data_1UJU
# 
_entry.id   1UJU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.355 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1UJU         pdb_00001uju 10.2210/pdb1uju/pdb 
RCSB  RCSB005906   ?            ?                   
WWPDB D_1000005906 ?            ?                   
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002200144.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1UJU 
_pdbx_database_status.recvd_initial_deposition_date   2003-08-11 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tochio, N.'                                             1 
'Koshiba, S.'                                            2 
'Kigawa, T.'                                             3 
'Yokoyama, S.'                                           4 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of the fourth PDZ domain of human scribble (KIAA0147 protein)' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tochio, N.'   1 ? 
primary 'Koshiba, S.'  2 ? 
primary 'Kigawa, T.'   3 ? 
primary 'Yokoyama, S.' 4 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           scribble 
_entity.formula_weight             11317.690 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'PDZ domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'KIAA0147 protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSSGSSGPGLRELCIQKAPGERLGISIRGGARGHAGNPRDPTDEGIFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGL
THGEAVQLLRSVGDTLTVLVCDGFESGPSSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSGSSGPGLRELCIQKAPGERLGISIRGGARGHAGNPRDPTDEGIFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGL
THGEAVQLLRSVGDTLTVLVCDGFESGPSSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002200144.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   GLY n 
1 5   SER n 
1 6   SER n 
1 7   GLY n 
1 8   PRO n 
1 9   GLY n 
1 10  LEU n 
1 11  ARG n 
1 12  GLU n 
1 13  LEU n 
1 14  CYS n 
1 15  ILE n 
1 16  GLN n 
1 17  LYS n 
1 18  ALA n 
1 19  PRO n 
1 20  GLY n 
1 21  GLU n 
1 22  ARG n 
1 23  LEU n 
1 24  GLY n 
1 25  ILE n 
1 26  SER n 
1 27  ILE n 
1 28  ARG n 
1 29  GLY n 
1 30  GLY n 
1 31  ALA n 
1 32  ARG n 
1 33  GLY n 
1 34  HIS n 
1 35  ALA n 
1 36  GLY n 
1 37  ASN n 
1 38  PRO n 
1 39  ARG n 
1 40  ASP n 
1 41  PRO n 
1 42  THR n 
1 43  ASP n 
1 44  GLU n 
1 45  GLY n 
1 46  ILE n 
1 47  PHE n 
1 48  ILE n 
1 49  SER n 
1 50  LYS n 
1 51  VAL n 
1 52  SER n 
1 53  PRO n 
1 54  THR n 
1 55  GLY n 
1 56  ALA n 
1 57  ALA n 
1 58  GLY n 
1 59  ARG n 
1 60  ASP n 
1 61  GLY n 
1 62  ARG n 
1 63  LEU n 
1 64  ARG n 
1 65  VAL n 
1 66  GLY n 
1 67  LEU n 
1 68  ARG n 
1 69  LEU n 
1 70  LEU n 
1 71  GLU n 
1 72  VAL n 
1 73  ASN n 
1 74  GLN n 
1 75  GLN n 
1 76  SER n 
1 77  LEU n 
1 78  LEU n 
1 79  GLY n 
1 80  LEU n 
1 81  THR n 
1 82  HIS n 
1 83  GLY n 
1 84  GLU n 
1 85  ALA n 
1 86  VAL n 
1 87  GLN n 
1 88  LEU n 
1 89  LEU n 
1 90  ARG n 
1 91  SER n 
1 92  VAL n 
1 93  GLY n 
1 94  ASP n 
1 95  THR n 
1 96  LEU n 
1 97  THR n 
1 98  VAL n 
1 99  LEU n 
1 100 VAL n 
1 101 CYS n 
1 102 ASP n 
1 103 GLY n 
1 104 PHE n 
1 105 GLU n 
1 106 SER n 
1 107 GLY n 
1 108 PRO n 
1 109 SER n 
1 110 SER n 
1 111 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'Kazusa cDNA ha01022s1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P021030-58 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'Cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LAP4_HUMAN 
_struct_ref.pdbx_db_accession          Q14160 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PGLRELCIQKAPGERLGISIRGGARGHAGNPRDPTDEGIFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGLTHGEAVQ
LLRSVGDTLTVLVCDGFE
;
_struct_ref.pdbx_align_begin           1096 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1UJU 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 105 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q14160 
_struct_ref_seq.db_align_beg                  1096 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1193 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       105 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1UJU GLY A 1   ? UNP Q14160 ? ? 'cloning artifact' 1   1  
1 1UJU SER A 2   ? UNP Q14160 ? ? 'cloning artifact' 2   2  
1 1UJU SER A 3   ? UNP Q14160 ? ? 'cloning artifact' 3   3  
1 1UJU GLY A 4   ? UNP Q14160 ? ? 'cloning artifact' 4   4  
1 1UJU SER A 5   ? UNP Q14160 ? ? 'cloning artifact' 5   5  
1 1UJU SER A 6   ? UNP Q14160 ? ? 'cloning artifact' 6   6  
1 1UJU GLY A 7   ? UNP Q14160 ? ? 'cloning artifact' 7   7  
1 1UJU SER A 106 ? UNP Q14160 ? ? 'cloning artifact' 106 8  
1 1UJU GLY A 107 ? UNP Q14160 ? ? 'cloning artifact' 107 9  
1 1UJU PRO A 108 ? UNP Q14160 ? ? 'cloning artifact' 108 10 
1 1UJU SER A 109 ? UNP Q14160 ? ? 'cloning artifact' 109 11 
1 1UJU SER A 110 ? UNP Q14160 ? ? 'cloning artifact' 110 12 
1 1UJU GLY A 111 ? UNP Q14160 ? ? 'cloning artifact' 111 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.5mM PDZ domain U-15N, 13C; 20mM phosphate buffer NA; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             AVANCE 
_pdbx_nmr_spectrometer.field_strength    800 
# 
_pdbx_nmr_refine.entry_id           1UJU 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1UJU 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy, target function' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1UJU 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XwinNMR 2.6       collection           Bruker          1 
NMRPipe 200204025 processing           'Delaglio, F'   2 
NMRView 5.0.4     'data analysis'      'Johnson, B.A.' 3 
KUJIRA  0.816     'data analysis'      'Kobayashi, N.' 4 
CYANA   2.0.17    'structure solution' 'Guentert, P.'  5 
CYANA   2.0.17    refinement           'Guentert, P.'  6 
# 
_exptl.entry_id          1UJU 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1UJU 
_struct.title                     'Solution structure of the fourth PDZ domain of human scribble (KIAA0147 protein)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UJU 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
'PDZ domain, cellular signaling, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 55 ? GLY A 61 ? GLY A 55 GLY A 61 1 ? 7  
HELX_P HELX_P2 2 THR A 81 ? ARG A 90 ? THR A 81 ARG A 90 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 13 ? GLN A 16 ? LEU A 13 GLN A 16 
A 2 THR A 95 ? VAL A 98 ? THR A 95 VAL A 98 
B 1 ILE A 25 ? ARG A 28 ? ILE A 25 ARG A 28 
B 2 PHE A 47 ? VAL A 51 ? PHE A 47 VAL A 51 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 13 ? N LEU A 13 O VAL A 98 ? O VAL A 98 
B 1 2 N SER A 26 ? N SER A 26 O LYS A 50 ? O LYS A 50 
# 
_database_PDB_matrix.entry_id          1UJU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1UJU 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -20.417 26.223  7.204   1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -21.522 26.093  6.272   1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -21.456 24.809  5.469   1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -21.876 23.752  5.941   1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? -19.578 25.744  7.036   1.00 0.00 ? 1   GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1   ? -22.449 26.113  6.825   1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -21.504 26.931  5.591   1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -20.928 24.900  4.253   1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -20.814 23.738  3.380   1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -19.569 22.924  3.720   1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -18.488 23.477  3.922   1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -20.766 24.176  1.915   1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -20.388 23.100  1.073   1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -20.611 25.771  3.933   1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -21.686 23.120  3.534   1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? -21.742 24.526  1.615   1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? -20.047 24.974  1.804   1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? -21.140 22.520  0.937   1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . SER A 1 3   ? -19.731 21.606  3.783   1.00 0.00 ? 3   SER A N    1  
ATOM 20    C CA   . SER A 1 3   ? -18.622 20.714  4.103   1.00 0.00 ? 3   SER A CA   1  
ATOM 21    C C    . SER A 1 3   ? -18.773 19.379  3.381   1.00 0.00 ? 3   SER A C    1  
ATOM 22    O O    . SER A 1 3   ? -19.870 18.830  3.289   1.00 0.00 ? 3   SER A O    1  
ATOM 23    C CB   . SER A 1 3   ? -18.543 20.484  5.613   1.00 0.00 ? 3   SER A CB   1  
ATOM 24    O OG   . SER A 1 3   ? -17.215 20.200  6.018   1.00 0.00 ? 3   SER A OG   1  
ATOM 25    H H    . SER A 1 3   ? -20.617 21.224  3.613   1.00 0.00 ? 3   SER A H    1  
ATOM 26    H HA   . SER A 1 3   ? -17.709 21.188  3.772   1.00 0.00 ? 3   SER A HA   1  
ATOM 27    H HB2  . SER A 1 3   ? -18.881 21.371  6.128   1.00 0.00 ? 3   SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3   ? -19.176 19.650  5.880   1.00 0.00 ? 3   SER A HB3  1  
ATOM 29    H HG   . SER A 1 3   ? -16.600 20.586  5.391   1.00 0.00 ? 3   SER A HG   1  
ATOM 30    N N    . GLY A 1 4   ? -17.660 18.861  2.868   1.00 0.00 ? 4   GLY A N    1  
ATOM 31    C CA   . GLY A 1 4   ? -17.689 17.594  2.160   1.00 0.00 ? 4   GLY A CA   1  
ATOM 32    C C    . GLY A 1 4   ? -16.856 16.529  2.844   1.00 0.00 ? 4   GLY A C    1  
ATOM 33    O O    . GLY A 1 4   ? -17.394 15.620  3.475   1.00 0.00 ? 4   GLY A O    1  
ATOM 34    H H    . GLY A 1 4   ? -16.813 19.343  2.971   1.00 0.00 ? 4   GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4   ? -18.712 17.252  2.099   1.00 0.00 ? 4   GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4   ? -17.310 17.745  1.160   1.00 0.00 ? 4   GLY A HA3  1  
ATOM 37    N N    . SER A 1 5   ? -15.537 16.640  2.717   1.00 0.00 ? 5   SER A N    1  
ATOM 38    C CA   . SER A 1 5   ? -14.627 15.675  3.323   1.00 0.00 ? 5   SER A CA   1  
ATOM 39    C C    . SER A 1 5   ? -14.642 15.795  4.843   1.00 0.00 ? 5   SER A C    1  
ATOM 40    O O    . SER A 1 5   ? -15.050 14.870  5.546   1.00 0.00 ? 5   SER A O    1  
ATOM 41    C CB   . SER A 1 5   ? -13.205 15.883  2.798   1.00 0.00 ? 5   SER A CB   1  
ATOM 42    O OG   . SER A 1 5   ? -13.161 15.765  1.386   1.00 0.00 ? 5   SER A OG   1  
ATOM 43    H H    . SER A 1 5   ? -15.168 17.387  2.200   1.00 0.00 ? 5   SER A H    1  
ATOM 44    H HA   . SER A 1 5   ? -14.962 14.685  3.048   1.00 0.00 ? 5   SER A HA   1  
ATOM 45    H HB2  . SER A 1 5   ? -12.863 16.868  3.075   1.00 0.00 ? 5   SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5   ? -12.552 15.139  3.230   1.00 0.00 ? 5   SER A HB3  1  
ATOM 47    H HG   . SER A 1 5   ? -13.675 15.003  1.112   1.00 0.00 ? 5   SER A HG   1  
ATOM 48    N N    . SER A 1 6   ? -14.194 16.941  5.345   1.00 0.00 ? 6   SER A N    1  
ATOM 49    C CA   . SER A 1 6   ? -14.152 17.182  6.782   1.00 0.00 ? 6   SER A CA   1  
ATOM 50    C C    . SER A 1 6   ? -13.085 16.318  7.447   1.00 0.00 ? 6   SER A C    1  
ATOM 51    O O    . SER A 1 6   ? -13.272 15.827  8.560   1.00 0.00 ? 6   SER A O    1  
ATOM 52    C CB   . SER A 1 6   ? -15.519 16.898  7.409   1.00 0.00 ? 6   SER A CB   1  
ATOM 53    O OG   . SER A 1 6   ? -15.729 17.699  8.559   1.00 0.00 ? 6   SER A OG   1  
ATOM 54    H H    . SER A 1 6   ? -13.882 17.641  4.733   1.00 0.00 ? 6   SER A H    1  
ATOM 55    H HA   . SER A 1 6   ? -13.904 18.222  6.937   1.00 0.00 ? 6   SER A HA   1  
ATOM 56    H HB2  . SER A 1 6   ? -16.294 17.112  6.689   1.00 0.00 ? 6   SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6   ? -15.570 15.857  7.695   1.00 0.00 ? 6   SER A HB3  1  
ATOM 58    H HG   . SER A 1 6   ? -14.883 17.919  8.955   1.00 0.00 ? 6   SER A HG   1  
ATOM 59    N N    . GLY A 1 7   ? -11.965 16.135  6.755   1.00 0.00 ? 7   GLY A N    1  
ATOM 60    C CA   . GLY A 1 7   ? -10.884 15.330  7.293   1.00 0.00 ? 7   GLY A CA   1  
ATOM 61    C C    . GLY A 1 7   ? -9.558  15.611  6.614   1.00 0.00 ? 7   GLY A C    1  
ATOM 62    O O    . GLY A 1 7   ? -9.497  15.889  5.416   1.00 0.00 ? 7   GLY A O    1  
ATOM 63    H H    . GLY A 1 7   ? -11.871 16.551  5.873   1.00 0.00 ? 7   GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7   ? -10.786 15.536  8.349   1.00 0.00 ? 7   GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7   ? -11.128 14.286  7.162   1.00 0.00 ? 7   GLY A HA3  1  
ATOM 66    N N    . PRO A 1 8   ? -8.465  15.540  7.388   1.00 0.00 ? 8   PRO A N    1  
ATOM 67    C CA   . PRO A 1 8   ? -7.114  15.787  6.875   1.00 0.00 ? 8   PRO A CA   1  
ATOM 68    C C    . PRO A 1 8   ? -6.640  14.683  5.937   1.00 0.00 ? 8   PRO A C    1  
ATOM 69    O O    . PRO A 1 8   ? -7.139  13.559  5.982   1.00 0.00 ? 8   PRO A O    1  
ATOM 70    C CB   . PRO A 1 8   ? -6.254  15.818  8.141   1.00 0.00 ? 8   PRO A CB   1  
ATOM 71    C CG   . PRO A 1 8   ? -7.008  14.999  9.131   1.00 0.00 ? 8   PRO A CG   1  
ATOM 72    C CD   . PRO A 1 8   ? -8.464  15.214  8.824   1.00 0.00 ? 8   PRO A CD   1  
ATOM 73    H HA   . PRO A 1 8   ? -7.050  16.740  6.370   1.00 0.00 ? 8   PRO A HA   1  
ATOM 74    H HB2  . PRO A 1 8   ? -5.284  15.392  7.931   1.00 0.00 ? 8   PRO A HB2  1  
ATOM 75    H HB3  . PRO A 1 8   ? -6.140  16.838  8.478   1.00 0.00 ? 8   PRO A HB3  1  
ATOM 76    H HG2  . PRO A 1 8   ? -6.750  13.957  9.018   1.00 0.00 ? 8   PRO A HG2  1  
ATOM 77    H HG3  . PRO A 1 8   ? -6.783  15.335  10.133  1.00 0.00 ? 8   PRO A HG3  1  
ATOM 78    H HD2  . PRO A 1 8   ? -9.027  14.312  9.015   1.00 0.00 ? 8   PRO A HD2  1  
ATOM 79    H HD3  . PRO A 1 8   ? -8.855  16.035  9.406   1.00 0.00 ? 8   PRO A HD3  1  
ATOM 80    N N    . GLY A 1 9   ? -5.672  15.011  5.086   1.00 0.00 ? 9   GLY A N    1  
ATOM 81    C CA   . GLY A 1 9   ? -5.147  14.036  4.148   1.00 0.00 ? 9   GLY A CA   1  
ATOM 82    C C    . GLY A 1 9   ? -3.646  14.155  3.967   1.00 0.00 ? 9   GLY A C    1  
ATOM 83    O O    . GLY A 1 9   ? -2.943  13.149  3.868   1.00 0.00 ? 9   GLY A O    1  
ATOM 84    H H    . GLY A 1 9   ? -5.312  15.923  5.094   1.00 0.00 ? 9   GLY A H    1  
ATOM 85    H HA2  . GLY A 1 9   ? -5.377  13.045  4.509   1.00 0.00 ? 9   GLY A HA2  1  
ATOM 86    H HA3  . GLY A 1 9   ? -5.625  14.179  3.191   1.00 0.00 ? 9   GLY A HA3  1  
ATOM 87    N N    . LEU A 1 10  ? -3.154  15.388  3.922   1.00 0.00 ? 10  LEU A N    1  
ATOM 88    C CA   . LEU A 1 10  ? -1.727  15.636  3.750   1.00 0.00 ? 10  LEU A CA   1  
ATOM 89    C C    . LEU A 1 10  ? -1.054  15.901  5.093   1.00 0.00 ? 10  LEU A C    1  
ATOM 90    O O    . LEU A 1 10  ? -0.101  16.676  5.180   1.00 0.00 ? 10  LEU A O    1  
ATOM 91    C CB   . LEU A 1 10  ? -1.505  16.825  2.813   1.00 0.00 ? 10  LEU A CB   1  
ATOM 92    C CG   . LEU A 1 10  ? -2.308  18.087  3.128   1.00 0.00 ? 10  LEU A CG   1  
ATOM 93    C CD1  . LEU A 1 10  ? -3.700  18.000  2.521   1.00 0.00 ? 10  LEU A CD1  1  
ATOM 94    C CD2  . LEU A 1 10  ? -2.394  18.303  4.632   1.00 0.00 ? 10  LEU A CD2  1  
ATOM 95    H H    . LEU A 1 10  ? -3.764  16.150  4.007   1.00 0.00 ? 10  LEU A H    1  
ATOM 96    H HA   . LEU A 1 10  ? -1.288  14.754  3.309   1.00 0.00 ? 10  LEU A HA   1  
ATOM 97    H HB2  . LEU A 1 10  ? -0.458  17.082  2.848   1.00 0.00 ? 10  LEU A HB2  1  
ATOM 98    H HB3  . LEU A 1 10  ? -1.763  16.508  1.812   1.00 0.00 ? 10  LEU A HB3  1  
ATOM 99    H HG   . LEU A 1 10  ? -1.808  18.942  2.694   1.00 0.00 ? 10  LEU A HG   1  
ATOM 100   H HD11 . LEU A 1 10  ? -3.768  18.672  1.679   1.00 0.00 ? 10  LEU A HD11 1  
ATOM 101   H HD12 . LEU A 1 10  ? -4.434  18.276  3.262   1.00 0.00 ? 10  LEU A HD12 1  
ATOM 102   H HD13 . LEU A 1 10  ? -3.885  16.988  2.190   1.00 0.00 ? 10  LEU A HD13 1  
ATOM 103   H HD21 . LEU A 1 10  ? -1.401  18.446  5.032   1.00 0.00 ? 10  LEU A HD21 1  
ATOM 104   H HD22 . LEU A 1 10  ? -2.847  17.438  5.095   1.00 0.00 ? 10  LEU A HD22 1  
ATOM 105   H HD23 . LEU A 1 10  ? -2.994  19.178  4.837   1.00 0.00 ? 10  LEU A HD23 1  
ATOM 106   N N    . ARG A 1 11  ? -1.555  15.251  6.139   1.00 0.00 ? 11  ARG A N    1  
ATOM 107   C CA   . ARG A 1 11  ? -1.002  15.415  7.477   1.00 0.00 ? 11  ARG A CA   1  
ATOM 108   C C    . ARG A 1 11  ? -0.158  14.206  7.869   1.00 0.00 ? 11  ARG A C    1  
ATOM 109   O O    . ARG A 1 11  ? -0.048  13.242  7.111   1.00 0.00 ? 11  ARG A O    1  
ATOM 110   C CB   . ARG A 1 11  ? -2.126  15.617  8.495   1.00 0.00 ? 11  ARG A CB   1  
ATOM 111   C CG   . ARG A 1 11  ? -2.850  16.945  8.349   1.00 0.00 ? 11  ARG A CG   1  
ATOM 112   C CD   . ARG A 1 11  ? -2.004  18.100  8.863   1.00 0.00 ? 11  ARG A CD   1  
ATOM 113   N NE   . ARG A 1 11  ? -2.181  18.310  10.298  1.00 0.00 ? 11  ARG A NE   1  
ATOM 114   C CZ   . ARG A 1 11  ? -1.665  19.341  10.958  1.00 0.00 ? 11  ARG A CZ   1  
ATOM 115   N NH1  . ARG A 1 11  ? -0.944  20.250  10.317  1.00 0.00 ? 11  ARG A NH1  1  
ATOM 116   N NH2  . ARG A 1 11  ? -1.870  19.464  12.263  1.00 0.00 ? 11  ARG A NH2  1  
ATOM 117   H H    . ARG A 1 11  ? -2.316  14.646  6.006   1.00 0.00 ? 11  ARG A H    1  
ATOM 118   H HA   . ARG A 1 11  ? -0.373  16.292  7.471   1.00 0.00 ? 11  ARG A HA   1  
ATOM 119   H HB2  . ARG A 1 11  ? -2.850  14.823  8.378   1.00 0.00 ? 11  ARG A HB2  1  
ATOM 120   H HB3  . ARG A 1 11  ? -1.708  15.567  9.489   1.00 0.00 ? 11  ARG A HB3  1  
ATOM 121   H HG2  . ARG A 1 11  ? -3.069  17.112  7.304   1.00 0.00 ? 11  ARG A HG2  1  
ATOM 122   H HG3  . ARG A 1 11  ? -3.771  16.907  8.910   1.00 0.00 ? 11  ARG A HG3  1  
ATOM 123   H HD2  . ARG A 1 11  ? -0.965  17.883  8.667   1.00 0.00 ? 11  ARG A HD2  1  
ATOM 124   H HD3  . ARG A 1 11  ? -2.290  18.999  8.339   1.00 0.00 ? 11  ARG A HD3  1  
ATOM 125   H HE   . ARG A 1 11  ? -2.710  17.651  10.792  1.00 0.00 ? 11  ARG A HE   1  
ATOM 126   H HH11 . ARG A 1 11  ? -0.789  20.160  9.333   1.00 0.00 ? 11  ARG A HH11 1  
ATOM 127   H HH12 . ARG A 1 11  ? -0.557  21.026  10.816  1.00 0.00 ? 11  ARG A HH12 1  
ATOM 128   H HH21 . ARG A 1 11  ? -2.413  18.781  12.751  1.00 0.00 ? 11  ARG A HH21 1  
ATOM 129   H HH22 . ARG A 1 11  ? -1.481  20.239  12.760  1.00 0.00 ? 11  ARG A HH22 1  
ATOM 130   N N    . GLU A 1 12  ? 0.436   14.265  9.057   1.00 0.00 ? 12  GLU A N    1  
ATOM 131   C CA   . GLU A 1 12  ? 1.271   13.175  9.548   1.00 0.00 ? 12  GLU A CA   1  
ATOM 132   C C    . GLU A 1 12  ? 0.414   12.025  10.070  1.00 0.00 ? 12  GLU A C    1  
ATOM 133   O O    . GLU A 1 12  ? -0.270  12.157  11.086  1.00 0.00 ? 12  GLU A O    1  
ATOM 134   C CB   . GLU A 1 12  ? 2.202   13.675  10.654  1.00 0.00 ? 12  GLU A CB   1  
ATOM 135   C CG   . GLU A 1 12  ? 3.267   12.667  11.055  1.00 0.00 ? 12  GLU A CG   1  
ATOM 136   C CD   . GLU A 1 12  ? 3.992   13.060  12.327  1.00 0.00 ? 12  GLU A CD   1  
ATOM 137   O OE1  . GLU A 1 12  ? 4.664   14.112  12.327  1.00 0.00 ? 12  GLU A OE1  1  
ATOM 138   O OE2  . GLU A 1 12  ? 3.887   12.314  13.324  1.00 0.00 ? 12  GLU A OE2  1  
ATOM 139   H H    . GLU A 1 12  ? 0.310   15.060  9.616   1.00 0.00 ? 12  GLU A H    1  
ATOM 140   H HA   . GLU A 1 12  ? 1.868   12.817  8.722   1.00 0.00 ? 12  GLU A HA   1  
ATOM 141   H HB2  . GLU A 1 12  ? 2.696   14.573  10.314  1.00 0.00 ? 12  GLU A HB2  1  
ATOM 142   H HB3  . GLU A 1 12  ? 1.611   13.908  11.527  1.00 0.00 ? 12  GLU A HB3  1  
ATOM 143   H HG2  . GLU A 1 12  ? 2.796   11.708  11.209  1.00 0.00 ? 12  GLU A HG2  1  
ATOM 144   H HG3  . GLU A 1 12  ? 3.989   12.588  10.256  1.00 0.00 ? 12  GLU A HG3  1  
ATOM 145   N N    . LEU A 1 13  ? 0.456   10.898  9.368   1.00 0.00 ? 13  LEU A N    1  
ATOM 146   C CA   . LEU A 1 13  ? -0.317  9.724   9.759   1.00 0.00 ? 13  LEU A CA   1  
ATOM 147   C C    . LEU A 1 13  ? 0.599   8.537   10.037  1.00 0.00 ? 13  LEU A C    1  
ATOM 148   O O    . LEU A 1 13  ? 1.765   8.534   9.639   1.00 0.00 ? 13  LEU A O    1  
ATOM 149   C CB   . LEU A 1 13  ? -1.322  9.362   8.664   1.00 0.00 ? 13  LEU A CB   1  
ATOM 150   C CG   . LEU A 1 13  ? -2.635  10.146  8.673   1.00 0.00 ? 13  LEU A CG   1  
ATOM 151   C CD1  . LEU A 1 13  ? -3.328  10.041  7.323   1.00 0.00 ? 13  LEU A CD1  1  
ATOM 152   C CD2  . LEU A 1 13  ? -3.548  9.644   9.782   1.00 0.00 ? 13  LEU A CD2  1  
ATOM 153   H H    . LEU A 1 13  ? 1.019   10.853  8.568   1.00 0.00 ? 13  LEU A H    1  
ATOM 154   H HA   . LEU A 1 13  ? -0.855  9.968   10.663  1.00 0.00 ? 13  LEU A HA   1  
ATOM 155   H HB2  . LEU A 1 13  ? -0.845  9.528   7.710   1.00 0.00 ? 13  LEU A HB2  1  
ATOM 156   H HB3  . LEU A 1 13  ? -1.560  8.313   8.768   1.00 0.00 ? 13  LEU A HB3  1  
ATOM 157   H HG   . LEU A 1 13  ? -2.423  11.190  8.859   1.00 0.00 ? 13  LEU A HG   1  
ATOM 158   H HD11 . LEU A 1 13  ? -4.386  9.890   7.472   1.00 0.00 ? 13  LEU A HD11 1  
ATOM 159   H HD12 . LEU A 1 13  ? -2.919  9.208   6.772   1.00 0.00 ? 13  LEU A HD12 1  
ATOM 160   H HD13 . LEU A 1 13  ? -3.169  10.953  6.765   1.00 0.00 ? 13  LEU A HD13 1  
ATOM 161   H HD21 . LEU A 1 13  ? -4.075  8.765   9.444   1.00 0.00 ? 13  LEU A HD21 1  
ATOM 162   H HD22 . LEU A 1 13  ? -4.260  10.415  10.038  1.00 0.00 ? 13  LEU A HD22 1  
ATOM 163   H HD23 . LEU A 1 13  ? -2.956  9.398   10.651  1.00 0.00 ? 13  LEU A HD23 1  
ATOM 164   N N    . CYS A 1 14  ? 0.064   7.530   10.719  1.00 0.00 ? 14  CYS A N    1  
ATOM 165   C CA   . CYS A 1 14  ? 0.834   6.336   11.048  1.00 0.00 ? 14  CYS A CA   1  
ATOM 166   C C    . CYS A 1 14  ? -0.045  5.091   10.995  1.00 0.00 ? 14  CYS A C    1  
ATOM 167   O O    . CYS A 1 14  ? -1.271  5.180   11.076  1.00 0.00 ? 14  CYS A O    1  
ATOM 168   C CB   . CYS A 1 14  ? 1.459   6.474   12.437  1.00 0.00 ? 14  CYS A CB   1  
ATOM 169   S SG   . CYS A 1 14  ? 0.272   6.856   13.747  1.00 0.00 ? 14  CYS A SG   1  
ATOM 170   H H    . CYS A 1 14  ? -0.870  7.591   11.008  1.00 0.00 ? 14  CYS A H    1  
ATOM 171   H HA   . CYS A 1 14  ? 1.621   6.237   10.317  1.00 0.00 ? 14  CYS A HA   1  
ATOM 172   H HB2  . CYS A 1 14  ? 1.947   5.546   12.698  1.00 0.00 ? 14  CYS A HB2  1  
ATOM 173   H HB3  . CYS A 1 14  ? 2.193   7.265   12.416  1.00 0.00 ? 14  CYS A HB3  1  
ATOM 174   H HG   . CYS A 1 14  ? -0.285  8.024   13.465  1.00 0.00 ? 14  CYS A HG   1  
ATOM 175   N N    . ILE A 1 15  ? 0.588   3.931   10.855  1.00 0.00 ? 15  ILE A N    1  
ATOM 176   C CA   . ILE A 1 15  ? -0.137  2.668   10.790  1.00 0.00 ? 15  ILE A CA   1  
ATOM 177   C C    . ILE A 1 15  ? 0.322   1.714   11.887  1.00 0.00 ? 15  ILE A C    1  
ATOM 178   O O    . ILE A 1 15  ? 1.458   1.241   11.876  1.00 0.00 ? 15  ILE A O    1  
ATOM 179   C CB   . ILE A 1 15  ? 0.044   1.985   9.421   1.00 0.00 ? 15  ILE A CB   1  
ATOM 180   C CG1  . ILE A 1 15  ? -0.514  2.872   8.306   1.00 0.00 ? 15  ILE A CG1  1  
ATOM 181   C CG2  . ILE A 1 15  ? -0.635  0.624   9.414   1.00 0.00 ? 15  ILE A CG2  1  
ATOM 182   C CD1  . ILE A 1 15  ? -0.262  2.327   6.918   1.00 0.00 ? 15  ILE A CD1  1  
ATOM 183   H H    . ILE A 1 15  ? 1.566   3.925   10.796  1.00 0.00 ? 15  ILE A H    1  
ATOM 184   H HA   . ILE A 1 15  ? -1.188  2.880   10.928  1.00 0.00 ? 15  ILE A HA   1  
ATOM 185   H HB   . ILE A 1 15  ? 1.100   1.834   9.256   1.00 0.00 ? 15  ILE A HB   1  
ATOM 186   H HG12 . ILE A 1 15  ? -1.581  2.971   8.434   1.00 0.00 ? 15  ILE A HG12 1  
ATOM 187   H HG13 . ILE A 1 15  ? -0.056  3.848   8.369   1.00 0.00 ? 15  ILE A HG13 1  
ATOM 188   H HG21 . ILE A 1 15  ? 0.046   -0.116  9.023   1.00 0.00 ? 15  ILE A HG21 1  
ATOM 189   H HG22 . ILE A 1 15  ? -0.916  0.357   10.422  1.00 0.00 ? 15  ILE A HG22 1  
ATOM 190   H HG23 . ILE A 1 15  ? -1.518  0.665   8.794   1.00 0.00 ? 15  ILE A HG23 1  
ATOM 191   H HD11 . ILE A 1 15  ? -0.009  1.280   6.982   1.00 0.00 ? 15  ILE A HD11 1  
ATOM 192   H HD12 . ILE A 1 15  ? -1.150  2.448   6.316   1.00 0.00 ? 15  ILE A HD12 1  
ATOM 193   H HD13 . ILE A 1 15  ? 0.557   2.867   6.463   1.00 0.00 ? 15  ILE A HD13 1  
ATOM 194   N N    . GLN A 1 16  ? -0.571  1.433   12.831  1.00 0.00 ? 16  GLN A N    1  
ATOM 195   C CA   . GLN A 1 16  ? -0.257  0.534   13.935  1.00 0.00 ? 16  GLN A CA   1  
ATOM 196   C C    . GLN A 1 16  ? -0.476  -0.921  13.531  1.00 0.00 ? 16  GLN A C    1  
ATOM 197   O O    . GLN A 1 16  ? -1.601  -1.335  13.249  1.00 0.00 ? 16  GLN A O    1  
ATOM 198   C CB   . GLN A 1 16  ? -1.115  0.871   15.155  1.00 0.00 ? 16  GLN A CB   1  
ATOM 199   C CG   . GLN A 1 16  ? -0.499  1.927   16.059  1.00 0.00 ? 16  GLN A CG   1  
ATOM 200   C CD   . GLN A 1 16  ? -0.928  3.333   15.690  1.00 0.00 ? 16  GLN A CD   1  
ATOM 201   O OE1  . GLN A 1 16  ? -1.881  3.526   14.935  1.00 0.00 ? 16  GLN A OE1  1  
ATOM 202   N NE2  . GLN A 1 16  ? -0.224  4.325   16.223  1.00 0.00 ? 16  GLN A NE2  1  
ATOM 203   H H    . GLN A 1 16  ? -1.460  1.841   12.785  1.00 0.00 ? 16  GLN A H    1  
ATOM 204   H HA   . GLN A 1 16  ? 0.783   0.671   14.189  1.00 0.00 ? 16  GLN A HA   1  
ATOM 205   H HB2  . GLN A 1 16  ? -2.075  1.233   14.817  1.00 0.00 ? 16  GLN A HB2  1  
ATOM 206   H HB3  . GLN A 1 16  ? -1.263  -0.027  15.736  1.00 0.00 ? 16  GLN A HB3  1  
ATOM 207   H HG2  . GLN A 1 16  ? -0.800  1.731   17.077  1.00 0.00 ? 16  GLN A HG2  1  
ATOM 208   H HG3  . GLN A 1 16  ? 0.577   1.862   15.984  1.00 0.00 ? 16  GLN A HG3  1  
ATOM 209   H HE21 . GLN A 1 16  ? 0.523   4.097   16.816  1.00 0.00 ? 16  GLN A HE21 1  
ATOM 210   H HE22 . GLN A 1 16  ? -0.479  5.245   16.001  1.00 0.00 ? 16  GLN A HE22 1  
ATOM 211   N N    . LYS A 1 17  ? 0.606   -1.691  13.503  1.00 0.00 ? 17  LYS A N    1  
ATOM 212   C CA   . LYS A 1 17  ? 0.533   -3.100  13.134  1.00 0.00 ? 17  LYS A CA   1  
ATOM 213   C C    . LYS A 1 17  ? 1.193   -3.975  14.195  1.00 0.00 ? 17  LYS A C    1  
ATOM 214   O O    . LYS A 1 17  ? 1.904   -3.478  15.068  1.00 0.00 ? 17  LYS A O    1  
ATOM 215   C CB   . LYS A 1 17  ? 1.204   -3.329  11.778  1.00 0.00 ? 17  LYS A CB   1  
ATOM 216   C CG   . LYS A 1 17  ? 2.689   -3.633  11.879  1.00 0.00 ? 17  LYS A CG   1  
ATOM 217   C CD   . LYS A 1 17  ? 3.442   -3.146  10.652  1.00 0.00 ? 17  LYS A CD   1  
ATOM 218   C CE   . LYS A 1 17  ? 3.327   -1.638  10.490  1.00 0.00 ? 17  LYS A CE   1  
ATOM 219   N NZ   . LYS A 1 17  ? 4.527   -1.059  9.826   1.00 0.00 ? 17  LYS A NZ   1  
ATOM 220   H H    . LYS A 1 17  ? 1.475   -1.303  13.738  1.00 0.00 ? 17  LYS A H    1  
ATOM 221   H HA   . LYS A 1 17  ? -0.510  -3.370  13.060  1.00 0.00 ? 17  LYS A HA   1  
ATOM 222   H HB2  . LYS A 1 17  ? 0.720   -4.160  11.286  1.00 0.00 ? 17  LYS A HB2  1  
ATOM 223   H HB3  . LYS A 1 17  ? 1.080   -2.442  11.174  1.00 0.00 ? 17  LYS A HB3  1  
ATOM 224   H HG2  . LYS A 1 17  ? 3.090   -3.142  12.753  1.00 0.00 ? 17  LYS A HG2  1  
ATOM 225   H HG3  . LYS A 1 17  ? 2.823   -4.702  11.971  1.00 0.00 ? 17  LYS A HG3  1  
ATOM 226   H HD2  . LYS A 1 17  ? 4.485   -3.407  10.753  1.00 0.00 ? 17  LYS A HD2  1  
ATOM 227   H HD3  . LYS A 1 17  ? 3.032   -3.626  9.775   1.00 0.00 ? 17  LYS A HD3  1  
ATOM 228   H HE2  . LYS A 1 17  ? 2.455   -1.419  9.894   1.00 0.00 ? 17  LYS A HE2  1  
ATOM 229   H HE3  . LYS A 1 17  ? 3.217   -1.192  11.467  1.00 0.00 ? 17  LYS A HE3  1  
ATOM 230   H HZ1  . LYS A 1 17  ? 5.206   -0.727  10.540  1.00 0.00 ? 17  LYS A HZ1  1  
ATOM 231   H HZ2  . LYS A 1 17  ? 4.251   -0.254  9.227   1.00 0.00 ? 17  LYS A HZ2  1  
ATOM 232   H HZ3  . LYS A 1 17  ? 4.988   -1.777  9.231   1.00 0.00 ? 17  LYS A HZ3  1  
ATOM 233   N N    . ALA A 1 18  ? 0.955   -5.280  14.112  1.00 0.00 ? 18  ALA A N    1  
ATOM 234   C CA   . ALA A 1 18  ? 1.530   -6.224  15.062  1.00 0.00 ? 18  ALA A CA   1  
ATOM 235   C C    . ALA A 1 18  ? 3.007   -5.931  15.302  1.00 0.00 ? 18  ALA A C    1  
ATOM 236   O O    . ALA A 1 18  ? 3.633   -5.147  14.587  1.00 0.00 ? 18  ALA A O    1  
ATOM 237   C CB   . ALA A 1 18  ? 1.346   -7.650  14.566  1.00 0.00 ? 18  ALA A CB   1  
ATOM 238   H H    . ALA A 1 18  ? 0.380   -5.616  13.393  1.00 0.00 ? 18  ALA A H    1  
ATOM 239   H HA   . ALA A 1 18  ? 0.997   -6.123  15.997  1.00 0.00 ? 18  ALA A HA   1  
ATOM 240   H HB1  . ALA A 1 18  ? 2.313   -8.120  14.457  1.00 0.00 ? 18  ALA A HB1  1  
ATOM 241   H HB2  . ALA A 1 18  ? 0.754   -8.206  15.278  1.00 0.00 ? 18  ALA A HB2  1  
ATOM 242   H HB3  . ALA A 1 18  ? 0.843   -7.637  13.611  1.00 0.00 ? 18  ALA A HB3  1  
ATOM 243   N N    . PRO A 1 19  ? 3.579   -6.573  16.331  1.00 0.00 ? 19  PRO A N    1  
ATOM 244   C CA   . PRO A 1 19  ? 4.990   -6.396  16.688  1.00 0.00 ? 19  PRO A CA   1  
ATOM 245   C C    . PRO A 1 19  ? 5.930   -7.009  15.656  1.00 0.00 ? 19  PRO A C    1  
ATOM 246   O O    . PRO A 1 19  ? 7.151   -6.917  15.782  1.00 0.00 ? 19  PRO A O    1  
ATOM 247   C CB   . PRO A 1 19  ? 5.112   -7.132  18.025  1.00 0.00 ? 19  PRO A CB   1  
ATOM 248   C CG   . PRO A 1 19  ? 4.020   -8.145  18.001  1.00 0.00 ? 19  PRO A CG   1  
ATOM 249   C CD   . PRO A 1 19  ? 2.893   -7.521  17.225  1.00 0.00 ? 19  PRO A CD   1  
ATOM 250   H HA   . PRO A 1 19  ? 5.237   -5.354  16.825  1.00 0.00 ? 19  PRO A HA   1  
ATOM 251   H HB2  . PRO A 1 19  ? 6.084   -7.599  18.094  1.00 0.00 ? 19  PRO A HB2  1  
ATOM 252   H HB3  . PRO A 1 19  ? 4.984   -6.432  18.838  1.00 0.00 ? 19  PRO A HB3  1  
ATOM 253   H HG2  . PRO A 1 19  ? 4.362   -9.042  17.510  1.00 0.00 ? 19  PRO A HG2  1  
ATOM 254   H HG3  . PRO A 1 19  ? 3.702   -8.365  19.010  1.00 0.00 ? 19  PRO A HG3  1  
ATOM 255   H HD2  . PRO A 1 19  ? 2.365   -8.273  16.657  1.00 0.00 ? 19  PRO A HD2  1  
ATOM 256   H HD3  . PRO A 1 19  ? 2.218   -7.003  17.889  1.00 0.00 ? 19  PRO A HD3  1  
ATOM 257   N N    . GLY A 1 20  ? 5.354   -7.634  14.634  1.00 0.00 ? 20  GLY A N    1  
ATOM 258   C CA   . GLY A 1 20  ? 6.156   -8.252  13.594  1.00 0.00 ? 20  GLY A CA   1  
ATOM 259   C C    . GLY A 1 20  ? 5.343   -8.597  12.362  1.00 0.00 ? 20  GLY A C    1  
ATOM 260   O O    . GLY A 1 20  ? 5.562   -9.634  11.737  1.00 0.00 ? 20  GLY A O    1  
ATOM 261   H H    . GLY A 1 20  ? 4.375   -7.676  14.585  1.00 0.00 ? 20  GLY A H    1  
ATOM 262   H HA2  . GLY A 1 20  ? 6.946   -7.573  13.313  1.00 0.00 ? 20  GLY A HA2  1  
ATOM 263   H HA3  . GLY A 1 20  ? 6.596   -9.158  13.986  1.00 0.00 ? 20  GLY A HA3  1  
ATOM 264   N N    . GLU A 1 21  ? 4.400   -7.727  12.014  1.00 0.00 ? 21  GLU A N    1  
ATOM 265   C CA   . GLU A 1 21  ? 3.550   -7.947  10.850  1.00 0.00 ? 21  GLU A CA   1  
ATOM 266   C C    . GLU A 1 21  ? 4.002   -7.084  9.675   1.00 0.00 ? 21  GLU A C    1  
ATOM 267   O O    . GLU A 1 21  ? 4.436   -5.947  9.857   1.00 0.00 ? 21  GLU A O    1  
ATOM 268   C CB   . GLU A 1 21  ? 2.091   -7.639  11.191  1.00 0.00 ? 21  GLU A CB   1  
ATOM 269   C CG   . GLU A 1 21  ? 1.167   -7.657  9.985   1.00 0.00 ? 21  GLU A CG   1  
ATOM 270   C CD   . GLU A 1 21  ? 0.895   -9.061  9.479   1.00 0.00 ? 21  GLU A CD   1  
ATOM 271   O OE1  . GLU A 1 21  ? 1.122   -10.021 10.244  1.00 0.00 ? 21  GLU A OE1  1  
ATOM 272   O OE2  . GLU A 1 21  ? 0.456   -9.198  8.319   1.00 0.00 ? 21  GLU A OE2  1  
ATOM 273   H H    . GLU A 1 21  ? 4.274   -6.918  12.553  1.00 0.00 ? 21  GLU A H    1  
ATOM 274   H HA   . GLU A 1 21  ? 3.633   -8.986  10.571  1.00 0.00 ? 21  GLU A HA   1  
ATOM 275   H HB2  . GLU A 1 21  ? 1.737   -8.371  11.901  1.00 0.00 ? 21  GLU A HB2  1  
ATOM 276   H HB3  . GLU A 1 21  ? 2.039   -6.659  11.643  1.00 0.00 ? 21  GLU A HB3  1  
ATOM 277   H HG2  . GLU A 1 21  ? 0.227   -7.202  10.260  1.00 0.00 ? 21  GLU A HG2  1  
ATOM 278   H HG3  . GLU A 1 21  ? 1.623   -7.086  9.190   1.00 0.00 ? 21  GLU A HG3  1  
ATOM 279   N N    . ARG A 1 22  ? 3.898   -7.635  8.470   1.00 0.00 ? 22  ARG A N    1  
ATOM 280   C CA   . ARG A 1 22  ? 4.298   -6.918  7.265   1.00 0.00 ? 22  ARG A CA   1  
ATOM 281   C C    . ARG A 1 22  ? 3.172   -6.014  6.772   1.00 0.00 ? 22  ARG A C    1  
ATOM 282   O O    . ARG A 1 22  ? 2.069   -6.480  6.482   1.00 0.00 ? 22  ARG A O    1  
ATOM 283   C CB   . ARG A 1 22  ? 4.693   -7.905  6.166   1.00 0.00 ? 22  ARG A CB   1  
ATOM 284   C CG   . ARG A 1 22  ? 3.636   -8.962  5.889   1.00 0.00 ? 22  ARG A CG   1  
ATOM 285   C CD   . ARG A 1 22  ? 3.642   -9.387  4.428   1.00 0.00 ? 22  ARG A CD   1  
ATOM 286   N NE   . ARG A 1 22  ? 2.380   -10.006 4.033   1.00 0.00 ? 22  ARG A NE   1  
ATOM 287   C CZ   . ARG A 1 22  ? 2.256   -10.823 2.993   1.00 0.00 ? 22  ARG A CZ   1  
ATOM 288   N NH1  . ARG A 1 22  ? 3.312   -11.119 2.249   1.00 0.00 ? 22  ARG A NH1  1  
ATOM 289   N NH2  . ARG A 1 22  ? 1.073   -11.347 2.697   1.00 0.00 ? 22  ARG A NH2  1  
ATOM 290   H H    . ARG A 1 22  ? 3.545   -8.546  8.389   1.00 0.00 ? 22  ARG A H    1  
ATOM 291   H HA   . ARG A 1 22  ? 5.153   -6.306  7.511   1.00 0.00 ? 22  ARG A HA   1  
ATOM 292   H HB2  . ARG A 1 22  ? 4.870   -7.357  5.252   1.00 0.00 ? 22  ARG A HB2  1  
ATOM 293   H HB3  . ARG A 1 22  ? 5.603   -8.406  6.458   1.00 0.00 ? 22  ARG A HB3  1  
ATOM 294   H HG2  . ARG A 1 22  ? 3.835   -9.827  6.504   1.00 0.00 ? 22  ARG A HG2  1  
ATOM 295   H HG3  . ARG A 1 22  ? 2.665   -8.560  6.134   1.00 0.00 ? 22  ARG A HG3  1  
ATOM 296   H HD2  . ARG A 1 22  ? 3.812   -8.515  3.815   1.00 0.00 ? 22  ARG A HD2  1  
ATOM 297   H HD3  . ARG A 1 22  ? 4.443   -10.095 4.277   1.00 0.00 ? 22  ARG A HD3  1  
ATOM 298   H HE   . ARG A 1 22  ? 1.586   -9.801  4.570   1.00 0.00 ? 22  ARG A HE   1  
ATOM 299   H HH11 . ARG A 1 22  ? 4.205   -10.726 2.470   1.00 0.00 ? 22  ARG A HH11 1  
ATOM 300   H HH12 . ARG A 1 22  ? 3.217   -11.735 1.467   1.00 0.00 ? 22  ARG A HH12 1  
ATOM 301   H HH21 . ARG A 1 22  ? 0.275   -11.127 3.256   1.00 0.00 ? 22  ARG A HH21 1  
ATOM 302   H HH22 . ARG A 1 22  ? 0.981   -11.962 1.914   1.00 0.00 ? 22  ARG A HH22 1  
ATOM 303   N N    . LEU A 1 23  ? 3.457   -4.720  6.680   1.00 0.00 ? 23  LEU A N    1  
ATOM 304   C CA   . LEU A 1 23  ? 2.469   -3.749  6.222   1.00 0.00 ? 23  LEU A CA   1  
ATOM 305   C C    . LEU A 1 23  ? 1.547   -4.364  5.174   1.00 0.00 ? 23  LEU A C    1  
ATOM 306   O O    . LEU A 1 23  ? 0.325   -4.320  5.305   1.00 0.00 ? 23  LEU A O    1  
ATOM 307   C CB   . LEU A 1 23  ? 3.166   -2.516  5.645   1.00 0.00 ? 23  LEU A CB   1  
ATOM 308   C CG   . LEU A 1 23  ? 2.432   -1.186  5.823   1.00 0.00 ? 23  LEU A CG   1  
ATOM 309   C CD1  . LEU A 1 23  ? 1.021   -1.275  5.263   1.00 0.00 ? 23  LEU A CD1  1  
ATOM 310   C CD2  . LEU A 1 23  ? 2.401   -0.786  7.291   1.00 0.00 ? 23  LEU A CD2  1  
ATOM 311   H H    . LEU A 1 23  ? 4.353   -4.408  6.925   1.00 0.00 ? 23  LEU A H    1  
ATOM 312   H HA   . LEU A 1 23  ? 1.877   -3.452  7.075   1.00 0.00 ? 23  LEU A HA   1  
ATOM 313   H HB2  . LEU A 1 23  ? 4.130   -2.428  6.121   1.00 0.00 ? 23  LEU A HB2  1  
ATOM 314   H HB3  . LEU A 1 23  ? 3.303   -2.680  4.586   1.00 0.00 ? 23  LEU A HB3  1  
ATOM 315   H HG   . LEU A 1 23  ? 2.959   -0.416  5.277   1.00 0.00 ? 23  LEU A HG   1  
ATOM 316   H HD11 . LEU A 1 23  ? 0.932   -2.161  4.652   1.00 0.00 ? 23  LEU A HD11 1  
ATOM 317   H HD12 . LEU A 1 23  ? 0.816   -0.401  4.663   1.00 0.00 ? 23  LEU A HD12 1  
ATOM 318   H HD13 . LEU A 1 23  ? 0.313   -1.326  6.078   1.00 0.00 ? 23  LEU A HD13 1  
ATOM 319   H HD21 . LEU A 1 23  ? 1.465   -0.294  7.510   1.00 0.00 ? 23  LEU A HD21 1  
ATOM 320   H HD22 . LEU A 1 23  ? 3.219   -0.111  7.498   1.00 0.00 ? 23  LEU A HD22 1  
ATOM 321   H HD23 . LEU A 1 23  ? 2.497   -1.668  7.906   1.00 0.00 ? 23  LEU A HD23 1  
ATOM 322   N N    . GLY A 1 24  ? 2.143   -4.939  4.133   1.00 0.00 ? 24  GLY A N    1  
ATOM 323   C CA   . GLY A 1 24  ? 1.360   -5.557  3.079   1.00 0.00 ? 24  GLY A CA   1  
ATOM 324   C C    . GLY A 1 24  ? 0.848   -4.548  2.070   1.00 0.00 ? 24  GLY A C    1  
ATOM 325   O O    . GLY A 1 24  ? -0.298  -4.631  1.626   1.00 0.00 ? 24  GLY A O    1  
ATOM 326   H H    . GLY A 1 24  ? 3.122   -4.944  4.082   1.00 0.00 ? 24  GLY A H    1  
ATOM 327   H HA2  . GLY A 1 24  ? 1.975   -6.282  2.567   1.00 0.00 ? 24  GLY A HA2  1  
ATOM 328   H HA3  . GLY A 1 24  ? 0.517   -6.065  3.523   1.00 0.00 ? 24  GLY A HA3  1  
ATOM 329   N N    . ILE A 1 25  ? 1.697   -3.591  1.709   1.00 0.00 ? 25  ILE A N    1  
ATOM 330   C CA   . ILE A 1 25  ? 1.322   -2.562  0.748   1.00 0.00 ? 25  ILE A CA   1  
ATOM 331   C C    . ILE A 1 25  ? 2.256   -2.570  -0.458  1.00 0.00 ? 25  ILE A C    1  
ATOM 332   O O    . ILE A 1 25  ? 3.350   -3.131  -0.404  1.00 0.00 ? 25  ILE A O    1  
ATOM 333   C CB   . ILE A 1 25  ? 1.340   -1.161  1.387   1.00 0.00 ? 25  ILE A CB   1  
ATOM 334   C CG1  . ILE A 1 25  ? 2.565   -1.004  2.291   1.00 0.00 ? 25  ILE A CG1  1  
ATOM 335   C CG2  . ILE A 1 25  ? 0.060   -0.922  2.174   1.00 0.00 ? 25  ILE A CG2  1  
ATOM 336   C CD1  . ILE A 1 25  ? 2.999   0.433   2.476   1.00 0.00 ? 25  ILE A CD1  1  
ATOM 337   H H    . ILE A 1 25  ? 2.596   -3.578  2.098   1.00 0.00 ? 25  ILE A H    1  
ATOM 338   H HA   . ILE A 1 25  ? 0.316   -2.770  0.412   1.00 0.00 ? 25  ILE A HA   1  
ATOM 339   H HB   . ILE A 1 25  ? 1.390   -0.429  0.596   1.00 0.00 ? 25  ILE A HB   1  
ATOM 340   H HG12 . ILE A 1 25  ? 2.341   -1.411  3.264   1.00 0.00 ? 25  ILE A HG12 1  
ATOM 341   H HG13 . ILE A 1 25  ? 3.393   -1.549  1.860   1.00 0.00 ? 25  ILE A HG13 1  
ATOM 342   H HG21 . ILE A 1 25  ? -0.034  -1.673  2.945   1.00 0.00 ? 25  ILE A HG21 1  
ATOM 343   H HG22 . ILE A 1 25  ? 0.096   0.057   2.629   1.00 0.00 ? 25  ILE A HG22 1  
ATOM 344   H HG23 . ILE A 1 25  ? -0.788  -0.979  1.509   1.00 0.00 ? 25  ILE A HG23 1  
ATOM 345   H HD11 . ILE A 1 25  ? 3.682   0.708   1.686   1.00 0.00 ? 25  ILE A HD11 1  
ATOM 346   H HD12 . ILE A 1 25  ? 2.134   1.078   2.447   1.00 0.00 ? 25  ILE A HD12 1  
ATOM 347   H HD13 . ILE A 1 25  ? 3.495   0.538   3.431   1.00 0.00 ? 25  ILE A HD13 1  
ATOM 348   N N    . SER A 1 26  ? 1.817   -1.942  -1.544  1.00 0.00 ? 26  SER A N    1  
ATOM 349   C CA   . SER A 1 26  ? 2.613   -1.879  -2.764  1.00 0.00 ? 26  SER A CA   1  
ATOM 350   C C    . SER A 1 26  ? 2.696   -0.447  -3.284  1.00 0.00 ? 26  SER A C    1  
ATOM 351   O O    . SER A 1 26  ? 1.744   0.325   -3.165  1.00 0.00 ? 26  SER A O    1  
ATOM 352   C CB   . SER A 1 26  ? 2.012   -2.789  -3.838  1.00 0.00 ? 26  SER A CB   1  
ATOM 353   O OG   . SER A 1 26  ? 2.575   -4.088  -3.777  1.00 0.00 ? 26  SER A OG   1  
ATOM 354   H H    . SER A 1 26  ? 0.935   -1.514  -1.525  1.00 0.00 ? 26  SER A H    1  
ATOM 355   H HA   . SER A 1 26  ? 3.609   -2.222  -2.529  1.00 0.00 ? 26  SER A HA   1  
ATOM 356   H HB2  . SER A 1 26  ? 0.946   -2.864  -3.687  1.00 0.00 ? 26  SER A HB2  1  
ATOM 357   H HB3  . SER A 1 26  ? 2.210   -2.368  -4.813  1.00 0.00 ? 26  SER A HB3  1  
ATOM 358   H HG   . SER A 1 26  ? 3.520   -4.036  -3.939  1.00 0.00 ? 26  SER A HG   1  
ATOM 359   N N    . ILE A 1 27  ? 3.842   -0.099  -3.861  1.00 0.00 ? 27  ILE A N    1  
ATOM 360   C CA   . ILE A 1 27  ? 4.050   1.239   -4.400  1.00 0.00 ? 27  ILE A CA   1  
ATOM 361   C C    . ILE A 1 27  ? 4.729   1.182   -5.765  1.00 0.00 ? 27  ILE A C    1  
ATOM 362   O O    . ILE A 1 27  ? 5.411   0.210   -6.090  1.00 0.00 ? 27  ILE A O    1  
ATOM 363   C CB   . ILE A 1 27  ? 4.902   2.102   -3.451  1.00 0.00 ? 27  ILE A CB   1  
ATOM 364   C CG1  . ILE A 1 27  ? 6.360   1.638   -3.474  1.00 0.00 ? 27  ILE A CG1  1  
ATOM 365   C CG2  . ILE A 1 27  ? 4.344   2.042   -2.037  1.00 0.00 ? 27  ILE A CG2  1  
ATOM 366   C CD1  . ILE A 1 27  ? 7.297   2.550   -2.714  1.00 0.00 ? 27  ILE A CD1  1  
ATOM 367   H H    . ILE A 1 27  ? 4.563   -0.759  -3.926  1.00 0.00 ? 27  ILE A H    1  
ATOM 368   H HA   . ILE A 1 27  ? 3.083   1.708   -4.511  1.00 0.00 ? 27  ILE A HA   1  
ATOM 369   H HB   . ILE A 1 27  ? 4.852   3.126   -3.789  1.00 0.00 ? 27  ILE A HB   1  
ATOM 370   H HG12 . ILE A 1 27  ? 6.425   0.655   -3.035  1.00 0.00 ? 27  ILE A HG12 1  
ATOM 371   H HG13 . ILE A 1 27  ? 6.698   1.592   -4.500  1.00 0.00 ? 27  ILE A HG13 1  
ATOM 372   H HG21 . ILE A 1 27  ? 5.128   1.753   -1.353  1.00 0.00 ? 27  ILE A HG21 1  
ATOM 373   H HG22 . ILE A 1 27  ? 3.965   3.014   -1.759  1.00 0.00 ? 27  ILE A HG22 1  
ATOM 374   H HG23 . ILE A 1 27  ? 3.544   1.318   -1.995  1.00 0.00 ? 27  ILE A HG23 1  
ATOM 375   H HD11 . ILE A 1 27  ? 8.121   2.833   -3.353  1.00 0.00 ? 27  ILE A HD11 1  
ATOM 376   H HD12 . ILE A 1 27  ? 6.763   3.435   -2.401  1.00 0.00 ? 27  ILE A HD12 1  
ATOM 377   H HD13 . ILE A 1 27  ? 7.677   2.032   -1.845  1.00 0.00 ? 27  ILE A HD13 1  
ATOM 378   N N    . ARG A 1 28  ? 4.538   2.231   -6.558  1.00 0.00 ? 28  ARG A N    1  
ATOM 379   C CA   . ARG A 1 28  ? 5.133   2.301   -7.888  1.00 0.00 ? 28  ARG A CA   1  
ATOM 380   C C    . ARG A 1 28  ? 5.804   3.653   -8.113  1.00 0.00 ? 28  ARG A C    1  
ATOM 381   O O    . ARG A 1 28  ? 5.225   4.700   -7.825  1.00 0.00 ? 28  ARG A O    1  
ATOM 382   C CB   . ARG A 1 28  ? 4.067   2.064   -8.959  1.00 0.00 ? 28  ARG A CB   1  
ATOM 383   C CG   . ARG A 1 28  ? 2.965   3.111   -8.964  1.00 0.00 ? 28  ARG A CG   1  
ATOM 384   C CD   . ARG A 1 28  ? 2.118   3.023   -10.224 1.00 0.00 ? 28  ARG A CD   1  
ATOM 385   N NE   . ARG A 1 28  ? 2.640   3.868   -11.295 1.00 0.00 ? 28  ARG A NE   1  
ATOM 386   C CZ   . ARG A 1 28  ? 2.268   3.758   -12.565 1.00 0.00 ? 28  ARG A CZ   1  
ATOM 387   N NH1  . ARG A 1 28  ? 1.376   2.844   -12.922 1.00 0.00 ? 28  ARG A NH1  1  
ATOM 388   N NH2  . ARG A 1 28  ? 2.789   4.564   -13.482 1.00 0.00 ? 28  ARG A NH2  1  
ATOM 389   H H    . ARG A 1 28  ? 3.984   2.975   -6.243  1.00 0.00 ? 28  ARG A H    1  
ATOM 390   H HA   . ARG A 1 28  ? 5.880   1.525   -7.959  1.00 0.00 ? 28  ARG A HA   1  
ATOM 391   H HB2  . ARG A 1 28  ? 4.541   2.069   -9.930  1.00 0.00 ? 28  ARG A HB2  1  
ATOM 392   H HB3  . ARG A 1 28  ? 3.615   1.098   -8.793  1.00 0.00 ? 28  ARG A HB3  1  
ATOM 393   H HG2  . ARG A 1 28  ? 2.329   2.955   -8.105  1.00 0.00 ? 28  ARG A HG2  1  
ATOM 394   H HG3  . ARG A 1 28  ? 3.413   4.092   -8.909  1.00 0.00 ? 28  ARG A HG3  1  
ATOM 395   H HD2  . ARG A 1 28  ? 2.105   1.997   -10.562 1.00 0.00 ? 28  ARG A HD2  1  
ATOM 396   H HD3  . ARG A 1 28  ? 1.112   3.337   -9.988  1.00 0.00 ? 28  ARG A HD3  1  
ATOM 397   H HE   . ARG A 1 28  ? 3.301   4.550   -11.053 1.00 0.00 ? 28  ARG A HE   1  
ATOM 398   H HH11 . ARG A 1 28  ? 0.982   2.236   -12.233 1.00 0.00 ? 28  ARG A HH11 1  
ATOM 399   H HH12 . ARG A 1 28  ? 1.097   2.764   -13.879 1.00 0.00 ? 28  ARG A HH12 1  
ATOM 400   H HH21 . ARG A 1 28  ? 3.461   5.254   -13.217 1.00 0.00 ? 28  ARG A HH21 1  
ATOM 401   H HH22 . ARG A 1 28  ? 2.508   4.480   -14.438 1.00 0.00 ? 28  ARG A HH22 1  
ATOM 402   N N    . GLY A 1 29  ? 7.029   3.621   -8.628  1.00 0.00 ? 29  GLY A N    1  
ATOM 403   C CA   . GLY A 1 29  ? 7.759   4.849   -8.882  1.00 0.00 ? 29  GLY A CA   1  
ATOM 404   C C    . GLY A 1 29  ? 9.261   4.657   -8.808  1.00 0.00 ? 29  GLY A C    1  
ATOM 405   O O    . GLY A 1 29  ? 9.784   3.629   -9.236  1.00 0.00 ? 29  GLY A O    1  
ATOM 406   H H    . GLY A 1 29  ? 7.441   2.757   -8.838  1.00 0.00 ? 29  GLY A H    1  
ATOM 407   H HA2  . GLY A 1 29  ? 7.500   5.212   -9.866  1.00 0.00 ? 29  GLY A HA2  1  
ATOM 408   H HA3  . GLY A 1 29  ? 7.466   5.587   -8.149  1.00 0.00 ? 29  GLY A HA3  1  
ATOM 409   N N    . GLY A 1 30  ? 9.957   5.651   -8.266  1.00 0.00 ? 30  GLY A N    1  
ATOM 410   C CA   . GLY A 1 30  ? 11.401  5.568   -8.149  1.00 0.00 ? 30  GLY A CA   1  
ATOM 411   C C    . GLY A 1 30  ? 12.111  6.637   -8.956  1.00 0.00 ? 30  GLY A C    1  
ATOM 412   O O    . GLY A 1 30  ? 11.610  7.079   -9.990  1.00 0.00 ? 30  GLY A O    1  
ATOM 413   H H    . GLY A 1 30  ? 9.487   6.448   -7.941  1.00 0.00 ? 30  GLY A H    1  
ATOM 414   H HA2  . GLY A 1 30  ? 11.675  5.675   -7.110  1.00 0.00 ? 30  GLY A HA2  1  
ATOM 415   H HA3  . GLY A 1 30  ? 11.724  4.598   -8.498  1.00 0.00 ? 30  GLY A HA3  1  
ATOM 416   N N    . ALA A 1 31  ? 13.280  7.056   -8.483  1.00 0.00 ? 31  ALA A N    1  
ATOM 417   C CA   . ALA A 1 31  ? 14.059  8.080   -9.168  1.00 0.00 ? 31  ALA A CA   1  
ATOM 418   C C    . ALA A 1 31  ? 14.383  7.659   -10.597 1.00 0.00 ? 31  ALA A C    1  
ATOM 419   O O    . ALA A 1 31  ? 14.854  8.464   -11.400 1.00 0.00 ? 31  ALA A O    1  
ATOM 420   C CB   . ALA A 1 31  ? 15.339  8.372   -8.399  1.00 0.00 ? 31  ALA A CB   1  
ATOM 421   H H    . ALA A 1 31  ? 13.627  6.666   -7.654  1.00 0.00 ? 31  ALA A H    1  
ATOM 422   H HA   . ALA A 1 31  ? 13.470  8.985   -9.195  1.00 0.00 ? 31  ALA A HA   1  
ATOM 423   H HB1  . ALA A 1 31  ? 15.986  7.508   -8.438  1.00 0.00 ? 31  ALA A HB1  1  
ATOM 424   H HB2  . ALA A 1 31  ? 15.840  9.219   -8.842  1.00 0.00 ? 31  ALA A HB2  1  
ATOM 425   H HB3  . ALA A 1 31  ? 15.097  8.594   -7.370  1.00 0.00 ? 31  ALA A HB3  1  
ATOM 426   N N    . ARG A 1 32  ? 14.127  6.392   -10.908 1.00 0.00 ? 32  ARG A N    1  
ATOM 427   C CA   . ARG A 1 32  ? 14.394  5.864   -12.241 1.00 0.00 ? 32  ARG A CA   1  
ATOM 428   C C    . ARG A 1 32  ? 13.176  5.123   -12.785 1.00 0.00 ? 32  ARG A C    1  
ATOM 429   O O    . ARG A 1 32  ? 12.798  5.296   -13.943 1.00 0.00 ? 32  ARG A O    1  
ATOM 430   C CB   . ARG A 1 32  ? 15.602  4.927   -12.208 1.00 0.00 ? 32  ARG A CB   1  
ATOM 431   C CG   . ARG A 1 32  ? 16.934  5.653   -12.102 1.00 0.00 ? 32  ARG A CG   1  
ATOM 432   C CD   . ARG A 1 32  ? 18.083  4.680   -11.892 1.00 0.00 ? 32  ARG A CD   1  
ATOM 433   N NE   . ARG A 1 32  ? 18.476  4.020   -13.135 1.00 0.00 ? 32  ARG A NE   1  
ATOM 434   C CZ   . ARG A 1 32  ? 19.643  3.409   -13.305 1.00 0.00 ? 32  ARG A CZ   1  
ATOM 435   N NH1  . ARG A 1 32  ? 20.527  3.373   -12.318 1.00 0.00 ? 32  ARG A NH1  1  
ATOM 436   N NH2  . ARG A 1 32  ? 19.927  2.831   -14.465 1.00 0.00 ? 32  ARG A NH2  1  
ATOM 437   H H    . ARG A 1 32  ? 13.751  5.798   -10.225 1.00 0.00 ? 32  ARG A H    1  
ATOM 438   H HA   . ARG A 1 32  ? 14.613  6.698   -12.890 1.00 0.00 ? 32  ARG A HA   1  
ATOM 439   H HB2  . ARG A 1 32  ? 15.509  4.266   -11.359 1.00 0.00 ? 32  ARG A HB2  1  
ATOM 440   H HB3  . ARG A 1 32  ? 15.610  4.337   -13.113 1.00 0.00 ? 32  ARG A HB3  1  
ATOM 441   H HG2  . ARG A 1 32  ? 17.106  6.205   -13.014 1.00 0.00 ? 32  ARG A HG2  1  
ATOM 442   H HG3  . ARG A 1 32  ? 16.894  6.336   -11.267 1.00 0.00 ? 32  ARG A HG3  1  
ATOM 443   H HD2  . ARG A 1 32  ? 18.931  5.224   -11.502 1.00 0.00 ? 32  ARG A HD2  1  
ATOM 444   H HD3  . ARG A 1 32  ? 17.777  3.930   -11.178 1.00 0.00 ? 32  ARG A HD3  1  
ATOM 445   H HE   . ARG A 1 32  ? 17.837  4.034   -13.877 1.00 0.00 ? 32  ARG A HE   1  
ATOM 446   H HH11 . ARG A 1 32  ? 20.315  3.807   -11.442 1.00 0.00 ? 32  ARG A HH11 1  
ATOM 447   H HH12 . ARG A 1 32  ? 21.404  2.911   -12.448 1.00 0.00 ? 32  ARG A HH12 1  
ATOM 448   H HH21 . ARG A 1 32  ? 19.263  2.855   -15.212 1.00 0.00 ? 32  ARG A HH21 1  
ATOM 449   H HH22 . ARG A 1 32  ? 20.805  2.371   -14.593 1.00 0.00 ? 32  ARG A HH22 1  
ATOM 450   N N    . GLY A 1 33  ? 12.567  4.295   -11.941 1.00 0.00 ? 33  GLY A N    1  
ATOM 451   C CA   . GLY A 1 33  ? 11.400  3.539   -12.356 1.00 0.00 ? 33  GLY A CA   1  
ATOM 452   C C    . GLY A 1 33  ? 10.516  4.316   -13.312 1.00 0.00 ? 33  GLY A C    1  
ATOM 453   O O    . GLY A 1 33  ? 10.463  5.546   -13.261 1.00 0.00 ? 33  GLY A O    1  
ATOM 454   H H    . GLY A 1 33  ? 12.913  4.197   -11.030 1.00 0.00 ? 33  GLY A H    1  
ATOM 455   H HA2  . GLY A 1 33  ? 11.726  2.631   -12.841 1.00 0.00 ? 33  GLY A HA2  1  
ATOM 456   H HA3  . GLY A 1 33  ? 10.822  3.281   -11.481 1.00 0.00 ? 33  GLY A HA3  1  
ATOM 457   N N    . HIS A 1 34  ? 9.821   3.599   -14.189 1.00 0.00 ? 34  HIS A N    1  
ATOM 458   C CA   . HIS A 1 34  ? 8.936   4.229   -15.162 1.00 0.00 ? 34  HIS A CA   1  
ATOM 459   C C    . HIS A 1 34  ? 8.255   5.455   -14.563 1.00 0.00 ? 34  HIS A C    1  
ATOM 460   O O    . HIS A 1 34  ? 7.676   5.389   -13.479 1.00 0.00 ? 34  HIS A O    1  
ATOM 461   C CB   . HIS A 1 34  ? 7.882   3.232   -15.645 1.00 0.00 ? 34  HIS A CB   1  
ATOM 462   C CG   . HIS A 1 34  ? 7.293   2.403   -14.546 1.00 0.00 ? 34  HIS A CG   1  
ATOM 463   N ND1  . HIS A 1 34  ? 6.381   2.897   -13.637 1.00 0.00 ? 34  HIS A ND1  1  
ATOM 464   C CD2  . HIS A 1 34  ? 7.488   1.105   -14.213 1.00 0.00 ? 34  HIS A CD2  1  
ATOM 465   C CE1  . HIS A 1 34  ? 6.043   1.940   -12.791 1.00 0.00 ? 34  HIS A CE1  1  
ATOM 466   N NE2  . HIS A 1 34  ? 6.700   0.842   -13.119 1.00 0.00 ? 34  HIS A NE2  1  
ATOM 467   H H    . HIS A 1 34  ? 9.905   2.622   -14.181 1.00 0.00 ? 34  HIS A H    1  
ATOM 468   H HA   . HIS A 1 34  ? 9.536   4.541   -16.003 1.00 0.00 ? 34  HIS A HA   1  
ATOM 469   H HB2  . HIS A 1 34  ? 7.077   3.771   -16.121 1.00 0.00 ? 34  HIS A HB2  1  
ATOM 470   H HB3  . HIS A 1 34  ? 8.333   2.561   -16.363 1.00 0.00 ? 34  HIS A HB3  1  
ATOM 471   H HD1  . HIS A 1 34  ? 6.036   3.813   -13.613 1.00 0.00 ? 34  HIS A HD1  1  
ATOM 472   H HD2  . HIS A 1 34  ? 8.142   0.406   -14.714 1.00 0.00 ? 34  HIS A HD2  1  
ATOM 473   H HE1  . HIS A 1 34  ? 5.347   2.038   -11.971 1.00 0.00 ? 34  HIS A HE1  1  
ATOM 474   H HE2  . HIS A 1 34  ? 6.699   0.009   -12.605 1.00 0.00 ? 34  HIS A HE2  1  
ATOM 475   N N    . ALA A 1 35  ? 8.329   6.575   -15.275 1.00 0.00 ? 35  ALA A N    1  
ATOM 476   C CA   . ALA A 1 35  ? 7.719   7.816   -14.814 1.00 0.00 ? 35  ALA A CA   1  
ATOM 477   C C    . ALA A 1 35  ? 6.327   7.565   -14.245 1.00 0.00 ? 35  ALA A C    1  
ATOM 478   O O    . ALA A 1 35  ? 5.397   7.232   -14.978 1.00 0.00 ? 35  ALA A O    1  
ATOM 479   C CB   . ALA A 1 35  ? 7.653   8.825   -15.950 1.00 0.00 ? 35  ALA A CB   1  
ATOM 480   H H    . ALA A 1 35  ? 8.805   6.565   -16.132 1.00 0.00 ? 35  ALA A H    1  
ATOM 481   H HA   . ALA A 1 35  ? 8.346   8.227   -14.036 1.00 0.00 ? 35  ALA A HA   1  
ATOM 482   H HB1  . ALA A 1 35  ? 8.655   9.120   -16.227 1.00 0.00 ? 35  ALA A HB1  1  
ATOM 483   H HB2  . ALA A 1 35  ? 7.161   8.378   -16.801 1.00 0.00 ? 35  ALA A HB2  1  
ATOM 484   H HB3  . ALA A 1 35  ? 7.098   9.694   -15.628 1.00 0.00 ? 35  ALA A HB3  1  
ATOM 485   N N    . GLY A 1 36  ? 6.191   7.726   -12.932 1.00 0.00 ? 36  GLY A N    1  
ATOM 486   C CA   . GLY A 1 36  ? 4.909   7.512   -12.287 1.00 0.00 ? 36  GLY A CA   1  
ATOM 487   C C    . GLY A 1 36  ? 3.775   8.220   -13.002 1.00 0.00 ? 36  GLY A C    1  
ATOM 488   O O    . GLY A 1 36  ? 2.680   7.675   -13.135 1.00 0.00 ? 36  GLY A O    1  
ATOM 489   H H    . GLY A 1 36  ? 6.968   7.993   -12.397 1.00 0.00 ? 36  GLY A H    1  
ATOM 490   H HA2  . GLY A 1 36  ? 4.701   6.453   -12.266 1.00 0.00 ? 36  GLY A HA2  1  
ATOM 491   H HA3  . GLY A 1 36  ? 4.964   7.879   -11.273 1.00 0.00 ? 36  GLY A HA3  1  
ATOM 492   N N    . ASN A 1 37  ? 4.037   9.439   -13.462 1.00 0.00 ? 37  ASN A N    1  
ATOM 493   C CA   . ASN A 1 37  ? 3.029   10.224  -14.165 1.00 0.00 ? 37  ASN A CA   1  
ATOM 494   C C    . ASN A 1 37  ? 3.054   9.927   -15.661 1.00 0.00 ? 37  ASN A C    1  
ATOM 495   O O    . ASN A 1 37  ? 4.054   10.146  -16.345 1.00 0.00 ? 37  ASN A O    1  
ATOM 496   C CB   . ASN A 1 37  ? 3.257   11.718  -13.925 1.00 0.00 ? 37  ASN A CB   1  
ATOM 497   C CG   . ASN A 1 37  ? 2.141   12.572  -14.496 1.00 0.00 ? 37  ASN A CG   1  
ATOM 498   O OD1  . ASN A 1 37  ? 1.034   12.088  -14.735 1.00 0.00 ? 37  ASN A OD1  1  
ATOM 499   N ND2  . ASN A 1 37  ? 2.428   13.849  -14.717 1.00 0.00 ? 37  ASN A ND2  1  
ATOM 500   H H    . ASN A 1 37  ? 4.929   9.821   -13.325 1.00 0.00 ? 37  ASN A H    1  
ATOM 501   H HA   . ASN A 1 37  ? 2.061   9.949   -13.772 1.00 0.00 ? 37  ASN A HA   1  
ATOM 502   H HB2  . ASN A 1 37  ? 3.316   11.901  -12.862 1.00 0.00 ? 37  ASN A HB2  1  
ATOM 503   H HB3  . ASN A 1 37  ? 4.185   12.013  -14.390 1.00 0.00 ? 37  ASN A HB3  1  
ATOM 504   H HD21 . ASN A 1 37  ? 3.330   14.165  -14.502 1.00 0.00 ? 37  ASN A HD21 1  
ATOM 505   H HD22 . ASN A 1 37  ? 1.724   14.424  -15.084 1.00 0.00 ? 37  ASN A HD22 1  
ATOM 506   N N    . PRO A 1 38  ? 1.929   9.418   -16.183 1.00 0.00 ? 38  PRO A N    1  
ATOM 507   C CA   . PRO A 1 38  ? 1.796   9.082   -17.604 1.00 0.00 ? 38  PRO A CA   1  
ATOM 508   C C    . PRO A 1 38  ? 1.764   10.321  -18.492 1.00 0.00 ? 38  PRO A C    1  
ATOM 509   O O    . PRO A 1 38  ? 1.875   10.223  -19.714 1.00 0.00 ? 38  PRO A O    1  
ATOM 510   C CB   . PRO A 1 38  ? 0.458   8.342   -17.669 1.00 0.00 ? 38  PRO A CB   1  
ATOM 511   C CG   . PRO A 1 38  ? -0.315  8.851   -16.502 1.00 0.00 ? 38  PRO A CG   1  
ATOM 512   C CD   . PRO A 1 38  ? 0.698   9.132   -15.426 1.00 0.00 ? 38  PRO A CD   1  
ATOM 513   H HA   . PRO A 1 38  ? 2.589   8.426   -17.931 1.00 0.00 ? 38  PRO A HA   1  
ATOM 514   H HB2  . PRO A 1 38  ? -0.038  8.571   -18.602 1.00 0.00 ? 38  PRO A HB2  1  
ATOM 515   H HB3  . PRO A 1 38  ? 0.627   7.278   -17.597 1.00 0.00 ? 38  PRO A HB3  1  
ATOM 516   H HG2  . PRO A 1 38  ? -0.836  9.756   -16.773 1.00 0.00 ? 38  PRO A HG2  1  
ATOM 517   H HG3  . PRO A 1 38  ? -1.014  8.098   -16.169 1.00 0.00 ? 38  PRO A HG3  1  
ATOM 518   H HD2  . PRO A 1 38  ? 0.398   9.988   -14.840 1.00 0.00 ? 38  PRO A HD2  1  
ATOM 519   H HD3  . PRO A 1 38  ? 0.828   8.266   -14.794 1.00 0.00 ? 38  PRO A HD3  1  
ATOM 520   N N    . ARG A 1 39  ? 1.611   11.485  -17.870 1.00 0.00 ? 39  ARG A N    1  
ATOM 521   C CA   . ARG A 1 39  ? 1.564   12.743  -18.605 1.00 0.00 ? 39  ARG A CA   1  
ATOM 522   C C    . ARG A 1 39  ? 2.970   13.225  -18.950 1.00 0.00 ? 39  ARG A C    1  
ATOM 523   O O    . ARG A 1 39  ? 3.316   13.376  -20.122 1.00 0.00 ? 39  ARG A O    1  
ATOM 524   C CB   . ARG A 1 39  ? 0.834   13.810  -17.786 1.00 0.00 ? 39  ARG A CB   1  
ATOM 525   C CG   . ARG A 1 39  ? 0.553   15.087  -18.562 1.00 0.00 ? 39  ARG A CG   1  
ATOM 526   C CD   . ARG A 1 39  ? -0.536  14.878  -19.603 1.00 0.00 ? 39  ARG A CD   1  
ATOM 527   N NE   . ARG A 1 39  ? -0.438  15.840  -20.697 1.00 0.00 ? 39  ARG A NE   1  
ATOM 528   C CZ   . ARG A 1 39  ? -1.085  15.709  -21.850 1.00 0.00 ? 39  ARG A CZ   1  
ATOM 529   N NH1  . ARG A 1 39  ? -1.871  14.662  -22.058 1.00 0.00 ? 39  ARG A NH1  1  
ATOM 530   N NH2  . ARG A 1 39  ? -0.945  16.627  -22.798 1.00 0.00 ? 39  ARG A NH2  1  
ATOM 531   H H    . ARG A 1 39  ? 1.528   11.499  -16.894 1.00 0.00 ? 39  ARG A H    1  
ATOM 532   H HA   . ARG A 1 39  ? 1.020   12.572  -19.522 1.00 0.00 ? 39  ARG A HA   1  
ATOM 533   H HB2  . ARG A 1 39  ? -0.109  13.405  -17.449 1.00 0.00 ? 39  ARG A HB2  1  
ATOM 534   H HB3  . ARG A 1 39  ? 1.437   14.062  -16.927 1.00 0.00 ? 39  ARG A HB3  1  
ATOM 535   H HG2  . ARG A 1 39  ? 0.233   15.853  -17.871 1.00 0.00 ? 39  ARG A HG2  1  
ATOM 536   H HG3  . ARG A 1 39  ? 1.459   15.402  -19.059 1.00 0.00 ? 39  ARG A HG3  1  
ATOM 537   H HD2  . ARG A 1 39  ? -0.445  13.880  -20.005 1.00 0.00 ? 39  ARG A HD2  1  
ATOM 538   H HD3  . ARG A 1 39  ? -1.498  14.987  -19.124 1.00 0.00 ? 39  ARG A HD3  1  
ATOM 539   H HE   . ARG A 1 39  ? 0.137   16.622  -20.564 1.00 0.00 ? 39  ARG A HE   1  
ATOM 540   H HH11 . ARG A 1 39  ? -1.979  13.970  -21.345 1.00 0.00 ? 39  ARG A HH11 1  
ATOM 541   H HH12 . ARG A 1 39  ? -2.357  14.567  -22.927 1.00 0.00 ? 39  ARG A HH12 1  
ATOM 542   H HH21 . ARG A 1 39  ? -0.353  17.418  -22.645 1.00 0.00 ? 39  ARG A HH21 1  
ATOM 543   H HH22 . ARG A 1 39  ? -1.431  16.528  -23.666 1.00 0.00 ? 39  ARG A HH22 1  
ATOM 544   N N    . ASP A 1 40  ? 3.776   13.466  -17.922 1.00 0.00 ? 40  ASP A N    1  
ATOM 545   C CA   . ASP A 1 40  ? 5.145   13.930  -18.115 1.00 0.00 ? 40  ASP A CA   1  
ATOM 546   C C    . ASP A 1 40  ? 6.146   12.855  -17.705 1.00 0.00 ? 40  ASP A C    1  
ATOM 547   O O    . ASP A 1 40  ? 6.120   12.341  -16.587 1.00 0.00 ? 40  ASP A O    1  
ATOM 548   C CB   . ASP A 1 40  ? 5.391   15.207  -17.311 1.00 0.00 ? 40  ASP A CB   1  
ATOM 549   C CG   . ASP A 1 40  ? 4.940   16.452  -18.049 1.00 0.00 ? 40  ASP A CG   1  
ATOM 550   O OD1  . ASP A 1 40  ? 5.549   16.779  -19.089 1.00 0.00 ? 40  ASP A OD1  1  
ATOM 551   O OD2  . ASP A 1 40  ? 3.978   17.100  -17.586 1.00 0.00 ? 40  ASP A OD2  1  
ATOM 552   H H    . ASP A 1 40  ? 3.442   13.327  -17.010 1.00 0.00 ? 40  ASP A H    1  
ATOM 553   H HA   . ASP A 1 40  ? 5.277   14.146  -19.165 1.00 0.00 ? 40  ASP A HA   1  
ATOM 554   H HB2  . ASP A 1 40  ? 4.849   15.148  -16.378 1.00 0.00 ? 40  ASP A HB2  1  
ATOM 555   H HB3  . ASP A 1 40  ? 6.447   15.296  -17.103 1.00 0.00 ? 40  ASP A HB3  1  
ATOM 556   N N    . PRO A 1 41  ? 7.050   12.504  -18.632 1.00 0.00 ? 41  PRO A N    1  
ATOM 557   C CA   . PRO A 1 41  ? 8.077   11.486  -18.391 1.00 0.00 ? 41  PRO A CA   1  
ATOM 558   C C    . PRO A 1 41  ? 9.134   11.953  -17.395 1.00 0.00 ? 41  PRO A C    1  
ATOM 559   O O    . PRO A 1 41  ? 9.911   11.151  -16.877 1.00 0.00 ? 41  PRO A O    1  
ATOM 560   C CB   . PRO A 1 41  ? 8.700   11.276  -19.773 1.00 0.00 ? 41  PRO A CB   1  
ATOM 561   C CG   . PRO A 1 41  ? 8.456   12.555  -20.497 1.00 0.00 ? 41  PRO A CG   1  
ATOM 562   C CD   . PRO A 1 41  ? 7.140   13.074  -19.987 1.00 0.00 ? 41  PRO A CD   1  
ATOM 563   H HA   . PRO A 1 41  ? 7.643   10.559  -18.045 1.00 0.00 ? 41  PRO A HA   1  
ATOM 564   H HB2  . PRO A 1 41  ? 9.758   11.077  -19.667 1.00 0.00 ? 41  PRO A HB2  1  
ATOM 565   H HB3  . PRO A 1 41  ? 8.219   10.445  -20.266 1.00 0.00 ? 41  PRO A HB3  1  
ATOM 566   H HG2  . PRO A 1 41  ? 9.246   13.257  -20.280 1.00 0.00 ? 41  PRO A HG2  1  
ATOM 567   H HG3  . PRO A 1 41  ? 8.398   12.369  -21.559 1.00 0.00 ? 41  PRO A HG3  1  
ATOM 568   H HD2  . PRO A 1 41  ? 7.149   14.153  -19.951 1.00 0.00 ? 41  PRO A HD2  1  
ATOM 569   H HD3  . PRO A 1 41  ? 6.329   12.722  -20.607 1.00 0.00 ? 41  PRO A HD3  1  
ATOM 570   N N    . THR A 1 42  ? 9.157   13.256  -17.131 1.00 0.00 ? 42  THR A N    1  
ATOM 571   C CA   . THR A 1 42  ? 10.118  13.830  -16.199 1.00 0.00 ? 42  THR A CA   1  
ATOM 572   C C    . THR A 1 42  ? 9.590   13.789  -14.769 1.00 0.00 ? 42  THR A C    1  
ATOM 573   O O    . THR A 1 42  ? 9.869   14.681  -13.969 1.00 0.00 ? 42  THR A O    1  
ATOM 574   C CB   . THR A 1 42  ? 10.458  15.287  -16.567 1.00 0.00 ? 42  THR A CB   1  
ATOM 575   O OG1  . THR A 1 42  ? 9.255   16.054  -16.688 1.00 0.00 ? 42  THR A OG1  1  
ATOM 576   C CG2  . THR A 1 42  ? 11.237  15.347  -17.872 1.00 0.00 ? 42  THR A CG2  1  
ATOM 577   H H    . THR A 1 42  ? 8.512   13.844  -17.576 1.00 0.00 ? 42  THR A H    1  
ATOM 578   H HA   . THR A 1 42  ? 11.026  13.246  -16.254 1.00 0.00 ? 42  THR A HA   1  
ATOM 579   H HB   . THR A 1 42  ? 11.068  15.708  -15.781 1.00 0.00 ? 42  THR A HB   1  
ATOM 580   H HG1  . THR A 1 42  ? 9.455   16.985  -16.563 1.00 0.00 ? 42  THR A HG1  1  
ATOM 581   H HG21 . THR A 1 42  ? 12.101  15.984  -17.747 1.00 0.00 ? 42  THR A HG21 1  
ATOM 582   H HG22 . THR A 1 42  ? 10.605  15.747  -18.651 1.00 0.00 ? 42  THR A HG22 1  
ATOM 583   H HG23 . THR A 1 42  ? 11.560  14.354  -18.145 1.00 0.00 ? 42  THR A HG23 1  
ATOM 584   N N    . ASP A 1 43  ? 8.826   12.749  -14.456 1.00 0.00 ? 43  ASP A N    1  
ATOM 585   C CA   . ASP A 1 43  ? 8.259   12.591  -13.121 1.00 0.00 ? 43  ASP A CA   1  
ATOM 586   C C    . ASP A 1 43  ? 8.641   11.239  -12.526 1.00 0.00 ? 43  ASP A C    1  
ATOM 587   O O    . ASP A 1 43  ? 8.251   10.192  -13.040 1.00 0.00 ? 43  ASP A O    1  
ATOM 588   C CB   . ASP A 1 43  ? 6.737   12.729  -13.171 1.00 0.00 ? 43  ASP A CB   1  
ATOM 589   C CG   . ASP A 1 43  ? 6.093   12.535  -11.812 1.00 0.00 ? 43  ASP A CG   1  
ATOM 590   O OD1  . ASP A 1 43  ? 6.277   13.409  -10.939 1.00 0.00 ? 43  ASP A OD1  1  
ATOM 591   O OD2  . ASP A 1 43  ? 5.406   11.510  -11.622 1.00 0.00 ? 43  ASP A OD2  1  
ATOM 592   H H    . ASP A 1 43  ? 8.639   12.070  -15.138 1.00 0.00 ? 43  ASP A H    1  
ATOM 593   H HA   . ASP A 1 43  ? 8.662   13.372  -12.495 1.00 0.00 ? 43  ASP A HA   1  
ATOM 594   H HB2  . ASP A 1 43  ? 6.483   13.715  -13.531 1.00 0.00 ? 43  ASP A HB2  1  
ATOM 595   H HB3  . ASP A 1 43  ? 6.337   11.989  -13.848 1.00 0.00 ? 43  ASP A HB3  1  
ATOM 596   N N    . GLU A 1 44  ? 9.406   11.271  -11.439 1.00 0.00 ? 44  GLU A N    1  
ATOM 597   C CA   . GLU A 1 44  ? 9.841   10.048  -10.775 1.00 0.00 ? 44  GLU A CA   1  
ATOM 598   C C    . GLU A 1 44  ? 9.105   9.856   -9.452  1.00 0.00 ? 44  GLU A C    1  
ATOM 599   O O    . GLU A 1 44  ? 9.543   9.096   -8.590  1.00 0.00 ? 44  GLU A O    1  
ATOM 600   C CB   . GLU A 1 44  ? 11.351  10.084  -10.530 1.00 0.00 ? 44  GLU A CB   1  
ATOM 601   C CG   . GLU A 1 44  ? 12.177  9.885   -11.790 1.00 0.00 ? 44  GLU A CG   1  
ATOM 602   C CD   . GLU A 1 44  ? 13.511  10.603  -11.733 1.00 0.00 ? 44  GLU A CD   1  
ATOM 603   O OE1  . GLU A 1 44  ? 14.034  10.795  -10.615 1.00 0.00 ? 44  GLU A OE1  1  
ATOM 604   O OE2  . GLU A 1 44  ? 14.032  10.973  -12.806 1.00 0.00 ? 44  GLU A OE2  1  
ATOM 605   H H    . GLU A 1 44  ? 9.684   12.138  -11.076 1.00 0.00 ? 44  GLU A H    1  
ATOM 606   H HA   . GLU A 1 44  ? 9.611   9.218   -11.426 1.00 0.00 ? 44  GLU A HA   1  
ATOM 607   H HB2  . GLU A 1 44  ? 11.611  11.040  -10.101 1.00 0.00 ? 44  GLU A HB2  1  
ATOM 608   H HB3  . GLU A 1 44  ? 11.608  9.303   -9.830  1.00 0.00 ? 44  GLU A HB3  1  
ATOM 609   H HG2  . GLU A 1 44  ? 12.359  8.830   -11.923 1.00 0.00 ? 44  GLU A HG2  1  
ATOM 610   H HG3  . GLU A 1 44  ? 11.618  10.262  -12.635 1.00 0.00 ? 44  GLU A HG3  1  
ATOM 611   N N    . GLY A 1 45  ? 7.981   10.551  -9.300  1.00 0.00 ? 45  GLY A N    1  
ATOM 612   C CA   . GLY A 1 45  ? 7.202   10.444  -8.081  1.00 0.00 ? 45  GLY A CA   1  
ATOM 613   C C    . GLY A 1 45  ? 6.877   9.007   -7.725  1.00 0.00 ? 45  GLY A C    1  
ATOM 614   O O    . GLY A 1 45  ? 6.978   8.114   -8.567  1.00 0.00 ? 45  GLY A O    1  
ATOM 615   H H    . GLY A 1 45  ? 7.680   11.142  -10.022 1.00 0.00 ? 45  GLY A H    1  
ATOM 616   H HA2  . GLY A 1 45  ? 7.760   10.887  -7.269  1.00 0.00 ? 45  GLY A HA2  1  
ATOM 617   H HA3  . GLY A 1 45  ? 6.278   10.989  -8.208  1.00 0.00 ? 45  GLY A HA3  1  
ATOM 618   N N    . ILE A 1 46  ? 6.486   8.782   -6.475  1.00 0.00 ? 46  ILE A N    1  
ATOM 619   C CA   . ILE A 1 46  ? 6.146   7.443   -6.011  1.00 0.00 ? 46  ILE A CA   1  
ATOM 620   C C    . ILE A 1 46  ? 4.763   7.419   -5.369  1.00 0.00 ? 46  ILE A C    1  
ATOM 621   O O    . ILE A 1 46  ? 4.516   8.100   -4.374  1.00 0.00 ? 46  ILE A O    1  
ATOM 622   C CB   . ILE A 1 46  ? 7.179   6.919   -4.996  1.00 0.00 ? 46  ILE A CB   1  
ATOM 623   C CG1  . ILE A 1 46  ? 8.583   6.945   -5.604  1.00 0.00 ? 46  ILE A CG1  1  
ATOM 624   C CG2  . ILE A 1 46  ? 6.816   5.511   -4.548  1.00 0.00 ? 46  ILE A CG2  1  
ATOM 625   C CD1  . ILE A 1 46  ? 9.689   6.981   -4.573  1.00 0.00 ? 46  ILE A CD1  1  
ATOM 626   H H    . ILE A 1 46  ? 6.425   9.534   -5.851  1.00 0.00 ? 46  ILE A H    1  
ATOM 627   H HA   . ILE A 1 46  ? 6.146   6.783   -6.867  1.00 0.00 ? 46  ILE A HA   1  
ATOM 628   H HB   . ILE A 1 46  ? 7.159   7.563   -4.130  1.00 0.00 ? 46  ILE A HB   1  
ATOM 629   H HG12 . ILE A 1 46  ? 8.723   6.063   -6.209  1.00 0.00 ? 46  ILE A HG12 1  
ATOM 630   H HG13 . ILE A 1 46  ? 8.681   7.822   -6.228  1.00 0.00 ? 46  ILE A HG13 1  
ATOM 631   H HG21 . ILE A 1 46  ? 7.513   4.806   -4.977  1.00 0.00 ? 46  ILE A HG21 1  
ATOM 632   H HG22 . ILE A 1 46  ? 6.864   5.453   -3.471  1.00 0.00 ? 46  ILE A HG22 1  
ATOM 633   H HG23 . ILE A 1 46  ? 5.816   5.275   -4.878  1.00 0.00 ? 46  ILE A HG23 1  
ATOM 634   H HD11 . ILE A 1 46  ? 10.616  6.666   -5.028  1.00 0.00 ? 46  ILE A HD11 1  
ATOM 635   H HD12 . ILE A 1 46  ? 9.795   7.986   -4.193  1.00 0.00 ? 46  ILE A HD12 1  
ATOM 636   H HD13 . ILE A 1 46  ? 9.443   6.313   -3.759  1.00 0.00 ? 46  ILE A HD13 1  
ATOM 637   N N    . PHE A 1 47  ? 3.864   6.627   -5.945  1.00 0.00 ? 47  PHE A N    1  
ATOM 638   C CA   . PHE A 1 47  ? 2.504   6.513   -5.429  1.00 0.00 ? 47  PHE A CA   1  
ATOM 639   C C    . PHE A 1 47  ? 2.103   5.049   -5.275  1.00 0.00 ? 47  PHE A C    1  
ATOM 640   O O    . PHE A 1 47  ? 2.558   4.187   -6.028  1.00 0.00 ? 47  PHE A O    1  
ATOM 641   C CB   . PHE A 1 47  ? 1.522   7.229   -6.358  1.00 0.00 ? 47  PHE A CB   1  
ATOM 642   C CG   . PHE A 1 47  ? 1.943   8.626   -6.713  1.00 0.00 ? 47  PHE A CG   1  
ATOM 643   C CD1  . PHE A 1 47  ? 3.120   8.853   -7.408  1.00 0.00 ? 47  PHE A CD1  1  
ATOM 644   C CD2  . PHE A 1 47  ? 1.161   9.712   -6.353  1.00 0.00 ? 47  PHE A CD2  1  
ATOM 645   C CE1  . PHE A 1 47  ? 3.510   10.138  -7.738  1.00 0.00 ? 47  PHE A CE1  1  
ATOM 646   C CE2  . PHE A 1 47  ? 1.546   10.998  -6.680  1.00 0.00 ? 47  PHE A CE2  1  
ATOM 647   C CZ   . PHE A 1 47  ? 2.722   11.212  -7.372  1.00 0.00 ? 47  PHE A CZ   1  
ATOM 648   H H    . PHE A 1 47  ? 4.120   6.108   -6.736  1.00 0.00 ? 47  PHE A H    1  
ATOM 649   H HA   . PHE A 1 47  ? 2.478   6.984   -4.459  1.00 0.00 ? 47  PHE A HA   1  
ATOM 650   H HB2  . PHE A 1 47  ? 1.430   6.667   -7.275  1.00 0.00 ? 47  PHE A HB2  1  
ATOM 651   H HB3  . PHE A 1 47  ? 0.557   7.284   -5.876  1.00 0.00 ? 47  PHE A HB3  1  
ATOM 652   H HD1  . PHE A 1 47  ? 3.737   8.013   -7.695  1.00 0.00 ? 47  PHE A HD1  1  
ATOM 653   H HD2  . PHE A 1 47  ? 0.242   9.547   -5.810  1.00 0.00 ? 47  PHE A HD2  1  
ATOM 654   H HE1  . PHE A 1 47  ? 4.430   10.301  -8.279  1.00 0.00 ? 47  PHE A HE1  1  
ATOM 655   H HE2  . PHE A 1 47  ? 0.929   11.836  -6.392  1.00 0.00 ? 47  PHE A HE2  1  
ATOM 656   H HZ   . PHE A 1 47  ? 3.025   12.216  -7.629  1.00 0.00 ? 47  PHE A HZ   1  
ATOM 657   N N    . ILE A 1 48  ? 1.248   4.776   -4.296  1.00 0.00 ? 48  ILE A N    1  
ATOM 658   C CA   . ILE A 1 48  ? 0.784   3.417   -4.044  1.00 0.00 ? 48  ILE A CA   1  
ATOM 659   C C    . ILE A 1 48  ? 0.184   2.799   -5.302  1.00 0.00 ? 48  ILE A C    1  
ATOM 660   O O    . ILE A 1 48  ? -0.629  3.422   -5.985  1.00 0.00 ? 48  ILE A O    1  
ATOM 661   C CB   . ILE A 1 48  ? -0.265  3.380   -2.916  1.00 0.00 ? 48  ILE A CB   1  
ATOM 662   C CG1  . ILE A 1 48  ? 0.366   3.806   -1.589  1.00 0.00 ? 48  ILE A CG1  1  
ATOM 663   C CG2  . ILE A 1 48  ? -0.869  1.989   -2.800  1.00 0.00 ? 48  ILE A CG2  1  
ATOM 664   C CD1  . ILE A 1 48  ? -0.635  3.956   -0.465  1.00 0.00 ? 48  ILE A CD1  1  
ATOM 665   H H    . ILE A 1 48  ? 0.921   5.505   -3.729  1.00 0.00 ? 48  ILE A H    1  
ATOM 666   H HA   . ILE A 1 48  ? 1.635   2.826   -3.736  1.00 0.00 ? 48  ILE A HA   1  
ATOM 667   H HB   . ILE A 1 48  ? -1.056  4.070   -3.168  1.00 0.00 ? 48  ILE A HB   1  
ATOM 668   H HG12 . ILE A 1 48  ? 1.092   3.066   -1.289  1.00 0.00 ? 48  ILE A HG12 1  
ATOM 669   H HG13 . ILE A 1 48  ? 0.861   4.757   -1.723  1.00 0.00 ? 48  ILE A HG13 1  
ATOM 670   H HG21 . ILE A 1 48  ? -1.671  2.004   -2.078  1.00 0.00 ? 48  ILE A HG21 1  
ATOM 671   H HG22 . ILE A 1 48  ? -1.256  1.683   -3.760  1.00 0.00 ? 48  ILE A HG22 1  
ATOM 672   H HG23 . ILE A 1 48  ? -0.109  1.292   -2.480  1.00 0.00 ? 48  ILE A HG23 1  
ATOM 673   H HD11 . ILE A 1 48  ? -1.282  4.797   -0.668  1.00 0.00 ? 48  ILE A HD11 1  
ATOM 674   H HD12 . ILE A 1 48  ? -1.227  3.057   -0.386  1.00 0.00 ? 48  ILE A HD12 1  
ATOM 675   H HD13 . ILE A 1 48  ? -0.110  4.124   0.465   1.00 0.00 ? 48  ILE A HD13 1  
ATOM 676   N N    . SER A 1 49  ? 0.588   1.568   -5.601  1.00 0.00 ? 49  SER A N    1  
ATOM 677   C CA   . SER A 1 49  ? 0.091   0.866   -6.778  1.00 0.00 ? 49  SER A CA   1  
ATOM 678   C C    . SER A 1 49  ? -0.851  -0.266  -6.378  1.00 0.00 ? 49  SER A C    1  
ATOM 679   O O    . SER A 1 49  ? -1.565  -0.820  -7.214  1.00 0.00 ? 49  SER A O    1  
ATOM 680   C CB   . SER A 1 49  ? 1.258   0.308   -7.595  1.00 0.00 ? 49  SER A CB   1  
ATOM 681   O OG   . SER A 1 49  ? 1.613   -0.992  -7.156  1.00 0.00 ? 49  SER A OG   1  
ATOM 682   H H    . SER A 1 49  ? 1.237   1.124   -5.016  1.00 0.00 ? 49  SER A H    1  
ATOM 683   H HA   . SER A 1 49  ? -0.453  1.575   -7.382  1.00 0.00 ? 49  SER A HA   1  
ATOM 684   H HB2  . SER A 1 49  ? 0.975   0.258   -8.635  1.00 0.00 ? 49  SER A HB2  1  
ATOM 685   H HB3  . SER A 1 49  ? 2.114   0.958   -7.485  1.00 0.00 ? 49  SER A HB3  1  
ATOM 686   H HG   . SER A 1 49  ? 1.418   -1.078  -6.220  1.00 0.00 ? 49  SER A HG   1  
ATOM 687   N N    . LYS A 1 50  ? -0.847  -0.604  -5.093  1.00 0.00 ? 50  LYS A N    1  
ATOM 688   C CA   . LYS A 1 50  ? -1.701  -1.669  -4.579  1.00 0.00 ? 50  LYS A CA   1  
ATOM 689   C C    . LYS A 1 50  ? -1.582  -1.776  -3.062  1.00 0.00 ? 50  LYS A C    1  
ATOM 690   O O    . LYS A 1 50  ? -0.579  -1.367  -2.477  1.00 0.00 ? 50  LYS A O    1  
ATOM 691   C CB   . LYS A 1 50  ? -1.331  -3.005  -5.227  1.00 0.00 ? 50  LYS A CB   1  
ATOM 692   C CG   . LYS A 1 50  ? -1.892  -4.212  -4.494  1.00 0.00 ? 50  LYS A CG   1  
ATOM 693   C CD   . LYS A 1 50  ? -1.372  -5.512  -5.083  1.00 0.00 ? 50  LYS A CD   1  
ATOM 694   C CE   . LYS A 1 50  ? -2.379  -6.641  -4.916  1.00 0.00 ? 50  LYS A CE   1  
ATOM 695   N NZ   . LYS A 1 50  ? -2.576  -7.001  -3.484  1.00 0.00 ? 50  LYS A NZ   1  
ATOM 696   H H    . LYS A 1 50  ? -0.255  -0.126  -4.475  1.00 0.00 ? 50  LYS A H    1  
ATOM 697   H HA   . LYS A 1 50  ? -2.722  -1.426  -4.832  1.00 0.00 ? 50  LYS A HA   1  
ATOM 698   H HB2  . LYS A 1 50  ? -1.708  -3.017  -6.239  1.00 0.00 ? 50  LYS A HB2  1  
ATOM 699   H HB3  . LYS A 1 50  ? -0.254  -3.094  -5.251  1.00 0.00 ? 50  LYS A HB3  1  
ATOM 700   H HG2  . LYS A 1 50  ? -1.601  -4.158  -3.455  1.00 0.00 ? 50  LYS A HG2  1  
ATOM 701   H HG3  . LYS A 1 50  ? -2.970  -4.198  -4.569  1.00 0.00 ? 50  LYS A HG3  1  
ATOM 702   H HD2  . LYS A 1 50  ? -1.180  -5.370  -6.136  1.00 0.00 ? 50  LYS A HD2  1  
ATOM 703   H HD3  . LYS A 1 50  ? -0.454  -5.783  -4.581  1.00 0.00 ? 50  LYS A HD3  1  
ATOM 704   H HE2  . LYS A 1 50  ? -3.324  -6.328  -5.333  1.00 0.00 ? 50  LYS A HE2  1  
ATOM 705   H HE3  . LYS A 1 50  ? -2.019  -7.508  -5.450  1.00 0.00 ? 50  LYS A HE3  1  
ATOM 706   H HZ1  . LYS A 1 50  ? -1.714  -6.790  -2.941  1.00 0.00 ? 50  LYS A HZ1  1  
ATOM 707   H HZ2  . LYS A 1 50  ? -2.787  -8.015  -3.397  1.00 0.00 ? 50  LYS A HZ2  1  
ATOM 708   H HZ3  . LYS A 1 50  ? -3.366  -6.457  -3.084  1.00 0.00 ? 50  LYS A HZ3  1  
ATOM 709   N N    . VAL A 1 51  ? -2.612  -2.332  -2.431  1.00 0.00 ? 51  VAL A N    1  
ATOM 710   C CA   . VAL A 1 51  ? -2.621  -2.496  -0.982  1.00 0.00 ? 51  VAL A CA   1  
ATOM 711   C C    . VAL A 1 51  ? -3.303  -3.800  -0.581  1.00 0.00 ? 51  VAL A C    1  
ATOM 712   O O    . VAL A 1 51  ? -4.458  -4.041  -0.931  1.00 0.00 ? 51  VAL A O    1  
ATOM 713   C CB   . VAL A 1 51  ? -3.337  -1.322  -0.289  1.00 0.00 ? 51  VAL A CB   1  
ATOM 714   C CG1  . VAL A 1 51  ? -3.430  -1.563  1.210   1.00 0.00 ? 51  VAL A CG1  1  
ATOM 715   C CG2  . VAL A 1 51  ? -2.619  -0.013  -0.583  1.00 0.00 ? 51  VAL A CG2  1  
ATOM 716   H H    . VAL A 1 51  ? -3.383  -2.639  -2.952  1.00 0.00 ? 51  VAL A H    1  
ATOM 717   H HA   . VAL A 1 51  ? -1.596  -2.517  -0.641  1.00 0.00 ? 51  VAL A HA   1  
ATOM 718   H HB   . VAL A 1 51  ? -4.340  -1.254  -0.683  1.00 0.00 ? 51  VAL A HB   1  
ATOM 719   H HG11 . VAL A 1 51  ? -2.939  -0.757  1.736   1.00 0.00 ? 51  VAL A HG11 1  
ATOM 720   H HG12 . VAL A 1 51  ? -4.469  -1.606  1.504   1.00 0.00 ? 51  VAL A HG12 1  
ATOM 721   H HG13 . VAL A 1 51  ? -2.947  -2.497  1.455   1.00 0.00 ? 51  VAL A HG13 1  
ATOM 722   H HG21 . VAL A 1 51  ? -2.373  0.034   -1.633  1.00 0.00 ? 51  VAL A HG21 1  
ATOM 723   H HG22 . VAL A 1 51  ? -3.263  0.817   -0.327  1.00 0.00 ? 51  VAL A HG22 1  
ATOM 724   H HG23 . VAL A 1 51  ? -1.713  0.041   0.003   1.00 0.00 ? 51  VAL A HG23 1  
ATOM 725   N N    . SER A 1 52  ? -2.579  -4.637  0.155   1.00 0.00 ? 52  SER A N    1  
ATOM 726   C CA   . SER A 1 52  ? -3.113  -5.919  0.601   1.00 0.00 ? 52  SER A CA   1  
ATOM 727   C C    . SER A 1 52  ? -4.209  -5.718  1.643   1.00 0.00 ? 52  SER A C    1  
ATOM 728   O O    . SER A 1 52  ? -4.144  -4.823  2.485   1.00 0.00 ? 52  SER A O    1  
ATOM 729   C CB   . SER A 1 52  ? -1.994  -6.786  1.182   1.00 0.00 ? 52  SER A CB   1  
ATOM 730   O OG   . SER A 1 52  ? -2.294  -8.165  1.044   1.00 0.00 ? 52  SER A OG   1  
ATOM 731   H H    . SER A 1 52  ? -1.664  -4.388  0.401   1.00 0.00 ? 52  SER A H    1  
ATOM 732   H HA   . SER A 1 52  ? -3.535  -6.419  -0.258  1.00 0.00 ? 52  SER A HA   1  
ATOM 733   H HB2  . SER A 1 52  ? -1.072  -6.577  0.661   1.00 0.00 ? 52  SER A HB2  1  
ATOM 734   H HB3  . SER A 1 52  ? -1.874  -6.559  2.231   1.00 0.00 ? 52  SER A HB3  1  
ATOM 735   H HG   . SER A 1 52  ? -2.882  -8.437  1.753   1.00 0.00 ? 52  SER A HG   1  
ATOM 736   N N    . PRO A 1 53  ? -5.242  -6.572  1.585   1.00 0.00 ? 53  PRO A N    1  
ATOM 737   C CA   . PRO A 1 53  ? -6.373  -6.509  2.516   1.00 0.00 ? 53  PRO A CA   1  
ATOM 738   C C    . PRO A 1 53  ? -5.983  -6.924  3.930   1.00 0.00 ? 53  PRO A C    1  
ATOM 739   O O    . PRO A 1 53  ? -6.487  -6.375  4.911   1.00 0.00 ? 53  PRO A O    1  
ATOM 740   C CB   . PRO A 1 53  ? -7.374  -7.505  1.924   1.00 0.00 ? 53  PRO A CB   1  
ATOM 741   C CG   . PRO A 1 53  ? -6.541  -8.462  1.144   1.00 0.00 ? 53  PRO A CG   1  
ATOM 742   C CD   . PRO A 1 53  ? -5.386  -7.663  0.607   1.00 0.00 ? 53  PRO A CD   1  
ATOM 743   H HA   . PRO A 1 53  ? -6.814  -5.524  2.539   1.00 0.00 ? 53  PRO A HA   1  
ATOM 744   H HB2  . PRO A 1 53  ? -7.906  -8.002  2.723   1.00 0.00 ? 53  PRO A HB2  1  
ATOM 745   H HB3  . PRO A 1 53  ? -8.074  -6.982  1.289   1.00 0.00 ? 53  PRO A HB3  1  
ATOM 746   H HG2  . PRO A 1 53  ? -6.185  -9.250  1.790   1.00 0.00 ? 53  PRO A HG2  1  
ATOM 747   H HG3  . PRO A 1 53  ? -7.121  -8.875  0.331   1.00 0.00 ? 53  PRO A HG3  1  
ATOM 748   H HD2  . PRO A 1 53  ? -4.492  -8.269  0.572   1.00 0.00 ? 53  PRO A HD2  1  
ATOM 749   H HD3  . PRO A 1 53  ? -5.619  -7.274  -0.373  1.00 0.00 ? 53  PRO A HD3  1  
ATOM 750   N N    . THR A 1 54  ? -5.082  -7.896  4.030   1.00 0.00 ? 54  THR A N    1  
ATOM 751   C CA   . THR A 1 54  ? -4.624  -8.384  5.325   1.00 0.00 ? 54  THR A CA   1  
ATOM 752   C C    . THR A 1 54  ? -3.435  -7.575  5.829   1.00 0.00 ? 54  THR A C    1  
ATOM 753   O O    . THR A 1 54  ? -2.896  -7.847  6.901   1.00 0.00 ? 54  THR A O    1  
ATOM 754   C CB   . THR A 1 54  ? -4.227  -9.871  5.257   1.00 0.00 ? 54  THR A CB   1  
ATOM 755   O OG1  . THR A 1 54  ? -3.010  -10.019 4.518   1.00 0.00 ? 54  THR A OG1  1  
ATOM 756   C CG2  . THR A 1 54  ? -5.326  -10.695 4.603   1.00 0.00 ? 54  THR A CG2  1  
ATOM 757   H H    . THR A 1 54  ? -4.717  -8.294  3.212   1.00 0.00 ? 54  THR A H    1  
ATOM 758   H HA   . THR A 1 54  ? -5.440  -8.283  6.027   1.00 0.00 ? 54  THR A HA   1  
ATOM 759   H HB   . THR A 1 54  ? -4.075  -10.234 6.263   1.00 0.00 ? 54  THR A HB   1  
ATOM 760   H HG1  . THR A 1 54  ? -3.212  -10.129 3.585   1.00 0.00 ? 54  THR A HG1  1  
ATOM 761   H HG21 . THR A 1 54  ? -5.989  -10.042 4.056   1.00 0.00 ? 54  THR A HG21 1  
ATOM 762   H HG22 . THR A 1 54  ? -5.884  -11.219 5.365   1.00 0.00 ? 54  THR A HG22 1  
ATOM 763   H HG23 . THR A 1 54  ? -4.885  -11.409 3.925   1.00 0.00 ? 54  THR A HG23 1  
ATOM 764   N N    . GLY A 1 55  ? -3.030  -6.577  5.049   1.00 0.00 ? 55  GLY A N    1  
ATOM 765   C CA   . GLY A 1 55  ? -1.907  -5.743  5.434   1.00 0.00 ? 55  GLY A CA   1  
ATOM 766   C C    . GLY A 1 55  ? -2.296  -4.672  6.433   1.00 0.00 ? 55  GLY A C    1  
ATOM 767   O O    . GLY A 1 55  ? -3.448  -4.241  6.475   1.00 0.00 ? 55  GLY A O    1  
ATOM 768   H H    . GLY A 1 55  ? -3.498  -6.407  4.204   1.00 0.00 ? 55  GLY A H    1  
ATOM 769   H HA2  . GLY A 1 55  ? -1.141  -6.368  5.870   1.00 0.00 ? 55  GLY A HA2  1  
ATOM 770   H HA3  . GLY A 1 55  ? -1.508  -5.267  4.550   1.00 0.00 ? 55  GLY A HA3  1  
ATOM 771   N N    . ALA A 1 56  ? -1.333  -4.243  7.243   1.00 0.00 ? 56  ALA A N    1  
ATOM 772   C CA   . ALA A 1 56  ? -1.581  -3.216  8.247   1.00 0.00 ? 56  ALA A CA   1  
ATOM 773   C C    . ALA A 1 56  ? -2.387  -2.060  7.663   1.00 0.00 ? 56  ALA A C    1  
ATOM 774   O O    . ALA A 1 56  ? -3.265  -1.508  8.324   1.00 0.00 ? 56  ALA A O    1  
ATOM 775   C CB   . ALA A 1 56  ? -0.265  -2.708  8.819   1.00 0.00 ? 56  ALA A CB   1  
ATOM 776   H H    . ALA A 1 56  ? -0.435  -4.625  7.161   1.00 0.00 ? 56  ALA A H    1  
ATOM 777   H HA   . ALA A 1 56  ? -2.145  -3.665  9.051   1.00 0.00 ? 56  ALA A HA   1  
ATOM 778   H HB1  . ALA A 1 56  ? 0.283   -2.185  8.048   1.00 0.00 ? 56  ALA A HB1  1  
ATOM 779   H HB2  . ALA A 1 56  ? -0.465  -2.036  9.639   1.00 0.00 ? 56  ALA A HB2  1  
ATOM 780   H HB3  . ALA A 1 56  ? 0.320   -3.544  9.172   1.00 0.00 ? 56  ALA A HB3  1  
ATOM 781   N N    . ALA A 1 57  ? -2.082  -1.700  6.421   1.00 0.00 ? 57  ALA A N    1  
ATOM 782   C CA   . ALA A 1 57  ? -2.779  -0.611  5.748   1.00 0.00 ? 57  ALA A CA   1  
ATOM 783   C C    . ALA A 1 57  ? -4.189  -1.028  5.345   1.00 0.00 ? 57  ALA A C    1  
ATOM 784   O O    . ALA A 1 57  ? -5.174  -0.475  5.833   1.00 0.00 ? 57  ALA A O    1  
ATOM 785   C CB   . ALA A 1 57  ? -1.993  -0.155  4.528   1.00 0.00 ? 57  ALA A CB   1  
ATOM 786   H H    . ALA A 1 57  ? -1.371  -2.179  5.945   1.00 0.00 ? 57  ALA A H    1  
ATOM 787   H HA   . ALA A 1 57  ? -2.843  0.220   6.436   1.00 0.00 ? 57  ALA A HA   1  
ATOM 788   H HB1  . ALA A 1 57  ? -2.636  -0.170  3.660   1.00 0.00 ? 57  ALA A HB1  1  
ATOM 789   H HB2  . ALA A 1 57  ? -1.628  0.848   4.689   1.00 0.00 ? 57  ALA A HB2  1  
ATOM 790   H HB3  . ALA A 1 57  ? -1.158  -0.821  4.368   1.00 0.00 ? 57  ALA A HB3  1  
ATOM 791   N N    . GLY A 1 58  ? -4.279  -2.008  4.451   1.00 0.00 ? 58  GLY A N    1  
ATOM 792   C CA   . GLY A 1 58  ? -5.574  -2.482  3.997   1.00 0.00 ? 58  GLY A CA   1  
ATOM 793   C C    . GLY A 1 58  ? -6.617  -2.461  5.097   1.00 0.00 ? 58  GLY A C    1  
ATOM 794   O O    . GLY A 1 58  ? -7.750  -2.031  4.879   1.00 0.00 ? 58  GLY A O    1  
ATOM 795   H H    . GLY A 1 58  ? -3.460  -2.413  4.096   1.00 0.00 ? 58  GLY A H    1  
ATOM 796   H HA2  . GLY A 1 58  ? -5.910  -1.856  3.185   1.00 0.00 ? 58  GLY A HA2  1  
ATOM 797   H HA3  . GLY A 1 58  ? -5.468  -3.495  3.638   1.00 0.00 ? 58  GLY A HA3  1  
ATOM 798   N N    . ARG A 1 59  ? -6.235  -2.928  6.281   1.00 0.00 ? 59  ARG A N    1  
ATOM 799   C CA   . ARG A 1 59  ? -7.147  -2.964  7.419   1.00 0.00 ? 59  ARG A CA   1  
ATOM 800   C C    . ARG A 1 59  ? -7.263  -1.587  8.066   1.00 0.00 ? 59  ARG A C    1  
ATOM 801   O O    . ARG A 1 59  ? -8.339  -1.189  8.512   1.00 0.00 ? 59  ARG A O    1  
ATOM 802   C CB   . ARG A 1 59  ? -6.668  -3.986  8.451   1.00 0.00 ? 59  ARG A CB   1  
ATOM 803   C CG   . ARG A 1 59  ? -5.425  -3.549  9.210   1.00 0.00 ? 59  ARG A CG   1  
ATOM 804   C CD   . ARG A 1 59  ? -5.081  -4.525  10.324  1.00 0.00 ? 59  ARG A CD   1  
ATOM 805   N NE   . ARG A 1 59  ? -3.699  -4.378  10.773  1.00 0.00 ? 59  ARG A NE   1  
ATOM 806   C CZ   . ARG A 1 59  ? -3.016  -5.344  11.376  1.00 0.00 ? 59  ARG A CZ   1  
ATOM 807   N NH1  . ARG A 1 59  ? -3.583  -6.521  11.601  1.00 0.00 ? 59  ARG A NH1  1  
ATOM 808   N NH2  . ARG A 1 59  ? -1.762  -5.134  11.756  1.00 0.00 ? 59  ARG A NH2  1  
ATOM 809   H H    . ARG A 1 59  ? -5.319  -3.257  6.393   1.00 0.00 ? 59  ARG A H    1  
ATOM 810   H HA   . ARG A 1 59  ? -8.119  -3.261  7.055   1.00 0.00 ? 59  ARG A HA   1  
ATOM 811   H HB2  . ARG A 1 59  ? -7.459  -4.154  9.168   1.00 0.00 ? 59  ARG A HB2  1  
ATOM 812   H HB3  . ARG A 1 59  ? -6.448  -4.914  7.946   1.00 0.00 ? 59  ARG A HB3  1  
ATOM 813   H HG2  . ARG A 1 59  ? -4.594  -3.499  8.522   1.00 0.00 ? 59  ARG A HG2  1  
ATOM 814   H HG3  . ARG A 1 59  ? -5.601  -2.574  9.638   1.00 0.00 ? 59  ARG A HG3  1  
ATOM 815   H HD2  . ARG A 1 59  ? -5.742  -4.344  11.159  1.00 0.00 ? 59  ARG A HD2  1  
ATOM 816   H HD3  . ARG A 1 59  ? -5.227  -5.531  9.961   1.00 0.00 ? 59  ARG A HD3  1  
ATOM 817   H HE   . ARG A 1 59  ? -3.261  -3.516  10.617  1.00 0.00 ? 59  ARG A HE   1  
ATOM 818   H HH11 . ARG A 1 59  ? -4.527  -6.683  11.315  1.00 0.00 ? 59  ARG A HH11 1  
ATOM 819   H HH12 . ARG A 1 59  ? -3.065  -7.247  12.054  1.00 0.00 ? 59  ARG A HH12 1  
ATOM 820   H HH21 . ARG A 1 59  ? -1.331  -4.247  11.588  1.00 0.00 ? 59  ARG A HH21 1  
ATOM 821   H HH22 . ARG A 1 59  ? -1.248  -5.861  12.209  1.00 0.00 ? 59  ARG A HH22 1  
ATOM 822   N N    . ASP A 1 60  ? -6.149  -0.865  8.113   1.00 0.00 ? 60  ASP A N    1  
ATOM 823   C CA   . ASP A 1 60  ? -6.125  0.467   8.705   1.00 0.00 ? 60  ASP A CA   1  
ATOM 824   C C    . ASP A 1 60  ? -7.376  1.253   8.325   1.00 0.00 ? 60  ASP A C    1  
ATOM 825   O O    . ASP A 1 60  ? -8.189  1.598   9.181   1.00 0.00 ? 60  ASP A O    1  
ATOM 826   C CB   . ASP A 1 60  ? -4.875  1.226   8.257   1.00 0.00 ? 60  ASP A CB   1  
ATOM 827   C CG   . ASP A 1 60  ? -4.690  2.531   9.006   1.00 0.00 ? 60  ASP A CG   1  
ATOM 828   O OD1  . ASP A 1 60  ? -5.689  3.257   9.186   1.00 0.00 ? 60  ASP A OD1  1  
ATOM 829   O OD2  . ASP A 1 60  ? -3.546  2.826   9.410   1.00 0.00 ? 60  ASP A OD2  1  
ATOM 830   H H    . ASP A 1 60  ? -5.322  -1.238  7.740   1.00 0.00 ? 60  ASP A H    1  
ATOM 831   H HA   . ASP A 1 60  ? -6.100  0.353   9.778   1.00 0.00 ? 60  ASP A HA   1  
ATOM 832   H HB2  . ASP A 1 60  ? -4.006  0.608   8.428   1.00 0.00 ? 60  ASP A HB2  1  
ATOM 833   H HB3  . ASP A 1 60  ? -4.954  1.444   7.202   1.00 0.00 ? 60  ASP A HB3  1  
ATOM 834   N N    . GLY A 1 61  ? -7.522  1.534   7.033   1.00 0.00 ? 61  GLY A N    1  
ATOM 835   C CA   . GLY A 1 61  ? -8.676  2.278   6.562   1.00 0.00 ? 61  GLY A CA   1  
ATOM 836   C C    . GLY A 1 61  ? -8.300  3.634   5.998   1.00 0.00 ? 61  GLY A C    1  
ATOM 837   O O    . GLY A 1 61  ? -9.130  4.316   5.398   1.00 0.00 ? 61  GLY A O    1  
ATOM 838   H H    . GLY A 1 61  ? -6.842  1.233   6.395   1.00 0.00 ? 61  GLY A H    1  
ATOM 839   H HA2  . GLY A 1 61  ? -9.171  1.705   5.793   1.00 0.00 ? 61  GLY A HA2  1  
ATOM 840   H HA3  . GLY A 1 61  ? -9.359  2.421   7.387   1.00 0.00 ? 61  GLY A HA3  1  
ATOM 841   N N    . ARG A 1 62  ? -7.045  4.027   6.193   1.00 0.00 ? 62  ARG A N    1  
ATOM 842   C CA   . ARG A 1 62  ? -6.562  5.312   5.702   1.00 0.00 ? 62  ARG A CA   1  
ATOM 843   C C    . ARG A 1 62  ? -5.634  5.123   4.506   1.00 0.00 ? 62  ARG A C    1  
ATOM 844   O O    . ARG A 1 62  ? -5.472  6.025   3.683   1.00 0.00 ? 62  ARG A O    1  
ATOM 845   C CB   . ARG A 1 62  ? -5.831  6.065   6.815   1.00 0.00 ? 62  ARG A CB   1  
ATOM 846   C CG   . ARG A 1 62  ? -6.506  5.952   8.172   1.00 0.00 ? 62  ARG A CG   1  
ATOM 847   C CD   . ARG A 1 62  ? -7.674  6.918   8.296   1.00 0.00 ? 62  ARG A CD   1  
ATOM 848   N NE   . ARG A 1 62  ? -8.778  6.557   7.411   1.00 0.00 ? 62  ARG A NE   1  
ATOM 849   C CZ   . ARG A 1 62  ? -9.826  7.342   7.186   1.00 0.00 ? 62  ARG A CZ   1  
ATOM 850   N NH1  . ARG A 1 62  ? -9.912  8.525   7.778   1.00 0.00 ? 62  ARG A NH1  1  
ATOM 851   N NH2  . ARG A 1 62  ? -10.791 6.944   6.367   1.00 0.00 ? 62  ARG A NH2  1  
ATOM 852   H H    . ARG A 1 62  ? -6.430  3.439   6.679   1.00 0.00 ? 62  ARG A H    1  
ATOM 853   H HA   . ARG A 1 62  ? -7.418  5.891   5.390   1.00 0.00 ? 62  ARG A HA   1  
ATOM 854   H HB2  . ARG A 1 62  ? -4.829  5.672   6.902   1.00 0.00 ? 62  ARG A HB2  1  
ATOM 855   H HB3  . ARG A 1 62  ? -5.777  7.110   6.550   1.00 0.00 ? 62  ARG A HB3  1  
ATOM 856   H HG2  . ARG A 1 62  ? -6.872  4.944   8.299   1.00 0.00 ? 62  ARG A HG2  1  
ATOM 857   H HG3  . ARG A 1 62  ? -5.783  6.174   8.943   1.00 0.00 ? 62  ARG A HG3  1  
ATOM 858   H HD2  . ARG A 1 62  ? -8.026  6.908   9.317   1.00 0.00 ? 62  ARG A HD2  1  
ATOM 859   H HD3  . ARG A 1 62  ? -7.331  7.910   8.043   1.00 0.00 ? 62  ARG A HD3  1  
ATOM 860   H HE   . ARG A 1 62  ? -8.735  5.687   6.963   1.00 0.00 ? 62  ARG A HE   1  
ATOM 861   H HH11 . ARG A 1 62  ? -9.185  8.828   8.395   1.00 0.00 ? 62  ARG A HH11 1  
ATOM 862   H HH12 . ARG A 1 62  ? -10.701 9.115   7.606   1.00 0.00 ? 62  ARG A HH12 1  
ATOM 863   H HH21 . ARG A 1 62  ? -10.730 6.052   5.919   1.00 0.00 ? 62  ARG A HH21 1  
ATOM 864   H HH22 . ARG A 1 62  ? -11.579 7.535   6.199   1.00 0.00 ? 62  ARG A HH22 1  
ATOM 865   N N    . LEU A 1 63  ? -5.025  3.945   4.417   1.00 0.00 ? 63  LEU A N    1  
ATOM 866   C CA   . LEU A 1 63  ? -4.112  3.637   3.322   1.00 0.00 ? 63  LEU A CA   1  
ATOM 867   C C    . LEU A 1 63  ? -4.851  2.965   2.169   1.00 0.00 ? 63  LEU A C    1  
ATOM 868   O O    . LEU A 1 63  ? -5.534  1.959   2.359   1.00 0.00 ? 63  LEU A O    1  
ATOM 869   C CB   . LEU A 1 63  ? -2.981  2.732   3.814   1.00 0.00 ? 63  LEU A CB   1  
ATOM 870   C CG   . LEU A 1 63  ? -1.656  2.842   3.058   1.00 0.00 ? 63  LEU A CG   1  
ATOM 871   C CD1  . LEU A 1 63  ? -1.719  2.059   1.756   1.00 0.00 ? 63  LEU A CD1  1  
ATOM 872   C CD2  . LEU A 1 63  ? -1.314  4.300   2.791   1.00 0.00 ? 63  LEU A CD2  1  
ATOM 873   H H    . LEU A 1 63  ? -5.193  3.266   5.103   1.00 0.00 ? 63  LEU A H    1  
ATOM 874   H HA   . LEU A 1 63  ? -3.691  4.567   2.970   1.00 0.00 ? 63  LEU A HA   1  
ATOM 875   H HB2  . LEU A 1 63  ? -2.792  2.972   4.849   1.00 0.00 ? 63  LEU A HB2  1  
ATOM 876   H HB3  . LEU A 1 63  ? -3.322  1.709   3.740   1.00 0.00 ? 63  LEU A HB3  1  
ATOM 877   H HG   . LEU A 1 63  ? -0.867  2.418   3.664   1.00 0.00 ? 63  LEU A HG   1  
ATOM 878   H HD11 . LEU A 1 63  ? -2.009  1.040   1.962   1.00 0.00 ? 63  LEU A HD11 1  
ATOM 879   H HD12 . LEU A 1 63  ? -0.747  2.069   1.284   1.00 0.00 ? 63  LEU A HD12 1  
ATOM 880   H HD13 . LEU A 1 63  ? -2.443  2.515   1.097   1.00 0.00 ? 63  LEU A HD13 1  
ATOM 881   H HD21 . LEU A 1 63  ? -0.241  4.424   2.796   1.00 0.00 ? 63  LEU A HD21 1  
ATOM 882   H HD22 . LEU A 1 63  ? -1.752  4.919   3.561   1.00 0.00 ? 63  LEU A HD22 1  
ATOM 883   H HD23 . LEU A 1 63  ? -1.706  4.591   1.828   1.00 0.00 ? 63  LEU A HD23 1  
ATOM 884   N N    . ARG A 1 64  ? -4.708  3.528   0.973   1.00 0.00 ? 64  ARG A N    1  
ATOM 885   C CA   . ARG A 1 64  ? -5.361  2.982   -0.210  1.00 0.00 ? 64  ARG A CA   1  
ATOM 886   C C    . ARG A 1 64  ? -4.457  3.104   -1.434  1.00 0.00 ? 64  ARG A C    1  
ATOM 887   O O    . ARG A 1 64  ? -3.381  3.698   -1.368  1.00 0.00 ? 64  ARG A O    1  
ATOM 888   C CB   . ARG A 1 64  ? -6.685  3.705   -0.467  1.00 0.00 ? 64  ARG A CB   1  
ATOM 889   C CG   . ARG A 1 64  ? -7.600  3.748   0.746   1.00 0.00 ? 64  ARG A CG   1  
ATOM 890   C CD   . ARG A 1 64  ? -8.992  4.236   0.376   1.00 0.00 ? 64  ARG A CD   1  
ATOM 891   N NE   . ARG A 1 64  ? -9.909  4.185   1.512   1.00 0.00 ? 64  ARG A NE   1  
ATOM 892   C CZ   . ARG A 1 64  ? -11.232 4.185   1.389   1.00 0.00 ? 64  ARG A CZ   1  
ATOM 893   N NH1  . ARG A 1 64  ? -11.789 4.231   0.186   1.00 0.00 ? 64  ARG A NH1  1  
ATOM 894   N NH2  . ARG A 1 64  ? -12.000 4.137   2.469   1.00 0.00 ? 64  ARG A NH2  1  
ATOM 895   H H    . ARG A 1 64  ? -4.150  4.329   0.885   1.00 0.00 ? 64  ARG A H    1  
ATOM 896   H HA   . ARG A 1 64  ? -5.561  1.937   -0.028  1.00 0.00 ? 64  ARG A HA   1  
ATOM 897   H HB2  . ARG A 1 64  ? -6.475  4.721   -0.768  1.00 0.00 ? 64  ARG A HB2  1  
ATOM 898   H HB3  . ARG A 1 64  ? -7.206  3.201   -1.267  1.00 0.00 ? 64  ARG A HB3  1  
ATOM 899   H HG2  . ARG A 1 64  ? -7.678  2.755   1.162   1.00 0.00 ? 64  ARG A HG2  1  
ATOM 900   H HG3  . ARG A 1 64  ? -7.176  4.417   1.481   1.00 0.00 ? 64  ARG A HG3  1  
ATOM 901   H HD2  . ARG A 1 64  ? -8.921  5.256   0.028   1.00 0.00 ? 64  ARG A HD2  1  
ATOM 902   H HD3  . ARG A 1 64  ? -9.379  3.612   -0.415  1.00 0.00 ? 64  ARG A HD3  1  
ATOM 903   H HE   . ARG A 1 64  ? -9.518  4.151   2.409   1.00 0.00 ? 64  ARG A HE   1  
ATOM 904   H HH11 . ARG A 1 64  ? -11.213 4.266   -0.630  1.00 0.00 ? 64  ARG A HH11 1  
ATOM 905   H HH12 . ARG A 1 64  ? -12.785 4.229   0.096   1.00 0.00 ? 64  ARG A HH12 1  
ATOM 906   H HH21 . ARG A 1 64  ? -11.583 4.102   3.377   1.00 0.00 ? 64  ARG A HH21 1  
ATOM 907   H HH22 . ARG A 1 64  ? -12.995 4.136   2.376   1.00 0.00 ? 64  ARG A HH22 1  
ATOM 908   N N    . VAL A 1 65  ? -4.902  2.535   -2.550  1.00 0.00 ? 65  VAL A N    1  
ATOM 909   C CA   . VAL A 1 65  ? -4.135  2.580   -3.789  1.00 0.00 ? 65  VAL A CA   1  
ATOM 910   C C    . VAL A 1 65  ? -4.360  3.895   -4.528  1.00 0.00 ? 65  VAL A C    1  
ATOM 911   O O    . VAL A 1 65  ? -5.291  4.022   -5.321  1.00 0.00 ? 65  VAL A O    1  
ATOM 912   C CB   . VAL A 1 65  ? -4.505  1.411   -4.721  1.00 0.00 ? 65  VAL A CB   1  
ATOM 913   C CG1  . VAL A 1 65  ? -3.480  1.272   -5.837  1.00 0.00 ? 65  VAL A CG1  1  
ATOM 914   C CG2  . VAL A 1 65  ? -4.623  0.117   -3.930  1.00 0.00 ? 65  VAL A CG2  1  
ATOM 915   H H    . VAL A 1 65  ? -5.768  2.076   -2.541  1.00 0.00 ? 65  VAL A H    1  
ATOM 916   H HA   . VAL A 1 65  ? -3.088  2.494   -3.537  1.00 0.00 ? 65  VAL A HA   1  
ATOM 917   H HB   . VAL A 1 65  ? -5.465  1.623   -5.169  1.00 0.00 ? 65  VAL A HB   1  
ATOM 918   H HG11 . VAL A 1 65  ? -2.693  1.998   -5.695  1.00 0.00 ? 65  VAL A HG11 1  
ATOM 919   H HG12 . VAL A 1 65  ? -3.061  0.277   -5.819  1.00 0.00 ? 65  VAL A HG12 1  
ATOM 920   H HG13 . VAL A 1 65  ? -3.960  1.444   -6.789  1.00 0.00 ? 65  VAL A HG13 1  
ATOM 921   H HG21 . VAL A 1 65  ? -3.646  -0.181  -3.581  1.00 0.00 ? 65  VAL A HG21 1  
ATOM 922   H HG22 . VAL A 1 65  ? -5.277  0.270   -3.084  1.00 0.00 ? 65  VAL A HG22 1  
ATOM 923   H HG23 . VAL A 1 65  ? -5.031  -0.657  -4.564  1.00 0.00 ? 65  VAL A HG23 1  
ATOM 924   N N    . GLY A 1 66  ? -3.498  4.872   -4.261  1.00 0.00 ? 66  GLY A N    1  
ATOM 925   C CA   . GLY A 1 66  ? -3.619  6.165   -4.909  1.00 0.00 ? 66  GLY A CA   1  
ATOM 926   C C    . GLY A 1 66  ? -3.003  7.283   -4.091  1.00 0.00 ? 66  GLY A C    1  
ATOM 927   O O    . GLY A 1 66  ? -2.796  8.388   -4.594  1.00 0.00 ? 66  GLY A O    1  
ATOM 928   H H    . GLY A 1 66  ? -2.775  4.713   -3.619  1.00 0.00 ? 66  GLY A H    1  
ATOM 929   H HA2  . GLY A 1 66  ? -3.128  6.122   -5.869  1.00 0.00 ? 66  GLY A HA2  1  
ATOM 930   H HA3  . GLY A 1 66  ? -4.667  6.381   -5.061  1.00 0.00 ? 66  GLY A HA3  1  
ATOM 931   N N    . LEU A 1 67  ? -2.711  6.997   -2.827  1.00 0.00 ? 67  LEU A N    1  
ATOM 932   C CA   . LEU A 1 67  ? -2.116  7.988   -1.937  1.00 0.00 ? 67  LEU A CA   1  
ATOM 933   C C    . LEU A 1 67  ? -0.629  8.158   -2.228  1.00 0.00 ? 67  LEU A C    1  
ATOM 934   O O    . LEU A 1 67  ? 0.150   7.213   -2.101  1.00 0.00 ? 67  LEU A O    1  
ATOM 935   C CB   . LEU A 1 67  ? -2.319  7.578   -0.477  1.00 0.00 ? 67  LEU A CB   1  
ATOM 936   C CG   . LEU A 1 67  ? -3.752  7.235   -0.069  1.00 0.00 ? 67  LEU A CG   1  
ATOM 937   C CD1  . LEU A 1 67  ? -3.802  6.800   1.388   1.00 0.00 ? 67  LEU A CD1  1  
ATOM 938   C CD2  . LEU A 1 67  ? -4.672  8.423   -0.305  1.00 0.00 ? 67  LEU A CD2  1  
ATOM 939   H H    . LEU A 1 67  ? -2.899  6.100   -2.483  1.00 0.00 ? 67  LEU A H    1  
ATOM 940   H HA   . LEU A 1 67  ? -2.615  8.930   -2.110  1.00 0.00 ? 67  LEU A HA   1  
ATOM 941   H HB2  . LEU A 1 67  ? -1.705  6.710   -0.290  1.00 0.00 ? 67  LEU A HB2  1  
ATOM 942   H HB3  . LEU A 1 67  ? -1.983  8.395   0.145   1.00 0.00 ? 67  LEU A HB3  1  
ATOM 943   H HG   . LEU A 1 67  ? -4.105  6.412   -0.675  1.00 0.00 ? 67  LEU A HG   1  
ATOM 944   H HD11 . LEU A 1 67  ? -4.815  6.534   1.649   1.00 0.00 ? 67  LEU A HD11 1  
ATOM 945   H HD12 . LEU A 1 67  ? -3.469  7.612   2.017   1.00 0.00 ? 67  LEU A HD12 1  
ATOM 946   H HD13 . LEU A 1 67  ? -3.157  5.946   1.531   1.00 0.00 ? 67  LEU A HD13 1  
ATOM 947   H HD21 . LEU A 1 67  ? -5.019  8.412   -1.328  1.00 0.00 ? 67  LEU A HD21 1  
ATOM 948   H HD22 . LEU A 1 67  ? -4.132  9.340   -0.118  1.00 0.00 ? 67  LEU A HD22 1  
ATOM 949   H HD23 . LEU A 1 67  ? -5.519  8.361   0.363   1.00 0.00 ? 67  LEU A HD23 1  
ATOM 950   N N    . ARG A 1 68  ? -0.241  9.369   -2.615  1.00 0.00 ? 68  ARG A N    1  
ATOM 951   C CA   . ARG A 1 68  ? 1.153   9.663   -2.923  1.00 0.00 ? 68  ARG A CA   1  
ATOM 952   C C    . ARG A 1 68  ? 2.007   9.631   -1.659  1.00 0.00 ? 68  ARG A C    1  
ATOM 953   O O    . ARG A 1 68  ? 1.742   10.357  -0.699  1.00 0.00 ? 68  ARG A O    1  
ATOM 954   C CB   . ARG A 1 68  ? 1.271   11.031  -3.597  1.00 0.00 ? 68  ARG A CB   1  
ATOM 955   C CG   . ARG A 1 68  ? 2.693   11.395  -3.991  1.00 0.00 ? 68  ARG A CG   1  
ATOM 956   C CD   . ARG A 1 68  ? 2.793   12.844  -4.441  1.00 0.00 ? 68  ARG A CD   1  
ATOM 957   N NE   . ARG A 1 68  ? 3.994   13.090  -5.234  1.00 0.00 ? 68  ARG A NE   1  
ATOM 958   C CZ   . ARG A 1 68  ? 4.492   14.301  -5.460  1.00 0.00 ? 68  ARG A CZ   1  
ATOM 959   N NH1  . ARG A 1 68  ? 3.894   15.371  -4.954  1.00 0.00 ? 68  ARG A NH1  1  
ATOM 960   N NH2  . ARG A 1 68  ? 5.589   14.443  -6.192  1.00 0.00 ? 68  ARG A NH2  1  
ATOM 961   H H    . ARG A 1 68  ? -0.909  10.081  -2.697  1.00 0.00 ? 68  ARG A H    1  
ATOM 962   H HA   . ARG A 1 68  ? 1.510   8.904   -3.603  1.00 0.00 ? 68  ARG A HA   1  
ATOM 963   H HB2  . ARG A 1 68  ? 0.662   11.034  -4.489  1.00 0.00 ? 68  ARG A HB2  1  
ATOM 964   H HB3  . ARG A 1 68  ? 0.904   11.786  -2.918  1.00 0.00 ? 68  ARG A HB3  1  
ATOM 965   H HG2  . ARG A 1 68  ? 3.341   11.250  -3.139  1.00 0.00 ? 68  ARG A HG2  1  
ATOM 966   H HG3  . ARG A 1 68  ? 3.008   10.753  -4.799  1.00 0.00 ? 68  ARG A HG3  1  
ATOM 967   H HD2  . ARG A 1 68  ? 1.925   13.083  -5.037  1.00 0.00 ? 68  ARG A HD2  1  
ATOM 968   H HD3  . ARG A 1 68  ? 2.814   13.478  -3.567  1.00 0.00 ? 68  ARG A HD3  1  
ATOM 969   H HE   . ARG A 1 68  ? 4.452   12.313  -5.617  1.00 0.00 ? 68  ARG A HE   1  
ATOM 970   H HH11 . ARG A 1 68  ? 3.068   15.267  -4.401  1.00 0.00 ? 68  ARG A HH11 1  
ATOM 971   H HH12 . ARG A 1 68  ? 4.272   16.281  -5.124  1.00 0.00 ? 68  ARG A HH12 1  
ATOM 972   H HH21 . ARG A 1 68  ? 6.042   13.638  -6.575  1.00 0.00 ? 68  ARG A HH21 1  
ATOM 973   H HH22 . ARG A 1 68  ? 5.962   15.354  -6.361  1.00 0.00 ? 68  ARG A HH22 1  
ATOM 974   N N    . LEU A 1 69  ? 3.031   8.786   -1.664  1.00 0.00 ? 69  LEU A N    1  
ATOM 975   C CA   . LEU A 1 69  ? 3.925   8.658   -0.518  1.00 0.00 ? 69  LEU A CA   1  
ATOM 976   C C    . LEU A 1 69  ? 4.839   9.874   -0.402  1.00 0.00 ? 69  LEU A C    1  
ATOM 977   O O    . LEU A 1 69  ? 5.749   10.059  -1.212  1.00 0.00 ? 69  LEU A O    1  
ATOM 978   C CB   . LEU A 1 69  ? 4.763   7.385   -0.638  1.00 0.00 ? 69  LEU A CB   1  
ATOM 979   C CG   . LEU A 1 69  ? 4.248   6.167   0.129   1.00 0.00 ? 69  LEU A CG   1  
ATOM 980   C CD1  . LEU A 1 69  ? 4.525   6.317   1.616   1.00 0.00 ? 69  LEU A CD1  1  
ATOM 981   C CD2  . LEU A 1 69  ? 2.760   5.969   -0.122  1.00 0.00 ? 69  LEU A CD2  1  
ATOM 982   H H    . LEU A 1 69  ? 3.192   8.233   -2.457  1.00 0.00 ? 69  LEU A H    1  
ATOM 983   H HA   . LEU A 1 69  ? 3.315   8.595   0.372   1.00 0.00 ? 69  LEU A HA   1  
ATOM 984   H HB2  . LEU A 1 69  ? 4.814   7.120   -1.683  1.00 0.00 ? 69  LEU A HB2  1  
ATOM 985   H HB3  . LEU A 1 69  ? 5.757   7.609   -0.277  1.00 0.00 ? 69  LEU A HB3  1  
ATOM 986   H HG   . LEU A 1 69  ? 4.767   5.284   -0.220  1.00 0.00 ? 69  LEU A HG   1  
ATOM 987   H HD11 . LEU A 1 69  ? 3.590   6.350   2.155   1.00 0.00 ? 69  LEU A HD11 1  
ATOM 988   H HD12 . LEU A 1 69  ? 5.073   7.231   1.790   1.00 0.00 ? 69  LEU A HD12 1  
ATOM 989   H HD13 . LEU A 1 69  ? 5.110   5.476   1.960   1.00 0.00 ? 69  LEU A HD13 1  
ATOM 990   H HD21 . LEU A 1 69  ? 2.307   6.919   -0.365  1.00 0.00 ? 69  LEU A HD21 1  
ATOM 991   H HD22 . LEU A 1 69  ? 2.296   5.566   0.767   1.00 0.00 ? 69  LEU A HD22 1  
ATOM 992   H HD23 . LEU A 1 69  ? 2.622   5.282   -0.944  1.00 0.00 ? 69  LEU A HD23 1  
ATOM 993   N N    . LEU A 1 70  ? 4.592   10.699  0.610   1.00 0.00 ? 70  LEU A N    1  
ATOM 994   C CA   . LEU A 1 70  ? 5.395   11.896  0.833   1.00 0.00 ? 70  LEU A CA   1  
ATOM 995   C C    . LEU A 1 70  ? 6.656   11.567  1.626   1.00 0.00 ? 70  LEU A C    1  
ATOM 996   O O    . LEU A 1 70  ? 7.765   11.906  1.214   1.00 0.00 ? 70  LEU A O    1  
ATOM 997   C CB   . LEU A 1 70  ? 4.574   12.953  1.575   1.00 0.00 ? 70  LEU A CB   1  
ATOM 998   C CG   . LEU A 1 70  ? 3.656   13.818  0.710   1.00 0.00 ? 70  LEU A CG   1  
ATOM 999   C CD1  . LEU A 1 70  ? 4.459   14.549  -0.355  1.00 0.00 ? 70  LEU A CD1  1  
ATOM 1000  C CD2  . LEU A 1 70  ? 2.568   12.968  0.071   1.00 0.00 ? 70  LEU A CD2  1  
ATOM 1001  H H    . LEU A 1 70  ? 3.854   10.499  1.221   1.00 0.00 ? 70  LEU A H    1  
ATOM 1002  H HA   . LEU A 1 70  ? 5.683   12.287  -0.132  1.00 0.00 ? 70  LEU A HA   1  
ATOM 1003  H HB2  . LEU A 1 70  ? 3.960   12.445  2.302   1.00 0.00 ? 70  LEU A HB2  1  
ATOM 1004  H HB3  . LEU A 1 70  ? 5.265   13.609  2.085   1.00 0.00 ? 70  LEU A HB3  1  
ATOM 1005  H HG   . LEU A 1 70  ? 3.179   14.561  1.335   1.00 0.00 ? 70  LEU A HG   1  
ATOM 1006  H HD11 . LEU A 1 70  ? 5.502   14.561  -0.075  1.00 0.00 ? 70  LEU A HD11 1  
ATOM 1007  H HD12 . LEU A 1 70  ? 4.099   15.563  -0.445  1.00 0.00 ? 70  LEU A HD12 1  
ATOM 1008  H HD13 . LEU A 1 70  ? 4.345   14.042  -1.302  1.00 0.00 ? 70  LEU A HD13 1  
ATOM 1009  H HD21 . LEU A 1 70  ? 2.011   13.568  -0.634  1.00 0.00 ? 70  LEU A HD21 1  
ATOM 1010  H HD22 . LEU A 1 70  ? 1.901   12.602  0.838   1.00 0.00 ? 70  LEU A HD22 1  
ATOM 1011  H HD23 . LEU A 1 70  ? 3.019   12.133  -0.443  1.00 0.00 ? 70  LEU A HD23 1  
ATOM 1012  N N    . GLU A 1 71  ? 6.477   10.902  2.763   1.00 0.00 ? 71  GLU A N    1  
ATOM 1013  C CA   . GLU A 1 71  ? 7.601   10.526  3.612   1.00 0.00 ? 71  GLU A CA   1  
ATOM 1014  C C    . GLU A 1 71  ? 7.231   9.354   4.517   1.00 0.00 ? 71  GLU A C    1  
ATOM 1015  O O    . GLU A 1 71  ? 6.157   9.334   5.118   1.00 0.00 ? 71  GLU A O    1  
ATOM 1016  C CB   . GLU A 1 71  ? 8.050   11.717  4.460   1.00 0.00 ? 71  GLU A CB   1  
ATOM 1017  C CG   . GLU A 1 71  ? 8.016   13.042  3.716   1.00 0.00 ? 71  GLU A CG   1  
ATOM 1018  C CD   . GLU A 1 71  ? 8.328   14.224  4.613   1.00 0.00 ? 71  GLU A CD   1  
ATOM 1019  O OE1  . GLU A 1 71  ? 9.332   14.158  5.352   1.00 0.00 ? 71  GLU A OE1  1  
ATOM 1020  O OE2  . GLU A 1 71  ? 7.568   15.214  4.577   1.00 0.00 ? 71  GLU A OE2  1  
ATOM 1021  H H    . GLU A 1 71  ? 5.568   10.660  3.038   1.00 0.00 ? 71  GLU A H    1  
ATOM 1022  H HA   . GLU A 1 71  ? 8.416   10.226  2.970   1.00 0.00 ? 71  GLU A HA   1  
ATOM 1023  H HB2  . GLU A 1 71  ? 7.402   11.795  5.321   1.00 0.00 ? 71  GLU A HB2  1  
ATOM 1024  H HB3  . GLU A 1 71  ? 9.061   11.544  4.797   1.00 0.00 ? 71  GLU A HB3  1  
ATOM 1025  H HG2  . GLU A 1 71  ? 8.745   13.011  2.920   1.00 0.00 ? 71  GLU A HG2  1  
ATOM 1026  H HG3  . GLU A 1 71  ? 7.031   13.178  3.295   1.00 0.00 ? 71  GLU A HG3  1  
ATOM 1027  N N    . VAL A 1 72  ? 8.129   8.378   4.608   1.00 0.00 ? 72  VAL A N    1  
ATOM 1028  C CA   . VAL A 1 72  ? 7.898   7.202   5.439   1.00 0.00 ? 72  VAL A CA   1  
ATOM 1029  C C    . VAL A 1 72  ? 8.754   7.245   6.700   1.00 0.00 ? 72  VAL A C    1  
ATOM 1030  O O    . VAL A 1 72  ? 9.974   7.105   6.639   1.00 0.00 ? 72  VAL A O    1  
ATOM 1031  C CB   . VAL A 1 72  ? 8.202   5.903   4.670   1.00 0.00 ? 72  VAL A CB   1  
ATOM 1032  C CG1  . VAL A 1 72  ? 8.069   4.696   5.586   1.00 0.00 ? 72  VAL A CG1  1  
ATOM 1033  C CG2  . VAL A 1 72  ? 7.283   5.771   3.465   1.00 0.00 ? 72  VAL A CG2  1  
ATOM 1034  H H    . VAL A 1 72  ? 8.967   8.451   4.105   1.00 0.00 ? 72  VAL A H    1  
ATOM 1035  H HA   . VAL A 1 72  ? 6.856   7.193   5.723   1.00 0.00 ? 72  VAL A HA   1  
ATOM 1036  H HB   . VAL A 1 72  ? 9.221   5.948   4.315   1.00 0.00 ? 72  VAL A HB   1  
ATOM 1037  H HG11 . VAL A 1 72  ? 9.014   4.175   5.634   1.00 0.00 ? 72  VAL A HG11 1  
ATOM 1038  H HG12 . VAL A 1 72  ? 7.787   5.025   6.576   1.00 0.00 ? 72  VAL A HG12 1  
ATOM 1039  H HG13 . VAL A 1 72  ? 7.312   4.031   5.198   1.00 0.00 ? 72  VAL A HG13 1  
ATOM 1040  H HG21 . VAL A 1 72  ? 7.814   6.067   2.573   1.00 0.00 ? 72  VAL A HG21 1  
ATOM 1041  H HG22 . VAL A 1 72  ? 6.961   4.744   3.367   1.00 0.00 ? 72  VAL A HG22 1  
ATOM 1042  H HG23 . VAL A 1 72  ? 6.420   6.406   3.598   1.00 0.00 ? 72  VAL A HG23 1  
ATOM 1043  N N    . ASN A 1 73  ? 8.104   7.438   7.843   1.00 0.00 ? 73  ASN A N    1  
ATOM 1044  C CA   . ASN A 1 73  ? 8.805   7.499   9.121   1.00 0.00 ? 73  ASN A CA   1  
ATOM 1045  C C    . ASN A 1 73  ? 9.734   8.708   9.174   1.00 0.00 ? 73  ASN A C    1  
ATOM 1046  O O    . ASN A 1 73  ? 10.861  8.616   9.660   1.00 0.00 ? 73  ASN A O    1  
ATOM 1047  C CB   . ASN A 1 73  ? 9.607   6.216   9.347   1.00 0.00 ? 73  ASN A CB   1  
ATOM 1048  C CG   . ASN A 1 73  ? 8.825   5.175   10.125  1.00 0.00 ? 73  ASN A CG   1  
ATOM 1049  O OD1  . ASN A 1 73  ? 7.919   5.506   10.890  1.00 0.00 ? 73  ASN A OD1  1  
ATOM 1050  N ND2  . ASN A 1 73  ? 9.172   3.908   9.931   1.00 0.00 ? 73  ASN A ND2  1  
ATOM 1051  H H    . ASN A 1 73  ? 7.130   7.543   7.828   1.00 0.00 ? 73  ASN A H    1  
ATOM 1052  H HA   . ASN A 1 73  ? 8.065   7.593   9.901   1.00 0.00 ? 73  ASN A HA   1  
ATOM 1053  H HB2  . ASN A 1 73  ? 9.878   5.794   8.390   1.00 0.00 ? 73  ASN A HB2  1  
ATOM 1054  H HB3  . ASN A 1 73  ? 10.505  6.451   9.899   1.00 0.00 ? 73  ASN A HB3  1  
ATOM 1055  H HD21 . ASN A 1 73  ? 9.903   3.718   9.307   1.00 0.00 ? 73  ASN A HD21 1  
ATOM 1056  H HD22 . ASN A 1 73  ? 8.682   3.214   10.421  1.00 0.00 ? 73  ASN A HD22 1  
ATOM 1057  N N    . GLN A 1 74  ? 9.251   9.840   8.672   1.00 0.00 ? 74  GLN A N    1  
ATOM 1058  C CA   . GLN A 1 74  ? 10.038  11.068  8.663   1.00 0.00 ? 74  GLN A CA   1  
ATOM 1059  C C    . GLN A 1 74  ? 11.273  10.916  7.780   1.00 0.00 ? 74  GLN A C    1  
ATOM 1060  O O    . GLN A 1 74  ? 12.315  11.514  8.048   1.00 0.00 ? 74  GLN A O    1  
ATOM 1061  C CB   . GLN A 1 74  ? 10.457  11.441  10.086  1.00 0.00 ? 74  GLN A CB   1  
ATOM 1062  C CG   . GLN A 1 74  ? 9.299   11.883  10.965  1.00 0.00 ? 74  GLN A CG   1  
ATOM 1063  C CD   . GLN A 1 74  ? 9.563   11.651  12.440  1.00 0.00 ? 74  GLN A CD   1  
ATOM 1064  O OE1  . GLN A 1 74  ? 10.110  12.514  13.128  1.00 0.00 ? 74  GLN A OE1  1  
ATOM 1065  N NE2  . GLN A 1 74  ? 9.176   10.481  12.934  1.00 0.00 ? 74  GLN A NE2  1  
ATOM 1066  H H    . GLN A 1 74  ? 8.346   9.850   8.299   1.00 0.00 ? 74  GLN A H    1  
ATOM 1067  H HA   . GLN A 1 74  ? 9.419   11.856  8.262   1.00 0.00 ? 74  GLN A HA   1  
ATOM 1068  H HB2  . GLN A 1 74  ? 10.924  10.583  10.548  1.00 0.00 ? 74  GLN A HB2  1  
ATOM 1069  H HB3  . GLN A 1 74  ? 11.173  12.248  10.038  1.00 0.00 ? 74  GLN A HB3  1  
ATOM 1070  H HG2  . GLN A 1 74  ? 9.127   12.938  10.808  1.00 0.00 ? 74  GLN A HG2  1  
ATOM 1071  H HG3  . GLN A 1 74  ? 8.416   11.329  10.681  1.00 0.00 ? 74  GLN A HG3  1  
ATOM 1072  H HE21 . GLN A 1 74  ? 8.748   9.842   12.327  1.00 0.00 ? 74  GLN A HE21 1  
ATOM 1073  H HE22 . GLN A 1 74  ? 9.335   10.304  13.884  1.00 0.00 ? 74  GLN A HE22 1  
ATOM 1074  N N    . GLN A 1 75  ? 11.147  10.114  6.728   1.00 0.00 ? 75  GLN A N    1  
ATOM 1075  C CA   . GLN A 1 75  ? 12.254  9.884   5.807   1.00 0.00 ? 75  GLN A CA   1  
ATOM 1076  C C    . GLN A 1 75  ? 11.817  10.112  4.364   1.00 0.00 ? 75  GLN A C    1  
ATOM 1077  O O    . GLN A 1 75  ? 11.342  9.193   3.696   1.00 0.00 ? 75  GLN A O    1  
ATOM 1078  C CB   . GLN A 1 75  ? 12.793  8.462   5.970   1.00 0.00 ? 75  GLN A CB   1  
ATOM 1079  C CG   . GLN A 1 75  ? 13.137  8.102   7.407   1.00 0.00 ? 75  GLN A CG   1  
ATOM 1080  C CD   . GLN A 1 75  ? 14.217  7.043   7.501   1.00 0.00 ? 75  GLN A CD   1  
ATOM 1081  O OE1  . GLN A 1 75  ? 14.999  6.853   6.569   1.00 0.00 ? 75  GLN A OE1  1  
ATOM 1082  N NE2  . GLN A 1 75  ? 14.267  6.347   8.631   1.00 0.00 ? 75  GLN A NE2  1  
ATOM 1083  H H    . GLN A 1 75  ? 10.291  9.666   6.569   1.00 0.00 ? 75  GLN A H    1  
ATOM 1084  H HA   . GLN A 1 75  ? 13.037  10.586  6.048   1.00 0.00 ? 75  GLN A HA   1  
ATOM 1085  H HB2  . GLN A 1 75  ? 12.050  7.764   5.615   1.00 0.00 ? 75  GLN A HB2  1  
ATOM 1086  H HB3  . GLN A 1 75  ? 13.687  8.358   5.373   1.00 0.00 ? 75  GLN A HB3  1  
ATOM 1087  H HG2  . GLN A 1 75  ? 13.481  8.991   7.914   1.00 0.00 ? 75  GLN A HG2  1  
ATOM 1088  H HG3  . GLN A 1 75  ? 12.247  7.733   7.894   1.00 0.00 ? 75  GLN A HG3  1  
ATOM 1089  H HE21 . GLN A 1 75  ? 13.611  6.552   9.330   1.00 0.00 ? 75  GLN A HE21 1  
ATOM 1090  H HE22 . GLN A 1 75  ? 14.954  5.655   8.718   1.00 0.00 ? 75  GLN A HE22 1  
ATOM 1091  N N    . SER A 1 76  ? 11.980  11.343  3.889   1.00 0.00 ? 76  SER A N    1  
ATOM 1092  C CA   . SER A 1 76  ? 11.599  11.693  2.526   1.00 0.00 ? 76  SER A CA   1  
ATOM 1093  C C    . SER A 1 76  ? 12.187  10.702  1.526   1.00 0.00 ? 76  SER A C    1  
ATOM 1094  O O    . SER A 1 76  ? 13.380  10.398  1.564   1.00 0.00 ? 76  SER A O    1  
ATOM 1095  C CB   . SER A 1 76  ? 12.065  13.111  2.191   1.00 0.00 ? 76  SER A CB   1  
ATOM 1096  O OG   . SER A 1 76  ? 11.655  13.489  0.889   1.00 0.00 ? 76  SER A OG   1  
ATOM 1097  H H    . SER A 1 76  ? 12.364  12.032  4.470   1.00 0.00 ? 76  SER A H    1  
ATOM 1098  H HA   . SER A 1 76  ? 10.521  11.653  2.463   1.00 0.00 ? 76  SER A HA   1  
ATOM 1099  H HB2  . SER A 1 76  ? 11.644  13.803  2.904   1.00 0.00 ? 76  SER A HB2  1  
ATOM 1100  H HB3  . SER A 1 76  ? 13.144  13.153  2.243   1.00 0.00 ? 76  SER A HB3  1  
ATOM 1101  H HG   . SER A 1 76  ? 11.842  14.420  0.752   1.00 0.00 ? 76  SER A HG   1  
ATOM 1102  N N    . LEU A 1 77  ? 11.342  10.203  0.631   1.00 0.00 ? 77  LEU A N    1  
ATOM 1103  C CA   . LEU A 1 77  ? 11.776  9.246   -0.381  1.00 0.00 ? 77  LEU A CA   1  
ATOM 1104  C C    . LEU A 1 77  ? 12.461  9.957   -1.544  1.00 0.00 ? 77  LEU A C    1  
ATOM 1105  O O    . LEU A 1 77  ? 12.816  9.332   -2.545  1.00 0.00 ? 77  LEU A O    1  
ATOM 1106  C CB   . LEU A 1 77  ? 10.582  8.438   -0.893  1.00 0.00 ? 77  LEU A CB   1  
ATOM 1107  C CG   . LEU A 1 77  ? 9.540   8.044   0.153   1.00 0.00 ? 77  LEU A CG   1  
ATOM 1108  C CD1  . LEU A 1 77  ? 8.426   7.227   -0.484  1.00 0.00 ? 77  LEU A CD1  1  
ATOM 1109  C CD2  . LEU A 1 77  ? 10.191  7.268   1.289   1.00 0.00 ? 77  LEU A CD2  1  
ATOM 1110  H H    . LEU A 1 77  ? 10.403  10.483  0.650   1.00 0.00 ? 77  LEU A H    1  
ATOM 1111  H HA   . LEU A 1 77  ? 12.484  8.574   0.081   1.00 0.00 ? 77  LEU A HA   1  
ATOM 1112  H HB2  . LEU A 1 77  ? 10.086  9.026   -1.650  1.00 0.00 ? 77  LEU A HB2  1  
ATOM 1113  H HB3  . LEU A 1 77  ? 10.965  7.531   -1.339  1.00 0.00 ? 77  LEU A HB3  1  
ATOM 1114  H HG   . LEU A 1 77  ? 9.100   8.940   0.569   1.00 0.00 ? 77  LEU A HG   1  
ATOM 1115  H HD11 . LEU A 1 77  ? 8.825   6.659   -1.310  1.00 0.00 ? 77  LEU A HD11 1  
ATOM 1116  H HD12 . LEU A 1 77  ? 7.653   7.890   -0.842  1.00 0.00 ? 77  LEU A HD12 1  
ATOM 1117  H HD13 . LEU A 1 77  ? 8.010   6.553   0.251   1.00 0.00 ? 77  LEU A HD13 1  
ATOM 1118  H HD21 . LEU A 1 77  ? 10.216  7.883   2.176   1.00 0.00 ? 77  LEU A HD21 1  
ATOM 1119  H HD22 . LEU A 1 77  ? 11.199  6.999   1.009   1.00 0.00 ? 77  LEU A HD22 1  
ATOM 1120  H HD23 . LEU A 1 77  ? 9.620   6.373   1.486   1.00 0.00 ? 77  LEU A HD23 1  
ATOM 1121  N N    . LEU A 1 78  ? 12.644  11.265  -1.406  1.00 0.00 ? 78  LEU A N    1  
ATOM 1122  C CA   . LEU A 1 78  ? 13.288  12.061  -2.444  1.00 0.00 ? 78  LEU A CA   1  
ATOM 1123  C C    . LEU A 1 78  ? 14.788  11.787  -2.489  1.00 0.00 ? 78  LEU A C    1  
ATOM 1124  O O    . LEU A 1 78  ? 15.513  12.089  -1.542  1.00 0.00 ? 78  LEU A O    1  
ATOM 1125  C CB   . LEU A 1 78  ? 13.038  13.551  -2.202  1.00 0.00 ? 78  LEU A CB   1  
ATOM 1126  C CG   . LEU A 1 78  ? 13.018  14.439  -3.446  1.00 0.00 ? 78  LEU A CG   1  
ATOM 1127  C CD1  . LEU A 1 78  ? 14.381  14.443  -4.121  1.00 0.00 ? 78  LEU A CD1  1  
ATOM 1128  C CD2  . LEU A 1 78  ? 11.941  13.975  -4.416  1.00 0.00 ? 78  LEU A CD2  1  
ATOM 1129  H H    . LEU A 1 78  ? 12.339  11.707  -0.586  1.00 0.00 ? 78  LEU A H    1  
ATOM 1130  H HA   . LEU A 1 78  ? 12.855  11.782  -3.393  1.00 0.00 ? 78  LEU A HA   1  
ATOM 1131  H HB2  . LEU A 1 78  ? 12.082  13.649  -1.710  1.00 0.00 ? 78  LEU A HB2  1  
ATOM 1132  H HB3  . LEU A 1 78  ? 13.817  13.914  -1.547  1.00 0.00 ? 78  LEU A HB3  1  
ATOM 1133  H HG   . LEU A 1 78  ? 12.790  15.455  -3.152  1.00 0.00 ? 78  LEU A HG   1  
ATOM 1134  H HD11 . LEU A 1 78  ? 14.654  15.455  -4.376  1.00 0.00 ? 78  LEU A HD11 1  
ATOM 1135  H HD12 . LEU A 1 78  ? 14.338  13.844  -5.020  1.00 0.00 ? 78  LEU A HD12 1  
ATOM 1136  H HD13 . LEU A 1 78  ? 15.117  14.029  -3.448  1.00 0.00 ? 78  LEU A HD13 1  
ATOM 1137  H HD21 . LEU A 1 78  ? 11.469  14.836  -4.867  1.00 0.00 ? 78  LEU A HD21 1  
ATOM 1138  H HD22 . LEU A 1 78  ? 11.201  13.398  -3.882  1.00 0.00 ? 78  LEU A HD22 1  
ATOM 1139  H HD23 . LEU A 1 78  ? 12.389  13.365  -5.186  1.00 0.00 ? 78  LEU A HD23 1  
ATOM 1140  N N    . GLY A 1 79  ? 15.248  11.215  -3.597  1.00 0.00 ? 79  GLY A N    1  
ATOM 1141  C CA   . GLY A 1 79  ? 16.659  10.912  -3.746  1.00 0.00 ? 79  GLY A CA   1  
ATOM 1142  C C    . GLY A 1 79  ? 16.917  9.430   -3.939  1.00 0.00 ? 79  GLY A C    1  
ATOM 1143  O O    . GLY A 1 79  ? 17.800  9.041   -4.704  1.00 0.00 ? 79  GLY A O    1  
ATOM 1144  H H    . GLY A 1 79  ? 14.623  10.996  -4.321  1.00 0.00 ? 79  GLY A H    1  
ATOM 1145  H HA2  . GLY A 1 79  ? 17.043  11.448  -4.600  1.00 0.00 ? 79  GLY A HA2  1  
ATOM 1146  H HA3  . GLY A 1 79  ? 17.182  11.244  -2.860  1.00 0.00 ? 79  GLY A HA3  1  
ATOM 1147  N N    . LEU A 1 80  ? 16.146  8.602   -3.243  1.00 0.00 ? 80  LEU A N    1  
ATOM 1148  C CA   . LEU A 1 80  ? 16.296  7.154   -3.340  1.00 0.00 ? 80  LEU A CA   1  
ATOM 1149  C C    . LEU A 1 80  ? 15.481  6.599   -4.503  1.00 0.00 ? 80  LEU A C    1  
ATOM 1150  O O    . LEU A 1 80  ? 14.643  7.295   -5.077  1.00 0.00 ? 80  LEU A O    1  
ATOM 1151  C CB   . LEU A 1 80  ? 15.861  6.488   -2.033  1.00 0.00 ? 80  LEU A CB   1  
ATOM 1152  C CG   . LEU A 1 80  ? 14.761  7.204   -1.249  1.00 0.00 ? 80  LEU A CG   1  
ATOM 1153  C CD1  . LEU A 1 80  ? 14.032  6.227   -0.339  1.00 0.00 ? 80  LEU A CD1  1  
ATOM 1154  C CD2  . LEU A 1 80  ? 15.345  8.354   -0.440  1.00 0.00 ? 80  LEU A CD2  1  
ATOM 1155  H H    . LEU A 1 80  ? 15.460  8.971   -2.650  1.00 0.00 ? 80  LEU A H    1  
ATOM 1156  H HA   . LEU A 1 80  ? 17.340  6.940   -3.513  1.00 0.00 ? 80  LEU A HA   1  
ATOM 1157  H HB2  . LEU A 1 80  ? 15.506  5.497   -2.270  1.00 0.00 ? 80  LEU A HB2  1  
ATOM 1158  H HB3  . LEU A 1 80  ? 16.730  6.414   -1.395  1.00 0.00 ? 80  LEU A HB3  1  
ATOM 1159  H HG   . LEU A 1 80  ? 14.041  7.614   -1.943  1.00 0.00 ? 80  LEU A HG   1  
ATOM 1160  H HD11 . LEU A 1 80  ? 14.464  6.264   0.649   1.00 0.00 ? 80  LEU A HD11 1  
ATOM 1161  H HD12 . LEU A 1 80  ? 14.126  5.227   -0.736  1.00 0.00 ? 80  LEU A HD12 1  
ATOM 1162  H HD13 . LEU A 1 80  ? 12.987  6.497   -0.286  1.00 0.00 ? 80  LEU A HD13 1  
ATOM 1163  H HD21 . LEU A 1 80  ? 16.264  8.686   -0.900  1.00 0.00 ? 80  LEU A HD21 1  
ATOM 1164  H HD22 . LEU A 1 80  ? 15.547  8.019   0.567   1.00 0.00 ? 80  LEU A HD22 1  
ATOM 1165  H HD23 . LEU A 1 80  ? 14.640  9.170   -0.415  1.00 0.00 ? 80  LEU A HD23 1  
ATOM 1166  N N    . THR A 1 81  ? 15.730  5.339   -4.846  1.00 0.00 ? 81  THR A N    1  
ATOM 1167  C CA   . THR A 1 81  ? 15.019  4.689   -5.940  1.00 0.00 ? 81  THR A CA   1  
ATOM 1168  C C    . THR A 1 81  ? 13.970  3.717   -5.413  1.00 0.00 ? 81  THR A C    1  
ATOM 1169  O O    . THR A 1 81  ? 14.032  3.286   -4.261  1.00 0.00 ? 81  THR A O    1  
ATOM 1170  C CB   . THR A 1 81  ? 15.987  3.930   -6.867  1.00 0.00 ? 81  THR A CB   1  
ATOM 1171  O OG1  . THR A 1 81  ? 16.639  2.881   -6.141  1.00 0.00 ? 81  THR A OG1  1  
ATOM 1172  C CG2  . THR A 1 81  ? 17.028  4.872   -7.451  1.00 0.00 ? 81  THR A CG2  1  
ATOM 1173  H H    . THR A 1 81  ? 16.409  4.835   -4.350  1.00 0.00 ? 81  THR A H    1  
ATOM 1174  H HA   . THR A 1 81  ? 14.526  5.456   -6.519  1.00 0.00 ? 81  THR A HA   1  
ATOM 1175  H HB   . THR A 1 81  ? 15.420  3.497   -7.678  1.00 0.00 ? 81  THR A HB   1  
ATOM 1176  H HG1  . THR A 1 81  ? 16.678  3.113   -5.210  1.00 0.00 ? 81  THR A HG1  1  
ATOM 1177  H HG21 . THR A 1 81  ? 16.576  5.473   -8.226  1.00 0.00 ? 81  THR A HG21 1  
ATOM 1178  H HG22 . THR A 1 81  ? 17.841  4.297   -7.869  1.00 0.00 ? 81  THR A HG22 1  
ATOM 1179  H HG23 . THR A 1 81  ? 17.407  5.517   -6.672  1.00 0.00 ? 81  THR A HG23 1  
ATOM 1180  N N    . HIS A 1 82  ? 13.008  3.373   -6.263  1.00 0.00 ? 82  HIS A N    1  
ATOM 1181  C CA   . HIS A 1 82  ? 11.945  2.450   -5.883  1.00 0.00 ? 82  HIS A CA   1  
ATOM 1182  C C    . HIS A 1 82  ? 12.461  1.404   -4.898  1.00 0.00 ? 82  HIS A C    1  
ATOM 1183  O O    . HIS A 1 82  ? 11.912  1.239   -3.810  1.00 0.00 ? 82  HIS A O    1  
ATOM 1184  C CB   . HIS A 1 82  ? 11.372  1.761   -7.122  1.00 0.00 ? 82  HIS A CB   1  
ATOM 1185  C CG   . HIS A 1 82  ? 9.967   1.273   -6.939  1.00 0.00 ? 82  HIS A CG   1  
ATOM 1186  N ND1  . HIS A 1 82  ? 9.580   -0.022  -7.212  1.00 0.00 ? 82  HIS A ND1  1  
ATOM 1187  C CD2  . HIS A 1 82  ? 8.856   1.914   -6.507  1.00 0.00 ? 82  HIS A CD2  1  
ATOM 1188  C CE1  . HIS A 1 82  ? 8.290   -0.156  -6.957  1.00 0.00 ? 82  HIS A CE1  1  
ATOM 1189  N NE2  . HIS A 1 82  ? 7.828   1.004   -6.527  1.00 0.00 ? 82  HIS A NE2  1  
ATOM 1190  H H    . HIS A 1 82  ? 13.013  3.750   -7.168  1.00 0.00 ? 82  HIS A H    1  
ATOM 1191  H HA   . HIS A 1 82  ? 11.164  3.021   -5.405  1.00 0.00 ? 82  HIS A HA   1  
ATOM 1192  H HB2  . HIS A 1 82  ? 11.375  2.458   -7.947  1.00 0.00 ? 82  HIS A HB2  1  
ATOM 1193  H HB3  . HIS A 1 82  ? 11.990  0.911   -7.372  1.00 0.00 ? 82  HIS A HB3  1  
ATOM 1194  H HD1  . HIS A 1 82  ? 10.162  -0.736  -7.544  1.00 0.00 ? 82  HIS A HD1  1  
ATOM 1195  H HD2  . HIS A 1 82  ? 8.790   2.949   -6.203  1.00 0.00 ? 82  HIS A HD2  1  
ATOM 1196  H HE1  . HIS A 1 82  ? 7.712   -1.060  -7.078  1.00 0.00 ? 82  HIS A HE1  1  
ATOM 1197  H HE2  . HIS A 1 82  ? 6.886   1.204   -6.349  1.00 0.00 ? 82  HIS A HE2  1  
ATOM 1198  N N    . GLY A 1 83  ? 13.519  0.700   -5.289  1.00 0.00 ? 83  GLY A N    1  
ATOM 1199  C CA   . GLY A 1 83  ? 14.090  -0.320  -4.430  1.00 0.00 ? 83  GLY A CA   1  
ATOM 1200  C C    . GLY A 1 83  ? 14.373  0.191   -3.032  1.00 0.00 ? 83  GLY A C    1  
ATOM 1201  O O    . GLY A 1 83  ? 14.047  -0.468  -2.045  1.00 0.00 ? 83  GLY A O    1  
ATOM 1202  H H    . GLY A 1 83  ? 13.915  0.876   -6.168  1.00 0.00 ? 83  GLY A H    1  
ATOM 1203  H HA2  . GLY A 1 83  ? 13.400  -1.149  -4.366  1.00 0.00 ? 83  GLY A HA2  1  
ATOM 1204  H HA3  . GLY A 1 83  ? 15.014  -0.667  -4.868  1.00 0.00 ? 83  GLY A HA3  1  
ATOM 1205  N N    . GLU A 1 84  ? 14.984  1.369   -2.946  1.00 0.00 ? 84  GLU A N    1  
ATOM 1206  C CA   . GLU A 1 84  ? 15.314  1.967   -1.658  1.00 0.00 ? 84  GLU A CA   1  
ATOM 1207  C C    . GLU A 1 84  ? 14.052  2.422   -0.931  1.00 0.00 ? 84  GLU A C    1  
ATOM 1208  O O    . GLU A 1 84  ? 13.869  2.140   0.253   1.00 0.00 ? 84  GLU A O    1  
ATOM 1209  C CB   . GLU A 1 84  ? 16.263  3.152   -1.848  1.00 0.00 ? 84  GLU A CB   1  
ATOM 1210  C CG   . GLU A 1 84  ? 17.730  2.759   -1.873  1.00 0.00 ? 84  GLU A CG   1  
ATOM 1211  C CD   . GLU A 1 84  ? 18.230  2.283   -0.523  1.00 0.00 ? 84  GLU A CD   1  
ATOM 1212  O OE1  . GLU A 1 84  ? 18.258  3.099   0.421   1.00 0.00 ? 84  GLU A OE1  1  
ATOM 1213  O OE2  . GLU A 1 84  ? 18.593  1.093   -0.412  1.00 0.00 ? 84  GLU A OE2  1  
ATOM 1214  H H    . GLU A 1 84  ? 15.219  1.847   -3.769  1.00 0.00 ? 84  GLU A H    1  
ATOM 1215  H HA   . GLU A 1 84  ? 15.807  1.215   -1.060  1.00 0.00 ? 84  GLU A HA   1  
ATOM 1216  H HB2  . GLU A 1 84  ? 16.026  3.641   -2.781  1.00 0.00 ? 84  GLU A HB2  1  
ATOM 1217  H HB3  . GLU A 1 84  ? 16.113  3.850   -1.038  1.00 0.00 ? 84  GLU A HB3  1  
ATOM 1218  H HG2  . GLU A 1 84  ? 17.864  1.963   -2.591  1.00 0.00 ? 84  GLU A HG2  1  
ATOM 1219  H HG3  . GLU A 1 84  ? 18.314  3.616   -2.175  1.00 0.00 ? 84  GLU A HG3  1  
ATOM 1220  N N    . ALA A 1 85  ? 13.186  3.130   -1.648  1.00 0.00 ? 85  ALA A N    1  
ATOM 1221  C CA   . ALA A 1 85  ? 11.941  3.624   -1.073  1.00 0.00 ? 85  ALA A CA   1  
ATOM 1222  C C    . ALA A 1 85  ? 11.139  2.490   -0.444  1.00 0.00 ? 85  ALA A C    1  
ATOM 1223  O O    . ALA A 1 85  ? 10.679  2.598   0.693   1.00 0.00 ? 85  ALA A O    1  
ATOM 1224  C CB   . ALA A 1 85  ? 11.113  4.332   -2.135  1.00 0.00 ? 85  ALA A CB   1  
ATOM 1225  H H    . ALA A 1 85  ? 13.388  3.323   -2.587  1.00 0.00 ? 85  ALA A H    1  
ATOM 1226  H HA   . ALA A 1 85  ? 12.190  4.344   -0.307  1.00 0.00 ? 85  ALA A HA   1  
ATOM 1227  H HB1  . ALA A 1 85  ? 11.137  5.398   -1.958  1.00 0.00 ? 85  ALA A HB1  1  
ATOM 1228  H HB2  . ALA A 1 85  ? 11.523  4.121   -3.111  1.00 0.00 ? 85  ALA A HB2  1  
ATOM 1229  H HB3  . ALA A 1 85  ? 10.093  3.982   -2.089  1.00 0.00 ? 85  ALA A HB3  1  
ATOM 1230  N N    . VAL A 1 86  ? 10.974  1.403   -1.191  1.00 0.00 ? 86  VAL A N    1  
ATOM 1231  C CA   . VAL A 1 86  ? 10.227  0.248   -0.705  1.00 0.00 ? 86  VAL A CA   1  
ATOM 1232  C C    . VAL A 1 86  ? 10.797  -0.260  0.614   1.00 0.00 ? 86  VAL A C    1  
ATOM 1233  O O    . VAL A 1 86  ? 10.080  -0.375  1.607   1.00 0.00 ? 86  VAL A O    1  
ATOM 1234  C CB   . VAL A 1 86  ? 10.238  -0.899  -1.733  1.00 0.00 ? 86  VAL A CB   1  
ATOM 1235  C CG1  . VAL A 1 86  ? 9.607   -2.151  -1.142  1.00 0.00 ? 86  VAL A CG1  1  
ATOM 1236  C CG2  . VAL A 1 86  ? 9.519   -0.480  -3.006  1.00 0.00 ? 86  VAL A CG2  1  
ATOM 1237  H H    . VAL A 1 86  ? 11.364  1.376   -2.089  1.00 0.00 ? 86  VAL A H    1  
ATOM 1238  H HA   . VAL A 1 86  ? 9.203   0.554   -0.550  1.00 0.00 ? 86  VAL A HA   1  
ATOM 1239  H HB   . VAL A 1 86  ? 11.265  -1.123  -1.981  1.00 0.00 ? 86  VAL A HB   1  
ATOM 1240  H HG11 . VAL A 1 86  ? 10.067  -2.370  -0.189  1.00 0.00 ? 86  VAL A HG11 1  
ATOM 1241  H HG12 . VAL A 1 86  ? 8.548   -1.990  -1.003  1.00 0.00 ? 86  VAL A HG12 1  
ATOM 1242  H HG13 . VAL A 1 86  ? 9.761   -2.983  -1.814  1.00 0.00 ? 86  VAL A HG13 1  
ATOM 1243  H HG21 . VAL A 1 86  ? 8.516   -0.880  -3.000  1.00 0.00 ? 86  VAL A HG21 1  
ATOM 1244  H HG22 . VAL A 1 86  ? 9.476   0.598   -3.058  1.00 0.00 ? 86  VAL A HG22 1  
ATOM 1245  H HG23 . VAL A 1 86  ? 10.053  -0.861  -3.864  1.00 0.00 ? 86  VAL A HG23 1  
ATOM 1246  N N    . GLN A 1 87  ? 12.091  -0.562  0.616   1.00 0.00 ? 87  GLN A N    1  
ATOM 1247  C CA   . GLN A 1 87  ? 12.758  -1.058  1.814   1.00 0.00 ? 87  GLN A CA   1  
ATOM 1248  C C    . GLN A 1 87  ? 12.543  -0.110  2.989   1.00 0.00 ? 87  GLN A C    1  
ATOM 1249  O O    . GLN A 1 87  ? 12.565  -0.525  4.148   1.00 0.00 ? 87  GLN A O    1  
ATOM 1250  C CB   . GLN A 1 87  ? 14.255  -1.236  1.554   1.00 0.00 ? 87  GLN A CB   1  
ATOM 1251  C CG   . GLN A 1 87  ? 14.569  -2.301  0.515   1.00 0.00 ? 87  GLN A CG   1  
ATOM 1252  C CD   . GLN A 1 87  ? 13.941  -3.641  0.845   1.00 0.00 ? 87  GLN A CD   1  
ATOM 1253  O OE1  . GLN A 1 87  ? 14.456  -4.395  1.670   1.00 0.00 ? 87  GLN A OE1  1  
ATOM 1254  N NE2  . GLN A 1 87  ? 12.820  -3.944  0.199   1.00 0.00 ? 87  GLN A NE2  1  
ATOM 1255  H H    . GLN A 1 87  ? 12.610  -0.448  -0.207  1.00 0.00 ? 87  GLN A H    1  
ATOM 1256  H HA   . GLN A 1 87  ? 12.328  -2.017  2.059   1.00 0.00 ? 87  GLN A HA   1  
ATOM 1257  H HB2  . GLN A 1 87  ? 14.663  -0.297  1.210   1.00 0.00 ? 87  GLN A HB2  1  
ATOM 1258  H HB3  . GLN A 1 87  ? 14.738  -1.513  2.479   1.00 0.00 ? 87  GLN A HB3  1  
ATOM 1259  H HG2  . GLN A 1 87  ? 14.197  -1.972  -0.443  1.00 0.00 ? 87  GLN A HG2  1  
ATOM 1260  H HG3  . GLN A 1 87  ? 15.641  -2.426  0.460   1.00 0.00 ? 87  GLN A HG3  1  
ATOM 1261  H HE21 . GLN A 1 87  ? 12.468  -3.295  -0.446  1.00 0.00 ? 87  GLN A HE21 1  
ATOM 1262  H HE22 . GLN A 1 87  ? 12.393  -4.803  0.392   1.00 0.00 ? 87  GLN A HE22 1  
ATOM 1263  N N    . LEU A 1 88  ? 12.337  1.166   2.682   1.00 0.00 ? 88  LEU A N    1  
ATOM 1264  C CA   . LEU A 1 88  ? 12.118  2.175   3.713   1.00 0.00 ? 88  LEU A CA   1  
ATOM 1265  C C    . LEU A 1 88  ? 10.758  1.990   4.377   1.00 0.00 ? 88  LEU A C    1  
ATOM 1266  O O    . LEU A 1 88  ? 10.577  2.319   5.550   1.00 0.00 ? 88  LEU A O    1  
ATOM 1267  C CB   . LEU A 1 88  ? 12.218  3.578   3.111   1.00 0.00 ? 88  LEU A CB   1  
ATOM 1268  C CG   . LEU A 1 88  ? 12.719  4.677   4.049   1.00 0.00 ? 88  LEU A CG   1  
ATOM 1269  C CD1  . LEU A 1 88  ? 12.857  5.994   3.301   1.00 0.00 ? 88  LEU A CD1  1  
ATOM 1270  C CD2  . LEU A 1 88  ? 11.781  4.832   5.237   1.00 0.00 ? 88  LEU A CD2  1  
ATOM 1271  H H    . LEU A 1 88  ? 12.331  1.438   1.741   1.00 0.00 ? 88  LEU A H    1  
ATOM 1272  H HA   . LEU A 1 88  ? 12.889  2.058   4.460   1.00 0.00 ? 88  LEU A HA   1  
ATOM 1273  H HB2  . LEU A 1 88  ? 12.891  3.529   2.269   1.00 0.00 ? 88  LEU A HB2  1  
ATOM 1274  H HB3  . LEU A 1 88  ? 11.233  3.859   2.766   1.00 0.00 ? 88  LEU A HB3  1  
ATOM 1275  H HG   . LEU A 1 88  ? 13.695  4.403   4.425   1.00 0.00 ? 88  LEU A HG   1  
ATOM 1276  H HD11 . LEU A 1 88  ? 13.727  6.523   3.661   1.00 0.00 ? 88  LEU A HD11 1  
ATOM 1277  H HD12 . LEU A 1 88  ? 11.976  6.596   3.467   1.00 0.00 ? 88  LEU A HD12 1  
ATOM 1278  H HD13 . LEU A 1 88  ? 12.966  5.799   2.245   1.00 0.00 ? 88  LEU A HD13 1  
ATOM 1279  H HD21 . LEU A 1 88  ? 11.976  5.774   5.729   1.00 0.00 ? 88  LEU A HD21 1  
ATOM 1280  H HD22 . LEU A 1 88  ? 11.945  4.022   5.933   1.00 0.00 ? 88  LEU A HD22 1  
ATOM 1281  H HD23 . LEU A 1 88  ? 10.758  4.810   4.894   1.00 0.00 ? 88  LEU A HD23 1  
ATOM 1282  N N    . LEU A 1 89  ? 9.804   1.459   3.620   1.00 0.00 ? 89  LEU A N    1  
ATOM 1283  C CA   . LEU A 1 89  ? 8.459   1.227   4.136   1.00 0.00 ? 89  LEU A CA   1  
ATOM 1284  C C    . LEU A 1 89  ? 8.416   -0.030  4.999   1.00 0.00 ? 89  LEU A C    1  
ATOM 1285  O O    . LEU A 1 89  ? 7.626   -0.123  5.938   1.00 0.00 ? 89  LEU A O    1  
ATOM 1286  C CB   . LEU A 1 89  ? 7.464   1.100   2.981   1.00 0.00 ? 89  LEU A CB   1  
ATOM 1287  C CG   . LEU A 1 89  ? 7.232   -0.313  2.446   1.00 0.00 ? 89  LEU A CG   1  
ATOM 1288  C CD1  . LEU A 1 89  ? 6.168   -1.027  3.265   1.00 0.00 ? 89  LEU A CD1  1  
ATOM 1289  C CD2  . LEU A 1 89  ? 6.837   -0.270  0.977   1.00 0.00 ? 89  LEU A CD2  1  
ATOM 1290  H H    . LEU A 1 89  ? 10.007  1.217   2.693   1.00 0.00 ? 89  LEU A H    1  
ATOM 1291  H HA   . LEU A 1 89  ? 8.186   2.076   4.744   1.00 0.00 ? 89  LEU A HA   1  
ATOM 1292  H HB2  . LEU A 1 89  ? 6.514   1.485   3.319   1.00 0.00 ? 89  LEU A HB2  1  
ATOM 1293  H HB3  . LEU A 1 89  ? 7.826   1.709   2.165   1.00 0.00 ? 89  LEU A HB3  1  
ATOM 1294  H HG   . LEU A 1 89  ? 8.151   -0.878  2.529   1.00 0.00 ? 89  LEU A HG   1  
ATOM 1295  H HD11 . LEU A 1 89  ? 5.258   -1.099  2.689   1.00 0.00 ? 89  LEU A HD11 1  
ATOM 1296  H HD12 . LEU A 1 89  ? 5.977   -0.470  4.170   1.00 0.00 ? 89  LEU A HD12 1  
ATOM 1297  H HD13 . LEU A 1 89  ? 6.514   -2.018  3.519   1.00 0.00 ? 89  LEU A HD13 1  
ATOM 1298  H HD21 . LEU A 1 89  ? 6.017   -0.951  0.805   1.00 0.00 ? 89  LEU A HD21 1  
ATOM 1299  H HD22 . LEU A 1 89  ? 7.680   -0.561  0.368   1.00 0.00 ? 89  LEU A HD22 1  
ATOM 1300  H HD23 . LEU A 1 89  ? 6.533   0.733   0.716   1.00 0.00 ? 89  LEU A HD23 1  
ATOM 1301  N N    . ARG A 1 90  ? 9.272   -0.994  4.675   1.00 0.00 ? 90  ARG A N    1  
ATOM 1302  C CA   . ARG A 1 90  ? 9.332   -2.245  5.421   1.00 0.00 ? 90  ARG A CA   1  
ATOM 1303  C C    . ARG A 1 90  ? 10.385  -2.170  6.522   1.00 0.00 ? 90  ARG A C    1  
ATOM 1304  O O    . ARG A 1 90  ? 10.576  -3.123  7.279   1.00 0.00 ? 90  ARG A O    1  
ATOM 1305  C CB   . ARG A 1 90  ? 9.644   -3.410  4.480   1.00 0.00 ? 90  ARG A CB   1  
ATOM 1306  C CG   . ARG A 1 90  ? 10.776  -3.122  3.508   1.00 0.00 ? 90  ARG A CG   1  
ATOM 1307  C CD   . ARG A 1 90  ? 11.155  -4.360  2.711   1.00 0.00 ? 90  ARG A CD   1  
ATOM 1308  N NE   . ARG A 1 90  ? 10.255  -4.581  1.582   1.00 0.00 ? 90  ARG A NE   1  
ATOM 1309  C CZ   . ARG A 1 90  ? 10.292  -5.664  0.814   1.00 0.00 ? 90  ARG A CZ   1  
ATOM 1310  N NH1  . ARG A 1 90  ? 11.178  -6.621  1.053   1.00 0.00 ? 90  ARG A NH1  1  
ATOM 1311  N NH2  . ARG A 1 90  ? 9.440   -5.792  -0.195  1.00 0.00 ? 90  ARG A NH2  1  
ATOM 1312  H H    . ARG A 1 90  ? 9.876   -0.861  3.915   1.00 0.00 ? 90  ARG A H    1  
ATOM 1313  H HA   . ARG A 1 90  ? 8.366   -2.408  5.874   1.00 0.00 ? 90  ARG A HA   1  
ATOM 1314  H HB2  . ARG A 1 90  ? 9.917   -4.272  5.072   1.00 0.00 ? 90  ARG A HB2  1  
ATOM 1315  H HB3  . ARG A 1 90  ? 8.758   -3.642  3.909   1.00 0.00 ? 90  ARG A HB3  1  
ATOM 1316  H HG2  . ARG A 1 90  ? 10.461  -2.349  2.823   1.00 0.00 ? 90  ARG A HG2  1  
ATOM 1317  H HG3  . ARG A 1 90  ? 11.638  -2.784  4.064   1.00 0.00 ? 90  ARG A HG3  1  
ATOM 1318  H HD2  . ARG A 1 90  ? 12.161  -4.239  2.339   1.00 0.00 ? 90  ARG A HD2  1  
ATOM 1319  H HD3  . ARG A 1 90  ? 11.114  -5.219  3.365   1.00 0.00 ? 90  ARG A HD3  1  
ATOM 1320  H HE   . ARG A 1 90  ? 9.592   -3.886  1.387   1.00 0.00 ? 90  ARG A HE   1  
ATOM 1321  H HH11 . ARG A 1 90  ? 11.820  -6.527  1.814   1.00 0.00 ? 90  ARG A HH11 1  
ATOM 1322  H HH12 . ARG A 1 90  ? 11.202  -7.436  0.474   1.00 0.00 ? 90  ARG A HH12 1  
ATOM 1323  H HH21 . ARG A 1 90  ? 8.770   -5.073  -0.379  1.00 0.00 ? 90  ARG A HH21 1  
ATOM 1324  H HH22 . ARG A 1 90  ? 9.468   -6.608  -0.773  1.00 0.00 ? 90  ARG A HH22 1  
ATOM 1325  N N    . SER A 1 91  ? 11.068  -1.032  6.606   1.00 0.00 ? 91  SER A N    1  
ATOM 1326  C CA   . SER A 1 91  ? 12.105  -0.835  7.612   1.00 0.00 ? 91  SER A CA   1  
ATOM 1327  C C    . SER A 1 91  ? 11.520  -0.229  8.884   1.00 0.00 ? 91  SER A C    1  
ATOM 1328  O O    . SER A 1 91  ? 12.199  0.501   9.607   1.00 0.00 ? 91  SER A O    1  
ATOM 1329  C CB   . SER A 1 91  ? 13.210  0.070   7.064   1.00 0.00 ? 91  SER A CB   1  
ATOM 1330  O OG   . SER A 1 91  ? 14.320  0.110   7.945   1.00 0.00 ? 91  SER A OG   1  
ATOM 1331  H H    . SER A 1 91  ? 10.870  -0.309  5.974   1.00 0.00 ? 91  SER A H    1  
ATOM 1332  H HA   . SER A 1 91  ? 12.526  -1.801  7.848   1.00 0.00 ? 91  SER A HA   1  
ATOM 1333  H HB2  . SER A 1 91  ? 13.539  -0.307  6.107   1.00 0.00 ? 91  SER A HB2  1  
ATOM 1334  H HB3  . SER A 1 91  ? 12.825  1.072   6.943   1.00 0.00 ? 91  SER A HB3  1  
ATOM 1335  H HG   . SER A 1 91  ? 14.365  -0.711  8.441   1.00 0.00 ? 91  SER A HG   1  
ATOM 1336  N N    . VAL A 1 92  ? 10.255  -0.537  9.151   1.00 0.00 ? 92  VAL A N    1  
ATOM 1337  C CA   . VAL A 1 92  ? 9.577   -0.025  10.336  1.00 0.00 ? 92  VAL A CA   1  
ATOM 1338  C C    . VAL A 1 92  ? 9.277   -1.145  11.325  1.00 0.00 ? 92  VAL A C    1  
ATOM 1339  O O    . VAL A 1 92  ? 8.975   -2.271  10.931  1.00 0.00 ? 92  VAL A O    1  
ATOM 1340  C CB   . VAL A 1 92  ? 8.261   0.686   9.966   1.00 0.00 ? 92  VAL A CB   1  
ATOM 1341  C CG1  . VAL A 1 92  ? 7.427   -0.184  9.039   1.00 0.00 ? 92  VAL A CG1  1  
ATOM 1342  C CG2  . VAL A 1 92  ? 7.479   1.044   11.221  1.00 0.00 ? 92  VAL A CG2  1  
ATOM 1343  H H    . VAL A 1 92  ? 9.766   -1.124  8.537   1.00 0.00 ? 92  VAL A H    1  
ATOM 1344  H HA   . VAL A 1 92  ? 10.230  0.695   10.809  1.00 0.00 ? 92  VAL A HA   1  
ATOM 1345  H HB   . VAL A 1 92  ? 8.503   1.600   9.445   1.00 0.00 ? 92  VAL A HB   1  
ATOM 1346  H HG11 . VAL A 1 92  ? 7.250   -1.142  9.506   1.00 0.00 ? 92  VAL A HG11 1  
ATOM 1347  H HG12 . VAL A 1 92  ? 6.483   0.302   8.841   1.00 0.00 ? 92  VAL A HG12 1  
ATOM 1348  H HG13 . VAL A 1 92  ? 7.958   -0.331  8.110   1.00 0.00 ? 92  VAL A HG13 1  
ATOM 1349  H HG21 . VAL A 1 92  ? 6.669   0.343   11.352  1.00 0.00 ? 92  VAL A HG21 1  
ATOM 1350  H HG22 . VAL A 1 92  ? 8.135   1.000   12.079  1.00 0.00 ? 92  VAL A HG22 1  
ATOM 1351  H HG23 . VAL A 1 92  ? 7.080   2.043   11.124  1.00 0.00 ? 92  VAL A HG23 1  
ATOM 1352  N N    . GLY A 1 93  ? 9.361   -0.828  12.614  1.00 0.00 ? 93  GLY A N    1  
ATOM 1353  C CA   . GLY A 1 93  ? 9.095   -1.819  13.640  1.00 0.00 ? 93  GLY A CA   1  
ATOM 1354  C C    . GLY A 1 93  ? 7.676   -2.349  13.580  1.00 0.00 ? 93  GLY A C    1  
ATOM 1355  O O    . GLY A 1 93  ? 7.387   -3.285  12.835  1.00 0.00 ? 93  GLY A O    1  
ATOM 1356  H H    . GLY A 1 93  ? 9.606   0.086   12.869  1.00 0.00 ? 93  GLY A H    1  
ATOM 1357  H HA2  . GLY A 1 93  ? 9.782   -2.643  13.516  1.00 0.00 ? 93  GLY A HA2  1  
ATOM 1358  H HA3  . GLY A 1 93  ? 9.258   -1.369  14.609  1.00 0.00 ? 93  GLY A HA3  1  
ATOM 1359  N N    . ASP A 1 94  ? 6.789   -1.751  14.369  1.00 0.00 ? 94  ASP A N    1  
ATOM 1360  C CA   . ASP A 1 94  ? 5.393   -2.169  14.403  1.00 0.00 ? 94  ASP A CA   1  
ATOM 1361  C C    . ASP A 1 94  ? 4.473   -1.025  13.989  1.00 0.00 ? 94  ASP A C    1  
ATOM 1362  O O    . ASP A 1 94  ? 3.271   -1.217  13.799  1.00 0.00 ? 94  ASP A O    1  
ATOM 1363  C CB   . ASP A 1 94  ? 5.019   -2.660  15.803  1.00 0.00 ? 94  ASP A CB   1  
ATOM 1364  C CG   . ASP A 1 94  ? 5.122   -1.565  16.846  1.00 0.00 ? 94  ASP A CG   1  
ATOM 1365  O OD1  . ASP A 1 94  ? 6.241   -1.056  17.064  1.00 0.00 ? 94  ASP A OD1  1  
ATOM 1366  O OD2  . ASP A 1 94  ? 4.083   -1.217  17.445  1.00 0.00 ? 94  ASP A OD2  1  
ATOM 1367  H H    . ASP A 1 94  ? 7.081   -1.010  14.940  1.00 0.00 ? 94  ASP A H    1  
ATOM 1368  H HA   . ASP A 1 94  ? 5.272   -2.982  13.703  1.00 0.00 ? 94  ASP A HA   1  
ATOM 1369  H HB2  . ASP A 1 94  ? 4.003   -3.025  15.790  1.00 0.00 ? 94  ASP A HB2  1  
ATOM 1370  H HB3  . ASP A 1 94  ? 5.683   -3.464  16.084  1.00 0.00 ? 94  ASP A HB3  1  
ATOM 1371  N N    . THR A 1 95  ? 5.044   0.167   13.852  1.00 0.00 ? 95  THR A N    1  
ATOM 1372  C CA   . THR A 1 95  ? 4.276   1.343   13.463  1.00 0.00 ? 95  THR A CA   1  
ATOM 1373  C C    . THR A 1 95  ? 5.155   2.363   12.748  1.00 0.00 ? 95  THR A C    1  
ATOM 1374  O O    . THR A 1 95  ? 6.267   2.657   13.189  1.00 0.00 ? 95  THR A O    1  
ATOM 1375  C CB   . THR A 1 95  ? 3.620   2.015   14.684  1.00 0.00 ? 95  THR A CB   1  
ATOM 1376  O OG1  . THR A 1 95  ? 2.966   1.030   15.493  1.00 0.00 ? 95  THR A OG1  1  
ATOM 1377  C CG2  . THR A 1 95  ? 2.614   3.068   14.247  1.00 0.00 ? 95  THR A CG2  1  
ATOM 1378  H H    . THR A 1 95  ? 6.006   0.257   14.017  1.00 0.00 ? 95  THR A H    1  
ATOM 1379  H HA   . THR A 1 95  ? 3.493   1.023   12.791  1.00 0.00 ? 95  THR A HA   1  
ATOM 1380  H HB   . THR A 1 95  ? 4.391   2.495   15.269  1.00 0.00 ? 95  THR A HB   1  
ATOM 1381  H HG1  . THR A 1 95  ? 3.156   1.199   16.419  1.00 0.00 ? 95  THR A HG1  1  
ATOM 1382  H HG21 . THR A 1 95  ? 1.980   2.662   13.473  1.00 0.00 ? 95  THR A HG21 1  
ATOM 1383  H HG22 . THR A 1 95  ? 3.139   3.931   13.866  1.00 0.00 ? 95  THR A HG22 1  
ATOM 1384  H HG23 . THR A 1 95  ? 2.008   3.360   15.092  1.00 0.00 ? 95  THR A HG23 1  
ATOM 1385  N N    . LEU A 1 96  ? 4.651   2.899   11.642  1.00 0.00 ? 96  LEU A N    1  
ATOM 1386  C CA   . LEU A 1 96  ? 5.391   3.888   10.865  1.00 0.00 ? 96  LEU A CA   1  
ATOM 1387  C C    . LEU A 1 96  ? 4.590   5.179   10.723  1.00 0.00 ? 96  LEU A C    1  
ATOM 1388  O O    . LEU A 1 96  ? 3.418   5.240   11.095  1.00 0.00 ? 96  LEU A O    1  
ATOM 1389  C CB   . LEU A 1 96  ? 5.730   3.329   9.482   1.00 0.00 ? 96  LEU A CB   1  
ATOM 1390  C CG   . LEU A 1 96  ? 4.708   3.603   8.379   1.00 0.00 ? 96  LEU A CG   1  
ATOM 1391  C CD1  . LEU A 1 96  ? 5.281   3.240   7.018   1.00 0.00 ? 96  LEU A CD1  1  
ATOM 1392  C CD2  . LEU A 1 96  ? 3.422   2.832   8.640   1.00 0.00 ? 96  LEU A CD2  1  
ATOM 1393  H H    . LEU A 1 96  ? 3.760   2.625   11.340  1.00 0.00 ? 96  LEU A H    1  
ATOM 1394  H HA   . LEU A 1 96  ? 6.308   4.104   11.392  1.00 0.00 ? 96  LEU A HA   1  
ATOM 1395  H HB2  . LEU A 1 96  ? 6.671   3.758   9.174   1.00 0.00 ? 96  LEU A HB2  1  
ATOM 1396  H HB3  . LEU A 1 96  ? 5.838   2.258   9.577   1.00 0.00 ? 96  LEU A HB3  1  
ATOM 1397  H HG   . LEU A 1 96  ? 4.470   4.658   8.370   1.00 0.00 ? 96  LEU A HG   1  
ATOM 1398  H HD11 . LEU A 1 96  ? 5.629   2.219   7.034   1.00 0.00 ? 96  LEU A HD11 1  
ATOM 1399  H HD12 . LEU A 1 96  ? 6.107   3.898   6.789   1.00 0.00 ? 96  LEU A HD12 1  
ATOM 1400  H HD13 . LEU A 1 96  ? 4.515   3.349   6.264   1.00 0.00 ? 96  LEU A HD13 1  
ATOM 1401  H HD21 . LEU A 1 96  ? 2.667   3.508   9.013   1.00 0.00 ? 96  LEU A HD21 1  
ATOM 1402  H HD22 . LEU A 1 96  ? 3.608   2.060   9.372   1.00 0.00 ? 96  LEU A HD22 1  
ATOM 1403  H HD23 . LEU A 1 96  ? 3.079   2.381   7.720   1.00 0.00 ? 96  LEU A HD23 1  
ATOM 1404  N N    . THR A 1 97  ? 5.230   6.209   10.179  1.00 0.00 ? 97  THR A N    1  
ATOM 1405  C CA   . THR A 1 97  ? 4.578   7.498   9.985   1.00 0.00 ? 97  THR A CA   1  
ATOM 1406  C C    . THR A 1 97  ? 4.573   7.896   8.514   1.00 0.00 ? 97  THR A C    1  
ATOM 1407  O O    . THR A 1 97  ? 5.565   8.411   7.996   1.00 0.00 ? 97  THR A O    1  
ATOM 1408  C CB   . THR A 1 97  ? 5.269   8.606   10.803  1.00 0.00 ? 97  THR A CB   1  
ATOM 1409  O OG1  . THR A 1 97  ? 5.675   8.093   12.077  1.00 0.00 ? 97  THR A OG1  1  
ATOM 1410  C CG2  . THR A 1 97  ? 4.339   9.793   11.001  1.00 0.00 ? 97  THR A CG2  1  
ATOM 1411  H H    . THR A 1 97  ? 6.164   6.098   9.902   1.00 0.00 ? 97  THR A H    1  
ATOM 1412  H HA   . THR A 1 97  ? 3.557   7.410   10.328  1.00 0.00 ? 97  THR A HA   1  
ATOM 1413  H HB   . THR A 1 97  ? 6.144   8.939   10.262  1.00 0.00 ? 97  THR A HB   1  
ATOM 1414  H HG1  . THR A 1 97  ? 5.778   8.820   12.696  1.00 0.00 ? 97  THR A HG1  1  
ATOM 1415  H HG21 . THR A 1 97  ? 4.423   10.461  10.157  1.00 0.00 ? 97  THR A HG21 1  
ATOM 1416  H HG22 . THR A 1 97  ? 4.612   10.317  11.904  1.00 0.00 ? 97  THR A HG22 1  
ATOM 1417  H HG23 . THR A 1 97  ? 3.321   9.442   11.082  1.00 0.00 ? 97  THR A HG23 1  
ATOM 1418  N N    . VAL A 1 98  ? 3.450   7.656   7.844   1.00 0.00 ? 98  VAL A N    1  
ATOM 1419  C CA   . VAL A 1 98  ? 3.316   7.992   6.432   1.00 0.00 ? 98  VAL A CA   1  
ATOM 1420  C C    . VAL A 1 98  ? 2.655   9.354   6.251   1.00 0.00 ? 98  VAL A C    1  
ATOM 1421  O O    . VAL A 1 98  ? 1.625   9.643   6.863   1.00 0.00 ? 98  VAL A O    1  
ATOM 1422  C CB   . VAL A 1 98  ? 2.492   6.930   5.679   1.00 0.00 ? 98  VAL A CB   1  
ATOM 1423  C CG1  . VAL A 1 98  ? 2.947   5.530   6.062   1.00 0.00 ? 98  VAL A CG1  1  
ATOM 1424  C CG2  . VAL A 1 98  ? 1.008   7.112   5.957   1.00 0.00 ? 98  VAL A CG2  1  
ATOM 1425  H H    . VAL A 1 98  ? 2.694   7.244   8.312   1.00 0.00 ? 98  VAL A H    1  
ATOM 1426  H HA   . VAL A 1 98  ? 4.305   8.022   6.000   1.00 0.00 ? 98  VAL A HA   1  
ATOM 1427  H HB   . VAL A 1 98  ? 2.657   7.061   4.619   1.00 0.00 ? 98  VAL A HB   1  
ATOM 1428  H HG11 . VAL A 1 98  ? 3.930   5.581   6.507   1.00 0.00 ? 98  VAL A HG11 1  
ATOM 1429  H HG12 . VAL A 1 98  ? 2.250   5.107   6.771   1.00 0.00 ? 98  VAL A HG12 1  
ATOM 1430  H HG13 . VAL A 1 98  ? 2.984   4.910   5.179   1.00 0.00 ? 98  VAL A HG13 1  
ATOM 1431  H HG21 . VAL A 1 98  ? 0.600   7.839   5.270   1.00 0.00 ? 98  VAL A HG21 1  
ATOM 1432  H HG22 . VAL A 1 98  ? 0.498   6.169   5.826   1.00 0.00 ? 98  VAL A HG22 1  
ATOM 1433  H HG23 . VAL A 1 98  ? 0.870   7.458   6.971   1.00 0.00 ? 98  VAL A HG23 1  
ATOM 1434  N N    . LEU A 1 99  ? 3.253   10.188  5.408   1.00 0.00 ? 99  LEU A N    1  
ATOM 1435  C CA   . LEU A 1 99  ? 2.723   11.521  5.145   1.00 0.00 ? 99  LEU A CA   1  
ATOM 1436  C C    . LEU A 1 99  ? 1.966   11.555  3.822   1.00 0.00 ? 99  LEU A C    1  
ATOM 1437  O O    . LEU A 1 99  ? 1.937   12.578  3.137   1.00 0.00 ? 99  LEU A O    1  
ATOM 1438  C CB   . LEU A 1 99  ? 3.857   12.548  5.124   1.00 0.00 ? 99  LEU A CB   1  
ATOM 1439  C CG   . LEU A 1 99  ? 3.433   14.017  5.119   1.00 0.00 ? 99  LEU A CG   1  
ATOM 1440  C CD1  . LEU A 1 99  ? 2.536   14.317  6.310   1.00 0.00 ? 99  LEU A CD1  1  
ATOM 1441  C CD2  . LEU A 1 99  ? 4.655   14.924  5.127   1.00 0.00 ? 99  LEU A CD2  1  
ATOM 1442  H H    . LEU A 1 99  ? 4.071   9.901   4.951   1.00 0.00 ? 99  LEU A H    1  
ATOM 1443  H HA   . LEU A 1 99  ? 2.040   11.769  5.944   1.00 0.00 ? 99  LEU A HA   1  
ATOM 1444  H HB2  . LEU A 1 99  ? 4.469   12.383  5.998   1.00 0.00 ? 99  LEU A HB2  1  
ATOM 1445  H HB3  . LEU A 1 99  ? 4.447   12.369  4.236   1.00 0.00 ? 99  LEU A HB3  1  
ATOM 1446  H HG   . LEU A 1 99  ? 2.870   14.219  4.218   1.00 0.00 ? 99  LEU A HG   1  
ATOM 1447  H HD11 . LEU A 1 99  ? 1.506   14.333  5.989   1.00 0.00 ? 99  LEU A HD11 1  
ATOM 1448  H HD12 . LEU A 1 99  ? 2.799   15.279  6.724   1.00 0.00 ? 99  LEU A HD12 1  
ATOM 1449  H HD13 . LEU A 1 99  ? 2.669   13.553  7.062   1.00 0.00 ? 99  LEU A HD13 1  
ATOM 1450  H HD21 . LEU A 1 99  ? 5.523   14.361  4.818   1.00 0.00 ? 99  LEU A HD21 1  
ATOM 1451  H HD22 . LEU A 1 99  ? 4.811   15.309  6.124   1.00 0.00 ? 99  LEU A HD22 1  
ATOM 1452  H HD23 . LEU A 1 99  ? 4.496   15.746  4.444   1.00 0.00 ? 99  LEU A HD23 1  
ATOM 1453  N N    . VAL A 1 100 ? 1.351   10.431  3.468   1.00 0.00 ? 100 VAL A N    1  
ATOM 1454  C CA   . VAL A 1 100 ? 0.591   10.332  2.229   1.00 0.00 ? 100 VAL A CA   1  
ATOM 1455  C C    . VAL A 1 100 ? -0.638  11.235  2.264   1.00 0.00 ? 100 VAL A C    1  
ATOM 1456  O O    . VAL A 1 100 ? -0.930  11.863  3.283   1.00 0.00 ? 100 VAL A O    1  
ATOM 1457  C CB   . VAL A 1 100 ? 0.142   8.884   1.959   1.00 0.00 ? 100 VAL A CB   1  
ATOM 1458  C CG1  . VAL A 1 100 ? 1.310   7.923   2.127   1.00 0.00 ? 100 VAL A CG1  1  
ATOM 1459  C CG2  . VAL A 1 100 ? -1.009  8.503   2.877   1.00 0.00 ? 100 VAL A CG2  1  
ATOM 1460  H H    . VAL A 1 100 ? 1.411   9.649   4.056   1.00 0.00 ? 100 VAL A H    1  
ATOM 1461  H HA   . VAL A 1 100 ? 1.232   10.646  1.417   1.00 0.00 ? 100 VAL A HA   1  
ATOM 1462  H HB   . VAL A 1 100 ? -0.203  8.820   0.937   1.00 0.00 ? 100 VAL A HB   1  
ATOM 1463  H HG11 . VAL A 1 100 ? 2.238   8.475   2.088   1.00 0.00 ? 100 VAL A HG11 1  
ATOM 1464  H HG12 . VAL A 1 100 ? 1.228   7.420   3.080   1.00 0.00 ? 100 VAL A HG12 1  
ATOM 1465  H HG13 . VAL A 1 100 ? 1.292   7.193   1.331   1.00 0.00 ? 100 VAL A HG13 1  
ATOM 1466  H HG21 . VAL A 1 100 ? -0.753  8.751   3.896   1.00 0.00 ? 100 VAL A HG21 1  
ATOM 1467  H HG22 . VAL A 1 100 ? -1.897  9.047   2.587   1.00 0.00 ? 100 VAL A HG22 1  
ATOM 1468  H HG23 . VAL A 1 100 ? -1.196  7.443   2.800   1.00 0.00 ? 100 VAL A HG23 1  
ATOM 1469  N N    . CYS A 1 101 ? -1.354  11.294  1.147   1.00 0.00 ? 101 CYS A N    1  
ATOM 1470  C CA   . CYS A 1 101 ? -2.552  12.121  1.050   1.00 0.00 ? 101 CYS A CA   1  
ATOM 1471  C C    . CYS A 1 101 ? -3.377  11.740  -0.175  1.00 0.00 ? 101 CYS A C    1  
ATOM 1472  O O    . CYS A 1 101 ? -2.846  11.219  -1.156  1.00 0.00 ? 101 CYS A O    1  
ATOM 1473  C CB   . CYS A 1 101 ? -2.172  13.601  0.984   1.00 0.00 ? 101 CYS A CB   1  
ATOM 1474  S SG   . CYS A 1 101 ? -1.846  14.205  -0.689  1.00 0.00 ? 101 CYS A SG   1  
ATOM 1475  H H    . CYS A 1 101 ? -1.070  10.771  0.369   1.00 0.00 ? 101 CYS A H    1  
ATOM 1476  H HA   . CYS A 1 101 ? -3.144  11.949  1.936   1.00 0.00 ? 101 CYS A HA   1  
ATOM 1477  H HB2  . CYS A 1 101 ? -2.978  14.190  1.394   1.00 0.00 ? 101 CYS A HB2  1  
ATOM 1478  H HB3  . CYS A 1 101 ? -1.281  13.762  1.573   1.00 0.00 ? 101 CYS A HB3  1  
ATOM 1479  H HG   . CYS A 1 101 ? -2.791  15.079  -0.999  1.00 0.00 ? 101 CYS A HG   1  
ATOM 1480  N N    . ASP A 1 102 ? -4.678  12.001  -0.110  1.00 0.00 ? 102 ASP A N    1  
ATOM 1481  C CA   . ASP A 1 102 ? -5.577  11.685  -1.213  1.00 0.00 ? 102 ASP A CA   1  
ATOM 1482  C C    . ASP A 1 102 ? -4.986  12.141  -2.544  1.00 0.00 ? 102 ASP A C    1  
ATOM 1483  O O    . ASP A 1 102 ? -5.025  13.323  -2.880  1.00 0.00 ? 102 ASP A O    1  
ATOM 1484  C CB   . ASP A 1 102 ? -6.940  12.346  -0.994  1.00 0.00 ? 102 ASP A CB   1  
ATOM 1485  C CG   . ASP A 1 102 ? -7.426  12.208  0.436   1.00 0.00 ? 102 ASP A CG   1  
ATOM 1486  O OD1  . ASP A 1 102 ? -7.276  11.109  1.010   1.00 0.00 ? 102 ASP A OD1  1  
ATOM 1487  O OD2  . ASP A 1 102 ? -7.957  13.199  0.980   1.00 0.00 ? 102 ASP A OD2  1  
ATOM 1488  H H    . ASP A 1 102 ? -5.042  12.418  0.700   1.00 0.00 ? 102 ASP A H    1  
ATOM 1489  H HA   . ASP A 1 102 ? -5.707  10.614  -1.239  1.00 0.00 ? 102 ASP A HA   1  
ATOM 1490  H HB2  . ASP A 1 102 ? -6.865  13.397  -1.229  1.00 0.00 ? 102 ASP A HB2  1  
ATOM 1491  H HB3  . ASP A 1 102 ? -7.665  11.885  -1.648  1.00 0.00 ? 102 ASP A HB3  1  
ATOM 1492  N N    . GLY A 1 103 ? -4.438  11.192  -3.297  1.00 0.00 ? 103 GLY A N    1  
ATOM 1493  C CA   . GLY A 1 103 ? -3.845  11.516  -4.582  1.00 0.00 ? 103 GLY A CA   1  
ATOM 1494  C C    . GLY A 1 103 ? -4.797  11.277  -5.736  1.00 0.00 ? 103 GLY A C    1  
ATOM 1495  O O    . GLY A 1 103 ? -5.008  12.159  -6.569  1.00 0.00 ? 103 GLY A O    1  
ATOM 1496  H H    . GLY A 1 103 ? -4.435  10.265  -2.978  1.00 0.00 ? 103 GLY A H    1  
ATOM 1497  H HA2  . GLY A 1 103 ? -3.552  12.555  -4.579  1.00 0.00 ? 103 GLY A HA2  1  
ATOM 1498  H HA3  . GLY A 1 103 ? -2.965  10.905  -4.723  1.00 0.00 ? 103 GLY A HA3  1  
ATOM 1499  N N    . PHE A 1 104 ? -5.373  10.080  -5.789  1.00 0.00 ? 104 PHE A N    1  
ATOM 1500  C CA   . PHE A 1 104 ? -6.306  9.727   -6.852  1.00 0.00 ? 104 PHE A CA   1  
ATOM 1501  C C    . PHE A 1 104 ? -7.033  8.425   -6.527  1.00 0.00 ? 104 PHE A C    1  
ATOM 1502  O O    . PHE A 1 104 ? -6.405  7.386   -6.326  1.00 0.00 ? 104 PHE A O    1  
ATOM 1503  C CB   . PHE A 1 104 ? -5.567  9.593   -8.185  1.00 0.00 ? 104 PHE A CB   1  
ATOM 1504  C CG   . PHE A 1 104 ? -4.227  8.925   -8.063  1.00 0.00 ? 104 PHE A CG   1  
ATOM 1505  C CD1  . PHE A 1 104 ? -3.086  9.672   -7.817  1.00 0.00 ? 104 PHE A CD1  1  
ATOM 1506  C CD2  . PHE A 1 104 ? -4.109  7.551   -8.193  1.00 0.00 ? 104 PHE A CD2  1  
ATOM 1507  C CE1  . PHE A 1 104 ? -1.852  9.060   -7.705  1.00 0.00 ? 104 PHE A CE1  1  
ATOM 1508  C CE2  . PHE A 1 104 ? -2.877  6.934   -8.082  1.00 0.00 ? 104 PHE A CE2  1  
ATOM 1509  C CZ   . PHE A 1 104 ? -1.748  7.689   -7.836  1.00 0.00 ? 104 PHE A CZ   1  
ATOM 1510  H H    . PHE A 1 104 ? -5.165  9.419   -5.095  1.00 0.00 ? 104 PHE A H    1  
ATOM 1511  H HA   . PHE A 1 104 ? -7.033  10.520  -6.931  1.00 0.00 ? 104 PHE A HA   1  
ATOM 1512  H HB2  . PHE A 1 104 ? -6.168  9.008   -8.864  1.00 0.00 ? 104 PHE A HB2  1  
ATOM 1513  H HB3  . PHE A 1 104 ? -5.413  10.576  -8.603  1.00 0.00 ? 104 PHE A HB3  1  
ATOM 1514  H HD1  . PHE A 1 104 ? -3.167  10.744  -7.712  1.00 0.00 ? 104 PHE A HD1  1  
ATOM 1515  H HD2  . PHE A 1 104 ? -4.992  6.959   -8.385  1.00 0.00 ? 104 PHE A HD2  1  
ATOM 1516  H HE1  . PHE A 1 104 ? -0.970  9.653   -7.512  1.00 0.00 ? 104 PHE A HE1  1  
ATOM 1517  H HE2  . PHE A 1 104 ? -2.799  5.862   -8.185  1.00 0.00 ? 104 PHE A HE2  1  
ATOM 1518  H HZ   . PHE A 1 104 ? -0.784  7.209   -7.750  1.00 0.00 ? 104 PHE A HZ   1  
ATOM 1519  N N    . GLU A 1 105 ? -8.360  8.491   -6.478  1.00 0.00 ? 105 GLU A N    1  
ATOM 1520  C CA   . GLU A 1 105 ? -9.171  7.317   -6.177  1.00 0.00 ? 105 GLU A CA   1  
ATOM 1521  C C    . GLU A 1 105 ? -9.129  6.316   -7.328  1.00 0.00 ? 105 GLU A C    1  
ATOM 1522  O O    . GLU A 1 105 ? -9.274  6.687   -8.492  1.00 0.00 ? 105 GLU A O    1  
ATOM 1523  C CB   . GLU A 1 105 ? -10.618 7.729   -5.897  1.00 0.00 ? 105 GLU A CB   1  
ATOM 1524  C CG   . GLU A 1 105 ? -10.810 8.401   -4.548  1.00 0.00 ? 105 GLU A CG   1  
ATOM 1525  C CD   . GLU A 1 105 ? -10.282 7.565   -3.399  1.00 0.00 ? 105 GLU A CD   1  
ATOM 1526  O OE1  . GLU A 1 105 ? -10.208 6.327   -3.550  1.00 0.00 ? 105 GLU A OE1  1  
ATOM 1527  O OE2  . GLU A 1 105 ? -9.943  8.148   -2.348  1.00 0.00 ? 105 GLU A OE2  1  
ATOM 1528  H H    . GLU A 1 105 ? -8.803  9.348   -6.648  1.00 0.00 ? 105 GLU A H    1  
ATOM 1529  H HA   . GLU A 1 105 ? -8.763  6.850   -5.294  1.00 0.00 ? 105 GLU A HA   1  
ATOM 1530  H HB2  . GLU A 1 105 ? -10.940 8.414   -6.667  1.00 0.00 ? 105 GLU A HB2  1  
ATOM 1531  H HB3  . GLU A 1 105 ? -11.242 6.848   -5.928  1.00 0.00 ? 105 GLU A HB3  1  
ATOM 1532  H HG2  . GLU A 1 105 ? -10.288 9.347   -4.554  1.00 0.00 ? 105 GLU A HG2  1  
ATOM 1533  H HG3  . GLU A 1 105 ? -11.865 8.575   -4.393  1.00 0.00 ? 105 GLU A HG3  1  
ATOM 1534  N N    . SER A 1 106 ? -8.929  5.046   -6.992  1.00 0.00 ? 106 SER A N    1  
ATOM 1535  C CA   . SER A 1 106 ? -8.864  3.991   -7.996  1.00 0.00 ? 106 SER A CA   1  
ATOM 1536  C C    . SER A 1 106 ? -10.184 3.231   -8.074  1.00 0.00 ? 106 SER A C    1  
ATOM 1537  O O    . SER A 1 106 ? -10.203 2.008   -8.204  1.00 0.00 ? 106 SER A O    1  
ATOM 1538  C CB   . SER A 1 106 ? -7.723  3.023   -7.676  1.00 0.00 ? 106 SER A CB   1  
ATOM 1539  O OG   . SER A 1 106 ? -7.890  2.445   -6.393  1.00 0.00 ? 106 SER A OG   1  
ATOM 1540  H H    . SER A 1 106 ? -8.821  4.813   -6.046  1.00 0.00 ? 106 SER A H    1  
ATOM 1541  H HA   . SER A 1 106 ? -8.672  4.455   -8.952  1.00 0.00 ? 106 SER A HA   1  
ATOM 1542  H HB2  . SER A 1 106 ? -7.705  2.234   -8.413  1.00 0.00 ? 106 SER A HB2  1  
ATOM 1543  H HB3  . SER A 1 106 ? -6.784  3.557   -7.698  1.00 0.00 ? 106 SER A HB3  1  
ATOM 1544  H HG   . SER A 1 106 ? -7.650  3.085   -5.719  1.00 0.00 ? 106 SER A HG   1  
ATOM 1545  N N    . GLY A 1 107 ? -11.289 3.966   -7.991  1.00 0.00 ? 107 GLY A N    1  
ATOM 1546  C CA   . GLY A 1 107 ? -12.599 3.346   -8.053  1.00 0.00 ? 107 GLY A CA   1  
ATOM 1547  C C    . GLY A 1 107 ? -13.022 2.749   -6.726  1.00 0.00 ? 107 GLY A C    1  
ATOM 1548  O O    . GLY A 1 107 ? -12.324 2.867   -5.718  1.00 0.00 ? 107 GLY A O    1  
ATOM 1549  H H    . GLY A 1 107 ? -11.213 4.938   -7.888  1.00 0.00 ? 107 GLY A H    1  
ATOM 1550  H HA2  . GLY A 1 107 ? -13.324 4.090   -8.349  1.00 0.00 ? 107 GLY A HA2  1  
ATOM 1551  H HA3  . GLY A 1 107 ? -12.579 2.563   -8.797  1.00 0.00 ? 107 GLY A HA3  1  
ATOM 1552  N N    . PRO A 1 108 ? -14.191 2.092   -6.713  1.00 0.00 ? 108 PRO A N    1  
ATOM 1553  C CA   . PRO A 1 108 ? -14.732 1.462   -5.505  1.00 0.00 ? 108 PRO A CA   1  
ATOM 1554  C C    . PRO A 1 108 ? -13.928 0.239   -5.079  1.00 0.00 ? 108 PRO A C    1  
ATOM 1555  O O    . PRO A 1 108 ? -13.253 -0.387  -5.896  1.00 0.00 ? 108 PRO A O    1  
ATOM 1556  C CB   . PRO A 1 108 ? -16.147 1.053   -5.922  1.00 0.00 ? 108 PRO A CB   1  
ATOM 1557  C CG   . PRO A 1 108 ? -16.076 0.897   -7.401  1.00 0.00 ? 108 PRO A CG   1  
ATOM 1558  C CD   . PRO A 1 108 ? -15.074 1.912   -7.877  1.00 0.00 ? 108 PRO A CD   1  
ATOM 1559  H HA   . PRO A 1 108 ? -14.785 2.161   -4.683  1.00 0.00 ? 108 PRO A HA   1  
ATOM 1560  H HB2  . PRO A 1 108 ? -16.413 0.124   -5.438  1.00 0.00 ? 108 PRO A HB2  1  
ATOM 1561  H HB3  . PRO A 1 108 ? -16.847 1.826   -5.640  1.00 0.00 ? 108 PRO A HB3  1  
ATOM 1562  H HG2  . PRO A 1 108 ? -15.747 -0.100  -7.650  1.00 0.00 ? 108 PRO A HG2  1  
ATOM 1563  H HG3  . PRO A 1 108 ? -17.044 1.094   -7.838  1.00 0.00 ? 108 PRO A HG3  1  
ATOM 1564  H HD2  . PRO A 1 108 ? -14.524 1.531   -8.724  1.00 0.00 ? 108 PRO A HD2  1  
ATOM 1565  H HD3  . PRO A 1 108 ? -15.568 2.839   -8.132  1.00 0.00 ? 108 PRO A HD3  1  
ATOM 1566  N N    . SER A 1 109 ? -14.005 -0.097  -3.795  1.00 0.00 ? 109 SER A N    1  
ATOM 1567  C CA   . SER A 1 109 ? -13.282 -1.245  -3.260  1.00 0.00 ? 109 SER A CA   1  
ATOM 1568  C C    . SER A 1 109 ? -14.208 -2.137  -2.440  1.00 0.00 ? 109 SER A C    1  
ATOM 1569  O O    . SER A 1 109 ? -15.345 -1.767  -2.147  1.00 0.00 ? 109 SER A O    1  
ATOM 1570  C CB   . SER A 1 109 ? -12.109 -0.777  -2.397  1.00 0.00 ? 109 SER A CB   1  
ATOM 1571  O OG   . SER A 1 109 ? -11.309 -1.872  -1.986  1.00 0.00 ? 109 SER A OG   1  
ATOM 1572  H H    . SER A 1 109 ? -14.561 0.441   -3.193  1.00 0.00 ? 109 SER A H    1  
ATOM 1573  H HA   . SER A 1 109 ? -12.899 -1.813  -4.095  1.00 0.00 ? 109 SER A HA   1  
ATOM 1574  H HB2  . SER A 1 109 ? -11.497 -0.093  -2.965  1.00 0.00 ? 109 SER A HB2  1  
ATOM 1575  H HB3  . SER A 1 109 ? -12.490 -0.276  -1.518  1.00 0.00 ? 109 SER A HB3  1  
ATOM 1576  H HG   . SER A 1 109 ? -10.667 -1.575  -1.337  1.00 0.00 ? 109 SER A HG   1  
ATOM 1577  N N    . SER A 1 110 ? -13.713 -3.315  -2.073  1.00 0.00 ? 110 SER A N    1  
ATOM 1578  C CA   . SER A 1 110 ? -14.496 -4.263  -1.290  1.00 0.00 ? 110 SER A CA   1  
ATOM 1579  C C    . SER A 1 110 ? -13.786 -4.606  0.016   1.00 0.00 ? 110 SER A C    1  
ATOM 1580  O O    . SER A 1 110 ? -12.558 -4.652  0.075   1.00 0.00 ? 110 SER A O    1  
ATOM 1581  C CB   . SER A 1 110 ? -14.749 -5.538  -2.097  1.00 0.00 ? 110 SER A CB   1  
ATOM 1582  O OG   . SER A 1 110 ? -15.844 -6.266  -1.570  1.00 0.00 ? 110 SER A OG   1  
ATOM 1583  H H    . SER A 1 110 ? -12.799 -3.552  -2.337  1.00 0.00 ? 110 SER A H    1  
ATOM 1584  H HA   . SER A 1 110 ? -15.444 -3.799  -1.060  1.00 0.00 ? 110 SER A HA   1  
ATOM 1585  H HB2  . SER A 1 110 ? -14.966 -5.275  -3.121  1.00 0.00 ? 110 SER A HB2  1  
ATOM 1586  H HB3  . SER A 1 110 ? -13.867 -6.161  -2.064  1.00 0.00 ? 110 SER A HB3  1  
ATOM 1587  H HG   . SER A 1 110 ? -15.741 -6.357  -0.620  1.00 0.00 ? 110 SER A HG   1  
ATOM 1588  N N    . GLY A 1 111 ? -14.570 -4.847  1.063   1.00 0.00 ? 111 GLY A N    1  
ATOM 1589  C CA   . GLY A 1 111 ? -14.000 -5.183  2.355   1.00 0.00 ? 111 GLY A CA   1  
ATOM 1590  C C    . GLY A 1 111 ? -13.872 -3.976  3.264   1.00 0.00 ? 111 GLY A C    1  
ATOM 1591  O O    . GLY A 1 111 ? -14.872 -3.448  3.750   1.00 0.00 ? 111 GLY A O    1  
ATOM 1592  H H    . GLY A 1 111 ? -15.543 -4.795  0.958   1.00 0.00 ? 111 GLY A H    1  
ATOM 1593  H HA2  . GLY A 1 111 ? -14.630 -5.917  2.834   1.00 0.00 ? 111 GLY A HA2  1  
ATOM 1594  H HA3  . GLY A 1 111 ? -13.019 -5.609  2.203   1.00 0.00 ? 111 GLY A HA3  1  
ATOM 1595  N N    . GLY A 1 1   ? -18.773 23.207  1.755   1.00 0.00 ? 1   GLY A N    2  
ATOM 1596  C CA   . GLY A 1 1   ? -19.581 23.073  2.953   1.00 0.00 ? 1   GLY A CA   2  
ATOM 1597  C C    . GLY A 1 1   ? -19.327 21.768  3.681   1.00 0.00 ? 1   GLY A C    2  
ATOM 1598  O O    . GLY A 1 1   ? -18.228 21.534  4.185   1.00 0.00 ? 1   GLY A O    2  
ATOM 1599  H H1   . GLY A 1 1   ? -19.203 23.401  0.896   1.00 0.00 ? 1   GLY A H1   2  
ATOM 1600  H HA2  . GLY A 1 1   ? -19.358 23.894  3.619   1.00 0.00 ? 1   GLY A HA2  2  
ATOM 1601  H HA3  . GLY A 1 1   ? -20.624 23.120  2.677   1.00 0.00 ? 1   GLY A HA3  2  
ATOM 1602  N N    . SER A 1 2   ? -20.345 20.916  3.739   1.00 0.00 ? 2   SER A N    2  
ATOM 1603  C CA   . SER A 1 2   ? -20.229 19.629  4.415   1.00 0.00 ? 2   SER A CA   2  
ATOM 1604  C C    . SER A 1 2   ? -19.636 18.577  3.483   1.00 0.00 ? 2   SER A C    2  
ATOM 1605  O O    . SER A 1 2   ? -20.175 18.309  2.409   1.00 0.00 ? 2   SER A O    2  
ATOM 1606  C CB   . SER A 1 2   ? -21.598 19.168  4.919   1.00 0.00 ? 2   SER A CB   2  
ATOM 1607  O OG   . SER A 1 2   ? -22.510 19.014  3.846   1.00 0.00 ? 2   SER A OG   2  
ATOM 1608  H H    . SER A 1 2   ? -21.197 21.160  3.318   1.00 0.00 ? 2   SER A H    2  
ATOM 1609  H HA   . SER A 1 2   ? -19.569 19.758  5.260   1.00 0.00 ? 2   SER A HA   2  
ATOM 1610  H HB2  . SER A 1 2   ? -21.492 18.220  5.424   1.00 0.00 ? 2   SER A HB2  2  
ATOM 1611  H HB3  . SER A 1 2   ? -21.991 19.902  5.607   1.00 0.00 ? 2   SER A HB3  2  
ATOM 1612  H HG   . SER A 1 2   ? -23.291 19.548  4.009   1.00 0.00 ? 2   SER A HG   2  
ATOM 1613  N N    . SER A 1 3   ? -18.523 17.983  3.902   1.00 0.00 ? 3   SER A N    2  
ATOM 1614  C CA   . SER A 1 3   ? -17.854 16.963  3.104   1.00 0.00 ? 3   SER A CA   2  
ATOM 1615  C C    . SER A 1 3   ? -17.951 15.597  3.777   1.00 0.00 ? 3   SER A C    2  
ATOM 1616  O O    . SER A 1 3   ? -18.466 14.642  3.197   1.00 0.00 ? 3   SER A O    2  
ATOM 1617  C CB   . SER A 1 3   ? -16.385 17.335  2.890   1.00 0.00 ? 3   SER A CB   2  
ATOM 1618  O OG   . SER A 1 3   ? -16.265 18.616  2.296   1.00 0.00 ? 3   SER A OG   2  
ATOM 1619  H H    . SER A 1 3   ? -18.142 18.240  4.768   1.00 0.00 ? 3   SER A H    2  
ATOM 1620  H HA   . SER A 1 3   ? -18.348 16.915  2.146   1.00 0.00 ? 3   SER A HA   2  
ATOM 1621  H HB2  . SER A 1 3   ? -15.876 17.344  3.842   1.00 0.00 ? 3   SER A HB2  2  
ATOM 1622  H HB3  . SER A 1 3   ? -15.923 16.605  2.241   1.00 0.00 ? 3   SER A HB3  2  
ATOM 1623  H HG   . SER A 1 3   ? -15.885 18.528  1.419   1.00 0.00 ? 3   SER A HG   2  
ATOM 1624  N N    . GLY A 1 4   ? -17.452 15.513  5.007   1.00 0.00 ? 4   GLY A N    2  
ATOM 1625  C CA   . GLY A 1 4   ? -17.491 14.260  5.739   1.00 0.00 ? 4   GLY A CA   2  
ATOM 1626  C C    . GLY A 1 4   ? -16.590 14.273  6.958   1.00 0.00 ? 4   GLY A C    2  
ATOM 1627  O O    . GLY A 1 4   ? -16.344 15.326  7.546   1.00 0.00 ? 4   GLY A O    2  
ATOM 1628  H H    . GLY A 1 4   ? -17.053 16.307  5.420   1.00 0.00 ? 4   GLY A H    2  
ATOM 1629  H HA2  . GLY A 1 4   ? -18.506 14.074  6.057   1.00 0.00 ? 4   GLY A HA2  2  
ATOM 1630  H HA3  . GLY A 1 4   ? -17.178 13.462  5.082   1.00 0.00 ? 4   GLY A HA3  2  
ATOM 1631  N N    . SER A 1 5   ? -16.098 13.099  7.340   1.00 0.00 ? 5   SER A N    2  
ATOM 1632  C CA   . SER A 1 5   ? -15.223 12.978  8.500   1.00 0.00 ? 5   SER A CA   2  
ATOM 1633  C C    . SER A 1 5   ? -13.772 13.253  8.117   1.00 0.00 ? 5   SER A C    2  
ATOM 1634  O O    . SER A 1 5   ? -13.097 14.069  8.745   1.00 0.00 ? 5   SER A O    2  
ATOM 1635  C CB   . SER A 1 5   ? -15.344 11.581  9.113   1.00 0.00 ? 5   SER A CB   2  
ATOM 1636  O OG   . SER A 1 5   ? -14.894 10.587  8.210   1.00 0.00 ? 5   SER A OG   2  
ATOM 1637  H H    . SER A 1 5   ? -16.331 12.294  6.830   1.00 0.00 ? 5   SER A H    2  
ATOM 1638  H HA   . SER A 1 5   ? -15.536 13.710  9.229   1.00 0.00 ? 5   SER A HA   2  
ATOM 1639  H HB2  . SER A 1 5   ? -14.747 11.532  10.011  1.00 0.00 ? 5   SER A HB2  2  
ATOM 1640  H HB3  . SER A 1 5   ? -16.379 11.387  9.358   1.00 0.00 ? 5   SER A HB3  2  
ATOM 1641  H HG   . SER A 1 5   ? -15.600 10.366  7.598   1.00 0.00 ? 5   SER A HG   2  
ATOM 1642  N N    . SER A 1 6   ? -13.299 12.566  7.083   1.00 0.00 ? 6   SER A N    2  
ATOM 1643  C CA   . SER A 1 6   ? -11.927 12.732  6.618   1.00 0.00 ? 6   SER A CA   2  
ATOM 1644  C C    . SER A 1 6   ? -11.727 14.112  5.999   1.00 0.00 ? 6   SER A C    2  
ATOM 1645  O O    . SER A 1 6   ? -12.348 14.450  4.992   1.00 0.00 ? 6   SER A O    2  
ATOM 1646  C CB   . SER A 1 6   ? -11.577 11.648  5.597   1.00 0.00 ? 6   SER A CB   2  
ATOM 1647  O OG   . SER A 1 6   ? -12.370 11.771  4.429   1.00 0.00 ? 6   SER A OG   2  
ATOM 1648  H H    . SER A 1 6   ? -13.886 11.930  6.623   1.00 0.00 ? 6   SER A H    2  
ATOM 1649  H HA   . SER A 1 6   ? -11.273 12.635  7.472   1.00 0.00 ? 6   SER A HA   2  
ATOM 1650  H HB2  . SER A 1 6   ? -10.537 11.738  5.322   1.00 0.00 ? 6   SER A HB2  2  
ATOM 1651  H HB3  . SER A 1 6   ? -11.750 10.675  6.035   1.00 0.00 ? 6   SER A HB3  2  
ATOM 1652  H HG   . SER A 1 6   ? -13.275 11.972  4.677   1.00 0.00 ? 6   SER A HG   2  
ATOM 1653  N N    . GLY A 1 7   ? -10.854 14.907  6.610   1.00 0.00 ? 7   GLY A N    2  
ATOM 1654  C CA   . GLY A 1 7   ? -10.586 16.242  6.106   1.00 0.00 ? 7   GLY A CA   2  
ATOM 1655  C C    . GLY A 1 7   ? -9.199  16.369  5.508   1.00 0.00 ? 7   GLY A C    2  
ATOM 1656  O O    . GLY A 1 7   ? -9.022  16.351  4.290   1.00 0.00 ? 7   GLY A O    2  
ATOM 1657  H H    . GLY A 1 7   ? -10.387 14.585  7.410   1.00 0.00 ? 7   GLY A H    2  
ATOM 1658  H HA2  . GLY A 1 7   ? -11.317 16.482  5.349   1.00 0.00 ? 7   GLY A HA2  2  
ATOM 1659  H HA3  . GLY A 1 7   ? -10.680 16.947  6.920   1.00 0.00 ? 7   GLY A HA3  2  
ATOM 1660  N N    . PRO A 1 8   ? -8.186  16.502  6.376   1.00 0.00 ? 8   PRO A N    2  
ATOM 1661  C CA   . PRO A 1 8   ? -6.790  16.637  5.949   1.00 0.00 ? 8   PRO A CA   2  
ATOM 1662  C C    . PRO A 1 8   ? -6.239  15.345  5.354   1.00 0.00 ? 8   PRO A C    2  
ATOM 1663  O O    . PRO A 1 8   ? -6.760  14.260  5.610   1.00 0.00 ? 8   PRO A O    2  
ATOM 1664  C CB   . PRO A 1 8   ? -6.054  16.984  7.245   1.00 0.00 ? 8   PRO A CB   2  
ATOM 1665  C CG   . PRO A 1 8   ? -6.906  16.418  8.328   1.00 0.00 ? 8   PRO A CG   2  
ATOM 1666  C CD   . PRO A 1 8   ? -8.324  16.532  7.842   1.00 0.00 ? 8   PRO A CD   2  
ATOM 1667  H HA   . PRO A 1 8   ? -6.669  17.440  5.237   1.00 0.00 ? 8   PRO A HA   2  
ATOM 1668  H HB2  . PRO A 1 8   ? -5.072  16.533  7.237   1.00 0.00 ? 8   PRO A HB2  2  
ATOM 1669  H HB3  . PRO A 1 8   ? -5.963  18.056  7.335   1.00 0.00 ? 8   PRO A HB3  2  
ATOM 1670  H HG2  . PRO A 1 8   ? -6.649  15.383  8.494   1.00 0.00 ? 8   PRO A HG2  2  
ATOM 1671  H HG3  . PRO A 1 8   ? -6.774  16.989  9.235   1.00 0.00 ? 8   PRO A HG3  2  
ATOM 1672  H HD2  . PRO A 1 8   ? -8.911  15.695  8.191   1.00 0.00 ? 8   PRO A HD2  2  
ATOM 1673  H HD3  . PRO A 1 8   ? -8.761  17.464  8.168   1.00 0.00 ? 8   PRO A HD3  2  
ATOM 1674  N N    . GLY A 1 9   ? -5.182  15.470  4.557   1.00 0.00 ? 9   GLY A N    2  
ATOM 1675  C CA   . GLY A 1 9   ? -4.578  14.304  3.938   1.00 0.00 ? 9   GLY A CA   2  
ATOM 1676  C C    . GLY A 1 9   ? -3.064  14.374  3.924   1.00 0.00 ? 9   GLY A C    2  
ATOM 1677  O O    . GLY A 1 9   ? -2.386  13.359  4.087   1.00 0.00 ? 9   GLY A O    2  
ATOM 1678  H H    . GLY A 1 9   ? -4.809  16.360  4.388   1.00 0.00 ? 9   GLY A H    2  
ATOM 1679  H HA2  . GLY A 1 9   ? -4.882  13.423  4.483   1.00 0.00 ? 9   GLY A HA2  2  
ATOM 1680  H HA3  . GLY A 1 9   ? -4.933  14.227  2.921   1.00 0.00 ? 9   GLY A HA3  2  
ATOM 1681  N N    . LEU A 1 10  ? -2.531  15.575  3.727   1.00 0.00 ? 10  LEU A N    2  
ATOM 1682  C CA   . LEU A 1 10  ? -1.086  15.774  3.690   1.00 0.00 ? 10  LEU A CA   2  
ATOM 1683  C C    . LEU A 1 10  ? -0.520  15.913  5.099   1.00 0.00 ? 10  LEU A C    2  
ATOM 1684  O O    . LEU A 1 10  ? 0.576   16.441  5.289   1.00 0.00 ? 10  LEU A O    2  
ATOM 1685  C CB   . LEU A 1 10  ? -0.743  17.016  2.865   1.00 0.00 ? 10  LEU A CB   2  
ATOM 1686  C CG   . LEU A 1 10  ? -1.565  18.270  3.168   1.00 0.00 ? 10  LEU A CG   2  
ATOM 1687  C CD1  . LEU A 1 10  ? -2.857  18.269  2.365   1.00 0.00 ? 10  LEU A CD1  2  
ATOM 1688  C CD2  . LEU A 1 10  ? -1.860  18.368  4.657   1.00 0.00 ? 10  LEU A CD2  2  
ATOM 1689  H H    . LEU A 1 10  ? -3.122  16.347  3.603   1.00 0.00 ? 10  LEU A H    2  
ATOM 1690  H HA   . LEU A 1 10  ? -0.644  14.908  3.221   1.00 0.00 ? 10  LEU A HA   2  
ATOM 1691  H HB2  . LEU A 1 10  ? 0.295   17.252  3.038   1.00 0.00 ? 10  LEU A HB2  2  
ATOM 1692  H HB3  . LEU A 1 10  ? -0.886  16.769  1.823   1.00 0.00 ? 10  LEU A HB3  2  
ATOM 1693  H HG   . LEU A 1 10  ? -0.995  19.143  2.880   1.00 0.00 ? 10  LEU A HG   2  
ATOM 1694  H HD11 . LEU A 1 10  ? -2.907  17.372  1.766   1.00 0.00 ? 10  LEU A HD11 2  
ATOM 1695  H HD12 . LEU A 1 10  ? -2.881  19.135  1.721   1.00 0.00 ? 10  LEU A HD12 2  
ATOM 1696  H HD13 . LEU A 1 10  ? -3.699  18.299  3.040   1.00 0.00 ? 10  LEU A HD13 2  
ATOM 1697  H HD21 . LEU A 1 10  ? -2.544  17.582  4.940   1.00 0.00 ? 10  LEU A HD21 2  
ATOM 1698  H HD22 . LEU A 1 10  ? -2.306  19.328  4.873   1.00 0.00 ? 10  LEU A HD22 2  
ATOM 1699  H HD23 . LEU A 1 10  ? -0.941  18.264  5.214   1.00 0.00 ? 10  LEU A HD23 2  
ATOM 1700  N N    . ARG A 1 11  ? -1.273  15.435  6.084   1.00 0.00 ? 11  ARG A N    2  
ATOM 1701  C CA   . ARG A 1 11  ? -0.845  15.505  7.476   1.00 0.00 ? 11  ARG A CA   2  
ATOM 1702  C C    . ARG A 1 11  ? -0.056  14.259  7.866   1.00 0.00 ? 11  ARG A C    2  
ATOM 1703  O O    . ARG A 1 11  ? -0.037  13.271  7.133   1.00 0.00 ? 11  ARG A O    2  
ATOM 1704  C CB   . ARG A 1 11  ? -2.057  15.663  8.397   1.00 0.00 ? 11  ARG A CB   2  
ATOM 1705  C CG   . ARG A 1 11  ? -2.672  17.053  8.361   1.00 0.00 ? 11  ARG A CG   2  
ATOM 1706  C CD   . ARG A 1 11  ? -1.842  18.049  9.155   1.00 0.00 ? 11  ARG A CD   2  
ATOM 1707  N NE   . ARG A 1 11  ? -2.662  19.120  9.717   1.00 0.00 ? 11  ARG A NE   2  
ATOM 1708  C CZ   . ARG A 1 11  ? -2.173  20.290  10.111  1.00 0.00 ? 11  ARG A CZ   2  
ATOM 1709  N NH1  . ARG A 1 11  ? -0.875  20.540  10.004  1.00 0.00 ? 11  ARG A NH1  2  
ATOM 1710  N NH2  . ARG A 1 11  ? -2.983  21.214  10.612  1.00 0.00 ? 11  ARG A NH2  2  
ATOM 1711  H H    . ARG A 1 11  ? -2.137  15.026  5.870   1.00 0.00 ? 11  ARG A H    2  
ATOM 1712  H HA   . ARG A 1 11  ? -0.207  16.369  7.584   1.00 0.00 ? 11  ARG A HA   2  
ATOM 1713  H HB2  . ARG A 1 11  ? -2.814  14.951  8.102   1.00 0.00 ? 11  ARG A HB2  2  
ATOM 1714  H HB3  . ARG A 1 11  ? -1.752  15.454  9.411   1.00 0.00 ? 11  ARG A HB3  2  
ATOM 1715  H HG2  . ARG A 1 11  ? -2.728  17.385  7.335   1.00 0.00 ? 11  ARG A HG2  2  
ATOM 1716  H HG3  . ARG A 1 11  ? -3.665  17.007  8.783   1.00 0.00 ? 11  ARG A HG3  2  
ATOM 1717  H HD2  . ARG A 1 11  ? -1.349  17.526  9.961   1.00 0.00 ? 11  ARG A HD2  2  
ATOM 1718  H HD3  . ARG A 1 11  ? -1.100  18.482  8.500   1.00 0.00 ? 11  ARG A HD3  2  
ATOM 1719  H HE   . ARG A 1 11  ? -3.623  18.956  9.805   1.00 0.00 ? 11  ARG A HE   2  
ATOM 1720  H HH11 . ARG A 1 11  ? -0.263  19.847  9.626   1.00 0.00 ? 11  ARG A HH11 2  
ATOM 1721  H HH12 . ARG A 1 11  ? -0.510  21.423  10.300  1.00 0.00 ? 11  ARG A HH12 2  
ATOM 1722  H HH21 . ARG A 1 11  ? -3.962  21.029  10.693  1.00 0.00 ? 11  ARG A HH21 2  
ATOM 1723  H HH22 . ARG A 1 11  ? -2.614  22.095  10.908  1.00 0.00 ? 11  ARG A HH22 2  
ATOM 1724  N N    . GLU A 1 12  ? 0.594   14.314  9.024   1.00 0.00 ? 12  GLU A N    2  
ATOM 1725  C CA   . GLU A 1 12  ? 1.386   13.190  9.510   1.00 0.00 ? 12  GLU A CA   2  
ATOM 1726  C C    . GLU A 1 12  ? 0.485   12.069  10.018  1.00 0.00 ? 12  GLU A C    2  
ATOM 1727  O O    . GLU A 1 12  ? -0.236  12.235  11.004  1.00 0.00 ? 12  GLU A O    2  
ATOM 1728  C CB   . GLU A 1 12  ? 2.330   13.646  10.624  1.00 0.00 ? 12  GLU A CB   2  
ATOM 1729  C CG   . GLU A 1 12  ? 3.444   12.656  10.922  1.00 0.00 ? 12  GLU A CG   2  
ATOM 1730  C CD   . GLU A 1 12  ? 4.364   13.130  12.030  1.00 0.00 ? 12  GLU A CD   2  
ATOM 1731  O OE1  . GLU A 1 12  ? 3.943   13.097  13.205  1.00 0.00 ? 12  GLU A OE1  2  
ATOM 1732  O OE2  . GLU A 1 12  ? 5.505   13.534  11.722  1.00 0.00 ? 12  GLU A OE2  2  
ATOM 1733  H H    . GLU A 1 12  ? 0.541   15.130  9.564   1.00 0.00 ? 12  GLU A H    2  
ATOM 1734  H HA   . GLU A 1 12  ? 1.973   12.817  8.684   1.00 0.00 ? 12  GLU A HA   2  
ATOM 1735  H HB2  . GLU A 1 12  ? 2.778   14.586  10.338  1.00 0.00 ? 12  GLU A HB2  2  
ATOM 1736  H HB3  . GLU A 1 12  ? 1.756   13.792  11.528  1.00 0.00 ? 12  GLU A HB3  2  
ATOM 1737  H HG2  . GLU A 1 12  ? 3.003   11.716  11.218  1.00 0.00 ? 12  GLU A HG2  2  
ATOM 1738  H HG3  . GLU A 1 12  ? 4.028   12.512  10.025  1.00 0.00 ? 12  GLU A HG3  2  
ATOM 1739  N N    . LEU A 1 13  ? 0.529   10.928  9.339   1.00 0.00 ? 13  LEU A N    2  
ATOM 1740  C CA   . LEU A 1 13  ? -0.283  9.779   9.721   1.00 0.00 ? 13  LEU A CA   2  
ATOM 1741  C C    . LEU A 1 13  ? 0.596   8.587   10.086  1.00 0.00 ? 13  LEU A C    2  
ATOM 1742  O O    . LEU A 1 13  ? 1.765   8.526   9.704   1.00 0.00 ? 13  LEU A O    2  
ATOM 1743  C CB   . LEU A 1 13  ? -1.231  9.398   8.582   1.00 0.00 ? 13  LEU A CB   2  
ATOM 1744  C CG   . LEU A 1 13  ? -2.485  10.260  8.436   1.00 0.00 ? 13  LEU A CG   2  
ATOM 1745  C CD1  . LEU A 1 13  ? -2.945  10.292  6.987   1.00 0.00 ? 13  LEU A CD1  2  
ATOM 1746  C CD2  . LEU A 1 13  ? -3.596  9.741   9.338   1.00 0.00 ? 13  LEU A CD2  2  
ATOM 1747  H H    . LEU A 1 13  ? 1.122   10.856  8.563   1.00 0.00 ? 13  LEU A H    2  
ATOM 1748  H HA   . LEU A 1 13  ? -0.867  10.058  10.586  1.00 0.00 ? 13  LEU A HA   2  
ATOM 1749  H HB2  . LEU A 1 13  ? -0.678  9.460   7.657   1.00 0.00 ? 13  LEU A HB2  2  
ATOM 1750  H HB3  . LEU A 1 13  ? -1.546  8.377   8.743   1.00 0.00 ? 13  LEU A HB3  2  
ATOM 1751  H HG   . LEU A 1 13  ? -2.255  11.273  8.736   1.00 0.00 ? 13  LEU A HG   2  
ATOM 1752  H HD11 . LEU A 1 13  ? -3.613  9.465   6.802   1.00 0.00 ? 13  LEU A HD11 2  
ATOM 1753  H HD12 . LEU A 1 13  ? -2.087  10.215  6.335   1.00 0.00 ? 13  LEU A HD12 2  
ATOM 1754  H HD13 . LEU A 1 13  ? -3.460  11.222  6.794   1.00 0.00 ? 13  LEU A HD13 2  
ATOM 1755  H HD21 . LEU A 1 13  ? -4.388  10.473  9.390   1.00 0.00 ? 13  LEU A HD21 2  
ATOM 1756  H HD22 . LEU A 1 13  ? -3.203  9.566   10.329  1.00 0.00 ? 13  LEU A HD22 2  
ATOM 1757  H HD23 . LEU A 1 13  ? -3.985  8.818   8.936   1.00 0.00 ? 13  LEU A HD23 2  
ATOM 1758  N N    . CYS A 1 14  ? 0.026   7.642   10.825  1.00 0.00 ? 14  CYS A N    2  
ATOM 1759  C CA   . CYS A 1 14  ? 0.758   6.450   11.240  1.00 0.00 ? 14  CYS A CA   2  
ATOM 1760  C C    . CYS A 1 14  ? -0.124  5.210   11.144  1.00 0.00 ? 14  CYS A C    2  
ATOM 1761  O O    . CYS A 1 14  ? -1.351  5.303   11.196  1.00 0.00 ? 14  CYS A O    2  
ATOM 1762  C CB   . CYS A 1 14  ? 1.273   6.616   12.671  1.00 0.00 ? 14  CYS A CB   2  
ATOM 1763  S SG   . CYS A 1 14  ? 0.016   7.163   13.849  1.00 0.00 ? 14  CYS A SG   2  
ATOM 1764  H H    . CYS A 1 14  ? -0.909  7.747   11.098  1.00 0.00 ? 14  CYS A H    2  
ATOM 1765  H HA   . CYS A 1 14  ? 1.600   6.331   10.575  1.00 0.00 ? 14  CYS A HA   2  
ATOM 1766  H HB2  . CYS A 1 14  ? 1.658   5.668   13.018  1.00 0.00 ? 14  CYS A HB2  2  
ATOM 1767  H HB3  . CYS A 1 14  ? 2.070   7.344   12.676  1.00 0.00 ? 14  CYS A HB3  2  
ATOM 1768  H HG   . CYS A 1 14  ? 0.172   8.465   14.037  1.00 0.00 ? 14  CYS A HG   2  
ATOM 1769  N N    . ILE A 1 15  ? 0.509   4.050   11.003  1.00 0.00 ? 15  ILE A N    2  
ATOM 1770  C CA   . ILE A 1 15  ? -0.218  2.791   10.900  1.00 0.00 ? 15  ILE A CA   2  
ATOM 1771  C C    . ILE A 1 15  ? 0.219   1.812   11.984  1.00 0.00 ? 15  ILE A C    2  
ATOM 1772  O O    . ILE A 1 15  ? 1.335   1.293   11.951  1.00 0.00 ? 15  ILE A O    2  
ATOM 1773  C CB   . ILE A 1 15  ? -0.016  2.136   9.521   1.00 0.00 ? 15  ILE A CB   2  
ATOM 1774  C CG1  . ILE A 1 15  ? -0.515  3.065   8.412   1.00 0.00 ? 15  ILE A CG1  2  
ATOM 1775  C CG2  . ILE A 1 15  ? -0.735  0.796   9.460   1.00 0.00 ? 15  ILE A CG2  2  
ATOM 1776  C CD1  . ILE A 1 15  ? -0.490  2.434   7.038   1.00 0.00 ? 15  ILE A CD1  2  
ATOM 1777  H H    . ILE A 1 15  ? 1.488   4.040   10.969  1.00 0.00 ? 15  ILE A H    2  
ATOM 1778  H HA   . ILE A 1 15  ? -1.270  3.003   11.025  1.00 0.00 ? 15  ILE A HA   2  
ATOM 1779  H HB   . ILE A 1 15  ? 1.040   1.957   9.383   1.00 0.00 ? 15  ILE A HB   2  
ATOM 1780  H HG12 . ILE A 1 15  ? -1.532  3.355   8.625   1.00 0.00 ? 15  ILE A HG12 2  
ATOM 1781  H HG13 . ILE A 1 15  ? 0.108   3.947   8.385   1.00 0.00 ? 15  ILE A HG13 2  
ATOM 1782  H HG21 . ILE A 1 15  ? -0.281  0.178   8.699   1.00 0.00 ? 15  ILE A HG21 2  
ATOM 1783  H HG22 . ILE A 1 15  ? -0.656  0.303   10.417  1.00 0.00 ? 15  ILE A HG22 2  
ATOM 1784  H HG23 . ILE A 1 15  ? -1.775  0.956   9.221   1.00 0.00 ? 15  ILE A HG23 2  
ATOM 1785  H HD11 . ILE A 1 15  ? -1.479  2.468   6.607   1.00 0.00 ? 15  ILE A HD11 2  
ATOM 1786  H HD12 . ILE A 1 15  ? 0.198   2.974   6.405   1.00 0.00 ? 15  ILE A HD12 2  
ATOM 1787  H HD13 . ILE A 1 15  ? -0.170  1.405   7.120   1.00 0.00 ? 15  ILE A HD13 2  
ATOM 1788  N N    . GLN A 1 16  ? -0.667  1.564   12.943  1.00 0.00 ? 16  GLN A N    2  
ATOM 1789  C CA   . GLN A 1 16  ? -0.372  0.647   14.037  1.00 0.00 ? 16  GLN A CA   2  
ATOM 1790  C C    . GLN A 1 16  ? -0.562  -0.802  13.599  1.00 0.00 ? 16  GLN A C    2  
ATOM 1791  O O    . GLN A 1 16  ? -1.672  -1.222  13.270  1.00 0.00 ? 16  GLN A O    2  
ATOM 1792  C CB   . GLN A 1 16  ? -1.267  0.950   15.240  1.00 0.00 ? 16  GLN A CB   2  
ATOM 1793  C CG   . GLN A 1 16  ? -0.644  1.917   16.233  1.00 0.00 ? 16  GLN A CG   2  
ATOM 1794  C CD   . GLN A 1 16  ? -1.680  2.721   16.993  1.00 0.00 ? 16  GLN A CD   2  
ATOM 1795  O OE1  . GLN A 1 16  ? -2.539  2.162   17.675  1.00 0.00 ? 16  GLN A OE1  2  
ATOM 1796  N NE2  . GLN A 1 16  ? -1.604  4.042   16.879  1.00 0.00 ? 16  GLN A NE2  2  
ATOM 1797  H H    . GLN A 1 16  ? -1.539  2.009   12.914  1.00 0.00 ? 16  GLN A H    2  
ATOM 1798  H HA   . GLN A 1 16  ? 0.659   0.791   14.321  1.00 0.00 ? 16  GLN A HA   2  
ATOM 1799  H HB2  . GLN A 1 16  ? -2.193  1.377   14.886  1.00 0.00 ? 16  GLN A HB2  2  
ATOM 1800  H HB3  . GLN A 1 16  ? -1.480  0.025   15.756  1.00 0.00 ? 16  GLN A HB3  2  
ATOM 1801  H HG2  . GLN A 1 16  ? -0.056  1.355   16.944  1.00 0.00 ? 16  GLN A HG2  2  
ATOM 1802  H HG3  . GLN A 1 16  ? -0.001  2.600   15.697  1.00 0.00 ? 16  GLN A HG3  2  
ATOM 1803  H HE21 . GLN A 1 16  ? -0.894  4.418   16.318  1.00 0.00 ? 16  GLN A HE21 2  
ATOM 1804  H HE22 . GLN A 1 16  ? -2.262  4.586   17.359  1.00 0.00 ? 16  GLN A HE22 2  
ATOM 1805  N N    . LYS A 1 17  ? 0.528   -1.562  13.596  1.00 0.00 ? 17  LYS A N    2  
ATOM 1806  C CA   . LYS A 1 17  ? 0.482   -2.964  13.199  1.00 0.00 ? 17  LYS A CA   2  
ATOM 1807  C C    . LYS A 1 17  ? 1.211   -3.840  14.213  1.00 0.00 ? 17  LYS A C    2  
ATOM 1808  O O    . LYS A 1 17  ? 1.768   -3.342  15.191  1.00 0.00 ? 17  LYS A O    2  
ATOM 1809  C CB   . LYS A 1 17  ? 1.106   -3.144  11.813  1.00 0.00 ? 17  LYS A CB   2  
ATOM 1810  C CG   . LYS A 1 17  ? 2.616   -3.297  11.841  1.00 0.00 ? 17  LYS A CG   2  
ATOM 1811  C CD   . LYS A 1 17  ? 3.246   -2.851  10.532  1.00 0.00 ? 17  LYS A CD   2  
ATOM 1812  C CE   . LYS A 1 17  ? 3.315   -1.335  10.435  1.00 0.00 ? 17  LYS A CE   2  
ATOM 1813  N NZ   . LYS A 1 17  ? 2.029   -0.750  9.964   1.00 0.00 ? 17  LYS A NZ   2  
ATOM 1814  H H    . LYS A 1 17  ? 1.384   -1.170  13.869  1.00 0.00 ? 17  LYS A H    2  
ATOM 1815  H HA   . LYS A 1 17  ? -0.554  -3.264  13.160  1.00 0.00 ? 17  LYS A HA   2  
ATOM 1816  H HB2  . LYS A 1 17  ? 0.683   -4.025  11.353  1.00 0.00 ? 17  LYS A HB2  2  
ATOM 1817  H HB3  . LYS A 1 17  ? 0.864   -2.281  11.208  1.00 0.00 ? 17  LYS A HB3  2  
ATOM 1818  H HG2  . LYS A 1 17  ? 3.016   -2.696  12.644  1.00 0.00 ? 17  LYS A HG2  2  
ATOM 1819  H HG3  . LYS A 1 17  ? 2.860   -4.336  12.011  1.00 0.00 ? 17  LYS A HG3  2  
ATOM 1820  H HD2  . LYS A 1 17  ? 4.248   -3.250  10.470  1.00 0.00 ? 17  LYS A HD2  2  
ATOM 1821  H HD3  . LYS A 1 17  ? 2.655   -3.229  9.710   1.00 0.00 ? 17  LYS A HD3  2  
ATOM 1822  H HE2  . LYS A 1 17  ? 3.546   -0.935  11.410  1.00 0.00 ? 17  LYS A HE2  2  
ATOM 1823  H HE3  . LYS A 1 17  ? 4.099   -1.067  9.741   1.00 0.00 ? 17  LYS A HE3  2  
ATOM 1824  H HZ1  . LYS A 1 17  ? 1.482   -1.465  9.442   1.00 0.00 ? 17  LYS A HZ1  2  
ATOM 1825  H HZ2  . LYS A 1 17  ? 2.213   0.057   9.334   1.00 0.00 ? 17  LYS A HZ2  2  
ATOM 1826  H HZ3  . LYS A 1 17  ? 1.467   -0.422  10.775  1.00 0.00 ? 17  LYS A HZ3  2  
ATOM 1827  N N    . ALA A 1 18  ? 1.203   -5.147  13.972  1.00 0.00 ? 18  ALA A N    2  
ATOM 1828  C CA   . ALA A 1 18  ? 1.866   -6.092  14.863  1.00 0.00 ? 18  ALA A CA   2  
ATOM 1829  C C    . ALA A 1 18  ? 3.343   -5.749  15.026  1.00 0.00 ? 18  ALA A C    2  
ATOM 1830  O O    . ALA A 1 18  ? 3.918   -4.989  14.246  1.00 0.00 ? 18  ALA A O    2  
ATOM 1831  C CB   . ALA A 1 18  ? 1.707   -7.512  14.339  1.00 0.00 ? 18  ALA A CB   2  
ATOM 1832  H H    . ALA A 1 18  ? 0.742   -5.484  13.176  1.00 0.00 ? 18  ALA A H    2  
ATOM 1833  H HA   . ALA A 1 18  ? 1.385   -6.035  15.828  1.00 0.00 ? 18  ALA A HA   2  
ATOM 1834  H HB1  . ALA A 1 18  ? 0.989   -7.518  13.532  1.00 0.00 ? 18  ALA A HB1  2  
ATOM 1835  H HB2  . ALA A 1 18  ? 2.659   -7.870  13.977  1.00 0.00 ? 18  ALA A HB2  2  
ATOM 1836  H HB3  . ALA A 1 18  ? 1.360   -8.152  15.136  1.00 0.00 ? 18  ALA A HB3  2  
ATOM 1837  N N    . PRO A 1 19  ? 3.973   -6.320  16.063  1.00 0.00 ? 19  PRO A N    2  
ATOM 1838  C CA   . PRO A 1 19  ? 5.391   -6.088  16.353  1.00 0.00 ? 19  PRO A CA   2  
ATOM 1839  C C    . PRO A 1 19  ? 6.307   -6.731  15.317  1.00 0.00 ? 19  PRO A C    2  
ATOM 1840  O O    . PRO A 1 19  ? 7.530   -6.652  15.421  1.00 0.00 ? 19  PRO A O    2  
ATOM 1841  C CB   . PRO A 1 19  ? 5.586   -6.747  17.721  1.00 0.00 ? 19  PRO A CB   2  
ATOM 1842  C CG   . PRO A 1 19  ? 4.522   -7.787  17.795  1.00 0.00 ? 19  PRO A CG   2  
ATOM 1843  C CD   . PRO A 1 19  ? 3.349   -7.235  17.033  1.00 0.00 ? 19  PRO A CD   2  
ATOM 1844  H HA   . PRO A 1 19  ? 5.615   -5.034  16.424  1.00 0.00 ? 19  PRO A HA   2  
ATOM 1845  H HB2  . PRO A 1 19  ? 6.573   -7.185  17.775  1.00 0.00 ? 19  PRO A HB2  2  
ATOM 1846  H HB3  . PRO A 1 19  ? 5.471   -6.008  18.500  1.00 0.00 ? 19  PRO A HB3  2  
ATOM 1847  H HG2  . PRO A 1 19  ? 4.870   -8.701  17.338  1.00 0.00 ? 19  PRO A HG2  2  
ATOM 1848  H HG3  . PRO A 1 19  ? 4.251   -7.961  18.826  1.00 0.00 ? 19  PRO A HG3  2  
ATOM 1849  H HD2  . PRO A 1 19  ? 2.820   -8.030  16.528  1.00 0.00 ? 19  PRO A HD2  2  
ATOM 1850  H HD3  . PRO A 1 19  ? 2.686   -6.700  17.697  1.00 0.00 ? 19  PRO A HD3  2  
ATOM 1851  N N    . GLY A 1 20  ? 5.706   -7.368  14.316  1.00 0.00 ? 20  GLY A N    2  
ATOM 1852  C CA   . GLY A 1 20  ? 6.483   -8.015  13.275  1.00 0.00 ? 20  GLY A CA   2  
ATOM 1853  C C    . GLY A 1 20  ? 5.661   -8.309  12.036  1.00 0.00 ? 20  GLY A C    2  
ATOM 1854  O O    . GLY A 1 20  ? 5.971   -9.232  11.283  1.00 0.00 ? 20  GLY A O    2  
ATOM 1855  H H    . GLY A 1 20  ? 4.727   -7.398  14.284  1.00 0.00 ? 20  GLY A H    2  
ATOM 1856  H HA2  . GLY A 1 20  ? 7.307   -7.372  13.004  1.00 0.00 ? 20  GLY A HA2  2  
ATOM 1857  H HA3  . GLY A 1 20  ? 6.877   -8.944  13.661  1.00 0.00 ? 20  GLY A HA3  2  
ATOM 1858  N N    . GLU A 1 21  ? 4.609   -7.524  11.825  1.00 0.00 ? 21  GLU A N    2  
ATOM 1859  C CA   . GLU A 1 21  ? 3.739   -7.708  10.670  1.00 0.00 ? 21  GLU A CA   2  
ATOM 1860  C C    . GLU A 1 21  ? 4.166   -6.804  9.517   1.00 0.00 ? 21  GLU A C    2  
ATOM 1861  O O    . GLU A 1 21  ? 4.575   -5.662  9.729   1.00 0.00 ? 21  GLU A O    2  
ATOM 1862  C CB   . GLU A 1 21  ? 2.285   -7.419  11.047  1.00 0.00 ? 21  GLU A CB   2  
ATOM 1863  C CG   . GLU A 1 21  ? 1.299   -7.681  9.920   1.00 0.00 ? 21  GLU A CG   2  
ATOM 1864  C CD   . GLU A 1 21  ? 1.430   -9.078  9.344   1.00 0.00 ? 21  GLU A CD   2  
ATOM 1865  O OE1  . GLU A 1 21  ? 1.485   -10.043 10.134  1.00 0.00 ? 21  GLU A OE1  2  
ATOM 1866  O OE2  . GLU A 1 21  ? 1.478   -9.204  8.102   1.00 0.00 ? 21  GLU A OE2  2  
ATOM 1867  H H    . GLU A 1 21  ? 4.413   -6.806  12.462  1.00 0.00 ? 21  GLU A H    2  
ATOM 1868  H HA   . GLU A 1 21  ? 3.821   -8.737  10.353  1.00 0.00 ? 21  GLU A HA   2  
ATOM 1869  H HB2  . GLU A 1 21  ? 2.013   -8.041  11.888  1.00 0.00 ? 21  GLU A HB2  2  
ATOM 1870  H HB3  . GLU A 1 21  ? 2.200   -6.382  11.337  1.00 0.00 ? 21  GLU A HB3  2  
ATOM 1871  H HG2  . GLU A 1 21  ? 0.296   -7.558  10.300  1.00 0.00 ? 21  GLU A HG2  2  
ATOM 1872  H HG3  . GLU A 1 21  ? 1.475   -6.964  9.132   1.00 0.00 ? 21  GLU A HG3  2  
ATOM 1873  N N    . ARG A 1 22  ? 4.069   -7.323  8.298   1.00 0.00 ? 22  ARG A N    2  
ATOM 1874  C CA   . ARG A 1 22  ? 4.447   -6.564  7.112   1.00 0.00 ? 22  ARG A CA   2  
ATOM 1875  C C    . ARG A 1 22  ? 3.281   -5.713  6.617   1.00 0.00 ? 22  ARG A C    2  
ATOM 1876  O O    . ARG A 1 22  ? 2.196   -6.228  6.340   1.00 0.00 ? 22  ARG A O    2  
ATOM 1877  C CB   . ARG A 1 22  ? 4.910   -7.509  6.002   1.00 0.00 ? 22  ARG A CB   2  
ATOM 1878  C CG   . ARG A 1 22  ? 6.184   -8.267  6.339   1.00 0.00 ? 22  ARG A CG   2  
ATOM 1879  C CD   . ARG A 1 22  ? 5.880   -9.589  7.026   1.00 0.00 ? 22  ARG A CD   2  
ATOM 1880  N NE   . ARG A 1 22  ? 7.097   -10.296 7.415   1.00 0.00 ? 22  ARG A NE   2  
ATOM 1881  C CZ   . ARG A 1 22  ? 7.099   -11.490 7.997   1.00 0.00 ? 22  ARG A CZ   2  
ATOM 1882  N NH1  . ARG A 1 22  ? 5.954   -12.108 8.255   1.00 0.00 ? 22  ARG A NH1  2  
ATOM 1883  N NH2  . ARG A 1 22  ? 8.248   -12.069 8.322   1.00 0.00 ? 22  ARG A NH2  2  
ATOM 1884  H H    . ARG A 1 22  ? 3.736   -8.239  8.193   1.00 0.00 ? 22  ARG A H    2  
ATOM 1885  H HA   . ARG A 1 22  ? 5.264   -5.912  7.382   1.00 0.00 ? 22  ARG A HA   2  
ATOM 1886  H HB2  . ARG A 1 22  ? 4.129   -8.230  5.809   1.00 0.00 ? 22  ARG A HB2  2  
ATOM 1887  H HB3  . ARG A 1 22  ? 5.086   -6.933  5.106   1.00 0.00 ? 22  ARG A HB3  2  
ATOM 1888  H HG2  . ARG A 1 22  ? 6.727   -8.465  5.426   1.00 0.00 ? 22  ARG A HG2  2  
ATOM 1889  H HG3  . ARG A 1 22  ? 6.789   -7.660  6.996   1.00 0.00 ? 22  ARG A HG3  2  
ATOM 1890  H HD2  . ARG A 1 22  ? 5.290   -9.394  7.909   1.00 0.00 ? 22  ARG A HD2  2  
ATOM 1891  H HD3  . ARG A 1 22  ? 5.315   -10.210 6.347   1.00 0.00 ? 22  ARG A HD3  2  
ATOM 1892  H HE   . ARG A 1 22  ? 7.954   -9.858  7.234   1.00 0.00 ? 22  ARG A HE   2  
ATOM 1893  H HH11 . ARG A 1 22  ? 5.087   -11.674 8.011   1.00 0.00 ? 22  ARG A HH11 2  
ATOM 1894  H HH12 . ARG A 1 22  ? 5.959   -13.007 8.692   1.00 0.00 ? 22  ARG A HH12 2  
ATOM 1895  H HH21 . ARG A 1 22  ? 9.113   -11.607 8.129   1.00 0.00 ? 22  ARG A HH21 2  
ATOM 1896  H HH22 . ARG A 1 22  ? 8.248   -12.968 8.760   1.00 0.00 ? 22  ARG A HH22 2  
ATOM 1897  N N    . LEU A 1 23  ? 3.511   -4.410  6.508   1.00 0.00 ? 23  LEU A N    2  
ATOM 1898  C CA   . LEU A 1 23  ? 2.480   -3.486  6.046   1.00 0.00 ? 23  LEU A CA   2  
ATOM 1899  C C    . LEU A 1 23  ? 1.583   -4.148  5.005   1.00 0.00 ? 23  LEU A C    2  
ATOM 1900  O O    . LEU A 1 23  ? 0.359   -4.053  5.075   1.00 0.00 ? 23  LEU A O    2  
ATOM 1901  C CB   . LEU A 1 23  ? 3.121   -2.228  5.459   1.00 0.00 ? 23  LEU A CB   2  
ATOM 1902  C CG   . LEU A 1 23  ? 2.337   -0.928  5.641   1.00 0.00 ? 23  LEU A CG   2  
ATOM 1903  C CD1  . LEU A 1 23  ? 0.884   -1.119  5.234   1.00 0.00 ? 23  LEU A CD1  2  
ATOM 1904  C CD2  . LEU A 1 23  ? 2.429   -0.447  7.082   1.00 0.00 ? 23  LEU A CD2  2  
ATOM 1905  H H    . LEU A 1 23  ? 4.395   -4.058  6.743   1.00 0.00 ? 23  LEU A H    2  
ATOM 1906  H HA   . LEU A 1 23  ? 1.878   -3.210  6.899   1.00 0.00 ? 23  LEU A HA   2  
ATOM 1907  H HB2  . LEU A 1 23  ? 4.086   -2.100  5.924   1.00 0.00 ? 23  LEU A HB2  2  
ATOM 1908  H HB3  . LEU A 1 23  ? 3.253   -2.389  4.398   1.00 0.00 ? 23  LEU A HB3  2  
ATOM 1909  H HG   . LEU A 1 23  ? 2.764   -0.165  5.005   1.00 0.00 ? 23  LEU A HG   2  
ATOM 1910  H HD11 . LEU A 1 23  ? 0.531   -0.230  4.732   1.00 0.00 ? 23  LEU A HD11 2  
ATOM 1911  H HD12 . LEU A 1 23  ? 0.284   -1.298  6.114   1.00 0.00 ? 23  LEU A HD12 2  
ATOM 1912  H HD13 . LEU A 1 23  ? 0.806   -1.965  4.567   1.00 0.00 ? 23  LEU A HD13 2  
ATOM 1913  H HD21 . LEU A 1 23  ? 3.391   0.017   7.245   1.00 0.00 ? 23  LEU A HD21 2  
ATOM 1914  H HD22 . LEU A 1 23  ? 2.318   -1.289  7.750   1.00 0.00 ? 23  LEU A HD22 2  
ATOM 1915  H HD23 . LEU A 1 23  ? 1.646   0.271   7.273   1.00 0.00 ? 23  LEU A HD23 2  
ATOM 1916  N N    . GLY A 1 24  ? 2.203   -4.821  4.039   1.00 0.00 ? 24  GLY A N    2  
ATOM 1917  C CA   . GLY A 1 24  ? 1.445   -5.490  2.998   1.00 0.00 ? 24  GLY A CA   2  
ATOM 1918  C C    . GLY A 1 24  ? 0.889   -4.523  1.972   1.00 0.00 ? 24  GLY A C    2  
ATOM 1919  O O    . GLY A 1 24  ? -0.252  -4.662  1.532   1.00 0.00 ? 24  GLY A O    2  
ATOM 1920  H H    . GLY A 1 24  ? 3.182   -4.862  4.034   1.00 0.00 ? 24  GLY A H    2  
ATOM 1921  H HA2  . GLY A 1 24  ? 2.089   -6.199  2.499   1.00 0.00 ? 24  GLY A HA2  2  
ATOM 1922  H HA3  . GLY A 1 24  ? 0.624   -6.024  3.454   1.00 0.00 ? 24  GLY A HA3  2  
ATOM 1923  N N    . ILE A 1 25  ? 1.697   -3.539  1.591   1.00 0.00 ? 25  ILE A N    2  
ATOM 1924  C CA   . ILE A 1 25  ? 1.279   -2.545  0.611   1.00 0.00 ? 25  ILE A CA   2  
ATOM 1925  C C    . ILE A 1 25  ? 2.212   -2.536  -0.596  1.00 0.00 ? 25  ILE A C    2  
ATOM 1926  O O    . ILE A 1 25  ? 3.326   -3.056  -0.536  1.00 0.00 ? 25  ILE A O    2  
ATOM 1927  C CB   . ILE A 1 25  ? 1.238   -1.132  1.224   1.00 0.00 ? 25  ILE A CB   2  
ATOM 1928  C CG1  . ILE A 1 25  ? 2.396   -0.945  2.205   1.00 0.00 ? 25  ILE A CG1  2  
ATOM 1929  C CG2  . ILE A 1 25  ? -0.095  -0.895  1.918   1.00 0.00 ? 25  ILE A CG2  2  
ATOM 1930  C CD1  . ILE A 1 25  ? 2.838   0.495   2.350   1.00 0.00 ? 25  ILE A CD1  2  
ATOM 1931  H H    . ILE A 1 25  ? 2.595   -3.481  1.977   1.00 0.00 ? 25  ILE A H    2  
ATOM 1932  H HA   . ILE A 1 25  ? 0.283   -2.801  0.280   1.00 0.00 ? 25  ILE A HA   2  
ATOM 1933  H HB   . ILE A 1 25  ? 1.332   -0.414  0.424   1.00 0.00 ? 25  ILE A HB   2  
ATOM 1934  H HG12 . ILE A 1 25  ? 2.097   -1.299  3.179   1.00 0.00 ? 25  ILE A HG12 2  
ATOM 1935  H HG13 . ILE A 1 25  ? 3.245   -1.520  1.863   1.00 0.00 ? 25  ILE A HG13 2  
ATOM 1936  H HG21 . ILE A 1 25  ? -0.518  -1.843  2.218   1.00 0.00 ? 25  ILE A HG21 2  
ATOM 1937  H HG22 . ILE A 1 25  ? 0.059   -0.279  2.791   1.00 0.00 ? 25  ILE A HG22 2  
ATOM 1938  H HG23 . ILE A 1 25  ? -0.771  -0.397  1.240   1.00 0.00 ? 25  ILE A HG23 2  
ATOM 1939  H HD11 . ILE A 1 25  ? 1.983   1.113   2.580   1.00 0.00 ? 25  ILE A HD11 2  
ATOM 1940  H HD12 . ILE A 1 25  ? 3.563   0.571   3.146   1.00 0.00 ? 25  ILE A HD12 2  
ATOM 1941  H HD13 . ILE A 1 25  ? 3.284   0.829   1.424   1.00 0.00 ? 25  ILE A HD13 2  
ATOM 1942  N N    . SER A 1 26  ? 1.749   -1.940  -1.690  1.00 0.00 ? 26  SER A N    2  
ATOM 1943  C CA   . SER A 1 26  ? 2.541   -1.865  -2.912  1.00 0.00 ? 26  SER A CA   2  
ATOM 1944  C C    . SER A 1 26  ? 2.787   -0.413  -3.311  1.00 0.00 ? 26  SER A C    2  
ATOM 1945  O O    . SER A 1 26  ? 2.059   0.488   -2.895  1.00 0.00 ? 26  SER A O    2  
ATOM 1946  C CB   . SER A 1 26  ? 1.834   -2.605  -4.049  1.00 0.00 ? 26  SER A CB   2  
ATOM 1947  O OG   . SER A 1 26  ? 2.771   -3.164  -4.954  1.00 0.00 ? 26  SER A OG   2  
ATOM 1948  H H    . SER A 1 26  ? 0.852   -1.544  -1.676  1.00 0.00 ? 26  SER A H    2  
ATOM 1949  H HA   . SER A 1 26  ? 3.492   -2.340  -2.721  1.00 0.00 ? 26  SER A HA   2  
ATOM 1950  H HB2  . SER A 1 26  ? 1.231   -3.400  -3.638  1.00 0.00 ? 26  SER A HB2  2  
ATOM 1951  H HB3  . SER A 1 26  ? 1.201   -1.914  -4.587  1.00 0.00 ? 26  SER A HB3  2  
ATOM 1952  H HG   . SER A 1 26  ? 2.818   -2.621  -5.744  1.00 0.00 ? 26  SER A HG   2  
ATOM 1953  N N    . ILE A 1 27  ? 3.818   -0.196  -4.121  1.00 0.00 ? 27  ILE A N    2  
ATOM 1954  C CA   . ILE A 1 27  ? 4.161   1.146   -4.577  1.00 0.00 ? 27  ILE A CA   2  
ATOM 1955  C C    . ILE A 1 27  ? 4.846   1.105   -5.939  1.00 0.00 ? 27  ILE A C    2  
ATOM 1956  O O    . ILE A 1 27  ? 5.593   0.174   -6.242  1.00 0.00 ? 27  ILE A O    2  
ATOM 1957  C CB   . ILE A 1 27  ? 5.082   1.864   -3.573  1.00 0.00 ? 27  ILE A CB   2  
ATOM 1958  C CG1  . ILE A 1 27  ? 6.505   1.311   -3.667  1.00 0.00 ? 27  ILE A CG1  2  
ATOM 1959  C CG2  . ILE A 1 27  ? 4.542   1.714   -2.159  1.00 0.00 ? 27  ILE A CG2  2  
ATOM 1960  C CD1  . ILE A 1 27  ? 7.515   2.101   -2.864  1.00 0.00 ? 27  ILE A CD1  2  
ATOM 1961  H H    . ILE A 1 27  ? 4.361   -0.955  -4.418  1.00 0.00 ? 27  ILE A H    2  
ATOM 1962  H HA   . ILE A 1 27  ? 3.245   1.712   -4.664  1.00 0.00 ? 27  ILE A HA   2  
ATOM 1963  H HB   . ILE A 1 27  ? 5.094   2.915   -3.818  1.00 0.00 ? 27  ILE A HB   2  
ATOM 1964  H HG12 . ILE A 1 27  ? 6.515   0.296   -3.304  1.00 0.00 ? 27  ILE A HG12 2  
ATOM 1965  H HG13 . ILE A 1 27  ? 6.820   1.323   -4.701  1.00 0.00 ? 27  ILE A HG13 2  
ATOM 1966  H HG21 . ILE A 1 27  ? 3.565   2.172   -2.096  1.00 0.00 ? 27  ILE A HG21 2  
ATOM 1967  H HG22 . ILE A 1 27  ? 4.464   0.666   -1.913  1.00 0.00 ? 27  ILE A HG22 2  
ATOM 1968  H HG23 . ILE A 1 27  ? 5.212   2.199   -1.464  1.00 0.00 ? 27  ILE A HG23 2  
ATOM 1969  H HD11 . ILE A 1 27  ? 7.035   2.970   -2.438  1.00 0.00 ? 27  ILE A HD11 2  
ATOM 1970  H HD12 . ILE A 1 27  ? 7.910   1.482   -2.073  1.00 0.00 ? 27  ILE A HD12 2  
ATOM 1971  H HD13 . ILE A 1 27  ? 8.321   2.417   -3.510  1.00 0.00 ? 27  ILE A HD13 2  
ATOM 1972  N N    . ARG A 1 28  ? 4.588   2.121   -6.756  1.00 0.00 ? 28  ARG A N    2  
ATOM 1973  C CA   . ARG A 1 28  ? 5.181   2.202   -8.085  1.00 0.00 ? 28  ARG A CA   2  
ATOM 1974  C C    . ARG A 1 28  ? 5.830   3.564   -8.310  1.00 0.00 ? 28  ARG A C    2  
ATOM 1975  O O    . ARG A 1 28  ? 5.229   4.602   -8.034  1.00 0.00 ? 28  ARG A O    2  
ATOM 1976  C CB   . ARG A 1 28  ? 4.119   1.948   -9.156  1.00 0.00 ? 28  ARG A CB   2  
ATOM 1977  C CG   . ARG A 1 28  ? 2.998   2.975   -9.158  1.00 0.00 ? 28  ARG A CG   2  
ATOM 1978  C CD   . ARG A 1 28  ? 2.159   2.882   -10.423 1.00 0.00 ? 28  ARG A CD   2  
ATOM 1979  N NE   . ARG A 1 28  ? 1.275   1.720   -10.409 1.00 0.00 ? 28  ARG A NE   2  
ATOM 1980  C CZ   . ARG A 1 28  ? 0.717   1.208   -11.501 1.00 0.00 ? 28  ARG A CZ   2  
ATOM 1981  N NH1  . ARG A 1 28  ? 0.952   1.752   -12.687 1.00 0.00 ? 28  ARG A NH1  2  
ATOM 1982  N NH2  . ARG A 1 28  ? -0.076  0.148   -11.407 1.00 0.00 ? 28  ARG A NH2  2  
ATOM 1983  H H    . ARG A 1 28  ? 3.985   2.833   -6.457  1.00 0.00 ? 28  ARG A H    2  
ATOM 1984  H HA   . ARG A 1 28  ? 5.941   1.438   -8.157  1.00 0.00 ? 28  ARG A HA   2  
ATOM 1985  H HB2  . ARG A 1 28  ? 4.592   1.963   -10.127 1.00 0.00 ? 28  ARG A HB2  2  
ATOM 1986  H HB3  . ARG A 1 28  ? 3.684   0.974   -8.991  1.00 0.00 ? 28  ARG A HB3  2  
ATOM 1987  H HG2  . ARG A 1 28  ? 2.361   2.801   -8.303  1.00 0.00 ? 28  ARG A HG2  2  
ATOM 1988  H HG3  . ARG A 1 28  ? 3.428   3.963   -9.093  1.00 0.00 ? 28  ARG A HG3  2  
ATOM 1989  H HD2  . ARG A 1 28  ? 1.561   3.777   -10.509 1.00 0.00 ? 28  ARG A HD2  2  
ATOM 1990  H HD3  . ARG A 1 28  ? 2.821   2.810   -11.273 1.00 0.00 ? 28  ARG A HD3  2  
ATOM 1991  H HE   . ARG A 1 28  ? 1.088   1.302   -9.543  1.00 0.00 ? 28  ARG A HE   2  
ATOM 1992  H HH11 . ARG A 1 28  ? 1.550   2.550   -12.760 1.00 0.00 ? 28  ARG A HH11 2  
ATOM 1993  H HH12 . ARG A 1 28  ? 0.532   1.364   -13.507 1.00 0.00 ? 28  ARG A HH12 2  
ATOM 1994  H HH21 . ARG A 1 28  ? -0.255  -0.265  -10.515 1.00 0.00 ? 28  ARG A HH21 2  
ATOM 1995  H HH22 . ARG A 1 28  ? -0.495  -0.236  -12.229 1.00 0.00 ? 28  ARG A HH22 2  
ATOM 1996  N N    . GLY A 1 29  ? 7.061   3.553   -8.811  1.00 0.00 ? 29  GLY A N    2  
ATOM 1997  C CA   . GLY A 1 29  ? 7.771   4.793   -9.063  1.00 0.00 ? 29  GLY A CA   2  
ATOM 1998  C C    . GLY A 1 29  ? 9.272   4.642   -8.914  1.00 0.00 ? 29  GLY A C    2  
ATOM 1999  O O    . GLY A 1 29  ? 9.831   3.591   -9.223  1.00 0.00 ? 29  GLY A O    2  
ATOM 2000  H H    . GLY A 1 29  ? 7.491   2.695   -9.011  1.00 0.00 ? 29  GLY A H    2  
ATOM 2001  H HA2  . GLY A 1 29  ? 7.551   5.124   -10.067 1.00 0.00 ? 29  GLY A HA2  2  
ATOM 2002  H HA3  . GLY A 1 29  ? 7.425   5.541   -8.365  1.00 0.00 ? 29  GLY A HA3  2  
ATOM 2003  N N    . GLY A 1 30  ? 9.927   5.698   -8.440  1.00 0.00 ? 30  GLY A N    2  
ATOM 2004  C CA   . GLY A 1 30  ? 11.367  5.658   -8.261  1.00 0.00 ? 30  GLY A CA   2  
ATOM 2005  C C    . GLY A 1 30  ? 12.071  6.798   -8.971  1.00 0.00 ? 30  GLY A C    2  
ATOM 2006  O O    . GLY A 1 30  ? 11.714  7.153   -10.094 1.00 0.00 ? 30  GLY A O    2  
ATOM 2007  H H    . GLY A 1 30  ? 9.429   6.510   -8.211  1.00 0.00 ? 30  GLY A H    2  
ATOM 2008  H HA2  . GLY A 1 30  ? 11.589  5.713   -7.206  1.00 0.00 ? 30  GLY A HA2  2  
ATOM 2009  H HA3  . GLY A 1 30  ? 11.741  4.722   -8.650  1.00 0.00 ? 30  GLY A HA3  2  
ATOM 2010  N N    . ALA A 1 31  ? 13.073  7.373   -8.315  1.00 0.00 ? 31  ALA A N    2  
ATOM 2011  C CA   . ALA A 1 31  ? 13.829  8.478   -8.890  1.00 0.00 ? 31  ALA A CA   2  
ATOM 2012  C C    . ALA A 1 31  ? 14.355  8.121   -10.276 1.00 0.00 ? 31  ALA A C    2  
ATOM 2013  O O    . ALA A 1 31  ? 14.779  8.994   -11.033 1.00 0.00 ? 31  ALA A O    2  
ATOM 2014  C CB   . ALA A 1 31  ? 14.978  8.866   -7.972  1.00 0.00 ? 31  ALA A CB   2  
ATOM 2015  H H    . ALA A 1 31  ? 13.311  7.044   -7.423  1.00 0.00 ? 31  ALA A H    2  
ATOM 2016  H HA   . ALA A 1 31  ? 13.166  9.327   -8.975  1.00 0.00 ? 31  ALA A HA   2  
ATOM 2017  H HB1  . ALA A 1 31  ? 15.512  9.703   -8.398  1.00 0.00 ? 31  ALA A HB1  2  
ATOM 2018  H HB2  . ALA A 1 31  ? 14.588  9.143   -7.004  1.00 0.00 ? 31  ALA A HB2  2  
ATOM 2019  H HB3  . ALA A 1 31  ? 15.651  8.029   -7.863  1.00 0.00 ? 31  ALA A HB3  2  
ATOM 2020  N N    . ARG A 1 32  ? 14.324  6.833   -10.602 1.00 0.00 ? 32  ARG A N    2  
ATOM 2021  C CA   . ARG A 1 32  ? 14.800  6.360   -11.896 1.00 0.00 ? 32  ARG A CA   2  
ATOM 2022  C C    . ARG A 1 32  ? 13.707  5.585   -12.627 1.00 0.00 ? 32  ARG A C    2  
ATOM 2023  O O    . ARG A 1 32  ? 13.674  5.550   -13.856 1.00 0.00 ? 32  ARG A O    2  
ATOM 2024  C CB   . ARG A 1 32  ? 16.035  5.475   -11.718 1.00 0.00 ? 32  ARG A CB   2  
ATOM 2025  C CG   . ARG A 1 32  ? 15.899  4.458   -10.598 1.00 0.00 ? 32  ARG A CG   2  
ATOM 2026  C CD   . ARG A 1 32  ? 17.154  3.610   -10.459 1.00 0.00 ? 32  ARG A CD   2  
ATOM 2027  N NE   . ARG A 1 32  ? 18.315  4.410   -10.080 1.00 0.00 ? 32  ARG A NE   2  
ATOM 2028  C CZ   . ARG A 1 32  ? 19.542  3.915   -9.964  1.00 0.00 ? 32  ARG A CZ   2  
ATOM 2029  N NH1  . ARG A 1 32  ? 19.767  2.629   -10.197 1.00 0.00 ? 32  ARG A NH1  2  
ATOM 2030  N NH2  . ARG A 1 32  ? 20.548  4.707   -9.615  1.00 0.00 ? 32  ARG A NH2  2  
ATOM 2031  H H    . ARG A 1 32  ? 13.975  6.184   -9.955  1.00 0.00 ? 32  ARG A H    2  
ATOM 2032  H HA   . ARG A 1 32  ? 15.069  7.224   -12.486 1.00 0.00 ? 32  ARG A HA   2  
ATOM 2033  H HB2  . ARG A 1 32  ? 16.217  4.941   -12.639 1.00 0.00 ? 32  ARG A HB2  2  
ATOM 2034  H HB3  . ARG A 1 32  ? 16.885  6.105   -11.502 1.00 0.00 ? 32  ARG A HB3  2  
ATOM 2035  H HG2  . ARG A 1 32  ? 15.726  4.980   -9.668  1.00 0.00 ? 32  ARG A HG2  2  
ATOM 2036  H HG3  . ARG A 1 32  ? 15.060  3.812   -10.811 1.00 0.00 ? 32  ARG A HG3  2  
ATOM 2037  H HD2  . ARG A 1 32  ? 16.983  2.860   -9.701  1.00 0.00 ? 32  ARG A HD2  2  
ATOM 2038  H HD3  . ARG A 1 32  ? 17.352  3.128   -11.404 1.00 0.00 ? 32  ARG A HD3  2  
ATOM 2039  H HE   . ARG A 1 32  ? 18.172  5.363   -9.903  1.00 0.00 ? 32  ARG A HE   2  
ATOM 2040  H HH11 . ARG A 1 32  ? 19.011  2.031   -10.461 1.00 0.00 ? 32  ARG A HH11 2  
ATOM 2041  H HH12 . ARG A 1 32  ? 20.692  2.259   -10.110 1.00 0.00 ? 32  ARG A HH12 2  
ATOM 2042  H HH21 . ARG A 1 32  ? 20.383  5.677   -9.439  1.00 0.00 ? 32  ARG A HH21 2  
ATOM 2043  H HH22 . ARG A 1 32  ? 21.471  4.334   -9.528  1.00 0.00 ? 32  ARG A HH22 2  
ATOM 2044  N N    . GLY A 1 33  ? 12.815  4.966   -11.861 1.00 0.00 ? 33  GLY A N    2  
ATOM 2045  C CA   . GLY A 1 33  ? 11.734  4.199   -12.453 1.00 0.00 ? 33  GLY A CA   2  
ATOM 2046  C C    . GLY A 1 33  ? 11.220  4.818   -13.738 1.00 0.00 ? 33  GLY A C    2  
ATOM 2047  O O    . GLY A 1 33  ? 10.827  5.985   -13.760 1.00 0.00 ? 33  GLY A O    2  
ATOM 2048  H H    . GLY A 1 33  ? 12.891  5.029   -10.886 1.00 0.00 ? 33  GLY A H    2  
ATOM 2049  H HA2  . GLY A 1 33  ? 12.087  3.201   -12.662 1.00 0.00 ? 33  GLY A HA2  2  
ATOM 2050  H HA3  . GLY A 1 33  ? 10.920  4.141   -11.745 1.00 0.00 ? 33  GLY A HA3  2  
ATOM 2051  N N    . HIS A 1 34  ? 11.224  4.036   -14.812 1.00 0.00 ? 34  HIS A N    2  
ATOM 2052  C CA   . HIS A 1 34  ? 10.756  4.515   -16.108 1.00 0.00 ? 34  HIS A CA   2  
ATOM 2053  C C    . HIS A 1 34  ? 9.546   5.430   -15.944 1.00 0.00 ? 34  HIS A C    2  
ATOM 2054  O O    . HIS A 1 34  ? 9.375   6.389   -16.697 1.00 0.00 ? 34  HIS A O    2  
ATOM 2055  C CB   . HIS A 1 34  ? 10.399  3.335   -17.013 1.00 0.00 ? 34  HIS A CB   2  
ATOM 2056  C CG   . HIS A 1 34  ? 11.590  2.559   -17.483 1.00 0.00 ? 34  HIS A CG   2  
ATOM 2057  N ND1  . HIS A 1 34  ? 12.385  2.963   -18.535 1.00 0.00 ? 34  HIS A ND1  2  
ATOM 2058  C CD2  . HIS A 1 34  ? 12.122  1.397   -17.036 1.00 0.00 ? 34  HIS A CD2  2  
ATOM 2059  C CE1  . HIS A 1 34  ? 13.352  2.082   -18.716 1.00 0.00 ? 34  HIS A CE1  2  
ATOM 2060  N NE2  . HIS A 1 34  ? 13.216  1.122   -17.820 1.00 0.00 ? 34  HIS A NE2  2  
ATOM 2061  H H    . HIS A 1 34  ? 11.549  3.115   -14.732 1.00 0.00 ? 34  HIS A H    2  
ATOM 2062  H HA   . HIS A 1 34  ? 11.557  5.077   -16.564 1.00 0.00 ? 34  HIS A HA   2  
ATOM 2063  H HB2  . HIS A 1 34  ? 9.754   2.658   -16.472 1.00 0.00 ? 34  HIS A HB2  2  
ATOM 2064  H HB3  . HIS A 1 34  ? 9.877   3.703   -17.884 1.00 0.00 ? 34  HIS A HB3  2  
ATOM 2065  H HD1  . HIS A 1 34  ? 12.257  3.773   -19.070 1.00 0.00 ? 34  HIS A HD1  2  
ATOM 2066  H HD2  . HIS A 1 34  ? 11.754  0.796   -16.216 1.00 0.00 ? 34  HIS A HD2  2  
ATOM 2067  H HE1  . HIS A 1 34  ? 14.125  2.137   -19.469 1.00 0.00 ? 34  HIS A HE1  2  
ATOM 2068  H HE2  . HIS A 1 34  ? 13.749  0.301   -17.786 1.00 0.00 ? 34  HIS A HE2  2  
ATOM 2069  N N    . ALA A 1 35  ? 8.710   5.127   -14.957 1.00 0.00 ? 35  ALA A N    2  
ATOM 2070  C CA   . ALA A 1 35  ? 7.518   5.923   -14.694 1.00 0.00 ? 35  ALA A CA   2  
ATOM 2071  C C    . ALA A 1 35  ? 6.801   5.439   -13.438 1.00 0.00 ? 35  ALA A C    2  
ATOM 2072  O O    . ALA A 1 35  ? 7.174   4.425   -12.850 1.00 0.00 ? 35  ALA A O    2  
ATOM 2073  C CB   . ALA A 1 35  ? 6.579   5.878   -15.890 1.00 0.00 ? 35  ALA A CB   2  
ATOM 2074  H H    . ALA A 1 35  ? 8.901   4.350   -14.391 1.00 0.00 ? 35  ALA A H    2  
ATOM 2075  H HA   . ALA A 1 35  ? 7.826   6.948   -14.548 1.00 0.00 ? 35  ALA A HA   2  
ATOM 2076  H HB1  . ALA A 1 35  ? 6.068   6.826   -15.982 1.00 0.00 ? 35  ALA A HB1  2  
ATOM 2077  H HB2  . ALA A 1 35  ? 7.148   5.687   -16.788 1.00 0.00 ? 35  ALA A HB2  2  
ATOM 2078  H HB3  . ALA A 1 35  ? 5.854   5.090   -15.749 1.00 0.00 ? 35  ALA A HB3  2  
ATOM 2079  N N    . GLY A 1 36  ? 5.769   6.173   -13.031 1.00 0.00 ? 36  GLY A N    2  
ATOM 2080  C CA   . GLY A 1 36  ? 5.017   5.802   -11.847 1.00 0.00 ? 36  GLY A CA   2  
ATOM 2081  C C    . GLY A 1 36  ? 3.872   6.756   -11.565 1.00 0.00 ? 36  GLY A C    2  
ATOM 2082  O O    . GLY A 1 36  ? 3.526   6.996   -10.410 1.00 0.00 ? 36  GLY A O    2  
ATOM 2083  H H    . GLY A 1 36  ? 5.516   6.972   -13.540 1.00 0.00 ? 36  GLY A H    2  
ATOM 2084  H HA2  . GLY A 1 36  ? 4.618   4.808   -11.983 1.00 0.00 ? 36  GLY A HA2  2  
ATOM 2085  H HA3  . GLY A 1 36  ? 5.684   5.799   -10.997 1.00 0.00 ? 36  GLY A HA3  2  
ATOM 2086  N N    . ASN A 1 37  ? 3.284   7.301   -12.625 1.00 0.00 ? 37  ASN A N    2  
ATOM 2087  C CA   . ASN A 1 37  ? 2.173   8.235   -12.486 1.00 0.00 ? 37  ASN A CA   2  
ATOM 2088  C C    . ASN A 1 37  ? 1.306   8.241   -13.742 1.00 0.00 ? 37  ASN A C    2  
ATOM 2089  O O    . ASN A 1 37  ? 1.754   8.593   -14.834 1.00 0.00 ? 37  ASN A O    2  
ATOM 2090  C CB   . ASN A 1 37  ? 2.697   9.646   -12.209 1.00 0.00 ? 37  ASN A CB   2  
ATOM 2091  C CG   . ASN A 1 37  ? 1.691   10.500  -11.462 1.00 0.00 ? 37  ASN A CG   2  
ATOM 2092  O OD1  . ASN A 1 37  ? 0.691   9.996   -10.950 1.00 0.00 ? 37  ASN A OD1  2  
ATOM 2093  N ND2  . ASN A 1 37  ? 1.953   11.800  -11.395 1.00 0.00 ? 37  ASN A ND2  2  
ATOM 2094  H H    . ASN A 1 37  ? 3.605   7.070   -13.522 1.00 0.00 ? 37  ASN A H    2  
ATOM 2095  H HA   . ASN A 1 37  ? 1.572   7.913   -11.650 1.00 0.00 ? 37  ASN A HA   2  
ATOM 2096  H HB2  . ASN A 1 37  ? 3.596   9.579   -11.614 1.00 0.00 ? 37  ASN A HB2  2  
ATOM 2097  H HB3  . ASN A 1 37  ? 2.927   10.129  -13.147 1.00 0.00 ? 37  ASN A HB3  2  
ATOM 2098  H HD21 . ASN A 1 37  ? 2.769   12.131  -11.826 1.00 0.00 ? 37  ASN A HD21 2  
ATOM 2099  H HD22 . ASN A 1 37  ? 1.320   12.375  -10.918 1.00 0.00 ? 37  ASN A HD22 2  
ATOM 2100  N N    . PRO A 1 38  ? 0.036   7.841   -13.586 1.00 0.00 ? 38  PRO A N    2  
ATOM 2101  C CA   . PRO A 1 38  ? -0.921  7.791   -14.695 1.00 0.00 ? 38  PRO A CA   2  
ATOM 2102  C C    . PRO A 1 38  ? -1.315  9.181   -15.183 1.00 0.00 ? 38  PRO A C    2  
ATOM 2103  O O    . PRO A 1 38  ? -2.142  9.322   -16.084 1.00 0.00 ? 38  PRO A O    2  
ATOM 2104  C CB   . PRO A 1 38  ? -2.130  7.074   -14.090 1.00 0.00 ? 38  PRO A CB   2  
ATOM 2105  C CG   . PRO A 1 38  ? -2.034  7.339   -12.627 1.00 0.00 ? 38  PRO A CG   2  
ATOM 2106  C CD   . PRO A 1 38  ? -0.565  7.406   -12.314 1.00 0.00 ? 38  PRO A CD   2  
ATOM 2107  H HA   . PRO A 1 38  ? -0.537  7.216   -15.525 1.00 0.00 ? 38  PRO A HA   2  
ATOM 2108  H HB2  . PRO A 1 38  ? -3.040  7.481   -14.508 1.00 0.00 ? 38  PRO A HB2  2  
ATOM 2109  H HB3  . PRO A 1 38  ? -2.071  6.017   -14.304 1.00 0.00 ? 38  PRO A HB3  2  
ATOM 2110  H HG2  . PRO A 1 38  ? -2.511  8.279   -12.392 1.00 0.00 ? 38  PRO A HG2  2  
ATOM 2111  H HG3  . PRO A 1 38  ? -2.498  6.534   -12.077 1.00 0.00 ? 38  PRO A HG3  2  
ATOM 2112  H HD2  . PRO A 1 38  ? -0.379  8.129   -11.533 1.00 0.00 ? 38  PRO A HD2  2  
ATOM 2113  H HD3  . PRO A 1 38  ? -0.196  6.433   -12.026 1.00 0.00 ? 38  PRO A HD3  2  
ATOM 2114  N N    . ARG A 1 39  ? -0.718  10.205  -14.583 1.00 0.00 ? 39  ARG A N    2  
ATOM 2115  C CA   . ARG A 1 39  ? -1.008  11.585  -14.956 1.00 0.00 ? 39  ARG A CA   2  
ATOM 2116  C C    . ARG A 1 39  ? 0.121   12.168  -15.800 1.00 0.00 ? 39  ARG A C    2  
ATOM 2117  O O    . ARG A 1 39  ? -0.121  12.777  -16.843 1.00 0.00 ? 39  ARG A O    2  
ATOM 2118  C CB   . ARG A 1 39  ? -1.219  12.440  -13.705 1.00 0.00 ? 39  ARG A CB   2  
ATOM 2119  C CG   . ARG A 1 39  ? -2.629  12.361  -13.143 1.00 0.00 ? 39  ARG A CG   2  
ATOM 2120  C CD   . ARG A 1 39  ? -2.685  12.856  -11.706 1.00 0.00 ? 39  ARG A CD   2  
ATOM 2121  N NE   . ARG A 1 39  ? -2.955  14.289  -11.632 1.00 0.00 ? 39  ARG A NE   2  
ATOM 2122  C CZ   . ARG A 1 39  ? -3.203  14.931  -10.496 1.00 0.00 ? 39  ARG A CZ   2  
ATOM 2123  N NH1  . ARG A 1 39  ? -3.213  14.272  -9.345  1.00 0.00 ? 39  ARG A NH1  2  
ATOM 2124  N NH2  . ARG A 1 39  ? -3.440  16.237  -10.509 1.00 0.00 ? 39  ARG A NH2  2  
ATOM 2125  H H    . ARG A 1 39  ? -0.068  10.030  -13.871 1.00 0.00 ? 39  ARG A H    2  
ATOM 2126  H HA   . ARG A 1 39  ? -1.916  11.586  -15.540 1.00 0.00 ? 39  ARG A HA   2  
ATOM 2127  H HB2  . ARG A 1 39  ? -0.531  12.113  -12.939 1.00 0.00 ? 39  ARG A HB2  2  
ATOM 2128  H HB3  . ARG A 1 39  ? -1.010  13.471  -13.950 1.00 0.00 ? 39  ARG A HB3  2  
ATOM 2129  H HG2  . ARG A 1 39  ? -3.283  12.971  -13.748 1.00 0.00 ? 39  ARG A HG2  2  
ATOM 2130  H HG3  . ARG A 1 39  ? -2.961  11.334  -13.175 1.00 0.00 ? 39  ARG A HG3  2  
ATOM 2131  H HD2  . ARG A 1 39  ? -3.468  12.324  -11.187 1.00 0.00 ? 39  ARG A HD2  2  
ATOM 2132  H HD3  . ARG A 1 39  ? -1.736  12.652  -11.233 1.00 0.00 ? 39  ARG A HD3  2  
ATOM 2133  H HE   . ARG A 1 39  ? -2.952  14.796  -12.470 1.00 0.00 ? 39  ARG A HE   2  
ATOM 2134  H HH11 . ARG A 1 39  ? -3.034  13.288  -9.333  1.00 0.00 ? 39  ARG A HH11 2  
ATOM 2135  H HH12 . ARG A 1 39  ? -3.398  14.758  -8.491  1.00 0.00 ? 39  ARG A HH12 2  
ATOM 2136  H HH21 . ARG A 1 39  ? -3.432  16.738  -11.374 1.00 0.00 ? 39  ARG A HH21 2  
ATOM 2137  H HH22 . ARG A 1 39  ? -3.626  16.720  -9.653  1.00 0.00 ? 39  ARG A HH22 2  
ATOM 2138  N N    . ASP A 1 40  ? 1.353   11.979  -15.343 1.00 0.00 ? 40  ASP A N    2  
ATOM 2139  C CA   . ASP A 1 40  ? 2.520   12.486  -16.056 1.00 0.00 ? 40  ASP A CA   2  
ATOM 2140  C C    . ASP A 1 40  ? 3.664   11.477  -16.012 1.00 0.00 ? 40  ASP A C    2  
ATOM 2141  O O    . ASP A 1 40  ? 4.191   11.145  -14.950 1.00 0.00 ? 40  ASP A O    2  
ATOM 2142  C CB   . ASP A 1 40  ? 2.974   13.817  -15.454 1.00 0.00 ? 40  ASP A CB   2  
ATOM 2143  C CG   . ASP A 1 40  ? 2.108   14.979  -15.899 1.00 0.00 ? 40  ASP A CG   2  
ATOM 2144  O OD1  . ASP A 1 40  ? 2.307   15.469  -17.030 1.00 0.00 ? 40  ASP A OD1  2  
ATOM 2145  O OD2  . ASP A 1 40  ? 1.230   15.397  -15.116 1.00 0.00 ? 40  ASP A OD2  2  
ATOM 2146  H H    . ASP A 1 40  ? 1.482   11.486  -14.505 1.00 0.00 ? 40  ASP A H    2  
ATOM 2147  H HA   . ASP A 1 40  ? 2.236   12.645  -17.085 1.00 0.00 ? 40  ASP A HA   2  
ATOM 2148  H HB2  . ASP A 1 40  ? 2.929   13.751  -14.376 1.00 0.00 ? 40  ASP A HB2  2  
ATOM 2149  H HB3  . ASP A 1 40  ? 3.992   14.013  -15.756 1.00 0.00 ? 40  ASP A HB3  2  
ATOM 2150  N N    . PRO A 1 41  ? 4.058   10.978  -17.193 1.00 0.00 ? 41  PRO A N    2  
ATOM 2151  C CA   . PRO A 1 41  ? 5.143   10.000  -17.317 1.00 0.00 ? 41  PRO A CA   2  
ATOM 2152  C C    . PRO A 1 41  ? 6.507   10.605  -17.007 1.00 0.00 ? 41  PRO A C    2  
ATOM 2153  O O    . PRO A 1 41  ? 7.415   9.914   -16.542 1.00 0.00 ? 41  PRO A O    2  
ATOM 2154  C CB   . PRO A 1 41  ? 5.069   9.571   -18.784 1.00 0.00 ? 41  PRO A CB   2  
ATOM 2155  C CG   . PRO A 1 41  ? 4.436   10.724  -19.484 1.00 0.00 ? 41  PRO A CG   2  
ATOM 2156  C CD   . PRO A 1 41  ? 3.475   11.330  -18.499 1.00 0.00 ? 41  PRO A CD   2  
ATOM 2157  H HA   . PRO A 1 41  ? 4.978   9.142   -16.681 1.00 0.00 ? 41  PRO A HA   2  
ATOM 2158  H HB2  . PRO A 1 41  ? 6.065   9.380   -19.157 1.00 0.00 ? 41  PRO A HB2  2  
ATOM 2159  H HB3  . PRO A 1 41  ? 4.468   8.678   -18.872 1.00 0.00 ? 41  PRO A HB3  2  
ATOM 2160  H HG2  . PRO A 1 41  ? 5.190   11.444  -19.763 1.00 0.00 ? 41  PRO A HG2  2  
ATOM 2161  H HG3  . PRO A 1 41  ? 3.906   10.376  -20.358 1.00 0.00 ? 41  PRO A HG3  2  
ATOM 2162  H HD2  . PRO A 1 41  ? 3.430   12.401  -18.625 1.00 0.00 ? 41  PRO A HD2  2  
ATOM 2163  H HD3  . PRO A 1 41  ? 2.493   10.893  -18.612 1.00 0.00 ? 41  PRO A HD3  2  
ATOM 2164  N N    . THR A 1 42  ? 6.647   11.902  -17.266 1.00 0.00 ? 42  THR A N    2  
ATOM 2165  C CA   . THR A 1 42  ? 7.901   12.601  -17.016 1.00 0.00 ? 42  THR A CA   2  
ATOM 2166  C C    . THR A 1 42  ? 8.019   13.012  -15.553 1.00 0.00 ? 42  THR A C    2  
ATOM 2167  O O    . THR A 1 42  ? 8.410   14.138  -15.244 1.00 0.00 ? 42  THR A O    2  
ATOM 2168  C CB   . THR A 1 42  ? 8.033   13.854  -17.902 1.00 0.00 ? 42  THR A CB   2  
ATOM 2169  O OG1  . THR A 1 42  ? 6.824   14.620  -17.850 1.00 0.00 ? 42  THR A OG1  2  
ATOM 2170  C CG2  . THR A 1 42  ? 8.334   13.468  -19.343 1.00 0.00 ? 42  THR A CG2  2  
ATOM 2171  H H    . THR A 1 42  ? 5.888   12.399  -17.636 1.00 0.00 ? 42  THR A H    2  
ATOM 2172  H HA   . THR A 1 42  ? 8.712   11.928  -17.257 1.00 0.00 ? 42  THR A HA   2  
ATOM 2173  H HB   . THR A 1 42  ? 8.849   14.456  -17.528 1.00 0.00 ? 42  THR A HB   2  
ATOM 2174  H HG1  . THR A 1 42  ? 6.201   14.279  -18.496 1.00 0.00 ? 42  THR A HG1  2  
ATOM 2175  H HG21 . THR A 1 42  ? 7.565   12.802  -19.705 1.00 0.00 ? 42  THR A HG21 2  
ATOM 2176  H HG22 . THR A 1 42  ? 9.292   12.973  -19.390 1.00 0.00 ? 42  THR A HG22 2  
ATOM 2177  H HG23 . THR A 1 42  ? 8.357   14.357  -19.955 1.00 0.00 ? 42  THR A HG23 2  
ATOM 2178  N N    . ASP A 1 43  ? 7.678   12.094  -14.655 1.00 0.00 ? 43  ASP A N    2  
ATOM 2179  C CA   . ASP A 1 43  ? 7.747   12.361  -13.223 1.00 0.00 ? 43  ASP A CA   2  
ATOM 2180  C C    . ASP A 1 43  ? 8.188   11.116  -12.459 1.00 0.00 ? 43  ASP A C    2  
ATOM 2181  O O    . ASP A 1 43  ? 7.485   10.106  -12.443 1.00 0.00 ? 43  ASP A O    2  
ATOM 2182  C CB   . ASP A 1 43  ? 6.390   12.839  -12.706 1.00 0.00 ? 43  ASP A CB   2  
ATOM 2183  C CG   . ASP A 1 43  ? 6.516   13.727  -11.484 1.00 0.00 ? 43  ASP A CG   2  
ATOM 2184  O OD1  . ASP A 1 43  ? 6.793   14.933  -11.652 1.00 0.00 ? 43  ASP A OD1  2  
ATOM 2185  O OD2  . ASP A 1 43  ? 6.337   13.216  -10.359 1.00 0.00 ? 43  ASP A OD2  2  
ATOM 2186  H H    . ASP A 1 43  ? 7.374   11.214  -14.964 1.00 0.00 ? 43  ASP A H    2  
ATOM 2187  H HA   . ASP A 1 43  ? 8.477   13.141  -13.067 1.00 0.00 ? 43  ASP A HA   2  
ATOM 2188  H HB2  . ASP A 1 43  ? 5.892   13.399  -13.485 1.00 0.00 ? 43  ASP A HB2  2  
ATOM 2189  H HB3  . ASP A 1 43  ? 5.789   11.980  -12.445 1.00 0.00 ? 43  ASP A HB3  2  
ATOM 2190  N N    . GLU A 1 44  ? 9.355   11.197  -11.828 1.00 0.00 ? 44  GLU A N    2  
ATOM 2191  C CA   . GLU A 1 44  ? 9.889   10.076  -11.064 1.00 0.00 ? 44  GLU A CA   2  
ATOM 2192  C C    . GLU A 1 44  ? 9.258   10.014  -9.676  1.00 0.00 ? 44  GLU A C    2  
ATOM 2193  O O    . GLU A 1 44  ? 9.939   9.764   -8.683  1.00 0.00 ? 44  GLU A O    2  
ATOM 2194  C CB   . GLU A 1 44  ? 11.410  10.193  -10.940 1.00 0.00 ? 44  GLU A CB   2  
ATOM 2195  C CG   . GLU A 1 44  ? 12.124  10.289  -12.278 1.00 0.00 ? 44  GLU A CG   2  
ATOM 2196  C CD   . GLU A 1 44  ? 11.686  11.494  -13.087 1.00 0.00 ? 44  GLU A CD   2  
ATOM 2197  O OE1  . GLU A 1 44  ? 11.562  12.590  -12.502 1.00 0.00 ? 44  GLU A OE1  2  
ATOM 2198  O OE2  . GLU A 1 44  ? 11.467  11.341  -14.307 1.00 0.00 ? 44  GLU A OE2  2  
ATOM 2199  H H    . GLU A 1 44  ? 9.869   12.030  -11.879 1.00 0.00 ? 44  GLU A H    2  
ATOM 2200  H HA   . GLU A 1 44  ? 9.649   9.168   -11.596 1.00 0.00 ? 44  GLU A HA   2  
ATOM 2201  H HB2  . GLU A 1 44  ? 11.645  11.076  -10.364 1.00 0.00 ? 44  GLU A HB2  2  
ATOM 2202  H HB3  . GLU A 1 44  ? 11.784  9.324   -10.418 1.00 0.00 ? 44  GLU A HB3  2  
ATOM 2203  H HG2  . GLU A 1 44  ? 13.186  10.362  -12.100 1.00 0.00 ? 44  GLU A HG2  2  
ATOM 2204  H HG3  . GLU A 1 44  ? 11.916  9.396   -12.848 1.00 0.00 ? 44  GLU A HG3  2  
ATOM 2205  N N    . GLY A 1 45  ? 7.950   10.245  -9.616  1.00 0.00 ? 45  GLY A N    2  
ATOM 2206  C CA   . GLY A 1 45  ? 7.248   10.212  -8.346  1.00 0.00 ? 45  GLY A CA   2  
ATOM 2207  C C    . GLY A 1 45  ? 7.054   8.801   -7.828  1.00 0.00 ? 45  GLY A C    2  
ATOM 2208  O O    . GLY A 1 45  ? 7.402   7.832   -8.503  1.00 0.00 ? 45  GLY A O    2  
ATOM 2209  H H    . GLY A 1 45  ? 7.457   10.440  -10.441 1.00 0.00 ? 45  GLY A H    2  
ATOM 2210  H HA2  . GLY A 1 45  ? 7.813   10.777  -7.620  1.00 0.00 ? 45  GLY A HA2  2  
ATOM 2211  H HA3  . GLY A 1 45  ? 6.279   10.674  -8.472  1.00 0.00 ? 45  GLY A HA3  2  
ATOM 2212  N N    . ILE A 1 46  ? 6.498   8.685   -6.627  1.00 0.00 ? 46  ILE A N    2  
ATOM 2213  C CA   . ILE A 1 46  ? 6.259   7.382   -6.019  1.00 0.00 ? 46  ILE A CA   2  
ATOM 2214  C C    . ILE A 1 46  ? 4.906   7.343   -5.316  1.00 0.00 ? 46  ILE A C    2  
ATOM 2215  O O    . ILE A 1 46  ? 4.679   8.064   -4.344  1.00 0.00 ? 46  ILE A O    2  
ATOM 2216  C CB   . ILE A 1 46  ? 7.362   7.022   -5.006  1.00 0.00 ? 46  ILE A CB   2  
ATOM 2217  C CG1  . ILE A 1 46  ? 8.737   7.085   -5.673  1.00 0.00 ? 46  ILE A CG1  2  
ATOM 2218  C CG2  . ILE A 1 46  ? 7.113   5.640   -4.421  1.00 0.00 ? 46  ILE A CG2  2  
ATOM 2219  C CD1  . ILE A 1 46  ? 9.887   7.061   -4.691  1.00 0.00 ? 46  ILE A CD1  2  
ATOM 2220  H H    . ILE A 1 46  ? 6.241   9.495   -6.138  1.00 0.00 ? 46  ILE A H    2  
ATOM 2221  H HA   . ILE A 1 46  ? 6.265   6.641   -6.806  1.00 0.00 ? 46  ILE A HA   2  
ATOM 2222  H HB   . ILE A 1 46  ? 7.327   7.739   -4.200  1.00 0.00 ? 46  ILE A HB   2  
ATOM 2223  H HG12 . ILE A 1 46  ? 8.849   6.240   -6.335  1.00 0.00 ? 46  ILE A HG12 2  
ATOM 2224  H HG13 . ILE A 1 46  ? 8.809   7.998   -6.247  1.00 0.00 ? 46  ILE A HG13 2  
ATOM 2225  H HG21 . ILE A 1 46  ? 7.800   4.933   -4.864  1.00 0.00 ? 46  ILE A HG21 2  
ATOM 2226  H HG22 . ILE A 1 46  ? 7.267   5.669   -3.353  1.00 0.00 ? 46  ILE A HG22 2  
ATOM 2227  H HG23 . ILE A 1 46  ? 6.099   5.336   -4.632  1.00 0.00 ? 46  ILE A HG23 2  
ATOM 2228  H HD11 . ILE A 1 46  ? 9.974   8.026   -4.214  1.00 0.00 ? 46  ILE A HD11 2  
ATOM 2229  H HD12 . ILE A 1 46  ? 9.707   6.304   -3.943  1.00 0.00 ? 46  ILE A HD12 2  
ATOM 2230  H HD13 . ILE A 1 46  ? 10.804  6.837   -5.216  1.00 0.00 ? 46  ILE A HD13 2  
ATOM 2231  N N    . PHE A 1 47  ? 4.011   6.496   -5.813  1.00 0.00 ? 47  PHE A N    2  
ATOM 2232  C CA   . PHE A 1 47  ? 2.680   6.362   -5.232  1.00 0.00 ? 47  PHE A CA   2  
ATOM 2233  C C    . PHE A 1 47  ? 2.319   4.893   -5.034  1.00 0.00 ? 47  PHE A C    2  
ATOM 2234  O O    . PHE A 1 47  ? 2.948   4.005   -5.609  1.00 0.00 ? 47  PHE A O    2  
ATOM 2235  C CB   . PHE A 1 47  ? 1.640   7.039   -6.126  1.00 0.00 ? 47  PHE A CB   2  
ATOM 2236  C CG   . PHE A 1 47  ? 2.078   8.377   -6.648  1.00 0.00 ? 47  PHE A CG   2  
ATOM 2237  C CD1  . PHE A 1 47  ? 3.182   8.484   -7.478  1.00 0.00 ? 47  PHE A CD1  2  
ATOM 2238  C CD2  . PHE A 1 47  ? 1.386   9.529   -6.308  1.00 0.00 ? 47  PHE A CD2  2  
ATOM 2239  C CE1  . PHE A 1 47  ? 3.588   9.714   -7.961  1.00 0.00 ? 47  PHE A CE1  2  
ATOM 2240  C CE2  . PHE A 1 47  ? 1.787   10.761  -6.788  1.00 0.00 ? 47  PHE A CE2  2  
ATOM 2241  C CZ   . PHE A 1 47  ? 2.890   10.854  -7.614  1.00 0.00 ? 47  PHE A CZ   2  
ATOM 2242  H H    . PHE A 1 47  ? 4.251   5.948   -6.589  1.00 0.00 ? 47  PHE A H    2  
ATOM 2243  H HA   . PHE A 1 47  ? 2.689   6.851   -4.270  1.00 0.00 ? 47  PHE A HA   2  
ATOM 2244  H HB2  . PHE A 1 47  ? 1.436   6.403   -6.974  1.00 0.00 ? 47  PHE A HB2  2  
ATOM 2245  H HB3  . PHE A 1 47  ? 0.730   7.183   -5.562  1.00 0.00 ? 47  PHE A HB3  2  
ATOM 2246  H HD1  . PHE A 1 47  ? 3.729   7.592   -7.750  1.00 0.00 ? 47  PHE A HD1  2  
ATOM 2247  H HD2  . PHE A 1 47  ? 0.524   9.458   -5.661  1.00 0.00 ? 47  PHE A HD2  2  
ATOM 2248  H HE1  . PHE A 1 47  ? 4.450   9.783   -8.607  1.00 0.00 ? 47  PHE A HE1  2  
ATOM 2249  H HE2  . PHE A 1 47  ? 1.239   11.651  -6.515  1.00 0.00 ? 47  PHE A HE2  2  
ATOM 2250  H HZ   . PHE A 1 47  ? 3.204   11.816  -7.990  1.00 0.00 ? 47  PHE A HZ   2  
ATOM 2251  N N    . ILE A 1 48  ? 1.301   4.645   -4.216  1.00 0.00 ? 48  ILE A N    2  
ATOM 2252  C CA   . ILE A 1 48  ? 0.855   3.284   -3.943  1.00 0.00 ? 48  ILE A CA   2  
ATOM 2253  C C    . ILE A 1 48  ? 0.237   2.649   -5.183  1.00 0.00 ? 48  ILE A C    2  
ATOM 2254  O O    . ILE A 1 48  ? -0.687  3.199   -5.781  1.00 0.00 ? 48  ILE A O    2  
ATOM 2255  C CB   . ILE A 1 48  ? -0.172  3.248   -2.795  1.00 0.00 ? 48  ILE A CB   2  
ATOM 2256  C CG1  . ILE A 1 48  ? 0.489   3.656   -1.477  1.00 0.00 ? 48  ILE A CG1  2  
ATOM 2257  C CG2  . ILE A 1 48  ? -0.787  1.862   -2.679  1.00 0.00 ? 48  ILE A CG2  2  
ATOM 2258  C CD1  . ILE A 1 48  ? -0.471  4.275   -0.486  1.00 0.00 ? 48  ILE A CD1  2  
ATOM 2259  H H    . ILE A 1 48  ? 0.839   5.395   -3.787  1.00 0.00 ? 48  ILE A H    2  
ATOM 2260  H HA   . ILE A 1 48  ? 1.717   2.705   -3.645  1.00 0.00 ? 48  ILE A HA   2  
ATOM 2261  H HB   . ILE A 1 48  ? -0.961  3.948   -3.026  1.00 0.00 ? 48  ILE A HB   2  
ATOM 2262  H HG12 . ILE A 1 48  ? 0.926   2.785   -1.016  1.00 0.00 ? 48  ILE A HG12 2  
ATOM 2263  H HG13 . ILE A 1 48  ? 1.267   4.378   -1.681  1.00 0.00 ? 48  ILE A HG13 2  
ATOM 2264  H HG21 . ILE A 1 48  ? -0.052  1.173   -2.290  1.00 0.00 ? 48  ILE A HG21 2  
ATOM 2265  H HG22 . ILE A 1 48  ? -1.633  1.899   -2.009  1.00 0.00 ? 48  ILE A HG22 2  
ATOM 2266  H HG23 . ILE A 1 48  ? -1.113  1.529   -3.653  1.00 0.00 ? 48  ILE A HG23 2  
ATOM 2267  H HD11 . ILE A 1 48  ? 0.051   5.003   0.116   1.00 0.00 ? 48  ILE A HD11 2  
ATOM 2268  H HD12 . ILE A 1 48  ? -1.277  4.758   -1.018  1.00 0.00 ? 48  ILE A HD12 2  
ATOM 2269  H HD13 . ILE A 1 48  ? -0.874  3.503   0.154   1.00 0.00 ? 48  ILE A HD13 2  
ATOM 2270  N N    . SER A 1 49  ? 0.754   1.484   -5.564  1.00 0.00 ? 49  SER A N    2  
ATOM 2271  C CA   . SER A 1 49  ? 0.254   0.774   -6.736  1.00 0.00 ? 49  SER A CA   2  
ATOM 2272  C C    . SER A 1 49  ? -0.756  -0.296  -6.332  1.00 0.00 ? 49  SER A C    2  
ATOM 2273  O O    . SER A 1 49  ? -1.445  -0.868  -7.177  1.00 0.00 ? 49  SER A O    2  
ATOM 2274  C CB   . SER A 1 49  ? 1.413   0.133   -7.502  1.00 0.00 ? 49  SER A CB   2  
ATOM 2275  O OG   . SER A 1 49  ? 1.978   -0.939  -6.769  1.00 0.00 ? 49  SER A OG   2  
ATOM 2276  H H    . SER A 1 49  ? 1.490   1.096   -5.047  1.00 0.00 ? 49  SER A H    2  
ATOM 2277  H HA   . SER A 1 49  ? -0.236  1.492   -7.375  1.00 0.00 ? 49  SER A HA   2  
ATOM 2278  H HB2  . SER A 1 49  ? 1.051   -0.244  -8.447  1.00 0.00 ? 49  SER A HB2  2  
ATOM 2279  H HB3  . SER A 1 49  ? 2.177   0.876   -7.680  1.00 0.00 ? 49  SER A HB3  2  
ATOM 2280  H HG   . SER A 1 49  ? 1.482   -1.743  -6.942  1.00 0.00 ? 49  SER A HG   2  
ATOM 2281  N N    . LYS A 1 50  ? -0.840  -0.561  -5.032  1.00 0.00 ? 50  LYS A N    2  
ATOM 2282  C CA   . LYS A 1 50  ? -1.766  -1.560  -4.513  1.00 0.00 ? 50  LYS A CA   2  
ATOM 2283  C C    . LYS A 1 50  ? -1.733  -1.593  -2.989  1.00 0.00 ? 50  LYS A C    2  
ATOM 2284  O O    . LYS A 1 50  ? -0.839  -1.021  -2.365  1.00 0.00 ? 50  LYS A O    2  
ATOM 2285  C CB   . LYS A 1 50  ? -1.422  -2.943  -5.071  1.00 0.00 ? 50  LYS A CB   2  
ATOM 2286  C CG   . LYS A 1 50  ? -2.430  -4.017  -4.700  1.00 0.00 ? 50  LYS A CG   2  
ATOM 2287  C CD   . LYS A 1 50  ? -2.249  -5.268  -5.544  1.00 0.00 ? 50  LYS A CD   2  
ATOM 2288  C CE   . LYS A 1 50  ? -2.868  -5.103  -6.923  1.00 0.00 ? 50  LYS A CE   2  
ATOM 2289  N NZ   . LYS A 1 50  ? -4.338  -5.341  -6.904  1.00 0.00 ? 50  LYS A NZ   2  
ATOM 2290  H H    . LYS A 1 50  ? -0.265  -0.072  -4.407  1.00 0.00 ? 50  LYS A H    2  
ATOM 2291  H HA   . LYS A 1 50  ? -2.761  -1.289  -4.834  1.00 0.00 ? 50  LYS A HA   2  
ATOM 2292  H HB2  . LYS A 1 50  ? -1.374  -2.882  -6.148  1.00 0.00 ? 50  LYS A HB2  2  
ATOM 2293  H HB3  . LYS A 1 50  ? -0.455  -3.241  -4.693  1.00 0.00 ? 50  LYS A HB3  2  
ATOM 2294  H HG2  . LYS A 1 50  ? -2.300  -4.276  -3.659  1.00 0.00 ? 50  LYS A HG2  2  
ATOM 2295  H HG3  . LYS A 1 50  ? -3.428  -3.631  -4.854  1.00 0.00 ? 50  LYS A HG3  2  
ATOM 2296  H HD2  . LYS A 1 50  ? -1.194  -5.466  -5.656  1.00 0.00 ? 50  LYS A HD2  2  
ATOM 2297  H HD3  . LYS A 1 50  ? -2.723  -6.101  -5.043  1.00 0.00 ? 50  LYS A HD3  2  
ATOM 2298  H HE2  . LYS A 1 50  ? -2.679  -4.099  -7.271  1.00 0.00 ? 50  LYS A HE2  2  
ATOM 2299  H HE3  . LYS A 1 50  ? -2.406  -5.810  -7.597  1.00 0.00 ? 50  LYS A HE3  2  
ATOM 2300  H HZ1  . LYS A 1 50  ? -4.806  -4.736  -7.609  1.00 0.00 ? 50  LYS A HZ1  2  
ATOM 2301  H HZ2  . LYS A 1 50  ? -4.723  -5.119  -5.964  1.00 0.00 ? 50  LYS A HZ2  2  
ATOM 2302  H HZ3  . LYS A 1 50  ? -4.542  -6.336  -7.125  1.00 0.00 ? 50  LYS A HZ3  2  
ATOM 2303  N N    . VAL A 1 51  ? -2.711  -2.268  -2.394  1.00 0.00 ? 51  VAL A N    2  
ATOM 2304  C CA   . VAL A 1 51  ? -2.792  -2.378  -0.942  1.00 0.00 ? 51  VAL A CA   2  
ATOM 2305  C C    . VAL A 1 51  ? -3.452  -3.687  -0.526  1.00 0.00 ? 51  VAL A C    2  
ATOM 2306  O O    . VAL A 1 51  ? -4.633  -3.911  -0.792  1.00 0.00 ? 51  VAL A O    2  
ATOM 2307  C CB   . VAL A 1 51  ? -3.579  -1.202  -0.333  1.00 0.00 ? 51  VAL A CB   2  
ATOM 2308  C CG1  . VAL A 1 51  ? -3.656  -1.337  1.180   1.00 0.00 ? 51  VAL A CG1  2  
ATOM 2309  C CG2  . VAL A 1 51  ? -2.946  0.124   -0.727  1.00 0.00 ? 51  VAL A CG2  2  
ATOM 2310  H H    . VAL A 1 51  ? -3.395  -2.703  -2.945  1.00 0.00 ? 51  VAL A H    2  
ATOM 2311  H HA   . VAL A 1 51  ? -1.786  -2.352  -0.549  1.00 0.00 ? 51  VAL A HA   2  
ATOM 2312  H HB   . VAL A 1 51  ? -4.585  -1.227  -0.726  1.00 0.00 ? 51  VAL A HB   2  
ATOM 2313  H HG11 . VAL A 1 51  ? -3.761  -2.380  1.443   1.00 0.00 ? 51  VAL A HG11 2  
ATOM 2314  H HG12 . VAL A 1 51  ? -2.754  -0.942  1.623   1.00 0.00 ? 51  VAL A HG12 2  
ATOM 2315  H HG13 . VAL A 1 51  ? -4.510  -0.787  1.547   1.00 0.00 ? 51  VAL A HG13 2  
ATOM 2316  H HG21 . VAL A 1 51  ? -1.961  0.194   -0.291  1.00 0.00 ? 51  VAL A HG21 2  
ATOM 2317  H HG22 . VAL A 1 51  ? -2.868  0.181   -1.803  1.00 0.00 ? 51  VAL A HG22 2  
ATOM 2318  H HG23 . VAL A 1 51  ? -3.558  0.937   -0.367  1.00 0.00 ? 51  VAL A HG23 2  
ATOM 2319  N N    . SER A 1 52  ? -2.682  -4.550  0.130   1.00 0.00 ? 52  SER A N    2  
ATOM 2320  C CA   . SER A 1 52  ? -3.191  -5.840  0.581   1.00 0.00 ? 52  SER A CA   2  
ATOM 2321  C C    . SER A 1 52  ? -4.238  -5.658  1.676   1.00 0.00 ? 52  SER A C    2  
ATOM 2322  O O    . SER A 1 52  ? -4.106  -4.812  2.561   1.00 0.00 ? 52  SER A O    2  
ATOM 2323  C CB   . SER A 1 52  ? -2.045  -6.713  1.094   1.00 0.00 ? 52  SER A CB   2  
ATOM 2324  O OG   . SER A 1 52  ? -2.393  -8.086  1.056   1.00 0.00 ? 52  SER A OG   2  
ATOM 2325  H H    . SER A 1 52  ? -1.748  -4.314  0.312   1.00 0.00 ? 52  SER A H    2  
ATOM 2326  H HA   . SER A 1 52  ? -3.653  -6.327  -0.265  1.00 0.00 ? 52  SER A HA   2  
ATOM 2327  H HB2  . SER A 1 52  ? -1.173  -6.558  0.477   1.00 0.00 ? 52  SER A HB2  2  
ATOM 2328  H HB3  . SER A 1 52  ? -1.817  -6.439  2.115   1.00 0.00 ? 52  SER A HB3  2  
ATOM 2329  H HG   . SER A 1 52  ? -1.872  -8.567  1.703   1.00 0.00 ? 52  SER A HG   2  
ATOM 2330  N N    . PRO A 1 53  ? -5.303  -6.471  1.616   1.00 0.00 ? 53  PRO A N    2  
ATOM 2331  C CA   . PRO A 1 53  ? -6.393  -6.420  2.595   1.00 0.00 ? 53  PRO A CA   2  
ATOM 2332  C C    . PRO A 1 53  ? -5.963  -6.924  3.969   1.00 0.00 ? 53  PRO A C    2  
ATOM 2333  O O    . PRO A 1 53  ? -6.472  -6.473  4.995   1.00 0.00 ? 53  PRO A O    2  
ATOM 2334  C CB   . PRO A 1 53  ? -7.453  -7.346  1.994   1.00 0.00 ? 53  PRO A CB   2  
ATOM 2335  C CG   . PRO A 1 53  ? -6.687  -8.288  1.131   1.00 0.00 ? 53  PRO A CG   2  
ATOM 2336  C CD   . PRO A 1 53  ? -5.525  -7.502  0.589   1.00 0.00 ? 53  PRO A CD   2  
ATOM 2337  H HA   . PRO A 1 53  ? -6.796  -5.422  2.689   1.00 0.00 ? 53  PRO A HA   2  
ATOM 2338  H HB2  . PRO A 1 53  ? -7.970  -7.868  2.787   1.00 0.00 ? 53  PRO A HB2  2  
ATOM 2339  H HB3  . PRO A 1 53  ? -8.158  -6.767  1.417   1.00 0.00 ? 53  PRO A HB3  2  
ATOM 2340  H HG2  . PRO A 1 53  ? -6.334  -9.122  1.719   1.00 0.00 ? 53  PRO A HG2  2  
ATOM 2341  H HG3  . PRO A 1 53  ? -7.313  -8.636  0.322   1.00 0.00 ? 53  PRO A HG3  2  
ATOM 2342  H HD2  . PRO A 1 53  ? -4.657  -8.136  0.485   1.00 0.00 ? 53  PRO A HD2  2  
ATOM 2343  H HD3  . PRO A 1 53  ? -5.782  -7.052  -0.358  1.00 0.00 ? 53  PRO A HD3  2  
ATOM 2344  N N    . THR A 1 54  ? -5.020  -7.862  3.982   1.00 0.00 ? 54  THR A N    2  
ATOM 2345  C CA   . THR A 1 54  ? -4.522  -8.427  5.229   1.00 0.00 ? 54  THR A CA   2  
ATOM 2346  C C    . THR A 1 54  ? -3.387  -7.584  5.800   1.00 0.00 ? 54  THR A C    2  
ATOM 2347  O O    . THR A 1 54  ? -2.941  -7.807  6.925   1.00 0.00 ? 54  THR A O    2  
ATOM 2348  C CB   . THR A 1 54  ? -4.024  -9.871  5.032   1.00 0.00 ? 54  THR A CB   2  
ATOM 2349  O OG1  . THR A 1 54  ? -2.789  -9.869  4.308   1.00 0.00 ? 54  THR A OG1  2  
ATOM 2350  C CG2  . THR A 1 54  ? -5.056  -10.701 4.283   1.00 0.00 ? 54  THR A CG2  2  
ATOM 2351  H H    . THR A 1 54  ? -4.653  -8.180  3.131   1.00 0.00 ? 54  THR A H    2  
ATOM 2352  H HA   . THR A 1 54  ? -5.338  -8.443  5.937   1.00 0.00 ? 54  THR A HA   2  
ATOM 2353  H HB   . THR A 1 54  ? -3.863  -10.316 6.003   1.00 0.00 ? 54  THR A HB   2  
ATOM 2354  H HG1  . THR A 1 54  ? -2.777  -9.129  3.697   1.00 0.00 ? 54  THR A HG1  2  
ATOM 2355  H HG21 . THR A 1 54  ? -5.606  -11.310 4.984   1.00 0.00 ? 54  THR A HG21 2  
ATOM 2356  H HG22 . THR A 1 54  ? -4.555  -11.338 3.568   1.00 0.00 ? 54  THR A HG22 2  
ATOM 2357  H HG23 . THR A 1 54  ? -5.737  -10.045 3.764   1.00 0.00 ? 54  THR A HG23 2  
ATOM 2358  N N    . GLY A 1 55  ? -2.925  -6.614  5.017   1.00 0.00 ? 55  GLY A N    2  
ATOM 2359  C CA   . GLY A 1 55  ? -1.846  -5.751  5.463   1.00 0.00 ? 55  GLY A CA   2  
ATOM 2360  C C    . GLY A 1 55  ? -2.308  -4.720  6.474   1.00 0.00 ? 55  GLY A C    2  
ATOM 2361  O O    . GLY A 1 55  ? -3.494  -4.399  6.545   1.00 0.00 ? 55  GLY A O    2  
ATOM 2362  H H    . GLY A 1 55  ? -3.320  -6.482  4.130   1.00 0.00 ? 55  GLY A H    2  
ATOM 2363  H HA2  . GLY A 1 55  ? -1.076  -6.360  5.912   1.00 0.00 ? 55  GLY A HA2  2  
ATOM 2364  H HA3  . GLY A 1 55  ? -1.433  -5.239  4.607   1.00 0.00 ? 55  GLY A HA3  2  
ATOM 2365  N N    . ALA A 1 56  ? -1.370  -4.201  7.258   1.00 0.00 ? 56  ALA A N    2  
ATOM 2366  C CA   . ALA A 1 56  ? -1.687  -3.199  8.269   1.00 0.00 ? 56  ALA A CA   2  
ATOM 2367  C C    . ALA A 1 56  ? -2.511  -2.062  7.675   1.00 0.00 ? 56  ALA A C    2  
ATOM 2368  O O    . ALA A 1 56  ? -3.435  -1.555  8.311   1.00 0.00 ? 56  ALA A O    2  
ATOM 2369  C CB   . ALA A 1 56  ? -0.410  -2.658  8.894   1.00 0.00 ? 56  ALA A CB   2  
ATOM 2370  H H    . ALA A 1 56  ? -0.442  -4.497  7.153   1.00 0.00 ? 56  ALA A H    2  
ATOM 2371  H HA   . ALA A 1 56  ? -2.264  -3.681  9.046   1.00 0.00 ? 56  ALA A HA   2  
ATOM 2372  H HB1  . ALA A 1 56  ? 0.325   -2.489  8.121   1.00 0.00 ? 56  ALA A HB1  2  
ATOM 2373  H HB2  . ALA A 1 56  ? -0.623  -1.727  9.399   1.00 0.00 ? 56  ALA A HB2  2  
ATOM 2374  H HB3  . ALA A 1 56  ? -0.026  -3.374  9.606   1.00 0.00 ? 56  ALA A HB3  2  
ATOM 2375  N N    . ALA A 1 57  ? -2.170  -1.665  6.454   1.00 0.00 ? 57  ALA A N    2  
ATOM 2376  C CA   . ALA A 1 57  ? -2.879  -0.588  5.774   1.00 0.00 ? 57  ALA A CA   2  
ATOM 2377  C C    . ALA A 1 57  ? -4.283  -1.025  5.370   1.00 0.00 ? 57  ALA A C    2  
ATOM 2378  O O    . ALA A 1 57  ? -5.275  -0.437  5.800   1.00 0.00 ? 57  ALA A O    2  
ATOM 2379  C CB   . ALA A 1 57  ? -2.096  -0.127  4.554   1.00 0.00 ? 57  ALA A CB   2  
ATOM 2380  H H    . ALA A 1 57  ? -1.424  -2.108  5.998   1.00 0.00 ? 57  ALA A H    2  
ATOM 2381  H HA   . ALA A 1 57  ? -2.955  0.245   6.458   1.00 0.00 ? 57  ALA A HA   2  
ATOM 2382  H HB1  . ALA A 1 57  ? -2.774  0.017   3.725   1.00 0.00 ? 57  ALA A HB1  2  
ATOM 2383  H HB2  . ALA A 1 57  ? -1.597  0.803   4.777   1.00 0.00 ? 57  ALA A HB2  2  
ATOM 2384  H HB3  . ALA A 1 57  ? -1.363  -0.876  4.294   1.00 0.00 ? 57  ALA A HB3  2  
ATOM 2385  N N    . GLY A 1 58  ? -4.360  -2.061  4.540   1.00 0.00 ? 58  GLY A N    2  
ATOM 2386  C CA   . GLY A 1 58  ? -5.647  -2.558  4.091   1.00 0.00 ? 58  GLY A CA   2  
ATOM 2387  C C    . GLY A 1 58  ? -6.680  -2.578  5.201   1.00 0.00 ? 58  GLY A C    2  
ATOM 2388  O O    . GLY A 1 58  ? -7.833  -2.201  4.991   1.00 0.00 ? 58  GLY A O    2  
ATOM 2389  H H    . GLY A 1 58  ? -3.535  -2.491  4.230   1.00 0.00 ? 58  GLY A H    2  
ATOM 2390  H HA2  . GLY A 1 58  ? -6.005  -1.927  3.291   1.00 0.00 ? 58  GLY A HA2  2  
ATOM 2391  H HA3  . GLY A 1 58  ? -5.521  -3.563  3.715   1.00 0.00 ? 58  GLY A HA3  2  
ATOM 2392  N N    . ARG A 1 59  ? -6.267  -3.021  6.383   1.00 0.00 ? 59  ARG A N    2  
ATOM 2393  C CA   . ARG A 1 59  ? -7.165  -3.092  7.529   1.00 0.00 ? 59  ARG A CA   2  
ATOM 2394  C C    . ARG A 1 59  ? -7.318  -1.723  8.186   1.00 0.00 ? 59  ARG A C    2  
ATOM 2395  O O    . ARG A 1 59  ? -8.371  -1.402  8.738   1.00 0.00 ? 59  ARG A O    2  
ATOM 2396  C CB   . ARG A 1 59  ? -6.645  -4.104  8.551   1.00 0.00 ? 59  ARG A CB   2  
ATOM 2397  C CG   . ARG A 1 59  ? -5.373  -3.659  9.255   1.00 0.00 ? 59  ARG A CG   2  
ATOM 2398  C CD   . ARG A 1 59  ? -4.958  -4.649  10.333  1.00 0.00 ? 59  ARG A CD   2  
ATOM 2399  N NE   . ARG A 1 59  ? -3.592  -4.415  10.794  1.00 0.00 ? 59  ARG A NE   2  
ATOM 2400  C CZ   . ARG A 1 59  ? -2.833  -5.353  11.349  1.00 0.00 ? 59  ARG A CZ   2  
ATOM 2401  N NH1  . ARG A 1 59  ? -3.304  -6.582  11.511  1.00 0.00 ? 59  ARG A NH1  2  
ATOM 2402  N NH2  . ARG A 1 59  ? -1.599  -5.063  11.743  1.00 0.00 ? 59  ARG A NH2  2  
ATOM 2403  H H    . ARG A 1 59  ? -5.335  -3.308  6.488   1.00 0.00 ? 59  ARG A H    2  
ATOM 2404  H HA   . ARG A 1 59  ? -8.131  -3.417  7.174   1.00 0.00 ? 59  ARG A HA   2  
ATOM 2405  H HB2  . ARG A 1 59  ? -7.406  -4.267  9.300   1.00 0.00 ? 59  ARG A HB2  2  
ATOM 2406  H HB3  . ARG A 1 59  ? -6.443  -5.036  8.046   1.00 0.00 ? 59  ARG A HB3  2  
ATOM 2407  H HG2  . ARG A 1 59  ? -4.578  -3.581  8.528   1.00 0.00 ? 59  ARG A HG2  2  
ATOM 2408  H HG3  . ARG A 1 59  ? -5.543  -2.695  9.710   1.00 0.00 ? 59  ARG A HG3  2  
ATOM 2409  H HD2  . ARG A 1 59  ? -5.632  -4.552  11.171  1.00 0.00 ? 59  ARG A HD2  2  
ATOM 2410  H HD3  . ARG A 1 59  ? -5.026  -5.649  9.930   1.00 0.00 ? 59  ARG A HD3  2  
ATOM 2411  H HE   . ARG A 1 59  ? -3.224  -3.514  10.683  1.00 0.00 ? 59  ARG A HE   2  
ATOM 2412  H HH11 . ARG A 1 59  ? -4.232  -6.804  11.214  1.00 0.00 ? 59  ARG A HH11 2  
ATOM 2413  H HH12 . ARG A 1 59  ? -2.730  -7.287  11.929  1.00 0.00 ? 59  ARG A HH12 2  
ATOM 2414  H HH21 . ARG A 1 59  ? -1.241  -4.138  11.622  1.00 0.00 ? 59  ARG A HH21 2  
ATOM 2415  H HH22 . ARG A 1 59  ? -1.029  -5.769  12.161  1.00 0.00 ? 59  ARG A HH22 2  
ATOM 2416  N N    . ASP A 1 60  ? -6.261  -0.921  8.122   1.00 0.00 ? 60  ASP A N    2  
ATOM 2417  C CA   . ASP A 1 60  ? -6.277  0.414   8.710   1.00 0.00 ? 60  ASP A CA   2  
ATOM 2418  C C    . ASP A 1 60  ? -7.512  1.189   8.262   1.00 0.00 ? 60  ASP A C    2  
ATOM 2419  O O    . ASP A 1 60  ? -8.437  1.409   9.043   1.00 0.00 ? 60  ASP A O    2  
ATOM 2420  C CB   . ASP A 1 60  ? -5.011  1.180   8.324   1.00 0.00 ? 60  ASP A CB   2  
ATOM 2421  C CG   . ASP A 1 60  ? -5.036  2.618   8.801   1.00 0.00 ? 60  ASP A CG   2  
ATOM 2422  O OD1  . ASP A 1 60  ? -5.102  2.835   10.030  1.00 0.00 ? 60  ASP A OD1  2  
ATOM 2423  O OD2  . ASP A 1 60  ? -4.989  3.527   7.947   1.00 0.00 ? 60  ASP A OD2  2  
ATOM 2424  H H    . ASP A 1 60  ? -5.450  -1.234  7.668   1.00 0.00 ? 60  ASP A H    2  
ATOM 2425  H HA   . ASP A 1 60  ? -6.307  0.303   9.783   1.00 0.00 ? 60  ASP A HA   2  
ATOM 2426  H HB2  . ASP A 1 60  ? -4.154  0.689   8.763   1.00 0.00 ? 60  ASP A HB2  2  
ATOM 2427  H HB3  . ASP A 1 60  ? -4.910  1.177   7.249   1.00 0.00 ? 60  ASP A HB3  2  
ATOM 2428  N N    . GLY A 1 61  ? -7.519  1.603   6.998   1.00 0.00 ? 61  GLY A N    2  
ATOM 2429  C CA   . GLY A 1 61  ? -8.644  2.351   6.469   1.00 0.00 ? 61  GLY A CA   2  
ATOM 2430  C C    . GLY A 1 61  ? -8.245  3.729   5.978   1.00 0.00 ? 61  GLY A C    2  
ATOM 2431  O O    . GLY A 1 61  ? -9.040  4.424   5.344   1.00 0.00 ? 61  GLY A O    2  
ATOM 2432  H H    . GLY A 1 61  ? -6.753  1.399   6.421   1.00 0.00 ? 61  GLY A H    2  
ATOM 2433  H HA2  . GLY A 1 61  ? -9.075  1.799   5.647   1.00 0.00 ? 61  GLY A HA2  2  
ATOM 2434  H HA3  . GLY A 1 61  ? -9.387  2.460   7.245   1.00 0.00 ? 61  GLY A HA3  2  
ATOM 2435  N N    . ARG A 1 62  ? -7.012  4.126   6.273   1.00 0.00 ? 62  ARG A N    2  
ATOM 2436  C CA   . ARG A 1 62  ? -6.510  5.432   5.860   1.00 0.00 ? 62  ARG A CA   2  
ATOM 2437  C C    . ARG A 1 62  ? -5.554  5.298   4.679   1.00 0.00 ? 62  ARG A C    2  
ATOM 2438  O O    . ARG A 1 62  ? -5.177  6.291   4.055   1.00 0.00 ? 62  ARG A O    2  
ATOM 2439  C CB   . ARG A 1 62  ? -5.802  6.122   7.027   1.00 0.00 ? 62  ARG A CB   2  
ATOM 2440  C CG   . ARG A 1 62  ? -6.514  5.950   8.359   1.00 0.00 ? 62  ARG A CG   2  
ATOM 2441  C CD   . ARG A 1 62  ? -7.621  6.978   8.536   1.00 0.00 ? 62  ARG A CD   2  
ATOM 2442  N NE   . ARG A 1 62  ? -8.837  6.600   7.820   1.00 0.00 ? 62  ARG A NE   2  
ATOM 2443  C CZ   . ARG A 1 62  ? -9.975  7.282   7.895   1.00 0.00 ? 62  ARG A CZ   2  
ATOM 2444  N NH1  . ARG A 1 62  ? -10.052 8.369   8.649   1.00 0.00 ? 62  ARG A NH1  2  
ATOM 2445  N NH2  . ARG A 1 62  ? -11.039 6.875   7.213   1.00 0.00 ? 62  ARG A NH2  2  
ATOM 2446  H H    . ARG A 1 62  ? -6.425  3.528   6.781   1.00 0.00 ? 62  ARG A H    2  
ATOM 2447  H HA   . ARG A 1 62  ? -7.355  6.031   5.558   1.00 0.00 ? 62  ARG A HA   2  
ATOM 2448  H HB2  . ARG A 1 62  ? -4.806  5.714   7.122   1.00 0.00 ? 62  ARG A HB2  2  
ATOM 2449  H HB3  . ARG A 1 62  ? -5.731  7.178   6.815   1.00 0.00 ? 62  ARG A HB3  2  
ATOM 2450  H HG2  . ARG A 1 62  ? -6.946  4.961   8.401   1.00 0.00 ? 62  ARG A HG2  2  
ATOM 2451  H HG3  . ARG A 1 62  ? -5.797  6.066   9.158   1.00 0.00 ? 62  ARG A HG3  2  
ATOM 2452  H HD2  . ARG A 1 62  ? -7.847  7.066   9.588   1.00 0.00 ? 62  ARG A HD2  2  
ATOM 2453  H HD3  . ARG A 1 62  ? -7.274  7.929   8.161   1.00 0.00 ? 62  ARG A HD3  2  
ATOM 2454  H HE   . ARG A 1 62  ? -8.802  5.800   7.257   1.00 0.00 ? 62  ARG A HE   2  
ATOM 2455  H HH11 . ARG A 1 62  ? -9.252  8.678   9.162   1.00 0.00 ? 62  ARG A HH11 2  
ATOM 2456  H HH12 . ARG A 1 62  ? -10.910 8.881   8.702   1.00 0.00 ? 62  ARG A HH12 2  
ATOM 2457  H HH21 . ARG A 1 62  ? -10.985 6.056   6.644   1.00 0.00 ? 62  ARG A HH21 2  
ATOM 2458  H HH22 . ARG A 1 62  ? -11.895 7.388   7.270   1.00 0.00 ? 62  ARG A HH22 2  
ATOM 2459  N N    . LEU A 1 63  ? -5.164  4.064   4.377   1.00 0.00 ? 63  LEU A N    2  
ATOM 2460  C CA   . LEU A 1 63  ? -4.251  3.799   3.270   1.00 0.00 ? 63  LEU A CA   2  
ATOM 2461  C C    . LEU A 1 63  ? -4.994  3.190   2.085   1.00 0.00 ? 63  LEU A C    2  
ATOM 2462  O O    . LEU A 1 63  ? -5.796  2.271   2.249   1.00 0.00 ? 63  LEU A O    2  
ATOM 2463  C CB   . LEU A 1 63  ? -3.130  2.861   3.721   1.00 0.00 ? 63  LEU A CB   2  
ATOM 2464  C CG   . LEU A 1 63  ? -1.909  2.785   2.805   1.00 0.00 ? 63  LEU A CG   2  
ATOM 2465  C CD1  . LEU A 1 63  ? -2.256  2.064   1.511   1.00 0.00 ? 63  LEU A CD1  2  
ATOM 2466  C CD2  . LEU A 1 63  ? -1.374  4.180   2.513   1.00 0.00 ? 63  LEU A CD2  2  
ATOM 2467  H H    . LEU A 1 63  ? -5.498  3.313   4.909   1.00 0.00 ? 63  LEU A H    2  
ATOM 2468  H HA   . LEU A 1 63  ? -3.820  4.741   2.964   1.00 0.00 ? 63  LEU A HA   2  
ATOM 2469  H HB2  . LEU A 1 63  ? -2.795  3.190   4.693   1.00 0.00 ? 63  LEU A HB2  2  
ATOM 2470  H HB3  . LEU A 1 63  ? -3.546  1.867   3.803   1.00 0.00 ? 63  LEU A HB3  2  
ATOM 2471  H HG   . LEU A 1 63  ? -1.129  2.224   3.300   1.00 0.00 ? 63  LEU A HG   2  
ATOM 2472  H HD11 . LEU A 1 63  ? -3.000  1.308   1.709   1.00 0.00 ? 63  LEU A HD11 2  
ATOM 2473  H HD12 . LEU A 1 63  ? -1.368  1.599   1.109   1.00 0.00 ? 63  LEU A HD12 2  
ATOM 2474  H HD13 . LEU A 1 63  ? -2.644  2.775   0.796   1.00 0.00 ? 63  LEU A HD13 2  
ATOM 2475  H HD21 . LEU A 1 63  ? -0.302  4.134   2.385   1.00 0.00 ? 63  LEU A HD21 2  
ATOM 2476  H HD22 . LEU A 1 63  ? -1.610  4.836   3.339   1.00 0.00 ? 63  LEU A HD22 2  
ATOM 2477  H HD23 . LEU A 1 63  ? -1.829  4.558   1.610   1.00 0.00 ? 63  LEU A HD23 2  
ATOM 2478  N N    . ARG A 1 64  ? -4.719  3.707   0.892   1.00 0.00 ? 64  ARG A N    2  
ATOM 2479  C CA   . ARG A 1 64  ? -5.360  3.214   -0.321  1.00 0.00 ? 64  ARG A CA   2  
ATOM 2480  C C    . ARG A 1 64  ? -4.391  3.246   -1.499  1.00 0.00 ? 64  ARG A C    2  
ATOM 2481  O O    . ARG A 1 64  ? -3.243  3.666   -1.361  1.00 0.00 ? 64  ARG A O    2  
ATOM 2482  C CB   . ARG A 1 64  ? -6.600  4.049   -0.643  1.00 0.00 ? 64  ARG A CB   2  
ATOM 2483  C CG   . ARG A 1 64  ? -7.365  4.505   0.589   1.00 0.00 ? 64  ARG A CG   2  
ATOM 2484  C CD   . ARG A 1 64  ? -8.805  4.857   0.252   1.00 0.00 ? 64  ARG A CD   2  
ATOM 2485  N NE   . ARG A 1 64  ? -9.628  3.667   0.055   1.00 0.00 ? 64  ARG A NE   2  
ATOM 2486  C CZ   . ARG A 1 64  ? -10.934 3.708   -0.183  1.00 0.00 ? 64  ARG A CZ   2  
ATOM 2487  N NH1  . ARG A 1 64  ? -11.563 4.873   -0.253  1.00 0.00 ? 64  ARG A NH1  2  
ATOM 2488  N NH2  . ARG A 1 64  ? -11.614 2.581   -0.351  1.00 0.00 ? 64  ARG A NH2  2  
ATOM 2489  H H    . ARG A 1 64  ? -4.070  4.439   0.826   1.00 0.00 ? 64  ARG A H    2  
ATOM 2490  H HA   . ARG A 1 64  ? -5.661  2.192   -0.145  1.00 0.00 ? 64  ARG A HA   2  
ATOM 2491  H HB2  . ARG A 1 64  ? -6.296  4.925   -1.196  1.00 0.00 ? 64  ARG A HB2  2  
ATOM 2492  H HB3  . ARG A 1 64  ? -7.266  3.460   -1.256  1.00 0.00 ? 64  ARG A HB3  2  
ATOM 2493  H HG2  . ARG A 1 64  ? -7.362  3.709   1.318   1.00 0.00 ? 64  ARG A HG2  2  
ATOM 2494  H HG3  . ARG A 1 64  ? -6.877  5.376   1.001   1.00 0.00 ? 64  ARG A HG3  2  
ATOM 2495  H HD2  . ARG A 1 64  ? -9.218  5.439   1.062   1.00 0.00 ? 64  ARG A HD2  2  
ATOM 2496  H HD3  . ARG A 1 64  ? -8.815  5.445   -0.654  1.00 0.00 ? 64  ARG A HD3  2  
ATOM 2497  H HE   . ARG A 1 64  ? -9.184  2.795   0.103   1.00 0.00 ? 64  ARG A HE   2  
ATOM 2498  H HH11 . ARG A 1 64  ? -11.052 5.724   -0.128  1.00 0.00 ? 64  ARG A HH11 2  
ATOM 2499  H HH12 . ARG A 1 64  ? -12.546 4.901   -0.434  1.00 0.00 ? 64  ARG A HH12 2  
ATOM 2500  H HH21 . ARG A 1 64  ? -11.144 1.701   -0.299  1.00 0.00 ? 64  ARG A HH21 2  
ATOM 2501  H HH22 . ARG A 1 64  ? -12.597 2.612   -0.530  1.00 0.00 ? 64  ARG A HH22 2  
ATOM 2502  N N    . VAL A 1 65  ? -4.863  2.797   -2.658  1.00 0.00 ? 65  VAL A N    2  
ATOM 2503  C CA   . VAL A 1 65  ? -4.039  2.775   -3.862  1.00 0.00 ? 65  VAL A CA   2  
ATOM 2504  C C    . VAL A 1 65  ? -4.134  4.095   -4.617  1.00 0.00 ? 65  VAL A C    2  
ATOM 2505  O O    . VAL A 1 65  ? -5.023  4.286   -5.446  1.00 0.00 ? 65  VAL A O    2  
ATOM 2506  C CB   . VAL A 1 65  ? -4.451  1.627   -4.802  1.00 0.00 ? 65  VAL A CB   2  
ATOM 2507  C CG1  . VAL A 1 65  ? -3.401  1.418   -5.882  1.00 0.00 ? 65  VAL A CG1  2  
ATOM 2508  C CG2  . VAL A 1 65  ? -4.678  0.347   -4.013  1.00 0.00 ? 65  VAL A CG2  2  
ATOM 2509  H H    . VAL A 1 65  ? -5.787  2.474   -2.706  1.00 0.00 ? 65  VAL A H    2  
ATOM 2510  H HA   . VAL A 1 65  ? -3.014  2.616   -3.561  1.00 0.00 ? 65  VAL A HA   2  
ATOM 2511  H HB   . VAL A 1 65  ? -5.380  1.898   -5.283  1.00 0.00 ? 65  VAL A HB   2  
ATOM 2512  H HG11 . VAL A 1 65  ? -3.886  1.313   -6.841  1.00 0.00 ? 65  VAL A HG11 2  
ATOM 2513  H HG12 . VAL A 1 65  ? -2.734  2.268   -5.906  1.00 0.00 ? 65  VAL A HG12 2  
ATOM 2514  H HG13 . VAL A 1 65  ? -2.836  0.523   -5.666  1.00 0.00 ? 65  VAL A HG13 2  
ATOM 2515  H HG21 . VAL A 1 65  ? -5.351  0.545   -3.192  1.00 0.00 ? 65  VAL A HG21 2  
ATOM 2516  H HG22 . VAL A 1 65  ? -5.111  -0.404  -4.659  1.00 0.00 ? 65  VAL A HG22 2  
ATOM 2517  H HG23 . VAL A 1 65  ? -3.735  -0.011  -3.628  1.00 0.00 ? 65  VAL A HG23 2  
ATOM 2518  N N    . GLY A 1 66  ? -3.210  5.006   -4.325  1.00 0.00 ? 66  GLY A N    2  
ATOM 2519  C CA   . GLY A 1 66  ? -3.207  6.298   -4.986  1.00 0.00 ? 66  GLY A CA   2  
ATOM 2520  C C    . GLY A 1 66  ? -2.598  7.387   -4.126  1.00 0.00 ? 66  GLY A C    2  
ATOM 2521  O O    . GLY A 1 66  ? -2.299  8.479   -4.613  1.00 0.00 ? 66  GLY A O    2  
ATOM 2522  H H    . GLY A 1 66  ? -2.525  4.798   -3.656  1.00 0.00 ? 66  GLY A H    2  
ATOM 2523  H HA2  . GLY A 1 66  ? -2.642  6.219   -5.903  1.00 0.00 ? 66  GLY A HA2  2  
ATOM 2524  H HA3  . GLY A 1 66  ? -4.225  6.570   -5.224  1.00 0.00 ? 66  GLY A HA3  2  
ATOM 2525  N N    . LEU A 1 67  ? -2.415  7.093   -2.844  1.00 0.00 ? 67  LEU A N    2  
ATOM 2526  C CA   . LEU A 1 67  ? -1.839  8.057   -1.912  1.00 0.00 ? 67  LEU A CA   2  
ATOM 2527  C C    . LEU A 1 67  ? -0.343  8.225   -2.159  1.00 0.00 ? 67  LEU A C    2  
ATOM 2528  O O    . LEU A 1 67  ? 0.446   7.318   -1.892  1.00 0.00 ? 67  LEU A O    2  
ATOM 2529  C CB   . LEU A 1 67  ? -2.083  7.611   -0.470  1.00 0.00 ? 67  LEU A CB   2  
ATOM 2530  C CG   . LEU A 1 67  ? -3.540  7.351   -0.085  1.00 0.00 ? 67  LEU A CG   2  
ATOM 2531  C CD1  . LEU A 1 67  ? -3.665  7.133   1.415   1.00 0.00 ? 67  LEU A CD1  2  
ATOM 2532  C CD2  . LEU A 1 67  ? -4.424  8.505   -0.535  1.00 0.00 ? 67  LEU A CD2  2  
ATOM 2533  H H    . LEU A 1 67  ? -2.673  6.208   -2.514  1.00 0.00 ? 67  LEU A H    2  
ATOM 2534  H HA   . LEU A 1 67  ? -2.327  9.007   -2.075  1.00 0.00 ? 67  LEU A HA   2  
ATOM 2535  H HB2  . LEU A 1 67  ? -1.530  6.699   -0.308  1.00 0.00 ? 67  LEU A HB2  2  
ATOM 2536  H HB3  . LEU A 1 67  ? -1.700  8.383   0.183   1.00 0.00 ? 67  LEU A HB3  2  
ATOM 2537  H HG   . LEU A 1 67  ? -3.882  6.453   -0.582  1.00 0.00 ? 67  LEU A HG   2  
ATOM 2538  H HD11 . LEU A 1 67  ? -4.133  7.995   1.865   1.00 0.00 ? 67  LEU A HD11 2  
ATOM 2539  H HD12 . LEU A 1 67  ? -2.683  6.992   1.841   1.00 0.00 ? 67  LEU A HD12 2  
ATOM 2540  H HD13 . LEU A 1 67  ? -4.268  6.256   1.602   1.00 0.00 ? 67  LEU A HD13 2  
ATOM 2541  H HD21 . LEU A 1 67  ? -4.668  8.385   -1.580  1.00 0.00 ? 67  LEU A HD21 2  
ATOM 2542  H HD22 . LEU A 1 67  ? -3.899  9.438   -0.392  1.00 0.00 ? 67  LEU A HD22 2  
ATOM 2543  H HD23 . LEU A 1 67  ? -5.333  8.510   0.049   1.00 0.00 ? 67  LEU A HD23 2  
ATOM 2544  N N    . ARG A 1 68  ? 0.041   9.392   -2.667  1.00 0.00 ? 68  ARG A N    2  
ATOM 2545  C CA   . ARG A 1 68  ? 1.442   9.679   -2.948  1.00 0.00 ? 68  ARG A CA   2  
ATOM 2546  C C    . ARG A 1 68  ? 2.271   9.646   -1.667  1.00 0.00 ? 68  ARG A C    2  
ATOM 2547  O O    . ARG A 1 68  ? 1.990   10.374  -0.715  1.00 0.00 ? 68  ARG A O    2  
ATOM 2548  C CB   . ARG A 1 68  ? 1.580   11.045  -3.623  1.00 0.00 ? 68  ARG A CB   2  
ATOM 2549  C CG   . ARG A 1 68  ? 3.017   11.427  -3.937  1.00 0.00 ? 68  ARG A CG   2  
ATOM 2550  C CD   . ARG A 1 68  ? 3.162   12.926  -4.145  1.00 0.00 ? 68  ARG A CD   2  
ATOM 2551  N NE   . ARG A 1 68  ? 2.986   13.305  -5.545  1.00 0.00 ? 68  ARG A NE   2  
ATOM 2552  C CZ   . ARG A 1 68  ? 2.669   14.532  -5.940  1.00 0.00 ? 68  ARG A CZ   2  
ATOM 2553  N NH1  . ARG A 1 68  ? 2.493   15.496  -5.046  1.00 0.00 ? 68  ARG A NH1  2  
ATOM 2554  N NH2  . ARG A 1 68  ? 2.526   14.799  -7.232  1.00 0.00 ? 68  ARG A NH2  2  
ATOM 2555  H H    . ARG A 1 68  ? -0.635  10.075  -2.859  1.00 0.00 ? 68  ARG A H    2  
ATOM 2556  H HA   . ARG A 1 68  ? 1.809   8.917   -3.620  1.00 0.00 ? 68  ARG A HA   2  
ATOM 2557  H HB2  . ARG A 1 68  ? 1.023   11.034  -4.548  1.00 0.00 ? 68  ARG A HB2  2  
ATOM 2558  H HB3  . ARG A 1 68  ? 1.164   11.798  -2.970  1.00 0.00 ? 68  ARG A HB3  2  
ATOM 2559  H HG2  . ARG A 1 68  ? 3.648   11.126  -3.114  1.00 0.00 ? 68  ARG A HG2  2  
ATOM 2560  H HG3  . ARG A 1 68  ? 3.327   10.916  -4.836  1.00 0.00 ? 68  ARG A HG3  2  
ATOM 2561  H HD2  . ARG A 1 68  ? 2.417   13.433  -3.549  1.00 0.00 ? 68  ARG A HD2  2  
ATOM 2562  H HD3  . ARG A 1 68  ? 4.147   13.227  -3.821  1.00 0.00 ? 68  ARG A HD3  2  
ATOM 2563  H HE   . ARG A 1 68  ? 3.111   12.608  -6.222  1.00 0.00 ? 68  ARG A HE   2  
ATOM 2564  H HH11 . ARG A 1 68  ? 2.601   15.298  -4.072  1.00 0.00 ? 68  ARG A HH11 2  
ATOM 2565  H HH12 . ARG A 1 68  ? 2.255   16.420  -5.346  1.00 0.00 ? 68  ARG A HH12 2  
ATOM 2566  H HH21 . ARG A 1 68  ? 2.658   14.075  -7.909  1.00 0.00 ? 68  ARG A HH21 2  
ATOM 2567  H HH22 . ARG A 1 68  ? 2.287   15.723  -7.528  1.00 0.00 ? 68  ARG A HH22 2  
ATOM 2568  N N    . LEU A 1 69  ? 3.293   8.797   -1.652  1.00 0.00 ? 69  LEU A N    2  
ATOM 2569  C CA   . LEU A 1 69  ? 4.163   8.669   -0.488  1.00 0.00 ? 69  LEU A CA   2  
ATOM 2570  C C    . LEU A 1 69  ? 5.048   9.901   -0.331  1.00 0.00 ? 69  LEU A C    2  
ATOM 2571  O O    . LEU A 1 69  ? 5.994   10.101  -1.094  1.00 0.00 ? 69  LEU A O    2  
ATOM 2572  C CB   . LEU A 1 69  ? 5.032   7.416   -0.612  1.00 0.00 ? 69  LEU A CB   2  
ATOM 2573  C CG   . LEU A 1 69  ? 4.518   6.169   0.108   1.00 0.00 ? 69  LEU A CG   2  
ATOM 2574  C CD1  . LEU A 1 69  ? 4.759   6.279   1.605   1.00 0.00 ? 69  LEU A CD1  2  
ATOM 2575  C CD2  . LEU A 1 69  ? 3.039   5.957   -0.182  1.00 0.00 ? 69  LEU A CD2  2  
ATOM 2576  H H    . LEU A 1 69  ? 3.467   8.244   -2.441  1.00 0.00 ? 69  LEU A H    2  
ATOM 2577  H HA   . LEU A 1 69  ? 3.536   8.577   0.386   1.00 0.00 ? 69  LEU A HA   2  
ATOM 2578  H HB2  . LEU A 1 69  ? 5.122   7.179   -1.661  1.00 0.00 ? 69  LEU A HB2  2  
ATOM 2579  H HB3  . LEU A 1 69  ? 6.008   7.651   -0.213  1.00 0.00 ? 69  LEU A HB3  2  
ATOM 2580  H HG   . LEU A 1 69  ? 5.057   5.304   -0.254  1.00 0.00 ? 69  LEU A HG   2  
ATOM 2581  H HD11 . LEU A 1 69  ? 3.855   6.615   2.091   1.00 0.00 ? 69  LEU A HD11 2  
ATOM 2582  H HD12 . LEU A 1 69  ? 5.552   6.988   1.791   1.00 0.00 ? 69  LEU A HD12 2  
ATOM 2583  H HD13 . LEU A 1 69  ? 5.041   5.313   1.997   1.00 0.00 ? 69  LEU A HD13 2  
ATOM 2584  H HD21 . LEU A 1 69  ? 2.928   5.227   -0.970  1.00 0.00 ? 69  LEU A HD21 2  
ATOM 2585  H HD22 . LEU A 1 69  ? 2.596   6.892   -0.494  1.00 0.00 ? 69  LEU A HD22 2  
ATOM 2586  H HD23 . LEU A 1 69  ? 2.544   5.604   0.710   1.00 0.00 ? 69  LEU A HD23 2  
ATOM 2587  N N    . LEU A 1 70  ? 4.736   10.724  0.664   1.00 0.00 ? 70  LEU A N    2  
ATOM 2588  C CA   . LEU A 1 70  ? 5.504   11.937  0.923   1.00 0.00 ? 70  LEU A CA   2  
ATOM 2589  C C    . LEU A 1 70  ? 6.701   11.642  1.821   1.00 0.00 ? 70  LEU A C    2  
ATOM 2590  O O    . LEU A 1 70  ? 7.801   12.144  1.590   1.00 0.00 ? 70  LEU A O    2  
ATOM 2591  C CB   . LEU A 1 70  ? 4.615   12.998  1.573   1.00 0.00 ? 70  LEU A CB   2  
ATOM 2592  C CG   . LEU A 1 70  ? 3.852   13.914  0.615   1.00 0.00 ? 70  LEU A CG   2  
ATOM 2593  C CD1  . LEU A 1 70  ? 4.762   14.388  -0.508  1.00 0.00 ? 70  LEU A CD1  2  
ATOM 2594  C CD2  . LEU A 1 70  ? 2.634   13.198  0.050   1.00 0.00 ? 70  LEU A CD2  2  
ATOM 2595  H H    . LEU A 1 70  ? 3.971   10.512  1.239   1.00 0.00 ? 70  LEU A H    2  
ATOM 2596  H HA   . LEU A 1 70  ? 5.863   12.311  -0.024  1.00 0.00 ? 70  LEU A HA   2  
ATOM 2597  H HB2  . LEU A 1 70  ? 3.890   12.490  2.191   1.00 0.00 ? 70  LEU A HB2  2  
ATOM 2598  H HB3  . LEU A 1 70  ? 5.243   13.619  2.196   1.00 0.00 ? 70  LEU A HB3  2  
ATOM 2599  H HG   . LEU A 1 70  ? 3.509   14.785  1.156   1.00 0.00 ? 70  LEU A HG   2  
ATOM 2600  H HD11 . LEU A 1 70  ? 4.663   13.726  -1.355  1.00 0.00 ? 70  LEU A HD11 2  
ATOM 2601  H HD12 . LEU A 1 70  ? 5.787   14.385  -0.166  1.00 0.00 ? 70  LEU A HD12 2  
ATOM 2602  H HD13 . LEU A 1 70  ? 4.483   15.390  -0.798  1.00 0.00 ? 70  LEU A HD13 2  
ATOM 2603  H HD21 . LEU A 1 70  ? 2.925   12.620  -0.814  1.00 0.00 ? 70  LEU A HD21 2  
ATOM 2604  H HD22 . LEU A 1 70  ? 1.890   13.927  -0.239  1.00 0.00 ? 70  LEU A HD22 2  
ATOM 2605  H HD23 . LEU A 1 70  ? 2.222   12.541  0.801   1.00 0.00 ? 70  LEU A HD23 2  
ATOM 2606  N N    . GLU A 1 71  ? 6.480   10.822  2.844   1.00 0.00 ? 71  GLU A N    2  
ATOM 2607  C CA   . GLU A 1 71  ? 7.542   10.459  3.775   1.00 0.00 ? 71  GLU A CA   2  
ATOM 2608  C C    . GLU A 1 71  ? 7.173   9.202   4.558   1.00 0.00 ? 71  GLU A C    2  
ATOM 2609  O O    . GLU A 1 71  ? 6.028   9.030   4.974   1.00 0.00 ? 71  GLU A O    2  
ATOM 2610  C CB   . GLU A 1 71  ? 7.819   11.612  4.742   1.00 0.00 ? 71  GLU A CB   2  
ATOM 2611  C CG   . GLU A 1 71  ? 8.148   12.923  4.048   1.00 0.00 ? 71  GLU A CG   2  
ATOM 2612  C CD   . GLU A 1 71  ? 8.509   14.026  5.024   1.00 0.00 ? 71  GLU A CD   2  
ATOM 2613  O OE1  . GLU A 1 71  ? 9.451   13.827  5.821   1.00 0.00 ? 71  GLU A OE1  2  
ATOM 2614  O OE2  . GLU A 1 71  ? 7.851   15.087  4.992   1.00 0.00 ? 71  GLU A OE2  2  
ATOM 2615  H H    . GLU A 1 71  ? 5.581   10.454  2.976   1.00 0.00 ? 71  GLU A H    2  
ATOM 2616  H HA   . GLU A 1 71  ? 8.434   10.262  3.200   1.00 0.00 ? 71  GLU A HA   2  
ATOM 2617  H HB2  . GLU A 1 71  ? 6.947   11.765  5.361   1.00 0.00 ? 71  GLU A HB2  2  
ATOM 2618  H HB3  . GLU A 1 71  ? 8.654   11.344  5.373   1.00 0.00 ? 71  GLU A HB3  2  
ATOM 2619  H HG2  . GLU A 1 71  ? 8.984   12.764  3.383   1.00 0.00 ? 71  GLU A HG2  2  
ATOM 2620  H HG3  . GLU A 1 71  ? 7.289   13.238  3.474   1.00 0.00 ? 71  GLU A HG3  2  
ATOM 2621  N N    . VAL A 1 72  ? 8.153   8.326   4.754   1.00 0.00 ? 72  VAL A N    2  
ATOM 2622  C CA   . VAL A 1 72  ? 7.933   7.084   5.486   1.00 0.00 ? 72  VAL A CA   2  
ATOM 2623  C C    . VAL A 1 72  ? 8.786   7.033   6.749   1.00 0.00 ? 72  VAL A C    2  
ATOM 2624  O O    . VAL A 1 72  ? 10.003  6.869   6.682   1.00 0.00 ? 72  VAL A O    2  
ATOM 2625  C CB   . VAL A 1 72  ? 8.252   5.855   4.615   1.00 0.00 ? 72  VAL A CB   2  
ATOM 2626  C CG1  . VAL A 1 72  ? 8.025   4.571   5.400   1.00 0.00 ? 72  VAL A CG1  2  
ATOM 2627  C CG2  . VAL A 1 72  ? 7.412   5.869   3.347   1.00 0.00 ? 72  VAL A CG2  2  
ATOM 2628  H H    . VAL A 1 72  ? 9.045   8.519   4.397   1.00 0.00 ? 72  VAL A H    2  
ATOM 2629  H HA   . VAL A 1 72  ? 6.891   7.041   5.765   1.00 0.00 ? 72  VAL A HA   2  
ATOM 2630  H HB   . VAL A 1 72  ? 9.294   5.899   4.333   1.00 0.00 ? 72  VAL A HB   2  
ATOM 2631  H HG11 . VAL A 1 72  ? 7.122   4.092   5.051   1.00 0.00 ? 72  VAL A HG11 2  
ATOM 2632  H HG12 . VAL A 1 72  ? 8.866   3.908   5.256   1.00 0.00 ? 72  VAL A HG12 2  
ATOM 2633  H HG13 . VAL A 1 72  ? 7.926   4.804   6.450   1.00 0.00 ? 72  VAL A HG13 2  
ATOM 2634  H HG21 . VAL A 1 72  ? 6.895   4.927   3.248   1.00 0.00 ? 72  VAL A HG21 2  
ATOM 2635  H HG22 . VAL A 1 72  ? 6.691   6.672   3.401   1.00 0.00 ? 72  VAL A HG22 2  
ATOM 2636  H HG23 . VAL A 1 72  ? 8.054   6.019   2.491   1.00 0.00 ? 72  VAL A HG23 2  
ATOM 2637  N N    . ASN A 1 73  ? 8.137   7.175   7.900   1.00 0.00 ? 73  ASN A N    2  
ATOM 2638  C CA   . ASN A 1 73  ? 8.835   7.146   9.180   1.00 0.00 ? 73  ASN A CA   2  
ATOM 2639  C C    . ASN A 1 73  ? 9.779   8.337   9.313   1.00 0.00 ? 73  ASN A C    2  
ATOM 2640  O O    . ASN A 1 73  ? 10.902  8.200   9.798   1.00 0.00 ? 73  ASN A O    2  
ATOM 2641  C CB   . ASN A 1 73  ? 9.620   5.840   9.326   1.00 0.00 ? 73  ASN A CB   2  
ATOM 2642  C CG   . ASN A 1 73  ? 8.848   4.784   10.094  1.00 0.00 ? 73  ASN A CG   2  
ATOM 2643  O OD1  . ASN A 1 73  ? 8.205   5.079   11.101  1.00 0.00 ? 73  ASN A OD1  2  
ATOM 2644  N ND2  . ASN A 1 73  ? 8.908   3.546   9.619   1.00 0.00 ? 73  ASN A ND2  2  
ATOM 2645  H H    . ASN A 1 73  ? 7.165   7.304   7.889   1.00 0.00 ? 73  ASN A H    2  
ATOM 2646  H HA   . ASN A 1 73  ? 8.094   7.199   9.963   1.00 0.00 ? 73  ASN A HA   2  
ATOM 2647  H HB2  . ASN A 1 73  ? 9.845   5.451   8.344   1.00 0.00 ? 73  ASN A HB2  2  
ATOM 2648  H HB3  . ASN A 1 73  ? 10.543  6.038   9.851   1.00 0.00 ? 73  ASN A HB3  2  
ATOM 2649  H HD21 . ASN A 1 73  ? 9.440   3.384   8.812   1.00 0.00 ? 73  ASN A HD21 2  
ATOM 2650  H HD22 . ASN A 1 73  ? 8.418   2.844   10.095  1.00 0.00 ? 73  ASN A HD22 2  
ATOM 2651  N N    . GLN A 1 74  ? 9.315   9.504   8.878   1.00 0.00 ? 74  GLN A N    2  
ATOM 2652  C CA   . GLN A 1 74  ? 10.118  10.719  8.948   1.00 0.00 ? 74  GLN A CA   2  
ATOM 2653  C C    . GLN A 1 74  ? 11.363  10.600  8.075   1.00 0.00 ? 74  GLN A C    2  
ATOM 2654  O O    . GLN A 1 74  ? 12.432  11.094  8.432   1.00 0.00 ? 74  GLN A O    2  
ATOM 2655  C CB   . GLN A 1 74  ? 10.522  11.006  10.396  1.00 0.00 ? 74  GLN A CB   2  
ATOM 2656  C CG   . GLN A 1 74  ? 9.355   11.401  11.286  1.00 0.00 ? 74  GLN A CG   2  
ATOM 2657  C CD   . GLN A 1 74  ? 9.589   11.052  12.743  1.00 0.00 ? 74  GLN A CD   2  
ATOM 2658  O OE1  . GLN A 1 74  ? 10.029  11.890  13.531  1.00 0.00 ? 74  GLN A OE1  2  
ATOM 2659  N NE2  . GLN A 1 74  ? 9.293   9.811   13.109  1.00 0.00 ? 74  GLN A NE2  2  
ATOM 2660  H H    . GLN A 1 74  ? 8.412   9.549   8.502   1.00 0.00 ? 74  GLN A H    2  
ATOM 2661  H HA   . GLN A 1 74  ? 9.515   11.536  8.584   1.00 0.00 ? 74  GLN A HA   2  
ATOM 2662  H HB2  . GLN A 1 74  ? 10.981  10.121  10.811  1.00 0.00 ? 74  GLN A HB2  2  
ATOM 2663  H HB3  . GLN A 1 74  ? 11.241  11.811  10.403  1.00 0.00 ? 74  GLN A HB3  2  
ATOM 2664  H HG2  . GLN A 1 74  ? 9.204   12.468  11.207  1.00 0.00 ? 74  GLN A HG2  2  
ATOM 2665  H HG3  . GLN A 1 74  ? 8.469   10.887  10.945  1.00 0.00 ? 74  GLN A HG3  2  
ATOM 2666  H HE21 . GLN A 1 74  ? 8.948   9.197   12.427  1.00 0.00 ? 74  GLN A HE21 2  
ATOM 2667  H HE22 . GLN A 1 74  ? 9.435   9.558   14.044  1.00 0.00 ? 74  GLN A HE22 2  
ATOM 2668  N N    . GLN A 1 75  ? 11.215  9.942   6.929   1.00 0.00 ? 75  GLN A N    2  
ATOM 2669  C CA   . GLN A 1 75  ? 12.328  9.757   6.006   1.00 0.00 ? 75  GLN A CA   2  
ATOM 2670  C C    . GLN A 1 75  ? 11.918  10.116  4.581   1.00 0.00 ? 75  GLN A C    2  
ATOM 2671  O O    . GLN A 1 75  ? 11.426  9.270   3.835   1.00 0.00 ? 75  GLN A O    2  
ATOM 2672  C CB   . GLN A 1 75  ? 12.827  8.312   6.057   1.00 0.00 ? 75  GLN A CB   2  
ATOM 2673  C CG   . GLN A 1 75  ? 13.221  7.854   7.452   1.00 0.00 ? 75  GLN A CG   2  
ATOM 2674  C CD   . GLN A 1 75  ? 14.278  6.767   7.432   1.00 0.00 ? 75  GLN A CD   2  
ATOM 2675  O OE1  . GLN A 1 75  ? 15.243  6.837   6.671   1.00 0.00 ? 75  GLN A OE1  2  
ATOM 2676  N NE2  . GLN A 1 75  ? 14.101  5.754   8.272   1.00 0.00 ? 75  GLN A NE2  2  
ATOM 2677  H H    . GLN A 1 75  ? 10.338  9.571   6.701   1.00 0.00 ? 75  GLN A H    2  
ATOM 2678  H HA   . GLN A 1 75  ? 13.126  10.415  6.314   1.00 0.00 ? 75  GLN A HA   2  
ATOM 2679  H HB2  . GLN A 1 75  ? 12.046  7.661   5.695   1.00 0.00 ? 75  GLN A HB2  2  
ATOM 2680  H HB3  . GLN A 1 75  ? 13.690  8.219   5.414   1.00 0.00 ? 75  GLN A HB3  2  
ATOM 2681  H HG2  . GLN A 1 75  ? 13.608  8.701   7.999   1.00 0.00 ? 75  GLN A HG2  2  
ATOM 2682  H HG3  . GLN A 1 75  ? 12.343  7.474   7.953   1.00 0.00 ? 75  GLN A HG3  2  
ATOM 2683  H HE21 . GLN A 1 75  ? 13.307  5.764   8.848   1.00 0.00 ? 75  GLN A HE21 2  
ATOM 2684  H HE22 . GLN A 1 75  ? 14.768  5.037   8.280   1.00 0.00 ? 75  GLN A HE22 2  
ATOM 2685  N N    . SER A 1 76  ? 12.124  11.376  4.211   1.00 0.00 ? 76  SER A N    2  
ATOM 2686  C CA   . SER A 1 76  ? 11.772  11.848  2.877   1.00 0.00 ? 76  SER A CA   2  
ATOM 2687  C C    . SER A 1 76  ? 12.283  10.886  1.808   1.00 0.00 ? 76  SER A C    2  
ATOM 2688  O O    . SER A 1 76  ? 13.466  10.543  1.779   1.00 0.00 ? 76  SER A O    2  
ATOM 2689  C CB   . SER A 1 76  ? 12.348  13.245  2.638   1.00 0.00 ? 76  SER A CB   2  
ATOM 2690  O OG   . SER A 1 76  ? 12.026  13.715  1.341   1.00 0.00 ? 76  SER A OG   2  
ATOM 2691  H H    . SER A 1 76  ? 12.521  12.003  4.851   1.00 0.00 ? 76  SER A H    2  
ATOM 2692  H HA   . SER A 1 76  ? 10.695  11.896  2.816   1.00 0.00 ? 76  SER A HA   2  
ATOM 2693  H HB2  . SER A 1 76  ? 11.940  13.929  3.367   1.00 0.00 ? 76  SER A HB2  2  
ATOM 2694  H HB3  . SER A 1 76  ? 13.423  13.211  2.740   1.00 0.00 ? 76  SER A HB3  2  
ATOM 2695  H HG   . SER A 1 76  ? 12.049  14.675  1.333   1.00 0.00 ? 76  SER A HG   2  
ATOM 2696  N N    . LEU A 1 77  ? 11.384  10.454  0.931   1.00 0.00 ? 77  LEU A N    2  
ATOM 2697  C CA   . LEU A 1 77  ? 11.742  9.531   -0.140  1.00 0.00 ? 77  LEU A CA   2  
ATOM 2698  C C    . LEU A 1 77  ? 12.449  10.264  -1.276  1.00 0.00 ? 77  LEU A C    2  
ATOM 2699  O O    . LEU A 1 77  ? 12.817  9.660   -2.285  1.00 0.00 ? 77  LEU A O    2  
ATOM 2700  C CB   . LEU A 1 77  ? 10.492  8.828   -0.673  1.00 0.00 ? 77  LEU A CB   2  
ATOM 2701  C CG   . LEU A 1 77  ? 9.561   8.225   0.380   1.00 0.00 ? 77  LEU A CG   2  
ATOM 2702  C CD1  . LEU A 1 77  ? 8.556   7.288   -0.270  1.00 0.00 ? 77  LEU A CD1  2  
ATOM 2703  C CD2  . LEU A 1 77  ? 10.364  7.493   1.445   1.00 0.00 ? 77  LEU A CD2  2  
ATOM 2704  H H    . LEU A 1 77  ? 10.457  10.762  1.006   1.00 0.00 ? 77  LEU A H    2  
ATOM 2705  H HA   . LEU A 1 77  ? 12.414  8.792   0.269   1.00 0.00 ? 77  LEU A HA   2  
ATOM 2706  H HB2  . LEU A 1 77  ? 9.925   9.547   -1.242  1.00 0.00 ? 77  LEU A HB2  2  
ATOM 2707  H HB3  . LEU A 1 77  ? 10.816  8.029   -1.325  1.00 0.00 ? 77  LEU A HB3  2  
ATOM 2708  H HG   . LEU A 1 77  ? 9.011   9.021   0.863   1.00 0.00 ? 77  LEU A HG   2  
ATOM 2709  H HD11 . LEU A 1 77  ? 9.072   6.432   -0.677  1.00 0.00 ? 77  LEU A HD11 2  
ATOM 2710  H HD12 . LEU A 1 77  ? 8.040   7.808   -1.063  1.00 0.00 ? 77  LEU A HD12 2  
ATOM 2711  H HD13 . LEU A 1 77  ? 7.840   6.959   0.469   1.00 0.00 ? 77  LEU A HD13 2  
ATOM 2712  H HD21 . LEU A 1 77  ? 9.698   7.145   2.221   1.00 0.00 ? 77  LEU A HD21 2  
ATOM 2713  H HD22 . LEU A 1 77  ? 11.094  8.166   1.872   1.00 0.00 ? 77  LEU A HD22 2  
ATOM 2714  H HD23 . LEU A 1 77  ? 10.869  6.649   0.999   1.00 0.00 ? 77  LEU A HD23 2  
ATOM 2715  N N    . LEU A 1 78  ? 12.638  11.568  -1.105  1.00 0.00 ? 78  LEU A N    2  
ATOM 2716  C CA   . LEU A 1 78  ? 13.305  12.383  -2.114  1.00 0.00 ? 78  LEU A CA   2  
ATOM 2717  C C    . LEU A 1 78  ? 14.800  12.084  -2.156  1.00 0.00 ? 78  LEU A C    2  
ATOM 2718  O O    . LEU A 1 78  ? 15.534  12.402  -1.222  1.00 0.00 ? 78  LEU A O    2  
ATOM 2719  C CB   . LEU A 1 78  ? 13.078  13.869  -1.829  1.00 0.00 ? 78  LEU A CB   2  
ATOM 2720  C CG   . LEU A 1 78  ? 13.042  14.789  -3.049  1.00 0.00 ? 78  LEU A CG   2  
ATOM 2721  C CD1  . LEU A 1 78  ? 14.403  14.832  -3.726  1.00 0.00 ? 78  LEU A CD1  2  
ATOM 2722  C CD2  . LEU A 1 78  ? 11.971  14.332  -4.030  1.00 0.00 ? 78  LEU A CD2  2  
ATOM 2723  H H    . LEU A 1 78  ? 12.323  11.993  -0.280  1.00 0.00 ? 78  LEU A H    2  
ATOM 2724  H HA   . LEU A 1 78  ? 12.874  12.140  -3.074  1.00 0.00 ? 78  LEU A HA   2  
ATOM 2725  H HB2  . LEU A 1 78  ? 12.135  13.966  -1.313  1.00 0.00 ? 78  LEU A HB2  2  
ATOM 2726  H HB3  . LEU A 1 78  ? 13.876  14.206  -1.182  1.00 0.00 ? 78  LEU A HB3  2  
ATOM 2727  H HG   . LEU A 1 78  ? 12.797  15.792  -2.729  1.00 0.00 ? 78  LEU A HG   2  
ATOM 2728  H HD11 . LEU A 1 78  ? 15.158  14.484  -3.038  1.00 0.00 ? 78  LEU A HD11 2  
ATOM 2729  H HD12 . LEU A 1 78  ? 14.626  15.847  -4.021  1.00 0.00 ? 78  LEU A HD12 2  
ATOM 2730  H HD13 . LEU A 1 78  ? 14.391  14.198  -4.600  1.00 0.00 ? 78  LEU A HD13 2  
ATOM 2731  H HD21 . LEU A 1 78  ? 11.249  15.123  -4.167  1.00 0.00 ? 78  LEU A HD21 2  
ATOM 2732  H HD22 . LEU A 1 78  ? 11.475  13.456  -3.638  1.00 0.00 ? 78  LEU A HD22 2  
ATOM 2733  H HD23 . LEU A 1 78  ? 12.430  14.094  -4.978  1.00 0.00 ? 78  LEU A HD23 2  
ATOM 2734  N N    . GLY A 1 79  ? 15.245  11.470  -3.249  1.00 0.00 ? 79  GLY A N    2  
ATOM 2735  C CA   . GLY A 1 79  ? 16.650  11.140  -3.394  1.00 0.00 ? 79  GLY A CA   2  
ATOM 2736  C C    . GLY A 1 79  ? 16.876  9.664   -3.651  1.00 0.00 ? 79  GLY A C    2  
ATOM 2737  O O    . GLY A 1 79  ? 17.761  9.288   -4.421  1.00 0.00 ? 79  GLY A O    2  
ATOM 2738  H H    . GLY A 1 79  ? 14.613  11.240  -3.963  1.00 0.00 ? 79  GLY A H    2  
ATOM 2739  H HA2  . GLY A 1 79  ? 17.059  11.705  -4.218  1.00 0.00 ? 79  GLY A HA2  2  
ATOM 2740  H HA3  . GLY A 1 79  ? 17.169  11.419  -2.488  1.00 0.00 ? 79  GLY A HA3  2  
ATOM 2741  N N    . LEU A 1 80  ? 16.075  8.823   -3.005  1.00 0.00 ? 80  LEU A N    2  
ATOM 2742  C CA   . LEU A 1 80  ? 16.192  7.378   -3.167  1.00 0.00 ? 80  LEU A CA   2  
ATOM 2743  C C    . LEU A 1 80  ? 15.367  6.895   -4.355  1.00 0.00 ? 80  LEU A C    2  
ATOM 2744  O O    . LEU A 1 80  ? 14.534  7.629   -4.888  1.00 0.00 ? 80  LEU A O    2  
ATOM 2745  C CB   . LEU A 1 80  ? 15.739  6.664   -1.892  1.00 0.00 ? 80  LEU A CB   2  
ATOM 2746  C CG   . LEU A 1 80  ? 14.597  7.328   -1.121  1.00 0.00 ? 80  LEU A CG   2  
ATOM 2747  C CD1  . LEU A 1 80  ? 13.772  6.284   -0.385  1.00 0.00 ? 80  LEU A CD1  2  
ATOM 2748  C CD2  . LEU A 1 80  ? 15.143  8.363   -0.147  1.00 0.00 ? 80  LEU A CD2  2  
ATOM 2749  H H    . LEU A 1 80  ? 15.389  9.182   -2.405  1.00 0.00 ? 80  LEU A H    2  
ATOM 2750  H HA   . LEU A 1 80  ? 17.231  7.148   -3.348  1.00 0.00 ? 80  LEU A HA   2  
ATOM 2751  H HB2  . LEU A 1 80  ? 15.419  5.671   -2.165  1.00 0.00 ? 80  LEU A HB2  2  
ATOM 2752  H HB3  . LEU A 1 80  ? 16.591  6.597   -1.231  1.00 0.00 ? 80  LEU A HB3  2  
ATOM 2753  H HG   . LEU A 1 80  ? 13.946  7.835   -1.819  1.00 0.00 ? 80  LEU A HG   2  
ATOM 2754  H HD11 . LEU A 1 80  ? 12.723  6.515   -0.490  1.00 0.00 ? 80  LEU A HD11 2  
ATOM 2755  H HD12 . LEU A 1 80  ? 14.039  6.286   0.662   1.00 0.00 ? 80  LEU A HD12 2  
ATOM 2756  H HD13 . LEU A 1 80  ? 13.970  5.308   -0.804  1.00 0.00 ? 80  LEU A HD13 2  
ATOM 2757  H HD21 . LEU A 1 80  ? 14.995  9.352   -0.554  1.00 0.00 ? 80  LEU A HD21 2  
ATOM 2758  H HD22 . LEU A 1 80  ? 16.198  8.191   0.007   1.00 0.00 ? 80  LEU A HD22 2  
ATOM 2759  H HD23 . LEU A 1 80  ? 14.622  8.280   0.795   1.00 0.00 ? 80  LEU A HD23 2  
ATOM 2760  N N    . THR A 1 81  ? 15.601  5.652   -4.765  1.00 0.00 ? 81  THR A N    2  
ATOM 2761  C CA   . THR A 1 81  ? 14.879  5.069   -5.889  1.00 0.00 ? 81  THR A CA   2  
ATOM 2762  C C    . THR A 1 81  ? 13.793  4.114   -5.409  1.00 0.00 ? 81  THR A C    2  
ATOM 2763  O O    . THR A 1 81  ? 13.613  3.916   -4.207  1.00 0.00 ? 81  THR A O    2  
ATOM 2764  C CB   . THR A 1 81  ? 15.830  4.313   -6.836  1.00 0.00 ? 81  THR A CB   2  
ATOM 2765  O OG1  . THR A 1 81  ? 16.466  3.237   -6.136  1.00 0.00 ? 81  THR A OG1  2  
ATOM 2766  C CG2  . THR A 1 81  ? 16.886  5.249   -7.404  1.00 0.00 ? 81  THR A CG2  2  
ATOM 2767  H H    . THR A 1 81  ? 16.277  5.116   -4.300  1.00 0.00 ? 81  THR A H    2  
ATOM 2768  H HA   . THR A 1 81  ? 14.418  5.874   -6.443  1.00 0.00 ? 81  THR A HA   2  
ATOM 2769  H HB   . THR A 1 81  ? 15.251  3.907   -7.654  1.00 0.00 ? 81  THR A HB   2  
ATOM 2770  H HG1  . THR A 1 81  ? 15.890  2.469   -6.139  1.00 0.00 ? 81  THR A HG1  2  
ATOM 2771  H HG21 . THR A 1 81  ? 17.613  4.676   -7.960  1.00 0.00 ? 81  THR A HG21 2  
ATOM 2772  H HG22 . THR A 1 81  ? 17.378  5.769   -6.596  1.00 0.00 ? 81  THR A HG22 2  
ATOM 2773  H HG23 . THR A 1 81  ? 16.415  5.966   -8.060  1.00 0.00 ? 81  THR A HG23 2  
ATOM 2774  N N    . HIS A 1 82  ? 13.070  3.523   -6.355  1.00 0.00 ? 82  HIS A N    2  
ATOM 2775  C CA   . HIS A 1 82  ? 12.001  2.586   -6.028  1.00 0.00 ? 82  HIS A CA   2  
ATOM 2776  C C    . HIS A 1 82  ? 12.491  1.523   -5.050  1.00 0.00 ? 82  HIS A C    2  
ATOM 2777  O O    . HIS A 1 82  ? 11.870  1.284   -4.015  1.00 0.00 ? 82  HIS A O    2  
ATOM 2778  C CB   . HIS A 1 82  ? 11.469  1.922   -7.298  1.00 0.00 ? 82  HIS A CB   2  
ATOM 2779  C CG   . HIS A 1 82  ? 10.072  1.400   -7.161  1.00 0.00 ? 82  HIS A CG   2  
ATOM 2780  N ND1  . HIS A 1 82  ? 9.704   0.126   -7.542  1.00 0.00 ? 82  HIS A ND1  2  
ATOM 2781  C CD2  . HIS A 1 82  ? 8.951   1.986   -6.681  1.00 0.00 ? 82  HIS A CD2  2  
ATOM 2782  C CE1  . HIS A 1 82  ? 8.416   -0.047  -7.303  1.00 0.00 ? 82  HIS A CE1  2  
ATOM 2783  N NE2  . HIS A 1 82  ? 7.936   1.067   -6.780  1.00 0.00 ? 82  HIS A NE2  2  
ATOM 2784  H H    . HIS A 1 82  ? 13.261  3.721   -7.295  1.00 0.00 ? 82  HIS A H    2  
ATOM 2785  H HA   . HIS A 1 82  ? 11.202  3.144   -5.563  1.00 0.00 ? 82  HIS A HA   2  
ATOM 2786  H HB2  . HIS A 1 82  ? 11.477  2.642   -8.103  1.00 0.00 ? 82  HIS A HB2  2  
ATOM 2787  H HB3  . HIS A 1 82  ? 12.111  1.092   -7.558  1.00 0.00 ? 82  HIS A HB3  2  
ATOM 2788  H HD1  . HIS A 1 82  ? 10.298  -0.549  -7.931  1.00 0.00 ? 82  HIS A HD1  2  
ATOM 2789  H HD2  . HIS A 1 82  ? 8.869   2.991   -6.292  1.00 0.00 ? 82  HIS A HD2  2  
ATOM 2790  H HE1  . HIS A 1 82  ? 7.852   -0.946  -7.501  1.00 0.00 ? 82  HIS A HE1  2  
ATOM 2791  H HE2  . HIS A 1 82  ? 6.991   1.238   -6.589  1.00 0.00 ? 82  HIS A HE2  2  
ATOM 2792  N N    . GLY A 1 83  ? 13.608  0.886   -5.386  1.00 0.00 ? 83  GLY A N    2  
ATOM 2793  C CA   . GLY A 1 83  ? 14.162  -0.145  -4.528  1.00 0.00 ? 83  GLY A CA   2  
ATOM 2794  C C    . GLY A 1 83  ? 14.395  0.343   -3.112  1.00 0.00 ? 83  GLY A C    2  
ATOM 2795  O O    . GLY A 1 83  ? 14.053  -0.343  -2.149  1.00 0.00 ? 83  GLY A O    2  
ATOM 2796  H H    . GLY A 1 83  ? 14.061  1.118   -6.224  1.00 0.00 ? 83  GLY A H    2  
ATOM 2797  H HA2  . GLY A 1 83  ? 13.479  -0.981  -4.502  1.00 0.00 ? 83  GLY A HA2  2  
ATOM 2798  H HA3  . GLY A 1 83  ? 15.104  -0.475  -4.942  1.00 0.00 ? 83  GLY A HA3  2  
ATOM 2799  N N    . GLU A 1 84  ? 14.980  1.529   -2.985  1.00 0.00 ? 84  GLU A N    2  
ATOM 2800  C CA   . GLU A 1 84  ? 15.260  2.106   -1.675  1.00 0.00 ? 84  GLU A CA   2  
ATOM 2801  C C    . GLU A 1 84  ? 13.966  2.456   -0.947  1.00 0.00 ? 84  GLU A C    2  
ATOM 2802  O O    . GLU A 1 84  ? 13.708  1.965   0.152   1.00 0.00 ? 84  GLU A O    2  
ATOM 2803  C CB   . GLU A 1 84  ? 16.131  3.356   -1.820  1.00 0.00 ? 84  GLU A CB   2  
ATOM 2804  C CG   . GLU A 1 84  ? 17.622  3.067   -1.783  1.00 0.00 ? 84  GLU A CG   2  
ATOM 2805  C CD   . GLU A 1 84  ? 18.458  4.264   -2.190  1.00 0.00 ? 84  GLU A CD   2  
ATOM 2806  O OE1  . GLU A 1 84  ? 18.706  4.432   -3.403  1.00 0.00 ? 84  GLU A OE1  2  
ATOM 2807  O OE2  . GLU A 1 84  ? 18.866  5.034   -1.295  1.00 0.00 ? 84  GLU A OE2  2  
ATOM 2808  H H    . GLU A 1 84  ? 15.229  2.029   -3.791  1.00 0.00 ? 84  GLU A H    2  
ATOM 2809  H HA   . GLU A 1 84  ? 15.797  1.370   -1.097  1.00 0.00 ? 84  GLU A HA   2  
ATOM 2810  H HB2  . GLU A 1 84  ? 15.900  3.835   -2.760  1.00 0.00 ? 84  GLU A HB2  2  
ATOM 2811  H HB3  . GLU A 1 84  ? 15.898  4.037   -1.014  1.00 0.00 ? 84  GLU A HB3  2  
ATOM 2812  H HG2  . GLU A 1 84  ? 17.896  2.780   -0.779  1.00 0.00 ? 84  GLU A HG2  2  
ATOM 2813  H HG3  . GLU A 1 84  ? 17.834  2.252   -2.460  1.00 0.00 ? 84  GLU A HG3  2  
ATOM 2814  N N    . ALA A 1 85  ? 13.156  3.308   -1.567  1.00 0.00 ? 85  ALA A N    2  
ATOM 2815  C CA   . ALA A 1 85  ? 11.888  3.722   -0.979  1.00 0.00 ? 85  ALA A CA   2  
ATOM 2816  C C    . ALA A 1 85  ? 11.138  2.530   -0.395  1.00 0.00 ? 85  ALA A C    2  
ATOM 2817  O O    . ALA A 1 85  ? 10.640  2.587   0.730   1.00 0.00 ? 85  ALA A O    2  
ATOM 2818  C CB   . ALA A 1 85  ? 11.031  4.430   -2.017  1.00 0.00 ? 85  ALA A CB   2  
ATOM 2819  H H    . ALA A 1 85  ? 13.417  3.665   -2.441  1.00 0.00 ? 85  ALA A H    2  
ATOM 2820  H HA   . ALA A 1 85  ? 12.102  4.424   -0.185  1.00 0.00 ? 85  ALA A HA   2  
ATOM 2821  H HB1  . ALA A 1 85  ? 9.988   4.310   -1.765  1.00 0.00 ? 85  ALA A HB1  2  
ATOM 2822  H HB2  . ALA A 1 85  ? 11.279  5.481   -2.033  1.00 0.00 ? 85  ALA A HB2  2  
ATOM 2823  H HB3  . ALA A 1 85  ? 11.218  4.002   -2.991  1.00 0.00 ? 85  ALA A HB3  2  
ATOM 2824  N N    . VAL A 1 86  ? 11.060  1.450   -1.166  1.00 0.00 ? 86  VAL A N    2  
ATOM 2825  C CA   . VAL A 1 86  ? 10.370  0.244   -0.725  1.00 0.00 ? 86  VAL A CA   2  
ATOM 2826  C C    . VAL A 1 86  ? 10.955  -0.276  0.583   1.00 0.00 ? 86  VAL A C    2  
ATOM 2827  O O    . VAL A 1 86  ? 10.257  -0.370  1.592   1.00 0.00 ? 86  VAL A O    2  
ATOM 2828  C CB   . VAL A 1 86  ? 10.449  -0.868  -1.788  1.00 0.00 ? 86  VAL A CB   2  
ATOM 2829  C CG1  . VAL A 1 86  ? 9.854   -2.162  -1.253  1.00 0.00 ? 86  VAL A CG1  2  
ATOM 2830  C CG2  . VAL A 1 86  ? 9.744   -0.435  -3.065  1.00 0.00 ? 86  VAL A CG2  2  
ATOM 2831  H H    . VAL A 1 86  ? 11.477  1.465   -2.053  1.00 0.00 ? 86  VAL A H    2  
ATOM 2832  H HA   . VAL A 1 86  ? 9.330   0.492   -0.570  1.00 0.00 ? 86  VAL A HA   2  
ATOM 2833  H HB   . VAL A 1 86  ? 11.490  -1.045  -2.018  1.00 0.00 ? 86  VAL A HB   2  
ATOM 2834  H HG11 . VAL A 1 86  ? 10.565  -2.964  -1.380  1.00 0.00 ? 86  VAL A HG11 2  
ATOM 2835  H HG12 . VAL A 1 86  ? 9.624   -2.046  -0.204  1.00 0.00 ? 86  VAL A HG12 2  
ATOM 2836  H HG13 . VAL A 1 86  ? 8.950   -2.393  -1.796  1.00 0.00 ? 86  VAL A HG13 2  
ATOM 2837  H HG21 . VAL A 1 86  ? 10.326  -0.747  -3.919  1.00 0.00 ? 86  VAL A HG21 2  
ATOM 2838  H HG22 . VAL A 1 86  ? 8.766   -0.892  -3.109  1.00 0.00 ? 86  VAL A HG22 2  
ATOM 2839  H HG23 . VAL A 1 86  ? 9.640   0.639   -3.072  1.00 0.00 ? 86  VAL A HG23 2  
ATOM 2840  N N    . GLN A 1 87  ? 12.241  -0.613  0.558   1.00 0.00 ? 87  GLN A N    2  
ATOM 2841  C CA   . GLN A 1 87  ? 12.920  -1.124  1.743   1.00 0.00 ? 87  GLN A CA   2  
ATOM 2842  C C    . GLN A 1 87  ? 12.676  -0.216  2.944   1.00 0.00 ? 87  GLN A C    2  
ATOM 2843  O O    . GLN A 1 87  ? 12.724  -0.661  4.092   1.00 0.00 ? 87  GLN A O    2  
ATOM 2844  C CB   . GLN A 1 87  ? 14.421  -1.250  1.481   1.00 0.00 ? 87  GLN A CB   2  
ATOM 2845  C CG   . GLN A 1 87  ? 14.767  -2.256  0.395   1.00 0.00 ? 87  GLN A CG   2  
ATOM 2846  C CD   . GLN A 1 87  ? 14.033  -3.572  0.564   1.00 0.00 ? 87  GLN A CD   2  
ATOM 2847  O OE1  . GLN A 1 87  ? 14.413  -4.407  1.385   1.00 0.00 ? 87  GLN A OE1  2  
ATOM 2848  N NE2  . GLN A 1 87  ? 12.975  -3.765  -0.215  1.00 0.00 ? 87  GLN A NE2  2  
ATOM 2849  H H    . GLN A 1 87  ? 12.744  -0.515  -0.277  1.00 0.00 ? 87  GLN A H    2  
ATOM 2850  H HA   . GLN A 1 87  ? 12.517  -2.102  1.959   1.00 0.00 ? 87  GLN A HA   2  
ATOM 2851  H HB2  . GLN A 1 87  ? 14.806  -0.286  1.185   1.00 0.00 ? 87  GLN A HB2  2  
ATOM 2852  H HB3  . GLN A 1 87  ? 14.909  -1.558  2.394   1.00 0.00 ? 87  GLN A HB3  2  
ATOM 2853  H HG2  . GLN A 1 87  ? 14.504  -1.836  -0.564  1.00 0.00 ? 87  GLN A HG2  2  
ATOM 2854  H HG3  . GLN A 1 87  ? 15.830  -2.447  0.424   1.00 0.00 ? 87  GLN A HG3  2  
ATOM 2855  H HE21 . GLN A 1 87  ? 12.732  -3.056  -0.847  1.00 0.00 ? 87  GLN A HE21 2  
ATOM 2856  H HE22 . GLN A 1 87  ? 12.483  -4.607  -0.128  1.00 0.00 ? 87  GLN A HE22 2  
ATOM 2857  N N    . LEU A 1 88  ? 12.413  1.058   2.673   1.00 0.00 ? 88  LEU A N    2  
ATOM 2858  C CA   . LEU A 1 88  ? 12.162  2.029   3.732   1.00 0.00 ? 88  LEU A CA   2  
ATOM 2859  C C    . LEU A 1 88  ? 10.773  1.834   4.331   1.00 0.00 ? 88  LEU A C    2  
ATOM 2860  O O    . LEU A 1 88  ? 10.558  2.076   5.520   1.00 0.00 ? 88  LEU A O    2  
ATOM 2861  C CB   . LEU A 1 88  ? 12.300  3.452   3.188   1.00 0.00 ? 88  LEU A CB   2  
ATOM 2862  C CG   . LEU A 1 88  ? 12.741  4.515   4.195   1.00 0.00 ? 88  LEU A CG   2  
ATOM 2863  C CD1  . LEU A 1 88  ? 13.016  5.835   3.492   1.00 0.00 ? 88  LEU A CD1  2  
ATOM 2864  C CD2  . LEU A 1 88  ? 11.687  4.695   5.278   1.00 0.00 ? 88  LEU A CD2  2  
ATOM 2865  H H    . LEU A 1 88  ? 12.388  1.353   1.739   1.00 0.00 ? 88  LEU A H    2  
ATOM 2866  H HA   . LEU A 1 88  ? 12.899  1.875   4.505   1.00 0.00 ? 88  LEU A HA   2  
ATOM 2867  H HB2  . LEU A 1 88  ? 13.025  3.432   2.390   1.00 0.00 ? 88  LEU A HB2  2  
ATOM 2868  H HB3  . LEU A 1 88  ? 11.339  3.749   2.793   1.00 0.00 ? 88  LEU A HB3  2  
ATOM 2869  H HG   . LEU A 1 88  ? 13.658  4.194   4.670   1.00 0.00 ? 88  LEU A HG   2  
ATOM 2870  H HD11 . LEU A 1 88  ? 13.957  5.775   2.967   1.00 0.00 ? 88  LEU A HD11 2  
ATOM 2871  H HD12 . LEU A 1 88  ? 13.061  6.630   4.222   1.00 0.00 ? 88  LEU A HD12 2  
ATOM 2872  H HD13 . LEU A 1 88  ? 12.223  6.039   2.787   1.00 0.00 ? 88  LEU A HD13 2  
ATOM 2873  H HD21 . LEU A 1 88  ? 10.704  4.579   4.845   1.00 0.00 ? 88  LEU A HD21 2  
ATOM 2874  H HD22 . LEU A 1 88  ? 11.777  5.682   5.708   1.00 0.00 ? 88  LEU A HD22 2  
ATOM 2875  H HD23 . LEU A 1 88  ? 11.832  3.952   6.048   1.00 0.00 ? 88  LEU A HD23 2  
ATOM 2876  N N    . LEU A 1 89  ? 9.833   1.393   3.502   1.00 0.00 ? 89  LEU A N    2  
ATOM 2877  C CA   . LEU A 1 89  ? 8.464   1.163   3.950   1.00 0.00 ? 89  LEU A CA   2  
ATOM 2878  C C    . LEU A 1 89  ? 8.351   -0.164  4.695   1.00 0.00 ? 89  LEU A C    2  
ATOM 2879  O O    . LEU A 1 89  ? 7.540   -0.305  5.611   1.00 0.00 ? 89  LEU A O    2  
ATOM 2880  C CB   . LEU A 1 89  ? 7.507   1.173   2.757   1.00 0.00 ? 89  LEU A CB   2  
ATOM 2881  C CG   . LEU A 1 89  ? 7.265   -0.176  2.078   1.00 0.00 ? 89  LEU A CG   2  
ATOM 2882  C CD1  . LEU A 1 89  ? 6.091   -0.895  2.723   1.00 0.00 ? 89  LEU A CD1  2  
ATOM 2883  C CD2  . LEU A 1 89  ? 7.025   0.013   0.588   1.00 0.00 ? 89  LEU A CD2  2  
ATOM 2884  H H    . LEU A 1 89  ? 10.064  1.218   2.566   1.00 0.00 ? 89  LEU A H    2  
ATOM 2885  H HA   . LEU A 1 89  ? 8.196   1.964   4.623   1.00 0.00 ? 89  LEU A HA   2  
ATOM 2886  H HB2  . LEU A 1 89  ? 6.554   1.546   3.100   1.00 0.00 ? 89  LEU A HB2  2  
ATOM 2887  H HB3  . LEU A 1 89  ? 7.910   1.850   2.017   1.00 0.00 ? 89  LEU A HB3  2  
ATOM 2888  H HG   . LEU A 1 89  ? 8.143   -0.796  2.201   1.00 0.00 ? 89  LEU A HG   2  
ATOM 2889  H HD11 . LEU A 1 89  ? 5.202   -0.736  2.130   1.00 0.00 ? 89  LEU A HD11 2  
ATOM 2890  H HD12 . LEU A 1 89  ? 5.933   -0.506  3.718   1.00 0.00 ? 89  LEU A HD12 2  
ATOM 2891  H HD13 . LEU A 1 89  ? 6.303   -1.952  2.780   1.00 0.00 ? 89  LEU A HD13 2  
ATOM 2892  H HD21 . LEU A 1 89  ? 5.973   -0.110  0.375   1.00 0.00 ? 89  LEU A HD21 2  
ATOM 2893  H HD22 . LEU A 1 89  ? 7.592   -0.723  0.036   1.00 0.00 ? 89  LEU A HD22 2  
ATOM 2894  H HD23 . LEU A 1 89  ? 7.338   1.003   0.295   1.00 0.00 ? 89  LEU A HD23 2  
ATOM 2895  N N    . ARG A 1 90  ? 9.171   -1.131  4.298   1.00 0.00 ? 90  ARG A N    2  
ATOM 2896  C CA   . ARG A 1 90  ? 9.164   -2.445  4.929   1.00 0.00 ? 90  ARG A CA   2  
ATOM 2897  C C    . ARG A 1 90  ? 10.154  -2.497  6.089   1.00 0.00 ? 90  ARG A C    2  
ATOM 2898  O O    . ARG A 1 90  ? 10.345  -3.543  6.709   1.00 0.00 ? 90  ARG A O    2  
ATOM 2899  C CB   . ARG A 1 90  ? 9.505   -3.529  3.904   1.00 0.00 ? 90  ARG A CB   2  
ATOM 2900  C CG   . ARG A 1 90  ? 10.799  -3.268  3.151   1.00 0.00 ? 90  ARG A CG   2  
ATOM 2901  C CD   . ARG A 1 90  ? 11.374  -4.551  2.570   1.00 0.00 ? 90  ARG A CD   2  
ATOM 2902  N NE   . ARG A 1 90  ? 11.766  -5.496  3.612   1.00 0.00 ? 90  ARG A NE   2  
ATOM 2903  C CZ   . ARG A 1 90  ? 11.919  -6.799  3.403   1.00 0.00 ? 90  ARG A CZ   2  
ATOM 2904  N NH1  . ARG A 1 90  ? 11.714  -7.308  2.197   1.00 0.00 ? 90  ARG A NH1  2  
ATOM 2905  N NH2  . ARG A 1 90  ? 12.278  -7.594  4.403   1.00 0.00 ? 90  ARG A NH2  2  
ATOM 2906  H H    . ARG A 1 90  ? 9.795   -0.958  3.563   1.00 0.00 ? 90  ARG A H    2  
ATOM 2907  H HA   . ARG A 1 90  ? 8.170   -2.625  5.312   1.00 0.00 ? 90  ARG A HA   2  
ATOM 2908  H HB2  . ARG A 1 90  ? 9.597   -4.476  4.415   1.00 0.00 ? 90  ARG A HB2  2  
ATOM 2909  H HB3  . ARG A 1 90  ? 8.702   -3.593  3.186   1.00 0.00 ? 90  ARG A HB3  2  
ATOM 2910  H HG2  . ARG A 1 90  ? 10.602  -2.578  2.344   1.00 0.00 ? 90  ARG A HG2  2  
ATOM 2911  H HG3  . ARG A 1 90  ? 11.519  -2.836  3.830   1.00 0.00 ? 90  ARG A HG3  2  
ATOM 2912  H HD2  . ARG A 1 90  ? 10.626  -5.012  1.942   1.00 0.00 ? 90  ARG A HD2  2  
ATOM 2913  H HD3  . ARG A 1 90  ? 12.240  -4.304  1.976   1.00 0.00 ? 90  ARG A HD3  2  
ATOM 2914  H HE   . ARG A 1 90  ? 11.922  -5.140  4.512   1.00 0.00 ? 90  ARG A HE   2  
ATOM 2915  H HH11 . ARG A 1 90  ? 11.444  -6.711  1.442   1.00 0.00 ? 90  ARG A HH11 2  
ATOM 2916  H HH12 . ARG A 1 90  ? 11.831  -8.290  2.042   1.00 0.00 ? 90  ARG A HH12 2  
ATOM 2917  H HH21 . ARG A 1 90  ? 12.434  -7.214  5.314   1.00 0.00 ? 90  ARG A HH21 2  
ATOM 2918  H HH22 . ARG A 1 90  ? 12.393  -8.575  4.244   1.00 0.00 ? 90  ARG A HH22 2  
ATOM 2919  N N    . SER A 1 91  ? 10.783  -1.361  6.375   1.00 0.00 ? 91  SER A N    2  
ATOM 2920  C CA   . SER A 1 91  ? 11.757  -1.278  7.457   1.00 0.00 ? 91  SER A CA   2  
ATOM 2921  C C    . SER A 1 91  ? 11.110  -0.744  8.731   1.00 0.00 ? 91  SER A C    2  
ATOM 2922  O O    . SER A 1 91  ? 11.766  -0.108  9.555   1.00 0.00 ? 91  SER A O    2  
ATOM 2923  C CB   . SER A 1 91  ? 12.927  -0.380  7.050   1.00 0.00 ? 91  SER A CB   2  
ATOM 2924  O OG   . SER A 1 91  ? 13.846  -1.080  6.230   1.00 0.00 ? 91  SER A OG   2  
ATOM 2925  H H    . SER A 1 91  ? 10.588  -0.561  5.843   1.00 0.00 ? 91  SER A H    2  
ATOM 2926  H HA   . SER A 1 91  ? 12.128  -2.275  7.646   1.00 0.00 ? 91  SER A HA   2  
ATOM 2927  H HB2  . SER A 1 91  ? 12.551  0.471   6.503   1.00 0.00 ? 91  SER A HB2  2  
ATOM 2928  H HB3  . SER A 1 91  ? 13.440  -0.039  7.937   1.00 0.00 ? 91  SER A HB3  2  
ATOM 2929  H HG   . SER A 1 91  ? 14.192  -0.488  5.558   1.00 0.00 ? 91  SER A HG   2  
ATOM 2930  N N    . VAL A 1 92  ? 9.816   -1.008  8.885   1.00 0.00 ? 92  VAL A N    2  
ATOM 2931  C CA   . VAL A 1 92  ? 9.078   -0.555  10.059  1.00 0.00 ? 92  VAL A CA   2  
ATOM 2932  C C    . VAL A 1 92  ? 9.039   -1.636  11.133  1.00 0.00 ? 92  VAL A C    2  
ATOM 2933  O O    . VAL A 1 92  ? 9.061   -2.828  10.831  1.00 0.00 ? 92  VAL A O    2  
ATOM 2934  C CB   . VAL A 1 92  ? 7.636   -0.155  9.695   1.00 0.00 ? 92  VAL A CB   2  
ATOM 2935  C CG1  . VAL A 1 92  ? 6.959   0.532   10.871  1.00 0.00 ? 92  VAL A CG1  2  
ATOM 2936  C CG2  . VAL A 1 92  ? 7.626   0.741   8.466   1.00 0.00 ? 92  VAL A CG2  2  
ATOM 2937  H H    . VAL A 1 92  ? 9.347   -1.520  8.194   1.00 0.00 ? 92  VAL A H    2  
ATOM 2938  H HA   . VAL A 1 92  ? 9.582   0.314   10.455  1.00 0.00 ? 92  VAL A HA   2  
ATOM 2939  H HB   . VAL A 1 92  ? 7.082   -1.053  9.464   1.00 0.00 ? 92  VAL A HB   2  
ATOM 2940  H HG11 . VAL A 1 92  ? 7.195   0.001   11.782  1.00 0.00 ? 92  VAL A HG11 2  
ATOM 2941  H HG12 . VAL A 1 92  ? 7.312   1.550   10.945  1.00 0.00 ? 92  VAL A HG12 2  
ATOM 2942  H HG13 . VAL A 1 92  ? 5.890   0.531   10.722  1.00 0.00 ? 92  VAL A HG13 2  
ATOM 2943  H HG21 . VAL A 1 92  ? 6.766   0.506   7.857   1.00 0.00 ? 92  VAL A HG21 2  
ATOM 2944  H HG22 . VAL A 1 92  ? 7.577   1.775   8.774   1.00 0.00 ? 92  VAL A HG22 2  
ATOM 2945  H HG23 . VAL A 1 92  ? 8.527   0.579   7.894   1.00 0.00 ? 92  VAL A HG23 2  
ATOM 2946  N N    . GLY A 1 93  ? 8.980   -1.210  12.391  1.00 0.00 ? 93  GLY A N    2  
ATOM 2947  C CA   . GLY A 1 93  ? 8.937   -2.154  13.493  1.00 0.00 ? 93  GLY A CA   2  
ATOM 2948  C C    . GLY A 1 93  ? 7.523   -2.567  13.849  1.00 0.00 ? 93  GLY A C    2  
ATOM 2949  O O    . GLY A 1 93  ? 7.085   -3.665  13.506  1.00 0.00 ? 93  GLY A O    2  
ATOM 2950  H H    . GLY A 1 93  ? 8.965   -0.247  12.573  1.00 0.00 ? 93  GLY A H    2  
ATOM 2951  H HA2  . GLY A 1 93  ? 9.500   -3.034  13.221  1.00 0.00 ? 93  GLY A HA2  2  
ATOM 2952  H HA3  . GLY A 1 93  ? 9.396   -1.699  14.359  1.00 0.00 ? 93  GLY A HA3  2  
ATOM 2953  N N    . ASP A 1 94  ? 6.808   -1.686  14.540  1.00 0.00 ? 94  ASP A N    2  
ATOM 2954  C CA   . ASP A 1 94  ? 5.434   -1.965  14.944  1.00 0.00 ? 94  ASP A CA   2  
ATOM 2955  C C    . ASP A 1 94  ? 4.486   -0.891  14.421  1.00 0.00 ? 94  ASP A C    2  
ATOM 2956  O O    . ASP A 1 94  ? 3.272   -1.092  14.366  1.00 0.00 ? 94  ASP A O    2  
ATOM 2957  C CB   . ASP A 1 94  ? 5.336   -2.053  16.467  1.00 0.00 ? 94  ASP A CB   2  
ATOM 2958  C CG   . ASP A 1 94  ? 5.986   -0.871  17.159  1.00 0.00 ? 94  ASP A CG   2  
ATOM 2959  O OD1  . ASP A 1 94  ? 7.147   -0.553  16.825  1.00 0.00 ? 94  ASP A OD1  2  
ATOM 2960  O OD2  . ASP A 1 94  ? 5.334   -0.263  18.033  1.00 0.00 ? 94  ASP A OD2  2  
ATOM 2961  H H    . ASP A 1 94  ? 7.213   -0.827  14.784  1.00 0.00 ? 94  ASP A H    2  
ATOM 2962  H HA   . ASP A 1 94  ? 5.150   -2.916  14.518  1.00 0.00 ? 94  ASP A HA   2  
ATOM 2963  H HB2  . ASP A 1 94  ? 4.294   -2.084  16.753  1.00 0.00 ? 94  ASP A HB2  2  
ATOM 2964  H HB3  . ASP A 1 94  ? 5.824   -2.956  16.802  1.00 0.00 ? 94  ASP A HB3  2  
ATOM 2965  N N    . THR A 1 95  ? 5.047   0.253   14.039  1.00 0.00 ? 95  THR A N    2  
ATOM 2966  C CA   . THR A 1 95  ? 4.251   1.360   13.524  1.00 0.00 ? 95  THR A CA   2  
ATOM 2967  C C    . THR A 1 95  ? 5.125   2.367   12.785  1.00 0.00 ? 95  THR A C    2  
ATOM 2968  O O    . THR A 1 95  ? 6.215   2.713   13.244  1.00 0.00 ? 95  THR A O    2  
ATOM 2969  C CB   . THR A 1 95  ? 3.496   2.083   14.655  1.00 0.00 ? 95  THR A CB   2  
ATOM 2970  O OG1  . THR A 1 95  ? 2.694   1.149   15.384  1.00 0.00 ? 95  THR A OG1  2  
ATOM 2971  C CG2  . THR A 1 95  ? 2.613   3.189   14.095  1.00 0.00 ? 95  THR A CG2  2  
ATOM 2972  H H    . THR A 1 95  ? 6.019   0.353   14.108  1.00 0.00 ? 95  THR A H    2  
ATOM 2973  H HA   . THR A 1 95  ? 3.524   0.955   12.835  1.00 0.00 ? 95  THR A HA   2  
ATOM 2974  H HB   . THR A 1 95  ? 4.220   2.525   15.325  1.00 0.00 ? 95  THR A HB   2  
ATOM 2975  H HG1  . THR A 1 95  ? 2.807   1.297   16.326  1.00 0.00 ? 95  THR A HG1  2  
ATOM 2976  H HG21 . THR A 1 95  ? 3.180   4.106   14.033  1.00 0.00 ? 95  THR A HG21 2  
ATOM 2977  H HG22 . THR A 1 95  ? 1.763   3.333   14.744  1.00 0.00 ? 95  THR A HG22 2  
ATOM 2978  H HG23 . THR A 1 95  ? 2.271   2.911   13.109  1.00 0.00 ? 95  THR A HG23 2  
ATOM 2979  N N    . LEU A 1 96  ? 4.641   2.836   11.640  1.00 0.00 ? 96  LEU A N    2  
ATOM 2980  C CA   . LEU A 1 96  ? 5.378   3.806   10.838  1.00 0.00 ? 96  LEU A CA   2  
ATOM 2981  C C    . LEU A 1 96  ? 4.588   5.102   10.689  1.00 0.00 ? 96  LEU A C    2  
ATOM 2982  O O    . LEU A 1 96  ? 3.407   5.165   11.031  1.00 0.00 ? 96  LEU A O    2  
ATOM 2983  C CB   . LEU A 1 96  ? 5.691   3.223   9.458   1.00 0.00 ? 96  LEU A CB   2  
ATOM 2984  C CG   . LEU A 1 96  ? 4.661   3.502   8.363   1.00 0.00 ? 96  LEU A CG   2  
ATOM 2985  C CD1  . LEU A 1 96  ? 5.237   3.180   6.993   1.00 0.00 ? 96  LEU A CD1  2  
ATOM 2986  C CD2  . LEU A 1 96  ? 3.390   2.702   8.610   1.00 0.00 ? 96  LEU A CD2  2  
ATOM 2987  H H    . LEU A 1 96  ? 3.768   2.523   11.326  1.00 0.00 ? 96  LEU A H    2  
ATOM 2988  H HA   . LEU A 1 96  ? 6.306   4.020   11.348  1.00 0.00 ? 96  LEU A HA   2  
ATOM 2989  H HB2  . LEU A 1 96  ? 6.636   3.631   9.134   1.00 0.00 ? 96  LEU A HB2  2  
ATOM 2990  H HB3  . LEU A 1 96  ? 5.780   2.152   9.565   1.00 0.00 ? 96  LEU A HB3  2  
ATOM 2991  H HG   . LEU A 1 96  ? 4.404   4.552   8.378   1.00 0.00 ? 96  LEU A HG   2  
ATOM 2992  H HD11 . LEU A 1 96  ? 5.787   2.253   7.043   1.00 0.00 ? 96  LEU A HD11 2  
ATOM 2993  H HD12 . LEU A 1 96  ? 5.900   3.976   6.686   1.00 0.00 ? 96  LEU A HD12 2  
ATOM 2994  H HD13 . LEU A 1 96  ? 4.434   3.086   6.278   1.00 0.00 ? 96  LEU A HD13 2  
ATOM 2995  H HD21 . LEU A 1 96  ? 2.827   2.629   7.692   1.00 0.00 ? 96  LEU A HD21 2  
ATOM 2996  H HD22 . LEU A 1 96  ? 2.792   3.199   9.360   1.00 0.00 ? 96  LEU A HD22 2  
ATOM 2997  H HD23 . LEU A 1 96  ? 3.649   1.712   8.954   1.00 0.00 ? 96  LEU A HD23 2  
ATOM 2998  N N    . THR A 1 97  ? 5.247   6.135   10.173  1.00 0.00 ? 97  THR A N    2  
ATOM 2999  C CA   . THR A 1 97  ? 4.607   7.429   9.977   1.00 0.00 ? 97  THR A CA   2  
ATOM 3000  C C    . THR A 1 97  ? 4.618   7.831   8.506   1.00 0.00 ? 97  THR A C    2  
ATOM 3001  O O    . THR A 1 97  ? 5.627   8.313   7.992   1.00 0.00 ? 97  THR A O    2  
ATOM 3002  C CB   . THR A 1 97  ? 5.299   8.529   10.803  1.00 0.00 ? 97  THR A CB   2  
ATOM 3003  O OG1  . THR A 1 97  ? 5.653   8.023   12.095  1.00 0.00 ? 97  THR A OG1  2  
ATOM 3004  C CG2  . THR A 1 97  ? 4.392   9.741   10.958  1.00 0.00 ? 97  THR A CG2  2  
ATOM 3005  H H    . THR A 1 97  ? 6.187   6.022   9.919   1.00 0.00 ? 97  THR A H    2  
ATOM 3006  H HA   . THR A 1 97  ? 3.582   7.348   10.310  1.00 0.00 ? 97  THR A HA   2  
ATOM 3007  H HB   . THR A 1 97  ? 6.198   8.835   10.286  1.00 0.00 ? 97  THR A HB   2  
ATOM 3008  H HG1  . THR A 1 97  ? 5.752   8.754   12.709  1.00 0.00 ? 97  THR A HG1  2  
ATOM 3009  H HG21 . THR A 1 97  ? 4.306   10.250  10.010  1.00 0.00 ? 97  THR A HG21 2  
ATOM 3010  H HG22 . THR A 1 97  ? 4.812   10.413  11.692  1.00 0.00 ? 97  THR A HG22 2  
ATOM 3011  H HG23 . THR A 1 97  ? 3.415   9.419   11.283  1.00 0.00 ? 97  THR A HG23 2  
ATOM 3012  N N    . VAL A 1 98  ? 3.489   7.630   7.834   1.00 0.00 ? 98  VAL A N    2  
ATOM 3013  C CA   . VAL A 1 98  ? 3.368   7.973   6.422   1.00 0.00 ? 98  VAL A CA   2  
ATOM 3014  C C    . VAL A 1 98  ? 2.725   9.343   6.243   1.00 0.00 ? 98  VAL A C    2  
ATOM 3015  O O    . VAL A 1 98  ? 1.681   9.633   6.830   1.00 0.00 ? 98  VAL A O    2  
ATOM 3016  C CB   . VAL A 1 98  ? 2.538   6.924   5.659   1.00 0.00 ? 98  VAL A CB   2  
ATOM 3017  C CG1  . VAL A 1 98  ? 2.959   5.517   6.056   1.00 0.00 ? 98  VAL A CG1  2  
ATOM 3018  C CG2  . VAL A 1 98  ? 1.052   7.136   5.910   1.00 0.00 ? 98  VAL A CG2  2  
ATOM 3019  H H    . VAL A 1 98  ? 2.718   7.242   8.299   1.00 0.00 ? 98  VAL A H    2  
ATOM 3020  H HA   . VAL A 1 98  ? 4.361   7.994   5.998   1.00 0.00 ? 98  VAL A HA   2  
ATOM 3021  H HB   . VAL A 1 98  ? 2.724   7.047   4.602   1.00 0.00 ? 98  VAL A HB   2  
ATOM 3022  H HG11 . VAL A 1 98  ? 2.230   5.102   6.736   1.00 0.00 ? 98  VAL A HG11 2  
ATOM 3023  H HG12 . VAL A 1 98  ? 3.023   4.898   5.173   1.00 0.00 ? 98  VAL A HG12 2  
ATOM 3024  H HG13 . VAL A 1 98  ? 3.923   5.554   6.541   1.00 0.00 ? 98  VAL A HG13 2  
ATOM 3025  H HG21 . VAL A 1 98  ? 0.669   7.859   5.206   1.00 0.00 ? 98  VAL A HG21 2  
ATOM 3026  H HG22 . VAL A 1 98  ? 0.529   6.199   5.784   1.00 0.00 ? 98  VAL A HG22 2  
ATOM 3027  H HG23 . VAL A 1 98  ? 0.905   7.498   6.916   1.00 0.00 ? 98  VAL A HG23 2  
ATOM 3028  N N    . LEU A 1 99  ? 3.352   10.183  5.427   1.00 0.00 ? 99  LEU A N    2  
ATOM 3029  C CA   . LEU A 1 99  ? 2.841   11.525  5.169   1.00 0.00 ? 99  LEU A CA   2  
ATOM 3030  C C    . LEU A 1 99  ? 2.077   11.572  3.850   1.00 0.00 ? 99  LEU A C    2  
ATOM 3031  O O    . LEU A 1 99  ? 1.959   12.626  3.226   1.00 0.00 ? 99  LEU A O    2  
ATOM 3032  C CB   . LEU A 1 99  ? 3.990   12.534  5.142   1.00 0.00 ? 99  LEU A CB   2  
ATOM 3033  C CG   . LEU A 1 99  ? 3.590   14.009  5.189   1.00 0.00 ? 99  LEU A CG   2  
ATOM 3034  C CD1  . LEU A 1 99  ? 2.810   14.310  6.459   1.00 0.00 ? 99  LEU A CD1  2  
ATOM 3035  C CD2  . LEU A 1 99  ? 4.820   14.899  5.093   1.00 0.00 ? 99  LEU A CD2  2  
ATOM 3036  H H    . LEU A 1 99  ? 4.179   9.895   4.988   1.00 0.00 ? 99  LEU A H    2  
ATOM 3037  H HA   . LEU A 1 99  ? 2.165   11.782  5.971   1.00 0.00 ? 99  LEU A HA   2  
ATOM 3038  H HB2  . LEU A 1 99  ? 4.623   12.336  5.994   1.00 0.00 ? 99  LEU A HB2  2  
ATOM 3039  H HB3  . LEU A 1 99  ? 4.551   12.371  4.233   1.00 0.00 ? 99  LEU A HB3  2  
ATOM 3040  H HG   . LEU A 1 99  ? 2.950   14.228  4.345   1.00 0.00 ? 99  LEU A HG   2  
ATOM 3041  H HD11 . LEU A 1 99  ? 1.752   14.233  6.258   1.00 0.00 ? 99  LEU A HD11 2  
ATOM 3042  H HD12 . LEU A 1 99  ? 3.040   15.311  6.794   1.00 0.00 ? 99  LEU A HD12 2  
ATOM 3043  H HD13 . LEU A 1 99  ? 3.084   13.602  7.227   1.00 0.00 ? 99  LEU A HD13 2  
ATOM 3044  H HD21 . LEU A 1 99  ? 5.461   14.719  5.943   1.00 0.00 ? 99  LEU A HD21 2  
ATOM 3045  H HD22 . LEU A 1 99  ? 4.515   15.935  5.085   1.00 0.00 ? 99  LEU A HD22 2  
ATOM 3046  H HD23 . LEU A 1 99  ? 5.357   14.674  4.183   1.00 0.00 ? 99  LEU A HD23 2  
ATOM 3047  N N    . VAL A 1 100 ? 1.558   10.422  3.431   1.00 0.00 ? 100 VAL A N    2  
ATOM 3048  C CA   . VAL A 1 100 ? 0.802   10.332  2.187   1.00 0.00 ? 100 VAL A CA   2  
ATOM 3049  C C    . VAL A 1 100 ? -0.447  11.204  2.239   1.00 0.00 ? 100 VAL A C    2  
ATOM 3050  O O    . VAL A 1 100 ? -0.783  11.763  3.284   1.00 0.00 ? 100 VAL A O    2  
ATOM 3051  C CB   . VAL A 1 100 ? 0.389   8.879   1.885   1.00 0.00 ? 100 VAL A CB   2  
ATOM 3052  C CG1  . VAL A 1 100 ? 1.544   7.928   2.159   1.00 0.00 ? 100 VAL A CG1  2  
ATOM 3053  C CG2  . VAL A 1 100 ? -0.835  8.493   2.701   1.00 0.00 ? 100 VAL A CG2  2  
ATOM 3054  H H    . VAL A 1 100 ? 1.686   9.615   3.972   1.00 0.00 ? 100 VAL A H    2  
ATOM 3055  H HA   . VAL A 1 100 ? 1.438   10.678  1.385   1.00 0.00 ? 100 VAL A HA   2  
ATOM 3056  H HB   . VAL A 1 100 ? 0.134   8.809   0.838   1.00 0.00 ? 100 VAL A HB   2  
ATOM 3057  H HG11 . VAL A 1 100 ? 2.415   8.494   2.454   1.00 0.00 ? 100 VAL A HG11 2  
ATOM 3058  H HG12 . VAL A 1 100 ? 1.270   7.247   2.952   1.00 0.00 ? 100 VAL A HG12 2  
ATOM 3059  H HG13 . VAL A 1 100 ? 1.767   7.366   1.264   1.00 0.00 ? 100 VAL A HG13 2  
ATOM 3060  H HG21 . VAL A 1 100 ? -0.734  8.879   3.705   1.00 0.00 ? 100 VAL A HG21 2  
ATOM 3061  H HG22 . VAL A 1 100 ? -1.720  8.911   2.243   1.00 0.00 ? 100 VAL A HG22 2  
ATOM 3062  H HG23 . VAL A 1 100 ? -0.922  7.418   2.736   1.00 0.00 ? 100 VAL A HG23 2  
ATOM 3063  N N    . CYS A 1 101 ? -1.132  11.315  1.106   1.00 0.00 ? 101 CYS A N    2  
ATOM 3064  C CA   . CYS A 1 101 ? -2.345  12.120  1.022   1.00 0.00 ? 101 CYS A CA   2  
ATOM 3065  C C    . CYS A 1 101 ? -3.148  11.764  -0.225  1.00 0.00 ? 101 CYS A C    2  
ATOM 3066  O O    . CYS A 1 101 ? -2.629  11.144  -1.153  1.00 0.00 ? 101 CYS A O    2  
ATOM 3067  C CB   . CYS A 1 101 ? -1.995  13.608  1.011   1.00 0.00 ? 101 CYS A CB   2  
ATOM 3068  S SG   . CYS A 1 101 ? -1.665  14.277  -0.636  1.00 0.00 ? 101 CYS A SG   2  
ATOM 3069  H H    . CYS A 1 101 ? -0.814  10.845  0.307   1.00 0.00 ? 101 CYS A H    2  
ATOM 3070  H HA   . CYS A 1 101 ? -2.945  11.906  1.894   1.00 0.00 ? 101 CYS A HA   2  
ATOM 3071  H HB2  . CYS A 1 101 ? -2.818  14.167  1.433   1.00 0.00 ? 101 CYS A HB2  2  
ATOM 3072  H HB3  . CYS A 1 101 ? -1.115  13.768  1.615   1.00 0.00 ? 101 CYS A HB3  2  
ATOM 3073  H HG   . CYS A 1 101 ? -1.829  13.299  -1.514  1.00 0.00 ? 101 CYS A HG   2  
ATOM 3074  N N    . ASP A 1 102 ? -4.416  12.160  -0.239  1.00 0.00 ? 102 ASP A N    2  
ATOM 3075  C CA   . ASP A 1 102 ? -5.291  11.883  -1.372  1.00 0.00 ? 102 ASP A CA   2  
ATOM 3076  C C    . ASP A 1 102 ? -4.675  12.391  -2.672  1.00 0.00 ? 102 ASP A C    2  
ATOM 3077  O O    . ASP A 1 102 ? -4.817  13.562  -3.022  1.00 0.00 ? 102 ASP A O    2  
ATOM 3078  C CB   . ASP A 1 102 ? -6.661  12.529  -1.156  1.00 0.00 ? 102 ASP A CB   2  
ATOM 3079  C CG   . ASP A 1 102 ? -7.220  12.252  0.226   1.00 0.00 ? 102 ASP A CG   2  
ATOM 3080  O OD1  . ASP A 1 102 ? -6.484  12.455  1.215   1.00 0.00 ? 102 ASP A OD1  2  
ATOM 3081  O OD2  . ASP A 1 102 ? -8.392  11.834  0.318   1.00 0.00 ? 102 ASP A OD2  2  
ATOM 3082  H H    . ASP A 1 102 ? -4.772  12.651  0.531   1.00 0.00 ? 102 ASP A H    2  
ATOM 3083  H HA   . ASP A 1 102 ? -5.415  10.813  -1.441  1.00 0.00 ? 102 ASP A HA   2  
ATOM 3084  H HB2  . ASP A 1 102 ? -6.571  13.598  -1.280  1.00 0.00 ? 102 ASP A HB2  2  
ATOM 3085  H HB3  . ASP A 1 102 ? -7.353  12.142  -1.889  1.00 0.00 ? 102 ASP A HB3  2  
ATOM 3086  N N    . GLY A 1 103 ? -3.988  11.501  -3.383  1.00 0.00 ? 103 GLY A N    2  
ATOM 3087  C CA   . GLY A 1 103 ? -3.359  11.879  -4.635  1.00 0.00 ? 103 GLY A CA   2  
ATOM 3088  C C    . GLY A 1 103 ? -4.282  11.702  -5.824  1.00 0.00 ? 103 GLY A C    2  
ATOM 3089  O O    . GLY A 1 103 ? -4.405  12.595  -6.663  1.00 0.00 ? 103 GLY A O    2  
ATOM 3090  H H    . GLY A 1 103 ? -3.908  10.581  -3.054  1.00 0.00 ? 103 GLY A H    2  
ATOM 3091  H HA2  . GLY A 1 103 ? -3.059  12.914  -4.577  1.00 0.00 ? 103 GLY A HA2  2  
ATOM 3092  H HA3  . GLY A 1 103 ? -2.481  11.267  -4.782  1.00 0.00 ? 103 GLY A HA3  2  
ATOM 3093  N N    . PHE A 1 104 ? -4.933  10.545  -5.899  1.00 0.00 ? 104 PHE A N    2  
ATOM 3094  C CA   . PHE A 1 104 ? -5.848  10.252  -6.996  1.00 0.00 ? 104 PHE A CA   2  
ATOM 3095  C C    . PHE A 1 104 ? -6.614  8.959   -6.735  1.00 0.00 ? 104 PHE A C    2  
ATOM 3096  O O    . PHE A 1 104 ? -6.022  7.885   -6.634  1.00 0.00 ? 104 PHE A O    2  
ATOM 3097  C CB   . PHE A 1 104 ? -5.079  10.145  -8.315  1.00 0.00 ? 104 PHE A CB   2  
ATOM 3098  C CG   . PHE A 1 104 ? -3.771  9.419   -8.189  1.00 0.00 ? 104 PHE A CG   2  
ATOM 3099  C CD1  . PHE A 1 104 ? -3.716  8.039   -8.304  1.00 0.00 ? 104 PHE A CD1  2  
ATOM 3100  C CD2  . PHE A 1 104 ? -2.596  10.115  -7.954  1.00 0.00 ? 104 PHE A CD2  2  
ATOM 3101  C CE1  . PHE A 1 104 ? -2.513  7.367   -8.189  1.00 0.00 ? 104 PHE A CE1  2  
ATOM 3102  C CE2  . PHE A 1 104 ? -1.391  9.449   -7.838  1.00 0.00 ? 104 PHE A CE2  2  
ATOM 3103  C CZ   . PHE A 1 104 ? -1.349  8.073   -7.955  1.00 0.00 ? 104 PHE A CZ   2  
ATOM 3104  H H    . PHE A 1 104 ? -4.794  9.872   -5.200  1.00 0.00 ? 104 PHE A H    2  
ATOM 3105  H HA   . PHE A 1 104 ? -6.553  11.067  -7.065  1.00 0.00 ? 104 PHE A HA   2  
ATOM 3106  H HB2  . PHE A 1 104 ? -5.685  9.615   -9.034  1.00 0.00 ? 104 PHE A HB2  2  
ATOM 3107  H HB3  . PHE A 1 104 ? -4.875  11.139  -8.685  1.00 0.00 ? 104 PHE A HB3  2  
ATOM 3108  H HD1  . PHE A 1 104 ? -4.626  7.486   -8.487  1.00 0.00 ? 104 PHE A HD1  2  
ATOM 3109  H HD2  . PHE A 1 104 ? -2.627  11.191  -7.862  1.00 0.00 ? 104 PHE A HD2  2  
ATOM 3110  H HE1  . PHE A 1 104 ? -2.484  6.292   -8.280  1.00 0.00 ? 104 PHE A HE1  2  
ATOM 3111  H HE2  . PHE A 1 104 ? -0.483  10.003  -7.655  1.00 0.00 ? 104 PHE A HE2  2  
ATOM 3112  H HZ   . PHE A 1 104 ? -0.409  7.551   -7.865  1.00 0.00 ? 104 PHE A HZ   2  
ATOM 3113  N N    . GLU A 1 105 ? -7.934  9.072   -6.626  1.00 0.00 ? 105 GLU A N    2  
ATOM 3114  C CA   . GLU A 1 105 ? -8.781  7.912   -6.375  1.00 0.00 ? 105 GLU A CA   2  
ATOM 3115  C C    . GLU A 1 105 ? -9.030  7.131   -7.662  1.00 0.00 ? 105 GLU A C    2  
ATOM 3116  O O    . GLU A 1 105 ? -9.420  7.701   -8.681  1.00 0.00 ? 105 GLU A O    2  
ATOM 3117  C CB   . GLU A 1 105 ? -10.115 8.349   -5.765  1.00 0.00 ? 105 GLU A CB   2  
ATOM 3118  C CG   . GLU A 1 105 ? -10.016 8.738   -4.300  1.00 0.00 ? 105 GLU A CG   2  
ATOM 3119  C CD   . GLU A 1 105 ? -11.162 9.625   -3.853  1.00 0.00 ? 105 GLU A CD   2  
ATOM 3120  O OE1  . GLU A 1 105 ? -12.228 9.081   -3.495  1.00 0.00 ? 105 GLU A OE1  2  
ATOM 3121  O OE2  . GLU A 1 105 ? -10.993 10.862  -3.860  1.00 0.00 ? 105 GLU A OE2  2  
ATOM 3122  H H    . GLU A 1 105 ? -8.348  9.956   -6.716  1.00 0.00 ? 105 GLU A H    2  
ATOM 3123  H HA   . GLU A 1 105 ? -8.268  7.272   -5.673  1.00 0.00 ? 105 GLU A HA   2  
ATOM 3124  H HB2  . GLU A 1 105 ? -10.489 9.198   -6.318  1.00 0.00 ? 105 GLU A HB2  2  
ATOM 3125  H HB3  . GLU A 1 105 ? -10.820 7.536   -5.853  1.00 0.00 ? 105 GLU A HB3  2  
ATOM 3126  H HG2  . GLU A 1 105 ? -10.022 7.839   -3.701  1.00 0.00 ? 105 GLU A HG2  2  
ATOM 3127  H HG3  . GLU A 1 105 ? -9.088  9.267   -4.143  1.00 0.00 ? 105 GLU A HG3  2  
ATOM 3128  N N    . SER A 1 106 ? -8.800  5.823   -7.607  1.00 0.00 ? 106 SER A N    2  
ATOM 3129  C CA   . SER A 1 106 ? -8.994  4.963   -8.769  1.00 0.00 ? 106 SER A CA   2  
ATOM 3130  C C    . SER A 1 106 ? -10.446 5.000   -9.235  1.00 0.00 ? 106 SER A C    2  
ATOM 3131  O O    . SER A 1 106 ? -10.724 5.104   -10.429 1.00 0.00 ? 106 SER A O    2  
ATOM 3132  C CB   . SER A 1 106 ? -8.588  3.525   -8.440  1.00 0.00 ? 106 SER A CB   2  
ATOM 3133  O OG   . SER A 1 106 ? -9.444  2.966   -7.459  1.00 0.00 ? 106 SER A OG   2  
ATOM 3134  H H    . SER A 1 106 ? -8.490  5.427   -6.766  1.00 0.00 ? 106 SER A H    2  
ATOM 3135  H HA   . SER A 1 106 ? -8.364  5.333   -9.564  1.00 0.00 ? 106 SER A HA   2  
ATOM 3136  H HB2  . SER A 1 106 ? -8.645  2.924   -9.334  1.00 0.00 ? 106 SER A HB2  2  
ATOM 3137  H HB3  . SER A 1 106 ? -7.575  3.517   -8.064  1.00 0.00 ? 106 SER A HB3  2  
ATOM 3138  H HG   . SER A 1 106 ? -8.933  2.407   -6.869  1.00 0.00 ? 106 SER A HG   2  
ATOM 3139  N N    . GLY A 1 107 ? -11.370 4.912   -8.282  1.00 0.00 ? 107 GLY A N    2  
ATOM 3140  C CA   . GLY A 1 107 ? -12.782 4.937   -8.614  1.00 0.00 ? 107 GLY A CA   2  
ATOM 3141  C C    . GLY A 1 107 ? -13.666 4.732   -7.400  1.00 0.00 ? 107 GLY A C    2  
ATOM 3142  O O    . GLY A 1 107 ? -13.350 3.954   -6.499  1.00 0.00 ? 107 GLY A O    2  
ATOM 3143  H H    . GLY A 1 107 ? -11.089 4.831   -7.347  1.00 0.00 ? 107 GLY A H    2  
ATOM 3144  H HA2  . GLY A 1 107 ? -13.019 5.890   -9.062  1.00 0.00 ? 107 GLY A HA2  2  
ATOM 3145  H HA3  . GLY A 1 107 ? -12.986 4.153   -9.329  1.00 0.00 ? 107 GLY A HA3  2  
ATOM 3146  N N    . PRO A 1 108 ? -14.803 5.444   -7.363  1.00 0.00 ? 108 PRO A N    2  
ATOM 3147  C CA   . PRO A 1 108 ? -15.758 5.354   -6.255  1.00 0.00 ? 108 PRO A CA   2  
ATOM 3148  C C    . PRO A 1 108 ? -16.482 4.013   -6.220  1.00 0.00 ? 108 PRO A C    2  
ATOM 3149  O O    . PRO A 1 108 ? -16.619 3.344   -7.245  1.00 0.00 ? 108 PRO A O    2  
ATOM 3150  C CB   . PRO A 1 108 ? -16.745 6.488   -6.545  1.00 0.00 ? 108 PRO A CB   2  
ATOM 3151  C CG   . PRO A 1 108 ? -16.665 6.691   -8.019  1.00 0.00 ? 108 PRO A CG   2  
ATOM 3152  C CD   . PRO A 1 108 ? -15.243 6.391   -8.402  1.00 0.00 ? 108 PRO A CD   2  
ATOM 3153  H HA   . PRO A 1 108 ? -15.278 5.528   -5.303  1.00 0.00 ? 108 PRO A HA   2  
ATOM 3154  H HB2  . PRO A 1 108 ? -17.738 6.190   -6.239  1.00 0.00 ? 108 PRO A HB2  2  
ATOM 3155  H HB3  . PRO A 1 108 ? -16.448 7.375   -6.007  1.00 0.00 ? 108 PRO A HB3  2  
ATOM 3156  H HG2  . PRO A 1 108 ? -17.340 6.015   -8.520  1.00 0.00 ? 108 PRO A HG2  2  
ATOM 3157  H HG3  . PRO A 1 108 ? -16.910 7.715   -8.261  1.00 0.00 ? 108 PRO A HG3  2  
ATOM 3158  H HD2  . PRO A 1 108 ? -15.204 5.935   -9.380  1.00 0.00 ? 108 PRO A HD2  2  
ATOM 3159  H HD3  . PRO A 1 108 ? -14.647 7.291   -8.379  1.00 0.00 ? 108 PRO A HD3  2  
ATOM 3160  N N    . SER A 1 109 ? -16.944 3.625   -5.036  1.00 0.00 ? 109 SER A N    2  
ATOM 3161  C CA   . SER A 1 109 ? -17.651 2.361   -4.868  1.00 0.00 ? 109 SER A CA   2  
ATOM 3162  C C    . SER A 1 109 ? -18.295 2.278   -3.487  1.00 0.00 ? 109 SER A C    2  
ATOM 3163  O O    . SER A 1 109 ? -17.862 2.946   -2.547  1.00 0.00 ? 109 SER A O    2  
ATOM 3164  C CB   . SER A 1 109 ? -16.693 1.186   -5.068  1.00 0.00 ? 109 SER A CB   2  
ATOM 3165  O OG   . SER A 1 109 ? -17.374 0.055   -5.584  1.00 0.00 ? 109 SER A OG   2  
ATOM 3166  H H    . SER A 1 109 ? -16.803 4.202   -4.256  1.00 0.00 ? 109 SER A H    2  
ATOM 3167  H HA   . SER A 1 109 ? -18.427 2.314   -5.617  1.00 0.00 ? 109 SER A HA   2  
ATOM 3168  H HB2  . SER A 1 109 ? -15.917 1.471   -5.762  1.00 0.00 ? 109 SER A HB2  2  
ATOM 3169  H HB3  . SER A 1 109 ? -16.249 0.921   -4.119  1.00 0.00 ? 109 SER A HB3  2  
ATOM 3170  H HG   . SER A 1 109 ? -17.969 -0.293  -4.916  1.00 0.00 ? 109 SER A HG   2  
ATOM 3171  N N    . SER A 1 110 ? -19.331 1.453   -3.372  1.00 0.00 ? 110 SER A N    2  
ATOM 3172  C CA   . SER A 1 110 ? -20.037 1.285   -2.108  1.00 0.00 ? 110 SER A CA   2  
ATOM 3173  C C    . SER A 1 110 ? -19.111 0.710   -1.040  1.00 0.00 ? 110 SER A C    2  
ATOM 3174  O O    . SER A 1 110 ? -18.466 -0.316  -1.249  1.00 0.00 ? 110 SER A O    2  
ATOM 3175  C CB   . SER A 1 110 ? -21.249 0.369   -2.294  1.00 0.00 ? 110 SER A CB   2  
ATOM 3176  O OG   . SER A 1 110 ? -20.856 -0.991  -2.346  1.00 0.00 ? 110 SER A OG   2  
ATOM 3177  H H    . SER A 1 110 ? -19.628 0.948   -4.158  1.00 0.00 ? 110 SER A H    2  
ATOM 3178  H HA   . SER A 1 110 ? -20.378 2.258   -1.786  1.00 0.00 ? 110 SER A HA   2  
ATOM 3179  H HB2  . SER A 1 110 ? -21.929 0.504   -1.467  1.00 0.00 ? 110 SER A HB2  2  
ATOM 3180  H HB3  . SER A 1 110 ? -21.749 0.623   -3.218  1.00 0.00 ? 110 SER A HB3  2  
ATOM 3181  H HG   . SER A 1 110 ? -20.582 -1.212  -3.240  1.00 0.00 ? 110 SER A HG   2  
ATOM 3182  N N    . GLY A 1 111 ? -19.051 1.381   0.106   1.00 0.00 ? 111 GLY A N    2  
ATOM 3183  C CA   . GLY A 1 111 ? -18.202 0.924   1.190   1.00 0.00 ? 111 GLY A CA   2  
ATOM 3184  C C    . GLY A 1 111 ? -18.946 0.050   2.181   1.00 0.00 ? 111 GLY A C    2  
ATOM 3185  O O    . GLY A 1 111 ? -18.333 -0.712  2.928   1.00 0.00 ? 111 GLY A O    2  
ATOM 3186  H H    . GLY A 1 111 ? -19.588 2.194   0.217   1.00 0.00 ? 111 GLY A H    2  
ATOM 3187  H HA2  . GLY A 1 111 ? -17.379 0.360   0.775   1.00 0.00 ? 111 GLY A HA2  2  
ATOM 3188  H HA3  . GLY A 1 111 ? -17.808 1.784   1.711   1.00 0.00 ? 111 GLY A HA3  2  
ATOM 3189  N N    . GLY A 1 1   ? -9.400  33.863  -4.859  1.00 0.00 ? 1   GLY A N    3  
ATOM 3190  C CA   . GLY A 1 1   ? -8.994  32.502  -4.561  1.00 0.00 ? 1   GLY A CA   3  
ATOM 3191  C C    . GLY A 1 1   ? -10.172 31.601  -4.249  1.00 0.00 ? 1   GLY A C    3  
ATOM 3192  O O    . GLY A 1 1   ? -11.017 31.937  -3.420  1.00 0.00 ? 1   GLY A O    3  
ATOM 3193  H H1   . GLY A 1 1   ? -9.632  34.113  -5.778  1.00 0.00 ? 1   GLY A H1   3  
ATOM 3194  H HA2  . GLY A 1 1   ? -8.463  32.102  -5.412  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 3195  H HA3  . GLY A 1 1   ? -8.331  32.515  -3.709  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 3196  N N    . SER A 1 2   ? -10.230 30.453  -4.917  1.00 0.00 ? 2   SER A N    3  
ATOM 3197  C CA   . SER A 1 2   ? -11.316 29.502  -4.711  1.00 0.00 ? 2   SER A CA   3  
ATOM 3198  C C    . SER A 1 2   ? -10.877 28.365  -3.794  1.00 0.00 ? 2   SER A C    3  
ATOM 3199  O O    . SER A 1 2   ? -9.963  27.608  -4.121  1.00 0.00 ? 2   SER A O    3  
ATOM 3200  C CB   . SER A 1 2   ? -11.790 28.938  -6.052  1.00 0.00 ? 2   SER A CB   3  
ATOM 3201  O OG   . SER A 1 2   ? -12.259 29.969  -6.902  1.00 0.00 ? 2   SER A OG   3  
ATOM 3202  H H    . SER A 1 2   ? -9.526  30.242  -5.566  1.00 0.00 ? 2   SER A H    3  
ATOM 3203  H HA   . SER A 1 2   ? -12.134 30.030  -4.244  1.00 0.00 ? 2   SER A HA   3  
ATOM 3204  H HB2  . SER A 1 2   ? -10.968 28.434  -6.537  1.00 0.00 ? 2   SER A HB2  3  
ATOM 3205  H HB3  . SER A 1 2   ? -12.592 28.235  -5.880  1.00 0.00 ? 2   SER A HB3  3  
ATOM 3206  H HG   . SER A 1 2   ? -11.807 30.789  -6.692  1.00 0.00 ? 2   SER A HG   3  
ATOM 3207  N N    . SER A 1 3   ? -11.535 28.252  -2.645  1.00 0.00 ? 3   SER A N    3  
ATOM 3208  C CA   . SER A 1 3   ? -11.210 27.210  -1.678  1.00 0.00 ? 3   SER A CA   3  
ATOM 3209  C C    . SER A 1 3   ? -11.227 25.834  -2.336  1.00 0.00 ? 3   SER A C    3  
ATOM 3210  O O    . SER A 1 3   ? -10.241 25.099  -2.289  1.00 0.00 ? 3   SER A O    3  
ATOM 3211  C CB   . SER A 1 3   ? -12.199 27.242  -0.511  1.00 0.00 ? 3   SER A CB   3  
ATOM 3212  O OG   . SER A 1 3   ? -12.054 28.429  0.248   1.00 0.00 ? 3   SER A OG   3  
ATOM 3213  H H    . SER A 1 3   ? -12.254 28.886  -2.441  1.00 0.00 ? 3   SER A H    3  
ATOM 3214  H HA   . SER A 1 3   ? -10.217 27.404  -1.302  1.00 0.00 ? 3   SER A HA   3  
ATOM 3215  H HB2  . SER A 1 3   ? -13.207 27.195  -0.895  1.00 0.00 ? 3   SER A HB2  3  
ATOM 3216  H HB3  . SER A 1 3   ? -12.019 26.393  0.133   1.00 0.00 ? 3   SER A HB3  3  
ATOM 3217  H HG   . SER A 1 3   ? -12.700 29.077  -0.044  1.00 0.00 ? 3   SER A HG   3  
ATOM 3218  N N    . GLY A 1 4   ? -12.355 25.492  -2.950  1.00 0.00 ? 4   GLY A N    3  
ATOM 3219  C CA   . GLY A 1 4   ? -12.481 24.205  -3.609  1.00 0.00 ? 4   GLY A CA   3  
ATOM 3220  C C    . GLY A 1 4   ? -13.040 23.135  -2.692  1.00 0.00 ? 4   GLY A C    3  
ATOM 3221  O O    . GLY A 1 4   ? -14.144 23.275  -2.166  1.00 0.00 ? 4   GLY A O    3  
ATOM 3222  H H    . GLY A 1 4   ? -13.109 26.118  -2.955  1.00 0.00 ? 4   GLY A H    3  
ATOM 3223  H HA2  . GLY A 1 4   ? -13.135 24.311  -4.462  1.00 0.00 ? 4   GLY A HA2  3  
ATOM 3224  H HA3  . GLY A 1 4   ? -11.505 23.893  -3.953  1.00 0.00 ? 4   GLY A HA3  3  
ATOM 3225  N N    . SER A 1 5   ? -12.277 22.064  -2.500  1.00 0.00 ? 5   SER A N    3  
ATOM 3226  C CA   . SER A 1 5   ? -12.705 20.964  -1.645  1.00 0.00 ? 5   SER A CA   3  
ATOM 3227  C C    . SER A 1 5   ? -11.709 20.738  -0.511  1.00 0.00 ? 5   SER A C    3  
ATOM 3228  O O    . SER A 1 5   ? -10.783 19.936  -0.635  1.00 0.00 ? 5   SER A O    3  
ATOM 3229  C CB   . SER A 1 5   ? -12.860 19.682  -2.465  1.00 0.00 ? 5   SER A CB   3  
ATOM 3230  O OG   . SER A 1 5   ? -13.621 18.715  -1.762  1.00 0.00 ? 5   SER A OG   3  
ATOM 3231  H H    . SER A 1 5   ? -11.406 22.012  -2.948  1.00 0.00 ? 5   SER A H    3  
ATOM 3232  H HA   . SER A 1 5   ? -13.662 21.227  -1.220  1.00 0.00 ? 5   SER A HA   3  
ATOM 3233  H HB2  . SER A 1 5   ? -13.361 19.911  -3.394  1.00 0.00 ? 5   SER A HB2  3  
ATOM 3234  H HB3  . SER A 1 5   ? -11.883 19.271  -2.675  1.00 0.00 ? 5   SER A HB3  3  
ATOM 3235  H HG   . SER A 1 5   ? -14.205 19.157  -1.140  1.00 0.00 ? 5   SER A HG   3  
ATOM 3236  N N    . SER A 1 6   ? -11.907 21.450  0.593   1.00 0.00 ? 6   SER A N    3  
ATOM 3237  C CA   . SER A 1 6   ? -11.024 21.331  1.748   1.00 0.00 ? 6   SER A CA   3  
ATOM 3238  C C    . SER A 1 6   ? -11.117 19.937  2.361   1.00 0.00 ? 6   SER A C    3  
ATOM 3239  O O    . SER A 1 6   ? -12.116 19.240  2.196   1.00 0.00 ? 6   SER A O    3  
ATOM 3240  C CB   . SER A 1 6   ? -11.378 22.387  2.798   1.00 0.00 ? 6   SER A CB   3  
ATOM 3241  O OG   . SER A 1 6   ? -11.213 23.696  2.281   1.00 0.00 ? 6   SER A OG   3  
ATOM 3242  H H    . SER A 1 6   ? -12.663 22.073  0.631   1.00 0.00 ? 6   SER A H    3  
ATOM 3243  H HA   . SER A 1 6   ? -10.012 21.497  1.410   1.00 0.00 ? 6   SER A HA   3  
ATOM 3244  H HB2  . SER A 1 6   ? -12.407 22.260  3.100   1.00 0.00 ? 6   SER A HB2  3  
ATOM 3245  H HB3  . SER A 1 6   ? -10.733 22.267  3.656   1.00 0.00 ? 6   SER A HB3  3  
ATOM 3246  H HG   . SER A 1 6   ? -12.051 24.012  1.934   1.00 0.00 ? 6   SER A HG   3  
ATOM 3247  N N    . GLY A 1 7   ? -10.065 19.538  3.070   1.00 0.00 ? 7   GLY A N    3  
ATOM 3248  C CA   . GLY A 1 7   ? -10.046 18.230  3.697   1.00 0.00 ? 7   GLY A CA   3  
ATOM 3249  C C    . GLY A 1 7   ? -8.647  17.790  4.079   1.00 0.00 ? 7   GLY A C    3  
ATOM 3250  O O    . GLY A 1 7   ? -7.672  18.075  3.384   1.00 0.00 ? 7   GLY A O    3  
ATOM 3251  H H    . GLY A 1 7   ? -9.295  20.137  3.167   1.00 0.00 ? 7   GLY A H    3  
ATOM 3252  H HA2  . GLY A 1 7   ? -10.659 18.260  4.585   1.00 0.00 ? 7   GLY A HA2  3  
ATOM 3253  H HA3  . GLY A 1 7   ? -10.462 17.508  3.009   1.00 0.00 ? 7   GLY A HA3  3  
ATOM 3254  N N    . PRO A 1 8   ? -8.534  17.081  5.212   1.00 0.00 ? 8   PRO A N    3  
ATOM 3255  C CA   . PRO A 1 8   ? -7.248  16.587  5.712   1.00 0.00 ? 8   PRO A CA   3  
ATOM 3256  C C    . PRO A 1 8   ? -6.676  15.473  4.842   1.00 0.00 ? 8   PRO A C    3  
ATOM 3257  O O    . PRO A 1 8   ? -7.415  14.757  4.168   1.00 0.00 ? 8   PRO A O    3  
ATOM 3258  C CB   . PRO A 1 8   ? -7.590  16.054  7.106   1.00 0.00 ? 8   PRO A CB   3  
ATOM 3259  C CG   . PRO A 1 8   ? -9.038  15.710  7.035   1.00 0.00 ? 8   PRO A CG   3  
ATOM 3260  C CD   . PRO A 1 8   ? -9.654  16.705  6.091   1.00 0.00 ? 8   PRO A CD   3  
ATOM 3261  H HA   . PRO A 1 8   ? -6.523  17.384  5.797   1.00 0.00 ? 8   PRO A HA   3  
ATOM 3262  H HB2  . PRO A 1 8   ? -6.986  15.184  7.320   1.00 0.00 ? 8   PRO A HB2  3  
ATOM 3263  H HB3  . PRO A 1 8   ? -7.402  16.820  7.844   1.00 0.00 ? 8   PRO A HB3  3  
ATOM 3264  H HG2  . PRO A 1 8   ? -9.158  14.707  6.654   1.00 0.00 ? 8   PRO A HG2  3  
ATOM 3265  H HG3  . PRO A 1 8   ? -9.484  15.797  8.015   1.00 0.00 ? 8   PRO A HG3  3  
ATOM 3266  H HD2  . PRO A 1 8   ? -10.451 16.245  5.525   1.00 0.00 ? 8   PRO A HD2  3  
ATOM 3267  H HD3  . PRO A 1 8   ? -10.021 17.563  6.634   1.00 0.00 ? 8   PRO A HD3  3  
ATOM 3268  N N    . GLY A 1 9   ? -5.354  15.331  4.862   1.00 0.00 ? 9   GLY A N    3  
ATOM 3269  C CA   . GLY A 1 9   ? -4.706  14.302  4.071   1.00 0.00 ? 9   GLY A CA   3  
ATOM 3270  C C    . GLY A 1 9   ? -3.195  14.419  4.093   1.00 0.00 ? 9   GLY A C    3  
ATOM 3271  O O    . GLY A 1 9   ? -2.489  13.418  4.224   1.00 0.00 ? 9   GLY A O    3  
ATOM 3272  H H    . GLY A 1 9   ? -4.815  15.931  5.419   1.00 0.00 ? 9   GLY A H    3  
ATOM 3273  H HA2  . GLY A 1 9   ? -4.987  13.334  4.459   1.00 0.00 ? 9   GLY A HA2  3  
ATOM 3274  H HA3  . GLY A 1 9   ? -5.047  14.382  3.049   1.00 0.00 ? 9   GLY A HA3  3  
ATOM 3275  N N    . LEU A 1 10  ? -2.696  15.643  3.962   1.00 0.00 ? 10  LEU A N    3  
ATOM 3276  C CA   . LEU A 1 10  ? -1.258  15.888  3.966   1.00 0.00 ? 10  LEU A CA   3  
ATOM 3277  C C    . LEU A 1 10  ? -0.729  16.005  5.392   1.00 0.00 ? 10  LEU A C    3  
ATOM 3278  O O    . LEU A 1 10  ? 0.260   16.693  5.643   1.00 0.00 ? 10  LEU A O    3  
ATOM 3279  C CB   . LEU A 1 10  ? -0.936  17.163  3.185   1.00 0.00 ? 10  LEU A CB   3  
ATOM 3280  C CG   . LEU A 1 10  ? -1.777  18.392  3.529   1.00 0.00 ? 10  LEU A CG   3  
ATOM 3281  C CD1  . LEU A 1 10  ? -3.046  18.423  2.691   1.00 0.00 ? 10  LEU A CD1  3  
ATOM 3282  C CD2  . LEU A 1 10  ? -2.116  18.408  5.013   1.00 0.00 ? 10  LEU A CD2  3  
ATOM 3283  H H    . LEU A 1 10  ? -3.309  16.401  3.861   1.00 0.00 ? 10  LEU A H    3  
ATOM 3284  H HA   . LEU A 1 10  ? -0.778  15.049  3.484   1.00 0.00 ? 10  LEU A HA   3  
ATOM 3285  H HB2  . LEU A 1 10  ? 0.099   17.409  3.367   1.00 0.00 ? 10  LEU A HB2  3  
ATOM 3286  H HB3  . LEU A 1 10  ? -1.074  16.950  2.134   1.00 0.00 ? 10  LEU A HB3  3  
ATOM 3287  H HG   . LEU A 1 10  ? -1.208  19.284  3.306   1.00 0.00 ? 10  LEU A HG   3  
ATOM 3288  H HD11 . LEU A 1 10  ? -3.091  19.352  2.142   1.00 0.00 ? 10  LEU A HD11 3  
ATOM 3289  H HD12 . LEU A 1 10  ? -3.907  18.345  3.338   1.00 0.00 ? 10  LEU A HD12 3  
ATOM 3290  H HD13 . LEU A 1 10  ? -3.039  17.595  1.998   1.00 0.00 ? 10  LEU A HD13 3  
ATOM 3291  H HD21 . LEU A 1 10  ? -2.767  19.244  5.224   1.00 0.00 ? 10  LEU A HD21 3  
ATOM 3292  H HD22 . LEU A 1 10  ? -1.207  18.505  5.589   1.00 0.00 ? 10  LEU A HD22 3  
ATOM 3293  H HD23 . LEU A 1 10  ? -2.615  17.487  5.278   1.00 0.00 ? 10  LEU A HD23 3  
ATOM 3294  N N    . ARG A 1 11  ? -1.394  15.326  6.321   1.00 0.00 ? 11  ARG A N    3  
ATOM 3295  C CA   . ARG A 1 11  ? -0.990  15.352  7.722   1.00 0.00 ? 11  ARG A CA   3  
ATOM 3296  C C    . ARG A 1 11  ? -0.166  14.117  8.074   1.00 0.00 ? 11  ARG A C    3  
ATOM 3297  O O    . ARG A 1 11  ? -0.192  13.117  7.356   1.00 0.00 ? 11  ARG A O    3  
ATOM 3298  C CB   . ARG A 1 11  ? -2.220  15.434  8.628   1.00 0.00 ? 11  ARG A CB   3  
ATOM 3299  C CG   . ARG A 1 11  ? -3.167  16.566  8.268   1.00 0.00 ? 11  ARG A CG   3  
ATOM 3300  C CD   . ARG A 1 11  ? -4.435  16.519  9.107   1.00 0.00 ? 11  ARG A CD   3  
ATOM 3301  N NE   . ARG A 1 11  ? -5.156  15.261  8.939   1.00 0.00 ? 11  ARG A NE   3  
ATOM 3302  C CZ   . ARG A 1 11  ? -6.201  14.908  9.680   1.00 0.00 ? 11  ARG A CZ   3  
ATOM 3303  N NH1  . ARG A 1 11  ? -6.645  15.715  10.633  1.00 0.00 ? 11  ARG A NH1  3  
ATOM 3304  N NH2  . ARG A 1 11  ? -6.804  13.745  9.467   1.00 0.00 ? 11  ARG A NH2  3  
ATOM 3305  H H    . ARG A 1 11  ? -2.175  14.795  6.059   1.00 0.00 ? 11  ARG A H    3  
ATOM 3306  H HA   . ARG A 1 11  ? -0.382  16.231  7.876   1.00 0.00 ? 11  ARG A HA   3  
ATOM 3307  H HB2  . ARG A 1 11  ? -2.764  14.503  8.561   1.00 0.00 ? 11  ARG A HB2  3  
ATOM 3308  H HB3  . ARG A 1 11  ? -1.892  15.577  9.647   1.00 0.00 ? 11  ARG A HB3  3  
ATOM 3309  H HG2  . ARG A 1 11  ? -2.669  17.509  8.441   1.00 0.00 ? 11  ARG A HG2  3  
ATOM 3310  H HG3  . ARG A 1 11  ? -3.433  16.483  7.225   1.00 0.00 ? 11  ARG A HG3  3  
ATOM 3311  H HD2  . ARG A 1 11  ? -4.167  16.634  10.147  1.00 0.00 ? 11  ARG A HD2  3  
ATOM 3312  H HD3  . ARG A 1 11  ? -5.078  17.334  8.809   1.00 0.00 ? 11  ARG A HD3  3  
ATOM 3313  H HE   . ARG A 1 11  ? -4.845  14.649  8.240   1.00 0.00 ? 11  ARG A HE   3  
ATOM 3314  H HH11 . ARG A 1 11  ? -6.192  16.592  10.795  1.00 0.00 ? 11  ARG A HH11 3  
ATOM 3315  H HH12 . ARG A 1 11  ? -7.432  15.448  11.189  1.00 0.00 ? 11  ARG A HH12 3  
ATOM 3316  H HH21 . ARG A 1 11  ? -6.473  13.134  8.749   1.00 0.00 ? 11  ARG A HH21 3  
ATOM 3317  H HH22 . ARG A 1 11  ? -7.590  13.481  10.025  1.00 0.00 ? 11  ARG A HH22 3  
ATOM 3318  N N    . GLU A 1 12  ? 0.563   14.194  9.183   1.00 0.00 ? 12  GLU A N    3  
ATOM 3319  C CA   . GLU A 1 12  ? 1.395   13.082  9.628   1.00 0.00 ? 12  GLU A CA   3  
ATOM 3320  C C    . GLU A 1 12  ? 0.534   11.904  10.076  1.00 0.00 ? 12  GLU A C    3  
ATOM 3321  O O    . GLU A 1 12  ? -0.095  11.948  11.134  1.00 0.00 ? 12  GLU A O    3  
ATOM 3322  C CB   . GLU A 1 12  ? 2.308   13.526  10.773  1.00 0.00 ? 12  GLU A CB   3  
ATOM 3323  C CG   . GLU A 1 12  ? 3.427   12.543  11.075  1.00 0.00 ? 12  GLU A CG   3  
ATOM 3324  C CD   . GLU A 1 12  ? 4.327   13.012  12.202  1.00 0.00 ? 12  GLU A CD   3  
ATOM 3325  O OE1  . GLU A 1 12  ? 3.901   12.931  13.373  1.00 0.00 ? 12  GLU A OE1  3  
ATOM 3326  O OE2  . GLU A 1 12  ? 5.456   13.461  11.912  1.00 0.00 ? 12  GLU A OE2  3  
ATOM 3327  H H    . GLU A 1 12  ? 0.542   15.018  9.713   1.00 0.00 ? 12  GLU A H    3  
ATOM 3328  H HA   . GLU A 1 12  ? 2.005   12.770  8.794   1.00 0.00 ? 12  GLU A HA   3  
ATOM 3329  H HB2  . GLU A 1 12  ? 2.751   14.477  10.516  1.00 0.00 ? 12  GLU A HB2  3  
ATOM 3330  H HB3  . GLU A 1 12  ? 1.712   13.646  11.666  1.00 0.00 ? 12  GLU A HB3  3  
ATOM 3331  H HG2  . GLU A 1 12  ? 2.991   11.596  11.354  1.00 0.00 ? 12  GLU A HG2  3  
ATOM 3332  H HG3  . GLU A 1 12  ? 4.025   12.414  10.185  1.00 0.00 ? 12  GLU A HG3  3  
ATOM 3333  N N    . LEU A 1 13  ? 0.512   10.853  9.264   1.00 0.00 ? 13  LEU A N    3  
ATOM 3334  C CA   . LEU A 1 13  ? -0.272  9.663   9.576   1.00 0.00 ? 13  LEU A CA   3  
ATOM 3335  C C    . LEU A 1 13  ? 0.637   8.467   9.842   1.00 0.00 ? 13  LEU A C    3  
ATOM 3336  O O    . LEU A 1 13  ? 1.786   8.437   9.399   1.00 0.00 ? 13  LEU A O    3  
ATOM 3337  C CB   . LEU A 1 13  ? -1.230  9.344   8.427   1.00 0.00 ? 13  LEU A CB   3  
ATOM 3338  C CG   . LEU A 1 13  ? -2.468  10.235  8.318   1.00 0.00 ? 13  LEU A CG   3  
ATOM 3339  C CD1  . LEU A 1 13  ? -3.010  10.225  6.897   1.00 0.00 ? 13  LEU A CD1  3  
ATOM 3340  C CD2  . LEU A 1 13  ? -3.538  9.783   9.302   1.00 0.00 ? 13  LEU A CD2  3  
ATOM 3341  H H    . LEU A 1 13  ? 1.033   10.877  8.436   1.00 0.00 ? 13  LEU A H    3  
ATOM 3342  H HA   . LEU A 1 13  ? -0.847  9.868   10.467  1.00 0.00 ? 13  LEU A HA   3  
ATOM 3343  H HB2  . LEU A 1 13  ? -0.679  9.430   7.503   1.00 0.00 ? 13  LEU A HB2  3  
ATOM 3344  H HB3  . LEU A 1 13  ? -1.565  8.324   8.550   1.00 0.00 ? 13  LEU A HB3  3  
ATOM 3345  H HG   . LEU A 1 13  ? -2.194  11.252  8.563   1.00 0.00 ? 13  LEU A HG   3  
ATOM 3346  H HD11 . LEU A 1 13  ? -2.415  10.881  6.281   1.00 0.00 ? 13  LEU A HD11 3  
ATOM 3347  H HD12 . LEU A 1 13  ? -4.035  10.564  6.900   1.00 0.00 ? 13  LEU A HD12 3  
ATOM 3348  H HD13 . LEU A 1 13  ? -2.965  9.220   6.502   1.00 0.00 ? 13  LEU A HD13 3  
ATOM 3349  H HD21 . LEU A 1 13  ? -4.174  10.620  9.550   1.00 0.00 ? 13  LEU A HD21 3  
ATOM 3350  H HD22 . LEU A 1 13  ? -3.067  9.411   10.200  1.00 0.00 ? 13  LEU A HD22 3  
ATOM 3351  H HD23 . LEU A 1 13  ? -4.131  9.000   8.854   1.00 0.00 ? 13  LEU A HD23 3  
ATOM 3352  N N    . CYS A 1 14  ? 0.115   7.484   10.566  1.00 0.00 ? 14  CYS A N    3  
ATOM 3353  C CA   . CYS A 1 14  ? 0.879   6.284   10.891  1.00 0.00 ? 14  CYS A CA   3  
ATOM 3354  C C    . CYS A 1 14  ? 0.006   5.038   10.781  1.00 0.00 ? 14  CYS A C    3  
ATOM 3355  O O    . CYS A 1 14  ? -1.220  5.130   10.720  1.00 0.00 ? 14  CYS A O    3  
ATOM 3356  C CB   . CYS A 1 14  ? 1.462   6.391   12.300  1.00 0.00 ? 14  CYS A CB   3  
ATOM 3357  S SG   . CYS A 1 14  ? 0.233   6.721   13.585  1.00 0.00 ? 14  CYS A SG   3  
ATOM 3358  H H    . CYS A 1 14  ? -0.806  7.566   10.892  1.00 0.00 ? 14  CYS A H    3  
ATOM 3359  H HA   . CYS A 1 14  ? 1.688   6.206   10.181  1.00 0.00 ? 14  CYS A HA   3  
ATOM 3360  H HB2  . CYS A 1 14  ? 1.955   5.463   12.549  1.00 0.00 ? 14  CYS A HB2  3  
ATOM 3361  H HB3  . CYS A 1 14  ? 2.185   7.193   12.322  1.00 0.00 ? 14  CYS A HB3  3  
ATOM 3362  H HG   . CYS A 1 14  ? 0.496   7.909   14.107  1.00 0.00 ? 14  CYS A HG   3  
ATOM 3363  N N    . ILE A 1 15  ? 0.647   3.874   10.755  1.00 0.00 ? 15  ILE A N    3  
ATOM 3364  C CA   . ILE A 1 15  ? -0.071  2.610   10.652  1.00 0.00 ? 15  ILE A CA   3  
ATOM 3365  C C    . ILE A 1 15  ? 0.378   1.633   11.735  1.00 0.00 ? 15  ILE A C    3  
ATOM 3366  O O    . ILE A 1 15  ? 1.467   1.065   11.658  1.00 0.00 ? 15  ILE A O    3  
ATOM 3367  C CB   . ILE A 1 15  ? 0.133   1.957   9.272   1.00 0.00 ? 15  ILE A CB   3  
ATOM 3368  C CG1  . ILE A 1 15  ? -0.262  2.931   8.160   1.00 0.00 ? 15  ILE A CG1  3  
ATOM 3369  C CG2  . ILE A 1 15  ? -0.675  0.672   9.170   1.00 0.00 ? 15  ILE A CG2  3  
ATOM 3370  C CD1  . ILE A 1 15  ? -0.075  2.368   6.769   1.00 0.00 ? 15  ILE A CD1  3  
ATOM 3371  H H    . ILE A 1 15  ? 1.625   3.866   10.807  1.00 0.00 ? 15  ILE A H    3  
ATOM 3372  H HA   . ILE A 1 15  ? -1.124  2.813   10.780  1.00 0.00 ? 15  ILE A HA   3  
ATOM 3373  H HB   . ILE A 1 15  ? 1.177   1.707   9.167   1.00 0.00 ? 15  ILE A HB   3  
ATOM 3374  H HG12 . ILE A 1 15  ? -1.302  3.195   8.274   1.00 0.00 ? 15  ILE A HG12 3  
ATOM 3375  H HG13 . ILE A 1 15  ? 0.342   3.824   8.242   1.00 0.00 ? 15  ILE A HG13 3  
ATOM 3376  H HG21 . ILE A 1 15  ? -1.641  0.888   8.739   1.00 0.00 ? 15  ILE A HG21 3  
ATOM 3377  H HG22 . ILE A 1 15  ? -0.151  -0.033  8.541   1.00 0.00 ? 15  ILE A HG22 3  
ATOM 3378  H HG23 . ILE A 1 15  ? -0.806  0.249   10.154  1.00 0.00 ? 15  ILE A HG23 3  
ATOM 3379  H HD11 . ILE A 1 15  ? -0.777  2.835   6.094   1.00 0.00 ? 15  ILE A HD11 3  
ATOM 3380  H HD12 . ILE A 1 15  ? 0.933   2.563   6.434   1.00 0.00 ? 15  ILE A HD12 3  
ATOM 3381  H HD13 . ILE A 1 15  ? -0.248  1.302   6.786   1.00 0.00 ? 15  ILE A HD13 3  
ATOM 3382  N N    . GLN A 1 16  ? -0.470  1.444   12.741  1.00 0.00 ? 16  GLN A N    3  
ATOM 3383  C CA   . GLN A 1 16  ? -0.160  0.535   13.838  1.00 0.00 ? 16  GLN A CA   3  
ATOM 3384  C C    . GLN A 1 16  ? -0.443  -0.911  13.444  1.00 0.00 ? 16  GLN A C    3  
ATOM 3385  O O    . GLN A 1 16  ? -1.584  -1.276  13.157  1.00 0.00 ? 16  GLN A O    3  
ATOM 3386  C CB   . GLN A 1 16  ? -0.973  0.906   15.080  1.00 0.00 ? 16  GLN A CB   3  
ATOM 3387  C CG   . GLN A 1 16  ? -0.250  1.859   16.018  1.00 0.00 ? 16  GLN A CG   3  
ATOM 3388  C CD   . GLN A 1 16  ? -1.202  2.746   16.795  1.00 0.00 ? 16  GLN A CD   3  
ATOM 3389  O OE1  . GLN A 1 16  ? -1.294  2.655   18.020  1.00 0.00 ? 16  GLN A OE1  3  
ATOM 3390  N NE2  . GLN A 1 16  ? -1.917  3.612   16.087  1.00 0.00 ? 16  GLN A NE2  3  
ATOM 3391  H H    . GLN A 1 16  ? -1.322  1.926   12.745  1.00 0.00 ? 16  GLN A H    3  
ATOM 3392  H HA   . GLN A 1 16  ? 0.890   0.634   14.064  1.00 0.00 ? 16  GLN A HA   3  
ATOM 3393  H HB2  . GLN A 1 16  ? -1.895  1.373   14.766  1.00 0.00 ? 16  GLN A HB2  3  
ATOM 3394  H HB3  . GLN A 1 16  ? -1.204  0.003   15.627  1.00 0.00 ? 16  GLN A HB3  3  
ATOM 3395  H HG2  . GLN A 1 16  ? 0.332   1.281   16.720  1.00 0.00 ? 16  GLN A HG2  3  
ATOM 3396  H HG3  . GLN A 1 16  ? 0.408   2.486   15.435  1.00 0.00 ? 16  GLN A HG3  3  
ATOM 3397  H HE21 . GLN A 1 16  ? -1.793  3.628   15.114  1.00 0.00 ? 16  GLN A HE21 3  
ATOM 3398  H HE22 . GLN A 1 16  ? -2.541  4.197   16.563  1.00 0.00 ? 16  GLN A HE22 3  
ATOM 3399  N N    . LYS A 1 17  ? 0.602   -1.731  13.432  1.00 0.00 ? 17  LYS A N    3  
ATOM 3400  C CA   . LYS A 1 17  ? 0.467   -3.138  13.074  1.00 0.00 ? 17  LYS A CA   3  
ATOM 3401  C C    . LYS A 1 17  ? 1.065   -4.034  14.153  1.00 0.00 ? 17  LYS A C    3  
ATOM 3402  O O    . LYS A 1 17  ? 1.756   -3.560  15.054  1.00 0.00 ? 17  LYS A O    3  
ATOM 3403  C CB   . LYS A 1 17  ? 1.151   -3.412  11.732  1.00 0.00 ? 17  LYS A CB   3  
ATOM 3404  C CG   . LYS A 1 17  ? 2.653   -3.604  11.843  1.00 0.00 ? 17  LYS A CG   3  
ATOM 3405  C CD   . LYS A 1 17  ? 3.352   -3.313  10.526  1.00 0.00 ? 17  LYS A CD   3  
ATOM 3406  C CE   . LYS A 1 17  ? 3.420   -1.819  10.250  1.00 0.00 ? 17  LYS A CE   3  
ATOM 3407  N NZ   . LYS A 1 17  ? 4.544   -1.170  10.979  1.00 0.00 ? 17  LYS A NZ   3  
ATOM 3408  H H    . LYS A 1 17  ? 1.486   -1.382  13.670  1.00 0.00 ? 17  LYS A H    3  
ATOM 3409  H HA   . LYS A 1 17  ? -0.586  -3.358  12.983  1.00 0.00 ? 17  LYS A HA   3  
ATOM 3410  H HB2  . LYS A 1 17  ? 0.726   -4.306  11.301  1.00 0.00 ? 17  LYS A HB2  3  
ATOM 3411  H HB3  . LYS A 1 17  ? 0.964   -2.579  11.070  1.00 0.00 ? 17  LYS A HB3  3  
ATOM 3412  H HG2  . LYS A 1 17  ? 3.038   -2.935  12.598  1.00 0.00 ? 17  LYS A HG2  3  
ATOM 3413  H HG3  . LYS A 1 17  ? 2.856   -4.627  12.130  1.00 0.00 ? 17  LYS A HG3  3  
ATOM 3414  H HD2  . LYS A 1 17  ? 4.357   -3.705  10.567  1.00 0.00 ? 17  LYS A HD2  3  
ATOM 3415  H HD3  . LYS A 1 17  ? 2.808   -3.794  9.726   1.00 0.00 ? 17  LYS A HD3  3  
ATOM 3416  H HE2  . LYS A 1 17  ? 3.555   -1.667  9.190   1.00 0.00 ? 17  LYS A HE2  3  
ATOM 3417  H HE3  . LYS A 1 17  ? 2.490   -1.366  10.562  1.00 0.00 ? 17  LYS A HE3  3  
ATOM 3418  H HZ1  . LYS A 1 17  ? 4.199   -0.749  11.866  1.00 0.00 ? 17  LYS A HZ1  3  
ATOM 3419  H HZ2  . LYS A 1 17  ? 4.965   -0.420  10.394  1.00 0.00 ? 17  LYS A HZ2  3  
ATOM 3420  H HZ3  . LYS A 1 17  ? 5.277   -1.872  11.204  1.00 0.00 ? 17  LYS A HZ3  3  
ATOM 3421  N N    . ALA A 1 18  ? 0.796   -5.332  14.055  1.00 0.00 ? 18  ALA A N    3  
ATOM 3422  C CA   . ALA A 1 18  ? 1.310   -6.294  15.021  1.00 0.00 ? 18  ALA A CA   3  
ATOM 3423  C C    . ALA A 1 18  ? 2.793   -6.063  15.290  1.00 0.00 ? 18  ALA A C    3  
ATOM 3424  O O    . ALA A 1 18  ? 3.466   -5.310  14.586  1.00 0.00 ? 18  ALA A O    3  
ATOM 3425  C CB   . ALA A 1 18  ? 1.077   -7.714  14.528  1.00 0.00 ? 18  ALA A CB   3  
ATOM 3426  H H    . ALA A 1 18  ? 0.239   -5.650  13.314  1.00 0.00 ? 18  ALA A H    3  
ATOM 3427  H HA   . ALA A 1 18  ? 0.763   -6.166  15.944  1.00 0.00 ? 18  ALA A HA   3  
ATOM 3428  H HB1  . ALA A 1 18  ? 2.029   -8.198  14.362  1.00 0.00 ? 18  ALA A HB1  3  
ATOM 3429  H HB2  . ALA A 1 18  ? 0.516   -8.265  15.268  1.00 0.00 ? 18  ALA A HB2  3  
ATOM 3430  H HB3  . ALA A 1 18  ? 0.521   -7.687  13.602  1.00 0.00 ? 18  ALA A HB3  3  
ATOM 3431  N N    . PRO A 1 19  ? 3.317   -6.724  16.333  1.00 0.00 ? 19  PRO A N    3  
ATOM 3432  C CA   . PRO A 1 19  ? 4.726   -6.606  16.719  1.00 0.00 ? 19  PRO A CA   3  
ATOM 3433  C C    . PRO A 1 19  ? 5.661   -7.262  15.708  1.00 0.00 ? 19  PRO A C    3  
ATOM 3434  O O    . PRO A 1 19  ? 6.877   -7.280  15.893  1.00 0.00 ? 19  PRO A O    3  
ATOM 3435  C CB   . PRO A 1 19  ? 4.789   -7.340  18.061  1.00 0.00 ? 19  PRO A CB   3  
ATOM 3436  C CG   . PRO A 1 19  ? 3.656   -8.306  18.018  1.00 0.00 ? 19  PRO A CG   3  
ATOM 3437  C CD   . PRO A 1 19  ? 2.573   -7.639  17.216  1.00 0.00 ? 19  PRO A CD   3  
ATOM 3438  H HA   . PRO A 1 19  ? 5.014   -5.574  16.857  1.00 0.00 ? 19  PRO A HA   3  
ATOM 3439  H HB2  . PRO A 1 19  ? 5.739   -7.848  18.151  1.00 0.00 ? 19  PRO A HB2  3  
ATOM 3440  H HB3  . PRO A 1 19  ? 4.674   -6.633  18.868  1.00 0.00 ? 19  PRO A HB3  3  
ATOM 3441  H HG2  . PRO A 1 19  ? 3.970   -9.220  17.536  1.00 0.00 ? 19  PRO A HG2  3  
ATOM 3442  H HG3  . PRO A 1 19  ? 3.309   -8.509  19.020  1.00 0.00 ? 19  PRO A HG3  3  
ATOM 3443  H HD2  . PRO A 1 19  ? 2.025   -8.370  16.640  1.00 0.00 ? 19  PRO A HD2  3  
ATOM 3444  H HD3  . PRO A 1 19  ? 1.907   -7.090  17.865  1.00 0.00 ? 19  PRO A HD3  3  
ATOM 3445  N N    . GLY A 1 20  ? 5.084   -7.800  14.638  1.00 0.00 ? 20  GLY A N    3  
ATOM 3446  C CA   . GLY A 1 20  ? 5.881   -8.450  13.613  1.00 0.00 ? 20  GLY A CA   3  
ATOM 3447  C C    . GLY A 1 20  ? 5.083   -8.743  12.358  1.00 0.00 ? 20  GLY A C    3  
ATOM 3448  O O    . GLY A 1 20  ? 5.193   -9.826  11.785  1.00 0.00 ? 20  GLY A O    3  
ATOM 3449  H H    . GLY A 1 20  ? 4.109   -7.756  14.543  1.00 0.00 ? 20  GLY A H    3  
ATOM 3450  H HA2  . GLY A 1 20  ? 6.711   -7.808  13.358  1.00 0.00 ? 20  GLY A HA2  3  
ATOM 3451  H HA3  . GLY A 1 20  ? 6.264   -9.379  14.007  1.00 0.00 ? 20  GLY A HA3  3  
ATOM 3452  N N    . GLU A 1 21  ? 4.278   -7.776  11.930  1.00 0.00 ? 21  GLU A N    3  
ATOM 3453  C CA   . GLU A 1 21  ? 3.457   -7.938  10.736  1.00 0.00 ? 21  GLU A CA   3  
ATOM 3454  C C    . GLU A 1 21  ? 3.943   -7.024  9.614   1.00 0.00 ? 21  GLU A C    3  
ATOM 3455  O O    . GLU A 1 21  ? 4.361   -5.892  9.859   1.00 0.00 ? 21  GLU A O    3  
ATOM 3456  C CB   . GLU A 1 21  ? 1.991   -7.639  11.053  1.00 0.00 ? 21  GLU A CB   3  
ATOM 3457  C CG   . GLU A 1 21  ? 1.044   -7.948  9.905   1.00 0.00 ? 21  GLU A CG   3  
ATOM 3458  C CD   . GLU A 1 21  ? 1.131   -9.391  9.450   1.00 0.00 ? 21  GLU A CD   3  
ATOM 3459  O OE1  . GLU A 1 21  ? 1.436   -10.262 10.292  1.00 0.00 ? 21  GLU A OE1  3  
ATOM 3460  O OE2  . GLU A 1 21  ? 0.893   -9.650  8.252   1.00 0.00 ? 21  GLU A OE2  3  
ATOM 3461  H H    . GLU A 1 21  ? 4.234   -6.934  12.430  1.00 0.00 ? 21  GLU A H    3  
ATOM 3462  H HA   . GLU A 1 21  ? 3.544   -8.963  10.411  1.00 0.00 ? 21  GLU A HA   3  
ATOM 3463  H HB2  . GLU A 1 21  ? 1.692   -8.229  11.908  1.00 0.00 ? 21  GLU A HB2  3  
ATOM 3464  H HB3  . GLU A 1 21  ? 1.895   -6.592  11.299  1.00 0.00 ? 21  GLU A HB3  3  
ATOM 3465  H HG2  . GLU A 1 21  ? 0.033   -7.747  10.225  1.00 0.00 ? 21  GLU A HG2  3  
ATOM 3466  H HG3  . GLU A 1 21  ? 1.290   -7.307  9.071   1.00 0.00 ? 21  GLU A HG3  3  
ATOM 3467  N N    . ARG A 1 22  ? 3.885   -7.524  8.385   1.00 0.00 ? 22  ARG A N    3  
ATOM 3468  C CA   . ARG A 1 22  ? 4.320   -6.755  7.225   1.00 0.00 ? 22  ARG A CA   3  
ATOM 3469  C C    . ARG A 1 22  ? 3.185   -5.884  6.694   1.00 0.00 ? 22  ARG A C    3  
ATOM 3470  O O    . ARG A 1 22  ? 2.102   -6.379  6.380   1.00 0.00 ? 22  ARG A O    3  
ATOM 3471  C CB   . ARG A 1 22  ? 4.817   -7.691  6.122   1.00 0.00 ? 22  ARG A CB   3  
ATOM 3472  C CG   . ARG A 1 22  ? 4.026   -8.984  6.018   1.00 0.00 ? 22  ARG A CG   3  
ATOM 3473  C CD   . ARG A 1 22  ? 4.593   -10.060 6.930   1.00 0.00 ? 22  ARG A CD   3  
ATOM 3474  N NE   . ARG A 1 22  ? 5.651   -10.827 6.280   1.00 0.00 ? 22  ARG A NE   3  
ATOM 3475  C CZ   . ARG A 1 22  ? 5.443   -11.638 5.248   1.00 0.00 ? 22  ARG A CZ   3  
ATOM 3476  N NH1  . ARG A 1 22  ? 4.222   -11.787 4.753   1.00 0.00 ? 22  ARG A NH1  3  
ATOM 3477  N NH2  . ARG A 1 22  ? 6.458   -12.303 4.710   1.00 0.00 ? 22  ARG A NH2  3  
ATOM 3478  H H    . ARG A 1 22  ? 3.542   -8.433  8.253   1.00 0.00 ? 22  ARG A H    3  
ATOM 3479  H HA   . ARG A 1 22  ? 5.132   -6.116  7.537   1.00 0.00 ? 22  ARG A HA   3  
ATOM 3480  H HB2  . ARG A 1 22  ? 4.753   -7.178  5.174   1.00 0.00 ? 22  ARG A HB2  3  
ATOM 3481  H HB3  . ARG A 1 22  ? 5.849   -7.941  6.318   1.00 0.00 ? 22  ARG A HB3  3  
ATOM 3482  H HG2  . ARG A 1 22  ? 3.001   -8.792  6.301   1.00 0.00 ? 22  ARG A HG2  3  
ATOM 3483  H HG3  . ARG A 1 22  ? 4.060   -9.335  4.997   1.00 0.00 ? 22  ARG A HG3  3  
ATOM 3484  H HD2  . ARG A 1 22  ? 4.995   -9.588  7.814   1.00 0.00 ? 22  ARG A HD2  3  
ATOM 3485  H HD3  . ARG A 1 22  ? 3.795   -10.731 7.212   1.00 0.00 ? 22  ARG A HD3  3  
ATOM 3486  H HE   . ARG A 1 22  ? 6.561   -10.733 6.630   1.00 0.00 ? 22  ARG A HE   3  
ATOM 3487  H HH11 . ARG A 1 22  ? 3.456   -11.286 5.156   1.00 0.00 ? 22  ARG A HH11 3  
ATOM 3488  H HH12 . ARG A 1 22  ? 4.068   -12.397 3.976   1.00 0.00 ? 22  ARG A HH12 3  
ATOM 3489  H HH21 . ARG A 1 22  ? 7.380   -12.194 5.081   1.00 0.00 ? 22  ARG A HH21 3  
ATOM 3490  H HH22 . ARG A 1 22  ? 6.300   -12.913 3.934   1.00 0.00 ? 22  ARG A HH22 3  
ATOM 3491  N N    . LEU A 1 23  ? 3.440   -4.584  6.596   1.00 0.00 ? 23  LEU A N    3  
ATOM 3492  C CA   . LEU A 1 23  ? 2.441   -3.643  6.103   1.00 0.00 ? 23  LEU A CA   3  
ATOM 3493  C C    . LEU A 1 23  ? 1.559   -4.292  5.041   1.00 0.00 ? 23  LEU A C    3  
ATOM 3494  O O    . LEU A 1 23  ? 0.333   -4.264  5.136   1.00 0.00 ? 23  LEU A O    3  
ATOM 3495  C CB   . LEU A 1 23  ? 3.122   -2.400  5.527   1.00 0.00 ? 23  LEU A CB   3  
ATOM 3496  C CG   . LEU A 1 23  ? 2.349   -1.087  5.662   1.00 0.00 ? 23  LEU A CG   3  
ATOM 3497  C CD1  . LEU A 1 23  ? 0.915   -1.261  5.187   1.00 0.00 ? 23  LEU A CD1  3  
ATOM 3498  C CD2  . LEU A 1 23  ? 2.379   -0.596  7.102   1.00 0.00 ? 23  LEU A CD2  3  
ATOM 3499  H H    . LEU A 1 23  ? 4.322   -4.248  6.861   1.00 0.00 ? 23  LEU A H    3  
ATOM 3500  H HA   . LEU A 1 23  ? 1.822   -3.350  6.938   1.00 0.00 ? 23  LEU A HA   3  
ATOM 3501  H HB2  . LEU A 1 23  ? 4.069   -2.279  6.030   1.00 0.00 ? 23  LEU A HB2  3  
ATOM 3502  H HB3  . LEU A 1 23  ? 3.295   -2.576  4.475   1.00 0.00 ? 23  LEU A HB3  3  
ATOM 3503  H HG   . LEU A 1 23  ? 2.817   -0.336  5.042   1.00 0.00 ? 23  LEU A HG   3  
ATOM 3504  H HD11 . LEU A 1 23  ? 0.862   -2.090  4.498   1.00 0.00 ? 23  LEU A HD11 3  
ATOM 3505  H HD12 . LEU A 1 23  ? 0.588   -0.359  4.691   1.00 0.00 ? 23  LEU A HD12 3  
ATOM 3506  H HD13 . LEU A 1 23  ? 0.275   -1.456  6.036   1.00 0.00 ? 23  LEU A HD13 3  
ATOM 3507  H HD21 . LEU A 1 23  ? 2.160   -1.419  7.767   1.00 0.00 ? 23  LEU A HD21 3  
ATOM 3508  H HD22 . LEU A 1 23  ? 1.639   0.180   7.234   1.00 0.00 ? 23  LEU A HD22 3  
ATOM 3509  H HD23 . LEU A 1 23  ? 3.359   -0.202  7.327   1.00 0.00 ? 23  LEU A HD23 3  
ATOM 3510  N N    . GLY A 1 24  ? 2.193   -4.878  4.030   1.00 0.00 ? 24  GLY A N    3  
ATOM 3511  C CA   . GLY A 1 24  ? 1.450   -5.527  2.966   1.00 0.00 ? 24  GLY A CA   3  
ATOM 3512  C C    . GLY A 1 24  ? 0.907   -4.540  1.952   1.00 0.00 ? 24  GLY A C    3  
ATOM 3513  O O    . GLY A 1 24  ? -0.228  -4.674  1.493   1.00 0.00 ? 24  GLY A O    3  
ATOM 3514  H H    . GLY A 1 24  ? 3.173   -4.869  4.006   1.00 0.00 ? 24  GLY A H    3  
ATOM 3515  H HA2  . GLY A 1 24  ? 2.102   -6.224  2.461   1.00 0.00 ? 24  GLY A HA2  3  
ATOM 3516  H HA3  . GLY A 1 24  ? 0.624   -6.072  3.399   1.00 0.00 ? 24  GLY A HA3  3  
ATOM 3517  N N    . ILE A 1 25  ? 1.717   -3.546  1.603   1.00 0.00 ? 25  ILE A N    3  
ATOM 3518  C CA   . ILE A 1 25  ? 1.310   -2.533  0.638   1.00 0.00 ? 25  ILE A CA   3  
ATOM 3519  C C    . ILE A 1 25  ? 2.231   -2.530  -0.578  1.00 0.00 ? 25  ILE A C    3  
ATOM 3520  O O    . ILE A 1 25  ? 3.373   -2.983  -0.505  1.00 0.00 ? 25  ILE A O    3  
ATOM 3521  C CB   . ILE A 1 25  ? 1.303   -1.127  1.266   1.00 0.00 ? 25  ILE A CB   3  
ATOM 3522  C CG1  . ILE A 1 25  ? 2.517   -0.948  2.181   1.00 0.00 ? 25  ILE A CG1  3  
ATOM 3523  C CG2  . ILE A 1 25  ? 0.013   -0.898  2.038   1.00 0.00 ? 25  ILE A CG2  3  
ATOM 3524  C CD1  . ILE A 1 25  ? 2.914   0.497   2.382   1.00 0.00 ? 25  ILE A CD1  3  
ATOM 3525  H H    . ILE A 1 25  ? 2.609   -3.494  2.004   1.00 0.00 ? 25  ILE A H    3  
ATOM 3526  H HA   . ILE A 1 25  ? 0.305   -2.765  0.314   1.00 0.00 ? 25  ILE A HA   3  
ATOM 3527  H HB   . ILE A 1 25  ? 1.352   -0.401  0.469   1.00 0.00 ? 25  ILE A HB   3  
ATOM 3528  H HG12 . ILE A 1 25  ? 2.295   -1.368  3.149   1.00 0.00 ? 25  ILE A HG12 3  
ATOM 3529  H HG13 . ILE A 1 25  ? 3.361   -1.469  1.753   1.00 0.00 ? 25  ILE A HG13 3  
ATOM 3530  H HG21 . ILE A 1 25  ? -0.781  -0.651  1.348   1.00 0.00 ? 25  ILE A HG21 3  
ATOM 3531  H HG22 . ILE A 1 25  ? -0.248  -1.795  2.578   1.00 0.00 ? 25  ILE A HG22 3  
ATOM 3532  H HG23 . ILE A 1 25  ? 0.149   -0.084  2.735   1.00 0.00 ? 25  ILE A HG23 3  
ATOM 3533  H HD11 . ILE A 1 25  ? 2.033   1.121   2.352   1.00 0.00 ? 25  ILE A HD11 3  
ATOM 3534  H HD12 . ILE A 1 25  ? 3.402   0.608   3.338   1.00 0.00 ? 25  ILE A HD12 3  
ATOM 3535  H HD13 . ILE A 1 25  ? 3.592   0.797   1.595   1.00 0.00 ? 25  ILE A HD13 3  
ATOM 3536  N N    . SER A 1 26  ? 1.726   -2.016  -1.695  1.00 0.00 ? 26  SER A N    3  
ATOM 3537  C CA   . SER A 1 26  ? 2.503   -1.955  -2.927  1.00 0.00 ? 26  SER A CA   3  
ATOM 3538  C C    . SER A 1 26  ? 2.591   -0.522  -3.444  1.00 0.00 ? 26  SER A C    3  
ATOM 3539  O O    . SER A 1 26  ? 1.617   0.229   -3.392  1.00 0.00 ? 26  SER A O    3  
ATOM 3540  C CB   . SER A 1 26  ? 1.877   -2.857  -3.994  1.00 0.00 ? 26  SER A CB   3  
ATOM 3541  O OG   . SER A 1 26  ? 2.424   -4.163  -3.942  1.00 0.00 ? 26  SER A OG   3  
ATOM 3542  H H    . SER A 1 26  ? 0.809   -1.671  -1.690  1.00 0.00 ? 26  SER A H    3  
ATOM 3543  H HA   . SER A 1 26  ? 3.499   -2.309  -2.709  1.00 0.00 ? 26  SER A HA   3  
ATOM 3544  H HB2  . SER A 1 26  ? 0.812   -2.918  -3.830  1.00 0.00 ? 26  SER A HB2  3  
ATOM 3545  H HB3  . SER A 1 26  ? 2.068   -2.438  -4.971  1.00 0.00 ? 26  SER A HB3  3  
ATOM 3546  H HG   . SER A 1 26  ? 2.923   -4.333  -4.743  1.00 0.00 ? 26  SER A HG   3  
ATOM 3547  N N    . ILE A 1 27  ? 3.765   -0.151  -3.943  1.00 0.00 ? 27  ILE A N    3  
ATOM 3548  C CA   . ILE A 1 27  ? 3.981   1.190   -4.470  1.00 0.00 ? 27  ILE A CA   3  
ATOM 3549  C C    . ILE A 1 27  ? 4.677   1.142   -5.826  1.00 0.00 ? 27  ILE A C    3  
ATOM 3550  O O    . ILE A 1 27  ? 5.350   0.166   -6.156  1.00 0.00 ? 27  ILE A O    3  
ATOM 3551  C CB   . ILE A 1 27  ? 4.822   2.046   -3.504  1.00 0.00 ? 27  ILE A CB   3  
ATOM 3552  C CG1  . ILE A 1 27  ? 6.265   1.539   -3.463  1.00 0.00 ? 27  ILE A CG1  3  
ATOM 3553  C CG2  . ILE A 1 27  ? 4.209   2.030   -2.112  1.00 0.00 ? 27  ILE A CG2  3  
ATOM 3554  C CD1  . ILE A 1 27  ? 7.233   2.523   -2.845  1.00 0.00 ? 27  ILE A CD1  3  
ATOM 3555  H H    . ILE A 1 27  ? 4.504   -0.795  -3.957  1.00 0.00 ? 27  ILE A H    3  
ATOM 3556  H HA   . ILE A 1 27  ? 3.016   1.661   -4.589  1.00 0.00 ? 27  ILE A HA   3  
ATOM 3557  H HB   . ILE A 1 27  ? 4.815   3.064   -3.862  1.00 0.00 ? 27  ILE A HB   3  
ATOM 3558  H HG12 . ILE A 1 27  ? 6.304   0.629   -2.885  1.00 0.00 ? 27  ILE A HG12 3  
ATOM 3559  H HG13 . ILE A 1 27  ? 6.596   1.336   -4.471  1.00 0.00 ? 27  ILE A HG13 3  
ATOM 3560  H HG21 . ILE A 1 27  ? 3.651   2.941   -1.954  1.00 0.00 ? 27  ILE A HG21 3  
ATOM 3561  H HG22 . ILE A 1 27  ? 3.546   1.183   -2.021  1.00 0.00 ? 27  ILE A HG22 3  
ATOM 3562  H HG23 . ILE A 1 27  ? 4.993   1.955   -1.374  1.00 0.00 ? 27  ILE A HG23 3  
ATOM 3563  H HD11 . ILE A 1 27  ? 7.963   2.822   -3.582  1.00 0.00 ? 27  ILE A HD11 3  
ATOM 3564  H HD12 . ILE A 1 27  ? 6.693   3.391   -2.498  1.00 0.00 ? 27  ILE A HD12 3  
ATOM 3565  H HD13 . ILE A 1 27  ? 7.737   2.056   -2.010  1.00 0.00 ? 27  ILE A HD13 3  
ATOM 3566  N N    . ARG A 1 28  ? 4.512   2.205   -6.607  1.00 0.00 ? 28  ARG A N    3  
ATOM 3567  C CA   . ARG A 1 28  ? 5.125   2.284   -7.928  1.00 0.00 ? 28  ARG A CA   3  
ATOM 3568  C C    . ARG A 1 28  ? 5.817   3.630   -8.126  1.00 0.00 ? 28  ARG A C    3  
ATOM 3569  O O    . ARG A 1 28  ? 5.294   4.672   -7.733  1.00 0.00 ? 28  ARG A O    3  
ATOM 3570  C CB   . ARG A 1 28  ? 4.070   2.076   -9.016  1.00 0.00 ? 28  ARG A CB   3  
ATOM 3571  C CG   . ARG A 1 28  ? 3.143   3.266   -9.202  1.00 0.00 ? 28  ARG A CG   3  
ATOM 3572  C CD   . ARG A 1 28  ? 2.210   3.067   -10.386 1.00 0.00 ? 28  ARG A CD   3  
ATOM 3573  N NE   . ARG A 1 28  ? 2.935   3.030   -11.654 1.00 0.00 ? 28  ARG A NE   3  
ATOM 3574  C CZ   . ARG A 1 28  ? 3.462   1.924   -12.167 1.00 0.00 ? 28  ARG A CZ   3  
ATOM 3575  N NH1  . ARG A 1 28  ? 3.345   0.770   -11.525 1.00 0.00 ? 28  ARG A NH1  3  
ATOM 3576  N NH2  . ARG A 1 28  ? 4.107   1.971   -13.326 1.00 0.00 ? 28  ARG A NH2  3  
ATOM 3577  H H    . ARG A 1 28  ? 3.964   2.952   -6.289  1.00 0.00 ? 28  ARG A H    3  
ATOM 3578  H HA   . ARG A 1 28  ? 5.863   1.500   -7.999  1.00 0.00 ? 28  ARG A HA   3  
ATOM 3579  H HB2  . ARG A 1 28  ? 4.570   1.888   -9.955  1.00 0.00 ? 28  ARG A HB2  3  
ATOM 3580  H HB3  . ARG A 1 28  ? 3.470   1.217   -8.759  1.00 0.00 ? 28  ARG A HB3  3  
ATOM 3581  H HG2  . ARG A 1 28  ? 2.550   3.392   -8.308  1.00 0.00 ? 28  ARG A HG2  3  
ATOM 3582  H HG3  . ARG A 1 28  ? 3.739   4.152   -9.369  1.00 0.00 ? 28  ARG A HG3  3  
ATOM 3583  H HD2  . ARG A 1 28  ? 1.682   2.134   -10.258 1.00 0.00 ? 28  ARG A HD2  3  
ATOM 3584  H HD3  . ARG A 1 28  ? 1.502   3.881   -10.410 1.00 0.00 ? 28  ARG A HD3  3  
ATOM 3585  H HE   . ARG A 1 28  ? 3.033   3.872   -12.145 1.00 0.00 ? 28  ARG A HE   3  
ATOM 3586  H HH11 . ARG A 1 28  ? 2.859   0.731   -10.652 1.00 0.00 ? 28  ARG A HH11 3  
ATOM 3587  H HH12 . ARG A 1 28  ? 3.742   -0.062  -11.914 1.00 0.00 ? 28  ARG A HH12 3  
ATOM 3588  H HH21 . ARG A 1 28  ? 4.197   2.839   -13.813 1.00 0.00 ? 28  ARG A HH21 3  
ATOM 3589  H HH22 . ARG A 1 28  ? 4.503   1.138   -13.711 1.00 0.00 ? 28  ARG A HH22 3  
ATOM 3590  N N    . GLY A 1 29  ? 6.997   3.599   -8.738  1.00 0.00 ? 29  GLY A N    3  
ATOM 3591  C CA   . GLY A 1 29  ? 7.741   4.821   -8.976  1.00 0.00 ? 29  GLY A CA   3  
ATOM 3592  C C    . GLY A 1 29  ? 9.240   4.613   -8.893  1.00 0.00 ? 29  GLY A C    3  
ATOM 3593  O O    . GLY A 1 29  ? 9.751   3.564   -9.283  1.00 0.00 ? 29  GLY A O    3  
ATOM 3594  H H    . GLY A 1 29  ? 7.365   2.738   -9.029  1.00 0.00 ? 29  GLY A H    3  
ATOM 3595  H HA2  . GLY A 1 29  ? 7.494   5.194   -9.959  1.00 0.00 ? 29  GLY A HA2  3  
ATOM 3596  H HA3  . GLY A 1 29  ? 7.450   5.556   -8.240  1.00 0.00 ? 29  GLY A HA3  3  
ATOM 3597  N N    . GLY A 1 30  ? 9.948   5.616   -8.383  1.00 0.00 ? 30  GLY A N    3  
ATOM 3598  C CA   . GLY A 1 30  ? 11.391  5.519   -8.260  1.00 0.00 ? 30  GLY A CA   3  
ATOM 3599  C C    . GLY A 1 30  ? 12.115  6.549   -9.104  1.00 0.00 ? 30  GLY A C    3  
ATOM 3600  O O    . GLY A 1 30  ? 11.533  7.134   -10.016 1.00 0.00 ? 30  GLY A O    3  
ATOM 3601  H H    . GLY A 1 30  ? 9.487   6.429   -8.087  1.00 0.00 ? 30  GLY A H    3  
ATOM 3602  H HA2  . GLY A 1 30  ? 11.664  5.660   -7.225  1.00 0.00 ? 30  GLY A HA2  3  
ATOM 3603  H HA3  . GLY A 1 30  ? 11.702  4.533   -8.572  1.00 0.00 ? 30  GLY A HA3  3  
ATOM 3604  N N    . ALA A 1 31  ? 13.389  6.773   -8.797  1.00 0.00 ? 31  ALA A N    3  
ATOM 3605  C CA   . ALA A 1 31  ? 14.194  7.740   -9.534  1.00 0.00 ? 31  ALA A CA   3  
ATOM 3606  C C    . ALA A 1 31  ? 14.917  7.076   -10.700 1.00 0.00 ? 31  ALA A C    3  
ATOM 3607  O O    . ALA A 1 31  ? 15.620  7.738   -11.465 1.00 0.00 ? 31  ALA A O    3  
ATOM 3608  C CB   . ALA A 1 31  ? 15.193  8.412   -8.604  1.00 0.00 ? 31  ALA A CB   3  
ATOM 3609  H H    . ALA A 1 31  ? 13.797  6.276   -8.058  1.00 0.00 ? 31  ALA A H    3  
ATOM 3610  H HA   . ALA A 1 31  ? 13.530  8.501   -9.920  1.00 0.00 ? 31  ALA A HA   3  
ATOM 3611  H HB1  . ALA A 1 31  ? 15.884  7.674   -8.224  1.00 0.00 ? 31  ALA A HB1  3  
ATOM 3612  H HB2  . ALA A 1 31  ? 15.738  9.169   -9.149  1.00 0.00 ? 31  ALA A HB2  3  
ATOM 3613  H HB3  . ALA A 1 31  ? 14.666  8.870   -7.780  1.00 0.00 ? 31  ALA A HB3  3  
ATOM 3614  N N    . ARG A 1 32  ? 14.741  5.765   -10.831 1.00 0.00 ? 32  ARG A N    3  
ATOM 3615  C CA   . ARG A 1 32  ? 15.379  5.012   -11.904 1.00 0.00 ? 32  ARG A CA   3  
ATOM 3616  C C    . ARG A 1 32  ? 14.366  4.128   -12.625 1.00 0.00 ? 32  ARG A C    3  
ATOM 3617  O O    . ARG A 1 32  ? 14.492  3.869   -13.821 1.00 0.00 ? 32  ARG A O    3  
ATOM 3618  C CB   . ARG A 1 32  ? 16.516  4.153   -11.347 1.00 0.00 ? 32  ARG A CB   3  
ATOM 3619  C CG   . ARG A 1 32  ? 17.791  4.934   -11.071 1.00 0.00 ? 32  ARG A CG   3  
ATOM 3620  C CD   . ARG A 1 32  ? 18.436  5.418   -12.360 1.00 0.00 ? 32  ARG A CD   3  
ATOM 3621  N NE   . ARG A 1 32  ? 19.743  6.025   -12.123 1.00 0.00 ? 32  ARG A NE   3  
ATOM 3622  C CZ   . ARG A 1 32  ? 20.318  6.883   -12.959 1.00 0.00 ? 32  ARG A CZ   3  
ATOM 3623  N NH1  . ARG A 1 32  ? 19.703  7.234   -14.081 1.00 0.00 ? 32  ARG A NH1  3  
ATOM 3624  N NH2  . ARG A 1 32  ? 21.509  7.393   -12.674 1.00 0.00 ? 32  ARG A NH2  3  
ATOM 3625  H H    . ARG A 1 32  ? 14.169  5.293   -10.190 1.00 0.00 ? 32  ARG A H    3  
ATOM 3626  H HA   . ARG A 1 32  ? 15.788  5.720   -12.609 1.00 0.00 ? 32  ARG A HA   3  
ATOM 3627  H HB2  . ARG A 1 32  ? 16.190  3.702   -10.421 1.00 0.00 ? 32  ARG A HB2  3  
ATOM 3628  H HB3  . ARG A 1 32  ? 16.744  3.374   -12.058 1.00 0.00 ? 32  ARG A HB3  3  
ATOM 3629  H HG2  . ARG A 1 32  ? 17.552  5.790   -10.458 1.00 0.00 ? 32  ARG A HG2  3  
ATOM 3630  H HG3  . ARG A 1 32  ? 18.487  4.296   -10.548 1.00 0.00 ? 32  ARG A HG3  3  
ATOM 3631  H HD2  . ARG A 1 32  ? 18.557  4.576   -13.025 1.00 0.00 ? 32  ARG A HD2  3  
ATOM 3632  H HD3  . ARG A 1 32  ? 17.788  6.149   -12.819 1.00 0.00 ? 32  ARG A HD3  3  
ATOM 3633  H HE   . ARG A 1 32  ? 20.215  5.780   -11.301 1.00 0.00 ? 32  ARG A HE   3  
ATOM 3634  H HH11 . ARG A 1 32  ? 18.805  6.852   -14.298 1.00 0.00 ? 32  ARG A HH11 3  
ATOM 3635  H HH12 . ARG A 1 32  ? 20.137  7.881   -14.708 1.00 0.00 ? 32  ARG A HH12 3  
ATOM 3636  H HH21 . ARG A 1 32  ? 21.975  7.132   -11.829 1.00 0.00 ? 32  ARG A HH21 3  
ATOM 3637  H HH22 . ARG A 1 32  ? 21.940  8.039   -13.303 1.00 0.00 ? 32  ARG A HH22 3  
ATOM 3638  N N    . GLY A 1 33  ? 13.360  3.667   -11.887 1.00 0.00 ? 33  GLY A N    3  
ATOM 3639  C CA   . GLY A 1 33  ? 12.340  2.816   -12.472 1.00 0.00 ? 33  GLY A CA   3  
ATOM 3640  C C    . GLY A 1 33  ? 11.593  3.499   -13.601 1.00 0.00 ? 33  GLY A C    3  
ATOM 3641  O O    . GLY A 1 33  ? 12.110  4.426   -14.226 1.00 0.00 ? 33  GLY A O    3  
ATOM 3642  H H    . GLY A 1 33  ? 13.310  3.906   -10.938 1.00 0.00 ? 33  GLY A H    3  
ATOM 3643  H HA2  . GLY A 1 33  ? 12.808  1.922   -12.854 1.00 0.00 ? 33  GLY A HA2  3  
ATOM 3644  H HA3  . GLY A 1 33  ? 11.633  2.541   -11.704 1.00 0.00 ? 33  GLY A HA3  3  
ATOM 3645  N N    . HIS A 1 34  ? 10.374  3.040   -13.865 1.00 0.00 ? 34  HIS A N    3  
ATOM 3646  C CA   . HIS A 1 34  ? 9.555   3.612   -14.928 1.00 0.00 ? 34  HIS A CA   3  
ATOM 3647  C C    . HIS A 1 34  ? 8.863   4.887   -14.454 1.00 0.00 ? 34  HIS A C    3  
ATOM 3648  O O    . HIS A 1 34  ? 7.681   5.099   -14.722 1.00 0.00 ? 34  HIS A O    3  
ATOM 3649  C CB   . HIS A 1 34  ? 8.513   2.598   -15.400 1.00 0.00 ? 34  HIS A CB   3  
ATOM 3650  C CG   . HIS A 1 34  ? 9.059   1.577   -16.350 1.00 0.00 ? 34  HIS A CG   3  
ATOM 3651  N ND1  . HIS A 1 34  ? 8.321   1.038   -17.382 1.00 0.00 ? 34  HIS A ND1  3  
ATOM 3652  C CD2  . HIS A 1 34  ? 10.281  0.997   -16.421 1.00 0.00 ? 34  HIS A CD2  3  
ATOM 3653  C CE1  . HIS A 1 34  ? 9.063   0.169   -18.045 1.00 0.00 ? 34  HIS A CE1  3  
ATOM 3654  N NE2  . HIS A 1 34  ? 10.257  0.127   -17.483 1.00 0.00 ? 34  HIS A NE2  3  
ATOM 3655  H H    . HIS A 1 34  ? 10.017  2.299   -13.333 1.00 0.00 ? 34  HIS A H    3  
ATOM 3656  H HA   . HIS A 1 34  ? 10.206  3.857   -15.753 1.00 0.00 ? 34  HIS A HA   3  
ATOM 3657  H HB2  . HIS A 1 34  ? 8.116   2.074   -14.543 1.00 0.00 ? 34  HIS A HB2  3  
ATOM 3658  H HB3  . HIS A 1 34  ? 7.711   3.122   -15.900 1.00 0.00 ? 34  HIS A HB3  3  
ATOM 3659  H HD1  . HIS A 1 34  ? 7.390   1.257   -17.595 1.00 0.00 ? 34  HIS A HD1  3  
ATOM 3660  H HD2  . HIS A 1 34  ? 11.119  1.184   -15.764 1.00 0.00 ? 34  HIS A HD2  3  
ATOM 3661  H HE1  . HIS A 1 34  ? 8.748   -0.407  -18.902 1.00 0.00 ? 34  HIS A HE1  3  
ATOM 3662  H HE2  . HIS A 1 34  ? 10.973  -0.497  -17.724 1.00 0.00 ? 34  HIS A HE2  3  
ATOM 3663  N N    . ALA A 1 35  ? 9.607   5.731   -13.746 1.00 0.00 ? 35  ALA A N    3  
ATOM 3664  C CA   . ALA A 1 35  ? 9.066   6.984   -13.236 1.00 0.00 ? 35  ALA A CA   3  
ATOM 3665  C C    . ALA A 1 35  ? 7.613   6.818   -12.803 1.00 0.00 ? 35  ALA A C    3  
ATOM 3666  O O    . ALA A 1 35  ? 6.824   7.759   -12.870 1.00 0.00 ? 35  ALA A O    3  
ATOM 3667  C CB   . ALA A 1 35  ? 9.183   8.077   -14.288 1.00 0.00 ? 35  ALA A CB   3  
ATOM 3668  H H    . ALA A 1 35  ? 10.543  5.505   -13.565 1.00 0.00 ? 35  ALA A H    3  
ATOM 3669  H HA   . ALA A 1 35  ? 9.655   7.278   -12.379 1.00 0.00 ? 35  ALA A HA   3  
ATOM 3670  H HB1  . ALA A 1 35  ? 9.803   7.728   -15.101 1.00 0.00 ? 35  ALA A HB1  3  
ATOM 3671  H HB2  . ALA A 1 35  ? 8.201   8.321   -14.664 1.00 0.00 ? 35  ALA A HB2  3  
ATOM 3672  H HB3  . ALA A 1 35  ? 9.629   8.955   -13.846 1.00 0.00 ? 35  ALA A HB3  3  
ATOM 3673  N N    . GLY A 1 36  ? 7.267   5.614   -12.358 1.00 0.00 ? 36  GLY A N    3  
ATOM 3674  C CA   . GLY A 1 36  ? 5.909   5.347   -11.921 1.00 0.00 ? 36  GLY A CA   3  
ATOM 3675  C C    . GLY A 1 36  ? 4.875   6.042   -12.784 1.00 0.00 ? 36  GLY A C    3  
ATOM 3676  O O    . GLY A 1 36  ? 3.883   6.564   -12.276 1.00 0.00 ? 36  GLY A O    3  
ATOM 3677  H H    . GLY A 1 36  ? 7.938   4.901   -12.327 1.00 0.00 ? 36  GLY A H    3  
ATOM 3678  H HA2  . GLY A 1 36  ? 5.734   4.282   -11.956 1.00 0.00 ? 36  GLY A HA2  3  
ATOM 3679  H HA3  . GLY A 1 36  ? 5.797   5.687   -10.902 1.00 0.00 ? 36  GLY A HA3  3  
ATOM 3680  N N    . ASN A 1 37  ? 5.107   6.051   -14.092 1.00 0.00 ? 37  ASN A N    3  
ATOM 3681  C CA   . ASN A 1 37  ? 4.189   6.690   -15.028 1.00 0.00 ? 37  ASN A CA   3  
ATOM 3682  C C    . ASN A 1 37  ? 4.592   6.400   -16.470 1.00 0.00 ? 37  ASN A C    3  
ATOM 3683  O O    . ASN A 1 37  ? 5.650   6.818   -16.942 1.00 0.00 ? 37  ASN A O    3  
ATOM 3684  C CB   . ASN A 1 37  ? 4.156   8.202   -14.790 1.00 0.00 ? 37  ASN A CB   3  
ATOM 3685  C CG   . ASN A 1 37  ? 2.880   8.840   -15.304 1.00 0.00 ? 37  ASN A CG   3  
ATOM 3686  O OD1  . ASN A 1 37  ? 2.238   8.322   -16.218 1.00 0.00 ? 37  ASN A OD1  3  
ATOM 3687  N ND2  . ASN A 1 37  ? 2.505   9.970   -14.716 1.00 0.00 ? 37  ASN A ND2  3  
ATOM 3688  H H    . ASN A 1 37  ? 5.916   5.619   -14.438 1.00 0.00 ? 37  ASN A H    3  
ATOM 3689  H HA   . ASN A 1 37  ? 3.203   6.286   -14.853 1.00 0.00 ? 37  ASN A HA   3  
ATOM 3690  H HB2  . ASN A 1 37  ? 4.230   8.395   -13.730 1.00 0.00 ? 37  ASN A HB2  3  
ATOM 3691  H HB3  . ASN A 1 37  ? 4.994   8.658   -15.295 1.00 0.00 ? 37  ASN A HB3  3  
ATOM 3692  H HD21 . ASN A 1 37  ? 3.066   10.325  -13.994 1.00 0.00 ? 37  ASN A HD21 3  
ATOM 3693  H HD22 . ASN A 1 37  ? 1.684   10.404  -15.028 1.00 0.00 ? 37  ASN A HD22 3  
ATOM 3694  N N    . PRO A 1 38  ? 3.729   5.667   -17.189 1.00 0.00 ? 38  PRO A N    3  
ATOM 3695  C CA   . PRO A 1 38  ? 3.972   5.305   -18.589 1.00 0.00 ? 38  PRO A CA   3  
ATOM 3696  C C    . PRO A 1 38  ? 3.881   6.507   -19.523 1.00 0.00 ? 38  PRO A C    3  
ATOM 3697  O O    . PRO A 1 38  ? 4.212   6.413   -20.705 1.00 0.00 ? 38  PRO A O    3  
ATOM 3698  C CB   . PRO A 1 38  ? 2.856   4.304   -18.896 1.00 0.00 ? 38  PRO A CB   3  
ATOM 3699  C CG   . PRO A 1 38  ? 1.766   4.646   -17.939 1.00 0.00 ? 38  PRO A CG   3  
ATOM 3700  C CD   . PRO A 1 38  ? 2.449   5.136   -16.692 1.00 0.00 ? 38  PRO A CD   3  
ATOM 3701  H HA   . PRO A 1 38  ? 4.932   4.826   -18.713 1.00 0.00 ? 38  PRO A HA   3  
ATOM 3702  H HB2  . PRO A 1 38  ? 2.534   4.422   -19.921 1.00 0.00 ? 38  PRO A HB2  3  
ATOM 3703  H HB3  . PRO A 1 38  ? 3.216   3.298   -18.739 1.00 0.00 ? 38  PRO A HB3  3  
ATOM 3704  H HG2  . PRO A 1 38  ? 1.143   5.424   -18.355 1.00 0.00 ? 38  PRO A HG2  3  
ATOM 3705  H HG3  . PRO A 1 38  ? 1.178   3.767   -17.724 1.00 0.00 ? 38  PRO A HG3  3  
ATOM 3706  H HD2  . PRO A 1 38  ? 1.865   5.913   -16.222 1.00 0.00 ? 38  PRO A HD2  3  
ATOM 3707  H HD3  . PRO A 1 38  ? 2.613   4.317   -16.006 1.00 0.00 ? 38  PRO A HD3  3  
ATOM 3708  N N    . ARG A 1 39  ? 3.431   7.636   -18.985 1.00 0.00 ? 39  ARG A N    3  
ATOM 3709  C CA   . ARG A 1 39  ? 3.296   8.856   -19.771 1.00 0.00 ? 39  ARG A CA   3  
ATOM 3710  C C    . ARG A 1 39  ? 4.596   9.655   -19.762 1.00 0.00 ? 39  ARG A C    3  
ATOM 3711  O O    . ARG A 1 39  ? 5.165   9.944   -20.815 1.00 0.00 ? 39  ARG A O    3  
ATOM 3712  C CB   . ARG A 1 39  ? 2.153   9.715   -19.226 1.00 0.00 ? 39  ARG A CB   3  
ATOM 3713  C CG   . ARG A 1 39  ? 1.964   11.023  -19.976 1.00 0.00 ? 39  ARG A CG   3  
ATOM 3714  C CD   . ARG A 1 39  ? 1.378   10.792  -21.361 1.00 0.00 ? 39  ARG A CD   3  
ATOM 3715  N NE   . ARG A 1 39  ? 0.764   12.001  -21.904 1.00 0.00 ? 39  ARG A NE   3  
ATOM 3716  C CZ   . ARG A 1 39  ? -0.151  11.991  -22.867 1.00 0.00 ? 39  ARG A CZ   3  
ATOM 3717  N NH1  . ARG A 1 39  ? -0.556  10.842  -23.389 1.00 0.00 ? 39  ARG A NH1  3  
ATOM 3718  N NH2  . ARG A 1 39  ? -0.663  13.133  -23.308 1.00 0.00 ? 39  ARG A NH2  3  
ATOM 3719  H H    . ARG A 1 39  ? 3.182   7.648   -18.037 1.00 0.00 ? 39  ARG A H    3  
ATOM 3720  H HA   . ARG A 1 39  ? 3.068   8.573   -20.788 1.00 0.00 ? 39  ARG A HA   3  
ATOM 3721  H HB2  . ARG A 1 39  ? 1.233   9.153   -19.291 1.00 0.00 ? 39  ARG A HB2  3  
ATOM 3722  H HB3  . ARG A 1 39  ? 2.354   9.945   -18.191 1.00 0.00 ? 39  ARG A HB3  3  
ATOM 3723  H HG2  . ARG A 1 39  ? 1.292   11.656  -19.415 1.00 0.00 ? 39  ARG A HG2  3  
ATOM 3724  H HG3  . ARG A 1 39  ? 2.922   11.512  -20.077 1.00 0.00 ? 39  ARG A HG3  3  
ATOM 3725  H HD2  . ARG A 1 39  ? 2.169   10.474  -22.023 1.00 0.00 ? 39  ARG A HD2  3  
ATOM 3726  H HD3  . ARG A 1 39  ? 0.630   10.017  -21.295 1.00 0.00 ? 39  ARG A HD3  3  
ATOM 3727  H HE   . ARG A 1 39  ? 1.049   12.861  -21.532 1.00 0.00 ? 39  ARG A HE   3  
ATOM 3728  H HH11 . ARG A 1 39  ? -0.173  9.980   -23.058 1.00 0.00 ? 39  ARG A HH11 3  
ATOM 3729  H HH12 . ARG A 1 39  ? -1.246  10.838  -24.113 1.00 0.00 ? 39  ARG A HH12 3  
ATOM 3730  H HH21 . ARG A 1 39  ? -0.360  14.001  -22.916 1.00 0.00 ? 39  ARG A HH21 3  
ATOM 3731  H HH22 . ARG A 1 39  ? -1.352  13.125  -24.033 1.00 0.00 ? 39  ARG A HH22 3  
ATOM 3732  N N    . ASP A 1 40  ? 5.059   10.009  -18.568 1.00 0.00 ? 40  ASP A N    3  
ATOM 3733  C CA   . ASP A 1 40  ? 6.291   10.774  -18.422 1.00 0.00 ? 40  ASP A CA   3  
ATOM 3734  C C    . ASP A 1 40  ? 7.301   10.019  -17.563 1.00 0.00 ? 40  ASP A C    3  
ATOM 3735  O O    . ASP A 1 40  ? 7.189   9.959   -16.339 1.00 0.00 ? 40  ASP A O    3  
ATOM 3736  C CB   . ASP A 1 40  ? 5.998   12.141  -17.803 1.00 0.00 ? 40  ASP A CB   3  
ATOM 3737  C CG   . ASP A 1 40  ? 5.589   13.170  -18.839 1.00 0.00 ? 40  ASP A CG   3  
ATOM 3738  O OD1  . ASP A 1 40  ? 6.429   13.516  -19.696 1.00 0.00 ? 40  ASP A OD1  3  
ATOM 3739  O OD2  . ASP A 1 40  ? 4.429   13.629  -18.792 1.00 0.00 ? 40  ASP A OD2  3  
ATOM 3740  H H    . ASP A 1 40  ? 4.559   9.748   -17.766 1.00 0.00 ? 40  ASP A H    3  
ATOM 3741  H HA   . ASP A 1 40  ? 6.711   10.917  -19.406 1.00 0.00 ? 40  ASP A HA   3  
ATOM 3742  H HB2  . ASP A 1 40  ? 5.195   12.040  -17.087 1.00 0.00 ? 40  ASP A HB2  3  
ATOM 3743  H HB3  . ASP A 1 40  ? 6.883   12.497  -17.297 1.00 0.00 ? 40  ASP A HB3  3  
ATOM 3744  N N    . PRO A 1 41  ? 8.310   9.426   -18.219 1.00 0.00 ? 41  PRO A N    3  
ATOM 3745  C CA   . PRO A 1 41  ? 9.359   8.664   -17.535 1.00 0.00 ? 41  PRO A CA   3  
ATOM 3746  C C    . PRO A 1 41  ? 10.285  9.557   -16.716 1.00 0.00 ? 41  PRO A C    3  
ATOM 3747  O O    . PRO A 1 41  ? 11.242  9.082   -16.104 1.00 0.00 ? 41  PRO A O    3  
ATOM 3748  C CB   . PRO A 1 41  ? 10.128  8.008   -18.685 1.00 0.00 ? 41  PRO A CB   3  
ATOM 3749  C CG   . PRO A 1 41  ? 9.891   8.898   -19.855 1.00 0.00 ? 41  PRO A CG   3  
ATOM 3750  C CD   . PRO A 1 41  ? 8.506   9.456   -19.678 1.00 0.00 ? 41  PRO A CD   3  
ATOM 3751  H HA   . PRO A 1 41  ? 8.941   7.899   -16.897 1.00 0.00 ? 41  PRO A HA   3  
ATOM 3752  H HB2  . PRO A 1 41  ? 11.178  7.954   -18.434 1.00 0.00 ? 41  PRO A HB2  3  
ATOM 3753  H HB3  . PRO A 1 41  ? 9.742   7.015   -18.860 1.00 0.00 ? 41  PRO A HB3  3  
ATOM 3754  H HG2  . PRO A 1 41  ? 10.618  9.696   -19.863 1.00 0.00 ? 41  PRO A HG2  3  
ATOM 3755  H HG3  . PRO A 1 41  ? 9.950   8.326   -20.769 1.00 0.00 ? 41  PRO A HG3  3  
ATOM 3756  H HD2  . PRO A 1 41  ? 8.455   10.468  -20.053 1.00 0.00 ? 41  PRO A HD2  3  
ATOM 3757  H HD3  . PRO A 1 41  ? 7.780   8.830   -20.176 1.00 0.00 ? 41  PRO A HD3  3  
ATOM 3758  N N    . THR A 1 42  ? 9.994   10.854  -16.708 1.00 0.00 ? 42  THR A N    3  
ATOM 3759  C CA   . THR A 1 42  ? 10.801  11.814  -15.965 1.00 0.00 ? 42  THR A CA   3  
ATOM 3760  C C    . THR A 1 42  ? 10.293  11.969  -14.536 1.00 0.00 ? 42  THR A C    3  
ATOM 3761  O O    . THR A 1 42  ? 11.065  12.256  -13.621 1.00 0.00 ? 42  THR A O    3  
ATOM 3762  C CB   . THR A 1 42  ? 10.804  13.194  -16.650 1.00 0.00 ? 42  THR A CB   3  
ATOM 3763  O OG1  . THR A 1 42  ? 9.480   13.738  -16.662 1.00 0.00 ? 42  THR A OG1  3  
ATOM 3764  C CG2  . THR A 1 42  ? 11.329  13.090  -18.074 1.00 0.00 ? 42  THR A CG2  3  
ATOM 3765  H H    . THR A 1 42  ? 9.218   11.172  -17.216 1.00 0.00 ? 42  THR A H    3  
ATOM 3766  H HA   . THR A 1 42  ? 11.816  11.446  -15.938 1.00 0.00 ? 42  THR A HA   3  
ATOM 3767  H HB   . THR A 1 42  ? 11.452  13.854  -16.091 1.00 0.00 ? 42  THR A HB   3  
ATOM 3768  H HG1  . THR A 1 42  ? 9.416   14.440  -16.010 1.00 0.00 ? 42  THR A HG1  3  
ATOM 3769  H HG21 . THR A 1 42  ? 11.142  12.097  -18.455 1.00 0.00 ? 42  THR A HG21 3  
ATOM 3770  H HG22 . THR A 1 42  ? 12.391  13.285  -18.081 1.00 0.00 ? 42  THR A HG22 3  
ATOM 3771  H HG23 . THR A 1 42  ? 10.825  13.814  -18.696 1.00 0.00 ? 42  THR A HG23 3  
ATOM 3772  N N    . ASP A 1 43  ? 8.991   11.778  -14.352 1.00 0.00 ? 43  ASP A N    3  
ATOM 3773  C CA   . ASP A 1 43  ? 8.381   11.896  -13.033 1.00 0.00 ? 43  ASP A CA   3  
ATOM 3774  C C    . ASP A 1 43  ? 8.828   10.756  -12.123 1.00 0.00 ? 43  ASP A C    3  
ATOM 3775  O O    . ASP A 1 43  ? 8.315   9.641   -12.212 1.00 0.00 ? 43  ASP A O    3  
ATOM 3776  C CB   . ASP A 1 43  ? 6.856   11.901  -13.152 1.00 0.00 ? 43  ASP A CB   3  
ATOM 3777  C CG   . ASP A 1 43  ? 6.172   12.154  -11.823 1.00 0.00 ? 43  ASP A CG   3  
ATOM 3778  O OD1  . ASP A 1 43  ? 6.311   13.275  -11.288 1.00 0.00 ? 43  ASP A OD1  3  
ATOM 3779  O OD2  . ASP A 1 43  ? 5.498   11.233  -11.318 1.00 0.00 ? 43  ASP A OD2  3  
ATOM 3780  H H    . ASP A 1 43  ? 8.428   11.552  -15.122 1.00 0.00 ? 43  ASP A H    3  
ATOM 3781  H HA   . ASP A 1 43  ? 8.702   12.831  -12.601 1.00 0.00 ? 43  ASP A HA   3  
ATOM 3782  H HB2  . ASP A 1 43  ? 6.558   12.676  -13.843 1.00 0.00 ? 43  ASP A HB2  3  
ATOM 3783  H HB3  . ASP A 1 43  ? 6.527   10.943  -13.529 1.00 0.00 ? 43  ASP A HB3  3  
ATOM 3784  N N    . GLU A 1 44  ? 9.789   11.044  -11.251 1.00 0.00 ? 44  GLU A N    3  
ATOM 3785  C CA   . GLU A 1 44  ? 10.307  10.042  -10.327 1.00 0.00 ? 44  GLU A CA   3  
ATOM 3786  C C    . GLU A 1 44  ? 9.382   9.883   -9.123  1.00 0.00 ? 44  GLU A C    3  
ATOM 3787  O O    . GLU A 1 44  ? 9.756   9.285   -8.114  1.00 0.00 ? 44  GLU A O    3  
ATOM 3788  C CB   . GLU A 1 44  ? 11.712  10.426  -9.858  1.00 0.00 ? 44  GLU A CB   3  
ATOM 3789  C CG   . GLU A 1 44  ? 12.707  10.594  -10.993 1.00 0.00 ? 44  GLU A CG   3  
ATOM 3790  C CD   . GLU A 1 44  ? 12.690  11.992  -11.581 1.00 0.00 ? 44  GLU A CD   3  
ATOM 3791  O OE1  . GLU A 1 44  ? 11.897  12.829  -11.101 1.00 0.00 ? 44  GLU A OE1  3  
ATOM 3792  O OE2  . GLU A 1 44  ? 13.470  12.249  -12.522 1.00 0.00 ? 44  GLU A OE2  3  
ATOM 3793  H H    . GLU A 1 44  ? 10.158  11.951  -11.228 1.00 0.00 ? 44  GLU A H    3  
ATOM 3794  H HA   . GLU A 1 44  ? 10.357  9.101   -10.853 1.00 0.00 ? 44  GLU A HA   3  
ATOM 3795  H HB2  . GLU A 1 44  ? 11.655  11.357  -9.314  1.00 0.00 ? 44  GLU A HB2  3  
ATOM 3796  H HB3  . GLU A 1 44  ? 12.080  9.655   -9.196  1.00 0.00 ? 44  GLU A HB3  3  
ATOM 3797  H HG2  . GLU A 1 44  ? 13.699  10.391  -10.619 1.00 0.00 ? 44  GLU A HG2  3  
ATOM 3798  H HG3  . GLU A 1 44  ? 12.466  9.888   -11.774 1.00 0.00 ? 44  GLU A HG3  3  
ATOM 3799  N N    . GLY A 1 45  ? 8.173   10.424  -9.237  1.00 0.00 ? 45  GLY A N    3  
ATOM 3800  C CA   . GLY A 1 45  ? 7.214   10.332  -8.151  1.00 0.00 ? 45  GLY A CA   3  
ATOM 3801  C C    . GLY A 1 45  ? 6.876   8.898   -7.796  1.00 0.00 ? 45  GLY A C    3  
ATOM 3802  O O    . GLY A 1 45  ? 6.917   8.014   -8.652  1.00 0.00 ? 45  GLY A O    3  
ATOM 3803  H H    . GLY A 1 45  ? 7.930   10.889  -10.065 1.00 0.00 ? 45  GLY A H    3  
ATOM 3804  H HA2  . GLY A 1 45  ? 7.625   10.821  -7.281  1.00 0.00 ? 45  GLY A HA2  3  
ATOM 3805  H HA3  . GLY A 1 45  ? 6.308   10.842  -8.443  1.00 0.00 ? 45  GLY A HA3  3  
ATOM 3806  N N    . ILE A 1 46  ? 6.541   8.667   -6.531  1.00 0.00 ? 46  ILE A N    3  
ATOM 3807  C CA   . ILE A 1 46  ? 6.195   7.330   -6.065  1.00 0.00 ? 46  ILE A CA   3  
ATOM 3808  C C    . ILE A 1 46  ? 4.826   7.319   -5.393  1.00 0.00 ? 46  ILE A C    3  
ATOM 3809  O O    . ILE A 1 46  ? 4.618   7.978   -4.374  1.00 0.00 ? 46  ILE A O    3  
ATOM 3810  C CB   . ILE A 1 46  ? 7.245   6.789   -5.076  1.00 0.00 ? 46  ILE A CB   3  
ATOM 3811  C CG1  . ILE A 1 46  ? 8.621   6.726   -5.742  1.00 0.00 ? 46  ILE A CG1  3  
ATOM 3812  C CG2  . ILE A 1 46  ? 6.834   5.416   -4.567  1.00 0.00 ? 46  ILE A CG2  3  
ATOM 3813  C CD1  . ILE A 1 46  ? 9.770   6.750   -4.759  1.00 0.00 ? 46  ILE A CD1  3  
ATOM 3814  H H    . ILE A 1 46  ? 6.527   9.413   -5.896  1.00 0.00 ? 46  ILE A H    3  
ATOM 3815  H HA   . ILE A 1 46  ? 6.168   6.675   -6.924  1.00 0.00 ? 46  ILE A HA   3  
ATOM 3816  H HB   . ILE A 1 46  ? 7.291   7.460   -4.233  1.00 0.00 ? 46  ILE A HB   3  
ATOM 3817  H HG12 . ILE A 1 46  ? 8.695   5.816   -6.316  1.00 0.00 ? 46  ILE A HG12 3  
ATOM 3818  H HG13 . ILE A 1 46  ? 8.731   7.574   -6.403  1.00 0.00 ? 46  ILE A HG13 3  
ATOM 3819  H HG21 . ILE A 1 46  ? 6.829   5.419   -3.487  1.00 0.00 ? 46  ILE A HG21 3  
ATOM 3820  H HG22 . ILE A 1 46  ? 5.845   5.179   -4.929  1.00 0.00 ? 46  ILE A HG22 3  
ATOM 3821  H HG23 . ILE A 1 46  ? 7.534   4.675   -4.921  1.00 0.00 ? 46  ILE A HG23 3  
ATOM 3822  H HD11 . ILE A 1 46  ? 10.654  6.345   -5.228  1.00 0.00 ? 46  ILE A HD11 3  
ATOM 3823  H HD12 . ILE A 1 46  ? 9.959   7.766   -4.449  1.00 0.00 ? 46  ILE A HD12 3  
ATOM 3824  H HD13 . ILE A 1 46  ? 9.516   6.152   -3.895  1.00 0.00 ? 46  ILE A HD13 3  
ATOM 3825  N N    . PHE A 1 47  ? 3.896   6.566   -5.970  1.00 0.00 ? 47  PHE A N    3  
ATOM 3826  C CA   . PHE A 1 47  ? 2.546   6.468   -5.426  1.00 0.00 ? 47  PHE A CA   3  
ATOM 3827  C C    . PHE A 1 47  ? 2.129   5.009   -5.267  1.00 0.00 ? 47  PHE A C    3  
ATOM 3828  O O    . PHE A 1 47  ? 2.658   4.124   -5.939  1.00 0.00 ? 47  PHE A O    3  
ATOM 3829  C CB   . PHE A 1 47  ? 1.554   7.198   -6.334  1.00 0.00 ? 47  PHE A CB   3  
ATOM 3830  C CG   . PHE A 1 47  ? 1.954   8.612   -6.645  1.00 0.00 ? 47  PHE A CG   3  
ATOM 3831  C CD1  . PHE A 1 47  ? 3.131   8.879   -7.324  1.00 0.00 ? 47  PHE A CD1  3  
ATOM 3832  C CD2  . PHE A 1 47  ? 1.153   9.674   -6.256  1.00 0.00 ? 47  PHE A CD2  3  
ATOM 3833  C CE1  . PHE A 1 47  ? 3.502   10.180  -7.612  1.00 0.00 ? 47  PHE A CE1  3  
ATOM 3834  C CE2  . PHE A 1 47  ? 1.518   10.976  -6.542  1.00 0.00 ? 47  PHE A CE2  3  
ATOM 3835  C CZ   . PHE A 1 47  ? 2.695   11.229  -7.219  1.00 0.00 ? 47  PHE A CZ   3  
ATOM 3836  H H    . PHE A 1 47  ? 4.123   6.064   -6.781  1.00 0.00 ? 47  PHE A H    3  
ATOM 3837  H HA   . PHE A 1 47  ? 2.546   6.938   -4.455  1.00 0.00 ? 47  PHE A HA   3  
ATOM 3838  H HB2  . PHE A 1 47  ? 1.472   6.664   -7.269  1.00 0.00 ? 47  PHE A HB2  3  
ATOM 3839  H HB3  . PHE A 1 47  ? 0.588   7.223   -5.852  1.00 0.00 ? 47  PHE A HB3  3  
ATOM 3840  H HD1  . PHE A 1 47  ? 3.764   8.059   -7.632  1.00 0.00 ? 47  PHE A HD1  3  
ATOM 3841  H HD2  . PHE A 1 47  ? 0.233   9.477   -5.725  1.00 0.00 ? 47  PHE A HD2  3  
ATOM 3842  H HE1  . PHE A 1 47  ? 4.423   10.374  -8.142  1.00 0.00 ? 47  PHE A HE1  3  
ATOM 3843  H HE2  . PHE A 1 47  ? 0.886   11.794  -6.233  1.00 0.00 ? 47  PHE A HE2  3  
ATOM 3844  H HZ   . PHE A 1 47  ? 2.982   12.245  -7.444  1.00 0.00 ? 47  PHE A HZ   3  
ATOM 3845  N N    . ILE A 1 48  ? 1.177   4.767   -4.372  1.00 0.00 ? 48  ILE A N    3  
ATOM 3846  C CA   . ILE A 1 48  ? 0.688   3.417   -4.124  1.00 0.00 ? 48  ILE A CA   3  
ATOM 3847  C C    . ILE A 1 48  ? 0.005   2.843   -5.361  1.00 0.00 ? 48  ILE A C    3  
ATOM 3848  O O    . ILE A 1 48  ? -0.854  3.488   -5.963  1.00 0.00 ? 48  ILE A O    3  
ATOM 3849  C CB   . ILE A 1 48  ? -0.301  3.384   -2.944  1.00 0.00 ? 48  ILE A CB   3  
ATOM 3850  C CG1  . ILE A 1 48  ? 0.387   3.852   -1.660  1.00 0.00 ? 48  ILE A CG1  3  
ATOM 3851  C CG2  . ILE A 1 48  ? -0.869  1.983   -2.767  1.00 0.00 ? 48  ILE A CG2  3  
ATOM 3852  C CD1  . ILE A 1 48  ? -0.580  4.262   -0.571  1.00 0.00 ? 48  ILE A CD1  3  
ATOM 3853  H H    . ILE A 1 48  ? 0.794   5.514   -3.867  1.00 0.00 ? 48  ILE A H    3  
ATOM 3854  H HA   . ILE A 1 48  ? 1.536   2.796   -3.874  1.00 0.00 ? 48  ILE A HA   3  
ATOM 3855  H HB   . ILE A 1 48  ? -1.119  4.051   -3.169  1.00 0.00 ? 48  ILE A HB   3  
ATOM 3856  H HG12 . ILE A 1 48  ? 0.999   3.051   -1.275  1.00 0.00 ? 48  ILE A HG12 3  
ATOM 3857  H HG13 . ILE A 1 48  ? 1.014   4.702   -1.886  1.00 0.00 ? 48  ILE A HG13 3  
ATOM 3858  H HG21 . ILE A 1 48  ? -0.120  1.345   -2.322  1.00 0.00 ? 48  ILE A HG21 3  
ATOM 3859  H HG22 . ILE A 1 48  ? -1.734  2.025   -2.122  1.00 0.00 ? 48  ILE A HG22 3  
ATOM 3860  H HG23 . ILE A 1 48  ? -1.155  1.586   -3.729  1.00 0.00 ? 48  ILE A HG23 3  
ATOM 3861  H HD11 . ILE A 1 48  ? -1.552  3.839   -0.774  1.00 0.00 ? 48  ILE A HD11 3  
ATOM 3862  H HD12 . ILE A 1 48  ? -0.222  3.904   0.382   1.00 0.00 ? 48  ILE A HD12 3  
ATOM 3863  H HD13 . ILE A 1 48  ? -0.656  5.340   -0.545  1.00 0.00 ? 48  ILE A HD13 3  
ATOM 3864  N N    . SER A 1 49  ? 0.391   1.627   -5.734  1.00 0.00 ? 49  SER A N    3  
ATOM 3865  C CA   . SER A 1 49  ? -0.182  0.967   -6.901  1.00 0.00 ? 49  SER A CA   3  
ATOM 3866  C C    . SER A 1 49  ? -1.059  -0.210  -6.483  1.00 0.00 ? 49  SER A C    3  
ATOM 3867  O O    . SER A 1 49  ? -1.839  -0.731  -7.279  1.00 0.00 ? 49  SER A O    3  
ATOM 3868  C CB   . SER A 1 49  ? 0.927   0.484   -7.836  1.00 0.00 ? 49  SER A CB   3  
ATOM 3869  O OG   . SER A 1 49  ? 0.389   -0.198  -8.956  1.00 0.00 ? 49  SER A OG   3  
ATOM 3870  H H    . SER A 1 49  ? 1.080   1.165   -5.213  1.00 0.00 ? 49  SER A H    3  
ATOM 3871  H HA   . SER A 1 49  ? -0.793  1.689   -7.423  1.00 0.00 ? 49  SER A HA   3  
ATOM 3872  H HB2  . SER A 1 49  ? 1.494   1.333   -8.186  1.00 0.00 ? 49  SER A HB2  3  
ATOM 3873  H HB3  . SER A 1 49  ? 1.580   -0.188  -7.299  1.00 0.00 ? 49  SER A HB3  3  
ATOM 3874  H HG   . SER A 1 49  ? 0.181   -1.102  -8.710  1.00 0.00 ? 49  SER A HG   3  
ATOM 3875  N N    . LYS A 1 50  ? -0.924  -0.623  -5.227  1.00 0.00 ? 50  LYS A N    3  
ATOM 3876  C CA   . LYS A 1 50  ? -1.703  -1.737  -4.700  1.00 0.00 ? 50  LYS A CA   3  
ATOM 3877  C C    . LYS A 1 50  ? -1.600  -1.802  -3.180  1.00 0.00 ? 50  LYS A C    3  
ATOM 3878  O O    . LYS A 1 50  ? -0.687  -1.231  -2.585  1.00 0.00 ? 50  LYS A O    3  
ATOM 3879  C CB   . LYS A 1 50  ? -1.223  -3.056  -5.311  1.00 0.00 ? 50  LYS A CB   3  
ATOM 3880  C CG   . LYS A 1 50  ? -1.394  -4.251  -4.390  1.00 0.00 ? 50  LYS A CG   3  
ATOM 3881  C CD   . LYS A 1 50  ? -0.848  -5.522  -5.018  1.00 0.00 ? 50  LYS A CD   3  
ATOM 3882  C CE   . LYS A 1 50  ? -1.603  -6.751  -4.535  1.00 0.00 ? 50  LYS A CE   3  
ATOM 3883  N NZ   . LYS A 1 50  ? -1.191  -7.151  -3.161  1.00 0.00 ? 50  LYS A NZ   3  
ATOM 3884  H H    . LYS A 1 50  ? -0.285  -0.167  -4.640  1.00 0.00 ? 50  LYS A H    3  
ATOM 3885  H HA   . LYS A 1 50  ? -2.735  -1.579  -4.973  1.00 0.00 ? 50  LYS A HA   3  
ATOM 3886  H HB2  . LYS A 1 50  ? -1.781  -3.243  -6.217  1.00 0.00 ? 50  LYS A HB2  3  
ATOM 3887  H HB3  . LYS A 1 50  ? -0.175  -2.964  -5.557  1.00 0.00 ? 50  LYS A HB3  3  
ATOM 3888  H HG2  . LYS A 1 50  ? -0.865  -4.062  -3.468  1.00 0.00 ? 50  LYS A HG2  3  
ATOM 3889  H HG3  . LYS A 1 50  ? -2.446  -4.386  -4.182  1.00 0.00 ? 50  LYS A HG3  3  
ATOM 3890  H HD2  . LYS A 1 50  ? -0.945  -5.454  -6.091  1.00 0.00 ? 50  LYS A HD2  3  
ATOM 3891  H HD3  . LYS A 1 50  ? 0.195   -5.624  -4.755  1.00 0.00 ? 50  LYS A HD3  3  
ATOM 3892  H HE2  . LYS A 1 50  ? -2.660  -6.532  -4.535  1.00 0.00 ? 50  LYS A HE2  3  
ATOM 3893  H HE3  . LYS A 1 50  ? -1.405  -7.568  -5.213  1.00 0.00 ? 50  LYS A HE3  3  
ATOM 3894  H HZ1  . LYS A 1 50  ? -0.384  -6.574  -2.849  1.00 0.00 ? 50  LYS A HZ1  3  
ATOM 3895  H HZ2  . LYS A 1 50  ? -0.912  -8.152  -3.148  1.00 0.00 ? 50  LYS A HZ2  3  
ATOM 3896  H HZ3  . LYS A 1 50  ? -1.979  -7.013  -2.497  1.00 0.00 ? 50  LYS A HZ3  3  
ATOM 3897  N N    . VAL A 1 51  ? -2.542  -2.503  -2.557  1.00 0.00 ? 51  VAL A N    3  
ATOM 3898  C CA   . VAL A 1 51  ? -2.556  -2.645  -1.106  1.00 0.00 ? 51  VAL A CA   3  
ATOM 3899  C C    . VAL A 1 51  ? -3.240  -3.941  -0.687  1.00 0.00 ? 51  VAL A C    3  
ATOM 3900  O O    . VAL A 1 51  ? -4.351  -4.239  -1.125  1.00 0.00 ? 51  VAL A O    3  
ATOM 3901  C CB   . VAL A 1 51  ? -3.272  -1.459  -0.433  1.00 0.00 ? 51  VAL A CB   3  
ATOM 3902  C CG1  . VAL A 1 51  ? -3.334  -1.658  1.074   1.00 0.00 ? 51  VAL A CG1  3  
ATOM 3903  C CG2  . VAL A 1 51  ? -2.575  -0.151  -0.778  1.00 0.00 ? 51  VAL A CG2  3  
ATOM 3904  H H    . VAL A 1 51  ? -3.244  -2.936  -3.086  1.00 0.00 ? 51  VAL A H    3  
ATOM 3905  H HA   . VAL A 1 51  ? -1.532  -2.662  -0.762  1.00 0.00 ? 51  VAL A HA   3  
ATOM 3906  H HB   . VAL A 1 51  ? -4.283  -1.414  -0.810  1.00 0.00 ? 51  VAL A HB   3  
ATOM 3907  H HG11 . VAL A 1 51  ? -2.821  -0.845  1.566   1.00 0.00 ? 51  VAL A HG11 3  
ATOM 3908  H HG12 . VAL A 1 51  ? -4.366  -1.679  1.392   1.00 0.00 ? 51  VAL A HG12 3  
ATOM 3909  H HG13 . VAL A 1 51  ? -2.857  -2.592  1.333   1.00 0.00 ? 51  VAL A HG13 3  
ATOM 3910  H HG21 . VAL A 1 51  ? -3.077  0.665   -0.280  1.00 0.00 ? 51  VAL A HG21 3  
ATOM 3911  H HG22 . VAL A 1 51  ? -1.546  -0.194  -0.451  1.00 0.00 ? 51  VAL A HG22 3  
ATOM 3912  H HG23 . VAL A 1 51  ? -2.607  0.003   -1.846  1.00 0.00 ? 51  VAL A HG23 3  
ATOM 3913  N N    . SER A 1 52  ? -2.568  -4.710  0.165   1.00 0.00 ? 52  SER A N    3  
ATOM 3914  C CA   . SER A 1 52  ? -3.109  -5.977  0.642   1.00 0.00 ? 52  SER A CA   3  
ATOM 3915  C C    . SER A 1 52  ? -4.250  -5.744  1.628   1.00 0.00 ? 52  SER A C    3  
ATOM 3916  O O    . SER A 1 52  ? -4.183  -4.877  2.499   1.00 0.00 ? 52  SER A O    3  
ATOM 3917  C CB   . SER A 1 52  ? -2.009  -6.809  1.303   1.00 0.00 ? 52  SER A CB   3  
ATOM 3918  O OG   . SER A 1 52  ? -2.416  -8.157  1.463   1.00 0.00 ? 52  SER A OG   3  
ATOM 3919  H H    . SER A 1 52  ? -1.686  -4.418  0.478   1.00 0.00 ? 52  SER A H    3  
ATOM 3920  H HA   . SER A 1 52  ? -3.492  -6.516  -0.212  1.00 0.00 ? 52  SER A HA   3  
ATOM 3921  H HB2  . SER A 1 52  ? -1.123  -6.784  0.688   1.00 0.00 ? 52  SER A HB2  3  
ATOM 3922  H HB3  . SER A 1 52  ? -1.785  -6.396  2.276   1.00 0.00 ? 52  SER A HB3  3  
ATOM 3923  H HG   . SER A 1 52  ? -2.914  -8.248  2.279   1.00 0.00 ? 52  SER A HG   3  
ATOM 3924  N N    . PRO A 1 53  ? -5.322  -6.537  1.489   1.00 0.00 ? 53  PRO A N    3  
ATOM 3925  C CA   . PRO A 1 53  ? -6.498  -6.438  2.359   1.00 0.00 ? 53  PRO A CA   3  
ATOM 3926  C C    . PRO A 1 53  ? -6.210  -6.911  3.780   1.00 0.00 ? 53  PRO A C    3  
ATOM 3927  O O    . PRO A 1 53  ? -6.873  -6.495  4.731   1.00 0.00 ? 53  PRO A O    3  
ATOM 3928  C CB   . PRO A 1 53  ? -7.517  -7.360  1.685   1.00 0.00 ? 53  PRO A CB   3  
ATOM 3929  C CG   . PRO A 1 53  ? -6.695  -8.340  0.923   1.00 0.00 ? 53  PRO A CG   3  
ATOM 3930  C CD   . PRO A 1 53  ? -5.470  -7.593  0.473   1.00 0.00 ? 53  PRO A CD   3  
ATOM 3931  H HA   . PRO A 1 53  ? -6.886  -5.430  2.388   1.00 0.00 ? 53  PRO A HA   3  
ATOM 3932  H HB2  . PRO A 1 53  ? -8.118  -7.849  2.439   1.00 0.00 ? 53  PRO A HB2  3  
ATOM 3933  H HB3  . PRO A 1 53  ? -8.152  -6.783  1.029   1.00 0.00 ? 53  PRO A HB3  3  
ATOM 3934  H HG2  . PRO A 1 53  ? -6.417  -9.164  1.563   1.00 0.00 ? 53  PRO A HG2  3  
ATOM 3935  H HG3  . PRO A 1 53  ? -7.249  -8.698  0.068   1.00 0.00 ? 53  PRO A HG3  3  
ATOM 3936  H HD2  . PRO A 1 53  ? -4.610  -8.246  0.468   1.00 0.00 ? 53  PRO A HD2  3  
ATOM 3937  H HD3  . PRO A 1 53  ? -5.627  -7.165  -0.506  1.00 0.00 ? 53  PRO A HD3  3  
ATOM 3938  N N    . THR A 1 54  ? -5.216  -7.783  3.918   1.00 0.00 ? 54  THR A N    3  
ATOM 3939  C CA   . THR A 1 54  ? -4.840  -8.313  5.223   1.00 0.00 ? 54  THR A CA   3  
ATOM 3940  C C    . THR A 1 54  ? -3.593  -7.621  5.760   1.00 0.00 ? 54  THR A C    3  
ATOM 3941  O O    . THR A 1 54  ? -2.984  -8.078  6.726   1.00 0.00 ? 54  THR A O    3  
ATOM 3942  C CB   . THR A 1 54  ? -4.584  -9.831  5.160   1.00 0.00 ? 54  THR A CB   3  
ATOM 3943  O OG1  . THR A 1 54  ? -3.297  -10.087 4.586   1.00 0.00 ? 54  THR A OG1  3  
ATOM 3944  C CG2  . THR A 1 54  ? -5.659  -10.528 4.339   1.00 0.00 ? 54  THR A CG2  3  
ATOM 3945  H H    . THR A 1 54  ? -4.725  -8.076  3.123   1.00 0.00 ? 54  THR A H    3  
ATOM 3946  H HA   . THR A 1 54  ? -5.660  -8.136  5.904   1.00 0.00 ? 54  THR A HA   3  
ATOM 3947  H HB   . THR A 1 54  ? -4.607  -10.226 6.165   1.00 0.00 ? 54  THR A HB   3  
ATOM 3948  H HG1  . THR A 1 54  ? -2.614  -9.876  5.226   1.00 0.00 ? 54  THR A HG1  3  
ATOM 3949  H HG21 . THR A 1 54  ? -5.198  -11.250 3.681   1.00 0.00 ? 54  THR A HG21 3  
ATOM 3950  H HG22 . THR A 1 54  ? -6.194  -9.796  3.752   1.00 0.00 ? 54  THR A HG22 3  
ATOM 3951  H HG23 . THR A 1 54  ? -6.347  -11.032 5.001   1.00 0.00 ? 54  THR A HG23 3  
ATOM 3952  N N    . GLY A 1 55  ? -3.218  -6.513  5.127   1.00 0.00 ? 55  GLY A N    3  
ATOM 3953  C CA   . GLY A 1 55  ? -2.045  -5.774  5.556   1.00 0.00 ? 55  GLY A CA   3  
ATOM 3954  C C    . GLY A 1 55  ? -2.379  -4.685  6.556   1.00 0.00 ? 55  GLY A C    3  
ATOM 3955  O O    . GLY A 1 55  ? -3.534  -4.277  6.676   1.00 0.00 ? 55  GLY A O    3  
ATOM 3956  H H    . GLY A 1 55  ? -3.742  -6.195  4.362   1.00 0.00 ? 55  GLY A H    3  
ATOM 3957  H HA2  . GLY A 1 55  ? -1.346  -6.462  6.009   1.00 0.00 ? 55  GLY A HA2  3  
ATOM 3958  H HA3  . GLY A 1 55  ? -1.582  -5.323  4.691   1.00 0.00 ? 55  GLY A HA3  3  
ATOM 3959  N N    . ALA A 1 56  ? -1.366  -4.213  7.275   1.00 0.00 ? 56  ALA A N    3  
ATOM 3960  C CA   . ALA A 1 56  ? -1.559  -3.164  8.269   1.00 0.00 ? 56  ALA A CA   3  
ATOM 3961  C C    . ALA A 1 56  ? -2.335  -1.989  7.684   1.00 0.00 ? 56  ALA A C    3  
ATOM 3962  O O    . ALA A 1 56  ? -3.136  -1.358  8.373   1.00 0.00 ? 56  ALA A O    3  
ATOM 3963  C CB   . ALA A 1 56  ? -0.215  -2.696  8.808   1.00 0.00 ? 56  ALA A CB   3  
ATOM 3964  H H    . ALA A 1 56  ? -0.468  -4.578  7.133   1.00 0.00 ? 56  ALA A H    3  
ATOM 3965  H HA   . ALA A 1 56  ? -2.123  -3.582  9.090   1.00 0.00 ? 56  ALA A HA   3  
ATOM 3966  H HB1  . ALA A 1 56  ? 0.413   -2.386  7.986   1.00 0.00 ? 56  ALA A HB1  3  
ATOM 3967  H HB2  . ALA A 1 56  ? -0.367  -1.864  9.479   1.00 0.00 ? 56  ALA A HB2  3  
ATOM 3968  H HB3  . ALA A 1 56  ? 0.261   -3.506  9.340   1.00 0.00 ? 56  ALA A HB3  3  
ATOM 3969  N N    . ALA A 1 57  ? -2.092  -1.701  6.410   1.00 0.00 ? 57  ALA A N    3  
ATOM 3970  C CA   . ALA A 1 57  ? -2.770  -0.603  5.732   1.00 0.00 ? 57  ALA A CA   3  
ATOM 3971  C C    . ALA A 1 57  ? -4.196  -0.988  5.353   1.00 0.00 ? 57  ALA A C    3  
ATOM 3972  O O    . ALA A 1 57  ? -5.154  -0.324  5.746   1.00 0.00 ? 57  ALA A O    3  
ATOM 3973  C CB   . ALA A 1 57  ? -1.988  -0.183  4.496   1.00 0.00 ? 57  ALA A CB   3  
ATOM 3974  H H    . ALA A 1 57  ? -1.443  -2.241  5.913   1.00 0.00 ? 57  ALA A H    3  
ATOM 3975  H HA   . ALA A 1 57  ? -2.803  0.238   6.410   1.00 0.00 ? 57  ALA A HA   3  
ATOM 3976  H HB1  . ALA A 1 57  ? -2.675  0.003   3.683   1.00 0.00 ? 57  ALA A HB1  3  
ATOM 3977  H HB2  . ALA A 1 57  ? -1.432  0.718   4.711   1.00 0.00 ? 57  ALA A HB2  3  
ATOM 3978  H HB3  . ALA A 1 57  ? -1.304  -0.971  4.218   1.00 0.00 ? 57  ALA A HB3  3  
ATOM 3979  N N    . GLY A 1 58  ? -4.329  -2.066  4.585   1.00 0.00 ? 58  GLY A N    3  
ATOM 3980  C CA   . GLY A 1 58  ? -5.641  -2.520  4.165   1.00 0.00 ? 58  GLY A CA   3  
ATOM 3981  C C    . GLY A 1 58  ? -6.662  -2.458  5.284   1.00 0.00 ? 58  GLY A C    3  
ATOM 3982  O O    . GLY A 1 58  ? -7.794  -2.020  5.078   1.00 0.00 ? 58  GLY A O    3  
ATOM 3983  H H    . GLY A 1 58  ? -3.529  -2.557  4.302   1.00 0.00 ? 58  GLY A H    3  
ATOM 3984  H HA2  . GLY A 1 58  ? -5.980  -1.900  3.348   1.00 0.00 ? 58  GLY A HA2  3  
ATOM 3985  H HA3  . GLY A 1 58  ? -5.563  -3.541  3.821   1.00 0.00 ? 58  GLY A HA3  3  
ATOM 3986  N N    . ARG A 1 59  ? -6.262  -2.899  6.473   1.00 0.00 ? 59  ARG A N    3  
ATOM 3987  C CA   . ARG A 1 59  ? -7.151  -2.894  7.628   1.00 0.00 ? 59  ARG A CA   3  
ATOM 3988  C C    . ARG A 1 59  ? -7.209  -1.508  8.264   1.00 0.00 ? 59  ARG A C    3  
ATOM 3989  O O    . ARG A 1 59  ? -8.198  -1.148  8.903   1.00 0.00 ? 59  ARG A O    3  
ATOM 3990  C CB   . ARG A 1 59  ? -6.686  -3.922  8.661   1.00 0.00 ? 59  ARG A CB   3  
ATOM 3991  C CG   . ARG A 1 59  ? -5.439  -3.499  9.421   1.00 0.00 ? 59  ARG A CG   3  
ATOM 3992  C CD   . ARG A 1 59  ? -5.009  -4.562  10.420  1.00 0.00 ? 59  ARG A CD   3  
ATOM 3993  N NE   . ARG A 1 59  ? -3.603  -4.428  10.791  1.00 0.00 ? 59  ARG A NE   3  
ATOM 3994  C CZ   . ARG A 1 59  ? -2.875  -5.423  11.284  1.00 0.00 ? 59  ARG A CZ   3  
ATOM 3995  N NH1  . ARG A 1 59  ? -3.417  -6.619  11.466  1.00 0.00 ? 59  ARG A NH1  3  
ATOM 3996  N NH2  . ARG A 1 59  ? -1.601  -5.223  11.598  1.00 0.00 ? 59  ARG A NH2  3  
ATOM 3997  H H    . ARG A 1 59  ? -5.348  -3.236  6.575   1.00 0.00 ? 59  ARG A H    3  
ATOM 3998  H HA   . ARG A 1 59  ? -8.140  -3.162  7.287   1.00 0.00 ? 59  ARG A HA   3  
ATOM 3999  H HB2  . ARG A 1 59  ? -7.479  -4.081  9.376   1.00 0.00 ? 59  ARG A HB2  3  
ATOM 4000  H HB3  . ARG A 1 59  ? -6.475  -4.852  8.155   1.00 0.00 ? 59  ARG A HB3  3  
ATOM 4001  H HG2  . ARG A 1 59  ? -4.636  -3.338  8.716   1.00 0.00 ? 59  ARG A HG2  3  
ATOM 4002  H HG3  . ARG A 1 59  ? -5.645  -2.581  9.950   1.00 0.00 ? 59  ARG A HG3  3  
ATOM 4003  H HD2  . ARG A 1 59  ? -5.616  -4.468  11.308  1.00 0.00 ? 59  ARG A HD2  3  
ATOM 4004  H HD3  . ARG A 1 59  ? -5.165  -5.535  9.979   1.00 0.00 ? 59  ARG A HD3  3  
ATOM 4005  H HE   . ARG A 1 59  ? -3.182  -3.552  10.665  1.00 0.00 ? 59  ARG A HE   3  
ATOM 4006  H HH11 . ARG A 1 59  ? -4.377  -6.773  11.229  1.00 0.00 ? 59  ARG A HH11 3  
ATOM 4007  H HH12 . ARG A 1 59  ? -2.867  -7.368  11.836  1.00 0.00 ? 59  ARG A HH12 3  
ATOM 4008  H HH21 . ARG A 1 59  ? -1.189  -4.323  11.463  1.00 0.00 ? 59  ARG A HH21 3  
ATOM 4009  H HH22 . ARG A 1 59  ? -1.054  -5.973  11.969  1.00 0.00 ? 59  ARG A HH22 3  
ATOM 4010  N N    . ASP A 1 60  ? -6.144  -0.736  8.084   1.00 0.00 ? 60  ASP A N    3  
ATOM 4011  C CA   . ASP A 1 60  ? -6.073  0.611   8.640   1.00 0.00 ? 60  ASP A CA   3  
ATOM 4012  C C    . ASP A 1 60  ? -7.342  1.396   8.324   1.00 0.00 ? 60  ASP A C    3  
ATOM 4013  O O    . ASP A 1 60  ? -8.033  1.868   9.226   1.00 0.00 ? 60  ASP A O    3  
ATOM 4014  C CB   . ASP A 1 60  ? -4.851  1.349   8.090   1.00 0.00 ? 60  ASP A CB   3  
ATOM 4015  C CG   . ASP A 1 60  ? -4.673  2.719   8.715   1.00 0.00 ? 60  ASP A CG   3  
ATOM 4016  O OD1  . ASP A 1 60  ? -4.728  2.815   9.959   1.00 0.00 ? 60  ASP A OD1  3  
ATOM 4017  O OD2  . ASP A 1 60  ? -4.477  3.694   7.960   1.00 0.00 ? 60  ASP A OD2  3  
ATOM 4018  H H    . ASP A 1 60  ? -5.386  -1.079  7.565   1.00 0.00 ? 60  ASP A H    3  
ATOM 4019  H HA   . ASP A 1 60  ? -5.976  0.523   9.711   1.00 0.00 ? 60  ASP A HA   3  
ATOM 4020  H HB2  . ASP A 1 60  ? -3.965  0.764   8.290   1.00 0.00 ? 60  ASP A HB2  3  
ATOM 4021  H HB3  . ASP A 1 60  ? -4.963  1.472   7.023   1.00 0.00 ? 60  ASP A HB3  3  
ATOM 4022  N N    . GLY A 1 61  ? -7.642  1.534   7.036   1.00 0.00 ? 61  GLY A N    3  
ATOM 4023  C CA   . GLY A 1 61  ? -8.827  2.264   6.624   1.00 0.00 ? 61  GLY A CA   3  
ATOM 4024  C C    . GLY A 1 61  ? -8.491  3.539   5.875   1.00 0.00 ? 61  GLY A C    3  
ATOM 4025  O O    . GLY A 1 61  ? -9.293  4.028   5.079   1.00 0.00 ? 61  GLY A O    3  
ATOM 4026  H H    . GLY A 1 61  ? -7.054  1.137   6.360   1.00 0.00 ? 61  GLY A H    3  
ATOM 4027  H HA2  . GLY A 1 61  ? -9.423  1.630   5.985   1.00 0.00 ? 61  GLY A HA2  3  
ATOM 4028  H HA3  . GLY A 1 61  ? -9.403  2.517   7.502   1.00 0.00 ? 61  GLY A HA3  3  
ATOM 4029  N N    . ARG A 1 62  ? -7.304  4.078   6.131   1.00 0.00 ? 62  ARG A N    3  
ATOM 4030  C CA   . ARG A 1 62  ? -6.866  5.305   5.477   1.00 0.00 ? 62  ARG A CA   3  
ATOM 4031  C C    . ARG A 1 62  ? -6.027  4.993   4.241   1.00 0.00 ? 62  ARG A C    3  
ATOM 4032  O O    . ARG A 1 62  ? -6.312  5.478   3.145   1.00 0.00 ? 62  ARG A O    3  
ATOM 4033  C CB   . ARG A 1 62  ? -6.058  6.167   6.450   1.00 0.00 ? 62  ARG A CB   3  
ATOM 4034  C CG   . ARG A 1 62  ? -6.735  6.361   7.797   1.00 0.00 ? 62  ARG A CG   3  
ATOM 4035  C CD   . ARG A 1 62  ? -7.788  7.457   7.739   1.00 0.00 ? 62  ARG A CD   3  
ATOM 4036  N NE   . ARG A 1 62  ? -9.008  7.009   7.072   1.00 0.00 ? 62  ARG A NE   3  
ATOM 4037  C CZ   . ARG A 1 62  ? -10.054 7.796   6.848   1.00 0.00 ? 62  ARG A CZ   3  
ATOM 4038  N NH1  . ARG A 1 62  ? -10.029 9.064   7.234   1.00 0.00 ? 62  ARG A NH1  3  
ATOM 4039  N NH2  . ARG A 1 62  ? -11.129 7.315   6.235   1.00 0.00 ? 62  ARG A NH2  3  
ATOM 4040  H H    . ARG A 1 62  ? -6.709  3.641   6.776   1.00 0.00 ? 62  ARG A H    3  
ATOM 4041  H HA   . ARG A 1 62  ? -7.746  5.851   5.172   1.00 0.00 ? 62  ARG A HA   3  
ATOM 4042  H HB2  . ARG A 1 62  ? -5.100  5.698   6.619   1.00 0.00 ? 62  ARG A HB2  3  
ATOM 4043  H HB3  . ARG A 1 62  ? -5.902  7.138   6.007   1.00 0.00 ? 62  ARG A HB3  3  
ATOM 4044  H HG2  . ARG A 1 62  ? -7.211  5.436   8.088   1.00 0.00 ? 62  ARG A HG2  3  
ATOM 4045  H HG3  . ARG A 1 62  ? -5.989  6.630   8.529   1.00 0.00 ? 62  ARG A HG3  3  
ATOM 4046  H HD2  . ARG A 1 62  ? -8.031  7.759   8.746   1.00 0.00 ? 62  ARG A HD2  3  
ATOM 4047  H HD3  . ARG A 1 62  ? -7.382  8.299   7.198   1.00 0.00 ? 62  ARG A HD3  3  
ATOM 4048  H HE   . ARG A 1 62  ? -9.048  6.075   6.778   1.00 0.00 ? 62  ARG A HE   3  
ATOM 4049  H HH11 . ARG A 1 62  ? -9.221  9.429   7.695   1.00 0.00 ? 62  ARG A HH11 3  
ATOM 4050  H HH12 . ARG A 1 62  ? -10.818 9.655   7.062   1.00 0.00 ? 62  ARG A HH12 3  
ATOM 4051  H HH21 . ARG A 1 62  ? -11.151 6.359   5.942   1.00 0.00 ? 62  ARG A HH21 3  
ATOM 4052  H HH22 . ARG A 1 62  ? -11.915 7.907   6.066   1.00 0.00 ? 62  ARG A HH22 3  
ATOM 4053  N N    . LEU A 1 63  ? -4.991  4.182   4.425   1.00 0.00 ? 63  LEU A N    3  
ATOM 4054  C CA   . LEU A 1 63  ? -4.110  3.805   3.326   1.00 0.00 ? 63  LEU A CA   3  
ATOM 4055  C C    . LEU A 1 63  ? -4.893  3.119   2.211   1.00 0.00 ? 63  LEU A C    3  
ATOM 4056  O O    . LEU A 1 63  ? -5.692  2.218   2.464   1.00 0.00 ? 63  LEU A O    3  
ATOM 4057  C CB   . LEU A 1 63  ? -3.001  2.880   3.829   1.00 0.00 ? 63  LEU A CB   3  
ATOM 4058  C CG   . LEU A 1 63  ? -1.688  2.917   3.046   1.00 0.00 ? 63  LEU A CG   3  
ATOM 4059  C CD1  . LEU A 1 63  ? -1.904  2.441   1.618   1.00 0.00 ? 63  LEU A CD1  3  
ATOM 4060  C CD2  . LEU A 1 63  ? -1.099  4.320   3.059   1.00 0.00 ? 63  LEU A CD2  3  
ATOM 4061  H H    . LEU A 1 63  ? -4.814  3.828   5.321   1.00 0.00 ? 63  LEU A H    3  
ATOM 4062  H HA   . LEU A 1 63  ? -3.664  4.707   2.934   1.00 0.00 ? 63  LEU A HA   3  
ATOM 4063  H HB2  . LEU A 1 63  ? -2.783  3.149   4.851   1.00 0.00 ? 63  LEU A HB2  3  
ATOM 4064  H HB3  . LEU A 1 63  ? -3.377  1.867   3.798   1.00 0.00 ? 63  LEU A HB3  3  
ATOM 4065  H HG   . LEU A 1 63  ? -0.977  2.251   3.515   1.00 0.00 ? 63  LEU A HG   3  
ATOM 4066  H HD11 . LEU A 1 63  ? -2.397  3.216   1.051   1.00 0.00 ? 63  LEU A HD11 3  
ATOM 4067  H HD12 . LEU A 1 63  ? -2.519  1.553   1.624   1.00 0.00 ? 63  LEU A HD12 3  
ATOM 4068  H HD13 . LEU A 1 63  ? -0.950  2.214   1.166   1.00 0.00 ? 63  LEU A HD13 3  
ATOM 4069  H HD21 . LEU A 1 63  ? -0.124  4.297   3.523   1.00 0.00 ? 63  LEU A HD21 3  
ATOM 4070  H HD22 . LEU A 1 63  ? -1.749  4.978   3.618   1.00 0.00 ? 63  LEU A HD22 3  
ATOM 4071  H HD23 . LEU A 1 63  ? -1.007  4.681   2.045   1.00 0.00 ? 63  LEU A HD23 3  
ATOM 4072  N N    . ARG A 1 64  ? -4.656  3.551   0.976   1.00 0.00 ? 64  ARG A N    3  
ATOM 4073  C CA   . ARG A 1 64  ? -5.338  2.978   -0.178  1.00 0.00 ? 64  ARG A CA   3  
ATOM 4074  C C    . ARG A 1 64  ? -4.643  3.380   -1.475  1.00 0.00 ? 64  ARG A C    3  
ATOM 4075  O O    . ARG A 1 64  ? -4.082  4.471   -1.579  1.00 0.00 ? 64  ARG A O    3  
ATOM 4076  C CB   . ARG A 1 64  ? -6.800  3.430   -0.209  1.00 0.00 ? 64  ARG A CB   3  
ATOM 4077  C CG   . ARG A 1 64  ? -6.973  4.912   -0.495  1.00 0.00 ? 64  ARG A CG   3  
ATOM 4078  C CD   . ARG A 1 64  ? -8.294  5.193   -1.194  1.00 0.00 ? 64  ARG A CD   3  
ATOM 4079  N NE   . ARG A 1 64  ? -9.386  5.387   -0.244  1.00 0.00 ? 64  ARG A NE   3  
ATOM 4080  C CZ   . ARG A 1 64  ? -10.659 5.516   -0.603  1.00 0.00 ? 64  ARG A CZ   3  
ATOM 4081  N NH1  . ARG A 1 64  ? -10.997 5.472   -1.884  1.00 0.00 ? 64  ARG A NH1  3  
ATOM 4082  N NH2  . ARG A 1 64  ? -11.596 5.688   0.320   1.00 0.00 ? 64  ARG A NH2  3  
ATOM 4083  H H    . ARG A 1 64  ? -4.007  4.273   0.838   1.00 0.00 ? 64  ARG A H    3  
ATOM 4084  H HA   . ARG A 1 64  ? -5.304  1.903   -0.083  1.00 0.00 ? 64  ARG A HA   3  
ATOM 4085  H HB2  . ARG A 1 64  ? -7.320  2.874   -0.975  1.00 0.00 ? 64  ARG A HB2  3  
ATOM 4086  H HB3  . ARG A 1 64  ? -7.250  3.215   0.749   1.00 0.00 ? 64  ARG A HB3  3  
ATOM 4087  H HG2  . ARG A 1 64  ? -6.950  5.455   0.439   1.00 0.00 ? 64  ARG A HG2  3  
ATOM 4088  H HG3  . ARG A 1 64  ? -6.163  5.244   -1.127  1.00 0.00 ? 64  ARG A HG3  3  
ATOM 4089  H HD2  . ARG A 1 64  ? -8.187  6.087   -1.791  1.00 0.00 ? 64  ARG A HD2  3  
ATOM 4090  H HD3  . ARG A 1 64  ? -8.531  4.358   -1.836  1.00 0.00 ? 64  ARG A HD3  3  
ATOM 4091  H HE   . ARG A 1 64  ? -9.159  5.422   0.708   1.00 0.00 ? 64  ARG A HE   3  
ATOM 4092  H HH11 . ARG A 1 64  ? -10.293 5.341   -2.582  1.00 0.00 ? 64  ARG A HH11 3  
ATOM 4093  H HH12 . ARG A 1 64  ? -11.956 5.569   -2.152  1.00 0.00 ? 64  ARG A HH12 3  
ATOM 4094  H HH21 . ARG A 1 64  ? -11.344 5.722   1.287   1.00 0.00 ? 64  ARG A HH21 3  
ATOM 4095  H HH22 . ARG A 1 64  ? -12.553 5.786   0.049   1.00 0.00 ? 64  ARG A HH22 3  
ATOM 4096  N N    . VAL A 1 65  ? -4.683  2.491   -2.462  1.00 0.00 ? 65  VAL A N    3  
ATOM 4097  C CA   . VAL A 1 65  ? -4.058  2.753   -3.753  1.00 0.00 ? 65  VAL A CA   3  
ATOM 4098  C C    . VAL A 1 65  ? -4.473  4.115   -4.299  1.00 0.00 ? 65  VAL A C    3  
ATOM 4099  O O    . VAL A 1 65  ? -5.606  4.299   -4.742  1.00 0.00 ? 65  VAL A O    3  
ATOM 4100  C CB   . VAL A 1 65  ? -4.422  1.667   -4.783  1.00 0.00 ? 65  VAL A CB   3  
ATOM 4101  C CG1  . VAL A 1 65  ? -3.731  1.938   -6.111  1.00 0.00 ? 65  VAL A CG1  3  
ATOM 4102  C CG2  . VAL A 1 65  ? -4.057  0.288   -4.254  1.00 0.00 ? 65  VAL A CG2  3  
ATOM 4103  H H    . VAL A 1 65  ? -5.146  1.639   -2.319  1.00 0.00 ? 65  VAL A H    3  
ATOM 4104  H HA   . VAL A 1 65  ? -2.987  2.743   -3.614  1.00 0.00 ? 65  VAL A HA   3  
ATOM 4105  H HB   . VAL A 1 65  ? -5.489  1.696   -4.946  1.00 0.00 ? 65  VAL A HB   3  
ATOM 4106  H HG11 . VAL A 1 65  ? -4.474  2.133   -6.870  1.00 0.00 ? 65  VAL A HG11 3  
ATOM 4107  H HG12 . VAL A 1 65  ? -3.082  2.796   -6.011  1.00 0.00 ? 65  VAL A HG12 3  
ATOM 4108  H HG13 . VAL A 1 65  ? -3.146  1.075   -6.395  1.00 0.00 ? 65  VAL A HG13 3  
ATOM 4109  H HG21 . VAL A 1 65  ? -4.531  0.134   -3.297  1.00 0.00 ? 65  VAL A HG21 3  
ATOM 4110  H HG22 . VAL A 1 65  ? -4.397  -0.466  -4.949  1.00 0.00 ? 65  VAL A HG22 3  
ATOM 4111  H HG23 . VAL A 1 65  ? -2.986  0.217   -4.142  1.00 0.00 ? 65  VAL A HG23 3  
ATOM 4112  N N    . GLY A 1 66  ? -3.547  5.068   -4.263  1.00 0.00 ? 66  GLY A N    3  
ATOM 4113  C CA   . GLY A 1 66  ? -3.835  6.401   -4.758  1.00 0.00 ? 66  GLY A CA   3  
ATOM 4114  C C    . GLY A 1 66  ? -3.153  7.482   -3.942  1.00 0.00 ? 66  GLY A C    3  
ATOM 4115  O O    . GLY A 1 66  ? -2.877  8.571   -4.448  1.00 0.00 ? 66  GLY A O    3  
ATOM 4116  H H    . GLY A 1 66  ? -2.660  4.864   -3.899  1.00 0.00 ? 66  GLY A H    3  
ATOM 4117  H HA2  . GLY A 1 66  ? -3.502  6.473   -5.782  1.00 0.00 ? 66  GLY A HA2  3  
ATOM 4118  H HA3  . GLY A 1 66  ? -4.903  6.562   -4.725  1.00 0.00 ? 66  GLY A HA3  3  
ATOM 4119  N N    . LEU A 1 67  ? -2.881  7.183   -2.677  1.00 0.00 ? 67  LEU A N    3  
ATOM 4120  C CA   . LEU A 1 67  ? -2.228  8.138   -1.789  1.00 0.00 ? 67  LEU A CA   3  
ATOM 4121  C C    . LEU A 1 67  ? -0.740  8.249   -2.107  1.00 0.00 ? 67  LEU A C    3  
ATOM 4122  O O    . LEU A 1 67  ? 0.001   7.271   -2.003  1.00 0.00 ? 67  LEU A O    3  
ATOM 4123  C CB   . LEU A 1 67  ? -2.420  7.721   -0.329  1.00 0.00 ? 67  LEU A CB   3  
ATOM 4124  C CG   . LEU A 1 67  ? -3.831  7.885   0.236   1.00 0.00 ? 67  LEU A CG   3  
ATOM 4125  C CD1  . LEU A 1 67  ? -4.050  6.940   1.407   1.00 0.00 ? 67  LEU A CD1  3  
ATOM 4126  C CD2  . LEU A 1 67  ? -4.072  9.327   0.659   1.00 0.00 ? 67  LEU A CD2  3  
ATOM 4127  H H    . LEU A 1 67  ? -3.125  6.300   -2.331  1.00 0.00 ? 67  LEU A H    3  
ATOM 4128  H HA   . LEU A 1 67  ? -2.689  9.102   -1.942  1.00 0.00 ? 67  LEU A HA   3  
ATOM 4129  H HB2  . LEU A 1 67  ? -2.149  6.680   -0.245  1.00 0.00 ? 67  LEU A HB2  3  
ATOM 4130  H HB3  . LEU A 1 67  ? -1.749  8.316   0.274   1.00 0.00 ? 67  LEU A HB3  3  
ATOM 4131  H HG   . LEU A 1 67  ? -4.551  7.636   -0.532  1.00 0.00 ? 67  LEU A HG   3  
ATOM 4132  H HD11 . LEU A 1 67  ? -3.419  6.071   1.291   1.00 0.00 ? 67  LEU A HD11 3  
ATOM 4133  H HD12 . LEU A 1 67  ? -5.085  6.632   1.432   1.00 0.00 ? 67  LEU A HD12 3  
ATOM 4134  H HD13 . LEU A 1 67  ? -3.803  7.446   2.329   1.00 0.00 ? 67  LEU A HD13 3  
ATOM 4135  H HD21 . LEU A 1 67  ? -3.148  9.755   1.019   1.00 0.00 ? 67  LEU A HD21 3  
ATOM 4136  H HD22 . LEU A 1 67  ? -4.811  9.351   1.447   1.00 0.00 ? 67  LEU A HD22 3  
ATOM 4137  H HD23 . LEU A 1 67  ? -4.428  9.895   -0.187  1.00 0.00 ? 67  LEU A HD23 3  
ATOM 4138  N N    . ARG A 1 68  ? -0.310  9.446   -2.492  1.00 0.00 ? 68  ARG A N    3  
ATOM 4139  C CA   . ARG A 1 68  ? 1.089   9.684   -2.824  1.00 0.00 ? 68  ARG A CA   3  
ATOM 4140  C C    . ARG A 1 68  ? 1.963   9.618   -1.575  1.00 0.00 ? 68  ARG A C    3  
ATOM 4141  O O    . ARG A 1 68  ? 1.651   10.230  -0.553  1.00 0.00 ? 68  ARG A O    3  
ATOM 4142  C CB   . ARG A 1 68  ? 1.250   11.046  -3.501  1.00 0.00 ? 68  ARG A CB   3  
ATOM 4143  C CG   . ARG A 1 68  ? 2.678   11.352  -3.923  1.00 0.00 ? 68  ARG A CG   3  
ATOM 4144  C CD   . ARG A 1 68  ? 2.819   12.784  -4.415  1.00 0.00 ? 68  ARG A CD   3  
ATOM 4145  N NE   . ARG A 1 68  ? 4.094   13.007  -5.092  1.00 0.00 ? 68  ARG A NE   3  
ATOM 4146  C CZ   . ARG A 1 68  ? 4.658   14.203  -5.220  1.00 0.00 ? 68  ARG A CZ   3  
ATOM 4147  N NH1  . ARG A 1 68  ? 4.064   15.277  -4.720  1.00 0.00 ? 68  ARG A NH1  3  
ATOM 4148  N NH2  . ARG A 1 68  ? 5.820   14.325  -5.850  1.00 0.00 ? 68  ARG A NH2  3  
ATOM 4149  H H    . ARG A 1 68  ? -0.949  10.186  -2.556  1.00 0.00 ? 68  ARG A H    3  
ATOM 4150  H HA   . ARG A 1 68  ? 1.404   8.912   -3.510  1.00 0.00 ? 68  ARG A HA   3  
ATOM 4151  H HB2  . ARG A 1 68  ? 0.624   11.075  -4.380  1.00 0.00 ? 68  ARG A HB2  3  
ATOM 4152  H HB3  . ARG A 1 68  ? 0.929   11.816  -2.814  1.00 0.00 ? 68  ARG A HB3  3  
ATOM 4153  H HG2  . ARG A 1 68  ? 3.333   11.207  -3.077  1.00 0.00 ? 68  ARG A HG2  3  
ATOM 4154  H HG3  . ARG A 1 68  ? 2.959   10.678  -4.719  1.00 0.00 ? 68  ARG A HG3  3  
ATOM 4155  H HD2  . ARG A 1 68  ? 2.015   12.995  -5.103  1.00 0.00 ? 68  ARG A HD2  3  
ATOM 4156  H HD3  . ARG A 1 68  ? 2.751   13.449  -3.567  1.00 0.00 ? 68  ARG A HD3  3  
ATOM 4157  H HE   . ARG A 1 68  ? 4.550   12.227  -5.469  1.00 0.00 ? 68  ARG A HE   3  
ATOM 4158  H HH11 . ARG A 1 68  ? 3.189   15.188  -4.244  1.00 0.00 ? 68  ARG A HH11 3  
ATOM 4159  H HH12 . ARG A 1 68  ? 4.492   16.176  -4.817  1.00 0.00 ? 68  ARG A HH12 3  
ATOM 4160  H HH21 . ARG A 1 68  ? 6.271   13.517  -6.228  1.00 0.00 ? 68  ARG A HH21 3  
ATOM 4161  H HH22 . ARG A 1 68  ? 6.244   15.225  -5.946  1.00 0.00 ? 68  ARG A HH22 3  
ATOM 4162  N N    . LEU A 1 69  ? 3.058   8.871   -1.664  1.00 0.00 ? 69  LEU A N    3  
ATOM 4163  C CA   . LEU A 1 69  ? 3.978   8.724   -0.541  1.00 0.00 ? 69  LEU A CA   3  
ATOM 4164  C C    . LEU A 1 69  ? 4.907   9.929   -0.437  1.00 0.00 ? 69  LEU A C    3  
ATOM 4165  O O    . LEU A 1 69  ? 5.766   10.140  -1.295  1.00 0.00 ? 69  LEU A O    3  
ATOM 4166  C CB   . LEU A 1 69  ? 4.800   7.443   -0.694  1.00 0.00 ? 69  LEU A CB   3  
ATOM 4167  C CG   . LEU A 1 69  ? 4.288   6.222   0.071   1.00 0.00 ? 69  LEU A CG   3  
ATOM 4168  C CD1  . LEU A 1 69  ? 4.633   6.334   1.548   1.00 0.00 ? 69  LEU A CD1  3  
ATOM 4169  C CD2  . LEU A 1 69  ? 2.786   6.066   -0.118  1.00 0.00 ? 69  LEU A CD2  3  
ATOM 4170  H H    . LEU A 1 69  ? 3.254   8.407   -2.504  1.00 0.00 ? 69  LEU A H    3  
ATOM 4171  H HA   . LEU A 1 69  ? 3.390   8.659   0.362   1.00 0.00 ? 69  LEU A HA   3  
ATOM 4172  H HB2  . LEU A 1 69  ? 4.825   7.190   -1.743  1.00 0.00 ? 69  LEU A HB2  3  
ATOM 4173  H HB3  . LEU A 1 69  ? 5.804   7.653   -0.352  1.00 0.00 ? 69  LEU A HB3  3  
ATOM 4174  H HG   . LEU A 1 69  ? 4.769   5.335   -0.317  1.00 0.00 ? 69  LEU A HG   3  
ATOM 4175  H HD11 . LEU A 1 69  ? 3.725   6.433   2.123   1.00 0.00 ? 69  LEU A HD11 3  
ATOM 4176  H HD12 . LEU A 1 69  ? 5.256   7.202   1.707   1.00 0.00 ? 69  LEU A HD12 3  
ATOM 4177  H HD13 . LEU A 1 69  ? 5.165   5.447   1.861   1.00 0.00 ? 69  LEU A HD13 3  
ATOM 4178  H HD21 . LEU A 1 69  ? 2.324   5.859   0.836   1.00 0.00 ? 69  LEU A HD21 3  
ATOM 4179  H HD22 . LEU A 1 69  ? 2.592   5.248   -0.797  1.00 0.00 ? 69  LEU A HD22 3  
ATOM 4180  H HD23 . LEU A 1 69  ? 2.378   6.978   -0.526  1.00 0.00 ? 69  LEU A HD23 3  
ATOM 4181  N N    . LEU A 1 70  ? 4.731   10.716  0.618   1.00 0.00 ? 70  LEU A N    3  
ATOM 4182  C CA   . LEU A 1 70  ? 5.556   11.899  0.836   1.00 0.00 ? 70  LEU A CA   3  
ATOM 4183  C C    . LEU A 1 70  ? 6.809   11.551  1.634   1.00 0.00 ? 70  LEU A C    3  
ATOM 4184  O O    . LEU A 1 70  ? 7.921   11.908  1.246   1.00 0.00 ? 70  LEU A O    3  
ATOM 4185  C CB   . LEU A 1 70  ? 4.754   12.976  1.570   1.00 0.00 ? 70  LEU A CB   3  
ATOM 4186  C CG   . LEU A 1 70  ? 3.848   13.848  0.700   1.00 0.00 ? 70  LEU A CG   3  
ATOM 4187  C CD1  . LEU A 1 70  ? 4.645   14.489  -0.425  1.00 0.00 ? 70  LEU A CD1  3  
ATOM 4188  C CD2  . LEU A 1 70  ? 2.696   13.027  0.139   1.00 0.00 ? 70  LEU A CD2  3  
ATOM 4189  H H    . LEU A 1 70  ? 4.031   10.497  1.267   1.00 0.00 ? 70  LEU A H    3  
ATOM 4190  H HA   . LEU A 1 70  ? 5.853   12.279  -0.130  1.00 0.00 ? 70  LEU A HA   3  
ATOM 4191  H HB2  . LEU A 1 70  ? 4.133   12.484  2.303   1.00 0.00 ? 70  LEU A HB2  3  
ATOM 4192  H HB3  . LEU A 1 70  ? 5.456   13.625  2.073   1.00 0.00 ? 70  LEU A HB3  3  
ATOM 4193  H HG   . LEU A 1 70  ? 3.431   14.640  1.306   1.00 0.00 ? 70  LEU A HG   3  
ATOM 4194  H HD11 . LEU A 1 70  ? 4.323   15.511  -0.557  1.00 0.00 ? 70  LEU A HD11 3  
ATOM 4195  H HD12 . LEU A 1 70  ? 4.483   13.939  -1.340  1.00 0.00 ? 70  LEU A HD12 3  
ATOM 4196  H HD13 . LEU A 1 70  ? 5.697   14.472  -0.177  1.00 0.00 ? 70  LEU A HD13 3  
ATOM 4197  H HD21 . LEU A 1 70  ? 1.816   13.647  0.064   1.00 0.00 ? 70  LEU A HD21 3  
ATOM 4198  H HD22 . LEU A 1 70  ? 2.494   12.194  0.797   1.00 0.00 ? 70  LEU A HD22 3  
ATOM 4199  H HD23 . LEU A 1 70  ? 2.961   12.657  -0.840  1.00 0.00 ? 70  LEU A HD23 3  
ATOM 4200  N N    . GLU A 1 71  ? 6.620   10.850  2.747   1.00 0.00 ? 71  GLU A N    3  
ATOM 4201  C CA   . GLU A 1 71  ? 7.735   10.452  3.597   1.00 0.00 ? 71  GLU A CA   3  
ATOM 4202  C C    . GLU A 1 71  ? 7.356   9.259   4.470   1.00 0.00 ? 71  GLU A C    3  
ATOM 4203  O O    . GLU A 1 71  ? 6.239   9.179   4.981   1.00 0.00 ? 71  GLU A O    3  
ATOM 4204  C CB   . GLU A 1 71  ? 8.177   11.623  4.479   1.00 0.00 ? 71  GLU A CB   3  
ATOM 4205  C CG   . GLU A 1 71  ? 8.130   12.967  3.772   1.00 0.00 ? 71  GLU A CG   3  
ATOM 4206  C CD   . GLU A 1 71  ? 8.479   14.122  4.692   1.00 0.00 ? 71  GLU A CD   3  
ATOM 4207  O OE1  . GLU A 1 71  ? 9.346   13.937  5.571   1.00 0.00 ? 71  GLU A OE1  3  
ATOM 4208  O OE2  . GLU A 1 71  ? 7.884   15.208  4.533   1.00 0.00 ? 71  GLU A OE2  3  
ATOM 4209  H H    . GLU A 1 71  ? 5.709   10.595  3.003   1.00 0.00 ? 71  GLU A H    3  
ATOM 4210  H HA   . GLU A 1 71  ? 8.556   10.167  2.956   1.00 0.00 ? 71  GLU A HA   3  
ATOM 4211  H HB2  . GLU A 1 71  ? 7.531   11.670  5.343   1.00 0.00 ? 71  GLU A HB2  3  
ATOM 4212  H HB3  . GLU A 1 71  ? 9.191   11.447  4.807   1.00 0.00 ? 71  GLU A HB3  3  
ATOM 4213  H HG2  . GLU A 1 71  ? 8.834   12.954  2.954   1.00 0.00 ? 71  GLU A HG2  3  
ATOM 4214  H HG3  . GLU A 1 71  ? 7.134   13.122  3.386   1.00 0.00 ? 71  GLU A HG3  3  
ATOM 4215  N N    . VAL A 1 72  ? 8.295   8.333   4.636   1.00 0.00 ? 72  VAL A N    3  
ATOM 4216  C CA   . VAL A 1 72  ? 8.061   7.144   5.447   1.00 0.00 ? 72  VAL A CA   3  
ATOM 4217  C C    . VAL A 1 72  ? 8.906   7.168   6.715   1.00 0.00 ? 72  VAL A C    3  
ATOM 4218  O O    . VAL A 1 72  ? 10.126  7.021   6.663   1.00 0.00 ? 72  VAL A O    3  
ATOM 4219  C CB   . VAL A 1 72  ? 8.373   5.857   4.660   1.00 0.00 ? 72  VAL A CB   3  
ATOM 4220  C CG1  . VAL A 1 72  ? 8.189   4.633   5.543   1.00 0.00 ? 72  VAL A CG1  3  
ATOM 4221  C CG2  . VAL A 1 72  ? 7.497   5.766   3.419   1.00 0.00 ? 72  VAL A CG2  3  
ATOM 4222  H H    . VAL A 1 72  ? 9.166   8.452   4.204   1.00 0.00 ? 72  VAL A H    3  
ATOM 4223  H HA   . VAL A 1 72  ? 7.016   7.128   5.722   1.00 0.00 ? 72  VAL A HA   3  
ATOM 4224  H HB   . VAL A 1 72  ? 9.405   5.894   4.344   1.00 0.00 ? 72  VAL A HB   3  
ATOM 4225  H HG11 . VAL A 1 72  ? 7.362   4.044   5.173   1.00 0.00 ? 72  VAL A HG11 3  
ATOM 4226  H HG12 . VAL A 1 72  ? 9.091   4.039   5.528   1.00 0.00 ? 72  VAL A HG12 3  
ATOM 4227  H HG13 . VAL A 1 72  ? 7.981   4.947   6.555   1.00 0.00 ? 72  VAL A HG13 3  
ATOM 4228  H HG21 . VAL A 1 72  ? 8.094   5.969   2.543   1.00 0.00 ? 72  VAL A HG21 3  
ATOM 4229  H HG22 . VAL A 1 72  ? 7.076   4.774   3.347   1.00 0.00 ? 72  VAL A HG22 3  
ATOM 4230  H HG23 . VAL A 1 72  ? 6.699   6.491   3.487   1.00 0.00 ? 72  VAL A HG23 3  
ATOM 4231  N N    . ASN A 1 73  ? 8.248   7.354   7.855   1.00 0.00 ? 73  ASN A N    3  
ATOM 4232  C CA   . ASN A 1 73  ? 8.939   7.398   9.138   1.00 0.00 ? 73  ASN A CA   3  
ATOM 4233  C C    . ASN A 1 73  ? 9.869   8.605   9.214   1.00 0.00 ? 73  ASN A C    3  
ATOM 4234  O O    . ASN A 1 73  ? 10.994  8.504   9.703   1.00 0.00 ? 73  ASN A O    3  
ATOM 4235  C CB   . ASN A 1 73  ? 9.738   6.111   9.355   1.00 0.00 ? 73  ASN A CB   3  
ATOM 4236  C CG   . ASN A 1 73  ? 8.954   5.068   10.129  1.00 0.00 ? 73  ASN A CG   3  
ATOM 4237  O OD1  . ASN A 1 73  ? 7.988   5.389   10.822  1.00 0.00 ? 73  ASN A OD1  3  
ATOM 4238  N ND2  . ASN A 1 73  ? 9.367   3.812   10.014  1.00 0.00 ? 73  ASN A ND2  3  
ATOM 4239  H H    . ASN A 1 73  ? 7.275   7.465   7.833   1.00 0.00 ? 73  ASN A H    3  
ATOM 4240  H HA   . ASN A 1 73  ? 8.193   7.484   9.914   1.00 0.00 ? 73  ASN A HA   3  
ATOM 4241  H HB2  . ASN A 1 73  ? 10.004  5.694   8.395   1.00 0.00 ? 73  ASN A HB2  3  
ATOM 4242  H HB3  . ASN A 1 73  ? 10.637  6.340   9.906   1.00 0.00 ? 73  ASN A HB3  3  
ATOM 4243  H HD21 . ASN A 1 73  ? 10.144  3.630   9.444   1.00 0.00 ? 73  ASN A HD21 3  
ATOM 4244  H HD22 . ASN A 1 73  ? 8.878   3.117   10.503  1.00 0.00 ? 73  ASN A HD22 3  
ATOM 4245  N N    . GLN A 1 74  ? 9.391   9.746   8.728   1.00 0.00 ? 74  GLN A N    3  
ATOM 4246  C CA   . GLN A 1 74  ? 10.179  10.972  8.741   1.00 0.00 ? 74  GLN A CA   3  
ATOM 4247  C C    . GLN A 1 74  ? 11.417  10.833  7.860   1.00 0.00 ? 74  GLN A C    3  
ATOM 4248  O O    . GLN A 1 74  ? 12.465  11.408  8.152   1.00 0.00 ? 74  GLN A O    3  
ATOM 4249  C CB   . GLN A 1 74  ? 10.594  11.322  10.172  1.00 0.00 ? 74  GLN A CB   3  
ATOM 4250  C CG   . GLN A 1 74  ? 9.432   11.748  11.055  1.00 0.00 ? 74  GLN A CG   3  
ATOM 4251  C CD   . GLN A 1 74  ? 9.692   11.489  12.526  1.00 0.00 ? 74  GLN A CD   3  
ATOM 4252  O OE1  . GLN A 1 74  ? 10.316  12.301  13.210  1.00 0.00 ? 74  GLN A OE1  3  
ATOM 4253  N NE2  . GLN A 1 74  ? 9.215   10.353  13.021  1.00 0.00 ? 74  GLN A NE2  3  
ATOM 4254  H H    . GLN A 1 74  ? 8.487   9.763   8.352   1.00 0.00 ? 74  GLN A H    3  
ATOM 4255  H HA   . GLN A 1 74  ? 9.562   11.767  8.351   1.00 0.00 ? 74  GLN A HA   3  
ATOM 4256  H HB2  . GLN A 1 74  ? 11.061  10.457  10.620  1.00 0.00 ? 74  GLN A HB2  3  
ATOM 4257  H HB3  . GLN A 1 74  ? 11.308  12.131  10.139  1.00 0.00 ? 74  GLN A HB3  3  
ATOM 4258  H HG2  . GLN A 1 74  ? 9.260   12.805  10.917  1.00 0.00 ? 74  GLN A HG2  3  
ATOM 4259  H HG3  . GLN A 1 74  ? 8.551   11.199  10.758  1.00 0.00 ? 74  GLN A HG3  3  
ATOM 4260  H HE21 . GLN A 1 74  ? 8.729   9.753   12.416  1.00 0.00 ? 74  GLN A HE21 3  
ATOM 4261  H HE22 . GLN A 1 74  ? 9.369   10.160  13.968  1.00 0.00 ? 74  GLN A HE22 3  
ATOM 4262  N N    . GLN A 1 75  ? 11.286  10.066  6.783   1.00 0.00 ? 75  GLN A N    3  
ATOM 4263  C CA   . GLN A 1 75  ? 12.395  9.851   5.860   1.00 0.00 ? 75  GLN A CA   3  
ATOM 4264  C C    . GLN A 1 75  ? 11.973  10.145  4.424   1.00 0.00 ? 75  GLN A C    3  
ATOM 4265  O O    . GLN A 1 75  ? 11.494  9.261   3.714   1.00 0.00 ? 75  GLN A O    3  
ATOM 4266  C CB   . GLN A 1 75  ? 12.906  8.414   5.970   1.00 0.00 ? 75  GLN A CB   3  
ATOM 4267  C CG   . GLN A 1 75  ? 13.308  8.017   7.381   1.00 0.00 ? 75  GLN A CG   3  
ATOM 4268  C CD   . GLN A 1 75  ? 14.396  6.962   7.403   1.00 0.00 ? 75  GLN A CD   3  
ATOM 4269  O OE1  . GLN A 1 75  ? 15.348  7.019   6.625   1.00 0.00 ? 75  GLN A OE1  3  
ATOM 4270  N NE2  . GLN A 1 75  ? 14.261  5.990   8.298   1.00 0.00 ? 75  GLN A NE2  3  
ATOM 4271  H H    . GLN A 1 75  ? 10.425  9.635   6.604   1.00 0.00 ? 75  GLN A H    3  
ATOM 4272  H HA   . GLN A 1 75  ? 13.190  10.528  6.134   1.00 0.00 ? 75  GLN A HA   3  
ATOM 4273  H HB2  . GLN A 1 75  ? 12.129  7.742   5.637   1.00 0.00 ? 75  GLN A HB2  3  
ATOM 4274  H HB3  . GLN A 1 75  ? 13.768  8.301   5.329   1.00 0.00 ? 75  GLN A HB3  3  
ATOM 4275  H HG2  . GLN A 1 75  ? 13.668  8.894   7.899   1.00 0.00 ? 75  GLN A HG2  3  
ATOM 4276  H HG3  . GLN A 1 75  ? 12.440  7.629   7.893   1.00 0.00 ? 75  GLN A HG3  3  
ATOM 4277  H HE21 . GLN A 1 75  ? 13.476  6.009   8.886   1.00 0.00 ? 75  GLN A HE21 3  
ATOM 4278  H HE22 . GLN A 1 75  ? 14.950  5.295   8.334   1.00 0.00 ? 75  GLN A HE22 3  
ATOM 4279  N N    . SER A 1 76  ? 12.154  11.393  4.003   1.00 0.00 ? 76  SER A N    3  
ATOM 4280  C CA   . SER A 1 76  ? 11.788  11.805  2.653   1.00 0.00 ? 76  SER A CA   3  
ATOM 4281  C C    . SER A 1 76  ? 12.307  10.808  1.622   1.00 0.00 ? 76  SER A C    3  
ATOM 4282  O O    . SER A 1 76  ? 13.482  10.439  1.634   1.00 0.00 ? 76  SER A O    3  
ATOM 4283  C CB   . SER A 1 76  ? 12.341  13.199  2.355   1.00 0.00 ? 76  SER A CB   3  
ATOM 4284  O OG   . SER A 1 76  ? 11.670  13.790  1.256   1.00 0.00 ? 76  SER A OG   3  
ATOM 4285  H H    . SER A 1 76  ? 12.540  12.053  4.616   1.00 0.00 ? 76  SER A H    3  
ATOM 4286  H HA   . SER A 1 76  ? 10.710  11.835  2.596   1.00 0.00 ? 76  SER A HA   3  
ATOM 4287  H HB2  . SER A 1 76  ? 12.210  13.829  3.222   1.00 0.00 ? 76  SER A HB2  3  
ATOM 4288  H HB3  . SER A 1 76  ? 13.393  13.123  2.120   1.00 0.00 ? 76  SER A HB3  3  
ATOM 4289  H HG   . SER A 1 76  ? 10.810  13.377  1.146   1.00 0.00 ? 76  SER A HG   3  
ATOM 4290  N N    . LEU A 1 77  ? 11.423  10.375  0.729   1.00 0.00 ? 77  LEU A N    3  
ATOM 4291  C CA   . LEU A 1 77  ? 11.791  9.421   -0.311  1.00 0.00 ? 77  LEU A CA   3  
ATOM 4292  C C    . LEU A 1 77  ? 12.428  10.130  -1.501  1.00 0.00 ? 77  LEU A C    3  
ATOM 4293  O O    . LEU A 1 77  ? 12.672  9.521   -2.544  1.00 0.00 ? 77  LEU A O    3  
ATOM 4294  C CB   . LEU A 1 77  ? 10.560  8.637   -0.770  1.00 0.00 ? 77  LEU A CB   3  
ATOM 4295  C CG   . LEU A 1 77  ? 9.568   8.244   0.326   1.00 0.00 ? 77  LEU A CG   3  
ATOM 4296  C CD1  . LEU A 1 77  ? 8.223   7.872   -0.280  1.00 0.00 ? 77  LEU A CD1  3  
ATOM 4297  C CD2  . LEU A 1 77  ? 10.118  7.094   1.156   1.00 0.00 ? 77  LEU A CD2  3  
ATOM 4298  H H    . LEU A 1 77  ? 10.502  10.705  0.769   1.00 0.00 ? 77  LEU A H    3  
ATOM 4299  H HA   . LEU A 1 77  ? 12.509  8.733   0.110   1.00 0.00 ? 77  LEU A HA   3  
ATOM 4300  H HB2  . LEU A 1 77  ? 10.033  9.242   -1.491  1.00 0.00 ? 77  LEU A HB2  3  
ATOM 4301  H HB3  . LEU A 1 77  ? 10.905  7.730   -1.246  1.00 0.00 ? 77  LEU A HB3  3  
ATOM 4302  H HG   . LEU A 1 77  ? 9.414   9.089   0.983   1.00 0.00 ? 77  LEU A HG   3  
ATOM 4303  H HD11 . LEU A 1 77  ? 7.874   6.949   0.158   1.00 0.00 ? 77  LEU A HD11 3  
ATOM 4304  H HD12 . LEU A 1 77  ? 8.332   7.746   -1.347  1.00 0.00 ? 77  LEU A HD12 3  
ATOM 4305  H HD13 . LEU A 1 77  ? 7.509   8.658   -0.082  1.00 0.00 ? 77  LEU A HD13 3  
ATOM 4306  H HD21 . LEU A 1 77  ? 9.920   7.278   2.201   1.00 0.00 ? 77  LEU A HD21 3  
ATOM 4307  H HD22 . LEU A 1 77  ? 11.184  7.014   0.999   1.00 0.00 ? 77  LEU A HD22 3  
ATOM 4308  H HD23 . LEU A 1 77  ? 9.640   6.173   0.856   1.00 0.00 ? 77  LEU A HD23 3  
ATOM 4309  N N    . LEU A 1 78  ? 12.699  11.421  -1.338  1.00 0.00 ? 78  LEU A N    3  
ATOM 4310  C CA   . LEU A 1 78  ? 13.311  12.214  -2.399  1.00 0.00 ? 78  LEU A CA   3  
ATOM 4311  C C    . LEU A 1 78  ? 14.805  11.925  -2.501  1.00 0.00 ? 78  LEU A C    3  
ATOM 4312  O O    . LEU A 1 78  ? 15.567  12.209  -1.579  1.00 0.00 ? 78  LEU A O    3  
ATOM 4313  C CB   . LEU A 1 78  ? 13.084  13.705  -2.142  1.00 0.00 ? 78  LEU A CB   3  
ATOM 4314  C CG   . LEU A 1 78  ? 13.024  14.598  -3.382  1.00 0.00 ? 78  LEU A CG   3  
ATOM 4315  C CD1  . LEU A 1 78  ? 14.373  14.626  -4.085  1.00 0.00 ? 78  LEU A CD1  3  
ATOM 4316  C CD2  . LEU A 1 78  ? 11.936  14.119  -4.332  1.00 0.00 ? 78  LEU A CD2  3  
ATOM 4317  H H    . LEU A 1 78  ? 12.482  11.851  -0.485  1.00 0.00 ? 78  LEU A H    3  
ATOM 4318  H HA   . LEU A 1 78  ? 12.839  11.942  -3.331  1.00 0.00 ? 78  LEU A HA   3  
ATOM 4319  H HB2  . LEU A 1 78  ? 12.150  13.811  -1.613  1.00 0.00 ? 78  LEU A HB2  3  
ATOM 4320  H HB3  . LEU A 1 78  ? 13.892  14.059  -1.517  1.00 0.00 ? 78  LEU A HB3  3  
ATOM 4321  H HG   . LEU A 1 78  ? 12.785  15.608  -3.080  1.00 0.00 ? 78  LEU A HG   3  
ATOM 4322  H HD11 . LEU A 1 78  ? 14.506  15.581  -4.570  1.00 0.00 ? 78  LEU A HD11 3  
ATOM 4323  H HD12 . LEU A 1 78  ? 14.410  13.839  -4.824  1.00 0.00 ? 78  LEU A HD12 3  
ATOM 4324  H HD13 . LEU A 1 78  ? 15.160  14.476  -3.361  1.00 0.00 ? 78  LEU A HD13 3  
ATOM 4325  H HD21 . LEU A 1 78  ? 11.228  14.918  -4.500  1.00 0.00 ? 78  LEU A HD21 3  
ATOM 4326  H HD22 . LEU A 1 78  ? 11.425  13.272  -3.897  1.00 0.00 ? 78  LEU A HD22 3  
ATOM 4327  H HD23 . LEU A 1 78  ? 12.380  13.828  -5.272  1.00 0.00 ? 78  LEU A HD23 3  
ATOM 4328  N N    . GLY A 1 79  ? 15.217  11.360  -3.632  1.00 0.00 ? 79  GLY A N    3  
ATOM 4329  C CA   . GLY A 1 79  ? 16.619  11.044  -3.836  1.00 0.00 ? 79  GLY A CA   3  
ATOM 4330  C C    . GLY A 1 79  ? 16.863  9.554   -3.974  1.00 0.00 ? 79  GLY A C    3  
ATOM 4331  O O    . GLY A 1 79  ? 17.767  9.130   -4.695  1.00 0.00 ? 79  GLY A O    3  
ATOM 4332  H H    . GLY A 1 79  ? 14.564  11.156  -4.334  1.00 0.00 ? 79  GLY A H    3  
ATOM 4333  H HA2  . GLY A 1 79  ? 16.961  11.539  -4.732  1.00 0.00 ? 79  GLY A HA2  3  
ATOM 4334  H HA3  . GLY A 1 79  ? 17.185  11.413  -2.993  1.00 0.00 ? 79  GLY A HA3  3  
ATOM 4335  N N    . LEU A 1 80  ? 16.058  8.758   -3.280  1.00 0.00 ? 80  LEU A N    3  
ATOM 4336  C CA   . LEU A 1 80  ? 16.192  7.306   -3.327  1.00 0.00 ? 80  LEU A CA   3  
ATOM 4337  C C    . LEU A 1 80  ? 15.377  6.721   -4.477  1.00 0.00 ? 80  LEU A C    3  
ATOM 4338  O O    . LEU A 1 80  ? 14.541  7.402   -5.070  1.00 0.00 ? 80  LEU A O    3  
ATOM 4339  C CB   . LEU A 1 80  ? 15.741  6.689   -2.002  1.00 0.00 ? 80  LEU A CB   3  
ATOM 4340  C CG   . LEU A 1 80  ? 14.566  7.378   -1.307  1.00 0.00 ? 80  LEU A CG   3  
ATOM 4341  C CD1  . LEU A 1 80  ? 13.801  6.386   -0.443  1.00 0.00 ? 80  LEU A CD1  3  
ATOM 4342  C CD2  . LEU A 1 80  ? 15.054  8.551   -0.471  1.00 0.00 ? 80  LEU A CD2  3  
ATOM 4343  H H    . LEU A 1 80  ? 15.356  9.154   -2.724  1.00 0.00 ? 80  LEU A H    3  
ATOM 4344  H HA   . LEU A 1 80  ? 17.234  7.074   -3.486  1.00 0.00 ? 80  LEU A HA   3  
ATOM 4345  H HB2  . LEU A 1 80  ? 15.458  5.665   -2.193  1.00 0.00 ? 80  LEU A HB2  3  
ATOM 4346  H HB3  . LEU A 1 80  ? 16.584  6.708   -1.326  1.00 0.00 ? 80  LEU A HB3  3  
ATOM 4347  H HG   . LEU A 1 80  ? 13.886  7.760   -2.056  1.00 0.00 ? 80  LEU A HG   3  
ATOM 4348  H HD11 . LEU A 1 80  ? 14.210  6.390   0.556   1.00 0.00 ? 80  LEU A HD11 3  
ATOM 4349  H HD12 . LEU A 1 80  ? 13.892  5.397   -0.865  1.00 0.00 ? 80  LEU A HD12 3  
ATOM 4350  H HD13 . LEU A 1 80  ? 12.759  6.669   -0.407  1.00 0.00 ? 80  LEU A HD13 3  
ATOM 4351  H HD21 . LEU A 1 80  ? 16.124  8.651   -0.581  1.00 0.00 ? 80  LEU A HD21 3  
ATOM 4352  H HD22 . LEU A 1 80  ? 14.814  8.378   0.568   1.00 0.00 ? 80  LEU A HD22 3  
ATOM 4353  H HD23 . LEU A 1 80  ? 14.572  9.457   -0.806  1.00 0.00 ? 80  LEU A HD23 3  
ATOM 4354  N N    . THR A 1 81  ? 15.626  5.452   -4.785  1.00 0.00 ? 81  THR A N    3  
ATOM 4355  C CA   . THR A 1 81  ? 14.916  4.774   -5.863  1.00 0.00 ? 81  THR A CA   3  
ATOM 4356  C C    . THR A 1 81  ? 13.891  3.789   -5.311  1.00 0.00 ? 81  THR A C    3  
ATOM 4357  O O    . THR A 1 81  ? 13.947  3.410   -4.141  1.00 0.00 ? 81  THR A O    3  
ATOM 4358  C CB   . THR A 1 81  ? 15.888  4.020   -6.789  1.00 0.00 ? 81  THR A CB   3  
ATOM 4359  O OG1  . THR A 1 81  ? 16.695  3.119   -6.023  1.00 0.00 ? 81  THR A OG1  3  
ATOM 4360  C CG2  . THR A 1 81  ? 16.781  4.993   -7.544  1.00 0.00 ? 81  THR A CG2  3  
ATOM 4361  H H    . THR A 1 81  ? 16.304  4.961   -4.276  1.00 0.00 ? 81  THR A H    3  
ATOM 4362  H HA   . THR A 1 81  ? 14.402  5.524   -6.447  1.00 0.00 ? 81  THR A HA   3  
ATOM 4363  H HB   . THR A 1 81  ? 15.311  3.453   -7.507  1.00 0.00 ? 81  THR A HB   3  
ATOM 4364  H HG1  . THR A 1 81  ? 17.406  3.607   -5.600  1.00 0.00 ? 81  THR A HG1  3  
ATOM 4365  H HG21 . THR A 1 81  ? 17.765  4.563   -7.660  1.00 0.00 ? 81  THR A HG21 3  
ATOM 4366  H HG22 . THR A 1 81  ? 16.855  5.917   -6.990  1.00 0.00 ? 81  THR A HG22 3  
ATOM 4367  H HG23 . THR A 1 81  ? 16.357  5.189   -8.517  1.00 0.00 ? 81  THR A HG23 3  
ATOM 4368  N N    . HIS A 1 82  ? 12.955  3.379   -6.161  1.00 0.00 ? 82  HIS A N    3  
ATOM 4369  C CA   . HIS A 1 82  ? 11.917  2.436   -5.758  1.00 0.00 ? 82  HIS A CA   3  
ATOM 4370  C C    . HIS A 1 82  ? 12.462  1.423   -4.756  1.00 0.00 ? 82  HIS A C    3  
ATOM 4371  O O    . HIS A 1 82  ? 11.931  1.276   -3.656  1.00 0.00 ? 82  HIS A O    3  
ATOM 4372  C CB   . HIS A 1 82  ? 11.356  1.710   -6.981  1.00 0.00 ? 82  HIS A CB   3  
ATOM 4373  C CG   . HIS A 1 82  ? 9.913   1.333   -6.844  1.00 0.00 ? 82  HIS A CG   3  
ATOM 4374  N ND1  . HIS A 1 82  ? 9.432   0.074   -7.138  1.00 0.00 ? 82  HIS A ND1  3  
ATOM 4375  C CD2  . HIS A 1 82  ? 8.843   2.058   -6.440  1.00 0.00 ? 82  HIS A CD2  3  
ATOM 4376  C CE1  . HIS A 1 82  ? 8.129   0.042   -6.923  1.00 0.00 ? 82  HIS A CE1  3  
ATOM 4377  N NE2  . HIS A 1 82  ? 7.747   1.232   -6.498  1.00 0.00 ? 82  HIS A NE2  3  
ATOM 4378  H H    . HIS A 1 82  ? 12.963  3.717   -7.081  1.00 0.00 ? 82  HIS A H    3  
ATOM 4379  H HA   . HIS A 1 82  ? 11.123  2.997   -5.289  1.00 0.00 ? 82  HIS A HA   3  
ATOM 4380  H HB2  . HIS A 1 82  ? 11.451  2.349   -7.846  1.00 0.00 ? 82  HIS A HB2  3  
ATOM 4381  H HB3  . HIS A 1 82  ? 11.922  0.804   -7.145  1.00 0.00 ? 82  HIS A HB3  3  
ATOM 4382  H HD1  . HIS A 1 82  ? 9.966   -0.681  -7.459  1.00 0.00 ? 82  HIS A HD1  3  
ATOM 4383  H HD2  . HIS A 1 82  ? 8.850   3.093   -6.130  1.00 0.00 ? 82  HIS A HD2  3  
ATOM 4384  H HE1  . HIS A 1 82  ? 7.485   -0.813  -7.068  1.00 0.00 ? 82  HIS A HE1  3  
ATOM 4385  H HE2  . HIS A 1 82  ? 6.819   1.506   -6.346  1.00 0.00 ? 82  HIS A HE2  3  
ATOM 4386  N N    . GLY A 1 83  ? 13.526  0.727   -5.144  1.00 0.00 ? 83  GLY A N    3  
ATOM 4387  C CA   . GLY A 1 83  ? 14.124  -0.264  -4.269  1.00 0.00 ? 83  GLY A CA   3  
ATOM 4388  C C    . GLY A 1 83  ? 14.424  0.288   -2.889  1.00 0.00 ? 83  GLY A C    3  
ATOM 4389  O O    . GLY A 1 83  ? 14.207  -0.387  -1.884  1.00 0.00 ? 83  GLY A O    3  
ATOM 4390  H H    . GLY A 1 83  ? 13.907  0.887   -6.033  1.00 0.00 ? 83  GLY A H    3  
ATOM 4391  H HA2  . GLY A 1 83  ? 13.447  -1.099  -4.172  1.00 0.00 ? 83  GLY A HA2  3  
ATOM 4392  H HA3  . GLY A 1 83  ? 15.046  -0.610  -4.713  1.00 0.00 ? 83  GLY A HA3  3  
ATOM 4393  N N    . GLU A 1 84  ? 14.927  1.518   -2.842  1.00 0.00 ? 84  GLU A N    3  
ATOM 4394  C CA   . GLU A 1 84  ? 15.260  2.158   -1.574  1.00 0.00 ? 84  GLU A CA   3  
ATOM 4395  C C    . GLU A 1 84  ? 13.996  2.573   -0.826  1.00 0.00 ? 84  GLU A C    3  
ATOM 4396  O O    . GLU A 1 84  ? 13.847  2.296   0.364   1.00 0.00 ? 84  GLU A O    3  
ATOM 4397  C CB   . GLU A 1 84  ? 16.150  3.380   -1.813  1.00 0.00 ? 84  GLU A CB   3  
ATOM 4398  C CG   . GLU A 1 84  ? 17.635  3.062   -1.801  1.00 0.00 ? 84  GLU A CG   3  
ATOM 4399  C CD   . GLU A 1 84  ? 18.181  2.871   -0.399  1.00 0.00 ? 84  GLU A CD   3  
ATOM 4400  O OE1  . GLU A 1 84  ? 18.154  1.725   0.096   1.00 0.00 ? 84  GLU A OE1  3  
ATOM 4401  O OE2  . GLU A 1 84  ? 18.633  3.867   0.203   1.00 0.00 ? 84  GLU A OE2  3  
ATOM 4402  H H    . GLU A 1 84  ? 15.078  2.005   -3.678  1.00 0.00 ? 84  GLU A H    3  
ATOM 4403  H HA   . GLU A 1 84  ? 15.801  1.442   -0.973  1.00 0.00 ? 84  GLU A HA   3  
ATOM 4404  H HB2  . GLU A 1 84  ? 15.901  3.809   -2.772  1.00 0.00 ? 84  GLU A HB2  3  
ATOM 4405  H HB3  . GLU A 1 84  ? 15.953  4.109   -1.040  1.00 0.00 ? 84  GLU A HB3  3  
ATOM 4406  H HG2  . GLU A 1 84  ? 17.801  2.154   -2.362  1.00 0.00 ? 84  GLU A HG2  3  
ATOM 4407  H HG3  . GLU A 1 84  ? 18.168  3.876   -2.271  1.00 0.00 ? 84  GLU A HG3  3  
ATOM 4408  N N    . ALA A 1 85  ? 13.090  3.240   -1.533  1.00 0.00 ? 85  ALA A N    3  
ATOM 4409  C CA   . ALA A 1 85  ? 11.839  3.692   -0.938  1.00 0.00 ? 85  ALA A CA   3  
ATOM 4410  C C    . ALA A 1 85  ? 11.091  2.535   -0.284  1.00 0.00 ? 85  ALA A C    3  
ATOM 4411  O O    . ALA A 1 85  ? 10.697  2.616   0.880   1.00 0.00 ? 85  ALA A O    3  
ATOM 4412  C CB   . ALA A 1 85  ? 10.965  4.360   -1.989  1.00 0.00 ? 85  ALA A CB   3  
ATOM 4413  H H    . ALA A 1 85  ? 13.266  3.430   -2.478  1.00 0.00 ? 85  ALA A H    3  
ATOM 4414  H HA   . ALA A 1 85  ? 12.075  4.427   -0.182  1.00 0.00 ? 85  ALA A HA   3  
ATOM 4415  H HB1  . ALA A 1 85  ? 9.948   4.012   -1.885  1.00 0.00 ? 85  ALA A HB1  3  
ATOM 4416  H HB2  . ALA A 1 85  ? 10.995  5.431   -1.854  1.00 0.00 ? 85  ALA A HB2  3  
ATOM 4417  H HB3  . ALA A 1 85  ? 11.332  4.111   -2.973  1.00 0.00 ? 85  ALA A HB3  3  
ATOM 4418  N N    . VAL A 1 86  ? 10.900  1.458   -1.039  1.00 0.00 ? 86  VAL A N    3  
ATOM 4419  C CA   . VAL A 1 86  ? 10.200  0.284   -0.533  1.00 0.00 ? 86  VAL A CA   3  
ATOM 4420  C C    . VAL A 1 86  ? 10.816  -0.202  0.775   1.00 0.00 ? 86  VAL A C    3  
ATOM 4421  O O    . VAL A 1 86  ? 10.158  -0.212  1.815   1.00 0.00 ? 86  VAL A O    3  
ATOM 4422  C CB   . VAL A 1 86  ? 10.222  -0.867  -1.556  1.00 0.00 ? 86  VAL A CB   3  
ATOM 4423  C CG1  . VAL A 1 86  ? 9.484   -2.081  -1.012  1.00 0.00 ? 86  VAL A CG1  3  
ATOM 4424  C CG2  . VAL A 1 86  ? 9.620   -0.416  -2.878  1.00 0.00 ? 86  VAL A CG2  3  
ATOM 4425  H H    . VAL A 1 86  ? 11.238  1.453   -1.959  1.00 0.00 ? 86  VAL A H    3  
ATOM 4426  H HA   . VAL A 1 86  ? 9.171   0.559   -0.355  1.00 0.00 ? 86  VAL A HA   3  
ATOM 4427  H HB   . VAL A 1 86  ? 11.251  -1.148  -1.730  1.00 0.00 ? 86  VAL A HB   3  
ATOM 4428  H HG11 . VAL A 1 86  ? 9.539   -2.887  -1.728  1.00 0.00 ? 86  VAL A HG11 3  
ATOM 4429  H HG12 . VAL A 1 86  ? 9.939   -2.392  -0.082  1.00 0.00 ? 86  VAL A HG12 3  
ATOM 4430  H HG13 . VAL A 1 86  ? 8.449   -1.824  -0.838  1.00 0.00 ? 86  VAL A HG13 3  
ATOM 4431  H HG21 . VAL A 1 86  ? 8.771   -1.039  -3.117  1.00 0.00 ? 86  VAL A HG21 3  
ATOM 4432  H HG22 . VAL A 1 86  ? 9.300   0.613   -2.796  1.00 0.00 ? 86  VAL A HG22 3  
ATOM 4433  H HG23 . VAL A 1 86  ? 10.361  -0.501  -3.659  1.00 0.00 ? 86  VAL A HG23 3  
ATOM 4434  N N    . GLN A 1 87  ? 12.082  -0.602  0.714   1.00 0.00 ? 87  GLN A N    3  
ATOM 4435  C CA   . GLN A 1 87  ? 12.786  -1.088  1.894   1.00 0.00 ? 87  GLN A CA   3  
ATOM 4436  C C    . GLN A 1 87  ? 12.619  -0.124  3.064   1.00 0.00 ? 87  GLN A C    3  
ATOM 4437  O O    . GLN A 1 87  ? 12.748  -0.512  4.226   1.00 0.00 ? 87  GLN A O    3  
ATOM 4438  C CB   . GLN A 1 87  ? 14.272  -1.281  1.584   1.00 0.00 ? 87  GLN A CB   3  
ATOM 4439  C CG   . GLN A 1 87  ? 14.544  -2.378  0.567   1.00 0.00 ? 87  GLN A CG   3  
ATOM 4440  C CD   . GLN A 1 87  ? 13.767  -3.647  0.856   1.00 0.00 ? 87  GLN A CD   3  
ATOM 4441  O OE1  . GLN A 1 87  ? 14.253  -4.543  1.545   1.00 0.00 ? 87  GLN A OE1  3  
ATOM 4442  N NE2  . GLN A 1 87  ? 12.551  -3.730  0.329   1.00 0.00 ? 87  GLN A NE2  3  
ATOM 4443  H H    . GLN A 1 87  ? 12.552  -0.569  -0.144  1.00 0.00 ? 87  GLN A H    3  
ATOM 4444  H HA   . GLN A 1 87  ? 12.358  -2.041  2.166   1.00 0.00 ? 87  GLN A HA   3  
ATOM 4445  H HB2  . GLN A 1 87  ? 14.669  -0.354  1.198   1.00 0.00 ? 87  GLN A HB2  3  
ATOM 4446  H HB3  . GLN A 1 87  ? 14.788  -1.532  2.499   1.00 0.00 ? 87  GLN A HB3  3  
ATOM 4447  H HG2  . GLN A 1 87  ? 14.266  -2.019  -0.413  1.00 0.00 ? 87  GLN A HG2  3  
ATOM 4448  H HG3  . GLN A 1 87  ? 15.599  -2.608  0.580   1.00 0.00 ? 87  GLN A HG3  3  
ATOM 4449  H HE21 . GLN A 1 87  ? 12.229  -2.977  -0.211  1.00 0.00 ? 87  GLN A HE21 3  
ATOM 4450  H HE22 . GLN A 1 87  ? 12.027  -4.539  0.498   1.00 0.00 ? 87  GLN A HE22 3  
ATOM 4451  N N    . LEU A 1 88  ? 12.333  1.135   2.750   1.00 0.00 ? 88  LEU A N    3  
ATOM 4452  C CA   . LEU A 1 88  ? 12.149  2.156   3.775   1.00 0.00 ? 88  LEU A CA   3  
ATOM 4453  C C    . LEU A 1 88  ? 10.800  1.994   4.469   1.00 0.00 ? 88  LEU A C    3  
ATOM 4454  O O    . LEU A 1 88  ? 10.665  2.270   5.662   1.00 0.00 ? 88  LEU A O    3  
ATOM 4455  C CB   . LEU A 1 88  ? 12.253  3.551   3.158   1.00 0.00 ? 88  LEU A CB   3  
ATOM 4456  C CG   . LEU A 1 88  ? 12.805  4.649   4.068   1.00 0.00 ? 88  LEU A CG   3  
ATOM 4457  C CD1  . LEU A 1 88  ? 12.901  5.968   3.317   1.00 0.00 ? 88  LEU A CD1  3  
ATOM 4458  C CD2  . LEU A 1 88  ? 11.935  4.801   5.308   1.00 0.00 ? 88  LEU A CD2  3  
ATOM 4459  H H    . LEU A 1 88  ? 12.243  1.384   1.807   1.00 0.00 ? 88  LEU A H    3  
ATOM 4460  H HA   . LEU A 1 88  ? 12.933  2.035   4.508   1.00 0.00 ? 88  LEU A HA   3  
ATOM 4461  H HB2  . LEU A 1 88  ? 12.897  3.483   2.295   1.00 0.00 ? 88  LEU A HB2  3  
ATOM 4462  H HB3  . LEU A 1 88  ? 11.263  3.848   2.843   1.00 0.00 ? 88  LEU A HB3  3  
ATOM 4463  H HG   . LEU A 1 88  ? 13.801  4.375   4.389   1.00 0.00 ? 88  LEU A HG   3  
ATOM 4464  H HD11 . LEU A 1 88  ? 12.751  5.793   2.263   1.00 0.00 ? 88  LEU A HD11 3  
ATOM 4465  H HD12 . LEU A 1 88  ? 13.878  6.401   3.475   1.00 0.00 ? 88  LEU A HD12 3  
ATOM 4466  H HD13 . LEU A 1 88  ? 12.144  6.646   3.683   1.00 0.00 ? 88  LEU A HD13 3  
ATOM 4467  H HD21 . LEU A 1 88  ? 12.158  4.004   6.003   1.00 0.00 ? 88  LEU A HD21 3  
ATOM 4468  H HD22 . LEU A 1 88  ? 10.894  4.751   5.025   1.00 0.00 ? 88  LEU A HD22 3  
ATOM 4469  H HD23 . LEU A 1 88  ? 12.137  5.753   5.775   1.00 0.00 ? 88  LEU A HD23 3  
ATOM 4470  N N    . LEU A 1 89  ? 9.803   1.543   3.715   1.00 0.00 ? 89  LEU A N    3  
ATOM 4471  C CA   . LEU A 1 89  ? 8.464   1.342   4.257   1.00 0.00 ? 89  LEU A CA   3  
ATOM 4472  C C    . LEU A 1 89  ? 8.398   0.060   5.082   1.00 0.00 ? 89  LEU A C    3  
ATOM 4473  O O    . LEU A 1 89  ? 7.658   -0.020  6.063   1.00 0.00 ? 89  LEU A O    3  
ATOM 4474  C CB   . LEU A 1 89  ? 7.437   1.287   3.125   1.00 0.00 ? 89  LEU A CB   3  
ATOM 4475  C CG   . LEU A 1 89  ? 7.164   -0.097  2.533   1.00 0.00 ? 89  LEU A CG   3  
ATOM 4476  C CD1  . LEU A 1 89  ? 6.182   -0.866  3.404   1.00 0.00 ? 89  LEU A CD1  3  
ATOM 4477  C CD2  . LEU A 1 89  ? 6.636   0.026   1.111   1.00 0.00 ? 89  LEU A CD2  3  
ATOM 4478  H H    . LEU A 1 89  ? 9.971   1.340   2.771   1.00 0.00 ? 89  LEU A H    3  
ATOM 4479  H HA   . LEU A 1 89  ? 8.237   2.180   4.898   1.00 0.00 ? 89  LEU A HA   3  
ATOM 4480  H HB2  . LEU A 1 89  ? 6.504   1.673   3.506   1.00 0.00 ? 89  LEU A HB2  3  
ATOM 4481  H HB3  . LEU A 1 89  ? 7.790   1.925   2.328   1.00 0.00 ? 89  LEU A HB3  3  
ATOM 4482  H HG   . LEU A 1 89  ? 8.089   -0.656  2.500   1.00 0.00 ? 89  LEU A HG   3  
ATOM 4483  H HD11 . LEU A 1 89  ? 5.282   -1.064  2.842   1.00 0.00 ? 89  LEU A HD11 3  
ATOM 4484  H HD12 . LEU A 1 89  ? 5.940   -0.279  4.277   1.00 0.00 ? 89  LEU A HD12 3  
ATOM 4485  H HD13 . LEU A 1 89  ? 6.629   -1.800  3.711   1.00 0.00 ? 89  LEU A HD13 3  
ATOM 4486  H HD21 . LEU A 1 89  ? 6.197   1.004   0.974   1.00 0.00 ? 89  LEU A HD21 3  
ATOM 4487  H HD22 . LEU A 1 89  ? 5.885   -0.732  0.939   1.00 0.00 ? 89  LEU A HD22 3  
ATOM 4488  H HD23 . LEU A 1 89  ? 7.448   -0.106  0.413   1.00 0.00 ? 89  LEU A HD23 3  
ATOM 4489  N N    . ARG A 1 90  ? 9.177   -0.938  4.679   1.00 0.00 ? 90  ARG A N    3  
ATOM 4490  C CA   . ARG A 1 90  ? 9.207   -2.215  5.382   1.00 0.00 ? 90  ARG A CA   3  
ATOM 4491  C C    . ARG A 1 90  ? 10.256  -2.201  6.490   1.00 0.00 ? 90  ARG A C    3  
ATOM 4492  O O    . ARG A 1 90  ? 10.394  -3.167  7.239   1.00 0.00 ? 90  ARG A O    3  
ATOM 4493  C CB   . ARG A 1 90  ? 9.499   -3.353  4.402   1.00 0.00 ? 90  ARG A CB   3  
ATOM 4494  C CG   . ARG A 1 90  ? 10.754  -3.136  3.572   1.00 0.00 ? 90  ARG A CG   3  
ATOM 4495  C CD   . ARG A 1 90  ? 11.360  -4.456  3.123   1.00 0.00 ? 90  ARG A CD   3  
ATOM 4496  N NE   . ARG A 1 90  ? 11.657  -5.334  4.251   1.00 0.00 ? 90  ARG A NE   3  
ATOM 4497  C CZ   . ARG A 1 90  ? 11.887  -6.637  4.128   1.00 0.00 ? 90  ARG A CZ   3  
ATOM 4498  N NH1  . ARG A 1 90  ? 11.854  -7.209  2.932   1.00 0.00 ? 90  ARG A NH1  3  
ATOM 4499  N NH2  . ARG A 1 90  ? 12.150  -7.370  5.202   1.00 0.00 ? 90  ARG A NH2  3  
ATOM 4500  H H    . ARG A 1 90  ? 9.744   -0.813  3.890   1.00 0.00 ? 90  ARG A H    3  
ATOM 4501  H HA   . ARG A 1 90  ? 8.235   -2.373  5.824   1.00 0.00 ? 90  ARG A HA   3  
ATOM 4502  H HB2  . ARG A 1 90  ? 9.618   -4.271  4.960   1.00 0.00 ? 90  ARG A HB2  3  
ATOM 4503  H HB3  . ARG A 1 90  ? 8.662   -3.456  3.729   1.00 0.00 ? 90  ARG A HB3  3  
ATOM 4504  H HG2  . ARG A 1 90  ? 10.500  -2.553  2.699   1.00 0.00 ? 90  ARG A HG2  3  
ATOM 4505  H HG3  . ARG A 1 90  ? 11.479  -2.600  4.167   1.00 0.00 ? 90  ARG A HG3  3  
ATOM 4506  H HD2  . ARG A 1 90  ? 10.662  -4.953  2.467   1.00 0.00 ? 90  ARG A HD2  3  
ATOM 4507  H HD3  . ARG A 1 90  ? 12.275  -4.252  2.587   1.00 0.00 ? 90  ARG A HD3  3  
ATOM 4508  H HE   . ARG A 1 90  ? 11.686  -4.932  5.144   1.00 0.00 ? 90  ARG A HE   3  
ATOM 4509  H HH11 . ARG A 1 90  ? 11.657  -6.659  2.121   1.00 0.00 ? 90  ARG A HH11 3  
ATOM 4510  H HH12 . ARG A 1 90  ? 12.028  -8.190  2.842   1.00 0.00 ? 90  ARG A HH12 3  
ATOM 4511  H HH21 . ARG A 1 90  ? 12.176  -6.942  6.105   1.00 0.00 ? 90  ARG A HH21 3  
ATOM 4512  H HH22 . ARG A 1 90  ? 12.322  -8.350  5.109   1.00 0.00 ? 90  ARG A HH22 3  
ATOM 4513  N N    . SER A 1 91  ? 10.993  -1.099  6.586   1.00 0.00 ? 91  SER A N    3  
ATOM 4514  C CA   . SER A 1 91  ? 12.033  -0.961  7.599   1.00 0.00 ? 91  SER A CA   3  
ATOM 4515  C C    . SER A 1 91  ? 11.475  -0.319  8.866   1.00 0.00 ? 91  SER A C    3  
ATOM 4516  O O    . SER A 1 91  ? 12.171  0.423   9.559   1.00 0.00 ? 91  SER A O    3  
ATOM 4517  C CB   . SER A 1 91  ? 13.193  -0.124  7.058   1.00 0.00 ? 91  SER A CB   3  
ATOM 4518  O OG   . SER A 1 91  ? 14.153  -0.941  6.411   1.00 0.00 ? 91  SER A OG   3  
ATOM 4519  H H    . SER A 1 91  ? 10.835  -0.363  5.959   1.00 0.00 ? 91  SER A H    3  
ATOM 4520  H HA   . SER A 1 91  ? 12.394  -1.950  7.840   1.00 0.00 ? 91  SER A HA   3  
ATOM 4521  H HB2  . SER A 1 91  ? 12.815  0.596   6.349   1.00 0.00 ? 91  SER A HB2  3  
ATOM 4522  H HB3  . SER A 1 91  ? 13.672  0.394   7.877   1.00 0.00 ? 91  SER A HB3  3  
ATOM 4523  H HG   . SER A 1 91  ? 15.030  -0.575  6.549   1.00 0.00 ? 91  SER A HG   3  
ATOM 4524  N N    . VAL A 1 92  ? 10.212  -0.611  9.163   1.00 0.00 ? 92  VAL A N    3  
ATOM 4525  C CA   . VAL A 1 92  ? 9.559   -0.064  10.346  1.00 0.00 ? 92  VAL A CA   3  
ATOM 4526  C C    . VAL A 1 92  ? 9.252   -1.160  11.360  1.00 0.00 ? 92  VAL A C    3  
ATOM 4527  O O    . VAL A 1 92  ? 8.937   -2.291  10.991  1.00 0.00 ? 92  VAL A O    3  
ATOM 4528  C CB   . VAL A 1 92  ? 8.251   0.663   9.980   1.00 0.00 ? 92  VAL A CB   3  
ATOM 4529  C CG1  . VAL A 1 92  ? 7.410   -0.190  9.044   1.00 0.00 ? 92  VAL A CG1  3  
ATOM 4530  C CG2  . VAL A 1 92  ? 7.471   1.020   11.236  1.00 0.00 ? 92  VAL A CG2  3  
ATOM 4531  H H    . VAL A 1 92  ? 9.708   -1.208  8.572   1.00 0.00 ? 92  VAL A H    3  
ATOM 4532  H HA   . VAL A 1 92  ? 10.230  0.652   10.797  1.00 0.00 ? 92  VAL A HA   3  
ATOM 4533  H HB   . VAL A 1 92  ? 8.504   1.579   9.467   1.00 0.00 ? 92  VAL A HB   3  
ATOM 4534  H HG11 . VAL A 1 92  ? 7.082   -1.079  9.564   1.00 0.00 ? 92  VAL A HG11 3  
ATOM 4535  H HG12 . VAL A 1 92  ? 6.549   0.375   8.717   1.00 0.00 ? 92  VAL A HG12 3  
ATOM 4536  H HG13 . VAL A 1 92  ? 8.002   -0.474  8.186   1.00 0.00 ? 92  VAL A HG13 3  
ATOM 4537  H HG21 . VAL A 1 92  ? 6.683   0.297   11.387  1.00 0.00 ? 92  VAL A HG21 3  
ATOM 4538  H HG22 . VAL A 1 92  ? 8.135   1.011   12.088  1.00 0.00 ? 92  VAL A HG22 3  
ATOM 4539  H HG23 . VAL A 1 92  ? 7.041   2.004   11.126  1.00 0.00 ? 92  VAL A HG23 3  
ATOM 4540  N N    . GLY A 1 93  ? 9.345   -0.817  12.641  1.00 0.00 ? 93  GLY A N    3  
ATOM 4541  C CA   . GLY A 1 93  ? 9.073   -1.783  13.689  1.00 0.00 ? 93  GLY A CA   3  
ATOM 4542  C C    . GLY A 1 93  ? 7.652   -2.308  13.640  1.00 0.00 ? 93  GLY A C    3  
ATOM 4543  O O    . GLY A 1 93  ? 7.345   -3.215  12.866  1.00 0.00 ? 93  GLY A O    3  
ATOM 4544  H H    . GLY A 1 93  ? 9.600   0.100   12.876  1.00 0.00 ? 93  GLY A H    3  
ATOM 4545  H HA2  . GLY A 1 93  ? 9.757   -2.612  13.585  1.00 0.00 ? 93  GLY A HA2  3  
ATOM 4546  H HA3  . GLY A 1 93  ? 9.237   -1.312  14.648  1.00 0.00 ? 93  GLY A HA3  3  
ATOM 4547  N N    . ASP A 1 94  ? 6.783   -1.739  14.468  1.00 0.00 ? 94  ASP A N    3  
ATOM 4548  C CA   . ASP A 1 94  ? 5.387   -2.155  14.516  1.00 0.00 ? 94  ASP A CA   3  
ATOM 4549  C C    . ASP A 1 94  ? 4.465   -1.019  14.084  1.00 0.00 ? 94  ASP A C    3  
ATOM 4550  O O    . ASP A 1 94  ? 3.257   -1.206  13.936  1.00 0.00 ? 94  ASP A O    3  
ATOM 4551  C CB   . ASP A 1 94  ? 5.019   -2.619  15.926  1.00 0.00 ? 94  ASP A CB   3  
ATOM 4552  C CG   . ASP A 1 94  ? 6.113   -3.451  16.566  1.00 0.00 ? 94  ASP A CG   3  
ATOM 4553  O OD1  . ASP A 1 94  ? 6.796   -4.198  15.834  1.00 0.00 ? 94  ASP A OD1  3  
ATOM 4554  O OD2  . ASP A 1 94  ? 6.287   -3.354  17.798  1.00 0.00 ? 94  ASP A OD2  3  
ATOM 4555  H H    . ASP A 1 94  ? 7.089   -1.020  15.061  1.00 0.00 ? 94  ASP A H    3  
ATOM 4556  H HA   . ASP A 1 94  ? 5.264   -2.981  13.832  1.00 0.00 ? 94  ASP A HA   3  
ATOM 4557  H HB2  . ASP A 1 94  ? 4.841   -1.754  16.548  1.00 0.00 ? 94  ASP A HB2  3  
ATOM 4558  H HB3  . ASP A 1 94  ? 4.119   -3.215  15.879  1.00 0.00 ? 94  ASP A HB3  3  
ATOM 4559  N N    . THR A 1 95  ? 5.043   0.162   13.885  1.00 0.00 ? 95  THR A N    3  
ATOM 4560  C CA   . THR A 1 95  ? 4.275   1.329   13.472  1.00 0.00 ? 95  THR A CA   3  
ATOM 4561  C C    . THR A 1 95  ? 5.160   2.348   12.764  1.00 0.00 ? 95  THR A C    3  
ATOM 4562  O O    . THR A 1 95  ? 6.227   2.710   13.261  1.00 0.00 ? 95  THR A O    3  
ATOM 4563  C CB   . THR A 1 95  ? 3.593   2.007   14.676  1.00 0.00 ? 95  THR A CB   3  
ATOM 4564  O OG1  . THR A 1 95  ? 2.915   1.027   15.471  1.00 0.00 ? 95  THR A OG1  3  
ATOM 4565  C CG2  . THR A 1 95  ? 2.603   3.064   14.213  1.00 0.00 ? 95  THR A CG2  3  
ATOM 4566  H H    . THR A 1 95  ? 6.010   0.248   14.019  1.00 0.00 ? 95  THR A H    3  
ATOM 4567  H HA   . THR A 1 95  ? 3.506   0.998   12.789  1.00 0.00 ? 95  THR A HA   3  
ATOM 4568  H HB   . THR A 1 95  ? 4.352   2.485   15.278  1.00 0.00 ? 95  THR A HB   3  
ATOM 4569  H HG1  . THR A 1 95  ? 2.245   1.457   16.007  1.00 0.00 ? 95  THR A HG1  3  
ATOM 4570  H HG21 . THR A 1 95  ? 1.839   2.601   13.605  1.00 0.00 ? 95  THR A HG21 3  
ATOM 4571  H HG22 . THR A 1 95  ? 3.121   3.813   13.632  1.00 0.00 ? 95  THR A HG22 3  
ATOM 4572  H HG23 . THR A 1 95  ? 2.145   3.529   15.073  1.00 0.00 ? 95  THR A HG23 3  
ATOM 4573  N N    . LEU A 1 96  ? 4.710   2.809   11.602  1.00 0.00 ? 96  LEU A N    3  
ATOM 4574  C CA   . LEU A 1 96  ? 5.462   3.788   10.825  1.00 0.00 ? 96  LEU A CA   3  
ATOM 4575  C C    . LEU A 1 96  ? 4.680   5.091   10.689  1.00 0.00 ? 96  LEU A C    3  
ATOM 4576  O O    . LEU A 1 96  ? 3.491   5.151   11.004  1.00 0.00 ? 96  LEU A O    3  
ATOM 4577  C CB   . LEU A 1 96  ? 5.787   3.228   9.439   1.00 0.00 ? 96  LEU A CB   3  
ATOM 4578  C CG   . LEU A 1 96  ? 4.779   3.545   8.334   1.00 0.00 ? 96  LEU A CG   3  
ATOM 4579  C CD1  . LEU A 1 96  ? 5.374   3.243   6.967   1.00 0.00 ? 96  LEU A CD1  3  
ATOM 4580  C CD2  . LEU A 1 96  ? 3.493   2.759   8.543   1.00 0.00 ? 96  LEU A CD2  3  
ATOM 4581  H H    . LEU A 1 96  ? 3.853   2.483   11.258  1.00 0.00 ? 96  LEU A H    3  
ATOM 4582  H HA   . LEU A 1 96  ? 6.385   3.989   11.349  1.00 0.00 ? 96  LEU A HA   3  
ATOM 4583  H HB2  . LEU A 1 96  ? 6.744   3.626   9.138   1.00 0.00 ? 96  LEU A HB2  3  
ATOM 4584  H HB3  . LEU A 1 96  ? 5.857   2.153   9.526   1.00 0.00 ? 96  LEU A HB3  3  
ATOM 4585  H HG   . LEU A 1 96  ? 4.538   4.599   8.367   1.00 0.00 ? 96  LEU A HG   3  
ATOM 4586  H HD11 . LEU A 1 96  ? 4.588   3.234   6.227   1.00 0.00 ? 96  LEU A HD11 3  
ATOM 4587  H HD12 . LEU A 1 96  ? 5.858   2.279   6.990   1.00 0.00 ? 96  LEU A HD12 3  
ATOM 4588  H HD13 . LEU A 1 96  ? 6.098   4.004   6.714   1.00 0.00 ? 96  LEU A HD13 3  
ATOM 4589  H HD21 . LEU A 1 96  ? 2.907   2.781   7.636   1.00 0.00 ? 96  LEU A HD21 3  
ATOM 4590  H HD22 . LEU A 1 96  ? 2.926   3.205   9.348   1.00 0.00 ? 96  LEU A HD22 3  
ATOM 4591  H HD23 . LEU A 1 96  ? 3.733   1.737   8.794   1.00 0.00 ? 96  LEU A HD23 3  
ATOM 4592  N N    . THR A 1 97  ? 5.356   6.134   10.215  1.00 0.00 ? 97  THR A N    3  
ATOM 4593  C CA   . THR A 1 97  ? 4.725   7.436   10.036  1.00 0.00 ? 97  THR A CA   3  
ATOM 4594  C C    . THR A 1 97  ? 4.711   7.842   8.567   1.00 0.00 ? 97  THR A C    3  
ATOM 4595  O O    . THR A 1 97  ? 5.700   8.356   8.045   1.00 0.00 ? 97  THR A O    3  
ATOM 4596  C CB   . THR A 1 97  ? 5.445   8.526   10.852  1.00 0.00 ? 97  THR A CB   3  
ATOM 4597  O OG1  . THR A 1 97  ? 5.913   7.982   12.091  1.00 0.00 ? 97  THR A OG1  3  
ATOM 4598  C CG2  . THR A 1 97  ? 4.516   9.699   11.126  1.00 0.00 ? 97  THR A CG2  3  
ATOM 4599  H H    . THR A 1 97  ? 6.301   6.024   9.982   1.00 0.00 ? 97  THR A H    3  
ATOM 4600  H HA   . THR A 1 97  ? 3.707   7.364   10.390  1.00 0.00 ? 97  THR A HA   3  
ATOM 4601  H HB   . THR A 1 97  ? 6.291   8.881   10.281  1.00 0.00 ? 97  THR A HB   3  
ATOM 4602  H HG1  . THR A 1 97  ? 6.140   8.698   12.690  1.00 0.00 ? 97  THR A HG1  3  
ATOM 4603  H HG21 . THR A 1 97  ? 4.716   10.095  12.110  1.00 0.00 ? 97  THR A HG21 3  
ATOM 4604  H HG22 . THR A 1 97  ? 3.490   9.366   11.073  1.00 0.00 ? 97  THR A HG22 3  
ATOM 4605  H HG23 . THR A 1 97  ? 4.683   10.469  10.388  1.00 0.00 ? 97  THR A HG23 3  
ATOM 4606  N N    . VAL A 1 98  ? 3.582   7.609   7.904   1.00 0.00 ? 98  VAL A N    3  
ATOM 4607  C CA   . VAL A 1 98  ? 3.439   7.953   6.495   1.00 0.00 ? 98  VAL A CA   3  
ATOM 4608  C C    . VAL A 1 98  ? 2.782   9.318   6.326   1.00 0.00 ? 98  VAL A C    3  
ATOM 4609  O O    . VAL A 1 98  ? 1.732   9.591   6.910   1.00 0.00 ? 98  VAL A O    3  
ATOM 4610  C CB   . VAL A 1 98  ? 2.606   6.899   5.741   1.00 0.00 ? 98  VAL A CB   3  
ATOM 4611  C CG1  . VAL A 1 98  ? 3.059   5.495   6.113   1.00 0.00 ? 98  VAL A CG1  3  
ATOM 4612  C CG2  . VAL A 1 98  ? 1.125   7.084   6.031   1.00 0.00 ? 98  VAL A CG2  3  
ATOM 4613  H H    . VAL A 1 98  ? 2.828   7.197   8.374   1.00 0.00 ? 98  VAL A H    3  
ATOM 4614  H HA   . VAL A 1 98  ? 4.426   7.982   6.056   1.00 0.00 ? 98  VAL A HA   3  
ATOM 4615  H HB   . VAL A 1 98  ? 2.764   7.035   4.682   1.00 0.00 ? 98  VAL A HB   3  
ATOM 4616  H HG11 . VAL A 1 98  ? 2.379   5.079   6.841   1.00 0.00 ? 98  VAL A HG11 3  
ATOM 4617  H HG12 . VAL A 1 98  ? 3.069   4.873   5.230   1.00 0.00 ? 98  VAL A HG12 3  
ATOM 4618  H HG13 . VAL A 1 98  ? 4.053   5.538   6.535   1.00 0.00 ? 98  VAL A HG13 3  
ATOM 4619  H HG21 . VAL A 1 98  ? 0.714   7.816   5.351   1.00 0.00 ? 98  VAL A HG21 3  
ATOM 4620  H HG22 . VAL A 1 98  ? 0.611   6.142   5.899   1.00 0.00 ? 98  VAL A HG22 3  
ATOM 4621  H HG23 . VAL A 1 98  ? 0.996   7.424   7.048   1.00 0.00 ? 98  VAL A HG23 3  
ATOM 4622  N N    . LEU A 1 99  ? 3.406   10.174  5.524   1.00 0.00 ? 99  LEU A N    3  
ATOM 4623  C CA   . LEU A 1 99  ? 2.882   11.513  5.277   1.00 0.00 ? 99  LEU A CA   3  
ATOM 4624  C C    . LEU A 1 99  ? 2.134   11.569  3.949   1.00 0.00 ? 99  LEU A C    3  
ATOM 4625  O O    . LEU A 1 99  ? 2.155   12.585  3.255   1.00 0.00 ? 99  LEU A O    3  
ATOM 4626  C CB   . LEU A 1 99  ? 4.020   12.536  5.279   1.00 0.00 ? 99  LEU A CB   3  
ATOM 4627  C CG   . LEU A 1 99  ? 3.601   14.006  5.301   1.00 0.00 ? 99  LEU A CG   3  
ATOM 4628  C CD1  . LEU A 1 99  ? 2.700   14.286  6.495   1.00 0.00 ? 99  LEU A CD1  3  
ATOM 4629  C CD2  . LEU A 1 99  ? 4.825   14.909  5.331   1.00 0.00 ? 99  LEU A CD2  3  
ATOM 4630  H H    . LEU A 1 99  ? 4.239   9.900   5.087   1.00 0.00 ? 99  LEU A H    3  
ATOM 4631  H HA   . LEU A 1 99  ? 2.194   11.751  6.075   1.00 0.00 ? 99  LEU A HA   3  
ATOM 4632  H HB2  . LEU A 1 99  ? 4.628   12.352  6.151   1.00 0.00 ? 99  LEU A HB2  3  
ATOM 4633  H HB3  . LEU A 1 99  ? 4.611   12.372  4.389   1.00 0.00 ? 99  LEU A HB3  3  
ATOM 4634  H HG   . LEU A 1 99  ? 3.041   14.228  4.403   1.00 0.00 ? 99  LEU A HG   3  
ATOM 4635  H HD11 . LEU A 1 99  ? 1.679   14.049  6.238   1.00 0.00 ? 99  LEU A HD11 3  
ATOM 4636  H HD12 . LEU A 1 99  ? 2.772   15.330  6.762   1.00 0.00 ? 99  LEU A HD12 3  
ATOM 4637  H HD13 . LEU A 1 99  ? 3.013   13.679  7.331   1.00 0.00 ? 99  LEU A HD13 3  
ATOM 4638  H HD21 . LEU A 1 99  ? 5.474   14.661  4.504   1.00 0.00 ? 99  LEU A HD21 3  
ATOM 4639  H HD22 . LEU A 1 99  ? 5.356   14.766  6.261   1.00 0.00 ? 99  LEU A HD22 3  
ATOM 4640  H HD23 . LEU A 1 99  ? 4.514   15.940  5.248   1.00 0.00 ? 99  LEU A HD23 3  
ATOM 4641  N N    . VAL A 1 100 ? 1.472   10.470  3.602   1.00 0.00 ? 100 VAL A N    3  
ATOM 4642  C CA   . VAL A 1 100 ? 0.714   10.394  2.359   1.00 0.00 ? 100 VAL A CA   3  
ATOM 4643  C C    . VAL A 1 100 ? -0.527  11.277  2.417   1.00 0.00 ? 100 VAL A C    3  
ATOM 4644  O O    . VAL A 1 100 ? -0.855  11.837  3.464   1.00 0.00 ? 100 VAL A O    3  
ATOM 4645  C CB   . VAL A 1 100 ? 0.288   8.947   2.048   1.00 0.00 ? 100 VAL A CB   3  
ATOM 4646  C CG1  . VAL A 1 100 ? 1.444   7.988   2.283   1.00 0.00 ? 100 VAL A CG1  3  
ATOM 4647  C CG2  . VAL A 1 100 ? -0.919  8.556   2.887   1.00 0.00 ? 100 VAL A CG2  3  
ATOM 4648  H H    . VAL A 1 100 ? 1.493   9.691   4.197   1.00 0.00 ? 100 VAL A H    3  
ATOM 4649  H HA   . VAL A 1 100 ? 1.352   10.739  1.558   1.00 0.00 ? 100 VAL A HA   3  
ATOM 4650  H HB   . VAL A 1 100 ? 0.009   8.891   1.006   1.00 0.00 ? 100 VAL A HB   3  
ATOM 4651  H HG11 . VAL A 1 100 ? 1.909   7.747   1.338   1.00 0.00 ? 100 VAL A HG11 3  
ATOM 4652  H HG12 . VAL A 1 100 ? 2.170   8.451   2.935   1.00 0.00 ? 100 VAL A HG12 3  
ATOM 4653  H HG13 . VAL A 1 100 ? 1.073   7.083   2.742   1.00 0.00 ? 100 VAL A HG13 3  
ATOM 4654  H HG21 . VAL A 1 100 ? -0.755  8.854   3.912   1.00 0.00 ? 100 VAL A HG21 3  
ATOM 4655  H HG22 . VAL A 1 100 ? -1.800  9.052   2.505   1.00 0.00 ? 100 VAL A HG22 3  
ATOM 4656  H HG23 . VAL A 1 100 ? -1.060  7.487   2.840   1.00 0.00 ? 100 VAL A HG23 3  
ATOM 4657  N N    . CYS A 1 101 ? -1.215  11.397  1.287   1.00 0.00 ? 101 CYS A N    3  
ATOM 4658  C CA   . CYS A 1 101 ? -2.422  12.212  1.209   1.00 0.00 ? 101 CYS A CA   3  
ATOM 4659  C C    . CYS A 1 101 ? -3.209  11.898  -0.058  1.00 0.00 ? 101 CYS A C    3  
ATOM 4660  O O    . CYS A 1 101 ? -2.714  11.216  -0.956  1.00 0.00 ? 101 CYS A O    3  
ATOM 4661  C CB   . CYS A 1 101 ? -2.061  13.698  1.245   1.00 0.00 ? 101 CYS A CB   3  
ATOM 4662  S SG   . CYS A 1 101 ? -1.507  14.362  -0.343  1.00 0.00 ? 101 CYS A SG   3  
ATOM 4663  H H    . CYS A 1 101 ? -0.904  10.927  0.485   1.00 0.00 ? 101 CYS A H    3  
ATOM 4664  H HA   . CYS A 1 101 ? -3.034  11.979  2.066   1.00 0.00 ? 101 CYS A HA   3  
ATOM 4665  H HB2  . CYS A 1 101 ? -2.929  14.264  1.551   1.00 0.00 ? 101 CYS A HB2  3  
ATOM 4666  H HB3  . CYS A 1 101 ? -1.268  13.851  1.962   1.00 0.00 ? 101 CYS A HB3  3  
ATOM 4667  H HG   . CYS A 1 101 ? -1.090  15.603  -0.144  1.00 0.00 ? 101 CYS A HG   3  
ATOM 4668  N N    . ASP A 1 102 ? -4.439  12.397  -0.124  1.00 0.00 ? 102 ASP A N    3  
ATOM 4669  C CA   . ASP A 1 102 ? -5.296  12.169  -1.281  1.00 0.00 ? 102 ASP A CA   3  
ATOM 4670  C C    . ASP A 1 102 ? -4.580  12.555  -2.572  1.00 0.00 ? 102 ASP A C    3  
ATOM 4671  O O    . ASP A 1 102 ? -4.276  13.725  -2.799  1.00 0.00 ? 102 ASP A O    3  
ATOM 4672  C CB   . ASP A 1 102 ? -6.595  12.966  -1.145  1.00 0.00 ? 102 ASP A CB   3  
ATOM 4673  C CG   . ASP A 1 102 ? -7.204  12.849  0.238   1.00 0.00 ? 102 ASP A CG   3  
ATOM 4674  O OD1  . ASP A 1 102 ? -6.791  13.614  1.135   1.00 0.00 ? 102 ASP A OD1  3  
ATOM 4675  O OD2  . ASP A 1 102 ? -8.094  11.993  0.424   1.00 0.00 ? 102 ASP A OD2  3  
ATOM 4676  H H    . ASP A 1 102 ? -4.777  12.933  0.624   1.00 0.00 ? 102 ASP A H    3  
ATOM 4677  H HA   . ASP A 1 102 ? -5.532  11.117  -1.316  1.00 0.00 ? 102 ASP A HA   3  
ATOM 4678  H HB2  . ASP A 1 102 ? -6.392  14.009  -1.342  1.00 0.00 ? 102 ASP A HB2  3  
ATOM 4679  H HB3  . ASP A 1 102 ? -7.311  12.600  -1.867  1.00 0.00 ? 102 ASP A HB3  3  
ATOM 4680  N N    . GLY A 1 103 ? -4.314  11.562  -3.415  1.00 0.00 ? 103 GLY A N    3  
ATOM 4681  C CA   . GLY A 1 103 ? -3.635  11.817  -4.672  1.00 0.00 ? 103 GLY A CA   3  
ATOM 4682  C C    . GLY A 1 103 ? -4.561  11.700  -5.865  1.00 0.00 ? 103 GLY A C    3  
ATOM 4683  O O    . GLY A 1 103 ? -4.441  12.454  -6.831  1.00 0.00 ? 103 GLY A O    3  
ATOM 4684  H H    . GLY A 1 103 ? -4.580  10.648  -3.181  1.00 0.00 ? 103 GLY A H    3  
ATOM 4685  H HA2  . GLY A 1 103 ? -3.220  12.814  -4.648  1.00 0.00 ? 103 GLY A HA2  3  
ATOM 4686  H HA3  . GLY A 1 103 ? -2.830  11.106  -4.784  1.00 0.00 ? 103 GLY A HA3  3  
ATOM 4687  N N    . PHE A 1 104 ? -5.489  10.750  -5.802  1.00 0.00 ? 104 PHE A N    3  
ATOM 4688  C CA   . PHE A 1 104 ? -6.438  10.534  -6.887  1.00 0.00 ? 104 PHE A CA   3  
ATOM 4689  C C    . PHE A 1 104 ? -7.702  9.849   -6.376  1.00 0.00 ? 104 PHE A C    3  
ATOM 4690  O O    . PHE A 1 104 ? -7.680  8.674   -6.013  1.00 0.00 ? 104 PHE A O    3  
ATOM 4691  C CB   . PHE A 1 104 ? -5.799  9.691   -7.992  1.00 0.00 ? 104 PHE A CB   3  
ATOM 4692  C CG   . PHE A 1 104 ? -4.325  9.932   -8.154  1.00 0.00 ? 104 PHE A CG   3  
ATOM 4693  C CD1  . PHE A 1 104 ? -3.410  9.283   -7.341  1.00 0.00 ? 104 PHE A CD1  3  
ATOM 4694  C CD2  . PHE A 1 104 ? -3.855  10.809  -9.118  1.00 0.00 ? 104 PHE A CD2  3  
ATOM 4695  C CE1  . PHE A 1 104 ? -2.053  9.502   -7.487  1.00 0.00 ? 104 PHE A CE1  3  
ATOM 4696  C CE2  . PHE A 1 104 ? -2.500  11.032  -9.269  1.00 0.00 ? 104 PHE A CE2  3  
ATOM 4697  C CZ   . PHE A 1 104 ? -1.598  10.379  -8.452  1.00 0.00 ? 104 PHE A CZ   3  
ATOM 4698  H H    . PHE A 1 104 ? -5.535  10.180  -5.005  1.00 0.00 ? 104 PHE A H    3  
ATOM 4699  H HA   . PHE A 1 104 ? -6.704  11.499  -7.291  1.00 0.00 ? 104 PHE A HA   3  
ATOM 4700  H HB2  . PHE A 1 104 ? -5.940  8.645   -7.764  1.00 0.00 ? 104 PHE A HB2  3  
ATOM 4701  H HB3  . PHE A 1 104 ? -6.279  9.918   -8.932  1.00 0.00 ? 104 PHE A HB3  3  
ATOM 4702  H HD1  . PHE A 1 104 ? -3.766  8.596   -6.585  1.00 0.00 ? 104 PHE A HD1  3  
ATOM 4703  H HD2  . PHE A 1 104 ? -4.559  11.321  -9.757  1.00 0.00 ? 104 PHE A HD2  3  
ATOM 4704  H HE1  . PHE A 1 104 ? -1.351  8.989   -6.846  1.00 0.00 ? 104 PHE A HE1  3  
ATOM 4705  H HE2  . PHE A 1 104 ? -2.146  11.718  -10.024 1.00 0.00 ? 104 PHE A HE2  3  
ATOM 4706  H HZ   . PHE A 1 104 ? -0.538  10.551  -8.568  1.00 0.00 ? 104 PHE A HZ   3  
ATOM 4707  N N    . GLU A 1 105 ? -8.803  10.594  -6.351  1.00 0.00 ? 105 GLU A N    3  
ATOM 4708  C CA   . GLU A 1 105 ? -10.076 10.060  -5.883  1.00 0.00 ? 105 GLU A CA   3  
ATOM 4709  C C    . GLU A 1 105 ? -10.323 8.665   -6.452  1.00 0.00 ? 105 GLU A C    3  
ATOM 4710  O O    . GLU A 1 105 ? -10.730 7.753   -5.733  1.00 0.00 ? 105 GLU A O    3  
ATOM 4711  C CB   . GLU A 1 105 ? -11.223 10.993  -6.276  1.00 0.00 ? 105 GLU A CB   3  
ATOM 4712  C CG   . GLU A 1 105 ? -11.207 12.321  -5.539  1.00 0.00 ? 105 GLU A CG   3  
ATOM 4713  C CD   . GLU A 1 105 ? -12.473 13.126  -5.758  1.00 0.00 ? 105 GLU A CD   3  
ATOM 4714  O OE1  . GLU A 1 105 ? -13.524 12.512  -6.039  1.00 0.00 ? 105 GLU A OE1  3  
ATOM 4715  O OE2  . GLU A 1 105 ? -12.414 14.368  -5.649  1.00 0.00 ? 105 GLU A OE2  3  
ATOM 4716  H H    . GLU A 1 105 ? -8.758  11.525  -6.653  1.00 0.00 ? 105 GLU A H    3  
ATOM 4717  H HA   . GLU A 1 105 ? -10.032 9.993   -4.806  1.00 0.00 ? 105 GLU A HA   3  
ATOM 4718  H HB2  . GLU A 1 105 ? -11.161 11.192  -7.336  1.00 0.00 ? 105 GLU A HB2  3  
ATOM 4719  H HB3  . GLU A 1 105 ? -12.160 10.500  -6.066  1.00 0.00 ? 105 GLU A HB3  3  
ATOM 4720  H HG2  . GLU A 1 105 ? -11.099 12.130  -4.482  1.00 0.00 ? 105 GLU A HG2  3  
ATOM 4721  H HG3  . GLU A 1 105 ? -10.365 12.902  -5.886  1.00 0.00 ? 105 GLU A HG3  3  
ATOM 4722  N N    . SER A 1 106 ? -10.074 8.509   -7.748  1.00 0.00 ? 106 SER A N    3  
ATOM 4723  C CA   . SER A 1 106 ? -10.272 7.228   -8.416  1.00 0.00 ? 106 SER A CA   3  
ATOM 4724  C C    . SER A 1 106 ? -11.588 6.589   -7.984  1.00 0.00 ? 106 SER A C    3  
ATOM 4725  O O    . SER A 1 106 ? -11.690 5.368   -7.869  1.00 0.00 ? 106 SER A O    3  
ATOM 4726  C CB   . SER A 1 106 ? -9.108  6.284   -8.110  1.00 0.00 ? 106 SER A CB   3  
ATOM 4727  O OG   . SER A 1 106 ? -8.999  6.043   -6.718  1.00 0.00 ? 106 SER A OG   3  
ATOM 4728  H H    . SER A 1 106 ? -9.751  9.275   -8.268  1.00 0.00 ? 106 SER A H    3  
ATOM 4729  H HA   . SER A 1 106 ? -10.307 7.411   -9.480  1.00 0.00 ? 106 SER A HA   3  
ATOM 4730  H HB2  . SER A 1 106 ? -9.269  5.343   -8.615  1.00 0.00 ? 106 SER A HB2  3  
ATOM 4731  H HB3  . SER A 1 106 ? -8.187  6.727   -8.460  1.00 0.00 ? 106 SER A HB3  3  
ATOM 4732  H HG   . SER A 1 106 ? -8.331  5.372   -6.560  1.00 0.00 ? 106 SER A HG   3  
ATOM 4733  N N    . GLY A 1 107 ? -12.595 7.424   -7.745  1.00 0.00 ? 107 GLY A N    3  
ATOM 4734  C CA   . GLY A 1 107 ? -13.891 6.923   -7.327  1.00 0.00 ? 107 GLY A CA   3  
ATOM 4735  C C    . GLY A 1 107 ? -14.631 6.223   -8.450  1.00 0.00 ? 107 GLY A C    3  
ATOM 4736  O O    . GLY A 1 107 ? -14.034 5.761   -9.423  1.00 0.00 ? 107 GLY A O    3  
ATOM 4737  H H    . GLY A 1 107 ? -12.456 8.388   -7.853  1.00 0.00 ? 107 GLY A H    3  
ATOM 4738  H HA2  . GLY A 1 107 ? -13.751 6.228   -6.513  1.00 0.00 ? 107 GLY A HA2  3  
ATOM 4739  H HA3  . GLY A 1 107 ? -14.490 7.752   -6.980  1.00 0.00 ? 107 GLY A HA3  3  
ATOM 4740  N N    . PRO A 1 108 ? -15.963 6.135   -8.321  1.00 0.00 ? 108 PRO A N    3  
ATOM 4741  C CA   . PRO A 1 108 ? -16.814 5.486   -9.323  1.00 0.00 ? 108 PRO A CA   3  
ATOM 4742  C C    . PRO A 1 108 ? -16.894 6.283   -10.620 1.00 0.00 ? 108 PRO A C    3  
ATOM 4743  O O    . PRO A 1 108 ? -17.455 7.378   -10.653 1.00 0.00 ? 108 PRO A O    3  
ATOM 4744  C CB   . PRO A 1 108 ? -18.184 5.432   -8.644  1.00 0.00 ? 108 PRO A CB   3  
ATOM 4745  C CG   . PRO A 1 108 ? -18.165 6.552   -7.661  1.00 0.00 ? 108 PRO A CG   3  
ATOM 4746  C CD   . PRO A 1 108 ? -16.742 6.662   -7.188  1.00 0.00 ? 108 PRO A CD   3  
ATOM 4747  H HA   . PRO A 1 108 ? -16.478 4.482   -9.539  1.00 0.00 ? 108 PRO A HA   3  
ATOM 4748  H HB2  . PRO A 1 108 ? -18.961 5.567   -9.383  1.00 0.00 ? 108 PRO A HB2  3  
ATOM 4749  H HB3  . PRO A 1 108 ? -18.309 4.478   -8.152  1.00 0.00 ? 108 PRO A HB3  3  
ATOM 4750  H HG2  . PRO A 1 108 ? -18.472 7.468   -8.143  1.00 0.00 ? 108 PRO A HG2  3  
ATOM 4751  H HG3  . PRO A 1 108 ? -18.818 6.324   -6.832  1.00 0.00 ? 108 PRO A HG3  3  
ATOM 4752  H HD2  . PRO A 1 108 ? -16.488 7.694   -6.993  1.00 0.00 ? 108 PRO A HD2  3  
ATOM 4753  H HD3  . PRO A 1 108 ? -16.590 6.060   -6.304  1.00 0.00 ? 108 PRO A HD3  3  
ATOM 4754  N N    . SER A 1 109 ? -16.329 5.727   -11.687 1.00 0.00 ? 109 SER A N    3  
ATOM 4755  C CA   . SER A 1 109 ? -16.334 6.389   -12.987 1.00 0.00 ? 109 SER A CA   3  
ATOM 4756  C C    . SER A 1 109 ? -17.630 6.103   -13.738 1.00 0.00 ? 109 SER A C    3  
ATOM 4757  O O    . SER A 1 109 ? -17.901 4.964   -14.119 1.00 0.00 ? 109 SER A O    3  
ATOM 4758  C CB   . SER A 1 109 ? -15.136 5.930   -13.821 1.00 0.00 ? 109 SER A CB   3  
ATOM 4759  O OG   . SER A 1 109 ? -15.136 6.548   -15.096 1.00 0.00 ? 109 SER A OG   3  
ATOM 4760  H H    . SER A 1 109 ? -15.897 4.852   -11.598 1.00 0.00 ? 109 SER A H    3  
ATOM 4761  H HA   . SER A 1 109 ? -16.257 7.453   -12.817 1.00 0.00 ? 109 SER A HA   3  
ATOM 4762  H HB2  . SER A 1 109 ? -14.222 6.189   -13.308 1.00 0.00 ? 109 SER A HB2  3  
ATOM 4763  H HB3  . SER A 1 109 ? -15.183 4.858   -13.953 1.00 0.00 ? 109 SER A HB3  3  
ATOM 4764  H HG   . SER A 1 109 ? -14.564 7.319   -15.078 1.00 0.00 ? 109 SER A HG   3  
ATOM 4765  N N    . SER A 1 110 ? -18.429 7.145   -13.946 1.00 0.00 ? 110 SER A N    3  
ATOM 4766  C CA   . SER A 1 110 ? -19.699 7.006   -14.648 1.00 0.00 ? 110 SER A CA   3  
ATOM 4767  C C    . SER A 1 110 ? -19.991 8.242   -15.494 1.00 0.00 ? 110 SER A C    3  
ATOM 4768  O O    . SER A 1 110 ? -20.244 9.324   -14.966 1.00 0.00 ? 110 SER A O    3  
ATOM 4769  C CB   . SER A 1 110 ? -20.835 6.779   -13.649 1.00 0.00 ? 110 SER A CB   3  
ATOM 4770  O OG   . SER A 1 110 ? -22.027 6.392   -14.311 1.00 0.00 ? 110 SER A OG   3  
ATOM 4771  H H    . SER A 1 110 ? -18.157 8.028   -13.618 1.00 0.00 ? 110 SER A H    3  
ATOM 4772  H HA   . SER A 1 110 ? -19.627 6.148   -15.299 1.00 0.00 ? 110 SER A HA   3  
ATOM 4773  H HB2  . SER A 1 110 ? -20.553 5.999   -12.958 1.00 0.00 ? 110 SER A HB2  3  
ATOM 4774  H HB3  . SER A 1 110 ? -21.021 7.694   -13.104 1.00 0.00 ? 110 SER A HB3  3  
ATOM 4775  H HG   . SER A 1 110 ? -22.251 7.047   -14.977 1.00 0.00 ? 110 SER A HG   3  
ATOM 4776  N N    . GLY A 1 111 ? -19.952 8.072   -16.812 1.00 0.00 ? 111 GLY A N    3  
ATOM 4777  C CA   . GLY A 1 111 ? -20.213 9.181   -17.711 1.00 0.00 ? 111 GLY A CA   3  
ATOM 4778  C C    . GLY A 1 111 ? -20.440 8.728   -19.139 1.00 0.00 ? 111 GLY A C    3  
ATOM 4779  O O    . GLY A 1 111 ? -21.511 8.950   -19.705 1.00 0.00 ? 111 GLY A O    3  
ATOM 4780  H H    . GLY A 1 111 ? -19.745 7.186   -17.177 1.00 0.00 ? 111 GLY A H    3  
ATOM 4781  H HA2  . GLY A 1 111 ? -21.090 9.709   -17.368 1.00 0.00 ? 111 GLY A HA2  3  
ATOM 4782  H HA3  . GLY A 1 111 ? -19.368 9.854   -17.689 1.00 0.00 ? 111 GLY A HA3  3  
ATOM 4783  N N    . GLY A 1 1   ? -26.361 17.772  2.705   1.00 0.00 ? 1   GLY A N    4  
ATOM 4784  C CA   . GLY A 1 1   ? -26.463 18.793  1.678   1.00 0.00 ? 1   GLY A CA   4  
ATOM 4785  C C    . GLY A 1 1   ? -25.477 18.578  0.547   1.00 0.00 ? 1   GLY A C    4  
ATOM 4786  O O    . GLY A 1 1   ? -24.693 17.630  0.570   1.00 0.00 ? 1   GLY A O    4  
ATOM 4787  H H1   . GLY A 1 1   ? -26.959 16.996  2.683   1.00 0.00 ? 1   GLY A H1   4  
ATOM 4788  H HA2  . GLY A 1 1   ? -27.465 18.784  1.276   1.00 0.00 ? 1   GLY A HA2  4  
ATOM 4789  H HA3  . GLY A 1 1   ? -26.275 19.758  2.126   1.00 0.00 ? 1   GLY A HA3  4  
ATOM 4790  N N    . SER A 1 2   ? -25.517 19.460  -0.446  1.00 0.00 ? 2   SER A N    4  
ATOM 4791  C CA   . SER A 1 2   ? -24.624 19.360  -1.594  1.00 0.00 ? 2   SER A CA   4  
ATOM 4792  C C    . SER A 1 2   ? -23.210 18.995  -1.152  1.00 0.00 ? 2   SER A C    4  
ATOM 4793  O O    . SER A 1 2   ? -22.561 18.140  -1.754  1.00 0.00 ? 2   SER A O    4  
ATOM 4794  C CB   . SER A 1 2   ? -24.604 20.679  -2.369  1.00 0.00 ? 2   SER A CB   4  
ATOM 4795  O OG   . SER A 1 2   ? -23.935 21.691  -1.636  1.00 0.00 ? 2   SER A OG   4  
ATOM 4796  H H    . SER A 1 2   ? -26.165 20.195  -0.407  1.00 0.00 ? 2   SER A H    4  
ATOM 4797  H HA   . SER A 1 2   ? -25.000 18.579  -2.239  1.00 0.00 ? 2   SER A HA   4  
ATOM 4798  H HB2  . SER A 1 2   ? -24.093 20.534  -3.308  1.00 0.00 ? 2   SER A HB2  4  
ATOM 4799  H HB3  . SER A 1 2   ? -25.619 20.999  -2.556  1.00 0.00 ? 2   SER A HB3  4  
ATOM 4800  H HG   . SER A 1 2   ? -22.990 21.627  -1.792  1.00 0.00 ? 2   SER A HG   4  
ATOM 4801  N N    . SER A 1 3   ? -22.739 19.651  -0.096  1.00 0.00 ? 3   SER A N    4  
ATOM 4802  C CA   . SER A 1 3   ? -21.401 19.399  0.426   1.00 0.00 ? 3   SER A CA   4  
ATOM 4803  C C    . SER A 1 3   ? -21.141 17.901  0.555   1.00 0.00 ? 3   SER A C    4  
ATOM 4804  O O    . SER A 1 3   ? -21.596 17.260  1.502   1.00 0.00 ? 3   SER A O    4  
ATOM 4805  C CB   . SER A 1 3   ? -21.225 20.078  1.786   1.00 0.00 ? 3   SER A CB   4  
ATOM 4806  O OG   . SER A 1 3   ? -21.179 21.488  1.649   1.00 0.00 ? 3   SER A OG   4  
ATOM 4807  H H    . SER A 1 3   ? -23.305 20.321  0.341   1.00 0.00 ? 3   SER A H    4  
ATOM 4808  H HA   . SER A 1 3   ? -20.690 19.817  -0.271  1.00 0.00 ? 3   SER A HA   4  
ATOM 4809  H HB2  . SER A 1 3   ? -22.054 19.817  2.425   1.00 0.00 ? 3   SER A HB2  4  
ATOM 4810  H HB3  . SER A 1 3   ? -20.302 19.741  2.236   1.00 0.00 ? 3   SER A HB3  4  
ATOM 4811  H HG   . SER A 1 3   ? -21.915 21.782  1.108   1.00 0.00 ? 3   SER A HG   4  
ATOM 4812  N N    . GLY A 1 4   ? -20.405 17.350  -0.405  1.00 0.00 ? 4   GLY A N    4  
ATOM 4813  C CA   . GLY A 1 4   ? -20.097 15.932  -0.382  1.00 0.00 ? 4   GLY A CA   4  
ATOM 4814  C C    . GLY A 1 4   ? -19.201 15.553  0.781   1.00 0.00 ? 4   GLY A C    4  
ATOM 4815  O O    . GLY A 1 4   ? -19.404 16.011  1.905   1.00 0.00 ? 4   GLY A O    4  
ATOM 4816  H H    . GLY A 1 4   ? -20.069 17.910  -1.136  1.00 0.00 ? 4   GLY A H    4  
ATOM 4817  H HA2  . GLY A 1 4   ? -21.019 15.375  -0.309  1.00 0.00 ? 4   GLY A HA2  4  
ATOM 4818  H HA3  . GLY A 1 4   ? -19.601 15.668  -1.304  1.00 0.00 ? 4   GLY A HA3  4  
ATOM 4819  N N    . SER A 1 5   ? -18.208 14.712  0.511   1.00 0.00 ? 5   SER A N    4  
ATOM 4820  C CA   . SER A 1 5   ? -17.281 14.267  1.545   1.00 0.00 ? 5   SER A CA   4  
ATOM 4821  C C    . SER A 1 5   ? -15.892 14.856  1.319   1.00 0.00 ? 5   SER A C    4  
ATOM 4822  O O    . SER A 1 5   ? -15.306 14.700  0.248   1.00 0.00 ? 5   SER A O    4  
ATOM 4823  C CB   . SER A 1 5   ? -17.202 12.739  1.566   1.00 0.00 ? 5   SER A CB   4  
ATOM 4824  O OG   . SER A 1 5   ? -18.259 12.184  2.329   1.00 0.00 ? 5   SER A OG   4  
ATOM 4825  H H    . SER A 1 5   ? -18.097 14.381  -0.405  1.00 0.00 ? 5   SER A H    4  
ATOM 4826  H HA   . SER A 1 5   ? -17.655 14.612  2.497   1.00 0.00 ? 5   SER A HA   4  
ATOM 4827  H HB2  . SER A 1 5   ? -17.268 12.364  0.556   1.00 0.00 ? 5   SER A HB2  4  
ATOM 4828  H HB3  . SER A 1 5   ? -16.261 12.436  2.002   1.00 0.00 ? 5   SER A HB3  4  
ATOM 4829  H HG   . SER A 1 5   ? -18.541 12.817  2.993   1.00 0.00 ? 5   SER A HG   4  
ATOM 4830  N N    . SER A 1 6   ? -15.371 15.534  2.337   1.00 0.00 ? 6   SER A N    4  
ATOM 4831  C CA   . SER A 1 6   ? -14.052 16.150  2.250   1.00 0.00 ? 6   SER A CA   4  
ATOM 4832  C C    . SER A 1 6   ? -13.234 15.863  3.505   1.00 0.00 ? 6   SER A C    4  
ATOM 4833  O O    . SER A 1 6   ? -13.742 15.304  4.476   1.00 0.00 ? 6   SER A O    4  
ATOM 4834  C CB   . SER A 1 6   ? -14.184 17.661  2.048   1.00 0.00 ? 6   SER A CB   4  
ATOM 4835  O OG   . SER A 1 6   ? -14.895 18.258  3.119   1.00 0.00 ? 6   SER A OG   4  
ATOM 4836  H H    . SER A 1 6   ? -15.887 15.623  3.165   1.00 0.00 ? 6   SER A H    4  
ATOM 4837  H HA   . SER A 1 6   ? -13.543 15.725  1.398   1.00 0.00 ? 6   SER A HA   4  
ATOM 4838  H HB2  . SER A 1 6   ? -13.201 18.102  1.995   1.00 0.00 ? 6   SER A HB2  4  
ATOM 4839  H HB3  . SER A 1 6   ? -14.716 17.853  1.127   1.00 0.00 ? 6   SER A HB3  4  
ATOM 4840  H HG   . SER A 1 6   ? -15.010 19.195  2.944   1.00 0.00 ? 6   SER A HG   4  
ATOM 4841  N N    . GLY A 1 7   ? -11.962 16.249  3.477   1.00 0.00 ? 7   GLY A N    4  
ATOM 4842  C CA   . GLY A 1 7   ? -11.093 16.025  4.617   1.00 0.00 ? 7   GLY A CA   4  
ATOM 4843  C C    . GLY A 1 7   ? -9.625  16.167  4.264   1.00 0.00 ? 7   GLY A C    4  
ATOM 4844  O O    . GLY A 1 7   ? -9.247  16.199  3.093   1.00 0.00 ? 7   GLY A O    4  
ATOM 4845  H H    . GLY A 1 7   ? -11.611 16.690  2.675   1.00 0.00 ? 7   GLY A H    4  
ATOM 4846  H HA2  . GLY A 1 7   ? -11.337 16.740  5.388   1.00 0.00 ? 7   GLY A HA2  4  
ATOM 4847  H HA3  . GLY A 1 7   ? -11.265 15.029  4.996   1.00 0.00 ? 7   GLY A HA3  4  
ATOM 4848  N N    . PRO A 1 8   ? -8.771  16.255  5.294   1.00 0.00 ? 8   PRO A N    4  
ATOM 4849  C CA   . PRO A 1 8   ? -7.323  16.397  5.112   1.00 0.00 ? 8   PRO A CA   4  
ATOM 4850  C C    . PRO A 1 8   ? -6.681  15.128  4.562   1.00 0.00 ? 8   PRO A C    4  
ATOM 4851  O O    . PRO A 1 8   ? -7.235  14.036  4.686   1.00 0.00 ? 8   PRO A O    4  
ATOM 4852  C CB   . PRO A 1 8   ? -6.814  16.684  6.526   1.00 0.00 ? 8   PRO A CB   4  
ATOM 4853  C CG   . PRO A 1 8   ? -7.835  16.078  7.427   1.00 0.00 ? 8   PRO A CG   4  
ATOM 4854  C CD   . PRO A 1 8   ? -9.152  16.224  6.716   1.00 0.00 ? 8   PRO A CD   4  
ATOM 4855  H HA   . PRO A 1 8   ? -7.084  17.229  4.466   1.00 0.00 ? 8   PRO A HA   4  
ATOM 4856  H HB2  . PRO A 1 8   ? -5.845  16.226  6.663   1.00 0.00 ? 8   PRO A HB2  4  
ATOM 4857  H HB3  . PRO A 1 8   ? -6.739  17.750  6.676   1.00 0.00 ? 8   PRO A HB3  4  
ATOM 4858  H HG2  . PRO A 1 8   ? -7.610  15.035  7.589   1.00 0.00 ? 8   PRO A HG2  4  
ATOM 4859  H HG3  . PRO A 1 8   ? -7.856  16.610  8.367   1.00 0.00 ? 8   PRO A HG3  4  
ATOM 4860  H HD2  . PRO A 1 8   ? -9.790  15.378  6.926   1.00 0.00 ? 8   PRO A HD2  4  
ATOM 4861  H HD3  . PRO A 1 8   ? -9.637  17.145  7.005   1.00 0.00 ? 8   PRO A HD3  4  
ATOM 4862  N N    . GLY A 1 9   ? -5.509  15.279  3.953   1.00 0.00 ? 9   GLY A N    4  
ATOM 4863  C CA   . GLY A 1 9   ? -4.811  14.136  3.394   1.00 0.00 ? 9   GLY A CA   4  
ATOM 4864  C C    . GLY A 1 9   ? -3.305  14.258  3.519   1.00 0.00 ? 9   GLY A C    4  
ATOM 4865  O O    . GLY A 1 9   ? -2.612  13.267  3.754   1.00 0.00 ? 9   GLY A O    4  
ATOM 4866  H H    . GLY A 1 9   ? -5.115  16.173  3.884   1.00 0.00 ? 9   GLY A H    4  
ATOM 4867  H HA2  . GLY A 1 9   ? -5.134  13.243  3.909   1.00 0.00 ? 9   GLY A HA2  4  
ATOM 4868  H HA3  . GLY A 1 9   ? -5.068  14.049  2.348   1.00 0.00 ? 9   GLY A HA3  4  
ATOM 4869  N N    . LEU A 1 10  ? -2.797  15.475  3.361   1.00 0.00 ? 10  LEU A N    4  
ATOM 4870  C CA   . LEU A 1 10  ? -1.362  15.723  3.456   1.00 0.00 ? 10  LEU A CA   4  
ATOM 4871  C C    . LEU A 1 10  ? -0.940  15.926  4.907   1.00 0.00 ? 10  LEU A C    4  
ATOM 4872  O O    . LEU A 1 10  ? -0.095  16.770  5.206   1.00 0.00 ? 10  LEU A O    4  
ATOM 4873  C CB   . LEU A 1 10  ? -0.981  16.950  2.625   1.00 0.00 ? 10  LEU A CB   4  
ATOM 4874  C CG   . LEU A 1 10  ? -1.866  18.184  2.805   1.00 0.00 ? 10  LEU A CG   4  
ATOM 4875  C CD1  . LEU A 1 10  ? -3.065  18.122  1.872   1.00 0.00 ? 10  LEU A CD1  4  
ATOM 4876  C CD2  . LEU A 1 10  ? -2.320  18.308  4.252   1.00 0.00 ? 10  LEU A CD2  4  
ATOM 4877  H H    . LEU A 1 10  ? -3.399  16.225  3.176   1.00 0.00 ? 10  LEU A H    4  
ATOM 4878  H HA   . LEU A 1 10  ? -0.850  14.858  3.062   1.00 0.00 ? 10  LEU A HA   4  
ATOM 4879  H HB2  . LEU A 1 10  ? 0.029   17.226  2.888   1.00 0.00 ? 10  LEU A HB2  4  
ATOM 4880  H HB3  . LEU A 1 10  ? -1.015  16.666  1.583   1.00 0.00 ? 10  LEU A HB3  4  
ATOM 4881  H HG   . LEU A 1 10  ? -1.295  19.068  2.556   1.00 0.00 ? 10  LEU A HG   4  
ATOM 4882  H HD11 . LEU A 1 10  ? -3.973  18.233  2.444   1.00 0.00 ? 10  LEU A HD11 4  
ATOM 4883  H HD12 . LEU A 1 10  ? -3.075  17.170  1.361   1.00 0.00 ? 10  LEU A HD12 4  
ATOM 4884  H HD13 . LEU A 1 10  ? -2.996  18.918  1.145   1.00 0.00 ? 10  LEU A HD13 4  
ATOM 4885  H HD21 . LEU A 1 10  ? -2.771  17.378  4.568   1.00 0.00 ? 10  LEU A HD21 4  
ATOM 4886  H HD22 . LEU A 1 10  ? -3.045  19.105  4.335   1.00 0.00 ? 10  LEU A HD22 4  
ATOM 4887  H HD23 . LEU A 1 10  ? -1.469  18.527  4.879   1.00 0.00 ? 10  LEU A HD23 4  
ATOM 4888  N N    . ARG A 1 11  ? -1.532  15.146  5.805   1.00 0.00 ? 11  ARG A N    4  
ATOM 4889  C CA   . ARG A 1 11  ? -1.217  15.239  7.226   1.00 0.00 ? 11  ARG A CA   4  
ATOM 4890  C C    . ARG A 1 11  ? -0.445  14.009  7.693   1.00 0.00 ? 11  ARG A C    4  
ATOM 4891  O O    . ARG A 1 11  ? -0.682  12.898  7.219   1.00 0.00 ? 11  ARG A O    4  
ATOM 4892  C CB   . ARG A 1 11  ? -2.499  15.392  8.046   1.00 0.00 ? 11  ARG A CB   4  
ATOM 4893  C CG   . ARG A 1 11  ? -3.175  16.742  7.872   1.00 0.00 ? 11  ARG A CG   4  
ATOM 4894  C CD   . ARG A 1 11  ? -4.490  16.809  8.634   1.00 0.00 ? 11  ARG A CD   4  
ATOM 4895  N NE   . ARG A 1 11  ? -4.306  17.287  10.001  1.00 0.00 ? 11  ARG A NE   4  
ATOM 4896  C CZ   . ARG A 1 11  ? -5.212  17.135  10.961  1.00 0.00 ? 11  ARG A CZ   4  
ATOM 4897  N NH1  . ARG A 1 11  ? -6.359  16.521  10.704  1.00 0.00 ? 11  ARG A NH1  4  
ATOM 4898  N NH2  . ARG A 1 11  ? -4.972  17.598  12.181  1.00 0.00 ? 11  ARG A NH2  4  
ATOM 4899  H H    . ARG A 1 11  ? -2.198  14.492  5.506   1.00 0.00 ? 11  ARG A H    4  
ATOM 4900  H HA   . ARG A 1 11  ? -0.600  16.113  7.372   1.00 0.00 ? 11  ARG A HA   4  
ATOM 4901  H HB2  . ARG A 1 11  ? -3.197  14.624  7.748   1.00 0.00 ? 11  ARG A HB2  4  
ATOM 4902  H HB3  . ARG A 1 11  ? -2.260  15.265  9.091   1.00 0.00 ? 11  ARG A HB3  4  
ATOM 4903  H HG2  . ARG A 1 11  ? -2.518  17.515  8.243   1.00 0.00 ? 11  ARG A HG2  4  
ATOM 4904  H HG3  . ARG A 1 11  ? -3.369  16.905  6.822   1.00 0.00 ? 11  ARG A HG3  4  
ATOM 4905  H HD2  . ARG A 1 11  ? -5.158  17.479  8.115   1.00 0.00 ? 11  ARG A HD2  4  
ATOM 4906  H HD3  . ARG A 1 11  ? -4.924  15.820  8.663   1.00 0.00 ? 11  ARG A HD3  4  
ATOM 4907  H HE   . ARG A 1 11  ? -3.466  17.744  10.213  1.00 0.00 ? 11  ARG A HE   4  
ATOM 4908  H HH11 . ARG A 1 11  ? -6.542  16.170  9.786   1.00 0.00 ? 11  ARG A HH11 4  
ATOM 4909  H HH12 . ARG A 1 11  ? -7.038  16.407  11.428  1.00 0.00 ? 11  ARG A HH12 4  
ATOM 4910  H HH21 . ARG A 1 11  ? -4.109  18.062  12.379  1.00 0.00 ? 11  ARG A HH21 4  
ATOM 4911  H HH22 . ARG A 1 11  ? -5.654  17.483  12.902  1.00 0.00 ? 11  ARG A HH22 4  
ATOM 4912  N N    . GLU A 1 12  ? 0.480   14.216  8.626   1.00 0.00 ? 12  GLU A N    4  
ATOM 4913  C CA   . GLU A 1 12  ? 1.287   13.123  9.156   1.00 0.00 ? 12  GLU A CA   4  
ATOM 4914  C C    . GLU A 1 12  ? 0.401   12.010  9.707   1.00 0.00 ? 12  GLU A C    4  
ATOM 4915  O O    . GLU A 1 12  ? -0.256  12.176  10.736  1.00 0.00 ? 12  GLU A O    4  
ATOM 4916  C CB   . GLU A 1 12  ? 2.223   13.636  10.253  1.00 0.00 ? 12  GLU A CB   4  
ATOM 4917  C CG   . GLU A 1 12  ? 3.290   12.634  10.660  1.00 0.00 ? 12  GLU A CG   4  
ATOM 4918  C CD   . GLU A 1 12  ? 4.235   13.183  11.711  1.00 0.00 ? 12  GLU A CD   4  
ATOM 4919  O OE1  . GLU A 1 12  ? 4.512   14.400  11.682  1.00 0.00 ? 12  GLU A OE1  4  
ATOM 4920  O OE2  . GLU A 1 12  ? 4.697   12.395  12.562  1.00 0.00 ? 12  GLU A OE2  4  
ATOM 4921  H H    . GLU A 1 12  ? 0.623   15.124  8.964   1.00 0.00 ? 12  GLU A H    4  
ATOM 4922  H HA   . GLU A 1 12  ? 1.881   12.726  8.346   1.00 0.00 ? 12  GLU A HA   4  
ATOM 4923  H HB2  . GLU A 1 12  ? 2.714   14.531  9.901   1.00 0.00 ? 12  GLU A HB2  4  
ATOM 4924  H HB3  . GLU A 1 12  ? 1.635   13.878  11.125  1.00 0.00 ? 12  GLU A HB3  4  
ATOM 4925  H HG2  . GLU A 1 12  ? 2.807   11.754  11.057  1.00 0.00 ? 12  GLU A HG2  4  
ATOM 4926  H HG3  . GLU A 1 12  ? 3.864   12.364  9.786   1.00 0.00 ? 12  GLU A HG3  4  
ATOM 4927  N N    . LEU A 1 13  ? 0.387   10.875  9.016   1.00 0.00 ? 13  LEU A N    4  
ATOM 4928  C CA   . LEU A 1 13  ? -0.418  9.734   9.435   1.00 0.00 ? 13  LEU A CA   4  
ATOM 4929  C C    . LEU A 1 13  ? 0.457   8.645   10.048  1.00 0.00 ? 13  LEU A C    4  
ATOM 4930  O O    . LEU A 1 13  ? 1.684   8.695   9.953   1.00 0.00 ? 13  LEU A O    4  
ATOM 4931  C CB   . LEU A 1 13  ? -1.196  9.169   8.245   1.00 0.00 ? 13  LEU A CB   4  
ATOM 4932  C CG   . LEU A 1 13  ? -2.583  9.766   8.005   1.00 0.00 ? 13  LEU A CG   4  
ATOM 4933  C CD1  . LEU A 1 13  ? -3.038  9.502   6.578   1.00 0.00 ? 13  LEU A CD1  4  
ATOM 4934  C CD2  . LEU A 1 13  ? -3.586  9.202   9.000   1.00 0.00 ? 13  LEU A CD2  4  
ATOM 4935  H H    . LEU A 1 13  ? 0.931   10.803  8.204   1.00 0.00 ? 13  LEU A H    4  
ATOM 4936  H HA   . LEU A 1 13  ? -1.119  10.079  10.181  1.00 0.00 ? 13  LEU A HA   4  
ATOM 4937  H HB2  . LEU A 1 13  ? -0.607  9.334   7.356   1.00 0.00 ? 13  LEU A HB2  4  
ATOM 4938  H HB3  . LEU A 1 13  ? -1.315  8.106   8.403   1.00 0.00 ? 13  LEU A HB3  4  
ATOM 4939  H HG   . LEU A 1 13  ? -2.536  10.837  8.146   1.00 0.00 ? 13  LEU A HG   4  
ATOM 4940  H HD11 . LEU A 1 13  ? -3.332  8.468   6.480   1.00 0.00 ? 13  LEU A HD11 4  
ATOM 4941  H HD12 . LEU A 1 13  ? -2.227  9.712   5.897   1.00 0.00 ? 13  LEU A HD12 4  
ATOM 4942  H HD13 . LEU A 1 13  ? -3.878  10.139  6.344   1.00 0.00 ? 13  LEU A HD13 4  
ATOM 4943  H HD21 . LEU A 1 13  ? -3.074  8.564   9.705   1.00 0.00 ? 13  LEU A HD21 4  
ATOM 4944  H HD22 . LEU A 1 13  ? -4.333  8.627   8.471   1.00 0.00 ? 13  LEU A HD22 4  
ATOM 4945  H HD23 . LEU A 1 13  ? -4.064  10.013  9.529   1.00 0.00 ? 13  LEU A HD23 4  
ATOM 4946  N N    . CYS A 1 14  ? -0.181  7.663   10.675  1.00 0.00 ? 14  CYS A N    4  
ATOM 4947  C CA   . CYS A 1 14  ? 0.539   6.561   11.302  1.00 0.00 ? 14  CYS A CA   4  
ATOM 4948  C C    . CYS A 1 14  ? -0.299  5.287   11.292  1.00 0.00 ? 14  CYS A C    4  
ATOM 4949  O O    . CYS A 1 14  ? -1.521  5.336   11.436  1.00 0.00 ? 14  CYS A O    4  
ATOM 4950  C CB   . CYS A 1 14  ? 0.918   6.925   12.739  1.00 0.00 ? 14  CYS A CB   4  
ATOM 4951  S SG   . CYS A 1 14  ? 2.246   5.911   13.430  1.00 0.00 ? 14  CYS A SG   4  
ATOM 4952  H H    . CYS A 1 14  ? -1.160  7.679   10.717  1.00 0.00 ? 14  CYS A H    4  
ATOM 4953  H HA   . CYS A 1 14  ? 1.440   6.389   10.734  1.00 0.00 ? 14  CYS A HA   4  
ATOM 4954  H HB2  . CYS A 1 14  ? 1.243   7.955   12.768  1.00 0.00 ? 14  CYS A HB2  4  
ATOM 4955  H HB3  . CYS A 1 14  ? 0.051   6.810   13.372  1.00 0.00 ? 14  CYS A HB3  4  
ATOM 4956  H HG   . CYS A 1 14  ? 3.242   5.891   12.557  1.00 0.00 ? 14  CYS A HG   4  
ATOM 4957  N N    . ILE A 1 15  ? 0.365   4.150   11.118  1.00 0.00 ? 15  ILE A N    4  
ATOM 4958  C CA   . ILE A 1 15  ? -0.320  2.863   11.088  1.00 0.00 ? 15  ILE A CA   4  
ATOM 4959  C C    . ILE A 1 15  ? 0.198   1.939   12.184  1.00 0.00 ? 15  ILE A C    4  
ATOM 4960  O O    . ILE A 1 15  ? 1.402   1.712   12.300  1.00 0.00 ? 15  ILE A O    4  
ATOM 4961  C CB   . ILE A 1 15  ? -0.151  2.168   9.724   1.00 0.00 ? 15  ILE A CB   4  
ATOM 4962  C CG1  . ILE A 1 15  ? -0.607  3.094   8.595   1.00 0.00 ? 15  ILE A CG1  4  
ATOM 4963  C CG2  . ILE A 1 15  ? -0.933  0.863   9.694   1.00 0.00 ? 15  ILE A CG2  4  
ATOM 4964  C CD1  . ILE A 1 15  ? -0.685  2.411   7.247   1.00 0.00 ? 15  ILE A CD1  4  
ATOM 4965  H H    . ILE A 1 15  ? 1.338   4.176   11.008  1.00 0.00 ? 15  ILE A H    4  
ATOM 4966  H HA   . ILE A 1 15  ? -1.373  3.042   11.250  1.00 0.00 ? 15  ILE A HA   4  
ATOM 4967  H HB   . ILE A 1 15  ? 0.894   1.936   9.590   1.00 0.00 ? 15  ILE A HB   4  
ATOM 4968  H HG12 . ILE A 1 15  ? -1.587  3.480   8.827   1.00 0.00 ? 15  ILE A HG12 4  
ATOM 4969  H HG13 . ILE A 1 15  ? 0.088   3.917   8.511   1.00 0.00 ? 15  ILE A HG13 4  
ATOM 4970  H HG21 . ILE A 1 15  ? -0.932  0.420   10.679  1.00 0.00 ? 15  ILE A HG21 4  
ATOM 4971  H HG22 . ILE A 1 15  ? -1.951  1.061   9.391   1.00 0.00 ? 15  ILE A HG22 4  
ATOM 4972  H HG23 . ILE A 1 15  ? -0.474  0.183   8.993   1.00 0.00 ? 15  ILE A HG23 4  
ATOM 4973  H HD11 . ILE A 1 15  ? -0.045  2.925   6.545   1.00 0.00 ? 15  ILE A HD11 4  
ATOM 4974  H HD12 . ILE A 1 15  ? -0.364  1.385   7.344   1.00 0.00 ? 15  ILE A HD12 4  
ATOM 4975  H HD13 . ILE A 1 15  ? -1.704  2.437   6.889   1.00 0.00 ? 15  ILE A HD13 4  
ATOM 4976  N N    . GLN A 1 16  ? -0.720  1.407   12.985  1.00 0.00 ? 16  GLN A N    4  
ATOM 4977  C CA   . GLN A 1 16  ? -0.355  0.506   14.072  1.00 0.00 ? 16  GLN A CA   4  
ATOM 4978  C C    . GLN A 1 16  ? -0.526  -0.950  13.652  1.00 0.00 ? 16  GLN A C    4  
ATOM 4979  O O    . GLN A 1 16  ? -1.642  -1.413  13.417  1.00 0.00 ? 16  GLN A O    4  
ATOM 4980  C CB   . GLN A 1 16  ? -1.206  0.796   15.310  1.00 0.00 ? 16  GLN A CB   4  
ATOM 4981  C CG   . GLN A 1 16  ? -0.573  1.797   16.263  1.00 0.00 ? 16  GLN A CG   4  
ATOM 4982  C CD   . GLN A 1 16  ? -1.602  2.604   17.030  1.00 0.00 ? 16  GLN A CD   4  
ATOM 4983  O OE1  . GLN A 1 16  ? -2.075  2.184   18.086  1.00 0.00 ? 16  GLN A OE1  4  
ATOM 4984  N NE2  . GLN A 1 16  ? -1.954  3.770   16.502  1.00 0.00 ? 16  GLN A NE2  4  
ATOM 4985  H H    . GLN A 1 16  ? -1.664  1.627   12.842  1.00 0.00 ? 16  GLN A H    4  
ATOM 4986  H HA   . GLN A 1 16  ? 0.683   0.679   14.312  1.00 0.00 ? 16  GLN A HA   4  
ATOM 4987  H HB2  . GLN A 1 16  ? -2.161  1.188   14.992  1.00 0.00 ? 16  GLN A HB2  4  
ATOM 4988  H HB3  . GLN A 1 16  ? -1.366  -0.128  15.846  1.00 0.00 ? 16  GLN A HB3  4  
ATOM 4989  H HG2  . GLN A 1 16  ? 0.042   1.261   16.971  1.00 0.00 ? 16  GLN A HG2  4  
ATOM 4990  H HG3  . GLN A 1 16  ? 0.044   2.476   15.693  1.00 0.00 ? 16  GLN A HG3  4  
ATOM 4991  H HE21 . GLN A 1 16  ? -1.536  4.040   15.657  1.00 0.00 ? 16  GLN A HE21 4  
ATOM 4992  H HE22 . GLN A 1 16  ? -2.617  4.311   16.976  1.00 0.00 ? 16  GLN A HE22 4  
ATOM 4993  N N    . LYS A 1 17  ? 0.588   -1.668  13.560  1.00 0.00 ? 17  LYS A N    4  
ATOM 4994  C CA   . LYS A 1 17  ? 0.563   -3.073  13.170  1.00 0.00 ? 17  LYS A CA   4  
ATOM 4995  C C    . LYS A 1 17  ? 1.257   -3.941  14.215  1.00 0.00 ? 17  LYS A C    4  
ATOM 4996  O O    . LYS A 1 17  ? 1.897   -3.430  15.133  1.00 0.00 ? 17  LYS A O    4  
ATOM 4997  C CB   . LYS A 1 17  ? 1.237   -3.257  11.809  1.00 0.00 ? 17  LYS A CB   4  
ATOM 4998  C CG   . LYS A 1 17  ? 2.737   -3.479  11.898  1.00 0.00 ? 17  LYS A CG   4  
ATOM 4999  C CD   . LYS A 1 17  ? 3.434   -3.113  10.598  1.00 0.00 ? 17  LYS A CD   4  
ATOM 5000  C CE   . LYS A 1 17  ? 3.319   -1.625  10.304  1.00 0.00 ? 17  LYS A CE   4  
ATOM 5001  N NZ   . LYS A 1 17  ? 3.593   -0.798  11.511  1.00 0.00 ? 17  LYS A NZ   4  
ATOM 5002  H H    . LYS A 1 17  ? 1.448   -1.243  13.761  1.00 0.00 ? 17  LYS A H    4  
ATOM 5003  H HA   . LYS A 1 17  ? -0.470  -3.378  13.095  1.00 0.00 ? 17  LYS A HA   4  
ATOM 5004  H HB2  . LYS A 1 17  ? 0.797   -4.111  11.315  1.00 0.00 ? 17  LYS A HB2  4  
ATOM 5005  H HB3  . LYS A 1 17  ? 1.060   -2.375  11.210  1.00 0.00 ? 17  LYS A HB3  4  
ATOM 5006  H HG2  . LYS A 1 17  ? 3.136   -2.865  12.692  1.00 0.00 ? 17  LYS A HG2  4  
ATOM 5007  H HG3  . LYS A 1 17  ? 2.926   -4.521  12.116  1.00 0.00 ? 17  LYS A HG3  4  
ATOM 5008  H HD2  . LYS A 1 17  ? 4.479   -3.374  10.674  1.00 0.00 ? 17  LYS A HD2  4  
ATOM 5009  H HD3  . LYS A 1 17  ? 2.980   -3.668  9.789   1.00 0.00 ? 17  LYS A HD3  4  
ATOM 5010  H HE2  . LYS A 1 17  ? 4.029   -1.368  9.533   1.00 0.00 ? 17  LYS A HE2  4  
ATOM 5011  H HE3  . LYS A 1 17  ? 2.318   -1.417  9.955   1.00 0.00 ? 17  LYS A HE3  4  
ATOM 5012  H HZ1  . LYS A 1 17  ? 4.402   -1.189  12.036  1.00 0.00 ? 17  LYS A HZ1  4  
ATOM 5013  H HZ2  . LYS A 1 17  ? 2.761   -0.790  12.135  1.00 0.00 ? 17  LYS A HZ2  4  
ATOM 5014  H HZ3  . LYS A 1 17  ? 3.814   0.179   11.233  1.00 0.00 ? 17  LYS A HZ3  4  
ATOM 5015  N N    . ALA A 1 18  ? 1.127   -5.255  14.067  1.00 0.00 ? 18  ALA A N    4  
ATOM 5016  C CA   . ALA A 1 18  ? 1.745   -6.193  14.996  1.00 0.00 ? 18  ALA A CA   4  
ATOM 5017  C C    . ALA A 1 18  ? 3.206   -5.835  15.247  1.00 0.00 ? 18  ALA A C    4  
ATOM 5018  O O    . ALA A 1 18  ? 3.796   -5.009  14.551  1.00 0.00 ? 18  ALA A O    4  
ATOM 5019  C CB   . ALA A 1 18  ? 1.631   -7.614  14.465  1.00 0.00 ? 18  ALA A CB   4  
ATOM 5020  H H    . ALA A 1 18  ? 0.604   -5.602  13.315  1.00 0.00 ? 18  ALA A H    4  
ATOM 5021  H HA   . ALA A 1 18  ? 1.206   -6.140  15.931  1.00 0.00 ? 18  ALA A HA   4  
ATOM 5022  H HB1  . ALA A 1 18  ? 1.078   -7.607  13.537  1.00 0.00 ? 18  ALA A HB1  4  
ATOM 5023  H HB2  . ALA A 1 18  ? 2.619   -8.014  14.293  1.00 0.00 ? 18  ALA A HB2  4  
ATOM 5024  H HB3  . ALA A 1 18  ? 1.115   -8.228  15.187  1.00 0.00 ? 18  ALA A HB3  4  
ATOM 5025  N N    . PRO A 1 19  ? 3.805   -6.470  16.265  1.00 0.00 ? 19  PRO A N    4  
ATOM 5026  C CA   . PRO A 1 19  ? 5.205   -6.234  16.631  1.00 0.00 ? 19  PRO A CA   4  
ATOM 5027  C C    . PRO A 1 19  ? 6.176   -6.781  15.591  1.00 0.00 ? 19  PRO A C    4  
ATOM 5028  O O    . PRO A 1 19  ? 7.392   -6.705  15.762  1.00 0.00 ? 19  PRO A O    4  
ATOM 5029  C CB   . PRO A 1 19  ? 5.357   -6.989  17.954  1.00 0.00 ? 19  PRO A CB   4  
ATOM 5030  C CG   . PRO A 1 19  ? 4.315   -8.052  17.906  1.00 0.00 ? 19  PRO A CG   4  
ATOM 5031  C CD   . PRO A 1 19  ? 3.162   -7.467  17.137  1.00 0.00 ? 19  PRO A CD   4  
ATOM 5032  H HA   . PRO A 1 19  ? 5.402   -5.184  16.790  1.00 0.00 ? 19  PRO A HA   4  
ATOM 5033  H HB2  . PRO A 1 19  ? 6.351   -7.412  18.018  1.00 0.00 ? 19  PRO A HB2  4  
ATOM 5034  H HB3  . PRO A 1 19  ? 5.194   -6.313  18.780  1.00 0.00 ? 19  PRO A HB3  4  
ATOM 5035  H HG2  . PRO A 1 19  ? 4.701   -8.923  17.398  1.00 0.00 ? 19  PRO A HG2  4  
ATOM 5036  H HG3  . PRO A 1 19  ? 4.005   -8.307  18.909  1.00 0.00 ? 19  PRO A HG3  4  
ATOM 5037  H HD2  . PRO A 1 19  ? 2.672   -8.231  16.553  1.00 0.00 ? 19  PRO A HD2  4  
ATOM 5038  H HD3  . PRO A 1 19  ? 2.461   -6.995  17.810  1.00 0.00 ? 19  PRO A HD3  4  
ATOM 5039  N N    . GLY A 1 20  ? 5.631   -7.332  14.510  1.00 0.00 ? 20  GLY A N    4  
ATOM 5040  C CA   . GLY A 1 20  ? 6.464   -7.883  13.458  1.00 0.00 ? 20  GLY A CA   4  
ATOM 5041  C C    . GLY A 1 20  ? 5.663   -8.286  12.236  1.00 0.00 ? 20  GLY A C    4  
ATOM 5042  O O    . GLY A 1 20  ? 5.936   -9.316  11.620  1.00 0.00 ? 20  GLY A O    4  
ATOM 5043  H H    . GLY A 1 20  ? 4.655   -7.365  14.428  1.00 0.00 ? 20  GLY A H    4  
ATOM 5044  H HA2  . GLY A 1 20  ? 7.195   -7.143  13.168  1.00 0.00 ? 20  GLY A HA2  4  
ATOM 5045  H HA3  . GLY A 1 20  ? 6.978   -8.753  13.840  1.00 0.00 ? 20  GLY A HA3  4  
ATOM 5046  N N    . GLU A 1 21  ? 4.671   -7.474  11.885  1.00 0.00 ? 21  GLU A N    4  
ATOM 5047  C CA   . GLU A 1 21  ? 3.827   -7.754  10.730  1.00 0.00 ? 21  GLU A CA   4  
ATOM 5048  C C    . GLU A 1 21  ? 4.237   -6.898  9.535   1.00 0.00 ? 21  GLU A C    4  
ATOM 5049  O O    . GLU A 1 21  ? 4.634   -5.743  9.693   1.00 0.00 ? 21  GLU A O    4  
ATOM 5050  C CB   . GLU A 1 21  ? 2.357   -7.501  11.071  1.00 0.00 ? 21  GLU A CB   4  
ATOM 5051  C CG   . GLU A 1 21  ? 1.419   -7.669  9.887   1.00 0.00 ? 21  GLU A CG   4  
ATOM 5052  C CD   . GLU A 1 21  ? 1.521   -9.043  9.253   1.00 0.00 ? 21  GLU A CD   4  
ATOM 5053  O OE1  . GLU A 1 21  ? 1.624   -10.037 10.003  1.00 0.00 ? 21  GLU A OE1  4  
ATOM 5054  O OE2  . GLU A 1 21  ? 1.497   -9.124  8.007   1.00 0.00 ? 21  GLU A OE2  4  
ATOM 5055  H H    . GLU A 1 21  ? 4.503   -6.667  12.416  1.00 0.00 ? 21  GLU A H    4  
ATOM 5056  H HA   . GLU A 1 21  ? 3.953   -8.795  10.472  1.00 0.00 ? 21  GLU A HA   4  
ATOM 5057  H HB2  . GLU A 1 21  ? 2.055   -8.192  11.844  1.00 0.00 ? 21  GLU A HB2  4  
ATOM 5058  H HB3  . GLU A 1 21  ? 2.255   -6.492  11.443  1.00 0.00 ? 21  GLU A HB3  4  
ATOM 5059  H HG2  . GLU A 1 21  ? 0.405   -7.520  10.224  1.00 0.00 ? 21  GLU A HG2  4  
ATOM 5060  H HG3  . GLU A 1 21  ? 1.664   -6.926  9.142   1.00 0.00 ? 21  GLU A HG3  4  
ATOM 5061  N N    . ARG A 1 22  ? 4.140   -7.473  8.341   1.00 0.00 ? 22  ARG A N    4  
ATOM 5062  C CA   . ARG A 1 22  ? 4.503   -6.765  7.120   1.00 0.00 ? 22  ARG A CA   4  
ATOM 5063  C C    . ARG A 1 22  ? 3.345   -5.901  6.628   1.00 0.00 ? 22  ARG A C    4  
ATOM 5064  O O    . ARG A 1 22  ? 2.260   -6.406  6.338   1.00 0.00 ? 22  ARG A O    4  
ATOM 5065  C CB   . ARG A 1 22  ? 4.912   -7.758  6.031   1.00 0.00 ? 22  ARG A CB   4  
ATOM 5066  C CG   . ARG A 1 22  ? 6.330   -8.283  6.186   1.00 0.00 ? 22  ARG A CG   4  
ATOM 5067  C CD   . ARG A 1 22  ? 6.466   -9.692  5.632   1.00 0.00 ? 22  ARG A CD   4  
ATOM 5068  N NE   . ARG A 1 22  ? 7.838   -10.185 5.719   1.00 0.00 ? 22  ARG A NE   4  
ATOM 5069  C CZ   . ARG A 1 22  ? 8.833   -9.726  4.968   1.00 0.00 ? 22  ARG A CZ   4  
ATOM 5070  N NH1  . ARG A 1 22  ? 8.609   -8.769  4.078   1.00 0.00 ? 22  ARG A NH1  4  
ATOM 5071  N NH2  . ARG A 1 22  ? 10.055  -10.225 5.106   1.00 0.00 ? 22  ARG A NH2  4  
ATOM 5072  H H    . ARG A 1 22  ? 3.818   -8.397  8.280   1.00 0.00 ? 22  ARG A H    4  
ATOM 5073  H HA   . ARG A 1 22  ? 5.343   -6.125  7.345   1.00 0.00 ? 22  ARG A HA   4  
ATOM 5074  H HB2  . ARG A 1 22  ? 4.235   -8.600  6.055   1.00 0.00 ? 22  ARG A HB2  4  
ATOM 5075  H HB3  . ARG A 1 22  ? 4.834   -7.272  5.070   1.00 0.00 ? 22  ARG A HB3  4  
ATOM 5076  H HG2  . ARG A 1 22  ? 7.005   -7.631  5.651   1.00 0.00 ? 22  ARG A HG2  4  
ATOM 5077  H HG3  . ARG A 1 22  ? 6.588   -8.291  7.234   1.00 0.00 ? 22  ARG A HG3  4  
ATOM 5078  H HD2  . ARG A 1 22  ? 5.821   -10.350 6.195   1.00 0.00 ? 22  ARG A HD2  4  
ATOM 5079  H HD3  . ARG A 1 22  ? 6.159   -9.689  4.596   1.00 0.00 ? 22  ARG A HD3  4  
ATOM 5080  H HE   . ARG A 1 22  ? 8.026   -10.892 6.370   1.00 0.00 ? 22  ARG A HE   4  
ATOM 5081  H HH11 . ARG A 1 22  ? 7.689   -8.391  3.973   1.00 0.00 ? 22  ARG A HH11 4  
ATOM 5082  H HH12 . ARG A 1 22  ? 9.360   -8.424  3.514   1.00 0.00 ? 22  ARG A HH12 4  
ATOM 5083  H HH21 . ARG A 1 22  ? 10.227  -10.946 5.775   1.00 0.00 ? 22  ARG A HH21 4  
ATOM 5084  H HH22 . ARG A 1 22  ? 10.802  -9.879  4.539   1.00 0.00 ? 22  ARG A HH22 4  
ATOM 5085  N N    . LEU A 1 23  ? 3.583   -4.598  6.536   1.00 0.00 ? 23  LEU A N    4  
ATOM 5086  C CA   . LEU A 1 23  ? 2.560   -3.663  6.079   1.00 0.00 ? 23  LEU A CA   4  
ATOM 5087  C C    . LEU A 1 23  ? 1.666   -4.308  5.025   1.00 0.00 ? 23  LEU A C    4  
ATOM 5088  O O    . LEU A 1 23  ? 0.440   -4.255  5.119   1.00 0.00 ? 23  LEU A O    4  
ATOM 5089  C CB   . LEU A 1 23  ? 3.211   -2.402  5.510   1.00 0.00 ? 23  LEU A CB   4  
ATOM 5090  C CG   . LEU A 1 23  ? 2.446   -1.096  5.726   1.00 0.00 ? 23  LEU A CG   4  
ATOM 5091  C CD1  . LEU A 1 23  ? 1.006   -1.237  5.260   1.00 0.00 ? 23  LEU A CD1  4  
ATOM 5092  C CD2  . LEU A 1 23  ? 2.497   -0.684  7.191   1.00 0.00 ? 23  LEU A CD2  4  
ATOM 5093  H H    . LEU A 1 23  ? 4.467   -4.254  6.780   1.00 0.00 ? 23  LEU A H    4  
ATOM 5094  H HA   . LEU A 1 23  ? 1.954   -3.393  6.931   1.00 0.00 ? 23  LEU A HA   4  
ATOM 5095  H HB2  . LEU A 1 23  ? 4.183   -2.296  5.968   1.00 0.00 ? 23  LEU A HB2  4  
ATOM 5096  H HB3  . LEU A 1 23  ? 3.331   -2.544  4.445   1.00 0.00 ? 23  LEU A HB3  4  
ATOM 5097  H HG   . LEU A 1 23  ? 2.910   -0.313  5.142   1.00 0.00 ? 23  LEU A HG   4  
ATOM 5098  H HD11 . LEU A 1 23  ? 0.356   -1.315  6.119   1.00 0.00 ? 23  LEU A HD11 4  
ATOM 5099  H HD12 . LEU A 1 23  ? 0.909   -2.125  4.654   1.00 0.00 ? 23  LEU A HD12 4  
ATOM 5100  H HD13 . LEU A 1 23  ? 0.730   -0.371  4.676   1.00 0.00 ? 23  LEU A HD13 4  
ATOM 5101  H HD21 . LEU A 1 23  ? 2.489   -1.567  7.812   1.00 0.00 ? 23  LEU A HD21 4  
ATOM 5102  H HD22 . LEU A 1 23  ? 1.637   -0.073  7.423   1.00 0.00 ? 23  LEU A HD22 4  
ATOM 5103  H HD23 . LEU A 1 23  ? 3.400   -0.122  7.375   1.00 0.00 ? 23  LEU A HD23 4  
ATOM 5104  N N    . GLY A 1 24  ? 2.288   -4.918  4.020   1.00 0.00 ? 24  GLY A N    4  
ATOM 5105  C CA   . GLY A 1 24  ? 1.534   -5.566  2.964   1.00 0.00 ? 24  GLY A CA   4  
ATOM 5106  C C    . GLY A 1 24  ? 0.965   -4.576  1.967   1.00 0.00 ? 24  GLY A C    4  
ATOM 5107  O O    . GLY A 1 24  ? -0.185  -4.701  1.545   1.00 0.00 ? 24  GLY A O    4  
ATOM 5108  H H    . GLY A 1 24  ? 3.268   -4.928  3.997   1.00 0.00 ? 24  GLY A H    4  
ATOM 5109  H HA2  . GLY A 1 24  ? 2.182   -6.254  2.443   1.00 0.00 ? 24  GLY A HA2  4  
ATOM 5110  H HA3  . GLY A 1 24  ? 0.719   -6.120  3.407   1.00 0.00 ? 24  GLY A HA3  4  
ATOM 5111  N N    . ILE A 1 25  ? 1.772   -3.590  1.589   1.00 0.00 ? 25  ILE A N    4  
ATOM 5112  C CA   . ILE A 1 25  ? 1.342   -2.575  0.636   1.00 0.00 ? 25  ILE A CA   4  
ATOM 5113  C C    . ILE A 1 25  ? 2.271   -2.527  -0.573  1.00 0.00 ? 25  ILE A C    4  
ATOM 5114  O O    . ILE A 1 25  ? 3.400   -3.014  -0.520  1.00 0.00 ? 25  ILE A O    4  
ATOM 5115  C CB   . ILE A 1 25  ? 1.290   -1.179  1.285   1.00 0.00 ? 25  ILE A CB   4  
ATOM 5116  C CG1  . ILE A 1 25  ? 2.474   -0.990  2.234   1.00 0.00 ? 25  ILE A CG1  4  
ATOM 5117  C CG2  . ILE A 1 25  ? -0.025  -0.988  2.025   1.00 0.00 ? 25  ILE A CG2  4  
ATOM 5118  C CD1  . ILE A 1 25  ? 2.872   0.458   2.423   1.00 0.00 ? 25  ILE A CD1  4  
ATOM 5119  H H    . ILE A 1 25  ? 2.677   -3.544  1.960   1.00 0.00 ? 25  ILE A H    4  
ATOM 5120  H HA   . ILE A 1 25  ? 0.347   -2.832  0.302   1.00 0.00 ? 25  ILE A HA   4  
ATOM 5121  H HB   . ILE A 1 25  ? 1.344   -0.440  0.500   1.00 0.00 ? 25  ILE A HB   4  
ATOM 5122  H HG12 . ILE A 1 25  ? 2.220   -1.392  3.202   1.00 0.00 ? 25  ILE A HG12 4  
ATOM 5123  H HG13 . ILE A 1 25  ? 3.329   -1.521  1.842   1.00 0.00 ? 25  ILE A HG13 4  
ATOM 5124  H HG21 . ILE A 1 25  ? -0.011  -0.041  2.545   1.00 0.00 ? 25  ILE A HG21 4  
ATOM 5125  H HG22 . ILE A 1 25  ? -0.841  -0.997  1.318   1.00 0.00 ? 25  ILE A HG22 4  
ATOM 5126  H HG23 . ILE A 1 25  ? -0.157  -1.788  2.737   1.00 0.00 ? 25  ILE A HG23 4  
ATOM 5127  H HD11 . ILE A 1 25  ? 3.451   0.786   1.572   1.00 0.00 ? 25  ILE A HD11 4  
ATOM 5128  H HD12 . ILE A 1 25  ? 1.986   1.066   2.514   1.00 0.00 ? 25  ILE A HD12 4  
ATOM 5129  H HD13 . ILE A 1 25  ? 3.468   0.553   3.320   1.00 0.00 ? 25  ILE A HD13 4  
ATOM 5130  N N    . SER A 1 26  ? 1.788   -1.934  -1.660  1.00 0.00 ? 26  SER A N    4  
ATOM 5131  C CA   . SER A 1 26  ? 2.574   -1.824  -2.883  1.00 0.00 ? 26  SER A CA   4  
ATOM 5132  C C    . SER A 1 26  ? 2.797   -0.361  -3.256  1.00 0.00 ? 26  SER A C    4  
ATOM 5133  O O    . SER A 1 26  ? 2.072   0.523   -2.801  1.00 0.00 ? 26  SER A O    4  
ATOM 5134  C CB   . SER A 1 26  ? 1.875   -2.554  -4.032  1.00 0.00 ? 26  SER A CB   4  
ATOM 5135  O OG   . SER A 1 26  ? 2.816   -3.061  -4.962  1.00 0.00 ? 26  SER A OG   4  
ATOM 5136  H H    . SER A 1 26  ? 0.880   -1.565  -1.640  1.00 0.00 ? 26  SER A H    4  
ATOM 5137  H HA   . SER A 1 26  ? 3.533   -2.288  -2.704  1.00 0.00 ? 26  SER A HA   4  
ATOM 5138  H HB2  . SER A 1 26  ? 1.300   -3.376  -3.635  1.00 0.00 ? 26  SER A HB2  4  
ATOM 5139  H HB3  . SER A 1 26  ? 1.216   -1.867  -4.543  1.00 0.00 ? 26  SER A HB3  4  
ATOM 5140  H HG   . SER A 1 26  ? 2.744   -2.576  -5.787  1.00 0.00 ? 26  SER A HG   4  
ATOM 5141  N N    . ILE A 1 27  ? 3.805   -0.116  -4.086  1.00 0.00 ? 27  ILE A N    4  
ATOM 5142  C CA   . ILE A 1 27  ? 4.123   1.238   -4.521  1.00 0.00 ? 27  ILE A CA   4  
ATOM 5143  C C    . ILE A 1 27  ? 4.771   1.235   -5.901  1.00 0.00 ? 27  ILE A C    4  
ATOM 5144  O O    . ILE A 1 27  ? 5.494   0.303   -6.257  1.00 0.00 ? 27  ILE A O    4  
ATOM 5145  C CB   . ILE A 1 27  ? 5.065   1.942   -3.526  1.00 0.00 ? 27  ILE A CB   4  
ATOM 5146  C CG1  . ILE A 1 27  ? 6.480   1.369   -3.636  1.00 0.00 ? 27  ILE A CG1  4  
ATOM 5147  C CG2  . ILE A 1 27  ? 4.539   1.799   -2.106  1.00 0.00 ? 27  ILE A CG2  4  
ATOM 5148  C CD1  . ILE A 1 27  ? 7.518   2.175   -2.889  1.00 0.00 ? 27  ILE A CD1  4  
ATOM 5149  H H    . ILE A 1 27  ? 4.347   -0.863  -4.414  1.00 0.00 ? 27  ILE A H    4  
ATOM 5150  H HA   . ILE A 1 27  ? 3.200   1.798   -4.569  1.00 0.00 ? 27  ILE A HA   4  
ATOM 5151  H HB   . ILE A 1 27  ? 5.091   2.993   -3.771  1.00 0.00 ? 27  ILE A HB   4  
ATOM 5152  H HG12 . ILE A 1 27  ? 6.487   0.367   -3.237  1.00 0.00 ? 27  ILE A HG12 4  
ATOM 5153  H HG13 . ILE A 1 27  ? 6.768   1.339   -4.677  1.00 0.00 ? 27  ILE A HG13 4  
ATOM 5154  H HG21 . ILE A 1 27  ? 5.189   2.330   -1.426  1.00 0.00 ? 27  ILE A HG21 4  
ATOM 5155  H HG22 . ILE A 1 27  ? 3.544   2.213   -2.048  1.00 0.00 ? 27  ILE A HG22 4  
ATOM 5156  H HG23 . ILE A 1 27  ? 4.511   0.754   -1.836  1.00 0.00 ? 27  ILE A HG23 4  
ATOM 5157  H HD11 . ILE A 1 27  ? 7.090   3.116   -2.578  1.00 0.00 ? 27  ILE A HD11 4  
ATOM 5158  H HD12 . ILE A 1 27  ? 7.847   1.623   -2.021  1.00 0.00 ? 27  ILE A HD12 4  
ATOM 5159  H HD13 . ILE A 1 27  ? 8.363   2.362   -3.536  1.00 0.00 ? 27  ILE A HD13 4  
ATOM 5160  N N    . ARG A 1 28  ? 4.508   2.283   -6.675  1.00 0.00 ? 28  ARG A N    4  
ATOM 5161  C CA   . ARG A 1 28  ? 5.066   2.401   -8.017  1.00 0.00 ? 28  ARG A CA   4  
ATOM 5162  C C    . ARG A 1 28  ? 5.820   3.718   -8.178  1.00 0.00 ? 28  ARG A C    4  
ATOM 5163  O O    . ARG A 1 28  ? 5.377   4.761   -7.701  1.00 0.00 ? 28  ARG A O    4  
ATOM 5164  C CB   . ARG A 1 28  ? 3.955   2.306   -9.064  1.00 0.00 ? 28  ARG A CB   4  
ATOM 5165  C CG   . ARG A 1 28  ? 2.909   3.402   -8.945  1.00 0.00 ? 28  ARG A CG   4  
ATOM 5166  C CD   . ARG A 1 28  ? 2.154   3.596   -10.250 1.00 0.00 ? 28  ARG A CD   4  
ATOM 5167  N NE   . ARG A 1 28  ? 0.803   4.106   -10.030 1.00 0.00 ? 28  ARG A NE   4  
ATOM 5168  C CZ   . ARG A 1 28  ? -0.240  3.329   -9.758  1.00 0.00 ? 28  ARG A CZ   4  
ATOM 5169  N NH1  . ARG A 1 28  ? -0.088  2.015   -9.672  1.00 0.00 ? 28  ARG A NH1  4  
ATOM 5170  N NH2  . ARG A 1 28  ? -1.438  3.867   -9.570  1.00 0.00 ? 28  ARG A NH2  4  
ATOM 5171  H H    . ARG A 1 28  ? 3.925   2.994   -6.336  1.00 0.00 ? 28  ARG A H    4  
ATOM 5172  H HA   . ARG A 1 28  ? 5.757   1.584   -8.162  1.00 0.00 ? 28  ARG A HA   4  
ATOM 5173  H HB2  . ARG A 1 28  ? 4.397   2.366   -10.048 1.00 0.00 ? 28  ARG A HB2  4  
ATOM 5174  H HB3  . ARG A 1 28  ? 3.459   1.352   -8.959  1.00 0.00 ? 28  ARG A HB3  4  
ATOM 5175  H HG2  . ARG A 1 28  ? 2.206   3.133   -8.171  1.00 0.00 ? 28  ARG A HG2  4  
ATOM 5176  H HG3  . ARG A 1 28  ? 3.400   4.327   -8.682  1.00 0.00 ? 28  ARG A HG3  4  
ATOM 5177  H HD2  . ARG A 1 28  ? 2.697   4.299   -10.864 1.00 0.00 ? 28  ARG A HD2  4  
ATOM 5178  H HD3  . ARG A 1 28  ? 2.092   2.646   -10.759 1.00 0.00 ? 28  ARG A HD3  4  
ATOM 5179  H HE   . ARG A 1 28  ? 0.668   5.074   -10.088 1.00 0.00 ? 28  ARG A HE   4  
ATOM 5180  H HH11 . ARG A 1 28  ? 0.814   1.607   -9.812  1.00 0.00 ? 28  ARG A HH11 4  
ATOM 5181  H HH12 . ARG A 1 28  ? -0.875  1.432   -9.466  1.00 0.00 ? 28  ARG A HH12 4  
ATOM 5182  H HH21 . ARG A 1 28  ? -1.557  4.858   -9.633  1.00 0.00 ? 28  ARG A HH21 4  
ATOM 5183  H HH22 . ARG A 1 28  ? -2.222  3.282   -9.365  1.00 0.00 ? 28  ARG A HH22 4  
ATOM 5184  N N    . GLY A 1 29  ? 6.963   3.660   -8.855  1.00 0.00 ? 29  GLY A N    4  
ATOM 5185  C CA   . GLY A 1 29  ? 7.761   4.854   -9.066  1.00 0.00 ? 29  GLY A CA   4  
ATOM 5186  C C    . GLY A 1 29  ? 9.244   4.602   -8.877  1.00 0.00 ? 29  GLY A C    4  
ATOM 5187  O O    . GLY A 1 29  ? 9.729   3.498   -9.121  1.00 0.00 ? 29  GLY A O    4  
ATOM 5188  H H    . GLY A 1 29  ? 7.268   2.800   -9.213  1.00 0.00 ? 29  GLY A H    4  
ATOM 5189  H HA2  . GLY A 1 29  ? 7.593   5.213   -10.071 1.00 0.00 ? 29  GLY A HA2  4  
ATOM 5190  H HA3  . GLY A 1 29  ? 7.445   5.613   -8.366  1.00 0.00 ? 29  GLY A HA3  4  
ATOM 5191  N N    . GLY A 1 30  ? 9.966   5.629   -8.440  1.00 0.00 ? 30  GLY A N    4  
ATOM 5192  C CA   . GLY A 1 30  ? 11.395  5.494   -8.228  1.00 0.00 ? 30  GLY A CA   4  
ATOM 5193  C C    . GLY A 1 30  ? 12.206  6.369   -9.162  1.00 0.00 ? 30  GLY A C    4  
ATOM 5194  O O    . GLY A 1 30  ? 11.860  6.527   -10.332 1.00 0.00 ? 30  GLY A O    4  
ATOM 5195  H H    . GLY A 1 30  ? 9.525   6.486   -8.262  1.00 0.00 ? 30  GLY A H    4  
ATOM 5196  H HA2  . GLY A 1 30  ? 11.624  5.765   -7.208  1.00 0.00 ? 30  GLY A HA2  4  
ATOM 5197  H HA3  . GLY A 1 30  ? 11.675  4.463   -8.386  1.00 0.00 ? 30  GLY A HA3  4  
ATOM 5198  N N    . ALA A 1 31  ? 13.288  6.942   -8.644  1.00 0.00 ? 31  ALA A N    4  
ATOM 5199  C CA   . ALA A 1 31  ? 14.151  7.806   -9.441  1.00 0.00 ? 31  ALA A CA   4  
ATOM 5200  C C    . ALA A 1 31  ? 14.789  7.034   -10.591 1.00 0.00 ? 31  ALA A C    4  
ATOM 5201  O O    . ALA A 1 31  ? 15.435  7.620   -11.460 1.00 0.00 ? 31  ALA A O    4  
ATOM 5202  C CB   . ALA A 1 31  ? 15.224  8.433   -8.564  1.00 0.00 ? 31  ALA A CB   4  
ATOM 5203  H H    . ALA A 1 31  ? 13.512  6.778   -7.705  1.00 0.00 ? 31  ALA A H    4  
ATOM 5204  H HA   . ALA A 1 31  ? 13.542  8.601   -9.848  1.00 0.00 ? 31  ALA A HA   4  
ATOM 5205  H HB1  . ALA A 1 31  ? 16.176  7.968   -8.773  1.00 0.00 ? 31  ALA A HB1  4  
ATOM 5206  H HB2  . ALA A 1 31  ? 15.286  9.491   -8.772  1.00 0.00 ? 31  ALA A HB2  4  
ATOM 5207  H HB3  . ALA A 1 31  ? 14.971  8.285   -7.524  1.00 0.00 ? 31  ALA A HB3  4  
ATOM 5208  N N    . ARG A 1 32  ? 14.605  5.718   -10.589 1.00 0.00 ? 32  ARG A N    4  
ATOM 5209  C CA   . ARG A 1 32  ? 15.164  4.867   -11.632 1.00 0.00 ? 32  ARG A CA   4  
ATOM 5210  C C    . ARG A 1 32  ? 14.082  3.996   -12.263 1.00 0.00 ? 32  ARG A C    4  
ATOM 5211  O O    . ARG A 1 32  ? 14.369  2.942   -12.828 1.00 0.00 ? 32  ARG A O    4  
ATOM 5212  C CB   . ARG A 1 32  ? 16.274  3.984   -11.058 1.00 0.00 ? 32  ARG A CB   4  
ATOM 5213  C CG   . ARG A 1 32  ? 17.618  4.686   -10.952 1.00 0.00 ? 32  ARG A CG   4  
ATOM 5214  C CD   . ARG A 1 32  ? 18.729  3.711   -10.594 1.00 0.00 ? 32  ARG A CD   4  
ATOM 5215  N NE   . ARG A 1 32  ? 20.049  4.240   -10.925 1.00 0.00 ? 32  ARG A NE   4  
ATOM 5216  C CZ   . ARG A 1 32  ? 21.155  3.505   -10.932 1.00 0.00 ? 32  ARG A CZ   4  
ATOM 5217  N NH1  . ARG A 1 32  ? 21.100  2.215   -10.628 1.00 0.00 ? 32  ARG A NH1  4  
ATOM 5218  N NH2  . ARG A 1 32  ? 22.320  4.059   -11.243 1.00 0.00 ? 32  ARG A NH2  4  
ATOM 5219  H H    . ARG A 1 32  ? 14.080  5.310   -9.869  1.00 0.00 ? 32  ARG A H    4  
ATOM 5220  H HA   . ARG A 1 32  ? 15.584  5.507   -12.393 1.00 0.00 ? 32  ARG A HA   4  
ATOM 5221  H HB2  . ARG A 1 32  ? 15.984  3.659   -10.069 1.00 0.00 ? 32  ARG A HB2  4  
ATOM 5222  H HB3  . ARG A 1 32  ? 16.393  3.119   -11.692 1.00 0.00 ? 32  ARG A HB3  4  
ATOM 5223  H HG2  . ARG A 1 32  ? 17.849  5.145   -11.902 1.00 0.00 ? 32  ARG A HG2  4  
ATOM 5224  H HG3  . ARG A 1 32  ? 17.557  5.446   -10.188 1.00 0.00 ? 32  ARG A HG3  4  
ATOM 5225  H HD2  . ARG A 1 32  ? 18.687  3.512   -9.534  1.00 0.00 ? 32  ARG A HD2  4  
ATOM 5226  H HD3  . ARG A 1 32  ? 18.572  2.792   -11.139 1.00 0.00 ? 32  ARG A HD3  4  
ATOM 5227  H HE   . ARG A 1 32  ? 20.113  5.191   -11.153 1.00 0.00 ? 32  ARG A HE   4  
ATOM 5228  H HH11 . ARG A 1 32  ? 20.223  1.795   -10.394 1.00 0.00 ? 32  ARG A HH11 4  
ATOM 5229  H HH12 . ARG A 1 32  ? 21.934  1.663   -10.635 1.00 0.00 ? 32  ARG A HH12 4  
ATOM 5230  H HH21 . ARG A 1 32  ? 22.366  5.030   -11.473 1.00 0.00 ? 32  ARG A HH21 4  
ATOM 5231  H HH22 . ARG A 1 32  ? 23.152  3.504   -11.248 1.00 0.00 ? 32  ARG A HH22 4  
ATOM 5232  N N    . GLY A 1 33  ? 12.834  4.446   -12.161 1.00 0.00 ? 33  GLY A N    4  
ATOM 5233  C CA   . GLY A 1 33  ? 11.728  3.696   -12.725 1.00 0.00 ? 33  GLY A CA   4  
ATOM 5234  C C    . GLY A 1 33  ? 10.862  4.539   -13.640 1.00 0.00 ? 33  GLY A C    4  
ATOM 5235  O O    . GLY A 1 33  ? 11.042  5.754   -13.731 1.00 0.00 ? 33  GLY A O    4  
ATOM 5236  H H    . GLY A 1 33  ? 12.664  5.293   -11.699 1.00 0.00 ? 33  GLY A H    4  
ATOM 5237  H HA2  . GLY A 1 33  ? 12.121  2.862   -13.288 1.00 0.00 ? 33  GLY A HA2  4  
ATOM 5238  H HA3  . GLY A 1 33  ? 11.117  3.316   -11.919 1.00 0.00 ? 33  GLY A HA3  4  
ATOM 5239  N N    . HIS A 1 34  ? 9.919   3.895   -14.321 1.00 0.00 ? 34  HIS A N    4  
ATOM 5240  C CA   . HIS A 1 34  ? 9.022   4.594   -15.234 1.00 0.00 ? 34  HIS A CA   4  
ATOM 5241  C C    . HIS A 1 34  ? 7.938   5.343   -14.464 1.00 0.00 ? 34  HIS A C    4  
ATOM 5242  O O    . HIS A 1 34  ? 7.218   4.755   -13.658 1.00 0.00 ? 34  HIS A O    4  
ATOM 5243  C CB   . HIS A 1 34  ? 8.382   3.607   -16.210 1.00 0.00 ? 34  HIS A CB   4  
ATOM 5244  C CG   . HIS A 1 34  ? 9.374   2.882   -17.066 1.00 0.00 ? 34  HIS A CG   4  
ATOM 5245  N ND1  . HIS A 1 34  ? 9.111   1.663   -17.656 1.00 0.00 ? 34  HIS A ND1  4  
ATOM 5246  C CD2  . HIS A 1 34  ? 10.635  3.211   -17.432 1.00 0.00 ? 34  HIS A CD2  4  
ATOM 5247  C CE1  . HIS A 1 34  ? 10.168  1.274   -18.346 1.00 0.00 ? 34  HIS A CE1  4  
ATOM 5248  N NE2  . HIS A 1 34  ? 11.106  2.196   -18.227 1.00 0.00 ? 34  HIS A NE2  4  
ATOM 5249  H H    . HIS A 1 34  ? 9.825   2.927   -14.206 1.00 0.00 ? 34  HIS A H    4  
ATOM 5250  H HA   . HIS A 1 34  ? 9.608   5.309   -15.792 1.00 0.00 ? 34  HIS A HA   4  
ATOM 5251  H HB2  . HIS A 1 34  ? 7.825   2.869   -15.651 1.00 0.00 ? 34  HIS A HB2  4  
ATOM 5252  H HB3  . HIS A 1 34  ? 7.707   4.141   -16.862 1.00 0.00 ? 34  HIS A HB3  4  
ATOM 5253  H HD1  . HIS A 1 34  ? 8.275   1.159   -17.578 1.00 0.00 ? 34  HIS A HD1  4  
ATOM 5254  H HD2  . HIS A 1 34  ? 11.172  4.106   -17.151 1.00 0.00 ? 34  HIS A HD2  4  
ATOM 5255  H HE1  . HIS A 1 34  ? 10.251  0.358   -18.912 1.00 0.00 ? 34  HIS A HE1  4  
ATOM 5256  H HE2  . HIS A 1 34  ? 12.021  2.117   -18.570 1.00 0.00 ? 34  HIS A HE2  4  
ATOM 5257  N N    . ALA A 1 35  ? 7.830   6.643   -14.718 1.00 0.00 ? 35  ALA A N    4  
ATOM 5258  C CA   . ALA A 1 35  ? 6.833   7.471   -14.050 1.00 0.00 ? 35  ALA A CA   4  
ATOM 5259  C C    . ALA A 1 35  ? 5.540   6.696   -13.821 1.00 0.00 ? 35  ALA A C    4  
ATOM 5260  O O    . ALA A 1 35  ? 4.915   6.218   -14.767 1.00 0.00 ? 35  ALA A O    4  
ATOM 5261  C CB   . ALA A 1 35  ? 6.561   8.728   -14.862 1.00 0.00 ? 35  ALA A CB   4  
ATOM 5262  H H    . ALA A 1 35  ? 8.433   7.054   -15.371 1.00 0.00 ? 35  ALA A H    4  
ATOM 5263  H HA   . ALA A 1 35  ? 7.236   7.770   -13.092 1.00 0.00 ? 35  ALA A HA   4  
ATOM 5264  H HB1  . ALA A 1 35  ? 6.167   8.452   -15.829 1.00 0.00 ? 35  ALA A HB1  4  
ATOM 5265  H HB2  . ALA A 1 35  ? 5.842   9.344   -14.342 1.00 0.00 ? 35  ALA A HB2  4  
ATOM 5266  H HB3  . ALA A 1 35  ? 7.481   9.279   -14.991 1.00 0.00 ? 35  ALA A HB3  4  
ATOM 5267  N N    . GLY A 1 36  ? 5.143   6.575   -12.557 1.00 0.00 ? 36  GLY A N    4  
ATOM 5268  C CA   . GLY A 1 36  ? 3.927   5.856   -12.228 1.00 0.00 ? 36  GLY A CA   4  
ATOM 5269  C C    . GLY A 1 36  ? 2.840   6.048   -13.267 1.00 0.00 ? 36  GLY A C    4  
ATOM 5270  O O    . GLY A 1 36  ? 2.274   5.078   -13.769 1.00 0.00 ? 36  GLY A O    4  
ATOM 5271  H H    . GLY A 1 36  ? 5.682   6.976   -11.844 1.00 0.00 ? 36  GLY A H    4  
ATOM 5272  H HA2  . GLY A 1 36  ? 4.153   4.803   -12.149 1.00 0.00 ? 36  GLY A HA2  4  
ATOM 5273  H HA3  . GLY A 1 36  ? 3.562   6.207   -11.274 1.00 0.00 ? 36  GLY A HA3  4  
ATOM 5274  N N    . ASN A 1 37  ? 2.547   7.303   -13.589 1.00 0.00 ? 37  ASN A N    4  
ATOM 5275  C CA   . ASN A 1 37  ? 1.519   7.619   -14.574 1.00 0.00 ? 37  ASN A CA   4  
ATOM 5276  C C    . ASN A 1 37  ? 2.109   7.671   -15.980 1.00 0.00 ? 37  ASN A C    4  
ATOM 5277  O O    . ASN A 1 37  ? 3.161   8.265   -16.216 1.00 0.00 ? 37  ASN A O    4  
ATOM 5278  C CB   . ASN A 1 37  ? 0.855   8.957   -14.238 1.00 0.00 ? 37  ASN A CB   4  
ATOM 5279  C CG   . ASN A 1 37  ? -0.593  9.012   -14.685 1.00 0.00 ? 37  ASN A CG   4  
ATOM 5280  O OD1  . ASN A 1 37  ? -1.349  8.059   -14.496 1.00 0.00 ? 37  ASN A OD1  4  
ATOM 5281  N ND2  . ASN A 1 37  ? -0.986  10.132  -15.281 1.00 0.00 ? 37  ASN A ND2  4  
ATOM 5282  H H    . ASN A 1 37  ? 3.033   8.035   -13.154 1.00 0.00 ? 37  ASN A H    4  
ATOM 5283  H HA   . ASN A 1 37  ? 0.774   6.839   -14.537 1.00 0.00 ? 37  ASN A HA   4  
ATOM 5284  H HB2  . ASN A 1 37  ? 0.888   9.109   -13.169 1.00 0.00 ? 37  ASN A HB2  4  
ATOM 5285  H HB3  . ASN A 1 37  ? 1.395   9.753   -14.728 1.00 0.00 ? 37  ASN A HB3  4  
ATOM 5286  H HD21 . ASN A 1 37  ? -0.329  10.850  -15.397 1.00 0.00 ? 37  ASN A HD21 4  
ATOM 5287  H HD22 . ASN A 1 37  ? -1.917  10.195  -15.579 1.00 0.00 ? 37  ASN A HD22 4  
ATOM 5288  N N    . PRO A 1 38  ? 1.417   7.034   -16.936 1.00 0.00 ? 38  PRO A N    4  
ATOM 5289  C CA   . PRO A 1 38  ? 1.853   6.993   -18.335 1.00 0.00 ? 38  PRO A CA   4  
ATOM 5290  C C    . PRO A 1 38  ? 1.737   8.352   -19.018 1.00 0.00 ? 38  PRO A C    4  
ATOM 5291  O O    . PRO A 1 38  ? 2.087   8.500   -20.189 1.00 0.00 ? 38  PRO A O    4  
ATOM 5292  C CB   . PRO A 1 38  ? 0.894   5.988   -18.976 1.00 0.00 ? 38  PRO A CB   4  
ATOM 5293  C CG   . PRO A 1 38  ? -0.327  6.031   -18.123 1.00 0.00 ? 38  PRO A CG   4  
ATOM 5294  C CD   . PRO A 1 38  ? 0.155   6.305   -16.725 1.00 0.00 ? 38  PRO A CD   4  
ATOM 5295  H HA   . PRO A 1 38  ? 2.868   6.633   -18.424 1.00 0.00 ? 38  PRO A HA   4  
ATOM 5296  H HB2  . PRO A 1 38  ? 0.678   6.290   -19.992 1.00 0.00 ? 38  PRO A HB2  4  
ATOM 5297  H HB3  . PRO A 1 38  ? 1.342   5.006   -18.975 1.00 0.00 ? 38  PRO A HB3  4  
ATOM 5298  H HG2  . PRO A 1 38  ? -0.980  6.823   -18.456 1.00 0.00 ? 38  PRO A HG2  4  
ATOM 5299  H HG3  . PRO A 1 38  ? -0.837  5.080   -18.164 1.00 0.00 ? 38  PRO A HG3  4  
ATOM 5300  H HD2  . PRO A 1 38  ? -0.559  6.916   -16.193 1.00 0.00 ? 38  PRO A HD2  4  
ATOM 5301  H HD3  . PRO A 1 38  ? 0.329   5.379   -16.198 1.00 0.00 ? 38  PRO A HD3  4  
ATOM 5302  N N    . ARG A 1 39  ? 1.243   9.340   -18.279 1.00 0.00 ? 39  ARG A N    4  
ATOM 5303  C CA   . ARG A 1 39  ? 1.080   10.686  -18.815 1.00 0.00 ? 39  ARG A CA   4  
ATOM 5304  C C    . ARG A 1 39  ? 2.435   11.317  -19.123 1.00 0.00 ? 39  ARG A C    4  
ATOM 5305  O O    . ARG A 1 39  ? 2.652   11.844  -20.214 1.00 0.00 ? 39  ARG A O    4  
ATOM 5306  C CB   . ARG A 1 39  ? 0.311   11.563  -17.824 1.00 0.00 ? 39  ARG A CB   4  
ATOM 5307  C CG   . ARG A 1 39  ? -0.355  12.768  -18.467 1.00 0.00 ? 39  ARG A CG   4  
ATOM 5308  C CD   . ARG A 1 39  ? -1.630  12.375  -19.198 1.00 0.00 ? 39  ARG A CD   4  
ATOM 5309  N NE   . ARG A 1 39  ? -2.743  12.155  -18.277 1.00 0.00 ? 39  ARG A NE   4  
ATOM 5310  C CZ   . ARG A 1 39  ? -3.507  13.132  -17.802 1.00 0.00 ? 39  ARG A CZ   4  
ATOM 5311  N NH1  . ARG A 1 39  ? -3.281  14.389  -18.158 1.00 0.00 ? 39  ARG A NH1  4  
ATOM 5312  N NH2  . ARG A 1 39  ? -4.501  12.852  -16.968 1.00 0.00 ? 39  ARG A NH2  4  
ATOM 5313  H H    . ARG A 1 39  ? 0.981   9.160   -17.352 1.00 0.00 ? 39  ARG A H    4  
ATOM 5314  H HA   . ARG A 1 39  ? 0.514   10.612  -19.731 1.00 0.00 ? 39  ARG A HA   4  
ATOM 5315  H HB2  . ARG A 1 39  ? -0.454  10.965  -17.352 1.00 0.00 ? 39  ARG A HB2  4  
ATOM 5316  H HB3  . ARG A 1 39  ? 0.997   11.918  -17.070 1.00 0.00 ? 39  ARG A HB3  4  
ATOM 5317  H HG2  . ARG A 1 39  ? -0.601  13.485  -17.698 1.00 0.00 ? 39  ARG A HG2  4  
ATOM 5318  H HG3  . ARG A 1 39  ? 0.331   13.213  -19.172 1.00 0.00 ? 39  ARG A HG3  4  
ATOM 5319  H HD2  . ARG A 1 39  ? -1.894  13.166  -19.883 1.00 0.00 ? 39  ARG A HD2  4  
ATOM 5320  H HD3  . ARG A 1 39  ? -1.447  11.466  -19.750 1.00 0.00 ? 39  ARG A HD3  4  
ATOM 5321  H HE   . ARG A 1 39  ? -2.927  11.234  -18.000 1.00 0.00 ? 39  ARG A HE   4  
ATOM 5322  H HH11 . ARG A 1 39  ? -2.534  14.602  -18.787 1.00 0.00 ? 39  ARG A HH11 4  
ATOM 5323  H HH12 . ARG A 1 39  ? -3.859  15.122  -17.799 1.00 0.00 ? 39  ARG A HH12 4  
ATOM 5324  H HH21 . ARG A 1 39  ? -4.675  11.906  -16.697 1.00 0.00 ? 39  ARG A HH21 4  
ATOM 5325  H HH22 . ARG A 1 39  ? -5.075  13.588  -16.610 1.00 0.00 ? 39  ARG A HH22 4  
ATOM 5326  N N    . ASP A 1 40  ? 3.343   11.258  -18.155 1.00 0.00 ? 40  ASP A N    4  
ATOM 5327  C CA   . ASP A 1 40  ? 4.677   11.823  -18.323 1.00 0.00 ? 40  ASP A CA   4  
ATOM 5328  C C    . ASP A 1 40  ? 5.734   10.911  -17.707 1.00 0.00 ? 40  ASP A C    4  
ATOM 5329  O O    . ASP A 1 40  ? 5.806   10.737  -16.490 1.00 0.00 ? 40  ASP A O    4  
ATOM 5330  C CB   . ASP A 1 40  ? 4.750   13.211  -17.686 1.00 0.00 ? 40  ASP A CB   4  
ATOM 5331  C CG   . ASP A 1 40  ? 3.826   14.206  -18.360 1.00 0.00 ? 40  ASP A CG   4  
ATOM 5332  O OD1  . ASP A 1 40  ? 4.168   14.681  -19.463 1.00 0.00 ? 40  ASP A OD1  4  
ATOM 5333  O OD2  . ASP A 1 40  ? 2.760   14.510  -17.784 1.00 0.00 ? 40  ASP A OD2  4  
ATOM 5334  H H    . ASP A 1 40  ? 3.110   10.824  -17.307 1.00 0.00 ? 40  ASP A H    4  
ATOM 5335  H HA   . ASP A 1 40  ? 4.869   11.912  -19.381 1.00 0.00 ? 40  ASP A HA   4  
ATOM 5336  H HB2  . ASP A 1 40  ? 4.472   13.138  -16.645 1.00 0.00 ? 40  ASP A HB2  4  
ATOM 5337  H HB3  . ASP A 1 40  ? 5.762   13.581  -17.759 1.00 0.00 ? 40  ASP A HB3  4  
ATOM 5338  N N    . PRO A 1 41  ? 6.573   10.313  -18.566 1.00 0.00 ? 41  PRO A N    4  
ATOM 5339  C CA   . PRO A 1 41  ? 7.641   9.409   -18.129 1.00 0.00 ? 41  PRO A CA   4  
ATOM 5340  C C    . PRO A 1 41  ? 8.758   10.143  -17.396 1.00 0.00 ? 41  PRO A C    4  
ATOM 5341  O O    . PRO A 1 41  ? 9.735   9.532   -16.959 1.00 0.00 ? 41  PRO A O    4  
ATOM 5342  C CB   . PRO A 1 41  ? 8.162   8.816   -19.441 1.00 0.00 ? 41  PRO A CB   4  
ATOM 5343  C CG   . PRO A 1 41  ? 7.830   9.836   -20.476 1.00 0.00 ? 41  PRO A CG   4  
ATOM 5344  C CD   . PRO A 1 41  ? 6.545   10.475  -20.029 1.00 0.00 ? 41  PRO A CD   4  
ATOM 5345  H HA   . PRO A 1 41  ? 7.259   8.618   -17.502 1.00 0.00 ? 41  PRO A HA   4  
ATOM 5346  H HB2  . PRO A 1 41  ? 9.229   8.658   -19.369 1.00 0.00 ? 41  PRO A HB2  4  
ATOM 5347  H HB3  . PRO A 1 41  ? 7.666   7.878   -19.638 1.00 0.00 ? 41  PRO A HB3  4  
ATOM 5348  H HG2  . PRO A 1 41  ? 8.617   10.573  -20.530 1.00 0.00 ? 41  PRO A HG2  4  
ATOM 5349  H HG3  . PRO A 1 41  ? 7.696   9.355   -21.434 1.00 0.00 ? 41  PRO A HG3  4  
ATOM 5350  H HD2  . PRO A 1 41  ? 6.529   11.520  -20.301 1.00 0.00 ? 41  PRO A HD2  4  
ATOM 5351  H HD3  . PRO A 1 41  ? 5.698   9.959   -20.457 1.00 0.00 ? 41  PRO A HD3  4  
ATOM 5352  N N    . THR A 1 42  ? 8.609   11.457  -17.262 1.00 0.00 ? 42  THR A N    4  
ATOM 5353  C CA   . THR A 1 42  ? 9.606   12.274  -16.582 1.00 0.00 ? 42  THR A CA   4  
ATOM 5354  C C    . THR A 1 42  ? 9.166   12.608  -15.161 1.00 0.00 ? 42  THR A C    4  
ATOM 5355  O O    . THR A 1 42  ? 9.202   13.767  -14.746 1.00 0.00 ? 42  THR A O    4  
ATOM 5356  C CB   . THR A 1 42  ? 9.874   13.585  -17.346 1.00 0.00 ? 42  THR A CB   4  
ATOM 5357  O OG1  . THR A 1 42  ? 8.658   14.328  -17.485 1.00 0.00 ? 42  THR A OG1  4  
ATOM 5358  C CG2  . THR A 1 42  ? 10.461  13.300  -18.720 1.00 0.00 ? 42  THR A CG2  4  
ATOM 5359  H H    . THR A 1 42  ? 7.809   11.886  -17.632 1.00 0.00 ? 42  THR A H    4  
ATOM 5360  H HA   . THR A 1 42  ? 10.527  11.711  -16.540 1.00 0.00 ? 42  THR A HA   4  
ATOM 5361  H HB   . THR A 1 42  ? 10.584  14.173  -16.782 1.00 0.00 ? 42  THR A HB   4  
ATOM 5362  H HG1  . THR A 1 42  ? 8.840   15.158  -17.932 1.00 0.00 ? 42  THR A HG1  4  
ATOM 5363  H HG21 . THR A 1 42  ? 10.486  12.233  -18.886 1.00 0.00 ? 42  THR A HG21 4  
ATOM 5364  H HG22 . THR A 1 42  ? 11.464  13.696  -18.772 1.00 0.00 ? 42  THR A HG22 4  
ATOM 5365  H HG23 . THR A 1 42  ? 9.849   13.767  -19.476 1.00 0.00 ? 42  THR A HG23 4  
ATOM 5366  N N    . ASP A 1 43  ? 8.751   11.587  -14.420 1.00 0.00 ? 43  ASP A N    4  
ATOM 5367  C CA   . ASP A 1 43  ? 8.306   11.773  -13.043 1.00 0.00 ? 43  ASP A CA   4  
ATOM 5368  C C    . ASP A 1 43  ? 8.825   10.652  -12.149 1.00 0.00 ? 43  ASP A C    4  
ATOM 5369  O O    . ASP A 1 43  ? 8.408   9.501   -12.275 1.00 0.00 ? 43  ASP A O    4  
ATOM 5370  C CB   . ASP A 1 43  ? 6.778   11.825  -12.982 1.00 0.00 ? 43  ASP A CB   4  
ATOM 5371  C CG   . ASP A 1 43  ? 6.273   12.537  -11.743 1.00 0.00 ? 43  ASP A CG   4  
ATOM 5372  O OD1  . ASP A 1 43  ? 7.010   12.569  -10.735 1.00 0.00 ? 43  ASP A OD1  4  
ATOM 5373  O OD2  . ASP A 1 43  ? 5.140   13.061  -11.780 1.00 0.00 ? 43  ASP A OD2  4  
ATOM 5374  H H    . ASP A 1 43  ? 8.745   10.687  -14.807 1.00 0.00 ? 43  ASP A H    4  
ATOM 5375  H HA   . ASP A 1 43  ? 8.703   12.712  -12.690 1.00 0.00 ? 43  ASP A HA   4  
ATOM 5376  H HB2  . ASP A 1 43  ? 6.407   12.348  -13.851 1.00 0.00 ? 43  ASP A HB2  4  
ATOM 5377  H HB3  . ASP A 1 43  ? 6.390   10.817  -12.980 1.00 0.00 ? 43  ASP A HB3  4  
ATOM 5378  N N    . GLU A 1 44  ? 9.738   10.997  -11.246 1.00 0.00 ? 44  GLU A N    4  
ATOM 5379  C CA   . GLU A 1 44  ? 10.315  10.018  -10.331 1.00 0.00 ? 44  GLU A CA   4  
ATOM 5380  C C    . GLU A 1 44  ? 9.427   9.829   -9.105  1.00 0.00 ? 44  GLU A C    4  
ATOM 5381  O O    . GLU A 1 44  ? 9.769   9.088   -8.185  1.00 0.00 ? 44  GLU A O    4  
ATOM 5382  C CB   . GLU A 1 44  ? 11.715  10.456  -9.898  1.00 0.00 ? 44  GLU A CB   4  
ATOM 5383  C CG   . GLU A 1 44  ? 12.718  10.507  -11.039 1.00 0.00 ? 44  GLU A CG   4  
ATOM 5384  C CD   . GLU A 1 44  ? 12.589  11.766  -11.873 1.00 0.00 ? 44  GLU A CD   4  
ATOM 5385  O OE1  . GLU A 1 44  ? 12.874  12.861  -11.344 1.00 0.00 ? 44  GLU A OE1  4  
ATOM 5386  O OE2  . GLU A 1 44  ? 12.203  11.657  -13.056 1.00 0.00 ? 44  GLU A OE2  4  
ATOM 5387  H H    . GLU A 1 44  ? 10.030  11.931  -11.194 1.00 0.00 ? 44  GLU A H    4  
ATOM 5388  H HA   . GLU A 1 44  ? 10.388  9.078   -10.856 1.00 0.00 ? 44  GLU A HA   4  
ATOM 5389  H HB2  . GLU A 1 44  ? 11.652  11.441  -9.458  1.00 0.00 ? 44  GLU A HB2  4  
ATOM 5390  H HB3  . GLU A 1 44  ? 12.082  9.763   -9.155  1.00 0.00 ? 44  GLU A HB3  4  
ATOM 5391  H HG2  . GLU A 1 44  ? 13.715  10.467  -10.627 1.00 0.00 ? 44  GLU A HG2  4  
ATOM 5392  H HG3  . GLU A 1 44  ? 12.559  9.651   -11.678 1.00 0.00 ? 44  GLU A HG3  4  
ATOM 5393  N N    . GLY A 1 45  ? 8.283   10.508  -9.100  1.00 0.00 ? 45  GLY A N    4  
ATOM 5394  C CA   . GLY A 1 45  ? 7.363   10.402  -7.982  1.00 0.00 ? 45  GLY A CA   4  
ATOM 5395  C C    . GLY A 1 45  ? 6.991   8.966   -7.671  1.00 0.00 ? 45  GLY A C    4  
ATOM 5396  O O    . GLY A 1 45  ? 7.026   8.105   -8.550  1.00 0.00 ? 45  GLY A O    4  
ATOM 5397  H H    . GLY A 1 45  ? 8.062   11.084  -9.861  1.00 0.00 ? 45  GLY A H    4  
ATOM 5398  H HA2  . GLY A 1 45  ? 7.823   10.842  -7.109  1.00 0.00 ? 45  GLY A HA2  4  
ATOM 5399  H HA3  . GLY A 1 45  ? 6.464   10.952  -8.218  1.00 0.00 ? 45  GLY A HA3  4  
ATOM 5400  N N    . ILE A 1 46  ? 6.636   8.707   -6.417  1.00 0.00 ? 46  ILE A N    4  
ATOM 5401  C CA   . ILE A 1 46  ? 6.257   7.365   -5.992  1.00 0.00 ? 46  ILE A CA   4  
ATOM 5402  C C    . ILE A 1 46  ? 4.864   7.358   -5.372  1.00 0.00 ? 46  ILE A C    4  
ATOM 5403  O O    . ILE A 1 46  ? 4.621   8.013   -4.359  1.00 0.00 ? 46  ILE A O    4  
ATOM 5404  C CB   . ILE A 1 46  ? 7.262   6.791   -4.976  1.00 0.00 ? 46  ILE A CB   4  
ATOM 5405  C CG1  . ILE A 1 46  ? 8.682   6.843   -5.545  1.00 0.00 ? 46  ILE A CG1  4  
ATOM 5406  C CG2  . ILE A 1 46  ? 6.886   5.364   -4.608  1.00 0.00 ? 46  ILE A CG2  4  
ATOM 5407  C CD1  . ILE A 1 46  ? 9.758   6.648   -4.501  1.00 0.00 ? 46  ILE A CD1  4  
ATOM 5408  H H    . ILE A 1 46  ? 6.628   9.436   -5.762  1.00 0.00 ? 46  ILE A H    4  
ATOM 5409  H HA   . ILE A 1 46  ? 6.254   6.728   -6.865  1.00 0.00 ? 46  ILE A HA   4  
ATOM 5410  H HB   . ILE A 1 46  ? 7.218   7.392   -4.081  1.00 0.00 ? 46  ILE A HB   4  
ATOM 5411  H HG12 . ILE A 1 46  ? 8.795   6.068   -6.286  1.00 0.00 ? 46  ILE A HG12 4  
ATOM 5412  H HG13 . ILE A 1 46  ? 8.840   7.806   -6.010  1.00 0.00 ? 46  ILE A HG13 4  
ATOM 5413  H HG21 . ILE A 1 46  ? 5.880   5.159   -4.944  1.00 0.00 ? 46  ILE A HG21 4  
ATOM 5414  H HG22 . ILE A 1 46  ? 7.570   4.677   -5.083  1.00 0.00 ? 46  ILE A HG22 4  
ATOM 5415  H HG23 . ILE A 1 46  ? 6.939   5.242   -3.536  1.00 0.00 ? 46  ILE A HG23 4  
ATOM 5416  H HD11 . ILE A 1 46  ? 9.456   5.874   -3.811  1.00 0.00 ? 46  ILE A HD11 4  
ATOM 5417  H HD12 . ILE A 1 46  ? 10.681  6.362   -4.983  1.00 0.00 ? 46  ILE A HD12 4  
ATOM 5418  H HD13 . ILE A 1 46  ? 9.907   7.572   -3.960  1.00 0.00 ? 46  ILE A HD13 4  
ATOM 5419  N N    . PHE A 1 47  ? 3.953   6.611   -5.987  1.00 0.00 ? 47  PHE A N    4  
ATOM 5420  C CA   . PHE A 1 47  ? 2.583   6.517   -5.495  1.00 0.00 ? 47  PHE A CA   4  
ATOM 5421  C C    . PHE A 1 47  ? 2.156   5.060   -5.350  1.00 0.00 ? 47  PHE A C    4  
ATOM 5422  O O    . PHE A 1 47  ? 2.589   4.196   -6.114  1.00 0.00 ? 47  PHE A O    4  
ATOM 5423  C CB   . PHE A 1 47  ? 1.628   7.249   -6.441  1.00 0.00 ? 47  PHE A CB   4  
ATOM 5424  C CG   . PHE A 1 47  ? 2.032   8.667   -6.722  1.00 0.00 ? 47  PHE A CG   4  
ATOM 5425  C CD1  . PHE A 1 47  ? 3.246   8.948   -7.328  1.00 0.00 ? 47  PHE A CD1  4  
ATOM 5426  C CD2  . PHE A 1 47  ? 1.199   9.720   -6.380  1.00 0.00 ? 47  PHE A CD2  4  
ATOM 5427  C CE1  . PHE A 1 47  ? 3.622   10.253  -7.589  1.00 0.00 ? 47  PHE A CE1  4  
ATOM 5428  C CE2  . PHE A 1 47  ? 1.569   11.027  -6.639  1.00 0.00 ? 47  PHE A CE2  4  
ATOM 5429  C CZ   . PHE A 1 47  ? 2.782   11.293  -7.243  1.00 0.00 ? 47  PHE A CZ   4  
ATOM 5430  H H    . PHE A 1 47  ? 4.207   6.112   -6.792  1.00 0.00 ? 47  PHE A H    4  
ATOM 5431  H HA   . PHE A 1 47  ? 2.547   6.989   -4.525  1.00 0.00 ? 47  PHE A HA   4  
ATOM 5432  H HB2  . PHE A 1 47  ? 1.591   6.722   -7.382  1.00 0.00 ? 47  PHE A HB2  4  
ATOM 5433  H HB3  . PHE A 1 47  ? 0.641   7.264   -6.002  1.00 0.00 ? 47  PHE A HB3  4  
ATOM 5434  H HD1  . PHE A 1 47  ? 3.904   8.134   -7.599  1.00 0.00 ? 47  PHE A HD1  4  
ATOM 5435  H HD2  . PHE A 1 47  ? 0.251   9.514   -5.907  1.00 0.00 ? 47  PHE A HD2  4  
ATOM 5436  H HE1  . PHE A 1 47  ? 4.571   10.457  -8.062  1.00 0.00 ? 47  PHE A HE1  4  
ATOM 5437  H HE2  . PHE A 1 47  ? 0.911   11.838  -6.367  1.00 0.00 ? 47  PHE A HE2  4  
ATOM 5438  H HZ   . PHE A 1 47  ? 3.073   12.313  -7.447  1.00 0.00 ? 47  PHE A HZ   4  
ATOM 5439  N N    . ILE A 1 48  ? 1.305   4.794   -4.365  1.00 0.00 ? 48  ILE A N    4  
ATOM 5440  C CA   . ILE A 1 48  ? 0.819   3.442   -4.120  1.00 0.00 ? 48  ILE A CA   4  
ATOM 5441  C C    . ILE A 1 48  ? 0.168   2.857   -5.368  1.00 0.00 ? 48  ILE A C    4  
ATOM 5442  O O    . ILE A 1 48  ? -0.610  3.527   -6.047  1.00 0.00 ? 48  ILE A O    4  
ATOM 5443  C CB   . ILE A 1 48  ? -0.196  3.410   -2.962  1.00 0.00 ? 48  ILE A CB   4  
ATOM 5444  C CG1  . ILE A 1 48  ? 0.465   3.874   -1.662  1.00 0.00 ? 48  ILE A CG1  4  
ATOM 5445  C CG2  . ILE A 1 48  ? -0.771  2.010   -2.800  1.00 0.00 ? 48  ILE A CG2  4  
ATOM 5446  C CD1  . ILE A 1 48  ? -0.515  4.091   -0.530  1.00 0.00 ? 48  ILE A CD1  4  
ATOM 5447  H H    . ILE A 1 48  ? 0.996   5.525   -3.790  1.00 0.00 ? 48  ILE A H    4  
ATOM 5448  H HA   . ILE A 1 48  ? 1.665   2.828   -3.847  1.00 0.00 ? 48  ILE A HA   4  
ATOM 5449  H HB   . ILE A 1 48  ? -1.006  4.080   -3.205  1.00 0.00 ? 48  ILE A HB   4  
ATOM 5450  H HG12 . ILE A 1 48  ? 1.179   3.131   -1.344  1.00 0.00 ? 48  ILE A HG12 4  
ATOM 5451  H HG13 . ILE A 1 48  ? 0.978   4.807   -1.842  1.00 0.00 ? 48  ILE A HG13 4  
ATOM 5452  H HG21 . ILE A 1 48  ? -1.551  2.026   -2.053  1.00 0.00 ? 48  ILE A HG21 4  
ATOM 5453  H HG22 . ILE A 1 48  ? -1.182  1.679   -3.742  1.00 0.00 ? 48  ILE A HG22 4  
ATOM 5454  H HG23 . ILE A 1 48  ? 0.011   1.333   -2.490  1.00 0.00 ? 48  ILE A HG23 4  
ATOM 5455  H HD11 . ILE A 1 48  ? -0.056  4.705   0.230   1.00 0.00 ? 48  ILE A HD11 4  
ATOM 5456  H HD12 . ILE A 1 48  ? -1.398  4.582   -0.908  1.00 0.00 ? 48  ILE A HD12 4  
ATOM 5457  H HD13 . ILE A 1 48  ? -0.788  3.136   -0.104  1.00 0.00 ? 48  ILE A HD13 4  
ATOM 5458  N N    . SER A 1 49  ? 0.490   1.602   -5.664  1.00 0.00 ? 49  SER A N    4  
ATOM 5459  C CA   . SER A 1 49  ? -0.063  0.926   -6.833  1.00 0.00 ? 49  SER A CA   4  
ATOM 5460  C C    . SER A 1 49  ? -0.970  -0.227  -6.415  1.00 0.00 ? 49  SER A C    4  
ATOM 5461  O O    . SER A 1 49  ? -1.721  -0.768  -7.227  1.00 0.00 ? 49  SER A O    4  
ATOM 5462  C CB   . SER A 1 49  ? 1.064   0.405   -7.727  1.00 0.00 ? 49  SER A CB   4  
ATOM 5463  O OG   . SER A 1 49  ? 1.730   -0.690  -7.123  1.00 0.00 ? 49  SER A OG   4  
ATOM 5464  H H    . SER A 1 49  ? 1.116   1.119   -5.084  1.00 0.00 ? 49  SER A H    4  
ATOM 5465  H HA   . SER A 1 49  ? -0.647  1.646   -7.386  1.00 0.00 ? 49  SER A HA   4  
ATOM 5466  H HB2  . SER A 1 49  ? 0.652   0.084   -8.671  1.00 0.00 ? 49  SER A HB2  4  
ATOM 5467  H HB3  . SER A 1 49  ? 1.779   1.197   -7.898  1.00 0.00 ? 49  SER A HB3  4  
ATOM 5468  H HG   . SER A 1 49  ? 2.292   -1.121  -7.772  1.00 0.00 ? 49  SER A HG   4  
ATOM 5469  N N    . LYS A 1 50  ? -0.894  -0.600  -5.142  1.00 0.00 ? 50  LYS A N    4  
ATOM 5470  C CA   . LYS A 1 50  ? -1.708  -1.688  -4.613  1.00 0.00 ? 50  LYS A CA   4  
ATOM 5471  C C    . LYS A 1 50  ? -1.605  -1.755  -3.093  1.00 0.00 ? 50  LYS A C    4  
ATOM 5472  O O    . LYS A 1 50  ? -0.672  -1.213  -2.499  1.00 0.00 ? 50  LYS A O    4  
ATOM 5473  C CB   . LYS A 1 50  ? -1.272  -3.022  -5.224  1.00 0.00 ? 50  LYS A CB   4  
ATOM 5474  C CG   . LYS A 1 50  ? -2.067  -4.212  -4.716  1.00 0.00 ? 50  LYS A CG   4  
ATOM 5475  C CD   . LYS A 1 50  ? -1.805  -5.455  -5.550  1.00 0.00 ? 50  LYS A CD   4  
ATOM 5476  C CE   . LYS A 1 50  ? -2.677  -5.484  -6.796  1.00 0.00 ? 50  LYS A CE   4  
ATOM 5477  N NZ   . LYS A 1 50  ? -4.101  -5.770  -6.469  1.00 0.00 ? 50  LYS A NZ   4  
ATOM 5478  H H    . LYS A 1 50  ? -0.276  -0.131  -4.543  1.00 0.00 ? 50  LYS A H    4  
ATOM 5479  H HA   . LYS A 1 50  ? -2.735  -1.496  -4.884  1.00 0.00 ? 50  LYS A HA   4  
ATOM 5480  H HB2  . LYS A 1 50  ? -1.389  -2.968  -6.296  1.00 0.00 ? 50  LYS A HB2  4  
ATOM 5481  H HB3  . LYS A 1 50  ? -0.229  -3.187  -4.992  1.00 0.00 ? 50  LYS A HB3  4  
ATOM 5482  H HG2  . LYS A 1 50  ? -1.785  -4.413  -3.693  1.00 0.00 ? 50  LYS A HG2  4  
ATOM 5483  H HG3  . LYS A 1 50  ? -3.121  -3.975  -4.761  1.00 0.00 ? 50  LYS A HG3  4  
ATOM 5484  H HD2  . LYS A 1 50  ? -0.768  -5.464  -5.851  1.00 0.00 ? 50  LYS A HD2  4  
ATOM 5485  H HD3  . LYS A 1 50  ? -2.016  -6.330  -4.953  1.00 0.00 ? 50  LYS A HD3  4  
ATOM 5486  H HE2  . LYS A 1 50  ? -2.615  -4.525  -7.286  1.00 0.00 ? 50  LYS A HE2  4  
ATOM 5487  H HE3  . LYS A 1 50  ? -2.308  -6.252  -7.460  1.00 0.00 ? 50  LYS A HE3  4  
ATOM 5488  H HZ1  . LYS A 1 50  ? -4.728  -5.244  -7.112  1.00 0.00 ? 50  LYS A HZ1  4  
ATOM 5489  H HZ2  . LYS A 1 50  ? -4.308  -5.484  -5.491  1.00 0.00 ? 50  LYS A HZ2  4  
ATOM 5490  H HZ3  . LYS A 1 50  ? -4.294  -6.787  -6.570  1.00 0.00 ? 50  LYS A HZ3  4  
ATOM 5491  N N    . VAL A 1 51  ? -2.568  -2.425  -2.468  1.00 0.00 ? 51  VAL A N    4  
ATOM 5492  C CA   . VAL A 1 51  ? -2.584  -2.566  -1.017  1.00 0.00 ? 51  VAL A CA   4  
ATOM 5493  C C    . VAL A 1 51  ? -3.250  -3.871  -0.598  1.00 0.00 ? 51  VAL A C    4  
ATOM 5494  O O    . VAL A 1 51  ? -4.412  -4.119  -0.922  1.00 0.00 ? 51  VAL A O    4  
ATOM 5495  C CB   . VAL A 1 51  ? -3.318  -1.389  -0.347  1.00 0.00 ? 51  VAL A CB   4  
ATOM 5496  C CG1  . VAL A 1 51  ? -3.375  -1.584  1.161   1.00 0.00 ? 51  VAL A CG1  4  
ATOM 5497  C CG2  . VAL A 1 51  ? -2.644  -0.072  -0.698  1.00 0.00 ? 51  VAL A CG2  4  
ATOM 5498  H H    . VAL A 1 51  ? -3.284  -2.836  -2.995  1.00 0.00 ? 51  VAL A H    4  
ATOM 5499  H HA   . VAL A 1 51  ? -1.560  -2.568  -0.670  1.00 0.00 ? 51  VAL A HA   4  
ATOM 5500  H HB   . VAL A 1 51  ? -4.330  -1.363  -0.722  1.00 0.00 ? 51  VAL A HB   4  
ATOM 5501  H HG11 . VAL A 1 51  ? -2.741  -2.412  1.440   1.00 0.00 ? 51  VAL A HG11 4  
ATOM 5502  H HG12 . VAL A 1 51  ? -3.033  -0.685  1.653   1.00 0.00 ? 51  VAL A HG12 4  
ATOM 5503  H HG13 . VAL A 1 51  ? -4.392  -1.793  1.458   1.00 0.00 ? 51  VAL A HG13 4  
ATOM 5504  H HG21 . VAL A 1 51  ? -1.681  -0.020  -0.212  1.00 0.00 ? 51  VAL A HG21 4  
ATOM 5505  H HG22 . VAL A 1 51  ? -2.511  -0.009  -1.768  1.00 0.00 ? 51  VAL A HG22 4  
ATOM 5506  H HG23 . VAL A 1 51  ? -3.260  0.749   -0.363  1.00 0.00 ? 51  VAL A HG23 4  
ATOM 5507  N N    . SER A 1 52  ? -2.508  -4.704  0.125   1.00 0.00 ? 52  SER A N    4  
ATOM 5508  C CA   . SER A 1 52  ? -3.025  -5.986  0.586   1.00 0.00 ? 52  SER A CA   4  
ATOM 5509  C C    . SER A 1 52  ? -4.120  -5.787  1.629   1.00 0.00 ? 52  SER A C    4  
ATOM 5510  O O    . SER A 1 52  ? -4.029  -4.926  2.505   1.00 0.00 ? 52  SER A O    4  
ATOM 5511  C CB   . SER A 1 52  ? -1.896  -6.836  1.171   1.00 0.00 ? 52  SER A CB   4  
ATOM 5512  O OG   . SER A 1 52  ? -2.295  -8.188  1.312   1.00 0.00 ? 52  SER A OG   4  
ATOM 5513  H H    . SER A 1 52  ? -1.588  -4.450  0.351   1.00 0.00 ? 52  SER A H    4  
ATOM 5514  H HA   . SER A 1 52  ? -3.446  -6.500  -0.267  1.00 0.00 ? 52  SER A HA   4  
ATOM 5515  H HB2  . SER A 1 52  ? -1.040  -6.793  0.515   1.00 0.00 ? 52  SER A HB2  4  
ATOM 5516  H HB3  . SER A 1 52  ? -1.625  -6.449  2.143   1.00 0.00 ? 52  SER A HB3  4  
ATOM 5517  H HG   . SER A 1 52  ? -1.556  -8.764  1.103   1.00 0.00 ? 52  SER A HG   4  
ATOM 5518  N N    . PRO A 1 53  ? -5.182  -6.601  1.535   1.00 0.00 ? 53  PRO A N    4  
ATOM 5519  C CA   . PRO A 1 53  ? -6.315  -6.535  2.462   1.00 0.00 ? 53  PRO A CA   4  
ATOM 5520  C C    . PRO A 1 53  ? -5.948  -7.015  3.862   1.00 0.00 ? 53  PRO A C    4  
ATOM 5521  O O    . PRO A 1 53  ? -6.514  -6.559  4.856   1.00 0.00 ? 53  PRO A O    4  
ATOM 5522  C CB   . PRO A 1 53  ? -7.347  -7.472  1.829   1.00 0.00 ? 53  PRO A CB   4  
ATOM 5523  C CG   . PRO A 1 53  ? -6.542  -8.428  1.018   1.00 0.00 ? 53  PRO A CG   4  
ATOM 5524  C CD   . PRO A 1 53  ? -5.357  -7.650  0.516   1.00 0.00 ? 53  PRO A CD   4  
ATOM 5525  H HA   . PRO A 1 53  ? -6.722  -5.536  2.521   1.00 0.00 ? 53  PRO A HA   4  
ATOM 5526  H HB2  . PRO A 1 53  ? -7.900  -7.981  2.607   1.00 0.00 ? 53  PRO A HB2  4  
ATOM 5527  H HB3  . PRO A 1 53  ? -8.024  -6.903  1.212   1.00 0.00 ? 53  PRO A HB3  4  
ATOM 5528  H HG2  . PRO A 1 53  ? -6.217  -9.251  1.635   1.00 0.00 ? 53  PRO A HG2  4  
ATOM 5529  H HG3  . PRO A 1 53  ? -7.131  -8.790  0.187   1.00 0.00 ? 53  PRO A HG3  4  
ATOM 5530  H HD2  . PRO A 1 53  ? -4.485  -8.285  0.462   1.00 0.00 ? 53  PRO A HD2  4  
ATOM 5531  H HD3  . PRO A 1 53  ? -5.571  -7.217  -0.449  1.00 0.00 ? 53  PRO A HD3  4  
ATOM 5532  N N    . THR A 1 54  ? -4.994  -7.939  3.935   1.00 0.00 ? 54  THR A N    4  
ATOM 5533  C CA   . THR A 1 54  ? -4.552  -8.482  5.213   1.00 0.00 ? 54  THR A CA   4  
ATOM 5534  C C    . THR A 1 54  ? -3.359  -7.704  5.757   1.00 0.00 ? 54  THR A C    4  
ATOM 5535  O O    . THR A 1 54  ? -2.789  -8.062  6.787   1.00 0.00 ? 54  THR A O    4  
ATOM 5536  C CB   . THR A 1 54  ? -4.168  -9.968  5.090   1.00 0.00 ? 54  THR A CB   4  
ATOM 5537  O OG1  . THR A 1 54  ? -2.900  -10.094 4.437   1.00 0.00 ? 54  THR A OG1  4  
ATOM 5538  C CG2  . THR A 1 54  ? -5.224  -10.737 4.310   1.00 0.00 ? 54  THR A CG2  4  
ATOM 5539  H H    . THR A 1 54  ? -4.581  -8.263  3.108   1.00 0.00 ? 54  THR A H    4  
ATOM 5540  H HA   . THR A 1 54  ? -5.371  -8.400  5.912   1.00 0.00 ? 54  THR A HA   4  
ATOM 5541  H HB   . THR A 1 54  ? -4.097  -10.390 6.082   1.00 0.00 ? 54  THR A HB   4  
ATOM 5542  H HG1  . THR A 1 54  ? -2.989  -9.846  3.513   1.00 0.00 ? 54  THR A HG1  4  
ATOM 5543  H HG21 . THR A 1 54  ? -5.861  -10.041 3.785   1.00 0.00 ? 54  THR A HG21 4  
ATOM 5544  H HG22 . THR A 1 54  ? -5.819  -11.325 4.993   1.00 0.00 ? 54  THR A HG22 4  
ATOM 5545  H HG23 . THR A 1 54  ? -4.741  -11.390 3.599   1.00 0.00 ? 54  THR A HG23 4  
ATOM 5546  N N    . GLY A 1 55  ? -2.985  -6.637  5.057   1.00 0.00 ? 55  GLY A N    4  
ATOM 5547  C CA   . GLY A 1 55  ? -1.861  -5.825  5.486   1.00 0.00 ? 55  GLY A CA   4  
ATOM 5548  C C    . GLY A 1 55  ? -2.262  -4.770  6.499   1.00 0.00 ? 55  GLY A C    4  
ATOM 5549  O O    . GLY A 1 55  ? -3.439  -4.435  6.624   1.00 0.00 ? 55  GLY A O    4  
ATOM 5550  H H    . GLY A 1 55  ? -3.477  -6.399  4.243   1.00 0.00 ? 55  GLY A H    4  
ATOM 5551  H HA2  . GLY A 1 55  ? -1.115  -6.467  5.928   1.00 0.00 ? 55  GLY A HA2  4  
ATOM 5552  H HA3  . GLY A 1 55  ? -1.436  -5.335  4.623   1.00 0.00 ? 55  GLY A HA3  4  
ATOM 5553  N N    . ALA A 1 56  ? -1.279  -4.245  7.224   1.00 0.00 ? 56  ALA A N    4  
ATOM 5554  C CA   . ALA A 1 56  ? -1.535  -3.222  8.230   1.00 0.00 ? 56  ALA A CA   4  
ATOM 5555  C C    . ALA A 1 56  ? -2.354  -2.074  7.650   1.00 0.00 ? 56  ALA A C    4  
ATOM 5556  O O    . ALA A 1 56  ? -3.245  -1.539  8.310   1.00 0.00 ? 56  ALA A O    4  
ATOM 5557  C CB   . ALA A 1 56  ? -0.223  -2.702  8.799   1.00 0.00 ? 56  ALA A CB   4  
ATOM 5558  H H    . ALA A 1 56  ? -0.360  -4.553  7.078   1.00 0.00 ? 56  ALA A H    4  
ATOM 5559  H HA   . ALA A 1 56  ? -2.093  -3.678  9.036   1.00 0.00 ? 56  ALA A HA   4  
ATOM 5560  H HB1  . ALA A 1 56  ? -0.430  -2.022  9.613   1.00 0.00 ? 56  ALA A HB1  4  
ATOM 5561  H HB2  . ALA A 1 56  ? 0.365   -3.531  9.162   1.00 0.00 ? 56  ALA A HB2  4  
ATOM 5562  H HB3  . ALA A 1 56  ? 0.323   -2.183  8.026   1.00 0.00 ? 56  ALA A HB3  4  
ATOM 5563  N N    . ALA A 1 57  ? -2.047  -1.700  6.412   1.00 0.00 ? 57  ALA A N    4  
ATOM 5564  C CA   . ALA A 1 57  ? -2.756  -0.617  5.743   1.00 0.00 ? 57  ALA A CA   4  
ATOM 5565  C C    . ALA A 1 57  ? -4.181  -1.030  5.389   1.00 0.00 ? 57  ALA A C    4  
ATOM 5566  O O    . ALA A 1 57  ? -5.146  -0.406  5.829   1.00 0.00 ? 57  ALA A O    4  
ATOM 5567  C CB   . ALA A 1 57  ? -2.003  -0.185  4.494   1.00 0.00 ? 57  ALA A CB   4  
ATOM 5568  H H    . ALA A 1 57  ? -1.327  -2.165  5.938   1.00 0.00 ? 57  ALA A H    4  
ATOM 5569  H HA   . ALA A 1 57  ? -2.794  0.225   6.420   1.00 0.00 ? 57  ALA A HA   4  
ATOM 5570  H HB1  . ALA A 1 57  ? -1.391  0.675   4.723   1.00 0.00 ? 57  ALA A HB1  4  
ATOM 5571  H HB2  . ALA A 1 57  ? -1.374  -0.995  4.155   1.00 0.00 ? 57  ALA A HB2  4  
ATOM 5572  H HB3  . ALA A 1 57  ? -2.709  0.071   3.719   1.00 0.00 ? 57  ALA A HB3  4  
ATOM 5573  N N    . GLY A 1 58  ? -4.305  -2.084  4.589   1.00 0.00 ? 58  GLY A N    4  
ATOM 5574  C CA   . GLY A 1 58  ? -5.615  -2.562  4.188   1.00 0.00 ? 58  GLY A CA   4  
ATOM 5575  C C    . GLY A 1 58  ? -6.629  -2.486  5.312   1.00 0.00 ? 58  GLY A C    4  
ATOM 5576  O O    . GLY A 1 58  ? -7.774  -2.089  5.099   1.00 0.00 ? 58  GLY A O    4  
ATOM 5577  H H    . GLY A 1 58  ? -3.499  -2.542  4.268   1.00 0.00 ? 58  GLY A H    4  
ATOM 5578  H HA2  . GLY A 1 58  ? -5.966  -1.964  3.360   1.00 0.00 ? 58  GLY A HA2  4  
ATOM 5579  H HA3  . GLY A 1 58  ? -5.528  -3.589  3.866   1.00 0.00 ? 58  GLY A HA3  4  
ATOM 5580  N N    . ARG A 1 59  ? -6.207  -2.868  6.513   1.00 0.00 ? 59  ARG A N    4  
ATOM 5581  C CA   . ARG A 1 59  ? -7.088  -2.845  7.675   1.00 0.00 ? 59  ARG A CA   4  
ATOM 5582  C C    . ARG A 1 59  ? -7.142  -1.448  8.288   1.00 0.00 ? 59  ARG A C    4  
ATOM 5583  O O    . ARG A 1 59  ? -8.153  -1.053  8.868   1.00 0.00 ? 59  ARG A O    4  
ATOM 5584  C CB   . ARG A 1 59  ? -6.613  -3.854  8.722   1.00 0.00 ? 59  ARG A CB   4  
ATOM 5585  C CG   . ARG A 1 59  ? -5.308  -3.464  9.396   1.00 0.00 ? 59  ARG A CG   4  
ATOM 5586  C CD   . ARG A 1 59  ? -4.884  -4.498  10.428  1.00 0.00 ? 59  ARG A CD   4  
ATOM 5587  N NE   . ARG A 1 59  ? -3.988  -3.932  11.433  1.00 0.00 ? 59  ARG A NE   4  
ATOM 5588  C CZ   . ARG A 1 59  ? -3.556  -4.605  12.494  1.00 0.00 ? 59  ARG A CZ   4  
ATOM 5589  N NH1  . ARG A 1 59  ? -3.935  -5.861  12.687  1.00 0.00 ? 59  ARG A NH1  4  
ATOM 5590  N NH2  . ARG A 1 59  ? -2.742  -4.021  13.364  1.00 0.00 ? 59  ARG A NH2  4  
ATOM 5591  H H    . ARG A 1 59  ? -5.283  -3.175  6.621   1.00 0.00 ? 59  ARG A H    4  
ATOM 5592  H HA   . ARG A 1 59  ? -8.079  -3.119  7.346   1.00 0.00 ? 59  ARG A HA   4  
ATOM 5593  H HB2  . ARG A 1 59  ? -7.373  -3.949  9.484   1.00 0.00 ? 59  ARG A HB2  4  
ATOM 5594  H HB3  . ARG A 1 59  ? -6.474  -4.812  8.244   1.00 0.00 ? 59  ARG A HB3  4  
ATOM 5595  H HG2  . ARG A 1 59  ? -4.536  -3.383  8.646   1.00 0.00 ? 59  ARG A HG2  4  
ATOM 5596  H HG3  . ARG A 1 59  ? -5.438  -2.511  9.887   1.00 0.00 ? 59  ARG A HG3  4  
ATOM 5597  H HD2  . ARG A 1 59  ? -5.766  -4.879  10.920  1.00 0.00 ? 59  ARG A HD2  4  
ATOM 5598  H HD3  . ARG A 1 59  ? -4.377  -5.306  9.921   1.00 0.00 ? 59  ARG A HD3  4  
ATOM 5599  H HE   . ARG A 1 59  ? -3.695  -3.006  11.310  1.00 0.00 ? 59  ARG A HE   4  
ATOM 5600  H HH11 . ARG A 1 59  ? -4.547  -6.303  12.032  1.00 0.00 ? 59  ARG A HH11 4  
ATOM 5601  H HH12 . ARG A 1 59  ? -3.607  -6.365  13.486  1.00 0.00 ? 59  ARG A HH12 4  
ATOM 5602  H HH21 . ARG A 1 59  ? -2.453  -3.075  13.222  1.00 0.00 ? 59  ARG A HH21 4  
ATOM 5603  H HH22 . ARG A 1 59  ? -2.417  -4.528  14.162  1.00 0.00 ? 59  ARG A HH22 4  
ATOM 5604  N N    . ASP A 1 60  ? -6.048  -0.707  8.155   1.00 0.00 ? 60  ASP A N    4  
ATOM 5605  C CA   . ASP A 1 60  ? -5.971  0.646   8.694   1.00 0.00 ? 60  ASP A CA   4  
ATOM 5606  C C    . ASP A 1 60  ? -7.229  1.439   8.354   1.00 0.00 ? 60  ASP A C    4  
ATOM 5607  O O    . ASP A 1 60  ? -7.912  1.949   9.242   1.00 0.00 ? 60  ASP A O    4  
ATOM 5608  C CB   . ASP A 1 60  ? -4.736  1.366   8.149   1.00 0.00 ? 60  ASP A CB   4  
ATOM 5609  C CG   . ASP A 1 60  ? -4.550  2.740   8.762   1.00 0.00 ? 60  ASP A CG   4  
ATOM 5610  O OD1  . ASP A 1 60  ? -5.140  2.998   9.832   1.00 0.00 ? 60  ASP A OD1  4  
ATOM 5611  O OD2  . ASP A 1 60  ? -3.812  3.557   8.172   1.00 0.00 ? 60  ASP A OD2  4  
ATOM 5612  H H    . ASP A 1 60  ? -5.274  -1.078  7.681   1.00 0.00 ? 60  ASP A H    4  
ATOM 5613  H HA   . ASP A 1 60  ? -5.887  0.570   9.768   1.00 0.00 ? 60  ASP A HA   4  
ATOM 5614  H HB2  . ASP A 1 60  ? -3.858  0.774   8.365   1.00 0.00 ? 60  ASP A HB2  4  
ATOM 5615  H HB3  . ASP A 1 60  ? -4.836  1.478   7.080   1.00 0.00 ? 60  ASP A HB3  4  
ATOM 5616  N N    . GLY A 1 61  ? -7.527  1.541   7.063   1.00 0.00 ? 61  GLY A N    4  
ATOM 5617  C CA   . GLY A 1 61  ? -8.702  2.275   6.628   1.00 0.00 ? 61  GLY A CA   4  
ATOM 5618  C C    . GLY A 1 61  ? -8.355  3.629   6.042   1.00 0.00 ? 61  GLY A C    4  
ATOM 5619  O O    . GLY A 1 61  ? -9.148  4.215   5.304   1.00 0.00 ? 61  GLY A O    4  
ATOM 5620  H H    . GLY A 1 61  ? -6.945  1.114   6.399   1.00 0.00 ? 61  GLY A H    4  
ATOM 5621  H HA2  . GLY A 1 61  ? -9.221  1.693   5.882   1.00 0.00 ? 61  GLY A HA2  4  
ATOM 5622  H HA3  . GLY A 1 61  ? -9.355  2.420   7.476   1.00 0.00 ? 61  GLY A HA3  4  
ATOM 5623  N N    . ARG A 1 62  ? -7.168  4.128   6.371   1.00 0.00 ? 62  ARG A N    4  
ATOM 5624  C CA   . ARG A 1 62  ? -6.720  5.423   5.874   1.00 0.00 ? 62  ARG A CA   4  
ATOM 5625  C C    . ARG A 1 62  ? -5.838  5.256   4.639   1.00 0.00 ? 62  ARG A C    4  
ATOM 5626  O O    . ARG A 1 62  ? -5.664  6.191   3.856   1.00 0.00 ? 62  ARG A O    4  
ATOM 5627  C CB   . ARG A 1 62  ? -5.953  6.174   6.964   1.00 0.00 ? 62  ARG A CB   4  
ATOM 5628  C CG   . ARG A 1 62  ? -6.505  5.949   8.362   1.00 0.00 ? 62  ARG A CG   4  
ATOM 5629  C CD   . ARG A 1 62  ? -7.746  6.792   8.613   1.00 0.00 ? 62  ARG A CD   4  
ATOM 5630  N NE   . ARG A 1 62  ? -8.841  6.434   7.716   1.00 0.00 ? 62  ARG A NE   4  
ATOM 5631  C CZ   . ARG A 1 62  ? -9.935  7.172   7.562   1.00 0.00 ? 62  ARG A CZ   4  
ATOM 5632  N NH1  . ARG A 1 62  ? -10.078 8.301   8.241   1.00 0.00 ? 62  ARG A NH1  4  
ATOM 5633  N NH2  . ARG A 1 62  ? -10.889 6.779   6.727   1.00 0.00 ? 62  ARG A NH2  4  
ATOM 5634  H H    . ARG A 1 62  ? -6.580  3.614   6.963   1.00 0.00 ? 62  ARG A H    4  
ATOM 5635  H HA   . ARG A 1 62  ? -7.594  5.995   5.602   1.00 0.00 ? 62  ARG A HA   4  
ATOM 5636  H HB2  . ARG A 1 62  ? -4.922  5.851   6.951   1.00 0.00 ? 62  ARG A HB2  4  
ATOM 5637  H HB3  . ARG A 1 62  ? -5.992  7.232   6.751   1.00 0.00 ? 62  ARG A HB3  4  
ATOM 5638  H HG2  . ARG A 1 62  ? -6.763  4.906   8.473   1.00 0.00 ? 62  ARG A HG2  4  
ATOM 5639  H HG3  . ARG A 1 62  ? -5.748  6.214   9.084   1.00 0.00 ? 62  ARG A HG3  4  
ATOM 5640  H HD2  . ARG A 1 62  ? -8.065  6.643   9.634   1.00 0.00 ? 62  ARG A HD2  4  
ATOM 5641  H HD3  . ARG A 1 62  ? -7.494  7.831   8.463   1.00 0.00 ? 62  ARG A HD3  4  
ATOM 5642  H HE   . ARG A 1 62  ? -8.756  5.603   7.205   1.00 0.00 ? 62  ARG A HE   4  
ATOM 5643  H HH11 . ARG A 1 62  ? -9.361  8.600   8.870   1.00 0.00 ? 62  ARG A HH11 4  
ATOM 5644  H HH12 . ARG A 1 62  ? -10.903 8.856   8.122   1.00 0.00 ? 62  ARG A HH12 4  
ATOM 5645  H HH21 . ARG A 1 62  ? -10.784 5.928   6.213   1.00 0.00 ? 62  ARG A HH21 4  
ATOM 5646  H HH22 . ARG A 1 62  ? -11.712 7.335   6.611   1.00 0.00 ? 62  ARG A HH22 4  
ATOM 5647  N N    . LEU A 1 63  ? -5.283  4.061   4.473   1.00 0.00 ? 63  LEU A N    4  
ATOM 5648  C CA   . LEU A 1 63  ? -4.419  3.771   3.334   1.00 0.00 ? 63  LEU A CA   4  
ATOM 5649  C C    . LEU A 1 63  ? -5.231  3.251   2.152   1.00 0.00 ? 63  LEU A C    4  
ATOM 5650  O O    . LEU A 1 63  ? -6.093  2.387   2.311   1.00 0.00 ? 63  LEU A O    4  
ATOM 5651  C CB   . LEU A 1 63  ? -3.353  2.745   3.726   1.00 0.00 ? 63  LEU A CB   4  
ATOM 5652  C CG   . LEU A 1 63  ? -2.061  2.775   2.909   1.00 0.00 ? 63  LEU A CG   4  
ATOM 5653  C CD1  . LEU A 1 63  ? -2.291  2.194   1.523   1.00 0.00 ? 63  LEU A CD1  4  
ATOM 5654  C CD2  . LEU A 1 63  ? -1.524  4.196   2.811   1.00 0.00 ? 63  LEU A CD2  4  
ATOM 5655  H H    . LEU A 1 63  ? -5.459  3.356   5.130   1.00 0.00 ? 63  LEU A H    4  
ATOM 5656  H HA   . LEU A 1 63  ? -3.932  4.690   3.045   1.00 0.00 ? 63  LEU A HA   4  
ATOM 5657  H HB2  . LEU A 1 63  ? -3.095  2.916   4.760   1.00 0.00 ? 63  LEU A HB2  4  
ATOM 5658  H HB3  . LEU A 1 63  ? -3.788  1.762   3.623   1.00 0.00 ? 63  LEU A HB3  4  
ATOM 5659  H HG   . LEU A 1 63  ? -1.315  2.169   3.405   1.00 0.00 ? 63  LEU A HG   4  
ATOM 5660  H HD11 . LEU A 1 63  ? -3.085  1.464   1.567   1.00 0.00 ? 63  LEU A HD11 4  
ATOM 5661  H HD12 . LEU A 1 63  ? -1.385  1.720   1.176   1.00 0.00 ? 63  LEU A HD12 4  
ATOM 5662  H HD13 . LEU A 1 63  ? -2.567  2.986   0.842   1.00 0.00 ? 63  LEU A HD13 4  
ATOM 5663  H HD21 . LEU A 1 63  ? -1.952  4.683   1.947   1.00 0.00 ? 63  LEU A HD21 4  
ATOM 5664  H HD22 . LEU A 1 63  ? -0.449  4.169   2.713   1.00 0.00 ? 63  LEU A HD22 4  
ATOM 5665  H HD23 . LEU A 1 63  ? -1.791  4.744   3.703   1.00 0.00 ? 63  LEU A HD23 4  
ATOM 5666  N N    . ARG A 1 64  ? -4.947  3.781   0.967   1.00 0.00 ? 64  ARG A N    4  
ATOM 5667  C CA   . ARG A 1 64  ? -5.650  3.370   -0.242  1.00 0.00 ? 64  ARG A CA   4  
ATOM 5668  C C    . ARG A 1 64  ? -4.703  3.339   -1.438  1.00 0.00 ? 64  ARG A C    4  
ATOM 5669  O O    . ARG A 1 64  ? -3.696  4.047   -1.464  1.00 0.00 ? 64  ARG A O    4  
ATOM 5670  C CB   . ARG A 1 64  ? -6.817  4.317   -0.526  1.00 0.00 ? 64  ARG A CB   4  
ATOM 5671  C CG   . ARG A 1 64  ? -7.764  4.487   0.651   1.00 0.00 ? 64  ARG A CG   4  
ATOM 5672  C CD   . ARG A 1 64  ? -8.886  3.461   0.616   1.00 0.00 ? 64  ARG A CD   4  
ATOM 5673  N NE   . ARG A 1 64  ? -9.997  3.893   -0.228  1.00 0.00 ? 64  ARG A NE   4  
ATOM 5674  C CZ   . ARG A 1 64  ? -10.807 4.899   0.082   1.00 0.00 ? 64  ARG A CZ   4  
ATOM 5675  N NH1  . ARG A 1 64  ? -10.630 5.574   1.209   1.00 0.00 ? 64  ARG A NH1  4  
ATOM 5676  N NH2  . ARG A 1 64  ? -11.796 5.232   -0.738  1.00 0.00 ? 64  ARG A NH2  4  
ATOM 5677  H H    . ARG A 1 64  ? -4.248  4.466   0.904   1.00 0.00 ? 64  ARG A H    4  
ATOM 5678  H HA   . ARG A 1 64  ? -6.037  2.375   -0.079  1.00 0.00 ? 64  ARG A HA   4  
ATOM 5679  H HB2  . ARG A 1 64  ? -6.422  5.289   -0.785  1.00 0.00 ? 64  ARG A HB2  4  
ATOM 5680  H HB3  . ARG A 1 64  ? -7.382  3.933   -1.362  1.00 0.00 ? 64  ARG A HB3  4  
ATOM 5681  H HG2  . ARG A 1 64  ? -7.208  4.365   1.569   1.00 0.00 ? 64  ARG A HG2  4  
ATOM 5682  H HG3  . ARG A 1 64  ? -8.192  5.478   0.616   1.00 0.00 ? 64  ARG A HG3  4  
ATOM 5683  H HD2  . ARG A 1 64  ? -8.494  2.531   0.231   1.00 0.00 ? 64  ARG A HD2  4  
ATOM 5684  H HD3  . ARG A 1 64  ? -9.247  3.309   1.622   1.00 0.00 ? 64  ARG A HD3  4  
ATOM 5685  H HE   . ARG A 1 64  ? -10.145 3.408   -1.066  1.00 0.00 ? 64  ARG A HE   4  
ATOM 5686  H HH11 . ARG A 1 64  ? -9.886  5.325   1.828   1.00 0.00 ? 64  ARG A HH11 4  
ATOM 5687  H HH12 . ARG A 1 64  ? -11.241 6.332   1.439   1.00 0.00 ? 64  ARG A HH12 4  
ATOM 5688  H HH21 . ARG A 1 64  ? -11.931 4.726   -1.589  1.00 0.00 ? 64  ARG A HH21 4  
ATOM 5689  H HH22 . ARG A 1 64  ? -12.405 5.989   -0.504  1.00 0.00 ? 64  ARG A HH22 4  
ATOM 5690  N N    . VAL A 1 65  ? -5.033  2.514   -2.427  1.00 0.00 ? 65  VAL A N    4  
ATOM 5691  C CA   . VAL A 1 65  ? -4.213  2.391   -3.626  1.00 0.00 ? 65  VAL A CA   4  
ATOM 5692  C C    . VAL A 1 65  ? -4.306  3.647   -4.486  1.00 0.00 ? 65  VAL A C    4  
ATOM 5693  O O    . VAL A 1 65  ? -5.131  3.729   -5.395  1.00 0.00 ? 65  VAL A O    4  
ATOM 5694  C CB   . VAL A 1 65  ? -4.631  1.172   -4.469  1.00 0.00 ? 65  VAL A CB   4  
ATOM 5695  C CG1  . VAL A 1 65  ? -3.627  0.926   -5.586  1.00 0.00 ? 65  VAL A CG1  4  
ATOM 5696  C CG2  . VAL A 1 65  ? -4.774  -0.060  -3.589  1.00 0.00 ? 65  VAL A CG2  4  
ATOM 5697  H H    . VAL A 1 65  ? -5.848  1.975   -2.348  1.00 0.00 ? 65  VAL A H    4  
ATOM 5698  H HA   . VAL A 1 65  ? -3.187  2.254   -3.316  1.00 0.00 ? 65  VAL A HA   4  
ATOM 5699  H HB   . VAL A 1 65  ? -5.590  1.382   -4.918  1.00 0.00 ? 65  VAL A HB   4  
ATOM 5700  H HG11 . VAL A 1 65  ? -3.834  1.594   -6.409  1.00 0.00 ? 65  VAL A HG11 4  
ATOM 5701  H HG12 . VAL A 1 65  ? -2.628  1.104   -5.218  1.00 0.00 ? 65  VAL A HG12 4  
ATOM 5702  H HG13 . VAL A 1 65  ? -3.710  -0.096  -5.924  1.00 0.00 ? 65  VAL A HG13 4  
ATOM 5703  H HG21 . VAL A 1 65  ? -5.119  0.236   -2.610  1.00 0.00 ? 65  VAL A HG21 4  
ATOM 5704  H HG22 . VAL A 1 65  ? -5.488  -0.739  -4.032  1.00 0.00 ? 65  VAL A HG22 4  
ATOM 5705  H HG23 . VAL A 1 65  ? -3.817  -0.553  -3.500  1.00 0.00 ? 65  VAL A HG23 4  
ATOM 5706  N N    . GLY A 1 66  ? -3.452  4.623   -4.193  1.00 0.00 ? 66  GLY A N    4  
ATOM 5707  C CA   . GLY A 1 66  ? -3.454  5.862   -4.949  1.00 0.00 ? 66  GLY A CA   4  
ATOM 5708  C C    . GLY A 1 66  ? -2.832  7.011   -4.181  1.00 0.00 ? 66  GLY A C    4  
ATOM 5709  O O    . GLY A 1 66  ? -2.466  8.032   -4.764  1.00 0.00 ? 66  GLY A O    4  
ATOM 5710  H H    . GLY A 1 66  ? -2.816  4.501   -3.457  1.00 0.00 ? 66  GLY A H    4  
ATOM 5711  H HA2  . GLY A 1 66  ? -2.901  5.713   -5.864  1.00 0.00 ? 66  GLY A HA2  4  
ATOM 5712  H HA3  . GLY A 1 66  ? -4.474  6.119   -5.194  1.00 0.00 ? 66  GLY A HA3  4  
ATOM 5713  N N    . LEU A 1 67  ? -2.713  6.847   -2.868  1.00 0.00 ? 67  LEU A N    4  
ATOM 5714  C CA   . LEU A 1 67  ? -2.132  7.880   -2.017  1.00 0.00 ? 67  LEU A CA   4  
ATOM 5715  C C    . LEU A 1 67  ? -0.644  8.049   -2.305  1.00 0.00 ? 67  LEU A C    4  
ATOM 5716  O O    . LEU A 1 67  ? 0.124   7.089   -2.238  1.00 0.00 ? 67  LEU A O    4  
ATOM 5717  C CB   . LEU A 1 67  ? -2.342  7.532   -0.543  1.00 0.00 ? 67  LEU A CB   4  
ATOM 5718  C CG   . LEU A 1 67  ? -3.759  7.116   -0.146  1.00 0.00 ? 67  LEU A CG   4  
ATOM 5719  C CD1  . LEU A 1 67  ? -3.878  6.996   1.365   1.00 0.00 ? 67  LEU A CD1  4  
ATOM 5720  C CD2  . LEU A 1 67  ? -4.777  8.111   -0.685  1.00 0.00 ? 67  LEU A CD2  4  
ATOM 5721  H H    . LEU A 1 67  ? -3.023  6.012   -2.460  1.00 0.00 ? 67  LEU A H    4  
ATOM 5722  H HA   . LEU A 1 67  ? -2.636  8.810   -2.234  1.00 0.00 ? 67  LEU A HA   4  
ATOM 5723  H HB2  . LEU A 1 67  ? -1.678  6.717   -0.298  1.00 0.00 ? 67  LEU A HB2  4  
ATOM 5724  H HB3  . LEU A 1 67  ? -2.075  8.400   0.043   1.00 0.00 ? 67  LEU A HB3  4  
ATOM 5725  H HG   . LEU A 1 67  ? -3.977  6.148   -0.575  1.00 0.00 ? 67  LEU A HG   4  
ATOM 5726  H HD11 . LEU A 1 67  ? -4.890  6.729   1.627   1.00 0.00 ? 67  LEU A HD11 4  
ATOM 5727  H HD12 . LEU A 1 67  ? -3.625  7.942   1.822   1.00 0.00 ? 67  LEU A HD12 4  
ATOM 5728  H HD13 . LEU A 1 67  ? -3.200  6.233   1.720   1.00 0.00 ? 67  LEU A HD13 4  
ATOM 5729  H HD21 . LEU A 1 67  ? -5.775  7.749   -0.483  1.00 0.00 ? 67  LEU A HD21 4  
ATOM 5730  H HD22 . LEU A 1 67  ? -4.644  8.219   -1.752  1.00 0.00 ? 67  LEU A HD22 4  
ATOM 5731  H HD23 . LEU A 1 67  ? -4.636  9.067   -0.205  1.00 0.00 ? 67  LEU A HD23 4  
ATOM 5732  N N    . ARG A 1 68  ? -0.243  9.276   -2.623  1.00 0.00 ? 68  ARG A N    4  
ATOM 5733  C CA   . ARG A 1 68  ? 1.153   9.571   -2.919  1.00 0.00 ? 68  ARG A CA   4  
ATOM 5734  C C    . ARG A 1 68  ? 2.000   9.522   -1.651  1.00 0.00 ? 68  ARG A C    4  
ATOM 5735  O O    . ARG A 1 68  ? 1.765   10.276  -0.705  1.00 0.00 ? 68  ARG A O    4  
ATOM 5736  C CB   . ARG A 1 68  ? 1.278   10.946  -3.576  1.00 0.00 ? 68  ARG A CB   4  
ATOM 5737  C CG   . ARG A 1 68  ? 2.701   11.306  -3.971  1.00 0.00 ? 68  ARG A CG   4  
ATOM 5738  C CD   . ARG A 1 68  ? 2.815   12.769  -4.369  1.00 0.00 ? 68  ARG A CD   4  
ATOM 5739  N NE   . ARG A 1 68  ? 3.942   13.005  -5.268  1.00 0.00 ? 68  ARG A NE   4  
ATOM 5740  C CZ   . ARG A 1 68  ? 4.356   14.216  -5.626  1.00 0.00 ? 68  ARG A CZ   4  
ATOM 5741  N NH1  . ARG A 1 68  ? 3.740   15.295  -5.162  1.00 0.00 ? 68  ARG A NH1  4  
ATOM 5742  N NH2  . ARG A 1 68  ? 5.388   14.349  -6.448  1.00 0.00 ? 68  ARG A NH2  4  
ATOM 5743  H H    . ARG A 1 68  ? -0.903  10.000  -2.659  1.00 0.00 ? 68  ARG A H    4  
ATOM 5744  H HA   . ARG A 1 68  ? 1.512   8.819   -3.606  1.00 0.00 ? 68  ARG A HA   4  
ATOM 5745  H HB2  . ARG A 1 68  ? 0.666   10.964  -4.466  1.00 0.00 ? 68  ARG A HB2  4  
ATOM 5746  H HB3  . ARG A 1 68  ? 0.918   11.695  -2.886  1.00 0.00 ? 68  ARG A HB3  4  
ATOM 5747  H HG2  . ARG A 1 68  ? 3.355   11.121  -3.132  1.00 0.00 ? 68  ARG A HG2  4  
ATOM 5748  H HG3  . ARG A 1 68  ? 3.000   10.690  -4.806  1.00 0.00 ? 68  ARG A HG3  4  
ATOM 5749  H HD2  . ARG A 1 68  ? 1.903   13.066  -4.865  1.00 0.00 ? 68  ARG A HD2  4  
ATOM 5750  H HD3  . ARG A 1 68  ? 2.949   13.362  -3.477  1.00 0.00 ? 68  ARG A HD3  4  
ATOM 5751  H HE   . ARG A 1 68  ? 4.411   12.222  -5.623  1.00 0.00 ? 68  ARG A HE   4  
ATOM 5752  H HH11 . ARG A 1 68  ? 2.962   15.197  -4.541  1.00 0.00 ? 68  ARG A HH11 4  
ATOM 5753  H HH12 . ARG A 1 68  ? 4.055   16.205  -5.431  1.00 0.00 ? 68  ARG A HH12 4  
ATOM 5754  H HH21 . ARG A 1 68  ? 5.855   13.538  -6.800  1.00 0.00 ? 68  ARG A HH21 4  
ATOM 5755  H HH22 . ARG A 1 68  ? 5.699   15.260  -6.716  1.00 0.00 ? 68  ARG A HH22 4  
ATOM 5756  N N    . LEU A 1 69  ? 2.986   8.632   -1.637  1.00 0.00 ? 69  LEU A N    4  
ATOM 5757  C CA   . LEU A 1 69  ? 3.868   8.484   -0.485  1.00 0.00 ? 69  LEU A CA   4  
ATOM 5758  C C    . LEU A 1 69  ? 4.734   9.726   -0.300  1.00 0.00 ? 69  LEU A C    4  
ATOM 5759  O O    . LEU A 1 69  ? 5.619   10.006  -1.111  1.00 0.00 ? 69  LEU A O    4  
ATOM 5760  C CB   . LEU A 1 69  ? 4.756   7.249   -0.652  1.00 0.00 ? 69  LEU A CB   4  
ATOM 5761  C CG   . LEU A 1 69  ? 4.283   5.982   0.060   1.00 0.00 ? 69  LEU A CG   4  
ATOM 5762  C CD1  . LEU A 1 69  ? 4.632   6.039   1.539   1.00 0.00 ? 69  LEU A CD1  4  
ATOM 5763  C CD2  . LEU A 1 69  ? 2.786   5.790   -0.130  1.00 0.00 ? 69  LEU A CD2  4  
ATOM 5764  H H    . LEU A 1 69  ? 3.124   8.059   -2.420  1.00 0.00 ? 69  LEU A H    4  
ATOM 5765  H HA   . LEU A 1 69  ? 3.250   8.357   0.391   1.00 0.00 ? 69  LEU A HA   4  
ATOM 5766  H HB2  . LEU A 1 69  ? 4.822   7.031   -1.707  1.00 0.00 ? 69  LEU A HB2  4  
ATOM 5767  H HB3  . LEU A 1 69  ? 5.738   7.496   -0.275  1.00 0.00 ? 69  LEU A HB3  4  
ATOM 5768  H HG   . LEU A 1 69  ? 4.788   5.126   -0.368  1.00 0.00 ? 69  LEU A HG   4  
ATOM 5769  H HD11 . LEU A 1 69  ? 4.701   7.070   1.853   1.00 0.00 ? 69  LEU A HD11 4  
ATOM 5770  H HD12 . LEU A 1 69  ? 5.580   5.549   1.705   1.00 0.00 ? 69  LEU A HD12 4  
ATOM 5771  H HD13 . LEU A 1 69  ? 3.863   5.539   2.110   1.00 0.00 ? 69  LEU A HD13 4  
ATOM 5772  H HD21 . LEU A 1 69  ? 2.378   6.640   -0.656  1.00 0.00 ? 69  LEU A HD21 4  
ATOM 5773  H HD22 . LEU A 1 69  ? 2.309   5.702   0.836   1.00 0.00 ? 69  LEU A HD22 4  
ATOM 5774  H HD23 . LEU A 1 69  ? 2.608   4.892   -0.702  1.00 0.00 ? 69  LEU A HD23 4  
ATOM 5775  N N    . LEU A 1 70  ? 4.476   10.466  0.772   1.00 0.00 ? 70  LEU A N    4  
ATOM 5776  C CA   . LEU A 1 70  ? 5.234   11.678  1.066   1.00 0.00 ? 70  LEU A CA   4  
ATOM 5777  C C    . LEU A 1 70  ? 6.493   11.353  1.863   1.00 0.00 ? 70  LEU A C    4  
ATOM 5778  O O    . LEU A 1 70  ? 7.599   11.721  1.470   1.00 0.00 ? 70  LEU A O    4  
ATOM 5779  C CB   . LEU A 1 70  ? 4.366   12.670  1.842   1.00 0.00 ? 70  LEU A CB   4  
ATOM 5780  C CG   . LEU A 1 70  ? 3.562   13.661  1.000   1.00 0.00 ? 70  LEU A CG   4  
ATOM 5781  C CD1  . LEU A 1 70  ? 4.445   14.298  -0.062  1.00 0.00 ? 70  LEU A CD1  4  
ATOM 5782  C CD2  . LEU A 1 70  ? 2.368   12.970  0.359   1.00 0.00 ? 70  LEU A CD2  4  
ATOM 5783  H H    . LEU A 1 70  ? 3.759   10.193  1.381   1.00 0.00 ? 70  LEU A H    4  
ATOM 5784  H HA   . LEU A 1 70  ? 5.523   12.124  0.126   1.00 0.00 ? 70  LEU A HA   4  
ATOM 5785  H HB2  . LEU A 1 70  ? 3.669   12.102  2.440   1.00 0.00 ? 70  LEU A HB2  4  
ATOM 5786  H HB3  . LEU A 1 70  ? 5.016   13.238  2.493   1.00 0.00 ? 70  LEU A HB3  4  
ATOM 5787  H HG   . LEU A 1 70  ? 3.190   14.449  1.641   1.00 0.00 ? 70  LEU A HG   4  
ATOM 5788  H HD11 . LEU A 1 70  ? 5.475   14.270  0.262   1.00 0.00 ? 70  LEU A HD11 4  
ATOM 5789  H HD12 . LEU A 1 70  ? 4.143   15.324  -0.213  1.00 0.00 ? 70  LEU A HD12 4  
ATOM 5790  H HD13 . LEU A 1 70  ? 4.344   13.753  -0.989  1.00 0.00 ? 70  LEU A HD13 4  
ATOM 5791  H HD21 . LEU A 1 70  ? 1.590   13.696  0.173   1.00 0.00 ? 70  LEU A HD21 4  
ATOM 5792  H HD22 . LEU A 1 70  ? 1.994   12.206  1.025   1.00 0.00 ? 70  LEU A HD22 4  
ATOM 5793  H HD23 . LEU A 1 70  ? 2.671   12.520  -0.574  1.00 0.00 ? 70  LEU A HD23 4  
ATOM 5794  N N    . GLU A 1 71  ? 6.315   10.660  2.984   1.00 0.00 ? 71  GLU A N    4  
ATOM 5795  C CA   . GLU A 1 71  ? 7.438   10.285  3.835   1.00 0.00 ? 71  GLU A CA   4  
ATOM 5796  C C    . GLU A 1 71  ? 7.091   9.068   4.688   1.00 0.00 ? 71  GLU A C    4  
ATOM 5797  O O    . GLU A 1 71  ? 6.020   9.004   5.292   1.00 0.00 ? 71  GLU A O    4  
ATOM 5798  C CB   . GLU A 1 71  ? 7.838   11.455  4.736   1.00 0.00 ? 71  GLU A CB   4  
ATOM 5799  C CG   . GLU A 1 71  ? 7.876   12.792  4.014   1.00 0.00 ? 71  GLU A CG   4  
ATOM 5800  C CD   . GLU A 1 71  ? 8.328   13.927  4.913   1.00 0.00 ? 71  GLU A CD   4  
ATOM 5801  O OE1  . GLU A 1 71  ? 8.967   13.644  5.948   1.00 0.00 ? 71  GLU A OE1  4  
ATOM 5802  O OE2  . GLU A 1 71  ? 8.042   15.096  4.582   1.00 0.00 ? 71  GLU A OE2  4  
ATOM 5803  H H    . GLU A 1 71  ? 5.408   10.395  3.244   1.00 0.00 ? 71  GLU A H    4  
ATOM 5804  H HA   . GLU A 1 71  ? 8.270   10.034  3.195   1.00 0.00 ? 71  GLU A HA   4  
ATOM 5805  H HB2  . GLU A 1 71  ? 7.129   11.528  5.548   1.00 0.00 ? 71  GLU A HB2  4  
ATOM 5806  H HB3  . GLU A 1 71  ? 8.819   11.261  5.143   1.00 0.00 ? 71  GLU A HB3  4  
ATOM 5807  H HG2  . GLU A 1 71  ? 8.561   12.718  3.183   1.00 0.00 ? 71  GLU A HG2  4  
ATOM 5808  H HG3  . GLU A 1 71  ? 6.886   13.017  3.646   1.00 0.00 ? 71  GLU A HG3  4  
ATOM 5809  N N    . VAL A 1 72  ? 8.004   8.103   4.733   1.00 0.00 ? 72  VAL A N    4  
ATOM 5810  C CA   . VAL A 1 72  ? 7.796   6.888   5.512   1.00 0.00 ? 72  VAL A CA   4  
ATOM 5811  C C    . VAL A 1 72  ? 8.660   6.886   6.768   1.00 0.00 ? 72  VAL A C    4  
ATOM 5812  O O    . VAL A 1 72  ? 9.883   6.778   6.692   1.00 0.00 ? 72  VAL A O    4  
ATOM 5813  C CB   . VAL A 1 72  ? 8.112   5.629   4.683   1.00 0.00 ? 72  VAL A CB   4  
ATOM 5814  C CG1  . VAL A 1 72  ? 7.935   4.376   5.526   1.00 0.00 ? 72  VAL A CG1  4  
ATOM 5815  C CG2  . VAL A 1 72  ? 7.234   5.575   3.441   1.00 0.00 ? 72  VAL A CG2  4  
ATOM 5816  H H    . VAL A 1 72  ? 8.838   8.212   4.230   1.00 0.00 ? 72  VAL A H    4  
ATOM 5817  H HA   . VAL A 1 72  ? 6.756   6.852   5.801   1.00 0.00 ? 72  VAL A HA   4  
ATOM 5818  H HB   . VAL A 1 72  ? 9.143   5.681   4.366   1.00 0.00 ? 72  VAL A HB   4  
ATOM 5819  H HG11 . VAL A 1 72  ? 7.613   4.654   6.519   1.00 0.00 ? 72  VAL A HG11 4  
ATOM 5820  H HG12 . VAL A 1 72  ? 7.192   3.738   5.071   1.00 0.00 ? 72  VAL A HG12 4  
ATOM 5821  H HG13 . VAL A 1 72  ? 8.875   3.848   5.587   1.00 0.00 ? 72  VAL A HG13 4  
ATOM 5822  H HG21 . VAL A 1 72  ? 6.820   6.554   3.251   1.00 0.00 ? 72  VAL A HG21 4  
ATOM 5823  H HG22 . VAL A 1 72  ? 7.827   5.264   2.593   1.00 0.00 ? 72  VAL A HG22 4  
ATOM 5824  H HG23 . VAL A 1 72  ? 6.432   4.869   3.598   1.00 0.00 ? 72  VAL A HG23 4  
ATOM 5825  N N    . ASN A 1 73  ? 8.015   7.007   7.923   1.00 0.00 ? 73  ASN A N    4  
ATOM 5826  C CA   . ASN A 1 73  ? 8.724   7.019   9.197   1.00 0.00 ? 73  ASN A CA   4  
ATOM 5827  C C    . ASN A 1 73  ? 9.624   8.246   9.307   1.00 0.00 ? 73  ASN A C    4  
ATOM 5828  O O    . ASN A 1 73  ? 10.753  8.157   9.789   1.00 0.00 ? 73  ASN A O    4  
ATOM 5829  C CB   . ASN A 1 73  ? 9.558   5.745   9.353   1.00 0.00 ? 73  ASN A CB   4  
ATOM 5830  C CG   . ASN A 1 73  ? 8.808   4.650   10.086  1.00 0.00 ? 73  ASN A CG   4  
ATOM 5831  O OD1  . ASN A 1 73  ? 8.169   4.897   11.109  1.00 0.00 ? 73  ASN A OD1  4  
ATOM 5832  N ND2  . ASN A 1 73  ? 8.884   3.430   9.565   1.00 0.00 ? 73  ASN A ND2  4  
ATOM 5833  H H    . ASN A 1 73  ? 7.038   7.090   7.919   1.00 0.00 ? 73  ASN A H    4  
ATOM 5834  H HA   . ASN A 1 73  ? 7.988   7.055   9.986   1.00 0.00 ? 73  ASN A HA   4  
ATOM 5835  H HB2  . ASN A 1 73  ? 9.827   5.377   8.373   1.00 0.00 ? 73  ASN A HB2  4  
ATOM 5836  H HB3  . ASN A 1 73  ? 10.456  5.975   9.906   1.00 0.00 ? 73  ASN A HB3  4  
ATOM 5837  H HD21 . ASN A 1 73  ? 9.412   3.307   8.749   1.00 0.00 ? 73  ASN A HD21 4  
ATOM 5838  H HD22 . ASN A 1 73  ? 8.408   2.703   10.019  1.00 0.00 ? 73  ASN A HD22 4  
ATOM 5839  N N    . GLN A 1 74  ? 9.116   9.388   8.857   1.00 0.00 ? 74  GLN A N    4  
ATOM 5840  C CA   . GLN A 1 74  ? 9.874   10.633  8.905   1.00 0.00 ? 74  GLN A CA   4  
ATOM 5841  C C    . GLN A 1 74  ? 11.116  10.548  8.024   1.00 0.00 ? 74  GLN A C    4  
ATOM 5842  O O    . GLN A 1 74  ? 12.141  11.161  8.319   1.00 0.00 ? 74  GLN A O    4  
ATOM 5843  C CB   . GLN A 1 74  ? 10.278  10.954  10.345  1.00 0.00 ? 74  GLN A CB   4  
ATOM 5844  C CG   . GLN A 1 74  ? 9.108   11.351  11.231  1.00 0.00 ? 74  GLN A CG   4  
ATOM 5845  C CD   . GLN A 1 74  ? 9.401   11.161  12.706  1.00 0.00 ? 74  GLN A CD   4  
ATOM 5846  O OE1  . GLN A 1 74  ? 10.063  11.990  13.331  1.00 0.00 ? 74  GLN A OE1  4  
ATOM 5847  N NE2  . GLN A 1 74  ? 8.909   10.064  13.271  1.00 0.00 ? 74  GLN A NE2  4  
ATOM 5848  H H    . GLN A 1 74  ? 8.210   9.394   8.485   1.00 0.00 ? 74  GLN A H    4  
ATOM 5849  H HA   . GLN A 1 74  ? 9.238   11.422  8.535   1.00 0.00 ? 74  GLN A HA   4  
ATOM 5850  H HB2  . GLN A 1 74  ? 10.749  10.083  10.777  1.00 0.00 ? 74  GLN A HB2  4  
ATOM 5851  H HB3  . GLN A 1 74  ? 10.986  11.769  10.335  1.00 0.00 ? 74  GLN A HB3  4  
ATOM 5852  H HG2  . GLN A 1 74  ? 8.878   12.392  11.057  1.00 0.00 ? 74  GLN A HG2  4  
ATOM 5853  H HG3  . GLN A 1 74  ? 8.252   10.747  10.967  1.00 0.00 ? 74  GLN A HG3  4  
ATOM 5854  H HE21 . GLN A 1 74  ? 8.392   9.448   12.710  1.00 0.00 ? 74  GLN A HE21 4  
ATOM 5855  H HE22 . GLN A 1 74  ? 9.084   9.916   14.223  1.00 0.00 ? 74  GLN A HE22 4  
ATOM 5856  N N    . GLN A 1 75  ? 11.016  9.783   6.941   1.00 0.00 ? 75  GLN A N    4  
ATOM 5857  C CA   . GLN A 1 75  ? 12.132  9.618   6.017   1.00 0.00 ? 75  GLN A CA   4  
ATOM 5858  C C    . GLN A 1 75  ? 11.692  9.876   4.580   1.00 0.00 ? 75  GLN A C    4  
ATOM 5859  O O    . GLN A 1 75  ? 11.247  8.964   3.884   1.00 0.00 ? 75  GLN A O    4  
ATOM 5860  C CB   . GLN A 1 75  ? 12.717  8.210   6.139   1.00 0.00 ? 75  GLN A CB   4  
ATOM 5861  C CG   . GLN A 1 75  ? 13.268  7.897   7.521   1.00 0.00 ? 75  GLN A CG   4  
ATOM 5862  C CD   . GLN A 1 75  ? 14.324  6.809   7.496   1.00 0.00 ? 75  GLN A CD   4  
ATOM 5863  O OE1  . GLN A 1 75  ? 15.379  6.966   6.881   1.00 0.00 ? 75  GLN A OE1  4  
ATOM 5864  N NE2  . GLN A 1 75  ? 14.044  5.697   8.165   1.00 0.00 ? 75  GLN A NE2  4  
ATOM 5865  H H    . GLN A 1 75  ? 10.172  9.320   6.760   1.00 0.00 ? 75  GLN A H    4  
ATOM 5866  H HA   . GLN A 1 75  ? 12.891  10.337  6.283   1.00 0.00 ? 75  GLN A HA   4  
ATOM 5867  H HB2  . GLN A 1 75  ? 11.944  7.490   5.912   1.00 0.00 ? 75  GLN A HB2  4  
ATOM 5868  H HB3  . GLN A 1 75  ? 13.519  8.103   5.423   1.00 0.00 ? 75  GLN A HB3  4  
ATOM 5869  H HG2  . GLN A 1 75  ? 13.708  8.794   7.930   1.00 0.00 ? 75  GLN A HG2  4  
ATOM 5870  H HG3  . GLN A 1 75  ? 12.455  7.575   8.154   1.00 0.00 ? 75  GLN A HG3  4  
ATOM 5871  H HE21 . GLN A 1 75  ? 13.183  5.641   8.630   1.00 0.00 ? 75  GLN A HE21 4  
ATOM 5872  H HE22 . GLN A 1 75  ? 14.708  4.977   8.165   1.00 0.00 ? 75  GLN A HE22 4  
ATOM 5873  N N    . SER A 1 76  ? 11.820  11.125  4.143   1.00 0.00 ? 76  SER A N    4  
ATOM 5874  C CA   . SER A 1 76  ? 11.431  11.504  2.790   1.00 0.00 ? 76  SER A CA   4  
ATOM 5875  C C    . SER A 1 76  ? 11.967  10.503  1.770   1.00 0.00 ? 76  SER A C    4  
ATOM 5876  O O    . SER A 1 76  ? 13.104  10.042  1.874   1.00 0.00 ? 76  SER A O    4  
ATOM 5877  C CB   . SER A 1 76  ? 11.946  12.907  2.463   1.00 0.00 ? 76  SER A CB   4  
ATOM 5878  O OG   . SER A 1 76  ? 11.629  13.269  1.130   1.00 0.00 ? 76  SER A OG   4  
ATOM 5879  H H    . SER A 1 76  ? 12.181  11.807  4.746   1.00 0.00 ? 76  SER A H    4  
ATOM 5880  H HA   . SER A 1 76  ? 10.352  11.506  2.742   1.00 0.00 ? 76  SER A HA   4  
ATOM 5881  H HB2  . SER A 1 76  ? 11.492  13.620  3.134   1.00 0.00 ? 76  SER A HB2  4  
ATOM 5882  H HB3  . SER A 1 76  ? 13.020  12.931  2.585   1.00 0.00 ? 76  SER A HB3  4  
ATOM 5883  H HG   . SER A 1 76  ? 12.315  13.845  0.783   1.00 0.00 ? 76  SER A HG   4  
ATOM 5884  N N    . LEU A 1 77  ? 11.140  10.172  0.785   1.00 0.00 ? 77  LEU A N    4  
ATOM 5885  C CA   . LEU A 1 77  ? 11.528  9.226   -0.255  1.00 0.00 ? 77  LEU A CA   4  
ATOM 5886  C C    . LEU A 1 77  ? 12.147  9.950   -1.447  1.00 0.00 ? 77  LEU A C    4  
ATOM 5887  O O    . LEU A 1 77  ? 12.454  9.336   -2.469  1.00 0.00 ? 77  LEU A O    4  
ATOM 5888  C CB   . LEU A 1 77  ? 10.316  8.413   -0.711  1.00 0.00 ? 77  LEU A CB   4  
ATOM 5889  C CG   . LEU A 1 77  ? 9.413   7.874   0.399   1.00 0.00 ? 77  LEU A CG   4  
ATOM 5890  C CD1  . LEU A 1 77  ? 8.297   7.023   -0.187  1.00 0.00 ? 77  LEU A CD1  4  
ATOM 5891  C CD2  . LEU A 1 77  ? 10.225  7.073   1.405   1.00 0.00 ? 77  LEU A CD2  4  
ATOM 5892  H H    . LEU A 1 77  ? 10.246  10.573  0.755   1.00 0.00 ? 77  LEU A H    4  
ATOM 5893  H HA   . LEU A 1 77  ? 12.264  8.556   0.165   1.00 0.00 ? 77  LEU A HA   4  
ATOM 5894  H HB2  . LEU A 1 77  ? 9.716   9.043   -1.349  1.00 0.00 ? 77  LEU A HB2  4  
ATOM 5895  H HB3  . LEU A 1 77  ? 10.680  7.570   -1.281  1.00 0.00 ? 77  LEU A HB3  4  
ATOM 5896  H HG   . LEU A 1 77  ? 8.959   8.706   0.920   1.00 0.00 ? 77  LEU A HG   4  
ATOM 5897  H HD11 . LEU A 1 77  ? 8.723   6.237   -0.791  1.00 0.00 ? 77  LEU A HD11 4  
ATOM 5898  H HD12 . LEU A 1 77  ? 7.656   7.641   -0.798  1.00 0.00 ? 77  LEU A HD12 4  
ATOM 5899  H HD13 . LEU A 1 77  ? 7.718   6.588   0.615   1.00 0.00 ? 77  LEU A HD13 4  
ATOM 5900  H HD21 . LEU A 1 77  ? 11.102  6.670   0.920   1.00 0.00 ? 77  LEU A HD21 4  
ATOM 5901  H HD22 . LEU A 1 77  ? 9.623   6.262   1.790   1.00 0.00 ? 77  LEU A HD22 4  
ATOM 5902  H HD23 . LEU A 1 77  ? 10.526  7.716   2.219   1.00 0.00 ? 77  LEU A HD23 4  
ATOM 5903  N N    . LEU A 1 78  ? 12.328  11.259  -1.308  1.00 0.00 ? 78  LEU A N    4  
ATOM 5904  C CA   . LEU A 1 78  ? 12.912  12.068  -2.372  1.00 0.00 ? 78  LEU A CA   4  
ATOM 5905  C C    . LEU A 1 78  ? 14.419  11.848  -2.458  1.00 0.00 ? 78  LEU A C    4  
ATOM 5906  O O    . LEU A 1 78  ? 15.154  12.135  -1.514  1.00 0.00 ? 78  LEU A O    4  
ATOM 5907  C CB   . LEU A 1 78  ? 12.614  13.549  -2.136  1.00 0.00 ? 78  LEU A CB   4  
ATOM 5908  C CG   . LEU A 1 78  ? 12.502  14.419  -3.388  1.00 0.00 ? 78  LEU A CG   4  
ATOM 5909  C CD1  . LEU A 1 78  ? 13.790  14.362  -4.195  1.00 0.00 ? 78  LEU A CD1  4  
ATOM 5910  C CD2  . LEU A 1 78  ? 11.319  13.981  -4.238  1.00 0.00 ? 78  LEU A CD2  4  
ATOM 5911  H H    . LEU A 1 78  ? 12.064  11.692  -0.470  1.00 0.00 ? 78  LEU A H    4  
ATOM 5912  H HA   . LEU A 1 78  ? 12.462  11.762  -3.305  1.00 0.00 ? 78  LEU A HA   4  
ATOM 5913  H HB2  . LEU A 1 78  ? 11.679  13.617  -1.602  1.00 0.00 ? 78  LEU A HB2  4  
ATOM 5914  H HB3  . LEU A 1 78  ? 13.407  13.952  -1.522  1.00 0.00 ? 78  LEU A HB3  4  
ATOM 5915  H HG   . LEU A 1 78  ? 12.340  15.447  -3.092  1.00 0.00 ? 78  LEU A HG   4  
ATOM 5916  H HD11 . LEU A 1 78  ? 13.714  13.585  -4.940  1.00 0.00 ? 78  LEU A HD11 4  
ATOM 5917  H HD12 . LEU A 1 78  ? 14.619  14.149  -3.536  1.00 0.00 ? 78  LEU A HD12 4  
ATOM 5918  H HD13 . LEU A 1 78  ? 13.953  15.313  -4.681  1.00 0.00 ? 78  LEU A HD13 4  
ATOM 5919  H HD21 . LEU A 1 78  ? 10.846  14.850  -4.672  1.00 0.00 ? 78  LEU A HD21 4  
ATOM 5920  H HD22 . LEU A 1 78  ? 10.606  13.455  -3.619  1.00 0.00 ? 78  LEU A HD22 4  
ATOM 5921  H HD23 . LEU A 1 78  ? 11.663  13.327  -5.026  1.00 0.00 ? 78  LEU A HD23 4  
ATOM 5922  N N    . GLY A 1 79  ? 14.874  11.339  -3.599  1.00 0.00 ? 79  GLY A N    4  
ATOM 5923  C CA   . GLY A 1 79  ? 16.291  11.091  -3.788  1.00 0.00 ? 79  GLY A CA   4  
ATOM 5924  C C    . GLY A 1 79  ? 16.601  9.622   -3.998  1.00 0.00 ? 79  GLY A C    4  
ATOM 5925  O O    . GLY A 1 79  ? 17.449  9.269   -4.819  1.00 0.00 ? 79  GLY A O    4  
ATOM 5926  H H    . GLY A 1 79  ? 14.242  11.129  -4.318  1.00 0.00 ? 79  GLY A H    4  
ATOM 5927  H HA2  . GLY A 1 79  ? 16.631  11.646  -4.650  1.00 0.00 ? 79  GLY A HA2  4  
ATOM 5928  H HA3  . GLY A 1 79  ? 16.825  11.438  -2.916  1.00 0.00 ? 79  GLY A HA3  4  
ATOM 5929  N N    . LEU A 1 80  ? 15.914  8.763   -3.254  1.00 0.00 ? 80  LEU A N    4  
ATOM 5930  C CA   . LEU A 1 80  ? 16.120  7.322   -3.360  1.00 0.00 ? 80  LEU A CA   4  
ATOM 5931  C C    . LEU A 1 80  ? 15.324  6.743   -4.525  1.00 0.00 ? 80  LEU A C    4  
ATOM 5932  O O    . LEU A 1 80  ? 14.452  7.407   -5.087  1.00 0.00 ? 80  LEU A O    4  
ATOM 5933  C CB   . LEU A 1 80  ? 15.715  6.631   -2.057  1.00 0.00 ? 80  LEU A CB   4  
ATOM 5934  C CG   . LEU A 1 80  ? 14.586  7.295   -1.268  1.00 0.00 ? 80  LEU A CG   4  
ATOM 5935  C CD1  . LEU A 1 80  ? 13.798  6.255   -0.487  1.00 0.00 ? 80  LEU A CD1  4  
ATOM 5936  C CD2  . LEU A 1 80  ? 15.142  8.359   -0.333  1.00 0.00 ? 80  LEU A CD2  4  
ATOM 5937  H H    . LEU A 1 80  ? 15.251  9.103   -2.617  1.00 0.00 ? 80  LEU A H    4  
ATOM 5938  H HA   . LEU A 1 80  ? 17.172  7.151   -3.538  1.00 0.00 ? 80  LEU A HA   4  
ATOM 5939  H HB2  . LEU A 1 80  ? 15.404  5.627   -2.299  1.00 0.00 ? 80  LEU A HB2  4  
ATOM 5940  H HB3  . LEU A 1 80  ? 16.587  6.592   -1.420  1.00 0.00 ? 80  LEU A HB3  4  
ATOM 5941  H HG   . LEU A 1 80  ? 13.908  7.777   -1.959  1.00 0.00 ? 80  LEU A HG   4  
ATOM 5942  H HD11 . LEU A 1 80  ? 12.885  6.024   -1.015  1.00 0.00 ? 80  LEU A HD11 4  
ATOM 5943  H HD12 . LEU A 1 80  ? 13.560  6.644   0.491   1.00 0.00 ? 80  LEU A HD12 4  
ATOM 5944  H HD13 . LEU A 1 80  ? 14.391  5.358   -0.382  1.00 0.00 ? 80  LEU A HD13 4  
ATOM 5945  H HD21 . LEU A 1 80  ? 14.649  9.300   -0.526  1.00 0.00 ? 80  LEU A HD21 4  
ATOM 5946  H HD22 . LEU A 1 80  ? 16.204  8.467   -0.503  1.00 0.00 ? 80  LEU A HD22 4  
ATOM 5947  H HD23 . LEU A 1 80  ? 14.969  8.064   0.691   1.00 0.00 ? 80  LEU A HD23 4  
ATOM 5948  N N    . THR A 1 81  ? 15.629  5.499   -4.883  1.00 0.00 ? 81  THR A N    4  
ATOM 5949  C CA   . THR A 1 81  ? 14.942  4.829   -5.980  1.00 0.00 ? 81  THR A CA   4  
ATOM 5950  C C    . THR A 1 81  ? 13.932  3.813   -5.458  1.00 0.00 ? 81  THR A C    4  
ATOM 5951  O O    . THR A 1 81  ? 13.996  3.399   -4.300  1.00 0.00 ? 81  THR A O    4  
ATOM 5952  C CB   . THR A 1 81  ? 15.937  4.114   -6.913  1.00 0.00 ? 81  THR A CB   4  
ATOM 5953  O OG1  . THR A 1 81  ? 16.615  3.073   -6.201  1.00 0.00 ? 81  THR A OG1  4  
ATOM 5954  C CG2  . THR A 1 81  ? 16.953  5.097   -7.475  1.00 0.00 ? 81  THR A CG2  4  
ATOM 5955  H H    . THR A 1 81  ? 16.333  5.022   -4.397  1.00 0.00 ? 81  THR A H    4  
ATOM 5956  H HA   . THR A 1 81  ? 14.418  5.580   -6.554  1.00 0.00 ? 81  THR A HA   4  
ATOM 5957  H HB   . THR A 1 81  ? 15.387  3.679   -7.735  1.00 0.00 ? 81  THR A HB   4  
ATOM 5958  H HG1  . THR A 1 81  ? 17.273  2.671   -6.773  1.00 0.00 ? 81  THR A HG1  4  
ATOM 5959  H HG21 . THR A 1 81  ? 17.708  5.300   -6.730  1.00 0.00 ? 81  THR A HG21 4  
ATOM 5960  H HG22 . THR A 1 81  ? 16.455  6.016   -7.744  1.00 0.00 ? 81  THR A HG22 4  
ATOM 5961  H HG23 . THR A 1 81  ? 17.419  4.670   -8.351  1.00 0.00 ? 81  THR A HG23 4  
ATOM 5962  N N    . HIS A 1 82  ? 13.001  3.415   -6.319  1.00 0.00 ? 82  HIS A N    4  
ATOM 5963  C CA   . HIS A 1 82  ? 11.978  2.445   -5.944  1.00 0.00 ? 82  HIS A CA   4  
ATOM 5964  C C    . HIS A 1 82  ? 12.533  1.425   -4.955  1.00 0.00 ? 82  HIS A C    4  
ATOM 5965  O O    . HIS A 1 82  ? 11.994  1.247   -3.863  1.00 0.00 ? 82  HIS A O    4  
ATOM 5966  C CB   . HIS A 1 82  ? 11.443  1.731   -7.185  1.00 0.00 ? 82  HIS A CB   4  
ATOM 5967  C CG   . HIS A 1 82  ? 10.014  1.300   -7.059  1.00 0.00 ? 82  HIS A CG   4  
ATOM 5968  N ND1  . HIS A 1 82  ? 9.582   0.027   -7.368  1.00 0.00 ? 82  HIS A ND1  4  
ATOM 5969  C CD2  . HIS A 1 82  ? 8.917   1.980   -6.653  1.00 0.00 ? 82  HIS A CD2  4  
ATOM 5970  C CE1  . HIS A 1 82  ? 8.280   -0.056  -7.159  1.00 0.00 ? 82  HIS A CE1  4  
ATOM 5971  N NE2  . HIS A 1 82  ? 7.852   1.115   -6.725  1.00 0.00 ? 82  HIS A NE2  4  
ATOM 5972  H H    . HIS A 1 82  ? 13.002  3.782   -7.227  1.00 0.00 ? 82  HIS A H    4  
ATOM 5973  H HA   . HIS A 1 82  ? 11.169  2.982   -5.472  1.00 0.00 ? 82  HIS A HA   4  
ATOM 5974  H HB2  . HIS A 1 82  ? 11.515  2.395   -8.034  1.00 0.00 ? 82  HIS A HB2  4  
ATOM 5975  H HB3  . HIS A 1 82  ? 12.041  0.850   -7.372  1.00 0.00 ? 82  HIS A HB3  4  
ATOM 5976  H HD1  . HIS A 1 82  ? 10.146  -0.705  -7.694  1.00 0.00 ? 82  HIS A HD1  4  
ATOM 5977  H HD2  . HIS A 1 82  ? 8.883   3.012   -6.333  1.00 0.00 ? 82  HIS A HD2  4  
ATOM 5978  H HE1  . HIS A 1 82  ? 7.670   -0.933  -7.316  1.00 0.00 ? 82  HIS A HE1  4  
ATOM 5979  H HE2  . HIS A 1 82  ? 6.914   1.353   -6.575  1.00 0.00 ? 82  HIS A HE2  4  
ATOM 5980  N N    . GLY A 1 83  ? 13.614  0.756   -5.345  1.00 0.00 ? 83  GLY A N    4  
ATOM 5981  C CA   . GLY A 1 83  ? 14.223  -0.238  -4.482  1.00 0.00 ? 83  GLY A CA   4  
ATOM 5982  C C    . GLY A 1 83  ? 14.505  0.295   -3.091  1.00 0.00 ? 83  GLY A C    4  
ATOM 5983  O O    . GLY A 1 83  ? 14.226  -0.372  -2.096  1.00 0.00 ? 83  GLY A O    4  
ATOM 5984  H H    . GLY A 1 83  ? 14.001  0.940   -6.227  1.00 0.00 ? 83  GLY A H    4  
ATOM 5985  H HA2  . GLY A 1 83  ? 13.559  -1.086  -4.403  1.00 0.00 ? 83  GLY A HA2  4  
ATOM 5986  H HA3  . GLY A 1 83  ? 15.153  -0.562  -4.926  1.00 0.00 ? 83  GLY A HA3  4  
ATOM 5987  N N    . GLU A 1 84  ? 15.062  1.501   -3.023  1.00 0.00 ? 84  GLU A N    4  
ATOM 5988  C CA   . GLU A 1 84  ? 15.384  2.122   -1.744  1.00 0.00 ? 84  GLU A CA   4  
ATOM 5989  C C    . GLU A 1 84  ? 14.113  2.501   -0.988  1.00 0.00 ? 84  GLU A C    4  
ATOM 5990  O O    . GLU A 1 84  ? 13.966  2.191   0.194   1.00 0.00 ? 84  GLU A O    4  
ATOM 5991  C CB   . GLU A 1 84  ? 16.252  3.363   -1.959  1.00 0.00 ? 84  GLU A CB   4  
ATOM 5992  C CG   . GLU A 1 84  ? 17.742  3.068   -1.976  1.00 0.00 ? 84  GLU A CG   4  
ATOM 5993  C CD   . GLU A 1 84  ? 18.328  2.938   -0.583  1.00 0.00 ? 84  GLU A CD   4  
ATOM 5994  O OE1  . GLU A 1 84  ? 18.050  3.815   0.262   1.00 0.00 ? 84  GLU A OE1  4  
ATOM 5995  O OE2  . GLU A 1 84  ? 19.064  1.959   -0.339  1.00 0.00 ? 84  GLU A OE2  4  
ATOM 5996  H H    . GLU A 1 84  ? 15.260  1.983   -3.853  1.00 0.00 ? 84  GLU A H    4  
ATOM 5997  H HA   . GLU A 1 84  ? 15.937  1.404   -1.157  1.00 0.00 ? 84  GLU A HA   4  
ATOM 5998  H HB2  . GLU A 1 84  ? 15.984  3.817   -2.902  1.00 0.00 ? 84  GLU A HB2  4  
ATOM 5999  H HB3  . GLU A 1 84  ? 16.055  4.067   -1.163  1.00 0.00 ? 84  GLU A HB3  4  
ATOM 6000  H HG2  . GLU A 1 84  ? 17.907  2.142   -2.506  1.00 0.00 ? 84  GLU A HG2  4  
ATOM 6001  H HG3  . GLU A 1 84  ? 18.249  3.871   -2.490  1.00 0.00 ? 84  GLU A HG3  4  
ATOM 6002  N N    . ALA A 1 85  ? 13.199  3.173   -1.679  1.00 0.00 ? 85  ALA A N    4  
ATOM 6003  C CA   . ALA A 1 85  ? 11.941  3.593   -1.074  1.00 0.00 ? 85  ALA A CA   4  
ATOM 6004  C C    . ALA A 1 85  ? 11.203  2.407   -0.463  1.00 0.00 ? 85  ALA A C    4  
ATOM 6005  O O    . ALA A 1 85  ? 10.701  2.486   0.658   1.00 0.00 ? 85  ALA A O    4  
ATOM 6006  C CB   . ALA A 1 85  ? 11.065  4.287   -2.107  1.00 0.00 ? 85  ALA A CB   4  
ATOM 6007  H H    . ALA A 1 85  ? 13.374  3.391   -2.618  1.00 0.00 ? 85  ALA A H    4  
ATOM 6008  H HA   . ALA A 1 85  ? 12.167  4.305   -0.293  1.00 0.00 ? 85  ALA A HA   4  
ATOM 6009  H HB1  . ALA A 1 85  ? 10.126  4.568   -1.651  1.00 0.00 ? 85  ALA A HB1  4  
ATOM 6010  H HB2  . ALA A 1 85  ? 11.568  5.172   -2.469  1.00 0.00 ? 85  ALA A HB2  4  
ATOM 6011  H HB3  . ALA A 1 85  ? 10.879  3.615   -2.931  1.00 0.00 ? 85  ALA A HB3  4  
ATOM 6012  N N    . VAL A 1 86  ? 11.139  1.308   -1.208  1.00 0.00 ? 86  VAL A N    4  
ATOM 6013  C CA   . VAL A 1 86  ? 10.462  0.105   -0.739  1.00 0.00 ? 86  VAL A CA   4  
ATOM 6014  C C    . VAL A 1 86  ? 11.053  -0.379  0.581   1.00 0.00 ? 86  VAL A C    4  
ATOM 6015  O O    . VAL A 1 86  ? 10.346  -0.496  1.582   1.00 0.00 ? 86  VAL A O    4  
ATOM 6016  C CB   . VAL A 1 86  ? 10.553  -1.031  -1.775  1.00 0.00 ? 86  VAL A CB   4  
ATOM 6017  C CG1  . VAL A 1 86  ? 9.902   -2.297  -1.240  1.00 0.00 ? 86  VAL A CG1  4  
ATOM 6018  C CG2  . VAL A 1 86  ? 9.911   -0.606  -3.088  1.00 0.00 ? 86  VAL A CG2  4  
ATOM 6019  H H    . VAL A 1 86  ? 11.559  1.306   -2.093  1.00 0.00 ? 86  VAL A H    4  
ATOM 6020  H HA   . VAL A 1 86  ? 9.420   0.345   -0.589  1.00 0.00 ? 86  VAL A HA   4  
ATOM 6021  H HB   . VAL A 1 86  ? 11.596  -1.240  -1.960  1.00 0.00 ? 86  VAL A HB   4  
ATOM 6022  H HG11 . VAL A 1 86  ? 10.497  -3.153  -1.520  1.00 0.00 ? 86  VAL A HG11 4  
ATOM 6023  H HG12 . VAL A 1 86  ? 9.835   -2.240  -0.163  1.00 0.00 ? 86  VAL A HG12 4  
ATOM 6024  H HG13 . VAL A 1 86  ? 8.911   -2.396  -1.657  1.00 0.00 ? 86  VAL A HG13 4  
ATOM 6025  H HG21 . VAL A 1 86  ? 8.856   -0.836  -3.063  1.00 0.00 ? 86  VAL A HG21 4  
ATOM 6026  H HG22 . VAL A 1 86  ? 10.044  0.458   -3.226  1.00 0.00 ? 86  VAL A HG22 4  
ATOM 6027  H HG23 . VAL A 1 86  ? 10.377  -1.136  -3.905  1.00 0.00 ? 86  VAL A HG23 4  
ATOM 6028  N N    . GLN A 1 87  ? 12.352  -0.658  0.575   1.00 0.00 ? 87  GLN A N    4  
ATOM 6029  C CA   . GLN A 1 87  ? 13.037  -1.130  1.773   1.00 0.00 ? 87  GLN A CA   4  
ATOM 6030  C C    . GLN A 1 87  ? 12.770  -0.202  2.953   1.00 0.00 ? 87  GLN A C    4  
ATOM 6031  O O    . GLN A 1 87  ? 12.892  -0.603  4.112   1.00 0.00 ? 87  GLN A O    4  
ATOM 6032  C CB   . GLN A 1 87  ? 14.542  -1.231  1.518   1.00 0.00 ? 87  GLN A CB   4  
ATOM 6033  C CG   . GLN A 1 87  ? 14.913  -2.261  0.464   1.00 0.00 ? 87  GLN A CG   4  
ATOM 6034  C CD   . GLN A 1 87  ? 14.149  -3.560  0.623   1.00 0.00 ? 87  GLN A CD   4  
ATOM 6035  O OE1  . GLN A 1 87  ? 14.337  -4.289  1.597   1.00 0.00 ? 87  GLN A OE1  4  
ATOM 6036  N NE2  . GLN A 1 87  ? 13.280  -3.858  -0.337  1.00 0.00 ? 87  GLN A NE2  4  
ATOM 6037  H H    . GLN A 1 87  ? 12.861  -0.545  -0.254  1.00 0.00 ? 87  GLN A H    4  
ATOM 6038  H HA   . GLN A 1 87  ? 12.655  -2.111  2.008   1.00 0.00 ? 87  GLN A HA   4  
ATOM 6039  H HB2  . GLN A 1 87  ? 14.906  -0.267  1.193   1.00 0.00 ? 87  GLN A HB2  4  
ATOM 6040  H HB3  . GLN A 1 87  ? 15.034  -1.500  2.441   1.00 0.00 ? 87  GLN A HB3  4  
ATOM 6041  H HG2  . GLN A 1 87  ? 14.698  -1.852  -0.512  1.00 0.00 ? 87  GLN A HG2  4  
ATOM 6042  H HG3  . GLN A 1 87  ? 15.970  -2.470  0.539   1.00 0.00 ? 87  GLN A HG3  4  
ATOM 6043  H HE21 . GLN A 1 87  ? 13.184  -3.230  -1.084  1.00 0.00 ? 87  GLN A HE21 4  
ATOM 6044  H HE22 . GLN A 1 87  ? 12.773  -4.692  -0.260  1.00 0.00 ? 87  GLN A HE22 4  
ATOM 6045  N N    . LEU A 1 88  ? 12.406  1.040   2.653   1.00 0.00 ? 88  LEU A N    4  
ATOM 6046  C CA   . LEU A 1 88  ? 12.122  2.026   3.690   1.00 0.00 ? 88  LEU A CA   4  
ATOM 6047  C C    . LEU A 1 88  ? 10.725  1.822   4.267   1.00 0.00 ? 88  LEU A C    4  
ATOM 6048  O O    . LEU A 1 88  ? 10.466  2.149   5.426   1.00 0.00 ? 88  LEU A O    4  
ATOM 6049  C CB   . LEU A 1 88  ? 12.252  3.441   3.125   1.00 0.00 ? 88  LEU A CB   4  
ATOM 6050  C CG   . LEU A 1 88  ? 12.733  4.513   4.103   1.00 0.00 ? 88  LEU A CG   4  
ATOM 6051  C CD1  . LEU A 1 88  ? 12.853  5.859   3.404   1.00 0.00 ? 88  LEU A CD1  4  
ATOM 6052  C CD2  . LEU A 1 88  ? 11.790  4.611   5.293   1.00 0.00 ? 88  LEU A CD2  4  
ATOM 6053  H H    . LEU A 1 88  ? 12.326  1.301   1.712   1.00 0.00 ? 88  LEU A H    4  
ATOM 6054  H HA   . LEU A 1 88  ? 12.847  1.895   4.479   1.00 0.00 ? 88  LEU A HA   4  
ATOM 6055  H HB2  . LEU A 1 88  ? 12.950  3.406   2.303   1.00 0.00 ? 88  LEU A HB2  4  
ATOM 6056  H HB3  . LEU A 1 88  ? 11.280  3.740   2.757   1.00 0.00 ? 88  LEU A HB3  4  
ATOM 6057  H HG   . LEU A 1 88  ? 13.712  4.241   4.472   1.00 0.00 ? 88  LEU A HG   4  
ATOM 6058  H HD11 . LEU A 1 88  ? 12.503  5.768   2.387   1.00 0.00 ? 88  LEU A HD11 4  
ATOM 6059  H HD12 . LEU A 1 88  ? 13.887  6.172   3.402   1.00 0.00 ? 88  LEU A HD12 4  
ATOM 6060  H HD13 . LEU A 1 88  ? 12.257  6.591   3.927   1.00 0.00 ? 88  LEU A HD13 4  
ATOM 6061  H HD21 . LEU A 1 88  ? 10.771  4.675   4.940   1.00 0.00 ? 88  LEU A HD21 4  
ATOM 6062  H HD22 . LEU A 1 88  ? 12.028  5.494   5.869   1.00 0.00 ? 88  LEU A HD22 4  
ATOM 6063  H HD23 . LEU A 1 88  ? 11.902  3.735   5.914   1.00 0.00 ? 88  LEU A HD23 4  
ATOM 6064  N N    . LEU A 1 89  ? 9.828   1.279   3.452   1.00 0.00 ? 89  LEU A N    4  
ATOM 6065  C CA   . LEU A 1 89  ? 8.456   1.029   3.882   1.00 0.00 ? 89  LEU A CA   4  
ATOM 6066  C C    . LEU A 1 89  ? 8.353   -0.297  4.629   1.00 0.00 ? 89  LEU A C    4  
ATOM 6067  O O    . LEU A 1 89  ? 7.463   -0.486  5.458   1.00 0.00 ? 89  LEU A O    4  
ATOM 6068  C CB   . LEU A 1 89  ? 7.516   1.022   2.675   1.00 0.00 ? 89  LEU A CB   4  
ATOM 6069  C CG   . LEU A 1 89  ? 7.313   -0.330  1.989   1.00 0.00 ? 89  LEU A CG   4  
ATOM 6070  C CD1  . LEU A 1 89  ? 6.149   -1.079  2.620   1.00 0.00 ? 89  LEU A CD1  4  
ATOM 6071  C CD2  . LEU A 1 89  ? 7.083   -0.142  0.497   1.00 0.00 ? 89  LEU A CD2  4  
ATOM 6072  H H    . LEU A 1 89  ? 10.093  1.039   2.540   1.00 0.00 ? 89  LEU A H    4  
ATOM 6073  H HA   . LEU A 1 89  ? 8.167   1.827   4.548   1.00 0.00 ? 89  LEU A HA   4  
ATOM 6074  H HB2  . LEU A 1 89  ? 6.551   1.372   3.006   1.00 0.00 ? 89  LEU A HB2  4  
ATOM 6075  H HB3  . LEU A 1 89  ? 7.915   1.709   1.942   1.00 0.00 ? 89  LEU A HB3  4  
ATOM 6076  H HG   . LEU A 1 89  ? 8.204   -0.929  2.119   1.00 0.00 ? 89  LEU A HG   4  
ATOM 6077  H HD11 . LEU A 1 89  ? 5.220   -0.689  2.234   1.00 0.00 ? 89  LEU A HD11 4  
ATOM 6078  H HD12 . LEU A 1 89  ? 6.177   -0.950  3.692   1.00 0.00 ? 89  LEU A HD12 4  
ATOM 6079  H HD13 . LEU A 1 89  ? 6.227   -2.130  2.382   1.00 0.00 ? 89  LEU A HD13 4  
ATOM 6080  H HD21 . LEU A 1 89  ? 6.033   -0.264  0.277   1.00 0.00 ? 89  LEU A HD21 4  
ATOM 6081  H HD22 . LEU A 1 89  ? 7.653   -0.879  -0.050  1.00 0.00 ? 89  LEU A HD22 4  
ATOM 6082  H HD23 . LEU A 1 89  ? 7.400   0.848   0.206   1.00 0.00 ? 89  LEU A HD23 4  
ATOM 6083  N N    . ARG A 1 90  ? 9.270   -1.212  4.330   1.00 0.00 ? 90  ARG A N    4  
ATOM 6084  C CA   . ARG A 1 90  ? 9.282   -2.520  4.974   1.00 0.00 ? 90  ARG A CA   4  
ATOM 6085  C C    . ARG A 1 90  ? 10.249  -2.535  6.154   1.00 0.00 ? 90  ARG A C    4  
ATOM 6086  O O    . ARG A 1 90  ? 10.414  -3.557  6.821   1.00 0.00 ? 90  ARG A O    4  
ATOM 6087  C CB   . ARG A 1 90  ? 9.672   -3.604  3.967   1.00 0.00 ? 90  ARG A CB   4  
ATOM 6088  C CG   . ARG A 1 90  ? 10.935  -3.282  3.185   1.00 0.00 ? 90  ARG A CG   4  
ATOM 6089  C CD   . ARG A 1 90  ? 11.354  -4.446  2.301   1.00 0.00 ? 90  ARG A CD   4  
ATOM 6090  N NE   . ARG A 1 90  ? 12.104  -5.456  3.044   1.00 0.00 ? 90  ARG A NE   4  
ATOM 6091  C CZ   . ARG A 1 90  ? 12.478  -6.621  2.528   1.00 0.00 ? 90  ARG A CZ   4  
ATOM 6092  N NH1  . ARG A 1 90  ? 12.173  -6.923  1.273   1.00 0.00 ? 90  ARG A NH1  4  
ATOM 6093  N NH2  . ARG A 1 90  ? 13.158  -7.488  3.268   1.00 0.00 ? 90  ARG A NH2  4  
ATOM 6094  H H    . ARG A 1 90  ? 9.954   -1.003  3.660   1.00 0.00 ? 90  ARG A H    4  
ATOM 6095  H HA   . ARG A 1 90  ? 8.285   -2.720  5.337   1.00 0.00 ? 90  ARG A HA   4  
ATOM 6096  H HB2  . ARG A 1 90  ? 9.831   -4.531  4.498   1.00 0.00 ? 90  ARG A HB2  4  
ATOM 6097  H HB3  . ARG A 1 90  ? 8.863   -3.734  3.265   1.00 0.00 ? 90  ARG A HB3  4  
ATOM 6098  H HG2  . ARG A 1 90  ? 10.751  -2.420  2.562   1.00 0.00 ? 90  ARG A HG2  4  
ATOM 6099  H HG3  . ARG A 1 90  ? 11.732  -3.064  3.880   1.00 0.00 ? 90  ARG A HG3  4  
ATOM 6100  H HD2  . ARG A 1 90  ? 10.468  -4.903  1.886   1.00 0.00 ? 90  ARG A HD2  4  
ATOM 6101  H HD3  . ARG A 1 90  ? 11.973  -4.069  1.501   1.00 0.00 ? 90  ARG A HD3  4  
ATOM 6102  H HE   . ARG A 1 90  ? 12.339  -5.254  3.973   1.00 0.00 ? 90  ARG A HE   4  
ATOM 6103  H HH11 . ARG A 1 90  ? 11.662  -6.271  0.713   1.00 0.00 ? 90  ARG A HH11 4  
ATOM 6104  H HH12 . ARG A 1 90  ? 12.457  -7.801  0.887   1.00 0.00 ? 90  ARG A HH12 4  
ATOM 6105  H HH21 . ARG A 1 90  ? 13.389  -7.264  4.214   1.00 0.00 ? 90  ARG A HH21 4  
ATOM 6106  H HH22 . ARG A 1 90  ? 13.438  -8.365  2.879   1.00 0.00 ? 90  ARG A HH22 4  
ATOM 6107  N N    . SER A 1 91  ? 10.884  -1.396  6.407   1.00 0.00 ? 91  SER A N    4  
ATOM 6108  C CA   . SER A 1 91  ? 11.838  -1.279  7.504   1.00 0.00 ? 91  SER A CA   4  
ATOM 6109  C C    . SER A 1 91  ? 11.155  -0.755  8.764   1.00 0.00 ? 91  SER A C    4  
ATOM 6110  O O    . SER A 1 91  ? 11.785  -0.113  9.604   1.00 0.00 ? 91  SER A O    4  
ATOM 6111  C CB   . SER A 1 91  ? 12.989  -0.352  7.111   1.00 0.00 ? 91  SER A CB   4  
ATOM 6112  O OG   . SER A 1 91  ? 13.868  -0.139  8.202   1.00 0.00 ? 91  SER A OG   4  
ATOM 6113  H H    . SER A 1 91  ? 10.710  -0.615  5.840   1.00 0.00 ? 91  SER A H    4  
ATOM 6114  H HA   . SER A 1 91  ? 12.233  -2.264  7.706   1.00 0.00 ? 91  SER A HA   4  
ATOM 6115  H HB2  . SER A 1 91  ? 13.545  -0.796  6.299   1.00 0.00 ? 91  SER A HB2  4  
ATOM 6116  H HB3  . SER A 1 91  ? 12.589  0.601   6.795   1.00 0.00 ? 91  SER A HB3  4  
ATOM 6117  H HG   . SER A 1 91  ? 14.770  -0.316  7.927   1.00 0.00 ? 91  SER A HG   4  
ATOM 6118  N N    . VAL A 1 92  ? 9.861   -1.033  8.887   1.00 0.00 ? 92  VAL A N    4  
ATOM 6119  C CA   . VAL A 1 92  ? 9.091   -0.591  10.044  1.00 0.00 ? 92  VAL A CA   4  
ATOM 6120  C C    . VAL A 1 92  ? 9.067   -1.661  11.130  1.00 0.00 ? 92  VAL A C    4  
ATOM 6121  O O    . VAL A 1 92  ? 9.112   -2.855  10.840  1.00 0.00 ? 92  VAL A O    4  
ATOM 6122  C CB   . VAL A 1 92  ? 7.643   -0.239  9.653   1.00 0.00 ? 92  VAL A CB   4  
ATOM 6123  C CG1  . VAL A 1 92  ? 6.928   0.442   10.810  1.00 0.00 ? 92  VAL A CG1  4  
ATOM 6124  C CG2  . VAL A 1 92  ? 7.626   0.642   8.413   1.00 0.00 ? 92  VAL A CG2  4  
ATOM 6125  H H    . VAL A 1 92  ? 9.414   -1.548  8.184   1.00 0.00 ? 92  VAL A H    4  
ATOM 6126  H HA   . VAL A 1 92  ? 9.562   0.298   10.438  1.00 0.00 ? 92  VAL A HA   4  
ATOM 6127  H HB   . VAL A 1 92  ? 7.120   -1.156  9.426   1.00 0.00 ? 92  VAL A HB   4  
ATOM 6128  H HG11 . VAL A 1 92  ? 5.860   0.352   10.676  1.00 0.00 ? 92  VAL A HG11 4  
ATOM 6129  H HG12 . VAL A 1 92  ? 7.217   -0.028  11.739  1.00 0.00 ? 92  VAL A HG12 4  
ATOM 6130  H HG13 . VAL A 1 92  ? 7.200   1.487   10.836  1.00 0.00 ? 92  VAL A HG13 4  
ATOM 6131  H HG21 . VAL A 1 92  ? 7.971   0.072   7.563   1.00 0.00 ? 92  VAL A HG21 4  
ATOM 6132  H HG22 . VAL A 1 92  ? 6.618   0.986   8.230   1.00 0.00 ? 92  VAL A HG22 4  
ATOM 6133  H HG23 . VAL A 1 92  ? 8.274   1.491   8.565   1.00 0.00 ? 92  VAL A HG23 4  
ATOM 6134  N N    . GLY A 1 93  ? 8.996   -1.223  12.383  1.00 0.00 ? 93  GLY A N    4  
ATOM 6135  C CA   . GLY A 1 93  ? 8.967   -2.156  13.494  1.00 0.00 ? 93  GLY A CA   4  
ATOM 6136  C C    . GLY A 1 93  ? 7.559   -2.588  13.852  1.00 0.00 ? 93  GLY A C    4  
ATOM 6137  O O    . GLY A 1 93  ? 7.132   -3.688  13.503  1.00 0.00 ? 93  GLY A O    4  
ATOM 6138  H H    . GLY A 1 93  ? 8.963   -0.258  12.555  1.00 0.00 ? 93  GLY A H    4  
ATOM 6139  H HA2  . GLY A 1 93  ? 9.545   -3.029  13.232  1.00 0.00 ? 93  GLY A HA2  4  
ATOM 6140  H HA3  . GLY A 1 93  ? 9.417   -1.685  14.356  1.00 0.00 ? 93  GLY A HA3  4  
ATOM 6141  N N    . ASP A 1 94  ? 6.836   -1.720  14.552  1.00 0.00 ? 94  ASP A N    4  
ATOM 6142  C CA   . ASP A 1 94  ? 5.467   -2.018  14.958  1.00 0.00 ? 94  ASP A CA   4  
ATOM 6143  C C    . ASP A 1 94  ? 4.511   -0.928  14.486  1.00 0.00 ? 94  ASP A C    4  
ATOM 6144  O O    . ASP A 1 94  ? 3.297   -1.130  14.434  1.00 0.00 ? 94  ASP A O    4  
ATOM 6145  C CB   . ASP A 1 94  ? 5.384   -2.163  16.478  1.00 0.00 ? 94  ASP A CB   4  
ATOM 6146  C CG   . ASP A 1 94  ? 6.489   -3.038  17.038  1.00 0.00 ? 94  ASP A CG   4  
ATOM 6147  O OD1  . ASP A 1 94  ? 7.195   -3.686  16.238  1.00 0.00 ? 94  ASP A OD1  4  
ATOM 6148  O OD2  . ASP A 1 94  ? 6.647   -3.073  18.276  1.00 0.00 ? 94  ASP A OD2  4  
ATOM 6149  H H    . ASP A 1 94  ? 7.232   -0.859  14.801  1.00 0.00 ? 94  ASP A H    4  
ATOM 6150  H HA   . ASP A 1 94  ? 5.181   -2.953  14.500  1.00 0.00 ? 94  ASP A HA   4  
ATOM 6151  H HB2  . ASP A 1 94  ? 5.460   -1.185  16.932  1.00 0.00 ? 94  ASP A HB2  4  
ATOM 6152  H HB3  . ASP A 1 94  ? 4.433   -2.603  16.740  1.00 0.00 ? 94  ASP A HB3  4  
ATOM 6153  N N    . THR A 1 95  ? 5.065   0.231   14.142  1.00 0.00 ? 95  THR A N    4  
ATOM 6154  C CA   . THR A 1 95  ? 4.262   1.354   13.677  1.00 0.00 ? 95  THR A CA   4  
ATOM 6155  C C    . THR A 1 95  ? 5.104   2.334   12.866  1.00 0.00 ? 95  THR A C    4  
ATOM 6156  O O    . THR A 1 95  ? 6.234   2.651   13.238  1.00 0.00 ? 95  THR A O    4  
ATOM 6157  C CB   . THR A 1 95  ? 3.611   2.106   14.853  1.00 0.00 ? 95  THR A CB   4  
ATOM 6158  O OG1  . THR A 1 95  ? 3.088   1.170   15.803  1.00 0.00 ? 95  THR A OG1  4  
ATOM 6159  C CG2  . THR A 1 95  ? 2.495   3.016   14.363  1.00 0.00 ? 95  THR A CG2  4  
ATOM 6160  H H    . THR A 1 95  ? 6.038   0.331   14.205  1.00 0.00 ? 95  THR A H    4  
ATOM 6161  H HA   . THR A 1 95  ? 3.476   0.964   13.047  1.00 0.00 ? 95  THR A HA   4  
ATOM 6162  H HB   . THR A 1 95  ? 4.365   2.712   15.334  1.00 0.00 ? 95  THR A HB   4  
ATOM 6163  H HG1  . THR A 1 95  ? 2.163   1.002   15.610  1.00 0.00 ? 95  THR A HG1  4  
ATOM 6164  H HG21 . THR A 1 95  ? 1.563   2.470   14.355  1.00 0.00 ? 95  THR A HG21 4  
ATOM 6165  H HG22 . THR A 1 95  ? 2.721   3.357   13.364  1.00 0.00 ? 95  THR A HG22 4  
ATOM 6166  H HG23 . THR A 1 95  ? 2.408   3.865   15.023  1.00 0.00 ? 95  THR A HG23 4  
ATOM 6167  N N    . LEU A 1 96  ? 4.546   2.810   11.759  1.00 0.00 ? 96  LEU A N    4  
ATOM 6168  C CA   . LEU A 1 96  ? 5.246   3.755   10.895  1.00 0.00 ? 96  LEU A CA   4  
ATOM 6169  C C    . LEU A 1 96  ? 4.439   5.038   10.725  1.00 0.00 ? 96  LEU A C    4  
ATOM 6170  O O    . LEU A 1 96  ? 3.230   5.060   10.962  1.00 0.00 ? 96  LEU A O    4  
ATOM 6171  C CB   . LEU A 1 96  ? 5.516   3.123   9.528   1.00 0.00 ? 96  LEU A CB   4  
ATOM 6172  C CG   . LEU A 1 96  ? 4.468   3.389   8.447   1.00 0.00 ? 96  LEU A CG   4  
ATOM 6173  C CD1  . LEU A 1 96  ? 5.040   3.104   7.067   1.00 0.00 ? 96  LEU A CD1  4  
ATOM 6174  C CD2  . LEU A 1 96  ? 3.223   2.550   8.694   1.00 0.00 ? 96  LEU A CD2  4  
ATOM 6175  H H    . LEU A 1 96  ? 3.643   2.520   11.515  1.00 0.00 ? 96  LEU A H    4  
ATOM 6176  H HA   . LEU A 1 96  ? 6.189   3.996   11.364  1.00 0.00 ? 96  LEU A HA   4  
ATOM 6177  H HB2  . LEU A 1 96  ? 6.462   3.500   9.171   1.00 0.00 ? 96  LEU A HB2  4  
ATOM 6178  H HB3  . LEU A 1 96  ? 5.586   2.054   9.667   1.00 0.00 ? 96  LEU A HB3  4  
ATOM 6179  H HG   . LEU A 1 96  ? 4.182   4.432   8.481   1.00 0.00 ? 96  LEU A HG   4  
ATOM 6180  H HD11 . LEU A 1 96  ? 5.459   2.110   7.050   1.00 0.00 ? 96  LEU A HD11 4  
ATOM 6181  H HD12 . LEU A 1 96  ? 5.812   3.825   6.842   1.00 0.00 ? 96  LEU A HD12 4  
ATOM 6182  H HD13 . LEU A 1 96  ? 4.254   3.178   6.330   1.00 0.00 ? 96  LEU A HD13 4  
ATOM 6183  H HD21 . LEU A 1 96  ? 2.494   3.138   9.232   1.00 0.00 ? 96  LEU A HD21 4  
ATOM 6184  H HD22 . LEU A 1 96  ? 3.485   1.680   9.278   1.00 0.00 ? 96  LEU A HD22 4  
ATOM 6185  H HD23 . LEU A 1 96  ? 2.806   2.238   7.748   1.00 0.00 ? 96  LEU A HD23 4  
ATOM 6186  N N    . THR A 1 97  ? 5.114   6.105   10.310  1.00 0.00 ? 97  THR A N    4  
ATOM 6187  C CA   . THR A 1 97  ? 4.460   7.392   10.107  1.00 0.00 ? 97  THR A CA   4  
ATOM 6188  C C    . THR A 1 97  ? 4.452   7.777   8.632   1.00 0.00 ? 97  THR A C    4  
ATOM 6189  O O    . THR A 1 97  ? 5.429   8.323   8.118   1.00 0.00 ? 97  THR A O    4  
ATOM 6190  C CB   . THR A 1 97  ? 5.151   8.507   10.914  1.00 0.00 ? 97  THR A CB   4  
ATOM 6191  O OG1  . THR A 1 97  ? 5.508   8.022   12.213  1.00 0.00 ? 97  THR A OG1  4  
ATOM 6192  C CG2  . THR A 1 97  ? 4.242   9.718   11.052  1.00 0.00 ? 97  THR A CG2  4  
ATOM 6193  H H    . THR A 1 97  ? 6.075   6.024   10.138  1.00 0.00 ? 97  THR A H    4  
ATOM 6194  H HA   . THR A 1 97  ? 3.440   7.306   10.452  1.00 0.00 ? 97  THR A HA   4  
ATOM 6195  H HB   . THR A 1 97  ? 6.048   8.806   10.391  1.00 0.00 ? 97  THR A HB   4  
ATOM 6196  H HG1  . THR A 1 97  ? 6.450   8.146   12.353  1.00 0.00 ? 97  THR A HG1  4  
ATOM 6197  H HG21 . THR A 1 97  ? 3.504   9.530   11.818  1.00 0.00 ? 97  THR A HG21 4  
ATOM 6198  H HG22 . THR A 1 97  ? 3.745   9.904   10.111  1.00 0.00 ? 97  THR A HG22 4  
ATOM 6199  H HG23 . THR A 1 97  ? 4.831   10.581  11.325  1.00 0.00 ? 97  THR A HG23 4  
ATOM 6200  N N    . VAL A 1 98  ? 3.344   7.492   7.957   1.00 0.00 ? 98  VAL A N    4  
ATOM 6201  C CA   . VAL A 1 98  ? 3.208   7.811   6.540   1.00 0.00 ? 98  VAL A CA   4  
ATOM 6202  C C    . VAL A 1 98  ? 2.579   9.185   6.345   1.00 0.00 ? 98  VAL A C    4  
ATOM 6203  O O    . VAL A 1 98  ? 1.542   9.495   6.932   1.00 0.00 ? 98  VAL A O    4  
ATOM 6204  C CB   . VAL A 1 98  ? 2.355   6.759   5.807   1.00 0.00 ? 98  VAL A CB   4  
ATOM 6205  C CG1  . VAL A 1 98  ? 2.763   5.354   6.225   1.00 0.00 ? 98  VAL A CG1  4  
ATOM 6206  C CG2  . VAL A 1 98  ? 0.876   6.994   6.073   1.00 0.00 ? 98  VAL A CG2  4  
ATOM 6207  H H    . VAL A 1 98  ? 2.599   7.056   8.422   1.00 0.00 ? 98  VAL A H    4  
ATOM 6208  H HA   . VAL A 1 98  ? 4.196   7.811   6.102   1.00 0.00 ? 98  VAL A HA   4  
ATOM 6209  H HB   . VAL A 1 98  ? 2.529   6.860   4.746   1.00 0.00 ? 98  VAL A HB   4  
ATOM 6210  H HG11 . VAL A 1 98  ? 2.056   4.974   6.948   1.00 0.00 ? 98  VAL A HG11 4  
ATOM 6211  H HG12 . VAL A 1 98  ? 2.775   4.710   5.358   1.00 0.00 ? 98  VAL A HG12 4  
ATOM 6212  H HG13 . VAL A 1 98  ? 3.748   5.383   6.667   1.00 0.00 ? 98  VAL A HG13 4  
ATOM 6213  H HG21 . VAL A 1 98  ? 0.724   7.171   7.128   1.00 0.00 ? 98  VAL A HG21 4  
ATOM 6214  H HG22 . VAL A 1 98  ? 0.541   7.855   5.512   1.00 0.00 ? 98  VAL A HG22 4  
ATOM 6215  H HG23 . VAL A 1 98  ? 0.312   6.125   5.769   1.00 0.00 ? 98  VAL A HG23 4  
ATOM 6216  N N    . LEU A 1 99  ? 3.214   10.007  5.515   1.00 0.00 ? 99  LEU A N    4  
ATOM 6217  C CA   . LEU A 1 99  ? 2.716   11.351  5.241   1.00 0.00 ? 99  LEU A CA   4  
ATOM 6218  C C    . LEU A 1 99  ? 1.904   11.377  3.950   1.00 0.00 ? 99  LEU A C    4  
ATOM 6219  O O    . LEU A 1 99  ? 1.672   12.439  3.372   1.00 0.00 ? 99  LEU A O    4  
ATOM 6220  C CB   . LEU A 1 99  ? 3.881   12.337  5.144   1.00 0.00 ? 99  LEU A CB   4  
ATOM 6221  C CG   . LEU A 1 99  ? 3.502   13.814  5.031   1.00 0.00 ? 99  LEU A CG   4  
ATOM 6222  C CD1  . LEU A 1 99  ? 2.473   14.184  6.088   1.00 0.00 ? 99  LEU A CD1  4  
ATOM 6223  C CD2  . LEU A 1 99  ? 4.738   14.693  5.158   1.00 0.00 ? 99  LEU A CD2  4  
ATOM 6224  H H    . LEU A 1 99  ? 4.036   9.704   5.077   1.00 0.00 ? 99  LEU A H    4  
ATOM 6225  H HA   . LEU A 1 99  ? 2.076   11.641  6.060   1.00 0.00 ? 99  LEU A HA   4  
ATOM 6226  H HB2  . LEU A 1 99  ? 4.489   12.219  6.028   1.00 0.00 ? 99  LEU A HB2  4  
ATOM 6227  H HB3  . LEU A 1 99  ? 4.463   12.076  4.271   1.00 0.00 ? 99  LEU A HB3  4  
ATOM 6228  H HG   . LEU A 1 99  ? 3.061   13.993  4.060   1.00 0.00 ? 99  LEU A HG   4  
ATOM 6229  H HD11 . LEU A 1 99  ? 1.556   13.647  5.900   1.00 0.00 ? 99  LEU A HD11 4  
ATOM 6230  H HD12 . LEU A 1 99  ? 2.284   15.246  6.051   1.00 0.00 ? 99  LEU A HD12 4  
ATOM 6231  H HD13 . LEU A 1 99  ? 2.851   13.921  7.066   1.00 0.00 ? 99  LEU A HD13 4  
ATOM 6232  H HD21 . LEU A 1 99  ? 5.426   14.464  4.357   1.00 0.00 ? 99  LEU A HD21 4  
ATOM 6233  H HD22 . LEU A 1 99  ? 5.217   14.506  6.108   1.00 0.00 ? 99  LEU A HD22 4  
ATOM 6234  H HD23 . LEU A 1 99  ? 4.449   15.732  5.098   1.00 0.00 ? 99  LEU A HD23 4  
ATOM 6235  N N    . VAL A 1 100 ? 1.473   10.202  3.503   1.00 0.00 ? 100 VAL A N    4  
ATOM 6236  C CA   . VAL A 1 100 ? 0.684   10.090  2.283   1.00 0.00 ? 100 VAL A CA   4  
ATOM 6237  C C    . VAL A 1 100 ? -0.476  11.079  2.286   1.00 0.00 ? 100 VAL A C    4  
ATOM 6238  O O    . VAL A 1 100 ? -0.671  11.820  3.250   1.00 0.00 ? 100 VAL A O    4  
ATOM 6239  C CB   . VAL A 1 100 ? 0.128   8.665   2.102   1.00 0.00 ? 100 VAL A CB   4  
ATOM 6240  C CG1  . VAL A 1 100 ? 1.264   7.663   1.961   1.00 0.00 ? 100 VAL A CG1  4  
ATOM 6241  C CG2  . VAL A 1 100 ? -0.779  8.295   3.266   1.00 0.00 ? 100 VAL A CG2  4  
ATOM 6242  H H    . VAL A 1 100 ? 1.691   9.390   4.008   1.00 0.00 ? 100 VAL A H    4  
ATOM 6243  H HA   . VAL A 1 100 ? 1.330   10.311  1.446   1.00 0.00 ? 100 VAL A HA   4  
ATOM 6244  H HB   . VAL A 1 100 ? -0.458  8.641   1.195   1.00 0.00 ? 100 VAL A HB   4  
ATOM 6245  H HG11 . VAL A 1 100 ? 2.143   8.042   2.462   1.00 0.00 ? 100 VAL A HG11 4  
ATOM 6246  H HG12 . VAL A 1 100 ? 0.972   6.723   2.406   1.00 0.00 ? 100 VAL A HG12 4  
ATOM 6247  H HG13 . VAL A 1 100 ? 1.484   7.513   0.914   1.00 0.00 ? 100 VAL A HG13 4  
ATOM 6248  H HG21 . VAL A 1 100 ? -0.522  8.896   4.126   1.00 0.00 ? 100 VAL A HG21 4  
ATOM 6249  H HG22 . VAL A 1 100 ? -1.808  8.478   2.993   1.00 0.00 ? 100 VAL A HG22 4  
ATOM 6250  H HG23 . VAL A 1 100 ? -0.650  7.250   3.505   1.00 0.00 ? 100 VAL A HG23 4  
ATOM 6251  N N    . CYS A 1 101 ? -1.244  11.086  1.202   1.00 0.00 ? 101 CYS A N    4  
ATOM 6252  C CA   . CYS A 1 101 ? -2.386  11.985  1.079   1.00 0.00 ? 101 CYS A CA   4  
ATOM 6253  C C    . CYS A 1 101 ? -3.265  11.588  -0.102  1.00 0.00 ? 101 CYS A C    4  
ATOM 6254  O O    . CYS A 1 101 ? -2.831  10.861  -0.996  1.00 0.00 ? 101 CYS A O    4  
ATOM 6255  C CB   . CYS A 1 101 ? -1.909  13.428  0.914   1.00 0.00 ? 101 CYS A CB   4  
ATOM 6256  S SG   . CYS A 1 101 ? -1.504  13.882  -0.789  1.00 0.00 ? 101 CYS A SG   4  
ATOM 6257  H H    . CYS A 1 101 ? -1.038  10.472  0.466   1.00 0.00 ? 101 CYS A H    4  
ATOM 6258  H HA   . CYS A 1 101 ? -2.966  11.907  1.986   1.00 0.00 ? 101 CYS A HA   4  
ATOM 6259  H HB2  . CYS A 1 101 ? -2.686  14.097  1.255   1.00 0.00 ? 101 CYS A HB2  4  
ATOM 6260  H HB3  . CYS A 1 101 ? -1.025  13.579  1.515   1.00 0.00 ? 101 CYS A HB3  4  
ATOM 6261  H HG   . CYS A 1 101 ? -1.346  15.196  -0.835  1.00 0.00 ? 101 CYS A HG   4  
ATOM 6262  N N    . ASP A 1 102 ? -4.504  12.069  -0.099  1.00 0.00 ? 102 ASP A N    4  
ATOM 6263  C CA   . ASP A 1 102 ? -5.445  11.765  -1.170  1.00 0.00 ? 102 ASP A CA   4  
ATOM 6264  C C    . ASP A 1 102 ? -4.923  12.269  -2.512  1.00 0.00 ? 102 ASP A C    4  
ATOM 6265  O O    . ASP A 1 102 ? -4.993  13.462  -2.808  1.00 0.00 ? 102 ASP A O    4  
ATOM 6266  C CB   . ASP A 1 102 ? -6.809  12.389  -0.872  1.00 0.00 ? 102 ASP A CB   4  
ATOM 6267  C CG   . ASP A 1 102 ? -6.692  13.768  -0.253  1.00 0.00 ? 102 ASP A CG   4  
ATOM 6268  O OD1  . ASP A 1 102 ? -5.734  14.493  -0.595  1.00 0.00 ? 102 ASP A OD1  4  
ATOM 6269  O OD2  . ASP A 1 102 ? -7.558  14.122  0.574   1.00 0.00 ? 102 ASP A OD2  4  
ATOM 6270  H H    . ASP A 1 102 ? -4.791  12.643  0.641   1.00 0.00 ? 102 ASP A H    4  
ATOM 6271  H HA   . ASP A 1 102 ? -5.554  10.692  -1.221  1.00 0.00 ? 102 ASP A HA   4  
ATOM 6272  H HB2  . ASP A 1 102 ? -7.368  12.475  -1.793  1.00 0.00 ? 102 ASP A HB2  4  
ATOM 6273  H HB3  . ASP A 1 102 ? -7.348  11.751  -0.187  1.00 0.00 ? 102 ASP A HB3  4  
ATOM 6274  N N    . GLY A 1 103 ? -4.399  11.353  -3.320  1.00 0.00 ? 103 GLY A N    4  
ATOM 6275  C CA   . GLY A 1 103 ? -3.872  11.724  -4.620  1.00 0.00 ? 103 GLY A CA   4  
ATOM 6276  C C    . GLY A 1 103 ? -4.905  11.597  -5.723  1.00 0.00 ? 103 GLY A C    4  
ATOM 6277  O O    . GLY A 1 103 ? -5.237  12.577  -6.389  1.00 0.00 ? 103 GLY A O    4  
ATOM 6278  H H    . GLY A 1 103 ? -4.371  10.417  -3.032  1.00 0.00 ? 103 GLY A H    4  
ATOM 6279  H HA2  . GLY A 1 103 ? -3.530  12.748  -4.579  1.00 0.00 ? 103 GLY A HA2  4  
ATOM 6280  H HA3  . GLY A 1 103 ? -3.034  11.084  -4.853  1.00 0.00 ? 103 GLY A HA3  4  
ATOM 6281  N N    . PHE A 1 104 ? -5.413  10.384  -5.918  1.00 0.00 ? 104 PHE A N    4  
ATOM 6282  C CA   . PHE A 1 104 ? -6.412  10.131  -6.949  1.00 0.00 ? 104 PHE A CA   4  
ATOM 6283  C C    . PHE A 1 104 ? -7.101  8.789   -6.721  1.00 0.00 ? 104 PHE A C    4  
ATOM 6284  O O    . PHE A 1 104 ? -6.478  7.733   -6.829  1.00 0.00 ? 104 PHE A O    4  
ATOM 6285  C CB   . PHE A 1 104 ? -5.763  10.154  -8.334  1.00 0.00 ? 104 PHE A CB   4  
ATOM 6286  C CG   . PHE A 1 104 ? -4.338  9.680   -8.337  1.00 0.00 ? 104 PHE A CG   4  
ATOM 6287  C CD1  . PHE A 1 104 ? -3.308  10.538  -7.985  1.00 0.00 ? 104 PHE A CD1  4  
ATOM 6288  C CD2  . PHE A 1 104 ? -4.028  8.376   -8.689  1.00 0.00 ? 104 PHE A CD2  4  
ATOM 6289  C CE1  . PHE A 1 104 ? -1.995  10.104  -7.987  1.00 0.00 ? 104 PHE A CE1  4  
ATOM 6290  C CE2  . PHE A 1 104 ? -2.717  7.937   -8.692  1.00 0.00 ? 104 PHE A CE2  4  
ATOM 6291  C CZ   . PHE A 1 104 ? -1.700  8.802   -8.340  1.00 0.00 ? 104 PHE A CZ   4  
ATOM 6292  H H    . PHE A 1 104 ? -5.108  9.642   -5.354  1.00 0.00 ? 104 PHE A H    4  
ATOM 6293  H HA   . PHE A 1 104 ? -7.151  10.916  -6.894  1.00 0.00 ? 104 PHE A HA   4  
ATOM 6294  H HB2  . PHE A 1 104 ? -6.325  9.515   -8.999  1.00 0.00 ? 104 PHE A HB2  4  
ATOM 6295  H HB3  . PHE A 1 104 ? -5.778  11.164  -8.714  1.00 0.00 ? 104 PHE A HB3  4  
ATOM 6296  H HD1  . PHE A 1 104 ? -3.537  11.556  -7.708  1.00 0.00 ? 104 PHE A HD1  4  
ATOM 6297  H HD2  . PHE A 1 104 ? -4.823  7.698   -8.965  1.00 0.00 ? 104 PHE A HD2  4  
ATOM 6298  H HE1  . PHE A 1 104 ? -1.202  10.782  -7.711  1.00 0.00 ? 104 PHE A HE1  4  
ATOM 6299  H HE2  . PHE A 1 104 ? -2.490  6.918   -8.969  1.00 0.00 ? 104 PHE A HE2  4  
ATOM 6300  H HZ   . PHE A 1 104 ? -0.675  8.461   -8.342  1.00 0.00 ? 104 PHE A HZ   4  
ATOM 6301  N N    . GLU A 1 105 ? -8.392  8.839   -6.404  1.00 0.00 ? 105 GLU A N    4  
ATOM 6302  C CA   . GLU A 1 105 ? -9.165  7.628   -6.158  1.00 0.00 ? 105 GLU A CA   4  
ATOM 6303  C C    . GLU A 1 105 ? -9.064  6.669   -7.341  1.00 0.00 ? 105 GLU A C    4  
ATOM 6304  O O    . GLU A 1 105 ? -8.677  5.511   -7.184  1.00 0.00 ? 105 GLU A O    4  
ATOM 6305  C CB   . GLU A 1 105 ? -10.631 7.977   -5.895  1.00 0.00 ? 105 GLU A CB   4  
ATOM 6306  C CG   . GLU A 1 105 ? -10.878 8.570   -4.517  1.00 0.00 ? 105 GLU A CG   4  
ATOM 6307  C CD   . GLU A 1 105 ? -12.207 9.294   -4.423  1.00 0.00 ? 105 GLU A CD   4  
ATOM 6308  O OE1  . GLU A 1 105 ? -12.501 10.113  -5.319  1.00 0.00 ? 105 GLU A OE1  4  
ATOM 6309  O OE2  . GLU A 1 105 ? -12.952 9.042   -3.453  1.00 0.00 ? 105 GLU A OE2  4  
ATOM 6310  H H    . GLU A 1 105 ? -8.833  9.712   -6.332  1.00 0.00 ? 105 GLU A H    4  
ATOM 6311  H HA   . GLU A 1 105 ? -8.757  7.145   -5.283  1.00 0.00 ? 105 GLU A HA   4  
ATOM 6312  H HB2  . GLU A 1 105 ? -10.958 8.692   -6.635  1.00 0.00 ? 105 GLU A HB2  4  
ATOM 6313  H HB3  . GLU A 1 105 ? -11.225 7.080   -5.988  1.00 0.00 ? 105 GLU A HB3  4  
ATOM 6314  H HG2  . GLU A 1 105 ? -10.868 7.773   -3.789  1.00 0.00 ? 105 GLU A HG2  4  
ATOM 6315  H HG3  . GLU A 1 105 ? -10.086 9.270   -4.294  1.00 0.00 ? 105 GLU A HG3  4  
ATOM 6316  N N    . SER A 1 106 ? -9.416  7.160   -8.525  1.00 0.00 ? 106 SER A N    4  
ATOM 6317  C CA   . SER A 1 106 ? -9.370  6.347   -9.734  1.00 0.00 ? 106 SER A CA   4  
ATOM 6318  C C    . SER A 1 106 ? -10.255 5.112   -9.593  1.00 0.00 ? 106 SER A C    4  
ATOM 6319  O O    . SER A 1 106 ? -9.816  3.989   -9.834  1.00 0.00 ? 106 SER A O    4  
ATOM 6320  C CB   . SER A 1 106 ? -7.930  5.924   -10.035 1.00 0.00 ? 106 SER A CB   4  
ATOM 6321  O OG   . SER A 1 106 ? -7.179  7.008   -10.555 1.00 0.00 ? 106 SER A OG   4  
ATOM 6322  H H    . SER A 1 106 ? -9.716  8.091   -8.586  1.00 0.00 ? 106 SER A H    4  
ATOM 6323  H HA   . SER A 1 106 ? -9.738  6.947   -10.552 1.00 0.00 ? 106 SER A HA   4  
ATOM 6324  H HB2  . SER A 1 106 ? -7.461  5.580   -9.126  1.00 0.00 ? 106 SER A HB2  4  
ATOM 6325  H HB3  . SER A 1 106 ? -7.937  5.125   -10.762 1.00 0.00 ? 106 SER A HB3  4  
ATOM 6326  H HG   . SER A 1 106 ? -6.321  6.692   -10.847 1.00 0.00 ? 106 SER A HG   4  
ATOM 6327  N N    . GLY A 1 107 ? -11.506 5.331   -9.200  1.00 0.00 ? 107 GLY A N    4  
ATOM 6328  C CA   . GLY A 1 107 ? -12.434 4.228   -9.032  1.00 0.00 ? 107 GLY A CA   4  
ATOM 6329  C C    . GLY A 1 107 ? -13.819 4.550   -9.559  1.00 0.00 ? 107 GLY A C    4  
ATOM 6330  O O    . GLY A 1 107 ? -13.989 4.962   -10.707 1.00 0.00 ? 107 GLY A O    4  
ATOM 6331  H H    . GLY A 1 107 ? -11.801 6.248   -9.022  1.00 0.00 ? 107 GLY A H    4  
ATOM 6332  H HA2  . GLY A 1 107 ? -12.052 3.366   -9.559  1.00 0.00 ? 107 GLY A HA2  4  
ATOM 6333  H HA3  . GLY A 1 107 ? -12.508 3.991   -7.981  1.00 0.00 ? 107 GLY A HA3  4  
ATOM 6334  N N    . PRO A 1 108 ? -14.838 4.361   -8.709  1.00 0.00 ? 108 PRO A N    4  
ATOM 6335  C CA   . PRO A 1 108 ? -16.233 4.627   -9.073  1.00 0.00 ? 108 PRO A CA   4  
ATOM 6336  C C    . PRO A 1 108 ? -16.516 6.116   -9.234  1.00 0.00 ? 108 PRO A C    4  
ATOM 6337  O O    . PRO A 1 108 ? -17.600 6.509   -9.666  1.00 0.00 ? 108 PRO A O    4  
ATOM 6338  C CB   . PRO A 1 108 ? -17.023 4.057   -7.892  1.00 0.00 ? 108 PRO A CB   4  
ATOM 6339  C CG   . PRO A 1 108 ? -16.076 4.105   -6.744  1.00 0.00 ? 108 PRO A CG   4  
ATOM 6340  C CD   . PRO A 1 108 ? -14.708 3.872   -7.325  1.00 0.00 ? 108 PRO A CD   4  
ATOM 6341  H HA   . PRO A 1 108 ? -16.512 4.109   -9.979  1.00 0.00 ? 108 PRO A HA   4  
ATOM 6342  H HB2  . PRO A 1 108 ? -17.896 4.669   -7.711  1.00 0.00 ? 108 PRO A HB2  4  
ATOM 6343  H HB3  . PRO A 1 108 ? -17.326 3.044   -8.112  1.00 0.00 ? 108 PRO A HB3  4  
ATOM 6344  H HG2  . PRO A 1 108 ? -16.122 5.073   -6.270  1.00 0.00 ? 108 PRO A HG2  4  
ATOM 6345  H HG3  . PRO A 1 108 ? -16.318 3.326   -6.036  1.00 0.00 ? 108 PRO A HG3  4  
ATOM 6346  H HD2  . PRO A 1 108 ? -13.967 4.440   -6.784  1.00 0.00 ? 108 PRO A HD2  4  
ATOM 6347  H HD3  . PRO A 1 108 ? -14.466 2.820   -7.310  1.00 0.00 ? 108 PRO A HD3  4  
ATOM 6348  N N    . SER A 1 109 ? -15.534 6.942   -8.884  1.00 0.00 ? 109 SER A N    4  
ATOM 6349  C CA   . SER A 1 109 ? -15.680 8.389   -8.987  1.00 0.00 ? 109 SER A CA   4  
ATOM 6350  C C    . SER A 1 109 ? -16.123 8.792   -10.390 1.00 0.00 ? 109 SER A C    4  
ATOM 6351  O O    . SER A 1 109 ? -16.794 9.808   -10.573 1.00 0.00 ? 109 SER A O    4  
ATOM 6352  C CB   . SER A 1 109 ? -14.360 9.081   -8.638  1.00 0.00 ? 109 SER A CB   4  
ATOM 6353  O OG   . SER A 1 109 ? -13.364 8.796   -9.604  1.00 0.00 ? 109 SER A OG   4  
ATOM 6354  H H    . SER A 1 109 ? -14.693 6.568   -8.546  1.00 0.00 ? 109 SER A H    4  
ATOM 6355  H HA   . SER A 1 109 ? -16.436 8.697   -8.280  1.00 0.00 ? 109 SER A HA   4  
ATOM 6356  H HB2  . SER A 1 109 ? -14.515 10.149  -8.603  1.00 0.00 ? 109 SER A HB2  4  
ATOM 6357  H HB3  . SER A 1 109 ? -14.020 8.735   -7.673  1.00 0.00 ? 109 SER A HB3  4  
ATOM 6358  H HG   . SER A 1 109 ? -12.608 9.370   -9.464  1.00 0.00 ? 109 SER A HG   4  
ATOM 6359  N N    . SER A 1 110 ? -15.744 7.988   -11.378 1.00 0.00 ? 110 SER A N    4  
ATOM 6360  C CA   . SER A 1 110 ? -16.098 8.262   -12.765 1.00 0.00 ? 110 SER A CA   4  
ATOM 6361  C C    . SER A 1 110 ? -17.592 8.541   -12.899 1.00 0.00 ? 110 SER A C    4  
ATOM 6362  O O    . SER A 1 110 ? -17.997 9.558   -13.461 1.00 0.00 ? 110 SER A O    4  
ATOM 6363  C CB   . SER A 1 110 ? -15.707 7.082   -13.656 1.00 0.00 ? 110 SER A CB   4  
ATOM 6364  O OG   . SER A 1 110 ? -14.316 7.088   -13.930 1.00 0.00 ? 110 SER A OG   4  
ATOM 6365  H H    . SER A 1 110 ? -15.210 7.193   -11.168 1.00 0.00 ? 110 SER A H    4  
ATOM 6366  H HA   . SER A 1 110 ? -15.551 9.137   -13.081 1.00 0.00 ? 110 SER A HA   4  
ATOM 6367  H HB2  . SER A 1 110 ? -15.959 6.158   -13.158 1.00 0.00 ? 110 SER A HB2  4  
ATOM 6368  H HB3  . SER A 1 110 ? -16.246 7.145   -14.591 1.00 0.00 ? 110 SER A HB3  4  
ATOM 6369  H HG   . SER A 1 110 ? -14.121 6.443   -14.613 1.00 0.00 ? 110 SER A HG   4  
ATOM 6370  N N    . GLY A 1 111 ? -18.408 7.629   -12.378 1.00 0.00 ? 111 GLY A N    4  
ATOM 6371  C CA   . GLY A 1 111 ? -19.848 7.795   -12.450 1.00 0.00 ? 111 GLY A CA   4  
ATOM 6372  C C    . GLY A 1 111 ? -20.450 7.114   -13.663 1.00 0.00 ? 111 GLY A C    4  
ATOM 6373  O O    . GLY A 1 111 ? -20.171 5.945   -13.929 1.00 0.00 ? 111 GLY A O    4  
ATOM 6374  H H    . GLY A 1 111 ? -18.028 6.838   -11.942 1.00 0.00 ? 111 GLY A H    4  
ATOM 6375  H HA2  . GLY A 1 111 ? -20.291 7.377   -11.558 1.00 0.00 ? 111 GLY A HA2  4  
ATOM 6376  H HA3  . GLY A 1 111 ? -20.076 8.850   -12.493 1.00 0.00 ? 111 GLY A HA3  4  
ATOM 6377  N N    . GLY A 1 1   ? -10.255 27.276  -5.709  1.00 0.00 ? 1   GLY A N    5  
ATOM 6378  C CA   . GLY A 1 1   ? -8.823  27.073  -5.830  1.00 0.00 ? 1   GLY A CA   5  
ATOM 6379  C C    . GLY A 1 1   ? -8.253  26.265  -4.681  1.00 0.00 ? 1   GLY A C    5  
ATOM 6380  O O    . GLY A 1 1   ? -8.792  25.219  -4.321  1.00 0.00 ? 1   GLY A O    5  
ATOM 6381  H H1   . GLY A 1 1   ? -10.874 26.690  -6.192  1.00 0.00 ? 1   GLY A H1   5  
ATOM 6382  H HA2  . GLY A 1 1   ? -8.621  26.555  -6.756  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 6383  H HA3  . GLY A 1 1   ? -8.336  28.036  -5.854  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 6384  N N    . SER A 1 2   ? -7.158  26.751  -4.104  1.00 0.00 ? 2   SER A N    5  
ATOM 6385  C CA   . SER A 1 2   ? -6.511  26.064  -2.993  1.00 0.00 ? 2   SER A CA   5  
ATOM 6386  C C    . SER A 1 2   ? -7.535  25.646  -1.942  1.00 0.00 ? 2   SER A C    5  
ATOM 6387  O O    . SER A 1 2   ? -7.670  24.464  -1.627  1.00 0.00 ? 2   SER A O    5  
ATOM 6388  C CB   . SER A 1 2   ? -5.450  26.965  -2.357  1.00 0.00 ? 2   SER A CB   5  
ATOM 6389  O OG   . SER A 1 2   ? -4.700  26.261  -1.383  1.00 0.00 ? 2   SER A OG   5  
ATOM 6390  H H    . SER A 1 2   ? -6.776  27.590  -4.436  1.00 0.00 ? 2   SER A H    5  
ATOM 6391  H HA   . SER A 1 2   ? -6.032  25.179  -3.384  1.00 0.00 ? 2   SER A HA   5  
ATOM 6392  H HB2  . SER A 1 2   ? -4.778  27.321  -3.123  1.00 0.00 ? 2   SER A HB2  5  
ATOM 6393  H HB3  . SER A 1 2   ? -5.934  27.807  -1.883  1.00 0.00 ? 2   SER A HB3  5  
ATOM 6394  H HG   . SER A 1 2   ? -4.170  25.586  -1.813  1.00 0.00 ? 2   SER A HG   5  
ATOM 6395  N N    . SER A 1 3   ? -8.255  26.625  -1.404  1.00 0.00 ? 3   SER A N    5  
ATOM 6396  C CA   . SER A 1 3   ? -9.265  26.361  -0.386  1.00 0.00 ? 3   SER A CA   5  
ATOM 6397  C C    . SER A 1 3   ? -10.524 25.766  -1.011  1.00 0.00 ? 3   SER A C    5  
ATOM 6398  O O    . SER A 1 3   ? -11.539 26.445  -1.155  1.00 0.00 ? 3   SER A O    5  
ATOM 6399  C CB   . SER A 1 3   ? -9.613  27.648  0.364   1.00 0.00 ? 3   SER A CB   5  
ATOM 6400  O OG   . SER A 1 3   ? -10.066 28.651  -0.529  1.00 0.00 ? 3   SER A OG   5  
ATOM 6401  H H    . SER A 1 3   ? -8.101  27.548  -1.697  1.00 0.00 ? 3   SER A H    5  
ATOM 6402  H HA   . SER A 1 3   ? -8.853  25.648  0.313   1.00 0.00 ? 3   SER A HA   5  
ATOM 6403  H HB2  . SER A 1 3   ? -10.393 27.444  1.082   1.00 0.00 ? 3   SER A HB2  5  
ATOM 6404  H HB3  . SER A 1 3   ? -8.735  28.010  0.879   1.00 0.00 ? 3   SER A HB3  5  
ATOM 6405  H HG   . SER A 1 3   ? -10.707 28.275  -1.136  1.00 0.00 ? 3   SER A HG   5  
ATOM 6406  N N    . GLY A 1 4   ? -10.448 24.491  -1.379  1.00 0.00 ? 4   GLY A N    5  
ATOM 6407  C CA   . GLY A 1 4   ? -11.586 23.825  -1.984  1.00 0.00 ? 4   GLY A CA   5  
ATOM 6408  C C    . GLY A 1 4   ? -12.293 22.893  -1.020  1.00 0.00 ? 4   GLY A C    5  
ATOM 6409  O O    . GLY A 1 4   ? -13.403 23.179  -0.571  1.00 0.00 ? 4   GLY A O    5  
ATOM 6410  H H    . GLY A 1 4   ? -9.612  23.998  -1.239  1.00 0.00 ? 4   GLY A H    5  
ATOM 6411  H HA2  . GLY A 1 4   ? -12.287 24.572  -2.326  1.00 0.00 ? 4   GLY A HA2  5  
ATOM 6412  H HA3  . GLY A 1 4   ? -11.244 23.252  -2.834  1.00 0.00 ? 4   GLY A HA3  5  
ATOM 6413  N N    . SER A 1 5   ? -11.650 21.774  -0.701  1.00 0.00 ? 5   SER A N    5  
ATOM 6414  C CA   . SER A 1 5   ? -12.227 20.795  0.212   1.00 0.00 ? 5   SER A CA   5  
ATOM 6415  C C    . SER A 1 5   ? -11.669 20.971  1.621   1.00 0.00 ? 5   SER A C    5  
ATOM 6416  O O    . SER A 1 5   ? -10.490 21.279  1.800   1.00 0.00 ? 5   SER A O    5  
ATOM 6417  C CB   . SER A 1 5   ? -11.947 19.375  -0.286  1.00 0.00 ? 5   SER A CB   5  
ATOM 6418  O OG   . SER A 1 5   ? -12.618 19.122  -1.507  1.00 0.00 ? 5   SER A OG   5  
ATOM 6419  H H    . SER A 1 5   ? -10.768 21.603  -1.092  1.00 0.00 ? 5   SER A H    5  
ATOM 6420  H HA   . SER A 1 5   ? -13.294 20.954  0.238   1.00 0.00 ? 5   SER A HA   5  
ATOM 6421  H HB2  . SER A 1 5   ? -10.885 19.254  -0.440  1.00 0.00 ? 5   SER A HB2  5  
ATOM 6422  H HB3  . SER A 1 5   ? -12.287 18.664  0.453   1.00 0.00 ? 5   SER A HB3  5  
ATOM 6423  H HG   . SER A 1 5   ? -12.336 19.760  -2.167  1.00 0.00 ? 5   SER A HG   5  
ATOM 6424  N N    . SER A 1 6   ? -12.524 20.774  2.619   1.00 0.00 ? 6   SER A N    5  
ATOM 6425  C CA   . SER A 1 6   ? -12.119 20.915  4.012   1.00 0.00 ? 6   SER A CA   5  
ATOM 6426  C C    . SER A 1 6   ? -11.777 19.557  4.619   1.00 0.00 ? 6   SER A C    5  
ATOM 6427  O O    . SER A 1 6   ? -12.345 19.157  5.634   1.00 0.00 ? 6   SER A O    5  
ATOM 6428  C CB   . SER A 1 6   ? -13.231 21.583  4.824   1.00 0.00 ? 6   SER A CB   5  
ATOM 6429  O OG   . SER A 1 6   ? -13.502 22.887  4.341   1.00 0.00 ? 6   SER A OG   5  
ATOM 6430  H H    . SER A 1 6   ? -13.451 20.531  2.412   1.00 0.00 ? 6   SER A H    5  
ATOM 6431  H HA   . SER A 1 6   ? -11.239 21.540  4.040   1.00 0.00 ? 6   SER A HA   5  
ATOM 6432  H HB2  . SER A 1 6   ? -14.131 20.991  4.751   1.00 0.00 ? 6   SER A HB2  5  
ATOM 6433  H HB3  . SER A 1 6   ? -12.927 21.650  5.858   1.00 0.00 ? 6   SER A HB3  5  
ATOM 6434  H HG   . SER A 1 6   ? -13.256 22.943  3.415   1.00 0.00 ? 6   SER A HG   5  
ATOM 6435  N N    . GLY A 1 7   ? -10.843 18.852  3.987   1.00 0.00 ? 7   GLY A N    5  
ATOM 6436  C CA   . GLY A 1 7   ? -10.441 17.547  4.477   1.00 0.00 ? 7   GLY A CA   5  
ATOM 6437  C C    . GLY A 1 7   ? -8.934  17.388  4.534   1.00 0.00 ? 7   GLY A C    5  
ATOM 6438  O O    . GLY A 1 7   ? -8.201  17.922  3.702   1.00 0.00 ? 7   GLY A O    5  
ATOM 6439  H H    . GLY A 1 7   ? -10.424 19.222  3.181   1.00 0.00 ? 7   GLY A H    5  
ATOM 6440  H HA2  . GLY A 1 7   ? -10.845 17.406  5.468   1.00 0.00 ? 7   GLY A HA2  5  
ATOM 6441  H HA3  . GLY A 1 7   ? -10.847 16.789  3.823   1.00 0.00 ? 7   GLY A HA3  5  
ATOM 6442  N N    . PRO A 1 8   ? -8.452  16.639  5.536   1.00 0.00 ? 8   PRO A N    5  
ATOM 6443  C CA   . PRO A 1 8   ? -7.018  16.395  5.723   1.00 0.00 ? 8   PRO A CA   5  
ATOM 6444  C C    . PRO A 1 8   ? -6.438  15.493  4.639   1.00 0.00 ? 8   PRO A C    5  
ATOM 6445  O O    . PRO A 1 8   ? -7.161  15.003  3.773   1.00 0.00 ? 8   PRO A O    5  
ATOM 6446  C CB   . PRO A 1 8   ? -6.951  15.703  7.087   1.00 0.00 ? 8   PRO A CB   5  
ATOM 6447  C CG   . PRO A 1 8   ? -8.287  15.065  7.254   1.00 0.00 ? 8   PRO A CG   5  
ATOM 6448  C CD   . PRO A 1 8   ? -9.268  15.972  6.564   1.00 0.00 ? 8   PRO A CD   5  
ATOM 6449  H HA   . PRO A 1 8   ? -6.460  17.319  5.758   1.00 0.00 ? 8   PRO A HA   5  
ATOM 6450  H HB2  . PRO A 1 8   ? -6.159  14.968  7.082   1.00 0.00 ? 8   PRO A HB2  5  
ATOM 6451  H HB3  . PRO A 1 8   ? -6.764  16.436  7.857   1.00 0.00 ? 8   PRO A HB3  5  
ATOM 6452  H HG2  . PRO A 1 8   ? -8.289  14.090  6.793   1.00 0.00 ? 8   PRO A HG2  5  
ATOM 6453  H HG3  . PRO A 1 8   ? -8.526  14.985  8.305   1.00 0.00 ? 8   PRO A HG3  5  
ATOM 6454  H HD2  . PRO A 1 8   ? -10.062 15.395  6.113   1.00 0.00 ? 8   PRO A HD2  5  
ATOM 6455  H HD3  . PRO A 1 8   ? -9.672  16.691  7.261   1.00 0.00 ? 8   PRO A HD3  5  
ATOM 6456  N N    . GLY A 1 9   ? -5.127  15.278  4.694   1.00 0.00 ? 9   GLY A N    5  
ATOM 6457  C CA   . GLY A 1 9   ? -4.472  14.435  3.711   1.00 0.00 ? 9   GLY A CA   5  
ATOM 6458  C C    . GLY A 1 9   ? -2.960  14.523  3.787   1.00 0.00 ? 9   GLY A C    5  
ATOM 6459  O O    . GLY A 1 9   ? -2.278  13.508  3.930   1.00 0.00 ? 9   GLY A O    5  
ATOM 6460  H H    . GLY A 1 9   ? -4.600  15.695  5.408   1.00 0.00 ? 9   GLY A H    5  
ATOM 6461  H HA2  . GLY A 1 9   ? -4.771  13.410  3.875   1.00 0.00 ? 9   GLY A HA2  5  
ATOM 6462  H HA3  . GLY A 1 9   ? -4.789  14.738  2.725   1.00 0.00 ? 9   GLY A HA3  5  
ATOM 6463  N N    . LEU A 1 10  ? -2.435  15.739  3.688   1.00 0.00 ? 10  LEU A N    5  
ATOM 6464  C CA   . LEU A 1 10  ? -0.994  15.957  3.745   1.00 0.00 ? 10  LEU A CA   5  
ATOM 6465  C C    . LEU A 1 10  ? -0.508  16.015  5.189   1.00 0.00 ? 10  LEU A C    5  
ATOM 6466  O O    . LEU A 1 10  ? 0.572   16.536  5.471   1.00 0.00 ? 10  LEU A O    5  
ATOM 6467  C CB   . LEU A 1 10  ? -0.625  17.252  3.018   1.00 0.00 ? 10  LEU A CB   5  
ATOM 6468  C CG   . LEU A 1 10  ? -1.466  18.480  3.367   1.00 0.00 ? 10  LEU A CG   5  
ATOM 6469  C CD1  . LEU A 1 10  ? -2.701  18.549  2.483   1.00 0.00 ? 10  LEU A CD1  5  
ATOM 6470  C CD2  . LEU A 1 10  ? -1.859  18.457  4.836   1.00 0.00 ? 10  LEU A CD2  5  
ATOM 6471  H H    . LEU A 1 10  ? -3.029  16.510  3.575   1.00 0.00 ? 10  LEU A H    5  
ATOM 6472  H HA   . LEU A 1 10  ? -0.514  15.126  3.249   1.00 0.00 ? 10  LEU A HA   5  
ATOM 6473  H HB2  . LEU A 1 10  ? 0.405   17.479  3.250   1.00 0.00 ? 10  LEU A HB2  5  
ATOM 6474  H HB3  . LEU A 1 10  ? -0.722  17.073  1.956   1.00 0.00 ? 10  LEU A HB3  5  
ATOM 6475  H HG   . LEU A 1 10  ? -0.879  19.372  3.191   1.00 0.00 ? 10  LEU A HG   5  
ATOM 6476  H HD11 . LEU A 1 10  ? -3.577  18.690  3.099   1.00 0.00 ? 10  LEU A HD11 5  
ATOM 6477  H HD12 . LEU A 1 10  ? -2.797  17.630  1.925   1.00 0.00 ? 10  LEU A HD12 5  
ATOM 6478  H HD13 . LEU A 1 10  ? -2.606  19.378  1.796   1.00 0.00 ? 10  LEU A HD13 5  
ATOM 6479  H HD21 . LEU A 1 10  ? -2.458  17.580  5.034   1.00 0.00 ? 10  LEU A HD21 5  
ATOM 6480  H HD22 . LEU A 1 10  ? -2.431  19.344  5.070   1.00 0.00 ? 10  LEU A HD22 5  
ATOM 6481  H HD23 . LEU A 1 10  ? -0.969  18.431  5.447   1.00 0.00 ? 10  LEU A HD23 5  
ATOM 6482  N N    . ARG A 1 11  ? -1.311  15.475  6.100   1.00 0.00 ? 11  ARG A N    5  
ATOM 6483  C CA   . ARG A 1 11  ? -0.962  15.465  7.516   1.00 0.00 ? 11  ARG A CA   5  
ATOM 6484  C C    . ARG A 1 11  ? -0.152  14.220  7.867   1.00 0.00 ? 11  ARG A C    5  
ATOM 6485  O O    . ARG A 1 11  ? -0.143  13.243  7.120   1.00 0.00 ? 11  ARG A O    5  
ATOM 6486  C CB   . ARG A 1 11  ? -2.226  15.522  8.375   1.00 0.00 ? 11  ARG A CB   5  
ATOM 6487  C CG   . ARG A 1 11  ? -2.912  16.879  8.360   1.00 0.00 ? 11  ARG A CG   5  
ATOM 6488  C CD   . ARG A 1 11  ? -4.122  16.902  9.281   1.00 0.00 ? 11  ARG A CD   5  
ATOM 6489  N NE   . ARG A 1 11  ? -3.763  17.277  10.646  1.00 0.00 ? 11  ARG A NE   5  
ATOM 6490  C CZ   . ARG A 1 11  ? -4.509  16.990  11.707  1.00 0.00 ? 11  ARG A CZ   5  
ATOM 6491  N NH1  . ARG A 1 11  ? -5.648  16.327  11.561  1.00 0.00 ? 11  ARG A NH1  5  
ATOM 6492  N NH2  . ARG A 1 11  ? -4.115  17.366  12.917  1.00 0.00 ? 11  ARG A NH2  5  
ATOM 6493  H H    . ARG A 1 11  ? -2.158  15.075  5.814   1.00 0.00 ? 11  ARG A H    5  
ATOM 6494  H HA   . ARG A 1 11  ? -0.361  16.339  7.716   1.00 0.00 ? 11  ARG A HA   5  
ATOM 6495  H HB2  . ARG A 1 11  ? -2.928  14.785  8.012   1.00 0.00 ? 11  ARG A HB2  5  
ATOM 6496  H HB3  . ARG A 1 11  ? -1.965  15.287  9.396   1.00 0.00 ? 11  ARG A HB3  5  
ATOM 6497  H HG2  . ARG A 1 11  ? -2.209  17.630  8.688   1.00 0.00 ? 11  ARG A HG2  5  
ATOM 6498  H HG3  . ARG A 1 11  ? -3.233  17.098  7.353   1.00 0.00 ? 11  ARG A HG3  5  
ATOM 6499  H HD2  . ARG A 1 11  ? -4.836  17.615  8.898   1.00 0.00 ? 11  ARG A HD2  5  
ATOM 6500  H HD3  . ARG A 1 11  ? -4.567  15.918  9.293   1.00 0.00 ? 11  ARG A HD3  5  
ATOM 6501  H HE   . ARG A 1 11  ? -2.925  17.768  10.777  1.00 0.00 ? 11  ARG A HE   5  
ATOM 6502  H HH11 . ARG A 1 11  ? -5.946  16.042  10.651  1.00 0.00 ? 11  ARG A HH11 5  
ATOM 6503  H HH12 . ARG A 1 11  ? -6.207  16.111  12.362  1.00 0.00 ? 11  ARG A HH12 5  
ATOM 6504  H HH21 . ARG A 1 11  ? -3.257  17.865  13.031  1.00 0.00 ? 11  ARG A HH21 5  
ATOM 6505  H HH22 . ARG A 1 11  ? -4.677  17.149  13.715  1.00 0.00 ? 11  ARG A HH22 5  
ATOM 6506  N N    . GLU A 1 12  ? 0.528   14.266  9.009   1.00 0.00 ? 12  GLU A N    5  
ATOM 6507  C CA   . GLU A 1 12  ? 1.342   13.142  9.457   1.00 0.00 ? 12  GLU A CA   5  
ATOM 6508  C C    . GLU A 1 12  ? 0.464   11.995  9.948   1.00 0.00 ? 12  GLU A C    5  
ATOM 6509  O O    . GLU A 1 12  ? -0.189  12.099  10.988  1.00 0.00 ? 12  GLU A O    5  
ATOM 6510  C CB   . GLU A 1 12  ? 2.292   13.585  10.572  1.00 0.00 ? 12  GLU A CB   5  
ATOM 6511  C CG   . GLU A 1 12  ? 3.406   12.590  10.854  1.00 0.00 ? 12  GLU A CG   5  
ATOM 6512  C CD   . GLU A 1 12  ? 4.379   13.086  11.905  1.00 0.00 ? 12  GLU A CD   5  
ATOM 6513  O OE1  . GLU A 1 12  ? 5.182   13.990  11.592  1.00 0.00 ? 12  GLU A OE1  5  
ATOM 6514  O OE2  . GLU A 1 12  ? 4.337   12.570  13.042  1.00 0.00 ? 12  GLU A OE2  5  
ATOM 6515  H H    . GLU A 1 12  ? 0.481   15.073  9.562   1.00 0.00 ? 12  GLU A H    5  
ATOM 6516  H HA   . GLU A 1 12  ? 1.925   12.798  8.616   1.00 0.00 ? 12  GLU A HA   5  
ATOM 6517  H HB2  . GLU A 1 12  ? 2.741   14.527  10.293  1.00 0.00 ? 12  GLU A HB2  5  
ATOM 6518  H HB3  . GLU A 1 12  ? 1.723   13.723  11.479  1.00 0.00 ? 12  GLU A HB3  5  
ATOM 6519  H HG2  . GLU A 1 12  ? 2.967   11.666  11.199  1.00 0.00 ? 12  GLU A HG2  5  
ATOM 6520  H HG3  . GLU A 1 12  ? 3.949   12.408  9.938   1.00 0.00 ? 12  GLU A HG3  5  
ATOM 6521  N N    . LEU A 1 13  ? 0.452   10.902  9.194   1.00 0.00 ? 13  LEU A N    5  
ATOM 6522  C CA   . LEU A 1 13  ? -0.347  9.735   9.551   1.00 0.00 ? 13  LEU A CA   5  
ATOM 6523  C C    . LEU A 1 13  ? 0.545   8.581   10.000  1.00 0.00 ? 13  LEU A C    5  
ATOM 6524  O O    . LEU A 1 13  ? 1.744   8.565   9.718   1.00 0.00 ? 13  LEU A O    5  
ATOM 6525  C CB   . LEU A 1 13  ? -1.207  9.298   8.364   1.00 0.00 ? 13  LEU A CB   5  
ATOM 6526  C CG   . LEU A 1 13  ? -2.438  10.156  8.074   1.00 0.00 ? 13  LEU A CG   5  
ATOM 6527  C CD1  . LEU A 1 13  ? -2.860  10.012  6.620   1.00 0.00 ? 13  LEU A CD1  5  
ATOM 6528  C CD2  . LEU A 1 13  ? -3.583  9.777   9.003   1.00 0.00 ? 13  LEU A CD2  5  
ATOM 6529  H H    . LEU A 1 13  ? 0.992   10.878  8.377   1.00 0.00 ? 13  LEU A H    5  
ATOM 6530  H HA   . LEU A 1 13  ? -0.994  10.014  10.370  1.00 0.00 ? 13  LEU A HA   5  
ATOM 6531  H HB2  . LEU A 1 13  ? -0.583  9.307   7.483   1.00 0.00 ? 13  LEU A HB2  5  
ATOM 6532  H HB3  . LEU A 1 13  ? -1.543  8.288   8.554   1.00 0.00 ? 13  LEU A HB3  5  
ATOM 6533  H HG   . LEU A 1 13  ? -2.194  11.195  8.249   1.00 0.00 ? 13  LEU A HG   5  
ATOM 6534  H HD11 . LEU A 1 13  ? -3.246  9.018   6.454   1.00 0.00 ? 13  LEU A HD11 5  
ATOM 6535  H HD12 . LEU A 1 13  ? -2.006  10.179  5.980   1.00 0.00 ? 13  LEU A HD12 5  
ATOM 6536  H HD13 . LEU A 1 13  ? -3.627  10.739  6.394   1.00 0.00 ? 13  LEU A HD13 5  
ATOM 6537  H HD21 . LEU A 1 13  ? -3.194  9.586   9.993   1.00 0.00 ? 13  LEU A HD21 5  
ATOM 6538  H HD22 . LEU A 1 13  ? -4.070  8.888   8.630   1.00 0.00 ? 13  LEU A HD22 5  
ATOM 6539  H HD23 . LEU A 1 13  ? -4.295  10.588  9.046   1.00 0.00 ? 13  LEU A HD23 5  
ATOM 6540  N N    . CYS A 1 14  ? -0.048  7.619   10.697  1.00 0.00 ? 14  CYS A N    5  
ATOM 6541  C CA   . CYS A 1 14  ? 0.692   6.460   11.184  1.00 0.00 ? 14  CYS A CA   5  
ATOM 6542  C C    . CYS A 1 14  ? -0.161  5.198   11.106  1.00 0.00 ? 14  CYS A C    5  
ATOM 6543  O O    . CYS A 1 14  ? -1.389  5.263   11.159  1.00 0.00 ? 14  CYS A O    5  
ATOM 6544  C CB   . CYS A 1 14  ? 1.153   6.691   12.624  1.00 0.00 ? 14  CYS A CB   5  
ATOM 6545  S SG   . CYS A 1 14  ? -0.190  7.052   13.779  1.00 0.00 ? 14  CYS A SG   5  
ATOM 6546  H H    . CYS A 1 14  ? -1.007  7.689   10.890  1.00 0.00 ? 14  CYS A H    5  
ATOM 6547  H HA   . CYS A 1 14  ? 1.559   6.333   10.553  1.00 0.00 ? 14  CYS A HA   5  
ATOM 6548  H HB2  . CYS A 1 14  ? 1.661   5.806   12.978  1.00 0.00 ? 14  CYS A HB2  5  
ATOM 6549  H HB3  . CYS A 1 14  ? 1.840   7.525   12.644  1.00 0.00 ? 14  CYS A HB3  5  
ATOM 6550  H HG   . CYS A 1 14  ? -0.755  8.190   13.406  1.00 0.00 ? 14  CYS A HG   5  
ATOM 6551  N N    . ILE A 1 15  ? 0.499   4.052   10.980  1.00 0.00 ? 15  ILE A N    5  
ATOM 6552  C CA   . ILE A 1 15  ? -0.199  2.775   10.894  1.00 0.00 ? 15  ILE A CA   5  
ATOM 6553  C C    . ILE A 1 15  ? 0.242   1.832   12.008  1.00 0.00 ? 15  ILE A C    5  
ATOM 6554  O O    . ILE A 1 15  ? 1.421   1.497   12.120  1.00 0.00 ? 15  ILE A O    5  
ATOM 6555  C CB   . ILE A 1 15  ? 0.040   2.093   9.534   1.00 0.00 ? 15  ILE A CB   5  
ATOM 6556  C CG1  . ILE A 1 15  ? -0.427  3.001   8.394   1.00 0.00 ? 15  ILE A CG1  5  
ATOM 6557  C CG2  . ILE A 1 15  ? -0.679  0.753   9.480   1.00 0.00 ? 15  ILE A CG2  5  
ATOM 6558  C CD1  . ILE A 1 15  ? -0.224  2.400   7.021   1.00 0.00 ? 15  ILE A CD1  5  
ATOM 6559  H H    . ILE A 1 15  ? 1.478   4.065   10.943  1.00 0.00 ? 15  ILE A H    5  
ATOM 6560  H HA   . ILE A 1 15  ? -1.258  2.967   10.997  1.00 0.00 ? 15  ILE A HA   5  
ATOM 6561  H HB   . ILE A 1 15  ? 1.098   1.910   9.429   1.00 0.00 ? 15  ILE A HB   5  
ATOM 6562  H HG12 . ILE A 1 15  ? -1.479  3.205   8.514   1.00 0.00 ? 15  ILE A HG12 5  
ATOM 6563  H HG13 . ILE A 1 15  ? 0.123   3.929   8.436   1.00 0.00 ? 15  ILE A HG13 5  
ATOM 6564  H HG21 . ILE A 1 15  ? -1.714  0.911   9.213   1.00 0.00 ? 15  ILE A HG21 5  
ATOM 6565  H HG22 . ILE A 1 15  ? -0.210  0.123   8.740   1.00 0.00 ? 15  ILE A HG22 5  
ATOM 6566  H HG23 . ILE A 1 15  ? -0.625  0.276   10.447  1.00 0.00 ? 15  ILE A HG23 5  
ATOM 6567  H HD11 . ILE A 1 15  ? 0.441   3.028   6.448   1.00 0.00 ? 15  ILE A HD11 5  
ATOM 6568  H HD12 . ILE A 1 15  ? 0.206   1.414   7.119   1.00 0.00 ? 15  ILE A HD12 5  
ATOM 6569  H HD13 . ILE A 1 15  ? -1.176  2.329   6.515   1.00 0.00 ? 15  ILE A HD13 5  
ATOM 6570  N N    . GLN A 1 16  ? -0.713  1.405   12.827  1.00 0.00 ? 16  GLN A N    5  
ATOM 6571  C CA   . GLN A 1 16  ? -0.423  0.498   13.932  1.00 0.00 ? 16  GLN A CA   5  
ATOM 6572  C C    . GLN A 1 16  ? -0.623  -0.954  13.512  1.00 0.00 ? 16  GLN A C    5  
ATOM 6573  O O    . GLN A 1 16  ? -1.749  -1.396  13.283  1.00 0.00 ? 16  GLN A O    5  
ATOM 6574  C CB   . GLN A 1 16  ? -1.314  0.822   15.133  1.00 0.00 ? 16  GLN A CB   5  
ATOM 6575  C CG   . GLN A 1 16  ? -0.722  1.864   16.067  1.00 0.00 ? 16  GLN A CG   5  
ATOM 6576  C CD   . GLN A 1 16  ? -1.126  3.277   15.696  1.00 0.00 ? 16  GLN A CD   5  
ATOM 6577  O OE1  . GLN A 1 16  ? -1.951  3.486   14.806  1.00 0.00 ? 16  GLN A OE1  5  
ATOM 6578  N NE2  . GLN A 1 16  ? -0.547  4.258   16.379  1.00 0.00 ? 16  GLN A NE2  5  
ATOM 6579  H H    . GLN A 1 16  ? -1.634  1.707   12.686  1.00 0.00 ? 16  GLN A H    5  
ATOM 6580  H HA   . GLN A 1 16  ? 0.610   0.640   14.214  1.00 0.00 ? 16  GLN A HA   5  
ATOM 6581  H HB2  . GLN A 1 16  ? -2.263  1.189   14.773  1.00 0.00 ? 16  GLN A HB2  5  
ATOM 6582  H HB3  . GLN A 1 16  ? -1.479  -0.084  15.698  1.00 0.00 ? 16  GLN A HB3  5  
ATOM 6583  H HG2  . GLN A 1 16  ? -1.060  1.662   17.072  1.00 0.00 ? 16  GLN A HG2  5  
ATOM 6584  H HG3  . GLN A 1 16  ? 0.355   1.792   16.029  1.00 0.00 ? 16  GLN A HG3  5  
ATOM 6585  H HE21 . GLN A 1 16  ? 0.102   4.017   17.074  1.00 0.00 ? 16  GLN A HE21 5  
ATOM 6586  H HE22 . GLN A 1 16  ? -0.789  5.181   16.160  1.00 0.00 ? 16  GLN A HE22 5  
ATOM 6587  N N    . LYS A 1 17  ? 0.477   -1.692  13.411  1.00 0.00 ? 17  LYS A N    5  
ATOM 6588  C CA   . LYS A 1 17  ? 0.424   -3.096  13.019  1.00 0.00 ? 17  LYS A CA   5  
ATOM 6589  C C    . LYS A 1 17  ? 1.094   -3.979  14.067  1.00 0.00 ? 17  LYS A C    5  
ATOM 6590  O O    . LYS A 1 17  ? 1.594   -3.488  15.078  1.00 0.00 ? 17  LYS A O    5  
ATOM 6591  C CB   . LYS A 1 17  ? 1.102   -3.293  11.661  1.00 0.00 ? 17  LYS A CB   5  
ATOM 6592  C CG   . LYS A 1 17  ? 2.597   -3.543  11.759  1.00 0.00 ? 17  LYS A CG   5  
ATOM 6593  C CD   . LYS A 1 17  ? 3.318   -3.114  10.491  1.00 0.00 ? 17  LYS A CD   5  
ATOM 6594  C CE   . LYS A 1 17  ? 3.464   -1.602  10.418  1.00 0.00 ? 17  LYS A CE   5  
ATOM 6595  N NZ   . LYS A 1 17  ? 2.246   -0.953  9.859   1.00 0.00 ? 17  LYS A NZ   5  
ATOM 6596  H H    . LYS A 1 17  ? 1.347   -1.283  13.607  1.00 0.00 ? 17  LYS A H    5  
ATOM 6597  H HA   . LYS A 1 17  ? -0.614  -3.378  12.938  1.00 0.00 ? 17  LYS A HA   5  
ATOM 6598  H HB2  . LYS A 1 17  ? 0.649   -4.139  11.166  1.00 0.00 ? 17  LYS A HB2  5  
ATOM 6599  H HB3  . LYS A 1 17  ? 0.945   -2.408  11.062  1.00 0.00 ? 17  LYS A HB3  5  
ATOM 6600  H HG2  . LYS A 1 17  ? 2.994   -2.982  12.592  1.00 0.00 ? 17  LYS A HG2  5  
ATOM 6601  H HG3  . LYS A 1 17  ? 2.767   -4.598  11.919  1.00 0.00 ? 17  LYS A HG3  5  
ATOM 6602  H HD2  . LYS A 1 17  ? 4.301   -3.560  10.478  1.00 0.00 ? 17  LYS A HD2  5  
ATOM 6603  H HD3  . LYS A 1 17  ? 2.754   -3.455  9.634   1.00 0.00 ? 17  LYS A HD3  5  
ATOM 6604  H HE2  . LYS A 1 17  ? 3.640   -1.221  11.412  1.00 0.00 ? 17  LYS A HE2  5  
ATOM 6605  H HE3  . LYS A 1 17  ? 4.309   -1.365  9.787   1.00 0.00 ? 17  LYS A HE3  5  
ATOM 6606  H HZ1  . LYS A 1 17  ? 1.641   -0.604  10.630  1.00 0.00 ? 17  LYS A HZ1  5  
ATOM 6607  H HZ2  . LYS A 1 17  ? 1.704   -1.637  9.293   1.00 0.00 ? 17  LYS A HZ2  5  
ATOM 6608  H HZ3  . LYS A 1 17  ? 2.513   -0.152  9.252   1.00 0.00 ? 17  LYS A HZ3  5  
ATOM 6609  N N    . ALA A 1 18  ? 1.101   -5.284  13.817  1.00 0.00 ? 18  ALA A N    5  
ATOM 6610  C CA   . ALA A 1 18  ? 1.712   -6.235  14.737  1.00 0.00 ? 18  ALA A CA   5  
ATOM 6611  C C    . ALA A 1 18  ? 3.192   -5.927  14.942  1.00 0.00 ? 18  ALA A C    5  
ATOM 6612  O O    . ALA A 1 18  ? 3.797   -5.150  14.203  1.00 0.00 ? 18  ALA A O    5  
ATOM 6613  C CB   . ALA A 1 18  ? 1.534   -7.656  14.223  1.00 0.00 ? 18  ALA A CB   5  
ATOM 6614  H H    . ALA A 1 18  ? 0.686   -5.615  12.993  1.00 0.00 ? 18  ALA A H    5  
ATOM 6615  H HA   . ALA A 1 18  ? 1.203   -6.155  15.687  1.00 0.00 ? 18  ALA A HA   5  
ATOM 6616  H HB1  . ALA A 1 18  ? 1.083   -8.263  14.995  1.00 0.00 ? 18  ALA A HB1  5  
ATOM 6617  H HB2  . ALA A 1 18  ? 0.895   -7.646  13.353  1.00 0.00 ? 18  ALA A HB2  5  
ATOM 6618  H HB3  . ALA A 1 18  ? 2.497   -8.067  13.959  1.00 0.00 ? 18  ALA A HB3  5  
ATOM 6619  N N    . PRO A 1 19  ? 3.789   -6.548  15.970  1.00 0.00 ? 19  PRO A N    5  
ATOM 6620  C CA   . PRO A 1 19  ? 5.205   -6.355  16.296  1.00 0.00 ? 19  PRO A CA   5  
ATOM 6621  C C    . PRO A 1 19  ? 6.130   -6.976  15.255  1.00 0.00 ? 19  PRO A C    5  
ATOM 6622  O O    . PRO A 1 19  ? 7.352   -6.902  15.374  1.00 0.00 ? 19  PRO A O    5  
ATOM 6623  C CB   . PRO A 1 19  ? 5.359   -7.067  17.642  1.00 0.00 ? 19  PRO A CB   5  
ATOM 6624  C CG   . PRO A 1 19  ? 4.275   -8.089  17.657  1.00 0.00 ? 19  PRO A CG   5  
ATOM 6625  C CD   . PRO A 1 19  ? 3.129   -7.487  16.892  1.00 0.00 ? 19  PRO A CD   5  
ATOM 6626  H HA   . PRO A 1 19  ? 5.447   -5.308  16.411  1.00 0.00 ? 19  PRO A HA   5  
ATOM 6627  H HB2  . PRO A 1 19  ? 6.337   -7.526  17.700  1.00 0.00 ? 19  PRO A HB2  5  
ATOM 6628  H HB3  . PRO A 1 19  ? 5.242   -6.356  18.446  1.00 0.00 ? 19  PRO A HB3  5  
ATOM 6629  H HG2  . PRO A 1 19  ? 4.615   -8.992  17.173  1.00 0.00 ? 19  PRO A HG2  5  
ATOM 6630  H HG3  . PRO A 1 19  ? 3.979   -8.295  18.675  1.00 0.00 ? 19  PRO A HG3  5  
ATOM 6631  H HD2  . PRO A 1 19  ? 2.595   -8.251  16.348  1.00 0.00 ? 19  PRO A HD2  5  
ATOM 6632  H HD3  . PRO A 1 19  ? 2.462   -6.963  17.562  1.00 0.00 ? 19  PRO A HD3  5  
ATOM 6633  N N    . GLY A 1 20  ? 5.538   -7.590  14.235  1.00 0.00 ? 20  GLY A N    5  
ATOM 6634  C CA   . GLY A 1 20  ? 6.324   -8.215  13.188  1.00 0.00 ? 20  GLY A CA   5  
ATOM 6635  C C    . GLY A 1 20  ? 5.502   -8.525  11.953  1.00 0.00 ? 20  GLY A C    5  
ATOM 6636  O O    . GLY A 1 20  ? 5.796   -9.474  11.226  1.00 0.00 ? 20  GLY A O    5  
ATOM 6637  H H    . GLY A 1 20  ? 4.559   -7.618  14.193  1.00 0.00 ? 20  GLY A H    5  
ATOM 6638  H HA2  . GLY A 1 20  ? 7.131   -7.552  12.914  1.00 0.00 ? 20  GLY A HA2  5  
ATOM 6639  H HA3  . GLY A 1 20  ? 6.742   -9.136  13.568  1.00 0.00 ? 20  GLY A HA3  5  
ATOM 6640  N N    . GLU A 1 21  ? 4.469   -7.724  11.715  1.00 0.00 ? 21  GLU A N    5  
ATOM 6641  C CA   . GLU A 1 21  ? 3.601   -7.920  10.559  1.00 0.00 ? 21  GLU A CA   5  
ATOM 6642  C C    . GLU A 1 21  ? 4.056   -7.060  9.384   1.00 0.00 ? 21  GLU A C    5  
ATOM 6643  O O    . GLU A 1 21  ? 4.460   -5.911  9.562   1.00 0.00 ? 21  GLU A O    5  
ATOM 6644  C CB   . GLU A 1 21  ? 2.152   -7.586  10.920  1.00 0.00 ? 21  GLU A CB   5  
ATOM 6645  C CG   . GLU A 1 21  ? 1.194   -7.686  9.744   1.00 0.00 ? 21  GLU A CG   5  
ATOM 6646  C CD   . GLU A 1 21  ? 0.999   -9.113  9.270   1.00 0.00 ? 21  GLU A CD   5  
ATOM 6647  O OE1  . GLU A 1 21  ? 1.418   -10.041 9.993   1.00 0.00 ? 21  GLU A OE1  5  
ATOM 6648  O OE2  . GLU A 1 21  ? 0.427   -9.301  8.176   1.00 0.00 ? 21  GLU A OE2  5  
ATOM 6649  H H    . GLU A 1 21  ? 4.285   -6.984  12.330  1.00 0.00 ? 21  GLU A H    5  
ATOM 6650  H HA   . GLU A 1 21  ? 3.660   -8.959  10.273  1.00 0.00 ? 21  GLU A HA   5  
ATOM 6651  H HB2  . GLU A 1 21  ? 1.818   -8.266  11.689  1.00 0.00 ? 21  GLU A HB2  5  
ATOM 6652  H HB3  . GLU A 1 21  ? 2.113   -6.577  11.303  1.00 0.00 ? 21  GLU A HB3  5  
ATOM 6653  H HG2  . GLU A 1 21  ? 0.235   -7.288  10.043  1.00 0.00 ? 21  GLU A HG2  5  
ATOM 6654  H HG3  . GLU A 1 21  ? 1.586   -7.100  8.926   1.00 0.00 ? 21  GLU A HG3  5  
ATOM 6655  N N    . ARG A 1 22  ? 3.988   -7.625  8.183   1.00 0.00 ? 22  ARG A N    5  
ATOM 6656  C CA   . ARG A 1 22  ? 4.394   -6.912  6.979   1.00 0.00 ? 22  ARG A CA   5  
ATOM 6657  C C    . ARG A 1 22  ? 3.267   -6.017  6.471   1.00 0.00 ? 22  ARG A C    5  
ATOM 6658  O O    . ARG A 1 22  ? 2.176   -6.493  6.156   1.00 0.00 ? 22  ARG A O    5  
ATOM 6659  C CB   . ARG A 1 22  ? 4.805   -7.902  5.888   1.00 0.00 ? 22  ARG A CB   5  
ATOM 6660  C CG   . ARG A 1 22  ? 3.711   -8.891  5.519   1.00 0.00 ? 22  ARG A CG   5  
ATOM 6661  C CD   . ARG A 1 22  ? 4.291   -10.228 5.085   1.00 0.00 ? 22  ARG A CD   5  
ATOM 6662  N NE   . ARG A 1 22  ? 3.359   -11.329 5.311   1.00 0.00 ? 22  ARG A NE   5  
ATOM 6663  C CZ   . ARG A 1 22  ? 3.180   -11.909 6.493   1.00 0.00 ? 22  ARG A CZ   5  
ATOM 6664  N NH1  . ARG A 1 22  ? 3.867   -11.496 7.549   1.00 0.00 ? 22  ARG A NH1  5  
ATOM 6665  N NH2  . ARG A 1 22  ? 2.313   -12.906 6.619   1.00 0.00 ? 22  ARG A NH2  5  
ATOM 6666  H H    . ARG A 1 22  ? 3.656   -8.544  8.105   1.00 0.00 ? 22  ARG A H    5  
ATOM 6667  H HA   . ARG A 1 22  ? 5.243   -6.294  7.230   1.00 0.00 ? 22  ARG A HA   5  
ATOM 6668  H HB2  . ARG A 1 22  ? 5.074   -7.350  4.999   1.00 0.00 ? 22  ARG A HB2  5  
ATOM 6669  H HB3  . ARG A 1 22  ? 5.664   -8.459  6.230   1.00 0.00 ? 22  ARG A HB3  5  
ATOM 6670  H HG2  . ARG A 1 22  ? 3.077   -9.049  6.379   1.00 0.00 ? 22  ARG A HG2  5  
ATOM 6671  H HG3  . ARG A 1 22  ? 3.127   -8.481  4.709   1.00 0.00 ? 22  ARG A HG3  5  
ATOM 6672  H HD2  . ARG A 1 22  ? 4.526   -10.178 4.032   1.00 0.00 ? 22  ARG A HD2  5  
ATOM 6673  H HD3  . ARG A 1 22  ? 5.195   -10.412 5.647   1.00 0.00 ? 22  ARG A HD3  5  
ATOM 6674  H HE   . ARG A 1 22  ? 2.842   -11.650 4.544   1.00 0.00 ? 22  ARG A HE   5  
ATOM 6675  H HH11 . ARG A 1 22  ? 4.520   -10.745 7.457   1.00 0.00 ? 22  ARG A HH11 5  
ATOM 6676  H HH12 . ARG A 1 22  ? 3.730   -11.934 8.438   1.00 0.00 ? 22  ARG A HH12 5  
ATOM 6677  H HH21 . ARG A 1 22  ? 1.794   -13.220 5.825   1.00 0.00 ? 22  ARG A HH21 5  
ATOM 6678  H HH22 . ARG A 1 22  ? 2.180   -13.342 7.508   1.00 0.00 ? 22  ARG A HH22 5  
ATOM 6679  N N    . LEU A 1 23  ? 3.539   -4.719  6.393   1.00 0.00 ? 23  LEU A N    5  
ATOM 6680  C CA   . LEU A 1 23  ? 2.549   -3.757  5.923   1.00 0.00 ? 23  LEU A CA   5  
ATOM 6681  C C    . LEU A 1 23  ? 1.659   -4.372  4.847   1.00 0.00 ? 23  LEU A C    5  
ATOM 6682  O O    . LEU A 1 23  ? 0.434   -4.282  4.913   1.00 0.00 ? 23  LEU A O    5  
ATOM 6683  C CB   . LEU A 1 23  ? 3.241   -2.508  5.375   1.00 0.00 ? 23  LEU A CB   5  
ATOM 6684  C CG   . LEU A 1 23  ? 2.503   -1.185  5.583   1.00 0.00 ? 23  LEU A CG   5  
ATOM 6685  C CD1  . LEU A 1 23  ? 1.050   -1.312  5.152   1.00 0.00 ? 23  LEU A CD1  5  
ATOM 6686  C CD2  . LEU A 1 23  ? 2.594   -0.745  7.037   1.00 0.00 ? 23  LEU A CD2  5  
ATOM 6687  H H    . LEU A 1 23  ? 4.427   -4.399  6.657   1.00 0.00 ? 23  LEU A H    5  
ATOM 6688  H HA   . LEU A 1 23  ? 1.933   -3.477  6.765   1.00 0.00 ? 23  LEU A HA   5  
ATOM 6689  H HB2  . LEU A 1 23  ? 4.205   -2.427  5.855   1.00 0.00 ? 23  LEU A HB2  5  
ATOM 6690  H HB3  . LEU A 1 23  ? 3.381   -2.647  4.313   1.00 0.00 ? 23  LEU A HB3  5  
ATOM 6691  H HG   . LEU A 1 23  ? 2.965   -0.422  4.972   1.00 0.00 ? 23  LEU A HG   5  
ATOM 6692  H HD11 . LEU A 1 23  ? 0.756   -0.426  4.610   1.00 0.00 ? 23  LEU A HD11 5  
ATOM 6693  H HD12 . LEU A 1 23  ? 0.424   -1.423  6.026   1.00 0.00 ? 23  LEU A HD12 5  
ATOM 6694  H HD13 . LEU A 1 23  ? 0.937   -2.178  4.517   1.00 0.00 ? 23  LEU A HD13 5  
ATOM 6695  H HD21 . LEU A 1 23  ? 2.682   -1.615  7.670   1.00 0.00 ? 23  LEU A HD21 5  
ATOM 6696  H HD22 . LEU A 1 23  ? 1.703   -0.195  7.303   1.00 0.00 ? 23  LEU A HD22 5  
ATOM 6697  H HD23 . LEU A 1 23  ? 3.460   -0.114  7.168   1.00 0.00 ? 23  LEU A HD23 5  
ATOM 6698  N N    . GLY A 1 24  ? 2.286   -4.999  3.856   1.00 0.00 ? 24  GLY A N    5  
ATOM 6699  C CA   . GLY A 1 24  ? 1.536   -5.622  2.781   1.00 0.00 ? 24  GLY A CA   5  
ATOM 6700  C C    . GLY A 1 24  ? 0.998   -4.611  1.788   1.00 0.00 ? 24  GLY A C    5  
ATOM 6701  O O    . GLY A 1 24  ? -0.146  -4.716  1.343   1.00 0.00 ? 24  GLY A O    5  
ATOM 6702  H H    . GLY A 1 24  ? 3.265   -5.039  3.855   1.00 0.00 ? 24  GLY A H    5  
ATOM 6703  H HA2  . GLY A 1 24  ? 2.181   -6.314  2.261   1.00 0.00 ? 24  GLY A HA2  5  
ATOM 6704  H HA3  . GLY A 1 24  ? 0.707   -6.168  3.206   1.00 0.00 ? 24  GLY A HA3  5  
ATOM 6705  N N    . ILE A 1 25  ? 1.822   -3.628  1.441   1.00 0.00 ? 25  ILE A N    5  
ATOM 6706  C CA   . ILE A 1 25  ? 1.422   -2.594  0.495   1.00 0.00 ? 25  ILE A CA   5  
ATOM 6707  C C    . ILE A 1 25  ? 2.353   -2.563  -0.712  1.00 0.00 ? 25  ILE A C    5  
ATOM 6708  O O    . ILE A 1 25  ? 3.446   -3.128  -0.681  1.00 0.00 ? 25  ILE A O    5  
ATOM 6709  C CB   . ILE A 1 25  ? 1.408   -1.203  1.154   1.00 0.00 ? 25  ILE A CB   5  
ATOM 6710  C CG1  . ILE A 1 25  ? 2.579   -1.065  2.130   1.00 0.00 ? 25  ILE A CG1  5  
ATOM 6711  C CG2  . ILE A 1 25  ? 0.085   -0.969  1.869   1.00 0.00 ? 25  ILE A CG2  5  
ATOM 6712  C CD1  . ILE A 1 25  ? 3.055   0.360   2.304   1.00 0.00 ? 25  ILE A CD1  5  
ATOM 6713  H H    . ILE A 1 25  ? 2.721   -3.599  1.830   1.00 0.00 ? 25  ILE A H    5  
ATOM 6714  H HA   . ILE A 1 25  ? 0.420   -2.821  0.158   1.00 0.00 ? 25  ILE A HA   5  
ATOM 6715  H HB   . ILE A 1 25  ? 1.506   -0.460  0.378   1.00 0.00 ? 25  ILE A HB   5  
ATOM 6716  H HG12 . ILE A 1 25  ? 2.279   -1.434  3.098   1.00 0.00 ? 25  ILE A HG12 5  
ATOM 6717  H HG13 . ILE A 1 25  ? 3.410   -1.652  1.767   1.00 0.00 ? 25  ILE A HG13 5  
ATOM 6718  H HG21 . ILE A 1 25  ? -0.699  -1.508  1.360   1.00 0.00 ? 25  ILE A HG21 5  
ATOM 6719  H HG22 . ILE A 1 25  ? 0.160   -1.320  2.887   1.00 0.00 ? 25  ILE A HG22 5  
ATOM 6720  H HG23 . ILE A 1 25  ? -0.143  0.086   1.868   1.00 0.00 ? 25  ILE A HG23 5  
ATOM 6721  H HD11 . ILE A 1 25  ? 3.904   0.377   2.972   1.00 0.00 ? 25  ILE A HD11 5  
ATOM 6722  H HD12 . ILE A 1 25  ? 3.342   0.764   1.345   1.00 0.00 ? 25  ILE A HD12 5  
ATOM 6723  H HD13 . ILE A 1 25  ? 2.258   0.957   2.723   1.00 0.00 ? 25  ILE A HD13 5  
ATOM 6724  N N    . SER A 1 26  ? 1.913   -1.897  -1.775  1.00 0.00 ? 26  SER A N    5  
ATOM 6725  C CA   . SER A 1 26  ? 2.707   -1.794  -2.994  1.00 0.00 ? 26  SER A CA   5  
ATOM 6726  C C    . SER A 1 26  ? 2.825   -0.340  -3.443  1.00 0.00 ? 26  SER A C    5  
ATOM 6727  O O    . SER A 1 26  ? 1.937   0.474   -3.189  1.00 0.00 ? 26  SER A O    5  
ATOM 6728  C CB   . SER A 1 26  ? 2.080   -2.634  -4.109  1.00 0.00 ? 26  SER A CB   5  
ATOM 6729  O OG   . SER A 1 26  ? 3.074   -3.163  -4.968  1.00 0.00 ? 26  SER A OG   5  
ATOM 6730  H H    . SER A 1 26  ? 1.033   -1.468  -1.739  1.00 0.00 ? 26  SER A H    5  
ATOM 6731  H HA   . SER A 1 26  ? 3.694   -2.174  -2.780  1.00 0.00 ? 26  SER A HA   5  
ATOM 6732  H HB2  . SER A 1 26  ? 1.527   -3.451  -3.672  1.00 0.00 ? 26  SER A HB2  5  
ATOM 6733  H HB3  . SER A 1 26  ? 1.411   -2.015  -4.689  1.00 0.00 ? 26  SER A HB3  5  
ATOM 6734  H HG   . SER A 1 26  ? 3.104   -2.649  -5.778  1.00 0.00 ? 26  SER A HG   5  
ATOM 6735  N N    . ILE A 1 27  ? 3.928   -0.022  -4.112  1.00 0.00 ? 27  ILE A N    5  
ATOM 6736  C CA   . ILE A 1 27  ? 4.163   1.332   -4.597  1.00 0.00 ? 27  ILE A CA   5  
ATOM 6737  C C    . ILE A 1 27  ? 4.797   1.316   -5.984  1.00 0.00 ? 27  ILE A C    5  
ATOM 6738  O O    . ILE A 1 27  ? 5.539   0.396   -6.329  1.00 0.00 ? 27  ILE A O    5  
ATOM 6739  C CB   . ILE A 1 27  ? 5.072   2.123   -3.639  1.00 0.00 ? 27  ILE A CB   5  
ATOM 6740  C CG1  . ILE A 1 27  ? 6.486   1.537   -3.640  1.00 0.00 ? 27  ILE A CG1  5  
ATOM 6741  C CG2  . ILE A 1 27  ? 4.492   2.118   -2.233  1.00 0.00 ? 27  ILE A CG2  5  
ATOM 6742  C CD1  . ILE A 1 27  ? 7.463   2.314   -2.787  1.00 0.00 ? 27  ILE A CD1  5  
ATOM 6743  H H    . ILE A 1 27  ? 4.600   -0.715  -4.284  1.00 0.00 ? 27  ILE A H    5  
ATOM 6744  H HA   . ILE A 1 27  ? 3.209   1.835   -4.655  1.00 0.00 ? 27  ILE A HA   5  
ATOM 6745  H HB   . ILE A 1 27  ? 5.115   3.146   -3.981  1.00 0.00 ? 27  ILE A HB   5  
ATOM 6746  H HG12 . ILE A 1 27  ? 6.449   0.526   -3.264  1.00 0.00 ? 27  ILE A HG12 5  
ATOM 6747  H HG13 . ILE A 1 27  ? 6.862   1.526   -4.653  1.00 0.00 ? 27  ILE A HG13 5  
ATOM 6748  H HG21 . ILE A 1 27  ? 3.615   1.488   -2.208  1.00 0.00 ? 27  ILE A HG21 5  
ATOM 6749  H HG22 . ILE A 1 27  ? 5.228   1.736   -1.541  1.00 0.00 ? 27  ILE A HG22 5  
ATOM 6750  H HG23 . ILE A 1 27  ? 4.220   3.124   -1.951  1.00 0.00 ? 27  ILE A HG23 5  
ATOM 6751  H HD11 . ILE A 1 27  ? 8.340   2.553   -3.371  1.00 0.00 ? 27  ILE A HD11 5  
ATOM 6752  H HD12 . ILE A 1 27  ? 6.998   3.226   -2.446  1.00 0.00 ? 27  ILE A HD12 5  
ATOM 6753  H HD13 . ILE A 1 27  ? 7.752   1.717   -1.935  1.00 0.00 ? 27  ILE A HD13 5  
ATOM 6754  N N    . ARG A 1 28  ? 4.501   2.342   -6.776  1.00 0.00 ? 28  ARG A N    5  
ATOM 6755  C CA   . ARG A 1 28  ? 5.042   2.447   -8.125  1.00 0.00 ? 28  ARG A CA   5  
ATOM 6756  C C    . ARG A 1 28  ? 5.761   3.778   -8.321  1.00 0.00 ? 28  ARG A C    5  
ATOM 6757  O O    . ARG A 1 28  ? 5.178   4.844   -8.130  1.00 0.00 ? 28  ARG A O    5  
ATOM 6758  C CB   . ARG A 1 28  ? 3.923   2.303   -9.159  1.00 0.00 ? 28  ARG A CB   5  
ATOM 6759  C CG   . ARG A 1 28  ? 2.919   3.445   -9.132  1.00 0.00 ? 28  ARG A CG   5  
ATOM 6760  C CD   . ARG A 1 28  ? 1.800   3.226   -10.138 1.00 0.00 ? 28  ARG A CD   5  
ATOM 6761  N NE   . ARG A 1 28  ? 0.666   4.114   -9.896  1.00 0.00 ? 28  ARG A NE   5  
ATOM 6762  C CZ   . ARG A 1 28  ? -0.435  4.119   -10.640 1.00 0.00 ? 28  ARG A CZ   5  
ATOM 6763  N NH1  . ARG A 1 28  ? -0.550  3.287   -11.666 1.00 0.00 ? 28  ARG A NH1  5  
ATOM 6764  N NH2  . ARG A 1 28  ? -1.424  4.957   -10.357 1.00 0.00 ? 28  ARG A NH2  5  
ATOM 6765  H H    . ARG A 1 28  ? 3.903   3.045   -6.444  1.00 0.00 ? 28  ARG A H    5  
ATOM 6766  H HA   . ARG A 1 28  ? 5.751   1.644   -8.262  1.00 0.00 ? 28  ARG A HA   5  
ATOM 6767  H HB2  . ARG A 1 28  ? 4.362   2.263   -10.145 1.00 0.00 ? 28  ARG A HB2  5  
ATOM 6768  H HB3  . ARG A 1 28  ? 3.392   1.382   -8.972  1.00 0.00 ? 28  ARG A HB3  5  
ATOM 6769  H HG2  . ARG A 1 28  ? 2.491   3.513   -8.143  1.00 0.00 ? 28  ARG A HG2  5  
ATOM 6770  H HG3  . ARG A 1 28  ? 3.430   4.366   -9.370  1.00 0.00 ? 28  ARG A HG3  5  
ATOM 6771  H HD2  . ARG A 1 28  ? 2.184   3.410   -11.130 1.00 0.00 ? 28  ARG A HD2  5  
ATOM 6772  H HD3  . ARG A 1 28  ? 1.465   2.202   -10.066 1.00 0.00 ? 28  ARG A HD3  5  
ATOM 6773  H HE   . ARG A 1 28  ? 0.729   4.737   -9.143  1.00 0.00 ? 28  ARG A HE   5  
ATOM 6774  H HH11 . ARG A 1 28  ? 0.194   2.654   -11.881 1.00 0.00 ? 28  ARG A HH11 5  
ATOM 6775  H HH12 . ARG A 1 28  ? -1.380  3.292   -12.224 1.00 0.00 ? 28  ARG A HH12 5  
ATOM 6776  H HH21 . ARG A 1 28  ? -1.342  5.585   -9.584  1.00 0.00 ? 28  ARG A HH21 5  
ATOM 6777  H HH22 . ARG A 1 28  ? -2.252  4.960   -10.917 1.00 0.00 ? 28  ARG A HH22 5  
ATOM 6778  N N    . GLY A 1 29  ? 7.033   3.707   -8.701  1.00 0.00 ? 29  GLY A N    5  
ATOM 6779  C CA   . GLY A 1 29  ? 7.812   4.913   -8.915  1.00 0.00 ? 29  GLY A CA   5  
ATOM 6780  C C    . GLY A 1 29  ? 9.300   4.680   -8.745  1.00 0.00 ? 29  GLY A C    5  
ATOM 6781  O O    . GLY A 1 29  ? 9.822   3.638   -9.140  1.00 0.00 ? 29  GLY A O    5  
ATOM 6782  H H    . GLY A 1 29  ? 7.447   2.829   -8.838  1.00 0.00 ? 29  GLY A H    5  
ATOM 6783  H HA2  . GLY A 1 29  ? 7.627   5.275   -9.915  1.00 0.00 ? 29  GLY A HA2  5  
ATOM 6784  H HA3  . GLY A 1 29  ? 7.494   5.663   -8.206  1.00 0.00 ? 29  GLY A HA3  5  
ATOM 6785  N N    . GLY A 1 30  ? 9.987   5.654   -8.157  1.00 0.00 ? 30  GLY A N    5  
ATOM 6786  C CA   . GLY A 1 30  ? 11.418  5.531   -7.948  1.00 0.00 ? 30  GLY A CA   5  
ATOM 6787  C C    . GLY A 1 30  ? 12.203  6.616   -8.659  1.00 0.00 ? 30  GLY A C    5  
ATOM 6788  O O    . GLY A 1 30  ? 11.956  6.904   -9.830  1.00 0.00 ? 30  GLY A O    5  
ATOM 6789  H H    . GLY A 1 30  ? 9.519   6.463   -7.862  1.00 0.00 ? 30  GLY A H    5  
ATOM 6790  H HA2  . GLY A 1 30  ? 11.623  5.589   -6.890  1.00 0.00 ? 30  GLY A HA2  5  
ATOM 6791  H HA3  . GLY A 1 30  ? 11.743  4.569   -8.316  1.00 0.00 ? 30  GLY A HA3  5  
ATOM 6792  N N    . ALA A 1 31  ? 13.150  7.221   -7.950  1.00 0.00 ? 31  ALA A N    5  
ATOM 6793  C CA   . ALA A 1 31  ? 13.974  8.279   -8.520  1.00 0.00 ? 31  ALA A CA   5  
ATOM 6794  C C    . ALA A 1 31  ? 14.949  7.721   -9.551  1.00 0.00 ? 31  ALA A C    5  
ATOM 6795  O O    . ALA A 1 31  ? 15.875  6.985   -9.208  1.00 0.00 ? 31  ALA A O    5  
ATOM 6796  C CB   . ALA A 1 31  ? 14.727  9.013   -7.420  1.00 0.00 ? 31  ALA A CB   5  
ATOM 6797  H H    . ALA A 1 31  ? 13.300  6.947   -7.021  1.00 0.00 ? 31  ALA A H    5  
ATOM 6798  H HA   . ALA A 1 31  ? 13.318  8.987   -9.007  1.00 0.00 ? 31  ALA A HA   5  
ATOM 6799  H HB1  . ALA A 1 31  ? 15.157  8.293   -6.738  1.00 0.00 ? 31  ALA A HB1  5  
ATOM 6800  H HB2  . ALA A 1 31  ? 15.514  9.609   -7.859  1.00 0.00 ? 31  ALA A HB2  5  
ATOM 6801  H HB3  . ALA A 1 31  ? 14.045  9.655   -6.883  1.00 0.00 ? 31  ALA A HB3  5  
ATOM 6802  N N    . ARG A 1 32  ? 14.735  8.075   -10.814 1.00 0.00 ? 32  ARG A N    5  
ATOM 6803  C CA   . ARG A 1 32  ? 15.595  7.607   -11.894 1.00 0.00 ? 32  ARG A CA   5  
ATOM 6804  C C    . ARG A 1 32  ? 15.393  6.115   -12.143 1.00 0.00 ? 32  ARG A C    5  
ATOM 6805  O O    . ARG A 1 32  ? 16.302  5.423   -12.600 1.00 0.00 ? 32  ARG A O    5  
ATOM 6806  C CB   . ARG A 1 32  ? 17.063  7.886   -11.564 1.00 0.00 ? 32  ARG A CB   5  
ATOM 6807  C CG   . ARG A 1 32  ? 17.321  9.307   -11.092 1.00 0.00 ? 32  ARG A CG   5  
ATOM 6808  C CD   . ARG A 1 32  ? 18.720  9.457   -10.514 1.00 0.00 ? 32  ARG A CD   5  
ATOM 6809  N NE   . ARG A 1 32  ? 19.750  9.385   -11.548 1.00 0.00 ? 32  ARG A NE   5  
ATOM 6810  C CZ   . ARG A 1 32  ? 21.053  9.403   -11.290 1.00 0.00 ? 32  ARG A CZ   5  
ATOM 6811  N NH1  . ARG A 1 32  ? 21.483  9.491   -10.039 1.00 0.00 ? 32  ARG A NH1  5  
ATOM 6812  N NH2  . ARG A 1 32  ? 21.928  9.334   -12.285 1.00 0.00 ? 32  ARG A NH2  5  
ATOM 6813  H H    . ARG A 1 32  ? 13.981  8.664   -11.024 1.00 0.00 ? 32  ARG A H    5  
ATOM 6814  H HA   . ARG A 1 32  ? 15.328  8.149   -12.789 1.00 0.00 ? 32  ARG A HA   5  
ATOM 6815  H HB2  . ARG A 1 32  ? 17.380  7.208   -10.785 1.00 0.00 ? 32  ARG A HB2  5  
ATOM 6816  H HB3  . ARG A 1 32  ? 17.658  7.709   -12.447 1.00 0.00 ? 32  ARG A HB3  5  
ATOM 6817  H HG2  . ARG A 1 32  ? 17.217  9.980   -11.930 1.00 0.00 ? 32  ARG A HG2  5  
ATOM 6818  H HG3  . ARG A 1 32  ? 16.598  9.561   -10.331 1.00 0.00 ? 32  ARG A HG3  5  
ATOM 6819  H HD2  . ARG A 1 32  ? 18.790  10.412  -10.017 1.00 0.00 ? 32  ARG A HD2  5  
ATOM 6820  H HD3  . ARG A 1 32  ? 18.886  8.665   -9.798  1.00 0.00 ? 32  ARG A HD3  5  
ATOM 6821  H HE   . ARG A 1 32  ? 19.454  9.320   -12.479 1.00 0.00 ? 32  ARG A HE   5  
ATOM 6822  H HH11 . ARG A 1 32  ? 20.826  9.542   -9.288  1.00 0.00 ? 32  ARG A HH11 5  
ATOM 6823  H HH12 . ARG A 1 32  ? 22.465  9.503   -9.848  1.00 0.00 ? 32  ARG A HH12 5  
ATOM 6824  H HH21 . ARG A 1 32  ? 21.607  9.268   -13.229 1.00 0.00 ? 32  ARG A HH21 5  
ATOM 6825  H HH22 . ARG A 1 32  ? 22.908  9.348   -12.090 1.00 0.00 ? 32  ARG A HH22 5  
ATOM 6826  N N    . GLY A 1 33  ? 14.195  5.626   -11.837 1.00 0.00 ? 33  GLY A N    5  
ATOM 6827  C CA   . GLY A 1 33  ? 13.896  4.220   -12.033 1.00 0.00 ? 33  GLY A CA   5  
ATOM 6828  C C    . GLY A 1 33  ? 13.129  3.964   -13.316 1.00 0.00 ? 33  GLY A C    5  
ATOM 6829  O O    . GLY A 1 33  ? 13.710  3.941   -14.401 1.00 0.00 ? 33  GLY A O    5  
ATOM 6830  H H    . GLY A 1 33  ? 13.509  6.226   -11.476 1.00 0.00 ? 33  GLY A H    5  
ATOM 6831  H HA2  . GLY A 1 33  ? 14.822  3.667   -12.064 1.00 0.00 ? 33  GLY A HA2  5  
ATOM 6832  H HA3  . GLY A 1 33  ? 13.306  3.870   -11.199 1.00 0.00 ? 33  GLY A HA3  5  
ATOM 6833  N N    . HIS A 1 34  ? 11.820  3.769   -13.191 1.00 0.00 ? 34  HIS A N    5  
ATOM 6834  C CA   . HIS A 1 34  ? 10.972  3.512   -14.350 1.00 0.00 ? 34  HIS A CA   5  
ATOM 6835  C C    . HIS A 1 34  ? 9.773   4.455   -14.366 1.00 0.00 ? 34  HIS A C    5  
ATOM 6836  O O    . HIS A 1 34  ? 8.930   4.418   -13.471 1.00 0.00 ? 34  HIS A O    5  
ATOM 6837  C CB   . HIS A 1 34  ? 10.493  2.060   -14.346 1.00 0.00 ? 34  HIS A CB   5  
ATOM 6838  C CG   . HIS A 1 34  ? 10.001  1.595   -13.010 1.00 0.00 ? 34  HIS A CG   5  
ATOM 6839  N ND1  . HIS A 1 34  ? 8.691   1.729   -12.602 1.00 0.00 ? 34  HIS A ND1  5  
ATOM 6840  C CD2  . HIS A 1 34  ? 10.652  0.994   -11.987 1.00 0.00 ? 34  HIS A CD2  5  
ATOM 6841  C CE1  . HIS A 1 34  ? 8.557   1.232   -11.385 1.00 0.00 ? 34  HIS A CE1  5  
ATOM 6842  N NE2  . HIS A 1 34  ? 9.733   0.778   -10.989 1.00 0.00 ? 34  HIS A NE2  5  
ATOM 6843  H H    . HIS A 1 34  ? 11.415  3.799   -12.300 1.00 0.00 ? 34  HIS A H    5  
ATOM 6844  H HA   . HIS A 1 34  ? 11.562  3.684   -15.238 1.00 0.00 ? 34  HIS A HA   5  
ATOM 6845  H HB2  . HIS A 1 34  ? 9.683   1.953   -15.052 1.00 0.00 ? 34  HIS A HB2  5  
ATOM 6846  H HB3  . HIS A 1 34  ? 11.309  1.417   -14.642 1.00 0.00 ? 34  HIS A HB3  5  
ATOM 6847  H HD1  . HIS A 1 34  ? 7.967   2.131   -13.125 1.00 0.00 ? 34  HIS A HD1  5  
ATOM 6848  H HD2  . HIS A 1 34  ? 11.701  0.731   -11.959 1.00 0.00 ? 34  HIS A HD2  5  
ATOM 6849  H HE1  . HIS A 1 34  ? 7.643   1.200   -10.811 1.00 0.00 ? 34  HIS A HE1  5  
ATOM 6850  H HE2  . HIS A 1 34  ? 9.934   0.436   -10.094 1.00 0.00 ? 34  HIS A HE2  5  
ATOM 6851  N N    . ALA A 1 35  ? 9.705   5.300   -15.390 1.00 0.00 ? 35  ALA A N    5  
ATOM 6852  C CA   . ALA A 1 35  ? 8.609   6.253   -15.523 1.00 0.00 ? 35  ALA A CA   5  
ATOM 6853  C C    . ALA A 1 35  ? 7.297   5.651   -15.032 1.00 0.00 ? 35  ALA A C    5  
ATOM 6854  O O    . ALA A 1 35  ? 6.886   4.582   -15.481 1.00 0.00 ? 35  ALA A O    5  
ATOM 6855  C CB   . ALA A 1 35  ? 8.476   6.705   -16.969 1.00 0.00 ? 35  ALA A CB   5  
ATOM 6856  H H    . ALA A 1 35  ? 10.407  5.282   -16.072 1.00 0.00 ? 35  ALA A H    5  
ATOM 6857  H HA   . ALA A 1 35  ? 8.844   7.118   -14.920 1.00 0.00 ? 35  ALA A HA   5  
ATOM 6858  H HB1  . ALA A 1 35  ? 7.439   6.919   -17.184 1.00 0.00 ? 35  ALA A HB1  5  
ATOM 6859  H HB2  . ALA A 1 35  ? 9.067   7.595   -17.123 1.00 0.00 ? 35  ALA A HB2  5  
ATOM 6860  H HB3  . ALA A 1 35  ? 8.826   5.922   -17.625 1.00 0.00 ? 35  ALA A HB3  5  
ATOM 6861  N N    . GLY A 1 36  ? 6.643   6.345   -14.105 1.00 0.00 ? 36  GLY A N    5  
ATOM 6862  C CA   . GLY A 1 36  ? 5.384   5.863   -13.568 1.00 0.00 ? 36  GLY A CA   5  
ATOM 6863  C C    . GLY A 1 36  ? 4.191   6.617   -14.120 1.00 0.00 ? 36  GLY A C    5  
ATOM 6864  O O    . GLY A 1 36  ? 3.245   6.013   -14.624 1.00 0.00 ? 36  GLY A O    5  
ATOM 6865  H H    . GLY A 1 36  ? 7.018   7.192   -13.784 1.00 0.00 ? 36  GLY A H    5  
ATOM 6866  H HA2  . GLY A 1 36  ? 5.279   4.816   -13.811 1.00 0.00 ? 36  GLY A HA2  5  
ATOM 6867  H HA3  . GLY A 1 36  ? 5.398   5.973   -12.493 1.00 0.00 ? 36  GLY A HA3  5  
ATOM 6868  N N    . ASN A 1 37  ? 4.234   7.942   -14.025 1.00 0.00 ? 37  ASN A N    5  
ATOM 6869  C CA   . ASN A 1 37  ? 3.147   8.780   -14.517 1.00 0.00 ? 37  ASN A CA   5  
ATOM 6870  C C    . ASN A 1 37  ? 3.360   9.141   -15.984 1.00 0.00 ? 37  ASN A C    5  
ATOM 6871  O O    . ASN A 1 37  ? 4.415   9.635   -16.381 1.00 0.00 ? 37  ASN A O    5  
ATOM 6872  C CB   . ASN A 1 37  ? 3.037   10.055  -13.678 1.00 0.00 ? 37  ASN A CB   5  
ATOM 6873  C CG   . ASN A 1 37  ? 2.563   9.777   -12.264 1.00 0.00 ? 37  ASN A CG   5  
ATOM 6874  O OD1  . ASN A 1 37  ? 2.611   8.640   -11.794 1.00 0.00 ? 37  ASN A OD1  5  
ATOM 6875  N ND2  . ASN A 1 37  ? 2.103   10.817  -11.579 1.00 0.00 ? 37  ASN A ND2  5  
ATOM 6876  H H    . ASN A 1 37  ? 5.016   8.367   -13.613 1.00 0.00 ? 37  ASN A H    5  
ATOM 6877  H HA   . ASN A 1 37  ? 2.229   8.220   -14.426 1.00 0.00 ? 37  ASN A HA   5  
ATOM 6878  H HB2  . ASN A 1 37  ? 4.007   10.529  -13.625 1.00 0.00 ? 37  ASN A HB2  5  
ATOM 6879  H HB3  . ASN A 1 37  ? 2.336   10.729  -14.147 1.00 0.00 ? 37  ASN A HB3  5  
ATOM 6880  H HD21 . ASN A 1 37  ? 2.095   11.694  -12.018 1.00 0.00 ? 37  ASN A HD21 5  
ATOM 6881  H HD22 . ASN A 1 37  ? 1.791   10.666  -10.663 1.00 0.00 ? 37  ASN A HD22 5  
ATOM 6882  N N    . PRO A 1 38  ? 2.334   8.890   -16.810 1.00 0.00 ? 38  PRO A N    5  
ATOM 6883  C CA   . PRO A 1 38  ? 2.383   9.181   -18.246 1.00 0.00 ? 38  PRO A CA   5  
ATOM 6884  C C    . PRO A 1 38  ? 2.376   10.678  -18.534 1.00 0.00 ? 38  PRO A C    5  
ATOM 6885  O O    . PRO A 1 38  ? 3.131   11.161  -19.378 1.00 0.00 ? 38  PRO A O    5  
ATOM 6886  C CB   . PRO A 1 38  ? 1.109   8.526   -18.785 1.00 0.00 ? 38  PRO A CB   5  
ATOM 6887  C CG   . PRO A 1 38  ? 0.180   8.490   -17.622 1.00 0.00 ? 38  PRO A CG   5  
ATOM 6888  C CD   . PRO A 1 38  ? 1.045   8.302   -16.406 1.00 0.00 ? 38  PRO A CD   5  
ATOM 6889  H HA   . PRO A 1 38  ? 3.247   8.730   -18.713 1.00 0.00 ? 38  PRO A HA   5  
ATOM 6890  H HB2  . PRO A 1 38  ? 0.709   9.123   -19.593 1.00 0.00 ? 38  PRO A HB2  5  
ATOM 6891  H HB3  . PRO A 1 38  ? 1.334   7.532   -19.141 1.00 0.00 ? 38  PRO A HB3  5  
ATOM 6892  H HG2  . PRO A 1 38  ? -0.362  9.422   -17.555 1.00 0.00 ? 38  PRO A HG2  5  
ATOM 6893  H HG3  . PRO A 1 38  ? -0.506  7.662   -17.725 1.00 0.00 ? 38  PRO A HG3  5  
ATOM 6894  H HD2  . PRO A 1 38  ? 0.629   8.829   -15.561 1.00 0.00 ? 38  PRO A HD2  5  
ATOM 6895  H HD3  . PRO A 1 38  ? 1.156   7.251   -16.181 1.00 0.00 ? 38  PRO A HD3  5  
ATOM 6896  N N    . ARG A 1 39  ? 1.519   11.408  -17.827 1.00 0.00 ? 39  ARG A N    5  
ATOM 6897  C CA   . ARG A 1 39  ? 1.413   12.851  -18.008 1.00 0.00 ? 39  ARG A CA   5  
ATOM 6898  C C    . ARG A 1 39  ? 2.773   13.458  -18.339 1.00 0.00 ? 39  ARG A C    5  
ATOM 6899  O O    . ARG A 1 39  ? 3.010   13.900  -19.464 1.00 0.00 ? 39  ARG A O    5  
ATOM 6900  C CB   . ARG A 1 39  ? 0.844   13.504  -16.747 1.00 0.00 ? 39  ARG A CB   5  
ATOM 6901  C CG   . ARG A 1 39  ? -0.585  13.090  -16.439 1.00 0.00 ? 39  ARG A CG   5  
ATOM 6902  C CD   . ARG A 1 39  ? -1.583  13.844  -17.304 1.00 0.00 ? 39  ARG A CD   5  
ATOM 6903  N NE   . ARG A 1 39  ? -1.850  15.184  -16.790 1.00 0.00 ? 39  ARG A NE   5  
ATOM 6904  C CZ   . ARG A 1 39  ? -2.785  15.989  -17.284 1.00 0.00 ? 39  ARG A CZ   5  
ATOM 6905  N NH1  . ARG A 1 39  ? -3.538  15.589  -18.300 1.00 0.00 ? 39  ARG A NH1  5  
ATOM 6906  N NH2  . ARG A 1 39  ? -2.968  17.195  -16.763 1.00 0.00 ? 39  ARG A NH2  5  
ATOM 6907  H H    . ARG A 1 39  ? 0.943   10.966  -17.169 1.00 0.00 ? 39  ARG A H    5  
ATOM 6908  H HA   . ARG A 1 39  ? 0.740   13.033  -18.833 1.00 0.00 ? 39  ARG A HA   5  
ATOM 6909  H HB2  . ARG A 1 39  ? 1.463   13.234  -15.905 1.00 0.00 ? 39  ARG A HB2  5  
ATOM 6910  H HB3  . ARG A 1 39  ? 0.866   14.576  -16.871 1.00 0.00 ? 39  ARG A HB3  5  
ATOM 6911  H HG2  . ARG A 1 39  ? -0.692  12.031  -16.626 1.00 0.00 ? 39  ARG A HG2  5  
ATOM 6912  H HG3  . ARG A 1 39  ? -0.794  13.297  -15.400 1.00 0.00 ? 39  ARG A HG3  5  
ATOM 6913  H HD2  . ARG A 1 39  ? -1.183  13.925  -18.304 1.00 0.00 ? 39  ARG A HD2  5  
ATOM 6914  H HD3  . ARG A 1 39  ? -2.508  13.288  -17.331 1.00 0.00 ? 39  ARG A HD3  5  
ATOM 6915  H HE   . ARG A 1 39  ? -1.305  15.499  -16.039 1.00 0.00 ? 39  ARG A HE   5  
ATOM 6916  H HH11 . ARG A 1 39  ? -3.403  14.681  -18.695 1.00 0.00 ? 39  ARG A HH11 5  
ATOM 6917  H HH12 . ARG A 1 39  ? -4.241  16.196  -18.670 1.00 0.00 ? 39  ARG A HH12 5  
ATOM 6918  H HH21 . ARG A 1 39  ? -2.402  17.499  -15.997 1.00 0.00 ? 39  ARG A HH21 5  
ATOM 6919  H HH22 . ARG A 1 39  ? -3.671  17.799  -17.135 1.00 0.00 ? 39  ARG A HH22 5  
ATOM 6920  N N    . ASP A 1 40  ? 3.663   13.477  -17.353 1.00 0.00 ? 40  ASP A N    5  
ATOM 6921  C CA   . ASP A 1 40  ? 4.999   14.030  -17.539 1.00 0.00 ? 40  ASP A CA   5  
ATOM 6922  C C    . ASP A 1 40  ? 6.065   12.965  -17.303 1.00 0.00 ? 40  ASP A C    5  
ATOM 6923  O O    . ASP A 1 40  ? 6.172   12.387  -16.221 1.00 0.00 ? 40  ASP A O    5  
ATOM 6924  C CB   . ASP A 1 40  ? 5.222   15.211  -16.592 1.00 0.00 ? 40  ASP A CB   5  
ATOM 6925  C CG   . ASP A 1 40  ? 4.429   16.437  -17.000 1.00 0.00 ? 40  ASP A CG   5  
ATOM 6926  O OD1  . ASP A 1 40  ? 4.161   16.596  -18.209 1.00 0.00 ? 40  ASP A OD1  5  
ATOM 6927  O OD2  . ASP A 1 40  ? 4.075   17.237  -16.109 1.00 0.00 ? 40  ASP A OD2  5  
ATOM 6928  H H    . ASP A 1 40  ? 3.414   13.110  -16.478 1.00 0.00 ? 40  ASP A H    5  
ATOM 6929  H HA   . ASP A 1 40  ? 5.075   14.378  -18.558 1.00 0.00 ? 40  ASP A HA   5  
ATOM 6930  H HB2  . ASP A 1 40  ? 4.922   14.926  -15.595 1.00 0.00 ? 40  ASP A HB2  5  
ATOM 6931  H HB3  . ASP A 1 40  ? 6.271   15.468  -16.589 1.00 0.00 ? 40  ASP A HB3  5  
ATOM 6932  N N    . PRO A 1 41  ? 6.874   12.696  -18.339 1.00 0.00 ? 41  PRO A N    5  
ATOM 6933  C CA   . PRO A 1 41  ? 7.946   11.699  -18.269 1.00 0.00 ? 41  PRO A CA   5  
ATOM 6934  C C    . PRO A 1 41  ? 9.091   12.141  -17.364 1.00 0.00 ? 41  PRO A C    5  
ATOM 6935  O O    . PRO A 1 41  ? 9.831   11.313  -16.833 1.00 0.00 ? 41  PRO A O    5  
ATOM 6936  C CB   . PRO A 1 41  ? 8.422   11.588  -19.719 1.00 0.00 ? 41  PRO A CB   5  
ATOM 6937  C CG   . PRO A 1 41  ? 8.070   12.898  -20.335 1.00 0.00 ? 41  PRO A CG   5  
ATOM 6938  C CD   . PRO A 1 41  ? 6.804   13.346  -19.658 1.00 0.00 ? 41  PRO A CD   5  
ATOM 6939  H HA   . PRO A 1 41  ? 7.575   10.741  -17.936 1.00 0.00 ? 41  PRO A HA   5  
ATOM 6940  H HB2  . PRO A 1 41  ? 9.489   11.417  -19.738 1.00 0.00 ? 41  PRO A HB2  5  
ATOM 6941  H HB3  . PRO A 1 41  ? 7.912   10.773  -20.209 1.00 0.00 ? 41  PRO A HB3  5  
ATOM 6942  H HG2  . PRO A 1 41  ? 8.861   13.611  -20.160 1.00 0.00 ? 41  PRO A HG2  5  
ATOM 6943  H HG3  . PRO A 1 41  ? 7.903   12.773  -21.395 1.00 0.00 ? 41  PRO A HG3  5  
ATOM 6944  H HD2  . PRO A 1 41  ? 6.789   14.422  -19.558 1.00 0.00 ? 41  PRO A HD2  5  
ATOM 6945  H HD3  . PRO A 1 41  ? 5.940   13.005  -20.210 1.00 0.00 ? 41  PRO A HD3  5  
ATOM 6946  N N    . THR A 1 42  ? 9.231   13.452  -17.192 1.00 0.00 ? 42  THR A N    5  
ATOM 6947  C CA   . THR A 1 42  ? 10.286  14.003  -16.352 1.00 0.00 ? 42  THR A CA   5  
ATOM 6948  C C    . THR A 1 42  ? 9.825   14.134  -14.905 1.00 0.00 ? 42  THR A C    5  
ATOM 6949  O O    . THR A 1 42  ? 10.107  15.132  -14.241 1.00 0.00 ? 42  THR A O    5  
ATOM 6950  C CB   . THR A 1 42  ? 10.744  15.384  -16.859 1.00 0.00 ? 42  THR A CB   5  
ATOM 6951  O OG1  . THR A 1 42  ? 9.626   16.276  -16.929 1.00 0.00 ? 42  THR A OG1  5  
ATOM 6952  C CG2  . THR A 1 42  ? 11.393  15.268  -18.230 1.00 0.00 ? 42  THR A CG2  5  
ATOM 6953  H H    . THR A 1 42  ? 8.609   14.061  -17.642 1.00 0.00 ? 42  THR A H    5  
ATOM 6954  H HA   . THR A 1 42  ? 11.130  13.330  -16.391 1.00 0.00 ? 42  THR A HA   5  
ATOM 6955  H HB   . THR A 1 42  ? 11.470  15.783  -16.166 1.00 0.00 ? 42  THR A HB   5  
ATOM 6956  H HG1  . THR A 1 42  ? 9.882   17.075  -17.396 1.00 0.00 ? 42  THR A HG1  5  
ATOM 6957  H HG21 . THR A 1 42  ? 12.460  15.411  -18.137 1.00 0.00 ? 42  THR A HG21 5  
ATOM 6958  H HG22 . THR A 1 42  ? 10.985  16.023  -18.886 1.00 0.00 ? 42  THR A HG22 5  
ATOM 6959  H HG23 . THR A 1 42  ? 11.196  14.290  -18.640 1.00 0.00 ? 42  THR A HG23 5  
ATOM 6960  N N    . ASP A 1 43  ? 9.116   13.120  -14.421 1.00 0.00 ? 43  ASP A N    5  
ATOM 6961  C CA   . ASP A 1 43  ? 8.617   13.121  -13.051 1.00 0.00 ? 43  ASP A CA   5  
ATOM 6962  C C    . ASP A 1 43  ? 8.820   11.757  -12.398 1.00 0.00 ? 43  ASP A C    5  
ATOM 6963  O O    . ASP A 1 43  ? 8.179   10.777  -12.775 1.00 0.00 ? 43  ASP A O    5  
ATOM 6964  C CB   . ASP A 1 43  ? 7.134   13.497  -13.025 1.00 0.00 ? 43  ASP A CB   5  
ATOM 6965  C CG   . ASP A 1 43  ? 6.571   13.535  -11.619 1.00 0.00 ? 43  ASP A CG   5  
ATOM 6966  O OD1  . ASP A 1 43  ? 7.002   14.401  -10.829 1.00 0.00 ? 43  ASP A OD1  5  
ATOM 6967  O OD2  . ASP A 1 43  ? 5.697   12.698  -11.307 1.00 0.00 ? 43  ASP A OD2  5  
ATOM 6968  H H    . ASP A 1 43  ? 8.923   12.353  -15.000 1.00 0.00 ? 43  ASP A H    5  
ATOM 6969  H HA   . ASP A 1 43  ? 9.175   13.859  -12.495 1.00 0.00 ? 43  ASP A HA   5  
ATOM 6970  H HB2  . ASP A 1 43  ? 7.009   14.474  -13.470 1.00 0.00 ? 43  ASP A HB2  5  
ATOM 6971  H HB3  . ASP A 1 43  ? 6.576   12.771  -13.598 1.00 0.00 ? 43  ASP A HB3  5  
ATOM 6972  N N    . GLU A 1 44  ? 9.717   11.704  -11.418 1.00 0.00 ? 44  GLU A N    5  
ATOM 6973  C CA   . GLU A 1 44  ? 10.005  10.460  -10.714 1.00 0.00 ? 44  GLU A CA   5  
ATOM 6974  C C    . GLU A 1 44  ? 9.300   10.424  -9.361  1.00 0.00 ? 44  GLU A C    5  
ATOM 6975  O O    . GLU A 1 44  ? 9.937   10.530  -8.314  1.00 0.00 ? 44  GLU A O    5  
ATOM 6976  C CB   . GLU A 1 44  ? 11.514  10.296  -10.520 1.00 0.00 ? 44  GLU A CB   5  
ATOM 6977  C CG   . GLU A 1 44  ? 12.325  10.598  -11.769 1.00 0.00 ? 44  GLU A CG   5  
ATOM 6978  C CD   . GLU A 1 44  ? 12.217  12.048  -12.198 1.00 0.00 ? 44  GLU A CD   5  
ATOM 6979  O OE1  . GLU A 1 44  ? 12.344  12.936  -11.330 1.00 0.00 ? 44  GLU A OE1  5  
ATOM 6980  O OE2  . GLU A 1 44  ? 12.004  12.295  -13.404 1.00 0.00 ? 44  GLU A OE2  5  
ATOM 6981  H H    . GLU A 1 44  ? 10.196  12.520  -11.163 1.00 0.00 ? 44  GLU A H    5  
ATOM 6982  H HA   . GLU A 1 44  ? 9.639   9.644   -11.319 1.00 0.00 ? 44  GLU A HA   5  
ATOM 6983  H HB2  . GLU A 1 44  ? 11.838  10.963  -9.735  1.00 0.00 ? 44  GLU A HB2  5  
ATOM 6984  H HB3  . GLU A 1 44  ? 11.718  9.278   -10.222 1.00 0.00 ? 44  GLU A HB3  5  
ATOM 6985  H HG2  . GLU A 1 44  ? 13.363  10.374  -11.572 1.00 0.00 ? 44  GLU A HG2  5  
ATOM 6986  H HG3  . GLU A 1 44  ? 11.969  9.972   -12.574 1.00 0.00 ? 44  GLU A HG3  5  
ATOM 6987  N N    . GLY A 1 45  ? 7.979   10.273  -9.393  1.00 0.00 ? 45  GLY A N    5  
ATOM 6988  C CA   . GLY A 1 45  ? 7.209   10.227  -8.164  1.00 0.00 ? 45  GLY A CA   5  
ATOM 6989  C C    . GLY A 1 45  ? 6.959   8.809   -7.690  1.00 0.00 ? 45  GLY A C    5  
ATOM 6990  O O    . GLY A 1 45  ? 7.099   7.857   -8.458  1.00 0.00 ? 45  GLY A O    5  
ATOM 6991  H H    . GLY A 1 45  ? 7.525   10.194  -10.257 1.00 0.00 ? 45  GLY A H    5  
ATOM 6992  H HA2  . GLY A 1 45  ? 7.745   10.763  -7.395  1.00 0.00 ? 45  GLY A HA2  5  
ATOM 6993  H HA3  . GLY A 1 45  ? 6.258   10.711  -8.330  1.00 0.00 ? 45  GLY A HA3  5  
ATOM 6994  N N    . ILE A 1 46  ? 6.590   8.667   -6.421  1.00 0.00 ? 46  ILE A N    5  
ATOM 6995  C CA   . ILE A 1 46  ? 6.320   7.355   -5.846  1.00 0.00 ? 46  ILE A CA   5  
ATOM 6996  C C    . ILE A 1 46  ? 4.966   7.329   -5.147  1.00 0.00 ? 46  ILE A C    5  
ATOM 6997  O O    . ILE A 1 46  ? 4.733   8.070   -4.192  1.00 0.00 ? 46  ILE A O    5  
ATOM 6998  C CB   . ILE A 1 46  ? 7.413   6.946   -4.841  1.00 0.00 ? 46  ILE A CB   5  
ATOM 6999  C CG1  . ILE A 1 46  ? 8.797   7.061   -5.483  1.00 0.00 ? 46  ILE A CG1  5  
ATOM 7000  C CG2  . ILE A 1 46  ? 7.171   5.529   -4.343  1.00 0.00 ? 46  ILE A CG2  5  
ATOM 7001  C CD1  . ILE A 1 46  ? 9.917   7.220   -4.479  1.00 0.00 ? 46  ILE A CD1  5  
ATOM 7002  H H    . ILE A 1 46  ? 6.495   9.464   -5.859  1.00 0.00 ? 46  ILE A H    5  
ATOM 7003  H HA   . ILE A 1 46  ? 6.312   6.634   -6.651  1.00 0.00 ? 46  ILE A HA   5  
ATOM 7004  H HB   . ILE A 1 46  ? 7.360   7.613   -3.994  1.00 0.00 ? 46  ILE A HB   5  
ATOM 7005  H HG12 . ILE A 1 46  ? 8.994   6.173   -6.062  1.00 0.00 ? 46  ILE A HG12 5  
ATOM 7006  H HG13 . ILE A 1 46  ? 8.811   7.922   -6.136  1.00 0.00 ? 46  ILE A HG13 5  
ATOM 7007  H HG21 . ILE A 1 46  ? 6.178   5.213   -4.626  1.00 0.00 ? 46  ILE A HG21 5  
ATOM 7008  H HG22 . ILE A 1 46  ? 7.899   4.864   -4.783  1.00 0.00 ? 46  ILE A HG22 5  
ATOM 7009  H HG23 . ILE A 1 46  ? 7.263   5.504   -3.268  1.00 0.00 ? 46  ILE A HG23 5  
ATOM 7010  H HD11 . ILE A 1 46  ? 9.605   6.824   -3.524  1.00 0.00 ? 46  ILE A HD11 5  
ATOM 7011  H HD12 . ILE A 1 46  ? 10.789  6.684   -4.824  1.00 0.00 ? 46  ILE A HD12 5  
ATOM 7012  H HD13 . ILE A 1 46  ? 10.159  8.268   -4.372  1.00 0.00 ? 46  ILE A HD13 5  
ATOM 7013  N N    . PHE A 1 47  ? 4.075   6.468   -5.627  1.00 0.00 ? 47  PHE A N    5  
ATOM 7014  C CA   . PHE A 1 47  ? 2.742   6.343   -5.048  1.00 0.00 ? 47  PHE A CA   5  
ATOM 7015  C C    . PHE A 1 47  ? 2.388   4.879   -4.808  1.00 0.00 ? 47  PHE A C    5  
ATOM 7016  O O    . PHE A 1 47  ? 3.182   3.982   -5.094  1.00 0.00 ? 47  PHE A O    5  
ATOM 7017  C CB   . PHE A 1 47  ? 1.701   6.988   -5.966  1.00 0.00 ? 47  PHE A CB   5  
ATOM 7018  C CG   . PHE A 1 47  ? 2.117   8.332   -6.491  1.00 0.00 ? 47  PHE A CG   5  
ATOM 7019  C CD1  . PHE A 1 47  ? 3.241   8.461   -7.291  1.00 0.00 ? 47  PHE A CD1  5  
ATOM 7020  C CD2  . PHE A 1 47  ? 1.383   9.467   -6.185  1.00 0.00 ? 47  PHE A CD2  5  
ATOM 7021  C CE1  . PHE A 1 47  ? 3.625   9.697   -7.776  1.00 0.00 ? 47  PHE A CE1  5  
ATOM 7022  C CE2  . PHE A 1 47  ? 1.762   10.705  -6.669  1.00 0.00 ? 47  PHE A CE2  5  
ATOM 7023  C CZ   . PHE A 1 47  ? 2.885   10.821  -7.464  1.00 0.00 ? 47  PHE A CZ   5  
ATOM 7024  H H    . PHE A 1 47  ? 4.319   5.903   -6.391  1.00 0.00 ? 47  PHE A H    5  
ATOM 7025  H HA   . PHE A 1 47  ? 2.744   6.860   -4.101  1.00 0.00 ? 47  PHE A HA   5  
ATOM 7026  H HB2  . PHE A 1 47  ? 1.528   6.341   -6.812  1.00 0.00 ? 47  PHE A HB2  5  
ATOM 7027  H HB3  . PHE A 1 47  ? 0.779   7.114   -5.419  1.00 0.00 ? 47  PHE A HB3  5  
ATOM 7028  H HD1  . PHE A 1 47  ? 3.821   7.583   -7.536  1.00 0.00 ? 47  PHE A HD1  5  
ATOM 7029  H HD2  . PHE A 1 47  ? 0.505   9.379   -5.563  1.00 0.00 ? 47  PHE A HD2  5  
ATOM 7030  H HE1  . PHE A 1 47  ? 4.504   9.783   -8.398  1.00 0.00 ? 47  PHE A HE1  5  
ATOM 7031  H HE2  . PHE A 1 47  ? 1.182   11.582  -6.423  1.00 0.00 ? 47  PHE A HE2  5  
ATOM 7032  H HZ   . PHE A 1 47  ? 3.184   11.787  -7.843  1.00 0.00 ? 47  PHE A HZ   5  
ATOM 7033  N N    . ILE A 1 48  ? 1.191   4.644   -4.282  1.00 0.00 ? 48  ILE A N    5  
ATOM 7034  C CA   . ILE A 1 48  ? 0.731   3.289   -4.004  1.00 0.00 ? 48  ILE A CA   5  
ATOM 7035  C C    . ILE A 1 48  ? 0.042   2.682   -5.222  1.00 0.00 ? 48  ILE A C    5  
ATOM 7036  O O    . ILE A 1 48  ? -0.945  3.222   -5.722  1.00 0.00 ? 48  ILE A O    5  
ATOM 7037  C CB   . ILE A 1 48  ? -0.241  3.258   -2.810  1.00 0.00 ? 48  ILE A CB   5  
ATOM 7038  C CG1  . ILE A 1 48  ? 0.469   3.716   -1.534  1.00 0.00 ? 48  ILE A CG1  5  
ATOM 7039  C CG2  . ILE A 1 48  ? -0.816  1.861   -2.631  1.00 0.00 ? 48  ILE A CG2  5  
ATOM 7040  C CD1  . ILE A 1 48  ? -0.478  4.125   -0.429  1.00 0.00 ? 48  ILE A CD1  5  
ATOM 7041  H H    . ILE A 1 48  ? 0.602   5.400   -4.076  1.00 0.00 ? 48  ILE A H    5  
ATOM 7042  H HA   . ILE A 1 48  ? 1.594   2.689   -3.756  1.00 0.00 ? 48  ILE A HA   5  
ATOM 7043  H HB   . ILE A 1 48  ? -1.057  3.933   -3.021  1.00 0.00 ? 48  ILE A HB   5  
ATOM 7044  H HG12 . ILE A 1 48  ? 1.083   2.911   -1.163  1.00 0.00 ? 48  ILE A HG12 5  
ATOM 7045  H HG13 . ILE A 1 48  ? 1.097   4.564   -1.766  1.00 0.00 ? 48  ILE A HG13 5  
ATOM 7046  H HG21 . ILE A 1 48  ? -1.163  1.490   -3.584  1.00 0.00 ? 48  ILE A HG21 5  
ATOM 7047  H HG22 . ILE A 1 48  ? -0.050  1.204   -2.247  1.00 0.00 ? 48  ILE A HG22 5  
ATOM 7048  H HG23 . ILE A 1 48  ? -1.642  1.897   -1.936  1.00 0.00 ? 48  ILE A HG23 5  
ATOM 7049  H HD11 . ILE A 1 48  ? -0.101  5.011   0.060   1.00 0.00 ? 48  ILE A HD11 5  
ATOM 7050  H HD12 . ILE A 1 48  ? -1.452  4.331   -0.846  1.00 0.00 ? 48  ILE A HD12 5  
ATOM 7051  H HD13 . ILE A 1 48  ? -0.558  3.323   0.292   1.00 0.00 ? 48  ILE A HD13 5  
ATOM 7052  N N    . SER A 1 49  ? 0.568   1.556   -5.693  1.00 0.00 ? 49  SER A N    5  
ATOM 7053  C CA   . SER A 1 49  ? 0.005   0.876   -6.853  1.00 0.00 ? 49  SER A CA   5  
ATOM 7054  C C    . SER A 1 49  ? -0.922  -0.256  -6.422  1.00 0.00 ? 49  SER A C    5  
ATOM 7055  O O    . SER A 1 49  ? -1.734  -0.745  -7.209  1.00 0.00 ? 49  SER A O    5  
ATOM 7056  C CB   . SER A 1 49  ? 1.123   0.326   -7.740  1.00 0.00 ? 49  SER A CB   5  
ATOM 7057  O OG   . SER A 1 49  ? 0.662   -0.758  -8.529  1.00 0.00 ? 49  SER A OG   5  
ATOM 7058  H H    . SER A 1 49  ? 1.355   1.175   -5.250  1.00 0.00 ? 49  SER A H    5  
ATOM 7059  H HA   . SER A 1 49  ? -0.567  1.599   -7.416  1.00 0.00 ? 49  SER A HA   5  
ATOM 7060  H HB2  . SER A 1 49  ? 1.477   1.107   -8.396  1.00 0.00 ? 49  SER A HB2  5  
ATOM 7061  H HB3  . SER A 1 49  ? 1.936   -0.018  -7.118  1.00 0.00 ? 49  SER A HB3  5  
ATOM 7062  H HG   . SER A 1 49  ? 0.409   -0.437  -9.398  1.00 0.00 ? 49  SER A HG   5  
ATOM 7063  N N    . LYS A 1 50  ? -0.796  -0.670  -5.166  1.00 0.00 ? 50  LYS A N    5  
ATOM 7064  C CA   . LYS A 1 50  ? -1.621  -1.744  -4.627  1.00 0.00 ? 50  LYS A CA   5  
ATOM 7065  C C    . LYS A 1 50  ? -1.523  -1.795  -3.106  1.00 0.00 ? 50  LYS A C    5  
ATOM 7066  O O    . LYS A 1 50  ? -0.576  -1.273  -2.517  1.00 0.00 ? 50  LYS A O    5  
ATOM 7067  C CB   . LYS A 1 50  ? -1.197  -3.089  -5.222  1.00 0.00 ? 50  LYS A CB   5  
ATOM 7068  C CG   . LYS A 1 50  ? -1.542  -4.279  -4.342  1.00 0.00 ? 50  LYS A CG   5  
ATOM 7069  C CD   . LYS A 1 50  ? -1.135  -5.590  -4.994  1.00 0.00 ? 50  LYS A CD   5  
ATOM 7070  C CE   . LYS A 1 50  ? -1.450  -5.594  -6.482  1.00 0.00 ? 50  LYS A CE   5  
ATOM 7071  N NZ   . LYS A 1 50  ? -1.426  -6.970  -7.050  1.00 0.00 ? 50  LYS A NZ   5  
ATOM 7072  H H    . LYS A 1 50  ? -0.131  -0.242  -4.586  1.00 0.00 ? 50  LYS A H    5  
ATOM 7073  H HA   . LYS A 1 50  ? -2.646  -1.546  -4.903  1.00 0.00 ? 50  LYS A HA   5  
ATOM 7074  H HB2  . LYS A 1 50  ? -1.687  -3.219  -6.175  1.00 0.00 ? 50  LYS A HB2  5  
ATOM 7075  H HB3  . LYS A 1 50  ? -0.127  -3.080  -5.375  1.00 0.00 ? 50  LYS A HB3  5  
ATOM 7076  H HG2  . LYS A 1 50  ? -1.023  -4.182  -3.400  1.00 0.00 ? 50  LYS A HG2  5  
ATOM 7077  H HG3  . LYS A 1 50  ? -2.608  -4.289  -4.169  1.00 0.00 ? 50  LYS A HG3  5  
ATOM 7078  H HD2  . LYS A 1 50  ? -0.073  -5.734  -4.862  1.00 0.00 ? 50  LYS A HD2  5  
ATOM 7079  H HD3  . LYS A 1 50  ? -1.672  -6.399  -4.519  1.00 0.00 ? 50  LYS A HD3  5  
ATOM 7080  H HE2  . LYS A 1 50  ? -2.432  -5.170  -6.630  1.00 0.00 ? 50  LYS A HE2  5  
ATOM 7081  H HE3  . LYS A 1 50  ? -0.716  -4.989  -6.993  1.00 0.00 ? 50  LYS A HE3  5  
ATOM 7082  H HZ1  . LYS A 1 50  ? -0.516  -7.145  -7.525  1.00 0.00 ? 50  LYS A HZ1  5  
ATOM 7083  H HZ2  . LYS A 1 50  ? -2.192  -7.085  -7.743  1.00 0.00 ? 50  LYS A HZ2  5  
ATOM 7084  H HZ3  . LYS A 1 50  ? -1.550  -7.672  -6.293  1.00 0.00 ? 50  LYS A HZ3  5  
ATOM 7085  N N    . VAL A 1 51  ? -2.506  -2.429  -2.474  1.00 0.00 ? 51  VAL A N    5  
ATOM 7086  C CA   . VAL A 1 51  ? -2.528  -2.551  -1.022  1.00 0.00 ? 51  VAL A CA   5  
ATOM 7087  C C    . VAL A 1 51  ? -3.216  -3.841  -0.589  1.00 0.00 ? 51  VAL A C    5  
ATOM 7088  O O    . VAL A 1 51  ? -4.412  -4.024  -0.812  1.00 0.00 ? 51  VAL A O    5  
ATOM 7089  C CB   . VAL A 1 51  ? -3.247  -1.355  -0.369  1.00 0.00 ? 51  VAL A CB   5  
ATOM 7090  C CG1  . VAL A 1 51  ? -3.372  -1.561  1.132   1.00 0.00 ? 51  VAL A CG1  5  
ATOM 7091  C CG2  . VAL A 1 51  ? -2.513  -0.059  -0.679  1.00 0.00 ? 51  VAL A CG2  5  
ATOM 7092  H H    . VAL A 1 51  ? -3.233  -2.825  -2.998  1.00 0.00 ? 51  VAL A H    5  
ATOM 7093  H HA   . VAL A 1 51  ? -1.506  -2.564  -0.672  1.00 0.00 ? 51  VAL A HA   5  
ATOM 7094  H HB   . VAL A 1 51  ? -4.242  -1.288  -0.785  1.00 0.00 ? 51  VAL A HB   5  
ATOM 7095  H HG11 . VAL A 1 51  ? -2.680  -2.328  1.449   1.00 0.00 ? 51  VAL A HG11 5  
ATOM 7096  H HG12 . VAL A 1 51  ? -3.146  -0.637  1.643   1.00 0.00 ? 51  VAL A HG12 5  
ATOM 7097  H HG13 . VAL A 1 51  ? -4.380  -1.867  1.371   1.00 0.00 ? 51  VAL A HG13 5  
ATOM 7098  H HG21 . VAL A 1 51  ? -2.937  0.743   -0.093  1.00 0.00 ? 51  VAL A HG21 5  
ATOM 7099  H HG22 . VAL A 1 51  ? -1.467  -0.170  -0.433  1.00 0.00 ? 51  VAL A HG22 5  
ATOM 7100  H HG23 . VAL A 1 51  ? -2.613  0.170   -1.729  1.00 0.00 ? 51  VAL A HG23 5  
ATOM 7101  N N    . SER A 1 52  ? -2.451  -4.732  0.033   1.00 0.00 ? 52  SER A N    5  
ATOM 7102  C CA   . SER A 1 52  ? -2.986  -6.008  0.496   1.00 0.00 ? 52  SER A CA   5  
ATOM 7103  C C    . SER A 1 52  ? -4.107  -5.792  1.507   1.00 0.00 ? 52  SER A C    5  
ATOM 7104  O O    . SER A 1 52  ? -3.999  -4.984  2.430   1.00 0.00 ? 52  SER A O    5  
ATOM 7105  C CB   . SER A 1 52  ? -1.875  -6.854  1.121   1.00 0.00 ? 52  SER A CB   5  
ATOM 7106  O OG   . SER A 1 52  ? -2.166  -8.237  1.016   1.00 0.00 ? 52  SER A OG   5  
ATOM 7107  H H    . SER A 1 52  ? -1.504  -4.528  0.183   1.00 0.00 ? 52  SER A H    5  
ATOM 7108  H HA   . SER A 1 52  ? -3.385  -6.530  -0.361  1.00 0.00 ? 52  SER A HA   5  
ATOM 7109  H HB2  . SER A 1 52  ? -0.944  -6.655  0.612   1.00 0.00 ? 52  SER A HB2  5  
ATOM 7110  H HB3  . SER A 1 52  ? -1.776  -6.597  2.166   1.00 0.00 ? 52  SER A HB3  5  
ATOM 7111  H HG   . SER A 1 52  ? -2.976  -8.431  1.494   1.00 0.00 ? 52  SER A HG   5  
ATOM 7112  N N    . PRO A 1 53  ? -5.212  -6.533  1.332   1.00 0.00 ? 53  PRO A N    5  
ATOM 7113  C CA   . PRO A 1 53  ? -6.375  -6.442  2.219   1.00 0.00 ? 53  PRO A CA   5  
ATOM 7114  C C    . PRO A 1 53  ? -6.094  -7.014  3.604   1.00 0.00 ? 53  PRO A C    5  
ATOM 7115  O O    . PRO A 1 53  ? -6.799  -6.711  4.568   1.00 0.00 ? 53  PRO A O    5  
ATOM 7116  C CB   . PRO A 1 53  ? -7.436  -7.279  1.500   1.00 0.00 ? 53  PRO A CB   5  
ATOM 7117  C CG   . PRO A 1 53  ? -6.659  -8.242  0.669   1.00 0.00 ? 53  PRO A CG   5  
ATOM 7118  C CD   . PRO A 1 53  ? -5.410  -7.516  0.253   1.00 0.00 ? 53  PRO A CD   5  
ATOM 7119  H HA   . PRO A 1 53  ? -6.722  -5.423  2.315   1.00 0.00 ? 53  PRO A HA   5  
ATOM 7120  H HB2  . PRO A 1 53  ? -8.049  -7.790  2.229   1.00 0.00 ? 53  PRO A HB2  5  
ATOM 7121  H HB3  . PRO A 1 53  ? -8.052  -6.638  0.888   1.00 0.00 ? 53  PRO A HB3  5  
ATOM 7122  H HG2  . PRO A 1 53  ? -6.410  -9.114  1.254   1.00 0.00 ? 53  PRO A HG2  5  
ATOM 7123  H HG3  . PRO A 1 53  ? -7.235  -8.523  -0.200  1.00 0.00 ? 53  PRO A HG3  5  
ATOM 7124  H HD2  . PRO A 1 53  ? -4.576  -8.201  0.198   1.00 0.00 ? 53  PRO A HD2  5  
ATOM 7125  H HD3  . PRO A 1 53  ? -5.558  -7.022  -0.695  1.00 0.00 ? 53  PRO A HD3  5  
ATOM 7126  N N    . THR A 1 54  ? -5.058  -7.842  3.698   1.00 0.00 ? 54  THR A N    5  
ATOM 7127  C CA   . THR A 1 54  ? -4.684  -8.457  4.966   1.00 0.00 ? 54  THR A CA   5  
ATOM 7128  C C    . THR A 1 54  ? -3.480  -7.755  5.583   1.00 0.00 ? 54  THR A C    5  
ATOM 7129  O O    . THR A 1 54  ? -2.975  -8.169  6.626   1.00 0.00 ? 54  THR A O    5  
ATOM 7130  C CB   . THR A 1 54  ? -4.358  -9.952  4.790   1.00 0.00 ? 54  THR A CB   5  
ATOM 7131  O OG1  . THR A 1 54  ? -3.091  -10.104 4.140   1.00 0.00 ? 54  THR A OG1  5  
ATOM 7132  C CG2  . THR A 1 54  ? -5.438  -10.649 3.977   1.00 0.00 ? 54  THR A CG2  5  
ATOM 7133  H H    . THR A 1 54  ? -4.534  -8.044  2.895   1.00 0.00 ? 54  THR A H    5  
ATOM 7134  H HA   . THR A 1 54  ? -5.524  -8.369  5.640   1.00 0.00 ? 54  THR A HA   5  
ATOM 7135  H HB   . THR A 1 54  ? -4.310  -10.411 5.767   1.00 0.00 ? 54  THR A HB   5  
ATOM 7136  H HG1  . THR A 1 54  ? -2.615  -10.839 4.534   1.00 0.00 ? 54  THR A HG1  5  
ATOM 7137  H HG21 . THR A 1 54  ? -6.068  -11.228 4.637   1.00 0.00 ? 54  THR A HG21 5  
ATOM 7138  H HG22 . THR A 1 54  ? -4.977  -11.304 3.253   1.00 0.00 ? 54  THR A HG22 5  
ATOM 7139  H HG23 . THR A 1 54  ? -6.036  -9.911  3.466   1.00 0.00 ? 54  THR A HG23 5  
ATOM 7140  N N    . GLY A 1 55  ? -3.024  -6.689  4.932   1.00 0.00 ? 55  GLY A N    5  
ATOM 7141  C CA   . GLY A 1 55  ? -1.882  -5.946  5.433   1.00 0.00 ? 55  GLY A CA   5  
ATOM 7142  C C    . GLY A 1 55  ? -2.271  -4.923  6.481   1.00 0.00 ? 55  GLY A C    5  
ATOM 7143  O O    . GLY A 1 55  ? -3.455  -4.699  6.731   1.00 0.00 ? 55  GLY A O    5  
ATOM 7144  H H    . GLY A 1 55  ? -3.466  -6.404  4.105   1.00 0.00 ? 55  GLY A H    5  
ATOM 7145  H HA2  . GLY A 1 55  ? -1.177  -6.640  5.866   1.00 0.00 ? 55  GLY A HA2  5  
ATOM 7146  H HA3  . GLY A 1 55  ? -1.409  -5.435  4.607   1.00 0.00 ? 55  GLY A HA3  5  
ATOM 7147  N N    . ALA A 1 56  ? -1.271  -4.301  7.098   1.00 0.00 ? 56  ALA A N    5  
ATOM 7148  C CA   . ALA A 1 56  ? -1.515  -3.295  8.125   1.00 0.00 ? 56  ALA A CA   5  
ATOM 7149  C C    . ALA A 1 56  ? -2.327  -2.130  7.571   1.00 0.00 ? 56  ALA A C    5  
ATOM 7150  O O    . ALA A 1 56  ? -3.212  -1.602  8.244   1.00 0.00 ? 56  ALA A O    5  
ATOM 7151  C CB   . ALA A 1 56  ? -0.197  -2.797  8.699   1.00 0.00 ? 56  ALA A CB   5  
ATOM 7152  H H    . ALA A 1 56  ? -0.348  -4.522  6.855   1.00 0.00 ? 56  ALA A H    5  
ATOM 7153  H HA   . ALA A 1 56  ? -2.073  -3.763  8.924   1.00 0.00 ? 56  ALA A HA   5  
ATOM 7154  H HB1  . ALA A 1 56  ? 0.364   -2.294  7.925   1.00 0.00 ? 56  ALA A HB1  5  
ATOM 7155  H HB2  . ALA A 1 56  ? -0.394  -2.109  9.508   1.00 0.00 ? 56  ALA A HB2  5  
ATOM 7156  H HB3  . ALA A 1 56  ? 0.374   -3.636  9.070   1.00 0.00 ? 56  ALA A HB3  5  
ATOM 7157  N N    . ALA A 1 57  ? -2.020  -1.733  6.341   1.00 0.00 ? 57  ALA A N    5  
ATOM 7158  C CA   . ALA A 1 57  ? -2.722  -0.630  5.696   1.00 0.00 ? 57  ALA A CA   5  
ATOM 7159  C C    . ALA A 1 57  ? -4.160  -1.014  5.365   1.00 0.00 ? 57  ALA A C    5  
ATOM 7160  O O    . ALA A 1 57  ? -5.106  -0.404  5.862   1.00 0.00 ? 57  ALA A O    5  
ATOM 7161  C CB   . ALA A 1 57  ? -1.986  -0.200  4.436   1.00 0.00 ? 57  ALA A CB   5  
ATOM 7162  H H    . ALA A 1 57  ? -1.304  -2.193  5.855   1.00 0.00 ? 57  ALA A H    5  
ATOM 7163  H HA   . ALA A 1 57  ? -2.732  0.206   6.381   1.00 0.00 ? 57  ALA A HA   5  
ATOM 7164  H HB1  . ALA A 1 57  ? -1.284  0.584   4.681   1.00 0.00 ? 57  ALA A HB1  5  
ATOM 7165  H HB2  . ALA A 1 57  ? -1.454  -1.044  4.024   1.00 0.00 ? 57  ALA A HB2  5  
ATOM 7166  H HB3  . ALA A 1 57  ? -2.697  0.167   3.712   1.00 0.00 ? 57  ALA A HB3  5  
ATOM 7167  N N    . GLY A 1 58  ? -4.318  -2.030  4.522   1.00 0.00 ? 58  GLY A N    5  
ATOM 7168  C CA   . GLY A 1 58  ? -5.644  -2.477  4.139   1.00 0.00 ? 58  GLY A CA   5  
ATOM 7169  C C    . GLY A 1 58  ? -6.611  -2.492  5.306   1.00 0.00 ? 58  GLY A C    5  
ATOM 7170  O O    . GLY A 1 58  ? -7.777  -2.125  5.160   1.00 0.00 ? 58  GLY A O    5  
ATOM 7171  H H    . GLY A 1 58  ? -3.527  -2.480  4.157   1.00 0.00 ? 58  GLY A H    5  
ATOM 7172  H HA2  . GLY A 1 58  ? -6.028  -1.817  3.376   1.00 0.00 ? 58  GLY A HA2  5  
ATOM 7173  H HA3  . GLY A 1 58  ? -5.572  -3.476  3.734   1.00 0.00 ? 58  GLY A HA3  5  
ATOM 7174  N N    . ARG A 1 59  ? -6.127  -2.919  6.468   1.00 0.00 ? 59  ARG A N    5  
ATOM 7175  C CA   . ARG A 1 59  ? -6.957  -2.984  7.665   1.00 0.00 ? 59  ARG A CA   5  
ATOM 7176  C C    . ARG A 1 59  ? -7.043  -1.619  8.341   1.00 0.00 ? 59  ARG A C    5  
ATOM 7177  O O    . ARG A 1 59  ? -8.002  -1.328  9.056   1.00 0.00 ? 59  ARG A O    5  
ATOM 7178  C CB   . ARG A 1 59  ? -6.397  -4.016  8.645   1.00 0.00 ? 59  ARG A CB   5  
ATOM 7179  C CG   . ARG A 1 59  ? -5.109  -3.577  9.322   1.00 0.00 ? 59  ARG A CG   5  
ATOM 7180  C CD   . ARG A 1 59  ? -4.643  -4.598  10.348  1.00 0.00 ? 59  ARG A CD   5  
ATOM 7181  N NE   . ARG A 1 59  ? -3.901  -3.976  11.441  1.00 0.00 ? 59  ARG A NE   5  
ATOM 7182  C CZ   . ARG A 1 59  ? -3.613  -4.597  12.580  1.00 0.00 ? 59  ARG A CZ   5  
ATOM 7183  N NH1  . ARG A 1 59  ? -4.000  -5.850  12.772  1.00 0.00 ? 59  ARG A NH1  5  
ATOM 7184  N NH2  . ARG A 1 59  ? -2.934  -3.964  13.528  1.00 0.00 ? 59  ARG A NH2  5  
ATOM 7185  H H    . ARG A 1 59  ? -5.189  -3.199  6.522   1.00 0.00 ? 59  ARG A H    5  
ATOM 7186  H HA   . ARG A 1 59  ? -7.949  -3.287  7.364   1.00 0.00 ? 59  ARG A HA   5  
ATOM 7187  H HB2  . ARG A 1 59  ? -7.134  -4.205  9.411   1.00 0.00 ? 59  ARG A HB2  5  
ATOM 7188  H HB3  . ARG A 1 59  ? -6.203  -4.934  8.110   1.00 0.00 ? 59  ARG A HB3  5  
ATOM 7189  H HG2  . ARG A 1 59  ? -4.341  -3.460  8.572   1.00 0.00 ? 59  ARG A HG2  5  
ATOM 7190  H HG3  . ARG A 1 59  ? -5.278  -2.633  9.818   1.00 0.00 ? 59  ARG A HG3  5  
ATOM 7191  H HD2  . ARG A 1 59  ? -5.507  -5.103  10.753  1.00 0.00 ? 59  ARG A HD2  5  
ATOM 7192  H HD3  . ARG A 1 59  ? -4.005  -5.317  9.855   1.00 0.00 ? 59  ARG A HD3  5  
ATOM 7193  H HE   . ARG A 1 59  ? -3.605  -3.050  11.320  1.00 0.00 ? 59  ARG A HE   5  
ATOM 7194  H HH11 . ARG A 1 59  ? -4.511  -6.330  12.059  1.00 0.00 ? 59  ARG A HH11 5  
ATOM 7195  H HH12 . ARG A 1 59  ? -3.780  -6.316  13.630  1.00 0.00 ? 59  ARG A HH12 5  
ATOM 7196  H HH21 . ARG A 1 59  ? -2.640  -3.019  13.387  1.00 0.00 ? 59  ARG A HH21 5  
ATOM 7197  H HH22 . ARG A 1 59  ? -2.717  -4.432  14.385  1.00 0.00 ? 59  ARG A HH22 5  
ATOM 7198  N N    . ASP A 1 60  ? -6.034  -0.786  8.111   1.00 0.00 ? 60  ASP A N    5  
ATOM 7199  C CA   . ASP A 1 60  ? -5.995  0.549   8.697   1.00 0.00 ? 60  ASP A CA   5  
ATOM 7200  C C    . ASP A 1 60  ? -7.278  1.315   8.389   1.00 0.00 ? 60  ASP A C    5  
ATOM 7201  O O    . ASP A 1 60  ? -8.021  1.692   9.294   1.00 0.00 ? 60  ASP A O    5  
ATOM 7202  C CB   . ASP A 1 60  ? -4.785  1.324   8.173   1.00 0.00 ? 60  ASP A CB   5  
ATOM 7203  C CG   . ASP A 1 60  ? -4.597  2.651   8.882   1.00 0.00 ? 60  ASP A CG   5  
ATOM 7204  O OD1  . ASP A 1 60  ? -4.904  2.727   10.091  1.00 0.00 ? 60  ASP A OD1  5  
ATOM 7205  O OD2  . ASP A 1 60  ? -4.141  3.613   8.230   1.00 0.00 ? 60  ASP A OD2  5  
ATOM 7206  H H    . ASP A 1 60  ? -5.298  -1.075  7.532   1.00 0.00 ? 60  ASP A H    5  
ATOM 7207  H HA   . ASP A 1 60  ? -5.905  0.439   9.767   1.00 0.00 ? 60  ASP A HA   5  
ATOM 7208  H HB2  . ASP A 1 60  ? -3.895  0.730   8.318   1.00 0.00 ? 60  ASP A HB2  5  
ATOM 7209  H HB3  . ASP A 1 60  ? -4.917  1.516   7.119   1.00 0.00 ? 60  ASP A HB3  5  
ATOM 7210  N N    . GLY A 1 61  ? -7.531  1.543   7.103   1.00 0.00 ? 61  GLY A N    5  
ATOM 7211  C CA   . GLY A 1 61  ? -8.724  2.264   6.699   1.00 0.00 ? 61  GLY A CA   5  
ATOM 7212  C C    . GLY A 1 61  ? -8.407  3.627   6.114   1.00 0.00 ? 61  GLY A C    5  
ATOM 7213  O O    . GLY A 1 61  ? -9.251  4.239   5.459   1.00 0.00 ? 61  GLY A O    5  
ATOM 7214  H H    . GLY A 1 61  ? -6.903  1.219   6.424   1.00 0.00 ? 61  GLY A H    5  
ATOM 7215  H HA2  . GLY A 1 61  ? -9.251  1.680   5.960   1.00 0.00 ? 61  GLY A HA2  5  
ATOM 7216  H HA3  . GLY A 1 61  ? -9.361  2.395   7.561   1.00 0.00 ? 61  GLY A HA3  5  
ATOM 7217  N N    . ARG A 1 62  ? -7.190  4.102   6.352   1.00 0.00 ? 62  ARG A N    5  
ATOM 7218  C CA   . ARG A 1 62  ? -6.765  5.402   5.847   1.00 0.00 ? 62  ARG A CA   5  
ATOM 7219  C C    . ARG A 1 62  ? -5.874  5.243   4.618   1.00 0.00 ? 62  ARG A C    5  
ATOM 7220  O O    . ARG A 1 62  ? -5.836  6.114   3.748   1.00 0.00 ? 62  ARG A O    5  
ATOM 7221  C CB   . ARG A 1 62  ? -6.019  6.177   6.934   1.00 0.00 ? 62  ARG A CB   5  
ATOM 7222  C CG   . ARG A 1 62  ? -6.586  5.969   8.329   1.00 0.00 ? 62  ARG A CG   5  
ATOM 7223  C CD   . ARG A 1 62  ? -7.762  6.895   8.596   1.00 0.00 ? 62  ARG A CD   5  
ATOM 7224  N NE   . ARG A 1 62  ? -8.910  6.581   7.750   1.00 0.00 ? 62  ARG A NE   5  
ATOM 7225  C CZ   . ARG A 1 62  ? -9.868  7.453   7.458   1.00 0.00 ? 62  ARG A CZ   5  
ATOM 7226  N NH1  . ARG A 1 62  ? -9.817  8.686   7.941   1.00 0.00 ? 62  ARG A NH1  5  
ATOM 7227  N NH2  . ARG A 1 62  ? -10.881 7.091   6.681   1.00 0.00 ? 62  ARG A NH2  5  
ATOM 7228  H H    . ARG A 1 62  ? -6.562  3.567   6.881   1.00 0.00 ? 62  ARG A H    5  
ATOM 7229  H HA   . ARG A 1 62  ? -7.649  5.954   5.566   1.00 0.00 ? 62  ARG A HA   5  
ATOM 7230  H HB2  . ARG A 1 62  ? -4.985  5.863   6.939   1.00 0.00 ? 62  ARG A HB2  5  
ATOM 7231  H HB3  . ARG A 1 62  ? -6.065  7.231   6.704   1.00 0.00 ? 62  ARG A HB3  5  
ATOM 7232  H HG2  . ARG A 1 62  ? -6.920  4.946   8.423   1.00 0.00 ? 62  ARG A HG2  5  
ATOM 7233  H HG3  . ARG A 1 62  ? -5.811  6.165   9.055   1.00 0.00 ? 62  ARG A HG3  5  
ATOM 7234  H HD2  . ARG A 1 62  ? -8.052  6.797   9.632   1.00 0.00 ? 62  ARG A HD2  5  
ATOM 7235  H HD3  . ARG A 1 62  ? -7.452  7.912   8.404   1.00 0.00 ? 62  ARG A HD3  5  
ATOM 7236  H HE   . ARG A 1 62  ? -8.968  5.675   7.382   1.00 0.00 ? 62  ARG A HE   5  
ATOM 7237  H HH11 . ARG A 1 62  ? -9.054  8.962   8.526   1.00 0.00 ? 62  ARG A HH11 5  
ATOM 7238  H HH12 . ARG A 1 62  ? -10.539 9.341   7.719   1.00 0.00 ? 62  ARG A HH12 5  
ATOM 7239  H HH21 . ARG A 1 62  ? -10.924 6.162   6.315   1.00 0.00 ? 62  ARG A HH21 5  
ATOM 7240  H HH22 . ARG A 1 62  ? -11.602 7.748   6.462   1.00 0.00 ? 62  ARG A HH22 5  
ATOM 7241  N N    . LEU A 1 63  ? -5.158  4.126   4.554   1.00 0.00 ? 63  LEU A N    5  
ATOM 7242  C CA   . LEU A 1 63  ? -4.267  3.852   3.432   1.00 0.00 ? 63  LEU A CA   5  
ATOM 7243  C C    . LEU A 1 63  ? -5.016  3.162   2.296   1.00 0.00 ? 63  LEU A C    5  
ATOM 7244  O O    . LEU A 1 63  ? -5.776  2.221   2.523   1.00 0.00 ? 63  LEU A O    5  
ATOM 7245  C CB   . LEU A 1 63  ? -3.094  2.982   3.887   1.00 0.00 ? 63  LEU A CB   5  
ATOM 7246  C CG   . LEU A 1 63  ? -1.908  2.896   2.926   1.00 0.00 ? 63  LEU A CG   5  
ATOM 7247  C CD1  . LEU A 1 63  ? -2.357  2.375   1.570   1.00 0.00 ? 63  LEU A CD1  5  
ATOM 7248  C CD2  . LEU A 1 63  ? -1.240  4.256   2.782   1.00 0.00 ? 63  LEU A CD2  5  
ATOM 7249  H H    . LEU A 1 63  ? -5.230  3.469   5.277   1.00 0.00 ? 63  LEU A H    5  
ATOM 7250  H HA   . LEU A 1 63  ? -3.885  4.797   3.074   1.00 0.00 ? 63  LEU A HA   5  
ATOM 7251  H HB2  . LEU A 1 63  ? -2.733  3.378   4.824   1.00 0.00 ? 63  LEU A HB2  5  
ATOM 7252  H HB3  . LEU A 1 63  ? -3.468  1.980   4.043   1.00 0.00 ? 63  LEU A HB3  5  
ATOM 7253  H HG   . LEU A 1 63  ? -1.179  2.205   3.324   1.00 0.00 ? 63  LEU A HG   5  
ATOM 7254  H HD11 . LEU A 1 63  ? -2.592  3.207   0.924   1.00 0.00 ? 63  LEU A HD11 5  
ATOM 7255  H HD12 . LEU A 1 63  ? -3.234  1.756   1.694   1.00 0.00 ? 63  LEU A HD12 5  
ATOM 7256  H HD13 . LEU A 1 63  ? -1.564  1.789   1.129   1.00 0.00 ? 63  LEU A HD13 5  
ATOM 7257  H HD21 . LEU A 1 63  ? -0.192  4.119   2.560   1.00 0.00 ? 63  LEU A HD21 5  
ATOM 7258  H HD22 . LEU A 1 63  ? -1.343  4.808   3.705   1.00 0.00 ? 63  LEU A HD22 5  
ATOM 7259  H HD23 . LEU A 1 63  ? -1.710  4.805   1.979   1.00 0.00 ? 63  LEU A HD23 5  
ATOM 7260  N N    . ARG A 1 64  ? -4.795  3.636   1.075   1.00 0.00 ? 64  ARG A N    5  
ATOM 7261  C CA   . ARG A 1 64  ? -5.449  3.064   -0.096  1.00 0.00 ? 64  ARG A CA   5  
ATOM 7262  C C    . ARG A 1 64  ? -4.648  3.354   -1.362  1.00 0.00 ? 64  ARG A C    5  
ATOM 7263  O O    . ARG A 1 64  ? -3.961  4.372   -1.455  1.00 0.00 ? 64  ARG A O    5  
ATOM 7264  C CB   . ARG A 1 64  ? -6.867  3.621   -0.238  1.00 0.00 ? 64  ARG A CB   5  
ATOM 7265  C CG   . ARG A 1 64  ? -6.958  5.121   -0.009  1.00 0.00 ? 64  ARG A CG   5  
ATOM 7266  C CD   . ARG A 1 64  ? -6.746  5.896   -1.300  1.00 0.00 ? 64  ARG A CD   5  
ATOM 7267  N NE   . ARG A 1 64  ? -7.902  5.806   -2.188  1.00 0.00 ? 64  ARG A NE   5  
ATOM 7268  C CZ   . ARG A 1 64  ? -8.082  6.594   -3.242  1.00 0.00 ? 64  ARG A CZ   5  
ATOM 7269  N NH1  . ARG A 1 64  ? -7.185  7.525   -3.539  1.00 0.00 ? 64  ARG A NH1  5  
ATOM 7270  N NH2  . ARG A 1 64  ? -9.160  6.451   -4.002  1.00 0.00 ? 64  ARG A NH2  5  
ATOM 7271  H H    . ARG A 1 64  ? -4.178  4.389   0.958   1.00 0.00 ? 64  ARG A H    5  
ATOM 7272  H HA   . ARG A 1 64  ? -5.504  1.995   0.043   1.00 0.00 ? 64  ARG A HA   5  
ATOM 7273  H HB2  . ARG A 1 64  ? -7.226  3.409   -1.235  1.00 0.00 ? 64  ARG A HB2  5  
ATOM 7274  H HB3  . ARG A 1 64  ? -7.507  3.129   0.478   1.00 0.00 ? 64  ARG A HB3  5  
ATOM 7275  H HG2  . ARG A 1 64  ? -7.936  5.357   0.384   1.00 0.00 ? 64  ARG A HG2  5  
ATOM 7276  H HG3  . ARG A 1 64  ? -6.201  5.413   0.705   1.00 0.00 ? 64  ARG A HG3  5  
ATOM 7277  H HD2  . ARG A 1 64  ? -6.571  6.933   -1.056  1.00 0.00 ? 64  ARG A HD2  5  
ATOM 7278  H HD3  . ARG A 1 64  ? -5.882  5.494   -1.807  1.00 0.00 ? 64  ARG A HD3  5  
ATOM 7279  H HE   . ARG A 1 64  ? -8.577  5.125   -1.987  1.00 0.00 ? 64  ARG A HE   5  
ATOM 7280  H HH11 . ARG A 1 64  ? -6.372  7.634   -2.968  1.00 0.00 ? 64  ARG A HH11 5  
ATOM 7281  H HH12 . ARG A 1 64  ? -7.322  8.116   -4.334  1.00 0.00 ? 64  ARG A HH12 5  
ATOM 7282  H HH21 . ARG A 1 64  ? -9.838  5.750   -3.782  1.00 0.00 ? 64  ARG A HH21 5  
ATOM 7283  H HH22 . ARG A 1 64  ? -9.294  7.044   -4.795  1.00 0.00 ? 64  ARG A HH22 5  
ATOM 7284  N N    . VAL A 1 65  ? -4.740  2.453   -2.335  1.00 0.00 ? 65  VAL A N    5  
ATOM 7285  C CA   . VAL A 1 65  ? -4.025  2.612   -3.595  1.00 0.00 ? 65  VAL A CA   5  
ATOM 7286  C C    . VAL A 1 65  ? -4.384  3.932   -4.268  1.00 0.00 ? 65  VAL A C    5  
ATOM 7287  O O    . VAL A 1 65  ? -5.464  4.075   -4.841  1.00 0.00 ? 65  VAL A O    5  
ATOM 7288  C CB   . VAL A 1 65  ? -4.331  1.455   -4.564  1.00 0.00 ? 65  VAL A CB   5  
ATOM 7289  C CG1  . VAL A 1 65  ? -3.503  1.588   -5.833  1.00 0.00 ? 65  VAL A CG1  5  
ATOM 7290  C CG2  . VAL A 1 65  ? -4.077  0.115   -3.890  1.00 0.00 ? 65  VAL A CG2  5  
ATOM 7291  H H    . VAL A 1 65  ? -5.304  1.663   -2.202  1.00 0.00 ? 65  VAL A H    5  
ATOM 7292  H HA   . VAL A 1 65  ? -2.966  2.605   -3.382  1.00 0.00 ? 65  VAL A HA   5  
ATOM 7293  H HB   . VAL A 1 65  ? -5.375  1.505   -4.835  1.00 0.00 ? 65  VAL A HB   5  
ATOM 7294  H HG11 . VAL A 1 65  ? -2.455  1.484   -5.592  1.00 0.00 ? 65  VAL A HG11 5  
ATOM 7295  H HG12 . VAL A 1 65  ? -3.790  0.817   -6.533  1.00 0.00 ? 65  VAL A HG12 5  
ATOM 7296  H HG13 . VAL A 1 65  ? -3.675  2.558   -6.275  1.00 0.00 ? 65  VAL A HG13 5  
ATOM 7297  H HG21 . VAL A 1 65  ? -4.625  0.071   -2.961  1.00 0.00 ? 65  VAL A HG21 5  
ATOM 7298  H HG22 . VAL A 1 65  ? -4.406  -0.684  -4.540  1.00 0.00 ? 65  VAL A HG22 5  
ATOM 7299  H HG23 . VAL A 1 65  ? -3.021  0.006   -3.692  1.00 0.00 ? 65  VAL A HG23 5  
ATOM 7300  N N    . GLY A 1 66  ? -3.471  4.896   -4.195  1.00 0.00 ? 66  GLY A N    5  
ATOM 7301  C CA   . GLY A 1 66  ? -3.710  6.192   -4.801  1.00 0.00 ? 66  GLY A CA   5  
ATOM 7302  C C    . GLY A 1 66  ? -3.078  7.325   -4.017  1.00 0.00 ? 66  GLY A C    5  
ATOM 7303  O O    . GLY A 1 66  ? -2.975  8.449   -4.509  1.00 0.00 ? 66  GLY A O    5  
ATOM 7304  H H    . GLY A 1 66  ? -2.628  4.725   -3.724  1.00 0.00 ? 66  GLY A H    5  
ATOM 7305  H HA2  . GLY A 1 66  ? -3.304  6.190   -5.802  1.00 0.00 ? 66  GLY A HA2  5  
ATOM 7306  H HA3  . GLY A 1 66  ? -4.776  6.360   -4.857  1.00 0.00 ? 66  GLY A HA3  5  
ATOM 7307  N N    . LEU A 1 67  ? -2.654  7.030   -2.793  1.00 0.00 ? 67  LEU A N    5  
ATOM 7308  C CA   . LEU A 1 67  ? -2.029  8.033   -1.938  1.00 0.00 ? 67  LEU A CA   5  
ATOM 7309  C C    . LEU A 1 67  ? -0.544  8.173   -2.258  1.00 0.00 ? 67  LEU A C    5  
ATOM 7310  O O    . LEU A 1 67  ? 0.206   7.198   -2.211  1.00 0.00 ? 67  LEU A O    5  
ATOM 7311  C CB   . LEU A 1 67  ? -2.212  7.662   -0.465  1.00 0.00 ? 67  LEU A CB   5  
ATOM 7312  C CG   . LEU A 1 67  ? -3.656  7.542   0.022   1.00 0.00 ? 67  LEU A CG   5  
ATOM 7313  C CD1  . LEU A 1 67  ? -3.695  7.063   1.465   1.00 0.00 ? 67  LEU A CD1  5  
ATOM 7314  C CD2  . LEU A 1 67  ? -4.379  8.874   -0.119  1.00 0.00 ? 67  LEU A CD2  5  
ATOM 7315  H H    . LEU A 1 67  ? -2.763  6.117   -2.456  1.00 0.00 ? 67  LEU A H    5  
ATOM 7316  H HA   . LEU A 1 67  ? -2.516  8.978   -2.125  1.00 0.00 ? 67  LEU A HA   5  
ATOM 7317  H HB2  . LEU A 1 67  ? -1.728  6.711   -0.302  1.00 0.00 ? 67  LEU A HB2  5  
ATOM 7318  H HB3  . LEU A 1 67  ? -1.722  8.420   0.130   1.00 0.00 ? 67  LEU A HB3  5  
ATOM 7319  H HG   . LEU A 1 67  ? -4.175  6.813   -0.584  1.00 0.00 ? 67  LEU A HG   5  
ATOM 7320  H HD11 . LEU A 1 67  ? -4.617  6.532   1.644   1.00 0.00 ? 67  LEU A HD11 5  
ATOM 7321  H HD12 . LEU A 1 67  ? -3.635  7.914   2.128   1.00 0.00 ? 67  LEU A HD12 5  
ATOM 7322  H HD13 . LEU A 1 67  ? -2.858  6.405   1.648   1.00 0.00 ? 67  LEU A HD13 5  
ATOM 7323  H HD21 . LEU A 1 67  ? -5.240  8.749   -0.758  1.00 0.00 ? 67  LEU A HD21 5  
ATOM 7324  H HD22 . LEU A 1 67  ? -3.710  9.602   -0.555  1.00 0.00 ? 67  LEU A HD22 5  
ATOM 7325  H HD23 . LEU A 1 67  ? -4.698  9.215   0.854   1.00 0.00 ? 67  LEU A HD23 5  
ATOM 7326  N N    . ARG A 1 68  ? -0.126  9.393   -2.581  1.00 0.00 ? 68  ARG A N    5  
ATOM 7327  C CA   . ARG A 1 68  ? 1.269   9.661   -2.907  1.00 0.00 ? 68  ARG A CA   5  
ATOM 7328  C C    . ARG A 1 68  ? 2.140   9.608   -1.656  1.00 0.00 ? 68  ARG A C    5  
ATOM 7329  O O    . ARG A 1 68  ? 1.875   10.300  -0.672  1.00 0.00 ? 68  ARG A O    5  
ATOM 7330  C CB   . ARG A 1 68  ? 1.404   11.029  -3.578  1.00 0.00 ? 68  ARG A CB   5  
ATOM 7331  C CG   . ARG A 1 68  ? 2.838   11.402  -3.917  1.00 0.00 ? 68  ARG A CG   5  
ATOM 7332  C CD   . ARG A 1 68  ? 2.970   12.886  -4.223  1.00 0.00 ? 68  ARG A CD   5  
ATOM 7333  N NE   . ARG A 1 68  ? 4.189   13.185  -4.969  1.00 0.00 ? 68  ARG A NE   5  
ATOM 7334  C CZ   . ARG A 1 68  ? 4.463   14.379  -5.483  1.00 0.00 ? 68  ARG A CZ   5  
ATOM 7335  N NH1  . ARG A 1 68  ? 3.608   15.381  -5.331  1.00 0.00 ? 68  ARG A NH1  5  
ATOM 7336  N NH2  . ARG A 1 68  ? 5.593   14.573  -6.149  1.00 0.00 ? 68  ARG A NH2  5  
ATOM 7337  H H    . ARG A 1 68  ? -0.772  10.130  -2.600  1.00 0.00 ? 68  ARG A H    5  
ATOM 7338  H HA   . ARG A 1 68  ? 1.601   8.898   -3.595  1.00 0.00 ? 68  ARG A HA   5  
ATOM 7339  H HB2  . ARG A 1 68  ? 0.831   11.027  -4.493  1.00 0.00 ? 68  ARG A HB2  5  
ATOM 7340  H HB3  . ARG A 1 68  ? 1.006   11.782  -2.915  1.00 0.00 ? 68  ARG A HB3  5  
ATOM 7341  H HG2  . ARG A 1 68  ? 3.471   11.162  -3.076  1.00 0.00 ? 68  ARG A HG2  5  
ATOM 7342  H HG3  . ARG A 1 68  ? 3.153   10.836  -4.781  1.00 0.00 ? 68  ARG A HG3  5  
ATOM 7343  H HD2  . ARG A 1 68  ? 2.117   13.197  -4.807  1.00 0.00 ? 68  ARG A HD2  5  
ATOM 7344  H HD3  . ARG A 1 68  ? 2.987   13.432  -3.291  1.00 0.00 ? 68  ARG A HD3  5  
ATOM 7345  H HE   . ARG A 1 68  ? 4.835   12.459  -5.093  1.00 0.00 ? 68  ARG A HE   5  
ATOM 7346  H HH11 . ARG A 1 68  ? 2.755   15.238  -4.829  1.00 0.00 ? 68  ARG A HH11 5  
ATOM 7347  H HH12 . ARG A 1 68  ? 3.816   16.280  -5.718  1.00 0.00 ? 68  ARG A HH12 5  
ATOM 7348  H HH21 . ARG A 1 68  ? 6.241   13.820  -6.265  1.00 0.00 ? 68  ARG A HH21 5  
ATOM 7349  H HH22 . ARG A 1 68  ? 5.798   15.472  -6.536  1.00 0.00 ? 68  ARG A HH22 5  
ATOM 7350  N N    . LEU A 1 69  ? 3.181   8.783   -1.700  1.00 0.00 ? 69  LEU A N    5  
ATOM 7351  C CA   . LEU A 1 69  ? 4.091   8.639   -0.570  1.00 0.00 ? 69  LEU A CA   5  
ATOM 7352  C C    . LEU A 1 69  ? 5.006   9.854   -0.449  1.00 0.00 ? 69  LEU A C    5  
ATOM 7353  O O    . LEU A 1 69  ? 5.920   10.039  -1.253  1.00 0.00 ? 69  LEU A O    5  
ATOM 7354  C CB   . LEU A 1 69  ? 4.930   7.369   -0.723  1.00 0.00 ? 69  LEU A CB   5  
ATOM 7355  C CG   . LEU A 1 69  ? 4.436   6.142   0.044   1.00 0.00 ? 69  LEU A CG   5  
ATOM 7356  C CD1  . LEU A 1 69  ? 4.767   6.268   1.523   1.00 0.00 ? 69  LEU A CD1  5  
ATOM 7357  C CD2  . LEU A 1 69  ? 2.939   5.955   -0.156  1.00 0.00 ? 69  LEU A CD2  5  
ATOM 7358  H H    . LEU A 1 69  ? 3.341   8.258   -2.511  1.00 0.00 ? 69  LEU A H    5  
ATOM 7359  H HA   . LEU A 1 69  ? 3.496   8.561   0.328   1.00 0.00 ? 69  LEU A HA   5  
ATOM 7360  H HB2  . LEU A 1 69  ? 4.956   7.115   -1.772  1.00 0.00 ? 69  LEU A HB2  5  
ATOM 7361  H HB3  . LEU A 1 69  ? 5.932   7.592   -0.384  1.00 0.00 ? 69  LEU A HB3  5  
ATOM 7362  H HG   . LEU A 1 69  ? 4.937   5.262   -0.336  1.00 0.00 ? 69  LEU A HG   5  
ATOM 7363  H HD11 . LEU A 1 69  ? 5.314   5.395   1.845   1.00 0.00 ? 69  LEU A HD11 5  
ATOM 7364  H HD12 . LEU A 1 69  ? 3.852   6.349   2.090   1.00 0.00 ? 69  LEU A HD12 5  
ATOM 7365  H HD13 . LEU A 1 69  ? 5.369   7.151   1.683   1.00 0.00 ? 69  LEU A HD13 5  
ATOM 7366  H HD21 . LEU A 1 69  ? 2.516   6.858   -0.570  1.00 0.00 ? 69  LEU A HD21 5  
ATOM 7367  H HD22 . LEU A 1 69  ? 2.473   5.743   0.795   1.00 0.00 ? 69  LEU A HD22 5  
ATOM 7368  H HD23 . LEU A 1 69  ? 2.766   5.132   -0.834  1.00 0.00 ? 69  LEU A HD23 5  
ATOM 7369  N N    . LEU A 1 70  ? 4.755   10.679  0.562   1.00 0.00 ? 70  LEU A N    5  
ATOM 7370  C CA   . LEU A 1 70  ? 5.557   11.875  0.791   1.00 0.00 ? 70  LEU A CA   5  
ATOM 7371  C C    . LEU A 1 70  ? 6.784   11.555  1.638   1.00 0.00 ? 70  LEU A C    5  
ATOM 7372  O O    . LEU A 1 70  ? 7.903   11.934  1.293   1.00 0.00 ? 70  LEU A O    5  
ATOM 7373  C CB   . LEU A 1 70  ? 4.716   12.953  1.478   1.00 0.00 ? 70  LEU A CB   5  
ATOM 7374  C CG   . LEU A 1 70  ? 3.679   13.656  0.601   1.00 0.00 ? 70  LEU A CG   5  
ATOM 7375  C CD1  . LEU A 1 70  ? 2.783   14.548  1.446   1.00 0.00 ? 70  LEU A CD1  5  
ATOM 7376  C CD2  . LEU A 1 70  ? 4.364   14.465  -0.491  1.00 0.00 ? 70  LEU A CD2  5  
ATOM 7377  H H    . LEU A 1 70  ? 4.013   10.479  1.170   1.00 0.00 ? 70  LEU A H    5  
ATOM 7378  H HA   . LEU A 1 70  ? 5.883   12.244  -0.170  1.00 0.00 ? 70  LEU A HA   5  
ATOM 7379  H HB2  . LEU A 1 70  ? 4.194   12.490  2.301   1.00 0.00 ? 70  LEU A HB2  5  
ATOM 7380  H HB3  . LEU A 1 70  ? 5.392   13.705  1.860   1.00 0.00 ? 70  LEU A HB3  5  
ATOM 7381  H HG   . LEU A 1 70  ? 3.055   12.912  0.125   1.00 0.00 ? 70  LEU A HG   5  
ATOM 7382  H HD11 . LEU A 1 70  ? 1.830   14.064  1.594   1.00 0.00 ? 70  LEU A HD11 5  
ATOM 7383  H HD12 . LEU A 1 70  ? 2.633   15.490  0.939   1.00 0.00 ? 70  LEU A HD12 5  
ATOM 7384  H HD13 . LEU A 1 70  ? 3.251   14.725  2.403   1.00 0.00 ? 70  LEU A HD13 5  
ATOM 7385  H HD21 . LEU A 1 70  ? 5.423   14.256  -0.482  1.00 0.00 ? 70  LEU A HD21 5  
ATOM 7386  H HD22 . LEU A 1 70  ? 4.204   15.519  -0.312  1.00 0.00 ? 70  LEU A HD22 5  
ATOM 7387  H HD23 . LEU A 1 70  ? 3.951   14.195  -1.451  1.00 0.00 ? 70  LEU A HD23 5  
ATOM 7388  N N    . GLU A 1 71  ? 6.566   10.853  2.745   1.00 0.00 ? 71  GLU A N    5  
ATOM 7389  C CA   . GLU A 1 71  ? 7.655   10.481  3.640   1.00 0.00 ? 71  GLU A CA   5  
ATOM 7390  C C    . GLU A 1 71  ? 7.262   9.291   4.510   1.00 0.00 ? 71  GLU A C    5  
ATOM 7391  O O    . GLU A 1 71  ? 6.139   9.217   5.009   1.00 0.00 ? 71  GLU A O    5  
ATOM 7392  C CB   . GLU A 1 71  ? 8.046   11.667  4.525   1.00 0.00 ? 71  GLU A CB   5  
ATOM 7393  C CG   . GLU A 1 71  ? 8.064   12.996  3.788   1.00 0.00 ? 71  GLU A CG   5  
ATOM 7394  C CD   . GLU A 1 71  ? 8.353   14.167  4.706   1.00 0.00 ? 71  GLU A CD   5  
ATOM 7395  O OE1  . GLU A 1 71  ? 8.842   13.932  5.831   1.00 0.00 ? 71  GLU A OE1  5  
ATOM 7396  O OE2  . GLU A 1 71  ? 8.089   15.319  4.301   1.00 0.00 ? 71  GLU A OE2  5  
ATOM 7397  H H    . GLU A 1 71  ? 5.651   10.580  2.966   1.00 0.00 ? 71  GLU A H    5  
ATOM 7398  H HA   . GLU A 1 71  ? 8.503   10.202  3.032   1.00 0.00 ? 71  GLU A HA   5  
ATOM 7399  H HB2  . GLU A 1 71  ? 7.342   11.739  5.340   1.00 0.00 ? 71  GLU A HB2  5  
ATOM 7400  H HB3  . GLU A 1 71  ? 9.032   11.489  4.928   1.00 0.00 ? 71  GLU A HB3  5  
ATOM 7401  H HG2  . GLU A 1 71  ? 8.827   12.960  3.025   1.00 0.00 ? 71  GLU A HG2  5  
ATOM 7402  H HG3  . GLU A 1 71  ? 7.100   13.149  3.325   1.00 0.00 ? 71  GLU A HG3  5  
ATOM 7403  N N    . VAL A 1 72  ? 8.195   8.361   4.688   1.00 0.00 ? 72  VAL A N    5  
ATOM 7404  C CA   . VAL A 1 72  ? 7.947   7.174   5.498   1.00 0.00 ? 72  VAL A CA   5  
ATOM 7405  C C    . VAL A 1 72  ? 8.800   7.184   6.762   1.00 0.00 ? 72  VAL A C    5  
ATOM 7406  O O    . VAL A 1 72  ? 10.018  7.029   6.702   1.00 0.00 ? 72  VAL A O    5  
ATOM 7407  C CB   . VAL A 1 72  ? 8.236   5.884   4.707   1.00 0.00 ? 72  VAL A CB   5  
ATOM 7408  C CG1  . VAL A 1 72  ? 8.076   4.663   5.599   1.00 0.00 ? 72  VAL A CG1  5  
ATOM 7409  C CG2  . VAL A 1 72  ? 7.326   5.790   3.492   1.00 0.00 ? 72  VAL A CG2  5  
ATOM 7410  H H    . VAL A 1 72  ? 9.071   8.476   4.264   1.00 0.00 ? 72  VAL A H    5  
ATOM 7411  H HA   . VAL A 1 72  ? 6.904   7.173   5.778   1.00 0.00 ? 72  VAL A HA   5  
ATOM 7412  H HB   . VAL A 1 72  ? 9.259   5.919   4.362   1.00 0.00 ? 72  VAL A HB   5  
ATOM 7413  H HG11 . VAL A 1 72  ? 7.363   3.984   5.156   1.00 0.00 ? 72  VAL A HG11 5  
ATOM 7414  H HG12 . VAL A 1 72  ? 9.030   4.167   5.705   1.00 0.00 ? 72  VAL A HG12 5  
ATOM 7415  H HG13 . VAL A 1 72  ? 7.722   4.972   6.572   1.00 0.00 ? 72  VAL A HG13 5  
ATOM 7416  H HG21 . VAL A 1 72  ? 6.336   6.129   3.758   1.00 0.00 ? 72  VAL A HG21 5  
ATOM 7417  H HG22 . VAL A 1 72  ? 7.718   6.410   2.698   1.00 0.00 ? 72  VAL A HG22 5  
ATOM 7418  H HG23 . VAL A 1 72  ? 7.277   4.764   3.156   1.00 0.00 ? 72  VAL A HG23 5  
ATOM 7419  N N    . ASN A 1 73  ? 8.149   7.366   7.906   1.00 0.00 ? 73  ASN A N    5  
ATOM 7420  C CA   . ASN A 1 73  ? 8.847   7.396   9.186   1.00 0.00 ? 73  ASN A CA   5  
ATOM 7421  C C    . ASN A 1 73  ? 9.778   8.602   9.270   1.00 0.00 ? 73  ASN A C    5  
ATOM 7422  O O    . ASN A 1 73  ? 10.896  8.502   9.774   1.00 0.00 ? 73  ASN A O    5  
ATOM 7423  C CB   . ASN A 1 73  ? 9.647   6.107   9.385   1.00 0.00 ? 73  ASN A CB   5  
ATOM 7424  C CG   . ASN A 1 73  ? 8.866   5.055   10.149  1.00 0.00 ? 73  ASN A CG   5  
ATOM 7425  O OD1  . ASN A 1 73  ? 8.013   5.377   10.976  1.00 0.00 ? 73  ASN A OD1  5  
ATOM 7426  N ND2  . ASN A 1 73  ? 9.155   3.788   9.875   1.00 0.00 ? 73  ASN A ND2  5  
ATOM 7427  H H    . ASN A 1 73  ? 7.176   7.484   7.890   1.00 0.00 ? 73  ASN A H    5  
ATOM 7428  H HA   . ASN A 1 73  ? 8.105   7.473   9.967   1.00 0.00 ? 73  ASN A HA   5  
ATOM 7429  H HB2  . ASN A 1 73  ? 9.909   5.701   8.419   1.00 0.00 ? 73  ASN A HB2  5  
ATOM 7430  H HB3  . ASN A 1 73  ? 10.548  6.330   9.935   1.00 0.00 ? 73  ASN A HB3  5  
ATOM 7431  H HD21 . ASN A 1 73  ? 9.847   3.606   9.204   1.00 0.00 ? 73  ASN A HD21 5  
ATOM 7432  H HD22 . ASN A 1 73  ? 8.666   3.088   10.354  1.00 0.00 ? 73  ASN A HD22 5  
ATOM 7433  N N    . GLN A 1 74  ? 9.307   9.742   8.773   1.00 0.00 ? 74  GLN A N    5  
ATOM 7434  C CA   . GLN A 1 74  ? 10.097  10.967  8.792   1.00 0.00 ? 74  GLN A CA   5  
ATOM 7435  C C    . GLN A 1 74  ? 11.343  10.825  7.925   1.00 0.00 ? 74  GLN A C    5  
ATOM 7436  O O    . GLN A 1 74  ? 12.384  11.412  8.218   1.00 0.00 ? 74  GLN A O    5  
ATOM 7437  C CB   . GLN A 1 74  ? 10.497  11.319  10.226  1.00 0.00 ? 74  GLN A CB   5  
ATOM 7438  C CG   . GLN A 1 74  ? 9.328   11.758  11.094  1.00 0.00 ? 74  GLN A CG   5  
ATOM 7439  C CD   . GLN A 1 74  ? 9.594   11.563  12.573  1.00 0.00 ? 74  GLN A CD   5  
ATOM 7440  O OE1  . GLN A 1 74  ? 10.362  12.309  13.182  1.00 0.00 ? 74  GLN A OE1  5  
ATOM 7441  N NE2  . GLN A 1 74  ? 8.958   10.557  13.162  1.00 0.00 ? 74  GLN A NE2  5  
ATOM 7442  H H    . GLN A 1 74  ? 8.408   9.759   8.385   1.00 0.00 ? 74  GLN A H    5  
ATOM 7443  H HA   . GLN A 1 74  ? 9.485   11.762  8.394   1.00 0.00 ? 74  GLN A HA   5  
ATOM 7444  H HB2  . GLN A 1 74  ? 10.951  10.453  10.684  1.00 0.00 ? 74  GLN A HB2  5  
ATOM 7445  H HB3  . GLN A 1 74  ? 11.218  12.122  10.199  1.00 0.00 ? 74  GLN A HB3  5  
ATOM 7446  H HG2  . GLN A 1 74  ? 9.136   12.806  10.913  1.00 0.00 ? 74  GLN A HG2  5  
ATOM 7447  H HG3  . GLN A 1 74  ? 8.457   11.182  10.820  1.00 0.00 ? 74  GLN A HG3  5  
ATOM 7448  H HE21 . GLN A 1 74  ? 8.362   10.003  12.614  1.00 0.00 ? 74  GLN A HE21 5  
ATOM 7449  H HE22 . GLN A 1 74  ? 9.112   10.407  14.117  1.00 0.00 ? 74  GLN A HE22 5  
ATOM 7450  N N    . GLN A 1 75  ? 11.228  10.042  6.857   1.00 0.00 ? 75  GLN A N    5  
ATOM 7451  C CA   . GLN A 1 75  ? 12.347  9.823   5.947   1.00 0.00 ? 75  GLN A CA   5  
ATOM 7452  C C    . GLN A 1 75  ? 11.943  10.117  4.507   1.00 0.00 ? 75  GLN A C    5  
ATOM 7453  O O    . GLN A 1 75  ? 11.485  9.230   3.786   1.00 0.00 ? 75  GLN A O    5  
ATOM 7454  C CB   . GLN A 1 75  ? 12.851  8.384   6.064   1.00 0.00 ? 75  GLN A CB   5  
ATOM 7455  C CG   . GLN A 1 75  ? 13.277  8.001   7.472   1.00 0.00 ? 75  GLN A CG   5  
ATOM 7456  C CD   . GLN A 1 75  ? 14.210  6.806   7.495   1.00 0.00 ? 75  GLN A CD   5  
ATOM 7457  O OE1  . GLN A 1 75  ? 15.270  6.819   6.868   1.00 0.00 ? 75  GLN A OE1  5  
ATOM 7458  N NE2  . GLN A 1 75  ? 13.821  5.764   8.219   1.00 0.00 ? 75  GLN A NE2  5  
ATOM 7459  H H    . GLN A 1 75  ? 10.372  9.602   6.676   1.00 0.00 ? 75  GLN A H    5  
ATOM 7460  H HA   . GLN A 1 75  ? 13.141  10.497  6.230   1.00 0.00 ? 75  GLN A HA   5  
ATOM 7461  H HB2  . GLN A 1 75  ? 12.064  7.712   5.754   1.00 0.00 ? 75  GLN A HB2  5  
ATOM 7462  H HB3  . GLN A 1 75  ? 13.700  8.258   5.408   1.00 0.00 ? 75  GLN A HB3  5  
ATOM 7463  H HG2  . GLN A 1 75  ? 13.784  8.841   7.923   1.00 0.00 ? 75  GLN A HG2  5  
ATOM 7464  H HG3  . GLN A 1 75  ? 12.396  7.762   8.049   1.00 0.00 ? 75  GLN A HG3  5  
ATOM 7465  H HE21 . GLN A 1 75  ? 12.963  5.823   8.691   1.00 0.00 ? 75  GLN A HE21 5  
ATOM 7466  H HE22 . GLN A 1 75  ? 14.404  4.978   8.251   1.00 0.00 ? 75  GLN A HE22 5  
ATOM 7467  N N    . SER A 1 76  ? 12.114  11.369  4.093   1.00 0.00 ? 76  SER A N    5  
ATOM 7468  C CA   . SER A 1 76  ? 11.764  11.781  2.739   1.00 0.00 ? 76  SER A CA   5  
ATOM 7469  C C    . SER A 1 76  ? 12.247  10.757  1.717   1.00 0.00 ? 76  SER A C    5  
ATOM 7470  O O    . SER A 1 76  ? 13.397  10.317  1.757   1.00 0.00 ? 76  SER A O    5  
ATOM 7471  C CB   . SER A 1 76  ? 12.367  13.152  2.428   1.00 0.00 ? 76  SER A CB   5  
ATOM 7472  O OG   . SER A 1 76  ? 11.965  13.608  1.148   1.00 0.00 ? 76  SER A OG   5  
ATOM 7473  H H    . SER A 1 76  ? 12.484  12.031  4.714   1.00 0.00 ? 76  SER A H    5  
ATOM 7474  H HA   . SER A 1 76  ? 10.688  11.850  2.681   1.00 0.00 ? 76  SER A HA   5  
ATOM 7475  H HB2  . SER A 1 76  ? 12.038  13.864  3.170   1.00 0.00 ? 76  SER A HB2  5  
ATOM 7476  H HB3  . SER A 1 76  ? 13.445  13.081  2.450   1.00 0.00 ? 76  SER A HB3  5  
ATOM 7477  H HG   . SER A 1 76  ? 11.130  14.075  1.222   1.00 0.00 ? 76  SER A HG   5  
ATOM 7478  N N    . LEU A 1 77  ? 11.361  10.382  0.801   1.00 0.00 ? 77  LEU A N    5  
ATOM 7479  C CA   . LEU A 1 77  ? 11.696  9.409   -0.234  1.00 0.00 ? 77  LEU A CA   5  
ATOM 7480  C C    . LEU A 1 77  ? 12.490  10.063  -1.360  1.00 0.00 ? 77  LEU A C    5  
ATOM 7481  O O    . LEU A 1 77  ? 12.869  9.405   -2.330  1.00 0.00 ? 77  LEU A O    5  
ATOM 7482  C CB   . LEU A 1 77  ? 10.422  8.774   -0.795  1.00 0.00 ? 77  LEU A CB   5  
ATOM 7483  C CG   . LEU A 1 77  ? 9.510   8.088   0.222   1.00 0.00 ? 77  LEU A CG   5  
ATOM 7484  C CD1  . LEU A 1 77  ? 8.471   7.231   -0.484  1.00 0.00 ? 77  LEU A CD1  5  
ATOM 7485  C CD2  . LEU A 1 77  ? 10.328  7.246   1.191   1.00 0.00 ? 77  LEU A CD2  5  
ATOM 7486  H H    . LEU A 1 77  ? 10.461  10.767  0.819   1.00 0.00 ? 77  LEU A H    5  
ATOM 7487  H HA   . LEU A 1 77  ? 12.303  8.639   0.219   1.00 0.00 ? 77  LEU A HA   5  
ATOM 7488  H HB2  . LEU A 1 77  ? 9.851   9.550   -1.280  1.00 0.00 ? 77  LEU A HB2  5  
ATOM 7489  H HB3  . LEU A 1 77  ? 10.717  8.035   -1.527  1.00 0.00 ? 77  LEU A HB3  5  
ATOM 7490  H HG   . LEU A 1 77  ? 8.986   8.842   0.793   1.00 0.00 ? 77  LEU A HG   5  
ATOM 7491  H HD11 . LEU A 1 77  ? 8.956   6.383   -0.944  1.00 0.00 ? 77  LEU A HD11 5  
ATOM 7492  H HD12 . LEU A 1 77  ? 7.977   7.818   -1.244  1.00 0.00 ? 77  LEU A HD12 5  
ATOM 7493  H HD13 . LEU A 1 77  ? 7.741   6.885   0.233   1.00 0.00 ? 77  LEU A HD13 5  
ATOM 7494  H HD21 . LEU A 1 77  ? 11.032  6.643   0.637   1.00 0.00 ? 77  LEU A HD21 5  
ATOM 7495  H HD22 . LEU A 1 77  ? 9.668   6.603   1.755   1.00 0.00 ? 77  LEU A HD22 5  
ATOM 7496  H HD23 . LEU A 1 77  ? 10.864  7.895   1.867   1.00 0.00 ? 77  LEU A HD23 5  
ATOM 7497  N N    . LEU A 1 78  ? 12.741  11.360  -1.224  1.00 0.00 ? 78  LEU A N    5  
ATOM 7498  C CA   . LEU A 1 78  ? 13.493  12.104  -2.229  1.00 0.00 ? 78  LEU A CA   5  
ATOM 7499  C C    . LEU A 1 78  ? 14.974  11.741  -2.179  1.00 0.00 ? 78  LEU A C    5  
ATOM 7500  O O    . LEU A 1 78  ? 15.635  11.929  -1.159  1.00 0.00 ? 78  LEU A O    5  
ATOM 7501  C CB   . LEU A 1 78  ? 13.317  13.608  -2.016  1.00 0.00 ? 78  LEU A CB   5  
ATOM 7502  C CG   . LEU A 1 78  ? 13.499  14.487  -3.254  1.00 0.00 ? 78  LEU A CG   5  
ATOM 7503  C CD1  . LEU A 1 78  ? 14.931  14.406  -3.760  1.00 0.00 ? 78  LEU A CD1  5  
ATOM 7504  C CD2  . LEU A 1 78  ? 12.521  14.078  -4.346  1.00 0.00 ? 78  LEU A CD2  5  
ATOM 7505  H H    . LEU A 1 78  ? 12.413  11.830  -0.429  1.00 0.00 ? 78  LEU A H    5  
ATOM 7506  H HA   . LEU A 1 78  ? 13.102  11.837  -3.199  1.00 0.00 ? 78  LEU A HA   5  
ATOM 7507  H HB2  . LEU A 1 78  ? 12.321  13.774  -1.637  1.00 0.00 ? 78  LEU A HB2  5  
ATOM 7508  H HB3  . LEU A 1 78  ? 14.039  13.923  -1.276  1.00 0.00 ? 78  LEU A HB3  5  
ATOM 7509  H HG   . LEU A 1 78  ? 13.297  15.516  -2.991  1.00 0.00 ? 78  LEU A HG   5  
ATOM 7510  H HD11 . LEU A 1 78  ? 15.599  14.247  -2.927  1.00 0.00 ? 78  LEU A HD11 5  
ATOM 7511  H HD12 . LEU A 1 78  ? 15.190  15.328  -4.259  1.00 0.00 ? 78  LEU A HD12 5  
ATOM 7512  H HD13 . LEU A 1 78  ? 15.021  13.584  -4.456  1.00 0.00 ? 78  LEU A HD13 5  
ATOM 7513  H HD21 . LEU A 1 78  ? 11.523  14.035  -3.937  1.00 0.00 ? 78  LEU A HD21 5  
ATOM 7514  H HD22 . LEU A 1 78  ? 12.796  13.106  -4.730  1.00 0.00 ? 78  LEU A HD22 5  
ATOM 7515  H HD23 . LEU A 1 78  ? 12.552  14.803  -5.146  1.00 0.00 ? 78  LEU A HD23 5  
ATOM 7516  N N    . GLY A 1 79  ? 15.488  11.222  -3.290  1.00 0.00 ? 79  GLY A N    5  
ATOM 7517  C CA   . GLY A 1 79  ? 16.888  10.843  -3.352  1.00 0.00 ? 79  GLY A CA   5  
ATOM 7518  C C    . GLY A 1 79  ? 17.077  9.354   -3.562  1.00 0.00 ? 79  GLY A C    5  
ATOM 7519  O O    . GLY A 1 79  ? 18.017  8.928   -4.235  1.00 0.00 ? 79  GLY A O    5  
ATOM 7520  H H    . GLY A 1 79  ? 14.913  11.095  -4.073  1.00 0.00 ? 79  GLY A H    5  
ATOM 7521  H HA2  . GLY A 1 79  ? 17.357  11.374  -4.168  1.00 0.00 ? 79  GLY A HA2  5  
ATOM 7522  H HA3  . GLY A 1 79  ? 17.368  11.129  -2.427  1.00 0.00 ? 79  GLY A HA3  5  
ATOM 7523  N N    . LEU A 1 80  ? 16.184  8.559   -2.983  1.00 0.00 ? 80  LEU A N    5  
ATOM 7524  C CA   . LEU A 1 80  ? 16.257  7.107   -3.108  1.00 0.00 ? 80  LEU A CA   5  
ATOM 7525  C C    . LEU A 1 80  ? 15.424  6.620   -4.289  1.00 0.00 ? 80  LEU A C    5  
ATOM 7526  O O    . LEU A 1 80  ? 14.515  7.311   -4.749  1.00 0.00 ? 80  LEU A O    5  
ATOM 7527  C CB   . LEU A 1 80  ? 15.776  6.440   -1.819  1.00 0.00 ? 80  LEU A CB   5  
ATOM 7528  C CG   . LEU A 1 80  ? 14.583  7.100   -1.126  1.00 0.00 ? 80  LEU A CG   5  
ATOM 7529  C CD1  . LEU A 1 80  ? 13.774  6.068   -0.356  1.00 0.00 ? 80  LEU A CD1  5  
ATOM 7530  C CD2  . LEU A 1 80  ? 15.054  8.212   -0.199  1.00 0.00 ? 80  LEU A CD2  5  
ATOM 7531  H H    . LEU A 1 80  ? 15.458  8.956   -2.459  1.00 0.00 ? 80  LEU A H    5  
ATOM 7532  H HA   . LEU A 1 80  ? 17.290  6.841   -3.277  1.00 0.00 ? 80  LEU A HA   5  
ATOM 7533  H HB2  . LEU A 1 80  ? 15.499  5.424   -2.056  1.00 0.00 ? 80  LEU A HB2  5  
ATOM 7534  H HB3  . LEU A 1 80  ? 16.602  6.432   -1.122  1.00 0.00 ? 80  LEU A HB3  5  
ATOM 7535  H HG   . LEU A 1 80  ? 13.938  7.539   -1.874  1.00 0.00 ? 80  LEU A HG   5  
ATOM 7536  H HD11 . LEU A 1 80  ? 13.902  5.098   -0.811  1.00 0.00 ? 80  LEU A HD11 5  
ATOM 7537  H HD12 . LEU A 1 80  ? 12.730  6.341   -0.376  1.00 0.00 ? 80  LEU A HD12 5  
ATOM 7538  H HD13 . LEU A 1 80  ? 14.117  6.034   0.668   1.00 0.00 ? 80  LEU A HD13 5  
ATOM 7539  H HD21 . LEU A 1 80  ? 15.321  7.792   0.759   1.00 0.00 ? 80  LEU A HD21 5  
ATOM 7540  H HD22 . LEU A 1 80  ? 14.258  8.931   -0.067  1.00 0.00 ? 80  LEU A HD22 5  
ATOM 7541  H HD23 . LEU A 1 80  ? 15.914  8.700   -0.631  1.00 0.00 ? 80  LEU A HD23 5  
ATOM 7542  N N    . THR A 1 81  ? 15.739  5.423   -4.774  1.00 0.00 ? 81  THR A N    5  
ATOM 7543  C CA   . THR A 1 81  ? 15.019  4.841   -5.900  1.00 0.00 ? 81  THR A CA   5  
ATOM 7544  C C    . THR A 1 81  ? 13.859  3.974   -5.423  1.00 0.00 ? 81  THR A C    5  
ATOM 7545  O O    . THR A 1 81  ? 13.641  3.818   -4.221  1.00 0.00 ? 81  THR A O    5  
ATOM 7546  C CB   . THR A 1 81  ? 15.951  3.992   -6.784  1.00 0.00 ? 81  THR A CB   5  
ATOM 7547  O OG1  . THR A 1 81  ? 16.409  2.847   -6.055  1.00 0.00 ? 81  THR A OG1  5  
ATOM 7548  C CG2  . THR A 1 81  ? 17.143  4.810   -7.256  1.00 0.00 ? 81  THR A CG2  5  
ATOM 7549  H H    . THR A 1 81  ? 16.473  4.920   -4.364  1.00 0.00 ? 81  THR A H    5  
ATOM 7550  H HA   . THR A 1 81  ? 14.628  5.651   -6.499  1.00 0.00 ? 81  THR A HA   5  
ATOM 7551  H HB   . THR A 1 81  ? 15.396  3.659   -7.650  1.00 0.00 ? 81  THR A HB   5  
ATOM 7552  H HG1  . THR A 1 81  ? 16.432  2.085   -6.638  1.00 0.00 ? 81  THR A HG1  5  
ATOM 7553  H HG21 . THR A 1 81  ? 16.878  5.349   -8.153  1.00 0.00 ? 81  THR A HG21 5  
ATOM 7554  H HG22 . THR A 1 81  ? 17.972  4.150   -7.465  1.00 0.00 ? 81  THR A HG22 5  
ATOM 7555  H HG23 . THR A 1 81  ? 17.426  5.510   -6.485  1.00 0.00 ? 81  THR A HG23 5  
ATOM 7556  N N    . HIS A 1 82  ? 13.119  3.410   -6.372  1.00 0.00 ? 82  HIS A N    5  
ATOM 7557  C CA   . HIS A 1 82  ? 11.982  2.556   -6.048  1.00 0.00 ? 82  HIS A CA   5  
ATOM 7558  C C    . HIS A 1 82  ? 12.375  1.491   -5.029  1.00 0.00 ? 82  HIS A C    5  
ATOM 7559  O O    . HIS A 1 82  ? 11.740  1.352   -3.984  1.00 0.00 ? 82  HIS A O    5  
ATOM 7560  C CB   . HIS A 1 82  ? 11.438  1.892   -7.313  1.00 0.00 ? 82  HIS A CB   5  
ATOM 7561  C CG   . HIS A 1 82  ? 10.012  1.451   -7.193  1.00 0.00 ? 82  HIS A CG   5  
ATOM 7562  N ND1  . HIS A 1 82  ? 9.592   0.171   -7.487  1.00 0.00 ? 82  HIS A ND1  5  
ATOM 7563  C CD2  . HIS A 1 82  ? 8.905   2.129   -6.806  1.00 0.00 ? 82  HIS A CD2  5  
ATOM 7564  C CE1  . HIS A 1 82  ? 8.290   0.080   -7.289  1.00 0.00 ? 82  HIS A CE1  5  
ATOM 7565  N NE2  . HIS A 1 82  ? 7.848   1.255   -6.874  1.00 0.00 ? 82  HIS A NE2  5  
ATOM 7566  H H    . HIS A 1 82  ? 13.343  3.571   -7.312  1.00 0.00 ? 82  HIS A H    5  
ATOM 7567  H HA   . HIS A 1 82  ? 11.211  3.179   -5.619  1.00 0.00 ? 82  HIS A HA   5  
ATOM 7568  H HB2  . HIS A 1 82  ? 11.501  2.592   -8.134  1.00 0.00 ? 82  HIS A HB2  5  
ATOM 7569  H HB3  . HIS A 1 82  ? 12.037  1.022   -7.542  1.00 0.00 ? 82  HIS A HB3  5  
ATOM 7570  H HD1  . HIS A 1 82  ? 10.164  -0.561  -7.798  1.00 0.00 ? 82  HIS A HD1  5  
ATOM 7571  H HD2  . HIS A 1 82  ? 8.861   3.165   -6.501  1.00 0.00 ? 82  HIS A HD2  5  
ATOM 7572  H HE1  . HIS A 1 82  ? 7.687   -0.803  -7.438  1.00 0.00 ? 82  HIS A HE1  5  
ATOM 7573  H HE2  . HIS A 1 82  ? 6.907   1.487   -6.736  1.00 0.00 ? 82  HIS A HE2  5  
ATOM 7574  N N    . GLY A 1 83  ? 13.426  0.739   -5.342  1.00 0.00 ? 83  GLY A N    5  
ATOM 7575  C CA   . GLY A 1 83  ? 13.885  -0.305  -4.444  1.00 0.00 ? 83  GLY A CA   5  
ATOM 7576  C C    . GLY A 1 83  ? 14.162  0.213   -3.046  1.00 0.00 ? 83  GLY A C    5  
ATOM 7577  O O    . GLY A 1 83  ? 13.712  -0.371  -2.061  1.00 0.00 ? 83  GLY A O    5  
ATOM 7578  H H    . GLY A 1 83  ? 13.894  0.895   -6.189  1.00 0.00 ? 83  GLY A H    5  
ATOM 7579  H HA2  . GLY A 1 83  ? 13.130  -1.074  -4.389  1.00 0.00 ? 83  GLY A HA2  5  
ATOM 7580  H HA3  . GLY A 1 83  ? 14.793  -0.733  -4.843  1.00 0.00 ? 83  GLY A HA3  5  
ATOM 7581  N N    . GLU A 1 84  ? 14.907  1.311   -2.960  1.00 0.00 ? 84  GLU A N    5  
ATOM 7582  C CA   . GLU A 1 84  ? 15.245  1.905   -1.672  1.00 0.00 ? 84  GLU A CA   5  
ATOM 7583  C C    . GLU A 1 84  ? 13.986  2.333   -0.923  1.00 0.00 ? 84  GLU A C    5  
ATOM 7584  O O    . GLU A 1 84  ? 13.789  1.974   0.237   1.00 0.00 ? 84  GLU A O    5  
ATOM 7585  C CB   . GLU A 1 84  ? 16.169  3.108   -1.867  1.00 0.00 ? 84  GLU A CB   5  
ATOM 7586  C CG   . GLU A 1 84  ? 17.641  2.739   -1.944  1.00 0.00 ? 84  GLU A CG   5  
ATOM 7587  C CD   . GLU A 1 84  ? 18.545  3.955   -2.019  1.00 0.00 ? 84  GLU A CD   5  
ATOM 7588  O OE1  . GLU A 1 84  ? 18.730  4.620   -0.978  1.00 0.00 ? 84  GLU A OE1  5  
ATOM 7589  O OE2  . GLU A 1 84  ? 19.065  4.241   -3.117  1.00 0.00 ? 84  GLU A OE2  5  
ATOM 7590  H H    . GLU A 1 84  ? 15.237  1.731   -3.782  1.00 0.00 ? 84  GLU A H    5  
ATOM 7591  H HA   . GLU A 1 84  ? 15.760  1.158   -1.088  1.00 0.00 ? 84  GLU A HA   5  
ATOM 7592  H HB2  . GLU A 1 84  ? 15.897  3.612   -2.783  1.00 0.00 ? 84  GLU A HB2  5  
ATOM 7593  H HB3  . GLU A 1 84  ? 16.034  3.789   -1.040  1.00 0.00 ? 84  GLU A HB3  5  
ATOM 7594  H HG2  . GLU A 1 84  ? 17.903  2.169   -1.065  1.00 0.00 ? 84  GLU A HG2  5  
ATOM 7595  H HG3  . GLU A 1 84  ? 17.802  2.134   -2.825  1.00 0.00 ? 84  GLU A HG3  5  
ATOM 7596  N N    . ALA A 1 85  ? 13.137  3.103   -1.597  1.00 0.00 ? 85  ALA A N    5  
ATOM 7597  C CA   . ALA A 1 85  ? 11.897  3.579   -0.997  1.00 0.00 ? 85  ALA A CA   5  
ATOM 7598  C C    . ALA A 1 85  ? 11.118  2.431   -0.363  1.00 0.00 ? 85  ALA A C    5  
ATOM 7599  O O    . ALA A 1 85  ? 10.708  2.510   0.795   1.00 0.00 ? 85  ALA A O    5  
ATOM 7600  C CB   . ALA A 1 85  ? 11.044  4.287   -2.039  1.00 0.00 ? 85  ALA A CB   5  
ATOM 7601  H H    . ALA A 1 85  ? 13.349  3.355   -2.519  1.00 0.00 ? 85  ALA A H    5  
ATOM 7602  H HA   . ALA A 1 85  ? 12.151  4.295   -0.228  1.00 0.00 ? 85  ALA A HA   5  
ATOM 7603  H HB1  . ALA A 1 85  ? 10.620  3.556   -2.712  1.00 0.00 ? 85  ALA A HB1  5  
ATOM 7604  H HB2  . ALA A 1 85  ? 10.249  4.827   -1.547  1.00 0.00 ? 85  ALA A HB2  5  
ATOM 7605  H HB3  . ALA A 1 85  ? 11.658  4.978   -2.597  1.00 0.00 ? 85  ALA A HB3  5  
ATOM 7606  N N    . VAL A 1 86  ? 10.915  1.365   -1.131  1.00 0.00 ? 86  VAL A N    5  
ATOM 7607  C CA   . VAL A 1 86  ? 10.184  0.201   -0.644  1.00 0.00 ? 86  VAL A CA   5  
ATOM 7608  C C    . VAL A 1 86  ? 10.759  -0.296  0.678   1.00 0.00 ? 86  VAL A C    5  
ATOM 7609  O O    . VAL A 1 86  ? 10.058  -0.355  1.687   1.00 0.00 ? 86  VAL A O    5  
ATOM 7610  C CB   . VAL A 1 86  ? 10.215  -0.949  -1.669  1.00 0.00 ? 86  VAL A CB   5  
ATOM 7611  C CG1  . VAL A 1 86  ? 9.668   -2.228  -1.053  1.00 0.00 ? 86  VAL A CG1  5  
ATOM 7612  C CG2  . VAL A 1 86  ? 9.431   -0.571  -2.916  1.00 0.00 ? 86  VAL A CG2  5  
ATOM 7613  H H    . VAL A 1 86  ? 11.265  1.361   -2.046  1.00 0.00 ? 86  VAL A H    5  
ATOM 7614  H HA   . VAL A 1 86  ? 9.155   0.492   -0.491  1.00 0.00 ? 86  VAL A HA   5  
ATOM 7615  H HB   . VAL A 1 86  ? 11.242  -1.124  -1.953  1.00 0.00 ? 86  VAL A HB   5  
ATOM 7616  H HG11 . VAL A 1 86  ? 10.399  -2.641  -0.374  1.00 0.00 ? 86  VAL A HG11 5  
ATOM 7617  H HG12 . VAL A 1 86  ? 8.758   -2.008  -0.513  1.00 0.00 ? 86  VAL A HG12 5  
ATOM 7618  H HG13 . VAL A 1 86  ? 9.459   -2.943  -1.835  1.00 0.00 ? 86  VAL A HG13 5  
ATOM 7619  H HG21 . VAL A 1 86  ? 10.072  -0.023  -3.591  1.00 0.00 ? 86  VAL A HG21 5  
ATOM 7620  H HG22 . VAL A 1 86  ? 9.076   -1.467  -3.405  1.00 0.00 ? 86  VAL A HG22 5  
ATOM 7621  H HG23 . VAL A 1 86  ? 8.588   0.045   -2.640  1.00 0.00 ? 86  VAL A HG23 5  
ATOM 7622  N N    . GLN A 1 87  ? 12.040  -0.650  0.664   1.00 0.00 ? 87  GLN A N    5  
ATOM 7623  C CA   . GLN A 1 87  ? 12.709  -1.142  1.862   1.00 0.00 ? 87  GLN A CA   5  
ATOM 7624  C C    . GLN A 1 87  ? 12.530  -0.170  3.023   1.00 0.00 ? 87  GLN A C    5  
ATOM 7625  O O    . GLN A 1 87  ? 12.664  -0.546  4.189   1.00 0.00 ? 87  GLN A O    5  
ATOM 7626  C CB   . GLN A 1 87  ? 14.199  -1.358  1.588   1.00 0.00 ? 87  GLN A CB   5  
ATOM 7627  C CG   . GLN A 1 87  ? 14.474  -2.349  0.469   1.00 0.00 ? 87  GLN A CG   5  
ATOM 7628  C CD   . GLN A 1 87  ? 13.632  -3.605  0.581   1.00 0.00 ? 87  GLN A CD   5  
ATOM 7629  O OE1  . GLN A 1 87  ? 13.860  -4.443  1.454   1.00 0.00 ? 87  GLN A OE1  5  
ATOM 7630  N NE2  . GLN A 1 87  ? 12.651  -3.742  -0.303  1.00 0.00 ? 87  GLN A NE2  5  
ATOM 7631  H H    . GLN A 1 87  ? 12.546  -0.580  -0.172  1.00 0.00 ? 87  GLN A H    5  
ATOM 7632  H HA   . GLN A 1 87  ? 12.261  -2.087  2.128   1.00 0.00 ? 87  GLN A HA   5  
ATOM 7633  H HB2  . GLN A 1 87  ? 14.644  -0.412  1.320   1.00 0.00 ? 87  GLN A HB2  5  
ATOM 7634  H HB3  . GLN A 1 87  ? 14.669  -1.725  2.488   1.00 0.00 ? 87  GLN A HB3  5  
ATOM 7635  H HG2  . GLN A 1 87  ? 14.258  -1.874  -0.477  1.00 0.00 ? 87  GLN A HG2  5  
ATOM 7636  H HG3  . GLN A 1 87  ? 15.517  -2.628  0.501   1.00 0.00 ? 87  GLN A HG3  5  
ATOM 7637  H HE21 . GLN A 1 87  ? 12.528  -3.034  -0.971  1.00 0.00 ? 87  GLN A HE21 5  
ATOM 7638  H HE22 . GLN A 1 87  ? 12.092  -4.544  -0.254  1.00 0.00 ? 87  GLN A HE22 5  
ATOM 7639  N N    . LEU A 1 88  ? 12.226  1.082   2.699   1.00 0.00 ? 88  LEU A N    5  
ATOM 7640  C CA   . LEU A 1 88  ? 12.028  2.110   3.715   1.00 0.00 ? 88  LEU A CA   5  
ATOM 7641  C C    . LEU A 1 88  ? 10.652  1.979   4.360   1.00 0.00 ? 88  LEU A C    5  
ATOM 7642  O O    . LEU A 1 88  ? 10.453  2.377   5.509   1.00 0.00 ? 88  LEU A O    5  
ATOM 7643  C CB   . LEU A 1 88  ? 12.186  3.501   3.100   1.00 0.00 ? 88  LEU A CB   5  
ATOM 7644  C CG   . LEU A 1 88  ? 12.719  4.590   4.031   1.00 0.00 ? 88  LEU A CG   5  
ATOM 7645  C CD1  . LEU A 1 88  ? 12.878  5.903   3.280   1.00 0.00 ? 88  LEU A CD1  5  
ATOM 7646  C CD2  . LEU A 1 88  ? 11.797  4.767   5.228   1.00 0.00 ? 88  LEU A CD2  5  
ATOM 7647  H H    . LEU A 1 88  ? 12.132  1.322   1.754   1.00 0.00 ? 88  LEU A H    5  
ATOM 7648  H HA   . LEU A 1 88  ? 12.783  1.973   4.475   1.00 0.00 ? 88  LEU A HA   5  
ATOM 7649  H HB2  . LEU A 1 88  ? 12.864  3.418   2.265   1.00 0.00 ? 88  LEU A HB2  5  
ATOM 7650  H HB3  . LEU A 1 88  ? 11.215  3.816   2.742   1.00 0.00 ? 88  LEU A HB3  5  
ATOM 7651  H HG   . LEU A 1 88  ? 13.693  4.296   4.398   1.00 0.00 ? 88  LEU A HG   5  
ATOM 7652  H HD11 . LEU A 1 88  ? 12.210  6.640   3.698   1.00 0.00 ? 88  LEU A HD11 5  
ATOM 7653  H HD12 . LEU A 1 88  ? 12.641  5.752   2.237   1.00 0.00 ? 88  LEU A HD12 5  
ATOM 7654  H HD13 . LEU A 1 88  ? 13.898  6.248   3.371   1.00 0.00 ? 88  LEU A HD13 5  
ATOM 7655  H HD21 . LEU A 1 88  ? 11.990  5.723   5.693   1.00 0.00 ? 88  LEU A HD21 5  
ATOM 7656  H HD22 . LEU A 1 88  ? 11.978  3.977   5.942   1.00 0.00 ? 88  LEU A HD22 5  
ATOM 7657  H HD23 . LEU A 1 88  ? 10.769  4.727   4.900   1.00 0.00 ? 88  LEU A HD23 5  
ATOM 7658  N N    . LEU A 1 89  ? 9.706   1.419   3.615   1.00 0.00 ? 89  LEU A N    5  
ATOM 7659  C CA   . LEU A 1 89  ? 8.348   1.233   4.115   1.00 0.00 ? 89  LEU A CA   5  
ATOM 7660  C C    . LEU A 1 89  ? 8.239   -0.050  4.933   1.00 0.00 ? 89  LEU A C    5  
ATOM 7661  O O    . LEU A 1 89  ? 7.412   -0.151  5.839   1.00 0.00 ? 89  LEU A O    5  
ATOM 7662  C CB   . LEU A 1 89  ? 7.355   1.196   2.952   1.00 0.00 ? 89  LEU A CB   5  
ATOM 7663  C CG   . LEU A 1 89  ? 7.060   -0.185  2.365   1.00 0.00 ? 89  LEU A CG   5  
ATOM 7664  C CD1  . LEU A 1 89  ? 6.111   -0.956  3.269   1.00 0.00 ? 89  LEU A CD1  5  
ATOM 7665  C CD2  . LEU A 1 89  ? 6.480   -0.056  0.965   1.00 0.00 ? 89  LEU A CD2  5  
ATOM 7666  H H    . LEU A 1 89  ? 9.924   1.122   2.708   1.00 0.00 ? 89  LEU A H    5  
ATOM 7667  H HA   . LEU A 1 89  ? 8.112   2.073   4.752   1.00 0.00 ? 89  LEU A HA   5  
ATOM 7668  H HB2  . LEU A 1 89  ? 6.423   1.614   3.299   1.00 0.00 ? 89  LEU A HB2  5  
ATOM 7669  H HB3  . LEU A 1 89  ? 7.753   1.815   2.160   1.00 0.00 ? 89  LEU A HB3  5  
ATOM 7670  H HG   . LEU A 1 89  ? 7.983   -0.744  2.296   1.00 0.00 ? 89  LEU A HG   5  
ATOM 7671  H HD11 . LEU A 1 89  ? 5.200   -1.173  2.732   1.00 0.00 ? 89  LEU A HD11 5  
ATOM 7672  H HD12 . LEU A 1 89  ? 5.882   -0.362  4.141   1.00 0.00 ? 89  LEU A HD12 5  
ATOM 7673  H HD13 . LEU A 1 89  ? 6.578   -1.881  3.576   1.00 0.00 ? 89  LEU A HD13 5  
ATOM 7674  H HD21 . LEU A 1 89  ? 6.510   -1.018  0.473   1.00 0.00 ? 89  LEU A HD21 5  
ATOM 7675  H HD22 . LEU A 1 89  ? 7.062   0.656   0.398   1.00 0.00 ? 89  LEU A HD22 5  
ATOM 7676  H HD23 . LEU A 1 89  ? 5.457   0.283   1.028   1.00 0.00 ? 89  LEU A HD23 5  
ATOM 7677  N N    . ARG A 1 90  ? 9.079   -1.026  4.607   1.00 0.00 ? 90  ARG A N    5  
ATOM 7678  C CA   . ARG A 1 90  ? 9.078   -2.302  5.311   1.00 0.00 ? 90  ARG A CA   5  
ATOM 7679  C C    . ARG A 1 90  ? 10.099  -2.298  6.446   1.00 0.00 ? 90  ARG A C    5  
ATOM 7680  O O    . ARG A 1 90  ? 10.267  -3.296  7.147   1.00 0.00 ? 90  ARG A O    5  
ATOM 7681  C CB   . ARG A 1 90  ? 9.382   -3.445  4.341   1.00 0.00 ? 90  ARG A CB   5  
ATOM 7682  C CG   . ARG A 1 90  ? 10.557  -3.164  3.419   1.00 0.00 ? 90  ARG A CG   5  
ATOM 7683  C CD   . ARG A 1 90  ? 11.039  -4.431  2.729   1.00 0.00 ? 90  ARG A CD   5  
ATOM 7684  N NE   . ARG A 1 90  ? 11.723  -5.331  3.654   1.00 0.00 ? 90  ARG A NE   5  
ATOM 7685  C CZ   . ARG A 1 90  ? 12.031  -6.590  3.362   1.00 0.00 ? 90  ARG A CZ   5  
ATOM 7686  N NH1  . ARG A 1 90  ? 11.718  -7.094  2.177   1.00 0.00 ? 90  ARG A NH1  5  
ATOM 7687  N NH2  . ARG A 1 90  ? 12.653  -7.347  4.257   1.00 0.00 ? 90  ARG A NH2  5  
ATOM 7688  H H    . ARG A 1 90  ? 9.715   -0.885  3.875   1.00 0.00 ? 90  ARG A H    5  
ATOM 7689  H HA   . ARG A 1 90  ? 8.094   -2.450  5.730   1.00 0.00 ? 90  ARG A HA   5  
ATOM 7690  H HB2  . ARG A 1 90  ? 9.605   -4.336  4.910   1.00 0.00 ? 90  ARG A HB2  5  
ATOM 7691  H HB3  . ARG A 1 90  ? 8.510   -3.626  3.732   1.00 0.00 ? 90  ARG A HB3  5  
ATOM 7692  H HG2  . ARG A 1 90  ? 10.250  -2.453  2.666   1.00 0.00 ? 90  ARG A HG2  5  
ATOM 7693  H HG3  . ARG A 1 90  ? 11.368  -2.750  3.999   1.00 0.00 ? 90  ARG A HG3  5  
ATOM 7694  H HD2  . ARG A 1 90  ? 10.187  -4.943  2.308   1.00 0.00 ? 90  ARG A HD2  5  
ATOM 7695  H HD3  . ARG A 1 90  ? 11.721  -4.157  1.938   1.00 0.00 ? 90  ARG A HD3  5  
ATOM 7696  H HE   . ARG A 1 90  ? 11.963  -4.979  4.536   1.00 0.00 ? 90  ARG A HE   5  
ATOM 7697  H HH11 . ARG A 1 90  ? 11.250  -6.526  1.500   1.00 0.00 ? 90  ARG A HH11 5  
ATOM 7698  H HH12 . ARG A 1 90  ? 11.952  -8.042  1.959   1.00 0.00 ? 90  ARG A HH12 5  
ATOM 7699  H HH21 . ARG A 1 90  ? 12.891  -6.970  5.152   1.00 0.00 ? 90  ARG A HH21 5  
ATOM 7700  H HH22 . ARG A 1 90  ? 12.884  -8.294  4.036   1.00 0.00 ? 90  ARG A HH22 5  
ATOM 7701  N N    . SER A 1 91  ? 10.779  -1.169  6.619   1.00 0.00 ? 91  SER A N    5  
ATOM 7702  C CA   . SER A 1 91  ? 11.786  -1.036  7.665   1.00 0.00 ? 91  SER A CA   5  
ATOM 7703  C C    . SER A 1 91  ? 11.195  -0.380  8.908   1.00 0.00 ? 91  SER A C    5  
ATOM 7704  O O    . SER A 1 91  ? 11.880  0.353   9.623   1.00 0.00 ? 91  SER A O    5  
ATOM 7705  C CB   . SER A 1 91  ? 12.974  -0.217  7.157   1.00 0.00 ? 91  SER A CB   5  
ATOM 7706  O OG   . SER A 1 91  ? 13.953  -0.057  8.169   1.00 0.00 ? 91  SER A OG   5  
ATOM 7707  H H    . SER A 1 91  ? 10.600  -0.408  6.028   1.00 0.00 ? 91  SER A H    5  
ATOM 7708  H HA   . SER A 1 91  ? 12.128  -2.028  7.923   1.00 0.00 ? 91  SER A HA   5  
ATOM 7709  H HB2  . SER A 1 91  ? 13.423  -0.721  6.315   1.00 0.00 ? 91  SER A HB2  5  
ATOM 7710  H HB3  . SER A 1 91  ? 12.629  0.760   6.849   1.00 0.00 ? 91  SER A HB3  5  
ATOM 7711  H HG   . SER A 1 91  ? 14.196  -0.917  8.519   1.00 0.00 ? 91  SER A HG   5  
ATOM 7712  N N    . VAL A 1 92  ? 9.918   -0.648  9.161   1.00 0.00 ? 92  VAL A N    5  
ATOM 7713  C CA   . VAL A 1 92  ? 9.233   -0.085  10.319  1.00 0.00 ? 92  VAL A CA   5  
ATOM 7714  C C    . VAL A 1 92  ? 8.905   -1.165  11.343  1.00 0.00 ? 92  VAL A C    5  
ATOM 7715  O O    . VAL A 1 92  ? 8.451   -2.253  10.989  1.00 0.00 ? 92  VAL A O    5  
ATOM 7716  C CB   . VAL A 1 92  ? 7.932   0.630   9.908   1.00 0.00 ? 92  VAL A CB   5  
ATOM 7717  C CG1  . VAL A 1 92  ? 7.112   -0.247  8.974   1.00 0.00 ? 92  VAL A CG1  5  
ATOM 7718  C CG2  . VAL A 1 92  ? 7.124   1.014   11.139  1.00 0.00 ? 92  VAL A CG2  5  
ATOM 7719  H H    . VAL A 1 92  ? 9.425   -1.239  8.555   1.00 0.00 ? 92  VAL A H    5  
ATOM 7720  H HA   . VAL A 1 92  ? 9.890   0.642   10.775  1.00 0.00 ? 92  VAL A HA   5  
ATOM 7721  H HB   . VAL A 1 92  ? 8.194   1.535   9.379   1.00 0.00 ? 92  VAL A HB   5  
ATOM 7722  H HG11 . VAL A 1 92  ? 7.625   -0.341  8.028   1.00 0.00 ? 92  VAL A HG11 5  
ATOM 7723  H HG12 . VAL A 1 92  ? 6.987   -1.225  9.416   1.00 0.00 ? 92  VAL A HG12 5  
ATOM 7724  H HG13 . VAL A 1 92  ? 6.144   0.204   8.815   1.00 0.00 ? 92  VAL A HG13 5  
ATOM 7725  H HG21 . VAL A 1 92  ? 7.665   0.725   12.028  1.00 0.00 ? 92  VAL A HG21 5  
ATOM 7726  H HG22 . VAL A 1 92  ? 6.964   2.082   11.146  1.00 0.00 ? 92  VAL A HG22 5  
ATOM 7727  H HG23 . VAL A 1 92  ? 6.171   0.507   11.116  1.00 0.00 ? 92  VAL A HG23 5  
ATOM 7728  N N    . GLY A 1 93  ? 9.138   -0.858  12.615  1.00 0.00 ? 93  GLY A N    5  
ATOM 7729  C CA   . GLY A 1 93  ? 8.860   -1.813  13.672  1.00 0.00 ? 93  GLY A CA   5  
ATOM 7730  C C    . GLY A 1 93  ? 7.414   -2.265  13.680  1.00 0.00 ? 93  GLY A C    5  
ATOM 7731  O O    . GLY A 1 93  ? 7.015   -3.108  12.876  1.00 0.00 ? 93  GLY A O    5  
ATOM 7732  H H    . GLY A 1 93  ? 9.500   0.025   12.838  1.00 0.00 ? 93  GLY A H    5  
ATOM 7733  H HA2  . GLY A 1 93  ? 9.496   -2.676  13.538  1.00 0.00 ? 93  GLY A HA2  5  
ATOM 7734  H HA3  . GLY A 1 93  ? 9.088   -1.356  14.624  1.00 0.00 ? 93  GLY A HA3  5  
ATOM 7735  N N    . ASP A 1 94  ? 6.626   -1.705  14.592  1.00 0.00 ? 94  ASP A N    5  
ATOM 7736  C CA   . ASP A 1 94  ? 5.215   -2.056  14.703  1.00 0.00 ? 94  ASP A CA   5  
ATOM 7737  C C    . ASP A 1 94  ? 4.330   -0.878  14.308  1.00 0.00 ? 94  ASP A C    5  
ATOM 7738  O O    . ASP A 1 94  ? 3.104   -0.993  14.271  1.00 0.00 ? 94  ASP A O    5  
ATOM 7739  C CB   . ASP A 1 94  ? 4.888   -2.501  16.129  1.00 0.00 ? 94  ASP A CB   5  
ATOM 7740  C CG   . ASP A 1 94  ? 5.051   -1.379  17.136  1.00 0.00 ? 94  ASP A CG   5  
ATOM 7741  O OD1  . ASP A 1 94  ? 4.277   -0.402  17.066  1.00 0.00 ? 94  ASP A OD1  5  
ATOM 7742  O OD2  . ASP A 1 94  ? 5.954   -1.479  17.994  1.00 0.00 ? 94  ASP A OD2  5  
ATOM 7743  H H    . ASP A 1 94  ? 7.003   -1.040  15.205  1.00 0.00 ? 94  ASP A H    5  
ATOM 7744  H HA   . ASP A 1 94  ? 5.023   -2.876  14.027  1.00 0.00 ? 94  ASP A HA   5  
ATOM 7745  H HB2  . ASP A 1 94  ? 3.865   -2.847  16.166  1.00 0.00 ? 94  ASP A HB2  5  
ATOM 7746  H HB3  . ASP A 1 94  ? 5.547   -3.310  16.407  1.00 0.00 ? 94  ASP A HB3  5  
ATOM 7747  N N    . THR A 1 95  ? 4.958   0.256   14.015  1.00 0.00 ? 95  THR A N    5  
ATOM 7748  C CA   . THR A 1 95  ? 4.228   1.456   13.625  1.00 0.00 ? 95  THR A CA   5  
ATOM 7749  C C    . THR A 1 95  ? 5.124   2.418   12.853  1.00 0.00 ? 95  THR A C    5  
ATOM 7750  O O    . THR A 1 95  ? 6.267   2.664   13.239  1.00 0.00 ? 95  THR A O    5  
ATOM 7751  C CB   . THR A 1 95  ? 3.650   2.184   14.853  1.00 0.00 ? 95  THR A CB   5  
ATOM 7752  O OG1  . THR A 1 95  ? 3.040   1.241   15.740  1.00 0.00 ? 95  THR A OG1  5  
ATOM 7753  C CG2  . THR A 1 95  ? 2.625   3.226   14.430  1.00 0.00 ? 95  THR A CG2  5  
ATOM 7754  H H    . THR A 1 95  ? 5.937   0.285   14.063  1.00 0.00 ? 95  THR A H    5  
ATOM 7755  H HA   . THR A 1 95  ? 3.407   1.155   12.991  1.00 0.00 ? 95  THR A HA   5  
ATOM 7756  H HB   . THR A 1 95  ? 4.457   2.684   15.370  1.00 0.00 ? 95  THR A HB   5  
ATOM 7757  H HG1  . THR A 1 95  ? 2.204   0.947   15.370  1.00 0.00 ? 95  THR A HG1  5  
ATOM 7758  H HG21 . THR A 1 95  ? 3.095   3.953   13.785  1.00 0.00 ? 95  THR A HG21 5  
ATOM 7759  H HG22 . THR A 1 95  ? 2.233   3.722   15.306  1.00 0.00 ? 95  THR A HG22 5  
ATOM 7760  H HG23 . THR A 1 95  ? 1.819   2.743   13.899  1.00 0.00 ? 95  THR A HG23 5  
ATOM 7761  N N    . LEU A 1 96  ? 4.598   2.960   11.760  1.00 0.00 ? 96  LEU A N    5  
ATOM 7762  C CA   . LEU A 1 96  ? 5.350   3.897   10.933  1.00 0.00 ? 96  LEU A CA   5  
ATOM 7763  C C    . LEU A 1 96  ? 4.597   5.215   10.781  1.00 0.00 ? 96  LEU A C    5  
ATOM 7764  O O    . LEU A 1 96  ? 3.419   5.314   11.127  1.00 0.00 ? 96  LEU A O    5  
ATOM 7765  C CB   . LEU A 1 96  ? 5.620   3.289   9.556   1.00 0.00 ? 96  LEU A CB   5  
ATOM 7766  C CG   . LEU A 1 96  ? 4.611   3.633   8.460   1.00 0.00 ? 96  LEU A CG   5  
ATOM 7767  C CD1  . LEU A 1 96  ? 5.150   3.237   7.094   1.00 0.00 ? 96  LEU A CD1  5  
ATOM 7768  C CD2  . LEU A 1 96  ? 3.278   2.950   8.729   1.00 0.00 ? 96  LEU A CD2  5  
ATOM 7769  H H    . LEU A 1 96  ? 3.682   2.726   11.503  1.00 0.00 ? 96  LEU A H    5  
ATOM 7770  H HA   . LEU A 1 96  ? 6.292   4.090   11.424  1.00 0.00 ? 96  LEU A HA   5  
ATOM 7771  H HB2  . LEU A 1 96  ? 6.591   3.628   9.229   1.00 0.00 ? 96  LEU A HB2  5  
ATOM 7772  H HB3  . LEU A 1 96  ? 5.635   2.214   9.667   1.00 0.00 ? 96  LEU A HB3  5  
ATOM 7773  H HG   . LEU A 1 96  ? 4.445   4.702   8.456   1.00 0.00 ? 96  LEU A HG   5  
ATOM 7774  H HD11 . LEU A 1 96  ? 5.835   3.994   6.744   1.00 0.00 ? 96  LEU A HD11 5  
ATOM 7775  H HD12 . LEU A 1 96  ? 4.330   3.144   6.397   1.00 0.00 ? 96  LEU A HD12 5  
ATOM 7776  H HD13 . LEU A 1 96  ? 5.666   2.291   7.172   1.00 0.00 ? 96  LEU A HD13 5  
ATOM 7777  H HD21 . LEU A 1 96  ? 2.665   2.995   7.840   1.00 0.00 ? 96  LEU A HD21 5  
ATOM 7778  H HD22 . LEU A 1 96  ? 2.773   3.453   9.541   1.00 0.00 ? 96  LEU A HD22 5  
ATOM 7779  H HD23 . LEU A 1 96  ? 3.450   1.918   8.995   1.00 0.00 ? 96  LEU A HD23 5  
ATOM 7780  N N    . THR A 1 97  ? 5.284   6.226   10.258  1.00 0.00 ? 97  THR A N    5  
ATOM 7781  C CA   . THR A 1 97  ? 4.681   7.538   10.059  1.00 0.00 ? 97  THR A CA   5  
ATOM 7782  C C    . THR A 1 97  ? 4.663   7.916   8.582   1.00 0.00 ? 97  THR A C    5  
ATOM 7783  O O    . THR A 1 97  ? 5.650   8.422   8.048   1.00 0.00 ? 97  THR A O    5  
ATOM 7784  C CB   . THR A 1 97  ? 5.431   8.627   10.847  1.00 0.00 ? 97  THR A CB   5  
ATOM 7785  O OG1  . THR A 1 97  ? 5.927   8.088   12.077  1.00 0.00 ? 97  THR A OG1  5  
ATOM 7786  C CG2  . THR A 1 97  ? 4.520   9.811   11.136  1.00 0.00 ? 97  THR A CG2  5  
ATOM 7787  H H    . THR A 1 97  ? 6.219   6.085   10.002  1.00 0.00 ? 97  THR A H    5  
ATOM 7788  H HA   . THR A 1 97  ? 3.664   7.496   10.422  1.00 0.00 ? 97  THR A HA   5  
ATOM 7789  H HB   . THR A 1 97  ? 6.265   8.971   10.251  1.00 0.00 ? 97  THR A HB   5  
ATOM 7790  H HG1  . THR A 1 97  ? 5.215   7.640   12.540  1.00 0.00 ? 97  THR A HG1  5  
ATOM 7791  H HG21 . THR A 1 97  ? 4.646   10.120  12.163  1.00 0.00 ? 97  THR A HG21 5  
ATOM 7792  H HG22 . THR A 1 97  ? 3.493   9.523   10.970  1.00 0.00 ? 97  THR A HG22 5  
ATOM 7793  H HG23 . THR A 1 97  ? 4.776   10.630  10.481  1.00 0.00 ? 97  THR A HG23 5  
ATOM 7794  N N    . VAL A 1 98  ? 3.534   7.667   7.926   1.00 0.00 ? 98  VAL A N    5  
ATOM 7795  C CA   . VAL A 1 98  ? 3.387   7.983   6.510   1.00 0.00 ? 98  VAL A CA   5  
ATOM 7796  C C    . VAL A 1 98  ? 2.759   9.359   6.317   1.00 0.00 ? 98  VAL A C    5  
ATOM 7797  O O    . VAL A 1 98  ? 1.725   9.671   6.909   1.00 0.00 ? 98  VAL A O    5  
ATOM 7798  C CB   . VAL A 1 98  ? 2.525   6.932   5.786   1.00 0.00 ? 98  VAL A CB   5  
ATOM 7799  C CG1  . VAL A 1 98  ? 2.956   5.527   6.179   1.00 0.00 ? 98  VAL A CG1  5  
ATOM 7800  C CG2  . VAL A 1 98  ? 1.051   7.151   6.090   1.00 0.00 ? 98  VAL A CG2  5  
ATOM 7801  H H    . VAL A 1 98  ? 2.781   7.262   8.405   1.00 0.00 ? 98  VAL A H    5  
ATOM 7802  H HA   . VAL A 1 98  ? 4.371   7.981   6.063   1.00 0.00 ? 98  VAL A HA   5  
ATOM 7803  H HB   . VAL A 1 98  ? 2.672   7.045   4.722   1.00 0.00 ? 98  VAL A HB   5  
ATOM 7804  H HG11 . VAL A 1 98  ? 3.084   4.928   5.289   1.00 0.00 ? 98  VAL A HG11 5  
ATOM 7805  H HG12 . VAL A 1 98  ? 3.889   5.574   6.720   1.00 0.00 ? 98  VAL A HG12 5  
ATOM 7806  H HG13 . VAL A 1 98  ? 2.198   5.080   6.806   1.00 0.00 ? 98  VAL A HG13 5  
ATOM 7807  H HG21 . VAL A 1 98  ? 0.949   7.605   7.065   1.00 0.00 ? 98  VAL A HG21 5  
ATOM 7808  H HG22 . VAL A 1 98  ? 0.622   7.803   5.343   1.00 0.00 ? 98  VAL A HG22 5  
ATOM 7809  H HG23 . VAL A 1 98  ? 0.535   6.202   6.078   1.00 0.00 ? 98  VAL A HG23 5  
ATOM 7810  N N    . LEU A 1 99  ? 3.390   10.179  5.483   1.00 0.00 ? 99  LEU A N    5  
ATOM 7811  C CA   . LEU A 1 99  ? 2.893   11.523  5.210   1.00 0.00 ? 99  LEU A CA   5  
ATOM 7812  C C    . LEU A 1 99  ? 2.118   11.561  3.898   1.00 0.00 ? 99  LEU A C    5  
ATOM 7813  O O    . LEU A 1 99  ? 2.011   12.607  3.257   1.00 0.00 ? 99  LEU A O    5  
ATOM 7814  C CB   . LEU A 1 99  ? 4.055   12.517  5.158   1.00 0.00 ? 99  LEU A CB   5  
ATOM 7815  C CG   . LEU A 1 99  ? 3.674   13.998  5.178   1.00 0.00 ? 99  LEU A CG   5  
ATOM 7816  C CD1  . LEU A 1 99  ? 2.879   14.326  6.432   1.00 0.00 ? 99  LEU A CD1  5  
ATOM 7817  C CD2  . LEU A 1 99  ? 4.917   14.870  5.089   1.00 0.00 ? 99  LEU A CD2  5  
ATOM 7818  H H    . LEU A 1 99  ? 4.209   9.875   5.041   1.00 0.00 ? 99  LEU A H    5  
ATOM 7819  H HA   . LEU A 1 99  ? 2.229   11.801  6.015   1.00 0.00 ? 99  LEU A HA   5  
ATOM 7820  H HB2  . LEU A 1 99  ? 4.691   12.328  6.009   1.00 0.00 ? 99  LEU A HB2  5  
ATOM 7821  H HB3  . LEU A 1 99  ? 4.609   12.329  4.249   1.00 0.00 ? 99  LEU A HB3  5  
ATOM 7822  H HG   . LEU A 1 99  ? 3.050   14.214  4.322   1.00 0.00 ? 99  LEU A HG   5  
ATOM 7823  H HD11 . LEU A 1 99  ? 3.070   13.578  7.186   1.00 0.00 ? 99  LEU A HD11 5  
ATOM 7824  H HD12 . LEU A 1 99  ? 1.825   14.339  6.197   1.00 0.00 ? 99  LEU A HD12 5  
ATOM 7825  H HD13 . LEU A 1 99  ? 3.176   15.296  6.803   1.00 0.00 ? 99  LEU A HD13 5  
ATOM 7826  H HD21 . LEU A 1 99  ? 5.684   14.470  5.736   1.00 0.00 ? 99  LEU A HD21 5  
ATOM 7827  H HD22 . LEU A 1 99  ? 4.674   15.876  5.399   1.00 0.00 ? 99  LEU A HD22 5  
ATOM 7828  H HD23 . LEU A 1 99  ? 5.276   14.883  4.071   1.00 0.00 ? 99  LEU A HD23 5  
ATOM 7829  N N    . VAL A 1 100 ? 1.575   10.413  3.504   1.00 0.00 ? 100 VAL A N    5  
ATOM 7830  C CA   . VAL A 1 100 ? 0.806   10.315  2.269   1.00 0.00 ? 100 VAL A CA   5  
ATOM 7831  C C    . VAL A 1 100 ? -0.435  11.199  2.323   1.00 0.00 ? 100 VAL A C    5  
ATOM 7832  O O    . VAL A 1 100 ? -0.816  11.687  3.388   1.00 0.00 ? 100 VAL A O    5  
ATOM 7833  C CB   . VAL A 1 100 ? 0.376   8.862   1.989   1.00 0.00 ? 100 VAL A CB   5  
ATOM 7834  C CG1  . VAL A 1 100 ? 1.549   7.912   2.180   1.00 0.00 ? 100 VAL A CG1  5  
ATOM 7835  C CG2  . VAL A 1 100 ? -0.789  8.470   2.885   1.00 0.00 ? 100 VAL A CG2  5  
ATOM 7836  H H    . VAL A 1 100 ? 1.695   9.613   4.057   1.00 0.00 ? 100 VAL A H    5  
ATOM 7837  H HA   . VAL A 1 100 ? 1.436   10.644  1.456   1.00 0.00 ? 100 VAL A HA   5  
ATOM 7838  H HB   . VAL A 1 100 ? 0.051   8.796   0.961   1.00 0.00 ? 100 VAL A HB   5  
ATOM 7839  H HG11 . VAL A 1 100 ? 2.326   8.409   2.742   1.00 0.00 ? 100 VAL A HG11 5  
ATOM 7840  H HG12 . VAL A 1 100 ? 1.218   7.035   2.717   1.00 0.00 ? 100 VAL A HG12 5  
ATOM 7841  H HG13 . VAL A 1 100 ? 1.935   7.620   1.214   1.00 0.00 ? 100 VAL A HG13 5  
ATOM 7842  H HG21 . VAL A 1 100 ? -0.653  8.907   3.863   1.00 0.00 ? 100 VAL A HG21 5  
ATOM 7843  H HG22 . VAL A 1 100 ? -1.712  8.832   2.455   1.00 0.00 ? 100 VAL A HG22 5  
ATOM 7844  H HG23 . VAL A 1 100 ? -0.831  7.395   2.972   1.00 0.00 ? 100 VAL A HG23 5  
ATOM 7845  N N    . CYS A 1 101 ? -1.061  11.401  1.169   1.00 0.00 ? 101 CYS A N    5  
ATOM 7846  C CA   . CYS A 1 101 ? -2.260  12.228  1.084   1.00 0.00 ? 101 CYS A CA   5  
ATOM 7847  C C    . CYS A 1 101 ? -3.068  11.887  -0.164  1.00 0.00 ? 101 CYS A C    5  
ATOM 7848  O O    . CYS A 1 101 ? -2.519  11.424  -1.164  1.00 0.00 ? 101 CYS A O    5  
ATOM 7849  C CB   . CYS A 1 101 ? -1.883  13.710  1.073   1.00 0.00 ? 101 CYS A CB   5  
ATOM 7850  S SG   . CYS A 1 101 ? -1.279  14.306  -0.524  1.00 0.00 ? 101 CYS A SG   5  
ATOM 7851  H H    . CYS A 1 101 ? -0.709  10.985  0.354   1.00 0.00 ? 101 CYS A H    5  
ATOM 7852  H HA   . CYS A 1 101 ? -2.863  12.025  1.955   1.00 0.00 ? 101 CYS A HA   5  
ATOM 7853  H HB2  . CYS A 1 101 ? -2.751  14.296  1.335   1.00 0.00 ? 101 CYS A HB2  5  
ATOM 7854  H HB3  . CYS A 1 101 ? -1.107  13.881  1.804   1.00 0.00 ? 101 CYS A HB3  5  
ATOM 7855  H HG   . CYS A 1 101 ? -2.188  14.009  -1.440  1.00 0.00 ? 101 CYS A HG   5  
ATOM 7856  N N    . ASP A 1 102 ? -4.374  12.116  -0.097  1.00 0.00 ? 102 ASP A N    5  
ATOM 7857  C CA   . ASP A 1 102 ? -5.259  11.833  -1.221  1.00 0.00 ? 102 ASP A CA   5  
ATOM 7858  C C    . ASP A 1 102 ? -4.642  12.311  -2.532  1.00 0.00 ? 102 ASP A C    5  
ATOM 7859  O O    . ASP A 1 102 ? -4.618  13.507  -2.819  1.00 0.00 ? 102 ASP A O    5  
ATOM 7860  C CB   . ASP A 1 102 ? -6.618  12.502  -1.009  1.00 0.00 ? 102 ASP A CB   5  
ATOM 7861  C CG   . ASP A 1 102 ? -7.496  11.735  -0.039  1.00 0.00 ? 102 ASP A CG   5  
ATOM 7862  O OD1  . ASP A 1 102 ? -7.410  12.002  1.178   1.00 0.00 ? 102 ASP A OD1  5  
ATOM 7863  O OD2  . ASP A 1 102 ? -8.269  10.868  -0.498  1.00 0.00 ? 102 ASP A OD2  5  
ATOM 7864  H H    . ASP A 1 102 ? -4.753  12.486  0.728   1.00 0.00 ? 102 ASP A H    5  
ATOM 7865  H HA   . ASP A 1 102 ? -5.398  10.764  -1.272  1.00 0.00 ? 102 ASP A HA   5  
ATOM 7866  H HB2  . ASP A 1 102 ? -6.465  13.497  -0.618  1.00 0.00 ? 102 ASP A HB2  5  
ATOM 7867  H HB3  . ASP A 1 102 ? -7.132  12.567  -1.957  1.00 0.00 ? 102 ASP A HB3  5  
ATOM 7868  N N    . GLY A 1 103 ? -4.142  11.367  -3.324  1.00 0.00 ? 103 GLY A N    5  
ATOM 7869  C CA   . GLY A 1 103 ? -3.531  11.711  -4.594  1.00 0.00 ? 103 GLY A CA   5  
ATOM 7870  C C    . GLY A 1 103 ? -4.525  11.702  -5.738  1.00 0.00 ? 103 GLY A C    5  
ATOM 7871  O O    . GLY A 1 103 ? -4.503  12.583  -6.597  1.00 0.00 ? 103 GLY A O    5  
ATOM 7872  H H    . GLY A 1 103 ? -4.189  10.429  -3.043  1.00 0.00 ? 103 GLY A H    5  
ATOM 7873  H HA2  . GLY A 1 103 ? -3.096  12.697  -4.517  1.00 0.00 ? 103 GLY A HA2  5  
ATOM 7874  H HA3  . GLY A 1 103 ? -2.747  10.999  -4.808  1.00 0.00 ? 103 GLY A HA3  5  
ATOM 7875  N N    . PHE A 1 104 ? -5.400  10.701  -5.751  1.00 0.00 ? 104 PHE A N    5  
ATOM 7876  C CA   . PHE A 1 104 ? -6.406  10.579  -6.800  1.00 0.00 ? 104 PHE A CA   5  
ATOM 7877  C C    . PHE A 1 104 ? -7.707  10.010  -6.241  1.00 0.00 ? 104 PHE A C    5  
ATOM 7878  O O    . PHE A 1 104 ? -7.796  8.822   -5.935  1.00 0.00 ? 104 PHE A O    5  
ATOM 7879  C CB   . PHE A 1 104 ? -5.889  9.685   -7.929  1.00 0.00 ? 104 PHE A CB   5  
ATOM 7880  C CG   . PHE A 1 104 ? -4.404  9.777   -8.134  1.00 0.00 ? 104 PHE A CG   5  
ATOM 7881  C CD1  . PHE A 1 104 ? -3.866  10.731  -8.982  1.00 0.00 ? 104 PHE A CD1  5  
ATOM 7882  C CD2  . PHE A 1 104 ? -3.546  8.909   -7.479  1.00 0.00 ? 104 PHE A CD2  5  
ATOM 7883  C CE1  . PHE A 1 104 ? -2.500  10.817  -9.173  1.00 0.00 ? 104 PHE A CE1  5  
ATOM 7884  C CE2  . PHE A 1 104 ? -2.179  8.990   -7.665  1.00 0.00 ? 104 PHE A CE2  5  
ATOM 7885  C CZ   . PHE A 1 104 ? -1.655  9.946   -8.513  1.00 0.00 ? 104 PHE A CZ   5  
ATOM 7886  H H    . PHE A 1 104 ? -5.368  10.029  -5.038  1.00 0.00 ? 104 PHE A H    5  
ATOM 7887  H HA   . PHE A 1 104 ? -6.597  11.566  -7.191  1.00 0.00 ? 104 PHE A HA   5  
ATOM 7888  H HB2  . PHE A 1 104 ? -6.130  8.657   -7.704  1.00 0.00 ? 104 PHE A HB2  5  
ATOM 7889  H HB3  . PHE A 1 104 ? -6.371  9.970   -8.852  1.00 0.00 ? 104 PHE A HB3  5  
ATOM 7890  H HD1  . PHE A 1 104 ? -4.525  11.414  -9.499  1.00 0.00 ? 104 PHE A HD1  5  
ATOM 7891  H HD2  . PHE A 1 104 ? -3.955  8.160   -6.815  1.00 0.00 ? 104 PHE A HD2  5  
ATOM 7892  H HE1  . PHE A 1 104 ? -2.093  11.566  -9.836  1.00 0.00 ? 104 PHE A HE1  5  
ATOM 7893  H HE2  . PHE A 1 104 ? -1.522  8.307   -7.147  1.00 0.00 ? 104 PHE A HE2  5  
ATOM 7894  H HZ   . PHE A 1 104 ? -0.587  10.011  -8.661  1.00 0.00 ? 104 PHE A HZ   5  
ATOM 7895  N N    . GLU A 1 105 ? -8.714  10.869  -6.112  1.00 0.00 ? 105 GLU A N    5  
ATOM 7896  C CA   . GLU A 1 105 ? -10.010 10.453  -5.589  1.00 0.00 ? 105 GLU A CA   5  
ATOM 7897  C C    . GLU A 1 105 ? -10.387 9.069   -6.109  1.00 0.00 ? 105 GLU A C    5  
ATOM 7898  O O    . GLU A 1 105 ? -10.946 8.251   -5.378  1.00 0.00 ? 105 GLU A O    5  
ATOM 7899  C CB   . GLU A 1 105 ? -11.089 11.466  -5.975  1.00 0.00 ? 105 GLU A CB   5  
ATOM 7900  C CG   . GLU A 1 105 ? -11.150 11.753  -7.466  1.00 0.00 ? 105 GLU A CG   5  
ATOM 7901  C CD   . GLU A 1 105 ? -10.043 12.681  -7.927  1.00 0.00 ? 105 GLU A CD   5  
ATOM 7902  O OE1  . GLU A 1 105 ? -10.050 13.862  -7.522  1.00 0.00 ? 105 GLU A OE1  5  
ATOM 7903  O OE2  . GLU A 1 105 ? -9.169  12.225  -8.694  1.00 0.00 ? 105 GLU A OE2  5  
ATOM 7904  H H    . GLU A 1 105 ? -8.581  11.804  -6.373  1.00 0.00 ? 105 GLU A H    5  
ATOM 7905  H HA   . GLU A 1 105 ? -9.936  10.412  -4.513  1.00 0.00 ? 105 GLU A HA   5  
ATOM 7906  H HB2  . GLU A 1 105 ? -12.051 11.087  -5.662  1.00 0.00 ? 105 GLU A HB2  5  
ATOM 7907  H HB3  . GLU A 1 105 ? -10.895 12.395  -5.459  1.00 0.00 ? 105 GLU A HB3  5  
ATOM 7908  H HG2  . GLU A 1 105 ? -11.064 10.820  -8.003  1.00 0.00 ? 105 GLU A HG2  5  
ATOM 7909  H HG3  . GLU A 1 105 ? -12.102 12.211  -7.693  1.00 0.00 ? 105 GLU A HG3  5  
ATOM 7910  N N    . SER A 1 106 ? -10.077 8.815   -7.376  1.00 0.00 ? 106 SER A N    5  
ATOM 7911  C CA   . SER A 1 106 ? -10.387 7.531   -7.996  1.00 0.00 ? 106 SER A CA   5  
ATOM 7912  C C    . SER A 1 106 ? -11.805 7.088   -7.648  1.00 0.00 ? 106 SER A C    5  
ATOM 7913  O O    . SER A 1 106 ? -12.048 5.917   -7.360  1.00 0.00 ? 106 SER A O    5  
ATOM 7914  C CB   . SER A 1 106 ? -9.383  6.468   -7.546  1.00 0.00 ? 106 SER A CB   5  
ATOM 7915  O OG   . SER A 1 106 ? -9.227  5.464   -8.534  1.00 0.00 ? 106 SER A OG   5  
ATOM 7916  H H    . SER A 1 106 ? -9.632  9.508   -7.908  1.00 0.00 ? 106 SER A H    5  
ATOM 7917  H HA   . SER A 1 106 ? -10.314 7.654   -9.066  1.00 0.00 ? 106 SER A HA   5  
ATOM 7918  H HB2  . SER A 1 106 ? -8.426  6.933   -7.369  1.00 0.00 ? 106 SER A HB2  5  
ATOM 7919  H HB3  . SER A 1 106 ? -9.735  6.008   -6.635  1.00 0.00 ? 106 SER A HB3  5  
ATOM 7920  H HG   . SER A 1 106 ? -8.326  5.133   -8.515  1.00 0.00 ? 106 SER A HG   5  
ATOM 7921  N N    . GLY A 1 107 ? -12.738 8.035   -7.677  1.00 0.00 ? 107 GLY A N    5  
ATOM 7922  C CA   . GLY A 1 107 ? -14.120 7.724   -7.362  1.00 0.00 ? 107 GLY A CA   5  
ATOM 7923  C C    . GLY A 1 107 ? -14.303 7.285   -5.923  1.00 0.00 ? 107 GLY A C    5  
ATOM 7924  O O    . GLY A 1 107 ? -13.710 6.305   -5.470  1.00 0.00 ? 107 GLY A O    5  
ATOM 7925  H H    . GLY A 1 107 ? -12.486 8.952   -7.913  1.00 0.00 ? 107 GLY A H    5  
ATOM 7926  H HA2  . GLY A 1 107 ? -14.725 8.601   -7.539  1.00 0.00 ? 107 GLY A HA2  5  
ATOM 7927  H HA3  . GLY A 1 107 ? -14.456 6.930   -8.013  1.00 0.00 ? 107 GLY A HA3  5  
ATOM 7928  N N    . PRO A 1 108 ? -15.139 8.022   -5.177  1.00 0.00 ? 108 PRO A N    5  
ATOM 7929  C CA   . PRO A 1 108 ? -15.416 7.723   -3.769  1.00 0.00 ? 108 PRO A CA   5  
ATOM 7930  C C    . PRO A 1 108 ? -16.231 6.445   -3.597  1.00 0.00 ? 108 PRO A C    5  
ATOM 7931  O O    . PRO A 1 108 ? -15.868 5.566   -2.816  1.00 0.00 ? 108 PRO A O    5  
ATOM 7932  C CB   . PRO A 1 108 ? -16.220 8.938   -3.299  1.00 0.00 ? 108 PRO A CB   5  
ATOM 7933  C CG   . PRO A 1 108 ? -16.853 9.474   -4.537  1.00 0.00 ? 108 PRO A CG   5  
ATOM 7934  C CD   . PRO A 1 108 ? -15.879 9.203   -5.650  1.00 0.00 ? 108 PRO A CD   5  
ATOM 7935  H HA   . PRO A 1 108 ? -14.505 7.647   -3.192  1.00 0.00 ? 108 PRO A HA   5  
ATOM 7936  H HB2  . PRO A 1 108 ? -16.963 8.625   -2.579  1.00 0.00 ? 108 PRO A HB2  5  
ATOM 7937  H HB3  . PRO A 1 108 ? -15.557 9.661   -2.850  1.00 0.00 ? 108 PRO A HB3  5  
ATOM 7938  H HG2  . PRO A 1 108 ? -17.786 8.965   -4.723  1.00 0.00 ? 108 PRO A HG2  5  
ATOM 7939  H HG3  . PRO A 1 108 ? -17.017 10.537  -4.434  1.00 0.00 ? 108 PRO A HG3  5  
ATOM 7940  H HD2  . PRO A 1 108 ? -16.406 8.986   -6.568  1.00 0.00 ? 108 PRO A HD2  5  
ATOM 7941  H HD3  . PRO A 1 108 ? -15.215 10.045  -5.784  1.00 0.00 ? 108 PRO A HD3  5  
ATOM 7942  N N    . SER A 1 109 ? -17.335 6.350   -4.331  1.00 0.00 ? 109 SER A N    5  
ATOM 7943  C CA   . SER A 1 109 ? -18.204 5.182   -4.258  1.00 0.00 ? 109 SER A CA   5  
ATOM 7944  C C    . SER A 1 109 ? -17.567 3.986   -4.958  1.00 0.00 ? 109 SER A C    5  
ATOM 7945  O O    . SER A 1 109 ? -16.861 4.140   -5.955  1.00 0.00 ? 109 SER A O    5  
ATOM 7946  C CB   . SER A 1 109 ? -19.564 5.490   -4.886  1.00 0.00 ? 109 SER A CB   5  
ATOM 7947  O OG   . SER A 1 109 ? -20.187 6.588   -4.241  1.00 0.00 ? 109 SER A OG   5  
ATOM 7948  H H    . SER A 1 109 ? -17.572 7.085   -4.935  1.00 0.00 ? 109 SER A H    5  
ATOM 7949  H HA   . SER A 1 109 ? -18.346 4.939   -3.215  1.00 0.00 ? 109 SER A HA   5  
ATOM 7950  H HB2  . SER A 1 109 ? -19.429 5.731   -5.930  1.00 0.00 ? 109 SER A HB2  5  
ATOM 7951  H HB3  . SER A 1 109 ? -20.204 4.624   -4.796  1.00 0.00 ? 109 SER A HB3  5  
ATOM 7952  H HG   . SER A 1 109 ? -20.955 6.863   -4.747  1.00 0.00 ? 109 SER A HG   5  
ATOM 7953  N N    . SER A 1 110 ? -17.822 2.793   -4.430  1.00 0.00 ? 110 SER A N    5  
ATOM 7954  C CA   . SER A 1 110 ? -17.271 1.570   -5.001  1.00 0.00 ? 110 SER A CA   5  
ATOM 7955  C C    . SER A 1 110 ? -17.533 1.506   -6.503  1.00 0.00 ? 110 SER A C    5  
ATOM 7956  O O    . SER A 1 110 ? -18.672 1.628   -6.951  1.00 0.00 ? 110 SER A O    5  
ATOM 7957  C CB   . SER A 1 110 ? -17.874 0.344   -4.314  1.00 0.00 ? 110 SER A CB   5  
ATOM 7958  O OG   . SER A 1 110 ? -19.287 0.340   -4.425  1.00 0.00 ? 110 SER A OG   5  
ATOM 7959  H H    . SER A 1 110 ? -18.392 2.735   -3.635  1.00 0.00 ? 110 SER A H    5  
ATOM 7960  H HA   . SER A 1 110 ? -16.204 1.577   -4.834  1.00 0.00 ? 110 SER A HA   5  
ATOM 7961  H HB2  . SER A 1 110 ? -17.486 -0.552  -4.775  1.00 0.00 ? 110 SER A HB2  5  
ATOM 7962  H HB3  . SER A 1 110 ? -17.607 0.354   -3.267  1.00 0.00 ? 110 SER A HB3  5  
ATOM 7963  H HG   . SER A 1 110 ? -19.542 -0.077  -5.251  1.00 0.00 ? 110 SER A HG   5  
ATOM 7964  N N    . GLY A 1 111 ? -16.469 1.313   -7.276  1.00 0.00 ? 111 GLY A N    5  
ATOM 7965  C CA   . GLY A 1 111 ? -16.604 1.236   -8.719  1.00 0.00 ? 111 GLY A CA   5  
ATOM 7966  C C    . GLY A 1 111 ? -15.635 0.248   -9.340  1.00 0.00 ? 111 GLY A C    5  
ATOM 7967  O O    . GLY A 1 111 ? -15.939 -0.371  -10.359 1.00 0.00 ? 111 GLY A O    5  
ATOM 7968  H H    . GLY A 1 111 ? -15.584 1.222   -6.863  1.00 0.00 ? 111 GLY A H    5  
ATOM 7969  H HA2  . GLY A 1 111 ? -17.612 0.935   -8.959  1.00 0.00 ? 111 GLY A HA2  5  
ATOM 7970  H HA3  . GLY A 1 111 ? -16.421 2.214   -9.139  1.00 0.00 ? 111 GLY A HA3  5  
ATOM 7971  N N    . GLY A 1 1   ? -23.427 28.170  12.731  1.00 0.00 ? 1   GLY A N    6  
ATOM 7972  C CA   . GLY A 1 1   ? -23.980 27.669  11.486  1.00 0.00 ? 1   GLY A CA   6  
ATOM 7973  C C    . GLY A 1 1   ? -23.166 26.528  10.908  1.00 0.00 ? 1   GLY A C    6  
ATOM 7974  O O    . GLY A 1 1   ? -21.970 26.413  11.174  1.00 0.00 ? 1   GLY A O    6  
ATOM 7975  H H1   . GLY A 1 1   ? -22.490 28.454  12.770  1.00 0.00 ? 1   GLY A H1   6  
ATOM 7976  H HA2  . GLY A 1 1   ? -24.987 27.325  11.664  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 7977  H HA3  . GLY A 1 1   ? -24.007 28.475  10.767  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 7978  N N    . SER A 1 2   ? -23.817 25.681  10.117  1.00 0.00 ? 2   SER A N    6  
ATOM 7979  C CA   . SER A 1 2   ? -23.147 24.539  9.505   1.00 0.00 ? 2   SER A CA   6  
ATOM 7980  C C    . SER A 1 2   ? -22.016 24.999  8.590   1.00 0.00 ? 2   SER A C    6  
ATOM 7981  O O    . SER A 1 2   ? -22.216 25.207  7.394   1.00 0.00 ? 2   SER A O    6  
ATOM 7982  C CB   . SER A 1 2   ? -24.149 23.698  8.712   1.00 0.00 ? 2   SER A CB   6  
ATOM 7983  O OG   . SER A 1 2   ? -23.486 22.738  7.908   1.00 0.00 ? 2   SER A OG   6  
ATOM 7984  H H    . SER A 1 2   ? -24.770 25.826  9.943   1.00 0.00 ? 2   SER A H    6  
ATOM 7985  H HA   . SER A 1 2   ? -22.731 23.935  10.297  1.00 0.00 ? 2   SER A HA   6  
ATOM 7986  H HB2  . SER A 1 2   ? -24.806 23.184  9.397   1.00 0.00 ? 2   SER A HB2  6  
ATOM 7987  H HB3  . SER A 1 2   ? -24.732 24.346  8.073   1.00 0.00 ? 2   SER A HB3  6  
ATOM 7988  H HG   . SER A 1 2   ? -22.942 22.176  8.463   1.00 0.00 ? 2   SER A HG   6  
ATOM 7989  N N    . SER A 1 3   ? -20.827 25.156  9.163   1.00 0.00 ? 3   SER A N    6  
ATOM 7990  C CA   . SER A 1 3   ? -19.663 25.595  8.402   1.00 0.00 ? 3   SER A CA   6  
ATOM 7991  C C    . SER A 1 3   ? -19.181 24.493  7.463   1.00 0.00 ? 3   SER A C    6  
ATOM 7992  O O    . SER A 1 3   ? -19.212 23.312  7.807   1.00 0.00 ? 3   SER A O    6  
ATOM 7993  C CB   . SER A 1 3   ? -18.534 26.006  9.348   1.00 0.00 ? 3   SER A CB   6  
ATOM 7994  O OG   . SER A 1 3   ? -17.629 26.890  8.709   1.00 0.00 ? 3   SER A OG   6  
ATOM 7995  H H    . SER A 1 3   ? -20.731 24.974  10.122  1.00 0.00 ? 3   SER A H    6  
ATOM 7996  H HA   . SER A 1 3   ? -19.957 26.451  7.812   1.00 0.00 ? 3   SER A HA   6  
ATOM 7997  H HB2  . SER A 1 3   ? -18.952 26.501  10.211  1.00 0.00 ? 3   SER A HB2  6  
ATOM 7998  H HB3  . SER A 1 3   ? -17.994 25.124  9.664   1.00 0.00 ? 3   SER A HB3  6  
ATOM 7999  H HG   . SER A 1 3   ? -18.108 27.651  8.374   1.00 0.00 ? 3   SER A HG   6  
ATOM 8000  N N    . GLY A 1 4   ? -18.734 24.889  6.275   1.00 0.00 ? 4   GLY A N    6  
ATOM 8001  C CA   . GLY A 1 4   ? -18.252 23.925  5.305   1.00 0.00 ? 4   GLY A CA   6  
ATOM 8002  C C    . GLY A 1 4   ? -16.974 23.242  5.752   1.00 0.00 ? 4   GLY A C    6  
ATOM 8003  O O    . GLY A 1 4   ? -16.151 23.842  6.443   1.00 0.00 ? 4   GLY A O    6  
ATOM 8004  H H    . GLY A 1 4   ? -18.733 25.845  6.056   1.00 0.00 ? 4   GLY A H    6  
ATOM 8005  H HA2  . GLY A 1 4   ? -19.013 23.175  5.150   1.00 0.00 ? 4   GLY A HA2  6  
ATOM 8006  H HA3  . GLY A 1 4   ? -18.066 24.434  4.370   1.00 0.00 ? 4   GLY A HA3  6  
ATOM 8007  N N    . SER A 1 5   ? -16.808 21.984  5.357   1.00 0.00 ? 5   SER A N    6  
ATOM 8008  C CA   . SER A 1 5   ? -15.623 21.217  5.726   1.00 0.00 ? 5   SER A CA   6  
ATOM 8009  C C    . SER A 1 5   ? -14.538 21.349  4.662   1.00 0.00 ? 5   SER A C    6  
ATOM 8010  O O    . SER A 1 5   ? -14.796 21.810  3.550   1.00 0.00 ? 5   SER A O    6  
ATOM 8011  C CB   . SER A 1 5   ? -15.985 19.744  5.923   1.00 0.00 ? 5   SER A CB   6  
ATOM 8012  O OG   . SER A 1 5   ? -16.908 19.583  6.985   1.00 0.00 ? 5   SER A OG   6  
ATOM 8013  H H    . SER A 1 5   ? -17.500 21.561  4.807   1.00 0.00 ? 5   SER A H    6  
ATOM 8014  H HA   . SER A 1 5   ? -15.248 21.615  6.657   1.00 0.00 ? 5   SER A HA   6  
ATOM 8015  H HB2  . SER A 1 5   ? -16.427 19.360  5.016   1.00 0.00 ? 5   SER A HB2  6  
ATOM 8016  H HB3  . SER A 1 5   ? -15.089 19.184  6.151   1.00 0.00 ? 5   SER A HB3  6  
ATOM 8017  H HG   . SER A 1 5   ? -16.444 19.637  7.824   1.00 0.00 ? 5   SER A HG   6  
ATOM 8018  N N    . SER A 1 6   ? -13.322 20.940  5.012   1.00 0.00 ? 6   SER A N    6  
ATOM 8019  C CA   . SER A 1 6   ? -12.196 21.015  4.090   1.00 0.00 ? 6   SER A CA   6  
ATOM 8020  C C    . SER A 1 6   ? -11.843 19.633  3.548   1.00 0.00 ? 6   SER A C    6  
ATOM 8021  O O    . SER A 1 6   ? -12.115 19.320  2.390   1.00 0.00 ? 6   SER A O    6  
ATOM 8022  C CB   . SER A 1 6   ? -10.979 21.628  4.786   1.00 0.00 ? 6   SER A CB   6  
ATOM 8023  O OG   . SER A 1 6   ? -9.836  21.581  3.950   1.00 0.00 ? 6   SER A OG   6  
ATOM 8024  H H    . SER A 1 6   ? -13.180 20.582  5.913   1.00 0.00 ? 6   SER A H    6  
ATOM 8025  H HA   . SER A 1 6   ? -12.484 21.649  3.265   1.00 0.00 ? 6   SER A HA   6  
ATOM 8026  H HB2  . SER A 1 6   ? -11.189 22.658  5.032   1.00 0.00 ? 6   SER A HB2  6  
ATOM 8027  H HB3  . SER A 1 6   ? -10.771 21.077  5.692   1.00 0.00 ? 6   SER A HB3  6  
ATOM 8028  H HG   . SER A 1 6   ? -9.051  21.452  4.488   1.00 0.00 ? 6   SER A HG   6  
ATOM 8029  N N    . GLY A 1 7   ? -11.236 18.809  4.397   1.00 0.00 ? 7   GLY A N    6  
ATOM 8030  C CA   . GLY A 1 7   ? -10.856 17.470  3.987   1.00 0.00 ? 7   GLY A CA   6  
ATOM 8031  C C    . GLY A 1 7   ? -9.360  17.243  4.063   1.00 0.00 ? 7   GLY A C    6  
ATOM 8032  O O    . GLY A 1 7   ? -8.631  17.435  3.090   1.00 0.00 ? 7   GLY A O    6  
ATOM 8033  H H    . GLY A 1 7   ? -11.045 19.113  5.309   1.00 0.00 ? 7   GLY A H    6  
ATOM 8034  H HA2  . GLY A 1 7   ? -11.351 16.755  4.627   1.00 0.00 ? 7   GLY A HA2  6  
ATOM 8035  H HA3  . GLY A 1 7   ? -11.181 17.312  2.969   1.00 0.00 ? 7   GLY A HA3  6  
ATOM 8036  N N    . PRO A 1 8   ? -8.880  16.826  5.244   1.00 0.00 ? 8   PRO A N    6  
ATOM 8037  C CA   . PRO A 1 8   ? -7.455  16.565  5.472   1.00 0.00 ? 8   PRO A CA   6  
ATOM 8038  C C    . PRO A 1 8   ? -6.965  15.329  4.726   1.00 0.00 ? 8   PRO A C    6  
ATOM 8039  O O    . PRO A 1 8   ? -7.746  14.635  4.075   1.00 0.00 ? 8   PRO A O    6  
ATOM 8040  C CB   . PRO A 1 8   ? -7.373  16.345  6.985   1.00 0.00 ? 8   PRO A CB   6  
ATOM 8041  C CG   . PRO A 1 8   ? -8.733  15.879  7.375   1.00 0.00 ? 8   PRO A CG   6  
ATOM 8042  C CD   . PRO A 1 8   ? -9.691  16.577  6.448   1.00 0.00 ? 8   PRO A CD   6  
ATOM 8043  H HA   . PRO A 1 8   ? -6.847  17.415  5.197   1.00 0.00 ? 8   PRO A HA   6  
ATOM 8044  H HB2  . PRO A 1 8   ? -6.622  15.598  7.202   1.00 0.00 ? 8   PRO A HB2  6  
ATOM 8045  H HB3  . PRO A 1 8   ? -7.118  17.272  7.474   1.00 0.00 ? 8   PRO A HB3  6  
ATOM 8046  H HG2  . PRO A 1 8   ? -8.805  14.810  7.252   1.00 0.00 ? 8   PRO A HG2  6  
ATOM 8047  H HG3  . PRO A 1 8   ? -8.936  16.155  8.399   1.00 0.00 ? 8   PRO A HG3  6  
ATOM 8048  H HD2  . PRO A 1 8   ? -10.530 15.937  6.221   1.00 0.00 ? 8   PRO A HD2  6  
ATOM 8049  H HD3  . PRO A 1 8   ? -10.028 17.506  6.884   1.00 0.00 ? 8   PRO A HD3  6  
ATOM 8050  N N    . GLY A 1 9   ? -5.667  15.059  4.826   1.00 0.00 ? 9   GLY A N    6  
ATOM 8051  C CA   . GLY A 1 9   ? -5.096  13.905  4.155   1.00 0.00 ? 9   GLY A CA   6  
ATOM 8052  C C    . GLY A 1 9   ? -3.587  13.989  4.042   1.00 0.00 ? 9   GLY A C    6  
ATOM 8053  O O    . GLY A 1 9   ? -2.903  12.965  3.988   1.00 0.00 ? 9   GLY A O    6  
ATOM 8054  H H    . GLY A 1 9   ? -5.093  15.647  5.359   1.00 0.00 ? 9   GLY A H    6  
ATOM 8055  H HA2  . GLY A 1 9   ? -5.357  13.015  4.708   1.00 0.00 ? 9   GLY A HA2  6  
ATOM 8056  H HA3  . GLY A 1 9   ? -5.517  13.836  3.162   1.00 0.00 ? 9   GLY A HA3  6  
ATOM 8057  N N    . LEU A 1 10  ? -3.065  15.210  4.004   1.00 0.00 ? 10  LEU A N    6  
ATOM 8058  C CA   . LEU A 1 10  ? -1.626  15.423  3.895   1.00 0.00 ? 10  LEU A CA   6  
ATOM 8059  C C    . LEU A 1 10  ? -0.999  15.623  5.271   1.00 0.00 ? 10  LEU A C    6  
ATOM 8060  O O    . LEU A 1 10  ? 0.025   16.293  5.406   1.00 0.00 ? 10  LEU A O    6  
ATOM 8061  C CB   . LEU A 1 10  ? -1.336  16.636  3.009   1.00 0.00 ? 10  LEU A CB   6  
ATOM 8062  C CG   . LEU A 1 10  ? -2.120  17.908  3.335   1.00 0.00 ? 10  LEU A CG   6  
ATOM 8063  C CD1  . LEU A 1 10  ? -3.488  17.877  2.672   1.00 0.00 ? 10  LEU A CD1  6  
ATOM 8064  C CD2  . LEU A 1 10  ? -2.260  18.077  4.841   1.00 0.00 ? 10  LEU A CD2  6  
ATOM 8065  H H    . LEU A 1 10  ? -3.660  15.986  4.051   1.00 0.00 ? 10  LEU A H    6  
ATOM 8066  H HA   . LEU A 1 10  ? -1.194  14.544  3.440   1.00 0.00 ? 10  LEU A HA   6  
ATOM 8067  H HB2  . LEU A 1 10  ? -0.285  16.865  3.095   1.00 0.00 ? 10  LEU A HB2  6  
ATOM 8068  H HB3  . LEU A 1 10  ? -1.561  16.360  1.989   1.00 0.00 ? 10  LEU A HB3  6  
ATOM 8069  H HG   . LEU A 1 10  ? -1.582  18.764  2.951   1.00 0.00 ? 10  LEU A HG   6  
ATOM 8070  H HD11 . LEU A 1 10  ? -3.541  17.038  1.994   1.00 0.00 ? 10  LEU A HD11 6  
ATOM 8071  H HD12 . LEU A 1 10  ? -3.642  18.794  2.122   1.00 0.00 ? 10  LEU A HD12 6  
ATOM 8072  H HD13 . LEU A 1 10  ? -4.253  17.779  3.428   1.00 0.00 ? 10  LEU A HD13 6  
ATOM 8073  H HD21 . LEU A 1 10  ? -2.780  17.224  5.252   1.00 0.00 ? 10  LEU A HD21 6  
ATOM 8074  H HD22 . LEU A 1 10  ? -2.821  18.976  5.052   1.00 0.00 ? 10  LEU A HD22 6  
ATOM 8075  H HD23 . LEU A 1 10  ? -1.279  18.150  5.288   1.00 0.00 ? 10  LEU A HD23 6  
ATOM 8076  N N    . ARG A 1 11  ? -1.619  15.035  6.289   1.00 0.00 ? 11  ARG A N    6  
ATOM 8077  C CA   . ARG A 1 11  ? -1.121  15.148  7.655   1.00 0.00 ? 11  ARG A CA   6  
ATOM 8078  C C    . ARG A 1 11  ? -0.301  13.920  8.038   1.00 0.00 ? 11  ARG A C    6  
ATOM 8079  O O    . ARG A 1 11  ? -0.260  12.935  7.300   1.00 0.00 ? 11  ARG A O    6  
ATOM 8080  C CB   . ARG A 1 11  ? -2.286  15.322  8.632   1.00 0.00 ? 11  ARG A CB   6  
ATOM 8081  C CG   . ARG A 1 11  ? -3.319  16.337  8.173   1.00 0.00 ? 11  ARG A CG   6  
ATOM 8082  C CD   . ARG A 1 11  ? -2.964  17.742  8.635   1.00 0.00 ? 11  ARG A CD   6  
ATOM 8083  N NE   . ARG A 1 11  ? -1.816  18.282  7.912   1.00 0.00 ? 11  ARG A NE   6  
ATOM 8084  C CZ   . ARG A 1 11  ? -1.311  19.491  8.131   1.00 0.00 ? 11  ARG A CZ   6  
ATOM 8085  N NH1  . ARG A 1 11  ? -1.850  20.281  9.050   1.00 0.00 ? 11  ARG A NH1  6  
ATOM 8086  N NH2  . ARG A 1 11  ? -0.265  19.912  7.432   1.00 0.00 ? 11  ARG A NH2  6  
ATOM 8087  H H    . ARG A 1 11  ? -2.431  14.514  6.118   1.00 0.00 ? 11  ARG A H    6  
ATOM 8088  H HA   . ARG A 1 11  ? -0.487  16.020  7.706   1.00 0.00 ? 11  ARG A HA   6  
ATOM 8089  H HB2  . ARG A 1 11  ? -2.780  14.370  8.758   1.00 0.00 ? 11  ARG A HB2  6  
ATOM 8090  H HB3  . ARG A 1 11  ? -1.894  15.644  9.585   1.00 0.00 ? 11  ARG A HB3  6  
ATOM 8091  H HG2  . ARG A 1 11  ? -3.367  16.327  7.094   1.00 0.00 ? 11  ARG A HG2  6  
ATOM 8092  H HG3  . ARG A 1 11  ? -4.282  16.066  8.581   1.00 0.00 ? 11  ARG A HG3  6  
ATOM 8093  H HD2  . ARG A 1 11  ? -3.815  18.386  8.473   1.00 0.00 ? 11  ARG A HD2  6  
ATOM 8094  H HD3  . ARG A 1 11  ? -2.731  17.711  9.689   1.00 0.00 ? 11  ARG A HD3  6  
ATOM 8095  H HE   . ARG A 1 11  ? -1.402  17.715  7.228   1.00 0.00 ? 11  ARG A HE   6  
ATOM 8096  H HH11 . ARG A 1 11  ? -2.638  19.966  9.579   1.00 0.00 ? 11  ARG A HH11 6  
ATOM 8097  H HH12 . ARG A 1 11  ? -1.467  21.190  9.214   1.00 0.00 ? 11  ARG A HH12 6  
ATOM 8098  H HH21 . ARG A 1 11  ? 0.144   19.319  6.739   1.00 0.00 ? 11  ARG A HH21 6  
ATOM 8099  H HH22 . ARG A 1 11  ? 0.114   20.821  7.598   1.00 0.00 ? 11  ARG A HH22 6  
ATOM 8100  N N    . GLU A 1 12  ? 0.351   13.986  9.194   1.00 0.00 ? 12  GLU A N    6  
ATOM 8101  C CA   . GLU A 1 12  ? 1.171   12.880  9.673   1.00 0.00 ? 12  GLU A CA   6  
ATOM 8102  C C    . GLU A 1 12  ? 0.298   11.736  10.183  1.00 0.00 ? 12  GLU A C    6  
ATOM 8103  O O    . GLU A 1 12  ? -0.332  11.843  11.236  1.00 0.00 ? 12  GLU A O    6  
ATOM 8104  C CB   . GLU A 1 12  ? 2.108   13.355  10.785  1.00 0.00 ? 12  GLU A CB   6  
ATOM 8105  C CG   . GLU A 1 12  ? 3.209   12.361  11.119  1.00 0.00 ? 12  GLU A CG   6  
ATOM 8106  C CD   . GLU A 1 12  ? 4.114   12.847  12.234  1.00 0.00 ? 12  GLU A CD   6  
ATOM 8107  O OE1  . GLU A 1 12  ? 3.603   13.490  13.175  1.00 0.00 ? 12  GLU A OE1  6  
ATOM 8108  O OE2  . GLU A 1 12  ? 5.333   12.584  12.167  1.00 0.00 ? 12  GLU A OE2  6  
ATOM 8109  H H    . GLU A 1 12  ? 0.279   14.799  9.738   1.00 0.00 ? 12  GLU A H    6  
ATOM 8110  H HA   . GLU A 1 12  ? 1.762   12.522  8.844   1.00 0.00 ? 12  GLU A HA   6  
ATOM 8111  H HB2  . GLU A 1 12  ? 2.569   14.282  10.479  1.00 0.00 ? 12  GLU A HB2  6  
ATOM 8112  H HB3  . GLU A 1 12  ? 1.527   13.530  11.679  1.00 0.00 ? 12  GLU A HB3  6  
ATOM 8113  H HG2  . GLU A 1 12  ? 2.755   11.430  11.424  1.00 0.00 ? 12  GLU A HG2  6  
ATOM 8114  H HG3  . GLU A 1 12  ? 3.808   12.197  10.235  1.00 0.00 ? 12  GLU A HG3  6  
ATOM 8115  N N    . LEU A 1 13  ? 0.264   10.644  9.428   1.00 0.00 ? 13  LEU A N    6  
ATOM 8116  C CA   . LEU A 1 13  ? -0.532  9.480   9.802   1.00 0.00 ? 13  LEU A CA   6  
ATOM 8117  C C    . LEU A 1 13  ? 0.364   8.292   10.136  1.00 0.00 ? 13  LEU A C    6  
ATOM 8118  O O    . LEU A 1 13  ? 1.517   8.232   9.707   1.00 0.00 ? 13  LEU A O    6  
ATOM 8119  C CB   . LEU A 1 13  ? -1.490  9.107   8.669   1.00 0.00 ? 13  LEU A CB   6  
ATOM 8120  C CG   . LEU A 1 13  ? -2.693  10.031  8.476   1.00 0.00 ? 13  LEU A CG   6  
ATOM 8121  C CD1  . LEU A 1 13  ? -3.508  9.601   7.266   1.00 0.00 ? 13  LEU A CD1  6  
ATOM 8122  C CD2  . LEU A 1 13  ? -3.559  10.047  9.727   1.00 0.00 ? 13  LEU A CD2  6  
ATOM 8123  H H    . LEU A 1 13  ? 0.786   10.618  8.600   1.00 0.00 ? 13  LEU A H    6  
ATOM 8124  H HA   . LEU A 1 13  ? -1.107  9.739   10.678  1.00 0.00 ? 13  LEU A HA   6  
ATOM 8125  H HB2  . LEU A 1 13  ? -0.927  9.102   7.748   1.00 0.00 ? 13  LEU A HB2  6  
ATOM 8126  H HB3  . LEU A 1 13  ? -1.864  8.113   8.866   1.00 0.00 ? 13  LEU A HB3  6  
ATOM 8127  H HG   . LEU A 1 13  ? -2.341  11.038  8.299   1.00 0.00 ? 13  LEU A HG   6  
ATOM 8128  H HD11 . LEU A 1 13  ? -3.264  8.581   7.012   1.00 0.00 ? 13  LEU A HD11 6  
ATOM 8129  H HD12 . LEU A 1 13  ? -3.279  10.245  6.430   1.00 0.00 ? 13  LEU A HD12 6  
ATOM 8130  H HD13 . LEU A 1 13  ? -4.561  9.674   7.497   1.00 0.00 ? 13  LEU A HD13 6  
ATOM 8131  H HD21 . LEU A 1 13  ? -3.452  9.109   10.250  1.00 0.00 ? 13  LEU A HD21 6  
ATOM 8132  H HD22 . LEU A 1 13  ? -4.593  10.187  9.447   1.00 0.00 ? 13  LEU A HD22 6  
ATOM 8133  H HD23 . LEU A 1 13  ? -3.247  10.857  10.370  1.00 0.00 ? 13  LEU A HD23 6  
ATOM 8134  N N    . CYS A 1 14  ? -0.173  7.349   10.902  1.00 0.00 ? 14  CYS A N    6  
ATOM 8135  C CA   . CYS A 1 14  ? 0.578   6.161   11.293  1.00 0.00 ? 14  CYS A CA   6  
ATOM 8136  C C    . CYS A 1 14  ? -0.293  4.912   11.199  1.00 0.00 ? 14  CYS A C    6  
ATOM 8137  O O    . CYS A 1 14  ? -1.506  4.973   11.400  1.00 0.00 ? 14  CYS A O    6  
ATOM 8138  C CB   . CYS A 1 14  ? 1.115   6.318   12.716  1.00 0.00 ? 14  CYS A CB   6  
ATOM 8139  S SG   . CYS A 1 14  ? -0.172  6.449   13.980  1.00 0.00 ? 14  CYS A SG   6  
ATOM 8140  H H    . CYS A 1 14  ? -1.097  7.454   11.213  1.00 0.00 ? 14  CYS A H    6  
ATOM 8141  H HA   . CYS A 1 14  ? 1.410   6.057   10.613  1.00 0.00 ? 14  CYS A HA   6  
ATOM 8142  H HB2  . CYS A 1 14  ? 1.726   5.461   12.959  1.00 0.00 ? 14  CYS A HB2  6  
ATOM 8143  H HB3  . CYS A 1 14  ? 1.721   7.210   12.768  1.00 0.00 ? 14  CYS A HB3  6  
ATOM 8144  H HG   . CYS A 1 14  ? 0.183   7.404   14.826  1.00 0.00 ? 14  CYS A HG   6  
ATOM 8145  N N    . ILE A 1 15  ? 0.335   3.782   10.891  1.00 0.00 ? 15  ILE A N    6  
ATOM 8146  C CA   . ILE A 1 15  ? -0.383  2.520   10.769  1.00 0.00 ? 15  ILE A CA   6  
ATOM 8147  C C    . ILE A 1 15  ? 0.043   1.538   11.856  1.00 0.00 ? 15  ILE A C    6  
ATOM 8148  O O    . ILE A 1 15  ? 1.052   0.847   11.719  1.00 0.00 ? 15  ILE A O    6  
ATOM 8149  C CB   . ILE A 1 15  ? -0.155  1.872   9.391   1.00 0.00 ? 15  ILE A CB   6  
ATOM 8150  C CG1  . ILE A 1 15  ? -0.640  2.805   8.279   1.00 0.00 ? 15  ILE A CG1  6  
ATOM 8151  C CG2  . ILE A 1 15  ? -0.866  0.530   9.311   1.00 0.00 ? 15  ILE A CG2  6  
ATOM 8152  C CD1  . ILE A 1 15  ? -0.552  2.195   6.897   1.00 0.00 ? 15  ILE A CD1  6  
ATOM 8153  H H    . ILE A 1 15  ? 1.303   3.798   10.742  1.00 0.00 ? 15  ILE A H    6  
ATOM 8154  H HA   . ILE A 1 15  ? -1.438  2.725   10.878  1.00 0.00 ? 15  ILE A HA   6  
ATOM 8155  H HB   . ILE A 1 15  ? 0.904   1.700   9.270   1.00 0.00 ? 15  ILE A HB   6  
ATOM 8156  H HG12 . ILE A 1 15  ? -1.670  3.066   8.460   1.00 0.00 ? 15  ILE A HG12 6  
ATOM 8157  H HG13 . ILE A 1 15  ? -0.039  3.703   8.285   1.00 0.00 ? 15  ILE A HG13 6  
ATOM 8158  H HG21 . ILE A 1 15  ? -1.826  0.659   8.833   1.00 0.00 ? 15  ILE A HG21 6  
ATOM 8159  H HG22 . ILE A 1 15  ? -0.268  -0.160  8.735   1.00 0.00 ? 15  ILE A HG22 6  
ATOM 8160  H HG23 . ILE A 1 15  ? -1.009  0.139   10.307  1.00 0.00 ? 15  ILE A HG23 6  
ATOM 8161  H HD11 . ILE A 1 15  ? -1.480  2.360   6.371   1.00 0.00 ? 15  ILE A HD11 6  
ATOM 8162  H HD12 . ILE A 1 15  ? 0.259   2.653   6.352   1.00 0.00 ? 15  ILE A HD12 6  
ATOM 8163  H HD13 . ILE A 1 15  ? -0.372  1.133   6.984   1.00 0.00 ? 15  ILE A HD13 6  
ATOM 8164  N N    . GLN A 1 16  ? -0.733  1.483   12.933  1.00 0.00 ? 16  GLN A N    6  
ATOM 8165  C CA   . GLN A 1 16  ? -0.436  0.585   14.043  1.00 0.00 ? 16  GLN A CA   6  
ATOM 8166  C C    . GLN A 1 16  ? -0.646  -0.870  13.637  1.00 0.00 ? 16  GLN A C    6  
ATOM 8167  O O    . GLN A 1 16  ? -1.771  -1.299  13.382  1.00 0.00 ? 16  GLN A O    6  
ATOM 8168  C CB   . GLN A 1 16  ? -1.314  0.922   15.249  1.00 0.00 ? 16  GLN A CB   6  
ATOM 8169  C CG   . GLN A 1 16  ? -0.667  1.896   16.220  1.00 0.00 ? 16  GLN A CG   6  
ATOM 8170  C CD   . GLN A 1 16  ? -1.682  2.751   16.953  1.00 0.00 ? 16  GLN A CD   6  
ATOM 8171  O OE1  . GLN A 1 16  ? -2.474  2.247   17.750  1.00 0.00 ? 16  GLN A OE1  6  
ATOM 8172  N NE2  . GLN A 1 16  ? -1.664  4.052   16.687  1.00 0.00 ? 16  GLN A NE2  6  
ATOM 8173  H H    . GLN A 1 16  ? -1.523  2.059   12.983  1.00 0.00 ? 16  GLN A H    6  
ATOM 8174  H HA   . GLN A 1 16  ? 0.600   0.724   14.314  1.00 0.00 ? 16  GLN A HA   6  
ATOM 8175  H HB2  . GLN A 1 16  ? -2.237  1.358   14.896  1.00 0.00 ? 16  GLN A HB2  6  
ATOM 8176  H HB3  . GLN A 1 16  ? -1.537  0.010   15.783  1.00 0.00 ? 16  GLN A HB3  6  
ATOM 8177  H HG2  . GLN A 1 16  ? -0.099  1.336   16.948  1.00 0.00 ? 16  GLN A HG2  6  
ATOM 8178  H HG3  . GLN A 1 16  ? -0.003  2.545   15.669  1.00 0.00 ? 16  GLN A HG3  6  
ATOM 8179  H HE21 . GLN A 1 16  ? -1.006  4.382   16.040  1.00 0.00 ? 16  GLN A HE21 6  
ATOM 8180  H HE22 . GLN A 1 16  ? -2.309  4.627   17.146  1.00 0.00 ? 16  GLN A HE22 6  
ATOM 8181  N N    . LYS A 1 17  ? 0.446   -1.626  13.579  1.00 0.00 ? 17  LYS A N    6  
ATOM 8182  C CA   . LYS A 1 17  ? 0.383   -3.034  13.205  1.00 0.00 ? 17  LYS A CA   6  
ATOM 8183  C C    . LYS A 1 17  ? 1.021   -3.911  14.277  1.00 0.00 ? 17  LYS A C    6  
ATOM 8184  O O    . LYS A 1 17  ? 1.623   -3.408  15.225  1.00 0.00 ? 17  LYS A O    6  
ATOM 8185  C CB   . LYS A 1 17  ? 1.084   -3.258  11.863  1.00 0.00 ? 17  LYS A CB   6  
ATOM 8186  C CG   . LYS A 1 17  ? 2.559   -3.595  11.996  1.00 0.00 ? 17  LYS A CG   6  
ATOM 8187  C CD   . LYS A 1 17  ? 3.319   -3.289  10.717  1.00 0.00 ? 17  LYS A CD   6  
ATOM 8188  C CE   . LYS A 1 17  ? 3.597   -1.801  10.576  1.00 0.00 ? 17  LYS A CE   6  
ATOM 8189  N NZ   . LYS A 1 17  ? 2.417   -1.064  10.043  1.00 0.00 ? 17  LYS A NZ   6  
ATOM 8190  H H    . LYS A 1 17  ? 1.315   -1.227  13.793  1.00 0.00 ? 17  LYS A H    6  
ATOM 8191  H HA   . LYS A 1 17  ? -0.658  -3.305  13.107  1.00 0.00 ? 17  LYS A HA   6  
ATOM 8192  H HB2  . LYS A 1 17  ? 0.595   -4.071  11.347  1.00 0.00 ? 17  LYS A HB2  6  
ATOM 8193  H HB3  . LYS A 1 17  ? 0.994   -2.360  11.269  1.00 0.00 ? 17  LYS A HB3  6  
ATOM 8194  H HG2  . LYS A 1 17  ? 2.981   -3.012  12.801  1.00 0.00 ? 17  LYS A HG2  6  
ATOM 8195  H HG3  . LYS A 1 17  ? 2.659   -4.648  12.221  1.00 0.00 ? 17  LYS A HG3  6  
ATOM 8196  H HD2  . LYS A 1 17  ? 4.259   -3.820  10.731  1.00 0.00 ? 17  LYS A HD2  6  
ATOM 8197  H HD3  . LYS A 1 17  ? 2.731   -3.618  9.872   1.00 0.00 ? 17  LYS A HD3  6  
ATOM 8198  H HE2  . LYS A 1 17  ? 3.851   -1.402  11.546  1.00 0.00 ? 17  LYS A HE2  6  
ATOM 8199  H HE3  . LYS A 1 17  ? 4.430   -1.666  9.902   1.00 0.00 ? 17  LYS A HE3  6  
ATOM 8200  H HZ1  . LYS A 1 17  ? 1.763   -1.726  9.580   1.00 0.00 ? 17  LYS A HZ1  6  
ATOM 8201  H HZ2  . LYS A 1 17  ? 2.724   -0.354  9.348   1.00 0.00 ? 17  LYS A HZ2  6  
ATOM 8202  H HZ3  . LYS A 1 17  ? 1.917   -0.583  10.817  1.00 0.00 ? 17  LYS A HZ3  6  
ATOM 8203  N N    . ALA A 1 18  ? 0.887   -5.223  14.118  1.00 0.00 ? 18  ALA A N    6  
ATOM 8204  C CA   . ALA A 1 18  ? 1.454   -6.170  15.071  1.00 0.00 ? 18  ALA A CA   6  
ATOM 8205  C C    . ALA A 1 18  ? 2.970   -6.024  15.154  1.00 0.00 ? 18  ALA A C    6  
ATOM 8206  O O    . ALA A 1 18  ? 3.606   -5.412  14.296  1.00 0.00 ? 18  ALA A O    6  
ATOM 8207  C CB   . ALA A 1 18  ? 1.079   -7.594  14.688  1.00 0.00 ? 18  ALA A CB   6  
ATOM 8208  H H    . ALA A 1 18  ? 0.396   -5.563  13.342  1.00 0.00 ? 18  ALA A H    6  
ATOM 8209  H HA   . ALA A 1 18  ? 1.029   -5.961  16.042  1.00 0.00 ? 18  ALA A HA   6  
ATOM 8210  H HB1  . ALA A 1 18  ? 0.688   -8.108  15.554  1.00 0.00 ? 18  ALA A HB1  6  
ATOM 8211  H HB2  . ALA A 1 18  ? 0.328   -7.571  13.912  1.00 0.00 ? 18  ALA A HB2  6  
ATOM 8212  H HB3  . ALA A 1 18  ? 1.955   -8.111  14.326  1.00 0.00 ? 18  ALA A HB3  6  
ATOM 8213  N N    . PRO A 1 19  ? 3.563   -6.598  16.211  1.00 0.00 ? 19  PRO A N    6  
ATOM 8214  C CA   . PRO A 1 19  ? 5.012   -6.545  16.431  1.00 0.00 ? 19  PRO A CA   6  
ATOM 8215  C C    . PRO A 1 19  ? 5.783   -7.385  15.418  1.00 0.00 ? 19  PRO A C    6  
ATOM 8216  O O    . PRO A 1 19  ? 7.007   -7.486  15.485  1.00 0.00 ? 19  PRO A O    6  
ATOM 8217  C CB   . PRO A 1 19  ? 5.178   -7.120  17.839  1.00 0.00 ? 19  PRO A CB   6  
ATOM 8218  C CG   . PRO A 1 19  ? 3.987   -7.994  18.035  1.00 0.00 ? 19  PRO A CG   6  
ATOM 8219  C CD   . PRO A 1 19  ? 2.866   -7.343  17.273  1.00 0.00 ? 19  PRO A CD   6  
ATOM 8220  H HA   . PRO A 1 19  ? 5.380   -5.529  16.409  1.00 0.00 ? 19  PRO A HA   6  
ATOM 8221  H HB2  . PRO A 1 19  ? 6.098   -7.686  17.894  1.00 0.00 ? 19  PRO A HB2  6  
ATOM 8222  H HB3  . PRO A 1 19  ? 5.200   -6.316  18.560  1.00 0.00 ? 19  PRO A HB3  6  
ATOM 8223  H HG2  . PRO A 1 19  ? 4.186   -8.979  17.641  1.00 0.00 ? 19  PRO A HG2  6  
ATOM 8224  H HG3  . PRO A 1 19  ? 3.743   -8.050  19.085  1.00 0.00 ? 19  PRO A HG3  6  
ATOM 8225  H HD2  . PRO A 1 19  ? 2.211   -8.091  16.852  1.00 0.00 ? 19  PRO A HD2  6  
ATOM 8226  H HD3  . PRO A 1 19  ? 2.314   -6.672  17.914  1.00 0.00 ? 19  PRO A HD3  6  
ATOM 8227  N N    . GLY A 1 20  ? 5.057   -7.985  14.479  1.00 0.00 ? 20  GLY A N    6  
ATOM 8228  C CA   . GLY A 1 20  ? 5.691   -8.808  13.466  1.00 0.00 ? 20  GLY A CA   6  
ATOM 8229  C C    . GLY A 1 20  ? 4.814   -9.002  12.245  1.00 0.00 ? 20  GLY A C    6  
ATOM 8230  O O    . GLY A 1 20  ? 4.959   -9.985  11.519  1.00 0.00 ? 20  GLY A O    6  
ATOM 8231  H H    . GLY A 1 20  ? 4.084   -7.868  14.475  1.00 0.00 ? 20  GLY A H    6  
ATOM 8232  H HA2  . GLY A 1 20  ? 6.615   -8.339  13.162  1.00 0.00 ? 20  GLY A HA2  6  
ATOM 8233  H HA3  . GLY A 1 20  ? 5.913   -9.776  13.891  1.00 0.00 ? 20  GLY A HA3  6  
ATOM 8234  N N    . GLU A 1 21  ? 3.900   -8.063  12.019  1.00 0.00 ? 21  GLU A N    6  
ATOM 8235  C CA   . GLU A 1 21  ? 2.995   -8.137  10.878  1.00 0.00 ? 21  GLU A CA   6  
ATOM 8236  C C    . GLU A 1 21  ? 3.535   -7.329  9.702   1.00 0.00 ? 21  GLU A C    6  
ATOM 8237  O O    . GLU A 1 21  ? 3.945   -6.179  9.860   1.00 0.00 ? 21  GLU A O    6  
ATOM 8238  C CB   . GLU A 1 21  ? 1.606   -7.626  11.267  1.00 0.00 ? 21  GLU A CB   6  
ATOM 8239  C CG   . GLU A 1 21  ? 0.557   -7.833  10.188  1.00 0.00 ? 21  GLU A CG   6  
ATOM 8240  C CD   . GLU A 1 21  ? 0.495   -9.269  9.703   1.00 0.00 ? 21  GLU A CD   6  
ATOM 8241  O OE1  . GLU A 1 21  ? -0.261  -10.065 10.298  1.00 0.00 ? 21  GLU A OE1  6  
ATOM 8242  O OE2  . GLU A 1 21  ? 1.203   -9.596  8.727   1.00 0.00 ? 21  GLU A OE2  6  
ATOM 8243  H H    . GLU A 1 21  ? 3.834   -7.303  12.634  1.00 0.00 ? 21  GLU A H    6  
ATOM 8244  H HA   . GLU A 1 21  ? 2.918   -9.172  10.583  1.00 0.00 ? 21  GLU A HA   6  
ATOM 8245  H HB2  . GLU A 1 21  ? 1.283   -8.141  12.159  1.00 0.00 ? 21  GLU A HB2  6  
ATOM 8246  H HB3  . GLU A 1 21  ? 1.671   -6.568  11.477  1.00 0.00 ? 21  GLU A HB3  6  
ATOM 8247  H HG2  . GLU A 1 21  ? -0.409  -7.563  10.586  1.00 0.00 ? 21  GLU A HG2  6  
ATOM 8248  H HG3  . GLU A 1 21  ? 0.791   -7.195  9.349   1.00 0.00 ? 21  GLU A HG3  6  
ATOM 8249  N N    . ARG A 1 22  ? 3.532   -7.940  8.521   1.00 0.00 ? 22  ARG A N    6  
ATOM 8250  C CA   . ARG A 1 22  ? 4.023   -7.279  7.318   1.00 0.00 ? 22  ARG A CA   6  
ATOM 8251  C C    . ARG A 1 22  ? 2.949   -6.378  6.716   1.00 0.00 ? 22  ARG A C    6  
ATOM 8252  O O    . ARG A 1 22  ? 1.880   -6.846  6.321   1.00 0.00 ? 22  ARG A O    6  
ATOM 8253  C CB   . ARG A 1 22  ? 4.470   -8.317  6.287   1.00 0.00 ? 22  ARG A CB   6  
ATOM 8254  C CG   . ARG A 1 22  ? 5.813   -8.953  6.604   1.00 0.00 ? 22  ARG A CG   6  
ATOM 8255  C CD   . ARG A 1 22  ? 6.057   -10.193 5.759   1.00 0.00 ? 22  ARG A CD   6  
ATOM 8256  N NE   . ARG A 1 22  ? 7.481   -10.458 5.574   1.00 0.00 ? 22  ARG A NE   6  
ATOM 8257  C CZ   . ARG A 1 22  ? 7.953   -11.494 4.889   1.00 0.00 ? 22  ARG A CZ   6  
ATOM 8258  N NH1  . ARG A 1 22  ? 7.118   -12.357 4.327   1.00 0.00 ? 22  ARG A NH1  6  
ATOM 8259  N NH2  . ARG A 1 22  ? 9.262   -11.668 4.765   1.00 0.00 ? 22  ARG A NH2  6  
ATOM 8260  H H    . ARG A 1 22  ? 3.192   -8.857  8.458   1.00 0.00 ? 22  ARG A H    6  
ATOM 8261  H HA   . ARG A 1 22  ? 4.872   -6.672  7.595   1.00 0.00 ? 22  ARG A HA   6  
ATOM 8262  H HB2  . ARG A 1 22  ? 3.728   -9.101  6.238   1.00 0.00 ? 22  ARG A HB2  6  
ATOM 8263  H HB3  . ARG A 1 22  ? 4.541   -7.840  5.321   1.00 0.00 ? 22  ARG A HB3  6  
ATOM 8264  H HG2  . ARG A 1 22  ? 6.596   -8.236  6.405   1.00 0.00 ? 22  ARG A HG2  6  
ATOM 8265  H HG3  . ARG A 1 22  ? 5.832   -9.229  7.648   1.00 0.00 ? 22  ARG A HG3  6  
ATOM 8266  H HD2  . ARG A 1 22  ? 5.603   -11.041 6.249   1.00 0.00 ? 22  ARG A HD2  6  
ATOM 8267  H HD3  . ARG A 1 22  ? 5.598   -10.049 4.792   1.00 0.00 ? 22  ARG A HD3  6  
ATOM 8268  H HE   . ARG A 1 22  ? 8.116   -9.833  5.981   1.00 0.00 ? 22  ARG A HE   6  
ATOM 8269  H HH11 . ARG A 1 22  ? 6.131   -12.228 4.418   1.00 0.00 ? 22  ARG A HH11 6  
ATOM 8270  H HH12 . ARG A 1 22  ? 7.476   -13.136 3.811   1.00 0.00 ? 22  ARG A HH12 6  
ATOM 8271  H HH21 . ARG A 1 22  ? 9.895   -11.020 5.187   1.00 0.00 ? 22  ARG A HH21 6  
ATOM 8272  H HH22 . ARG A 1 22  ? 9.616   -12.448 4.250   1.00 0.00 ? 22  ARG A HH22 6  
ATOM 8273  N N    . LEU A 1 23  ? 3.240   -5.083  6.649   1.00 0.00 ? 23  LEU A N    6  
ATOM 8274  C CA   . LEU A 1 23  ? 2.299   -4.115  6.096   1.00 0.00 ? 23  LEU A CA   6  
ATOM 8275  C C    . LEU A 1 23  ? 1.493   -4.730  4.957   1.00 0.00 ? 23  LEU A C    6  
ATOM 8276  O O    . LEU A 1 23  ? 0.264   -4.668  4.949   1.00 0.00 ? 23  LEU A O    6  
ATOM 8277  C CB   . LEU A 1 23  ? 3.046   -2.877  5.597   1.00 0.00 ? 23  LEU A CB   6  
ATOM 8278  C CG   . LEU A 1 23  ? 2.312   -1.544  5.751   1.00 0.00 ? 23  LEU A CG   6  
ATOM 8279  C CD1  . LEU A 1 23  ? 0.862   -1.679  5.314   1.00 0.00 ? 23  LEU A CD1  6  
ATOM 8280  C CD2  . LEU A 1 23  ? 2.394   -1.053  7.189   1.00 0.00 ? 23  LEU A CD2  6  
ATOM 8281  H H    . LEU A 1 23  ? 4.107   -4.770  6.980   1.00 0.00 ? 23  LEU A H    6  
ATOM 8282  H HA   . LEU A 1 23  ? 1.621   -3.824  6.885   1.00 0.00 ? 23  LEU A HA   6  
ATOM 8283  H HB2  . LEU A 1 23  ? 3.974   -2.808  6.144   1.00 0.00 ? 23  LEU A HB2  6  
ATOM 8284  H HB3  . LEU A 1 23  ? 3.258   -3.020  4.547   1.00 0.00 ? 23  LEU A HB3  6  
ATOM 8285  H HG   . LEU A 1 23  ? 2.784   -0.806  5.117   1.00 0.00 ? 23  LEU A HG   6  
ATOM 8286  H HD11 . LEU A 1 23  ? 0.234   -1.802  6.183   1.00 0.00 ? 23  LEU A HD11 6  
ATOM 8287  H HD12 . LEU A 1 23  ? 0.759   -2.541  4.670   1.00 0.00 ? 23  LEU A HD12 6  
ATOM 8288  H HD13 . LEU A 1 23  ? 0.564   -0.791  4.776   1.00 0.00 ? 23  LEU A HD13 6  
ATOM 8289  H HD21 . LEU A 1 23  ? 3.238   -0.386  7.293   1.00 0.00 ? 23  LEU A HD21 6  
ATOM 8290  H HD22 . LEU A 1 23  ? 2.518   -1.897  7.851   1.00 0.00 ? 23  LEU A HD22 6  
ATOM 8291  H HD23 . LEU A 1 23  ? 1.486   -0.526  7.441   1.00 0.00 ? 23  LEU A HD23 6  
ATOM 8292  N N    . GLY A 1 24  ? 2.193   -5.325  3.996   1.00 0.00 ? 24  GLY A N    6  
ATOM 8293  C CA   . GLY A 1 24  ? 1.526   -5.944  2.866   1.00 0.00 ? 24  GLY A CA   6  
ATOM 8294  C C    . GLY A 1 24  ? 1.002   -4.926  1.873   1.00 0.00 ? 24  GLY A C    6  
ATOM 8295  O O    . GLY A 1 24  ? -0.116  -5.054  1.374   1.00 0.00 ? 24  GLY A O    6  
ATOM 8296  H H    . GLY A 1 24  ? 3.172   -5.343  4.055   1.00 0.00 ? 24  GLY A H    6  
ATOM 8297  H HA2  . GLY A 1 24  ? 2.224   -6.597  2.363   1.00 0.00 ? 24  GLY A HA2  6  
ATOM 8298  H HA3  . GLY A 1 24  ? 0.697   -6.533  3.231   1.00 0.00 ? 24  GLY A HA3  6  
ATOM 8299  N N    . ILE A 1 25  ? 1.811   -3.911  1.586   1.00 0.00 ? 25  ILE A N    6  
ATOM 8300  C CA   . ILE A 1 25  ? 1.422   -2.867  0.646   1.00 0.00 ? 25  ILE A CA   6  
ATOM 8301  C C    . ILE A 1 25  ? 2.380   -2.809  -0.539  1.00 0.00 ? 25  ILE A C    6  
ATOM 8302  O O    . ILE A 1 25  ? 3.429   -3.453  -0.534  1.00 0.00 ? 25  ILE A O    6  
ATOM 8303  C CB   . ILE A 1 25  ? 1.380   -1.486  1.326   1.00 0.00 ? 25  ILE A CB   6  
ATOM 8304  C CG1  . ILE A 1 25  ? 2.525   -1.353  2.331   1.00 0.00 ? 25  ILE A CG1  6  
ATOM 8305  C CG2  . ILE A 1 25  ? 0.039   -1.273  2.011   1.00 0.00 ? 25  ILE A CG2  6  
ATOM 8306  C CD1  . ILE A 1 25  ? 3.016   0.068   2.504   1.00 0.00 ? 25  ILE A CD1  6  
ATOM 8307  H H    . ILE A 1 25  ? 2.690   -3.864  2.016   1.00 0.00 ? 25  ILE A H    6  
ATOM 8308  H HA   . ILE A 1 25  ? 0.431   -3.098  0.284   1.00 0.00 ? 25  ILE A HA   6  
ATOM 8309  H HB   . ILE A 1 25  ? 1.491   -0.730  0.563   1.00 0.00 ? 25  ILE A HB   6  
ATOM 8310  H HG12 . ILE A 1 25  ? 2.194   -1.708  3.294   1.00 0.00 ? 25  ILE A HG12 6  
ATOM 8311  H HG13 . ILE A 1 25  ? 3.359   -1.954  1.998   1.00 0.00 ? 25  ILE A HG13 6  
ATOM 8312  H HG21 . ILE A 1 25  ? -0.748  -1.689  1.399   1.00 0.00 ? 25  ILE A HG21 6  
ATOM 8313  H HG22 . ILE A 1 25  ? 0.044   -1.765  2.972   1.00 0.00 ? 25  ILE A HG22 6  
ATOM 8314  H HG23 . ILE A 1 25  ? -0.132  -0.216  2.148   1.00 0.00 ? 25  ILE A HG23 6  
ATOM 8315  H HD11 . ILE A 1 25  ? 3.923   0.067   3.090   1.00 0.00 ? 25  ILE A HD11 6  
ATOM 8316  H HD12 . ILE A 1 25  ? 3.212   0.502   1.536   1.00 0.00 ? 25  ILE A HD12 6  
ATOM 8317  H HD13 . ILE A 1 25  ? 2.261   0.650   3.013   1.00 0.00 ? 25  ILE A HD13 6  
ATOM 8318  N N    . SER A 1 26  ? 2.012   -2.032  -1.553  1.00 0.00 ? 26  SER A N    6  
ATOM 8319  C CA   . SER A 1 26  ? 2.838   -1.891  -2.746  1.00 0.00 ? 26  SER A CA   6  
ATOM 8320  C C    . SER A 1 26  ? 2.994   -0.422  -3.128  1.00 0.00 ? 26  SER A C    6  
ATOM 8321  O O    . SER A 1 26  ? 2.280   0.442   -2.620  1.00 0.00 ? 26  SER A O    6  
ATOM 8322  C CB   . SER A 1 26  ? 2.224   -2.670  -3.911  1.00 0.00 ? 26  SER A CB   6  
ATOM 8323  O OG   . SER A 1 26  ? 3.227   -3.147  -4.791  1.00 0.00 ? 26  SER A OG   6  
ATOM 8324  H H    . SER A 1 26  ? 1.164   -1.544  -1.497  1.00 0.00 ? 26  SER A H    6  
ATOM 8325  H HA   . SER A 1 26  ? 3.812   -2.300  -2.525  1.00 0.00 ? 26  SER A HA   6  
ATOM 8326  H HB2  . SER A 1 26  ? 1.670   -3.513  -3.526  1.00 0.00 ? 26  SER A HB2  6  
ATOM 8327  H HB3  . SER A 1 26  ? 1.557   -2.022  -4.462  1.00 0.00 ? 26  SER A HB3  6  
ATOM 8328  H HG   . SER A 1 26  ? 3.911   -3.592  -4.285  1.00 0.00 ? 26  SER A HG   6  
ATOM 8329  N N    . ILE A 1 27  ? 3.935   -0.148  -4.026  1.00 0.00 ? 27  ILE A N    6  
ATOM 8330  C CA   . ILE A 1 27  ? 4.185   1.215   -4.477  1.00 0.00 ? 27  ILE A CA   6  
ATOM 8331  C C    . ILE A 1 27  ? 4.823   1.227   -5.862  1.00 0.00 ? 27  ILE A C    6  
ATOM 8332  O O    . ILE A 1 27  ? 5.620   0.350   -6.197  1.00 0.00 ? 27  ILE A O    6  
ATOM 8333  C CB   . ILE A 1 27  ? 5.099   1.973   -3.497  1.00 0.00 ? 27  ILE A CB   6  
ATOM 8334  C CG1  . ILE A 1 27  ? 6.535   1.455   -3.599  1.00 0.00 ? 27  ILE A CG1  6  
ATOM 8335  C CG2  . ILE A 1 27  ? 4.579   1.834   -2.073  1.00 0.00 ? 27  ILE A CG2  6  
ATOM 8336  C CD1  . ILE A 1 27  ? 7.523   2.248   -2.773  1.00 0.00 ? 27  ILE A CD1  6  
ATOM 8337  H H    . ILE A 1 27  ? 4.472   -0.880  -4.395  1.00 0.00 ? 27  ILE A H    6  
ATOM 8338  H HA   . ILE A 1 27  ? 3.236   1.729   -4.525  1.00 0.00 ? 27  ILE A HA   6  
ATOM 8339  H HB   . ILE A 1 27  ? 5.082   3.020   -3.760  1.00 0.00 ? 27  ILE A HB   6  
ATOM 8340  H HG12 . ILE A 1 27  ? 6.566   0.432   -3.260  1.00 0.00 ? 27  ILE A HG12 6  
ATOM 8341  H HG13 . ILE A 1 27  ? 6.853   1.498   -4.630  1.00 0.00 ? 27  ILE A HG13 6  
ATOM 8342  H HG21 . ILE A 1 27  ? 3.591   2.266   -2.007  1.00 0.00 ? 27  ILE A HG21 6  
ATOM 8343  H HG22 . ILE A 1 27  ? 4.533   0.789   -1.808  1.00 0.00 ? 27  ILE A HG22 6  
ATOM 8344  H HG23 . ILE A 1 27  ? 5.243   2.349   -1.396  1.00 0.00 ? 27  ILE A HG23 6  
ATOM 8345  H HD11 . ILE A 1 27  ? 7.136   3.242   -2.604  1.00 0.00 ? 27  ILE A HD11 6  
ATOM 8346  H HD12 . ILE A 1 27  ? 7.680   1.755   -1.826  1.00 0.00 ? 27  ILE A HD12 6  
ATOM 8347  H HD13 . ILE A 1 27  ? 8.463   2.315   -3.303  1.00 0.00 ? 27  ILE A HD13 6  
ATOM 8348  N N    . ARG A 1 28  ? 4.470   2.228   -6.662  1.00 0.00 ? 28  ARG A N    6  
ATOM 8349  C CA   . ARG A 1 28  ? 5.008   2.355   -8.011  1.00 0.00 ? 28  ARG A CA   6  
ATOM 8350  C C    . ARG A 1 28  ? 5.673   3.715   -8.205  1.00 0.00 ? 28  ARG A C    6  
ATOM 8351  O O    . ARG A 1 28  ? 5.054   4.756   -7.988  1.00 0.00 ? 28  ARG A O    6  
ATOM 8352  C CB   . ARG A 1 28  ? 3.898   2.165   -9.046  1.00 0.00 ? 28  ARG A CB   6  
ATOM 8353  C CG   . ARG A 1 28  ? 2.760   3.163   -8.909  1.00 0.00 ? 28  ARG A CG   6  
ATOM 8354  C CD   . ARG A 1 28  ? 1.698   2.947   -9.976  1.00 0.00 ? 28  ARG A CD   6  
ATOM 8355  N NE   . ARG A 1 28  ? 0.399   3.475   -9.569  1.00 0.00 ? 28  ARG A NE   6  
ATOM 8356  C CZ   . ARG A 1 28  ? -0.661  3.516   -10.370 1.00 0.00 ? 28  ARG A CZ   6  
ATOM 8357  N NH1  . ARG A 1 28  ? -0.575  3.062   -11.613 1.00 0.00 ? 28  ARG A NH1  6  
ATOM 8358  N NH2  . ARG A 1 28  ? -1.810  4.010   -9.927  1.00 0.00 ? 28  ARG A NH2  6  
ATOM 8359  H H    . ARG A 1 28  ? 3.830   2.896   -6.338  1.00 0.00 ? 28  ARG A H    6  
ATOM 8360  H HA   . ARG A 1 28  ? 5.750   1.582   -8.146  1.00 0.00 ? 28  ARG A HA   6  
ATOM 8361  H HB2  . ARG A 1 28  ? 4.322   2.269   -10.034 1.00 0.00 ? 28  ARG A HB2  6  
ATOM 8362  H HB3  . ARG A 1 28  ? 3.491   1.171   -8.941  1.00 0.00 ? 28  ARG A HB3  6  
ATOM 8363  H HG2  . ARG A 1 28  ? 2.306   3.045   -7.936  1.00 0.00 ? 28  ARG A HG2  6  
ATOM 8364  H HG3  . ARG A 1 28  ? 3.157   4.162   -9.004  1.00 0.00 ? 28  ARG A HG3  6  
ATOM 8365  H HD2  . ARG A 1 28  ? 2.011   3.446   -10.881 1.00 0.00 ? 28  ARG A HD2  6  
ATOM 8366  H HD3  . ARG A 1 28  ? 1.605   1.888   -10.162 1.00 0.00 ? 28  ARG A HD3  6  
ATOM 8367  H HE   . ARG A 1 28  ? 0.313   3.815   -8.655  1.00 0.00 ? 28  ARG A HE   6  
ATOM 8368  H HH11 . ARG A 1 28  ? 0.289   2.688   -11.949 1.00 0.00 ? 28  ARG A HH11 6  
ATOM 8369  H HH12 . ARG A 1 28  ? -1.374  3.093   -12.213 1.00 0.00 ? 28  ARG A HH12 6  
ATOM 8370  H HH21 . ARG A 1 28  ? -1.878  4.353   -8.990  1.00 0.00 ? 28  ARG A HH21 6  
ATOM 8371  H HH22 . ARG A 1 28  ? -2.606  4.041   -10.529 1.00 0.00 ? 28  ARG A HH22 6  
ATOM 8372  N N    . GLY A 1 29  ? 6.937   3.697   -8.615  1.00 0.00 ? 29  GLY A N    6  
ATOM 8373  C CA   . GLY A 1 29  ? 7.665   4.934   -8.831  1.00 0.00 ? 29  GLY A CA   6  
ATOM 8374  C C    . GLY A 1 29  ? 9.164   4.757   -8.692  1.00 0.00 ? 29  GLY A C    6  
ATOM 8375  O O    . GLY A 1 29  ? 9.701   3.692   -8.995  1.00 0.00 ? 29  GLY A O    6  
ATOM 8376  H H    . GLY A 1 29  ? 7.380   2.836   -8.772  1.00 0.00 ? 29  GLY A H    6  
ATOM 8377  H HA2  . GLY A 1 29  ? 7.446   5.299   -9.823  1.00 0.00 ? 29  GLY A HA2  6  
ATOM 8378  H HA3  . GLY A 1 29  ? 7.332   5.664   -8.108  1.00 0.00 ? 29  GLY A HA3  6  
ATOM 8379  N N    . GLY A 1 30  ? 9.842   5.804   -8.233  1.00 0.00 ? 30  GLY A N    6  
ATOM 8380  C CA   . GLY A 1 30  ? 11.282  5.740   -8.065  1.00 0.00 ? 30  GLY A CA   6  
ATOM 8381  C C    . GLY A 1 30  ? 12.008  6.801   -8.868  1.00 0.00 ? 30  GLY A C    6  
ATOM 8382  O O    . GLY A 1 30  ? 11.634  7.095   -10.003 1.00 0.00 ? 30  GLY A O    6  
ATOM 8383  H H    . GLY A 1 30  ? 9.361   6.628   -8.008  1.00 0.00 ? 30  GLY A H    6  
ATOM 8384  H HA2  . GLY A 1 30  ? 11.518  5.870   -7.020  1.00 0.00 ? 30  GLY A HA2  6  
ATOM 8385  H HA3  . GLY A 1 30  ? 11.627  4.767   -8.383  1.00 0.00 ? 30  GLY A HA3  6  
ATOM 8386  N N    . ALA A 1 31  ? 13.048  7.380   -8.277  1.00 0.00 ? 31  ALA A N    6  
ATOM 8387  C CA   . ALA A 1 31  ? 13.828  8.414   -8.944  1.00 0.00 ? 31  ALA A CA   6  
ATOM 8388  C C    . ALA A 1 31  ? 14.959  7.805   -9.766  1.00 0.00 ? 31  ALA A C    6  
ATOM 8389  O O    . ALA A 1 31  ? 15.850  7.150   -9.225  1.00 0.00 ? 31  ALA A O    6  
ATOM 8390  C CB   . ALA A 1 31  ? 14.385  9.397   -7.924  1.00 0.00 ? 31  ALA A CB   6  
ATOM 8391  H H    . ALA A 1 31  ? 13.298  7.103   -7.371  1.00 0.00 ? 31  ALA A H    6  
ATOM 8392  H HA   . ALA A 1 31  ? 13.167  8.956   -9.606  1.00 0.00 ? 31  ALA A HA   6  
ATOM 8393  H HB1  . ALA A 1 31  ? 15.008  10.122  -8.427  1.00 0.00 ? 31  ALA A HB1  6  
ATOM 8394  H HB2  . ALA A 1 31  ? 13.569  9.903   -7.430  1.00 0.00 ? 31  ALA A HB2  6  
ATOM 8395  H HB3  . ALA A 1 31  ? 14.972  8.862   -7.193  1.00 0.00 ? 31  ALA A HB3  6  
ATOM 8396  N N    . ARG A 1 32  ? 14.917  8.025   -11.076 1.00 0.00 ? 32  ARG A N    6  
ATOM 8397  C CA   . ARG A 1 32  ? 15.937  7.495   -11.973 1.00 0.00 ? 32  ARG A CA   6  
ATOM 8398  C C    . ARG A 1 32  ? 15.933  5.969   -11.961 1.00 0.00 ? 32  ARG A C    6  
ATOM 8399  O O    . ARG A 1 32  ? 16.986  5.335   -11.994 1.00 0.00 ? 32  ARG A O    6  
ATOM 8400  C CB   . ARG A 1 32  ? 17.319  8.015   -11.571 1.00 0.00 ? 32  ARG A CB   6  
ATOM 8401  C CG   . ARG A 1 32  ? 17.426  9.531   -11.582 1.00 0.00 ? 32  ARG A CG   6  
ATOM 8402  C CD   . ARG A 1 32  ? 18.775  9.998   -11.060 1.00 0.00 ? 32  ARG A CD   6  
ATOM 8403  N NE   . ARG A 1 32  ? 19.860  9.681   -11.985 1.00 0.00 ? 32  ARG A NE   6  
ATOM 8404  C CZ   . ARG A 1 32  ? 21.072  10.220  -11.909 1.00 0.00 ? 32  ARG A CZ   6  
ATOM 8405  N NH1  . ARG A 1 32  ? 21.352  11.098  -10.956 1.00 0.00 ? 32  ARG A NH1  6  
ATOM 8406  N NH2  . ARG A 1 32  ? 22.006  9.881   -12.788 1.00 0.00 ? 32  ARG A NH2  6  
ATOM 8407  H H    . ARG A 1 32  ? 14.181  8.554   -11.449 1.00 0.00 ? 32  ARG A H    6  
ATOM 8408  H HA   . ARG A 1 32  ? 15.710  7.836   -12.972 1.00 0.00 ? 32  ARG A HA   6  
ATOM 8409  H HB2  . ARG A 1 32  ? 17.545  7.667   -10.574 1.00 0.00 ? 32  ARG A HB2  6  
ATOM 8410  H HB3  . ARG A 1 32  ? 18.052  7.619   -12.258 1.00 0.00 ? 32  ARG A HB3  6  
ATOM 8411  H HG2  . ARG A 1 32  ? 17.303  9.884   -12.596 1.00 0.00 ? 32  ARG A HG2  6  
ATOM 8412  H HG3  . ARG A 1 32  ? 16.646  9.942   -10.959 1.00 0.00 ? 32  ARG A HG3  6  
ATOM 8413  H HD2  . ARG A 1 32  ? 18.740  11.067  -10.915 1.00 0.00 ? 32  ARG A HD2  6  
ATOM 8414  H HD3  . ARG A 1 32  ? 18.967  9.513   -10.114 1.00 0.00 ? 32  ARG A HD3  6  
ATOM 8415  H HE   . ARG A 1 32  ? 19.674  9.035   -12.697 1.00 0.00 ? 32  ARG A HE   6  
ATOM 8416  H HH11 . ARG A 1 32  ? 20.650  11.354  -10.292 1.00 0.00 ? 32  ARG A HH11 6  
ATOM 8417  H HH12 . ARG A 1 32  ? 22.266  11.501  -10.900 1.00 0.00 ? 32  ARG A HH12 6  
ATOM 8418  H HH21 . ARG A 1 32  ? 21.799  9.219   -13.508 1.00 0.00 ? 32  ARG A HH21 6  
ATOM 8419  H HH22 . ARG A 1 32  ? 22.917  10.287  -12.730 1.00 0.00 ? 32  ARG A HH22 6  
ATOM 8420  N N    . GLY A 1 33  ? 14.739  5.386   -11.913 1.00 0.00 ? 33  GLY A N    6  
ATOM 8421  C CA   . GLY A 1 33  ? 14.619  3.940   -11.897 1.00 0.00 ? 33  GLY A CA   6  
ATOM 8422  C C    . GLY A 1 33  ? 13.622  3.429   -12.918 1.00 0.00 ? 33  GLY A C    6  
ATOM 8423  O O    . GLY A 1 33  ? 13.988  3.119   -14.052 1.00 0.00 ? 33  GLY A O    6  
ATOM 8424  H H    . GLY A 1 33  ? 13.932  5.943   -11.889 1.00 0.00 ? 33  GLY A H    6  
ATOM 8425  H HA2  . GLY A 1 33  ? 15.586  3.508   -12.106 1.00 0.00 ? 33  GLY A HA2  6  
ATOM 8426  H HA3  . GLY A 1 33  ? 14.301  3.628   -10.913 1.00 0.00 ? 33  GLY A HA3  6  
ATOM 8427  N N    . HIS A 1 34  ? 12.359  3.339   -12.516 1.00 0.00 ? 34  HIS A N    6  
ATOM 8428  C CA   . HIS A 1 34  ? 11.306  2.861   -13.404 1.00 0.00 ? 34  HIS A CA   6  
ATOM 8429  C C    . HIS A 1 34  ? 10.279  3.958   -13.670 1.00 0.00 ? 34  HIS A C    6  
ATOM 8430  O O    . HIS A 1 34  ? 9.639   4.459   -12.747 1.00 0.00 ? 34  HIS A O    6  
ATOM 8431  C CB   . HIS A 1 34  ? 10.616  1.637   -12.800 1.00 0.00 ? 34  HIS A CB   6  
ATOM 8432  C CG   . HIS A 1 34  ? 11.327  0.349   -13.082 1.00 0.00 ? 34  HIS A CG   6  
ATOM 8433  N ND1  . HIS A 1 34  ? 11.137  -0.794  -12.335 1.00 0.00 ? 34  HIS A ND1  6  
ATOM 8434  C CD2  . HIS A 1 34  ? 12.230  0.027   -14.038 1.00 0.00 ? 34  HIS A CD2  6  
ATOM 8435  C CE1  . HIS A 1 34  ? 11.894  -1.764  -12.818 1.00 0.00 ? 34  HIS A CE1  6  
ATOM 8436  N NE2  . HIS A 1 34  ? 12.567  -1.291  -13.852 1.00 0.00 ? 34  HIS A NE2  6  
ATOM 8437  H H    . HIS A 1 34  ? 12.129  3.601   -11.600 1.00 0.00 ? 34  HIS A H    6  
ATOM 8438  H HA   . HIS A 1 34  ? 11.764  2.579   -14.340 1.00 0.00 ? 34  HIS A HA   6  
ATOM 8439  H HB2  . HIS A 1 34  ? 10.560  1.756   -11.728 1.00 0.00 ? 34  HIS A HB2  6  
ATOM 8440  H HB3  . HIS A 1 34  ? 9.616   1.560   -13.202 1.00 0.00 ? 34  HIS A HB3  6  
ATOM 8441  H HD1  . HIS A 1 34  ? 10.538  -0.882  -11.565 1.00 0.00 ? 34  HIS A HD1  6  
ATOM 8442  H HD2  . HIS A 1 34  ? 12.615  0.684   -14.805 1.00 0.00 ? 34  HIS A HD2  6  
ATOM 8443  H HE1  . HIS A 1 34  ? 11.953  -2.771  -12.433 1.00 0.00 ? 34  HIS A HE1  6  
ATOM 8444  H HE2  . HIS A 1 34  ? 13.264  -1.776  -14.340 1.00 0.00 ? 34  HIS A HE2  6  
ATOM 8445  N N    . ALA A 1 35  ? 10.129  4.325   -14.939 1.00 0.00 ? 35  ALA A N    6  
ATOM 8446  C CA   . ALA A 1 35  ? 9.180   5.362   -15.326 1.00 0.00 ? 35  ALA A CA   6  
ATOM 8447  C C    . ALA A 1 35  ? 7.817   5.126   -14.684 1.00 0.00 ? 35  ALA A C    6  
ATOM 8448  O O    . ALA A 1 35  ? 7.224   4.059   -14.836 1.00 0.00 ? 35  ALA A O    6  
ATOM 8449  C CB   . ALA A 1 35  ? 9.049   5.417   -16.841 1.00 0.00 ? 35  ALA A CB   6  
ATOM 8450  H H    . ALA A 1 35  ? 10.668  3.888   -15.630 1.00 0.00 ? 35  ALA A H    6  
ATOM 8451  H HA   . ALA A 1 35  ? 9.567   6.312   -14.988 1.00 0.00 ? 35  ALA A HA   6  
ATOM 8452  H HB1  . ALA A 1 35  ? 8.038   5.695   -17.104 1.00 0.00 ? 35  ALA A HB1  6  
ATOM 8453  H HB2  . ALA A 1 35  ? 9.737   6.150   -17.235 1.00 0.00 ? 35  ALA A HB2  6  
ATOM 8454  H HB3  . ALA A 1 35  ? 9.276   4.448   -17.258 1.00 0.00 ? 35  ALA A HB3  6  
ATOM 8455  N N    . GLY A 1 36  ? 7.326   6.130   -13.964 1.00 0.00 ? 36  GLY A N    6  
ATOM 8456  C CA   . GLY A 1 36  ? 6.036   6.012   -13.308 1.00 0.00 ? 36  GLY A CA   6  
ATOM 8457  C C    . GLY A 1 36  ? 4.878   6.157   -14.276 1.00 0.00 ? 36  GLY A C    6  
ATOM 8458  O O    . GLY A 1 36  ? 3.967   5.330   -14.291 1.00 0.00 ? 36  GLY A O    6  
ATOM 8459  H H    . GLY A 1 36  ? 7.843   6.958   -13.877 1.00 0.00 ? 36  GLY A H    6  
ATOM 8460  H HA2  . GLY A 1 36  ? 5.975   5.045   -12.831 1.00 0.00 ? 36  GLY A HA2  6  
ATOM 8461  H HA3  . GLY A 1 36  ? 5.957   6.780   -12.553 1.00 0.00 ? 36  GLY A HA3  6  
ATOM 8462  N N    . ASN A 1 37  ? 4.913   7.211   -15.084 1.00 0.00 ? 37  ASN A N    6  
ATOM 8463  C CA   . ASN A 1 37  ? 3.857   7.463   -16.057 1.00 0.00 ? 37  ASN A CA   6  
ATOM 8464  C C    . ASN A 1 37  ? 4.410   7.440   -17.479 1.00 0.00 ? 37  ASN A C    6  
ATOM 8465  O O    . ASN A 1 37  ? 5.508   7.926   -17.752 1.00 0.00 ? 37  ASN A O    6  
ATOM 8466  C CB   . ASN A 1 37  ? 3.190   8.811   -15.780 1.00 0.00 ? 37  ASN A CB   6  
ATOM 8467  C CG   . ASN A 1 37  ? 2.064   8.702   -14.770 1.00 0.00 ? 37  ASN A CG   6  
ATOM 8468  O OD1  . ASN A 1 37  ? 1.582   7.608   -14.476 1.00 0.00 ? 37  ASN A OD1  6  
ATOM 8469  N ND2  . ASN A 1 37  ? 1.638   9.840   -14.233 1.00 0.00 ? 37  ASN A ND2  6  
ATOM 8470  H H    . ASN A 1 37  ? 5.667   7.835   -15.024 1.00 0.00 ? 37  ASN A H    6  
ATOM 8471  H HA   . ASN A 1 37  ? 3.121   6.680   -15.957 1.00 0.00 ? 37  ASN A HA   6  
ATOM 8472  H HB2  . ASN A 1 37  ? 3.928   9.499   -15.393 1.00 0.00 ? 37  ASN A HB2  6  
ATOM 8473  H HB3  . ASN A 1 37  ? 2.786   9.203   -16.701 1.00 0.00 ? 37  ASN A HB3  6  
ATOM 8474  H HD21 . ASN A 1 37  ? 2.069   10.675  -14.515 1.00 0.00 ? 37  ASN A HD21 6  
ATOM 8475  H HD22 . ASN A 1 37  ? 0.912   9.799   -13.577 1.00 0.00 ? 37  ASN A HD22 6  
ATOM 8476  N N    . PRO A 1 38  ? 3.634   6.862   -18.407 1.00 0.00 ? 38  PRO A N    6  
ATOM 8477  C CA   . PRO A 1 38  ? 4.025   6.762   -19.816 1.00 0.00 ? 38  PRO A CA   6  
ATOM 8478  C C    . PRO A 1 38  ? 4.021   8.117   -20.516 1.00 0.00 ? 38  PRO A C    6  
ATOM 8479  O O    . PRO A 1 38  ? 4.996   8.492   -21.167 1.00 0.00 ? 38  PRO A O    6  
ATOM 8480  C CB   . PRO A 1 38  ? 2.955   5.847   -20.418 1.00 0.00 ? 38  PRO A CB   6  
ATOM 8481  C CG   . PRO A 1 38  ? 1.769   6.019   -19.533 1.00 0.00 ? 38  PRO A CG   6  
ATOM 8482  C CD   . PRO A 1 38  ? 2.313   6.261   -18.152 1.00 0.00 ? 38  PRO A CD   6  
ATOM 8483  H HA   . PRO A 1 38  ? 4.997   6.304   -19.927 1.00 0.00 ? 38  PRO A HA   6  
ATOM 8484  H HB2  . PRO A 1 38  ? 2.741   6.157   -21.431 1.00 0.00 ? 38  PRO A HB2  6  
ATOM 8485  H HB3  . PRO A 1 38  ? 3.306   4.826   -20.413 1.00 0.00 ? 38  PRO A HB3  6  
ATOM 8486  H HG2  . PRO A 1 38  ? 1.186   6.866   -19.860 1.00 0.00 ? 38  PRO A HG2  6  
ATOM 8487  H HG3  . PRO A 1 38  ? 1.168   5.121   -19.546 1.00 0.00 ? 38  PRO A HG3  6  
ATOM 8488  H HD2  . PRO A 1 38  ? 1.677   6.945   -17.610 1.00 0.00 ? 38  PRO A HD2  6  
ATOM 8489  H HD3  . PRO A 1 38  ? 2.412   5.329   -17.616 1.00 0.00 ? 38  PRO A HD3  6  
ATOM 8490  N N    . ARG A 1 39  ? 2.919   8.847   -20.377 1.00 0.00 ? 39  ARG A N    6  
ATOM 8491  C CA   . ARG A 1 39  ? 2.789   10.160  -20.997 1.00 0.00 ? 39  ARG A CA   6  
ATOM 8492  C C    . ARG A 1 39  ? 4.132   10.884  -21.024 1.00 0.00 ? 39  ARG A C    6  
ATOM 8493  O O    . ARG A 1 39  ? 4.750   11.027  -22.080 1.00 0.00 ? 39  ARG A O    6  
ATOM 8494  C CB   . ARG A 1 39  ? 1.759   11.003  -20.243 1.00 0.00 ? 39  ARG A CB   6  
ATOM 8495  C CG   . ARG A 1 39  ? 1.687   12.445  -20.719 1.00 0.00 ? 39  ARG A CG   6  
ATOM 8496  C CD   . ARG A 1 39  ? 1.052   12.546  -22.097 1.00 0.00 ? 39  ARG A CD   6  
ATOM 8497  N NE   . ARG A 1 39  ? 1.148   13.895  -22.647 1.00 0.00 ? 39  ARG A NE   6  
ATOM 8498  C CZ   . ARG A 1 39  ? 0.629   14.251  -23.817 1.00 0.00 ? 39  ARG A CZ   6  
ATOM 8499  N NH1  . ARG A 1 39  ? -0.021  13.362  -24.555 1.00 0.00 ? 39  ARG A NH1  6  
ATOM 8500  N NH2  . ARG A 1 39  ? 0.758   15.498  -24.250 1.00 0.00 ? 39  ARG A NH2  6  
ATOM 8501  H H    . ARG A 1 39  ? 2.175   8.494   -19.845 1.00 0.00 ? 39  ARG A H    6  
ATOM 8502  H HA   . ARG A 1 39  ? 2.450   10.016  -22.011 1.00 0.00 ? 39  ARG A HA   6  
ATOM 8503  H HB2  . ARG A 1 39  ? 0.784   10.557  -20.369 1.00 0.00 ? 39  ARG A HB2  6  
ATOM 8504  H HB3  . ARG A 1 39  ? 2.013   11.006  -19.193 1.00 0.00 ? 39  ARG A HB3  6  
ATOM 8505  H HG2  . ARG A 1 39  ? 1.094   13.016  -20.019 1.00 0.00 ? 39  ARG A HG2  6  
ATOM 8506  H HG3  . ARG A 1 39  ? 2.687   12.851  -20.762 1.00 0.00 ? 39  ARG A HG3  6  
ATOM 8507  H HD2  . ARG A 1 39  ? 1.556   11.860  -22.762 1.00 0.00 ? 39  ARG A HD2  6  
ATOM 8508  H HD3  . ARG A 1 39  ? 0.010   12.272  -22.019 1.00 0.00 ? 39  ARG A HD3  6  
ATOM 8509  H HE   . ARG A 1 39  ? 1.624   14.568  -22.118 1.00 0.00 ? 39  ARG A HE   6  
ATOM 8510  H HH11 . ARG A 1 39  ? -0.120  12.421  -24.231 1.00 0.00 ? 39  ARG A HH11 6  
ATOM 8511  H HH12 . ARG A 1 39  ? -0.412  13.632  -25.435 1.00 0.00 ? 39  ARG A HH12 6  
ATOM 8512  H HH21 . ARG A 1 39  ? 1.247   16.172  -23.695 1.00 0.00 ? 39  ARG A HH21 6  
ATOM 8513  H HH22 . ARG A 1 39  ? 0.367   15.765  -25.130 1.00 0.00 ? 39  ARG A HH22 6  
ATOM 8514  N N    . ASP A 1 40  ? 4.578   11.337  -19.858 1.00 0.00 ? 40  ASP A N    6  
ATOM 8515  C CA   . ASP A 1 40  ? 5.849   12.045  -19.748 1.00 0.00 ? 40  ASP A CA   6  
ATOM 8516  C C    . ASP A 1 40  ? 6.791   11.324  -18.789 1.00 0.00 ? 40  ASP A C    6  
ATOM 8517  O O    . ASP A 1 40  ? 6.496   11.143  -17.608 1.00 0.00 ? 40  ASP A O    6  
ATOM 8518  C CB   . ASP A 1 40  ? 5.617   13.480  -19.273 1.00 0.00 ? 40  ASP A CB   6  
ATOM 8519  C CG   . ASP A 1 40  ? 4.849   14.308  -20.284 1.00 0.00 ? 40  ASP A CG   6  
ATOM 8520  O OD1  . ASP A 1 40  ? 5.381   14.539  -21.390 1.00 0.00 ? 40  ASP A OD1  6  
ATOM 8521  O OD2  . ASP A 1 40  ? 3.714   14.724  -19.970 1.00 0.00 ? 40  ASP A OD2  6  
ATOM 8522  H H    . ASP A 1 40  ? 4.041   11.191  -19.051 1.00 0.00 ? 40  ASP A H    6  
ATOM 8523  H HA   . ASP A 1 40  ? 6.301   12.068  -20.728 1.00 0.00 ? 40  ASP A HA   6  
ATOM 8524  H HB2  . ASP A 1 40  ? 5.056   13.461  -18.350 1.00 0.00 ? 40  ASP A HB2  6  
ATOM 8525  H HB3  . ASP A 1 40  ? 6.573   13.953  -19.099 1.00 0.00 ? 40  ASP A HB3  6  
ATOM 8526  N N    . PRO A 1 41  ? 7.954   10.901  -19.308 1.00 0.00 ? 41  PRO A N    6  
ATOM 8527  C CA   . PRO A 1 41  ? 8.963   10.193  -18.516 1.00 0.00 ? 41  PRO A CA   6  
ATOM 8528  C C    . PRO A 1 41  ? 9.637   11.100  -17.492 1.00 0.00 ? 41  PRO A C    6  
ATOM 8529  O O    . PRO A 1 41  ? 10.493  10.659  -16.724 1.00 0.00 ? 41  PRO A O    6  
ATOM 8530  C CB   . PRO A 1 41  ? 9.975   9.727   -19.565 1.00 0.00 ? 41  PRO A CB   6  
ATOM 8531  C CG   . PRO A 1 41  ? 9.824   10.690  -20.692 1.00 0.00 ? 41  PRO A CG   6  
ATOM 8532  C CD   . PRO A 1 41  ? 8.372   11.083  -20.708 1.00 0.00 ? 41  PRO A CD   6  
ATOM 8533  H HA   . PRO A 1 41  ? 8.542   9.335   -18.013 1.00 0.00 ? 41  PRO A HA   6  
ATOM 8534  H HB2  . PRO A 1 41  ? 10.972  9.760   -19.147 1.00 0.00 ? 41  PRO A HB2  6  
ATOM 8535  H HB3  . PRO A 1 41  ? 9.741   8.719   -19.873 1.00 0.00 ? 41  PRO A HB3  6  
ATOM 8536  H HG2  . PRO A 1 41  ? 10.445  11.556  -20.520 1.00 0.00 ? 41  PRO A HG2  6  
ATOM 8537  H HG3  . PRO A 1 41  ? 10.093  10.212  -21.622 1.00 0.00 ? 41  PRO A HG3  6  
ATOM 8538  H HD2  . PRO A 1 41  ? 8.264   12.113  -21.013 1.00 0.00 ? 41  PRO A HD2  6  
ATOM 8539  H HD3  . PRO A 1 41  ? 7.813   10.432  -21.364 1.00 0.00 ? 41  PRO A HD3  6  
ATOM 8540  N N    . THR A 1 42  ? 9.246   12.371  -17.485 1.00 0.00 ? 42  THR A N    6  
ATOM 8541  C CA   . THR A 1 42  ? 9.813   13.340  -16.556 1.00 0.00 ? 42  THR A CA   6  
ATOM 8542  C C    . THR A 1 42  ? 9.083   13.312  -15.218 1.00 0.00 ? 42  THR A C    6  
ATOM 8543  O O    . THR A 1 42  ? 9.043   14.311  -14.500 1.00 0.00 ? 42  THR A O    6  
ATOM 8544  C CB   . THR A 1 42  ? 9.755   14.768  -17.129 1.00 0.00 ? 42  THR A CB   6  
ATOM 8545  O OG1  . THR A 1 42  ? 8.402   15.114  -17.448 1.00 0.00 ? 42  THR A OG1  6  
ATOM 8546  C CG2  . THR A 1 42  ? 10.621  14.887  -18.374 1.00 0.00 ? 42  THR A CG2  6  
ATOM 8547  H H    . THR A 1 42  ? 8.560   12.662  -18.121 1.00 0.00 ? 42  THR A H    6  
ATOM 8548  H HA   . THR A 1 42  ? 10.850  13.081  -16.395 1.00 0.00 ? 42  THR A HA   6  
ATOM 8549  H HB   . THR A 1 42  ? 10.128  15.455  -16.383 1.00 0.00 ? 42  THR A HB   6  
ATOM 8550  H HG1  . THR A 1 42  ? 7.910   15.261  -16.636 1.00 0.00 ? 42  THR A HG1  6  
ATOM 8551  H HG21 . THR A 1 42  ? 10.163  14.339  -19.185 1.00 0.00 ? 42  THR A HG21 6  
ATOM 8552  H HG22 . THR A 1 42  ? 11.600  14.481  -18.172 1.00 0.00 ? 42  THR A HG22 6  
ATOM 8553  H HG23 . THR A 1 42  ? 10.712  15.927  -18.651 1.00 0.00 ? 42  THR A HG23 6  
ATOM 8554  N N    . ASP A 1 43  ? 8.506   12.161  -14.888 1.00 0.00 ? 43  ASP A N    6  
ATOM 8555  C CA   . ASP A 1 43  ? 7.779   12.002  -13.635 1.00 0.00 ? 43  ASP A CA   6  
ATOM 8556  C C    . ASP A 1 43  ? 8.337   10.835  -12.827 1.00 0.00 ? 43  ASP A C    6  
ATOM 8557  O O    . ASP A 1 43  ? 8.240   9.680   -13.240 1.00 0.00 ? 43  ASP A O    6  
ATOM 8558  C CB   . ASP A 1 43  ? 6.290   11.783  -13.909 1.00 0.00 ? 43  ASP A CB   6  
ATOM 8559  C CG   . ASP A 1 43  ? 5.411   12.315  -12.794 1.00 0.00 ? 43  ASP A CG   6  
ATOM 8560  O OD1  . ASP A 1 43  ? 5.571   11.856  -11.643 1.00 0.00 ? 43  ASP A OD1  6  
ATOM 8561  O OD2  . ASP A 1 43  ? 4.563   13.189  -13.071 1.00 0.00 ? 43  ASP A OD2  6  
ATOM 8562  H H    . ASP A 1 43  ? 8.573   11.400  -15.503 1.00 0.00 ? 43  ASP A H    6  
ATOM 8563  H HA   . ASP A 1 43  ? 7.900   12.910  -13.063 1.00 0.00 ? 43  ASP A HA   6  
ATOM 8564  H HB2  . ASP A 1 43  ? 6.021   12.288  -14.825 1.00 0.00 ? 43  ASP A HB2  6  
ATOM 8565  H HB3  . ASP A 1 43  ? 6.102   10.725  -14.018 1.00 0.00 ? 43  ASP A HB3  6  
ATOM 8566  N N    . GLU A 1 44  ? 8.921   11.146  -11.674 1.00 0.00 ? 44  GLU A N    6  
ATOM 8567  C CA   . GLU A 1 44  ? 9.497   10.122  -10.809 1.00 0.00 ? 44  GLU A CA   6  
ATOM 8568  C C    . GLU A 1 44  ? 8.722   10.019  -9.499  1.00 0.00 ? 44  GLU A C    6  
ATOM 8569  O O    . GLU A 1 44  ? 9.277   9.648   -8.465  1.00 0.00 ? 44  GLU A O    6  
ATOM 8570  C CB   . GLU A 1 44  ? 10.967  10.432  -10.523 1.00 0.00 ? 44  GLU A CB   6  
ATOM 8571  C CG   . GLU A 1 44  ? 11.845  10.422  -11.763 1.00 0.00 ? 44  GLU A CG   6  
ATOM 8572  C CD   . GLU A 1 44  ? 11.792  11.731  -12.526 1.00 0.00 ? 44  GLU A CD   6  
ATOM 8573  O OE1  . GLU A 1 44  ? 12.199  12.766  -11.958 1.00 0.00 ? 44  GLU A OE1  6  
ATOM 8574  O OE2  . GLU A 1 44  ? 11.344  11.721  -13.692 1.00 0.00 ? 44  GLU A OE2  6  
ATOM 8575  H H    . GLU A 1 44  ? 8.968   12.085  -11.399 1.00 0.00 ? 44  GLU A H    6  
ATOM 8576  H HA   . GLU A 1 44  ? 9.432   9.177   -11.327 1.00 0.00 ? 44  GLU A HA   6  
ATOM 8577  H HB2  . GLU A 1 44  ? 11.035  11.409  -10.067 1.00 0.00 ? 44  GLU A HB2  6  
ATOM 8578  H HB3  . GLU A 1 44  ? 11.350  9.696   -9.831  1.00 0.00 ? 44  GLU A HB3  6  
ATOM 8579  H HG2  . GLU A 1 44  ? 12.866  10.237  -11.465 1.00 0.00 ? 44  GLU A HG2  6  
ATOM 8580  H HG3  . GLU A 1 44  ? 11.513  9.628   -12.417 1.00 0.00 ? 44  GLU A HG3  6  
ATOM 8581  N N    . GLY A 1 45  ? 7.436   10.351  -9.550  1.00 0.00 ? 45  GLY A N    6  
ATOM 8582  C CA   . GLY A 1 45  ? 6.606   10.291  -8.361  1.00 0.00 ? 45  GLY A CA   6  
ATOM 8583  C C    . GLY A 1 45  ? 6.388   8.870   -7.878  1.00 0.00 ? 45  GLY A C    6  
ATOM 8584  O O    . GLY A 1 45  ? 6.272   7.945   -8.682  1.00 0.00 ? 45  GLY A O    6  
ATOM 8585  H H    . GLY A 1 45  ? 7.047   10.640  -10.402 1.00 0.00 ? 45  GLY A H    6  
ATOM 8586  H HA2  . GLY A 1 45  ? 7.080   10.859  -7.575  1.00 0.00 ? 45  GLY A HA2  6  
ATOM 8587  H HA3  . GLY A 1 45  ? 5.646   10.734  -8.583  1.00 0.00 ? 45  GLY A HA3  6  
ATOM 8588  N N    . ILE A 1 46  ? 6.335   8.697   -6.562  1.00 0.00 ? 46  ILE A N    6  
ATOM 8589  C CA   . ILE A 1 46  ? 6.131   7.379   -5.973  1.00 0.00 ? 46  ILE A CA   6  
ATOM 8590  C C    . ILE A 1 46  ? 4.806   7.312   -5.221  1.00 0.00 ? 46  ILE A C    6  
ATOM 8591  O O    . ILE A 1 46  ? 4.583   8.057   -4.267  1.00 0.00 ? 46  ILE A O    6  
ATOM 8592  C CB   . ILE A 1 46  ? 7.274   7.009   -5.010  1.00 0.00 ? 46  ILE A CB   6  
ATOM 8593  C CG1  . ILE A 1 46  ? 8.617   7.042   -5.742  1.00 0.00 ? 46  ILE A CG1  6  
ATOM 8594  C CG2  . ILE A 1 46  ? 7.030   5.637   -4.400  1.00 0.00 ? 46  ILE A CG2  6  
ATOM 8595  C CD1  . ILE A 1 46  ? 9.804   7.209   -4.819  1.00 0.00 ? 46  ILE A CD1  6  
ATOM 8596  H H    . ILE A 1 46  ? 6.435   9.473   -5.972  1.00 0.00 ? 46  ILE A H    6  
ATOM 8597  H HA   . ILE A 1 46  ? 6.114   6.655   -6.775  1.00 0.00 ? 46  ILE A HA   6  
ATOM 8598  H HB   . ILE A 1 46  ? 7.290   7.734   -4.210  1.00 0.00 ? 46  ILE A HB   6  
ATOM 8599  H HG12 . ILE A 1 46  ? 8.747   6.118   -6.284  1.00 0.00 ? 46  ILE A HG12 6  
ATOM 8600  H HG13 . ILE A 1 46  ? 8.619   7.867   -6.439  1.00 0.00 ? 46  ILE A HG13 6  
ATOM 8601  H HG21 . ILE A 1 46  ? 7.247   5.669   -3.343  1.00 0.00 ? 46  ILE A HG21 6  
ATOM 8602  H HG22 . ILE A 1 46  ? 5.997   5.357   -4.546  1.00 0.00 ? 46  ILE A HG22 6  
ATOM 8603  H HG23 . ILE A 1 46  ? 7.671   4.911   -4.878  1.00 0.00 ? 46  ILE A HG23 6  
ATOM 8604  H HD11 . ILE A 1 46  ? 9.828   8.221   -4.443  1.00 0.00 ? 46  ILE A HD11 6  
ATOM 8605  H HD12 . ILE A 1 46  ? 9.719   6.519   -3.993  1.00 0.00 ? 46  ILE A HD12 6  
ATOM 8606  H HD13 . ILE A 1 46  ? 10.715  7.007   -5.364  1.00 0.00 ? 46  ILE A HD13 6  
ATOM 8607  N N    . PHE A 1 47  ? 3.929   6.413   -5.657  1.00 0.00 ? 47  PHE A N    6  
ATOM 8608  C CA   . PHE A 1 47  ? 2.626   6.247   -5.024  1.00 0.00 ? 47  PHE A CA   6  
ATOM 8609  C C    . PHE A 1 47  ? 2.325   4.772   -4.776  1.00 0.00 ? 47  PHE A C    6  
ATOM 8610  O O    . PHE A 1 47  ? 3.170   3.908   -5.010  1.00 0.00 ? 47  PHE A O    6  
ATOM 8611  C CB   . PHE A 1 47  ? 1.530   6.863   -5.897  1.00 0.00 ? 47  PHE A CB   6  
ATOM 8612  C CG   . PHE A 1 47  ? 1.938   8.152   -6.551  1.00 0.00 ? 47  PHE A CG   6  
ATOM 8613  C CD1  . PHE A 1 47  ? 2.997   8.186   -7.444  1.00 0.00 ? 47  PHE A CD1  6  
ATOM 8614  C CD2  . PHE A 1 47  ? 1.264   9.330   -6.272  1.00 0.00 ? 47  PHE A CD2  6  
ATOM 8615  C CE1  . PHE A 1 47  ? 3.375   9.371   -8.048  1.00 0.00 ? 47  PHE A CE1  6  
ATOM 8616  C CE2  . PHE A 1 47  ? 1.637   10.517  -6.873  1.00 0.00 ? 47  PHE A CE2  6  
ATOM 8617  C CZ   . PHE A 1 47  ? 2.695   10.538  -7.761  1.00 0.00 ? 47  PHE A CZ   6  
ATOM 8618  H H    . PHE A 1 47  ? 4.165   5.848   -6.422  1.00 0.00 ? 47  PHE A H    6  
ATOM 8619  H HA   . PHE A 1 47  ? 2.651   6.762   -4.076  1.00 0.00 ? 47  PHE A HA   6  
ATOM 8620  H HB2  . PHE A 1 47  ? 1.266   6.165   -6.677  1.00 0.00 ? 47  PHE A HB2  6  
ATOM 8621  H HB3  . PHE A 1 47  ? 0.662   7.060   -5.286  1.00 0.00 ? 47  PHE A HB3  6  
ATOM 8622  H HD1  . PHE A 1 47  ? 3.530   7.273   -7.669  1.00 0.00 ? 47  PHE A HD1  6  
ATOM 8623  H HD2  . PHE A 1 47  ? 0.438   9.316   -5.576  1.00 0.00 ? 47  PHE A HD2  6  
ATOM 8624  H HE1  . PHE A 1 47  ? 4.202   9.383   -8.742  1.00 0.00 ? 47  PHE A HE1  6  
ATOM 8625  H HE2  . PHE A 1 47  ? 1.104   11.429  -6.646  1.00 0.00 ? 47  PHE A HE2  6  
ATOM 8626  H HZ   . PHE A 1 47  ? 2.988   11.464  -8.232  1.00 0.00 ? 47  PHE A HZ   6  
ATOM 8627  N N    . ILE A 1 48  ? 1.116   4.493   -4.302  1.00 0.00 ? 48  ILE A N    6  
ATOM 8628  C CA   . ILE A 1 48  ? 0.703   3.123   -4.023  1.00 0.00 ? 48  ILE A CA   6  
ATOM 8629  C C    . ILE A 1 48  ? 0.044   2.488   -5.242  1.00 0.00 ? 48  ILE A C    6  
ATOM 8630  O O    . ILE A 1 48  ? -0.878  3.055   -5.828  1.00 0.00 ? 48  ILE A O    6  
ATOM 8631  C CB   . ILE A 1 48  ? -0.274  3.061   -2.834  1.00 0.00 ? 48  ILE A CB   6  
ATOM 8632  C CG1  . ILE A 1 48  ? 0.320   3.776   -1.619  1.00 0.00 ? 48  ILE A CG1  6  
ATOM 8633  C CG2  . ILE A 1 48  ? -0.605  1.615   -2.495  1.00 0.00 ? 48  ILE A CG2  6  
ATOM 8634  C CD1  . ILE A 1 48  ? -0.628  3.857   -0.443  1.00 0.00 ? 48  ILE A CD1  6  
ATOM 8635  H H    . ILE A 1 48  ? 0.486   5.225   -4.136  1.00 0.00 ? 48  ILE A H    6  
ATOM 8636  H HA   . ILE A 1 48  ? 1.586   2.555   -3.767  1.00 0.00 ? 48  ILE A HA   6  
ATOM 8637  H HB   . ILE A 1 48  ? -1.189  3.556   -3.122  1.00 0.00 ? 48  ILE A HB   6  
ATOM 8638  H HG12 . ILE A 1 48  ? 1.204   3.249   -1.296  1.00 0.00 ? 48  ILE A HG12 6  
ATOM 8639  H HG13 . ILE A 1 48  ? 0.589   4.784   -1.900  1.00 0.00 ? 48  ILE A HG13 6  
ATOM 8640  H HG21 . ILE A 1 48  ? -1.667  1.453   -2.608  1.00 0.00 ? 48  ILE A HG21 6  
ATOM 8641  H HG22 . ILE A 1 48  ? -0.069  0.958   -3.163  1.00 0.00 ? 48  ILE A HG22 6  
ATOM 8642  H HG23 . ILE A 1 48  ? -0.315  1.408   -1.476  1.00 0.00 ? 48  ILE A HG23 6  
ATOM 8643  H HD11 . ILE A 1 48  ? -1.644  3.740   -0.789  1.00 0.00 ? 48  ILE A HD11 6  
ATOM 8644  H HD12 . ILE A 1 48  ? -0.394  3.075   0.264   1.00 0.00 ? 48  ILE A HD12 6  
ATOM 8645  H HD13 . ILE A 1 48  ? -0.522  4.819   0.039   1.00 0.00 ? 48  ILE A HD13 6  
ATOM 8646  N N    . SER A 1 49  ? 0.522   1.307   -5.619  1.00 0.00 ? 49  SER A N    6  
ATOM 8647  C CA   . SER A 1 49  ? -0.019  0.594   -6.770  1.00 0.00 ? 49  SER A CA   6  
ATOM 8648  C C    . SER A 1 49  ? -0.887  -0.579  -6.325  1.00 0.00 ? 49  SER A C    6  
ATOM 8649  O O    . SER A 1 49  ? -1.622  -1.161  -7.122  1.00 0.00 ? 49  SER A O    6  
ATOM 8650  C CB   . SER A 1 49  ? 1.115   0.093   -7.666  1.00 0.00 ? 49  SER A CB   6  
ATOM 8651  O OG   . SER A 1 49  ? 0.696   -1.011  -8.449  1.00 0.00 ? 49  SER A OG   6  
ATOM 8652  H H    . SER A 1 49  ? 1.259   0.906   -5.111  1.00 0.00 ? 49  SER A H    6  
ATOM 8653  H HA   . SER A 1 49  ? -0.630  1.286   -7.331  1.00 0.00 ? 49  SER A HA   6  
ATOM 8654  H HB2  . SER A 1 49  ? 1.428   0.888   -8.325  1.00 0.00 ? 49  SER A HB2  6  
ATOM 8655  H HB3  . SER A 1 49  ? 1.948   -0.213  -7.050  1.00 0.00 ? 49  SER A HB3  6  
ATOM 8656  H HG   . SER A 1 49  ? 0.342   -0.696  -9.284  1.00 0.00 ? 49  SER A HG   6  
ATOM 8657  N N    . LYS A 1 50  ? -0.796  -0.921  -5.044  1.00 0.00 ? 50  LYS A N    6  
ATOM 8658  C CA   . LYS A 1 50  ? -1.573  -2.023  -4.489  1.00 0.00 ? 50  LYS A CA   6  
ATOM 8659  C C    . LYS A 1 50  ? -1.359  -2.135  -2.983  1.00 0.00 ? 50  LYS A C    6  
ATOM 8660  O O    . LYS A 1 50  ? -0.241  -1.977  -2.491  1.00 0.00 ? 50  LYS A O    6  
ATOM 8661  C CB   . LYS A 1 50  ? -1.187  -3.339  -5.169  1.00 0.00 ? 50  LYS A CB   6  
ATOM 8662  C CG   . LYS A 1 50  ? -1.878  -4.555  -4.577  1.00 0.00 ? 50  LYS A CG   6  
ATOM 8663  C CD   . LYS A 1 50  ? -1.542  -5.819  -5.350  1.00 0.00 ? 50  LYS A CD   6  
ATOM 8664  C CE   . LYS A 1 50  ? -2.218  -5.834  -6.713  1.00 0.00 ? 50  LYS A CE   6  
ATOM 8665  N NZ   . LYS A 1 50  ? -1.972  -7.111  -7.439  1.00 0.00 ? 50  LYS A NZ   6  
ATOM 8666  H H    . LYS A 1 50  ? -0.192  -0.418  -4.457  1.00 0.00 ? 50  LYS A H    6  
ATOM 8667  H HA   . LYS A 1 50  ? -2.616  -1.822  -4.678  1.00 0.00 ? 50  LYS A HA   6  
ATOM 8668  H HB2  . LYS A 1 50  ? -1.445  -3.278  -6.216  1.00 0.00 ? 50  LYS A HB2  6  
ATOM 8669  H HB3  . LYS A 1 50  ? -0.119  -3.478  -5.078  1.00 0.00 ? 50  LYS A HB3  6  
ATOM 8670  H HG2  . LYS A 1 50  ? -1.557  -4.677  -3.553  1.00 0.00 ? 50  LYS A HG2  6  
ATOM 8671  H HG3  . LYS A 1 50  ? -2.947  -4.399  -4.605  1.00 0.00 ? 50  LYS A HG3  6  
ATOM 8672  H HD2  . LYS A 1 50  ? -0.473  -5.871  -5.491  1.00 0.00 ? 50  LYS A HD2  6  
ATOM 8673  H HD3  . LYS A 1 50  ? -1.875  -6.677  -4.783  1.00 0.00 ? 50  LYS A HD3  6  
ATOM 8674  H HE2  . LYS A 1 50  ? -3.281  -5.708  -6.574  1.00 0.00 ? 50  LYS A HE2  6  
ATOM 8675  H HE3  . LYS A 1 50  ? -1.832  -5.015  -7.301  1.00 0.00 ? 50  LYS A HE3  6  
ATOM 8676  H HZ1  . LYS A 1 50  ? -1.164  -7.612  -7.017  1.00 0.00 ? 50  LYS A HZ1  6  
ATOM 8677  H HZ2  . LYS A 1 50  ? -1.762  -6.918  -8.439  1.00 0.00 ? 50  LYS A HZ2  6  
ATOM 8678  H HZ3  . LYS A 1 50  ? -2.812  -7.722  -7.383  1.00 0.00 ? 50  LYS A HZ3  6  
ATOM 8679  N N    . VAL A 1 51  ? -2.437  -2.410  -2.255  1.00 0.00 ? 51  VAL A N    6  
ATOM 8680  C CA   . VAL A 1 51  ? -2.366  -2.546  -0.805  1.00 0.00 ? 51  VAL A CA   6  
ATOM 8681  C C    . VAL A 1 51  ? -3.355  -3.591  -0.303  1.00 0.00 ? 51  VAL A C    6  
ATOM 8682  O O    . VAL A 1 51  ? -4.566  -3.447  -0.472  1.00 0.00 ? 51  VAL A O    6  
ATOM 8683  C CB   . VAL A 1 51  ? -2.650  -1.206  -0.102  1.00 0.00 ? 51  VAL A CB   6  
ATOM 8684  C CG1  . VAL A 1 51  ? -3.613  -0.363  -0.925  1.00 0.00 ? 51  VAL A CG1  6  
ATOM 8685  C CG2  . VAL A 1 51  ? -3.201  -1.445  1.296   1.00 0.00 ? 51  VAL A CG2  6  
ATOM 8686  H H    . VAL A 1 51  ? -3.300  -2.525  -2.705  1.00 0.00 ? 51  VAL A H    6  
ATOM 8687  H HA   . VAL A 1 51  ? -1.365  -2.858  -0.548  1.00 0.00 ? 51  VAL A HA   6  
ATOM 8688  H HB   . VAL A 1 51  ? -1.720  -0.665  -0.012  1.00 0.00 ? 51  VAL A HB   6  
ATOM 8689  H HG11 . VAL A 1 51  ? -4.058  -0.976  -1.695  1.00 0.00 ? 51  VAL A HG11 6  
ATOM 8690  H HG12 . VAL A 1 51  ? -4.387  0.030   -0.283  1.00 0.00 ? 51  VAL A HG12 6  
ATOM 8691  H HG13 . VAL A 1 51  ? -3.075  0.454   -1.383  1.00 0.00 ? 51  VAL A HG13 6  
ATOM 8692  H HG21 . VAL A 1 51  ? -2.865  -2.406  1.655   1.00 0.00 ? 51  VAL A HG21 6  
ATOM 8693  H HG22 . VAL A 1 51  ? -2.847  -0.669  1.961   1.00 0.00 ? 51  VAL A HG22 6  
ATOM 8694  H HG23 . VAL A 1 51  ? -4.280  -1.428  1.267   1.00 0.00 ? 51  VAL A HG23 6  
ATOM 8695  N N    . SER A 1 52  ? -2.831  -4.644  0.317   1.00 0.00 ? 52  SER A N    6  
ATOM 8696  C CA   . SER A 1 52  ? -3.668  -5.716  0.842   1.00 0.00 ? 52  SER A CA   6  
ATOM 8697  C C    . SER A 1 52  ? -4.830  -5.151  1.653   1.00 0.00 ? 52  SER A C    6  
ATOM 8698  O O    . SER A 1 52  ? -4.664  -4.260  2.486   1.00 0.00 ? 52  SER A O    6  
ATOM 8699  C CB   . SER A 1 52  ? -2.837  -6.661  1.712   1.00 0.00 ? 52  SER A CB   6  
ATOM 8700  O OG   . SER A 1 52  ? -3.667  -7.564  2.423   1.00 0.00 ? 52  SER A OG   6  
ATOM 8701  H H    . SER A 1 52  ? -1.858  -4.701  0.421   1.00 0.00 ? 52  SER A H    6  
ATOM 8702  H HA   . SER A 1 52  ? -4.065  -6.268  0.003   1.00 0.00 ? 52  SER A HA   6  
ATOM 8703  H HB2  . SER A 1 52  ? -2.165  -7.227  1.084   1.00 0.00 ? 52  SER A HB2  6  
ATOM 8704  H HB3  . SER A 1 52  ? -2.264  -6.082  2.422   1.00 0.00 ? 52  SER A HB3  6  
ATOM 8705  H HG   . SER A 1 52  ? -3.204  -8.395  2.546   1.00 0.00 ? 52  SER A HG   6  
ATOM 8706  N N    . PRO A 1 53  ? -6.037  -5.681  1.405   1.00 0.00 ? 53  PRO A N    6  
ATOM 8707  C CA   . PRO A 1 53  ? -7.252  -5.246  2.101   1.00 0.00 ? 53  PRO A CA   6  
ATOM 8708  C C    . PRO A 1 53  ? -7.261  -5.665  3.567   1.00 0.00 ? 53  PRO A C    6  
ATOM 8709  O O    . PRO A 1 53  ? -8.040  -5.146  4.367   1.00 0.00 ? 53  PRO A O    6  
ATOM 8710  C CB   . PRO A 1 53  ? -8.372  -5.954  1.335   1.00 0.00 ? 53  PRO A CB   6  
ATOM 8711  C CG   . PRO A 1 53  ? -7.723  -7.154  0.736   1.00 0.00 ? 53  PRO A CG   6  
ATOM 8712  C CD   . PRO A 1 53  ? -6.309  -6.747  0.426   1.00 0.00 ? 53  PRO A CD   6  
ATOM 8713  H HA   . PRO A 1 53  ? -7.386  -4.176  2.032   1.00 0.00 ? 53  PRO A HA   6  
ATOM 8714  H HB2  . PRO A 1 53  ? -9.160  -6.232  2.021   1.00 0.00 ? 53  PRO A HB2  6  
ATOM 8715  H HB3  . PRO A 1 53  ? -8.764  -5.296  0.574   1.00 0.00 ? 53  PRO A HB3  6  
ATOM 8716  H HG2  . PRO A 1 53  ? -7.732  -7.968  1.444   1.00 0.00 ? 53  PRO A HG2  6  
ATOM 8717  H HG3  . PRO A 1 53  ? -8.239  -7.436  -0.169  1.00 0.00 ? 53  PRO A HG3  6  
ATOM 8718  H HD2  . PRO A 1 53  ? -5.637  -7.581  0.566   1.00 0.00 ? 53  PRO A HD2  6  
ATOM 8719  H HD3  . PRO A 1 53  ? -6.238  -6.369  -0.584  1.00 0.00 ? 53  PRO A HD3  6  
ATOM 8720  N N    . THR A 1 54  ? -6.390  -6.607  3.914   1.00 0.00 ? 54  THR A N    6  
ATOM 8721  C CA   . THR A 1 54  ? -6.298  -7.096  5.284   1.00 0.00 ? 54  THR A CA   6  
ATOM 8722  C C    . THR A 1 54  ? -4.961  -6.721  5.914   1.00 0.00 ? 54  THR A C    6  
ATOM 8723  O O    . THR A 1 54  ? -4.744  -6.933  7.106   1.00 0.00 ? 54  THR A O    6  
ATOM 8724  C CB   . THR A 1 54  ? -6.472  -8.625  5.348   1.00 0.00 ? 54  THR A CB   6  
ATOM 8725  O OG1  . THR A 1 54  ? -5.700  -9.162  6.428   1.00 0.00 ? 54  THR A OG1  6  
ATOM 8726  C CG2  . THR A 1 54  ? -6.043  -9.273  4.040   1.00 0.00 ? 54  THR A CG2  6  
ATOM 8727  H H    . THR A 1 54  ? -5.795  -6.982  3.231   1.00 0.00 ? 54  THR A H    6  
ATOM 8728  H HA   . THR A 1 54  ? -7.094  -6.640  5.855   1.00 0.00 ? 54  THR A HA   6  
ATOM 8729  H HB   . THR A 1 54  ? -7.516  -8.847  5.517   1.00 0.00 ? 54  THR A HB   6  
ATOM 8730  H HG1  . THR A 1 54  ? -6.035  -8.821  7.261   1.00 0.00 ? 54  THR A HG1  6  
ATOM 8731  H HG21 . THR A 1 54  ? -6.028  -10.347 4.158   1.00 0.00 ? 54  THR A HG21 6  
ATOM 8732  H HG22 . THR A 1 54  ? -5.055  -8.927  3.774   1.00 0.00 ? 54  THR A HG22 6  
ATOM 8733  H HG23 . THR A 1 54  ? -6.740  -9.007  3.261   1.00 0.00 ? 54  THR A HG23 6  
ATOM 8734  N N    . GLY A 1 55  ? -4.067  -6.162  5.104   1.00 0.00 ? 55  GLY A N    6  
ATOM 8735  C CA   . GLY A 1 55  ? -2.762  -5.766  5.601   1.00 0.00 ? 55  GLY A CA   6  
ATOM 8736  C C    . GLY A 1 55  ? -2.848  -4.673  6.648   1.00 0.00 ? 55  GLY A C    6  
ATOM 8737  O O    . GLY A 1 55  ? -3.926  -4.144  6.916   1.00 0.00 ? 55  GLY A O    6  
ATOM 8738  H H    . GLY A 1 55  ? -4.296  -6.017  4.162   1.00 0.00 ? 55  GLY A H    6  
ATOM 8739  H HA2  . GLY A 1 55  ? -2.277  -6.628  6.034   1.00 0.00 ? 55  GLY A HA2  6  
ATOM 8740  H HA3  . GLY A 1 55  ? -2.168  -5.409  4.772   1.00 0.00 ? 55  GLY A HA3  6  
ATOM 8741  N N    . ALA A 1 56  ? -1.708  -4.334  7.242   1.00 0.00 ? 56  ALA A N    6  
ATOM 8742  C CA   . ALA A 1 56  ? -1.659  -3.297  8.265   1.00 0.00 ? 56  ALA A CA   6  
ATOM 8743  C C    . ALA A 1 56  ? -2.302  -2.006  7.770   1.00 0.00 ? 56  ALA A C    6  
ATOM 8744  O O    . ALA A 1 56  ? -2.964  -1.301  8.530   1.00 0.00 ? 56  ALA A O    6  
ATOM 8745  C CB   . ALA A 1 56  ? -0.220  -3.043  8.689   1.00 0.00 ? 56  ALA A CB   6  
ATOM 8746  H H    . ALA A 1 56  ? -0.881  -4.792  6.984   1.00 0.00 ? 56  ALA A H    6  
ATOM 8747  H HA   . ALA A 1 56  ? -2.205  -3.653  9.127   1.00 0.00 ? 56  ALA A HA   6  
ATOM 8748  H HB1  . ALA A 1 56  ? 0.376   -3.920  8.481   1.00 0.00 ? 56  ALA A HB1  6  
ATOM 8749  H HB2  . ALA A 1 56  ? 0.174   -2.201  8.141   1.00 0.00 ? 56  ALA A HB2  6  
ATOM 8750  H HB3  . ALA A 1 56  ? -0.189  -2.830  9.747   1.00 0.00 ? 56  ALA A HB3  6  
ATOM 8751  N N    . ALA A 1 57  ? -2.102  -1.703  6.491   1.00 0.00 ? 57  ALA A N    6  
ATOM 8752  C CA   . ALA A 1 57  ? -2.664  -0.498  5.895   1.00 0.00 ? 57  ALA A CA   6  
ATOM 8753  C C    . ALA A 1 57  ? -4.128  -0.702  5.520   1.00 0.00 ? 57  ALA A C    6  
ATOM 8754  O O    . ALA A 1 57  ? -5.010  -0.003  6.018   1.00 0.00 ? 57  ALA A O    6  
ATOM 8755  C CB   . ALA A 1 57  ? -1.857  -0.088  4.672   1.00 0.00 ? 57  ALA A CB   6  
ATOM 8756  H H    . ALA A 1 57  ? -1.565  -2.306  5.936   1.00 0.00 ? 57  ALA A H    6  
ATOM 8757  H HA   . ALA A 1 57  ? -2.597  0.297   6.624   1.00 0.00 ? 57  ALA A HA   6  
ATOM 8758  H HB1  . ALA A 1 57  ? -1.118  0.646   4.960   1.00 0.00 ? 57  ALA A HB1  6  
ATOM 8759  H HB2  . ALA A 1 57  ? -1.363  -0.955  4.260   1.00 0.00 ? 57  ALA A HB2  6  
ATOM 8760  H HB3  . ALA A 1 57  ? -2.517  0.337   3.931   1.00 0.00 ? 57  ALA A HB3  6  
ATOM 8761  N N    . GLY A 1 58  ? -4.380  -1.665  4.638   1.00 0.00 ? 58  GLY A N    6  
ATOM 8762  C CA   . GLY A 1 58  ? -5.739  -1.943  4.211   1.00 0.00 ? 58  GLY A CA   6  
ATOM 8763  C C    . GLY A 1 58  ? -6.744  -1.783  5.335   1.00 0.00 ? 58  GLY A C    6  
ATOM 8764  O O    . GLY A 1 58  ? -7.785  -1.150  5.160   1.00 0.00 ? 58  GLY A O    6  
ATOM 8765  H H    . GLY A 1 58  ? -3.637  -2.190  4.274   1.00 0.00 ? 58  GLY A H    6  
ATOM 8766  H HA2  . GLY A 1 58  ? -5.999  -1.266  3.411   1.00 0.00 ? 58  GLY A HA2  6  
ATOM 8767  H HA3  . GLY A 1 58  ? -5.788  -2.957  3.842   1.00 0.00 ? 58  GLY A HA3  6  
ATOM 8768  N N    . ARG A 1 59  ? -6.433  -2.359  6.491   1.00 0.00 ? 59  ARG A N    6  
ATOM 8769  C CA   . ARG A 1 59  ? -7.318  -2.280  7.647   1.00 0.00 ? 59  ARG A CA   6  
ATOM 8770  C C    . ARG A 1 59  ? -7.355  -0.862  8.208   1.00 0.00 ? 59  ARG A C    6  
ATOM 8771  O O    . ARG A 1 59  ? -8.396  -0.391  8.665   1.00 0.00 ? 59  ARG A O    6  
ATOM 8772  C CB   . ARG A 1 59  ? -6.863  -3.258  8.732   1.00 0.00 ? 59  ARG A CB   6  
ATOM 8773  C CG   . ARG A 1 59  ? -5.524  -2.897  9.354   1.00 0.00 ? 59  ARG A CG   6  
ATOM 8774  C CD   . ARG A 1 59  ? -5.147  -3.865  10.465  1.00 0.00 ? 59  ARG A CD   6  
ATOM 8775  N NE   . ARG A 1 59  ? -3.722  -3.806  10.782  1.00 0.00 ? 59  ARG A NE   6  
ATOM 8776  C CZ   . ARG A 1 59  ? -3.053  -4.805  11.346  1.00 0.00 ? 59  ARG A CZ   6  
ATOM 8777  N NH1  . ARG A 1 59  ? -3.676  -5.935  11.652  1.00 0.00 ? 59  ARG A NH1  6  
ATOM 8778  N NH2  . ARG A 1 59  ? -1.758  -4.676  11.603  1.00 0.00 ? 59  ARG A NH2  6  
ATOM 8779  H H    . ARG A 1 59  ? -5.588  -2.850  6.569   1.00 0.00 ? 59  ARG A H    6  
ATOM 8780  H HA   . ARG A 1 59  ? -8.311  -2.553  7.323   1.00 0.00 ? 59  ARG A HA   6  
ATOM 8781  H HB2  . ARG A 1 59  ? -7.605  -3.278  9.517   1.00 0.00 ? 59  ARG A HB2  6  
ATOM 8782  H HB3  . ARG A 1 59  ? -6.781  -4.244  8.300   1.00 0.00 ? 59  ARG A HB3  6  
ATOM 8783  H HG2  . ARG A 1 59  ? -4.762  -2.930  8.590   1.00 0.00 ? 59  ARG A HG2  6  
ATOM 8784  H HG3  . ARG A 1 59  ? -5.585  -1.899  9.763   1.00 0.00 ? 59  ARG A HG3  6  
ATOM 8785  H HD2  . ARG A 1 59  ? -5.713  -3.615  11.350  1.00 0.00 ? 59  ARG A HD2  6  
ATOM 8786  H HD3  . ARG A 1 59  ? -5.395  -4.867  10.150  1.00 0.00 ? 59  ARG A HD3  6  
ATOM 8787  H HE   . ARG A 1 59  ? -3.243  -2.980  10.564  1.00 0.00 ? 59  ARG A HE   6  
ATOM 8788  H HH11 . ARG A 1 59  ? -4.651  -6.036  11.458  1.00 0.00 ? 59  ARG A HH11 6  
ATOM 8789  H HH12 . ARG A 1 59  ? -3.169  -6.687  12.075  1.00 0.00 ? 59  ARG A HH12 6  
ATOM 8790  H HH21 . ARG A 1 59  ? -1.285  -3.826  11.373  1.00 0.00 ? 59  ARG A HH21 6  
ATOM 8791  H HH22 . ARG A 1 59  ? -1.255  -5.429  12.027  1.00 0.00 ? 59  ARG A HH22 6  
ATOM 8792  N N    . ASP A 1 60  ? -6.211  -0.187  8.170   1.00 0.00 ? 60  ASP A N    6  
ATOM 8793  C CA   . ASP A 1 60  ? -6.112  1.178   8.674   1.00 0.00 ? 60  ASP A CA   6  
ATOM 8794  C C    . ASP A 1 60  ? -7.352  1.986   8.303   1.00 0.00 ? 60  ASP A C    6  
ATOM 8795  O O    . ASP A 1 60  ? -8.025  2.543   9.169   1.00 0.00 ? 60  ASP A O    6  
ATOM 8796  C CB   . ASP A 1 60  ? -4.860  1.859   8.120   1.00 0.00 ? 60  ASP A CB   6  
ATOM 8797  C CG   . ASP A 1 60  ? -4.668  3.257   8.674   1.00 0.00 ? 60  ASP A CG   6  
ATOM 8798  O OD1  . ASP A 1 60  ? -4.186  3.381   9.820   1.00 0.00 ? 60  ASP A OD1  6  
ATOM 8799  O OD2  . ASP A 1 60  ? -4.999  4.228   7.962   1.00 0.00 ? 60  ASP A OD2  6  
ATOM 8800  H H    . ASP A 1 60  ? -5.415  -0.616  7.794   1.00 0.00 ? 60  ASP A H    6  
ATOM 8801  H HA   . ASP A 1 60  ? -6.038  1.130   9.750   1.00 0.00 ? 60  ASP A HA   6  
ATOM 8802  H HB2  . ASP A 1 60  ? -3.993  1.269   8.377   1.00 0.00 ? 60  ASP A HB2  6  
ATOM 8803  H HB3  . ASP A 1 60  ? -4.940  1.926   7.045   1.00 0.00 ? 60  ASP A HB3  6  
ATOM 8804  N N    . GLY A 1 61  ? -7.648  2.045   7.008   1.00 0.00 ? 61  GLY A N    6  
ATOM 8805  C CA   . GLY A 1 61  ? -8.806  2.788   6.544   1.00 0.00 ? 61  GLY A CA   6  
ATOM 8806  C C    . GLY A 1 61  ? -8.424  4.007   5.729   1.00 0.00 ? 61  GLY A C    6  
ATOM 8807  O O    . GLY A 1 61  ? -9.220  4.502   4.930   1.00 0.00 ? 61  GLY A O    6  
ATOM 8808  H H    . GLY A 1 61  ? -7.075  1.581   6.362   1.00 0.00 ? 61  GLY A H    6  
ATOM 8809  H HA2  . GLY A 1 61  ? -9.417  2.138   5.936   1.00 0.00 ? 61  GLY A HA2  6  
ATOM 8810  H HA3  . GLY A 1 61  ? -9.380  3.108   7.401   1.00 0.00 ? 61  GLY A HA3  6  
ATOM 8811  N N    . ARG A 1 62  ? -7.204  4.494   5.931   1.00 0.00 ? 62  ARG A N    6  
ATOM 8812  C CA   . ARG A 1 62  ? -6.720  5.665   5.210   1.00 0.00 ? 62  ARG A CA   6  
ATOM 8813  C C    . ARG A 1 62  ? -5.919  5.252   3.978   1.00 0.00 ? 62  ARG A C    6  
ATOM 8814  O O    . ARG A 1 62  ? -6.092  5.813   2.895   1.00 0.00 ? 62  ARG A O    6  
ATOM 8815  C CB   . ARG A 1 62  ? -5.855  6.533   6.126   1.00 0.00 ? 62  ARG A CB   6  
ATOM 8816  C CG   . ARG A 1 62  ? -6.550  6.935   7.417   1.00 0.00 ? 62  ARG A CG   6  
ATOM 8817  C CD   . ARG A 1 62  ? -7.516  8.088   7.194   1.00 0.00 ? 62  ARG A CD   6  
ATOM 8818  N NE   . ARG A 1 62  ? -8.806  7.630   6.685   1.00 0.00 ? 62  ARG A NE   6  
ATOM 8819  C CZ   . ARG A 1 62  ? -9.826  8.442   6.430   1.00 0.00 ? 62  ARG A CZ   6  
ATOM 8820  N NH1  . ARG A 1 62  ? -9.706  9.746   6.636   1.00 0.00 ? 62  ARG A NH1  6  
ATOM 8821  N NH2  . ARG A 1 62  ? -10.968 7.950   5.968   1.00 0.00 ? 62  ARG A NH2  6  
ATOM 8822  H H    . ARG A 1 62  ? -6.615  4.056   6.580   1.00 0.00 ? 62  ARG A H    6  
ATOM 8823  H HA   . ARG A 1 62  ? -7.578  6.237   4.891   1.00 0.00 ? 62  ARG A HA   6  
ATOM 8824  H HB2  . ARG A 1 62  ? -4.959  5.986   6.380   1.00 0.00 ? 62  ARG A HB2  6  
ATOM 8825  H HB3  . ARG A 1 62  ? -5.580  7.432   5.596   1.00 0.00 ? 62  ARG A HB3  6  
ATOM 8826  H HG2  . ARG A 1 62  ? -7.100  6.087   7.798   1.00 0.00 ? 62  ARG A HG2  6  
ATOM 8827  H HG3  . ARG A 1 62  ? -5.803  7.236   8.137   1.00 0.00 ? 62  ARG A HG3  6  
ATOM 8828  H HD2  . ARG A 1 62  ? -7.671  8.597   8.134   1.00 0.00 ? 62  ARG A HD2  6  
ATOM 8829  H HD3  . ARG A 1 62  ? -7.080  8.772   6.482   1.00 0.00 ? 62  ARG A HD3  6  
ATOM 8830  H HE   . ARG A 1 62  ? -8.916  6.669   6.526   1.00 0.00 ? 62  ARG A HE   6  
ATOM 8831  H HH11 . ARG A 1 62  ? -8.846  10.120  6.983   1.00 0.00 ? 62  ARG A HH11 6  
ATOM 8832  H HH12 . ARG A 1 62  ? -10.475 10.356  6.442   1.00 0.00 ? 62  ARG A HH12 6  
ATOM 8833  H HH21 . ARG A 1 62  ? -11.062 6.967   5.812   1.00 0.00 ? 62  ARG A HH21 6  
ATOM 8834  H HH22 . ARG A 1 62  ? -11.735 8.562   5.777   1.00 0.00 ? 62  ARG A HH22 6  
ATOM 8835  N N    . LEU A 1 63  ? -5.042  4.270   4.151   1.00 0.00 ? 63  LEU A N    6  
ATOM 8836  C CA   . LEU A 1 63  ? -4.213  3.782   3.054   1.00 0.00 ? 63  LEU A CA   6  
ATOM 8837  C C    . LEU A 1 63  ? -5.076  3.288   1.898   1.00 0.00 ? 63  LEU A C    6  
ATOM 8838  O O    . LEU A 1 63  ? -6.154  2.732   2.108   1.00 0.00 ? 63  LEU A O    6  
ATOM 8839  C CB   . LEU A 1 63  ? -3.300  2.655   3.541   1.00 0.00 ? 63  LEU A CB   6  
ATOM 8840  C CG   . LEU A 1 63  ? -1.976  2.493   2.792   1.00 0.00 ? 63  LEU A CG   6  
ATOM 8841  C CD1  . LEU A 1 63  ? -2.209  1.867   1.426   1.00 0.00 ? 63  LEU A CD1  6  
ATOM 8842  C CD2  . LEU A 1 63  ? -1.275  3.836   2.653   1.00 0.00 ? 63  LEU A CD2  6  
ATOM 8843  H H    . LEU A 1 63  ? -4.948  3.862   5.037   1.00 0.00 ? 63  LEU A H    6  
ATOM 8844  H HA   . LEU A 1 63  ? -3.604  4.603   2.708   1.00 0.00 ? 63  LEU A HA   6  
ATOM 8845  H HB2  . LEU A 1 63  ? -3.072  2.840   4.579   1.00 0.00 ? 63  LEU A HB2  6  
ATOM 8846  H HB3  . LEU A 1 63  ? -3.846  1.727   3.454   1.00 0.00 ? 63  LEU A HB3  6  
ATOM 8847  H HG   . LEU A 1 63  ? -1.330  1.834   3.355   1.00 0.00 ? 63  LEU A HG   6  
ATOM 8848  H HD11 . LEU A 1 63  ? -2.355  2.646   0.693   1.00 0.00 ? 63  LEU A HD11 6  
ATOM 8849  H HD12 . LEU A 1 63  ? -3.086  1.238   1.463   1.00 0.00 ? 63  LEU A HD12 6  
ATOM 8850  H HD13 . LEU A 1 63  ? -1.350  1.271   1.152   1.00 0.00 ? 63  LEU A HD13 6  
ATOM 8851  H HD21 . LEU A 1 63  ? -1.556  4.293   1.716   1.00 0.00 ? 63  LEU A HD21 6  
ATOM 8852  H HD22 . LEU A 1 63  ? -0.205  3.687   2.674   1.00 0.00 ? 63  LEU A HD22 6  
ATOM 8853  H HD23 . LEU A 1 63  ? -1.565  4.480   3.470   1.00 0.00 ? 63  LEU A HD23 6  
ATOM 8854  N N    . ARG A 1 64  ? -4.594  3.494   0.676   1.00 0.00 ? 64  ARG A N    6  
ATOM 8855  C CA   . ARG A 1 64  ? -5.321  3.069   -0.514  1.00 0.00 ? 64  ARG A CA   6  
ATOM 8856  C C    . ARG A 1 64  ? -4.496  3.319   -1.773  1.00 0.00 ? 64  ARG A C    6  
ATOM 8857  O O    . ARG A 1 64  ? -3.734  4.283   -1.848  1.00 0.00 ? 64  ARG A O    6  
ATOM 8858  C CB   . ARG A 1 64  ? -6.657  3.808   -0.612  1.00 0.00 ? 64  ARG A CB   6  
ATOM 8859  C CG   . ARG A 1 64  ? -6.526  5.319   -0.509  1.00 0.00 ? 64  ARG A CG   6  
ATOM 8860  C CD   . ARG A 1 64  ? -7.738  6.024   -1.099  1.00 0.00 ? 64  ARG A CD   6  
ATOM 8861  N NE   . ARG A 1 64  ? -7.710  7.462   -0.847  1.00 0.00 ? 64  ARG A NE   6  
ATOM 8862  C CZ   . ARG A 1 64  ? -7.956  8.005   0.340   1.00 0.00 ? 64  ARG A CZ   6  
ATOM 8863  N NH1  . ARG A 1 64  ? -8.246  7.233   1.378   1.00 0.00 ? 64  ARG A NH1  6  
ATOM 8864  N NH2  . ARG A 1 64  ? -7.912  9.323   0.490   1.00 0.00 ? 64  ARG A NH2  6  
ATOM 8865  H H    . ARG A 1 64  ? -3.729  3.943   0.573   1.00 0.00 ? 64  ARG A H    6  
ATOM 8866  H HA   . ARG A 1 64  ? -5.511  2.010   -0.426  1.00 0.00 ? 64  ARG A HA   6  
ATOM 8867  H HB2  . ARG A 1 64  ? -7.117  3.572   -1.561  1.00 0.00 ? 64  ARG A HB2  6  
ATOM 8868  H HB3  . ARG A 1 64  ? -7.301  3.469   0.185   1.00 0.00 ? 64  ARG A HB3  6  
ATOM 8869  H HG2  . ARG A 1 64  ? -6.436  5.593   0.531   1.00 0.00 ? 64  ARG A HG2  6  
ATOM 8870  H HG3  . ARG A 1 64  ? -5.642  5.632   -1.044  1.00 0.00 ? 64  ARG A HG3  6  
ATOM 8871  H HD2  . ARG A 1 64  ? -7.751  5.856   -2.166  1.00 0.00 ? 64  ARG A HD2  6  
ATOM 8872  H HD3  . ARG A 1 64  ? -8.630  5.607   -0.658  1.00 0.00 ? 64  ARG A HD3  6  
ATOM 8873  H HE   . ARG A 1 64  ? -7.498  8.051   -1.601  1.00 0.00 ? 64  ARG A HE   6  
ATOM 8874  H HH11 . ARG A 1 64  ? -8.279  6.240   1.268   1.00 0.00 ? 64  ARG A HH11 6  
ATOM 8875  H HH12 . ARG A 1 64  ? -8.430  7.644   2.271   1.00 0.00 ? 64  ARG A HH12 6  
ATOM 8876  H HH21 . ARG A 1 64  ? -7.694  9.908   -0.290  1.00 0.00 ? 64  ARG A HH21 6  
ATOM 8877  H HH22 . ARG A 1 64  ? -8.098  9.730   1.384   1.00 0.00 ? 64  ARG A HH22 6  
ATOM 8878  N N    . VAL A 1 65  ? -4.653  2.443   -2.760  1.00 0.00 ? 65  VAL A N    6  
ATOM 8879  C CA   . VAL A 1 65  ? -3.923  2.568   -4.017  1.00 0.00 ? 65  VAL A CA   6  
ATOM 8880  C C    . VAL A 1 65  ? -4.204  3.910   -4.684  1.00 0.00 ? 65  VAL A C    6  
ATOM 8881  O O    . VAL A 1 65  ? -5.277  4.124   -5.245  1.00 0.00 ? 65  VAL A O    6  
ATOM 8882  C CB   . VAL A 1 65  ? -4.290  1.435   -4.994  1.00 0.00 ? 65  VAL A CB   6  
ATOM 8883  C CG1  . VAL A 1 65  ? -3.510  1.577   -6.292  1.00 0.00 ? 65  VAL A CG1  6  
ATOM 8884  C CG2  . VAL A 1 65  ? -4.035  0.078   -4.355  1.00 0.00 ? 65  VAL A CG2  6  
ATOM 8885  H H    . VAL A 1 65  ? -5.275  1.695   -2.642  1.00 0.00 ? 65  VAL A H    6  
ATOM 8886  H HA   . VAL A 1 65  ? -2.868  2.499   -3.798  1.00 0.00 ? 65  VAL A HA   6  
ATOM 8887  H HB   . VAL A 1 65  ? -5.343  1.510   -5.222  1.00 0.00 ? 65  VAL A HB   6  
ATOM 8888  H HG11 . VAL A 1 65  ? -2.824  0.748   -6.392  1.00 0.00 ? 65  VAL A HG11 6  
ATOM 8889  H HG12 . VAL A 1 65  ? -4.197  1.580   -7.126  1.00 0.00 ? 65  VAL A HG12 6  
ATOM 8890  H HG13 . VAL A 1 65  ? -2.955  2.503   -6.279  1.00 0.00 ? 65  VAL A HG13 6  
ATOM 8891  H HG21 . VAL A 1 65  ? -3.010  0.025   -4.020  1.00 0.00 ? 65  VAL A HG21 6  
ATOM 8892  H HG22 . VAL A 1 65  ? -4.696  -0.052  -3.510  1.00 0.00 ? 65  VAL A HG22 6  
ATOM 8893  H HG23 . VAL A 1 65  ? -4.219  -0.701  -5.079  1.00 0.00 ? 65  VAL A HG23 6  
ATOM 8894  N N    . GLY A 1 66  ? -3.229  4.812   -4.618  1.00 0.00 ? 66  GLY A N    6  
ATOM 8895  C CA   . GLY A 1 66  ? -3.390  6.123   -5.221  1.00 0.00 ? 66  GLY A CA   6  
ATOM 8896  C C    . GLY A 1 66  ? -2.774  7.225   -4.383  1.00 0.00 ? 66  GLY A C    6  
ATOM 8897  O O    . GLY A 1 66  ? -2.399  8.276   -4.905  1.00 0.00 ? 66  GLY A O    6  
ATOM 8898  H H    . GLY A 1 66  ? -2.394  4.586   -4.158  1.00 0.00 ? 66  GLY A H    6  
ATOM 8899  H HA2  . GLY A 1 66  ? -2.922  6.120   -6.194  1.00 0.00 ? 66  GLY A HA2  6  
ATOM 8900  H HA3  . GLY A 1 66  ? -4.445  6.324   -5.340  1.00 0.00 ? 66  GLY A HA3  6  
ATOM 8901  N N    . LEU A 1 67  ? -2.670  6.988   -3.080  1.00 0.00 ? 67  LEU A N    6  
ATOM 8902  C CA   . LEU A 1 67  ? -2.096  7.970   -2.167  1.00 0.00 ? 67  LEU A CA   6  
ATOM 8903  C C    . LEU A 1 67  ? -0.595  8.116   -2.397  1.00 0.00 ? 67  LEU A C    6  
ATOM 8904  O O    . LEU A 1 67  ? 0.164   7.160   -2.233  1.00 0.00 ? 67  LEU A O    6  
ATOM 8905  C CB   . LEU A 1 67  ? -2.364  7.566   -0.716  1.00 0.00 ? 67  LEU A CB   6  
ATOM 8906  C CG   . LEU A 1 67  ? -3.802  7.738   -0.227  1.00 0.00 ? 67  LEU A CG   6  
ATOM 8907  C CD1  . LEU A 1 67  ? -4.124  6.718   0.855   1.00 0.00 ? 67  LEU A CD1  6  
ATOM 8908  C CD2  . LEU A 1 67  ? -4.025  9.152   0.289   1.00 0.00 ? 67  LEU A CD2  6  
ATOM 8909  H H    . LEU A 1 67  ? -2.986  6.133   -2.722  1.00 0.00 ? 67  LEU A H    6  
ATOM 8910  H HA   . LEU A 1 67  ? -2.571  8.920   -2.361  1.00 0.00 ? 67  LEU A HA   6  
ATOM 8911  H HB2  . LEU A 1 67  ? -2.101  6.524   -0.610  1.00 0.00 ? 67  LEU A HB2  6  
ATOM 8912  H HB3  . LEU A 1 67  ? -1.724  8.163   -0.083  1.00 0.00 ? 67  LEU A HB3  6  
ATOM 8913  H HG   . LEU A 1 67  ? -4.480  7.571   -1.053  1.00 0.00 ? 67  LEU A HG   6  
ATOM 8914  H HD11 . LEU A 1 67  ? -5.023  7.015   1.374   1.00 0.00 ? 67  LEU A HD11 6  
ATOM 8915  H HD12 . LEU A 1 67  ? -3.304  6.666   1.556   1.00 0.00 ? 67  LEU A HD12 6  
ATOM 8916  H HD13 . LEU A 1 67  ? -4.271  5.748   0.403   1.00 0.00 ? 67  LEU A HD13 6  
ATOM 8917  H HD21 . LEU A 1 67  ? -3.072  9.650   0.393   1.00 0.00 ? 67  LEU A HD21 6  
ATOM 8918  H HD22 . LEU A 1 67  ? -4.517  9.112   1.250   1.00 0.00 ? 67  LEU A HD22 6  
ATOM 8919  H HD23 . LEU A 1 67  ? -4.641  9.697   -0.410  1.00 0.00 ? 67  LEU A HD23 6  
ATOM 8920  N N    . ARG A 1 68  ? -0.173  9.318   -2.774  1.00 0.00 ? 68  ARG A N    6  
ATOM 8921  C CA   . ARG A 1 68  ? 1.237   9.589   -3.026  1.00 0.00 ? 68  ARG A CA   6  
ATOM 8922  C C    . ARG A 1 68  ? 2.039   9.545   -1.728  1.00 0.00 ? 68  ARG A C    6  
ATOM 8923  O O    . ARG A 1 68  ? 1.741   10.269  -0.777  1.00 0.00 ? 68  ARG A O    6  
ATOM 8924  C CB   . ARG A 1 68  ? 1.405   10.954  -3.695  1.00 0.00 ? 68  ARG A CB   6  
ATOM 8925  C CG   . ARG A 1 68  ? 2.828   11.241  -4.145  1.00 0.00 ? 68  ARG A CG   6  
ATOM 8926  C CD   . ARG A 1 68  ? 3.009   12.704  -4.521  1.00 0.00 ? 68  ARG A CD   6  
ATOM 8927  N NE   . ARG A 1 68  ? 4.043   12.884  -5.537  1.00 0.00 ? 68  ARG A NE   6  
ATOM 8928  C CZ   . ARG A 1 68  ? 4.416   14.070  -6.004  1.00 0.00 ? 68  ARG A CZ   6  
ATOM 8929  N NH1  . ARG A 1 68  ? 3.843   15.176  -5.547  1.00 0.00 ? 68  ARG A NH1  6  
ATOM 8930  N NH2  . ARG A 1 68  ? 5.364   14.152  -6.928  1.00 0.00 ? 68  ARG A NH2  6  
ATOM 8931  H H    . ARG A 1 68  ? -0.826  10.040  -2.888  1.00 0.00 ? 68  ARG A H    6  
ATOM 8932  H HA   . ARG A 1 68  ? 1.609   8.824   -3.691  1.00 0.00 ? 68  ARG A HA   6  
ATOM 8933  H HB2  . ARG A 1 68  ? 0.761   10.999  -4.561  1.00 0.00 ? 68  ARG A HB2  6  
ATOM 8934  H HB3  . ARG A 1 68  ? 1.110   11.723  -2.997  1.00 0.00 ? 68  ARG A HB3  6  
ATOM 8935  H HG2  . ARG A 1 68  ? 3.506   11.002  -3.339  1.00 0.00 ? 68  ARG A HG2  6  
ATOM 8936  H HG3  . ARG A 1 68  ? 3.055   10.627  -5.003  1.00 0.00 ? 68  ARG A HG3  6  
ATOM 8937  H HD2  . ARG A 1 68  ? 2.073   13.082  -4.903  1.00 0.00 ? 68  ARG A HD2  6  
ATOM 8938  H HD3  . ARG A 1 68  ? 3.287   13.257  -3.636  1.00 0.00 ? 68  ARG A HD3  6  
ATOM 8939  H HE   . ARG A 1 68  ? 4.479   12.080  -5.888  1.00 0.00 ? 68  ARG A HE   6  
ATOM 8940  H HH11 . ARG A 1 68  ? 3.130   15.117  -4.850  1.00 0.00 ? 68  ARG A HH11 6  
ATOM 8941  H HH12 . ARG A 1 68  ? 4.127   16.068  -5.900  1.00 0.00 ? 68  ARG A HH12 6  
ATOM 8942  H HH21 . ARG A 1 68  ? 5.798   13.321  -7.274  1.00 0.00 ? 68  ARG A HH21 6  
ATOM 8943  H HH22 . ARG A 1 68  ? 5.644   15.045  -7.279  1.00 0.00 ? 68  ARG A HH22 6  
ATOM 8944  N N    . LEU A 1 69  ? 3.056   8.691   -1.696  1.00 0.00 ? 69  LEU A N    6  
ATOM 8945  C CA   . LEU A 1 69  ? 3.901   8.552   -0.515  1.00 0.00 ? 69  LEU A CA   6  
ATOM 8946  C C    . LEU A 1 69  ? 4.841   9.745   -0.374  1.00 0.00 ? 69  LEU A C    6  
ATOM 8947  O O    . LEU A 1 69  ? 5.775   9.910   -1.160  1.00 0.00 ? 69  LEU A O    6  
ATOM 8948  C CB   . LEU A 1 69  ? 4.711   7.257   -0.593  1.00 0.00 ? 69  LEU A CB   6  
ATOM 8949  C CG   . LEU A 1 69  ? 4.126   6.053   0.147   1.00 0.00 ? 69  LEU A CG   6  
ATOM 8950  C CD1  . LEU A 1 69  ? 4.324   6.202   1.647   1.00 0.00 ? 69  LEU A CD1  6  
ATOM 8951  C CD2  . LEU A 1 69  ? 2.650   5.890   -0.185  1.00 0.00 ? 69  LEU A CD2  6  
ATOM 8952  H H    . LEU A 1 69  ? 3.245   8.142   -2.484  1.00 0.00 ? 69  LEU A H    6  
ATOM 8953  H HA   . LEU A 1 69  ? 3.257   8.512   0.351   1.00 0.00 ? 69  LEU A HA   6  
ATOM 8954  H HB2  . LEU A 1 69  ? 4.808   6.990   -1.634  1.00 0.00 ? 69  LEU A HB2  6  
ATOM 8955  H HB3  . LEU A 1 69  ? 5.691   7.455   -0.182  1.00 0.00 ? 69  LEU A HB3  6  
ATOM 8956  H HG   . LEU A 1 69  ? 4.642   5.158   -0.170  1.00 0.00 ? 69  LEU A HG   6  
ATOM 8957  H HD11 . LEU A 1 69  ? 3.695   5.494   2.165   1.00 0.00 ? 69  LEU A HD11 6  
ATOM 8958  H HD12 . LEU A 1 69  ? 4.060   7.205   1.948   1.00 0.00 ? 69  LEU A HD12 6  
ATOM 8959  H HD13 . LEU A 1 69  ? 5.359   6.012   1.894   1.00 0.00 ? 69  LEU A HD13 6  
ATOM 8960  H HD21 . LEU A 1 69  ? 2.261   6.824   -0.564  1.00 0.00 ? 69  LEU A HD21 6  
ATOM 8961  H HD22 . LEU A 1 69  ? 2.109   5.611   0.708   1.00 0.00 ? 69  LEU A HD22 6  
ATOM 8962  H HD23 . LEU A 1 69  ? 2.532   5.120   -0.933  1.00 0.00 ? 69  LEU A HD23 6  
ATOM 8963  N N    . LEU A 1 70  ? 4.589   10.574  0.634   1.00 0.00 ? 70  LEU A N    6  
ATOM 8964  C CA   . LEU A 1 70  ? 5.414   11.751  0.880   1.00 0.00 ? 70  LEU A CA   6  
ATOM 8965  C C    . LEU A 1 70  ? 6.630   11.396  1.730   1.00 0.00 ? 70  LEU A C    6  
ATOM 8966  O O    . LEU A 1 70  ? 7.762   11.731  1.381   1.00 0.00 ? 70  LEU A O    6  
ATOM 8967  C CB   . LEU A 1 70  ? 4.592   12.838  1.575   1.00 0.00 ? 70  LEU A CB   6  
ATOM 8968  C CG   . LEU A 1 70  ? 3.789   13.762  0.659   1.00 0.00 ? 70  LEU A CG   6  
ATOM 8969  C CD1  . LEU A 1 70  ? 4.643   14.227  -0.511  1.00 0.00 ? 70  LEU A CD1  6  
ATOM 8970  C CD2  . LEU A 1 70  ? 2.535   13.060  0.160   1.00 0.00 ? 70  LEU A CD2  6  
ATOM 8971  H H    . LEU A 1 70  ? 3.831   10.390  1.226   1.00 0.00 ? 70  LEU A H    6  
ATOM 8972  H HA   . LEU A 1 70  ? 5.754   12.124  -0.075  1.00 0.00 ? 70  LEU A HA   6  
ATOM 8973  H HB2  . LEU A 1 70  ? 3.898   12.351  2.243   1.00 0.00 ? 70  LEU A HB2  6  
ATOM 8974  H HB3  . LEU A 1 70  ? 5.273   13.450  2.150   1.00 0.00 ? 70  LEU A HB3  6  
ATOM 8975  H HG   . LEU A 1 70  ? 3.484   14.636  1.217   1.00 0.00 ? 70  LEU A HG   6  
ATOM 8976  H HD11 . LEU A 1 70  ? 4.357   15.230  -0.789  1.00 0.00 ? 70  LEU A HD11 6  
ATOM 8977  H HD12 . LEU A 1 70  ? 4.495   13.564  -1.350  1.00 0.00 ? 70  LEU A HD12 6  
ATOM 8978  H HD13 . LEU A 1 70  ? 5.684   14.216  -0.223  1.00 0.00 ? 70  LEU A HD13 6  
ATOM 8979  H HD21 . LEU A 1 70  ? 2.628   12.866  -0.899  1.00 0.00 ? 70  LEU A HD21 6  
ATOM 8980  H HD22 . LEU A 1 70  ? 1.675   13.690  0.336   1.00 0.00 ? 70  LEU A HD22 6  
ATOM 8981  H HD23 . LEU A 1 70  ? 2.411   12.126  0.687   1.00 0.00 ? 70  LEU A HD23 6  
ATOM 8982  N N    . GLU A 1 71  ? 6.388   10.714  2.845   1.00 0.00 ? 71  GLU A N    6  
ATOM 8983  C CA   . GLU A 1 71  ? 7.465   10.313  3.743   1.00 0.00 ? 71  GLU A CA   6  
ATOM 8984  C C    . GLU A 1 71  ? 7.088   9.050   4.512   1.00 0.00 ? 71  GLU A C    6  
ATOM 8985  O O    . GLU A 1 71  ? 5.949   8.893   4.951   1.00 0.00 ? 71  GLU A O    6  
ATOM 8986  C CB   . GLU A 1 71  ? 7.790   11.442  4.722   1.00 0.00 ? 71  GLU A CB   6  
ATOM 8987  C CG   . GLU A 1 71  ? 8.105   12.764  4.043   1.00 0.00 ? 71  GLU A CG   6  
ATOM 8988  C CD   . GLU A 1 71  ? 8.840   13.728  4.955   1.00 0.00 ? 71  GLU A CD   6  
ATOM 8989  O OE1  . GLU A 1 71  ? 8.840   13.498  6.183   1.00 0.00 ? 71  GLU A OE1  6  
ATOM 8990  O OE2  . GLU A 1 71  ? 9.415   14.710  4.442   1.00 0.00 ? 71  GLU A OE2  6  
ATOM 8991  H H    . GLU A 1 71  ? 5.464   10.476  3.069   1.00 0.00 ? 71  GLU A H    6  
ATOM 8992  H HA   . GLU A 1 71  ? 8.338   10.107  3.142   1.00 0.00 ? 71  GLU A HA   6  
ATOM 8993  H HB2  . GLU A 1 71  ? 6.944   11.590  5.377   1.00 0.00 ? 71  GLU A HB2  6  
ATOM 8994  H HB3  . GLU A 1 71  ? 8.645   11.153  5.315   1.00 0.00 ? 71  GLU A HB3  6  
ATOM 8995  H HG2  . GLU A 1 71  ? 8.721   12.572  3.178   1.00 0.00 ? 71  GLU A HG2  6  
ATOM 8996  H HG3  . GLU A 1 71  ? 7.179   13.224  3.730   1.00 0.00 ? 71  GLU A HG3  6  
ATOM 8997  N N    . VAL A 1 72  ? 8.055   8.151   4.672   1.00 0.00 ? 72  VAL A N    6  
ATOM 8998  C CA   . VAL A 1 72  ? 7.826   6.902   5.388   1.00 0.00 ? 72  VAL A CA   6  
ATOM 8999  C C    . VAL A 1 72  ? 8.647   6.847   6.672   1.00 0.00 ? 72  VAL A C    6  
ATOM 9000  O O    . VAL A 1 72  ? 9.870   6.719   6.633   1.00 0.00 ? 72  VAL A O    6  
ATOM 9001  C CB   . VAL A 1 72  ? 8.176   5.682   4.515   1.00 0.00 ? 72  VAL A CB   6  
ATOM 9002  C CG1  . VAL A 1 72  ? 8.021   4.394   5.310   1.00 0.00 ? 72  VAL A CG1  6  
ATOM 9003  C CG2  . VAL A 1 72  ? 7.308   5.655   3.266   1.00 0.00 ? 72  VAL A CG2  6  
ATOM 9004  H H    . VAL A 1 72  ? 8.943   8.333   4.299   1.00 0.00 ? 72  VAL A H    6  
ATOM 9005  H HA   . VAL A 1 72  ? 6.777   6.849   5.641   1.00 0.00 ? 72  VAL A HA   6  
ATOM 9006  H HB   . VAL A 1 72  ? 9.208   5.768   4.209   1.00 0.00 ? 72  VAL A HB   6  
ATOM 9007  H HG11 . VAL A 1 72  ? 8.966   3.871   5.334   1.00 0.00 ? 72  VAL A HG11 6  
ATOM 9008  H HG12 . VAL A 1 72  ? 7.713   4.628   6.318   1.00 0.00 ? 72  VAL A HG12 6  
ATOM 9009  H HG13 . VAL A 1 72  ? 7.276   3.769   4.841   1.00 0.00 ? 72  VAL A HG13 6  
ATOM 9010  H HG21 . VAL A 1 72  ? 6.473   4.988   3.424   1.00 0.00 ? 72  VAL A HG21 6  
ATOM 9011  H HG22 . VAL A 1 72  ? 6.940   6.650   3.061   1.00 0.00 ? 72  VAL A HG22 6  
ATOM 9012  H HG23 . VAL A 1 72  ? 7.893   5.308   2.428   1.00 0.00 ? 72  VAL A HG23 6  
ATOM 9013  N N    . ASN A 1 73  ? 7.966   6.943   7.808   1.00 0.00 ? 73  ASN A N    6  
ATOM 9014  C CA   . ASN A 1 73  ? 8.632   6.904   9.105   1.00 0.00 ? 73  ASN A CA   6  
ATOM 9015  C C    . ASN A 1 73  ? 9.533   8.121   9.291   1.00 0.00 ? 73  ASN A C    6  
ATOM 9016  O O    . ASN A 1 73  ? 10.643  8.010   9.810   1.00 0.00 ? 73  ASN A O    6  
ATOM 9017  C CB   . ASN A 1 73  ? 9.455   5.621   9.240   1.00 0.00 ? 73  ASN A CB   6  
ATOM 9018  C CG   . ASN A 1 73  ? 8.702   4.525   9.969   1.00 0.00 ? 73  ASN A CG   6  
ATOM 9019  O OD1  . ASN A 1 73  ? 8.128   4.753   11.034  1.00 0.00 ? 73  ASN A OD1  6  
ATOM 9020  N ND2  . ASN A 1 73  ? 8.701   3.327   9.397   1.00 0.00 ? 73  ASN A ND2  6  
ATOM 9021  H H    . ASN A 1 73  ? 6.991   7.043   7.775   1.00 0.00 ? 73  ASN A H    6  
ATOM 9022  H HA   . ASN A 1 73  ? 7.870   6.914   9.870   1.00 0.00 ? 73  ASN A HA   6  
ATOM 9023  H HB2  . ASN A 1 73  ? 9.713   5.261   8.255   1.00 0.00 ? 73  ASN A HB2  6  
ATOM 9024  H HB3  . ASN A 1 73  ? 10.360  5.837   9.788   1.00 0.00 ? 73  ASN A HB3  6  
ATOM 9025  H HD21 . ASN A 1 73  ? 9.180   3.218   8.548   1.00 0.00 ? 73  ASN A HD21 6  
ATOM 9026  H HD22 . ASN A 1 73  ? 8.222   2.600   9.846   1.00 0.00 ? 73  ASN A HD22 6  
ATOM 9027  N N    . GLN A 1 74  ? 9.045   9.282   8.863   1.00 0.00 ? 74  GLN A N    6  
ATOM 9028  C CA   . GLN A 1 74  ? 9.806   10.520  8.982   1.00 0.00 ? 74  GLN A CA   6  
ATOM 9029  C C    . GLN A 1 74  ? 11.082  10.457  8.148   1.00 0.00 ? 74  GLN A C    6  
ATOM 9030  O O    . GLN A 1 74  ? 12.110  11.017  8.528   1.00 0.00 ? 74  GLN A O    6  
ATOM 9031  C CB   . GLN A 1 74  ? 10.154  10.791  10.447  1.00 0.00 ? 74  GLN A CB   6  
ATOM 9032  C CG   . GLN A 1 74  ? 8.950   11.160  11.299  1.00 0.00 ? 74  GLN A CG   6  
ATOM 9033  C CD   . GLN A 1 74  ? 9.185   10.919  12.777  1.00 0.00 ? 74  GLN A CD   6  
ATOM 9034  O OE1  . GLN A 1 74  ? 10.067  11.526  13.384  1.00 0.00 ? 74  GLN A OE1  6  
ATOM 9035  N NE2  . GLN A 1 74  ? 8.395   10.028  13.364  1.00 0.00 ? 74  GLN A NE2  6  
ATOM 9036  H H    . GLN A 1 74  ? 8.154   9.305   8.457   1.00 0.00 ? 74  GLN A H    6  
ATOM 9037  H HA   . GLN A 1 74  ? 9.189   11.325  8.613   1.00 0.00 ? 74  GLN A HA   6  
ATOM 9038  H HB2  . GLN A 1 74  ? 10.607  9.905   10.867  1.00 0.00 ? 74  GLN A HB2  6  
ATOM 9039  H HB3  . GLN A 1 74  ? 10.862  11.605  10.492  1.00 0.00 ? 74  GLN A HB3  6  
ATOM 9040  H HG2  . GLN A 1 74  ? 8.729   12.207  11.152  1.00 0.00 ? 74  GLN A HG2  6  
ATOM 9041  H HG3  . GLN A 1 74  ? 8.105   10.567  10.982  1.00 0.00 ? 74  GLN A HG3  6  
ATOM 9042  H HE21 . GLN A 1 74  ? 7.715   9.581   12.817  1.00 0.00 ? 74  GLN A HE21 6  
ATOM 9043  H HE22 . GLN A 1 74  ? 8.525   9.851   14.319  1.00 0.00 ? 74  GLN A HE22 6  
ATOM 9044  N N    . GLN A 1 75  ? 11.007  9.772   7.011   1.00 0.00 ? 75  GLN A N    6  
ATOM 9045  C CA   . GLN A 1 75  ? 12.156  9.636   6.125   1.00 0.00 ? 75  GLN A CA   6  
ATOM 9046  C C    . GLN A 1 75  ? 11.778  9.975   4.687   1.00 0.00 ? 75  GLN A C    6  
ATOM 9047  O O    . GLN A 1 75  ? 11.331  9.111   3.932   1.00 0.00 ? 75  GLN A O    6  
ATOM 9048  C CB   . GLN A 1 75  ? 12.716  8.214   6.196   1.00 0.00 ? 75  GLN A CB   6  
ATOM 9049  C CG   . GLN A 1 75  ? 13.125  7.791   7.598   1.00 0.00 ? 75  GLN A CG   6  
ATOM 9050  C CD   . GLN A 1 75  ? 14.187  6.709   7.594   1.00 0.00 ? 75  GLN A CD   6  
ATOM 9051  O OE1  . GLN A 1 75  ? 14.851  6.478   6.583   1.00 0.00 ? 75  GLN A OE1  6  
ATOM 9052  N NE2  . GLN A 1 75  ? 14.352  6.037   8.728   1.00 0.00 ? 75  GLN A NE2  6  
ATOM 9053  H H    . GLN A 1 75  ? 10.159  9.349   6.764   1.00 0.00 ? 75  GLN A H    6  
ATOM 9054  H HA   . GLN A 1 75  ? 12.915  10.329  6.457   1.00 0.00 ? 75  GLN A HA   6  
ATOM 9055  H HB2  . GLN A 1 75  ? 11.965  7.526   5.839   1.00 0.00 ? 75  GLN A HB2  6  
ATOM 9056  H HB3  . GLN A 1 75  ? 13.584  8.150   5.557   1.00 0.00 ? 75  GLN A HB3  6  
ATOM 9057  H HG2  . GLN A 1 75  ? 13.513  8.652   8.121   1.00 0.00 ? 75  GLN A HG2  6  
ATOM 9058  H HG3  . GLN A 1 75  ? 12.253  7.418   8.115   1.00 0.00 ? 75  GLN A HG3  6  
ATOM 9059  H HE21 . GLN A 1 75  ? 13.786  6.274   9.492   1.00 0.00 ? 75  GLN A HE21 6  
ATOM 9060  H HE22 . GLN A 1 75  ? 15.030  5.332   8.753   1.00 0.00 ? 75  GLN A HE22 6  
ATOM 9061  N N    . SER A 1 76  ? 11.960  11.238  4.314   1.00 0.00 ? 76  SER A N    6  
ATOM 9062  C CA   . SER A 1 76  ? 11.634  11.692  2.968   1.00 0.00 ? 76  SER A CA   6  
ATOM 9063  C C    . SER A 1 76  ? 12.124  10.694  1.924   1.00 0.00 ? 76  SER A C    6  
ATOM 9064  O O    . SER A 1 76  ? 13.284  10.278  1.942   1.00 0.00 ? 76  SER A O    6  
ATOM 9065  C CB   . SER A 1 76  ? 12.253  13.066  2.706   1.00 0.00 ? 76  SER A CB   6  
ATOM 9066  O OG   . SER A 1 76  ? 11.598  13.726  1.636   1.00 0.00 ? 76  SER A OG   6  
ATOM 9067  H H    . SER A 1 76  ? 12.320  11.880  4.962   1.00 0.00 ? 76  SER A H    6  
ATOM 9068  H HA   . SER A 1 76  ? 10.559  11.771  2.896   1.00 0.00 ? 76  SER A HA   6  
ATOM 9069  H HB2  . SER A 1 76  ? 12.165  13.673  3.594   1.00 0.00 ? 76  SER A HB2  6  
ATOM 9070  H HB3  . SER A 1 76  ? 13.297  12.946  2.454   1.00 0.00 ? 76  SER A HB3  6  
ATOM 9071  H HG   . SER A 1 76  ? 12.250  14.146  1.071   1.00 0.00 ? 76  SER A HG   6  
ATOM 9072  N N    . LEU A 1 77  ? 11.234  10.313  1.014   1.00 0.00 ? 77  LEU A N    6  
ATOM 9073  C CA   . LEU A 1 77  ? 11.575  9.362   -0.039  1.00 0.00 ? 77  LEU A CA   6  
ATOM 9074  C C    . LEU A 1 77  ? 12.111  10.084  -1.271  1.00 0.00 ? 77  LEU A C    6  
ATOM 9075  O O    . LEU A 1 77  ? 12.282  9.482   -2.331  1.00 0.00 ? 77  LEU A O    6  
ATOM 9076  C CB   . LEU A 1 77  ? 10.349  8.528   -0.416  1.00 0.00 ? 77  LEU A CB   6  
ATOM 9077  C CG   . LEU A 1 77  ? 9.504   8.012   0.750   1.00 0.00 ? 77  LEU A CG   6  
ATOM 9078  C CD1  . LEU A 1 77  ? 8.323   7.203   0.236   1.00 0.00 ? 77  LEU A CD1  6  
ATOM 9079  C CD2  . LEU A 1 77  ? 10.353  7.178   1.697   1.00 0.00 ? 77  LEU A CD2  6  
ATOM 9080  H H    . LEU A 1 77  ? 10.326  10.678  1.051   1.00 0.00 ? 77  LEU A H    6  
ATOM 9081  H HA   . LEU A 1 77  ? 12.343  8.707   0.342   1.00 0.00 ? 77  LEU A HA   6  
ATOM 9082  H HB2  . LEU A 1 77  ? 9.714   9.136   -1.041  1.00 0.00 ? 77  LEU A HB2  6  
ATOM 9083  H HB3  . LEU A 1 77  ? 10.694  7.672   -0.980  1.00 0.00 ? 77  LEU A HB3  6  
ATOM 9084  H HG   . LEU A 1 77  ? 9.114   8.856   1.304   1.00 0.00 ? 77  LEU A HG   6  
ATOM 9085  H HD11 . LEU A 1 77  ? 8.538   6.150   0.336   1.00 0.00 ? 77  LEU A HD11 6  
ATOM 9086  H HD12 . LEU A 1 77  ? 8.151   7.438   -0.804  1.00 0.00 ? 77  LEU A HD12 6  
ATOM 9087  H HD13 . LEU A 1 77  ? 7.442   7.448   0.811   1.00 0.00 ? 77  LEU A HD13 6  
ATOM 9088  H HD21 . LEU A 1 77  ? 10.174  6.129   1.511   1.00 0.00 ? 77  LEU A HD21 6  
ATOM 9089  H HD22 . LEU A 1 77  ? 10.090  7.412   2.718   1.00 0.00 ? 77  LEU A HD22 6  
ATOM 9090  H HD23 . LEU A 1 77  ? 11.398  7.399   1.533   1.00 0.00 ? 77  LEU A HD23 6  
ATOM 9091  N N    . LEU A 1 78  ? 12.376  11.378  -1.124  1.00 0.00 ? 78  LEU A N    6  
ATOM 9092  C CA   . LEU A 1 78  ? 12.895  12.182  -2.224  1.00 0.00 ? 78  LEU A CA   6  
ATOM 9093  C C    . LEU A 1 78  ? 14.400  11.987  -2.378  1.00 0.00 ? 78  LEU A C    6  
ATOM 9094  O O    . LEU A 1 78  ? 15.165  12.220  -1.444  1.00 0.00 ? 78  LEU A O    6  
ATOM 9095  C CB   . LEU A 1 78  ? 12.582  13.662  -1.992  1.00 0.00 ? 78  LEU A CB   6  
ATOM 9096  C CG   . LEU A 1 78  ? 12.681  14.569  -3.219  1.00 0.00 ? 78  LEU A CG   6  
ATOM 9097  C CD1  . LEU A 1 78  ? 14.113  14.627  -3.727  1.00 0.00 ? 78  LEU A CD1  6  
ATOM 9098  C CD2  . LEU A 1 78  ? 11.743  14.086  -4.316  1.00 0.00 ? 78  LEU A CD2  6  
ATOM 9099  H H    . LEU A 1 78  ? 12.219  11.803  -0.255  1.00 0.00 ? 78  LEU A H    6  
ATOM 9100  H HA   . LEU A 1 78  ? 12.407  11.857  -3.131  1.00 0.00 ? 78  LEU A HA   6  
ATOM 9101  H HB2  . LEU A 1 78  ? 11.575  13.731  -1.611  1.00 0.00 ? 78  LEU A HB2  6  
ATOM 9102  H HB3  . LEU A 1 78  ? 13.273  14.032  -1.249  1.00 0.00 ? 78  LEU A HB3  6  
ATOM 9103  H HG   . LEU A 1 78  ? 12.385  15.571  -2.943  1.00 0.00 ? 78  LEU A HG   6  
ATOM 9104  H HD11 . LEU A 1 78  ? 14.297  13.788  -4.381  1.00 0.00 ? 78  LEU A HD11 6  
ATOM 9105  H HD12 . LEU A 1 78  ? 14.794  14.585  -2.889  1.00 0.00 ? 78  LEU A HD12 6  
ATOM 9106  H HD13 . LEU A 1 78  ? 14.266  15.548  -4.269  1.00 0.00 ? 78  LEU A HD13 6  
ATOM 9107  H HD21 . LEU A 1 78  ? 11.519  14.905  -4.984  1.00 0.00 ? 78  LEU A HD21 6  
ATOM 9108  H HD22 . LEU A 1 78  ? 10.828  13.722  -3.873  1.00 0.00 ? 78  LEU A HD22 6  
ATOM 9109  H HD23 . LEU A 1 78  ? 12.217  13.289  -4.870  1.00 0.00 ? 78  LEU A HD23 6  
ATOM 9110  N N    . GLY A 1 79  ? 14.818  11.560  -3.566  1.00 0.00 ? 79  GLY A N    6  
ATOM 9111  C CA   . GLY A 1 79  ? 16.230  11.343  -3.822  1.00 0.00 ? 79  GLY A CA   6  
ATOM 9112  C C    . GLY A 1 79  ? 16.565  9.878   -4.017  1.00 0.00 ? 79  GLY A C    6  
ATOM 9113  O O    . GLY A 1 79  ? 17.460  9.536   -4.791  1.00 0.00 ? 79  GLY A O    6  
ATOM 9114  H H    . GLY A 1 79  ? 14.162  11.391  -4.274  1.00 0.00 ? 79  GLY A H    6  
ATOM 9115  H HA2  . GLY A 1 79  ? 16.511  11.888  -4.710  1.00 0.00 ? 79  GLY A HA2  6  
ATOM 9116  H HA3  . GLY A 1 79  ? 16.798  11.722  -2.984  1.00 0.00 ? 79  GLY A HA3  6  
ATOM 9117  N N    . LEU A 1 80  ? 15.849  9.010   -3.311  1.00 0.00 ? 80  LEU A N    6  
ATOM 9118  C CA   . LEU A 1 80  ? 16.076  7.572   -3.409  1.00 0.00 ? 80  LEU A CA   6  
ATOM 9119  C C    . LEU A 1 80  ? 15.289  6.974   -4.571  1.00 0.00 ? 80  LEU A C    6  
ATOM 9120  O O    . LEU A 1 80  ? 14.368  7.599   -5.099  1.00 0.00 ? 80  LEU A O    6  
ATOM 9121  C CB   . LEU A 1 80  ? 15.680  6.883   -2.102  1.00 0.00 ? 80  LEU A CB   6  
ATOM 9122  C CG   . LEU A 1 80  ? 14.489  7.488   -1.358  1.00 0.00 ? 80  LEU A CG   6  
ATOM 9123  C CD1  . LEU A 1 80  ? 13.741  6.414   -0.585  1.00 0.00 ? 80  LEU A CD1  6  
ATOM 9124  C CD2  . LEU A 1 80  ? 14.952  8.596   -0.423  1.00 0.00 ? 80  LEU A CD2  6  
ATOM 9125  H H    . LEU A 1 80  ? 15.150  9.342   -2.711  1.00 0.00 ? 80  LEU A H    6  
ATOM 9126  H HA   . LEU A 1 80  ? 17.130  7.414   -3.585  1.00 0.00 ? 80  LEU A HA   6  
ATOM 9127  H HB2  . LEU A 1 80  ? 15.440  5.856   -2.329  1.00 0.00 ? 80  LEU A HB2  6  
ATOM 9128  H HB3  . LEU A 1 80  ? 16.535  6.914   -1.441  1.00 0.00 ? 80  LEU A HB3  6  
ATOM 9129  H HG   . LEU A 1 80  ? 13.805  7.920   -2.076  1.00 0.00 ? 80  LEU A HG   6  
ATOM 9130  H HD11 . LEU A 1 80  ? 12.678  6.556   -0.709  1.00 0.00 ? 80  LEU A HD11 6  
ATOM 9131  H HD12 . LEU A 1 80  ? 13.993  6.482   0.463   1.00 0.00 ? 80  LEU A HD12 6  
ATOM 9132  H HD13 . LEU A 1 80  ? 14.020  5.440   -0.960  1.00 0.00 ? 80  LEU A HD13 6  
ATOM 9133  H HD21 . LEU A 1 80  ? 14.427  8.515   0.518   1.00 0.00 ? 80  LEU A HD21 6  
ATOM 9134  H HD22 . LEU A 1 80  ? 14.741  9.557   -0.871  1.00 0.00 ? 80  LEU A HD22 6  
ATOM 9135  H HD23 . LEU A 1 80  ? 16.014  8.504   -0.253  1.00 0.00 ? 80  LEU A HD23 6  
ATOM 9136  N N    . THR A 1 81  ? 15.656  5.758   -4.964  1.00 0.00 ? 81  THR A N    6  
ATOM 9137  C CA   . THR A 1 81  ? 14.984  5.075   -6.062  1.00 0.00 ? 81  THR A CA   6  
ATOM 9138  C C    . THR A 1 81  ? 13.952  4.081   -5.542  1.00 0.00 ? 81  THR A C    6  
ATOM 9139  O O    . THR A 1 81  ? 14.004  3.666   -4.384  1.00 0.00 ? 81  THR A O    6  
ATOM 9140  C CB   . THR A 1 81  ? 15.990  4.331   -6.961  1.00 0.00 ? 81  THR A CB   6  
ATOM 9141  O OG1  . THR A 1 81  ? 16.701  3.353   -6.194  1.00 0.00 ? 81  THR A OG1  6  
ATOM 9142  C CG2  . THR A 1 81  ? 16.976  5.304   -7.590  1.00 0.00 ? 81  THR A CG2  6  
ATOM 9143  H H    . THR A 1 81  ? 16.397  5.312   -4.504  1.00 0.00 ? 81  THR A H    6  
ATOM 9144  H HA   . THR A 1 81  ? 14.481  5.820   -6.661  1.00 0.00 ? 81  THR A HA   6  
ATOM 9145  H HB   . THR A 1 81  ? 15.445  3.832   -7.749  1.00 0.00 ? 81  THR A HB   6  
ATOM 9146  H HG1  . THR A 1 81  ? 16.766  2.537   -6.696  1.00 0.00 ? 81  THR A HG1  6  
ATOM 9147  H HG21 . THR A 1 81  ? 16.707  6.314   -7.320  1.00 0.00 ? 81  THR A HG21 6  
ATOM 9148  H HG22 . THR A 1 81  ? 16.948  5.199   -8.665  1.00 0.00 ? 81  THR A HG22 6  
ATOM 9149  H HG23 . THR A 1 81  ? 17.971  5.088   -7.233  1.00 0.00 ? 81  THR A HG23 6  
ATOM 9150  N N    . HIS A 1 82  ? 13.016  3.700   -6.406  1.00 0.00 ? 82  HIS A N    6  
ATOM 9151  C CA   . HIS A 1 82  ? 11.972  2.752   -6.033  1.00 0.00 ? 82  HIS A CA   6  
ATOM 9152  C C    . HIS A 1 82  ? 12.502  1.725   -5.036  1.00 0.00 ? 82  HIS A C    6  
ATOM 9153  O O    . HIS A 1 82  ? 11.950  1.559   -3.949  1.00 0.00 ? 82  HIS A O    6  
ATOM 9154  C CB   . HIS A 1 82  ? 11.431  2.043   -7.274  1.00 0.00 ? 82  HIS A CB   6  
ATOM 9155  C CG   . HIS A 1 82  ? 10.021  1.561   -7.122  1.00 0.00 ? 82  HIS A CG   6  
ATOM 9156  N ND1  . HIS A 1 82  ? 9.637   0.263   -7.385  1.00 0.00 ? 82  HIS A ND1  6  
ATOM 9157  C CD2  . HIS A 1 82  ? 8.901   2.211   -6.728  1.00 0.00 ? 82  HIS A CD2  6  
ATOM 9158  C CE1  . HIS A 1 82  ? 8.341   0.136   -7.162  1.00 0.00 ? 82  HIS A CE1  6  
ATOM 9159  N NE2  . HIS A 1 82  ? 7.870   1.303   -6.762  1.00 0.00 ? 82  HIS A NE2  6  
ATOM 9160  H H    . HIS A 1 82  ? 13.028  4.065   -7.315  1.00 0.00 ? 82  HIS A H    6  
ATOM 9161  H HA   . HIS A 1 82  ? 11.171  3.307   -5.568  1.00 0.00 ? 82  HIS A HA   6  
ATOM 9162  H HB2  . HIS A 1 82  ? 11.458  2.725   -8.111  1.00 0.00 ? 82  HIS A HB2  6  
ATOM 9163  H HB3  . HIS A 1 82  ? 12.053  1.187   -7.493  1.00 0.00 ? 82  HIS A HB3  6  
ATOM 9164  H HD1  . HIS A 1 82  ? 10.226  -0.457  -7.692  1.00 0.00 ? 82  HIS A HD1  6  
ATOM 9165  H HD2  . HIS A 1 82  ? 8.829   3.250   -6.441  1.00 0.00 ? 82  HIS A HD2  6  
ATOM 9166  H HE1  . HIS A 1 82  ? 7.764   -0.768  -7.285  1.00 0.00 ? 82  HIS A HE1  6  
ATOM 9167  H HE2  . HIS A 1 82  ? 6.924   1.509   -6.611  1.00 0.00 ? 82  HIS A HE2  6  
ATOM 9168  N N    . GLY A 1 83  ? 13.575  1.038   -5.416  1.00 0.00 ? 83  GLY A N    6  
ATOM 9169  C CA   . GLY A 1 83  ? 14.160  0.035   -4.544  1.00 0.00 ? 83  GLY A CA   6  
ATOM 9170  C C    . GLY A 1 83  ? 14.511  0.589   -3.178  1.00 0.00 ? 83  GLY A C    6  
ATOM 9171  O O    . GLY A 1 83  ? 14.198  -0.021  -2.156  1.00 0.00 ? 83  GLY A O    6  
ATOM 9172  H H    . GLY A 1 83  ? 13.972  1.213   -6.294  1.00 0.00 ? 83  GLY A H    6  
ATOM 9173  H HA2  . GLY A 1 83  ? 13.457  -0.775  -4.424  1.00 0.00 ? 83  GLY A HA2  6  
ATOM 9174  H HA3  . GLY A 1 83  ? 15.058  -0.347  -5.007  1.00 0.00 ? 83  GLY A HA3  6  
ATOM 9175  N N    . GLU A 1 84  ? 15.165  1.746   -3.160  1.00 0.00 ? 84  GLU A N    6  
ATOM 9176  C CA   . GLU A 1 84  ? 15.561  2.379   -1.907  1.00 0.00 ? 84  GLU A CA   6  
ATOM 9177  C C    . GLU A 1 84  ? 14.337  2.748   -1.073  1.00 0.00 ? 84  GLU A C    6  
ATOM 9178  O O    . GLU A 1 84  ? 14.306  2.520   0.136   1.00 0.00 ? 84  GLU A O    6  
ATOM 9179  C CB   . GLU A 1 84  ? 16.398  3.630   -2.185  1.00 0.00 ? 84  GLU A CB   6  
ATOM 9180  C CG   . GLU A 1 84  ? 17.879  3.343   -2.367  1.00 0.00 ? 84  GLU A CG   6  
ATOM 9181  C CD   . GLU A 1 84  ? 18.615  3.214   -1.047  1.00 0.00 ? 84  GLU A CD   6  
ATOM 9182  O OE1  . GLU A 1 84  ? 18.692  2.085   -0.520  1.00 0.00 ? 84  GLU A OE1  6  
ATOM 9183  O OE2  . GLU A 1 84  ? 19.113  4.241   -0.542  1.00 0.00 ? 84  GLU A OE2  6  
ATOM 9184  H H    . GLU A 1 84  ? 15.386  2.184   -4.008  1.00 0.00 ? 84  GLU A H    6  
ATOM 9185  H HA   . GLU A 1 84  ? 16.160  1.673   -1.353  1.00 0.00 ? 84  GLU A HA   6  
ATOM 9186  H HB2  . GLU A 1 84  ? 16.030  4.103   -3.084  1.00 0.00 ? 84  GLU A HB2  6  
ATOM 9187  H HB3  . GLU A 1 84  ? 16.285  4.315   -1.357  1.00 0.00 ? 84  GLU A HB3  6  
ATOM 9188  H HG2  . GLU A 1 84  ? 17.989  2.419   -2.914  1.00 0.00 ? 84  GLU A HG2  6  
ATOM 9189  H HG3  . GLU A 1 84  ? 18.322  4.150   -2.932  1.00 0.00 ? 84  GLU A HG3  6  
ATOM 9190  N N    . ALA A 1 85  ? 13.332  3.319   -1.728  1.00 0.00 ? 85  ALA A N    6  
ATOM 9191  C CA   . ALA A 1 85  ? 12.106  3.718   -1.048  1.00 0.00 ? 85  ALA A CA   6  
ATOM 9192  C C    . ALA A 1 85  ? 11.394  2.511   -0.447  1.00 0.00 ? 85  ALA A C    6  
ATOM 9193  O O    . ALA A 1 85  ? 11.052  2.505   0.735   1.00 0.00 ? 85  ALA A O    6  
ATOM 9194  C CB   . ALA A 1 85  ? 11.184  4.452   -2.011  1.00 0.00 ? 85  ALA A CB   6  
ATOM 9195  H H    . ALA A 1 85  ? 13.417  3.475   -2.692  1.00 0.00 ? 85  ALA A H    6  
ATOM 9196  H HA   . ALA A 1 85  ? 12.372  4.399   -0.253  1.00 0.00 ? 85  ALA A HA   6  
ATOM 9197  H HB1  . ALA A 1 85  ? 10.236  4.639   -1.527  1.00 0.00 ? 85  ALA A HB1  6  
ATOM 9198  H HB2  . ALA A 1 85  ? 11.635  5.391   -2.295  1.00 0.00 ? 85  ALA A HB2  6  
ATOM 9199  H HB3  . ALA A 1 85  ? 11.026  3.846   -2.890  1.00 0.00 ? 85  ALA A HB3  6  
ATOM 9200  N N    . VAL A 1 86  ? 11.173  1.490   -1.269  1.00 0.00 ? 86  VAL A N    6  
ATOM 9201  C CA   . VAL A 1 86  ? 10.502  0.277   -0.819  1.00 0.00 ? 86  VAL A CA   6  
ATOM 9202  C C    . VAL A 1 86  ? 11.122  -0.247  0.472   1.00 0.00 ? 86  VAL A C    6  
ATOM 9203  O O    . VAL A 1 86  ? 10.454  -0.334  1.502   1.00 0.00 ? 86  VAL A O    6  
ATOM 9204  C CB   . VAL A 1 86  ? 10.561  -0.828  -1.890  1.00 0.00 ? 86  VAL A CB   6  
ATOM 9205  C CG1  . VAL A 1 86  ? 10.177  -2.173  -1.291  1.00 0.00 ? 86  VAL A CG1  6  
ATOM 9206  C CG2  . VAL A 1 86  ? 9.658   -0.481  -3.064  1.00 0.00 ? 86  VAL A CG2  6  
ATOM 9207  H H    . VAL A 1 86  ? 11.469  1.554   -2.201  1.00 0.00 ? 86  VAL A H    6  
ATOM 9208  H HA   . VAL A 1 86  ? 9.464   0.517   -0.636  1.00 0.00 ? 86  VAL A HA   6  
ATOM 9209  H HB   . VAL A 1 86  ? 11.576  -0.897  -2.252  1.00 0.00 ? 86  VAL A HB   6  
ATOM 9210  H HG11 . VAL A 1 86  ? 9.655   -2.016  -0.359  1.00 0.00 ? 86  VAL A HG11 6  
ATOM 9211  H HG12 . VAL A 1 86  ? 9.536   -2.704  -1.979  1.00 0.00 ? 86  VAL A HG12 6  
ATOM 9212  H HG13 . VAL A 1 86  ? 11.070  -2.754  -1.109  1.00 0.00 ? 86  VAL A HG13 6  
ATOM 9213  H HG21 . VAL A 1 86  ? 8.693   -0.166  -2.694  1.00 0.00 ? 86  VAL A HG21 6  
ATOM 9214  H HG22 . VAL A 1 86  ? 10.103  0.320   -3.636  1.00 0.00 ? 86  VAL A HG22 6  
ATOM 9215  H HG23 . VAL A 1 86  ? 9.537   -1.349  -3.694  1.00 0.00 ? 86  VAL A HG23 6  
ATOM 9216  N N    . GLN A 1 87  ? 12.403  -0.595  0.407   1.00 0.00 ? 87  GLN A N    6  
ATOM 9217  C CA   . GLN A 1 87  ? 13.113  -1.111  1.571   1.00 0.00 ? 87  GLN A CA   6  
ATOM 9218  C C    . GLN A 1 87  ? 12.855  -0.241  2.797   1.00 0.00 ? 87  GLN A C    6  
ATOM 9219  O O    . GLN A 1 87  ? 12.971  -0.700  3.934   1.00 0.00 ? 87  GLN A O    6  
ATOM 9220  C CB   . GLN A 1 87  ? 14.615  -1.181  1.289   1.00 0.00 ? 87  GLN A CB   6  
ATOM 9221  C CG   . GLN A 1 87  ? 14.976  -2.114  0.144   1.00 0.00 ? 87  GLN A CG   6  
ATOM 9222  C CD   . GLN A 1 87  ? 14.453  -3.522  0.351   1.00 0.00 ? 87  GLN A CD   6  
ATOM 9223  O OE1  . GLN A 1 87  ? 14.901  -4.236  1.249   1.00 0.00 ? 87  GLN A OE1  6  
ATOM 9224  N NE2  . GLN A 1 87  ? 13.501  -3.929  -0.480  1.00 0.00 ? 87  GLN A NE2  6  
ATOM 9225  H H    . GLN A 1 87  ? 12.881  -0.503  -0.442  1.00 0.00 ? 87  GLN A H    6  
ATOM 9226  H HA   . GLN A 1 87  ? 12.746  -2.107  1.769   1.00 0.00 ? 87  GLN A HA   6  
ATOM 9227  H HB2  . GLN A 1 87  ? 14.970  -0.191  1.045   1.00 0.00 ? 87  GLN A HB2  6  
ATOM 9228  H HB3  . GLN A 1 87  ? 15.121  -1.527  2.179   1.00 0.00 ? 87  GLN A HB3  6  
ATOM 9229  H HG2  . GLN A 1 87  ? 14.554  -1.721  -0.770  1.00 0.00 ? 87  GLN A HG2  6  
ATOM 9230  H HG3  . GLN A 1 87  ? 16.051  -2.153  0.054   1.00 0.00 ? 87  GLN A HG3  6  
ATOM 9231  H HE21 . GLN A 1 87  ? 13.195  -3.306  -1.173  1.00 0.00 ? 87  GLN A HE21 6  
ATOM 9232  H HE22 . GLN A 1 87  ? 13.146  -4.834  -0.370  1.00 0.00 ? 87  GLN A HE22 6  
ATOM 9233  N N    . LEU A 1 88  ? 12.503  1.018   2.559   1.00 0.00 ? 88  LEU A N    6  
ATOM 9234  C CA   . LEU A 1 88  ? 12.228  1.954   3.644   1.00 0.00 ? 88  LEU A CA   6  
ATOM 9235  C C    . LEU A 1 88  ? 10.838  1.719   4.226   1.00 0.00 ? 88  LEU A C    6  
ATOM 9236  O O    . LEU A 1 88  ? 10.614  1.908   5.422   1.00 0.00 ? 88  LEU A O    6  
ATOM 9237  C CB   . LEU A 1 88  ? 12.348  3.395   3.143   1.00 0.00 ? 88  LEU A CB   6  
ATOM 9238  C CG   . LEU A 1 88  ? 12.791  4.430   4.178   1.00 0.00 ? 88  LEU A CG   6  
ATOM 9239  C CD1  . LEU A 1 88  ? 13.087  5.762   3.507   1.00 0.00 ? 88  LEU A CD1  6  
ATOM 9240  C CD2  . LEU A 1 88  ? 11.729  4.597   5.254   1.00 0.00 ? 88  LEU A CD2  6  
ATOM 9241  H H    . LEU A 1 88  ? 12.427  1.327   1.632   1.00 0.00 ? 88  LEU A H    6  
ATOM 9242  H HA   . LEU A 1 88  ? 12.962  1.788   4.418   1.00 0.00 ? 88  LEU A HA   6  
ATOM 9243  H HB2  . LEU A 1 88  ? 13.064  3.406   2.336   1.00 0.00 ? 88  LEU A HB2  6  
ATOM 9244  H HB3  . LEU A 1 88  ? 11.380  3.694   2.767   1.00 0.00 ? 88  LEU A HB3  6  
ATOM 9245  H HG   . LEU A 1 88  ? 13.700  4.087   4.654   1.00 0.00 ? 88  LEU A HG   6  
ATOM 9246  H HD11 . LEU A 1 88  ? 14.155  5.913   3.462   1.00 0.00 ? 88  LEU A HD11 6  
ATOM 9247  H HD12 . LEU A 1 88  ? 12.634  6.560   4.076   1.00 0.00 ? 88  LEU A HD12 6  
ATOM 9248  H HD13 . LEU A 1 88  ? 12.681  5.759   2.506   1.00 0.00 ? 88  LEU A HD13 6  
ATOM 9249  H HD21 . LEU A 1 88  ? 11.792  3.776   5.952   1.00 0.00 ? 88  LEU A HD21 6  
ATOM 9250  H HD22 . LEU A 1 88  ? 10.750  4.605   4.796   1.00 0.00 ? 88  LEU A HD22 6  
ATOM 9251  H HD23 . LEU A 1 88  ? 11.890  5.528   5.777   1.00 0.00 ? 88  LEU A HD23 6  
ATOM 9252  N N    . LEU A 1 89  ? 9.908   1.305   3.373   1.00 0.00 ? 89  LEU A N    6  
ATOM 9253  C CA   . LEU A 1 89  ? 8.539   1.042   3.802   1.00 0.00 ? 89  LEU A CA   6  
ATOM 9254  C C    . LEU A 1 89  ? 8.436   -0.315  4.492   1.00 0.00 ? 89  LEU A C    6  
ATOM 9255  O O    . LEU A 1 89  ? 7.603   -0.511  5.377   1.00 0.00 ? 89  LEU A O    6  
ATOM 9256  C CB   . LEU A 1 89  ? 7.589   1.092   2.604   1.00 0.00 ? 89  LEU A CB   6  
ATOM 9257  C CG   . LEU A 1 89  ? 7.376   -0.228  1.861   1.00 0.00 ? 89  LEU A CG   6  
ATOM 9258  C CD1  . LEU A 1 89  ? 6.310   -1.064  2.553   1.00 0.00 ? 89  LEU A CD1  6  
ATOM 9259  C CD2  . LEU A 1 89  ? 6.995   0.032   0.411   1.00 0.00 ? 89  LEU A CD2  6  
ATOM 9260  H H    . LEU A 1 89  ? 10.146  1.173   2.432   1.00 0.00 ? 89  LEU A H    6  
ATOM 9261  H HA   . LEU A 1 89  ? 8.258   1.812   4.506   1.00 0.00 ? 89  LEU A HA   6  
ATOM 9262  H HB2  . LEU A 1 89  ? 6.627   1.430   2.959   1.00 0.00 ? 89  LEU A HB2  6  
ATOM 9263  H HB3  . LEU A 1 89  ? 7.984   1.810   1.900   1.00 0.00 ? 89  LEU A HB3  6  
ATOM 9264  H HG   . LEU A 1 89  ? 8.299   -0.791  1.870   1.00 0.00 ? 89  LEU A HG   6  
ATOM 9265  H HD11 . LEU A 1 89  ? 5.518   -1.286  1.854   1.00 0.00 ? 89  LEU A HD11 6  
ATOM 9266  H HD12 . LEU A 1 89  ? 5.908   -0.514  3.390   1.00 0.00 ? 89  LEU A HD12 6  
ATOM 9267  H HD13 . LEU A 1 89  ? 6.749   -1.986  2.905   1.00 0.00 ? 89  LEU A HD13 6  
ATOM 9268  H HD21 . LEU A 1 89  ? 7.310   -0.802  -0.198  1.00 0.00 ? 89  LEU A HD21 6  
ATOM 9269  H HD22 . LEU A 1 89  ? 7.482   0.933   0.067   1.00 0.00 ? 89  LEU A HD22 6  
ATOM 9270  H HD23 . LEU A 1 89  ? 5.925   0.150   0.336   1.00 0.00 ? 89  LEU A HD23 6  
ATOM 9271  N N    . ARG A 1 90  ? 9.289   -1.247  4.081   1.00 0.00 ? 90  ARG A N    6  
ATOM 9272  C CA   . ARG A 1 90  ? 9.294   -2.586  4.660   1.00 0.00 ? 90  ARG A CA   6  
ATOM 9273  C C    . ARG A 1 90  ? 10.240  -2.657  5.856   1.00 0.00 ? 90  ARG A C    6  
ATOM 9274  O O    . ARG A 1 90  ? 10.448  -3.724  6.433   1.00 0.00 ? 90  ARG A O    6  
ATOM 9275  C CB   . ARG A 1 90  ? 9.706   -3.617  3.609   1.00 0.00 ? 90  ARG A CB   6  
ATOM 9276  C CG   . ARG A 1 90  ? 11.014  -3.286  2.910   1.00 0.00 ? 90  ARG A CG   6  
ATOM 9277  C CD   . ARG A 1 90  ? 11.587  -4.499  2.195   1.00 0.00 ? 90  ARG A CD   6  
ATOM 9278  N NE   . ARG A 1 90  ? 12.066  -5.511  3.132   1.00 0.00 ? 90  ARG A NE   6  
ATOM 9279  C CZ   . ARG A 1 90  ? 13.141  -5.355  3.897   1.00 0.00 ? 90  ARG A CZ   6  
ATOM 9280  N NH1  . ARG A 1 90  ? 13.845  -4.232  3.835   1.00 0.00 ? 90  ARG A NH1  6  
ATOM 9281  N NH2  . ARG A 1 90  ? 13.514  -6.321  4.726   1.00 0.00 ? 90  ARG A NH2  6  
ATOM 9282  H H    . ARG A 1 90  ? 9.929   -1.031  3.372   1.00 0.00 ? 90  ARG A H    6  
ATOM 9283  H HA   . ARG A 1 90  ? 8.292   -2.806  4.995   1.00 0.00 ? 90  ARG A HA   6  
ATOM 9284  H HB2  . ARG A 1 90  ? 9.814   -4.579  4.088   1.00 0.00 ? 90  ARG A HB2  6  
ATOM 9285  H HB3  . ARG A 1 90  ? 8.930   -3.681  2.861   1.00 0.00 ? 90  ARG A HB3  6  
ATOM 9286  H HG2  . ARG A 1 90  ? 10.837  -2.505  2.184   1.00 0.00 ? 90  ARG A HG2  6  
ATOM 9287  H HG3  . ARG A 1 90  ? 11.727  -2.941  3.644   1.00 0.00 ? 90  ARG A HG3  6  
ATOM 9288  H HD2  . ARG A 1 90  ? 10.817  -4.933  1.575   1.00 0.00 ? 90  ARG A HD2  6  
ATOM 9289  H HD3  . ARG A 1 90  ? 12.410  -4.179  1.573   1.00 0.00 ? 90  ARG A HD3  6  
ATOM 9290  H HE   . ARG A 1 90  ? 11.561  -6.348  3.194   1.00 0.00 ? 90  ARG A HE   6  
ATOM 9291  H HH11 . ARG A 1 90  ? 13.566  -3.502  3.213   1.00 0.00 ? 90  ARG A HH11 6  
ATOM 9292  H HH12 . ARG A 1 90  ? 14.653  -4.117  4.413   1.00 0.00 ? 90  ARG A HH12 6  
ATOM 9293  H HH21 . ARG A 1 90  ? 12.986  -7.169  4.775   1.00 0.00 ? 90  ARG A HH21 6  
ATOM 9294  H HH22 . ARG A 1 90  ? 14.323  -6.203  5.301   1.00 0.00 ? 90  ARG A HH22 6  
ATOM 9295  N N    . SER A 1 91  ? 10.810  -1.513  6.222   1.00 0.00 ? 91  SER A N    6  
ATOM 9296  C CA   . SER A 1 91  ? 11.736  -1.446  7.346   1.00 0.00 ? 91  SER A CA   6  
ATOM 9297  C C    . SER A 1 91  ? 11.021  -0.987  8.613   1.00 0.00 ? 91  SER A C    6  
ATOM 9298  O O    . SER A 1 91  ? 11.653  -0.529  9.565   1.00 0.00 ? 91  SER A O    6  
ATOM 9299  C CB   . SER A 1 91  ? 12.892  -0.496  7.026   1.00 0.00 ? 91  SER A CB   6  
ATOM 9300  O OG   . SER A 1 91  ? 13.872  -0.522  8.049   1.00 0.00 ? 91  SER A OG   6  
ATOM 9301  H H    . SER A 1 91  ? 10.604  -0.695  5.722   1.00 0.00 ? 91  SER A H    6  
ATOM 9302  H HA   . SER A 1 91  ? 12.132  -2.438  7.509   1.00 0.00 ? 91  SER A HA   6  
ATOM 9303  H HB2  . SER A 1 91  ? 13.352  -0.793  6.096   1.00 0.00 ? 91  SER A HB2  6  
ATOM 9304  H HB3  . SER A 1 91  ? 12.511  0.511   6.934   1.00 0.00 ? 91  SER A HB3  6  
ATOM 9305  H HG   . SER A 1 91  ? 14.171  0.372   8.229   1.00 0.00 ? 91  SER A HG   6  
ATOM 9306  N N    . VAL A 1 92  ? 9.698   -1.113  8.617   1.00 0.00 ? 92  VAL A N    6  
ATOM 9307  C CA   . VAL A 1 92  ? 8.895   -0.712  9.766   1.00 0.00 ? 92  VAL A CA   6  
ATOM 9308  C C    . VAL A 1 92  ? 8.879   -1.802  10.832  1.00 0.00 ? 92  VAL A C    6  
ATOM 9309  O O    . VAL A 1 92  ? 8.991   -2.988  10.524  1.00 0.00 ? 92  VAL A O    6  
ATOM 9310  C CB   . VAL A 1 92  ? 7.446   -0.391  9.354   1.00 0.00 ? 92  VAL A CB   6  
ATOM 9311  C CG1  . VAL A 1 92  ? 6.670   0.178   10.532  1.00 0.00 ? 92  VAL A CG1  6  
ATOM 9312  C CG2  . VAL A 1 92  ? 7.429   0.573   8.178   1.00 0.00 ? 92  VAL A CG2  6  
ATOM 9313  H H    . VAL A 1 92  ? 9.251   -1.485  7.828   1.00 0.00 ? 92  VAL A H    6  
ATOM 9314  H HA   . VAL A 1 92  ? 9.335   0.182   10.185  1.00 0.00 ? 92  VAL A HA   6  
ATOM 9315  H HB   . VAL A 1 92  ? 6.969   -1.309  9.047   1.00 0.00 ? 92  VAL A HB   6  
ATOM 9316  H HG11 . VAL A 1 92  ? 7.015   1.180   10.740  1.00 0.00 ? 92  VAL A HG11 6  
ATOM 9317  H HG12 . VAL A 1 92  ? 5.617   0.201   10.292  1.00 0.00 ? 92  VAL A HG12 6  
ATOM 9318  H HG13 . VAL A 1 92  ? 6.828   -0.443  11.401  1.00 0.00 ? 92  VAL A HG13 6  
ATOM 9319  H HG21 . VAL A 1 92  ? 7.304   1.582   8.542   1.00 0.00 ? 92  VAL A HG21 6  
ATOM 9320  H HG22 . VAL A 1 92  ? 8.361   0.499   7.637   1.00 0.00 ? 92  VAL A HG22 6  
ATOM 9321  H HG23 . VAL A 1 92  ? 6.610   0.324   7.519   1.00 0.00 ? 92  VAL A HG23 6  
ATOM 9322  N N    . GLY A 1 93  ? 8.739   -1.391  12.089  1.00 0.00 ? 93  GLY A N    6  
ATOM 9323  C CA   . GLY A 1 93  ? 8.710   -2.345  13.182  1.00 0.00 ? 93  GLY A CA   6  
ATOM 9324  C C    . GLY A 1 93  ? 7.299   -2.739  13.570  1.00 0.00 ? 93  GLY A C    6  
ATOM 9325  O O    . GLY A 1 93  ? 6.821   -3.810  13.195  1.00 0.00 ? 93  GLY A O    6  
ATOM 9326  H H    . GLY A 1 93  ? 8.654   -0.433  12.275  1.00 0.00 ? 93  GLY A H    6  
ATOM 9327  H HA2  . GLY A 1 93  ? 9.252   -3.231  12.887  1.00 0.00 ? 93  GLY A HA2  6  
ATOM 9328  H HA3  . GLY A 1 93  ? 9.197   -1.906  14.040  1.00 0.00 ? 93  GLY A HA3  6  
ATOM 9329  N N    . ASP A 1 94  ? 6.631   -1.874  14.326  1.00 0.00 ? 94  ASP A N    6  
ATOM 9330  C CA   . ASP A 1 94  ? 5.266   -2.138  14.766  1.00 0.00 ? 94  ASP A CA   6  
ATOM 9331  C C    . ASP A 1 94  ? 4.315   -1.056  14.265  1.00 0.00 ? 94  ASP A C    6  
ATOM 9332  O O    . ASP A 1 94  ? 3.107   -1.274  14.162  1.00 0.00 ? 94  ASP A O    6  
ATOM 9333  C CB   . ASP A 1 94  ? 5.207   -2.221  16.292  1.00 0.00 ? 94  ASP A CB   6  
ATOM 9334  C CG   . ASP A 1 94  ? 6.037   -1.144  16.963  1.00 0.00 ? 94  ASP A CG   6  
ATOM 9335  O OD1  . ASP A 1 94  ? 6.111   -0.025  16.414  1.00 0.00 ? 94  ASP A OD1  6  
ATOM 9336  O OD2  . ASP A 1 94  ? 6.613   -1.421  18.036  1.00 0.00 ? 94  ASP A OD2  6  
ATOM 9337  H H    . ASP A 1 94  ? 7.066   -1.038  14.593  1.00 0.00 ? 94  ASP A H    6  
ATOM 9338  H HA   . ASP A 1 94  ? 4.962   -3.087  14.351  1.00 0.00 ? 94  ASP A HA   6  
ATOM 9339  H HB2  . ASP A 1 94  ? 4.181   -2.110  16.613  1.00 0.00 ? 94  ASP A HB2  6  
ATOM 9340  H HB3  . ASP A 1 94  ? 5.576   -3.185  16.609  1.00 0.00 ? 94  ASP A HB3  6  
ATOM 9341  N N    . THR A 1 95  ? 4.867   0.113   13.955  1.00 0.00 ? 95  THR A N    6  
ATOM 9342  C CA   . THR A 1 95  ? 4.068   1.230   13.468  1.00 0.00 ? 95  THR A CA   6  
ATOM 9343  C C    . THR A 1 95  ? 4.936   2.251   12.741  1.00 0.00 ? 95  THR A C    6  
ATOM 9344  O O    . THR A 1 95  ? 5.986   2.657   13.242  1.00 0.00 ? 95  THR A O    6  
ATOM 9345  C CB   . THR A 1 95  ? 3.323   1.933   14.618  1.00 0.00 ? 95  THR A CB   6  
ATOM 9346  O OG1  . THR A 1 95  ? 2.631   0.966   15.416  1.00 0.00 ? 95  THR A OG1  6  
ATOM 9347  C CG2  . THR A 1 95  ? 2.334   2.954   14.079  1.00 0.00 ? 95  THR A CG2  6  
ATOM 9348  H H    . THR A 1 95  ? 5.835   0.226   14.059  1.00 0.00 ? 95  THR A H    6  
ATOM 9349  H HA   . THR A 1 95  ? 3.334   0.839   12.777  1.00 0.00 ? 95  THR A HA   6  
ATOM 9350  H HB   . THR A 1 95  ? 4.047   2.446   15.236  1.00 0.00 ? 95  THR A HB   6  
ATOM 9351  H HG1  . THR A 1 95  ? 2.533   1.300   16.311  1.00 0.00 ? 95  THR A HG1  6  
ATOM 9352  H HG21 . THR A 1 95  ? 2.873   3.792   13.662  1.00 0.00 ? 95  THR A HG21 6  
ATOM 9353  H HG22 . THR A 1 95  ? 1.697   3.298   14.881  1.00 0.00 ? 95  THR A HG22 6  
ATOM 9354  H HG23 . THR A 1 95  ? 1.729   2.498   13.310  1.00 0.00 ? 95  THR A HG23 6  
ATOM 9355  N N    . LEU A 1 96  ? 4.492   2.663   11.559  1.00 0.00 ? 96  LEU A N    6  
ATOM 9356  C CA   . LEU A 1 96  ? 5.229   3.639   10.763  1.00 0.00 ? 96  LEU A CA   6  
ATOM 9357  C C    . LEU A 1 96  ? 4.455   4.949   10.655  1.00 0.00 ? 96  LEU A C    6  
ATOM 9358  O O    . LEU A 1 96  ? 3.296   5.034   11.061  1.00 0.00 ? 96  LEU A O    6  
ATOM 9359  C CB   . LEU A 1 96  ? 5.507   3.081   9.366   1.00 0.00 ? 96  LEU A CB   6  
ATOM 9360  C CG   . LEU A 1 96  ? 4.467   3.406   8.294   1.00 0.00 ? 96  LEU A CG   6  
ATOM 9361  C CD1  . LEU A 1 96  ? 5.017   3.107   6.908   1.00 0.00 ? 96  LEU A CD1  6  
ATOM 9362  C CD2  . LEU A 1 96  ? 3.184   2.625   8.541   1.00 0.00 ? 96  LEU A CD2  6  
ATOM 9363  H H    . LEU A 1 96  ? 3.649   2.304   11.212  1.00 0.00 ? 96  LEU A H    6  
ATOM 9364  H HA   . LEU A 1 96  ? 6.169   3.830   11.259  1.00 0.00 ? 96  LEU A HA   6  
ATOM 9365  H HB2  . LEU A 1 96  ? 6.456   3.475   9.036   1.00 0.00 ? 96  LEU A HB2  6  
ATOM 9366  H HB3  . LEU A 1 96  ? 5.575   2.005   9.448   1.00 0.00 ? 96  LEU A HB3  6  
ATOM 9367  H HG   . LEU A 1 96  ? 4.231   4.460   8.338   1.00 0.00 ? 96  LEU A HG   6  
ATOM 9368  H HD11 . LEU A 1 96  ? 5.648   3.921   6.587   1.00 0.00 ? 96  LEU A HD11 6  
ATOM 9369  H HD12 . LEU A 1 96  ? 4.198   2.990   6.213   1.00 0.00 ? 96  LEU A HD12 6  
ATOM 9370  H HD13 . LEU A 1 96  ? 5.594   2.194   6.939   1.00 0.00 ? 96  LEU A HD13 6  
ATOM 9371  H HD21 . LEU A 1 96  ? 3.400   1.765   9.158   1.00 0.00 ? 96  LEU A HD21 6  
ATOM 9372  H HD22 . LEU A 1 96  ? 2.775   2.296   7.596   1.00 0.00 ? 96  LEU A HD22 6  
ATOM 9373  H HD23 . LEU A 1 96  ? 2.468   3.258   9.043   1.00 0.00 ? 96  LEU A HD23 6  
ATOM 9374  N N    . THR A 1 97  ? 5.104   5.970   10.102  1.00 0.00 ? 97  THR A N    6  
ATOM 9375  C CA   . THR A 1 97  ? 4.477   7.275   9.939   1.00 0.00 ? 97  THR A CA   6  
ATOM 9376  C C    . THR A 1 97  ? 4.448   7.692   8.473   1.00 0.00 ? 97  THR A C    6  
ATOM 9377  O O    . THR A 1 97  ? 5.432   8.207   7.943   1.00 0.00 ? 97  THR A O    6  
ATOM 9378  C CB   . THR A 1 97  ? 5.212   8.357   10.753  1.00 0.00 ? 97  THR A CB   6  
ATOM 9379  O OG1  . THR A 1 97  ? 5.657   7.813   12.001  1.00 0.00 ? 97  THR A OG1  6  
ATOM 9380  C CG2  . THR A 1 97  ? 4.306   9.551   11.009  1.00 0.00 ? 97  THR A CG2  6  
ATOM 9381  H H    . THR A 1 97  ? 6.026   5.840   9.798   1.00 0.00 ? 97  THR A H    6  
ATOM 9382  H HA   . THR A 1 97  ? 3.463   7.206   10.304  1.00 0.00 ? 97  THR A HA   6  
ATOM 9383  H HB   . THR A 1 97  ? 6.071   8.690   10.188  1.00 0.00 ? 97  THR A HB   6  
ATOM 9384  H HG1  . THR A 1 97  ? 6.451   7.292   11.858  1.00 0.00 ? 97  THR A HG1  6  
ATOM 9385  H HG21 . THR A 1 97  ? 4.387   9.849   12.044  1.00 0.00 ? 97  THR A HG21 6  
ATOM 9386  H HG22 . THR A 1 97  ? 3.283   9.280   10.792  1.00 0.00 ? 97  THR A HG22 6  
ATOM 9387  H HG23 . THR A 1 97  ? 4.604   10.371  10.374  1.00 0.00 ? 97  THR A HG23 6  
ATOM 9388  N N    . VAL A 1 98  ? 3.311   7.466   7.821   1.00 0.00 ? 98  VAL A N    6  
ATOM 9389  C CA   . VAL A 1 98  ? 3.153   7.819   6.416   1.00 0.00 ? 98  VAL A CA   6  
ATOM 9390  C C    . VAL A 1 98  ? 2.495   9.186   6.264   1.00 0.00 ? 98  VAL A C    6  
ATOM 9391  O O    . VAL A 1 98  ? 1.459   9.460   6.872   1.00 0.00 ? 98  VAL A O    6  
ATOM 9392  C CB   . VAL A 1 98  ? 2.312   6.770   5.664   1.00 0.00 ? 98  VAL A CB   6  
ATOM 9393  C CG1  . VAL A 1 98  ? 2.770   5.364   6.019   1.00 0.00 ? 98  VAL A CG1  6  
ATOM 9394  C CG2  . VAL A 1 98  ? 0.833   6.952   5.974   1.00 0.00 ? 98  VAL A CG2  6  
ATOM 9395  H H    . VAL A 1 98  ? 2.561   7.052   8.297   1.00 0.00 ? 98  VAL A H    6  
ATOM 9396  H HA   . VAL A 1 98  ? 4.135   7.851   5.966   1.00 0.00 ? 98  VAL A HA   6  
ATOM 9397  H HB   . VAL A 1 98  ? 2.456   6.915   4.604   1.00 0.00 ? 98  VAL A HB   6  
ATOM 9398  H HG11 . VAL A 1 98  ? 2.099   4.942   6.753   1.00 0.00 ? 98  VAL A HG11 6  
ATOM 9399  H HG12 . VAL A 1 98  ? 2.768   4.749   5.131   1.00 0.00 ? 98  VAL A HG12 6  
ATOM 9400  H HG13 . VAL A 1 98  ? 3.769   5.404   6.427   1.00 0.00 ? 98  VAL A HG13 6  
ATOM 9401  H HG21 . VAL A 1 98  ? 0.720   7.320   6.983   1.00 0.00 ? 98  VAL A HG21 6  
ATOM 9402  H HG22 . VAL A 1 98  ? 0.405   7.663   5.282   1.00 0.00 ? 98  VAL A HG22 6  
ATOM 9403  H HG23 . VAL A 1 98  ? 0.325   6.005   5.876   1.00 0.00 ? 98  VAL A HG23 6  
ATOM 9404  N N    . LEU A 1 99  ? 3.102   10.041  5.448   1.00 0.00 ? 99  LEU A N    6  
ATOM 9405  C CA   . LEU A 1 99  ? 2.575   11.382  5.215   1.00 0.00 ? 99  LEU A CA   6  
ATOM 9406  C C    . LEU A 1 99  ? 1.893   11.469  3.853   1.00 0.00 ? 99  LEU A C    6  
ATOM 9407  O O    . LEU A 1 99  ? 1.932   12.508  3.194   1.00 0.00 ? 99  LEU A O    6  
ATOM 9408  C CB   . LEU A 1 99  ? 3.699   12.415  5.303   1.00 0.00 ? 99  LEU A CB   6  
ATOM 9409  C CG   . LEU A 1 99  ? 3.261   13.879  5.365   1.00 0.00 ? 99  LEU A CG   6  
ATOM 9410  C CD1  . LEU A 1 99  ? 2.490   14.152  6.648   1.00 0.00 ? 99  LEU A CD1  6  
ATOM 9411  C CD2  . LEU A 1 99  ? 4.467   14.802  5.260   1.00 0.00 ? 99  LEU A CD2  6  
ATOM 9412  H H    . LEU A 1 99  ? 3.924   9.766   4.992   1.00 0.00 ? 99  LEU A H    6  
ATOM 9413  H HA   . LEU A 1 99  ? 1.845   11.589  5.984   1.00 0.00 ? 99  LEU A HA   6  
ATOM 9414  H HB2  . LEU A 1 99  ? 4.273   12.204  6.192   1.00 0.00 ? 99  LEU A HB2  6  
ATOM 9415  H HB3  . LEU A 1 99  ? 4.328   12.294  4.432   1.00 0.00 ? 99  LEU A HB3  6  
ATOM 9416  H HG   . LEU A 1 99  ? 2.605   14.088  4.532   1.00 0.00 ? 99  LEU A HG   6  
ATOM 9417  H HD11 . LEU A 1 99  ? 1.431   14.065  6.456   1.00 0.00 ? 99  LEU A HD11 6  
ATOM 9418  H HD12 . LEU A 1 99  ? 2.713   15.149  6.996   1.00 0.00 ? 99  LEU A HD12 6  
ATOM 9419  H HD13 . LEU A 1 99  ? 2.780   13.434  7.401   1.00 0.00 ? 99  LEU A HD13 6  
ATOM 9420  H HD21 . LEU A 1 99  ? 4.254   15.731  5.766   1.00 0.00 ? 99  LEU A HD21 6  
ATOM 9421  H HD22 . LEU A 1 99  ? 4.678   14.999  4.219   1.00 0.00 ? 99  LEU A HD22 6  
ATOM 9422  H HD23 . LEU A 1 99  ? 5.323   14.329  5.718   1.00 0.00 ? 99  LEU A HD23 6  
ATOM 9423  N N    . VAL A 1 100 ? 1.267   10.372  3.439   1.00 0.00 ? 100 VAL A N    6  
ATOM 9424  C CA   . VAL A 1 100 ? 0.574   10.326  2.157   1.00 0.00 ? 100 VAL A CA   6  
ATOM 9425  C C    . VAL A 1 100 ? -0.635  11.254  2.153   1.00 0.00 ? 100 VAL A C    6  
ATOM 9426  O O    . VAL A 1 100 ? -0.913  11.933  3.142   1.00 0.00 ? 100 VAL A O    6  
ATOM 9427  C CB   . VAL A 1 100 ? 0.110   8.896   1.821   1.00 0.00 ? 100 VAL A CB   6  
ATOM 9428  C CG1  . VAL A 1 100 ? 1.193   7.887   2.173   1.00 0.00 ? 100 VAL A CG1  6  
ATOM 9429  C CG2  . VAL A 1 100 ? -1.188  8.573   2.547   1.00 0.00 ? 100 VAL A CG2  6  
ATOM 9430  H H    . VAL A 1 100 ? 1.271   9.575   4.009   1.00 0.00 ? 100 VAL A H    6  
ATOM 9431  H HA   . VAL A 1 100 ? 1.265   10.647  1.392   1.00 0.00 ? 100 VAL A HA   6  
ATOM 9432  H HB   . VAL A 1 100 ? -0.072  8.838   0.758   1.00 0.00 ? 100 VAL A HB   6  
ATOM 9433  H HG11 . VAL A 1 100 ? 1.983   8.383   2.717   1.00 0.00 ? 100 VAL A HG11 6  
ATOM 9434  H HG12 . VAL A 1 100 ? 0.770   7.103   2.785   1.00 0.00 ? 100 VAL A HG12 6  
ATOM 9435  H HG13 . VAL A 1 100 ? 1.594   7.459   1.266   1.00 0.00 ? 100 VAL A HG13 6  
ATOM 9436  H HG21 . VAL A 1 100 ? -1.067  8.768   3.602   1.00 0.00 ? 100 VAL A HG21 6  
ATOM 9437  H HG22 . VAL A 1 100 ? -1.983  9.190   2.155   1.00 0.00 ? 100 VAL A HG22 6  
ATOM 9438  H HG23 . VAL A 1 100 ? -1.434  7.532   2.398   1.00 0.00 ? 100 VAL A HG23 6  
ATOM 9439  N N    . CYS A 1 101 ? -1.351  11.279  1.034   1.00 0.00 ? 101 CYS A N    6  
ATOM 9440  C CA   . CYS A 1 101 ? -2.532  12.125  0.900   1.00 0.00 ? 101 CYS A CA   6  
ATOM 9441  C C    . CYS A 1 101 ? -3.260  11.839  -0.409  1.00 0.00 ? 101 CYS A C    6  
ATOM 9442  O O    . CYS A 1 101 ? -2.674  11.313  -1.355  1.00 0.00 ? 101 CYS A O    6  
ATOM 9443  C CB   . CYS A 1 101 ? -2.137  13.601  0.966   1.00 0.00 ? 101 CYS A CB   6  
ATOM 9444  S SG   . CYS A 1 101 ? -1.689  14.317  -0.633  1.00 0.00 ? 101 CYS A SG   6  
ATOM 9445  H H    . CYS A 1 101 ? -1.080  10.715  0.280   1.00 0.00 ? 101 CYS A H    6  
ATOM 9446  H HA   . CYS A 1 101 ? -3.194  11.901  1.723   1.00 0.00 ? 101 CYS A HA   6  
ATOM 9447  H HB2  . CYS A 1 101 ? -2.966  14.171  1.359   1.00 0.00 ? 101 CYS A HB2  6  
ATOM 9448  H HB3  . CYS A 1 101 ? -1.289  13.710  1.625   1.00 0.00 ? 101 CYS A HB3  6  
ATOM 9449  H HG   . CYS A 1 101 ? -0.836  15.306  -0.413  1.00 0.00 ? 101 CYS A HG   6  
ATOM 9450  N N    . ASP A 1 102 ? -4.542  12.186  -0.455  1.00 0.00 ? 102 ASP A N    6  
ATOM 9451  C CA   . ASP A 1 102 ? -5.351  11.966  -1.648  1.00 0.00 ? 102 ASP A CA   6  
ATOM 9452  C C    . ASP A 1 102 ? -4.664  12.537  -2.884  1.00 0.00 ? 102 ASP A C    6  
ATOM 9453  O O    . ASP A 1 102 ? -4.647  13.750  -3.092  1.00 0.00 ? 102 ASP A O    6  
ATOM 9454  C CB   . ASP A 1 102 ? -6.732  12.601  -1.477  1.00 0.00 ? 102 ASP A CB   6  
ATOM 9455  C CG   . ASP A 1 102 ? -6.668  13.948  -0.785  1.00 0.00 ? 102 ASP A CG   6  
ATOM 9456  O OD1  . ASP A 1 102 ? -6.092  14.889  -1.370  1.00 0.00 ? 102 ASP A OD1  6  
ATOM 9457  O OD2  . ASP A 1 102 ? -7.196  14.062  0.341   1.00 0.00 ? 102 ASP A OD2  6  
ATOM 9458  H H    . ASP A 1 102 ? -4.953  12.601  0.332   1.00 0.00 ? 102 ASP A H    6  
ATOM 9459  H HA   . ASP A 1 102 ? -5.469  10.901  -1.777  1.00 0.00 ? 102 ASP A HA   6  
ATOM 9460  H HB2  . ASP A 1 102 ? -7.181  12.738  -2.450  1.00 0.00 ? 102 ASP A HB2  6  
ATOM 9461  H HB3  . ASP A 1 102 ? -7.353  11.942  -0.888  1.00 0.00 ? 102 ASP A HB3  6  
ATOM 9462  N N    . GLY A 1 103 ? -4.097  11.655  -3.701  1.00 0.00 ? 103 GLY A N    6  
ATOM 9463  C CA   . GLY A 1 103 ? -3.415  12.091  -4.905  1.00 0.00 ? 103 GLY A CA   6  
ATOM 9464  C C    . GLY A 1 103 ? -4.331  12.117  -6.113  1.00 0.00 ? 103 GLY A C    6  
ATOM 9465  O O    . GLY A 1 103 ? -4.375  13.105  -6.846  1.00 0.00 ? 103 GLY A O    6  
ATOM 9466  H H    . GLY A 1 103 ? -4.142  10.700  -3.484  1.00 0.00 ? 103 GLY A H    6  
ATOM 9467  H HA2  . GLY A 1 103 ? -3.020  13.083  -4.744  1.00 0.00 ? 103 GLY A HA2  6  
ATOM 9468  H HA3  . GLY A 1 103 ? -2.595  11.416  -5.105  1.00 0.00 ? 103 GLY A HA3  6  
ATOM 9469  N N    . PHE A 1 104 ? -5.063  11.028  -6.322  1.00 0.00 ? 104 PHE A N    6  
ATOM 9470  C CA   . PHE A 1 104 ? -5.981  10.929  -7.451  1.00 0.00 ? 104 PHE A CA   6  
ATOM 9471  C C    . PHE A 1 104 ? -6.968  9.782   -7.251  1.00 0.00 ? 104 PHE A C    6  
ATOM 9472  O O    . PHE A 1 104 ? -6.571  8.623   -7.132  1.00 0.00 ? 104 PHE A O    6  
ATOM 9473  C CB   . PHE A 1 104 ? -5.202  10.726  -8.752  1.00 0.00 ? 104 PHE A CB   6  
ATOM 9474  C CG   . PHE A 1 104 ? -3.986  9.860   -8.593  1.00 0.00 ? 104 PHE A CG   6  
ATOM 9475  C CD1  . PHE A 1 104 ? -2.778  10.406  -8.187  1.00 0.00 ? 104 PHE A CD1  6  
ATOM 9476  C CD2  . PHE A 1 104 ? -4.049  8.500   -8.850  1.00 0.00 ? 104 PHE A CD2  6  
ATOM 9477  C CE1  . PHE A 1 104 ? -1.657  9.611   -8.041  1.00 0.00 ? 104 PHE A CE1  6  
ATOM 9478  C CE2  . PHE A 1 104 ? -2.931  7.700   -8.705  1.00 0.00 ? 104 PHE A CE2  6  
ATOM 9479  C CZ   . PHE A 1 104 ? -1.734  8.256   -8.299  1.00 0.00 ? 104 PHE A CZ   6  
ATOM 9480  H H    . PHE A 1 104 ? -4.984  10.273  -5.702  1.00 0.00 ? 104 PHE A H    6  
ATOM 9481  H HA   . PHE A 1 104 ? -6.532  11.855  -7.511  1.00 0.00 ? 104 PHE A HA   6  
ATOM 9482  H HB2  . PHE A 1 104 ? -5.848  10.260  -9.481  1.00 0.00 ? 104 PHE A HB2  6  
ATOM 9483  H HB3  . PHE A 1 104 ? -4.881  11.687  -9.124  1.00 0.00 ? 104 PHE A HB3  6  
ATOM 9484  H HD1  . PHE A 1 104 ? -2.717  11.465  -7.984  1.00 0.00 ? 104 PHE A HD1  6  
ATOM 9485  H HD2  . PHE A 1 104 ? -4.986  8.063   -9.167  1.00 0.00 ? 104 PHE A HD2  6  
ATOM 9486  H HE1  . PHE A 1 104 ? -0.722  10.048  -7.723  1.00 0.00 ? 104 PHE A HE1  6  
ATOM 9487  H HE2  . PHE A 1 104 ? -2.995  6.641   -8.908  1.00 0.00 ? 104 PHE A HE2  6  
ATOM 9488  H HZ   . PHE A 1 104 ? -0.859  7.633   -8.186  1.00 0.00 ? 104 PHE A HZ   6  
ATOM 9489  N N    . GLU A 1 105 ? -8.254  10.116  -7.214  1.00 0.00 ? 105 GLU A N    6  
ATOM 9490  C CA   . GLU A 1 105 ? -9.297  9.114   -7.027  1.00 0.00 ? 105 GLU A CA   6  
ATOM 9491  C C    . GLU A 1 105 ? -9.322  8.130   -8.194  1.00 0.00 ? 105 GLU A C    6  
ATOM 9492  O O    . GLU A 1 105 ? -9.311  8.531   -9.357  1.00 0.00 ? 105 GLU A O    6  
ATOM 9493  C CB   . GLU A 1 105 ? -10.663 9.788   -6.884  1.00 0.00 ? 105 GLU A CB   6  
ATOM 9494  C CG   . GLU A 1 105 ? -10.887 10.427  -5.524  1.00 0.00 ? 105 GLU A CG   6  
ATOM 9495  C CD   . GLU A 1 105 ? -11.136 9.404   -4.433  1.00 0.00 ? 105 GLU A CD   6  
ATOM 9496  O OE1  . GLU A 1 105 ? -10.262 8.537   -4.223  1.00 0.00 ? 105 GLU A OE1  6  
ATOM 9497  O OE2  . GLU A 1 105 ? -12.204 9.470   -3.789  1.00 0.00 ? 105 GLU A OE2  6  
ATOM 9498  H H    . GLU A 1 105 ? -8.507  11.057  -7.314  1.00 0.00 ? 105 GLU A H    6  
ATOM 9499  H HA   . GLU A 1 105 ? -9.077  8.572   -6.120  1.00 0.00 ? 105 GLU A HA   6  
ATOM 9500  H HB2  . GLU A 1 105 ? -10.753 10.555  -7.639  1.00 0.00 ? 105 GLU A HB2  6  
ATOM 9501  H HB3  . GLU A 1 105 ? -11.434 9.048   -7.042  1.00 0.00 ? 105 GLU A HB3  6  
ATOM 9502  H HG2  . GLU A 1 105 ? -10.012 11.004  -5.262  1.00 0.00 ? 105 GLU A HG2  6  
ATOM 9503  H HG3  . GLU A 1 105 ? -11.744 11.082  -5.585  1.00 0.00 ? 105 GLU A HG3  6  
ATOM 9504  N N    . SER A 1 106 ? -9.356  6.841   -7.872  1.00 0.00 ? 106 SER A N    6  
ATOM 9505  C CA   . SER A 1 106 ? -9.379  5.800   -8.893  1.00 0.00 ? 106 SER A CA   6  
ATOM 9506  C C    . SER A 1 106 ? -10.350 6.158   -10.014 1.00 0.00 ? 106 SER A C    6  
ATOM 9507  O O    . SER A 1 106 ? -10.002 6.102   -11.192 1.00 0.00 ? 106 SER A O    6  
ATOM 9508  C CB   . SER A 1 106 ? -9.771  4.457   -8.273  1.00 0.00 ? 106 SER A CB   6  
ATOM 9509  O OG   . SER A 1 106 ? -10.988 4.563   -7.554  1.00 0.00 ? 106 SER A OG   6  
ATOM 9510  H H    . SER A 1 106 ? -9.364  6.584   -6.926  1.00 0.00 ? 106 SER A H    6  
ATOM 9511  H HA   . SER A 1 106 ? -8.384  5.719   -9.306  1.00 0.00 ? 106 SER A HA   6  
ATOM 9512  H HB2  . SER A 1 106 ? -9.892  3.724   -9.055  1.00 0.00 ? 106 SER A HB2  6  
ATOM 9513  H HB3  . SER A 1 106 ? -8.994  4.136   -7.595  1.00 0.00 ? 106 SER A HB3  6  
ATOM 9514  H HG   . SER A 1 106 ? -11.703 4.197   -8.079  1.00 0.00 ? 106 SER A HG   6  
ATOM 9515  N N    . GLY A 1 107 ? -11.570 6.527   -9.636  1.00 0.00 ? 107 GLY A N    6  
ATOM 9516  C CA   . GLY A 1 107 ? -12.573 6.889   -10.620 1.00 0.00 ? 107 GLY A CA   6  
ATOM 9517  C C    . GLY A 1 107 ? -12.514 8.356   -10.996 1.00 0.00 ? 107 GLY A C    6  
ATOM 9518  O O    . GLY A 1 107 ? -11.547 9.057   -10.696 1.00 0.00 ? 107 GLY A O    6  
ATOM 9519  H H    . GLY A 1 107 ? -11.791 6.553   -8.681  1.00 0.00 ? 107 GLY A H    6  
ATOM 9520  H HA2  . GLY A 1 107 ? -12.422 6.294   -11.508 1.00 0.00 ? 107 GLY A HA2  6  
ATOM 9521  H HA3  . GLY A 1 107 ? -13.551 6.673   -10.216 1.00 0.00 ? 107 GLY A HA3  6  
ATOM 9522  N N    . PRO A 1 108 ? -13.566 8.842   -11.670 1.00 0.00 ? 108 PRO A N    6  
ATOM 9523  C CA   . PRO A 1 108 ? -13.653 10.240  -12.103 1.00 0.00 ? 108 PRO A CA   6  
ATOM 9524  C C    . PRO A 1 108 ? -13.836 11.199  -10.932 1.00 0.00 ? 108 PRO A C    6  
ATOM 9525  O O    . PRO A 1 108 ? -14.902 11.246  -10.317 1.00 0.00 ? 108 PRO A O    6  
ATOM 9526  C CB   . PRO A 1 108 ? -14.889 10.255  -13.006 1.00 0.00 ? 108 PRO A CB   6  
ATOM 9527  C CG   . PRO A 1 108 ? -15.721 9.116   -12.529 1.00 0.00 ? 108 PRO A CG   6  
ATOM 9528  C CD   . PRO A 1 108 ? -14.753 8.064   -12.062 1.00 0.00 ? 108 PRO A CD   6  
ATOM 9529  H HA   . PRO A 1 108 ? -12.784 10.533  -12.674 1.00 0.00 ? 108 PRO A HA   6  
ATOM 9530  H HB2  . PRO A 1 108 ? -15.407 11.198  -12.895 1.00 0.00 ? 108 PRO A HB2  6  
ATOM 9531  H HB3  . PRO A 1 108 ? -14.589 10.122  -14.035 1.00 0.00 ? 108 PRO A HB3  6  
ATOM 9532  H HG2  . PRO A 1 108 ? -16.350 9.436   -11.713 1.00 0.00 ? 108 PRO A HG2  6  
ATOM 9533  H HG3  . PRO A 1 108 ? -16.323 8.736   -13.342 1.00 0.00 ? 108 PRO A HG3  6  
ATOM 9534  H HD2  . PRO A 1 108 ? -15.159 7.527   -11.217 1.00 0.00 ? 108 PRO A HD2  6  
ATOM 9535  H HD3  . PRO A 1 108 ? -14.519 7.382   -12.866 1.00 0.00 ? 108 PRO A HD3  6  
ATOM 9536  N N    . SER A 1 109 ? -12.792 11.963  -10.630 1.00 0.00 ? 109 SER A N    6  
ATOM 9537  C CA   . SER A 1 109 ? -12.837 12.920  -9.530  1.00 0.00 ? 109 SER A CA   6  
ATOM 9538  C C    . SER A 1 109 ? -14.018 13.873  -9.688  1.00 0.00 ? 109 SER A C    6  
ATOM 9539  O O    . SER A 1 109 ? -14.758 14.126  -8.737  1.00 0.00 ? 109 SER A O    6  
ATOM 9540  C CB   . SER A 1 109 ? -11.531 13.713  -9.462  1.00 0.00 ? 109 SER A CB   6  
ATOM 9541  O OG   . SER A 1 109 ? -11.336 14.264  -8.171  1.00 0.00 ? 109 SER A OG   6  
ATOM 9542  H H    . SER A 1 109 ? -11.970 11.880  -11.158 1.00 0.00 ? 109 SER A H    6  
ATOM 9543  H HA   . SER A 1 109 ? -12.959 12.364  -8.612  1.00 0.00 ? 109 SER A HA   6  
ATOM 9544  H HB2  . SER A 1 109 ? -10.703 13.060  -9.690  1.00 0.00 ? 109 SER A HB2  6  
ATOM 9545  H HB3  . SER A 1 109 ? -11.564 14.518  -10.183 1.00 0.00 ? 109 SER A HB3  6  
ATOM 9546  H HG   . SER A 1 109 ? -10.826 13.652  -7.636  1.00 0.00 ? 109 SER A HG   6  
ATOM 9547  N N    . SER A 1 110 ? -14.187 14.400  -10.896 1.00 0.00 ? 110 SER A N    6  
ATOM 9548  C CA   . SER A 1 110 ? -15.274 15.330  -11.180 1.00 0.00 ? 110 SER A CA   6  
ATOM 9549  C C    . SER A 1 110 ? -16.622 14.614  -11.151 1.00 0.00 ? 110 SER A C    6  
ATOM 9550  O O    . SER A 1 110 ? -16.685 13.386  -11.132 1.00 0.00 ? 110 SER A O    6  
ATOM 9551  C CB   . SER A 1 110 ? -15.065 15.993  -12.542 1.00 0.00 ? 110 SER A CB   6  
ATOM 9552  O OG   . SER A 1 110 ? -13.949 16.865  -12.519 1.00 0.00 ? 110 SER A OG   6  
ATOM 9553  H H    . SER A 1 110 ? -13.564 14.160  -11.614 1.00 0.00 ? 110 SER A H    6  
ATOM 9554  H HA   . SER A 1 110 ? -15.268 16.091  -10.414 1.00 0.00 ? 110 SER A HA   6  
ATOM 9555  H HB2  . SER A 1 110 ? -14.896 15.231  -13.288 1.00 0.00 ? 110 SER A HB2  6  
ATOM 9556  H HB3  . SER A 1 110 ? -15.946 16.562  -12.802 1.00 0.00 ? 110 SER A HB3  6  
ATOM 9557  H HG   . SER A 1 110 ? -14.215 17.717  -12.169 1.00 0.00 ? 110 SER A HG   6  
ATOM 9558  N N    . GLY A 1 111 ? -17.699 15.394  -11.148 1.00 0.00 ? 111 GLY A N    6  
ATOM 9559  C CA   . GLY A 1 111 ? -19.031 14.818  -11.121 1.00 0.00 ? 111 GLY A CA   6  
ATOM 9560  C C    . GLY A 1 111 ? -20.112 15.846  -11.390 1.00 0.00 ? 111 GLY A C    6  
ATOM 9561  O O    . GLY A 1 111 ? -20.510 16.053  -12.536 1.00 0.00 ? 111 GLY A O    6  
ATOM 9562  H H    . GLY A 1 111 ? -17.588 16.368  -11.164 1.00 0.00 ? 111 GLY A H    6  
ATOM 9563  H HA2  . GLY A 1 111 ? -19.091 14.043  -11.870 1.00 0.00 ? 111 GLY A HA2  6  
ATOM 9564  H HA3  . GLY A 1 111 ? -19.202 14.380  -10.149 1.00 0.00 ? 111 GLY A HA3  6  
ATOM 9565  N N    . GLY A 1 1   ? -20.725 27.670  -2.395  1.00 0.00 ? 1   GLY A N    7  
ATOM 9566  C CA   . GLY A 1 1   ? -19.920 26.650  -1.749  1.00 0.00 ? 1   GLY A CA   7  
ATOM 9567  C C    . GLY A 1 1   ? -18.744 27.233  -0.990  1.00 0.00 ? 1   GLY A C    7  
ATOM 9568  O O    . GLY A 1 1   ? -18.022 28.084  -1.510  1.00 0.00 ? 1   GLY A O    7  
ATOM 9569  H H1   . GLY A 1 1   ? -21.397 27.412  -3.060  1.00 0.00 ? 1   GLY A H1   7  
ATOM 9570  H HA2  . GLY A 1 1   ? -20.542 26.099  -1.059  1.00 0.00 ? 1   GLY A HA2  7  
ATOM 9571  H HA3  . GLY A 1 1   ? -19.546 25.971  -2.502  1.00 0.00 ? 1   GLY A HA3  7  
ATOM 9572  N N    . SER A 1 2   ? -18.552 26.776  0.243   1.00 0.00 ? 2   SER A N    7  
ATOM 9573  C CA   . SER A 1 2   ? -17.458 27.262  1.077   1.00 0.00 ? 2   SER A CA   7  
ATOM 9574  C C    . SER A 1 2   ? -16.437 26.158  1.331   1.00 0.00 ? 2   SER A C    7  
ATOM 9575  O O    . SER A 1 2   ? -16.750 25.136  1.941   1.00 0.00 ? 2   SER A O    7  
ATOM 9576  C CB   . SER A 1 2   ? -17.999 27.789  2.407   1.00 0.00 ? 2   SER A CB   7  
ATOM 9577  O OG   . SER A 1 2   ? -16.948 28.028  3.326   1.00 0.00 ? 2   SER A OG   7  
ATOM 9578  H H    . SER A 1 2   ? -19.161 26.097  0.601   1.00 0.00 ? 2   SER A H    7  
ATOM 9579  H HA   . SER A 1 2   ? -16.974 28.071  0.549   1.00 0.00 ? 2   SER A HA   7  
ATOM 9580  H HB2  . SER A 1 2   ? -18.529 28.714  2.237   1.00 0.00 ? 2   SER A HB2  7  
ATOM 9581  H HB3  . SER A 1 2   ? -18.674 27.060  2.832   1.00 0.00 ? 2   SER A HB3  7  
ATOM 9582  H HG   . SER A 1 2   ? -16.914 28.964  3.538   1.00 0.00 ? 2   SER A HG   7  
ATOM 9583  N N    . SER A 1 3   ? -15.213 26.373  0.859   1.00 0.00 ? 3   SER A N    7  
ATOM 9584  C CA   . SER A 1 3   ? -14.145 25.395  1.031   1.00 0.00 ? 3   SER A CA   7  
ATOM 9585  C C    . SER A 1 3   ? -13.436 25.595  2.367   1.00 0.00 ? 3   SER A C    7  
ATOM 9586  O O    . SER A 1 3   ? -13.338 26.713  2.870   1.00 0.00 ? 3   SER A O    7  
ATOM 9587  C CB   . SER A 1 3   ? -13.137 25.502  -0.115  1.00 0.00 ? 3   SER A CB   7  
ATOM 9588  O OG   . SER A 1 3   ? -13.701 25.051  -1.334  1.00 0.00 ? 3   SER A OG   7  
ATOM 9589  H H    . SER A 1 3   ? -15.025 27.208  0.381   1.00 0.00 ? 3   SER A H    7  
ATOM 9590  H HA   . SER A 1 3   ? -14.590 24.412  1.017   1.00 0.00 ? 3   SER A HA   7  
ATOM 9591  H HB2  . SER A 1 3   ? -12.836 26.532  -0.231  1.00 0.00 ? 3   SER A HB2  7  
ATOM 9592  H HB3  . SER A 1 3   ? -12.271 24.898  0.114   1.00 0.00 ? 3   SER A HB3  7  
ATOM 9593  H HG   . SER A 1 3   ? -13.791 24.095  -1.311  1.00 0.00 ? 3   SER A HG   7  
ATOM 9594  N N    . GLY A 1 4   ? -12.942 24.500  2.938   1.00 0.00 ? 4   GLY A N    7  
ATOM 9595  C CA   . GLY A 1 4   ? -12.249 24.575  4.210   1.00 0.00 ? 4   GLY A CA   7  
ATOM 9596  C C    . GLY A 1 4   ? -11.574 23.269  4.580   1.00 0.00 ? 4   GLY A C    7  
ATOM 9597  O O    . GLY A 1 4   ? -11.289 22.442  3.714   1.00 0.00 ? 4   GLY A O    7  
ATOM 9598  H H    . GLY A 1 4   ? -13.050 23.634  2.491   1.00 0.00 ? 4   GLY A H    7  
ATOM 9599  H HA2  . GLY A 1 4   ? -11.501 25.352  4.155   1.00 0.00 ? 4   GLY A HA2  7  
ATOM 9600  H HA3  . GLY A 1 4   ? -12.962 24.829  4.981   1.00 0.00 ? 4   GLY A HA3  7  
ATOM 9601  N N    . SER A 1 5   ? -11.315 23.083  5.871   1.00 0.00 ? 5   SER A N    7  
ATOM 9602  C CA   . SER A 1 5   ? -10.663 21.871  6.353   1.00 0.00 ? 5   SER A CA   7  
ATOM 9603  C C    . SER A 1 5   ? -11.696 20.823  6.757   1.00 0.00 ? 5   SER A C    7  
ATOM 9604  O O    . SER A 1 5   ? -12.026 20.683  7.935   1.00 0.00 ? 5   SER A O    7  
ATOM 9605  C CB   . SER A 1 5   ? -9.754  22.193  7.541   1.00 0.00 ? 5   SER A CB   7  
ATOM 9606  O OG   . SER A 1 5   ? -9.395  21.015  8.242   1.00 0.00 ? 5   SER A OG   7  
ATOM 9607  H H    . SER A 1 5   ? -11.565 23.780  6.513   1.00 0.00 ? 5   SER A H    7  
ATOM 9608  H HA   . SER A 1 5   ? -10.062 21.475  5.548   1.00 0.00 ? 5   SER A HA   7  
ATOM 9609  H HB2  . SER A 1 5   ? -8.856  22.673  7.184   1.00 0.00 ? 5   SER A HB2  7  
ATOM 9610  H HB3  . SER A 1 5   ? -10.273 22.857  8.217   1.00 0.00 ? 5   SER A HB3  7  
ATOM 9611  H HG   . SER A 1 5   ? -9.554  21.141  9.181   1.00 0.00 ? 5   SER A HG   7  
ATOM 9612  N N    . SER A 1 6   ? -12.202 20.090  5.772   1.00 0.00 ? 6   SER A N    7  
ATOM 9613  C CA   . SER A 1 6   ? -13.201 19.057  6.023   1.00 0.00 ? 6   SER A CA   7  
ATOM 9614  C C    . SER A 1 6   ? -12.709 17.697  5.538   1.00 0.00 ? 6   SER A C    7  
ATOM 9615  O O    . SER A 1 6   ? -13.453 16.941  4.915   1.00 0.00 ? 6   SER A O    7  
ATOM 9616  C CB   . SER A 1 6   ? -14.518 19.412  5.331   1.00 0.00 ? 6   SER A CB   7  
ATOM 9617  O OG   . SER A 1 6   ? -15.283 20.307  6.119   1.00 0.00 ? 6   SER A OG   7  
ATOM 9618  H H    . SER A 1 6   ? -11.899 20.249  4.853   1.00 0.00 ? 6   SER A H    7  
ATOM 9619  H HA   . SER A 1 6   ? -13.366 19.008  7.089   1.00 0.00 ? 6   SER A HA   7  
ATOM 9620  H HB2  . SER A 1 6   ? -14.308 19.878  4.380   1.00 0.00 ? 6   SER A HB2  7  
ATOM 9621  H HB3  . SER A 1 6   ? -15.092 18.511  5.171   1.00 0.00 ? 6   SER A HB3  7  
ATOM 9622  H HG   . SER A 1 6   ? -15.509 19.888  6.952   1.00 0.00 ? 6   SER A HG   7  
ATOM 9623  N N    . GLY A 1 7   ? -11.448 17.392  5.830   1.00 0.00 ? 7   GLY A N    7  
ATOM 9624  C CA   . GLY A 1 7   ? -10.877 16.123  5.417   1.00 0.00 ? 7   GLY A CA   7  
ATOM 9625  C C    . GLY A 1 7   ? -9.430  16.252  4.985   1.00 0.00 ? 7   GLY A C    7  
ATOM 9626  O O    . GLY A 1 7   ? -9.117  16.303  3.795   1.00 0.00 ? 7   GLY A O    7  
ATOM 9627  H H    . GLY A 1 7   ? -10.901 18.033  6.330   1.00 0.00 ? 7   GLY A H    7  
ATOM 9628  H HA2  . GLY A 1 7   ? -10.935 15.429  6.242   1.00 0.00 ? 7   GLY A HA2  7  
ATOM 9629  H HA3  . GLY A 1 7   ? -11.453 15.734  4.591   1.00 0.00 ? 7   GLY A HA3  7  
ATOM 9630  N N    . PRO A 1 8   ? -8.518  16.309  5.967   1.00 0.00 ? 8   PRO A N    7  
ATOM 9631  C CA   . PRO A 1 8   ? -7.081  16.435  5.707   1.00 0.00 ? 8   PRO A CA   7  
ATOM 9632  C C    . PRO A 1 8   ? -6.489  15.169  5.097   1.00 0.00 ? 8   PRO A C    7  
ATOM 9633  O O    . PRO A 1 8   ? -7.030  14.076  5.263   1.00 0.00 ? 8   PRO A O    7  
ATOM 9634  C CB   . PRO A 1 8   ? -6.489  16.686  7.096   1.00 0.00 ? 8   PRO A CB   7  
ATOM 9635  C CG   . PRO A 1 8   ? -7.467  16.076  8.040   1.00 0.00 ? 8   PRO A CG   7  
ATOM 9636  C CD   . PRO A 1 8   ? -8.819  16.253  7.407   1.00 0.00 ? 8   PRO A CD   7  
ATOM 9637  H HA   . PRO A 1 8   ? -6.866  17.276  5.065   1.00 0.00 ? 8   PRO A HA   7  
ATOM 9638  H HB2  . PRO A 1 8   ? -5.520  16.212  7.168   1.00 0.00 ? 8   PRO A HB2  7  
ATOM 9639  H HB3  . PRO A 1 8   ? -6.390  17.748  7.262   1.00 0.00 ? 8   PRO A HB3  7  
ATOM 9640  H HG2  . PRO A 1 8   ? -7.248  15.027  8.169   1.00 0.00 ? 8   PRO A HG2  7  
ATOM 9641  H HG3  . PRO A 1 8   ? -7.428  16.588  8.990   1.00 0.00 ? 8   PRO A HG3  7  
ATOM 9642  H HD2  . PRO A 1 8   ? -9.456  15.412  7.636   1.00 0.00 ? 8   PRO A HD2  7  
ATOM 9643  H HD3  . PRO A 1 8   ? -9.274  17.175  7.741   1.00 0.00 ? 8   PRO A HD3  7  
ATOM 9644  N N    . GLY A 1 9   ? -5.373  15.323  4.390   1.00 0.00 ? 9   GLY A N    7  
ATOM 9645  C CA   . GLY A 1 9   ? -4.727  14.183  3.766   1.00 0.00 ? 9   GLY A CA   7  
ATOM 9646  C C    . GLY A 1 9   ? -3.215  14.292  3.786   1.00 0.00 ? 9   GLY A C    7  
ATOM 9647  O O    . GLY A 1 9   ? -2.515  13.293  3.957   1.00 0.00 ? 9   GLY A O    7  
ATOM 9648  H H    . GLY A 1 9   ? -4.987  16.218  4.291   1.00 0.00 ? 9   GLY A H    7  
ATOM 9649  H HA2  . GLY A 1 9   ? -5.020  13.286  4.290   1.00 0.00 ? 9   GLY A HA2  7  
ATOM 9650  H HA3  . GLY A 1 9   ? -5.057  14.114  2.740   1.00 0.00 ? 9   GLY A HA3  7  
ATOM 9651  N N    . LEU A 1 10  ? -2.708  15.507  3.609   1.00 0.00 ? 10  LEU A N    7  
ATOM 9652  C CA   . LEU A 1 10  ? -1.269  15.743  3.606   1.00 0.00 ? 10  LEU A CA   7  
ATOM 9653  C C    . LEU A 1 10  ? -0.730  15.843  5.030   1.00 0.00 ? 10  LEU A C    7  
ATOM 9654  O O    . LEU A 1 10  ? 0.382   16.322  5.251   1.00 0.00 ? 10  LEU A O    7  
ATOM 9655  C CB   . LEU A 1 10  ? -0.944  17.024  2.835   1.00 0.00 ? 10  LEU A CB   7  
ATOM 9656  C CG   . LEU A 1 10  ? -1.768  18.257  3.204   1.00 0.00 ? 10  LEU A CG   7  
ATOM 9657  C CD1  . LEU A 1 10  ? -3.038  18.320  2.371   1.00 0.00 ? 10  LEU A CD1  7  
ATOM 9658  C CD2  . LEU A 1 10  ? -2.102  18.251  4.689   1.00 0.00 ? 10  LEU A CD2  7  
ATOM 9659  H H    . LEU A 1 10  ? -3.316  16.264  3.478   1.00 0.00 ? 10  LEU A H    7  
ATOM 9660  H HA   . LEU A 1 10  ? -0.797  14.906  3.113   1.00 0.00 ? 10  LEU A HA   7  
ATOM 9661  H HB2  . LEU A 1 10  ? 0.096   17.258  3.006   1.00 0.00 ? 10  LEU A HB2  7  
ATOM 9662  H HB3  . LEU A 1 10  ? -1.098  16.824  1.784   1.00 0.00 ? 10  LEU A HB3  7  
ATOM 9663  H HG   . LEU A 1 10  ? -1.188  19.146  2.995   1.00 0.00 ? 10  LEU A HG   7  
ATOM 9664  H HD11 . LEU A 1 10  ? -3.060  17.487  1.684   1.00 0.00 ? 10  LEU A HD11 7  
ATOM 9665  H HD12 . LEU A 1 10  ? -3.059  19.245  1.815   1.00 0.00 ? 10  LEU A HD12 7  
ATOM 9666  H HD13 . LEU A 1 10  ? -3.899  18.272  3.022   1.00 0.00 ? 10  LEU A HD13 7  
ATOM 9667  H HD21 . LEU A 1 10  ? -2.761  19.077  4.913   1.00 0.00 ? 10  LEU A HD21 7  
ATOM 9668  H HD22 . LEU A 1 10  ? -1.192  18.350  5.263   1.00 0.00 ? 10  LEU A HD22 7  
ATOM 9669  H HD23 . LEU A 1 10  ? -2.589  17.322  4.944   1.00 0.00 ? 10  LEU A HD23 7  
ATOM 9670  N N    . ARG A 1 11  ? -1.525  15.385  5.991   1.00 0.00 ? 11  ARG A N    7  
ATOM 9671  C CA   . ARG A 1 11  ? -1.128  15.421  7.393   1.00 0.00 ? 11  ARG A CA   7  
ATOM 9672  C C    . ARG A 1 11  ? -0.302  14.191  7.757   1.00 0.00 ? 11  ARG A C    7  
ATOM 9673  O O    . ARG A 1 11  ? -0.334  13.181  7.054   1.00 0.00 ? 11  ARG A O    7  
ATOM 9674  C CB   . ARG A 1 11  ? -2.362  15.504  8.293   1.00 0.00 ? 11  ARG A CB   7  
ATOM 9675  C CG   . ARG A 1 11  ? -3.062  16.853  8.246   1.00 0.00 ? 11  ARG A CG   7  
ATOM 9676  C CD   . ARG A 1 11  ? -2.322  17.893  9.072   1.00 0.00 ? 11  ARG A CD   7  
ATOM 9677  N NE   . ARG A 1 11  ? -3.222  18.917  9.596   1.00 0.00 ? 11  ARG A NE   7  
ATOM 9678  C CZ   . ARG A 1 11  ? -2.935  19.684  10.641  1.00 0.00 ? 11  ARG A CZ   7  
ATOM 9679  N NH1  . ARG A 1 11  ? -1.777  19.543  11.272  1.00 0.00 ? 11  ARG A NH1  7  
ATOM 9680  N NH2  . ARG A 1 11  ? -3.806  20.594  11.058  1.00 0.00 ? 11  ARG A NH2  7  
ATOM 9681  H H    . ARG A 1 11  ? -2.401  15.014  5.752   1.00 0.00 ? 11  ARG A H    7  
ATOM 9682  H HA   . ARG A 1 11  ? -0.524  16.303  7.544   1.00 0.00 ? 11  ARG A HA   7  
ATOM 9683  H HB2  . ARG A 1 11  ? -3.069  14.746  7.987   1.00 0.00 ? 11  ARG A HB2  7  
ATOM 9684  H HB3  . ARG A 1 11  ? -2.063  15.314  9.313   1.00 0.00 ? 11  ARG A HB3  7  
ATOM 9685  H HG2  . ARG A 1 11  ? -3.106  17.189  7.220   1.00 0.00 ? 11  ARG A HG2  7  
ATOM 9686  H HG3  . ARG A 1 11  ? -4.063  16.742  8.634   1.00 0.00 ? 11  ARG A HG3  7  
ATOM 9687  H HD2  . ARG A 1 11  ? -1.837  17.398  9.900   1.00 0.00 ? 11  ARG A HD2  7  
ATOM 9688  H HD3  . ARG A 1 11  ? -1.578  18.366  8.449   1.00 0.00 ? 11  ARG A HD3  7  
ATOM 9689  H HE   . ARG A 1 11  ? -4.083  19.038  9.144   1.00 0.00 ? 11  ARG A HE   7  
ATOM 9690  H HH11 . ARG A 1 11  ? -1.118  18.859  10.960  1.00 0.00 ? 11  ARG A HH11 7  
ATOM 9691  H HH12 . ARG A 1 11  ? -1.562  20.123  12.059  1.00 0.00 ? 11  ARG A HH12 7  
ATOM 9692  H HH21 . ARG A 1 11  ? -4.679  20.703  10.585  1.00 0.00 ? 11  ARG A HH21 7  
ATOM 9693  H HH22 . ARG A 1 11  ? -3.588  21.170  11.845  1.00 0.00 ? 11  ARG A HH22 7  
ATOM 9694  N N    . GLU A 1 12  ? 0.437   14.285  8.857   1.00 0.00 ? 12  GLU A N    7  
ATOM 9695  C CA   . GLU A 1 12  ? 1.272   13.179  9.312   1.00 0.00 ? 12  GLU A CA   7  
ATOM 9696  C C    . GLU A 1 12  ? 0.416   12.031  9.838   1.00 0.00 ? 12  GLU A C    7  
ATOM 9697  O O    . GLU A 1 12  ? -0.265  12.164  10.855  1.00 0.00 ? 12  GLU A O    7  
ATOM 9698  C CB   . GLU A 1 12  ? 2.234   13.653  10.404  1.00 0.00 ? 12  GLU A CB   7  
ATOM 9699  C CG   . GLU A 1 12  ? 3.242   12.597  10.828  1.00 0.00 ? 12  GLU A CG   7  
ATOM 9700  C CD   . GLU A 1 12  ? 3.958   12.958  12.115  1.00 0.00 ? 12  GLU A CD   7  
ATOM 9701  O OE1  . GLU A 1 12  ? 3.273   13.129  13.146  1.00 0.00 ? 12  GLU A OE1  7  
ATOM 9702  O OE2  . GLU A 1 12  ? 5.201   13.069  12.092  1.00 0.00 ? 12  GLU A OE2  7  
ATOM 9703  H H    . GLU A 1 12  ? 0.421   15.116  9.375   1.00 0.00 ? 12  GLU A H    7  
ATOM 9704  H HA   . GLU A 1 12  ? 1.846   12.828  8.468   1.00 0.00 ? 12  GLU A HA   7  
ATOM 9705  H HB2  . GLU A 1 12  ? 2.777   14.514  10.040  1.00 0.00 ? 12  GLU A HB2  7  
ATOM 9706  H HB3  . GLU A 1 12  ? 1.660   13.942  11.272  1.00 0.00 ? 12  GLU A HB3  7  
ATOM 9707  H HG2  . GLU A 1 12  ? 2.724   11.661  10.972  1.00 0.00 ? 12  GLU A HG2  7  
ATOM 9708  H HG3  . GLU A 1 12  ? 3.976   12.484  10.044  1.00 0.00 ? 12  GLU A HG3  7  
ATOM 9709  N N    . LEU A 1 13  ? 0.455   10.903  9.137   1.00 0.00 ? 13  LEU A N    7  
ATOM 9710  C CA   . LEU A 1 13  ? -0.317  9.730   9.531   1.00 0.00 ? 13  LEU A CA   7  
ATOM 9711  C C    . LEU A 1 13  ? 0.604   8.582   9.933   1.00 0.00 ? 13  LEU A C    7  
ATOM 9712  O O    . LEU A 1 13  ? 1.821   8.662   9.766   1.00 0.00 ? 13  LEU A O    7  
ATOM 9713  C CB   . LEU A 1 13  ? -1.231  9.289   8.387   1.00 0.00 ? 13  LEU A CB   7  
ATOM 9714  C CG   . LEU A 1 13  ? -2.570  10.020  8.277   1.00 0.00 ? 13  LEU A CG   7  
ATOM 9715  C CD1  . LEU A 1 13  ? -3.298  9.612   7.006   1.00 0.00 ? 13  LEU A CD1  7  
ATOM 9716  C CD2  . LEU A 1 13  ? -3.431  9.741   9.500   1.00 0.00 ? 13  LEU A CD2  7  
ATOM 9717  H H    . LEU A 1 13  ? 1.017   10.857  8.335   1.00 0.00 ? 13  LEU A H    7  
ATOM 9718  H HA   . LEU A 1 13  ? -0.924  10.003  10.381  1.00 0.00 ? 13  LEU A HA   7  
ATOM 9719  H HB2  . LEU A 1 13  ? -0.697  9.437   7.461   1.00 0.00 ? 13  LEU A HB2  7  
ATOM 9720  H HB3  . LEU A 1 13  ? -1.438  8.236   8.516   1.00 0.00 ? 13  LEU A HB3  7  
ATOM 9721  H HG   . LEU A 1 13  ? -2.388  11.085  8.230   1.00 0.00 ? 13  LEU A HG   7  
ATOM 9722  H HD11 . LEU A 1 13  ? -2.577  9.351   6.246   1.00 0.00 ? 13  LEU A HD11 7  
ATOM 9723  H HD12 . LEU A 1 13  ? -3.905  10.435  6.659   1.00 0.00 ? 13  LEU A HD12 7  
ATOM 9724  H HD13 . LEU A 1 13  ? -3.931  8.760   7.211   1.00 0.00 ? 13  LEU A HD13 7  
ATOM 9725  H HD21 . LEU A 1 13  ? -2.863  9.166   10.216  1.00 0.00 ? 13  LEU A HD21 7  
ATOM 9726  H HD22 . LEU A 1 13  ? -4.307  9.183   9.204   1.00 0.00 ? 13  LEU A HD22 7  
ATOM 9727  H HD23 . LEU A 1 13  ? -3.733  10.676  9.948   1.00 0.00 ? 13  LEU A HD23 7  
ATOM 9728  N N    . CYS A 1 14  ? 0.014   7.515   10.461  1.00 0.00 ? 14  CYS A N    7  
ATOM 9729  C CA   . CYS A 1 14  ? 0.781   6.349   10.885  1.00 0.00 ? 14  CYS A CA   7  
ATOM 9730  C C    . CYS A 1 14  ? -0.059  5.080   10.785  1.00 0.00 ? 14  CYS A C    7  
ATOM 9731  O O    . CYS A 1 14  ? -1.288  5.138   10.760  1.00 0.00 ? 14  CYS A O    7  
ATOM 9732  C CB   . CYS A 1 14  ? 1.278   6.534   12.320  1.00 0.00 ? 14  CYS A CB   7  
ATOM 9733  S SG   . CYS A 1 14  ? 0.014   7.132   13.467  1.00 0.00 ? 14  CYS A SG   7  
ATOM 9734  H H    . CYS A 1 14  ? -0.960  7.510   10.568  1.00 0.00 ? 14  CYS A H    7  
ATOM 9735  H HA   . CYS A 1 14  ? 1.632   6.256   10.228  1.00 0.00 ? 14  CYS A HA   7  
ATOM 9736  H HB2  . CYS A 1 14  ? 1.638   5.587   12.694  1.00 0.00 ? 14  CYS A HB2  7  
ATOM 9737  H HB3  . CYS A 1 14  ? 2.089   7.246   12.323  1.00 0.00 ? 14  CYS A HB3  7  
ATOM 9738  H HG   . CYS A 1 14  ? -0.575  6.078   14.011  1.00 0.00 ? 14  CYS A HG   7  
ATOM 9739  N N    . ILE A 1 15  ? 0.614   3.935   10.726  1.00 0.00 ? 15  ILE A N    7  
ATOM 9740  C CA   . ILE A 1 15  ? -0.071  2.652   10.628  1.00 0.00 ? 15  ILE A CA   7  
ATOM 9741  C C    . ILE A 1 15  ? 0.438   1.675   11.682  1.00 0.00 ? 15  ILE A C    7  
ATOM 9742  O O    . ILE A 1 15  ? 1.586   1.234   11.630  1.00 0.00 ? 15  ILE A O    7  
ATOM 9743  C CB   . ILE A 1 15  ? 0.108   2.024   9.233   1.00 0.00 ? 15  ILE A CB   7  
ATOM 9744  C CG1  . ILE A 1 15  ? -0.411  2.974   8.151   1.00 0.00 ? 15  ILE A CG1  7  
ATOM 9745  C CG2  . ILE A 1 15  ? -0.610  0.685   9.159   1.00 0.00 ? 15  ILE A CG2  7  
ATOM 9746  C CD1  . ILE A 1 15  ? -0.161  2.481   6.743   1.00 0.00 ? 15  ILE A CD1  7  
ATOM 9747  H H    . ILE A 1 15  ? 1.593   3.954   10.750  1.00 0.00 ? 15  ILE A H    7  
ATOM 9748  H HA   . ILE A 1 15  ? -1.125  2.824   10.790  1.00 0.00 ? 15  ILE A HA   7  
ATOM 9749  H HB   . ILE A 1 15  ? 1.161   1.850   9.074   1.00 0.00 ? 15  ILE A HB   7  
ATOM 9750  H HG12 . ILE A 1 15  ? -1.475  3.101   8.274   1.00 0.00 ? 15  ILE A HG12 7  
ATOM 9751  H HG13 . ILE A 1 15  ? 0.077   3.932   8.260   1.00 0.00 ? 15  ILE A HG13 7  
ATOM 9752  H HG21 . ILE A 1 15  ? -1.650  0.847   8.917   1.00 0.00 ? 15  ILE A HG21 7  
ATOM 9753  H HG22 . ILE A 1 15  ? -0.155  0.075   8.393   1.00 0.00 ? 15  ILE A HG22 7  
ATOM 9754  H HG23 . ILE A 1 15  ? -0.536  0.183   10.111  1.00 0.00 ? 15  ILE A HG23 7  
ATOM 9755  H HD11 . ILE A 1 15  ? -0.942  2.842   6.091   1.00 0.00 ? 15  ILE A HD11 7  
ATOM 9756  H HD12 . ILE A 1 15  ? 0.795   2.844   6.398   1.00 0.00 ? 15  ILE A HD12 7  
ATOM 9757  H HD13 . ILE A 1 15  ? -0.159  1.400   6.736   1.00 0.00 ? 15  ILE A HD13 7  
ATOM 9758  N N    . GLN A 1 16  ? -0.424  1.340   12.636  1.00 0.00 ? 16  GLN A N    7  
ATOM 9759  C CA   . GLN A 1 16  ? -0.062  0.414   13.702  1.00 0.00 ? 16  GLN A CA   7  
ATOM 9760  C C    . GLN A 1 16  ? -0.156  -1.031  13.223  1.00 0.00 ? 16  GLN A C    7  
ATOM 9761  O O    . GLN A 1 16  ? -1.182  -1.454  12.691  1.00 0.00 ? 16  GLN A O    7  
ATOM 9762  C CB   . GLN A 1 16  ? -0.968  0.621   14.917  1.00 0.00 ? 16  GLN A CB   7  
ATOM 9763  C CG   . GLN A 1 16  ? -0.410  1.607   15.931  1.00 0.00 ? 16  GLN A CG   7  
ATOM 9764  C CD   . GLN A 1 16  ? -1.497  2.316   16.714  1.00 0.00 ? 16  GLN A CD   7  
ATOM 9765  O OE1  . GLN A 1 16  ? -1.853  1.903   17.818  1.00 0.00 ? 16  GLN A OE1  7  
ATOM 9766  N NE2  . GLN A 1 16  ? -2.031  3.391   16.146  1.00 0.00 ? 16  GLN A NE2  7  
ATOM 9767  H H    . GLN A 1 16  ? -1.325  1.725   12.623  1.00 0.00 ? 16  GLN A H    7  
ATOM 9768  H HA   . GLN A 1 16  ? 0.959   0.620   13.987  1.00 0.00 ? 16  GLN A HA   7  
ATOM 9769  H HB2  . GLN A 1 16  ? -1.925  0.989   14.578  1.00 0.00 ? 16  GLN A HB2  7  
ATOM 9770  H HB3  . GLN A 1 16  ? -1.110  -0.328  15.411  1.00 0.00 ? 16  GLN A HB3  7  
ATOM 9771  H HG2  . GLN A 1 16  ? 0.221   1.071   16.625  1.00 0.00 ? 16  GLN A HG2  7  
ATOM 9772  H HG3  . GLN A 1 16  ? 0.179   2.346   15.409  1.00 0.00 ? 16  GLN A HG3  7  
ATOM 9773  H HE21 . GLN A 1 16  ? -1.699  3.661   15.264  1.00 0.00 ? 16  GLN A HE21 7  
ATOM 9774  H HE22 . GLN A 1 16  ? -2.736  3.868   16.629  1.00 0.00 ? 16  GLN A HE22 7  
ATOM 9775  N N    . LYS A 1 17  ? 0.922   -1.784  13.415  1.00 0.00 ? 17  LYS A N    7  
ATOM 9776  C CA   . LYS A 1 17  ? 0.961   -3.183  13.004  1.00 0.00 ? 17  LYS A CA   7  
ATOM 9777  C C    . LYS A 1 17  ? 1.675   -4.036  14.047  1.00 0.00 ? 17  LYS A C    7  
ATOM 9778  O O    . LYS A 1 17  ? 2.231   -3.516  15.014  1.00 0.00 ? 17  LYS A O    7  
ATOM 9779  C CB   . LYS A 1 17  ? 1.664   -3.318  11.651  1.00 0.00 ? 17  LYS A CB   7  
ATOM 9780  C CG   . LYS A 1 17  ? 3.157   -3.573  11.764  1.00 0.00 ? 17  LYS A CG   7  
ATOM 9781  C CD   . LYS A 1 17  ? 3.879   -3.238  10.470  1.00 0.00 ? 17  LYS A CD   7  
ATOM 9782  C CE   . LYS A 1 17  ? 3.899   -1.738  10.215  1.00 0.00 ? 17  LYS A CE   7  
ATOM 9783  N NZ   . LYS A 1 17  ? 4.474   -0.988  11.366  1.00 0.00 ? 17  LYS A NZ   7  
ATOM 9784  H H    . LYS A 1 17  ? 1.710   -1.390  13.845  1.00 0.00 ? 17  LYS A H    7  
ATOM 9785  H HA   . LYS A 1 17  ? -0.056  -3.529  12.908  1.00 0.00 ? 17  LYS A HA   7  
ATOM 9786  H HB2  . LYS A 1 17  ? 1.219   -4.140  11.109  1.00 0.00 ? 17  LYS A HB2  7  
ATOM 9787  H HB3  . LYS A 1 17  ? 1.517   -2.406  11.090  1.00 0.00 ? 17  LYS A HB3  7  
ATOM 9788  H HG2  . LYS A 1 17  ? 3.559   -2.960  12.557  1.00 0.00 ? 17  LYS A HG2  7  
ATOM 9789  H HG3  . LYS A 1 17  ? 3.318   -4.616  11.996  1.00 0.00 ? 17  LYS A HG3  7  
ATOM 9790  H HD2  . LYS A 1 17  ? 4.897   -3.594  10.533  1.00 0.00 ? 17  LYS A HD2  7  
ATOM 9791  H HD3  . LYS A 1 17  ? 3.374   -3.727  9.649   1.00 0.00 ? 17  LYS A HD3  7  
ATOM 9792  H HE2  . LYS A 1 17  ? 4.495   -1.543  9.337   1.00 0.00 ? 17  LYS A HE2  7  
ATOM 9793  H HE3  . LYS A 1 17  ? 2.887   -1.402  10.046  1.00 0.00 ? 17  LYS A HE3  7  
ATOM 9794  H HZ1  . LYS A 1 17  ? 3.814   -1.007  12.170  1.00 0.00 ? 17  LYS A HZ1  7  
ATOM 9795  H HZ2  . LYS A 1 17  ? 4.645   0.002   11.097  1.00 0.00 ? 17  LYS A HZ2  7  
ATOM 9796  H HZ3  . LYS A 1 17  ? 5.374   -1.417  11.660  1.00 0.00 ? 17  LYS A HZ3  7  
ATOM 9797  N N    . ALA A 1 18  ? 1.657   -5.349  13.844  1.00 0.00 ? 18  ALA A N    7  
ATOM 9798  C CA   . ALA A 1 18  ? 2.305   -6.274  14.765  1.00 0.00 ? 18  ALA A CA   7  
ATOM 9799  C C    . ALA A 1 18  ? 3.805   -6.011  14.842  1.00 0.00 ? 18  ALA A C    7  
ATOM 9800  O O    . ALA A 1 18  ? 4.369   -5.255  14.050  1.00 0.00 ? 18  ALA A O    7  
ATOM 9801  C CB   . ALA A 1 18  ? 2.041   -7.712  14.343  1.00 0.00 ? 18  ALA A CB   7  
ATOM 9802  H H    . ALA A 1 18  ? 1.197   -5.704  13.055  1.00 0.00 ? 18  ALA A H    7  
ATOM 9803  H HA   . ALA A 1 18  ? 1.873   -6.128  15.745  1.00 0.00 ? 18  ALA A HA   7  
ATOM 9804  H HB1  . ALA A 1 18  ? 1.502   -8.223  15.127  1.00 0.00 ? 18  ALA A HB1  7  
ATOM 9805  H HB2  . ALA A 1 18  ? 1.453   -7.719  13.438  1.00 0.00 ? 18  ALA A HB2  7  
ATOM 9806  H HB3  . ALA A 1 18  ? 2.981   -8.213  14.166  1.00 0.00 ? 18  ALA A HB3  7  
ATOM 9807  N N    . PRO A 1 19  ? 4.469   -6.646  15.819  1.00 0.00 ? 19  PRO A N    7  
ATOM 9808  C CA   . PRO A 1 19  ? 5.913   -6.495  16.023  1.00 0.00 ? 19  PRO A CA   7  
ATOM 9809  C C    . PRO A 1 19  ? 6.727   -7.149  14.911  1.00 0.00 ? 19  PRO A C    7  
ATOM 9810  O O    . PRO A 1 19  ? 7.954   -7.066  14.896  1.00 0.00 ? 19  PRO A O    7  
ATOM 9811  C CB   . PRO A 1 19  ? 6.160   -7.208  17.355  1.00 0.00 ? 19  PRO A CB   7  
ATOM 9812  C CG   . PRO A 1 19  ? 5.050   -8.196  17.467  1.00 0.00 ? 19  PRO A CG   7  
ATOM 9813  C CD   . PRO A 1 19  ? 3.862   -7.561  16.800  1.00 0.00 ? 19  PRO A CD   7  
ATOM 9814  H HA   . PRO A 1 19  ? 6.195   -5.456  16.111  1.00 0.00 ? 19  PRO A HA   7  
ATOM 9815  H HB2  . PRO A 1 19  ? 7.124   -7.696  17.332  1.00 0.00 ? 19  PRO A HB2  7  
ATOM 9816  H HB3  . PRO A 1 19  ? 6.132   -6.491  18.162  1.00 0.00 ? 19  PRO A HB3  7  
ATOM 9817  H HG2  . PRO A 1 19  ? 5.320   -9.110  16.962  1.00 0.00 ? 19  PRO A HG2  7  
ATOM 9818  H HG3  . PRO A 1 19  ? 4.836   -8.390  18.508  1.00 0.00 ? 19  PRO A HG3  7  
ATOM 9819  H HD2  . PRO A 1 19  ? 3.261   -8.311  16.307  1.00 0.00 ? 19  PRO A HD2  7  
ATOM 9820  H HD3  . PRO A 1 19  ? 3.271   -7.016  17.521  1.00 0.00 ? 19  PRO A HD3  7  
ATOM 9821  N N    . GLY A 1 20  ? 6.034   -7.798  13.980  1.00 0.00 ? 20  GLY A N    7  
ATOM 9822  C CA   . GLY A 1 20  ? 6.710   -8.456  12.877  1.00 0.00 ? 20  GLY A CA   7  
ATOM 9823  C C    . GLY A 1 20  ? 5.787   -8.711  11.702  1.00 0.00 ? 20  GLY A C    7  
ATOM 9824  O O    . GLY A 1 20  ? 5.924   -9.716  11.005  1.00 0.00 ? 20  GLY A O    7  
ATOM 9825  H H    . GLY A 1 20  ? 5.057   -7.831  14.044  1.00 0.00 ? 20  GLY A H    7  
ATOM 9826  H HA2  . GLY A 1 20  ? 7.530   -7.835  12.550  1.00 0.00 ? 20  GLY A HA2  7  
ATOM 9827  H HA3  . GLY A 1 20  ? 7.103   -9.401  13.223  1.00 0.00 ? 20  GLY A HA3  7  
ATOM 9828  N N    . GLU A 1 21  ? 4.844   -7.800  11.483  1.00 0.00 ? 21  GLU A N    7  
ATOM 9829  C CA   . GLU A 1 21  ? 3.894   -7.933  10.385  1.00 0.00 ? 21  GLU A CA   7  
ATOM 9830  C C    . GLU A 1 21  ? 4.292   -7.044  9.210   1.00 0.00 ? 21  GLU A C    7  
ATOM 9831  O O    . GLU A 1 21  ? 4.695   -5.896  9.395   1.00 0.00 ? 21  GLU A O    7  
ATOM 9832  C CB   . GLU A 1 21  ? 2.483   -7.574  10.855  1.00 0.00 ? 21  GLU A CB   7  
ATOM 9833  C CG   . GLU A 1 21  ? 1.431   -7.686  9.765   1.00 0.00 ? 21  GLU A CG   7  
ATOM 9834  C CD   . GLU A 1 21  ? 1.487   -9.013  9.033   1.00 0.00 ? 21  GLU A CD   7  
ATOM 9835  O OE1  . GLU A 1 21  ? 1.931   -10.009 9.642   1.00 0.00 ? 21  GLU A OE1  7  
ATOM 9836  O OE2  . GLU A 1 21  ? 1.087   -9.055  7.851   1.00 0.00 ? 21  GLU A OE2  7  
ATOM 9837  H H    . GLU A 1 21  ? 4.786   -7.020  12.073  1.00 0.00 ? 21  GLU A H    7  
ATOM 9838  H HA   . GLU A 1 21  ? 3.904   -8.963  10.061  1.00 0.00 ? 21  GLU A HA   7  
ATOM 9839  H HB2  . GLU A 1 21  ? 2.207   -8.236  11.663  1.00 0.00 ? 21  GLU A HB2  7  
ATOM 9840  H HB3  . GLU A 1 21  ? 2.486   -6.558  11.220  1.00 0.00 ? 21  GLU A HB3  7  
ATOM 9841  H HG2  . GLU A 1 21  ? 0.454   -7.581  10.213  1.00 0.00 ? 21  GLU A HG2  7  
ATOM 9842  H HG3  . GLU A 1 21  ? 1.585   -6.891  9.050   1.00 0.00 ? 21  GLU A HG3  7  
ATOM 9843  N N    . ARG A 1 22  ? 4.175   -7.584  8.001   1.00 0.00 ? 22  ARG A N    7  
ATOM 9844  C CA   . ARG A 1 22  ? 4.524   -6.841  6.796   1.00 0.00 ? 22  ARG A CA   7  
ATOM 9845  C C    . ARG A 1 22  ? 3.380   -5.923  6.373   1.00 0.00 ? 22  ARG A C    7  
ATOM 9846  O O    . ARG A 1 22  ? 2.279   -6.384  6.072   1.00 0.00 ? 22  ARG A O    7  
ATOM 9847  C CB   . ARG A 1 22  ? 4.865   -7.805  5.658   1.00 0.00 ? 22  ARG A CB   7  
ATOM 9848  C CG   . ARG A 1 22  ? 6.291   -8.330  5.711   1.00 0.00 ? 22  ARG A CG   7  
ATOM 9849  C CD   . ARG A 1 22  ? 6.419   -9.667  5.000   1.00 0.00 ? 22  ARG A CD   7  
ATOM 9850  N NE   . ARG A 1 22  ? 6.143   -9.555  3.570   1.00 0.00 ? 22  ARG A NE   7  
ATOM 9851  C CZ   . ARG A 1 22  ? 6.001   -10.602 2.765   1.00 0.00 ? 22  ARG A CZ   7  
ATOM 9852  N NH1  . ARG A 1 22  ? 6.109   -11.833 3.246   1.00 0.00 ? 22  ARG A NH1  7  
ATOM 9853  N NH2  . ARG A 1 22  ? 5.750   -10.419 1.475   1.00 0.00 ? 22  ARG A NH2  7  
ATOM 9854  H H    . ARG A 1 22  ? 3.847   -8.504  7.917   1.00 0.00 ? 22  ARG A H    7  
ATOM 9855  H HA   . ARG A 1 22  ? 5.391   -6.238  7.017   1.00 0.00 ? 22  ARG A HA   7  
ATOM 9856  H HB2  . ARG A 1 22  ? 4.193   -8.649  5.703   1.00 0.00 ? 22  ARG A HB2  7  
ATOM 9857  H HB3  . ARG A 1 22  ? 4.727   -7.295  4.717   1.00 0.00 ? 22  ARG A HB3  7  
ATOM 9858  H HG2  . ARG A 1 22  ? 6.945   -7.616  5.233   1.00 0.00 ? 22  ARG A HG2  7  
ATOM 9859  H HG3  . ARG A 1 22  ? 6.581   -8.452  6.744   1.00 0.00 ? 22  ARG A HG3  7  
ATOM 9860  H HD2  . ARG A 1 22  ? 7.425   -10.036 5.134   1.00 0.00 ? 22  ARG A HD2  7  
ATOM 9861  H HD3  . ARG A 1 22  ? 5.719   -10.362 5.439   1.00 0.00 ? 22  ARG A HD3  7  
ATOM 9862  H HE   . ARG A 1 22  ? 6.059   -8.655  3.193   1.00 0.00 ? 22  ARG A HE   7  
ATOM 9863  H HH11 . ARG A 1 22  ? 6.297   -11.974 4.218   1.00 0.00 ? 22  ARG A HH11 7  
ATOM 9864  H HH12 . ARG A 1 22  ? 6.001   -12.619 2.638   1.00 0.00 ? 22  ARG A HH12 7  
ATOM 9865  H HH21 . ARG A 1 22  ? 5.668   -9.493  1.108   1.00 0.00 ? 22  ARG A HH21 7  
ATOM 9866  H HH22 . ARG A 1 22  ? 5.644   -11.207 0.869   1.00 0.00 ? 22  ARG A HH22 7  
ATOM 9867  N N    . LEU A 1 23  ? 3.650   -4.623  6.354   1.00 0.00 ? 23  LEU A N    7  
ATOM 9868  C CA   . LEU A 1 23  ? 2.644   -3.639  5.968   1.00 0.00 ? 23  LEU A CA   7  
ATOM 9869  C C    . LEU A 1 23  ? 1.682   -4.219  4.936   1.00 0.00 ? 23  LEU A C    7  
ATOM 9870  O O    . LEU A 1 23  ? 0.470   -4.027  5.025   1.00 0.00 ? 23  LEU A O    7  
ATOM 9871  C CB   . LEU A 1 23  ? 3.317   -2.385  5.408   1.00 0.00 ? 23  LEU A CB   7  
ATOM 9872  C CG   . LEU A 1 23  ? 2.574   -1.067  5.631   1.00 0.00 ? 23  LEU A CG   7  
ATOM 9873  C CD1  . LEU A 1 23  ? 1.103   -1.217  5.276   1.00 0.00 ? 23  LEU A CD1  7  
ATOM 9874  C CD2  . LEU A 1 23  ? 2.732   -0.604  7.072   1.00 0.00 ? 23  LEU A CD2  7  
ATOM 9875  H H    . LEU A 1 23  ? 4.546   -4.315  6.604   1.00 0.00 ? 23  LEU A H    7  
ATOM 9876  H HA   . LEU A 1 23  ? 2.085   -3.372  6.853   1.00 0.00 ? 23  LEU A HA   7  
ATOM 9877  H HB2  . LEU A 1 23  ? 4.289   -2.298  5.867   1.00 0.00 ? 23  LEU A HB2  7  
ATOM 9878  H HB3  . LEU A 1 23  ? 3.435   -2.522  4.342   1.00 0.00 ? 23  LEU A HB3  7  
ATOM 9879  H HG   . LEU A 1 23  ? 2.997   -0.309  4.987   1.00 0.00 ? 23  LEU A HG   7  
ATOM 9880  H HD11 . LEU A 1 23  ? 0.994   -1.961  4.502   1.00 0.00 ? 23  LEU A HD11 7  
ATOM 9881  H HD12 . LEU A 1 23  ? 0.720   -0.271  4.923   1.00 0.00 ? 23  LEU A HD12 7  
ATOM 9882  H HD13 . LEU A 1 23  ? 0.550   -1.524  6.152   1.00 0.00 ? 23  LEU A HD13 7  
ATOM 9883  H HD21 . LEU A 1 23  ? 1.844   -0.069  7.377   1.00 0.00 ? 23  LEU A HD21 7  
ATOM 9884  H HD22 . LEU A 1 23  ? 3.589   0.050   7.148   1.00 0.00 ? 23  LEU A HD22 7  
ATOM 9885  H HD23 . LEU A 1 23  ? 2.874   -1.461  7.713   1.00 0.00 ? 23  LEU A HD23 7  
ATOM 9886  N N    . GLY A 1 24  ? 2.232   -4.931  3.957   1.00 0.00 ? 24  GLY A N    7  
ATOM 9887  C CA   . GLY A 1 24  ? 1.409   -5.530  2.922   1.00 0.00 ? 24  GLY A CA   7  
ATOM 9888  C C    . GLY A 1 24  ? 0.885   -4.507  1.934   1.00 0.00 ? 24  GLY A C    7  
ATOM 9889  O O    . GLY A 1 24  ? -0.271  -4.572  1.517   1.00 0.00 ? 24  GLY A O    7  
ATOM 9890  H H    . GLY A 1 24  ? 3.205   -5.050  3.937   1.00 0.00 ? 24  GLY A H    7  
ATOM 9891  H HA2  . GLY A 1 24  ? 1.996   -6.263  2.390   1.00 0.00 ? 24  GLY A HA2  7  
ATOM 9892  H HA3  . GLY A 1 24  ? 0.570   -6.025  3.388   1.00 0.00 ? 24  GLY A HA3  7  
ATOM 9893  N N    . ILE A 1 25  ? 1.738   -3.559  1.558   1.00 0.00 ? 25  ILE A N    7  
ATOM 9894  C CA   . ILE A 1 25  ? 1.354   -2.518  0.613   1.00 0.00 ? 25  ILE A CA   7  
ATOM 9895  C C    . ILE A 1 25  ? 2.235   -2.553  -0.631  1.00 0.00 ? 25  ILE A C    7  
ATOM 9896  O O    . ILE A 1 25  ? 3.321   -3.133  -0.619  1.00 0.00 ? 25  ILE A O    7  
ATOM 9897  C CB   . ILE A 1 25  ? 1.440   -1.119  1.250   1.00 0.00 ? 25  ILE A CB   7  
ATOM 9898  C CG1  . ILE A 1 25  ? 2.647   -1.035  2.187   1.00 0.00 ? 25  ILE A CG1  7  
ATOM 9899  C CG2  . ILE A 1 25  ? 0.156   -0.799  2.002   1.00 0.00 ? 25  ILE A CG2  7  
ATOM 9900  C CD1  . ILE A 1 25  ? 3.245   0.352   2.278   1.00 0.00 ? 25  ILE A CD1  7  
ATOM 9901  H H    . ILE A 1 25  ? 2.646   -3.560  1.925   1.00 0.00 ? 25  ILE A H    7  
ATOM 9902  H HA   . ILE A 1 25  ? 0.329   -2.696  0.320   1.00 0.00 ? 25  ILE A HA   7  
ATOM 9903  H HB   . ILE A 1 25  ? 1.556   -0.394  0.459   1.00 0.00 ? 25  ILE A HB   7  
ATOM 9904  H HG12 . ILE A 1 25  ? 2.347   -1.332  3.179   1.00 0.00 ? 25  ILE A HG12 7  
ATOM 9905  H HG13 . ILE A 1 25  ? 3.416   -1.706  1.831   1.00 0.00 ? 25  ILE A HG13 7  
ATOM 9906  H HG21 . ILE A 1 25  ? -0.380  -1.715  2.204   1.00 0.00 ? 25  ILE A HG21 7  
ATOM 9907  H HG22 . ILE A 1 25  ? 0.398   -0.311  2.934   1.00 0.00 ? 25  ILE A HG22 7  
ATOM 9908  H HG23 . ILE A 1 25  ? -0.459  -0.146  1.402   1.00 0.00 ? 25  ILE A HG23 7  
ATOM 9909  H HD11 . ILE A 1 25  ? 3.915   0.400   3.124   1.00 0.00 ? 25  ILE A HD11 7  
ATOM 9910  H HD12 . ILE A 1 25  ? 3.791   0.570   1.373   1.00 0.00 ? 25  ILE A HD12 7  
ATOM 9911  H HD13 . ILE A 1 25  ? 2.454   1.077   2.405   1.00 0.00 ? 25  ILE A HD13 7  
ATOM 9912  N N    . SER A 1 26  ? 1.760   -1.927  -1.704  1.00 0.00 ? 26  SER A N    7  
ATOM 9913  C CA   . SER A 1 26  ? 2.504   -1.888  -2.957  1.00 0.00 ? 26  SER A CA   7  
ATOM 9914  C C    . SER A 1 26  ? 2.588   -0.463  -3.495  1.00 0.00 ? 26  SER A C    7  
ATOM 9915  O O    . SER A 1 26  ? 1.598   0.270   -3.498  1.00 0.00 ? 26  SER A O    7  
ATOM 9916  C CB   . SER A 1 26  ? 1.844   -2.798  -3.995  1.00 0.00 ? 26  SER A CB   7  
ATOM 9917  O OG   . SER A 1 26  ? 2.401   -4.101  -3.958  1.00 0.00 ? 26  SER A OG   7  
ATOM 9918  H H    . SER A 1 26  ? 0.888   -1.483  -1.651  1.00 0.00 ? 26  SER A H    7  
ATOM 9919  H HA   . SER A 1 26  ? 3.504   -2.246  -2.761  1.00 0.00 ? 26  SER A HA   7  
ATOM 9920  H HB2  . SER A 1 26  ? 0.787   -2.866  -3.790  1.00 0.00 ? 26  SER A HB2  7  
ATOM 9921  H HB3  . SER A 1 26  ? 1.994   -2.383  -4.981  1.00 0.00 ? 26  SER A HB3  7  
ATOM 9922  H HG   . SER A 1 26  ? 3.323   -4.048  -3.696  1.00 0.00 ? 26  SER A HG   7  
ATOM 9923  N N    . ILE A 1 27  ? 3.776   -0.077  -3.948  1.00 0.00 ? 27  ILE A N    7  
ATOM 9924  C CA   . ILE A 1 27  ? 3.990   1.259   -4.489  1.00 0.00 ? 27  ILE A CA   7  
ATOM 9925  C C    . ILE A 1 27  ? 4.676   1.199   -5.849  1.00 0.00 ? 27  ILE A C    7  
ATOM 9926  O O    . ILE A 1 27  ? 5.356   0.223   -6.170  1.00 0.00 ? 27  ILE A O    7  
ATOM 9927  C CB   . ILE A 1 27  ? 4.838   2.123   -3.537  1.00 0.00 ? 27  ILE A CB   7  
ATOM 9928  C CG1  . ILE A 1 27  ? 6.298   1.667   -3.563  1.00 0.00 ? 27  ILE A CG1  7  
ATOM 9929  C CG2  . ILE A 1 27  ? 4.281   2.055   -2.123  1.00 0.00 ? 27  ILE A CG2  7  
ATOM 9930  C CD1  . ILE A 1 27  ? 7.222   2.551   -2.755  1.00 0.00 ? 27  ILE A CD1  7  
ATOM 9931  H H    . ILE A 1 27  ? 4.526   -0.707  -3.919  1.00 0.00 ? 27  ILE A H    7  
ATOM 9932  H HA   . ILE A 1 27  ? 3.024   1.730   -4.606  1.00 0.00 ? 27  ILE A HA   7  
ATOM 9933  H HB   . ILE A 1 27  ? 4.782   3.148   -3.871  1.00 0.00 ? 27  ILE A HB   7  
ATOM 9934  H HG12 . ILE A 1 27  ? 6.363   0.667   -3.163  1.00 0.00 ? 27  ILE A HG12 7  
ATOM 9935  H HG13 . ILE A 1 27  ? 6.648   1.665   -4.585  1.00 0.00 ? 27  ILE A HG13 7  
ATOM 9936  H HG21 . ILE A 1 27  ? 3.437   1.381   -2.100  1.00 0.00 ? 27  ILE A HG21 7  
ATOM 9937  H HG22 . ILE A 1 27  ? 5.046   1.695   -1.452  1.00 0.00 ? 27  ILE A HG22 7  
ATOM 9938  H HG23 . ILE A 1 27  ? 3.963   3.039   -1.812  1.00 0.00 ? 27  ILE A HG23 7  
ATOM 9939  H HD11 . ILE A 1 27  ? 8.119   2.748   -3.323  1.00 0.00 ? 27  ILE A HD11 7  
ATOM 9940  H HD12 . ILE A 1 27  ? 6.725   3.483   -2.531  1.00 0.00 ? 27  ILE A HD12 7  
ATOM 9941  H HD13 . ILE A 1 27  ? 7.483   2.052   -1.833  1.00 0.00 ? 27  ILE A HD13 7  
ATOM 9942  N N    . ARG A 1 28  ? 4.496   2.248   -6.644  1.00 0.00 ? 28  ARG A N    7  
ATOM 9943  C CA   . ARG A 1 28  ? 5.098   2.315   -7.970  1.00 0.00 ? 28  ARG A CA   7  
ATOM 9944  C C    . ARG A 1 28  ? 5.772   3.665   -8.194  1.00 0.00 ? 28  ARG A C    7  
ATOM 9945  O O    . ARG A 1 28  ? 5.193   4.714   -7.913  1.00 0.00 ? 28  ARG A O    7  
ATOM 9946  C CB   . ARG A 1 28  ? 4.039   2.076   -9.048  1.00 0.00 ? 28  ARG A CB   7  
ATOM 9947  C CG   . ARG A 1 28  ? 2.948   3.134   -9.074  1.00 0.00 ? 28  ARG A CG   7  
ATOM 9948  C CD   . ARG A 1 28  ? 2.106   3.035   -10.337 1.00 0.00 ? 28  ARG A CD   7  
ATOM 9949  N NE   . ARG A 1 28  ? 2.647   3.852   -11.420 1.00 0.00 ? 28  ARG A NE   7  
ATOM 9950  C CZ   . ARG A 1 28  ? 2.064   3.977   -12.607 1.00 0.00 ? 28  ARG A CZ   7  
ATOM 9951  N NH1  . ARG A 1 28  ? 0.929   3.342   -12.862 1.00 0.00 ? 28  ARG A NH1  7  
ATOM 9952  N NH2  . ARG A 1 28  ? 2.617   4.739   -13.542 1.00 0.00 ? 28  ARG A NH2  7  
ATOM 9953  H H    . ARG A 1 28  ? 3.944   2.995   -6.333  1.00 0.00 ? 28  ARG A H    7  
ATOM 9954  H HA   . ARG A 1 28  ? 5.846   1.538   -8.035  1.00 0.00 ? 28  ARG A HA   7  
ATOM 9955  H HB2  . ARG A 1 28  ? 4.521   2.064   -10.014 1.00 0.00 ? 28  ARG A HB2  7  
ATOM 9956  H HB3  . ARG A 1 28  ? 3.576   1.117   -8.874  1.00 0.00 ? 28  ARG A HB3  7  
ATOM 9957  H HG2  . ARG A 1 28  ? 2.306   2.998   -8.216  1.00 0.00 ? 28  ARG A HG2  7  
ATOM 9958  H HG3  . ARG A 1 28  ? 3.406   4.111   -9.032  1.00 0.00 ? 28  ARG A HG3  7  
ATOM 9959  H HD2  . ARG A 1 28  ? 2.079   2.004   -10.656 1.00 0.00 ? 28  ARG A HD2  7  
ATOM 9960  H HD3  . ARG A 1 28  ? 1.104   3.369   -10.112 1.00 0.00 ? 28  ARG A HD3  7  
ATOM 9961  H HE   . ARG A 1 28  ? 3.485   4.330   -11.253 1.00 0.00 ? 28  ARG A HE   7  
ATOM 9962  H HH11 . ARG A 1 28  ? 0.509   2.768   -12.159 1.00 0.00 ? 28  ARG A HH11 7  
ATOM 9963  H HH12 . ARG A 1 28  ? 0.491   3.438   -13.757 1.00 0.00 ? 28  ARG A HH12 7  
ATOM 9964  H HH21 . ARG A 1 28  ? 3.473   5.219   -13.354 1.00 0.00 ? 28  ARG A HH21 7  
ATOM 9965  H HH22 . ARG A 1 28  ? 2.178   4.832   -14.435 1.00 0.00 ? 28  ARG A HH22 7  
ATOM 9966  N N    . GLY A 1 29  ? 7.000   3.632   -8.703  1.00 0.00 ? 29  GLY A N    7  
ATOM 9967  C CA   . GLY A 1 29  ? 7.732   4.859   -8.955  1.00 0.00 ? 29  GLY A CA   7  
ATOM 9968  C C    . GLY A 1 29  ? 9.234   4.654   -8.928  1.00 0.00 ? 29  GLY A C    7  
ATOM 9969  O O    . GLY A 1 29  ? 9.743   3.670   -9.463  1.00 0.00 ? 29  GLY A O    7  
ATOM 9970  H H    . GLY A 1 29  ? 7.412   2.766   -8.908  1.00 0.00 ? 29  GLY A H    7  
ATOM 9971  H HA2  . GLY A 1 29  ? 7.449   5.242   -9.924  1.00 0.00 ? 29  GLY A HA2  7  
ATOM 9972  H HA3  . GLY A 1 29  ? 7.466   5.585   -8.201  1.00 0.00 ? 29  GLY A HA3  7  
ATOM 9973  N N    . GLY A 1 30  ? 9.946   5.587   -8.304  1.00 0.00 ? 30  GLY A N    7  
ATOM 9974  C CA   . GLY A 1 30  ? 11.392  5.487   -8.222  1.00 0.00 ? 30  GLY A CA   7  
ATOM 9975  C C    . GLY A 1 30  ? 12.093  6.624   -8.939  1.00 0.00 ? 30  GLY A C    7  
ATOM 9976  O O    . GLY A 1 30  ? 11.534  7.228   -9.854  1.00 0.00 ? 30  GLY A O    7  
ATOM 9977  H H    . GLY A 1 30  ? 9.486   6.350   -7.895  1.00 0.00 ? 30  GLY A H    7  
ATOM 9978  H HA2  . GLY A 1 30  ? 11.684  5.496   -7.183  1.00 0.00 ? 30  GLY A HA2  7  
ATOM 9979  H HA3  . GLY A 1 30  ? 11.701  4.552   -8.666  1.00 0.00 ? 30  GLY A HA3  7  
ATOM 9980  N N    . ALA A 1 31  ? 13.320  6.916   -8.523  1.00 0.00 ? 31  ALA A N    7  
ATOM 9981  C CA   . ALA A 1 31  ? 14.099  7.987   -9.131  1.00 0.00 ? 31  ALA A CA   7  
ATOM 9982  C C    . ALA A 1 31  ? 14.399  7.684   -10.595 1.00 0.00 ? 31  ALA A C    7  
ATOM 9983  O O    . ALA A 1 31  ? 14.950  8.520   -11.312 1.00 0.00 ? 31  ALA A O    7  
ATOM 9984  C CB   . ALA A 1 31  ? 15.392  8.205   -8.360  1.00 0.00 ? 31  ALA A CB   7  
ATOM 9985  H H    . ALA A 1 31  ? 13.712  6.398   -7.789  1.00 0.00 ? 31  ALA A H    7  
ATOM 9986  H HA   . ALA A 1 31  ? 13.517  8.897   -9.075  1.00 0.00 ? 31  ALA A HA   7  
ATOM 9987  H HB1  . ALA A 1 31  ? 15.160  8.488   -7.343  1.00 0.00 ? 31  ALA A HB1  7  
ATOM 9988  H HB2  . ALA A 1 31  ? 15.967  7.291   -8.357  1.00 0.00 ? 31  ALA A HB2  7  
ATOM 9989  H HB3  . ALA A 1 31  ? 15.964  8.990   -8.830  1.00 0.00 ? 31  ALA A HB3  7  
ATOM 9990  N N    . ARG A 1 32  ? 14.035  6.483   -11.033 1.00 0.00 ? 32  ARG A N    7  
ATOM 9991  C CA   . ARG A 1 32  ? 14.267  6.069   -12.411 1.00 0.00 ? 32  ARG A CA   7  
ATOM 9992  C C    . ARG A 1 32  ? 13.024  5.406   -12.997 1.00 0.00 ? 32  ARG A C    7  
ATOM 9993  O O    . ARG A 1 32  ? 12.745  5.530   -14.188 1.00 0.00 ? 32  ARG A O    7  
ATOM 9994  C CB   . ARG A 1 32  ? 15.454  5.107   -12.484 1.00 0.00 ? 32  ARG A CB   7  
ATOM 9995  C CG   . ARG A 1 32  ? 16.798  5.778   -12.251 1.00 0.00 ? 32  ARG A CG   7  
ATOM 9996  C CD   . ARG A 1 32  ? 17.202  6.642   -13.435 1.00 0.00 ? 32  ARG A CD   7  
ATOM 9997  N NE   . ARG A 1 32  ? 18.652  6.773   -13.548 1.00 0.00 ? 32  ARG A NE   7  
ATOM 9998  C CZ   . ARG A 1 32  ? 19.458  5.766   -13.867 1.00 0.00 ? 32  ARG A CZ   7  
ATOM 9999  N NH1  . ARG A 1 32  ? 18.957  4.562   -14.105 1.00 0.00 ? 32  ARG A NH1  7  
ATOM 10000 N NH2  . ARG A 1 32  ? 20.767  5.964   -13.950 1.00 0.00 ? 32  ARG A NH2  7  
ATOM 10001 H H    . ARG A 1 32  ? 13.600  5.860   -10.414 1.00 0.00 ? 32  ARG A H    7  
ATOM 10002 H HA   . ARG A 1 32  ? 14.496  6.952   -12.989 1.00 0.00 ? 32  ARG A HA   7  
ATOM 10003 H HB2  . ARG A 1 32  ? 15.326  4.338   -11.736 1.00 0.00 ? 32  ARG A HB2  7  
ATOM 10004 H HB3  . ARG A 1 32  ? 15.470  4.648   -13.461 1.00 0.00 ? 32  ARG A HB3  7  
ATOM 10005 H HG2  . ARG A 1 32  ? 16.731  6.401   -11.371 1.00 0.00 ? 32  ARG A HG2  7  
ATOM 10006 H HG3  . ARG A 1 32  ? 17.548  5.016   -12.099 1.00 0.00 ? 32  ARG A HG3  7  
ATOM 10007 H HD2  . ARG A 1 32  ? 16.819  6.193   -14.339 1.00 0.00 ? 32  ARG A HD2  7  
ATOM 10008 H HD3  . ARG A 1 32  ? 16.770  7.624   -13.310 1.00 0.00 ? 32  ARG A HD3  7  
ATOM 10009 H HE   . ARG A 1 32  ? 19.043  7.654   -13.376 1.00 0.00 ? 32  ARG A HE   7  
ATOM 10010 H HH11 . ARG A 1 32  ? 17.971  4.410   -14.044 1.00 0.00 ? 32  ARG A HH11 7  
ATOM 10011 H HH12 . ARG A 1 32  ? 19.566  3.806   -14.347 1.00 0.00 ? 32  ARG A HH12 7  
ATOM 10012 H HH21 . ARG A 1 32  ? 21.148  6.870   -13.772 1.00 0.00 ? 32  ARG A HH21 7  
ATOM 10013 H HH22 . ARG A 1 32  ? 21.373  5.206   -14.191 1.00 0.00 ? 32  ARG A HH22 7  
ATOM 10014 N N    . GLY A 1 33  ? 12.281  4.701   -12.149 1.00 0.00 ? 33  GLY A N    7  
ATOM 10015 C CA   . GLY A 1 33  ? 11.077  4.028   -12.601 1.00 0.00 ? 33  GLY A CA   7  
ATOM 10016 C C    . GLY A 1 33  ? 10.358  4.796   -13.693 1.00 0.00 ? 33  GLY A C    7  
ATOM 10017 O O    . GLY A 1 33  ? 9.777   5.852   -13.440 1.00 0.00 ? 33  GLY A O    7  
ATOM 10018 H H    . GLY A 1 33  ? 12.552  4.637   -11.210 1.00 0.00 ? 33  GLY A H    7  
ATOM 10019 H HA2  . GLY A 1 33  ? 11.343  3.052   -12.977 1.00 0.00 ? 33  GLY A HA2  7  
ATOM 10020 H HA3  . GLY A 1 33  ? 10.408  3.909   -11.761 1.00 0.00 ? 33  GLY A HA3  7  
ATOM 10021 N N    . HIS A 1 34  ? 10.399  4.267   -14.911 1.00 0.00 ? 34  HIS A N    7  
ATOM 10022 C CA   . HIS A 1 34  ? 9.747   4.910   -16.046 1.00 0.00 ? 34  HIS A CA   7  
ATOM 10023 C C    . HIS A 1 34  ? 8.441   5.573   -15.619 1.00 0.00 ? 34  HIS A C    7  
ATOM 10024 O O    . HIS A 1 34  ? 7.598   4.947   -14.977 1.00 0.00 ? 34  HIS A O    7  
ATOM 10025 C CB   . HIS A 1 34  ? 9.477   3.890   -17.152 1.00 0.00 ? 34  HIS A CB   7  
ATOM 10026 C CG   . HIS A 1 34  ? 10.711  3.195   -17.641 1.00 0.00 ? 34  HIS A CG   7  
ATOM 10027 N ND1  . HIS A 1 34  ? 10.687  1.955   -18.243 1.00 0.00 ? 34  HIS A ND1  7  
ATOM 10028 C CD2  . HIS A 1 34  ? 12.010  3.574   -17.614 1.00 0.00 ? 34  HIS A CD2  7  
ATOM 10029 C CE1  . HIS A 1 34  ? 11.918  1.600   -18.564 1.00 0.00 ? 34  HIS A CE1  7  
ATOM 10030 N NE2  . HIS A 1 34  ? 12.740  2.566   -18.194 1.00 0.00 ? 34  HIS A NE2  7  
ATOM 10031 H H    . HIS A 1 34  ? 10.878  3.423   -15.050 1.00 0.00 ? 34  HIS A H    7  
ATOM 10032 H HA   . HIS A 1 34  ? 10.414  5.670   -16.425 1.00 0.00 ? 34  HIS A HA   7  
ATOM 10033 H HB2  . HIS A 1 34  ? 8.798   3.137   -16.780 1.00 0.00 ? 34  HIS A HB2  7  
ATOM 10034 H HB3  . HIS A 1 34  ? 9.023   4.393   -17.995 1.00 0.00 ? 34  HIS A HB3  7  
ATOM 10035 H HD1  . HIS A 1 34  ? 9.887   1.414   -18.409 1.00 0.00 ? 34  HIS A HD1  7  
ATOM 10036 H HD2  . HIS A 1 34  ? 12.401  4.498   -17.211 1.00 0.00 ? 34  HIS A HD2  7  
ATOM 10037 H HE1  . HIS A 1 34  ? 12.205  0.679   -19.048 1.00 0.00 ? 34  HIS A HE1  7  
ATOM 10038 H HE2  . HIS A 1 34  ? 13.718  2.522   -18.237 1.00 0.00 ? 34  HIS A HE2  7  
ATOM 10039 N N    . ALA A 1 35  ? 8.282   6.842   -15.978 1.00 0.00 ? 35  ALA A N    7  
ATOM 10040 C CA   . ALA A 1 35  ? 7.078   7.589   -15.633 1.00 0.00 ? 35  ALA A CA   7  
ATOM 10041 C C    . ALA A 1 35  ? 6.547   7.172   -14.266 1.00 0.00 ? 35  ALA A C    7  
ATOM 10042 O O    . ALA A 1 35  ? 5.341   7.022   -14.077 1.00 0.00 ? 35  ALA A O    7  
ATOM 10043 C CB   . ALA A 1 35  ? 6.010   7.391   -16.699 1.00 0.00 ? 35  ALA A CB   7  
ATOM 10044 H H    . ALA A 1 35  ? 8.990   7.287   -16.489 1.00 0.00 ? 35  ALA A H    7  
ATOM 10045 H HA   . ALA A 1 35  ? 7.333   8.639   -15.605 1.00 0.00 ? 35  ALA A HA   7  
ATOM 10046 H HB1  . ALA A 1 35  ? 5.950   6.343   -16.956 1.00 0.00 ? 35  ALA A HB1  7  
ATOM 10047 H HB2  . ALA A 1 35  ? 5.057   7.724   -16.319 1.00 0.00 ? 35  ALA A HB2  7  
ATOM 10048 H HB3  . ALA A 1 35  ? 6.268   7.963   -17.577 1.00 0.00 ? 35  ALA A HB3  7  
ATOM 10049 N N    . GLY A 1 36  ? 7.457   6.986   -13.314 1.00 0.00 ? 36  GLY A N    7  
ATOM 10050 C CA   . GLY A 1 36  ? 7.061   6.588   -11.976 1.00 0.00 ? 36  GLY A CA   7  
ATOM 10051 C C    . GLY A 1 36  ? 5.740   7.202   -11.556 1.00 0.00 ? 36  GLY A C    7  
ATOM 10052 O O    . GLY A 1 36  ? 4.849   6.503   -11.073 1.00 0.00 ? 36  GLY A O    7  
ATOM 10053 H H    . GLY A 1 36  ? 8.406   7.121   -13.522 1.00 0.00 ? 36  GLY A H    7  
ATOM 10054 H HA2  . GLY A 1 36  ? 6.973   5.512   -11.944 1.00 0.00 ? 36  GLY A HA2  7  
ATOM 10055 H HA3  . GLY A 1 36  ? 7.826   6.898   -11.279 1.00 0.00 ? 36  GLY A HA3  7  
ATOM 10056 N N    . ASN A 1 37  ? 5.613   8.512   -11.739 1.00 0.00 ? 37  ASN A N    7  
ATOM 10057 C CA   . ASN A 1 37  ? 4.392   9.220   -11.373 1.00 0.00 ? 37  ASN A CA   7  
ATOM 10058 C C    . ASN A 1 37  ? 3.315   9.032   -12.437 1.00 0.00 ? 37  ASN A C    7  
ATOM 10059 O O    . ASN A 1 37  ? 3.527   9.286   -13.623 1.00 0.00 ? 37  ASN A O    7  
ATOM 10060 C CB   . ASN A 1 37  ? 4.680   10.710  -11.180 1.00 0.00 ? 37  ASN A CB   7  
ATOM 10061 C CG   . ASN A 1 37  ? 3.511   11.449  -10.557 1.00 0.00 ? 37  ASN A CG   7  
ATOM 10062 O OD1  . ASN A 1 37  ? 2.352   11.095  -10.774 1.00 0.00 ? 37  ASN A OD1  7  
ATOM 10063 N ND2  . ASN A 1 37  ? 3.812   12.482  -9.779  1.00 0.00 ? 37  ASN A ND2  7  
ATOM 10064 H H    . ASN A 1 37  ? 6.358   9.015   -12.128 1.00 0.00 ? 37  ASN A H    7  
ATOM 10065 H HA   . ASN A 1 37  ? 4.036   8.808   -10.441 1.00 0.00 ? 37  ASN A HA   7  
ATOM 10066 H HB2  . ASN A 1 37  ? 5.538   10.824  -10.534 1.00 0.00 ? 37  ASN A HB2  7  
ATOM 10067 H HB3  . ASN A 1 37  ? 4.894   11.157  -12.140 1.00 0.00 ? 37  ASN A HB3  7  
ATOM 10068 H HD21 . ASN A 1 37  ? 4.758   12.706  -9.651  1.00 0.00 ? 37  ASN A HD21 7  
ATOM 10069 H HD22 . ASN A 1 37  ? 3.076   12.977  -9.362  1.00 0.00 ? 37  ASN A HD22 7  
ATOM 10070 N N    . PRO A 1 38  ? 2.129   8.577   -12.005 1.00 0.00 ? 38  PRO A N    7  
ATOM 10071 C CA   . PRO A 1 38  ? 0.994   8.346   -12.904 1.00 0.00 ? 38  PRO A CA   7  
ATOM 10072 C C    . PRO A 1 38  ? 0.409   9.646   -13.444 1.00 0.00 ? 38  PRO A C    7  
ATOM 10073 O O    . PRO A 1 38  ? -0.558  9.633   -14.206 1.00 0.00 ? 38  PRO A O    7  
ATOM 10074 C CB   . PRO A 1 38  ? -0.024  7.631   -12.013 1.00 0.00 ? 38  PRO A CB   7  
ATOM 10075 C CG   . PRO A 1 38  ? 0.313   8.064   -10.628 1.00 0.00 ? 38  PRO A CG   7  
ATOM 10076 C CD   . PRO A 1 38  ? 1.805   8.254   -10.605 1.00 0.00 ? 38  PRO A CD   7  
ATOM 10077 H HA   . PRO A 1 38  ? 1.266   7.705   -13.729 1.00 0.00 ? 38  PRO A HA   7  
ATOM 10078 H HB2  . PRO A 1 38  ? -1.024  7.933   -12.290 1.00 0.00 ? 38  PRO A HB2  7  
ATOM 10079 H HB3  . PRO A 1 38  ? 0.079   6.562   -12.128 1.00 0.00 ? 38  PRO A HB3  7  
ATOM 10080 H HG2  . PRO A 1 38  ? -0.186  8.994   -10.402 1.00 0.00 ? 38  PRO A HG2  7  
ATOM 10081 H HG3  . PRO A 1 38  ? 0.022   7.300   -9.923  1.00 0.00 ? 38  PRO A HG3  7  
ATOM 10082 H HD2  . PRO A 1 38  ? 2.072   9.069   -9.949  1.00 0.00 ? 38  PRO A HD2  7  
ATOM 10083 H HD3  . PRO A 1 38  ? 2.296   7.343   -10.297 1.00 0.00 ? 38  PRO A HD3  7  
ATOM 10084 N N    . ARG A 1 39  ? 1.001   10.767  -13.045 1.00 0.00 ? 39  ARG A N    7  
ATOM 10085 C CA   . ARG A 1 39  ? 0.537   12.076  -13.489 1.00 0.00 ? 39  ARG A CA   7  
ATOM 10086 C C    . ARG A 1 39  ? 1.605   12.777  -14.324 1.00 0.00 ? 39  ARG A C    7  
ATOM 10087 O O    . ARG A 1 39  ? 1.325   13.279  -15.413 1.00 0.00 ? 39  ARG A O    7  
ATOM 10088 C CB   . ARG A 1 39  ? 0.164   12.944  -12.286 1.00 0.00 ? 39  ARG A CB   7  
ATOM 10089 C CG   . ARG A 1 39  ? -1.183  12.593  -11.675 1.00 0.00 ? 39  ARG A CG   7  
ATOM 10090 C CD   . ARG A 1 39  ? -1.842  13.808  -11.042 1.00 0.00 ? 39  ARG A CD   7  
ATOM 10091 N NE   . ARG A 1 39  ? -2.199  14.817  -12.036 1.00 0.00 ? 39  ARG A NE   7  
ATOM 10092 C CZ   . ARG A 1 39  ? -2.920  15.898  -11.759 1.00 0.00 ? 39  ARG A CZ   7  
ATOM 10093 N NH1  . ARG A 1 39  ? -3.357  16.110  -10.526 1.00 0.00 ? 39  ARG A NH1  7  
ATOM 10094 N NH2  . ARG A 1 39  ? -3.205  16.770  -12.718 1.00 0.00 ? 39  ARG A NH2  7  
ATOM 10095 H H    . ARG A 1 39  ? 1.767   10.713  -12.437 1.00 0.00 ? 39  ARG A H    7  
ATOM 10096 H HA   . ARG A 1 39  ? -0.341  11.927  -14.100 1.00 0.00 ? 39  ARG A HA   7  
ATOM 10097 H HB2  . ARG A 1 39  ? 0.921   12.827  -11.524 1.00 0.00 ? 39  ARG A HB2  7  
ATOM 10098 H HB3  . ARG A 1 39  ? 0.135   13.977  -12.598 1.00 0.00 ? 39  ARG A HB3  7  
ATOM 10099 H HG2  . ARG A 1 39  ? -1.830  12.210  -12.450 1.00 0.00 ? 39  ARG A HG2  7  
ATOM 10100 H HG3  . ARG A 1 39  ? -1.038  11.837  -10.918 1.00 0.00 ? 39  ARG A HG3  7  
ATOM 10101 H HD2  . ARG A 1 39  ? -2.736  13.490  -10.529 1.00 0.00 ? 39  ARG A HD2  7  
ATOM 10102 H HD3  . ARG A 1 39  ? -1.155  14.244  -10.332 1.00 0.00 ? 39  ARG A HD3  7  
ATOM 10103 H HE   . ARG A 1 39  ? -1.887  14.680  -12.954 1.00 0.00 ? 39  ARG A HE   7  
ATOM 10104 H HH11 . ARG A 1 39  ? -3.143  15.455  -9.801  1.00 0.00 ? 39  ARG A HH11 7  
ATOM 10105 H HH12 . ARG A 1 39  ? -3.898  16.925  -10.320 1.00 0.00 ? 39  ARG A HH12 7  
ATOM 10106 H HH21 . ARG A 1 39  ? -2.877  16.614  -13.649 1.00 0.00 ? 39  ARG A HH21 7  
ATOM 10107 H HH22 . ARG A 1 39  ? -3.747  17.583  -12.509 1.00 0.00 ? 39  ARG A HH22 7  
ATOM 10108 N N    . ASP A 1 40  ? 2.827   12.808  -13.806 1.00 0.00 ? 40  ASP A N    7  
ATOM 10109 C CA   . ASP A 1 40  ? 3.937   13.446  -14.503 1.00 0.00 ? 40  ASP A CA   7  
ATOM 10110 C C    . ASP A 1 40  ? 5.008   12.424  -14.871 1.00 0.00 ? 40  ASP A C    7  
ATOM 10111 O O    . ASP A 1 40  ? 5.744   11.926  -14.019 1.00 0.00 ? 40  ASP A O    7  
ATOM 10112 C CB   . ASP A 1 40  ? 4.545   14.551  -13.637 1.00 0.00 ? 40  ASP A CB   7  
ATOM 10113 C CG   . ASP A 1 40  ? 3.816   15.871  -13.787 1.00 0.00 ? 40  ASP A CG   7  
ATOM 10114 O OD1  . ASP A 1 40  ? 2.640   15.950  -13.375 1.00 0.00 ? 40  ASP A OD1  7  
ATOM 10115 O OD2  . ASP A 1 40  ? 4.421   16.826  -14.318 1.00 0.00 ? 40  ASP A OD2  7  
ATOM 10116 H H    . ASP A 1 40  ? 2.988   12.390  -12.934 1.00 0.00 ? 40  ASP A H    7  
ATOM 10117 H HA   . ASP A 1 40  ? 3.550   13.885  -15.411 1.00 0.00 ? 40  ASP A HA   7  
ATOM 10118 H HB2  . ASP A 1 40  ? 4.499   14.252  -12.600 1.00 0.00 ? 40  ASP A HB2  7  
ATOM 10119 H HB3  . ASP A 1 40  ? 5.577   14.695  -13.920 1.00 0.00 ? 40  ASP A HB3  7  
ATOM 10120 N N    . PRO A 1 41  ? 5.099   12.102  -16.170 1.00 0.00 ? 41  PRO A N    7  
ATOM 10121 C CA   . PRO A 1 41  ? 6.076   11.136  -16.680 1.00 0.00 ? 41  PRO A CA   7  
ATOM 10122 C C    . PRO A 1 41  ? 7.505   11.665  -16.611 1.00 0.00 ? 41  PRO A C    7  
ATOM 10123 O O    . PRO A 1 41  ? 8.466   10.910  -16.755 1.00 0.00 ? 41  PRO A O    7  
ATOM 10124 C CB   . PRO A 1 41  ? 5.650   10.936  -18.137 1.00 0.00 ? 41  PRO A CB   7  
ATOM 10125 C CG   . PRO A 1 41  ? 4.935   12.192  -18.498 1.00 0.00 ? 41  PRO A CG   7  
ATOM 10126 C CD   . PRO A 1 41  ? 4.254   12.657  -17.241 1.00 0.00 ? 41  PRO A CD   7  
ATOM 10127 H HA   . PRO A 1 41  ? 6.016   10.195  -16.153 1.00 0.00 ? 41  PRO A HA   7  
ATOM 10128 H HB2  . PRO A 1 41  ? 6.525   10.787  -18.753 1.00 0.00 ? 41  PRO A HB2  7  
ATOM 10129 H HB3  . PRO A 1 41  ? 5.001   10.077  -18.210 1.00 0.00 ? 41  PRO A HB3  7  
ATOM 10130 H HG2  . PRO A 1 41  ? 5.643   12.932  -18.838 1.00 0.00 ? 41  PRO A HG2  7  
ATOM 10131 H HG3  . PRO A 1 41  ? 4.204   11.989  -19.267 1.00 0.00 ? 41  PRO A HG3  7  
ATOM 10132 H HD2  . PRO A 1 41  ? 4.237   13.736  -17.199 1.00 0.00 ? 41  PRO A HD2  7  
ATOM 10133 H HD3  . PRO A 1 41  ? 3.251   12.259  -17.185 1.00 0.00 ? 41  PRO A HD3  7  
ATOM 10134 N N    . THR A 1 42  ? 7.638   12.970  -16.389 1.00 0.00 ? 42  THR A N    7  
ATOM 10135 C CA   . THR A 1 42  ? 8.949   13.600  -16.302 1.00 0.00 ? 42  THR A CA   7  
ATOM 10136 C C    . THR A 1 42  ? 9.332   13.873  -14.852 1.00 0.00 ? 42  THR A C    7  
ATOM 10137 O O    . THR A 1 42  ? 10.356  14.499  -14.578 1.00 0.00 ? 42  THR A O    7  
ATOM 10138 C CB   . THR A 1 42  ? 8.990   14.923  -17.089 1.00 0.00 ? 42  THR A CB   7  
ATOM 10139 O OG1  . THR A 1 42  ? 10.334  15.413  -17.155 1.00 0.00 ? 42  THR A OG1  7  
ATOM 10140 C CG2  . THR A 1 42  ? 8.095   15.968  -16.439 1.00 0.00 ? 42  THR A CG2  7  
ATOM 10141 H H    . THR A 1 42  ? 6.834   13.520  -16.283 1.00 0.00 ? 42  THR A H    7  
ATOM 10142 H HA   . THR A 1 42  ? 9.673   12.925  -16.735 1.00 0.00 ? 42  THR A HA   7  
ATOM 10143 H HB   . THR A 1 42  ? 8.632   14.738  -18.092 1.00 0.00 ? 42  THR A HB   7  
ATOM 10144 H HG1  . THR A 1 42  ? 10.609  15.709  -16.284 1.00 0.00 ? 42  THR A HG1  7  
ATOM 10145 H HG21 . THR A 1 42  ? 7.482   16.437  -17.194 1.00 0.00 ? 42  THR A HG21 7  
ATOM 10146 H HG22 . THR A 1 42  ? 8.707   16.715  -15.956 1.00 0.00 ? 42  THR A HG22 7  
ATOM 10147 H HG23 . THR A 1 42  ? 7.462   15.492  -15.706 1.00 0.00 ? 42  THR A HG23 7  
ATOM 10148 N N    . ASP A 1 43  ? 8.505   13.399  -13.927 1.00 0.00 ? 43  ASP A N    7  
ATOM 10149 C CA   . ASP A 1 43  ? 8.758   13.590  -12.504 1.00 0.00 ? 43  ASP A CA   7  
ATOM 10150 C C    . ASP A 1 43  ? 8.832   12.250  -11.780 1.00 0.00 ? 43  ASP A C    7  
ATOM 10151 O O    . ASP A 1 43  ? 7.827   11.554  -11.639 1.00 0.00 ? 43  ASP A O    7  
ATOM 10152 C CB   . ASP A 1 43  ? 7.665   14.460  -11.882 1.00 0.00 ? 43  ASP A CB   7  
ATOM 10153 C CG   . ASP A 1 43  ? 8.103   15.096  -10.577 1.00 0.00 ? 43  ASP A CG   7  
ATOM 10154 O OD1  . ASP A 1 43  ? 9.133   15.803  -10.577 1.00 0.00 ? 43  ASP A OD1  7  
ATOM 10155 O OD2  . ASP A 1 43  ? 7.416   14.888  -9.556  1.00 0.00 ? 43  ASP A OD2  7  
ATOM 10156 H H    . ASP A 1 43  ? 7.705   12.907  -14.208 1.00 0.00 ? 43  ASP A H    7  
ATOM 10157 H HA   . ASP A 1 43  ? 9.708   14.094  -12.401 1.00 0.00 ? 43  ASP A HA   7  
ATOM 10158 H HB2  . ASP A 1 43  ? 7.403   15.248  -12.574 1.00 0.00 ? 43  ASP A HB2  7  
ATOM 10159 H HB3  . ASP A 1 43  ? 6.794   13.850  -11.690 1.00 0.00 ? 43  ASP A HB3  7  
ATOM 10160 N N    . GLU A 1 44  ? 10.030  11.894  -11.324 1.00 0.00 ? 44  GLU A N    7  
ATOM 10161 C CA   . GLU A 1 44  ? 10.234  10.636  -10.616 1.00 0.00 ? 44  GLU A CA   7  
ATOM 10162 C C    . GLU A 1 44  ? 9.446   10.612  -9.310  1.00 0.00 ? 44  GLU A C    7  
ATOM 10163 O O    . GLU A 1 44  ? 9.982   10.910  -8.244  1.00 0.00 ? 44  GLU A O    7  
ATOM 10164 C CB   . GLU A 1 44  ? 11.722  10.421  -10.331 1.00 0.00 ? 44  GLU A CB   7  
ATOM 10165 C CG   . GLU A 1 44  ? 12.627  10.831  -11.481 1.00 0.00 ? 44  GLU A CG   7  
ATOM 10166 C CD   . GLU A 1 44  ? 13.032  12.290  -11.413 1.00 0.00 ? 44  GLU A CD   7  
ATOM 10167 O OE1  . GLU A 1 44  ? 13.139  12.826  -10.290 1.00 0.00 ? 44  GLU A OE1  7  
ATOM 10168 O OE2  . GLU A 1 44  ? 13.243  12.897  -12.484 1.00 0.00 ? 44  GLU A OE2  7  
ATOM 10169 H H    . GLU A 1 44  ? 10.793  12.492  -11.468 1.00 0.00 ? 44  GLU A H    7  
ATOM 10170 H HA   . GLU A 1 44  ? 9.880   9.837   -11.251 1.00 0.00 ? 44  GLU A HA   7  
ATOM 10171 H HB2  . GLU A 1 44  ? 11.996  10.999  -9.460  1.00 0.00 ? 44  GLU A HB2  7  
ATOM 10172 H HB3  . GLU A 1 44  ? 11.889  9.374   -10.125 1.00 0.00 ? 44  GLU A HB3  7  
ATOM 10173 H HG2  . GLU A 1 44  ? 13.520  10.224  -11.453 1.00 0.00 ? 44  GLU A HG2  7  
ATOM 10174 H HG3  . GLU A 1 44  ? 12.106  10.659  -12.411 1.00 0.00 ? 44  GLU A HG3  7  
ATOM 10175 N N    . GLY A 1 45  ? 8.168   10.255  -9.403  1.00 0.00 ? 45  GLY A N    7  
ATOM 10176 C CA   . GLY A 1 45  ? 7.326   10.199  -8.223  1.00 0.00 ? 45  GLY A CA   7  
ATOM 10177 C C    . GLY A 1 45  ? 7.002   8.777   -7.808  1.00 0.00 ? 45  GLY A C    7  
ATOM 10178 O O    . GLY A 1 45  ? 7.185   7.840   -8.585  1.00 0.00 ? 45  GLY A O    7  
ATOM 10179 H H    . GLY A 1 45  ? 7.795   10.028  -10.280 1.00 0.00 ? 45  GLY A H    7  
ATOM 10180 H HA2  . GLY A 1 45  ? 7.833   10.694  -7.408  1.00 0.00 ? 45  GLY A HA2  7  
ATOM 10181 H HA3  . GLY A 1 45  ? 6.403   10.720  -8.428  1.00 0.00 ? 45  GLY A HA3  7  
ATOM 10182 N N    . ILE A 1 46  ? 6.523   8.616   -6.579  1.00 0.00 ? 46  ILE A N    7  
ATOM 10183 C CA   . ILE A 1 46  ? 6.174   7.298   -6.063  1.00 0.00 ? 46  ILE A CA   7  
ATOM 10184 C C    . ILE A 1 46  ? 4.799   7.312   -5.403  1.00 0.00 ? 46  ILE A C    7  
ATOM 10185 O O    . ILE A 1 46  ? 4.585   8.001   -4.406  1.00 0.00 ? 46  ILE A O    7  
ATOM 10186 C CB   . ILE A 1 46  ? 7.215   6.799   -5.044  1.00 0.00 ? 46  ILE A CB   7  
ATOM 10187 C CG1  . ILE A 1 46  ? 8.605   6.757   -5.682  1.00 0.00 ? 46  ILE A CG1  7  
ATOM 10188 C CG2  . ILE A 1 46  ? 6.826   5.426   -4.518  1.00 0.00 ? 46  ILE A CG2  7  
ATOM 10189 C CD1  . ILE A 1 46  ? 9.733   6.887   -4.682  1.00 0.00 ? 46  ILE A CD1  7  
ATOM 10190 H H    . ILE A 1 46  ? 6.399   9.401   -6.007  1.00 0.00 ? 46  ILE A H    7  
ATOM 10191 H HA   . ILE A 1 46  ? 6.155   6.609   -6.895  1.00 0.00 ? 46  ILE A HA   7  
ATOM 10192 H HB   . ILE A 1 46  ? 7.229   7.486   -4.212  1.00 0.00 ? 46  ILE A HB   7  
ATOM 10193 H HG12 . ILE A 1 46  ? 8.729   5.819   -6.199  1.00 0.00 ? 46  ILE A HG12 7  
ATOM 10194 H HG13 . ILE A 1 46  ? 8.693   7.568   -6.390  1.00 0.00 ? 46  ILE A HG13 7  
ATOM 10195 H HG21 . ILE A 1 46  ? 7.543   4.693   -4.859  1.00 0.00 ? 46  ILE A HG21 7  
ATOM 10196 H HG22 . ILE A 1 46  ? 6.816   5.443   -3.439  1.00 0.00 ? 46  ILE A HG22 7  
ATOM 10197 H HG23 . ILE A 1 46  ? 5.844   5.165   -4.883  1.00 0.00 ? 46  ILE A HG23 7  
ATOM 10198 H HD11 . ILE A 1 46  ? 9.875   7.928   -4.432  1.00 0.00 ? 46  ILE A HD11 7  
ATOM 10199 H HD12 . ILE A 1 46  ? 9.489   6.331   -3.789  1.00 0.00 ? 46  ILE A HD12 7  
ATOM 10200 H HD13 . ILE A 1 46  ? 10.643  6.494   -5.113  1.00 0.00 ? 46  ILE A HD13 7  
ATOM 10201 N N    . PHE A 1 47  ? 3.871   6.545   -5.965  1.00 0.00 ? 47  PHE A N    7  
ATOM 10202 C CA   . PHE A 1 47  ? 2.516   6.469   -5.431  1.00 0.00 ? 47  PHE A CA   7  
ATOM 10203 C C    . PHE A 1 47  ? 2.083   5.016   -5.255  1.00 0.00 ? 47  PHE A C    7  
ATOM 10204 O O    . PHE A 1 47  ? 2.599   4.118   -5.921  1.00 0.00 ? 47  PHE A O    7  
ATOM 10205 C CB   . PHE A 1 47  ? 1.539   7.196   -6.356  1.00 0.00 ? 47  PHE A CB   7  
ATOM 10206 C CG   . PHE A 1 47  ? 1.977   8.587   -6.717  1.00 0.00 ? 47  PHE A CG   7  
ATOM 10207 C CD1  . PHE A 1 47  ? 3.155   8.797   -7.414  1.00 0.00 ? 47  PHE A CD1  7  
ATOM 10208 C CD2  . PHE A 1 47  ? 1.210   9.684   -6.359  1.00 0.00 ? 47  PHE A CD2  7  
ATOM 10209 C CE1  . PHE A 1 47  ? 3.561   10.075  -7.748  1.00 0.00 ? 47  PHE A CE1  7  
ATOM 10210 C CE2  . PHE A 1 47  ? 1.610   10.964  -6.691  1.00 0.00 ? 47  PHE A CE2  7  
ATOM 10211 C CZ   . PHE A 1 47  ? 2.788   11.160  -7.385  1.00 0.00 ? 47  PHE A CZ   7  
ATOM 10212 H H    . PHE A 1 47  ? 4.103   6.019   -6.759  1.00 0.00 ? 47  PHE A H    7  
ATOM 10213 H HA   . PHE A 1 47  ? 2.514   6.952   -4.466  1.00 0.00 ? 47  PHE A HA   7  
ATOM 10214 H HB2  . PHE A 1 47  ? 1.434   6.634   -7.272  1.00 0.00 ? 47  PHE A HB2  7  
ATOM 10215 H HB3  . PHE A 1 47  ? 0.578   7.265   -5.869  1.00 0.00 ? 47  PHE A HB3  7  
ATOM 10216 H HD1  . PHE A 1 47  ? 3.762   7.948   -7.699  1.00 0.00 ? 47  PHE A HD1  7  
ATOM 10217 H HD2  . PHE A 1 47  ? 0.289   9.532   -5.815  1.00 0.00 ? 47  PHE A HD2  7  
ATOM 10218 H HE1  . PHE A 1 47  ? 4.483   10.225  -8.291  1.00 0.00 ? 47  PHE A HE1  7  
ATOM 10219 H HE2  . PHE A 1 47  ? 1.004   11.811  -6.405  1.00 0.00 ? 47  PHE A HE2  7  
ATOM 10220 H HZ   . PHE A 1 47  ? 3.103   12.160  -7.646  1.00 0.00 ? 47  PHE A HZ   7  
ATOM 10221 N N    . ILE A 1 48  ? 1.132   4.794   -4.353  1.00 0.00 ? 48  ILE A N    7  
ATOM 10222 C CA   . ILE A 1 48  ? 0.629   3.452   -4.090  1.00 0.00 ? 48  ILE A CA   7  
ATOM 10223 C C    . ILE A 1 48  ? -0.074  2.878   -5.315  1.00 0.00 ? 48  ILE A C    7  
ATOM 10224 O O    . ILE A 1 48  ? -0.983  3.496   -5.868  1.00 0.00 ? 48  ILE A O    7  
ATOM 10225 C CB   . ILE A 1 48  ? -0.348  3.441   -2.899  1.00 0.00 ? 48  ILE A CB   7  
ATOM 10226 C CG1  . ILE A 1 48  ? 0.349   3.945   -1.634  1.00 0.00 ? 48  ILE A CG1  7  
ATOM 10227 C CG2  . ILE A 1 48  ? -0.904  2.041   -2.683  1.00 0.00 ? 48  ILE A CG2  7  
ATOM 10228 C CD1  . ILE A 1 48  ? -0.574  4.063   -0.442  1.00 0.00 ? 48  ILE A CD1  7  
ATOM 10229 H H    . ILE A 1 48  ? 0.760   5.551   -3.854  1.00 0.00 ? 48  ILE A H    7  
ATOM 10230 H HA   . ILE A 1 48  ? 1.472   2.823   -3.843  1.00 0.00 ? 48  ILE A HA   7  
ATOM 10231 H HB   . ILE A 1 48  ? -1.173  4.097   -3.133  1.00 0.00 ? 48  ILE A HB   7  
ATOM 10232 H HG12 . ILE A 1 48  ? 1.143   3.264   -1.372  1.00 0.00 ? 48  ILE A HG12 7  
ATOM 10233 H HG13 . ILE A 1 48  ? 0.768   4.922   -1.828  1.00 0.00 ? 48  ILE A HG13 7  
ATOM 10234 H HG21 . ILE A 1 48  ? -0.148  1.422   -2.223  1.00 0.00 ? 48  ILE A HG21 7  
ATOM 10235 H HG22 . ILE A 1 48  ? -1.767  2.093   -2.037  1.00 0.00 ? 48  ILE A HG22 7  
ATOM 10236 H HG23 . ILE A 1 48  ? -1.189  1.616   -3.633  1.00 0.00 ? 48  ILE A HG23 7  
ATOM 10237 H HD11 . ILE A 1 48  ? -0.897  5.089   -0.336  1.00 0.00 ? 48  ILE A HD11 7  
ATOM 10238 H HD12 . ILE A 1 48  ? -1.434  3.427   -0.587  1.00 0.00 ? 48  ILE A HD12 7  
ATOM 10239 H HD13 . ILE A 1 48  ? -0.048  3.760   0.452   1.00 0.00 ? 48  ILE A HD13 7  
ATOM 10240 N N    . SER A 1 49  ? 0.353   1.691   -5.733  1.00 0.00 ? 49  SER A N    7  
ATOM 10241 C CA   . SER A 1 49  ? -0.234  1.033   -6.895  1.00 0.00 ? 49  SER A CA   7  
ATOM 10242 C C    . SER A 1 49  ? -1.136  -0.121  -6.468  1.00 0.00 ? 49  SER A C    7  
ATOM 10243 O O    . SER A 1 49  ? -1.974  -0.589  -7.239  1.00 0.00 ? 49  SER A O    7  
ATOM 10244 C CB   . SER A 1 49  ? 0.866   0.518   -7.826  1.00 0.00 ? 49  SER A CB   7  
ATOM 10245 O OG   . SER A 1 49  ? 0.430   -0.620  -8.549  1.00 0.00 ? 49  SER A OG   7  
ATOM 10246 H H    . SER A 1 49  ? 1.082   1.248   -5.250  1.00 0.00 ? 49  SER A H    7  
ATOM 10247 H HA   . SER A 1 49  ? -0.829  1.763   -7.424  1.00 0.00 ? 49  SER A HA   7  
ATOM 10248 H HB2  . SER A 1 49  ? 1.133   1.294   -8.527  1.00 0.00 ? 49  SER A HB2  7  
ATOM 10249 H HB3  . SER A 1 49  ? 1.732   0.248   -7.240  1.00 0.00 ? 49  SER A HB3  7  
ATOM 10250 H HG   . SER A 1 49  ? -0.515  -0.560  -8.701  1.00 0.00 ? 49  SER A HG   7  
ATOM 10251 N N    . LYS A 1 50  ? -0.958  -0.577  -5.232  1.00 0.00 ? 50  LYS A N    7  
ATOM 10252 C CA   . LYS A 1 50  ? -1.755  -1.675  -4.699  1.00 0.00 ? 50  LYS A CA   7  
ATOM 10253 C C    . LYS A 1 50  ? -1.606  -1.770  -3.184  1.00 0.00 ? 50  LYS A C    7  
ATOM 10254 O O    . LYS A 1 50  ? -0.596  -1.348  -2.622  1.00 0.00 ? 50  LYS A O    7  
ATOM 10255 C CB   . LYS A 1 50  ? -1.337  -2.997  -5.347  1.00 0.00 ? 50  LYS A CB   7  
ATOM 10256 C CG   . LYS A 1 50  ? -1.749  -4.222  -4.550  1.00 0.00 ? 50  LYS A CG   7  
ATOM 10257 C CD   . LYS A 1 50  ? -1.070  -5.479  -5.068  1.00 0.00 ? 50  LYS A CD   7  
ATOM 10258 C CE   . LYS A 1 50  ? -1.908  -6.719  -4.794  1.00 0.00 ? 50  LYS A CE   7  
ATOM 10259 N NZ   . LYS A 1 50  ? -2.989  -6.891  -5.803  1.00 0.00 ? 50  LYS A NZ   7  
ATOM 10260 H H    . LYS A 1 50  ? -0.274  -0.163  -4.664  1.00 0.00 ? 50  LYS A H    7  
ATOM 10261 H HA   . LYS A 1 50  ? -2.790  -1.480  -4.936  1.00 0.00 ? 50  LYS A HA   7  
ATOM 10262 H HB2  . LYS A 1 50  ? -1.787  -3.062  -6.327  1.00 0.00 ? 50  LYS A HB2  7  
ATOM 10263 H HB3  . LYS A 1 50  ? -0.261  -3.008  -5.453  1.00 0.00 ? 50  LYS A HB3  7  
ATOM 10264 H HG2  . LYS A 1 50  ? -1.474  -4.078  -3.516  1.00 0.00 ? 50  LYS A HG2  7  
ATOM 10265 H HG3  . LYS A 1 50  ? -2.820  -4.346  -4.625  1.00 0.00 ? 50  LYS A HG3  7  
ATOM 10266 H HD2  . LYS A 1 50  ? -0.923  -5.386  -6.133  1.00 0.00 ? 50  LYS A HD2  7  
ATOM 10267 H HD3  . LYS A 1 50  ? -0.112  -5.588  -4.578  1.00 0.00 ? 50  LYS A HD3  7  
ATOM 10268 H HE2  . LYS A 1 50  ? -1.264  -7.585  -4.818  1.00 0.00 ? 50  LYS A HE2  7  
ATOM 10269 H HE3  . LYS A 1 50  ? -2.352  -6.627  -3.814  1.00 0.00 ? 50  LYS A HE3  7  
ATOM 10270 H HZ1  . LYS A 1 50  ? -2.785  -6.317  -6.646  1.00 0.00 ? 50  LYS A HZ1  7  
ATOM 10271 H HZ2  . LYS A 1 50  ? -3.901  -6.589  -5.405  1.00 0.00 ? 50  LYS A HZ2  7  
ATOM 10272 H HZ3  . LYS A 1 50  ? -3.060  -7.889  -6.085  1.00 0.00 ? 50  LYS A HZ3  7  
ATOM 10273 N N    . VAL A 1 51  ? -2.619  -2.328  -2.528  1.00 0.00 ? 51  VAL A N    7  
ATOM 10274 C CA   . VAL A 1 51  ? -2.599  -2.481  -1.078  1.00 0.00 ? 51  VAL A CA   7  
ATOM 10275 C C    . VAL A 1 51  ? -3.299  -3.766  -0.652  1.00 0.00 ? 51  VAL A C    7  
ATOM 10276 O O    . VAL A 1 51  ? -4.461  -3.993  -0.986  1.00 0.00 ? 51  VAL A O    7  
ATOM 10277 C CB   . VAL A 1 51  ? -3.274  -1.286  -0.379  1.00 0.00 ? 51  VAL A CB   7  
ATOM 10278 C CG1  . VAL A 1 51  ? -3.279  -1.482  1.129   1.00 0.00 ? 51  VAL A CG1  7  
ATOM 10279 C CG2  . VAL A 1 51  ? -2.577  0.013   -0.754  1.00 0.00 ? 51  VAL A CG2  7  
ATOM 10280 H H    . VAL A 1 51  ? -3.397  -2.645  -3.032  1.00 0.00 ? 51  VAL A H    7  
ATOM 10281 H HA   . VAL A 1 51  ? -1.567  -2.521  -0.761  1.00 0.00 ? 51  VAL A HA   7  
ATOM 10282 H HB   . VAL A 1 51  ? -4.299  -1.230  -0.716  1.00 0.00 ? 51  VAL A HB   7  
ATOM 10283 H HG11 . VAL A 1 51  ? -2.503  -0.876  1.573   1.00 0.00 ? 51  VAL A HG11 7  
ATOM 10284 H HG12 . VAL A 1 51  ? -4.239  -1.190  1.528   1.00 0.00 ? 51  VAL A HG12 7  
ATOM 10285 H HG13 . VAL A 1 51  ? -3.096  -2.522  1.357   1.00 0.00 ? 51  VAL A HG13 7  
ATOM 10286 H HG21 . VAL A 1 51  ? -1.687  0.129   -0.154  1.00 0.00 ? 51  VAL A HG21 7  
ATOM 10287 H HG22 . VAL A 1 51  ? -2.305  -0.011  -1.799  1.00 0.00 ? 51  VAL A HG22 7  
ATOM 10288 H HG23 . VAL A 1 51  ? -3.243  0.844   -0.575  1.00 0.00 ? 51  VAL A HG23 7  
ATOM 10289 N N    . SER A 1 52  ? -2.582  -4.605  0.089   1.00 0.00 ? 52  SER A N    7  
ATOM 10290 C CA   . SER A 1 52  ? -3.133  -5.871  0.560   1.00 0.00 ? 52  SER A CA   7  
ATOM 10291 C C    . SER A 1 52  ? -4.234  -5.635  1.589   1.00 0.00 ? 52  SER A C    7  
ATOM 10292 O O    . SER A 1 52  ? -4.088  -4.846  2.522   1.00 0.00 ? 52  SER A O    7  
ATOM 10293 C CB   . SER A 1 52  ? -2.028  -6.738  1.168   1.00 0.00 ? 52  SER A CB   7  
ATOM 10294 O OG   . SER A 1 52  ? -2.366  -8.112  1.107   1.00 0.00 ? 52  SER A OG   7  
ATOM 10295 H H    . SER A 1 52  ? -1.660  -4.368  0.323   1.00 0.00 ? 52  SER A H    7  
ATOM 10296 H HA   . SER A 1 52  ? -3.555  -6.385  -0.291  1.00 0.00 ? 52  SER A HA   7  
ATOM 10297 H HB2  . SER A 1 52  ? -1.110  -6.581  0.622   1.00 0.00 ? 52  SER A HB2  7  
ATOM 10298 H HB3  . SER A 1 52  ? -1.884  -6.460  2.202   1.00 0.00 ? 52  SER A HB3  7  
ATOM 10299 H HG   . SER A 1 52  ? -1.576  -8.630  0.936   1.00 0.00 ? 52  SER A HG   7  
ATOM 10300 N N    . PRO A 1 53  ? -5.364  -6.337  1.416   1.00 0.00 ? 53  PRO A N    7  
ATOM 10301 C CA   . PRO A 1 53  ? -6.513  -6.222  2.320   1.00 0.00 ? 53  PRO A CA   7  
ATOM 10302 C C    . PRO A 1 53  ? -6.233  -6.824  3.692   1.00 0.00 ? 53  PRO A C    7  
ATOM 10303 O O    . PRO A 1 53  ? -7.030  -6.680  4.620   1.00 0.00 ? 53  PRO A O    7  
ATOM 10304 C CB   . PRO A 1 53  ? -7.609  -7.013  1.602   1.00 0.00 ? 53  PRO A CB   7  
ATOM 10305 C CG   . PRO A 1 53  ? -6.875  -7.987  0.746   1.00 0.00 ? 53  PRO A CG   7  
ATOM 10306 C CD   . PRO A 1 53  ? -5.607  -7.296  0.326   1.00 0.00 ? 53  PRO A CD   7  
ATOM 10307 H HA   . PRO A 1 53  ? -6.825  -5.195  2.436   1.00 0.00 ? 53  PRO A HA   7  
ATOM 10308 H HB2  . PRO A 1 53  ? -8.230  -7.516  2.330   1.00 0.00 ? 53  PRO A HB2  7  
ATOM 10309 H HB3  . PRO A 1 53  ? -8.212  -6.343  1.008   1.00 0.00 ? 53  PRO A HB3  7  
ATOM 10310 H HG2  . PRO A 1 53  ? -6.646  -8.876  1.315   1.00 0.00 ? 53  PRO A HG2  7  
ATOM 10311 H HG3  . PRO A 1 53  ? -7.470  -8.237  -0.119  1.00 0.00 ? 53  PRO A HG3  7  
ATOM 10312 H HD2  . PRO A 1 53  ? -4.797  -8.006  0.249   1.00 0.00 ? 53  PRO A HD2  7  
ATOM 10313 H HD3  . PRO A 1 53  ? -5.751  -6.783  -0.613  1.00 0.00 ? 53  PRO A HD3  7  
ATOM 10314 N N    . THR A 1 54  ? -5.095  -7.501  3.816   1.00 0.00 ? 54  THR A N    7  
ATOM 10315 C CA   . THR A 1 54  ? -4.711  -8.126  5.075   1.00 0.00 ? 54  THR A CA   7  
ATOM 10316 C C    . THR A 1 54  ? -3.511  -7.419  5.696   1.00 0.00 ? 54  THR A C    7  
ATOM 10317 O O    . THR A 1 54  ? -3.146  -7.684  6.840   1.00 0.00 ? 54  THR A O    7  
ATOM 10318 C CB   . THR A 1 54  ? -4.371  -9.616  4.882   1.00 0.00 ? 54  THR A CB   7  
ATOM 10319 O OG1  . THR A 1 54  ? -3.205  -9.750  4.063   1.00 0.00 ? 54  THR A OG1  7  
ATOM 10320 C CG2  . THR A 1 54  ? -5.535  -10.357 4.242   1.00 0.00 ? 54  THR A CG2  7  
ATOM 10321 H H    . THR A 1 54  ? -4.502  -7.581  3.041   1.00 0.00 ? 54  THR A H    7  
ATOM 10322 H HA   . THR A 1 54  ? -5.549  -8.054  5.753   1.00 0.00 ? 54  THR A HA   7  
ATOM 10323 H HB   . THR A 1 54  ? -4.174  -10.053 5.851   1.00 0.00 ? 54  THR A HB   7  
ATOM 10324 H HG1  . THR A 1 54  ? -3.413  -9.487  3.164   1.00 0.00 ? 54  THR A HG1  7  
ATOM 10325 H HG21 . THR A 1 54  ? -5.155  -11.106 3.563   1.00 0.00 ? 54  THR A HG21 7  
ATOM 10326 H HG22 . THR A 1 54  ? -6.153  -9.658  3.699   1.00 0.00 ? 54  THR A HG22 7  
ATOM 10327 H HG23 . THR A 1 54  ? -6.123  -10.835 5.011   1.00 0.00 ? 54  THR A HG23 7  
ATOM 10328 N N    . GLY A 1 55  ? -2.901  -6.517  4.933   1.00 0.00 ? 55  GLY A N    7  
ATOM 10329 C CA   . GLY A 1 55  ? -1.749  -5.785  5.426   1.00 0.00 ? 55  GLY A CA   7  
ATOM 10330 C C    . GLY A 1 55  ? -2.120  -4.762  6.481   1.00 0.00 ? 55  GLY A C    7  
ATOM 10331 O O    . GLY A 1 55  ? -3.298  -4.471  6.686   1.00 0.00 ? 55  GLY A O    7  
ATOM 10332 H H    . GLY A 1 55  ? -3.237  -6.347  4.028   1.00 0.00 ? 55  GLY A H    7  
ATOM 10333 H HA2  . GLY A 1 55  ? -1.046  -6.486  5.851   1.00 0.00 ? 55  GLY A HA2  7  
ATOM 10334 H HA3  . GLY A 1 55  ? -1.279  -5.276  4.597   1.00 0.00 ? 55  GLY A HA3  7  
ATOM 10335 N N    . ALA A 1 56  ? -1.112  -4.216  7.153   1.00 0.00 ? 56  ALA A N    7  
ATOM 10336 C CA   . ALA A 1 56  ? -1.338  -3.219  8.193   1.00 0.00 ? 56  ALA A CA   7  
ATOM 10337 C C    . ALA A 1 56  ? -2.123  -2.029  7.651   1.00 0.00 ? 56  ALA A C    7  
ATOM 10338 O O    . ALA A 1 56  ? -2.939  -1.438  8.358   1.00 0.00 ? 56  ALA A O    7  
ATOM 10339 C CB   . ALA A 1 56  ? -0.012  -2.756  8.778   1.00 0.00 ? 56  ALA A CB   7  
ATOM 10340 H H    . ALA A 1 56  ? -0.194  -4.489  6.944   1.00 0.00 ? 56  ALA A H    7  
ATOM 10341 H HA   . ALA A 1 56  ? -1.909  -3.685  8.983   1.00 0.00 ? 56  ALA A HA   7  
ATOM 10342 H HB1  . ALA A 1 56  ? 0.536   -3.612  9.146   1.00 0.00 ? 56  ALA A HB1  7  
ATOM 10343 H HB2  . ALA A 1 56  ? 0.566   -2.261  8.012   1.00 0.00 ? 56  ALA A HB2  7  
ATOM 10344 H HB3  . ALA A 1 56  ? -0.197  -2.070  9.590   1.00 0.00 ? 56  ALA A HB3  7  
ATOM 10345 N N    . ALA A 1 57  ? -1.871  -1.683  6.393   1.00 0.00 ? 57  ALA A N    7  
ATOM 10346 C CA   . ALA A 1 57  ? -2.555  -0.565  5.756   1.00 0.00 ? 57  ALA A CA   7  
ATOM 10347 C C    . ALA A 1 57  ? -3.995  -0.928  5.409   1.00 0.00 ? 57  ALA A C    7  
ATOM 10348 O O    . ALA A 1 57  ? -4.938  -0.358  5.956   1.00 0.00 ? 57  ALA A O    7  
ATOM 10349 C CB   . ALA A 1 57  ? -1.803  -0.127  4.508   1.00 0.00 ? 57  ALA A CB   7  
ATOM 10350 H H    . ALA A 1 57  ? -1.210  -2.193  5.880   1.00 0.00 ? 57  ALA A H    7  
ATOM 10351 H HA   . ALA A 1 57  ? -2.561  0.262   6.451   1.00 0.00 ? 57  ALA A HA   7  
ATOM 10352 H HB1  . ALA A 1 57  ? -1.084  -0.887  4.237   1.00 0.00 ? 57  ALA A HB1  7  
ATOM 10353 H HB2  . ALA A 1 57  ? -2.502  0.012   3.697   1.00 0.00 ? 57  ALA A HB2  7  
ATOM 10354 H HB3  . ALA A 1 57  ? -1.290  0.802   4.704   1.00 0.00 ? 57  ALA A HB3  7  
ATOM 10355 N N    . GLY A 1 58  ? -4.156  -1.880  4.495   1.00 0.00 ? 58  GLY A N    7  
ATOM 10356 C CA   . GLY A 1 58  ? -5.485  -2.302  4.090   1.00 0.00 ? 58  GLY A CA   7  
ATOM 10357 C C    . GLY A 1 58  ? -6.442  -2.404  5.260   1.00 0.00 ? 58  GLY A C    7  
ATOM 10358 O O    . GLY A 1 58  ? -7.610  -2.028  5.150   1.00 0.00 ? 58  GLY A O    7  
ATOM 10359 H H    . GLY A 1 58  ? -3.367  -2.299  4.092   1.00 0.00 ? 58  GLY A H    7  
ATOM 10360 H HA2  . GLY A 1 58  ? -5.875  -1.589  3.379   1.00 0.00 ? 58  GLY A HA2  7  
ATOM 10361 H HA3  . GLY A 1 58  ? -5.413  -3.269  3.613   1.00 0.00 ? 58  GLY A HA3  7  
ATOM 10362 N N    . ARG A 1 59  ? -5.949  -2.915  6.383   1.00 0.00 ? 59  ARG A N    7  
ATOM 10363 C CA   . ARG A 1 59  ? -6.771  -3.068  7.578   1.00 0.00 ? 59  ARG A CA   7  
ATOM 10364 C C    . ARG A 1 59  ? -6.959  -1.729  8.284   1.00 0.00 ? 59  ARG A C    7  
ATOM 10365 O O    . ARG A 1 59  ? -7.969  -1.505  8.953   1.00 0.00 ? 59  ARG A O    7  
ATOM 10366 C CB   . ARG A 1 59  ? -6.133  -4.076  8.536   1.00 0.00 ? 59  ARG A CB   7  
ATOM 10367 C CG   . ARG A 1 59  ? -4.868  -3.564  9.205   1.00 0.00 ? 59  ARG A CG   7  
ATOM 10368 C CD   . ARG A 1 59  ? -4.266  -4.608  10.133  1.00 0.00 ? 59  ARG A CD   7  
ATOM 10369 N NE   . ARG A 1 59  ? -3.544  -3.999  11.247  1.00 0.00 ? 59  ARG A NE   7  
ATOM 10370 C CZ   . ARG A 1 59  ? -3.284  -4.630  12.386  1.00 0.00 ? 59  ARG A CZ   7  
ATOM 10371 N NH1  . ARG A 1 59  ? -3.685  -5.881  12.562  1.00 0.00 ? 59  ARG A NH1  7  
ATOM 10372 N NH2  . ARG A 1 59  ? -2.621  -4.009  13.354  1.00 0.00 ? 59  ARG A NH2  7  
ATOM 10373 H H    . ARG A 1 59  ? -5.011  -3.197  6.409   1.00 0.00 ? 59  ARG A H    7  
ATOM 10374 H HA   . ARG A 1 59  ? -7.737  -3.439  7.271   1.00 0.00 ? 59  ARG A HA   7  
ATOM 10375 H HB2  . ARG A 1 59  ? -6.847  -4.324  9.308   1.00 0.00 ? 59  ARG A HB2  7  
ATOM 10376 H HB3  . ARG A 1 59  ? -5.885  -4.971  7.985   1.00 0.00 ? 59  ARG A HB3  7  
ATOM 10377 H HG2  . ARG A 1 59  ? -4.144  -3.315  8.443   1.00 0.00 ? 59  ARG A HG2  7  
ATOM 10378 H HG3  . ARG A 1 59  ? -5.108  -2.681  9.778   1.00 0.00 ? 59  ARG A HG3  7  
ATOM 10379 H HD2  . ARG A 1 59  ? -5.062  -5.222  10.526  1.00 0.00 ? 59  ARG A HD2  7  
ATOM 10380 H HD3  . ARG A 1 59  ? -3.583  -5.222  9.566   1.00 0.00 ? 59  ARG A HD3  7  
ATOM 10381 H HE   . ARG A 1 59  ? -3.239  -3.075  11.139  1.00 0.00 ? 59  ARG A HE   7  
ATOM 10382 H HH11 . ARG A 1 59  ? -4.184  -6.352  11.834  1.00 0.00 ? 59  ARG A HH11 7  
ATOM 10383 H HH12 . ARG A 1 59  ? -3.487  -6.355  13.420  1.00 0.00 ? 59  ARG A HH12 7  
ATOM 10384 H HH21 . ARG A 1 59  ? -2.317  -3.065  13.225  1.00 0.00 ? 59  ARG A HH21 7  
ATOM 10385 H HH22 . ARG A 1 59  ? -2.426  -4.484  14.211  1.00 0.00 ? 59  ARG A HH22 7  
ATOM 10386 N N    . ASP A 1 60  ? -5.982  -0.843  8.130   1.00 0.00 ? 60  ASP A N    7  
ATOM 10387 C CA   . ASP A 1 60  ? -6.040  0.475   8.752   1.00 0.00 ? 60  ASP A CA   7  
ATOM 10388 C C    . ASP A 1 60  ? -7.330  1.197   8.376   1.00 0.00 ? 60  ASP A C    7  
ATOM 10389 O O    . ASP A 1 60  ? -8.165  1.485   9.232   1.00 0.00 ? 60  ASP A O    7  
ATOM 10390 C CB   . ASP A 1 60  ? -4.831  1.314   8.334   1.00 0.00 ? 60  ASP A CB   7  
ATOM 10391 C CG   . ASP A 1 60  ? -4.680  2.569   9.170   1.00 0.00 ? 60  ASP A CG   7  
ATOM 10392 O OD1  . ASP A 1 60  ? -5.630  3.379   9.201   1.00 0.00 ? 60  ASP A OD1  7  
ATOM 10393 O OD2  . ASP A 1 60  ? -3.612  2.743   9.793   1.00 0.00 ? 60  ASP A OD2  7  
ATOM 10394 H H    . ASP A 1 60  ? -5.203  -1.080  7.585   1.00 0.00 ? 60  ASP A H    7  
ATOM 10395 H HA   . ASP A 1 60  ? -6.018  0.338   9.822   1.00 0.00 ? 60  ASP A HA   7  
ATOM 10396 H HB2  . ASP A 1 60  ? -3.935  0.721   8.444   1.00 0.00 ? 60  ASP A HB2  7  
ATOM 10397 H HB3  . ASP A 1 60  ? -4.942  1.603   7.299   1.00 0.00 ? 60  ASP A HB3  7  
ATOM 10398 N N    . GLY A 1 61  ? -7.485  1.489   7.088   1.00 0.00 ? 61  GLY A N    7  
ATOM 10399 C CA   . GLY A 1 61  ? -8.675  2.176   6.621   1.00 0.00 ? 61  GLY A CA   7  
ATOM 10400 C C    . GLY A 1 61  ? -8.350  3.452   5.869   1.00 0.00 ? 61  GLY A C    7  
ATOM 10401 O O    . GLY A 1 61  ? -9.142  3.915   5.048   1.00 0.00 ? 61  GLY A O    7  
ATOM 10402 H H    . GLY A 1 61  ? -6.786  1.236   6.449   1.00 0.00 ? 61  GLY A H    7  
ATOM 10403 H HA2  . GLY A 1 61  ? -9.226  1.516   5.968   1.00 0.00 ? 61  GLY A HA2  7  
ATOM 10404 H HA3  . GLY A 1 61  ? -9.292  2.422   7.472   1.00 0.00 ? 61  GLY A HA3  7  
ATOM 10405 N N    . ARG A 1 62  ? -7.183  4.022   6.150   1.00 0.00 ? 62  ARG A N    7  
ATOM 10406 C CA   . ARG A 1 62  ? -6.757  5.254   5.497   1.00 0.00 ? 62  ARG A CA   7  
ATOM 10407 C C    . ARG A 1 62  ? -5.926  4.950   4.254   1.00 0.00 ? 62  ARG A C    7  
ATOM 10408 O O    . ARG A 1 62  ? -6.346  5.230   3.130   1.00 0.00 ? 62  ARG A O    7  
ATOM 10409 C CB   . ARG A 1 62  ? -5.948  6.117   6.466   1.00 0.00 ? 62  ARG A CB   7  
ATOM 10410 C CG   . ARG A 1 62  ? -6.550  6.196   7.860   1.00 0.00 ? 62  ARG A CG   7  
ATOM 10411 C CD   . ARG A 1 62  ? -7.718  7.168   7.908   1.00 0.00 ? 62  ARG A CD   7  
ATOM 10412 N NE   . ARG A 1 62  ? -8.884  6.658   7.192   1.00 0.00 ? 62  ARG A NE   7  
ATOM 10413 C CZ   . ARG A 1 62  ? -9.886  7.426   6.777   1.00 0.00 ? 62  ARG A CZ   7  
ATOM 10414 N NH1  . ARG A 1 62  ? -9.862  8.732   7.005   1.00 0.00 ? 62  ARG A NH1  7  
ATOM 10415 N NH2  . ARG A 1 62  ? -10.913 6.888   6.132   1.00 0.00 ? 62  ARG A NH2  7  
ATOM 10416 H H    . ARG A 1 62  ? -6.595  3.605   6.814   1.00 0.00 ? 62  ARG A H    7  
ATOM 10417 H HA   . ARG A 1 62  ? -7.643  5.795   5.200   1.00 0.00 ? 62  ARG A HA   7  
ATOM 10418 H HB2  . ARG A 1 62  ? -4.952  5.706   6.551   1.00 0.00 ? 62  ARG A HB2  7  
ATOM 10419 H HB3  . ARG A 1 62  ? -5.883  7.119   6.068   1.00 0.00 ? 62  ARG A HB3  7  
ATOM 10420 H HG2  . ARG A 1 62  ? -6.900  5.215   8.147   1.00 0.00 ? 62  ARG A HG2  7  
ATOM 10421 H HG3  . ARG A 1 62  ? -5.789  6.526   8.552   1.00 0.00 ? 62  ARG A HG3  7  
ATOM 10422 H HD2  . ARG A 1 62  ? -7.986  7.337   8.940   1.00 0.00 ? 62  ARG A HD2  7  
ATOM 10423 H HD3  . ARG A 1 62  ? -7.411  8.101   7.459   1.00 0.00 ? 62  ARG A HD3  7  
ATOM 10424 H HE   . ARG A 1 62  ? -8.922  5.696   7.013   1.00 0.00 ? 62  ARG A HE   7  
ATOM 10425 H HH11 . ARG A 1 62  ? -9.089  9.140   7.490   1.00 0.00 ? 62  ARG A HH11 7  
ATOM 10426 H HH12 . ARG A 1 62  ? -10.617 9.308   6.691   1.00 0.00 ? 62  ARG A HH12 7  
ATOM 10427 H HH21 . ARG A 1 62  ? -10.933 5.904   5.958   1.00 0.00 ? 62  ARG A HH21 7  
ATOM 10428 H HH22 . ARG A 1 62  ? -11.666 7.467   5.820   1.00 0.00 ? 62  ARG A HH22 7  
ATOM 10429 N N    . LEU A 1 63  ? -4.747  4.376   4.463   1.00 0.00 ? 63  LEU A N    7  
ATOM 10430 C CA   . LEU A 1 63  ? -3.856  4.034   3.359   1.00 0.00 ? 63  LEU A CA   7  
ATOM 10431 C C    . LEU A 1 63  ? -4.609  3.291   2.261   1.00 0.00 ? 63  LEU A C    7  
ATOM 10432 O O    . LEU A 1 63  ? -5.139  2.203   2.485   1.00 0.00 ? 63  LEU A O    7  
ATOM 10433 C CB   . LEU A 1 63  ? -2.692  3.179   3.863   1.00 0.00 ? 63  LEU A CB   7  
ATOM 10434 C CG   . LEU A 1 63  ? -1.514  3.015   2.903   1.00 0.00 ? 63  LEU A CG   7  
ATOM 10435 C CD1  . LEU A 1 63  ? -1.969  2.367   1.605   1.00 0.00 ? 63  LEU A CD1  7  
ATOM 10436 C CD2  . LEU A 1 63  ? -0.859  4.361   2.627   1.00 0.00 ? 63  LEU A CD2  7  
ATOM 10437 H H    . LEU A 1 63  ? -4.467  4.177   5.380   1.00 0.00 ? 63  LEU A H    7  
ATOM 10438 H HA   . LEU A 1 63  ? -3.465  4.955   2.952   1.00 0.00 ? 63  LEU A HA   7  
ATOM 10439 H HB2  . LEU A 1 63  ? -2.319  3.630   4.770   1.00 0.00 ? 63  LEU A HB2  7  
ATOM 10440 H HB3  . LEU A 1 63  ? -3.079  2.195   4.086   1.00 0.00 ? 63  LEU A HB3  7  
ATOM 10441 H HG   . LEU A 1 63  ? -0.775  2.370   3.357   1.00 0.00 ? 63  LEU A HG   7  
ATOM 10442 H HD11 . LEU A 1 63  ? -1.106  2.063   1.032   1.00 0.00 ? 63  LEU A HD11 7  
ATOM 10443 H HD12 . LEU A 1 63  ? -2.550  3.075   1.033   1.00 0.00 ? 63  LEU A HD12 7  
ATOM 10444 H HD13 . LEU A 1 63  ? -2.577  1.502   1.829   1.00 0.00 ? 63  LEU A HD13 7  
ATOM 10445 H HD21 . LEU A 1 63  ? -1.355  4.838   1.795   1.00 0.00 ? 63  LEU A HD21 7  
ATOM 10446 H HD22 . LEU A 1 63  ? 0.184   4.212   2.388   1.00 0.00 ? 63  LEU A HD22 7  
ATOM 10447 H HD23 . LEU A 1 63  ? -0.943  4.988   3.503   1.00 0.00 ? 63  LEU A HD23 7  
ATOM 10448 N N    . ARG A 1 64  ? -4.652  3.886   1.073   1.00 0.00 ? 64  ARG A N    7  
ATOM 10449 C CA   . ARG A 1 64  ? -5.340  3.280   -0.061  1.00 0.00 ? 64  ARG A CA   7  
ATOM 10450 C C    . ARG A 1 64  ? -4.580  3.538   -1.358  1.00 0.00 ? 64  ARG A C    7  
ATOM 10451 O O    . ARG A 1 64  ? -3.834  4.511   -1.471  1.00 0.00 ? 64  ARG A O    7  
ATOM 10452 C CB   . ARG A 1 64  ? -6.764  3.829   -0.173  1.00 0.00 ? 64  ARG A CB   7  
ATOM 10453 C CG   . ARG A 1 64  ? -6.827  5.261   -0.677  1.00 0.00 ? 64  ARG A CG   7  
ATOM 10454 C CD   . ARG A 1 64  ? -8.151  5.551   -1.366  1.00 0.00 ? 64  ARG A CD   7  
ATOM 10455 N NE   . ARG A 1 64  ? -9.256  5.632   -0.415  1.00 0.00 ? 64  ARG A NE   7  
ATOM 10456 C CZ   . ARG A 1 64  ? -10.403 6.252   -0.671  1.00 0.00 ? 64  ARG A CZ   7  
ATOM 10457 N NH1  . ARG A 1 64  ? -10.593 6.843   -1.843  1.00 0.00 ? 64  ARG A NH1  7  
ATOM 10458 N NH2  . ARG A 1 64  ? -11.361 6.282   0.245   1.00 0.00 ? 64  ARG A NH2  7  
ATOM 10459 H H    . ARG A 1 64  ? -4.211  4.754   0.956   1.00 0.00 ? 64  ARG A H    7  
ATOM 10460 H HA   . ARG A 1 64  ? -5.386  2.215   0.110   1.00 0.00 ? 64  ARG A HA   7  
ATOM 10461 H HB2  . ARG A 1 64  ? -7.324  3.205   -0.854  1.00 0.00 ? 64  ARG A HB2  7  
ATOM 10462 H HB3  . ARG A 1 64  ? -7.228  3.792   0.801   1.00 0.00 ? 64  ARG A HB3  7  
ATOM 10463 H HG2  . ARG A 1 64  ? -6.714  5.933   0.160   1.00 0.00 ? 64  ARG A HG2  7  
ATOM 10464 H HG3  . ARG A 1 64  ? -6.022  5.421   -1.380  1.00 0.00 ? 64  ARG A HG3  7  
ATOM 10465 H HD2  . ARG A 1 64  ? -8.070  6.492   -1.890  1.00 0.00 ? 64  ARG A HD2  7  
ATOM 10466 H HD3  . ARG A 1 64  ? -8.354  4.762   -2.074  1.00 0.00 ? 64  ARG A HD3  7  
ATOM 10467 H HE   . ARG A 1 64  ? -9.137  5.202   0.457   1.00 0.00 ? 64  ARG A HE   7  
ATOM 10468 H HH11 . ARG A 1 64  ? -9.873  6.821   -2.536  1.00 0.00 ? 64  ARG A HH11 7  
ATOM 10469 H HH12 . ARG A 1 64  ? -11.457 7.309   -2.034  1.00 0.00 ? 64  ARG A HH12 7  
ATOM 10470 H HH21 . ARG A 1 64  ? -11.222 5.838   1.130   1.00 0.00 ? 64  ARG A HH21 7  
ATOM 10471 H HH22 . ARG A 1 64  ? -12.223 6.750   0.052   1.00 0.00 ? 64  ARG A HH22 7  
ATOM 10472 N N    . VAL A 1 65  ? -4.775  2.659   -2.337  1.00 0.00 ? 65  VAL A N    7  
ATOM 10473 C CA   . VAL A 1 65  ? -4.109  2.791   -3.627  1.00 0.00 ? 65  VAL A CA   7  
ATOM 10474 C C    . VAL A 1 65  ? -4.503  4.092   -4.318  1.00 0.00 ? 65  VAL A C    7  
ATOM 10475 O O    . VAL A 1 65  ? -5.614  4.224   -4.828  1.00 0.00 ? 65  VAL A O    7  
ATOM 10476 C CB   . VAL A 1 65  ? -4.443  1.608   -4.555  1.00 0.00 ? 65  VAL A CB   7  
ATOM 10477 C CG1  . VAL A 1 65  ? -3.740  1.765   -5.895  1.00 0.00 ? 65  VAL A CG1  7  
ATOM 10478 C CG2  . VAL A 1 65  ? -4.063  0.291   -3.895  1.00 0.00 ? 65  VAL A CG2  7  
ATOM 10479 H H    . VAL A 1 65  ? -5.381  1.904   -2.187  1.00 0.00 ? 65  VAL A H    7  
ATOM 10480 H HA   . VAL A 1 65  ? -3.042  2.796   -3.453  1.00 0.00 ? 65  VAL A HA   7  
ATOM 10481 H HB   . VAL A 1 65  ? -5.508  1.605   -4.731  1.00 0.00 ? 65  VAL A HB   7  
ATOM 10482 H HG11 . VAL A 1 65  ? -4.035  2.700   -6.348  1.00 0.00 ? 65  VAL A HG11 7  
ATOM 10483 H HG12 . VAL A 1 65  ? -2.670  1.759   -5.743  1.00 0.00 ? 65  VAL A HG12 7  
ATOM 10484 H HG13 . VAL A 1 65  ? -4.017  0.948   -6.544  1.00 0.00 ? 65  VAL A HG13 7  
ATOM 10485 H HG21 . VAL A 1 65  ? -4.456  0.267   -2.890  1.00 0.00 ? 65  VAL A HG21 7  
ATOM 10486 H HG22 . VAL A 1 65  ? -4.478  -0.529  -4.464  1.00 0.00 ? 65  VAL A HG22 7  
ATOM 10487 H HG23 . VAL A 1 65  ? -2.988  0.200   -3.865  1.00 0.00 ? 65  VAL A HG23 7  
ATOM 10488 N N    . GLY A 1 66  ? -3.582  5.051   -4.331  1.00 0.00 ? 66  GLY A N    7  
ATOM 10489 C CA   . GLY A 1 66  ? -3.852  6.330   -4.963  1.00 0.00 ? 66  GLY A CA   7  
ATOM 10490 C C    . GLY A 1 66  ? -3.141  7.478   -4.274  1.00 0.00 ? 66  GLY A C    7  
ATOM 10491 O O    . GLY A 1 66  ? -2.838  8.495   -4.899  1.00 0.00 ? 66  GLY A O    7  
ATOM 10492 H H    . GLY A 1 66  ? -2.712  4.890   -3.908  1.00 0.00 ? 66  GLY A H    7  
ATOM 10493 H HA2  . GLY A 1 66  ? -3.529  6.286   -5.992  1.00 0.00 ? 66  GLY A HA2  7  
ATOM 10494 H HA3  . GLY A 1 66  ? -4.916  6.514   -4.937  1.00 0.00 ? 66  GLY A HA3  7  
ATOM 10495 N N    . LEU A 1 67  ? -2.875  7.318   -2.982  1.00 0.00 ? 67  LEU A N    7  
ATOM 10496 C CA   . LEU A 1 67  ? -2.197  8.351   -2.207  1.00 0.00 ? 67  LEU A CA   7  
ATOM 10497 C C    . LEU A 1 67  ? -0.709  8.394   -2.542  1.00 0.00 ? 67  LEU A C    7  
ATOM 10498 O O    . LEU A 1 67  ? -0.074  7.355   -2.724  1.00 0.00 ? 67  LEU A O    7  
ATOM 10499 C CB   . LEU A 1 67  ? -2.388  8.100   -0.710  1.00 0.00 ? 67  LEU A CB   7  
ATOM 10500 C CG   . LEU A 1 67  ? -3.783  8.386   -0.154  1.00 0.00 ? 67  LEU A CG   7  
ATOM 10501 C CD1  . LEU A 1 67  ? -4.771  7.329   -0.624  1.00 0.00 ? 67  LEU A CD1  7  
ATOM 10502 C CD2  . LEU A 1 67  ? -3.749  8.448   1.366   1.00 0.00 ? 67  LEU A CD2  7  
ATOM 10503 H H    . LEU A 1 67  ? -3.141  6.486   -2.539  1.00 0.00 ? 67  LEU A H    7  
ATOM 10504 H HA   . LEU A 1 67  ? -2.639  9.302   -2.464  1.00 0.00 ? 67  LEU A HA   7  
ATOM 10505 H HB2  . LEU A 1 67  ? -2.161  7.063   -0.517  1.00 0.00 ? 67  LEU A HB2  7  
ATOM 10506 H HB3  . LEU A 1 67  ? -1.684  8.726   -0.179  1.00 0.00 ? 67  LEU A HB3  7  
ATOM 10507 H HG   . LEU A 1 67  ? -4.121  9.345   -0.522  1.00 0.00 ? 67  LEU A HG   7  
ATOM 10508 H HD11 . LEU A 1 67  ? -5.771  7.621   -0.341  1.00 0.00 ? 67  LEU A HD11 7  
ATOM 10509 H HD12 . LEU A 1 67  ? -4.529  6.381   -0.167  1.00 0.00 ? 67  LEU A HD12 7  
ATOM 10510 H HD13 . LEU A 1 67  ? -4.713  7.235   -1.699  1.00 0.00 ? 67  LEU A HD13 7  
ATOM 10511 H HD21 . LEU A 1 67  ? -2.966  7.802   1.735   1.00 0.00 ? 67  LEU A HD21 7  
ATOM 10512 H HD22 . LEU A 1 67  ? -4.700  8.121   1.761   1.00 0.00 ? 67  LEU A HD22 7  
ATOM 10513 H HD23 . LEU A 1 67  ? -3.558  9.463   1.680   1.00 0.00 ? 67  LEU A HD23 7  
ATOM 10514 N N    . ARG A 1 68  ? -0.160  9.602   -2.618  1.00 0.00 ? 68  ARG A N    7  
ATOM 10515 C CA   . ARG A 1 68  ? 1.253   9.780   -2.930  1.00 0.00 ? 68  ARG A CA   7  
ATOM 10516 C C    . ARG A 1 68  ? 2.099   9.732   -1.661  1.00 0.00 ? 68  ARG A C    7  
ATOM 10517 O O    . ARG A 1 68  ? 1.908   10.532  -0.744  1.00 0.00 ? 68  ARG A O    7  
ATOM 10518 C CB   . ARG A 1 68  ? 1.474   11.110  -3.653  1.00 0.00 ? 68  ARG A CB   7  
ATOM 10519 C CG   . ARG A 1 68  ? 2.896   11.303  -4.152  1.00 0.00 ? 68  ARG A CG   7  
ATOM 10520 C CD   . ARG A 1 68  ? 3.101   12.696  -4.726  1.00 0.00 ? 68  ARG A CD   7  
ATOM 10521 N NE   . ARG A 1 68  ? 4.302   12.776  -5.553  1.00 0.00 ? 68  ARG A NE   7  
ATOM 10522 C CZ   . ARG A 1 68  ? 4.846   13.921  -5.950  1.00 0.00 ? 68  ARG A CZ   7  
ATOM 10523 N NH1  . ARG A 1 68  ? 4.300   15.076  -5.596  1.00 0.00 ? 68  ARG A NH1  7  
ATOM 10524 N NH2  . ARG A 1 68  ? 5.940   13.912  -6.701  1.00 0.00 ? 68  ARG A NH2  7  
ATOM 10525 H H    . ARG A 1 68  ? -0.719  10.392  -2.463  1.00 0.00 ? 68  ARG A H    7  
ATOM 10526 H HA   . ARG A 1 68  ? 1.554   8.972   -3.580  1.00 0.00 ? 68  ARG A HA   7  
ATOM 10527 H HB2  . ARG A 1 68  ? 0.808   11.159  -4.503  1.00 0.00 ? 68  ARG A HB2  7  
ATOM 10528 H HB3  . ARG A 1 68  ? 1.240   11.917  -2.976  1.00 0.00 ? 68  ARG A HB3  7  
ATOM 10529 H HG2  . ARG A 1 68  ? 3.579   11.162  -3.327  1.00 0.00 ? 68  ARG A HG2  7  
ATOM 10530 H HG3  . ARG A 1 68  ? 3.101   10.572  -4.920  1.00 0.00 ? 68  ARG A HG3  7  
ATOM 10531 H HD2  . ARG A 1 68  ? 2.243   12.952  -5.329  1.00 0.00 ? 68  ARG A HD2  7  
ATOM 10532 H HD3  . ARG A 1 68  ? 3.190   13.397  -3.910  1.00 0.00 ? 68  ARG A HD3  7  
ATOM 10533 H HE   . ARG A 1 68  ? 4.722   11.934  -5.826  1.00 0.00 ? 68  ARG A HE   7  
ATOM 10534 H HH11 . ARG A 1 68  ? 3.477   15.086  -5.029  1.00 0.00 ? 68  ARG A HH11 7  
ATOM 10535 H HH12 . ARG A 1 68  ? 4.712   15.937  -5.895  1.00 0.00 ? 68  ARG A HH12 7  
ATOM 10536 H HH21 . ARG A 1 68  ? 6.355   13.043  -6.970  1.00 0.00 ? 68  ARG A HH21 7  
ATOM 10537 H HH22 . ARG A 1 68  ? 6.349   14.774  -6.999  1.00 0.00 ? 68  ARG A HH22 7  
ATOM 10538 N N    . LEU A 1 69  ? 3.035   8.790   -1.616  1.00 0.00 ? 69  LEU A N    7  
ATOM 10539 C CA   . LEU A 1 69  ? 3.911   8.638   -0.459  1.00 0.00 ? 69  LEU A CA   7  
ATOM 10540 C C    . LEU A 1 69  ? 4.858   9.827   -0.332  1.00 0.00 ? 69  LEU A C    7  
ATOM 10541 O O    . LEU A 1 69  ? 5.815   9.957   -1.096  1.00 0.00 ? 69  LEU A O    7  
ATOM 10542 C CB   . LEU A 1 69  ? 4.715   7.341   -0.572  1.00 0.00 ? 69  LEU A CB   7  
ATOM 10543 C CG   . LEU A 1 69  ? 4.158   6.138   0.189   1.00 0.00 ? 69  LEU A CG   7  
ATOM 10544 C CD1  . LEU A 1 69  ? 4.468   6.254   1.673   1.00 0.00 ? 69  LEU A CD1  7  
ATOM 10545 C CD2  . LEU A 1 69  ? 2.658   6.013   -0.036  1.00 0.00 ? 69  LEU A CD2  7  
ATOM 10546 H H    . LEU A 1 69  ? 3.140   8.183   -2.377  1.00 0.00 ? 69  LEU A H    7  
ATOM 10547 H HA   . LEU A 1 69  ? 3.290   8.591   0.423   1.00 0.00 ? 69  LEU A HA   7  
ATOM 10548 H HB2  . LEU A 1 69  ? 4.770   7.076   -1.616  1.00 0.00 ? 69  LEU A HB2  7  
ATOM 10549 H HB3  . LEU A 1 69  ? 5.711   7.537   -0.199  1.00 0.00 ? 69  LEU A HB3  7  
ATOM 10550 H HG   . LEU A 1 69  ? 4.628   5.237   -0.181  1.00 0.00 ? 69  LEU A HG   7  
ATOM 10551 H HD11 . LEU A 1 69  ? 4.688   7.282   1.916   1.00 0.00 ? 69  LEU A HD11 7  
ATOM 10552 H HD12 . LEU A 1 69  ? 5.322   5.637   1.911   1.00 0.00 ? 69  LEU A HD12 7  
ATOM 10553 H HD13 . LEU A 1 69  ? 3.615   5.922   2.246   1.00 0.00 ? 69  LEU A HD13 7  
ATOM 10554 H HD21 . LEU A 1 69  ? 2.476   5.475   -0.955  1.00 0.00 ? 69  LEU A HD21 7  
ATOM 10555 H HD22 . LEU A 1 69  ? 2.221   6.999   -0.104  1.00 0.00 ? 69  LEU A HD22 7  
ATOM 10556 H HD23 . LEU A 1 69  ? 2.214   5.477   0.790   1.00 0.00 ? 69  LEU A HD23 7  
ATOM 10557 N N    . LEU A 1 70  ? 4.585   10.692  0.639   1.00 0.00 ? 70  LEU A N    7  
ATOM 10558 C CA   . LEU A 1 70  ? 5.414   11.871  0.868   1.00 0.00 ? 70  LEU A CA   7  
ATOM 10559 C C    . LEU A 1 70  ? 6.672   11.508  1.651   1.00 0.00 ? 70  LEU A C    7  
ATOM 10560 O O    . LEU A 1 70  ? 7.783   11.858  1.254   1.00 0.00 ? 70  LEU A O    7  
ATOM 10561 C CB   . LEU A 1 70  ? 4.620   12.938  1.623   1.00 0.00 ? 70  LEU A CB   7  
ATOM 10562 C CG   . LEU A 1 70  ? 3.854   13.941  0.760   1.00 0.00 ? 70  LEU A CG   7  
ATOM 10563 C CD1  . LEU A 1 70  ? 4.735   14.457  -0.367  1.00 0.00 ? 70  LEU A CD1  7  
ATOM 10564 C CD2  . LEU A 1 70  ? 2.588   13.308  0.202   1.00 0.00 ? 70  LEU A CD2  7  
ATOM 10565 H H    . LEU A 1 70  ? 3.809   10.535  1.215   1.00 0.00 ? 70  LEU A H    7  
ATOM 10566 H HA   . LEU A 1 70  ? 5.704   12.264  -0.095  1.00 0.00 ? 70  LEU A HA   7  
ATOM 10567 H HB2  . LEU A 1 70  ? 3.905   12.433  2.255   1.00 0.00 ? 70  LEU A HB2  7  
ATOM 10568 H HB3  . LEU A 1 70  ? 5.314   13.491  2.239   1.00 0.00 ? 70  LEU A HB3  7  
ATOM 10569 H HG   . LEU A 1 70  ? 3.566   14.786  1.371   1.00 0.00 ? 70  LEU A HG   7  
ATOM 10570 H HD11 . LEU A 1 70  ? 5.757   14.521  -0.025  1.00 0.00 ? 70  LEU A HD11 7  
ATOM 10571 H HD12 . LEU A 1 70  ? 4.395   15.436  -0.671  1.00 0.00 ? 70  LEU A HD12 7  
ATOM 10572 H HD13 . LEU A 1 70  ? 4.678   13.780  -1.207  1.00 0.00 ? 70  LEU A HD13 7  
ATOM 10573 H HD21 . LEU A 1 70  ? 2.278   12.497  0.845   1.00 0.00 ? 70  LEU A HD21 7  
ATOM 10574 H HD22 . LEU A 1 70  ? 2.782   12.927  -0.790  1.00 0.00 ? 70  LEU A HD22 7  
ATOM 10575 H HD23 . LEU A 1 70  ? 1.805   14.050  0.156   1.00 0.00 ? 70  LEU A HD23 7  
ATOM 10576 N N    . GLU A 1 71  ? 6.488   10.802  2.762   1.00 0.00 ? 71  GLU A N    7  
ATOM 10577 C CA   . GLU A 1 71  ? 7.609   10.391  3.599   1.00 0.00 ? 71  GLU A CA   7  
ATOM 10578 C C    . GLU A 1 71  ? 7.224   9.208   4.483   1.00 0.00 ? 71  GLU A C    7  
ATOM 10579 O O    . GLU A 1 71  ? 6.097   9.125   4.971   1.00 0.00 ? 71  GLU A O    7  
ATOM 10580 C CB   . GLU A 1 71  ? 8.081   11.559  4.468   1.00 0.00 ? 71  GLU A CB   7  
ATOM 10581 C CG   . GLU A 1 71  ? 8.102   12.891  3.738   1.00 0.00 ? 71  GLU A CG   7  
ATOM 10582 C CD   . GLU A 1 71  ? 8.486   14.046  4.643   1.00 0.00 ? 71  GLU A CD   7  
ATOM 10583 O OE1  . GLU A 1 71  ? 8.845   13.789  5.811   1.00 0.00 ? 71  GLU A OE1  7  
ATOM 10584 O OE2  . GLU A 1 71  ? 8.427   15.205  4.183   1.00 0.00 ? 71  GLU A OE2  7  
ATOM 10585 H H    . GLU A 1 71  ? 5.578   10.553  3.026   1.00 0.00 ? 71  GLU A H    7  
ATOM 10586 H HA   . GLU A 1 71  ? 8.416   10.090  2.948   1.00 0.00 ? 71  GLU A HA   7  
ATOM 10587 H HB2  . GLU A 1 71  ? 7.422   11.648  5.319   1.00 0.00 ? 71  GLU A HB2  7  
ATOM 10588 H HB3  . GLU A 1 71  ? 9.081   11.349  4.819   1.00 0.00 ? 71  GLU A HB3  7  
ATOM 10589 H HG2  . GLU A 1 71  ? 8.817   12.834  2.931   1.00 0.00 ? 71  GLU A HG2  7  
ATOM 10590 H HG3  . GLU A 1 71  ? 7.119   13.081  3.334   1.00 0.00 ? 71  GLU A HG3  7  
ATOM 10591 N N    . VAL A 1 72  ? 8.168   8.294   4.683   1.00 0.00 ? 72  VAL A N    7  
ATOM 10592 C CA   . VAL A 1 72  ? 7.928   7.116   5.508   1.00 0.00 ? 72  VAL A CA   7  
ATOM 10593 C C    . VAL A 1 72  ? 8.800   7.134   6.759   1.00 0.00 ? 72  VAL A C    7  
ATOM 10594 O O    . VAL A 1 72  ? 10.015  6.961   6.683   1.00 0.00 ? 72  VAL A O    7  
ATOM 10595 C CB   . VAL A 1 72  ? 8.200   5.818   4.725   1.00 0.00 ? 72  VAL A CB   7  
ATOM 10596 C CG1  . VAL A 1 72  ? 8.041   4.605   5.629   1.00 0.00 ? 72  VAL A CG1  7  
ATOM 10597 C CG2  . VAL A 1 72  ? 7.277   5.720   3.520   1.00 0.00 ? 72  VAL A CG2  7  
ATOM 10598 H H    . VAL A 1 72  ? 9.047   8.416   4.267   1.00 0.00 ? 72  VAL A H    7  
ATOM 10599 H HA   . VAL A 1 72  ? 6.889   7.121   5.805   1.00 0.00 ? 72  VAL A HA   7  
ATOM 10600 H HB   . VAL A 1 72  ? 9.220   5.843   4.370   1.00 0.00 ? 72  VAL A HB   7  
ATOM 10601 H HG11 . VAL A 1 72  ? 8.916   3.977   5.545   1.00 0.00 ? 72  VAL A HG11 7  
ATOM 10602 H HG12 . VAL A 1 72  ? 7.928   4.931   6.653   1.00 0.00 ? 72  VAL A HG12 7  
ATOM 10603 H HG13 . VAL A 1 72  ? 7.167   4.046   5.330   1.00 0.00 ? 72  VAL A HG13 7  
ATOM 10604 H HG21 . VAL A 1 72  ? 6.487   6.450   3.612   1.00 0.00 ? 72  VAL A HG21 7  
ATOM 10605 H HG22 . VAL A 1 72  ? 7.840   5.910   2.618   1.00 0.00 ? 72  VAL A HG22 7  
ATOM 10606 H HG23 . VAL A 1 72  ? 6.849   4.729   3.474   1.00 0.00 ? 72  VAL A HG23 7  
ATOM 10607 N N    . ASN A 1 73  ? 8.169   7.345   7.910   1.00 0.00 ? 73  ASN A N    7  
ATOM 10608 C CA   . ASN A 1 73  ? 8.887   7.386   9.178   1.00 0.00 ? 73  ASN A CA   7  
ATOM 10609 C C    . ASN A 1 73  ? 9.839   8.578   9.226   1.00 0.00 ? 73  ASN A C    7  
ATOM 10610 O O    . ASN A 1 73  ? 10.970  8.462   9.696   1.00 0.00 ? 73  ASN A O    7  
ATOM 10611 C CB   . ASN A 1 73  ? 9.668   6.087   9.389   1.00 0.00 ? 73  ASN A CB   7  
ATOM 10612 C CG   . ASN A 1 73  ? 8.883   5.064   10.186  1.00 0.00 ? 73  ASN A CG   7  
ATOM 10613 O OD1  . ASN A 1 73  ? 7.990   5.414   10.958  1.00 0.00 ? 73  ASN A OD1  7  
ATOM 10614 N ND2  . ASN A 1 73  ? 9.213   3.791   10.002  1.00 0.00 ? 73  ASN A ND2  7  
ATOM 10615 H H    . ASN A 1 73  ? 7.198   7.477   7.906   1.00 0.00 ? 73  ASN A H    7  
ATOM 10616 H HA   . ASN A 1 73  ? 8.159   7.490   9.968   1.00 0.00 ? 73  ASN A HA   7  
ATOM 10617 H HB2  . ASN A 1 73  ? 9.907   5.659   8.426   1.00 0.00 ? 73  ASN A HB2  7  
ATOM 10618 H HB3  . ASN A 1 73  ? 10.583  6.305   9.918   1.00 0.00 ? 73  ASN A HB3  7  
ATOM 10619 H HD21 . ASN A 1 73  ? 9.935   3.586   9.371   1.00 0.00 ? 73  ASN A HD21 7  
ATOM 10620 H HD22 . ASN A 1 73  ? 8.722   3.108   10.504  1.00 0.00 ? 73  ASN A HD22 7  
ATOM 10621 N N    . GLN A 1 74  ? 9.370   9.722   8.739   1.00 0.00 ? 74  GLN A N    7  
ATOM 10622 C CA   . GLN A 1 74  ? 10.180  10.935  8.726   1.00 0.00 ? 74  GLN A CA   7  
ATOM 10623 C C    . GLN A 1 74  ? 11.392  10.771  7.816   1.00 0.00 ? 74  GLN A C    7  
ATOM 10624 O O    . GLN A 1 74  ? 12.463  11.313  8.089   1.00 0.00 ? 74  GLN A O    7  
ATOM 10625 C CB   . GLN A 1 74  ? 10.635  11.284  10.144  1.00 0.00 ? 74  GLN A CB   7  
ATOM 10626 C CG   . GLN A 1 74  ? 9.501   11.721  11.057  1.00 0.00 ? 74  GLN A CG   7  
ATOM 10627 C CD   . GLN A 1 74  ? 9.778   11.420  12.517  1.00 0.00 ? 74  GLN A CD   7  
ATOM 10628 O OE1  . GLN A 1 74  ? 10.510  12.150  13.185  1.00 0.00 ? 74  GLN A OE1  7  
ATOM 10629 N NE2  . GLN A 1 74  ? 9.192   10.340  13.021  1.00 0.00 ? 74  GLN A NE2  7  
ATOM 10630 H H    . GLN A 1 74  ? 8.460   9.751   8.378   1.00 0.00 ? 74  GLN A H    7  
ATOM 10631 H HA   . GLN A 1 74  ? 9.567   11.738  8.347   1.00 0.00 ? 74  GLN A HA   7  
ATOM 10632 H HB2  . GLN A 1 74  ? 11.107  10.417  10.581  1.00 0.00 ? 74  GLN A HB2  7  
ATOM 10633 H HB3  . GLN A 1 74  ? 11.355  12.088  10.091  1.00 0.00 ? 74  GLN A HB3  7  
ATOM 10634 H HG2  . GLN A 1 74  ? 9.356   12.785  10.946  1.00 0.00 ? 74  GLN A HG2  7  
ATOM 10635 H HG3  . GLN A 1 74  ? 8.600   11.203  10.763  1.00 0.00 ? 74  GLN A HG3  7  
ATOM 10636 H HE21 . GLN A 1 74  ? 8.623   9.804   12.429  1.00 0.00 ? 74  GLN A HE21 7  
ATOM 10637 H HE22 . GLN A 1 74  ? 9.355   10.121  13.961  1.00 0.00 ? 74  GLN A HE22 7  
ATOM 10638 N N    . GLN A 1 75  ? 11.216  10.019  6.734   1.00 0.00 ? 75  GLN A N    7  
ATOM 10639 C CA   . GLN A 1 75  ? 12.297  9.784   5.784   1.00 0.00 ? 75  GLN A CA   7  
ATOM 10640 C C    . GLN A 1 75  ? 11.851  10.103  4.361   1.00 0.00 ? 75  GLN A C    7  
ATOM 10641 O O    . GLN A 1 75  ? 11.332  9.240   3.654   1.00 0.00 ? 75  GLN A O    7  
ATOM 10642 C CB   . GLN A 1 75  ? 12.771  8.332   5.869   1.00 0.00 ? 75  GLN A CB   7  
ATOM 10643 C CG   . GLN A 1 75  ? 13.178  7.905   7.270   1.00 0.00 ? 75  GLN A CG   7  
ATOM 10644 C CD   . GLN A 1 75  ? 14.214  6.798   7.265   1.00 0.00 ? 75  GLN A CD   7  
ATOM 10645 O OE1  . GLN A 1 75  ? 15.306  6.957   6.719   1.00 0.00 ? 75  GLN A OE1  7  
ATOM 10646 N NE2  . GLN A 1 75  ? 13.877  5.669   7.876   1.00 0.00 ? 75  GLN A NE2  7  
ATOM 10647 H H    . GLN A 1 75  ? 10.340  9.614   6.570   1.00 0.00 ? 75  GLN A H    7  
ATOM 10648 H HA   . GLN A 1 75  ? 13.117  10.436  6.046   1.00 0.00 ? 75  GLN A HA   7  
ATOM 10649 H HB2  . GLN A 1 75  ? 11.973  7.685   5.536   1.00 0.00 ? 75  GLN A HB2  7  
ATOM 10650 H HB3  . GLN A 1 75  ? 13.622  8.205   5.216   1.00 0.00 ? 75  GLN A HB3  7  
ATOM 10651 H HG2  . GLN A 1 75  ? 13.589  8.759   7.787   1.00 0.00 ? 75  GLN A HG2  7  
ATOM 10652 H HG3  . GLN A 1 75  ? 12.301  7.556   7.795   1.00 0.00 ? 75  GLN A HG3  7  
ATOM 10653 H HE21 . GLN A 1 75  ? 12.989  5.613   8.288   1.00 0.00 ? 75  GLN A HE21 7  
ATOM 10654 H HE22 . GLN A 1 75  ? 14.527  4.937   7.887   1.00 0.00 ? 75  GLN A HE22 7  
ATOM 10655 N N    . SER A 1 76  ? 12.057  11.350  3.948   1.00 0.00 ? 76  SER A N    7  
ATOM 10656 C CA   . SER A 1 76  ? 11.672  11.785  2.610   1.00 0.00 ? 76  SER A CA   7  
ATOM 10657 C C    . SER A 1 76  ? 12.114  10.770  1.560   1.00 0.00 ? 76  SER A C    7  
ATOM 10658 O O    . SER A 1 76  ? 13.275  10.359  1.528   1.00 0.00 ? 76  SER A O    7  
ATOM 10659 C CB   . SER A 1 76  ? 12.281  13.154  2.301   1.00 0.00 ? 76  SER A CB   7  
ATOM 10660 O OG   . SER A 1 76  ? 11.883  13.612  1.020   1.00 0.00 ? 76  SER A OG   7  
ATOM 10661 H H    . SER A 1 76  ? 12.475  11.993  4.558   1.00 0.00 ? 76  SER A H    7  
ATOM 10662 H HA   . SER A 1 76  ? 10.595  11.865  2.585   1.00 0.00 ? 76  SER A HA   7  
ATOM 10663 H HB2  . SER A 1 76  ? 11.953  13.866  3.043   1.00 0.00 ? 76  SER A HB2  7  
ATOM 10664 H HB3  . SER A 1 76  ? 13.359  13.079  2.325   1.00 0.00 ? 76  SER A HB3  7  
ATOM 10665 H HG   . SER A 1 76  ? 10.932  13.517  0.928   1.00 0.00 ? 76  SER A HG   7  
ATOM 10666 N N    . LEU A 1 77  ? 11.182  10.370  0.704   1.00 0.00 ? 77  LEU A N    7  
ATOM 10667 C CA   . LEU A 1 77  ? 11.474  9.402   -0.349  1.00 0.00 ? 77  LEU A CA   7  
ATOM 10668 C C    . LEU A 1 77  ? 12.190  10.070  -1.518  1.00 0.00 ? 77  LEU A C    7  
ATOM 10669 O O    . LEU A 1 77  ? 12.533  9.417   -2.505  1.00 0.00 ? 77  LEU A O    7  
ATOM 10670 C CB   . LEU A 1 77  ? 10.182  8.744   -0.836  1.00 0.00 ? 77  LEU A CB   7  
ATOM 10671 C CG   . LEU A 1 77  ? 9.345   8.038   0.231   1.00 0.00 ? 77  LEU A CG   7  
ATOM 10672 C CD1  . LEU A 1 77  ? 8.282   7.163   -0.416  1.00 0.00 ? 77  LEU A CD1  7  
ATOM 10673 C CD2  . LEU A 1 77  ? 10.235  7.209   1.146   1.00 0.00 ? 77  LEU A CD2  7  
ATOM 10674 H H    . LEU A 1 77  ? 10.275  10.732  0.779   1.00 0.00 ? 77  LEU A H    7  
ATOM 10675 H HA   . LEU A 1 77  ? 12.120  8.645   0.068   1.00 0.00 ? 77  LEU A HA   7  
ATOM 10676 H HB2  . LEU A 1 77  ? 9.568   9.510   -1.284  1.00 0.00 ? 77  LEU A HB2  7  
ATOM 10677 H HB3  . LEU A 1 77  ? 10.447  8.013   -1.587  1.00 0.00 ? 77  LEU A HB3  7  
ATOM 10678 H HG   . LEU A 1 77  ? 8.842   8.781   0.835   1.00 0.00 ? 77  LEU A HG   7  
ATOM 10679 H HD11 . LEU A 1 77  ? 7.567   6.853   0.331   1.00 0.00 ? 77  LEU A HD11 7  
ATOM 10680 H HD12 . LEU A 1 77  ? 8.749   6.292   -0.851  1.00 0.00 ? 77  LEU A HD12 7  
ATOM 10681 H HD13 . LEU A 1 77  ? 7.776   7.724   -1.189  1.00 0.00 ? 77  LEU A HD13 7  
ATOM 10682 H HD21 . LEU A 1 77  ? 9.627   6.717   1.891   1.00 0.00 ? 77  LEU A HD21 7  
ATOM 10683 H HD22 . LEU A 1 77  ? 10.950  7.856   1.635   1.00 0.00 ? 77  LEU A HD22 7  
ATOM 10684 H HD23 . LEU A 1 77  ? 10.760  6.468   0.562   1.00 0.00 ? 77  LEU A HD23 7  
ATOM 10685 N N    . LEU A 1 78  ? 12.415  11.374  -1.401  1.00 0.00 ? 78  LEU A N    7  
ATOM 10686 C CA   . LEU A 1 78  ? 13.093  12.131  -2.448  1.00 0.00 ? 78  LEU A CA   7  
ATOM 10687 C C    . LEU A 1 78  ? 14.594  11.863  -2.427  1.00 0.00 ? 78  LEU A C    7  
ATOM 10688 O O    . LEU A 1 78  ? 15.278  12.179  -1.455  1.00 0.00 ? 78  LEU A O    7  
ATOM 10689 C CB   . LEU A 1 78  ? 12.828  13.627  -2.276  1.00 0.00 ? 78  LEU A CB   7  
ATOM 10690 C CG   . LEU A 1 78  ? 12.874  14.468  -3.552  1.00 0.00 ? 78  LEU A CG   7  
ATOM 10691 C CD1  . LEU A 1 78  ? 14.238  14.357  -4.215  1.00 0.00 ? 78  LEU A CD1  7  
ATOM 10692 C CD2  . LEU A 1 78  ? 11.775  14.040  -4.513  1.00 0.00 ? 78  LEU A CD2  7  
ATOM 10693 H H    . LEU A 1 78  ? 12.118  11.840  -0.592  1.00 0.00 ? 78  LEU A H    7  
ATOM 10694 H HA   . LEU A 1 78  ? 12.695  11.810  -3.399  1.00 0.00 ? 78  LEU A HA   7  
ATOM 10695 H HB2  . LEU A 1 78  ? 11.847  13.741  -1.841  1.00 0.00 ? 78  LEU A HB2  7  
ATOM 10696 H HB3  . LEU A 1 78  ? 13.570  14.018  -1.594  1.00 0.00 ? 78  LEU A HB3  7  
ATOM 10697 H HG   . LEU A 1 78  ? 12.712  15.507  -3.298  1.00 0.00 ? 78  LEU A HG   7  
ATOM 10698 H HD11 . LEU A 1 78  ? 14.961  14.007  -3.494  1.00 0.00 ? 78  LEU A HD11 7  
ATOM 10699 H HD12 . LEU A 1 78  ? 14.538  15.325  -4.587  1.00 0.00 ? 78  LEU A HD12 7  
ATOM 10700 H HD13 . LEU A 1 78  ? 14.182  13.658  -5.038  1.00 0.00 ? 78  LEU A HD13 7  
ATOM 10701 H HD21 . LEU A 1 78  ? 11.266  13.175  -4.115  1.00 0.00 ? 78  LEU A HD21 7  
ATOM 10702 H HD22 . LEU A 1 78  ? 12.210  13.792  -5.471  1.00 0.00 ? 78  LEU A HD22 7  
ATOM 10703 H HD23 . LEU A 1 78  ? 11.070  14.849  -4.637  1.00 0.00 ? 78  LEU A HD23 7  
ATOM 10704 N N    . GLY A 1 79  ? 15.101  11.280  -3.510  1.00 0.00 ? 79  GLY A N    7  
ATOM 10705 C CA   . GLY A 1 79  ? 16.519  10.982  -3.596  1.00 0.00 ? 79  GLY A CA   7  
ATOM 10706 C C    . GLY A 1 79  ? 16.791  9.498   -3.741  1.00 0.00 ? 79  GLY A C    7  
ATOM 10707 O O    . GLY A 1 79  ? 17.736  9.096   -4.421  1.00 0.00 ? 79  GLY A O    7  
ATOM 10708 H H    . GLY A 1 79  ? 14.508  11.050  -4.255  1.00 0.00 ? 79  GLY A H    7  
ATOM 10709 H HA2  . GLY A 1 79  ? 16.933  11.498  -4.449  1.00 0.00 ? 79  GLY A HA2  7  
ATOM 10710 H HA3  . GLY A 1 79  ? 17.005  11.339  -2.701  1.00 0.00 ? 79  GLY A HA3  7  
ATOM 10711 N N    . LEU A 1 80  ? 15.963  8.680   -3.099  1.00 0.00 ? 80  LEU A N    7  
ATOM 10712 C CA   . LEU A 1 80  ? 16.120  7.231   -3.158  1.00 0.00 ? 80  LEU A CA   7  
ATOM 10713 C C    . LEU A 1 80  ? 15.364  6.650   -4.349  1.00 0.00 ? 80  LEU A C    7  
ATOM 10714 O O    . LEU A 1 80  ? 14.595  7.347   -5.011  1.00 0.00 ? 80  LEU A O    7  
ATOM 10715 C CB   . LEU A 1 80  ? 15.622  6.591   -1.861  1.00 0.00 ? 80  LEU A CB   7  
ATOM 10716 C CG   . LEU A 1 80  ? 14.416  7.261   -1.203  1.00 0.00 ? 80  LEU A CG   7  
ATOM 10717 C CD1  . LEU A 1 80  ? 13.595  6.240   -0.430  1.00 0.00 ? 80  LEU A CD1  7  
ATOM 10718 C CD2  . LEU A 1 80  ? 14.866  8.390   -0.287  1.00 0.00 ? 80  LEU A CD2  7  
ATOM 10719 H H    . LEU A 1 80  ? 15.229  9.059   -2.574  1.00 0.00 ? 80  LEU A H    7  
ATOM 10720 H HA   . LEU A 1 80  ? 17.172  7.017   -3.276  1.00 0.00 ? 80  LEU A HA   7  
ATOM 10721 H HB2  . LEU A 1 80  ? 15.355  5.569   -2.079  1.00 0.00 ? 80  LEU A HB2  7  
ATOM 10722 H HB3  . LEU A 1 80  ? 16.438  6.606   -1.152  1.00 0.00 ? 80  LEU A HB3  7  
ATOM 10723 H HG   . LEU A 1 80  ? 13.783  7.684   -1.971  1.00 0.00 ? 80  LEU A HG   7  
ATOM 10724 H HD11 . LEU A 1 80  ? 13.898  6.245   0.606   1.00 0.00 ? 80  LEU A HD11 7  
ATOM 10725 H HD12 . LEU A 1 80  ? 13.756  5.258   -0.848  1.00 0.00 ? 80  LEU A HD12 7  
ATOM 10726 H HD13 . LEU A 1 80  ? 12.547  6.493   -0.501  1.00 0.00 ? 80  LEU A HD13 7  
ATOM 10727 H HD21 . LEU A 1 80  ? 15.942  8.370   -0.194  1.00 0.00 ? 80  LEU A HD21 7  
ATOM 10728 H HD22 . LEU A 1 80  ? 14.418  8.262   0.688   1.00 0.00 ? 80  LEU A HD22 7  
ATOM 10729 H HD23 . LEU A 1 80  ? 14.557  9.337   -0.704  1.00 0.00 ? 80  LEU A HD23 7  
ATOM 10730 N N    . THR A 1 81  ? 15.586  5.366   -4.614  1.00 0.00 ? 81  THR A N    7  
ATOM 10731 C CA   . THR A 1 81  ? 14.925  4.690   -5.724  1.00 0.00 ? 81  THR A CA   7  
ATOM 10732 C C    . THR A 1 81  ? 13.861  3.721   -5.221  1.00 0.00 ? 81  THR A C    7  
ATOM 10733 O O    . THR A 1 81  ? 13.873  3.318   -4.058  1.00 0.00 ? 81  THR A O    7  
ATOM 10734 C CB   . THR A 1 81  ? 15.936  3.919   -6.594  1.00 0.00 ? 81  THR A CB   7  
ATOM 10735 O OG1  . THR A 1 81  ? 16.698  3.020   -5.780  1.00 0.00 ? 81  THR A OG1  7  
ATOM 10736 C CG2  . THR A 1 81  ? 16.873  4.877   -7.313  1.00 0.00 ? 81  THR A CG2  7  
ATOM 10737 H H    . THR A 1 81  ? 16.210  4.863   -4.050  1.00 0.00 ? 81  THR A H    7  
ATOM 10738 H HA   . THR A 1 81  ? 14.453  5.442   -6.339  1.00 0.00 ? 81  THR A HA   7  
ATOM 10739 H HB   . THR A 1 81  ? 15.391  3.349   -7.333  1.00 0.00 ? 81  THR A HB   7  
ATOM 10740 H HG1  . THR A 1 81  ? 16.173  2.238   -5.589  1.00 0.00 ? 81  THR A HG1  7  
ATOM 10741 H HG21 . THR A 1 81  ? 17.725  4.332   -7.691  1.00 0.00 ? 81  THR A HG21 7  
ATOM 10742 H HG22 . THR A 1 81  ? 17.209  5.637   -6.623  1.00 0.00 ? 81  THR A HG22 7  
ATOM 10743 H HG23 . THR A 1 81  ? 16.350  5.343   -8.135  1.00 0.00 ? 81  THR A HG23 7  
ATOM 10744 N N    . HIS A 1 82  ? 12.941  3.349   -6.106  1.00 0.00 ? 82  HIS A N    7  
ATOM 10745 C CA   . HIS A 1 82  ? 11.870  2.425   -5.752  1.00 0.00 ? 82  HIS A CA   7  
ATOM 10746 C C    . HIS A 1 82  ? 12.348  1.409   -4.719  1.00 0.00 ? 82  HIS A C    7  
ATOM 10747 O O    . HIS A 1 82  ? 11.733  1.242   -3.667  1.00 0.00 ? 82  HIS A O    7  
ATOM 10748 C CB   . HIS A 1 82  ? 11.359  1.702   -6.998  1.00 0.00 ? 82  HIS A CB   7  
ATOM 10749 C CG   . HIS A 1 82  ? 9.941   1.234   -6.880  1.00 0.00 ? 82  HIS A CG   7  
ATOM 10750 N ND1  . HIS A 1 82  ? 9.547   -0.055  -7.170  1.00 0.00 ? 82  HIS A ND1  7  
ATOM 10751 C CD2  . HIS A 1 82  ? 8.820   1.892   -6.500  1.00 0.00 ? 82  HIS A CD2  7  
ATOM 10752 C CE1  . HIS A 1 82  ? 8.245   -0.170  -6.975  1.00 0.00 ? 82  HIS A CE1  7  
ATOM 10753 N NE2  . HIS A 1 82  ? 7.781   0.998   -6.567  1.00 0.00 ? 82  HIS A NE2  7  
ATOM 10754 H H    . HIS A 1 82  ? 12.985  3.704   -7.018  1.00 0.00 ? 82  HIS A H    7  
ATOM 10755 H HA   . HIS A 1 82  ? 11.063  3.001   -5.325  1.00 0.00 ? 82  HIS A HA   7  
ATOM 10756 H HB2  . HIS A 1 82  ? 11.418  2.371   -7.844  1.00 0.00 ? 82  HIS A HB2  7  
ATOM 10757 H HB3  . HIS A 1 82  ? 11.979  0.837   -7.185  1.00 0.00 ? 82  HIS A HB3  7  
ATOM 10758 H HD1  . HIS A 1 82  ? 10.133  -0.777  -7.476  1.00 0.00 ? 82  HIS A HD1  7  
ATOM 10759 H HD2  . HIS A 1 82  ? 8.755   2.928   -6.199  1.00 0.00 ? 82  HIS A HD2  7  
ATOM 10760 H HE1  . HIS A 1 82  ? 7.660   -1.065  -7.122  1.00 0.00 ? 82  HIS A HE1  7  
ATOM 10761 H HE2  . HIS A 1 82  ? 6.834   1.212   -6.432  1.00 0.00 ? 82  HIS A HE2  7  
ATOM 10762 N N    . GLY A 1 83  ? 13.449  0.731   -5.029  1.00 0.00 ? 83  GLY A N    7  
ATOM 10763 C CA   . GLY A 1 83  ? 13.990  -0.261  -4.119  1.00 0.00 ? 83  GLY A CA   7  
ATOM 10764 C C    . GLY A 1 83  ? 14.234  0.297   -2.731  1.00 0.00 ? 83  GLY A C    7  
ATOM 10765 O O    . GLY A 1 83  ? 13.813  -0.291  -1.735  1.00 0.00 ? 83  GLY A O    7  
ATOM 10766 H H    . GLY A 1 83  ? 13.897  0.906   -5.883  1.00 0.00 ? 83  GLY A H    7  
ATOM 10767 H HA2  . GLY A 1 83  ? 13.295  -1.085  -4.047  1.00 0.00 ? 83  GLY A HA2  7  
ATOM 10768 H HA3  . GLY A 1 83  ? 14.925  -0.626  -4.517  1.00 0.00 ? 83  GLY A HA3  7  
ATOM 10769 N N    . GLU A 1 84  ? 14.917  1.436   -2.664  1.00 0.00 ? 84  GLU A N    7  
ATOM 10770 C CA   . GLU A 1 84  ? 15.218  2.072   -1.387  1.00 0.00 ? 84  GLU A CA   7  
ATOM 10771 C C    . GLU A 1 84  ? 13.938  2.518   -0.686  1.00 0.00 ? 84  GLU A C    7  
ATOM 10772 O O    . GLU A 1 84  ? 13.766  2.299   0.512   1.00 0.00 ? 84  GLU A O    7  
ATOM 10773 C CB   . GLU A 1 84  ? 16.144  3.272   -1.596  1.00 0.00 ? 84  GLU A CB   7  
ATOM 10774 C CG   . GLU A 1 84  ? 17.620  2.916   -1.560  1.00 0.00 ? 84  GLU A CG   7  
ATOM 10775 C CD   . GLU A 1 84  ? 18.189  2.925   -0.155  1.00 0.00 ? 84  GLU A CD   7  
ATOM 10776 O OE1  . GLU A 1 84  ? 17.932  1.959   0.594   1.00 0.00 ? 84  GLU A OE1  7  
ATOM 10777 O OE2  . GLU A 1 84  ? 18.890  3.897   0.197   1.00 0.00 ? 84  GLU A OE2  7  
ATOM 10778 H H    . GLU A 1 84  ? 15.226  1.857   -3.493  1.00 0.00 ? 84  GLU A H    7  
ATOM 10779 H HA   . GLU A 1 84  ? 15.720  1.346   -0.766  1.00 0.00 ? 84  GLU A HA   7  
ATOM 10780 H HB2  . GLU A 1 84  ? 15.925  3.718   -2.555  1.00 0.00 ? 84  GLU A HB2  7  
ATOM 10781 H HB3  . GLU A 1 84  ? 15.951  3.998   -0.820  1.00 0.00 ? 84  GLU A HB3  7  
ATOM 10782 H HG2  . GLU A 1 84  ? 17.750  1.929   -1.978  1.00 0.00 ? 84  GLU A HG2  7  
ATOM 10783 H HG3  . GLU A 1 84  ? 18.165  3.633   -2.158  1.00 0.00 ? 84  GLU A HG3  7  
ATOM 10784 N N    . ALA A 1 85  ? 13.044  3.146   -1.443  1.00 0.00 ? 85  ALA A N    7  
ATOM 10785 C CA   . ALA A 1 85  ? 11.780  3.622   -0.896  1.00 0.00 ? 85  ALA A CA   7  
ATOM 10786 C C    . ALA A 1 85  ? 10.986  2.479   -0.274  1.00 0.00 ? 85  ALA A C    7  
ATOM 10787 O O    . ALA A 1 85  ? 10.483  2.595   0.844   1.00 0.00 ? 85  ALA A O    7  
ATOM 10788 C CB   . ALA A 1 85  ? 10.961  4.308   -1.980  1.00 0.00 ? 85  ALA A CB   7  
ATOM 10789 H H    . ALA A 1 85  ? 13.239  3.291   -2.392  1.00 0.00 ? 85  ALA A H    7  
ATOM 10790 H HA   . ALA A 1 85  ? 12.001  4.352   -0.131  1.00 0.00 ? 85  ALA A HA   7  
ATOM 10791 H HB1  . ALA A 1 85  ? 11.402  4.106   -2.945  1.00 0.00 ? 85  ALA A HB1  7  
ATOM 10792 H HB2  . ALA A 1 85  ? 9.950   3.929   -1.960  1.00 0.00 ? 85  ALA A HB2  7  
ATOM 10793 H HB3  . ALA A 1 85  ? 10.951  5.373   -1.803  1.00 0.00 ? 85  ALA A HB3  7  
ATOM 10794 N N    . VAL A 1 86  ? 10.876  1.374   -1.005  1.00 0.00 ? 86  VAL A N    7  
ATOM 10795 C CA   . VAL A 1 86  ? 10.143  0.209   -0.524  1.00 0.00 ? 86  VAL A CA   7  
ATOM 10796 C C    . VAL A 1 86  ? 10.736  -0.314  0.779   1.00 0.00 ? 86  VAL A C    7  
ATOM 10797 O O    . VAL A 1 86  ? 10.049  -0.391  1.797   1.00 0.00 ? 86  VAL A O    7  
ATOM 10798 C CB   . VAL A 1 86  ? 10.144  -0.925  -1.567  1.00 0.00 ? 86  VAL A CB   7  
ATOM 10799 C CG1  . VAL A 1 86  ? 9.536   -2.190  -0.982  1.00 0.00 ? 86  VAL A CG1  7  
ATOM 10800 C CG2  . VAL A 1 86  ? 9.397   -0.495  -2.821  1.00 0.00 ? 86  VAL A CG2  7  
ATOM 10801 H H    . VAL A 1 86  ? 11.298  1.342   -1.889  1.00 0.00 ? 86  VAL A H    7  
ATOM 10802 H HA   . VAL A 1 86  ? 9.119   0.507   -0.349  1.00 0.00 ? 86  VAL A HA   7  
ATOM 10803 H HB   . VAL A 1 86  ? 11.168  -1.136  -1.839  1.00 0.00 ? 86  VAL A HB   7  
ATOM 10804 H HG11 . VAL A 1 86  ? 8.483   -2.033  -0.802  1.00 0.00 ? 86  VAL A HG11 7  
ATOM 10805 H HG12 . VAL A 1 86  ? 9.667   -3.007  -1.676  1.00 0.00 ? 86  VAL A HG12 7  
ATOM 10806 H HG13 . VAL A 1 86  ? 10.028  -2.427  -0.049  1.00 0.00 ? 86  VAL A HG13 7  
ATOM 10807 H HG21 . VAL A 1 86  ? 8.488   -1.071  -2.912  1.00 0.00 ? 86  VAL A HG21 7  
ATOM 10808 H HG22 . VAL A 1 86  ? 9.152   0.555   -2.753  1.00 0.00 ? 86  VAL A HG22 7  
ATOM 10809 H HG23 . VAL A 1 86  ? 10.019  -0.664  -3.687  1.00 0.00 ? 86  VAL A HG23 7  
ATOM 10810 N N    . GLN A 1 87  ? 12.015  -0.672  0.739   1.00 0.00 ? 87  GLN A N    7  
ATOM 10811 C CA   . GLN A 1 87  ? 12.701  -1.189  1.918   1.00 0.00 ? 87  GLN A CA   7  
ATOM 10812 C C    . GLN A 1 87  ? 12.504  -0.260  3.112   1.00 0.00 ? 87  GLN A C    7  
ATOM 10813 O O    . GLN A 1 87  ? 12.566  -0.692  4.264   1.00 0.00 ? 87  GLN A O    7  
ATOM 10814 C CB   . GLN A 1 87  ? 14.193  -1.361  1.631   1.00 0.00 ? 87  GLN A CB   7  
ATOM 10815 C CG   . GLN A 1 87  ? 14.490  -2.384  0.547   1.00 0.00 ? 87  GLN A CG   7  
ATOM 10816 C CD   . GLN A 1 87  ? 13.834  -3.725  0.814   1.00 0.00 ? 87  GLN A CD   7  
ATOM 10817 O OE1  . GLN A 1 87  ? 14.244  -4.462  1.711   1.00 0.00 ? 87  GLN A OE1  7  
ATOM 10818 N NE2  . GLN A 1 87  ? 12.808  -4.047  0.035   1.00 0.00 ? 87  GLN A NE2  7  
ATOM 10819 H H    . GLN A 1 87  ? 12.509  -0.588  -0.102  1.00 0.00 ? 87  GLN A H    7  
ATOM 10820 H HA   . GLN A 1 87  ? 12.275  -2.152  2.153   1.00 0.00 ? 87  GLN A HA   7  
ATOM 10821 H HB2  . GLN A 1 87  ? 14.600  -0.410  1.321   1.00 0.00 ? 87  GLN A HB2  7  
ATOM 10822 H HB3  . GLN A 1 87  ? 14.688  -1.676  2.538   1.00 0.00 ? 87  GLN A HB3  7  
ATOM 10823 H HG2  . GLN A 1 87  ? 14.128  -2.006  -0.397  1.00 0.00 ? 87  GLN A HG2  7  
ATOM 10824 H HG3  . GLN A 1 87  ? 15.559  -2.529  0.490   1.00 0.00 ? 87  GLN A HG3  7  
ATOM 10825 H HE21 . GLN A 1 87  ? 12.537  -3.410  -0.660  1.00 0.00 ? 87  GLN A HE21 7  
ATOM 10826 H HE22 . GLN A 1 87  ? 12.365  -4.907  0.185   1.00 0.00 ? 87  GLN A HE22 7  
ATOM 10827 N N    . LEU A 1 88  ? 12.268  1.016   2.830   1.00 0.00 ? 88  LEU A N    7  
ATOM 10828 C CA   . LEU A 1 88  ? 12.062  2.006   3.881   1.00 0.00 ? 88  LEU A CA   7  
ATOM 10829 C C    . LEU A 1 88  ? 10.705  1.817   4.550   1.00 0.00 ? 88  LEU A C    7  
ATOM 10830 O O    . LEU A 1 88  ? 10.532  2.130   5.729   1.00 0.00 ? 88  LEU A O    7  
ATOM 10831 C CB   . LEU A 1 88  ? 12.166  3.420   3.305   1.00 0.00 ? 88  LEU A CB   7  
ATOM 10832 C CG   . LEU A 1 88  ? 12.694  4.495   4.256   1.00 0.00 ? 88  LEU A CG   7  
ATOM 10833 C CD1  . LEU A 1 88  ? 12.934  5.797   3.508   1.00 0.00 ? 88  LEU A CD1  7  
ATOM 10834 C CD2  . LEU A 1 88  ? 11.725  4.710   5.409   1.00 0.00 ? 88  LEU A CD2  7  
ATOM 10835 H H    . LEU A 1 88  ? 12.230  1.300   1.893   1.00 0.00 ? 88  LEU A H    7  
ATOM 10836 H HA   . LEU A 1 88  ? 12.837  1.870   4.621   1.00 0.00 ? 88  LEU A HA   7  
ATOM 10837 H HB2  . LEU A 1 88  ? 12.825  3.381   2.452   1.00 0.00 ? 88  LEU A HB2  7  
ATOM 10838 H HB3  . LEU A 1 88  ? 11.179  3.718   2.982   1.00 0.00 ? 88  LEU A HB3  7  
ATOM 10839 H HG   . LEU A 1 88  ? 13.639  4.169   4.669   1.00 0.00 ? 88  LEU A HG   7  
ATOM 10840 H HD11 . LEU A 1 88  ? 13.884  6.215   3.808   1.00 0.00 ? 88  LEU A HD11 7  
ATOM 10841 H HD12 . LEU A 1 88  ? 12.144  6.496   3.740   1.00 0.00 ? 88  LEU A HD12 7  
ATOM 10842 H HD13 . LEU A 1 88  ? 12.944  5.605   2.445   1.00 0.00 ? 88  LEU A HD13 7  
ATOM 10843 H HD21 . LEU A 1 88  ? 10.712  4.693   5.034   1.00 0.00 ? 88  LEU A HD21 7  
ATOM 10844 H HD22 . LEU A 1 88  ? 11.921  5.667   5.870   1.00 0.00 ? 88  LEU A HD22 7  
ATOM 10845 H HD23 . LEU A 1 88  ? 11.853  3.925   6.138   1.00 0.00 ? 88  LEU A HD23 7  
ATOM 10846 N N    . LEU A 1 89  ? 9.744   1.300   3.792   1.00 0.00 ? 89  LEU A N    7  
ATOM 10847 C CA   . LEU A 1 89  ? 8.401   1.066   4.312   1.00 0.00 ? 89  LEU A CA   7  
ATOM 10848 C C    . LEU A 1 89  ? 8.358   -0.204  5.156   1.00 0.00 ? 89  LEU A C    7  
ATOM 10849 O O    . LEU A 1 89  ? 7.562   -0.314  6.088   1.00 0.00 ? 89  LEU A O    7  
ATOM 10850 C CB   . LEU A 1 89  ? 7.399   0.962   3.161   1.00 0.00 ? 89  LEU A CB   7  
ATOM 10851 C CG   . LEU A 1 89  ? 7.163   -0.442  2.601   1.00 0.00 ? 89  LEU A CG   7  
ATOM 10852 C CD1  . LEU A 1 89  ? 6.171   -1.202  3.467   1.00 0.00 ? 89  LEU A CD1  7  
ATOM 10853 C CD2  . LEU A 1 89  ? 6.671   -0.367  1.163   1.00 0.00 ? 89  LEU A CD2  7  
ATOM 10854 H H    . LEU A 1 89  ? 9.941   1.071   2.860   1.00 0.00 ? 89  LEU A H    7  
ATOM 10855 H HA   . LEU A 1 89  ? 8.136   1.907   4.935   1.00 0.00 ? 89  LEU A HA   7  
ATOM 10856 H HB2  . LEU A 1 89  ? 6.451   1.340   3.513   1.00 0.00 ? 89  LEU A HB2  7  
ATOM 10857 H HB3  . LEU A 1 89  ? 7.757   1.585   2.354   1.00 0.00 ? 89  LEU A HB3  7  
ATOM 10858 H HG   . LEU A 1 89  ? 8.097   -0.987  2.608   1.00 0.00 ? 89  LEU A HG   7  
ATOM 10859 H HD11 . LEU A 1 89  ? 5.188   -1.144  3.024   1.00 0.00 ? 89  LEU A HD11 7  
ATOM 10860 H HD12 . LEU A 1 89  ? 6.147   -0.767  4.455   1.00 0.00 ? 89  LEU A HD12 7  
ATOM 10861 H HD13 . LEU A 1 89  ? 6.474   -2.237  3.537   1.00 0.00 ? 89  LEU A HD13 7  
ATOM 10862 H HD21 . LEU A 1 89  ? 6.348   0.641   0.946   1.00 0.00 ? 89  LEU A HD21 7  
ATOM 10863 H HD22 . LEU A 1 89  ? 5.842   -1.047  1.030   1.00 0.00 ? 89  LEU A HD22 7  
ATOM 10864 H HD23 . LEU A 1 89  ? 7.473   -0.640  0.494   1.00 0.00 ? 89  LEU A HD23 7  
ATOM 10865 N N    . ARG A 1 90  ? 9.221   -1.159  4.824   1.00 0.00 ? 90  ARG A N    7  
ATOM 10866 C CA   . ARG A 1 90  ? 9.282   -2.420  5.552   1.00 0.00 ? 90  ARG A CA   7  
ATOM 10867 C C    . ARG A 1 90  ? 10.312  -2.350  6.675   1.00 0.00 ? 90  ARG A C    7  
ATOM 10868 O O    . ARG A 1 90  ? 10.522  -3.323  7.399   1.00 0.00 ? 90  ARG A O    7  
ATOM 10869 C CB   . ARG A 1 90  ? 9.627   -3.567  4.600   1.00 0.00 ? 90  ARG A CB   7  
ATOM 10870 C CG   . ARG A 1 90  ? 10.786  -3.255  3.666   1.00 0.00 ? 90  ARG A CG   7  
ATOM 10871 C CD   . ARG A 1 90  ? 11.203  -4.481  2.869   1.00 0.00 ? 90  ARG A CD   7  
ATOM 10872 N NE   . ARG A 1 90  ? 11.621  -5.581  3.734   1.00 0.00 ? 90  ARG A NE   7  
ATOM 10873 C CZ   . ARG A 1 90  ? 10.777  -6.462  4.261   1.00 0.00 ? 90  ARG A CZ   7  
ATOM 10874 N NH1  . ARG A 1 90  ? 9.478   -6.372  4.011   1.00 0.00 ? 90  ARG A NH1  7  
ATOM 10875 N NH2  . ARG A 1 90  ? 11.233  -7.435  5.039   1.00 0.00 ? 90  ARG A NH2  7  
ATOM 10876 H H    . ARG A 1 90  ? 9.830   -1.012  4.070   1.00 0.00 ? 90  ARG A H    7  
ATOM 10877 H HA   . ARG A 1 90  ? 8.308   -2.602  5.982   1.00 0.00 ? 90  ARG A HA   7  
ATOM 10878 H HB2  . ARG A 1 90  ? 9.888   -4.438  5.183   1.00 0.00 ? 90  ARG A HB2  7  
ATOM 10879 H HB3  . ARG A 1 90  ? 8.760   -3.793  3.998   1.00 0.00 ? 90  ARG A HB3  7  
ATOM 10880 H HG2  . ARG A 1 90  ? 10.484  -2.479  2.979   1.00 0.00 ? 90  ARG A HG2  7  
ATOM 10881 H HG3  . ARG A 1 90  ? 11.626  -2.914  4.252   1.00 0.00 ? 90  ARG A HG3  7  
ATOM 10882 H HD2  . ARG A 1 90  ? 10.367  -4.805  2.268   1.00 0.00 ? 90  ARG A HD2  7  
ATOM 10883 H HD3  . ARG A 1 90  ? 12.026  -4.210  2.223   1.00 0.00 ? 90  ARG A HD3  7  
ATOM 10884 H HE   . ARG A 1 90  ? 12.576  -5.666  3.931   1.00 0.00 ? 90  ARG A HE   7  
ATOM 10885 H HH11 . ARG A 1 90  ? 9.132   -5.640  3.425   1.00 0.00 ? 90  ARG A HH11 7  
ATOM 10886 H HH12 . ARG A 1 90  ? 8.846   -7.038  4.408   1.00 0.00 ? 90  ARG A HH12 7  
ATOM 10887 H HH21 . ARG A 1 90  ? 12.212  -7.506  5.229   1.00 0.00 ? 90  ARG A HH21 7  
ATOM 10888 H HH22 . ARG A 1 90  ? 10.598  -8.098  5.435   1.00 0.00 ? 90  ARG A HH22 7  
ATOM 10889 N N    . SER A 1 91  ? 10.950  -1.193  6.814   1.00 0.00 ? 91  SER A N    7  
ATOM 10890 C CA   . SER A 1 91  ? 11.961  -0.997  7.847   1.00 0.00 ? 91  SER A CA   7  
ATOM 10891 C C    . SER A 1 91  ? 11.372  -0.272  9.054   1.00 0.00 ? 91  SER A C    7  
ATOM 10892 O O    . SER A 1 91  ? 12.039  0.545   9.688   1.00 0.00 ? 91  SER A O    7  
ATOM 10893 C CB   . SER A 1 91  ? 13.144  -0.203  7.289   1.00 0.00 ? 91  SER A CB   7  
ATOM 10894 O OG   . SER A 1 91  ? 14.214  -0.162  8.216   1.00 0.00 ? 91  SER A OG   7  
ATOM 10895 H H    . SER A 1 91  ? 10.738  -0.454  6.206   1.00 0.00 ? 91  SER A H    7  
ATOM 10896 H HA   . SER A 1 91  ? 12.308  -1.970  8.160   1.00 0.00 ? 91  SER A HA   7  
ATOM 10897 H HB2  . SER A 1 91  ? 13.490  -0.669  6.379   1.00 0.00 ? 91  SER A HB2  7  
ATOM 10898 H HB3  . SER A 1 91  ? 12.827  0.808   7.077   1.00 0.00 ? 91  SER A HB3  7  
ATOM 10899 H HG   . SER A 1 91  ? 14.994  0.199   7.789   1.00 0.00 ? 91  SER A HG   7  
ATOM 10900 N N    . VAL A 1 92  ? 10.116  -0.579  9.365   1.00 0.00 ? 92  VAL A N    7  
ATOM 10901 C CA   . VAL A 1 92  ? 9.436   0.042   10.495  1.00 0.00 ? 92  VAL A CA   7  
ATOM 10902 C C    . VAL A 1 92  ? 9.182   -0.971  11.607  1.00 0.00 ? 92  VAL A C    7  
ATOM 10903 O O    . VAL A 1 92  ? 8.918   -2.143  11.344  1.00 0.00 ? 92  VAL A O    7  
ATOM 10904 C CB   . VAL A 1 92  ? 8.094   0.666   10.069  1.00 0.00 ? 92  VAL A CB   7  
ATOM 10905 C CG1  . VAL A 1 92  ? 7.314   -0.296  9.187   1.00 0.00 ? 92  VAL A CG1  7  
ATOM 10906 C CG2  . VAL A 1 92  ? 7.280   1.063   11.291  1.00 0.00 ? 92  VAL A CG2  7  
ATOM 10907 H H    . VAL A 1 92  ? 9.637   -1.238  8.821   1.00 0.00 ? 92  VAL A H    7  
ATOM 10908 H HA   . VAL A 1 92  ? 10.071  0.828   10.876  1.00 0.00 ? 92  VAL A HA   7  
ATOM 10909 H HB   . VAL A 1 92  ? 8.302   1.558   9.496   1.00 0.00 ? 92  VAL A HB   7  
ATOM 10910 H HG11 . VAL A 1 92  ? 7.199   -1.240  9.698   1.00 0.00 ? 92  VAL A HG11 7  
ATOM 10911 H HG12 . VAL A 1 92  ? 6.340   0.120   8.974   1.00 0.00 ? 92  VAL A HG12 7  
ATOM 10912 H HG13 . VAL A 1 92  ? 7.849   -0.451  8.262   1.00 0.00 ? 92  VAL A HG13 7  
ATOM 10913 H HG21 . VAL A 1 92  ? 6.518   0.319   11.472  1.00 0.00 ? 92  VAL A HG21 7  
ATOM 10914 H HG22 . VAL A 1 92  ? 7.929   1.129   12.152  1.00 0.00 ? 92  VAL A HG22 7  
ATOM 10915 H HG23 . VAL A 1 92  ? 6.813   2.021   11.118  1.00 0.00 ? 92  VAL A HG23 7  
ATOM 10916 N N    . GLY A 1 93  ? 9.265   -0.509  12.851  1.00 0.00 ? 93  GLY A N    7  
ATOM 10917 C CA   . GLY A 1 93  ? 9.041   -1.387  13.984  1.00 0.00 ? 93  GLY A CA   7  
ATOM 10918 C C    . GLY A 1 93  ? 7.619   -1.909  14.042  1.00 0.00 ? 93  GLY A C    7  
ATOM 10919 O O    . GLY A 1 93  ? 7.237   -2.778  13.258  1.00 0.00 ? 93  GLY A O    7  
ATOM 10920 H H    . GLY A 1 93  ? 9.479   0.436   13.000  1.00 0.00 ? 93  GLY A H    7  
ATOM 10921 H HA2  . GLY A 1 93  ? 9.718   -2.225  13.916  1.00 0.00 ? 93  GLY A HA2  7  
ATOM 10922 H HA3  . GLY A 1 93  ? 9.249   -0.843  14.894  1.00 0.00 ? 93  GLY A HA3  7  
ATOM 10923 N N    . ASP A 1 94  ? 6.833   -1.379  14.973  1.00 0.00 ? 94  ASP A N    7  
ATOM 10924 C CA   . ASP A 1 94  ? 5.445   -1.797  15.130  1.00 0.00 ? 94  ASP A CA   7  
ATOM 10925 C C    . ASP A 1 94  ? 4.495   -0.758  14.544  1.00 0.00 ? 94  ASP A C    7  
ATOM 10926 O O    . ASP A 1 94  ? 3.279   -0.953  14.523  1.00 0.00 ? 94  ASP A O    7  
ATOM 10927 C CB   . ASP A 1 94  ? 5.123   -2.024  16.608  1.00 0.00 ? 94  ASP A CB   7  
ATOM 10928 C CG   . ASP A 1 94  ? 4.078   -3.102  16.814  1.00 0.00 ? 94  ASP A CG   7  
ATOM 10929 O OD1  . ASP A 1 94  ? 4.405   -4.291  16.615  1.00 0.00 ? 94  ASP A OD1  7  
ATOM 10930 O OD2  . ASP A 1 94  ? 2.932   -2.758  17.174  1.00 0.00 ? 94  ASP A OD2  7  
ATOM 10931 H H    . ASP A 1 94  ? 7.196   -0.690  15.568  1.00 0.00 ? 94  ASP A H    7  
ATOM 10932 H HA   . ASP A 1 94  ? 5.316   -2.726  14.597  1.00 0.00 ? 94  ASP A HA   7  
ATOM 10933 H HB2  . ASP A 1 94  ? 6.025   -2.319  17.125  1.00 0.00 ? 94  ASP A HB2  7  
ATOM 10934 H HB3  . ASP A 1 94  ? 4.753   -1.103  17.035  1.00 0.00 ? 94  ASP A HB3  7  
ATOM 10935 N N    . THR A 1 95  ? 5.057   0.349   14.068  1.00 0.00 ? 95  THR A N    7  
ATOM 10936 C CA   . THR A 1 95  ? 4.261   1.420   13.483  1.00 0.00 ? 95  THR A CA   7  
ATOM 10937 C C    . THR A 1 95  ? 5.139   2.403   12.717  1.00 0.00 ? 95  THR A C    7  
ATOM 10938 O O    . THR A 1 95  ? 6.261   2.700   13.128  1.00 0.00 ? 95  THR A O    7  
ATOM 10939 C CB   . THR A 1 95  ? 3.472   2.187   14.561  1.00 0.00 ? 95  THR A CB   7  
ATOM 10940 O OG1  . THR A 1 95  ? 2.672   1.276   15.324  1.00 0.00 ? 95  THR A OG1  7  
ATOM 10941 C CG2  . THR A 1 95  ? 2.581   3.246   13.930  1.00 0.00 ? 95  THR A CG2  7  
ATOM 10942 H H    . THR A 1 95  ? 6.031   0.447   14.113  1.00 0.00 ? 95  THR A H    7  
ATOM 10943 H HA   . THR A 1 95  ? 3.554   0.975   12.798  1.00 0.00 ? 95  THR A HA   7  
ATOM 10944 H HB   . THR A 1 95  ? 4.175   2.676   15.220  1.00 0.00 ? 95  THR A HB   7  
ATOM 10945 H HG1  . THR A 1 95  ? 2.295   1.736   16.078  1.00 0.00 ? 95  THR A HG1  7  
ATOM 10946 H HG21 . THR A 1 95  ? 2.171   2.867   13.005  1.00 0.00 ? 95  THR A HG21 7  
ATOM 10947 H HG22 . THR A 1 95  ? 3.162   4.133   13.729  1.00 0.00 ? 95  THR A HG22 7  
ATOM 10948 H HG23 . THR A 1 95  ? 1.776   3.489   14.607  1.00 0.00 ? 95  THR A HG23 7  
ATOM 10949 N N    . LEU A 1 96  ? 4.621   2.906   11.602  1.00 0.00 ? 96  LEU A N    7  
ATOM 10950 C CA   . LEU A 1 96  ? 5.359   3.857   10.777  1.00 0.00 ? 96  LEU A CA   7  
ATOM 10951 C C    . LEU A 1 96  ? 4.594   5.170   10.645  1.00 0.00 ? 96  LEU A C    7  
ATOM 10952 O O    . LEU A 1 96  ? 3.420   5.258   11.006  1.00 0.00 ? 96  LEU A O    7  
ATOM 10953 C CB   . LEU A 1 96  ? 5.622   3.265   9.392   1.00 0.00 ? 96  LEU A CB   7  
ATOM 10954 C CG   . LEU A 1 96  ? 4.580   3.581   8.318   1.00 0.00 ? 96  LEU A CG   7  
ATOM 10955 C CD1  . LEU A 1 96  ? 5.145   3.312   6.931   1.00 0.00 ? 96  LEU A CD1  7  
ATOM 10956 C CD2  . LEU A 1 96  ? 3.315   2.767   8.547   1.00 0.00 ? 96  LEU A CD2  7  
ATOM 10957 H H    . LEU A 1 96  ? 3.722   2.632   11.325  1.00 0.00 ? 96  LEU A H    7  
ATOM 10958 H HA   . LEU A 1 96  ? 6.304   4.053   11.262  1.00 0.00 ? 96  LEU A HA   7  
ATOM 10959 H HB2  . LEU A 1 96  ? 6.574   3.639   9.048   1.00 0.00 ? 96  LEU A HB2  7  
ATOM 10960 H HB3  . LEU A 1 96  ? 5.675   2.191   9.497   1.00 0.00 ? 96  LEU A HB3  7  
ATOM 10961 H HG   . LEU A 1 96  ? 4.320   4.629   8.375   1.00 0.00 ? 96  LEU A HG   7  
ATOM 10962 H HD11 . LEU A 1 96  ? 5.583   4.218   6.540   1.00 0.00 ? 96  LEU A HD11 7  
ATOM 10963 H HD12 . LEU A 1 96  ? 4.351   2.984   6.277   1.00 0.00 ? 96  LEU A HD12 7  
ATOM 10964 H HD13 . LEU A 1 96  ? 5.901   2.543   6.993   1.00 0.00 ? 96  LEU A HD13 7  
ATOM 10965 H HD21 . LEU A 1 96  ? 2.670   2.856   7.685   1.00 0.00 ? 96  LEU A HD21 7  
ATOM 10966 H HD22 . LEU A 1 96  ? 2.801   3.140   9.421   1.00 0.00 ? 96  LEU A HD22 7  
ATOM 10967 H HD23 . LEU A 1 96  ? 3.576   1.730   8.697   1.00 0.00 ? 96  LEU A HD23 7  
ATOM 10968 N N    . THR A 1 97  ? 5.266   6.191   10.121  1.00 0.00 ? 97  THR A N    7  
ATOM 10969 C CA   . THR A 1 97  ? 4.650   7.499   9.939   1.00 0.00 ? 97  THR A CA   7  
ATOM 10970 C C    . THR A 1 97  ? 4.659   7.912   8.472   1.00 0.00 ? 97  THR A C    7  
ATOM 10971 O O    . THR A 1 97  ? 5.663   8.412   7.963   1.00 0.00 ? 97  THR A O    7  
ATOM 10972 C CB   . THR A 1 97  ? 5.369   8.579   10.769  1.00 0.00 ? 97  THR A CB   7  
ATOM 10973 O OG1  . THR A 1 97  ? 5.780   8.036   12.029  1.00 0.00 ? 97  THR A OG1  7  
ATOM 10974 C CG2  . THR A 1 97  ? 4.462   9.778   10.999  1.00 0.00 ? 97  THR A CG2  7  
ATOM 10975 H H    . THR A 1 97  ? 6.199   6.059   9.852   1.00 0.00 ? 97  THR A H    7  
ATOM 10976 H HA   . THR A 1 97  ? 3.626   7.436   10.279  1.00 0.00 ? 97  THR A HA   7  
ATOM 10977 H HB   . THR A 1 97  ? 6.243   8.907   10.225  1.00 0.00 ? 97  THR A HB   7  
ATOM 10978 H HG1  . THR A 1 97  ? 5.070   8.136   12.667  1.00 0.00 ? 97  THR A HG1  7  
ATOM 10979 H HG21 . THR A 1 97  ? 3.435   9.448   11.052  1.00 0.00 ? 97  THR A HG21 7  
ATOM 10980 H HG22 . THR A 1 97  ? 4.574   10.477  10.184  1.00 0.00 ? 97  THR A HG22 7  
ATOM 10981 H HG23 . THR A 1 97  ? 4.732   10.261  11.927  1.00 0.00 ? 97  THR A HG23 7  
ATOM 10982 N N    . VAL A 1 98  ? 3.535   7.701   7.795   1.00 0.00 ? 98  VAL A N    7  
ATOM 10983 C CA   . VAL A 1 98  ? 3.413   8.053   6.385   1.00 0.00 ? 98  VAL A CA   7  
ATOM 10984 C C    . VAL A 1 98  ? 2.709   9.394   6.213   1.00 0.00 ? 98  VAL A C    7  
ATOM 10985 O O    . VAL A 1 98  ? 1.645   9.628   6.788   1.00 0.00 ? 98  VAL A O    7  
ATOM 10986 C CB   . VAL A 1 98  ? 2.640   6.975   5.602   1.00 0.00 ? 98  VAL A CB   7  
ATOM 10987 C CG1  . VAL A 1 98  ? 3.134   5.586   5.976   1.00 0.00 ? 98  VAL A CG1  7  
ATOM 10988 C CG2  . VAL A 1 98  ? 1.146   7.104   5.853   1.00 0.00 ? 98  VAL A CG2  7  
ATOM 10989 H H    . VAL A 1 98  ? 2.769   7.299   8.255   1.00 0.00 ? 98  VAL A H    7  
ATOM 10990 H HA   . VAL A 1 98  ? 4.409   8.124   5.972   1.00 0.00 ? 98  VAL A HA   7  
ATOM 10991 H HB   . VAL A 1 98  ? 2.821   7.125   4.548   1.00 0.00 ? 98  VAL A HB   7  
ATOM 10992 H HG11 . VAL A 1 98  ? 4.101   5.664   6.452   1.00 0.00 ? 98  VAL A HG11 7  
ATOM 10993 H HG12 . VAL A 1 98  ? 2.433   5.125   6.656   1.00 0.00 ? 98  VAL A HG12 7  
ATOM 10994 H HG13 . VAL A 1 98  ? 3.221   4.983   5.084   1.00 0.00 ? 98  VAL A HG13 7  
ATOM 10995 H HG21 . VAL A 1 98  ? 0.632   6.269   5.401   1.00 0.00 ? 98  VAL A HG21 7  
ATOM 10996 H HG22 . VAL A 1 98  ? 0.958   7.108   6.917   1.00 0.00 ? 98  VAL A HG22 7  
ATOM 10997 H HG23 . VAL A 1 98  ? 0.786   8.026   5.421   1.00 0.00 ? 98  VAL A HG23 7  
ATOM 10998 N N    . LEU A 1 99  ? 3.309   10.272  5.417   1.00 0.00 ? 99  LEU A N    7  
ATOM 10999 C CA   . LEU A 1 99  ? 2.739   11.592  5.167   1.00 0.00 ? 99  LEU A CA   7  
ATOM 11000 C C    . LEU A 1 99  ? 1.936   11.601  3.870   1.00 0.00 ? 99  LEU A C    7  
ATOM 11001 O O    . LEU A 1 99  ? 1.707   12.656  3.277   1.00 0.00 ? 99  LEU A O    7  
ATOM 11002 C CB   . LEU A 1 99  ? 3.848   12.644  5.101   1.00 0.00 ? 99  LEU A CB   7  
ATOM 11003 C CG   . LEU A 1 99  ? 3.392   14.103  5.133   1.00 0.00 ? 99  LEU A CG   7  
ATOM 11004 C CD1  . LEU A 1 99  ? 2.590   14.384  6.394   1.00 0.00 ? 99  LEU A CD1  7  
ATOM 11005 C CD2  . LEU A 1 99  ? 4.588   15.038  5.039   1.00 0.00 ? 99  LEU A CD2  7  
ATOM 11006 H H    . LEU A 1 99  ? 4.155   10.029  4.987   1.00 0.00 ? 99  LEU A H    7  
ATOM 11007 H HA   . LEU A 1 99  ? 2.078   11.828  5.988   1.00 0.00 ? 99  LEU A HA   7  
ATOM 11008 H HB2  . LEU A 1 99  ? 4.505   12.485  5.943   1.00 0.00 ? 99  LEU A HB2  7  
ATOM 11009 H HB3  . LEU A 1 99  ? 4.397   12.487  4.184   1.00 0.00 ? 99  LEU A HB3  7  
ATOM 11010 H HG   . LEU A 1 99  ? 2.751   14.291  4.282   1.00 0.00 ? 99  LEU A HG   7  
ATOM 11011 H HD11 . LEU A 1 99  ? 3.026   13.851  7.224   1.00 0.00 ? 99  LEU A HD11 7  
ATOM 11012 H HD12 . LEU A 1 99  ? 1.570   14.058  6.252   1.00 0.00 ? 99  LEU A HD12 7  
ATOM 11013 H HD13 . LEU A 1 99  ? 2.603   15.445  6.599   1.00 0.00 ? 99  LEU A HD13 7  
ATOM 11014 H HD21 . LEU A 1 99  ? 4.450   15.717  4.211   1.00 0.00 ? 99  LEU A HD21 7  
ATOM 11015 H HD22 . LEU A 1 99  ? 5.487   14.458  4.882   1.00 0.00 ? 99  LEU A HD22 7  
ATOM 11016 H HD23 . LEU A 1 99  ? 4.678   15.601  5.956   1.00 0.00 ? 99  LEU A HD23 7  
ATOM 11017 N N    . VAL A 1 100 ? 1.509   10.420  3.436   1.00 0.00 ? 100 VAL A N    7  
ATOM 11018 C CA   . VAL A 1 100 ? 0.728   10.292  2.211   1.00 0.00 ? 100 VAL A CA   7  
ATOM 11019 C C    . VAL A 1 100 ? -0.473  11.231  2.225   1.00 0.00 ? 100 VAL A C    7  
ATOM 11020 O O    . VAL A 1 100 ? -0.643  12.026  3.151   1.00 0.00 ? 100 VAL A O    7  
ATOM 11021 C CB   . VAL A 1 100 ? 0.234   8.848   2.009   1.00 0.00 ? 100 VAL A CB   7  
ATOM 11022 C CG1  . VAL A 1 100 ? 1.350   7.856   2.299   1.00 0.00 ? 100 VAL A CG1  7  
ATOM 11023 C CG2  . VAL A 1 100 ? -0.978  8.571   2.887   1.00 0.00 ? 100 VAL A CG2  7  
ATOM 11024 H H    . VAL A 1 100 ? 1.723   9.615   3.952   1.00 0.00 ? 100 VAL A H    7  
ATOM 11025 H HA   . VAL A 1 100 ? 1.366   10.552  1.380   1.00 0.00 ? 100 VAL A HA   7  
ATOM 11026 H HB   . VAL A 1 100 ? -0.062  8.731   0.977   1.00 0.00 ? 100 VAL A HB   7  
ATOM 11027 H HG11 . VAL A 1 100 ? 1.253   7.004   1.641   1.00 0.00 ? 100 VAL A HG11 7  
ATOM 11028 H HG12 . VAL A 1 100 ? 2.306   8.331   2.136   1.00 0.00 ? 100 VAL A HG12 7  
ATOM 11029 H HG13 . VAL A 1 100 ? 1.281   7.527   3.325   1.00 0.00 ? 100 VAL A HG13 7  
ATOM 11030 H HG21 . VAL A 1 100 ? -1.262  7.534   2.791   1.00 0.00 ? 100 VAL A HG21 7  
ATOM 11031 H HG22 . VAL A 1 100 ? -0.731  8.783   3.918   1.00 0.00 ? 100 VAL A HG22 7  
ATOM 11032 H HG23 . VAL A 1 100 ? -1.798  9.201   2.577   1.00 0.00 ? 100 VAL A HG23 7  
ATOM 11033 N N    . CYS A 1 101 ? -1.304  11.135  1.193   1.00 0.00 ? 101 CYS A N    7  
ATOM 11034 C CA   . CYS A 1 101 ? -2.491  11.977  1.086   1.00 0.00 ? 101 CYS A CA   7  
ATOM 11035 C C    . CYS A 1 101 ? -3.319  11.596  -0.137  1.00 0.00 ? 101 CYS A C    7  
ATOM 11036 O O    . CYS A 1 101 ? -2.805  11.004  -1.087  1.00 0.00 ? 101 CYS A O    7  
ATOM 11037 C CB   . CYS A 1 101 ? -2.090  13.451  1.007   1.00 0.00 ? 101 CYS A CB   7  
ATOM 11038 S SG   . CYS A 1 101 ? -1.737  14.031  -0.669  1.00 0.00 ? 101 CYS A SG   7  
ATOM 11039 H H    . CYS A 1 101 ? -1.116  10.483  0.486   1.00 0.00 ? 101 CYS A H    7  
ATOM 11040 H HA   . CYS A 1 101 ? -3.087  11.822  1.972   1.00 0.00 ? 101 CYS A HA   7  
ATOM 11041 H HB2  . CYS A 1 101 ? -2.894  14.056  1.400   1.00 0.00 ? 101 CYS A HB2  7  
ATOM 11042 H HB3  . CYS A 1 101 ? -1.204  13.608  1.604   1.00 0.00 ? 101 CYS A HB3  7  
ATOM 11043 H HG   . CYS A 1 101 ? -1.134  13.049  -1.322  1.00 0.00 ? 101 CYS A HG   7  
ATOM 11044 N N    . ASP A 1 102 ? -4.602  11.937  -0.105  1.00 0.00 ? 102 ASP A N    7  
ATOM 11045 C CA   . ASP A 1 102 ? -5.502  11.630  -1.211  1.00 0.00 ? 102 ASP A CA   7  
ATOM 11046 C C    . ASP A 1 102 ? -4.933  12.137  -2.532  1.00 0.00 ? 102 ASP A C    7  
ATOM 11047 O O    . ASP A 1 102 ? -5.019  13.324  -2.842  1.00 0.00 ? 102 ASP A O    7  
ATOM 11048 C CB   . ASP A 1 102 ? -6.878  12.249  -0.963  1.00 0.00 ? 102 ASP A CB   7  
ATOM 11049 C CG   . ASP A 1 102 ? -7.298  12.164  0.491   1.00 0.00 ? 102 ASP A CG   7  
ATOM 11050 O OD1  . ASP A 1 102 ? -6.959  11.158  1.148   1.00 0.00 ? 102 ASP A OD1  7  
ATOM 11051 O OD2  . ASP A 1 102 ? -7.967  13.103  0.972   1.00 0.00 ? 102 ASP A OD2  7  
ATOM 11052 H H    . ASP A 1 102 ? -4.953  12.407  0.680   1.00 0.00 ? 102 ASP A H    7  
ATOM 11053 H HA   . ASP A 1 102 ? -5.606  10.557  -1.266  1.00 0.00 ? 102 ASP A HA   7  
ATOM 11054 H HB2  . ASP A 1 102 ? -6.855  13.290  -1.251  1.00 0.00 ? 102 ASP A HB2  7  
ATOM 11055 H HB3  . ASP A 1 102 ? -7.612  11.731  -1.562  1.00 0.00 ? 102 ASP A HB3  7  
ATOM 11056 N N    . GLY A 1 103 ? -4.349  11.228  -3.307  1.00 0.00 ? 103 GLY A N    7  
ATOM 11057 C CA   . GLY A 1 103 ? -3.772  11.602  -4.585  1.00 0.00 ? 103 GLY A CA   7  
ATOM 11058 C C    . GLY A 1 103 ? -4.766  11.491  -5.724  1.00 0.00 ? 103 GLY A C    7  
ATOM 11059 O O    . GLY A 1 103 ? -5.013  12.462  -6.439  1.00 0.00 ? 103 GLY A O    7  
ATOM 11060 H H    . GLY A 1 103 ? -4.309  10.295  -3.008  1.00 0.00 ? 103 GLY A H    7  
ATOM 11061 H HA2  . GLY A 1 103 ? -3.422  12.622  -4.525  1.00 0.00 ? 103 GLY A HA2  7  
ATOM 11062 H HA3  . GLY A 1 103 ? -2.932  10.955  -4.792  1.00 0.00 ? 103 GLY A HA3  7  
ATOM 11063 N N    . PHE A 1 104 ? -5.337  10.303  -5.895  1.00 0.00 ? 104 PHE A N    7  
ATOM 11064 C CA   . PHE A 1 104 ? -6.308  10.068  -6.958  1.00 0.00 ? 104 PHE A CA   7  
ATOM 11065 C C    . PHE A 1 104 ? -7.055  8.757   -6.731  1.00 0.00 ? 104 PHE A C    7  
ATOM 11066 O O    . PHE A 1 104 ? -6.480  7.675   -6.848  1.00 0.00 ? 104 PHE A O    7  
ATOM 11067 C CB   . PHE A 1 104 ? -5.609  10.041  -8.319  1.00 0.00 ? 104 PHE A CB   7  
ATOM 11068 C CG   . PHE A 1 104 ? -4.209  9.502   -8.264  1.00 0.00 ? 104 PHE A CG   7  
ATOM 11069 C CD1  . PHE A 1 104 ? -3.145  10.331  -7.949  1.00 0.00 ? 104 PHE A CD1  7  
ATOM 11070 C CD2  . PHE A 1 104 ? -3.956  8.165   -8.527  1.00 0.00 ? 104 PHE A CD2  7  
ATOM 11071 C CE1  . PHE A 1 104 ? -1.855  9.838   -7.898  1.00 0.00 ? 104 PHE A CE1  7  
ATOM 11072 C CE2  . PHE A 1 104 ? -2.668  7.665   -8.477  1.00 0.00 ? 104 PHE A CE2  7  
ATOM 11073 C CZ   . PHE A 1 104 ? -1.616  8.503   -8.161  1.00 0.00 ? 104 PHE A CZ   7  
ATOM 11074 H H    . PHE A 1 104 ? -5.099  9.567   -5.293  1.00 0.00 ? 104 PHE A H    7  
ATOM 11075 H HA   . PHE A 1 104 ? -7.018  10.880  -6.943  1.00 0.00 ? 104 PHE A HA   7  
ATOM 11076 H HB2  . PHE A 1 104 ? -6.177  9.420   -8.995  1.00 0.00 ? 104 PHE A HB2  7  
ATOM 11077 H HB3  . PHE A 1 104 ? -5.564  11.046  -8.712  1.00 0.00 ? 104 PHE A HB3  7  
ATOM 11078 H HD1  . PHE A 1 104 ? -3.330  11.375  -7.741  1.00 0.00 ? 104 PHE A HD1  7  
ATOM 11079 H HD2  . PHE A 1 104 ? -4.779  7.509   -8.774  1.00 0.00 ? 104 PHE A HD2  7  
ATOM 11080 H HE1  . PHE A 1 104 ? -1.034  10.494  -7.650  1.00 0.00 ? 104 PHE A HE1  7  
ATOM 11081 H HE2  . PHE A 1 104 ? -2.486  6.621   -8.683  1.00 0.00 ? 104 PHE A HE2  7  
ATOM 11082 H HZ   . PHE A 1 104 ? -0.610  8.115   -8.122  1.00 0.00 ? 104 PHE A HZ   7  
ATOM 11083 N N    . GLU A 1 105 ? -8.339  8.863   -6.406  1.00 0.00 ? 105 GLU A N    7  
ATOM 11084 C CA   . GLU A 1 105 ? -9.164  7.686   -6.161  1.00 0.00 ? 105 GLU A CA   7  
ATOM 11085 C C    . GLU A 1 105 ? -9.362  6.883   -7.444  1.00 0.00 ? 105 GLU A C    7  
ATOM 11086 O O    . GLU A 1 105 ? -9.990  7.354   -8.393  1.00 0.00 ? 105 GLU A O    7  
ATOM 11087 C CB   . GLU A 1 105 ? -10.523 8.097   -5.590  1.00 0.00 ? 105 GLU A CB   7  
ATOM 11088 C CG   . GLU A 1 105 ? -11.303 9.038   -6.493  1.00 0.00 ? 105 GLU A CG   7  
ATOM 11089 C CD   . GLU A 1 105 ? -12.564 9.564   -5.836  1.00 0.00 ? 105 GLU A CD   7  
ATOM 11090 O OE1  . GLU A 1 105 ? -12.487 10.608  -5.155  1.00 0.00 ? 105 GLU A OE1  7  
ATOM 11091 O OE2  . GLU A 1 105 ? -13.629 8.933   -6.003  1.00 0.00 ? 105 GLU A OE2  7  
ATOM 11092 H H    . GLU A 1 105 ? -8.741  9.753   -6.328  1.00 0.00 ? 105 GLU A H    7  
ATOM 11093 H HA   . GLU A 1 105 ? -8.654  7.067   -5.439  1.00 0.00 ? 105 GLU A HA   7  
ATOM 11094 H HB2  . GLU A 1 105 ? -11.117 7.210   -5.430  1.00 0.00 ? 105 GLU A HB2  7  
ATOM 11095 H HB3  . GLU A 1 105 ? -10.366 8.590   -4.642  1.00 0.00 ? 105 GLU A HB3  7  
ATOM 11096 H HG2  . GLU A 1 105 ? -10.672 9.876   -6.749  1.00 0.00 ? 105 GLU A HG2  7  
ATOM 11097 H HG3  . GLU A 1 105 ? -11.577 8.507   -7.393  1.00 0.00 ? 105 GLU A HG3  7  
ATOM 11098 N N    . SER A 1 106 ? -8.820  5.670   -7.466  1.00 0.00 ? 106 SER A N    7  
ATOM 11099 C CA   . SER A 1 106 ? -8.933  4.803   -8.633  1.00 0.00 ? 106 SER A CA   7  
ATOM 11100 C C    . SER A 1 106 ? -10.396 4.559   -8.990  1.00 0.00 ? 106 SER A C    7  
ATOM 11101 O O    . SER A 1 106 ? -10.778 4.610   -10.158 1.00 0.00 ? 106 SER A O    7  
ATOM 11102 C CB   . SER A 1 106 ? -8.230  3.469   -8.374  1.00 0.00 ? 106 SER A CB   7  
ATOM 11103 O OG   . SER A 1 106 ? -7.886  2.829   -9.590  1.00 0.00 ? 106 SER A OG   7  
ATOM 11104 H H    . SER A 1 106 ? -8.331  5.351   -6.678  1.00 0.00 ? 106 SER A H    7  
ATOM 11105 H HA   . SER A 1 106 ? -8.450  5.299   -9.462  1.00 0.00 ? 106 SER A HA   7  
ATOM 11106 H HB2  . SER A 1 106 ? -7.329  3.644   -7.806  1.00 0.00 ? 106 SER A HB2  7  
ATOM 11107 H HB3  . SER A 1 106 ? -8.889  2.822   -7.813  1.00 0.00 ? 106 SER A HB3  7  
ATOM 11108 H HG   . SER A 1 106 ? -8.240  1.937   -9.594  1.00 0.00 ? 106 SER A HG   7  
ATOM 11109 N N    . GLY A 1 107 ? -11.210 4.294   -7.973  1.00 0.00 ? 107 GLY A N    7  
ATOM 11110 C CA   . GLY A 1 107 ? -12.622 4.046   -8.199  1.00 0.00 ? 107 GLY A CA   7  
ATOM 11111 C C    . GLY A 1 107 ? -13.170 2.954   -7.301  1.00 0.00 ? 107 GLY A C    7  
ATOM 11112 O O    . GLY A 1 107 ? -12.478 1.992   -6.965  1.00 0.00 ? 107 GLY A O    7  
ATOM 11113 H H    . GLY A 1 107 ? -10.849 4.267   -7.062  1.00 0.00 ? 107 GLY A H    7  
ATOM 11114 H HA2  . GLY A 1 107 ? -13.171 4.958   -8.015  1.00 0.00 ? 107 GLY A HA2  7  
ATOM 11115 H HA3  . GLY A 1 107 ? -12.764 3.754   -9.229  1.00 0.00 ? 107 GLY A HA3  7  
ATOM 11116 N N    . PRO A 1 108 ? -14.440 3.097   -6.896  1.00 0.00 ? 108 PRO A N    7  
ATOM 11117 C CA   . PRO A 1 108 ? -15.108 2.125   -6.026  1.00 0.00 ? 108 PRO A CA   7  
ATOM 11118 C C    . PRO A 1 108 ? -15.380 0.802   -6.734  1.00 0.00 ? 108 PRO A C    7  
ATOM 11119 O O    . PRO A 1 108 ? -15.151 0.673   -7.937  1.00 0.00 ? 108 PRO A O    7  
ATOM 11120 C CB   . PRO A 1 108 ? -16.424 2.818   -5.664  1.00 0.00 ? 108 PRO A CB   7  
ATOM 11121 C CG   . PRO A 1 108 ? -16.677 3.761   -6.789  1.00 0.00 ? 108 PRO A CG   7  
ATOM 11122 C CD   . PRO A 1 108 ? -15.324 4.218   -7.258  1.00 0.00 ? 108 PRO A CD   7  
ATOM 11123 H HA   . PRO A 1 108 ? -14.538 1.940   -5.127  1.00 0.00 ? 108 PRO A HA   7  
ATOM 11124 H HB2  . PRO A 1 108 ? -17.211 2.081   -5.581  1.00 0.00 ? 108 PRO A HB2  7  
ATOM 11125 H HB3  . PRO A 1 108 ? -16.313 3.342   -4.727  1.00 0.00 ? 108 PRO A HB3  7  
ATOM 11126 H HG2  . PRO A 1 108 ? -17.198 3.252   -7.585  1.00 0.00 ? 108 PRO A HG2  7  
ATOM 11127 H HG3  . PRO A 1 108 ? -17.256 4.603   -6.438  1.00 0.00 ? 108 PRO A HG3  7  
ATOM 11128 H HD2  . PRO A 1 108 ? -15.328 4.377   -8.326  1.00 0.00 ? 108 PRO A HD2  7  
ATOM 11129 H HD3  . PRO A 1 108 ? -15.030 5.121   -6.742  1.00 0.00 ? 108 PRO A HD3  7  
ATOM 11130 N N    . SER A 1 109 ? -15.868 -0.178  -5.981  1.00 0.00 ? 109 SER A N    7  
ATOM 11131 C CA   . SER A 1 109 ? -16.168 -1.492  -6.538  1.00 0.00 ? 109 SER A CA   7  
ATOM 11132 C C    . SER A 1 109 ? -16.988 -2.324  -5.555  1.00 0.00 ? 109 SER A C    7  
ATOM 11133 O O    . SER A 1 109 ? -16.833 -2.201  -4.340  1.00 0.00 ? 109 SER A O    7  
ATOM 11134 C CB   . SER A 1 109 ? -14.874 -2.228  -6.890  1.00 0.00 ? 109 SER A CB   7  
ATOM 11135 O OG   . SER A 1 109 ? -15.144 -3.428  -7.592  1.00 0.00 ? 109 SER A OG   7  
ATOM 11136 H H    . SER A 1 109 ? -16.029 -0.014  -5.028  1.00 0.00 ? 109 SER A H    7  
ATOM 11137 H HA   . SER A 1 109 ? -16.746 -1.347  -7.438  1.00 0.00 ? 109 SER A HA   7  
ATOM 11138 H HB2  . SER A 1 109 ? -14.259 -1.592  -7.509  1.00 0.00 ? 109 SER A HB2  7  
ATOM 11139 H HB3  . SER A 1 109 ? -14.341 -2.468  -5.981  1.00 0.00 ? 109 SER A HB3  7  
ATOM 11140 H HG   . SER A 1 109 ? -15.680 -4.006  -7.045  1.00 0.00 ? 109 SER A HG   7  
ATOM 11141 N N    . SER A 1 110 ? -17.861 -3.170  -6.091  1.00 0.00 ? 110 SER A N    7  
ATOM 11142 C CA   . SER A 1 110 ? -18.708 -4.020  -5.264  1.00 0.00 ? 110 SER A CA   7  
ATOM 11143 C C    . SER A 1 110 ? -18.712 -5.455  -5.783  1.00 0.00 ? 110 SER A C    7  
ATOM 11144 O O    . SER A 1 110 ? -18.286 -5.722  -6.905  1.00 0.00 ? 110 SER A O    7  
ATOM 11145 C CB   . SER A 1 110 ? -20.137 -3.475  -5.231  1.00 0.00 ? 110 SER A CB   7  
ATOM 11146 O OG   . SER A 1 110 ? -20.160 -2.131  -4.783  1.00 0.00 ? 110 SER A OG   7  
ATOM 11147 H H    . SER A 1 110 ? -17.938 -3.223  -7.067  1.00 0.00 ? 110 SER A H    7  
ATOM 11148 H HA   . SER A 1 110 ? -18.307 -4.014  -4.261  1.00 0.00 ? 110 SER A HA   7  
ATOM 11149 H HB2  . SER A 1 110 ? -20.559 -3.518  -6.224  1.00 0.00 ? 110 SER A HB2  7  
ATOM 11150 H HB3  . SER A 1 110 ? -20.734 -4.076  -4.560  1.00 0.00 ? 110 SER A HB3  7  
ATOM 11151 H HG   . SER A 1 110 ? -19.357 -1.685  -5.065  1.00 0.00 ? 110 SER A HG   7  
ATOM 11152 N N    . GLY A 1 111 ? -19.196 -6.376  -4.955  1.00 0.00 ? 111 GLY A N    7  
ATOM 11153 C CA   . GLY A 1 111 ? -19.246 -7.773  -5.347  1.00 0.00 ? 111 GLY A CA   7  
ATOM 11154 C C    . GLY A 1 111 ? -20.277 -8.036  -6.426  1.00 0.00 ? 111 GLY A C    7  
ATOM 11155 O O    . GLY A 1 111 ? -19.935 -8.444  -7.535  1.00 0.00 ? 111 GLY A O    7  
ATOM 11156 H H    . GLY A 1 111 ? -19.522 -6.105  -4.071  1.00 0.00 ? 111 GLY A H    7  
ATOM 11157 H HA2  . GLY A 1 111 ? -18.274 -8.068  -5.713  1.00 0.00 ? 111 GLY A HA2  7  
ATOM 11158 H HA3  . GLY A 1 111 ? -19.489 -8.369  -4.480  1.00 0.00 ? 111 GLY A HA3  7  
ATOM 11159 N N    . GLY A 1 1   ? -12.930 21.652  -11.320 1.00 0.00 ? 1   GLY A N    8  
ATOM 11160 C CA   . GLY A 1 1   ? -13.962 21.157  -10.429 1.00 0.00 ? 1   GLY A CA   8  
ATOM 11161 C C    . GLY A 1 1   ? -14.257 22.116  -9.293  1.00 0.00 ? 1   GLY A C    8  
ATOM 11162 O O    . GLY A 1 1   ? -14.627 23.267  -9.524  1.00 0.00 ? 1   GLY A O    8  
ATOM 11163 H H1   . GLY A 1 1   ? -12.745 22.614  -11.367 1.00 0.00 ? 1   GLY A H1   8  
ATOM 11164 H HA2  . GLY A 1 1   ? -14.867 20.998  -10.996 1.00 0.00 ? 1   GLY A HA2  8  
ATOM 11165 H HA3  . GLY A 1 1   ? -13.640 20.213  -10.013 1.00 0.00 ? 1   GLY A HA3  8  
ATOM 11166 N N    . SER A 1 2   ? -14.094 21.642  -8.062  1.00 0.00 ? 2   SER A N    8  
ATOM 11167 C CA   . SER A 1 2   ? -14.350 22.465  -6.885  1.00 0.00 ? 2   SER A CA   8  
ATOM 11168 C C    . SER A 1 2   ? -13.126 23.303  -6.531  1.00 0.00 ? 2   SER A C    8  
ATOM 11169 O O    . SER A 1 2   ? -12.095 22.772  -6.117  1.00 0.00 ? 2   SER A O    8  
ATOM 11170 C CB   . SER A 1 2   ? -14.741 21.584  -5.697  1.00 0.00 ? 2   SER A CB   8  
ATOM 11171 O OG   . SER A 1 2   ? -15.153 22.371  -4.593  1.00 0.00 ? 2   SER A OG   8  
ATOM 11172 H H    . SER A 1 2   ? -13.797 20.716  -7.942  1.00 0.00 ? 2   SER A H    8  
ATOM 11173 H HA   . SER A 1 2   ? -15.171 23.127  -7.117  1.00 0.00 ? 2   SER A HA   8  
ATOM 11174 H HB2  . SER A 1 2   ? -15.554 20.936  -5.984  1.00 0.00 ? 2   SER A HB2  8  
ATOM 11175 H HB3  . SER A 1 2   ? -13.891 20.987  -5.400  1.00 0.00 ? 2   SER A HB3  8  
ATOM 11176 H HG   . SER A 1 2   ? -14.781 23.253  -4.671  1.00 0.00 ? 2   SER A HG   8  
ATOM 11177 N N    . SER A 1 3   ? -13.247 24.616  -6.698  1.00 0.00 ? 3   SER A N    8  
ATOM 11178 C CA   . SER A 1 3   ? -12.150 25.529  -6.400  1.00 0.00 ? 3   SER A CA   8  
ATOM 11179 C C    . SER A 1 3   ? -12.172 25.944  -4.932  1.00 0.00 ? 3   SER A C    8  
ATOM 11180 O O    . SER A 1 3   ? -13.135 26.548  -4.461  1.00 0.00 ? 3   SER A O    8  
ATOM 11181 C CB   . SER A 1 3   ? -12.232 26.768  -7.294  1.00 0.00 ? 3   SER A CB   8  
ATOM 11182 O OG   . SER A 1 3   ? -12.217 26.409  -8.665  1.00 0.00 ? 3   SER A OG   8  
ATOM 11183 H H    . SER A 1 3   ? -14.094 24.979  -7.031  1.00 0.00 ? 3   SER A H    8  
ATOM 11184 H HA   . SER A 1 3   ? -11.224 25.011  -6.601  1.00 0.00 ? 3   SER A HA   8  
ATOM 11185 H HB2  . SER A 1 3   ? -13.147 27.300  -7.083  1.00 0.00 ? 3   SER A HB2  8  
ATOM 11186 H HB3  . SER A 1 3   ? -11.387 27.410  -7.092  1.00 0.00 ? 3   SER A HB3  8  
ATOM 11187 H HG   . SER A 1 3   ? -12.580 25.527  -8.769  1.00 0.00 ? 3   SER A HG   8  
ATOM 11188 N N    . GLY A 1 4   ? -11.102 25.616  -4.214  1.00 0.00 ? 4   GLY A N    8  
ATOM 11189 C CA   . GLY A 1 4   ? -11.019 25.962  -2.807  1.00 0.00 ? 4   GLY A CA   8  
ATOM 11190 C C    . GLY A 1 4   ? -10.099 25.036  -2.036  1.00 0.00 ? 4   GLY A C    8  
ATOM 11191 O O    . GLY A 1 4   ? -9.232  24.385  -2.619  1.00 0.00 ? 4   GLY A O    8  
ATOM 11192 H H    . GLY A 1 4   ? -10.364 25.134  -4.643  1.00 0.00 ? 4   GLY A H    8  
ATOM 11193 H HA2  . GLY A 1 4   ? -10.652 26.974  -2.718  1.00 0.00 ? 4   GLY A HA2  8  
ATOM 11194 H HA3  . GLY A 1 4   ? -12.007 25.909  -2.376  1.00 0.00 ? 4   GLY A HA3  8  
ATOM 11195 N N    . SER A 1 5   ? -10.286 24.979  -0.721  1.00 0.00 ? 5   SER A N    8  
ATOM 11196 C CA   . SER A 1 5   ? -9.462  24.130  0.132   1.00 0.00 ? 5   SER A CA   8  
ATOM 11197 C C    . SER A 1 5   ? -9.294  22.743  -0.482  1.00 0.00 ? 5   SER A C    8  
ATOM 11198 O O    . SER A 1 5   ? -10.226 21.939  -0.490  1.00 0.00 ? 5   SER A O    8  
ATOM 11199 C CB   . SER A 1 5   ? -10.085 24.012  1.524   1.00 0.00 ? 5   SER A CB   8  
ATOM 11200 O OG   . SER A 1 5   ? -9.159  23.476  2.453   1.00 0.00 ? 5   SER A OG   8  
ATOM 11201 H H    . SER A 1 5   ? -10.993 25.522  -0.315  1.00 0.00 ? 5   SER A H    8  
ATOM 11202 H HA   . SER A 1 5   ? -8.490  24.592  0.219   1.00 0.00 ? 5   SER A HA   8  
ATOM 11203 H HB2  . SER A 1 5   ? -10.391 24.990  1.863   1.00 0.00 ? 5   SER A HB2  8  
ATOM 11204 H HB3  . SER A 1 5   ? -10.946 23.362  1.476   1.00 0.00 ? 5   SER A HB3  8  
ATOM 11205 H HG   . SER A 1 5   ? -8.989  24.120  3.144   1.00 0.00 ? 5   SER A HG   8  
ATOM 11206 N N    . SER A 1 6   ? -8.098  22.471  -0.995  1.00 0.00 ? 6   SER A N    8  
ATOM 11207 C CA   . SER A 1 6   ? -7.807  21.183  -1.614  1.00 0.00 ? 6   SER A CA   8  
ATOM 11208 C C    . SER A 1 6   ? -8.398  20.040  -0.794  1.00 0.00 ? 6   SER A C    8  
ATOM 11209 O O    . SER A 1 6   ? -9.186  19.242  -1.299  1.00 0.00 ? 6   SER A O    8  
ATOM 11210 C CB   . SER A 1 6   ? -6.296  20.994  -1.760  1.00 0.00 ? 6   SER A CB   8  
ATOM 11211 O OG   . SER A 1 6   ? -5.651  21.045  -0.500  1.00 0.00 ? 6   SER A OG   8  
ATOM 11212 H H    . SER A 1 6   ? -7.396  23.154  -0.957  1.00 0.00 ? 6   SER A H    8  
ATOM 11213 H HA   . SER A 1 6   ? -8.259  21.178  -2.595  1.00 0.00 ? 6   SER A HA   8  
ATOM 11214 H HB2  . SER A 1 6   ? -6.099  20.034  -2.213  1.00 0.00 ? 6   SER A HB2  8  
ATOM 11215 H HB3  . SER A 1 6   ? -5.897  21.777  -2.388  1.00 0.00 ? 6   SER A HB3  8  
ATOM 11216 H HG   . SER A 1 6   ? -5.658  20.172  -0.100  1.00 0.00 ? 6   SER A HG   8  
ATOM 11217 N N    . GLY A 1 7   ? -8.009  19.968  0.476   1.00 0.00 ? 7   GLY A N    8  
ATOM 11218 C CA   . GLY A 1 7   ? -8.509  18.920  1.346   1.00 0.00 ? 7   GLY A CA   8  
ATOM 11219 C C    . GLY A 1 7   ? -7.425  18.336  2.231   1.00 0.00 ? 7   GLY A C    8  
ATOM 11220 O O    . GLY A 1 7   ? -6.250  18.296  1.866   1.00 0.00 ? 7   GLY A O    8  
ATOM 11221 H H    . GLY A 1 7   ? -7.378  20.633  0.824   1.00 0.00 ? 7   GLY A H    8  
ATOM 11222 H HA2  . GLY A 1 7   ? -9.289  19.328  1.971   1.00 0.00 ? 7   GLY A HA2  8  
ATOM 11223 H HA3  . GLY A 1 7   ? -8.924  18.131  0.738   1.00 0.00 ? 7   GLY A HA3  8  
ATOM 11224 N N    . PRO A 1 8   ? -7.819  17.872  3.427   1.00 0.00 ? 8   PRO A N    8  
ATOM 11225 C CA   . PRO A 1 8   ? -6.887  17.281  4.392   1.00 0.00 ? 8   PRO A CA   8  
ATOM 11226 C C    . PRO A 1 8   ? -6.357  15.927  3.931   1.00 0.00 ? 8   PRO A C    8  
ATOM 11227 O O    . PRO A 1 8   ? -7.116  15.080  3.460   1.00 0.00 ? 8   PRO A O    8  
ATOM 11228 C CB   . PRO A 1 8   ? -7.739  17.120  5.654   1.00 0.00 ? 8   PRO A CB   8  
ATOM 11229 C CG   . PRO A 1 8   ? -9.139  17.024  5.156   1.00 0.00 ? 8   PRO A CG   8  
ATOM 11230 C CD   . PRO A 1 8   ? -9.203  17.889  3.928   1.00 0.00 ? 8   PRO A CD   8  
ATOM 11231 H HA   . PRO A 1 8   ? -6.057  17.940  4.597   1.00 0.00 ? 8   PRO A HA   8  
ATOM 11232 H HB2  . PRO A 1 8   ? -7.442  16.224  6.179   1.00 0.00 ? 8   PRO A HB2  8  
ATOM 11233 H HB3  . PRO A 1 8   ? -7.606  17.980  6.294   1.00 0.00 ? 8   PRO A HB3  8  
ATOM 11234 H HG2  . PRO A 1 8   ? -9.370  16.000  4.906   1.00 0.00 ? 8   PRO A HG2  8  
ATOM 11235 H HG3  . PRO A 1 8   ? -9.822  17.391  5.908   1.00 0.00 ? 8   PRO A HG3  8  
ATOM 11236 H HD2  . PRO A 1 8   ? -9.881  17.465  3.202   1.00 0.00 ? 8   PRO A HD2  8  
ATOM 11237 H HD3  . PRO A 1 8   ? -9.506  18.892  4.189   1.00 0.00 ? 8   PRO A HD3  8  
ATOM 11238 N N    . GLY A 1 9   ? -5.050  15.730  4.071   1.00 0.00 ? 9   GLY A N    8  
ATOM 11239 C CA   . GLY A 1 9   ? -4.441  14.477  3.664   1.00 0.00 ? 9   GLY A CA   8  
ATOM 11240 C C    . GLY A 1 9   ? -2.934  14.484  3.827   1.00 0.00 ? 9   GLY A C    8  
ATOM 11241 O O    . GLY A 1 9   ? -2.320  13.438  4.039   1.00 0.00 ? 9   GLY A O    8  
ATOM 11242 H H    . GLY A 1 9   ? -4.494  16.441  4.452   1.00 0.00 ? 9   GLY A H    8  
ATOM 11243 H HA2  . GLY A 1 9   ? -4.854  13.678  4.263   1.00 0.00 ? 9   GLY A HA2  8  
ATOM 11244 H HA3  . GLY A 1 9   ? -4.679  14.294  2.626   1.00 0.00 ? 9   GLY A HA3  8  
ATOM 11245 N N    . LEU A 1 10  ? -2.336  15.666  3.726   1.00 0.00 ? 10  LEU A N    8  
ATOM 11246 C CA   . LEU A 1 10  ? -0.890  15.806  3.862   1.00 0.00 ? 10  LEU A CA   8  
ATOM 11247 C C    . LEU A 1 10  ? -0.489  15.914  5.330   1.00 0.00 ? 10  LEU A C    8  
ATOM 11248 O O    . LEU A 1 10  ? 0.516   16.540  5.664   1.00 0.00 ? 10  LEU A O    8  
ATOM 11249 C CB   . LEU A 1 10  ? -0.403  17.037  3.097   1.00 0.00 ? 10  LEU A CB   8  
ATOM 11250 C CG   . LEU A 1 10  ? -1.174  18.333  3.350   1.00 0.00 ? 10  LEU A CG   8  
ATOM 11251 C CD1  . LEU A 1 10  ? -2.359  18.444  2.403   1.00 0.00 ? 10  LEU A CD1  8  
ATOM 11252 C CD2  . LEU A 1 10  ? -1.637  18.404  4.798   1.00 0.00 ? 10  LEU A CD2  8  
ATOM 11253 H H    . LEU A 1 10  ? -2.878  16.464  3.557   1.00 0.00 ? 10  LEU A H    8  
ATOM 11254 H HA   . LEU A 1 10  ? -0.431  14.924  3.440   1.00 0.00 ? 10  LEU A HA   8  
ATOM 11255 H HB2  . LEU A 1 10  ? 0.628   17.208  3.366   1.00 0.00 ? 10  LEU A HB2  8  
ATOM 11256 H HB3  . LEU A 1 10  ? -0.465  16.815  2.041   1.00 0.00 ? 10  LEU A HB3  8  
ATOM 11257 H HG   . LEU A 1 10  ? -0.521  19.175  3.165   1.00 0.00 ? 10  LEU A HG   8  
ATOM 11258 H HD11 . LEU A 1 10  ? -2.343  19.408  1.918   1.00 0.00 ? 10  LEU A HD11 8  
ATOM 11259 H HD12 . LEU A 1 10  ? -3.277  18.337  2.962   1.00 0.00 ? 10  LEU A HD12 8  
ATOM 11260 H HD13 . LEU A 1 10  ? -2.298  17.663  1.659   1.00 0.00 ? 10  LEU A HD13 8  
ATOM 11261 H HD21 . LEU A 1 10  ? -0.784  18.306  5.453   1.00 0.00 ? 10  LEU A HD21 8  
ATOM 11262 H HD22 . LEU A 1 10  ? -2.334  17.602  4.992   1.00 0.00 ? 10  LEU A HD22 8  
ATOM 11263 H HD23 . LEU A 1 10  ? -2.120  19.353  4.975   1.00 0.00 ? 10  LEU A HD23 8  
ATOM 11264 N N    . ARG A 1 11  ? -1.281  15.297  6.201   1.00 0.00 ? 11  ARG A N    8  
ATOM 11265 C CA   . ARG A 1 11  ? -1.007  15.322  7.633   1.00 0.00 ? 11  ARG A CA   8  
ATOM 11266 C C    . ARG A 1 11  ? -0.256  14.067  8.066   1.00 0.00 ? 11  ARG A C    8  
ATOM 11267 O O    . ARG A 1 11  ? -0.518  12.973  7.567   1.00 0.00 ? 11  ARG A O    8  
ATOM 11268 C CB   . ARG A 1 11  ? -2.313  15.445  8.421   1.00 0.00 ? 11  ARG A CB   8  
ATOM 11269 C CG   . ARG A 1 11  ? -3.052  16.751  8.176   1.00 0.00 ? 11  ARG A CG   8  
ATOM 11270 C CD   . ARG A 1 11  ? -4.483  16.685  8.684   1.00 0.00 ? 11  ARG A CD   8  
ATOM 11271 N NE   . ARG A 1 11  ? -5.245  15.618  8.039   1.00 0.00 ? 11  ARG A NE   8  
ATOM 11272 C CZ   . ARG A 1 11  ? -5.299  14.373  8.498   1.00 0.00 ? 11  ARG A CZ   8  
ATOM 11273 N NH1  . ARG A 1 11  ? -4.640  14.039  9.599   1.00 0.00 ? 11  ARG A NH1  8  
ATOM 11274 N NH2  . ARG A 1 11  ? -6.014  13.458  7.855   1.00 0.00 ? 11  ARG A NH2  8  
ATOM 11275 H H    . ARG A 1 11  ? -2.068  14.813  5.873   1.00 0.00 ? 11  ARG A H    8  
ATOM 11276 H HA   . ARG A 1 11  ? -0.391  16.185  7.838   1.00 0.00 ? 11  ARG A HA   8  
ATOM 11277 H HB2  . ARG A 1 11  ? -2.966  14.630  8.143   1.00 0.00 ? 11  ARG A HB2  8  
ATOM 11278 H HB3  . ARG A 1 11  ? -2.091  15.375  9.475   1.00 0.00 ? 11  ARG A HB3  8  
ATOM 11279 H HG2  . ARG A 1 11  ? -2.536  17.548  8.690   1.00 0.00 ? 11  ARG A HG2  8  
ATOM 11280 H HG3  . ARG A 1 11  ? -3.064  16.952  7.115   1.00 0.00 ? 11  ARG A HG3  8  
ATOM 11281 H HD2  . ARG A 1 11  ? -4.465  16.507  9.749   1.00 0.00 ? 11  ARG A HD2  8  
ATOM 11282 H HD3  . ARG A 1 11  ? -4.966  17.630  8.485   1.00 0.00 ? 11  ARG A HD3  8  
ATOM 11283 H HE   . ARG A 1 11  ? -5.739  15.843  7.224   1.00 0.00 ? 11  ARG A HE   8  
ATOM 11284 H HH11 . ARG A 1 11  ? -4.102  14.727  10.086  1.00 0.00 ? 11  ARG A HH11 8  
ATOM 11285 H HH12 . ARG A 1 11  ? -4.683  13.101  9.943   1.00 0.00 ? 11  ARG A HH12 8  
ATOM 11286 H HH21 . ARG A 1 11  ? -6.512  13.706  7.025   1.00 0.00 ? 11  ARG A HH21 8  
ATOM 11287 H HH22 . ARG A 1 11  ? -6.054  12.521  8.201   1.00 0.00 ? 11  ARG A HH22 8  
ATOM 11288 N N    . GLU A 1 12  ? 0.679   14.234  8.996   1.00 0.00 ? 12  GLU A N    8  
ATOM 11289 C CA   . GLU A 1 12  ? 1.469   13.114  9.494   1.00 0.00 ? 12  GLU A CA   8  
ATOM 11290 C C    . GLU A 1 12  ? 0.566   11.983  9.976   1.00 0.00 ? 12  GLU A C    8  
ATOM 11291 O O    . GLU A 1 12  ? -0.178  12.138  10.946  1.00 0.00 ? 12  GLU A O    8  
ATOM 11292 C CB   . GLU A 1 12  ? 2.383   13.572  10.632  1.00 0.00 ? 12  GLU A CB   8  
ATOM 11293 C CG   . GLU A 1 12  ? 3.520   12.608  10.925  1.00 0.00 ? 12  GLU A CG   8  
ATOM 11294 C CD   . GLU A 1 12  ? 4.501   13.155  11.944  1.00 0.00 ? 12  GLU A CD   8  
ATOM 11295 O OE1  . GLU A 1 12  ? 5.149   14.182  11.652  1.00 0.00 ? 12  GLU A OE1  8  
ATOM 11296 O OE2  . GLU A 1 12  ? 4.621   12.555  13.033  1.00 0.00 ? 12  GLU A OE2  8  
ATOM 11297 H H    . GLU A 1 12  ? 0.842   15.131  9.355   1.00 0.00 ? 12  GLU A H    8  
ATOM 11298 H HA   . GLU A 1 12  ? 2.078   12.750  8.680   1.00 0.00 ? 12  GLU A HA   8  
ATOM 11299 H HB2  . GLU A 1 12  ? 2.809   14.531  10.372  1.00 0.00 ? 12  GLU A HB2  8  
ATOM 11300 H HB3  . GLU A 1 12  ? 1.793   13.683  11.529  1.00 0.00 ? 12  GLU A HB3  8  
ATOM 11301 H HG2  . GLU A 1 12  ? 3.105   11.687  11.307  1.00 0.00 ? 12  GLU A HG2  8  
ATOM 11302 H HG3  . GLU A 1 12  ? 4.052   12.408  10.006  1.00 0.00 ? 12  GLU A HG3  8  
ATOM 11303 N N    . LEU A 1 13  ? 0.635   10.846  9.294   1.00 0.00 ? 13  LEU A N    8  
ATOM 11304 C CA   . LEU A 1 13  ? -0.176  9.688   9.651   1.00 0.00 ? 13  LEU A CA   8  
ATOM 11305 C C    . LEU A 1 13  ? 0.704   8.509   10.052  1.00 0.00 ? 13  LEU A C    8  
ATOM 11306 O O    . LEU A 1 13  ? 1.903   8.491   9.767   1.00 0.00 ? 13  LEU A O    8  
ATOM 11307 C CB   . LEU A 1 13  ? -1.078  9.291   8.481   1.00 0.00 ? 13  LEU A CB   8  
ATOM 11308 C CG   . LEU A 1 13  ? -2.426  10.006  8.400   1.00 0.00 ? 13  LEU A CG   8  
ATOM 11309 C CD1  . LEU A 1 13  ? -2.929  10.036  6.965   1.00 0.00 ? 13  LEU A CD1  8  
ATOM 11310 C CD2  . LEU A 1 13  ? -3.443  9.332   9.309   1.00 0.00 ? 13  LEU A CD2  8  
ATOM 11311 H H    . LEU A 1 13  ? 1.247   10.782  8.531   1.00 0.00 ? 13  LEU A H    8  
ATOM 11312 H HA   . LEU A 1 13  ? -0.794  9.963   10.493  1.00 0.00 ? 13  LEU A HA   8  
ATOM 11313 H HB2  . LEU A 1 13  ? -0.541  9.493   7.567   1.00 0.00 ? 13  LEU A HB2  8  
ATOM 11314 H HB3  . LEU A 1 13  ? -1.269  8.230   8.557   1.00 0.00 ? 13  LEU A HB3  8  
ATOM 11315 H HG   . LEU A 1 13  ? -2.305  11.028  8.732   1.00 0.00 ? 13  LEU A HG   8  
ATOM 11316 H HD11 . LEU A 1 13  ? -2.092  9.950   6.288   1.00 0.00 ? 13  LEU A HD11 8  
ATOM 11317 H HD12 . LEU A 1 13  ? -3.444  10.968  6.783   1.00 0.00 ? 13  LEU A HD12 8  
ATOM 11318 H HD13 . LEU A 1 13  ? -3.609  9.212   6.804   1.00 0.00 ? 13  LEU A HD13 8  
ATOM 11319 H HD21 . LEU A 1 13  ? -4.228  10.033  9.553   1.00 0.00 ? 13  LEU A HD21 8  
ATOM 11320 H HD22 . LEU A 1 13  ? -2.955  9.008   10.217  1.00 0.00 ? 13  LEU A HD22 8  
ATOM 11321 H HD23 . LEU A 1 13  ? -3.868  8.478   8.803   1.00 0.00 ? 13  LEU A HD23 8  
ATOM 11322 N N    . CYS A 1 14  ? 0.103   7.526   10.713  1.00 0.00 ? 14  CYS A N    8  
ATOM 11323 C CA   . CYS A 1 14  ? 0.833   6.341   11.152  1.00 0.00 ? 14  CYS A CA   8  
ATOM 11324 C C    . CYS A 1 14  ? -0.057  5.104   11.099  1.00 0.00 ? 14  CYS A C    8  
ATOM 11325 O O    . CYS A 1 14  ? -1.281  5.202   11.198  1.00 0.00 ? 14  CYS A O    8  
ATOM 11326 C CB   . CYS A 1 14  ? 1.364   6.542   12.573  1.00 0.00 ? 14  CYS A CB   8  
ATOM 11327 S SG   . CYS A 1 14  ? 0.073   6.770   13.818  1.00 0.00 ? 14  CYS A SG   8  
ATOM 11328 H H    . CYS A 1 14  ? -0.854  7.598   10.911  1.00 0.00 ? 14  CYS A H    8  
ATOM 11329 H HA   . CYS A 1 14  ? 1.667   6.199   10.482  1.00 0.00 ? 14  CYS A HA   8  
ATOM 11330 H HB2  . CYS A 1 14  ? 1.944   5.676   12.857  1.00 0.00 ? 14  CYS A HB2  8  
ATOM 11331 H HB3  . CYS A 1 14  ? 1.999   7.415   12.592  1.00 0.00 ? 14  CYS A HB3  8  
ATOM 11332 H HG   . CYS A 1 14  ? 0.468   6.170   14.930  1.00 0.00 ? 14  CYS A HG   8  
ATOM 11333 N N    . ILE A 1 15  ? 0.565   3.941   10.940  1.00 0.00 ? 15  ILE A N    8  
ATOM 11334 C CA   . ILE A 1 15  ? -0.171  2.684   10.872  1.00 0.00 ? 15  ILE A CA   8  
ATOM 11335 C C    . ILE A 1 15  ? 0.271   1.729   11.976  1.00 0.00 ? 15  ILE A C    8  
ATOM 11336 O O    . ILE A 1 15  ? 1.386   1.209   11.950  1.00 0.00 ? 15  ILE A O    8  
ATOM 11337 C CB   . ILE A 1 15  ? 0.015   1.995   9.507   1.00 0.00 ? 15  ILE A CB   8  
ATOM 11338 C CG1  . ILE A 1 15  ? -0.469  2.910   8.380   1.00 0.00 ? 15  ILE A CG1  8  
ATOM 11339 C CG2  . ILE A 1 15  ? -0.729  0.669   9.477   1.00 0.00 ? 15  ILE A CG2  8  
ATOM 11340 C CD1  . ILE A 1 15  ? -0.125  2.399   6.998   1.00 0.00 ? 15  ILE A CD1  8  
ATOM 11341 H H    . ILE A 1 15  ? 1.542   3.927   10.867  1.00 0.00 ? 15  ILE A H    8  
ATOM 11342 H HA   . ILE A 1 15  ? -1.220  2.906   11.001  1.00 0.00 ? 15  ILE A HA   8  
ATOM 11343 H HB   . ILE A 1 15  ? 1.067   1.794   9.371   1.00 0.00 ? 15  ILE A HB   8  
ATOM 11344 H HG12 . ILE A 1 15  ? -1.541  3.007   8.439   1.00 0.00 ? 15  ILE A HG12 8  
ATOM 11345 H HG13 . ILE A 1 15  ? -0.016  3.884   8.497   1.00 0.00 ? 15  ILE A HG13 8  
ATOM 11346 H HG21 . ILE A 1 15  ? -0.488  0.101   10.364  1.00 0.00 ? 15  ILE A HG21 8  
ATOM 11347 H HG22 . ILE A 1 15  ? -1.792  0.854   9.448   1.00 0.00 ? 15  ILE A HG22 8  
ATOM 11348 H HG23 . ILE A 1 15  ? -0.436  0.111   8.601   1.00 0.00 ? 15  ILE A HG23 8  
ATOM 11349 H HD11 . ILE A 1 15  ? -0.106  1.320   7.007   1.00 0.00 ? 15  ILE A HD11 8  
ATOM 11350 H HD12 . ILE A 1 15  ? -0.866  2.742   6.292   1.00 0.00 ? 15  ILE A HD12 8  
ATOM 11351 H HD13 . ILE A 1 15  ? 0.847   2.773   6.708   1.00 0.00 ? 15  ILE A HD13 8  
ATOM 11352 N N    . GLN A 1 16  ? -0.613  1.501   12.942  1.00 0.00 ? 16  GLN A N    8  
ATOM 11353 C CA   . GLN A 1 16  ? -0.314  0.607   14.054  1.00 0.00 ? 16  GLN A CA   8  
ATOM 11354 C C    . GLN A 1 16  ? -0.617  -0.842  13.684  1.00 0.00 ? 16  GLN A C    8  
ATOM 11355 O O    . GLN A 1 16  ? -1.774  -1.262  13.674  1.00 0.00 ? 16  GLN A O    8  
ATOM 11356 C CB   . GLN A 1 16  ? -1.120  1.009   15.291  1.00 0.00 ? 16  GLN A CB   8  
ATOM 11357 C CG   . GLN A 1 16  ? -0.384  1.970   16.210  1.00 0.00 ? 16  GLN A CG   8  
ATOM 11358 C CD   . GLN A 1 16  ? -1.325  2.783   17.078  1.00 0.00 ? 16  GLN A CD   8  
ATOM 11359 O OE1  . GLN A 1 16  ? -1.588  2.429   18.228  1.00 0.00 ? 16  GLN A OE1  8  
ATOM 11360 N NE2  . GLN A 1 16  ? -1.836  3.880   16.531  1.00 0.00 ? 16  GLN A NE2  8  
ATOM 11361 H H    . GLN A 1 16  ? -1.485  1.945   12.907  1.00 0.00 ? 16  GLN A H    8  
ATOM 11362 H HA   . GLN A 1 16  ? 0.738   0.695   14.277  1.00 0.00 ? 16  GLN A HA   8  
ATOM 11363 H HB2  . GLN A 1 16  ? -2.037  1.481   14.970  1.00 0.00 ? 16  GLN A HB2  8  
ATOM 11364 H HB3  . GLN A 1 16  ? -1.361  0.120   15.854  1.00 0.00 ? 16  GLN A HB3  8  
ATOM 11365 H HG2  . GLN A 1 16  ? 0.273   1.403   16.852  1.00 0.00 ? 16  GLN A HG2  8  
ATOM 11366 H HG3  . GLN A 1 16  ? 0.201   2.648   15.606  1.00 0.00 ? 16  GLN A HG3  8  
ATOM 11367 H HE21 . GLN A 1 16  ? -1.582  4.099   15.610  1.00 0.00 ? 16  GLN A HE21 8  
ATOM 11368 H HE22 . GLN A 1 16  ? -2.448  4.423   17.069  1.00 0.00 ? 16  GLN A HE22 8  
ATOM 11369 N N    . LYS A 1 17  ? 0.430   -1.601  13.381  1.00 0.00 ? 17  LYS A N    8  
ATOM 11370 C CA   . LYS A 1 17  ? 0.277   -3.003  13.011  1.00 0.00 ? 17  LYS A CA   8  
ATOM 11371 C C    . LYS A 1 17  ? 0.872   -3.915  14.080  1.00 0.00 ? 17  LYS A C    8  
ATOM 11372 O O    . LYS A 1 17  ? 1.528   -3.451  15.011  1.00 0.00 ? 17  LYS A O    8  
ATOM 11373 C CB   . LYS A 1 17  ? 0.950   -3.273  11.663  1.00 0.00 ? 17  LYS A CB   8  
ATOM 11374 C CG   . LYS A 1 17  ? 2.452   -3.478  11.764  1.00 0.00 ? 17  LYS A CG   8  
ATOM 11375 C CD   . LYS A 1 17  ? 3.153   -3.113  10.466  1.00 0.00 ? 17  LYS A CD   8  
ATOM 11376 C CE   . LYS A 1 17  ? 3.209   -1.606  10.268  1.00 0.00 ? 17  LYS A CE   8  
ATOM 11377 N NZ   . LYS A 1 17  ? 4.194   -0.963  11.182  1.00 0.00 ? 17  LYS A NZ   8  
ATOM 11378 H H    . LYS A 1 17  ? 1.328   -1.209  13.407  1.00 0.00 ? 17  LYS A H    8  
ATOM 11379 H HA   . LYS A 1 17  ? -0.778  -3.211  12.924  1.00 0.00 ? 17  LYS A HA   8  
ATOM 11380 H HB2  . LYS A 1 17  ? 0.515   -4.160  11.228  1.00 0.00 ? 17  LYS A HB2  8  
ATOM 11381 H HB3  . LYS A 1 17  ? 0.766   -2.433  11.008  1.00 0.00 ? 17  LYS A HB3  8  
ATOM 11382 H HG2  . LYS A 1 17  ? 2.839   -2.856  12.557  1.00 0.00 ? 17  LYS A HG2  8  
ATOM 11383 H HG3  . LYS A 1 17  ? 2.650   -4.516  11.990  1.00 0.00 ? 17  LYS A HG3  8  
ATOM 11384 H HD2  . LYS A 1 17  ? 4.161   -3.499  10.490  1.00 0.00 ? 17  LYS A HD2  8  
ATOM 11385 H HD3  . LYS A 1 17  ? 2.615   -3.556  9.640   1.00 0.00 ? 17  LYS A HD3  8  
ATOM 11386 H HE2  . LYS A 1 17  ? 3.492   -1.401  9.247   1.00 0.00 ? 17  LYS A HE2  8  
ATOM 11387 H HE3  . LYS A 1 17  ? 2.230   -1.194  10.460  1.00 0.00 ? 17  LYS A HE3  8  
ATOM 11388 H HZ1  . LYS A 1 17  ? 3.718   -0.641  12.049  1.00 0.00 ? 17  LYS A HZ1  8  
ATOM 11389 H HZ2  . LYS A 1 17  ? 4.631   -0.143  10.716  1.00 0.00 ? 17  LYS A HZ2  8  
ATOM 11390 H HZ3  . LYS A 1 17  ? 4.939   -1.641  11.439  1.00 0.00 ? 17  LYS A HZ3  8  
ATOM 11391 N N    . ALA A 1 18  ? 0.638   -5.216  13.937  1.00 0.00 ? 18  ALA A N    8  
ATOM 11392 C CA   . ALA A 1 18  ? 1.153   -6.193  14.888  1.00 0.00 ? 18  ALA A CA   8  
ATOM 11393 C C    . ALA A 1 18  ? 2.603   -5.892  15.253  1.00 0.00 ? 18  ALA A C    8  
ATOM 11394 O O    . ALA A 1 18  ? 3.267   -5.065  14.629  1.00 0.00 ? 18  ALA A O    8  
ATOM 11395 C CB   . ALA A 1 18  ? 1.031   -7.599  14.319  1.00 0.00 ? 18  ALA A CB   8  
ATOM 11396 H H    . ALA A 1 18  ? 0.108   -5.526  13.174  1.00 0.00 ? 18  ALA A H    8  
ATOM 11397 H HA   . ALA A 1 18  ? 0.549   -6.140  15.782  1.00 0.00 ? 18  ALA A HA   8  
ATOM 11398 H HB1  . ALA A 1 18  ? 0.481   -8.220  15.012  1.00 0.00 ? 18  ALA A HB1  8  
ATOM 11399 H HB2  . ALA A 1 18  ? 0.507   -7.561  13.375  1.00 0.00 ? 18  ALA A HB2  8  
ATOM 11400 H HB3  . ALA A 1 18  ? 2.017   -8.013  14.168  1.00 0.00 ? 18  ALA A HB3  8  
ATOM 11401 N N    . PRO A 1 19  ? 3.108   -6.579  16.289  1.00 0.00 ? 19  PRO A N    8  
ATOM 11402 C CA   . PRO A 1 19  ? 4.484   -6.401  16.761  1.00 0.00 ? 19  PRO A CA   8  
ATOM 11403 C C    . PRO A 1 19  ? 5.510   -6.947  15.774  1.00 0.00 ? 19  PRO A C    8  
ATOM 11404 O O    . PRO A 1 19  ? 6.714   -6.894  16.021  1.00 0.00 ? 19  PRO A O    8  
ATOM 11405 C CB   . PRO A 1 19  ? 4.518   -7.202  18.065  1.00 0.00 ? 19  PRO A CB   8  
ATOM 11406 C CG   . PRO A 1 19  ? 3.449   -8.228  17.908  1.00 0.00 ? 19  PRO A CG   8  
ATOM 11407 C CD   . PRO A 1 19  ? 2.373   -7.581  17.080  1.00 0.00 ? 19  PRO A CD   8  
ATOM 11408 H HA   . PRO A 1 19  ? 4.702   -5.364  16.968  1.00 0.00 ? 19  PRO A HA   8  
ATOM 11409 H HB2  . PRO A 1 19  ? 5.491   -7.659  18.184  1.00 0.00 ? 19  PRO A HB2  8  
ATOM 11410 H HB3  . PRO A 1 19  ? 4.317   -6.547  18.899  1.00 0.00 ? 19  PRO A HB3  8  
ATOM 11411 H HG2  . PRO A 1 19  ? 3.843   -9.094  17.399  1.00 0.00 ? 19  PRO A HG2  8  
ATOM 11412 H HG3  . PRO A 1 19  ? 3.061   -8.504  18.877  1.00 0.00 ? 19  PRO A HG3  8  
ATOM 11413 H HD2  . PRO A 1 19  ? 1.902   -8.309  16.437  1.00 0.00 ? 19  PRO A HD2  8  
ATOM 11414 H HD3  . PRO A 1 19  ? 1.641   -7.107  17.717  1.00 0.00 ? 19  PRO A HD3  8  
ATOM 11415 N N    . GLY A 1 20  ? 5.025   -7.472  14.652  1.00 0.00 ? 20  GLY A N    8  
ATOM 11416 C CA   . GLY A 1 20  ? 5.913   -8.020  13.644  1.00 0.00 ? 20  GLY A CA   8  
ATOM 11417 C C    . GLY A 1 20  ? 5.190   -8.358  12.356  1.00 0.00 ? 20  GLY A C    8  
ATOM 11418 O O    . GLY A 1 20  ? 5.450   -9.394  11.745  1.00 0.00 ? 20  GLY A O    8  
ATOM 11419 H H    . GLY A 1 20  ? 4.055   -7.488  14.509  1.00 0.00 ? 20  GLY A H    8  
ATOM 11420 H HA2  . GLY A 1 20  ? 6.688   -7.298  13.432  1.00 0.00 ? 20  GLY A HA2  8  
ATOM 11421 H HA3  . GLY A 1 20  ? 6.370   -8.918  14.033  1.00 0.00 ? 20  GLY A HA3  8  
ATOM 11422 N N    . GLU A 1 21  ? 4.279   -7.482  11.943  1.00 0.00 ? 21  GLU A N    8  
ATOM 11423 C CA   . GLU A 1 21  ? 3.515   -7.696  10.720  1.00 0.00 ? 21  GLU A CA   8  
ATOM 11424 C C    . GLU A 1 21  ? 4.008   -6.780  9.603   1.00 0.00 ? 21  GLU A C    8  
ATOM 11425 O O    . GLU A 1 21  ? 4.332   -5.616  9.838   1.00 0.00 ? 21  GLU A O    8  
ATOM 11426 C CB   . GLU A 1 21  ? 2.025   -7.452  10.974  1.00 0.00 ? 21  GLU A CB   8  
ATOM 11427 C CG   . GLU A 1 21  ? 1.167   -7.576  9.726   1.00 0.00 ? 21  GLU A CG   8  
ATOM 11428 C CD   . GLU A 1 21  ? 1.266   -8.946  9.084   1.00 0.00 ? 21  GLU A CD   8  
ATOM 11429 O OE1  . GLU A 1 21  ? 1.798   -9.870  9.734   1.00 0.00 ? 21  GLU A OE1  8  
ATOM 11430 O OE2  . GLU A 1 21  ? 0.812   -9.094  7.930   1.00 0.00 ? 21  GLU A OE2  8  
ATOM 11431 H H    . GLU A 1 21  ? 4.117   -6.675  12.474  1.00 0.00 ? 21  GLU A H    8  
ATOM 11432 H HA   . GLU A 1 21  ? 3.655   -8.722  10.416  1.00 0.00 ? 21  GLU A HA   8  
ATOM 11433 H HB2  . GLU A 1 21  ? 1.674   -8.169  11.701  1.00 0.00 ? 21  GLU A HB2  8  
ATOM 11434 H HB3  . GLU A 1 21  ? 1.900   -6.457  11.374  1.00 0.00 ? 21  GLU A HB3  8  
ATOM 11435 H HG2  . GLU A 1 21  ? 0.137   -7.395  9.994   1.00 0.00 ? 21  GLU A HG2  8  
ATOM 11436 H HG3  . GLU A 1 21  ? 1.487   -6.834  9.009   1.00 0.00 ? 21  GLU A HG3  8  
ATOM 11437 N N    . ARG A 1 22  ? 4.063   -7.315  8.388   1.00 0.00 ? 22  ARG A N    8  
ATOM 11438 C CA   . ARG A 1 22  ? 4.519   -6.548  7.235   1.00 0.00 ? 22  ARG A CA   8  
ATOM 11439 C C    . ARG A 1 22  ? 3.365   -5.767  6.612   1.00 0.00 ? 22  ARG A C    8  
ATOM 11440 O O    . ARG A 1 22  ? 2.351   -6.345  6.218   1.00 0.00 ? 22  ARG A O    8  
ATOM 11441 C CB   . ARG A 1 22  ? 5.143   -7.477  6.192   1.00 0.00 ? 22  ARG A CB   8  
ATOM 11442 C CG   . ARG A 1 22  ? 4.201   -8.567  5.706   1.00 0.00 ? 22  ARG A CG   8  
ATOM 11443 C CD   . ARG A 1 22  ? 4.953   -9.847  5.378   1.00 0.00 ? 22  ARG A CD   8  
ATOM 11444 N NE   . ARG A 1 22  ? 5.444   -9.857  4.002   1.00 0.00 ? 22  ARG A NE   8  
ATOM 11445 C CZ   . ARG A 1 22  ? 6.050   -10.900 3.446   1.00 0.00 ? 22  ARG A CZ   8  
ATOM 11446 N NH1  . ARG A 1 22  ? 6.238   -12.012 4.143   1.00 0.00 ? 22  ARG A NH1  8  
ATOM 11447 N NH2  . ARG A 1 22  ? 6.468   -10.832 2.188   1.00 0.00 ? 22  ARG A NH2  8  
ATOM 11448 H H    . ARG A 1 22  ? 3.792   -8.249  8.264   1.00 0.00 ? 22  ARG A H    8  
ATOM 11449 H HA   . ARG A 1 22  ? 5.268   -5.850  7.576   1.00 0.00 ? 22  ARG A HA   8  
ATOM 11450 H HB2  . ARG A 1 22  ? 5.447   -6.888  5.339   1.00 0.00 ? 22  ARG A HB2  8  
ATOM 11451 H HB3  . ARG A 1 22  ? 6.013   -7.949  6.623   1.00 0.00 ? 22  ARG A HB3  8  
ATOM 11452 H HG2  . ARG A 1 22  ? 3.477   -8.776  6.479   1.00 0.00 ? 22  ARG A HG2  8  
ATOM 11453 H HG3  . ARG A 1 22  ? 3.693   -8.220  4.818   1.00 0.00 ? 22  ARG A HG3  8  
ATOM 11454 H HD2  . ARG A 1 22  ? 5.793   -9.938  6.050   1.00 0.00 ? 22  ARG A HD2  8  
ATOM 11455 H HD3  . ARG A 1 22  ? 4.288   -10.685 5.519   1.00 0.00 ? 22  ARG A HD3  8  
ATOM 11456 H HE   . ARG A 1 22  ? 5.316   -9.045  3.469   1.00 0.00 ? 22  ARG A HE   8  
ATOM 11457 H HH11 . ARG A 1 22  ? 5.922   -12.066 5.090   1.00 0.00 ? 22  ARG A HH11 8  
ATOM 11458 H HH12 . ARG A 1 22  ? 6.693   -12.796 3.721   1.00 0.00 ? 22  ARG A HH12 8  
ATOM 11459 H HH21 . ARG A 1 22  ? 6.328   -9.995  1.659   1.00 0.00 ? 22  ARG A HH21 8  
ATOM 11460 H HH22 . ARG A 1 22  ? 6.924   -11.617 1.770   1.00 0.00 ? 22  ARG A HH22 8  
ATOM 11461 N N    . LEU A 1 23  ? 3.527   -4.452  6.525   1.00 0.00 ? 23  LEU A N    8  
ATOM 11462 C CA   . LEU A 1 23  ? 2.500   -3.591  5.950   1.00 0.00 ? 23  LEU A CA   8  
ATOM 11463 C C    . LEU A 1 23  ? 1.750   -4.309  4.833   1.00 0.00 ? 23  LEU A C    8  
ATOM 11464 O O    . LEU A 1 23  ? 0.521   -4.288  4.783   1.00 0.00 ? 23  LEU A O    8  
ATOM 11465 C CB   . LEU A 1 23  ? 3.127   -2.303  5.413   1.00 0.00 ? 23  LEU A CB   8  
ATOM 11466 C CG   . LEU A 1 23  ? 2.291   -1.033  5.569   1.00 0.00 ? 23  LEU A CG   8  
ATOM 11467 C CD1  . LEU A 1 23  ? 0.883   -1.252  5.037   1.00 0.00 ? 23  LEU A CD1  8  
ATOM 11468 C CD2  . LEU A 1 23  ? 2.251   -0.596  7.026   1.00 0.00 ? 23  LEU A CD2  8  
ATOM 11469 H H    . LEU A 1 23  ? 4.357   -4.049  6.856   1.00 0.00 ? 23  LEU A H    8  
ATOM 11470 H HA   . LEU A 1 23  ? 1.800   -3.341  6.734   1.00 0.00 ? 23  LEU A HA   8  
ATOM 11471 H HB2  . LEU A 1 23  ? 4.061   -2.150  5.931   1.00 0.00 ? 23  LEU A HB2  8  
ATOM 11472 H HB3  . LEU A 1 23  ? 3.321   -2.446  4.359   1.00 0.00 ? 23  LEU A HB3  8  
ATOM 11473 H HG   . LEU A 1 23  ? 2.744   -0.238  4.993   1.00 0.00 ? 23  LEU A HG   8  
ATOM 11474 H HD11 . LEU A 1 23  ? 0.594   -0.410  4.427   1.00 0.00 ? 23  LEU A HD11 8  
ATOM 11475 H HD12 . LEU A 1 23  ? 0.197   -1.348  5.866   1.00 0.00 ? 23  LEU A HD12 8  
ATOM 11476 H HD13 . LEU A 1 23  ? 0.859   -2.154  4.444   1.00 0.00 ? 23  LEU A HD13 8  
ATOM 11477 H HD21 . LEU A 1 23  ? 1.344   -0.039  7.210   1.00 0.00 ? 23  LEU A HD21 8  
ATOM 11478 H HD22 . LEU A 1 23  ? 3.107   0.029   7.238   1.00 0.00 ? 23  LEU A HD22 8  
ATOM 11479 H HD23 . LEU A 1 23  ? 2.274   -1.467  7.664   1.00 0.00 ? 23  LEU A HD23 8  
ATOM 11480 N N    . GLY A 1 24  ? 2.499   -4.947  3.939   1.00 0.00 ? 24  GLY A N    8  
ATOM 11481 C CA   . GLY A 1 24  ? 1.888   -5.665  2.836   1.00 0.00 ? 24  GLY A CA   8  
ATOM 11482 C C    . GLY A 1 24  ? 1.287   -4.735  1.801   1.00 0.00 ? 24  GLY A C    8  
ATOM 11483 O O    . GLY A 1 24  ? 0.169   -4.955  1.334   1.00 0.00 ? 24  GLY A O    8  
ATOM 11484 H H    . GLY A 1 24  ? 3.475   -4.929  4.029   1.00 0.00 ? 24  GLY A H    8  
ATOM 11485 H HA2  . GLY A 1 24  ? 2.638   -6.279  2.361   1.00 0.00 ? 24  GLY A HA2  8  
ATOM 11486 H HA3  . GLY A 1 24  ? 1.108   -6.303  3.225   1.00 0.00 ? 24  GLY A HA3  8  
ATOM 11487 N N    . ILE A 1 25  ? 2.029   -3.693  1.442   1.00 0.00 ? 25  ILE A N    8  
ATOM 11488 C CA   . ILE A 1 25  ? 1.562   -2.726  0.456   1.00 0.00 ? 25  ILE A CA   8  
ATOM 11489 C C    . ILE A 1 25  ? 2.483   -2.692  -0.759  1.00 0.00 ? 25  ILE A C    8  
ATOM 11490 O O    . ILE A 1 25  ? 3.581   -3.246  -0.734  1.00 0.00 ? 25  ILE A O    8  
ATOM 11491 C CB   . ILE A 1 25  ? 1.469   -1.311  1.056   1.00 0.00 ? 25  ILE A CB   8  
ATOM 11492 C CG1  . ILE A 1 25  ? 2.576   -1.097  2.090   1.00 0.00 ? 25  ILE A CG1  8  
ATOM 11493 C CG2  . ILE A 1 25  ? 0.101   -1.091  1.684   1.00 0.00 ? 25  ILE A CG2  8  
ATOM 11494 C CD1  . ILE A 1 25  ? 3.032   0.341   2.199   1.00 0.00 ? 25  ILE A CD1  8  
ATOM 11495 H H    . ILE A 1 25  ? 2.912   -3.571  1.850   1.00 0.00 ? 25  ILE A H    8  
ATOM 11496 H HA   . ILE A 1 25  ? 0.574   -3.026  0.137   1.00 0.00 ? 25  ILE A HA   8  
ATOM 11497 H HB   . ILE A 1 25  ? 1.590   -0.596  0.256   1.00 0.00 ? 25  ILE A HB   8  
ATOM 11498 H HG12 . ILE A 1 25  ? 2.219   -1.406  3.059   1.00 0.00 ? 25  ILE A HG12 8  
ATOM 11499 H HG13 . ILE A 1 25  ? 3.432   -1.698  1.818   1.00 0.00 ? 25  ILE A HG13 8  
ATOM 11500 H HG21 . ILE A 1 25  ? -0.666  -1.434  1.006   1.00 0.00 ? 25  ILE A HG21 8  
ATOM 11501 H HG22 . ILE A 1 25  ? 0.036   -1.645  2.609   1.00 0.00 ? 25  ILE A HG22 8  
ATOM 11502 H HG23 . ILE A 1 25  ? -0.040  -0.039  1.884   1.00 0.00 ? 25  ILE A HG23 8  
ATOM 11503 H HD11 . ILE A 1 25  ? 2.172   0.985   2.307   1.00 0.00 ? 25  ILE A HD11 8  
ATOM 11504 H HD12 . ILE A 1 25  ? 3.676   0.451   3.058   1.00 0.00 ? 25  ILE A HD12 8  
ATOM 11505 H HD13 . ILE A 1 25  ? 3.574   0.615   1.305   1.00 0.00 ? 25  ILE A HD13 8  
ATOM 11506 N N    . SER A 1 26  ? 2.028   -2.035  -1.821  1.00 0.00 ? 26  SER A N    8  
ATOM 11507 C CA   . SER A 1 26  ? 2.809   -1.929  -3.047  1.00 0.00 ? 26  SER A CA   8  
ATOM 11508 C C    . SER A 1 26  ? 2.811   -0.495  -3.568  1.00 0.00 ? 26  SER A C    8  
ATOM 11509 O O    . SER A 1 26  ? 1.833   0.236   -3.409  1.00 0.00 ? 26  SER A O    8  
ATOM 11510 C CB   . SER A 1 26  ? 2.252   -2.871  -4.116  1.00 0.00 ? 26  SER A CB   8  
ATOM 11511 O OG   . SER A 1 26  ? 2.871   -4.144  -4.047  1.00 0.00 ? 26  SER A OG   8  
ATOM 11512 H H    . SER A 1 26  ? 1.143   -1.613  -1.779  1.00 0.00 ? 26  SER A H    8  
ATOM 11513 H HA   . SER A 1 26  ? 3.825   -2.218  -2.819  1.00 0.00 ? 26  SER A HA   8  
ATOM 11514 H HB2  . SER A 1 26  ? 1.190   -2.992  -3.966  1.00 0.00 ? 26  SER A HB2  8  
ATOM 11515 H HB3  . SER A 1 26  ? 2.432   -2.449  -5.094  1.00 0.00 ? 26  SER A HB3  8  
ATOM 11516 H HG   . SER A 1 26  ? 3.205   -4.385  -4.914  1.00 0.00 ? 26  SER A HG   8  
ATOM 11517 N N    . ILE A 1 27  ? 3.916   -0.100  -4.191  1.00 0.00 ? 27  ILE A N    8  
ATOM 11518 C CA   . ILE A 1 27  ? 4.046   1.246   -4.737  1.00 0.00 ? 27  ILE A CA   8  
ATOM 11519 C C    . ILE A 1 27  ? 4.717   1.222   -6.106  1.00 0.00 ? 27  ILE A C    8  
ATOM 11520 O O    . ILE A 1 27  ? 5.459   0.293   -6.428  1.00 0.00 ? 27  ILE A O    8  
ATOM 11521 C CB   . ILE A 1 27  ? 4.854   2.159   -3.797  1.00 0.00 ? 27  ILE A CB   8  
ATOM 11522 C CG1  . ILE A 1 27  ? 6.308   1.688   -3.718  1.00 0.00 ? 27  ILE A CG1  8  
ATOM 11523 C CG2  . ILE A 1 27  ? 4.224   2.185   -2.412  1.00 0.00 ? 27  ILE A CG2  8  
ATOM 11524 C CD1  . ILE A 1 27  ? 7.180   2.563   -2.845  1.00 0.00 ? 27  ILE A CD1  8  
ATOM 11525 H H    . ILE A 1 27  ? 4.662   -0.728  -4.286  1.00 0.00 ? 27  ILE A H    8  
ATOM 11526 H HA   . ILE A 1 27  ? 3.053   1.659   -4.842  1.00 0.00 ? 27  ILE A HA   8  
ATOM 11527 H HB   . ILE A 1 27  ? 4.830   3.162   -4.196  1.00 0.00 ? 27  ILE A HB   8  
ATOM 11528 H HG12 . ILE A 1 27  ? 6.334   0.687   -3.315  1.00 0.00 ? 27  ILE A HG12 8  
ATOM 11529 H HG13 . ILE A 1 27  ? 6.731   1.682   -4.712  1.00 0.00 ? 27  ILE A HG13 8  
ATOM 11530 H HG21 . ILE A 1 27  ? 4.996   2.088   -1.663  1.00 0.00 ? 27  ILE A HG21 8  
ATOM 11531 H HG22 . ILE A 1 27  ? 3.703   3.120   -2.272  1.00 0.00 ? 27  ILE A HG22 8  
ATOM 11532 H HG23 . ILE A 1 27  ? 3.527   1.366   -2.318  1.00 0.00 ? 27  ILE A HG23 8  
ATOM 11533 H HD11 . ILE A 1 27  ? 8.018   2.926   -3.421  1.00 0.00 ? 27  ILE A HD11 8  
ATOM 11534 H HD12 . ILE A 1 27  ? 6.603   3.399   -2.481  1.00 0.00 ? 27  ILE A HD12 8  
ATOM 11535 H HD13 . ILE A 1 27  ? 7.544   1.985   -2.007  1.00 0.00 ? 27  ILE A HD13 8  
ATOM 11536 N N    . ARG A 1 28  ? 4.454   2.249   -6.906  1.00 0.00 ? 28  ARG A N    8  
ATOM 11537 C CA   . ARG A 1 28  ? 5.033   2.346   -8.240  1.00 0.00 ? 28  ARG A CA   8  
ATOM 11538 C C    . ARG A 1 28  ? 5.736   3.687   -8.431  1.00 0.00 ? 28  ARG A C    8  
ATOM 11539 O O    . ARG A 1 28  ? 5.136   4.746   -8.249  1.00 0.00 ? 28  ARG A O    8  
ATOM 11540 C CB   . ARG A 1 28  ? 3.949   2.171   -9.305  1.00 0.00 ? 28  ARG A CB   8  
ATOM 11541 C CG   . ARG A 1 28  ? 2.874   3.245   -9.263  1.00 0.00