897  11.192  5.696   1.00 0.00 ? 73  THR A O    6  
ATOM 10492 C CB   . THR A 1 73  ? -1.907  12.833  7.995   1.00 0.00 ? 73  THR A CB   6  
ATOM 10493 O OG1  . THR A 1 73  ? -1.431  12.237  9.208   1.00 0.00 ? 73  THR A OG1  6  
ATOM 10494 C CG2  . THR A 1 73  ? -2.781  14.034  8.323   1.00 0.00 ? 73  THR A CG2  6  
ATOM 10495 H H    . THR A 1 73  ? -3.424  10.797  8.887   1.00 0.00 ? 73  THR A H    6  
ATOM 10496 H HA   . THR A 1 73  ? -3.218  12.314  6.384   1.00 0.00 ? 73  THR A HA   6  
ATOM 10497 H HB   . THR A 1 73  ? -1.062  13.169  7.413   1.00 0.00 ? 73  THR A HB   6  
ATOM 10498 H HG1  . THR A 1 73  ? -2.020  12.468  9.930   1.00 0.00 ? 73  THR A HG1  6  
ATOM 10499 H HG21 . THR A 1 73  ? -3.309  13.854  9.248   1.00 0.00 ? 73  THR A HG21 6  
ATOM 10500 H HG22 . THR A 1 73  ? -3.493  14.190  7.526   1.00 0.00 ? 73  THR A HG22 6  
ATOM 10501 H HG23 . THR A 1 73  ? -2.161  14.911  8.429   1.00 0.00 ? 73  THR A HG23 6  
ATOM 10502 N N    . GLU A 1 74  ? -1.783  9.555   6.961   1.00 0.00 ? 74  GLU A N    6  
ATOM 10503 C CA   . GLU A 1 74  ? -0.898  8.521   6.437   1.00 0.00 ? 74  GLU A CA   6  
ATOM 10504 C C    . GLU A 1 74  ? -1.571  7.750   5.306   1.00 0.00 ? 74  GLU A C    6  
ATOM 10505 O O    . GLU A 1 74  ? -2.464  6.935   5.541   1.00 0.00 ? 74  GLU A O    6  
ATOM 10506 C CB   . GLU A 1 74  ? -0.488  7.558   7.553   1.00 0.00 ? 74  GLU A CB   6  
ATOM 10507 C CG   . GLU A 1 74  ? 0.740   8.009   8.326   1.00 0.00 ? 74  GLU A CG   6  
ATOM 10508 C CD   . GLU A 1 74  ? 1.497   6.851   8.947   1.00 0.00 ? 74  GLU A CD   6  
ATOM 10509 O OE1  . GLU A 1 74  ? 0.847   5.971   9.549   1.00 0.00 ? 74  GLU A OE1  6  
ATOM 10510 O OE2  . GLU A 1 74  ? 2.740   6.824   8.830   1.00 0.00 ? 74  GLU A OE2  6  
ATOM 10511 H H    . GLU A 1 74  ? -2.450  9.316   7.638   1.00 0.00 ? 74  GLU A H    6  
ATOM 10512 H HA   . GLU A 1 74  ? -0.015  9.006   6.050   1.00 0.00 ? 74  GLU A HA   6  
ATOM 10513 H HB2  . GLU A 1 74  ? -1.309  7.459   8.247   1.00 0.00 ? 74  GLU A HB2  6  
ATOM 10514 H HB3  . GLU A 1 74  ? -0.278  6.592   7.118   1.00 0.00 ? 74  GLU A HB3  6  
ATOM 10515 H HG2  . GLU A 1 74  ? 1.402   8.531   7.652   1.00 0.00 ? 74  GLU A HG2  6  
ATOM 10516 H HG3  . GLU A 1 74  ? 0.428   8.679   9.113   1.00 0.00 ? 74  GLU A HG3  6  
ATOM 10517 N N    . ARG A 1 75  ? -1.138  8.014   4.078   1.00 0.00 ? 75  ARG A N    6  
ATOM 10518 C CA   . ARG A 1 75  ? -1.699  7.347   2.909   1.00 0.00 ? 75  ARG A CA   6  
ATOM 10519 C C    . ARG A 1 75  ? -0.804  6.197   2.457   1.00 0.00 ? 75  ARG A C    6  
ATOM 10520 O O    . ARG A 1 75  ? -0.648  5.951   1.261   1.00 0.00 ? 75  ARG A O    6  
ATOM 10521 C CB   . ARG A 1 75  ? -1.883  8.345   1.765   1.00 0.00 ? 75  ARG A CB   6  
ATOM 10522 C CG   . ARG A 1 75  ? -3.242  9.024   1.761   1.00 0.00 ? 75  ARG A CG   6  
ATOM 10523 C CD   . ARG A 1 75  ? -3.227  10.306  2.579   1.00 0.00 ? 75  ARG A CD   6  
ATOM 10524 N NE   . ARG A 1 75  ? -2.351  11.318  1.995   1.00 0.00 ? 75  ARG A NE   6  
ATOM 10525 C CZ   . ARG A 1 75  ? -2.145  12.513  2.537   1.00 0.00 ? 75  ARG A CZ   6  
ATOM 10526 N NH1  . ARG A 1 75  ? -2.749  12.843  3.670   1.00 0.00 ? 75  ARG A NH1  6  
ATOM 10527 N NH2  . ARG A 1 75  ? -1.333  13.380  1.945   1.00 0.00 ? 75  ARG A NH2  6  
ATOM 10528 H H    . ARG A 1 75  ? -0.424  8.674   3.954   1.00 0.00 ? 75  ARG A H    6  
ATOM 10529 H HA   . ARG A 1 75  ? -2.664  6.949   3.186   1.00 0.00 ? 75  ARG A HA   6  
ATOM 10530 H HB2  . ARG A 1 75  ? -1.123  9.109   1.844   1.00 0.00 ? 75  ARG A HB2  6  
ATOM 10531 H HB3  . ARG A 1 75  ? -1.762  7.824   0.827   1.00 0.00 ? 75  ARG A HB3  6  
ATOM 10532 H HG2  . ARG A 1 75  ? -3.512  9.263   0.743   1.00 0.00 ? 75  ARG A HG2  6  
ATOM 10533 H HG3  . ARG A 1 75  ? -3.973  8.348   2.180   1.00 0.00 ? 75  ARG A HG3  6  
ATOM 10534 H HD2  . ARG A 1 75  ? -4.232  10.698  2.628   1.00 0.00 ? 75  ARG A HD2  6  
ATOM 10535 H HD3  . ARG A 1 75  ? -2.882  10.076  3.576   1.00 0.00 ? 75  ARG A HD3  6  
ATOM 10536 H HE   . ARG A 1 75  ? -1.895  11.094  1.157   1.00 0.00 ? 75  ARG A HE   6  
ATOM 10537 H HH11 . ARG A 1 75  ? -3.360  12.192  4.118   1.00 0.00 ? 75  ARG A HH11 6  
ATOM 10538 H HH12 . ARG A 1 75  ? -2.591  13.744  4.077   1.00 0.00 ? 75  ARG A HH12 6  
ATOM 10539 H HH21 . ARG A 1 75  ? -0.876  13.134  1.091   1.00 0.00 ? 75  ARG A HH21 6  
ATOM 10540 H HH22 . ARG A 1 75  ? -1.179  14.279  2.354   1.00 0.00 ? 75  ARG A HH22 6  
ATOM 10541 N N    . SER A 1 76  ? -0.216  5.496   3.422   1.00 0.00 ? 76  SER A N    6  
ATOM 10542 C CA   . SER A 1 76  ? 0.667   4.375   3.124   1.00 0.00 ? 76  SER A CA   6  
ATOM 10543 C C    . SER A 1 76  ? 0.818   3.464   4.338   1.00 0.00 ? 76  SER A C    6  
ATOM 10544 O O    . SER A 1 76  ? 0.777   3.921   5.480   1.00 0.00 ? 76  SER A O    6  
ATOM 10545 C CB   . SER A 1 76  ? 2.040   4.885   2.681   1.00 0.00 ? 76  SER A CB   6  
ATOM 10546 O OG   . SER A 1 76  ? 1.917   5.881   1.681   1.00 0.00 ? 76  SER A OG   6  
ATOM 10547 H H    . SER A 1 76  ? -0.379  5.741   4.357   1.00 0.00 ? 76  SER A H    6  
ATOM 10548 H HA   . SER A 1 76  ? 0.225   3.811   2.317   1.00 0.00 ? 76  SER A HA   6  
ATOM 10549 H HB2  . SER A 1 76  ? 2.556   5.306   3.530   1.00 0.00 ? 76  SER A HB2  6  
ATOM 10550 H HB3  . SER A 1 76  ? 2.615   4.061   2.283   1.00 0.00 ? 76  SER A HB3  6  
ATOM 10551 H HG   . SER A 1 76  ? 2.642   6.505   1.759   1.00 0.00 ? 76  SER A HG   6  
ATOM 10552 N N    . ALA A 1 77  ? 0.992   2.172   4.082   1.00 0.00 ? 77  ALA A N    6  
ATOM 10553 C CA   . ALA A 1 77  ? 1.150   1.195   5.152   1.00 0.00 ? 77  ALA A CA   6  
ATOM 10554 C C    . ALA A 1 77  ? 2.039   0.037   4.711   1.00 0.00 ? 77  ALA A C    6  
ATOM 10555 O O    . ALA A 1 77  ? 2.172   -0.238  3.519   1.00 0.00 ? 77  ALA A O    6  
ATOM 10556 C CB   . ALA A 1 77  ? -0.209  0.679   5.602   1.00 0.00 ? 77  ALA A CB   6  
ATOM 10557 H H    . ALA A 1 77  ? 1.015   1.868   3.150   1.00 0.00 ? 77  ALA A H    6  
ATOM 10558 H HA   . ALA A 1 77  ? 1.615   1.693   5.992   1.00 0.00 ? 77  ALA A HA   6  
ATOM 10559 H HB1  . ALA A 1 77  ? -0.200  -0.401  5.605   1.00 0.00 ? 77  ALA A HB1  6  
ATOM 10560 H HB2  . ALA A 1 77  ? -0.420  1.041   6.597   1.00 0.00 ? 77  ALA A HB2  6  
ATOM 10561 H HB3  . ALA A 1 77  ? -0.970  1.031   4.922   1.00 0.00 ? 77  ALA A HB3  6  
ATOM 10562 N N    . VAL A 1 78  ? 2.645   -0.641  5.681   1.00 0.00 ? 78  VAL A N    6  
ATOM 10563 C CA   . VAL A 1 78  ? 3.520   -1.770  5.393   1.00 0.00 ? 78  VAL A CA   6  
ATOM 10564 C C    . VAL A 1 78  ? 3.021   -3.040  6.073   1.00 0.00 ? 78  VAL A C    6  
ATOM 10565 O O    . VAL A 1 78  ? 2.766   -3.053  7.278   1.00 0.00 ? 78  VAL A O    6  
ATOM 10566 C CB   . VAL A 1 78  ? 4.965   -1.491  5.848   1.00 0.00 ? 78  VAL A CB   6  
ATOM 10567 C CG1  . VAL A 1 78  ? 5.856   -2.691  5.565   1.00 0.00 ? 78  VAL A CG1  6  
ATOM 10568 C CG2  . VAL A 1 78  ? 5.506   -0.243  5.168   1.00 0.00 ? 78  VAL A CG2  6  
ATOM 10569 H H    . VAL A 1 78  ? 2.499   -0.375  6.613   1.00 0.00 ? 78  VAL A H    6  
ATOM 10570 H HA   . VAL A 1 78  ? 3.526   -1.924  4.324   1.00 0.00 ? 78  VAL A HA   6  
ATOM 10571 H HB   . VAL A 1 78  ? 4.958   -1.320  6.915   1.00 0.00 ? 78  VAL A HB   6  
ATOM 10572 H HG11 . VAL A 1 78  ? 6.671   -2.709  6.273   1.00 0.00 ? 78  VAL A HG11 6  
ATOM 10573 H HG12 . VAL A 1 78  ? 5.278   -3.599  5.657   1.00 0.00 ? 78  VAL A HG12 6  
ATOM 10574 H HG13 . VAL A 1 78  ? 6.252   -2.616  4.563   1.00 0.00 ? 78  VAL A HG13 6  
ATOM 10575 H HG21 . VAL A 1 78  ? 4.724   0.212   4.578   1.00 0.00 ? 78  VAL A HG21 6  
ATOM 10576 H HG22 . VAL A 1 78  ? 5.845   0.458   5.917   1.00 0.00 ? 78  VAL A HG22 6  
ATOM 10577 H HG23 . VAL A 1 78  ? 6.332   -0.511  4.526   1.00 0.00 ? 78  VAL A HG23 6  
ATOM 10578 N N    . LEU A 1 79  ? 2.884   -4.107  5.294   1.00 0.00 ? 79  LEU A N    6  
ATOM 10579 C CA   . LEU A 1 79  ? 2.416   -5.384  5.821   1.00 0.00 ? 79  LEU A CA   6  
ATOM 10580 C C    . LEU A 1 79  ? 3.581   -6.344  6.039   1.00 0.00 ? 79  LEU A C    6  
ATOM 10581 O O    . LEU A 1 79  ? 4.233   -6.773  5.086   1.00 0.00 ? 79  LEU A O    6  
ATOM 10582 C CB   . LEU A 1 79  ? 1.397   -6.009  4.867   1.00 0.00 ? 79  LEU A CB   6  
ATOM 10583 C CG   . LEU A 1 79  ? 0.240   -5.108  4.436   1.00 0.00 ? 79  LEU A CG   6  
ATOM 10584 C CD1  . LEU A 1 79  ? -0.448  -5.674  3.203   1.00 0.00 ? 79  LEU A CD1  6  
ATOM 10585 C CD2  . LEU A 1 79  ? -0.756  -4.937  5.574   1.00 0.00 ? 79  LEU A CD2  6  
ATOM 10586 H H    . LEU A 1 79  ? 3.103   -4.036  4.342   1.00 0.00 ? 79  LEU A H    6  
ATOM 10587 H HA   . LEU A 1 79  ? 1.939   -5.195  6.771   1.00 0.00 ? 79  LEU A HA   6  
ATOM 10588 H HB2  . LEU A 1 79  ? 1.924   -6.319  3.977   1.00 0.00 ? 79  LEU A HB2  6  
ATOM 10589 H HB3  . LEU A 1 79  ? 0.977   -6.878  5.355   1.00 0.00 ? 79  LEU A HB3  6  
ATOM 10590 H HG   . LEU A 1 79  ? 0.628   -4.131  4.181   1.00 0.00 ? 79  LEU A HG   6  
ATOM 10591 H HD11 . LEU A 1 79  ? -0.814  -4.864  2.591   1.00 0.00 ? 79  LEU A HD11 6  
ATOM 10592 H HD12 . LEU A 1 79  ? -1.275  -6.298  3.508   1.00 0.00 ? 79  LEU A HD12 6  
ATOM 10593 H HD13 . LEU A 1 79  ? 0.257   -6.264  2.637   1.00 0.00 ? 79  LEU A HD13 6  
ATOM 10594 H HD21 . LEU A 1 79  ? -0.717  -3.921  5.936   1.00 0.00 ? 79  LEU A HD21 6  
ATOM 10595 H HD22 . LEU A 1 79  ? -0.505  -5.616  6.376   1.00 0.00 ? 79  LEU A HD22 6  
ATOM 10596 H HD23 . LEU A 1 79  ? -1.751  -5.154  5.216   1.00 0.00 ? 79  LEU A HD23 6  
ATOM 10597 N N    . VAL A 1 80  ? 3.838   -6.679  7.299   1.00 0.00 ? 80  VAL A N    6  
ATOM 10598 C CA   . VAL A 1 80  ? 4.923   -7.591  7.642   1.00 0.00 ? 80  VAL A CA   6  
ATOM 10599 C C    . VAL A 1 80  ? 4.389   -8.980  7.973   1.00 0.00 ? 80  VAL A C    6  
ATOM 10600 O O    . VAL A 1 80  ? 3.179   -9.192  8.037   1.00 0.00 ? 80  VAL A O    6  
ATOM 10601 C CB   . VAL A 1 80  ? 5.738   -7.068  8.839   1.00 0.00 ? 80  VAL A CB   6  
ATOM 10602 C CG1  . VAL A 1 80  ? 6.505   -5.811  8.455   1.00 0.00 ? 80  VAL A CG1  6  
ATOM 10603 C CG2  . VAL A 1 80  ? 4.828   -6.804  10.029  1.00 0.00 ? 80  VAL A CG2  6  
ATOM 10604 H H    . VAL A 1 80  ? 3.284   -6.305  8.016   1.00 0.00 ? 80  VAL A H    6  
ATOM 10605 H HA   . VAL A 1 80  ? 5.581   -7.663  6.789   1.00 0.00 ? 80  VAL A HA   6  
ATOM 10606 H HB   . VAL A 1 80  ? 6.453   -7.827  9.121   1.00 0.00 ? 80  VAL A HB   6  
ATOM 10607 H HG11 . VAL A 1 80  ? 7.031   -5.981  7.527   1.00 0.00 ? 80  VAL A HG11 6  
ATOM 10608 H HG12 . VAL A 1 80  ? 5.813   -4.990  8.334   1.00 0.00 ? 80  VAL A HG12 6  
ATOM 10609 H HG13 . VAL A 1 80  ? 7.216   -5.572  9.233   1.00 0.00 ? 80  VAL A HG13 6  
ATOM 10610 H HG21 . VAL A 1 80  ? 5.428   -6.662  10.916  1.00 0.00 ? 80  VAL A HG21 6  
ATOM 10611 H HG22 . VAL A 1 80  ? 4.242   -5.915  9.845   1.00 0.00 ? 80  VAL A HG22 6  
ATOM 10612 H HG23 . VAL A 1 80  ? 4.168   -7.646  10.172  1.00 0.00 ? 80  VAL A HG23 6  
ATOM 10613 N N    . ASN A 1 81  ? 5.301   -9.924  8.184   1.00 0.00 ? 81  ASN A N    6  
ATOM 10614 C CA   . ASN A 1 81  ? 4.922   -11.294 8.509   1.00 0.00 ? 81  ASN A CA   6  
ATOM 10615 C C    . ASN A 1 81  ? 4.087   -11.907 7.389   1.00 0.00 ? 81  ASN A C    6  
ATOM 10616 O O    . ASN A 1 81  ? 3.025   -12.481 7.634   1.00 0.00 ? 81  ASN A O    6  
ATOM 10617 C CB   . ASN A 1 81  ? 4.139   -11.331 9.823   1.00 0.00 ? 81  ASN A CB   6  
ATOM 10618 C CG   . ASN A 1 81  ? 5.047   -11.395 11.035  1.00 0.00 ? 81  ASN A CG   6  
ATOM 10619 O OD1  . ASN A 1 81  ? 5.477   -12.474 11.446  1.00 0.00 ? 81  ASN A OD1  6  
ATOM 10620 N ND2  . ASN A 1 81  ? 5.343   -10.238 11.615  1.00 0.00 ? 81  ASN A ND2  6  
ATOM 10621 H H    . ASN A 1 81  ? 6.251   -9.694  8.119   1.00 0.00 ? 81  ASN A H    6  
ATOM 10622 H HA   . ASN A 1 81  ? 5.828   -11.870 8.624   1.00 0.00 ? 81  ASN A HA   6  
ATOM 10623 H HB2  . ASN A 1 81  ? 3.532   -10.440 9.898   1.00 0.00 ? 81  ASN A HB2  6  
ATOM 10624 H HB3  . ASN A 1 81  ? 3.497   -12.199 9.829   1.00 0.00 ? 81  ASN A HB3  6  
ATOM 10625 H HD21 . ASN A 1 81  ? 4.964   -9.419  11.234  1.00 0.00 ? 81  ASN A HD21 6  
ATOM 10626 H HD22 . ASN A 1 81  ? 5.928   -10.251 12.401  1.00 0.00 ? 81  ASN A HD22 6  
ATOM 10627 N N    . LEU A 1 82  ? 4.574   -11.783 6.159   1.00 0.00 ? 82  LEU A N    6  
ATOM 10628 C CA   . LEU A 1 82  ? 3.874   -12.326 5.000   1.00 0.00 ? 82  LEU A CA   6  
ATOM 10629 C C    . LEU A 1 82  ? 4.561   -13.589 4.491   1.00 0.00 ? 82  LEU A C    6  
ATOM 10630 O O    . LEU A 1 82  ? 5.705   -13.873 4.846   1.00 0.00 ? 82  LEU A O    6  
ATOM 10631 C CB   . LEU A 1 82  ? 3.808   -11.282 3.884   1.00 0.00 ? 82  LEU A CB   6  
ATOM 10632 C CG   . LEU A 1 82  ? 3.071   -9.985  4.221   1.00 0.00 ? 82  LEU A CG   6  
ATOM 10633 C CD1  . LEU A 1 82  ? 3.121   -9.022  3.045   1.00 0.00 ? 82  LEU A CD1  6  
ATOM 10634 C CD2  . LEU A 1 82  ? 1.629   -10.278 4.611   1.00 0.00 ? 82  LEU A CD2  6  
ATOM 10635 H H    . LEU A 1 82  ? 5.425   -11.316 6.026   1.00 0.00 ? 82  LEU A H    6  
ATOM 10636 H HA   . LEU A 1 82  ? 2.869   -12.576 5.308   1.00 0.00 ? 82  LEU A HA   6  
ATOM 10637 H HB2  . LEU A 1 82  ? 4.820   -11.025 3.612   1.00 0.00 ? 82  LEU A HB2  6  
ATOM 10638 H HB3  . LEU A 1 82  ? 3.313   -11.735 3.037   1.00 0.00 ? 82  LEU A HB3  6  
ATOM 10639 H HG   . LEU A 1 82  ? 3.556   -9.510  5.062   1.00 0.00 ? 82  LEU A HG   6  
ATOM 10640 H HD11 . LEU A 1 82  ? 2.766   -9.521  2.156   1.00 0.00 ? 82  LEU A HD11 6  
ATOM 10641 H HD12 . LEU A 1 82  ? 4.139   -8.694  2.892   1.00 0.00 ? 82  LEU A HD12 6  
ATOM 10642 H HD13 . LEU A 1 82  ? 2.495   -8.167  3.253   1.00 0.00 ? 82  LEU A HD13 6  
ATOM 10643 H HD21 . LEU A 1 82  ? 1.507   -10.125 5.673   1.00 0.00 ? 82  LEU A HD21 6  
ATOM 10644 H HD22 . LEU A 1 82  ? 1.390   -11.303 4.366   1.00 0.00 ? 82  LEU A HD22 6  
ATOM 10645 H HD23 . LEU A 1 82  ? 0.969   -9.614  4.073   1.00 0.00 ? 82  LEU A HD23 6  
ATOM 10646 N N    . LYS A 1 83  ? 3.856   -14.344 3.655   1.00 0.00 ? 83  LYS A N    6  
ATOM 10647 C CA   . LYS A 1 83  ? 4.398   -15.575 3.093   1.00 0.00 ? 83  LYS A CA   6  
ATOM 10648 C C    . LYS A 1 83  ? 5.159   -15.295 1.801   1.00 0.00 ? 83  LYS A C    6  
ATOM 10649 O O    . LYS A 1 83  ? 4.792   -14.406 1.032   1.00 0.00 ? 83  LYS A O    6  
ATOM 10650 C CB   . LYS A 1 83  ? 3.272   -16.577 2.827   1.00 0.00 ? 83  LYS A CB   6  
ATOM 10651 C CG   . LYS A 1 83  ? 2.881   -17.392 4.048   1.00 0.00 ? 83  LYS A CG   6  
ATOM 10652 C CD   . LYS A 1 83  ? 1.665   -18.260 3.773   1.00 0.00 ? 83  LYS A CD   6  
ATOM 10653 C CE   . LYS A 1 83  ? 2.015   -19.447 2.889   1.00 0.00 ? 83  LYS A CE   6  
ATOM 10654 N NZ   . LYS A 1 83  ? 2.697   -20.526 3.655   1.00 0.00 ? 83  LYS A NZ   6  
ATOM 10655 H H    . LYS A 1 83  ? 2.948   -14.065 3.409   1.00 0.00 ? 83  LYS A H    6  
ATOM 10656 H HA   . LYS A 1 83  ? 5.080   -15.997 3.815   1.00 0.00 ? 83  LYS A HA   6  
ATOM 10657 H HB2  . LYS A 1 83  ? 2.400   -16.039 2.485   1.00 0.00 ? 83  LYS A HB2  6  
ATOM 10658 H HB3  . LYS A 1 83  ? 3.590   -17.260 2.051   1.00 0.00 ? 83  LYS A HB3  6  
ATOM 10659 H HG2  . LYS A 1 83  ? 3.709   -18.028 4.325   1.00 0.00 ? 83  LYS A HG2  6  
ATOM 10660 H HG3  . LYS A 1 83  ? 2.655   -16.718 4.862   1.00 0.00 ? 83  LYS A HG3  6  
ATOM 10661 H HD2  . LYS A 1 83  ? 1.275   -18.626 4.711   1.00 0.00 ? 83  LYS A HD2  6  
ATOM 10662 H HD3  . LYS A 1 83  ? 0.912   -17.662 3.278   1.00 0.00 ? 83  LYS A HD3  6  
ATOM 10663 H HE2  . LYS A 1 83  ? 1.106   -19.841 2.461   1.00 0.00 ? 83  LYS A HE2  6  
ATOM 10664 H HE3  . LYS A 1 83  ? 2.668   -19.109 2.098   1.00 0.00 ? 83  LYS A HE3  6  
ATOM 10665 H HZ1  . LYS A 1 83  ? 3.414   -20.116 4.288   1.00 0.00 ? 83  LYS A HZ1  6  
ATOM 10666 H HZ2  . LYS A 1 83  ? 3.166   -21.186 3.002   1.00 0.00 ? 83  LYS A HZ2  6  
ATOM 10667 H HZ3  . LYS A 1 83  ? 2.006   -21.052 4.226   1.00 0.00 ? 83  LYS A HZ3  6  
ATOM 10668 N N    . LYS A 1 84  ? 6.221   -16.059 1.568   1.00 0.00 ? 84  LYS A N    6  
ATOM 10669 C CA   . LYS A 1 84  ? 7.033   -15.895 0.368   1.00 0.00 ? 84  LYS A CA   6  
ATOM 10670 C C    . LYS A 1 84  ? 6.609   -16.882 -0.715  1.00 0.00 ? 84  LYS A C    6  
ATOM 10671 O O    . LYS A 1 84  ? 6.602   -18.092 -0.497  1.00 0.00 ? 84  LYS A O    6  
ATOM 10672 C CB   . LYS A 1 84  ? 8.514   -16.091 0.700   1.00 0.00 ? 84  LYS A CB   6  
ATOM 10673 C CG   . LYS A 1 84  ? 8.785   -17.290 1.592   1.00 0.00 ? 84  LYS A CG   6  
ATOM 10674 C CD   . LYS A 1 84  ? 8.743   -16.911 3.063   1.00 0.00 ? 84  LYS A CD   6  
ATOM 10675 C CE   . LYS A 1 84  ? 10.072  -16.336 3.528   1.00 0.00 ? 84  LYS A CE   6  
ATOM 10676 N NZ   . LYS A 1 84  ? 11.150  -17.364 3.530   1.00 0.00 ? 84  LYS A NZ   6  
ATOM 10677 H H    . LYS A 1 84  ? 6.464   -16.751 2.219   1.00 0.00 ? 84  LYS A H    6  
ATOM 10678 H HA   . LYS A 1 84  ? 6.885   -14.891 0.002   1.00 0.00 ? 84  LYS A HA   6  
ATOM 10679 H HB2  . LYS A 1 84  ? 9.062   -16.223 -0.221  1.00 0.00 ? 84  LYS A HB2  6  
ATOM 10680 H HB3  . LYS A 1 84  ? 8.879   -15.206 1.201   1.00 0.00 ? 84  LYS A HB3  6  
ATOM 10681 H HG2  . LYS A 1 84  ? 8.034   -18.043 1.405   1.00 0.00 ? 84  LYS A HG2  6  
ATOM 10682 H HG3  . LYS A 1 84  ? 9.763   -17.687 1.360   1.00 0.00 ? 84  LYS A HG3  6  
ATOM 10683 H HD2  . LYS A 1 84  ? 7.972   -16.170 3.214   1.00 0.00 ? 84  LYS A HD2  6  
ATOM 10684 H HD3  . LYS A 1 84  ? 8.517   -17.792 3.647   1.00 0.00 ? 84  LYS A HD3  6  
ATOM 10685 H HE2  . LYS A 1 84  ? 10.354  -15.533 2.866   1.00 0.00 ? 84  LYS A HE2  6  
ATOM 10686 H HE3  . LYS A 1 84  ? 9.952   -15.951 4.530   1.00 0.00 ? 84  LYS A HE3  6  
ATOM 10687 H HZ1  . LYS A 1 84  ? 11.155  -17.874 4.437   1.00 0.00 ? 84  LYS A HZ1  6  
ATOM 10688 H HZ2  . LYS A 1 84  ? 12.076  -16.911 3.396   1.00 0.00 ? 84  LYS A HZ2  6  
ATOM 10689 H HZ3  . LYS A 1 84  ? 10.995  -18.046 2.761   1.00 0.00 ? 84  LYS A HZ3  6  
ATOM 10690 N N    . GLY A 1 85  ? 6.257   -16.355 -1.884  1.00 0.00 ? 85  GLY A N    6  
ATOM 10691 C CA   . GLY A 1 85  ? 5.837   -17.204 -2.983  1.00 0.00 ? 85  GLY A CA   6  
ATOM 10692 C C    . GLY A 1 85  ? 4.334   -17.392 -3.031  1.00 0.00 ? 85  GLY A C    6  
ATOM 10693 O O    . GLY A 1 85  ? 3.841   -18.520 -3.040  1.00 0.00 ? 85  GLY A O    6  
ATOM 10694 H H    . GLY A 1 85  ? 6.281   -15.382 -2.000  1.00 0.00 ? 85  GLY A H    6  
ATOM 10695 H HA2  . GLY A 1 85  ? 6.164   -16.759 -3.912  1.00 0.00 ? 85  GLY A HA2  6  
ATOM 10696 H HA3  . GLY A 1 85  ? 6.306   -18.171 -2.875  1.00 0.00 ? 85  GLY A HA3  6  
ATOM 10697 N N    . VAL A 1 86  ? 3.601   -16.283 -3.059  1.00 0.00 ? 86  VAL A N    6  
ATOM 10698 C CA   . VAL A 1 86  ? 2.145   -16.329 -3.105  1.00 0.00 ? 86  VAL A CA   6  
ATOM 10699 C C    . VAL A 1 86  ? 1.554   -14.932 -3.252  1.00 0.00 ? 86  VAL A C    6  
ATOM 10700 O O    . VAL A 1 86  ? 2.077   -13.963 -2.700  1.00 0.00 ? 86  VAL A O    6  
ATOM 10701 C CB   . VAL A 1 86  ? 1.564   -16.989 -1.840  1.00 0.00 ? 86  VAL A CB   6  
ATOM 10702 C CG1  . VAL A 1 86  ? 1.793   -16.105 -0.623  1.00 0.00 ? 86  VAL A CG1  6  
ATOM 10703 C CG2  . VAL A 1 86  ? 0.083   -17.284 -2.025  1.00 0.00 ? 86  VAL A CG2  6  
ATOM 10704 H H    . VAL A 1 86  ? 4.051   -15.412 -3.050  1.00 0.00 ? 86  VAL A H    6  
ATOM 10705 H HA   . VAL A 1 86  ? 1.856   -16.923 -3.960  1.00 0.00 ? 86  VAL A HA   6  
ATOM 10706 H HB   . VAL A 1 86  ? 2.079   -17.925 -1.679  1.00 0.00 ? 86  VAL A HB   6  
ATOM 10707 H HG11 . VAL A 1 86  ? 2.633   -15.451 -0.807  1.00 0.00 ? 86  VAL A HG11 6  
ATOM 10708 H HG12 . VAL A 1 86  ? 0.909   -15.514 -0.436  1.00 0.00 ? 86  VAL A HG12 6  
ATOM 10709 H HG13 . VAL A 1 86  ? 2.001   -16.724 0.237   1.00 0.00 ? 86  VAL A HG13 6  
ATOM 10710 H HG21 . VAL A 1 86  ? -0.250  -16.870 -2.964  1.00 0.00 ? 86  VAL A HG21 6  
ATOM 10711 H HG22 . VAL A 1 86  ? -0.074  -18.353 -2.026  1.00 0.00 ? 86  VAL A HG22 6  
ATOM 10712 H HG23 . VAL A 1 86  ? -0.476  -16.839 -1.215  1.00 0.00 ? 86  VAL A HG23 6  
ATOM 10713 N N    . THR A 1 87  ? 0.460   -14.833 -4.001  1.00 0.00 ? 87  THR A N    6  
ATOM 10714 C CA   . THR A 1 87  ? -0.202  -13.554 -4.222  1.00 0.00 ? 87  THR A CA   6  
ATOM 10715 C C    . THR A 1 87  ? -0.992  -13.124 -2.991  1.00 0.00 ? 87  THR A C    6  
ATOM 10716 O O    . THR A 1 87  ? -1.542  -13.958 -2.272  1.00 0.00 ? 87  THR A O    6  
ATOM 10717 C CB   . THR A 1 87  ? -1.152  -13.615 -5.433  1.00 0.00 ? 87  THR A CB   6  
ATOM 10718 O OG1  . THR A 1 87  ? -0.627  -14.506 -6.423  1.00 0.00 ? 87  THR A OG1  6  
ATOM 10719 C CG2  . THR A 1 87  ? -1.347  -12.233 -6.038  1.00 0.00 ? 87  THR A CG2  6  
ATOM 10720 H H    . THR A 1 87  ? 0.091   -15.641 -4.415  1.00 0.00 ? 87  THR A H    6  
ATOM 10721 H HA   . THR A 1 87  ? 0.559   -12.815 -4.426  1.00 0.00 ? 87  THR A HA   6  
ATOM 10722 H HB   . THR A 1 87  ? -2.112  -13.984 -5.100  1.00 0.00 ? 87  THR A HB   6  
ATOM 10723 H HG1  . THR A 1 87  ? -0.905  -14.214 -7.295  1.00 0.00 ? 87  THR A HG1  6  
ATOM 10724 H HG21 . THR A 1 87  ? -1.683  -11.549 -5.273  1.00 0.00 ? 87  THR A HG21 6  
ATOM 10725 H HG22 . THR A 1 87  ? -2.086  -12.285 -6.824  1.00 0.00 ? 87  THR A HG22 6  
ATOM 10726 H HG23 . THR A 1 87  ? -0.411  -11.884 -6.446  1.00 0.00 ? 87  THR A HG23 6  
ATOM 10727 N N    . TYR A 1 88  ? -1.044  -11.818 -2.755  1.00 0.00 ? 88  TYR A N    6  
ATOM 10728 C CA   . TYR A 1 88  ? -1.766  -11.277 -1.609  1.00 0.00 ? 88  TYR A CA   6  
ATOM 10729 C C    . TYR A 1 88  ? -2.650  -10.105 -2.025  1.00 0.00 ? 88  TYR A C    6  
ATOM 10730 O O    . TYR A 1 88  ? -2.154  -9.037  -2.383  1.00 0.00 ? 88  TYR A O    6  
ATOM 10731 C CB   . TYR A 1 88  ? -0.784  -10.830 -0.525  1.00 0.00 ? 88  TYR A CB   6  
ATOM 10732 C CG   . TYR A 1 88  ? -0.442  -11.918 0.468   1.00 0.00 ? 88  TYR A CG   6  
ATOM 10733 C CD1  . TYR A 1 88  ? -1.227  -12.127 1.596   1.00 0.00 ? 88  TYR A CD1  6  
ATOM 10734 C CD2  . TYR A 1 88  ? 0.665   -12.735 0.280   1.00 0.00 ? 88  TYR A CD2  6  
ATOM 10735 C CE1  . TYR A 1 88  ? -0.918  -13.119 2.507   1.00 0.00 ? 88  TYR A CE1  6  
ATOM 10736 C CE2  . TYR A 1 88  ? 0.980   -13.730 1.184   1.00 0.00 ? 88  TYR A CE2  6  
ATOM 10737 C CZ   . TYR A 1 88  ? 0.186   -13.918 2.296   1.00 0.00 ? 88  TYR A CZ   6  
ATOM 10738 O OH   . TYR A 1 88  ? 0.497   -14.907 3.201   1.00 0.00 ? 88  TYR A OH   6  
ATOM 10739 H H    . TYR A 1 88  ? -0.586  -11.202 -3.364  1.00 0.00 ? 88  TYR A H    6  
ATOM 10740 H HA   . TYR A 1 88  ? -2.393  -12.062 -1.211  1.00 0.00 ? 88  TYR A HA   6  
ATOM 10741 H HB2  . TYR A 1 88  ? 0.134   -10.508 -0.992  1.00 0.00 ? 88  TYR A HB2  6  
ATOM 10742 H HB3  . TYR A 1 88  ? -1.214  -10.004 0.022   1.00 0.00 ? 88  TYR A HB3  6  
ATOM 10743 H HD1  . TYR A 1 88  ? -2.091  -11.499 1.758   1.00 0.00 ? 88  TYR A HD1  6  
ATOM 10744 H HD2  . TYR A 1 88  ? 1.285   -12.585 -0.592  1.00 0.00 ? 88  TYR A HD2  6  
ATOM 10745 H HE1  . TYR A 1 88  ? -1.540  -13.266 3.378   1.00 0.00 ? 88  TYR A HE1  6  
ATOM 10746 H HE2  . TYR A 1 88  ? 1.845   -14.356 1.020   1.00 0.00 ? 88  TYR A HE2  6  
ATOM 10747 H HH   . TYR A 1 88  ? 0.132   -15.743 2.899   1.00 0.00 ? 88  TYR A HH   6  
ATOM 10748 N N    . GLU A 1 89  ? -3.962  -10.314 -1.976  1.00 0.00 ? 89  GLU A N    6  
ATOM 10749 C CA   . GLU A 1 89  ? -4.915  -9.275  -2.348  1.00 0.00 ? 89  GLU A CA   6  
ATOM 10750 C C    . GLU A 1 89  ? -5.052  -8.239  -1.236  1.00 0.00 ? 89  GLU A C    6  
ATOM 10751 O O    . GLU A 1 89  ? -5.281  -8.584  -0.076  1.00 0.00 ? 89  GLU A O    6  
ATOM 10752 C CB   . GLU A 1 89  ? -6.281  -9.892  -2.657  1.00 0.00 ? 89  GLU A CB   6  
ATOM 10753 C CG   . GLU A 1 89  ? -7.180  -8.993  -3.488  1.00 0.00 ? 89  GLU A CG   6  
ATOM 10754 C CD   . GLU A 1 89  ? -8.318  -9.751  -4.143  1.00 0.00 ? 89  GLU A CD   6  
ATOM 10755 O OE1  . GLU A 1 89  ? -8.076  -10.869 -4.645  1.00 0.00 ? 89  GLU A OE1  6  
ATOM 10756 O OE2  . GLU A 1 89  ? -9.451  -9.227  -4.153  1.00 0.00 ? 89  GLU A OE2  6  
ATOM 10757 H H    . GLU A 1 89  ? -4.296  -11.187 -1.682  1.00 0.00 ? 89  GLU A H    6  
ATOM 10758 H HA   . GLU A 1 89  ? -4.542  -8.786  -3.235  1.00 0.00 ? 89  GLU A HA   6  
ATOM 10759 H HB2  . GLU A 1 89  ? -6.131  -10.816 -3.195  1.00 0.00 ? 89  GLU A HB2  6  
ATOM 10760 H HB3  . GLU A 1 89  ? -6.784  -10.106 -1.725  1.00 0.00 ? 89  GLU A HB3  6  
ATOM 10761 H HG2  . GLU A 1 89  ? -7.598  -8.231  -2.847  1.00 0.00 ? 89  GLU A HG2  6  
ATOM 10762 H HG3  . GLU A 1 89  ? -6.586  -8.526  -4.261  1.00 0.00 ? 89  GLU A HG3  6  
ATOM 10763 N N    . ILE A 1 90  ? -4.909  -6.968  -1.598  1.00 0.00 ? 90  ILE A N    6  
ATOM 10764 C CA   . ILE A 1 90  ? -5.018  -5.882  -0.632  1.00 0.00 ? 90  ILE A CA   6  
ATOM 10765 C C    . ILE A 1 90  ? -5.835  -4.725  -1.195  1.00 0.00 ? 90  ILE A C    6  
ATOM 10766 O O    . ILE A 1 90  ? -5.773  -4.429  -2.389  1.00 0.00 ? 90  ILE A O    6  
ATOM 10767 C CB   . ILE A 1 90  ? -3.631  -5.361  -0.213  1.00 0.00 ? 90  ILE A CB   6  
ATOM 10768 C CG1  . ILE A 1 90  ? -2.691  -6.530  0.088   1.00 0.00 ? 90  ILE A CG1  6  
ATOM 10769 C CG2  . ILE A 1 90  ? -3.751  -4.446  0.997   1.00 0.00 ? 90  ILE A CG2  6  
ATOM 10770 C CD1  . ILE A 1 90  ? -1.237  -6.226  -0.198  1.00 0.00 ? 90  ILE A CD1  6  
ATOM 10771 H H    . ILE A 1 90  ? -4.728  -6.757  -2.537  1.00 0.00 ? 90  ILE A H    6  
ATOM 10772 H HA   . ILE A 1 90  ? -5.516  -6.267  0.247   1.00 0.00 ? 90  ILE A HA   6  
ATOM 10773 H HB   . ILE A 1 90  ? -3.226  -4.784  -1.031  1.00 0.00 ? 90  ILE A HB   6  
ATOM 10774 H HG12 . ILE A 1 90  ? -2.776  -6.792  1.131   1.00 0.00 ? 90  ILE A HG12 6  
ATOM 10775 H HG13 . ILE A 1 90  ? -2.979  -7.378  -0.517  1.00 0.00 ? 90  ILE A HG13 6  
ATOM 10776 H HG21 . ILE A 1 90  ? -3.107  -4.805  1.785   1.00 0.00 ? 90  ILE A HG21 6  
ATOM 10777 H HG22 . ILE A 1 90  ? -3.458  -3.444  0.721   1.00 0.00 ? 90  ILE A HG22 6  
ATOM 10778 H HG23 . ILE A 1 90  ? -4.774  -4.439  1.342   1.00 0.00 ? 90  ILE A HG23 6  
ATOM 10779 H HD11 . ILE A 1 90  ? -0.922  -5.381  0.395   1.00 0.00 ? 90  ILE A HD11 6  
ATOM 10780 H HD12 . ILE A 1 90  ? -0.634  -7.086  0.050   1.00 0.00 ? 90  ILE A HD12 6  
ATOM 10781 H HD13 . ILE A 1 90  ? -1.118  -5.993  -1.247  1.00 0.00 ? 90  ILE A HD13 6  
ATOM 10782 N N    . LYS A 1 91  ? -6.601  -4.071  -0.328  1.00 0.00 ? 91  LYS A N    6  
ATOM 10783 C CA   . LYS A 1 91  ? -7.429  -2.943  -0.736  1.00 0.00 ? 91  LYS A CA   6  
ATOM 10784 C C    . LYS A 1 91  ? -7.575  -1.935  0.399   1.00 0.00 ? 91  LYS A C    6  
ATOM 10785 O O    . LYS A 1 91  ? -7.839  -2.307  1.543   1.00 0.00 ? 91  LYS A O    6  
ATOM 10786 C CB   . LYS A 1 91  ? -8.810  -3.432  -1.179  1.00 0.00 ? 91  LYS A CB   6  
ATOM 10787 C CG   . LYS A 1 91  ? -9.552  -4.211  -0.106  1.00 0.00 ? 91  LYS A CG   6  
ATOM 10788 C CD   . LYS A 1 91  ? -9.242  -5.696  -0.181  1.00 0.00 ? 91  LYS A CD   6  
ATOM 10789 C CE   . LYS A 1 91  ? -10.029 -6.483  0.856   1.00 0.00 ? 91  LYS A CE   6  
ATOM 10790 N NZ   . LYS A 1 91  ? -11.422 -6.756  0.407   1.00 0.00 ? 91  LYS A NZ   6  
ATOM 10791 H H    . LYS A 1 91  ? -6.608  -4.354  0.611   1.00 0.00 ? 91  LYS A H    6  
ATOM 10792 H HA   . LYS A 1 91  ? -6.943  -2.460  -1.571  1.00 0.00 ? 91  LYS A HA   6  
ATOM 10793 H HB2  . LYS A 1 91  ? -9.410  -2.577  -1.454  1.00 0.00 ? 91  LYS A HB2  6  
ATOM 10794 H HB3  . LYS A 1 91  ? -8.693  -4.071  -2.042  1.00 0.00 ? 91  LYS A HB3  6  
ATOM 10795 H HG2  . LYS A 1 91  ? -9.256  -3.841  0.864   1.00 0.00 ? 91  LYS A HG2  6  
ATOM 10796 H HG3  . LYS A 1 91  ? -10.615 -4.066  -0.240  1.00 0.00 ? 91  LYS A HG3  6  
ATOM 10797 H HD2  . LYS A 1 91  ? -9.502  -6.060  -1.164  1.00 0.00 ? 91  LYS A HD2  6  
ATOM 10798 H HD3  . LYS A 1 91  ? -8.186  -5.844  -0.008  1.00 0.00 ? 91  LYS A HD3  6  
ATOM 10799 H HE2  . LYS A 1 91  ? -9.526  -7.421  1.034   1.00 0.00 ? 91  LYS A HE2  6  
ATOM 10800 H HE3  . LYS A 1 91  ? -10.060 -5.912  1.773   1.00 0.00 ? 91  LYS A HE3  6  
ATOM 10801 H HZ1  . LYS A 1 91  ? -11.577 -7.781  0.329   1.00 0.00 ? 91  LYS A HZ1  6  
ATOM 10802 H HZ2  . LYS A 1 91  ? -11.589 -6.320  -0.522  1.00 0.00 ? 91  LYS A HZ2  6  
ATOM 10803 H HZ3  . LYS A 1 91  ? -12.101 -6.364  1.090   1.00 0.00 ? 91  LYS A HZ3  6  
ATOM 10804 N N    . VAL A 1 92  ? -7.402  -0.657  0.076   1.00 0.00 ? 92  VAL A N    6  
ATOM 10805 C CA   . VAL A 1 92  ? -7.516  0.404   1.069   1.00 0.00 ? 92  VAL A CA   6  
ATOM 10806 C C    . VAL A 1 92  ? -8.782  1.225   0.852   1.00 0.00 ? 92  VAL A C    6  
ATOM 10807 O O    . VAL A 1 92  ? -9.122  1.573   -0.279  1.00 0.00 ? 92  VAL A O    6  
ATOM 10808 C CB   . VAL A 1 92  ? -6.296  1.343   1.030   1.00 0.00 ? 92  VAL A CB   6  
ATOM 10809 C CG1  . VAL A 1 92  ? -6.439  2.448   2.065   1.00 0.00 ? 92  VAL A CG1  6  
ATOM 10810 C CG2  . VAL A 1 92  ? -5.012  0.557   1.251   1.00 0.00 ? 92  VAL A CG2  6  
ATOM 10811 H H    . VAL A 1 92  ? -7.193  -0.423  -0.852  1.00 0.00 ? 92  VAL A H    6  
ATOM 10812 H HA   . VAL A 1 92  ? -7.560  -0.055  2.046   1.00 0.00 ? 92  VAL A HA   6  
ATOM 10813 H HB   . VAL A 1 92  ? -6.249  1.800   0.052   1.00 0.00 ? 92  VAL A HB   6  
ATOM 10814 H HG11 . VAL A 1 92  ? -6.831  2.034   2.982   1.00 0.00 ? 92  VAL A HG11 6  
ATOM 10815 H HG12 . VAL A 1 92  ? -5.473  2.893   2.254   1.00 0.00 ? 92  VAL A HG12 6  
ATOM 10816 H HG13 . VAL A 1 92  ? -7.116  3.203   1.694   1.00 0.00 ? 92  VAL A HG13 6  
ATOM 10817 H HG21 . VAL A 1 92  ? -4.644  0.745   2.249   1.00 0.00 ? 92  VAL A HG21 6  
ATOM 10818 H HG22 . VAL A 1 92  ? -5.211  -0.498  1.134   1.00 0.00 ? 92  VAL A HG22 6  
ATOM 10819 H HG23 . VAL A 1 92  ? -4.271  0.866   0.529   1.00 0.00 ? 92  VAL A HG23 6  
ATOM 10820 N N    . ARG A 1 93  ? -9.476  1.532   1.943   1.00 0.00 ? 93  ARG A N    6  
ATOM 10821 C CA   . ARG A 1 93  ? -10.706 2.312   1.872   1.00 0.00 ? 93  ARG A CA   6  
ATOM 10822 C C    . ARG A 1 93  ? -10.809 3.273   3.053   1.00 0.00 ? 93  ARG A C    6  
ATOM 10823 O O    . ARG A 1 93  ? -10.389 2.970   4.170   1.00 0.00 ? 93  ARG A O    6  
ATOM 10824 C CB   . ARG A 1 93  ? -11.922 1.385   1.847   1.00 0.00 ? 93  ARG A CB   6  
ATOM 10825 C CG   . ARG A 1 93  ? -12.333 0.882   3.222   1.00 0.00 ? 93  ARG A CG   6  
ATOM 10826 C CD   . ARG A 1 93  ? -11.413 -0.227  3.707   1.00 0.00 ? 93  ARG A CD   6  
ATOM 10827 N NE   . ARG A 1 93  ? -11.405 -1.369  2.797   1.00 0.00 ? 93  ARG A NE   6  
ATOM 10828 C CZ   . ARG A 1 93  ? -12.307 -2.344  2.834   1.00 0.00 ? 93  ARG A CZ   6  
ATOM 10829 N NH1  . ARG A 1 93  ? -13.283 -2.316  3.731   1.00 0.00 ? 93  ARG A NH1  6  
ATOM 10830 N NH2  . ARG A 1 93  ? -12.233 -3.350  1.972   1.00 0.00 ? 93  ARG A NH2  6  
ATOM 10831 H H    . ARG A 1 93  ? -9.154  1.226   2.817   1.00 0.00 ? 93  ARG A H    6  
ATOM 10832 H HA   . ARG A 1 93  ? -10.683 2.885   0.957   1.00 0.00 ? 93  ARG A HA   6  
ATOM 10833 H HB2  . ARG A 1 93  ? -12.759 1.918   1.419   1.00 0.00 ? 93  ARG A HB2  6  
ATOM 10834 H HB3  . ARG A 1 93  ? -11.696 0.530   1.228   1.00 0.00 ? 93  ARG A HB3  6  
ATOM 10835 H HG2  . ARG A 1 93  ? -12.290 1.703   3.923   1.00 0.00 ? 93  ARG A HG2  6  
ATOM 10836 H HG3  . ARG A 1 93  ? -13.343 0.504   3.169   1.00 0.00 ? 93  ARG A HG3  6  
ATOM 10837 H HD2  . ARG A 1 93  ? -10.410 0.164   3.786   1.00 0.00 ? 93  ARG A HD2  6  
ATOM 10838 H HD3  . ARG A 1 93  ? -11.749 -0.555  4.679   1.00 0.00 ? 93  ARG A HD3  6  
ATOM 10839 H HE   . ARG A 1 93  ? -10.693 -1.410  2.126   1.00 0.00 ? 93  ARG A HE   6  
ATOM 10840 H HH11 . ARG A 1 93  ? -13.341 -1.559  4.381   1.00 0.00 ? 93  ARG A HH11 6  
ATOM 10841 H HH12 . ARG A 1 93  ? -13.961 -3.051  3.755   1.00 0.00 ? 93  ARG A HH12 6  
ATOM 10842 H HH21 . ARG A 1 93  ? -11.499 -3.375  1.294   1.00 0.00 ? 93  ARG A HH21 6  
ATOM 10843 H HH22 . ARG A 1 93  ? -12.911 -4.084  2.000   1.00 0.00 ? 93  ARG A HH22 6  
ATOM 10844 N N    . PRO A 1 94  ? -11.381 4.460   2.802   1.00 0.00 ? 94  PRO A N    6  
ATOM 10845 C CA   . PRO A 1 94  ? -11.553 5.489   3.831   1.00 0.00 ? 94  PRO A CA   6  
ATOM 10846 C C    . PRO A 1 94  ? -12.594 5.098   4.875   1.00 0.00 ? 94  PRO A C    6  
ATOM 10847 O O    . PRO A 1 94  ? -13.757 4.861   4.547   1.00 0.00 ? 94  PRO A O    6  
ATOM 10848 C CB   . PRO A 1 94  ? -12.025 6.710   3.037   1.00 0.00 ? 94  PRO A CB   6  
ATOM 10849 C CG   . PRO A 1 94  ? -12.667 6.144   1.818   1.00 0.00 ? 94  PRO A CG   6  
ATOM 10850 C CD   . PRO A 1 94  ? -11.905 4.888   1.494   1.00 0.00 ? 94  PRO A CD   6  
ATOM 10851 H HA   . PRO A 1 94  ? -10.619 5.717   4.324   1.00 0.00 ? 94  PRO A HA   6  
ATOM 10852 H HB2  . PRO A 1 94  ? -12.730 7.277   3.629   1.00 0.00 ? 94  PRO A HB2  6  
ATOM 10853 H HB3  . PRO A 1 94  ? -11.177 7.329   2.786   1.00 0.00 ? 94  PRO A HB3  6  
ATOM 10854 H HG2  . PRO A 1 94  ? -13.701 5.913   2.021   1.00 0.00 ? 94  PRO A HG2  6  
ATOM 10855 H HG3  . PRO A 1 94  ? -12.591 6.848   1.003   1.00 0.00 ? 94  PRO A HG3  6  
ATOM 10856 H HD2  . PRO A 1 94  ? -12.566 4.142   1.080   1.00 0.00 ? 94  PRO A HD2  6  
ATOM 10857 H HD3  . PRO A 1 94  ? -11.099 5.103   0.808   1.00 0.00 ? 94  PRO A HD3  6  
ATOM 10858 N N    . TYR A 1 95  ? -12.169 5.031   6.131   1.00 0.00 ? 95  TYR A N    6  
ATOM 10859 C CA   . TYR A 1 95  ? -13.065 4.666   7.223   1.00 0.00 ? 95  TYR A CA   6  
ATOM 10860 C C    . TYR A 1 95  ? -13.197 5.810   8.224   1.00 0.00 ? 95  TYR A C    6  
ATOM 10861 O O    . TYR A 1 95  ? -12.233 6.524   8.499   1.00 0.00 ? 95  TYR A O    6  
ATOM 10862 C CB   . TYR A 1 95  ? -12.555 3.410   7.930   1.00 0.00 ? 95  TYR A CB   6  
ATOM 10863 C CG   . TYR A 1 95  ? -11.609 3.700   9.074   1.00 0.00 ? 95  TYR A CG   6  
ATOM 10864 C CD1  . TYR A 1 95  ? -12.049 4.364   10.213  1.00 0.00 ? 95  TYR A CD1  6  
ATOM 10865 C CD2  . TYR A 1 95  ? -10.277 3.312   9.015   1.00 0.00 ? 95  TYR A CD2  6  
ATOM 10866 C CE1  . TYR A 1 95  ? -11.188 4.633   11.260  1.00 0.00 ? 95  TYR A CE1  6  
ATOM 10867 C CE2  . TYR A 1 95  ? -9.410  3.575   10.058  1.00 0.00 ? 95  TYR A CE2  6  
ATOM 10868 C CZ   . TYR A 1 95  ? -9.870  4.236   11.178  1.00 0.00 ? 95  TYR A CZ   6  
ATOM 10869 O OH   . TYR A 1 95  ? -9.009  4.500   12.218  1.00 0.00 ? 95  TYR A OH   6  
ATOM 10870 H H    . TYR A 1 95  ? -11.231 5.231   6.330   1.00 0.00 ? 95  TYR A H    6  
ATOM 10871 H HA   . TYR A 1 95  ? -14.037 4.460   6.799   1.00 0.00 ? 95  TYR A HA   6  
ATOM 10872 H HB2  . TYR A 1 95  ? -13.396 2.862   8.327   1.00 0.00 ? 95  TYR A HB2  6  
ATOM 10873 H HB3  . TYR A 1 95  ? -12.032 2.790   7.216   1.00 0.00 ? 95  TYR A HB3  6  
ATOM 10874 H HD1  . TYR A 1 95  ? -13.082 4.674   10.274  1.00 0.00 ? 95  TYR A HD1  6  
ATOM 10875 H HD2  . TYR A 1 95  ? -9.919  2.795   8.136   1.00 0.00 ? 95  TYR A HD2  6  
ATOM 10876 H HE1  . TYR A 1 95  ? -11.549 5.150   12.137  1.00 0.00 ? 95  TYR A HE1  6  
ATOM 10877 H HE2  . TYR A 1 95  ? -8.377  3.265   9.994   1.00 0.00 ? 95  TYR A HE2  6  
ATOM 10878 H HH   . TYR A 1 95  ? -8.807  5.439   12.235  1.00 0.00 ? 95  TYR A HH   6  
ATOM 10879 N N    . PHE A 1 96  ? -14.399 5.975   8.767   1.00 0.00 ? 96  PHE A N    6  
ATOM 10880 C CA   . PHE A 1 96  ? -14.659 7.031   9.739   1.00 0.00 ? 96  PHE A CA   6  
ATOM 10881 C C    . PHE A 1 96  ? -14.812 6.453   11.143  1.00 0.00 ? 96  PHE A C    6  
ATOM 10882 O O    . PHE A 1 96  ? -13.910 6.562   11.972  1.00 0.00 ? 96  PHE A O    6  
ATOM 10883 C CB   . PHE A 1 96  ? -15.921 7.807   9.354   1.00 0.00 ? 96  PHE A CB   6  
ATOM 10884 C CG   . PHE A 1 96  ? -16.293 8.874   10.344  1.00 0.00 ? 96  PHE A CG   6  
ATOM 10885 C CD1  . PHE A 1 96  ? -15.343 9.405   11.201  1.00 0.00 ? 96  PHE A CD1  6  
ATOM 10886 C CD2  . PHE A 1 96  ? -17.594 9.346   10.417  1.00 0.00 ? 96  PHE A CD2  6  
ATOM 10887 C CE1  . PHE A 1 96  ? -15.682 10.387  12.112  1.00 0.00 ? 96  PHE A CE1  6  
ATOM 10888 C CE2  . PHE A 1 96  ? -17.939 10.329  11.326  1.00 0.00 ? 96  PHE A CE2  6  
ATOM 10889 C CZ   . PHE A 1 96  ? -16.982 10.849  12.175  1.00 0.00 ? 96  PHE A CZ   6  
ATOM 10890 H H    . PHE A 1 96  ? -15.128 5.373   8.508   1.00 0.00 ? 96  PHE A H    6  
ATOM 10891 H HA   . PHE A 1 96  ? -13.816 7.705   9.730   1.00 0.00 ? 96  PHE A HA   6  
ATOM 10892 H HB2  . PHE A 1 96  ? -15.765 8.282   8.398   1.00 0.00 ? 96  PHE A HB2  6  
ATOM 10893 H HB3  . PHE A 1 96  ? -16.749 7.119   9.279   1.00 0.00 ? 96  PHE A HB3  6  
ATOM 10894 H HD1  . PHE A 1 96  ? -14.325 9.044   11.153  1.00 0.00 ? 96  PHE A HD1  6  
ATOM 10895 H HD2  . PHE A 1 96  ? -18.343 8.940   9.754   1.00 0.00 ? 96  PHE A HD2  6  
ATOM 10896 H HE1  . PHE A 1 96  ? -14.931 10.791  12.775  1.00 0.00 ? 96  PHE A HE1  6  
ATOM 10897 H HE2  . PHE A 1 96  ? -18.956 10.688  11.373  1.00 0.00 ? 96  PHE A HE2  6  
ATOM 10898 H HZ   . PHE A 1 96  ? -17.249 11.616  12.886  1.00 0.00 ? 96  PHE A HZ   6  
ATOM 10899 N N    . ASN A 1 97  ? -15.962 5.838   11.401  1.00 0.00 ? 97  ASN A N    6  
ATOM 10900 C CA   . ASN A 1 97  ? -16.235 5.244   12.705  1.00 0.00 ? 97  ASN A CA   6  
ATOM 10901 C C    . ASN A 1 97  ? -16.220 3.721   12.621  1.00 0.00 ? 97  ASN A C    6  
ATOM 10902 O O    . ASN A 1 97  ? -15.266 3.075   13.056  1.00 0.00 ? 97  ASN A O    6  
ATOM 10903 C CB   . ASN A 1 97  ? -17.587 5.724   13.234  1.00 0.00 ? 97  ASN A CB   6  
ATOM 10904 C CG   . ASN A 1 97  ? -17.489 7.059   13.946  1.00 0.00 ? 97  ASN A CG   6  
ATOM 10905 O OD1  . ASN A 1 97  ? -16.425 7.678   13.984  1.00 0.00 ? 97  ASN A OD1  6  
ATOM 10906 N ND2  . ASN A 1 97  ? -18.601 7.511   14.514  1.00 0.00 ? 97  ASN A ND2  6  
ATOM 10907 H H    . ASN A 1 97  ? -16.643 5.784   10.699  1.00 0.00 ? 97  ASN A H    6  
ATOM 10908 H HA   . ASN A 1 97  ? -15.458 5.563   13.383  1.00 0.00 ? 97  ASN A HA   6  
ATOM 10909 H HB2  . ASN A 1 97  ? -18.274 5.829   12.407  1.00 0.00 ? 97  ASN A HB2  6  
ATOM 10910 H HB3  . ASN A 1 97  ? -17.975 4.994   13.929  1.00 0.00 ? 97  ASN A HB3  6  
ATOM 10911 H HD21 . ASN A 1 97  ? -19.412 6.964   14.443  1.00 0.00 ? 97  ASN A HD21 6  
ATOM 10912 H HD22 . ASN A 1 97  ? -18.566 8.372   14.980  1.00 0.00 ? 97  ASN A HD22 6  
ATOM 10913 N N    . GLU A 1 98  ? -17.283 3.154   12.060  1.00 0.00 ? 98  GLU A N    6  
ATOM 10914 C CA   . GLU A 1 98  ? -17.392 1.706   11.920  1.00 0.00 ? 98  GLU A CA   6  
ATOM 10915 C C    . GLU A 1 98  ? -17.574 1.313   10.457  1.00 0.00 ? 98  GLU A C    6  
ATOM 10916 O O    . GLU A 1 98  ? -17.128 0.248   10.028  1.00 0.00 ? 98  GLU A O    6  
ATOM 10917 C CB   . GLU A 1 98  ? -18.563 1.178   12.751  1.00 0.00 ? 98  GLU A CB   6  
ATOM 10918 C CG   . GLU A 1 98  ? -19.925 1.533   12.179  1.00 0.00 ? 98  GLU A CG   6  
ATOM 10919 C CD   . GLU A 1 98  ? -20.417 2.890   12.644  1.00 0.00 ? 98  GLU A CD   6  
ATOM 10920 O OE1  . GLU A 1 98  ? -19.571 3.757   12.947  1.00 0.00 ? 98  GLU A OE1  6  
ATOM 10921 O OE2  . GLU A 1 98  ? -21.650 3.084   12.704  1.00 0.00 ? 98  GLU A OE2  6  
ATOM 10922 H H    . GLU A 1 98  ? -18.011 3.722   11.733  1.00 0.00 ? 98  GLU A H    6  
ATOM 10923 H HA   . GLU A 1 98  ? -16.476 1.268   12.287  1.00 0.00 ? 98  GLU A HA   6  
ATOM 10924 H HB2  . GLU A 1 98  ? -18.490 0.102   12.811  1.00 0.00 ? 98  GLU A HB2  6  
ATOM 10925 H HB3  . GLU A 1 98  ? -18.496 1.590   13.747  1.00 0.00 ? 98  GLU A HB3  6  
ATOM 10926 H HG2  . GLU A 1 98  ? -19.857 1.543   11.101  1.00 0.00 ? 98  GLU A HG2  6  
ATOM 10927 H HG3  . GLU A 1 98  ? -20.638 0.783   12.487  1.00 0.00 ? 98  GLU A HG3  6  
ATOM 10928 N N    . PHE A 1 99  ? -18.233 2.180   9.695   1.00 0.00 ? 99  PHE A N    6  
ATOM 10929 C CA   . PHE A 1 99  ? -18.476 1.924   8.280   1.00 0.00 ? 99  PHE A CA   6  
ATOM 10930 C C    . PHE A 1 99  ? -17.191 2.074   7.471   1.00 0.00 ? 99  PHE A C    6  
ATOM 10931 O O    . PHE A 1 99  ? -16.257 2.756   7.893   1.00 0.00 ? 99  PHE A O    6  
ATOM 10932 C CB   . PHE A 1 99  ? -19.545 2.878   7.744   1.00 0.00 ? 99  PHE A CB   6  
ATOM 10933 C CG   . PHE A 1 99  ? -19.586 4.197   8.462   1.00 0.00 ? 99  PHE A CG   6  
ATOM 10934 C CD1  . PHE A 1 99  ? -20.298 4.335   9.643   1.00 0.00 ? 99  PHE A CD1  6  
ATOM 10935 C CD2  . PHE A 1 99  ? -18.913 5.298   7.957   1.00 0.00 ? 99  PHE A CD2  6  
ATOM 10936 C CE1  . PHE A 1 99  ? -20.338 5.547   10.307  1.00 0.00 ? 99  PHE A CE1  6  
ATOM 10937 C CE2  . PHE A 1 99  ? -18.949 6.512   8.617   1.00 0.00 ? 99  PHE A CE2  6  
ATOM 10938 C CZ   . PHE A 1 99  ? -19.663 6.637   9.792   1.00 0.00 ? 99  PHE A CZ   6  
ATOM 10939 H H    . PHE A 1 99  ? -18.564 3.012   10.094  1.00 0.00 ? 99  PHE A H    6  
ATOM 10940 H HA   . PHE A 1 99  ? -18.831 0.909   8.184   1.00 0.00 ? 99  PHE A HA   6  
ATOM 10941 H HB2  . PHE A 1 99  ? -19.350 3.076   6.700   1.00 0.00 ? 99  PHE A HB2  6  
ATOM 10942 H HB3  . PHE A 1 99  ? -20.514 2.414   7.843   1.00 0.00 ? 99  PHE A HB3  6  
ATOM 10943 H HD1  . PHE A 1 99  ? -20.827 3.483   10.046  1.00 0.00 ? 99  PHE A HD1  6  
ATOM 10944 H HD2  . PHE A 1 99  ? -18.355 5.202   7.037   1.00 0.00 ? 99  PHE A HD2  6  
ATOM 10945 H HE1  . PHE A 1 99  ? -20.897 5.641   11.226  1.00 0.00 ? 99  PHE A HE1  6  
ATOM 10946 H HE2  . PHE A 1 99  ? -18.421 7.362   8.212   1.00 0.00 ? 99  PHE A HE2  6  
ATOM 10947 H HZ   . PHE A 1 99  ? -19.693 7.584   10.310  1.00 0.00 ? 99  PHE A HZ   6  
ATOM 10948 N N    . GLN A 1 100 ? -17.152 1.432   6.308   1.00 0.00 ? 100 GLN A N    6  
ATOM 10949 C CA   . GLN A 1 100 ? -15.982 1.494   5.441   1.00 0.00 ? 100 GLN A CA   6  
ATOM 10950 C C    . GLN A 1 100 ? -16.355 2.020   4.060   1.00 0.00 ? 100 GLN A C    6  
ATOM 10951 O O    . GLN A 1 100 ? -17.275 1.514   3.419   1.00 0.00 ? 100 GLN A O    6  
ATOM 10952 C CB   . GLN A 1 100 ? -15.340 0.110   5.317   1.00 0.00 ? 100 GLN A CB   6  
ATOM 10953 C CG   . GLN A 1 100 ? -16.328 -1.035  5.468   1.00 0.00 ? 100 GLN A CG   6  
ATOM 10954 C CD   . GLN A 1 100 ? -16.787 -1.223  6.901   1.00 0.00 ? 100 GLN A CD   6  
ATOM 10955 O OE1  . GLN A 1 100 ? -16.181 -0.695  7.834   1.00 0.00 ? 100 GLN A OE1  6  
ATOM 10956 N NE2  . GLN A 1 100 ? -17.863 -1.979  7.083   1.00 0.00 ? 100 GLN A NE2  6  
ATOM 10957 H H    . GLN A 1 100 ? -17.928 0.905   6.028   1.00 0.00 ? 100 GLN A H    6  
ATOM 10958 H HA   . GLN A 1 100 ? -15.271 2.170   5.891   1.00 0.00 ? 100 GLN A HA   6  
ATOM 10959 H HB2  . GLN A 1 100 ? -14.874 0.029   4.346   1.00 0.00 ? 100 GLN A HB2  6  
ATOM 10960 H HB3  . GLN A 1 100 ? -14.583 0.008   6.080   1.00 0.00 ? 100 GLN A HB3  6  
ATOM 10961 H HG2  . GLN A 1 100 ? -17.193 -0.831  4.854   1.00 0.00 ? 100 GLN A HG2  6  
ATOM 10962 H HG3  . GLN A 1 100 ? -15.857 -1.947  5.133   1.00 0.00 ? 100 GLN A HG3  6  
ATOM 10963 H HE21 . GLN A 1 100 ? -18.294 -2.369  6.293   1.00 0.00 ? 100 GLN A HE21 6  
ATOM 10964 H HE22 . GLN A 1 100 ? -18.181 -2.119  7.999   1.00 0.00 ? 100 GLN A HE22 6  
ATOM 10965 N N    . GLY A 1 101 ? -15.634 3.041   3.606   1.00 0.00 ? 101 GLY A N    6  
ATOM 10966 C CA   . GLY A 1 101 ? -15.905 3.620   2.303   1.00 0.00 ? 101 GLY A CA   6  
ATOM 10967 C C    . GLY A 1 101 ? -15.595 2.665   1.168   1.00 0.00 ? 101 GLY A C    6  
ATOM 10968 O O    . GLY A 1 101 ? -15.100 1.561   1.395   1.00 0.00 ? 101 GLY A O    6  
ATOM 10969 H H    . GLY A 1 101 ? -14.912 3.405   4.161   1.00 0.00 ? 101 GLY A H    6  
ATOM 10970 H HA2  . GLY A 1 101 ? -16.948 3.896   2.254   1.00 0.00 ? 101 GLY A HA2  6  
ATOM 10971 H HA3  . GLY A 1 101 ? -15.302 4.509   2.185   1.00 0.00 ? 101 GLY A HA3  6  
ATOM 10972 N N    . MET A 1 102 ? -15.888 3.089   -0.057  1.00 0.00 ? 102 MET A N    6  
ATOM 10973 C CA   . MET A 1 102 ? -15.638 2.261   -1.231  1.00 0.00 ? 102 MET A CA   6  
ATOM 10974 C C    . MET A 1 102 ? -14.209 1.727   -1.225  1.00 0.00 ? 102 MET A C    6  
ATOM 10975 O O    . MET A 1 102 ? -13.256 2.477   -1.014  1.00 0.00 ? 102 MET A O    6  
ATOM 10976 C CB   . MET A 1 102 ? -15.889 3.064   -2.510  1.00 0.00 ? 102 MET A CB   6  
ATOM 10977 C CG   . MET A 1 102 ? -17.336 3.031   -2.973  1.00 0.00 ? 102 MET A CG   6  
ATOM 10978 S SD   . MET A 1 102 ? -17.499 3.226   -4.758  1.00 0.00 ? 102 MET A SD   6  
ATOM 10979 C CE   . MET A 1 102 ? -17.047 4.948   -4.953  1.00 0.00 ? 102 MET A CE   6  
ATOM 10980 H H    . MET A 1 102 ? -16.281 3.979   -0.174  1.00 0.00 ? 102 MET A H    6  
ATOM 10981 H HA   . MET A 1 102 ? -16.322 1.427   -1.201  1.00 0.00 ? 102 MET A HA   6  
ATOM 10982 H HB2  . MET A 1 102 ? -15.612 4.093   -2.335  1.00 0.00 ? 102 MET A HB2  6  
ATOM 10983 H HB3  . MET A 1 102 ? -15.272 2.663   -3.300  1.00 0.00 ? 102 MET A HB3  6  
ATOM 10984 H HG2  . MET A 1 102 ? -17.771 2.085   -2.688  1.00 0.00 ? 102 MET A HG2  6  
ATOM 10985 H HG3  . MET A 1 102 ? -17.873 3.832   -2.487  1.00 0.00 ? 102 MET A HG3  6  
ATOM 10986 H HE1  . MET A 1 102 ? -16.416 5.059   -5.823  1.00 0.00 ? 102 MET A HE1  6  
ATOM 10987 H HE2  . MET A 1 102 ? -17.940 5.542   -5.078  1.00 0.00 ? 102 MET A HE2  6  
ATOM 10988 H HE3  . MET A 1 102 ? -16.512 5.281   -4.076  1.00 0.00 ? 102 MET A HE3  6  
ATOM 10989 N N    . ASP A 1 103 ? -14.068 0.426   -1.458  1.00 0.00 ? 103 ASP A N    6  
ATOM 10990 C CA   . ASP A 1 103 ? -12.755 -0.209  -1.480  1.00 0.00 ? 103 ASP A CA   6  
ATOM 10991 C C    . ASP A 1 103 ? -12.047 0.054   -2.805  1.00 0.00 ? 103 ASP A C    6  
ATOM 10992 O O    . ASP A 1 103 ? -12.674 0.064   -3.864  1.00 0.00 ? 103 ASP A O    6  
ATOM 10993 C CB   . ASP A 1 103 ? -12.890 -1.714  -1.249  1.00 0.00 ? 103 ASP A CB   6  
ATOM 10994 C CG   . ASP A 1 103 ? -14.020 -2.325  -2.053  1.00 0.00 ? 103 ASP A CG   6  
ATOM 10995 O OD1  . ASP A 1 103 ? -13.973 -2.246  -3.299  1.00 0.00 ? 103 ASP A OD1  6  
ATOM 10996 O OD2  . ASP A 1 103 ? -14.952 -2.883  -1.437  1.00 0.00 ? 103 ASP A OD2  6  
ATOM 10997 H H    . ASP A 1 103 ? -14.866 -0.120  -1.619  1.00 0.00 ? 103 ASP A H    6  
ATOM 10998 H HA   . ASP A 1 103 ? -12.167 0.218   -0.681  1.00 0.00 ? 103 ASP A HA   6  
ATOM 10999 H HB2  . ASP A 1 103 ? -11.967 -2.200  -1.534  1.00 0.00 ? 103 ASP A HB2  6  
ATOM 11000 H HB3  . ASP A 1 103 ? -13.078 -1.896  -0.201  1.00 0.00 ? 103 ASP A HB3  6  
ATOM 11001 N N    . SER A 1 104 ? -10.737 0.268   -2.737  1.00 0.00 ? 104 SER A N    6  
ATOM 11002 C CA   . SER A 1 104 ? -9.943  0.535   -3.931  1.00 0.00 ? 104 SER A CA   6  
ATOM 11003 C C    . SER A 1 104 ? -9.761  -0.734  -4.759  1.00 0.00 ? 104 SER A C    6  
ATOM 11004 O O    . SER A 1 104 ? -10.059 -1.835  -4.298  1.00 0.00 ? 104 SER A O    6  
ATOM 11005 C CB   . SER A 1 104 ? -8.577  1.106   -3.545  1.00 0.00 ? 104 SER A CB   6  
ATOM 11006 O OG   . SER A 1 104 ? -7.924  1.670   -4.668  1.00 0.00 ? 104 SER A OG   6  
ATOM 11007 H H    . SER A 1 104 ? -10.294 0.247   -1.863  1.00 0.00 ? 104 SER A H    6  
ATOM 11008 H HA   . SER A 1 104 ? -10.474 1.265   -4.525  1.00 0.00 ? 104 SER A HA   6  
ATOM 11009 H HB2  . SER A 1 104 ? -8.709  1.873   -2.797  1.00 0.00 ? 104 SER A HB2  6  
ATOM 11010 H HB3  . SER A 1 104 ? -7.961  0.315   -3.144  1.00 0.00 ? 104 SER A HB3  6  
ATOM 11011 H HG   . SER A 1 104 ? -8.269  2.551   -4.831  1.00 0.00 ? 104 SER A HG   6  
ATOM 11012 N N    . GLU A 1 105 ? -9.271  -0.569  -5.983  1.00 0.00 ? 105 GLU A N    6  
ATOM 11013 C CA   . GLU A 1 105 ? -9.050  -1.701  -6.875  1.00 0.00 ? 105 GLU A CA   6  
ATOM 11014 C C    . GLU A 1 105 ? -8.126  -2.730  -6.230  1.00 0.00 ? 105 GLU A C    6  
ATOM 11015 O O    . GLU A 1 105 ? -6.903  -2.597  -6.275  1.00 0.00 ? 105 GLU A O    6  
ATOM 11016 C CB   . GLU A 1 105 ? -8.453  -1.225  -8.202  1.00 0.00 ? 105 GLU A CB   6  
ATOM 11017 C CG   . GLU A 1 105 ? -9.249  -0.111  -8.862  1.00 0.00 ? 105 GLU A CG   6  
ATOM 11018 C CD   . GLU A 1 105 ? -8.562  0.446   -10.093 1.00 0.00 ? 105 GLU A CD   6  
ATOM 11019 O OE1  . GLU A 1 105 ? -8.550  -0.247  -11.132 1.00 0.00 ? 105 GLU A OE1  6  
ATOM 11020 O OE2  . GLU A 1 105 ? -8.035  1.576   -10.018 1.00 0.00 ? 105 GLU A OE2  6  
ATOM 11021 H H    . GLU A 1 105 ? -9.052  0.335   -6.294  1.00 0.00 ? 105 GLU A H    6  
ATOM 11022 H HA   . GLU A 1 105 ? -10.006 -2.164  -7.067  1.00 0.00 ? 105 GLU A HA   6  
ATOM 11023 H HB2  . GLU A 1 105 ? -7.450  -0.866  -8.023  1.00 0.00 ? 105 GLU A HB2  6  
ATOM 11024 H HB3  . GLU A 1 105 ? -8.410  -2.061  -8.884  1.00 0.00 ? 105 GLU A HB3  6  
ATOM 11025 H HG2  . GLU A 1 105 ? -10.214 -0.499  -9.152  1.00 0.00 ? 105 GLU A HG2  6  
ATOM 11026 H HG3  . GLU A 1 105 ? -9.384  0.689   -8.150  1.00 0.00 ? 105 GLU A HG3  6  
ATOM 11027 N N    . SER A 1 106 ? -8.720  -3.756  -5.630  1.00 0.00 ? 106 SER A N    6  
ATOM 11028 C CA   . SER A 1 106 ? -7.952  -4.806  -4.971  1.00 0.00 ? 106 SER A CA   6  
ATOM 11029 C C    . SER A 1 106 ? -6.695  -5.140  -5.768  1.00 0.00 ? 106 SER A C    6  
ATOM 11030 O O    . SER A 1 106 ? -6.757  -5.813  -6.797  1.00 0.00 ? 106 SER A O    6  
ATOM 11031 C CB   . SER A 1 106 ? -8.809  -6.062  -4.799  1.00 0.00 ? 106 SER A CB   6  
ATOM 11032 O OG   . SER A 1 106 ? -10.029 -5.761  -4.144  1.00 0.00 ? 106 SER A OG   6  
ATOM 11033 H H    . SER A 1 106 ? -9.699  -3.806  -5.628  1.00 0.00 ? 106 SER A H    6  
ATOM 11034 H HA   . SER A 1 106 ? -7.661  -4.442  -3.997  1.00 0.00 ? 106 SER A HA   6  
ATOM 11035 H HB2  . SER A 1 106 ? -9.028  -6.481  -5.769  1.00 0.00 ? 106 SER A HB2  6  
ATOM 11036 H HB3  . SER A 1 106 ? -8.266  -6.786  -4.208  1.00 0.00 ? 106 SER A HB3  6  
ATOM 11037 H HG   . SER A 1 106 ? -10.727 -6.319  -4.496  1.00 0.00 ? 106 SER A HG   6  
ATOM 11038 N N    . LYS A 1 107 ? -5.552  -4.664  -5.285  1.00 0.00 ? 107 LYS A N    6  
ATOM 11039 C CA   . LYS A 1 107 ? -4.278  -4.911  -5.948  1.00 0.00 ? 107 LYS A CA   6  
ATOM 11040 C C    . LYS A 1 107 ? -3.636  -6.195  -5.433  1.00 0.00 ? 107 LYS A C    6  
ATOM 11041 O O    . LYS A 1 107 ? -3.455  -6.372  -4.228  1.00 0.00 ? 107 LYS A O    6  
ATOM 11042 C CB   . LYS A 1 107 ? -3.328  -3.731  -5.730  1.00 0.00 ? 107 LYS A CB   6  
ATOM 11043 C CG   . LYS A 1 107 ? -3.799  -2.442  -6.382  1.00 0.00 ? 107 LYS A CG   6  
ATOM 11044 C CD   . LYS A 1 107 ? -3.953  -2.601  -7.885  1.00 0.00 ? 107 LYS A CD   6  
ATOM 11045 C CE   . LYS A 1 107 ? -3.950  -1.254  -8.591  1.00 0.00 ? 107 LYS A CE   6  
ATOM 11046 N NZ   . LYS A 1 107 ? -4.541  -1.342  -9.955  1.00 0.00 ? 107 LYS A NZ   6  
ATOM 11047 H H    . LYS A 1 107 ? -5.566  -4.133  -4.460  1.00 0.00 ? 107 LYS A H    6  
ATOM 11048 H HA   . LYS A 1 107 ? -4.469  -5.017  -7.005  1.00 0.00 ? 107 LYS A HA   6  
ATOM 11049 H HB2  . LYS A 1 107 ? -3.227  -3.557  -4.669  1.00 0.00 ? 107 LYS A HB2  6  
ATOM 11050 H HB3  . LYS A 1 107 ? -2.360  -3.983  -6.139  1.00 0.00 ? 107 LYS A HB3  6  
ATOM 11051 H HG2  . LYS A 1 107 ? -4.754  -2.165  -5.961  1.00 0.00 ? 107 LYS A HG2  6  
ATOM 11052 H HG3  . LYS A 1 107 ? -3.076  -1.664  -6.183  1.00 0.00 ? 107 LYS A HG3  6  
ATOM 11053 H HD2  . LYS A 1 107 ? -3.133  -3.194  -8.262  1.00 0.00 ? 107 LYS A HD2  6  
ATOM 11054 H HD3  . LYS A 1 107 ? -4.887  -3.104  -8.092  1.00 0.00 ? 107 LYS A HD3  6  
ATOM 11055 H HE2  . LYS A 1 107 ? -4.524  -0.553  -8.004  1.00 0.00 ? 107 LYS A HE2  6  
ATOM 11056 H HE3  . LYS A 1 107 ? -2.930  -0.907  -8.671  1.00 0.00 ? 107 LYS A HE3  6  
ATOM 11057 H HZ1  . LYS A 1 107 ? -5.475  -0.884  -9.970  1.00 0.00 ? 107 LYS A HZ1  6  
ATOM 11058 H HZ2  . LYS A 1 107 ? -4.651  -2.337  -10.234 1.00 0.00 ? 107 LYS A HZ2  6  
ATOM 11059 H HZ3  . LYS A 1 107 ? -3.923  -0.867  -10.644 1.00 0.00 ? 107 LYS A HZ3  6  
ATOM 11060 N N    . THR A 1 108 ? -3.293  -7.091  -6.354  1.00 0.00 ? 108 THR A N    6  
ATOM 11061 C CA   . THR A 1 108 ? -2.671  -8.359  -5.993  1.00 0.00 ? 108 THR A CA   6  
ATOM 11062 C C    . THR A 1 108 ? -1.151  -8.249  -6.008  1.00 0.00 ? 108 THR A C    6  
ATOM 11063 O O    . THR A 1 108 ? -0.556  -7.865  -7.015  1.00 0.00 ? 108 THR A O    6  
ATOM 11064 C CB   . THR A 1 108 ? -3.103  -9.488  -6.948  1.00 0.00 ? 108 THR A CB   6  
ATOM 11065 O OG1  . THR A 1 108 ? -3.304  -8.965  -8.266  1.00 0.00 ? 108 THR A OG1  6  
ATOM 11066 C CG2  . THR A 1 108 ? -4.382  -10.151 -6.459  1.00 0.00 ? 108 THR A CG2  6  
ATOM 11067 H H    . THR A 1 108 ? -3.463  -6.893  -7.299  1.00 0.00 ? 108 THR A H    6  
ATOM 11068 H HA   . THR A 1 108 ? -2.994  -8.616  -4.995  1.00 0.00 ? 108 THR A HA   6  
ATOM 11069 H HB   . THR A 1 108 ? -2.319  -10.231 -6.979  1.00 0.00 ? 108 THR A HB   6  
ATOM 11070 H HG1  . THR A 1 108 ? -4.189  -8.600  -8.334  1.00 0.00 ? 108 THR A HG1  6  
ATOM 11071 H HG21 . THR A 1 108 ? -4.765  -9.609  -5.606  1.00 0.00 ? 108 THR A HG21 6  
ATOM 11072 H HG22 . THR A 1 108 ? -4.172  -11.171 -6.174  1.00 0.00 ? 108 THR A HG22 6  
ATOM 11073 H HG23 . THR A 1 108 ? -5.116  -10.142 -7.250  1.00 0.00 ? 108 THR A HG23 6  
ATOM 11074 N N    . VAL A 1 109 ? -0.527  -8.590  -4.885  1.00 0.00 ? 109 VAL A N    6  
ATOM 11075 C CA   . VAL A 1 109 ? 0.926   -8.532  -4.769  1.00 0.00 ? 109 VAL A CA   6  
ATOM 11076 C C    . VAL A 1 109 ? 1.526   -9.931  -4.679  1.00 0.00 ? 109 VAL A C    6  
ATOM 11077 O O    . VAL A 1 109 ? 1.189   -10.706 -3.784  1.00 0.00 ? 109 VAL A O    6  
ATOM 11078 C CB   . VAL A 1 109 ? 1.358   -7.719  -3.535  1.00 0.00 ? 109 VAL A CB   6  
ATOM 11079 C CG1  . VAL A 1 109 ? 0.802   -8.342  -2.263  1.00 0.00 ? 109 VAL A CG1  6  
ATOM 11080 C CG2  . VAL A 1 109 ? 2.875   -7.618  -3.469  1.00 0.00 ? 109 VAL A CG2  6  
ATOM 11081 H H    . VAL A 1 109 ? -1.056  -8.889  -4.116  1.00 0.00 ? 109 VAL A H    6  
ATOM 11082 H HA   . VAL A 1 109 ? 1.311   -8.041  -5.651  1.00 0.00 ? 109 VAL A HA   6  
ATOM 11083 H HB   . VAL A 1 109 ? 0.955   -6.721  -3.627  1.00 0.00 ? 109 VAL A HB   6  
ATOM 11084 H HG11 . VAL A 1 109 ? 0.074   -9.097  -2.521  1.00 0.00 ? 109 VAL A HG11 6  
ATOM 11085 H HG12 . VAL A 1 109 ? 1.606   -8.793  -1.701  1.00 0.00 ? 109 VAL A HG12 6  
ATOM 11086 H HG13 . VAL A 1 109 ? 0.329   -7.576  -1.665  1.00 0.00 ? 109 VAL A HG13 6  
ATOM 11087 H HG21 . VAL A 1 109 ? 3.156   -6.612  -3.193  1.00 0.00 ? 109 VAL A HG21 6  
ATOM 11088 H HG22 . VAL A 1 109 ? 3.251   -8.312  -2.732  1.00 0.00 ? 109 VAL A HG22 6  
ATOM 11089 H HG23 . VAL A 1 109 ? 3.294   -7.856  -4.435  1.00 0.00 ? 109 VAL A HG23 6  
ATOM 11090 N N    . ARG A 1 110 ? 2.418   -10.247 -5.612  1.00 0.00 ? 110 ARG A N    6  
ATOM 11091 C CA   . ARG A 1 110 ? 3.066   -11.553 -5.639  1.00 0.00 ? 110 ARG A CA   6  
ATOM 11092 C C    . ARG A 1 110 ? 4.454   -11.484 -5.009  1.00 0.00 ? 110 ARG A C    6  
ATOM 11093 O O    . ARG A 1 110 ? 5.385   -10.925 -5.589  1.00 0.00 ? 110 ARG A O    6  
ATOM 11094 C CB   . ARG A 1 110 ? 3.172   -12.064 -7.077  1.00 0.00 ? 110 ARG A CB   6  
ATOM 11095 C CG   . ARG A 1 110 ? 3.134   -13.579 -7.189  1.00 0.00 ? 110 ARG A CG   6  
ATOM 11096 C CD   . ARG A 1 110 ? 3.333   -14.037 -8.625  1.00 0.00 ? 110 ARG A CD   6  
ATOM 11097 N NE   . ARG A 1 110 ? 4.654   -13.678 -9.135  1.00 0.00 ? 110 ARG A NE   6  
ATOM 11098 C CZ   . ARG A 1 110 ? 4.935   -12.501 -9.684  1.00 0.00 ? 110 ARG A CZ   6  
ATOM 11099 N NH1  . ARG A 1 110 ? 3.992   -11.575 -9.792  1.00 0.00 ? 110 ARG A NH1  6  
ATOM 11100 N NH2  . ARG A 1 110 ? 6.160   -12.249 -10.125 1.00 0.00 ? 110 ARG A NH2  6  
ATOM 11101 H H    . ARG A 1 110 ? 2.646   -9.586  -6.300  1.00 0.00 ? 110 ARG A H    6  
ATOM 11102 H HA   . ARG A 1 110 ? 2.457   -12.237 -5.067  1.00 0.00 ? 110 ARG A HA   6  
ATOM 11103 H HB2  . ARG A 1 110 ? 2.350   -11.662 -7.651  1.00 0.00 ? 110 ARG A HB2  6  
ATOM 11104 H HB3  . ARG A 1 110 ? 4.101   -11.717 -7.502  1.00 0.00 ? 110 ARG A HB3  6  
ATOM 11105 H HG2  . ARG A 1 110 ? 3.920   -13.996 -6.577  1.00 0.00 ? 110 ARG A HG2  6  
ATOM 11106 H HG3  . ARG A 1 110 ? 2.176   -13.933 -6.837  1.00 0.00 ? 110 ARG A HG3  6  
ATOM 11107 H HD2  . ARG A 1 110 ? 3.222   -15.110 -8.666  1.00 0.00 ? 110 ARG A HD2  6  
ATOM 11108 H HD3  . ARG A 1 110 ? 2.580   -13.574 -9.244  1.00 0.00 ? 110 ARG A HD3  6  
ATOM 11109 H HE   . ARG A 1 110 ? 5.365   -14.347 -9.065  1.00 0.00 ? 110 ARG A HE   6  
ATOM 11110 H HH11 . ARG A 1 110 ? 3.068   -11.762 -9.459  1.00 0.00 ? 110 ARG A HH11 6  
ATOM 11111 H HH12 . ARG A 1 110 ? 4.206   -10.689 -10.204 1.00 0.00 ? 110 ARG A HH12 6  
ATOM 11112 H HH21 . ARG A 1 110 ? 6.873   -12.944 -10.045 1.00 0.00 ? 110 ARG A HH21 6  
ATOM 11113 H HH22 . ARG A 1 110 ? 6.370   -11.363 -10.537 1.00 0.00 ? 110 ARG A HH22 6  
ATOM 11114 N N    . THR A 1 111 ? 4.586   -12.057 -3.816  1.00 0.00 ? 111 THR A N    6  
ATOM 11115 C CA   . THR A 1 111 ? 5.858   -12.059 -3.106  1.00 0.00 ? 111 THR A CA   6  
ATOM 11116 C C    . THR A 1 111 ? 6.796   -13.124 -3.662  1.00 0.00 ? 111 THR A C    6  
ATOM 11117 O O    . THR A 1 111 ? 6.606   -14.318 -3.429  1.00 0.00 ? 111 THR A O    6  
ATOM 11118 C CB   . THR A 1 111 ? 5.660   -12.303 -1.598  1.00 0.00 ? 111 THR A CB   6  
ATOM 11119 O OG1  . THR A 1 111 ? 4.986   -13.549 -1.388  1.00 0.00 ? 111 THR A OG1  6  
ATOM 11120 C CG2  . THR A 1 111 ? 4.858   -11.174 -0.968  1.00 0.00 ? 111 THR A CG2  6  
ATOM 11121 H H    . THR A 1 111 ? 3.807   -12.486 -3.405  1.00 0.00 ? 111 THR A H    6  
ATOM 11122 H HA   . THR A 1 111 ? 6.314   -11.088 -3.235  1.00 0.00 ? 111 THR A HA   6  
ATOM 11123 H HB   . THR A 1 111 ? 6.631   -12.344 -1.125  1.00 0.00 ? 111 THR A HB   6  
ATOM 11124 H HG1  . THR A 1 111 ? 4.471   -13.770 -2.168  1.00 0.00 ? 111 THR A HG1  6  
ATOM 11125 H HG21 . THR A 1 111 ? 4.474   -10.529 -1.744  1.00 0.00 ? 111 THR A HG21 6  
ATOM 11126 H HG22 . THR A 1 111 ? 5.496   -10.605 -0.308  1.00 0.00 ? 111 THR A HG22 6  
ATOM 11127 H HG23 . THR A 1 111 ? 4.036   -11.589 -0.405  1.00 0.00 ? 111 THR A HG23 6  
ATOM 11128 N N    . THR A 1 112 ? 7.811   -12.685 -4.401  1.00 0.00 ? 112 THR A N    6  
ATOM 11129 C CA   . THR A 1 112 ? 8.779   -13.601 -4.991  1.00 0.00 ? 112 THR A CA   6  
ATOM 11130 C C    . THR A 1 112 ? 9.239   -14.643 -3.978  1.00 0.00 ? 112 THR A C    6  
ATOM 11131 O O    . THR A 1 112 ? 9.036   -14.484 -2.775  1.00 0.00 ? 112 THR A O    6  
ATOM 11132 C CB   . THR A 1 112 ? 10.010  -12.847 -5.530  1.00 0.00 ? 112 THR A CB   6  
ATOM 11133 O OG1  . THR A 1 112 ? 10.930  -13.771 -6.121  1.00 0.00 ? 112 THR A OG1  6  
ATOM 11134 C CG2  . THR A 1 112 ? 10.702  -12.076 -4.417  1.00 0.00 ? 112 THR A CG2  6  
ATOM 11135 H H    . THR A 1 112 ? 7.910   -11.722 -4.551  1.00 0.00 ? 112 THR A H    6  
ATOM 11136 H HA   . THR A 1 112 ? 8.300   -14.104 -5.819  1.00 0.00 ? 112 THR A HA   6  
ATOM 11137 H HB   . THR A 1 112 ? 9.681   -12.146 -6.284  1.00 0.00 ? 112 THR A HB   6  
ATOM 11138 H HG1  . THR A 1 112 ? 11.428  -14.214 -5.429  1.00 0.00 ? 112 THR A HG1  6  
ATOM 11139 H HG21 . THR A 1 112 ? 10.216  -12.287 -3.476  1.00 0.00 ? 112 THR A HG21 6  
ATOM 11140 H HG22 . THR A 1 112 ? 10.644  -11.017 -4.622  1.00 0.00 ? 112 THR A HG22 6  
ATOM 11141 H HG23 . THR A 1 112 ? 11.738  -12.376 -4.362  1.00 0.00 ? 112 THR A HG23 6  
ATOM 11142 N N    . GLU A 1 113 ? 9.861   -15.709 -4.473  1.00 0.00 ? 113 GLU A N    6  
ATOM 11143 C CA   . GLU A 1 113 ? 10.349  -16.777 -3.609  1.00 0.00 ? 113 GLU A CA   6  
ATOM 11144 C C    . GLU A 1 113 ? 11.840  -16.610 -3.327  1.00 0.00 ? 113 GLU A C    6  
ATOM 11145 O O    . GLU A 1 113 ? 12.267  -16.613 -2.173  1.00 0.00 ? 113 GLU A O    6  
ATOM 11146 C CB   . GLU A 1 113 ? 10.090  -18.141 -4.251  1.00 0.00 ? 113 GLU A CB   6  
ATOM 11147 C CG   . GLU A 1 113 ? 8.715   -18.709 -3.941  1.00 0.00 ? 113 GLU A CG   6  
ATOM 11148 C CD   . GLU A 1 113 ? 8.618   -20.194 -4.230  1.00 0.00 ? 113 GLU A CD   6  
ATOM 11149 O OE1  . GLU A 1 113 ? 9.143   -20.631 -5.275  1.00 0.00 ? 113 GLU A OE1  6  
ATOM 11150 O OE2  . GLU A 1 113 ? 8.017   -20.920 -3.411  1.00 0.00 ? 113 GLU A OE2  6  
ATOM 11151 H H    . GLU A 1 113 ? 9.993   -15.779 -5.441  1.00 0.00 ? 113 GLU A H    6  
ATOM 11152 H HA   . GLU A 1 113 ? 9.810   -16.721 -2.675  1.00 0.00 ? 113 GLU A HA   6  
ATOM 11153 H HB2  . GLU A 1 113 ? 10.184  -18.045 -5.323  1.00 0.00 ? 113 GLU A HB2  6  
ATOM 11154 H HB3  . GLU A 1 113 ? 10.833  -18.840 -3.895  1.00 0.00 ? 113 GLU A HB3  6  
ATOM 11155 H HG2  . GLU A 1 113 ? 8.500   -18.547 -2.895  1.00 0.00 ? 113 GLU A HG2  6  
ATOM 11156 H HG3  . GLU A 1 113 ? 7.982   -18.191 -4.542  1.00 0.00 ? 113 GLU A HG3  6  
ATOM 11157 N N    . GLU A 1 114 ? 12.624  -16.465 -4.391  1.00 0.00 ? 114 GLU A N    6  
ATOM 11158 C CA   . GLU A 1 114 ? 14.067  -16.299 -4.258  1.00 0.00 ? 114 GLU A CA   6  
ATOM 11159 C C    . GLU A 1 114 ? 14.578  -15.214 -5.201  1.00 0.00 ? 114 GLU A C    6  
ATOM 11160 O O    . GLU A 1 114 ? 14.106  -15.085 -6.330  1.00 0.00 ? 114 GLU A O    6  
ATOM 11161 C CB   . GLU A 1 114 ? 14.784  -17.620 -4.545  1.00 0.00 ? 114 GLU A CB   6  
ATOM 11162 C CG   . GLU A 1 114 ? 16.248  -17.619 -4.138  1.00 0.00 ? 114 GLU A CG   6  
ATOM 11163 C CD   . GLU A 1 114 ? 16.440  -17.833 -2.649  1.00 0.00 ? 114 GLU A CD   6  
ATOM 11164 O OE1  . GLU A 1 114 ? 16.541  -19.004 -2.227  1.00 0.00 ? 114 GLU A OE1  6  
ATOM 11165 O OE2  . GLU A 1 114 ? 16.488  -16.830 -1.907  1.00 0.00 ? 114 GLU A OE2  6  
ATOM 11166 H H    . GLU A 1 114 ? 12.224  -16.471 -5.285  1.00 0.00 ? 114 GLU A H    6  
ATOM 11167 H HA   . GLU A 1 114 ? 14.274  -16.002 -3.241  1.00 0.00 ? 114 GLU A HA   6  
ATOM 11168 H HB2  . GLU A 1 114 ? 14.283  -18.412 -4.009  1.00 0.00 ? 114 GLU A HB2  6  
ATOM 11169 H HB3  . GLU A 1 114 ? 14.727  -17.822 -5.604  1.00 0.00 ? 114 GLU A HB3  6  
ATOM 11170 H HG2  . GLU A 1 114 ? 16.756  -18.410 -4.668  1.00 0.00 ? 114 GLU A HG2  6  
ATOM 11171 H HG3  . GLU A 1 114 ? 16.683  -16.668 -4.410  1.00 0.00 ? 114 GLU A HG3  6  
ATOM 11172 N N    . SER A 1 115 ? 15.547  -14.435 -4.728  1.00 0.00 ? 115 SER A N    6  
ATOM 11173 C CA   . SER A 1 115 ? 16.120  -13.358 -5.527  1.00 0.00 ? 115 SER A CA   6  
ATOM 11174 C C    . SER A 1 115 ? 17.146  -13.902 -6.516  1.00 0.00 ? 115 SER A C    6  
ATOM 11175 O O    . SER A 1 115 ? 18.313  -14.090 -6.177  1.00 0.00 ? 115 SER A O    6  
ATOM 11176 C CB   . SER A 1 115 ? 16.774  -12.314 -4.619  1.00 0.00 ? 115 SER A CB   6  
ATOM 11177 O OG   . SER A 1 115 ? 15.815  -11.701 -3.775  1.00 0.00 ? 115 SER A OG   6  
ATOM 11178 H H    . SER A 1 115 ? 15.881  -14.588 -3.819  1.00 0.00 ? 115 SER A H    6  
ATOM 11179 H HA   . SER A 1 115 ? 15.318  -12.891 -6.078  1.00 0.00 ? 115 SER A HA   6  
ATOM 11180 H HB2  . SER A 1 115 ? 17.522  -12.793 -4.006  1.00 0.00 ? 115 SER A HB2  6  
ATOM 11181 H HB3  . SER A 1 115 ? 17.240  -11.553 -5.228  1.00 0.00 ? 115 SER A HB3  6  
ATOM 11182 H HG   . SER A 1 115 ? 14.961  -11.693 -4.212  1.00 0.00 ? 115 SER A HG   6  
ATOM 11183 N N    . GLY A 1 116 ? 16.700  -14.154 -7.743  1.00 0.00 ? 116 GLY A N    6  
ATOM 11184 C CA   . GLY A 1 116 ? 17.590  -14.674 -8.764  1.00 0.00 ? 116 GLY A CA   6  
ATOM 11185 C C    . GLY A 1 116 ? 18.023  -13.610 -9.754  1.00 0.00 ? 116 GLY A C    6  
ATOM 11186 O O    . GLY A 1 116 ? 18.943  -12.833 -9.499  1.00 0.00 ? 116 GLY A O    6  
ATOM 11187 H H    . GLY A 1 116 ? 15.758  -13.985 -7.957  1.00 0.00 ? 116 GLY A H    6  
ATOM 11188 H HA2  . GLY A 1 116 ? 18.468  -15.084 -8.286  1.00 0.00 ? 116 GLY A HA2  6  
ATOM 11189 H HA3  . GLY A 1 116 ? 17.083  -15.463 -9.300  1.00 0.00 ? 116 GLY A HA3  6  
ATOM 11190 N N    . PRO A 1 117 ? 17.350  -13.567 -10.913 1.00 0.00 ? 117 PRO A N    6  
ATOM 11191 C CA   . PRO A 1 117 ? 17.653  -12.596 -11.969 1.00 0.00 ? 117 PRO A CA   6  
ATOM 11192 C C    . PRO A 1 117 ? 17.263  -11.175 -11.577 1.00 0.00 ? 117 PRO A C    6  
ATOM 11193 O O    . PRO A 1 117 ? 16.080  -10.844 -11.501 1.00 0.00 ? 117 PRO A O    6  
ATOM 11194 C CB   . PRO A 1 117 ? 16.805  -13.077 -13.148 1.00 0.00 ? 117 PRO A CB   6  
ATOM 11195 C CG   . PRO A 1 117 ? 15.679  -13.827 -12.524 1.00 0.00 ? 117 PRO A CG   6  
ATOM 11196 C CD   . PRO A 1 117 ? 16.242  -14.464 -11.284 1.00 0.00 ? 117 PRO A CD   6  
ATOM 11197 H HA   . PRO A 1 117 ? 18.698  -12.619 -12.241 1.00 0.00 ? 117 PRO A HA   6  
ATOM 11198 H HB2  . PRO A 1 117 ? 16.450  -12.225 -13.711 1.00 0.00 ? 117 PRO A HB2  6  
ATOM 11199 H HB3  . PRO A 1 117 ? 17.398  -13.715 -13.786 1.00 0.00 ? 117 PRO A HB3  6  
ATOM 11200 H HG2  . PRO A 1 117 ? 14.882  -13.145 -12.267 1.00 0.00 ? 117 PRO A HG2  6  
ATOM 11201 H HG3  . PRO A 1 117 ? 15.321  -14.585 -13.205 1.00 0.00 ? 117 PRO A HG3  6  
ATOM 11202 H HD2  . PRO A 1 117 ? 15.496  -14.496 -10.504 1.00 0.00 ? 117 PRO A HD2  6  
ATOM 11203 H HD3  . PRO A 1 117 ? 16.607  -15.457 -11.502 1.00 0.00 ? 117 PRO A HD3  6  
ATOM 11204 N N    . SER A 1 118 ? 18.266  -10.338 -11.331 1.00 0.00 ? 118 SER A N    6  
ATOM 11205 C CA   . SER A 1 118 ? 18.028  -8.952  -10.944 1.00 0.00 ? 118 SER A CA   6  
ATOM 11206 C C    . SER A 1 118 ? 19.221  -8.074  -11.307 1.00 0.00 ? 118 SER A C    6  
ATOM 11207 O O    . SER A 1 118 ? 20.274  -8.571  -11.706 1.00 0.00 ? 118 SER A O    6  
ATOM 11208 C CB   . SER A 1 118 ? 17.751  -8.860  -9.442  1.00 0.00 ? 118 SER A CB   6  
ATOM 11209 O OG   . SER A 1 118 ? 16.448  -9.327  -9.134  1.00 0.00 ? 118 SER A OG   6  
ATOM 11210 H H    . SER A 1 118 ? 19.188  -10.661 -11.408 1.00 0.00 ? 118 SER A H    6  
ATOM 11211 H HA   . SER A 1 118 ? 17.160  -8.602  -11.483 1.00 0.00 ? 118 SER A HA   6  
ATOM 11212 H HB2  . SER A 1 118 ? 18.471  -9.461  -8.908  1.00 0.00 ? 118 SER A HB2  6  
ATOM 11213 H HB3  . SER A 1 118 ? 17.836  -7.830  -9.125  1.00 0.00 ? 118 SER A HB3  6  
ATOM 11214 H HG   . SER A 1 118 ? 15.842  -8.583  -9.097  1.00 0.00 ? 118 SER A HG   6  
ATOM 11215 N N    . SER A 1 119 ? 19.048  -6.763  -11.165 1.00 0.00 ? 119 SER A N    6  
ATOM 11216 C CA   . SER A 1 119 ? 20.109  -5.814  -11.481 1.00 0.00 ? 119 SER A CA   6  
ATOM 11217 C C    . SER A 1 119 ? 20.941  -5.496  -10.243 1.00 0.00 ? 119 SER A C    6  
ATOM 11218 O O    . SER A 1 119 ? 22.170  -5.531  -10.281 1.00 0.00 ? 119 SER A O    6  
ATOM 11219 C CB   . SER A 1 119 ? 19.515  -4.526  -12.054 1.00 0.00 ? 119 SER A CB   6  
ATOM 11220 O OG   . SER A 1 119 ? 20.534  -3.604  -12.401 1.00 0.00 ? 119 SER A OG   6  
ATOM 11221 H H    . SER A 1 119 ? 18.186  -6.427  -10.842 1.00 0.00 ? 119 SER A H    6  
ATOM 11222 H HA   . SER A 1 119 ? 20.748  -6.267  -12.224 1.00 0.00 ? 119 SER A HA   6  
ATOM 11223 H HB2  . SER A 1 119 ? 18.941  -4.759  -12.939 1.00 0.00 ? 119 SER A HB2  6  
ATOM 11224 H HB3  . SER A 1 119 ? 18.870  -4.071  -11.317 1.00 0.00 ? 119 SER A HB3  6  
ATOM 11225 H HG   . SER A 1 119 ? 21.193  -4.044  -12.942 1.00 0.00 ? 119 SER A HG   6  
ATOM 11226 N N    . GLY A 1 120 ? 20.260  -5.186  -9.143  1.00 0.00 ? 120 GLY A N    6  
ATOM 11227 C CA   . GLY A 1 120 ? 20.951  -4.866  -7.908  1.00 0.00 ? 120 GLY A CA   6  
ATOM 11228 C C    . GLY A 1 120 ? 20.710  -3.438  -7.462  1.00 0.00 ? 120 GLY A C    6  
ATOM 11229 O O    . GLY A 1 120 ? 21.003  -3.079  -6.321  1.00 0.00 ? 120 GLY A O    6  
ATOM 11230 H H    . GLY A 1 120 ? 19.280  -5.174  -9.171  1.00 0.00 ? 120 GLY A H    6  
ATOM 11231 H HA2  . GLY A 1 120 ? 20.610  -5.537  -7.133  1.00 0.00 ? 120 GLY A HA2  6  
ATOM 11232 H HA3  . GLY A 1 120 ? 22.012  -5.011  -8.054  1.00 0.00 ? 120 GLY A HA3  6  
ATOM 11233 N N    . GLY A 1 1   ? -26.916 24.474  17.066  1.00 0.00 ? 1   GLY A N    7  
ATOM 11234 C CA   . GLY A 1 1   ? -25.743 24.950  17.776  1.00 0.00 ? 1   GLY A CA   7  
ATOM 11235 C C    . GLY A 1 1   ? -24.652 25.429  16.840  1.00 0.00 ? 1   GLY A C    7  
ATOM 11236 O O    . GLY A 1 1   ? -24.929 25.841  15.713  1.00 0.00 ? 1   GLY A O    7  
ATOM 11237 H H1   . GLY A 1 1   ? -27.731 25.018  17.052  1.00 0.00 ? 1   GLY A H1   7  
ATOM 11238 H HA2  . GLY A 1 1   ? -26.033 25.765  18.422  1.00 0.00 ? 1   GLY A HA2  7  
ATOM 11239 H HA3  . GLY A 1 1   ? -25.353 24.145  18.382  1.00 0.00 ? 1   GLY A HA3  7  
ATOM 11240 N N    . SER A 1 2   ? -23.409 25.378  17.306  1.00 0.00 ? 2   SER A N    7  
ATOM 11241 C CA   . SER A 1 2   ? -22.272 25.816  16.504  1.00 0.00 ? 2   SER A CA   7  
ATOM 11242 C C    . SER A 1 2   ? -21.276 24.677  16.306  1.00 0.00 ? 2   SER A C    7  
ATOM 11243 O O    . SER A 1 2   ? -21.000 24.269  15.178  1.00 0.00 ? 2   SER A O    7  
ATOM 11244 C CB   . SER A 1 2   ? -21.579 27.005  17.171  1.00 0.00 ? 2   SER A CB   7  
ATOM 11245 O OG   . SER A 1 2   ? -21.208 26.698  18.504  1.00 0.00 ? 2   SER A OG   7  
ATOM 11246 H H    . SER A 1 2   ? -23.252 25.040  18.213  1.00 0.00 ? 2   SER A H    7  
ATOM 11247 H HA   . SER A 1 2   ? -22.647 26.123  15.539  1.00 0.00 ? 2   SER A HA   7  
ATOM 11248 H HB2  . SER A 1 2   ? -20.691 27.260  16.613  1.00 0.00 ? 2   SER A HB2  7  
ATOM 11249 H HB3  . SER A 1 2   ? -22.251 27.851  17.183  1.00 0.00 ? 2   SER A HB3  7  
ATOM 11250 H HG   . SER A 1 2   ? -20.796 27.465  18.907  1.00 0.00 ? 2   SER A HG   7  
ATOM 11251 N N    . SER A 1 3   ? -20.741 24.169  17.411  1.00 0.00 ? 3   SER A N    7  
ATOM 11252 C CA   . SER A 1 3   ? -19.772 23.080  17.360  1.00 0.00 ? 3   SER A CA   7  
ATOM 11253 C C    . SER A 1 3   ? -20.466 21.729  17.504  1.00 0.00 ? 3   SER A C    7  
ATOM 11254 O O    . SER A 1 3   ? -21.496 21.614  18.166  1.00 0.00 ? 3   SER A O    7  
ATOM 11255 C CB   . SER A 1 3   ? -18.726 23.248  18.463  1.00 0.00 ? 3   SER A CB   7  
ATOM 11256 O OG   . SER A 1 3   ? -17.800 24.271  18.136  1.00 0.00 ? 3   SER A OG   7  
ATOM 11257 H H    . SER A 1 3   ? -21.002 24.537  18.281  1.00 0.00 ? 3   SER A H    7  
ATOM 11258 H HA   . SER A 1 3   ? -19.280 23.118  16.400  1.00 0.00 ? 3   SER A HA   7  
ATOM 11259 H HB2  . SER A 1 3   ? -19.219 23.507  19.387  1.00 0.00 ? 3   SER A HB2  7  
ATOM 11260 H HB3  . SER A 1 3   ? -18.188 22.319  18.590  1.00 0.00 ? 3   SER A HB3  7  
ATOM 11261 H HG   . SER A 1 3   ? -18.212 24.894  17.533  1.00 0.00 ? 3   SER A HG   7  
ATOM 11262 N N    . GLY A 1 4   ? -19.893 20.706  16.876  1.00 0.00 ? 4   GLY A N    7  
ATOM 11263 C CA   . GLY A 1 4   ? -20.469 19.376  16.945  1.00 0.00 ? 4   GLY A CA   7  
ATOM 11264 C C    . GLY A 1 4   ? -20.104 18.523  15.746  1.00 0.00 ? 4   GLY A C    7  
ATOM 11265 O O    . GLY A 1 4   ? -20.122 18.997  14.610  1.00 0.00 ? 4   GLY A O    7  
ATOM 11266 H H    . GLY A 1 4   ? -19.072 20.857  16.362  1.00 0.00 ? 4   GLY A H    7  
ATOM 11267 H HA2  . GLY A 1 4   ? -20.115 18.889  17.841  1.00 0.00 ? 4   GLY A HA2  7  
ATOM 11268 H HA3  . GLY A 1 4   ? -21.544 19.464  16.995  1.00 0.00 ? 4   GLY A HA3  7  
ATOM 11269 N N    . SER A 1 5   ? -19.769 17.262  15.999  1.00 0.00 ? 5   SER A N    7  
ATOM 11270 C CA   . SER A 1 5   ? -19.393 16.342  14.932  1.00 0.00 ? 5   SER A CA   7  
ATOM 11271 C C    . SER A 1 5   ? -20.515 15.348  14.650  1.00 0.00 ? 5   SER A C    7  
ATOM 11272 O O    . SER A 1 5   ? -20.268 14.163  14.425  1.00 0.00 ? 5   SER A O    7  
ATOM 11273 C CB   . SER A 1 5   ? -18.113 15.592  15.305  1.00 0.00 ? 5   SER A CB   7  
ATOM 11274 O OG   . SER A 1 5   ? -17.018 16.482  15.429  1.00 0.00 ? 5   SER A OG   7  
ATOM 11275 H H    . SER A 1 5   ? -19.774 16.943  16.926  1.00 0.00 ? 5   SER A H    7  
ATOM 11276 H HA   . SER A 1 5   ? -19.212 16.925  14.041  1.00 0.00 ? 5   SER A HA   7  
ATOM 11277 H HB2  . SER A 1 5   ? -18.257 15.084  16.246  1.00 0.00 ? 5   SER A HB2  7  
ATOM 11278 H HB3  . SER A 1 5   ? -17.887 14.867  14.536  1.00 0.00 ? 5   SER A HB3  7  
ATOM 11279 H HG   . SER A 1 5   ? -16.563 16.317  16.259  1.00 0.00 ? 5   SER A HG   7  
ATOM 11280 N N    . SER A 1 6   ? -21.750 15.839  14.665  1.00 0.00 ? 6   SER A N    7  
ATOM 11281 C CA   . SER A 1 6   ? -22.912 14.994  14.416  1.00 0.00 ? 6   SER A CA   7  
ATOM 11282 C C    . SER A 1 6   ? -22.591 13.921  13.380  1.00 0.00 ? 6   SER A C    7  
ATOM 11283 O O    . SER A 1 6   ? -22.796 12.732  13.617  1.00 0.00 ? 6   SER A O    7  
ATOM 11284 C CB   . SER A 1 6   ? -24.093 15.842  13.940  1.00 0.00 ? 6   SER A CB   7  
ATOM 11285 O OG   . SER A 1 6   ? -25.327 15.257  14.319  1.00 0.00 ? 6   SER A OG   7  
ATOM 11286 H H    . SER A 1 6   ? -21.883 16.792  14.851  1.00 0.00 ? 6   SER A H    7  
ATOM 11287 H HA   . SER A 1 6   ? -23.177 14.512  15.345  1.00 0.00 ? 6   SER A HA   7  
ATOM 11288 H HB2  . SER A 1 6   ? -24.026 16.827  14.377  1.00 0.00 ? 6   SER A HB2  7  
ATOM 11289 H HB3  . SER A 1 6   ? -24.063 15.924  12.863  1.00 0.00 ? 6   SER A HB3  7  
ATOM 11290 H HG   . SER A 1 6   ? -25.716 14.811  13.563  1.00 0.00 ? 6   SER A HG   7  
ATOM 11291 N N    . GLY A 1 7   ? -22.086 14.352  12.228  1.00 0.00 ? 7   GLY A N    7  
ATOM 11292 C CA   . GLY A 1 7   ? -21.745 13.417  11.171  1.00 0.00 ? 7   GLY A CA   7  
ATOM 11293 C C    . GLY A 1 7   ? -22.743 13.441  10.031  1.00 0.00 ? 7   GLY A C    7  
ATOM 11294 O O    . GLY A 1 7   ? -23.533 12.511  9.870   1.00 0.00 ? 7   GLY A O    7  
ATOM 11295 H H    . GLY A 1 7   ? -21.945 15.313  12.094  1.00 0.00 ? 7   GLY A H    7  
ATOM 11296 H HA2  . GLY A 1 7   ? -20.768 13.668  10.786  1.00 0.00 ? 7   GLY A HA2  7  
ATOM 11297 H HA3  . GLY A 1 7   ? -21.713 12.420  11.586  1.00 0.00 ? 7   GLY A HA3  7  
ATOM 11298 N N    . ARG A 1 8   ? -22.710 14.508  9.239   1.00 0.00 ? 8   ARG A N    7  
ATOM 11299 C CA   . ARG A 1 8   ? -23.621 14.650  8.110   1.00 0.00 ? 8   ARG A CA   7  
ATOM 11300 C C    . ARG A 1 8   ? -22.898 14.387  6.792   1.00 0.00 ? 8   ARG A C    7  
ATOM 11301 O O    . ARG A 1 8   ? -23.466 13.808  5.867   1.00 0.00 ? 8   ARG A O    7  
ATOM 11302 C CB   . ARG A 1 8   ? -24.235 16.051  8.096   1.00 0.00 ? 8   ARG A CB   7  
ATOM 11303 C CG   . ARG A 1 8   ? -23.219 17.164  8.295   1.00 0.00 ? 8   ARG A CG   7  
ATOM 11304 C CD   . ARG A 1 8   ? -23.642 18.438  7.580   1.00 0.00 ? 8   ARG A CD   7  
ATOM 11305 N NE   . ARG A 1 8   ? -24.441 19.308  8.439   1.00 0.00 ? 8   ARG A NE   7  
ATOM 11306 C CZ   . ARG A 1 8   ? -24.631 20.601  8.203   1.00 0.00 ? 8   ARG A CZ   7  
ATOM 11307 N NH1  . ARG A 1 8   ? -24.082 21.171  7.139   1.00 0.00 ? 8   ARG A NH1  7  
ATOM 11308 N NH2  . ARG A 1 8   ? -25.371 21.327  9.031   1.00 0.00 ? 8   ARG A NH2  7  
ATOM 11309 H H    . ARG A 1 8   ? -22.057 15.217  9.419   1.00 0.00 ? 8   ARG A H    7  
ATOM 11310 H HA   . ARG A 1 8   ? -24.409 13.922  8.226   1.00 0.00 ? 8   ARG A HA   7  
ATOM 11311 H HB2  . ARG A 1 8   ? -24.726 16.207  7.147   1.00 0.00 ? 8   ARG A HB2  7  
ATOM 11312 H HB3  . ARG A 1 8   ? -24.968 16.117  8.886   1.00 0.00 ? 8   ARG A HB3  7  
ATOM 11313 H HG2  . ARG A 1 8   ? -23.127 17.370  9.351   1.00 0.00 ? 8   ARG A HG2  7  
ATOM 11314 H HG3  . ARG A 1 8   ? -22.266 16.841  7.904   1.00 0.00 ? 8   ARG A HG3  7  
ATOM 11315 H HD2  . ARG A 1 8   ? -22.756 18.971  7.269   1.00 0.00 ? 8   ARG A HD2  7  
ATOM 11316 H HD3  . ARG A 1 8   ? -24.225 18.171  6.712   1.00 0.00 ? 8   ARG A HD3  7  
ATOM 11317 H HE   . ARG A 1 8   ? -24.855 18.907  9.231   1.00 0.00 ? 8   ARG A HE   7  
ATOM 11318 H HH11 . ARG A 1 8   ? -23.525 20.626  6.512   1.00 0.00 ? 8   ARG A HH11 7  
ATOM 11319 H HH12 . ARG A 1 8   ? -24.228 22.145  6.962   1.00 0.00 ? 8   ARG A HH12 7  
ATOM 11320 H HH21 . ARG A 1 8   ? -25.786 20.900  9.834   1.00 0.00 ? 8   ARG A HH21 7  
ATOM 11321 H HH22 . ARG A 1 8   ? -25.513 22.300  8.852   1.00 0.00 ? 8   ARG A HH22 7  
ATOM 11322 N N    . GLN A 1 9   ? -21.643 14.818  6.715   1.00 0.00 ? 9   GLN A N    7  
ATOM 11323 C CA   . GLN A 1 9   ? -20.844 14.630  5.510   1.00 0.00 ? 9   GLN A CA   7  
ATOM 11324 C C    . GLN A 1 9   ? -20.295 13.209  5.437   1.00 0.00 ? 9   GLN A C    7  
ATOM 11325 O O    . GLN A 1 9   ? -19.621 12.841  4.475   1.00 0.00 ? 9   GLN A O    7  
ATOM 11326 C CB   . GLN A 1 9   ? -19.692 15.636  5.474   1.00 0.00 ? 9   GLN A CB   7  
ATOM 11327 C CG   . GLN A 1 9   ? -18.532 15.266  6.384   1.00 0.00 ? 9   GLN A CG   7  
ATOM 11328 C CD   . GLN A 1 9   ? -17.287 16.085  6.106   1.00 0.00 ? 9   GLN A CD   7  
ATOM 11329 O OE1  . GLN A 1 9   ? -17.094 16.585  4.997   1.00 0.00 ? 9   GLN A OE1  7  
ATOM 11330 N NE2  . GLN A 1 9   ? -16.435 16.229  7.114   1.00 0.00 ? 9   GLN A NE2  7  
ATOM 11331 H H    . GLN A 1 9   ? -21.245 15.272  7.486   1.00 0.00 ? 9   GLN A H    7  
ATOM 11332 H HA   . GLN A 1 9   ? -21.484 14.800  4.658   1.00 0.00 ? 9   GLN A HA   7  
ATOM 11333 H HB2  . GLN A 1 9   ? -19.321 15.705  4.463   1.00 0.00 ? 9   GLN A HB2  7  
ATOM 11334 H HB3  . GLN A 1 9   ? -20.065 16.603  5.779   1.00 0.00 ? 9   GLN A HB3  7  
ATOM 11335 H HG2  . GLN A 1 9   ? -18.829 15.428  7.410   1.00 0.00 ? 9   GLN A HG2  7  
ATOM 11336 H HG3  . GLN A 1 9   ? -18.298 14.221  6.239   1.00 0.00 ? 9   GLN A HG3  7  
ATOM 11337 H HE21 . GLN A 1 9   ? -16.655 15.802  7.969   1.00 0.00 ? 9   GLN A HE21 7  
ATOM 11338 H HE22 . GLN A 1 9   ? -15.622 16.753  6.962   1.00 0.00 ? 9   GLN A HE22 7  
ATOM 11339 N N    . VAL A 1 10  ? -20.589 12.413  6.460   1.00 0.00 ? 10  VAL A N    7  
ATOM 11340 C CA   . VAL A 1 10  ? -20.126 11.031  6.511   1.00 0.00 ? 10  VAL A CA   7  
ATOM 11341 C C    . VAL A 1 10  ? -20.583 10.252  5.283   1.00 0.00 ? 10  VAL A C    7  
ATOM 11342 O O    . VAL A 1 10  ? -19.767 9.841   4.458   1.00 0.00 ? 10  VAL A O    7  
ATOM 11343 C CB   . VAL A 1 10  ? -20.634 10.316  7.777   1.00 0.00 ? 10  VAL A CB   7  
ATOM 11344 C CG1  . VAL A 1 10  ? -19.976 8.951   7.920   1.00 0.00 ? 10  VAL A CG1  7  
ATOM 11345 C CG2  . VAL A 1 10  ? -20.380 11.170  9.010   1.00 0.00 ? 10  VAL A CG2  7  
ATOM 11346 H H    . VAL A 1 10  ? -21.131 12.763  7.197   1.00 0.00 ? 10  VAL A H    7  
ATOM 11347 H HA   . VAL A 1 10  ? -19.046 11.042  6.537   1.00 0.00 ? 10  VAL A HA   7  
ATOM 11348 H HB   . VAL A 1 10  ? -21.699 10.168  7.680   1.00 0.00 ? 10  VAL A HB   7  
ATOM 11349 H HG11 . VAL A 1 10  ? -18.919 9.039   7.717   1.00 0.00 ? 10  VAL A HG11 7  
ATOM 11350 H HG12 . VAL A 1 10  ? -20.122 8.584   8.925   1.00 0.00 ? 10  VAL A HG12 7  
ATOM 11351 H HG13 . VAL A 1 10  ? -20.421 8.263   7.216   1.00 0.00 ? 10  VAL A HG13 7  
ATOM 11352 H HG21 . VAL A 1 10  ? -19.960 10.556  9.792   1.00 0.00 ? 10  VAL A HG21 7  
ATOM 11353 H HG22 . VAL A 1 10  ? -19.688 11.962  8.763   1.00 0.00 ? 10  VAL A HG22 7  
ATOM 11354 H HG23 . VAL A 1 10  ? -21.311 11.599  9.349   1.00 0.00 ? 10  VAL A HG23 7  
ATOM 11355 N N    . GLN A 1 11  ? -21.893 10.055  5.167   1.00 0.00 ? 11  GLN A N    7  
ATOM 11356 C CA   . GLN A 1 11  ? -22.458 9.325   4.039   1.00 0.00 ? 11  GLN A CA   7  
ATOM 11357 C C    . GLN A 1 11  ? -22.638 10.241  2.833   1.00 0.00 ? 11  GLN A C    7  
ATOM 11358 O O    . GLN A 1 11  ? -23.477 9.989   1.968   1.00 0.00 ? 11  GLN A O    7  
ATOM 11359 C CB   . GLN A 1 11  ? -23.801 8.704   4.427   1.00 0.00 ? 11  GLN A CB   7  
ATOM 11360 C CG   . GLN A 1 11  ? -23.745 7.885   5.707   1.00 0.00 ? 11  GLN A CG   7  
ATOM 11361 C CD   . GLN A 1 11  ? -24.861 6.863   5.795   1.00 0.00 ? 11  GLN A CD   7  
ATOM 11362 O OE1  . GLN A 1 11  ? -25.392 6.417   4.777   1.00 0.00 ? 11  GLN A OE1  7  
ATOM 11363 N NE2  . GLN A 1 11  ? -25.223 6.486   7.016   1.00 0.00 ? 11  GLN A NE2  7  
ATOM 11364 H H    . GLN A 1 11  ? -22.492 10.408  5.857   1.00 0.00 ? 11  GLN A H    7  
ATOM 11365 H HA   . GLN A 1 11  ? -21.770 8.536   3.776   1.00 0.00 ? 11  GLN A HA   7  
ATOM 11366 H HB2  . GLN A 1 11  ? -24.524 9.494   4.563   1.00 0.00 ? 11  GLN A HB2  7  
ATOM 11367 H HB3  . GLN A 1 11  ? -24.130 8.058   3.627   1.00 0.00 ? 11  GLN A HB3  7  
ATOM 11368 H HG2  . GLN A 1 11  ? -22.799 7.365   5.745   1.00 0.00 ? 11  GLN A HG2  7  
ATOM 11369 H HG3  . GLN A 1 11  ? -23.821 8.554   6.551   1.00 0.00 ? 11  GLN A HG3  7  
ATOM 11370 H HE21 . GLN A 1 11  ? -24.757 6.884   7.780   1.00 0.00 ? 11  GLN A HE21 7  
ATOM 11371 H HE22 . GLN A 1 11  ? -25.943 5.827   7.102   1.00 0.00 ? 11  GLN A HE22 7  
ATOM 11372 N N    . LYS A 1 12  ? -21.846 11.307  2.783   1.00 0.00 ? 12  LYS A N    7  
ATOM 11373 C CA   . LYS A 1 12  ? -21.917 12.262  1.683   1.00 0.00 ? 12  LYS A CA   7  
ATOM 11374 C C    . LYS A 1 12  ? -20.596 12.314  0.922   1.00 0.00 ? 12  LYS A C    7  
ATOM 11375 O O    . LYS A 1 12  ? -20.579 12.387  -0.306  1.00 0.00 ? 12  LYS A O    7  
ATOM 11376 C CB   . LYS A 1 12  ? -22.268 13.655  2.211   1.00 0.00 ? 12  LYS A CB   7  
ATOM 11377 C CG   . LYS A 1 12  ? -22.477 14.686  1.116   1.00 0.00 ? 12  LYS A CG   7  
ATOM 11378 C CD   . LYS A 1 12  ? -23.762 14.429  0.346   1.00 0.00 ? 12  LYS A CD   7  
ATOM 11379 C CE   . LYS A 1 12  ? -23.771 15.164  -0.986  1.00 0.00 ? 12  LYS A CE   7  
ATOM 11380 N NZ   . LYS A 1 12  ? -24.917 14.748  -1.841  1.00 0.00 ? 12  LYS A NZ   7  
ATOM 11381 H H    . LYS A 1 12  ? -21.197 11.455  3.503   1.00 0.00 ? 12  LYS A H    7  
ATOM 11382 H HA   . LYS A 1 12  ? -22.694 11.935  1.009   1.00 0.00 ? 12  LYS A HA   7  
ATOM 11383 H HB2  . LYS A 1 12  ? -23.176 13.587  2.792   1.00 0.00 ? 12  LYS A HB2  7  
ATOM 11384 H HB3  . LYS A 1 12  ? -21.467 13.997  2.850   1.00 0.00 ? 12  LYS A HB3  7  
ATOM 11385 H HG2  . LYS A 1 12  ? -22.528 15.667  1.562   1.00 0.00 ? 12  LYS A HG2  7  
ATOM 11386 H HG3  . LYS A 1 12  ? -21.643 14.643  0.430   1.00 0.00 ? 12  LYS A HG3  7  
ATOM 11387 H HD2  . LYS A 1 12  ? -23.855 13.369  0.160   1.00 0.00 ? 12  LYS A HD2  7  
ATOM 11388 H HD3  . LYS A 1 12  ? -24.600 14.767  0.939   1.00 0.00 ? 12  LYS A HD3  7  
ATOM 11389 H HE2  . LYS A 1 12  ? -23.840 16.224  -0.797  1.00 0.00 ? 12  LYS A HE2  7  
ATOM 11390 H HE3  . LYS A 1 12  ? -22.848 14.950  -1.505  1.00 0.00 ? 12  LYS A HE3  7  
ATOM 11391 H HZ1  . LYS A 1 12  ? -25.088 15.460  -2.579  1.00 0.00 ? 12  LYS A HZ1  7  
ATOM 11392 H HZ2  . LYS A 1 12  ? -25.776 14.650  -1.264  1.00 0.00 ? 12  LYS A HZ2  7  
ATOM 11393 H HZ3  . LYS A 1 12  ? -24.711 13.835  -2.296  1.00 0.00 ? 12  LYS A HZ3  7  
ATOM 11394 N N    . GLU A 1 13  ? -19.491 12.274  1.660   1.00 0.00 ? 13  GLU A N    7  
ATOM 11395 C CA   . GLU A 1 13  ? -18.166 12.316  1.053   1.00 0.00 ? 13  GLU A CA   7  
ATOM 11396 C C    . GLU A 1 13  ? -17.567 10.915  0.957   1.00 0.00 ? 13  GLU A C    7  
ATOM 11397 O O    . GLU A 1 13  ? -16.925 10.569  -0.036  1.00 0.00 ? 13  GLU A O    7  
ATOM 11398 C CB   . GLU A 1 13  ? -17.238 13.225  1.863   1.00 0.00 ? 13  GLU A CB   7  
ATOM 11399 C CG   . GLU A 1 13  ? -15.765 12.892  1.698   1.00 0.00 ? 13  GLU A CG   7  
ATOM 11400 C CD   . GLU A 1 13  ? -15.259 13.162  0.294   1.00 0.00 ? 13  GLU A CD   7  
ATOM 11401 O OE1  . GLU A 1 13  ? -15.942 12.760  -0.671  1.00 0.00 ? 13  GLU A OE1  7  
ATOM 11402 O OE2  . GLU A 1 13  ? -14.180 13.776  0.161   1.00 0.00 ? 13  GLU A OE2  7  
ATOM 11403 H H    . GLU A 1 13  ? -19.569 12.215  2.635   1.00 0.00 ? 13  GLU A H    7  
ATOM 11404 H HA   . GLU A 1 13  ? -18.270 12.719  0.057   1.00 0.00 ? 13  GLU A HA   7  
ATOM 11405 H HB2  . GLU A 1 13  ? -17.393 14.247  1.551   1.00 0.00 ? 13  GLU A HB2  7  
ATOM 11406 H HB3  . GLU A 1 13  ? -17.491 13.135  2.909   1.00 0.00 ? 13  GLU A HB3  7  
ATOM 11407 H HG2  . GLU A 1 13  ? -15.194 13.492  2.391   1.00 0.00 ? 13  GLU A HG2  7  
ATOM 11408 H HG3  . GLU A 1 13  ? -15.617 11.846  1.923   1.00 0.00 ? 13  GLU A HG3  7  
ATOM 11409 N N    . LEU A 1 14  ? -17.780 10.115  1.995   1.00 0.00 ? 14  LEU A N    7  
ATOM 11410 C CA   . LEU A 1 14  ? -17.261 8.752   2.030   1.00 0.00 ? 14  LEU A CA   7  
ATOM 11411 C C    . LEU A 1 14  ? -17.291 8.123   0.640   1.00 0.00 ? 14  LEU A C    7  
ATOM 11412 O O    . LEU A 1 14  ? -16.249 7.805   0.069   1.00 0.00 ? 14  LEU A O    7  
ATOM 11413 C CB   . LEU A 1 14  ? -18.075 7.900   3.005   1.00 0.00 ? 14  LEU A CB   7  
ATOM 11414 C CG   . LEU A 1 14  ? -17.730 6.411   3.045   1.00 0.00 ? 14  LEU A CG   7  
ATOM 11415 C CD1  . LEU A 1 14  ? -16.577 6.155   4.003   1.00 0.00 ? 14  LEU A CD1  7  
ATOM 11416 C CD2  . LEU A 1 14  ? -18.949 5.591   3.444   1.00 0.00 ? 14  LEU A CD2  7  
ATOM 11417 H H    . LEU A 1 14  ? -18.298 10.447  2.757   1.00 0.00 ? 14  LEU A H    7  
ATOM 11418 H HA   . LEU A 1 14  ? -16.238 8.795   2.370   1.00 0.00 ? 14  LEU A HA   7  
ATOM 11419 H HB2  . LEU A 1 14  ? -17.927 8.300   3.996   1.00 0.00 ? 14  LEU A HB2  7  
ATOM 11420 H HB3  . LEU A 1 14  ? -19.117 7.992   2.734   1.00 0.00 ? 14  LEU A HB3  7  
ATOM 11421 H HG   . LEU A 1 14  ? -17.421 6.093   2.059   1.00 0.00 ? 14  LEU A HG   7  
ATOM 11422 H HD11 . LEU A 1 14  ? -15.642 6.230   3.469   1.00 0.00 ? 14  LEU A HD11 7  
ATOM 11423 H HD12 . LEU A 1 14  ? -16.673 5.165   4.425   1.00 0.00 ? 14  LEU A HD12 7  
ATOM 11424 H HD13 . LEU A 1 14  ? -16.599 6.888   4.796   1.00 0.00 ? 14  LEU A HD13 7  
ATOM 11425 H HD21 . LEU A 1 14  ? -18.629 4.699   3.962   1.00 0.00 ? 14  LEU A HD21 7  
ATOM 11426 H HD22 . LEU A 1 14  ? -19.502 5.314   2.558   1.00 0.00 ? 14  LEU A HD22 7  
ATOM 11427 H HD23 . LEU A 1 14  ? -19.581 6.179   4.094   1.00 0.00 ? 14  LEU A HD23 7  
ATOM 11428 N N    . GLY A 1 15  ? -18.494 7.947   0.101   1.00 0.00 ? 15  GLY A N    7  
ATOM 11429 C CA   . GLY A 1 15  ? -18.638 7.359   -1.218  1.00 0.00 ? 15  GLY A CA   7  
ATOM 11430 C C    . GLY A 1 15  ? -17.933 8.165   -2.291  1.00 0.00 ? 15  GLY A C    7  
ATOM 11431 O O    . GLY A 1 15  ? -17.229 7.607   -3.134  1.00 0.00 ? 15  GLY A O    7  
ATOM 11432 H H    . GLY A 1 15  ? -19.291 8.220   0.603   1.00 0.00 ? 15  GLY A H    7  
ATOM 11433 H HA2  . GLY A 1 15  ? -18.225 6.362   -1.202  1.00 0.00 ? 15  GLY A HA2  7  
ATOM 11434 H HA3  . GLY A 1 15  ? -19.688 7.300   -1.460  1.00 0.00 ? 15  GLY A HA3  7  
ATOM 11435 N N    . ASP A 1 16  ? -18.124 9.479   -2.263  1.00 0.00 ? 16  ASP A N    7  
ATOM 11436 C CA   . ASP A 1 16  ? -17.502 10.363  -3.242  1.00 0.00 ? 16  ASP A CA   7  
ATOM 11437 C C    . ASP A 1 16  ? -16.011 10.067  -3.372  1.00 0.00 ? 16  ASP A C    7  
ATOM 11438 O O    . ASP A 1 16  ? -15.485 9.948   -4.479  1.00 0.00 ? 16  ASP A O    7  
ATOM 11439 C CB   . ASP A 1 16  ? -17.711 11.825  -2.846  1.00 0.00 ? 16  ASP A CB   7  
ATOM 11440 C CG   . ASP A 1 16  ? -19.059 12.359  -3.292  1.00 0.00 ? 16  ASP A CG   7  
ATOM 11441 O OD1  . ASP A 1 16  ? -19.508 11.987  -4.396  1.00 0.00 ? 16  ASP A OD1  7  
ATOM 11442 O OD2  . ASP A 1 16  ? -19.664 13.148  -2.536  1.00 0.00 ? 16  ASP A OD2  7  
ATOM 11443 H H    . ASP A 1 16  ? -18.696 9.864   -1.567  1.00 0.00 ? 16  ASP A H    7  
ATOM 11444 H HA   . ASP A 1 16  ? -17.975 10.187  -4.196  1.00 0.00 ? 16  ASP A HA   7  
ATOM 11445 H HB2  . ASP A 1 16  ? -17.648 11.913  -1.771  1.00 0.00 ? 16  ASP A HB2  7  
ATOM 11446 H HB3  . ASP A 1 16  ? -16.938 12.428  -3.299  1.00 0.00 ? 16  ASP A HB3  7  
ATOM 11447 N N    . VAL A 1 17  ? -15.335 9.949   -2.233  1.00 0.00 ? 17  VAL A N    7  
ATOM 11448 C CA   . VAL A 1 17  ? -13.904 9.667   -2.219  1.00 0.00 ? 17  VAL A CA   7  
ATOM 11449 C C    . VAL A 1 17  ? -13.580 8.430   -3.050  1.00 0.00 ? 17  VAL A C    7  
ATOM 11450 O O    . VAL A 1 17  ? -14.190 7.374   -2.875  1.00 0.00 ? 17  VAL A O    7  
ATOM 11451 C CB   . VAL A 1 17  ? -13.388 9.457   -0.783  1.00 0.00 ? 17  VAL A CB   7  
ATOM 11452 C CG1  . VAL A 1 17  ? -11.904 9.125   -0.793  1.00 0.00 ? 17  VAL A CG1  7  
ATOM 11453 C CG2  . VAL A 1 17  ? -13.661 10.690  0.066   1.00 0.00 ? 17  VAL A CG2  7  
ATOM 11454 H H    . VAL A 1 17  ? -15.810 10.054  -1.383  1.00 0.00 ? 17  VAL A H    7  
ATOM 11455 H HA   . VAL A 1 17  ? -13.392 10.518  -2.643  1.00 0.00 ? 17  VAL A HA   7  
ATOM 11456 H HB   . VAL A 1 17  ? -13.918 8.622   -0.350  1.00 0.00 ? 17  VAL A HB   7  
ATOM 11457 H HG11 . VAL A 1 17  ? -11.407 9.675   -0.008  1.00 0.00 ? 17  VAL A HG11 7  
ATOM 11458 H HG12 . VAL A 1 17  ? -11.771 8.065   -0.631  1.00 0.00 ? 17  VAL A HG12 7  
ATOM 11459 H HG13 . VAL A 1 17  ? -11.480 9.399   -1.748  1.00 0.00 ? 17  VAL A HG13 7  
ATOM 11460 H HG21 . VAL A 1 17  ? -12.944 10.737  0.871   1.00 0.00 ? 17  VAL A HG21 7  
ATOM 11461 H HG22 . VAL A 1 17  ? -13.573 11.576  -0.546  1.00 0.00 ? 17  VAL A HG22 7  
ATOM 11462 H HG23 . VAL A 1 17  ? -14.659 10.632  0.474   1.00 0.00 ? 17  VAL A HG23 7  
ATOM 11463 N N    . LEU A 1 18  ? -12.617 8.567   -3.954  1.00 0.00 ? 18  LEU A N    7  
ATOM 11464 C CA   . LEU A 1 18  ? -12.210 7.460   -4.813  1.00 0.00 ? 18  LEU A CA   7  
ATOM 11465 C C    . LEU A 1 18  ? -10.734 7.130   -4.613  1.00 0.00 ? 18  LEU A C    7  
ATOM 11466 O O    . LEU A 1 18  ? -9.872  7.627   -5.338  1.00 0.00 ? 18  LEU A O    7  
ATOM 11467 C CB   . LEU A 1 18  ? -12.473 7.804   -6.280  1.00 0.00 ? 18  LEU A CB   7  
ATOM 11468 C CG   . LEU A 1 18  ? -12.694 6.617   -7.218  1.00 0.00 ? 18  LEU A CG   7  
ATOM 11469 C CD1  . LEU A 1 18  ? -13.326 7.078   -8.522  1.00 0.00 ? 18  LEU A CD1  7  
ATOM 11470 C CD2  . LEU A 1 18  ? -11.380 5.896   -7.485  1.00 0.00 ? 18  LEU A CD2  7  
ATOM 11471 H H    . LEU A 1 18  ? -12.168 9.433   -4.047  1.00 0.00 ? 18  LEU A H    7  
ATOM 11472 H HA   . LEU A 1 18  ? -12.799 6.597   -4.542  1.00 0.00 ? 18  LEU A HA   7  
ATOM 11473 H HB2  . LEU A 1 18  ? -13.354 8.426   -6.321  1.00 0.00 ? 18  LEU A HB2  7  
ATOM 11474 H HB3  . LEU A 1 18  ? -11.623 8.362   -6.646  1.00 0.00 ? 18  LEU A HB3  7  
ATOM 11475 H HG   . LEU A 1 18  ? -13.371 5.916   -6.749  1.00 0.00 ? 18  LEU A HG   7  
ATOM 11476 H HD11 . LEU A 1 18  ? -14.175 6.452   -8.751  1.00 0.00 ? 18  LEU A HD11 7  
ATOM 11477 H HD12 . LEU A 1 18  ? -12.600 7.005   -9.319  1.00 0.00 ? 18  LEU A HD12 7  
ATOM 11478 H HD13 . LEU A 1 18  ? -13.649 8.103   -8.423  1.00 0.00 ? 18  LEU A HD13 7  
ATOM 11479 H HD21 . LEU A 1 18  ? -10.579 6.619   -7.543  1.00 0.00 ? 18  LEU A HD21 7  
ATOM 11480 H HD22 . LEU A 1 18  ? -11.448 5.358   -8.419  1.00 0.00 ? 18  LEU A HD22 7  
ATOM 11481 H HD23 . LEU A 1 18  ? -11.181 5.202   -6.682  1.00 0.00 ? 18  LEU A HD23 7  
ATOM 11482 N N    . VAL A 1 19  ? -10.450 6.287   -3.625  1.00 0.00 ? 19  VAL A N    7  
ATOM 11483 C CA   . VAL A 1 19  ? -9.079  5.887   -3.331  1.00 0.00 ? 19  VAL A CA   7  
ATOM 11484 C C    . VAL A 1 19  ? -8.405  5.291   -4.562  1.00 0.00 ? 19  VAL A C    7  
ATOM 11485 O O    . VAL A 1 19  ? -8.973  4.435   -5.240  1.00 0.00 ? 19  VAL A O    7  
ATOM 11486 C CB   . VAL A 1 19  ? -9.027  4.861   -2.184  1.00 0.00 ? 19  VAL A CB   7  
ATOM 11487 C CG1  . VAL A 1 19  ? -7.587  4.493   -1.861  1.00 0.00 ? 19  VAL A CG1  7  
ATOM 11488 C CG2  . VAL A 1 19  ? -9.737  5.404   -0.952  1.00 0.00 ? 19  VAL A CG2  7  
ATOM 11489 H H    . VAL A 1 19  ? -11.181 5.925   -3.081  1.00 0.00 ? 19  VAL A H    7  
ATOM 11490 H HA   . VAL A 1 19  ? -8.533  6.767   -3.024  1.00 0.00 ? 19  VAL A HA   7  
ATOM 11491 H HB   . VAL A 1 19  ? -9.541  3.967   -2.504  1.00 0.00 ? 19  VAL A HB   7  
ATOM 11492 H HG11 . VAL A 1 19  ? -7.303  4.944   -0.922  1.00 0.00 ? 19  VAL A HG11 7  
ATOM 11493 H HG12 . VAL A 1 19  ? -7.497  3.419   -1.788  1.00 0.00 ? 19  VAL A HG12 7  
ATOM 11494 H HG13 . VAL A 1 19  ? -6.939  4.857   -2.645  1.00 0.00 ? 19  VAL A HG13 7  
ATOM 11495 H HG21 . VAL A 1 19  ? -10.805 5.365   -1.107  1.00 0.00 ? 19  VAL A HG21 7  
ATOM 11496 H HG22 . VAL A 1 19  ? -9.476  4.804   -0.092  1.00 0.00 ? 19  VAL A HG22 7  
ATOM 11497 H HG23 . VAL A 1 19  ? -9.433  6.426   -0.782  1.00 0.00 ? 19  VAL A HG23 7  
ATOM 11498 N N    . ARG A 1 20  ? -7.190  5.750   -4.845  1.00 0.00 ? 20  ARG A N    7  
ATOM 11499 C CA   . ARG A 1 20  ? -6.438  5.262   -5.995  1.00 0.00 ? 20  ARG A CA   7  
ATOM 11500 C C    . ARG A 1 20  ? -5.248  4.418   -5.548  1.00 0.00 ? 20  ARG A C    7  
ATOM 11501 O O    . ARG A 1 20  ? -4.241  4.946   -5.076  1.00 0.00 ? 20  ARG A O    7  
ATOM 11502 C CB   . ARG A 1 20  ? -5.953  6.436   -6.848  1.00 0.00 ? 20  ARG A CB   7  
ATOM 11503 C CG   . ARG A 1 20  ? -7.069  7.149   -7.593  1.00 0.00 ? 20  ARG A CG   7  
ATOM 11504 C CD   . ARG A 1 20  ? -6.549  7.843   -8.843  1.00 0.00 ? 20  ARG A CD   7  
ATOM 11505 N NE   . ARG A 1 20  ? -6.558  6.958   -10.004 1.00 0.00 ? 20  ARG A NE   7  
ATOM 11506 C CZ   . ARG A 1 20  ? -7.634  6.738   -10.753 1.00 0.00 ? 20  ARG A CZ   7  
ATOM 11507 N NH1  . ARG A 1 20  ? -8.781  7.337   -10.463 1.00 0.00 ? 20  ARG A NH1  7  
ATOM 11508 N NH2  . ARG A 1 20  ? -7.563  5.918   -11.794 1.00 0.00 ? 20  ARG A NH2  7  
ATOM 11509 H H    . ARG A 1 20  ? -6.790  6.433   -4.267  1.00 0.00 ? 20  ARG A H    7  
ATOM 11510 H HA   . ARG A 1 20  ? -7.099  4.647   -6.587  1.00 0.00 ? 20  ARG A HA   7  
ATOM 11511 H HB2  . ARG A 1 20  ? -5.462  7.153   -6.207  1.00 0.00 ? 20  ARG A HB2  7  
ATOM 11512 H HB3  . ARG A 1 20  ? -5.243  6.068   -7.573  1.00 0.00 ? 20  ARG A HB3  7  
ATOM 11513 H HG2  . ARG A 1 20  ? -7.817  6.426   -7.882  1.00 0.00 ? 20  ARG A HG2  7  
ATOM 11514 H HG3  . ARG A 1 20  ? -7.511  7.887   -6.940  1.00 0.00 ? 20  ARG A HG3  7  
ATOM 11515 H HD2  . ARG A 1 20  ? -7.174  8.699   -9.050  1.00 0.00 ? 20  ARG A HD2  7  
ATOM 11516 H HD3  . ARG A 1 20  ? -5.537  8.172   -8.661  1.00 0.00 ? 20  ARG A HD3  7  
ATOM 11517 H HE   . ARG A 1 20  ? -5.721  6.505   -10.237 1.00 0.00 ? 20  ARG A HE   7  
ATOM 11518 H HH11 . ARG A 1 20  ? -8.837  7.955   -9.679  1.00 0.00 ? 20  ARG A HH11 7  
ATOM 11519 H HH12 . ARG A 1 20  ? -9.589  7.171   -11.028 1.00 0.00 ? 20  ARG A HH12 7  
ATOM 11520 H HH21 . ARG A 1 20  ? -6.700  5.466   -12.016 1.00 0.00 ? 20  ARG A HH21 7  
ATOM 11521 H HH22 . ARG A 1 20  ? -8.373  5.754   -12.356 1.00 0.00 ? 20  ARG A HH22 7  
ATOM 11522 N N    . LEU A 1 21  ? -5.372  3.104   -5.700  1.00 0.00 ? 21  LEU A N    7  
ATOM 11523 C CA   . LEU A 1 21  ? -4.307  2.185   -5.312  1.00 0.00 ? 21  LEU A CA   7  
ATOM 11524 C C    . LEU A 1 21  ? -3.335  1.960   -6.466  1.00 0.00 ? 21  LEU A C    7  
ATOM 11525 O O    . LEU A 1 21  ? -3.632  1.224   -7.407  1.00 0.00 ? 21  LEU A O    7  
ATOM 11526 C CB   . LEU A 1 21  ? -4.899  0.849   -4.861  1.00 0.00 ? 21  LEU A CB   7  
ATOM 11527 C CG   . LEU A 1 21  ? -4.021  0.004   -3.937  1.00 0.00 ? 21  LEU A CG   7  
ATOM 11528 C CD1  . LEU A 1 21  ? -3.636  0.795   -2.696  1.00 0.00 ? 21  LEU A CD1  7  
ATOM 11529 C CD2  . LEU A 1 21  ? -4.737  -1.282  -3.551  1.00 0.00 ? 21  LEU A CD2  7  
ATOM 11530 H H    . LEU A 1 21  ? -6.198  2.742   -6.082  1.00 0.00 ? 21  LEU A H    7  
ATOM 11531 H HA   . LEU A 1 21  ? -3.771  2.629   -4.487  1.00 0.00 ? 21  LEU A HA   7  
ATOM 11532 H HB2  . LEU A 1 21  ? -5.822  1.055   -4.342  1.00 0.00 ? 21  LEU A HB2  7  
ATOM 11533 H HB3  . LEU A 1 21  ? -5.107  0.265   -5.746  1.00 0.00 ? 21  LEU A HB3  7  
ATOM 11534 H HG   . LEU A 1 21  ? -3.112  -0.261  -4.458  1.00 0.00 ? 21  LEU A HG   7  
ATOM 11535 H HD11 . LEU