data_1UK0
# 
_entry.id   1UK0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1UK0         
RCSB  RCSB005912   
WWPDB D_1000005912 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1UK1 
_pdbx_database_related.details        '1UK1 contains the same protein complexed with FR143829' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1UK0 
_pdbx_database_status.recvd_initial_deposition_date   2003-08-13 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Kinoshita, T.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Inhibitor-induced structural change of the active site of human poly(ADP-ribose) polymerase.' 
_citation.journal_abbrev            'Febs Lett.' 
_citation.journal_volume            556 
_citation.page_first                43 
_citation.page_last                 46 
_citation.year                      2004 
_citation.journal_id_ASTM           FEBLAL 
_citation.country                   NE 
_citation.journal_id_ISSN           0014-5793 
_citation.journal_id_CSD            0165 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14706823 
_citation.pdbx_database_id_DOI      '10.1016/S0014-5793(03)01362-0' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kinoshita, T.' 1 
primary 'Nakanishi, I.' 2 
primary 'Warizaya, M.'  3 
primary 'Iwashita, A.'  4 
primary 'Kido, Y.'      5 
primary 'Hattori, K.'   6 
primary 'Fujii, T.'     7 
# 
_cell.entry_id           1UK0 
_cell.length_a           179.820 
_cell.length_b           53.550 
_cell.length_c           92.010 
_cell.angle_alpha        90.00 
_cell.angle_beta         114.40 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1UK0 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Poly [ADP-ribose] polymerase-1'                                                            39196.863 2   
2.4.2.30 ? 'catalytic domain' ? 
2 non-polymer syn '2-{3-[4-(4-FLUOROPHENYL)-3,6-DIHYDRO-1(2H)-PYRIDINYL]PROPYL}-8-METHYL-4(3H)-QUINAZOLINONE' 377.455   2   ? ? ? 
? 
3 water       nat water                                                                                       18.015    253 ? ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;poly(ADP-ribose) polymerase, PARP-1, ADPRT, NAD(+) ADP-ribosyltransferase-1,
Poly[ADP-ribose] synthetase-1
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIP
HDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNT
HATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMV
SKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVND
TSLLYNEYIVYDIAQVNLKYLLKLKFNFKT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIP
HDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNT
HATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMV
SKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVND
TSLLYNEYIVYDIAQVNLKYLLKLKFNFKT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   SER n 
1 3   LYS n 
1 4   LEU n 
1 5   PRO n 
1 6   LYS n 
1 7   PRO n 
1 8   VAL n 
1 9   GLN n 
1 10  ASP n 
1 11  LEU n 
1 12  ILE n 
1 13  LYS n 
1 14  MET n 
1 15  ILE n 
1 16  PHE n 
1 17  ASP n 
1 18  VAL n 
1 19  GLU n 
1 20  SER n 
1 21  MET n 
1 22  LYS n 
1 23  LYS n 
1 24  ALA n 
1 25  MET n 
1 26  VAL n 
1 27  GLU n 
1 28  TYR n 
1 29  GLU n 
1 30  ILE n 
1 31  ASP n 
1 32  LEU n 
1 33  GLN n 
1 34  LYS n 
1 35  MET n 
1 36  PRO n 
1 37  LEU n 
1 38  GLY n 
1 39  LYS n 
1 40  LEU n 
1 41  SER n 
1 42  LYS n 
1 43  ARG n 
1 44  GLN n 
1 45  ILE n 
1 46  GLN n 
1 47  ALA n 
1 48  ALA n 
1 49  TYR n 
1 50  SER n 
1 51  ILE n 
1 52  LEU n 
1 53  SER n 
1 54  GLU n 
1 55  VAL n 
1 56  GLN n 
1 57  GLN n 
1 58  ALA n 
1 59  VAL n 
1 60  SER n 
1 61  GLN n 
1 62  GLY n 
1 63  SER n 
1 64  SER n 
1 65  ASP n 
1 66  SER n 
1 67  GLN n 
1 68  ILE n 
1 69  LEU n 
1 70  ASP n 
1 71  LEU n 
1 72  SER n 
1 73  ASN n 
1 74  ARG n 
1 75  PHE n 
1 76  TYR n 
1 77  THR n 
1 78  LEU n 
1 79  ILE n 
1 80  PRO n 
1 81  HIS n 
1 82  ASP n 
1 83  PHE n 
1 84  GLY n 
1 85  MET n 
1 86  LYS n 
1 87  LYS n 
1 88  PRO n 
1 89  PRO n 
1 90  LEU n 
1 91  LEU n 
1 92  ASN n 
1 93  ASN n 
1 94  ALA n 
1 95  ASP n 
1 96  SER n 
1 97  VAL n 
1 98  GLN n 
1 99  ALA n 
1 100 LYS n 
1 101 VAL n 
1 102 GLU n 
1 103 MET n 
1 104 LEU n 
1 105 ASP n 
1 106 ASN n 
1 107 LEU n 
1 108 LEU n 
1 109 ASP n 
1 110 ILE n 
1 111 GLU n 
1 112 VAL n 
1 113 ALA n 
1 114 TYR n 
1 115 SER n 
1 116 LEU n 
1 117 LEU n 
1 118 ARG n 
1 119 GLY n 
1 120 GLY n 
1 121 SER n 
1 122 ASP n 
1 123 ASP n 
1 124 SER n 
1 125 SER n 
1 126 LYS n 
1 127 ASP n 
1 128 PRO n 
1 129 ILE n 
1 130 ASP n 
1 131 VAL n 
1 132 ASN n 
1 133 TYR n 
1 134 GLU n 
1 135 LYS n 
1 136 LEU n 
1 137 LYS n 
1 138 THR n 
1 139 ASP n 
1 140 ILE n 
1 141 LYS n 
1 142 VAL n 
1 143 VAL n 
1 144 ASP n 
1 145 ARG n 
1 146 ASP n 
1 147 SER n 
1 148 GLU n 
1 149 GLU n 
1 150 ALA n 
1 151 GLU n 
1 152 ILE n 
1 153 ILE n 
1 154 ARG n 
1 155 LYS n 
1 156 TYR n 
1 157 VAL n 
1 158 LYS n 
1 159 ASN n 
1 160 THR n 
1 161 HIS n 
1 162 ALA n 
1 163 THR n 
1 164 THR n 
1 165 HIS n 
1 166 ASN n 
1 167 ALA n 
1 168 TYR n 
1 169 ASP n 
1 170 LEU n 
1 171 GLU n 
1 172 VAL n 
1 173 ILE n 
1 174 ASP n 
1 175 ILE n 
1 176 PHE n 
1 177 LYS n 
1 178 ILE n 
1 179 GLU n 
1 180 ARG n 
1 181 GLU n 
1 182 GLY n 
1 183 GLU n 
1 184 CYS n 
1 185 GLN n 
1 186 ARG n 
1 187 TYR n 
1 188 LYS n 
1 189 PRO n 
1 190 PHE n 
1 191 LYS n 
1 192 GLN n 
1 193 LEU n 
1 194 HIS n 
1 195 ASN n 
1 196 ARG n 
1 197 ARG n 
1 198 LEU n 
1 199 LEU n 
1 200 TRP n 
1 201 HIS n 
1 202 GLY n 
1 203 SER n 
1 204 ARG n 
1 205 THR n 
1 206 THR n 
1 207 ASN n 
1 208 PHE n 
1 209 ALA n 
1 210 GLY n 
1 211 ILE n 
1 212 LEU n 
1 213 SER n 
1 214 GLN n 
1 215 GLY n 
1 216 LEU n 
1 217 ARG n 
1 218 ILE n 
1 219 ALA n 
1 220 PRO n 
1 221 PRO n 
1 222 GLU n 
1 223 ALA n 
1 224 PRO n 
1 225 VAL n 
1 226 THR n 
1 227 GLY n 
1 228 TYR n 
1 229 MET n 
1 230 PHE n 
1 231 GLY n 
1 232 LYS n 
1 233 GLY n 
1 234 ILE n 
1 235 TYR n 
1 236 PHE n 
1 237 ALA n 
1 238 ASP n 
1 239 MET n 
1 240 VAL n 
1 241 SER n 
1 242 LYS n 
1 243 SER n 
1 244 ALA n 
1 245 ASN n 
1 246 TYR n 
1 247 CYS n 
1 248 HIS n 
1 249 THR n 
1 250 SER n 
1 251 GLN n 
1 252 GLY n 
1 253 ASP n 
1 254 PRO n 
1 255 ILE n 
1 256 GLY n 
1 257 LEU n 
1 258 ILE n 
1 259 LEU n 
1 260 LEU n 
1 261 GLY n 
1 262 GLU n 
1 263 VAL n 
1 264 ALA n 
1 265 LEU n 
1 266 GLY n 
1 267 ASN n 
1 268 MET n 
1 269 TYR n 
1 270 GLU n 
1 271 LEU n 
1 272 LYS n 
1 273 HIS n 
1 274 ALA n 
1 275 SER n 
1 276 HIS n 
1 277 ILE n 
1 278 SER n 
1 279 LYS n 
1 280 LEU n 
1 281 PRO n 
1 282 LYS n 
1 283 GLY n 
1 284 LYS n 
1 285 HIS n 
1 286 SER n 
1 287 VAL n 
1 288 LYS n 
1 289 GLY n 
1 290 LEU n 
1 291 GLY n 
1 292 LYS n 
1 293 THR n 
1 294 THR n 
1 295 PRO n 
1 296 ASP n 
1 297 PRO n 
1 298 SER n 
1 299 ALA n 
1 300 ASN n 
1 301 ILE n 
1 302 SER n 
1 303 LEU n 
1 304 ASP n 
1 305 GLY n 
1 306 VAL n 
1 307 ASP n 
1 308 VAL n 
1 309 PRO n 
1 310 LEU n 
1 311 GLY n 
1 312 THR n 
1 313 GLY n 
1 314 ILE n 
1 315 SER n 
1 316 SER n 
1 317 GLY n 
1 318 VAL n 
1 319 ASN n 
1 320 ASP n 
1 321 THR n 
1 322 SER n 
1 323 LEU n 
1 324 LEU n 
1 325 TYR n 
1 326 ASN n 
1 327 GLU n 
1 328 TYR n 
1 329 ILE n 
1 330 VAL n 
1 331 TYR n 
1 332 ASP n 
1 333 ILE n 
1 334 ALA n 
1 335 GLN n 
1 336 VAL n 
1 337 ASN n 
1 338 LEU n 
1 339 LYS n 
1 340 TYR n 
1 341 LEU n 
1 342 LEU n 
1 343 LYS n 
1 344 LEU n 
1 345 LYS n 
1 346 PHE n 
1 347 ASN n 
1 348 PHE n 
1 349 LYS n 
1 350 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX4T-2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PARP1_HUMAN 
_struct_ref.pdbx_db_accession          P09874 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIP
HDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNT
HATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMV
SKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVND
TSLLYNEYIVYDIAQVNLKYLLKLKFNFKT
;
_struct_ref.pdbx_align_begin           661 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1UK0 A 1 ? 350 ? P09874 661 ? 1010 ? 1 350 
2 1 1UK0 B 1 ? 350 ? P09874 661 ? 1010 ? 1 350 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                     ? 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                                                    ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                  ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                             ? 
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                    ? 
'C3 H7 N O2 S'   121.158 
FRM non-polymer         . '2-{3-[4-(4-FLUOROPHENYL)-3,6-DIHYDRO-1(2H)-PYRIDINYL]PROPYL}-8-METHYL-4(3H)-QUINAZOLINONE' ? 
'C23 H24 F N3 O' 377.455 
GLN 'L-peptide linking' y GLUTAMINE                                                                                   ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                             ? 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                                     ? 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                   ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                                       ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                  ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                     ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                                      ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                                  ? 
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                               ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                                     ? 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                                      ? 
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                                                   ? 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                  ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                    ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                                      ? 
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1UK0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.48 
_exptl_crystal.density_percent_sol   49.97 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    'PEG400, Ammonium sulphate, Tris-HCl, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   2003-05-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    Si 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-6B' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-6B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.entry_id                     1UK0 
_reflns.observed_criterion_sigma_F   1 
_reflns.observed_criterion_sigma_I   1 
_reflns.d_resolution_high            3 
_reflns.d_resolution_low             50 
_reflns.number_all                   38495 
_reflns.number_obs                   15613 
_reflns.percent_possible_obs         95.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3 
_reflns_shell.d_res_low              3.18 
_reflns_shell.percent_possible_all   94.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1UK0 
_refine.ls_d_res_high                            3 
_refine.ls_d_res_low                             50 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     15353 
_refine.ls_number_reflns_obs                     14592 
_refine.ls_number_reflns_R_free                  761 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.219 
_refine.ls_R_factor_R_free                       0.246 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5508 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         56 
_refine_hist.number_atoms_solvent             253 
_refine_hist.number_atoms_total               5817 
_refine_hist.d_res_high                       3 
_refine_hist.d_res_low                        50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.037 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d          5.5   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 30.4  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 5.22  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       3 
_refine_ls_shell.d_res_low                        3.18 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.283 
_refine_ls_shell.percent_reflns_obs               0.947 
_refine_ls_shell.R_factor_R_free                  0.296 
_refine_ls_shell.R_factor_R_free_error            0.028 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             110 
_refine_ls_shell.number_reflns_obs                2395 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1UK0 
_struct.title                     
'Crystal structure of catalytic domain of human poly(ADP-ribose) polymerase with a novel inhibitor' 
_struct.pdbx_descriptor           'Poly [ADP-ribose] polymerase-1(E.C.2.4.2.30)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UK0 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'Protein-inhibitor complex, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 5   ? PHE A 16  ? PRO A 5   PHE A 16  1 ? 12 
HELX_P HELX_P2  2  ASP A 17  ? TYR A 28  ? ASP A 17  TYR A 28  1 ? 12 
HELX_P HELX_P3  3  SER A 41  ? GLN A 61  ? SER A 41  GLN A 61  1 ? 21 
HELX_P HELX_P4  4  SER A 64  ? ILE A 79  ? SER A 64  ILE A 79  1 ? 16 
HELX_P HELX_P5  5  ASN A 93  ? GLY A 119 ? ASN A 93  GLY A 119 1 ? 27 
HELX_P HELX_P6  6  VAL A 131 ? LEU A 136 ? VAL A 131 LEU A 136 1 ? 6  
HELX_P HELX_P7  7  SER A 147 ? THR A 160 ? SER A 147 THR A 160 1 ? 14 
HELX_P HELX_P8  8  ALA A 162 ? ASN A 166 ? ALA A 162 ASN A 166 5 ? 5  
HELX_P HELX_P9  9  GLY A 182 ? LYS A 188 ? GLY A 182 LYS A 188 1 ? 7  
HELX_P HELX_P10 10 PRO A 189 ? LEU A 193 ? PRO A 189 LEU A 193 5 ? 5  
HELX_P HELX_P11 11 ASN A 207 ? GLY A 215 ? ASN A 207 GLY A 215 1 ? 9  
HELX_P HELX_P12 12 PRO A 224 ? TYR A 228 ? PRO A 224 TYR A 228 5 ? 5  
HELX_P HELX_P13 13 MET A 239 ? TYR A 246 ? MET A 239 TYR A 246 1 ? 8  
HELX_P HELX_P14 14 PRO A 297 ? ASN A 300 ? PRO A 297 ASN A 300 5 ? 4  
HELX_P HELX_P15 15 SER A 302 ? VAL A 306 ? SER A 302 VAL A 306 5 ? 5  
HELX_P HELX_P16 16 ASP A 332 ? ALA A 334 ? ASP A 332 ALA A 334 5 ? 3  
HELX_P HELX_P17 17 PRO B 5   ? PHE B 16  ? PRO B 5   PHE B 16  1 ? 12 
HELX_P HELX_P18 18 ASP B 17  ? GLU B 27  ? ASP B 17  GLU B 27  1 ? 11 
HELX_P HELX_P19 19 PRO B 36  ? LEU B 40  ? PRO B 36  LEU B 40  5 ? 5  
HELX_P HELX_P20 20 SER B 41  ? GLN B 61  ? SER B 41  GLN B 61  1 ? 21 
HELX_P HELX_P21 21 SER B 64  ? TYR B 76  ? SER B 64  TYR B 76  1 ? 13 
HELX_P HELX_P22 22 ALA B 94  ? ASP B 109 ? ALA B 94  ASP B 109 1 ? 16 
HELX_P HELX_P23 23 GLU B 111 ? SER B 121 ? GLU B 111 SER B 121 1 ? 11 
HELX_P HELX_P24 24 ASP B 127 ? LEU B 136 ? ASP B 127 LEU B 136 1 ? 10 
HELX_P HELX_P25 25 SER B 147 ? HIS B 161 ? SER B 147 HIS B 161 1 ? 15 
HELX_P HELX_P26 26 GLY B 182 ? GLN B 192 ? GLY B 182 GLN B 192 1 ? 11 
HELX_P HELX_P27 27 ARG B 204 ? GLY B 215 ? ARG B 204 GLY B 215 1 ? 12 
HELX_P HELX_P28 28 MET B 239 ? ASN B 245 ? MET B 239 ASN B 245 1 ? 7  
HELX_P HELX_P29 29 TYR B 246 ? HIS B 248 ? TYR B 246 HIS B 248 5 ? 3  
HELX_P HELX_P30 30 PRO B 297 ? ASN B 300 ? PRO B 297 ASN B 300 5 ? 4  
HELX_P HELX_P31 31 SER B 302 ? VAL B 306 ? SER B 302 VAL B 306 5 ? 5  
HELX_P HELX_P32 32 ASP B 332 ? ALA B 334 ? ASP B 332 ALA B 334 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 123 A . ? ASP 123 A SER 124 A ? SER 124 A 1 -14.58 
2 GLY 252 A . ? GLY 252 A ASP 253 A ? ASP 253 A 1 -9.62  
3 ASP 123 B . ? ASP 123 B SER 124 B ? SER 124 B 1 28.49  
4 ALA 167 B . ? ALA 167 B TYR 168 B ? TYR 168 B 1 14.31  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
C ? 4 ? 
D ? 2 ? 
E ? 2 ? 
F ? 4 ? 
G ? 4 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 138 ? VAL A 142 ? THR A 138 VAL A 142 
A 2 PHE A 176 ? ARG A 180 ? PHE A 176 ARG A 180 
B 1 ASP A 169 ? VAL A 172 ? ASP A 169 VAL A 172 
B 2 VAL A 336 ? ASN A 347 ? VAL A 336 ASN A 347 
B 3 ILE A 255 ? ALA A 264 ? ILE A 255 ALA A 264 
B 4 ARG A 196 ? GLY A 202 ? ARG A 196 GLY A 202 
C 1 ILE A 234 ? TYR A 235 ? ILE A 234 TYR A 235 
C 2 GLU A 327 ? VAL A 330 ? GLU A 327 VAL A 330 
C 3 SER A 286 ? GLY A 289 ? SER A 286 GLY A 289 
C 4 MET A 268 ? LEU A 271 ? MET A 268 LEU A 271 
D 1 THR A 293 ? PRO A 295 ? THR A 293 PRO A 295 
D 2 GLY A 313 ? SER A 315 ? GLY A 313 SER A 315 
E 1 ILE B 140 ? LYS B 141 ? ILE B 140 LYS B 141 
E 2 LYS B 177 ? ILE B 178 ? LYS B 177 ILE B 178 
F 1 VAL B 172 ? ASP B 174 ? VAL B 172 ASP B 174 
F 2 VAL B 336 ? LEU B 344 ? VAL B 336 LEU B 344 
F 3 ILE B 258 ? ALA B 264 ? ILE B 258 ALA B 264 
F 4 ARG B 196 ? GLY B 202 ? ARG B 196 GLY B 202 
G 1 ILE B 234 ? ALA B 237 ? ILE B 234 ALA B 237 
G 2 GLU B 327 ? VAL B 330 ? GLU B 327 VAL B 330 
G 3 SER B 286 ? GLY B 289 ? SER B 286 GLY B 289 
G 4 MET B 268 ? LEU B 271 ? MET B 268 LEU B 271 
H 1 THR B 293 ? PRO B 295 ? THR B 293 PRO B 295 
H 2 GLY B 313 ? SER B 315 ? GLY B 313 SER B 315 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 141 ? N LYS A 141 O LYS A 177 ? O LYS A 177 
B 1 2 N ASP A 169 ? N ASP A 169 O ASN A 347 ? O ASN A 347 
B 2 3 O ASN A 337 ? O ASN A 337 N GLU A 262 ? N GLU A 262 
B 3 4 O GLY A 261 ? O GLY A 261 N LEU A 199 ? N LEU A 199 
C 1 2 N ILE A 234 ? N ILE A 234 O VAL A 330 ? O VAL A 330 
C 2 3 O ILE A 329 ? O ILE A 329 N VAL A 287 ? N VAL A 287 
C 3 4 O LYS A 288 ? O LYS A 288 N TYR A 269 ? N TYR A 269 
D 1 2 N THR A 294 ? N THR A 294 O ILE A 314 ? O ILE A 314 
E 1 2 N LYS B 141 ? N LYS B 141 O LYS B 177 ? O LYS B 177 
F 1 2 N ASP B 174 ? N ASP B 174 O LYS B 343 ? O LYS B 343 
F 2 3 O ASN B 337 ? O ASN B 337 N GLU B 262 ? N GLU B 262 
F 3 4 O GLY B 261 ? O GLY B 261 N LEU B 199 ? N LEU B 199 
G 1 2 N PHE B 236 ? N PHE B 236 O TYR B 328 ? O TYR B 328 
G 2 3 O GLU B 327 ? O GLU B 327 N GLY B 289 ? N GLY B 289 
G 3 4 O LYS B 288 ? O LYS B 288 N TYR B 269 ? N TYR B 269 
H 1 2 N THR B 294 ? N THR B 294 O ILE B 314 ? O ILE B 314 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE FRM A 501' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE FRM B 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 ASP A 105 ? ASP A 105 . ? 1_555 ? 
2  AC1 11 LEU A 108 ? LEU A 108 . ? 1_555 ? 
3  AC1 11 ASP A 109 ? ASP A 109 . ? 1_555 ? 
4  AC1 11 HIS A 201 ? HIS A 201 . ? 1_555 ? 
5  AC1 11 GLY A 202 ? GLY A 202 . ? 1_555 ? 
6  AC1 11 SER A 203 ? SER A 203 . ? 1_555 ? 
7  AC1 11 ASN A 207 ? ASN A 207 . ? 1_555 ? 
8  AC1 11 ARG A 217 ? ARG A 217 . ? 1_555 ? 
9  AC1 11 TYR A 235 ? TYR A 235 . ? 1_555 ? 
10 AC1 11 SER A 243 ? SER A 243 . ? 1_555 ? 
11 AC1 11 TYR A 246 ? TYR A 246 . ? 1_555 ? 
12 AC2 11 LEU B 108 ? LEU B 108 . ? 1_555 ? 
13 AC2 11 ASP B 109 ? ASP B 109 . ? 1_555 ? 
14 AC2 11 HIS B 201 ? HIS B 201 . ? 1_555 ? 
15 AC2 11 GLY B 202 ? GLY B 202 . ? 1_555 ? 
16 AC2 11 ARG B 217 ? ARG B 217 . ? 1_555 ? 
17 AC2 11 TYR B 235 ? TYR B 235 . ? 1_555 ? 
18 AC2 11 PHE B 236 ? PHE B 236 . ? 1_555 ? 
19 AC2 11 SER B 243 ? SER B 243 . ? 1_555 ? 
20 AC2 11 TYR B 246 ? TYR B 246 . ? 1_555 ? 
21 AC2 11 GLU B 327 ? GLU B 327 . ? 1_555 ? 
22 AC2 11 HOH F .   ? HOH B 505 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1UK0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1UK0 
_atom_sites.fract_transf_matrix[1][1]   0.005561 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002523 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018674 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011934 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 1   ? -8.730  22.416  55.321  1.00 12.44 ? 1   LYS A N   1 
ATOM   2    C CA  . LYS A 1 1   ? -7.606  21.597  54.839  1.00 17.22 ? 1   LYS A CA  1 
ATOM   3    C C   . LYS A 1 1   ? -8.280  20.399  54.142  1.00 19.93 ? 1   LYS A C   1 
ATOM   4    O O   . LYS A 1 1   ? -9.464  20.278  54.394  1.00 17.16 ? 1   LYS A O   1 
ATOM   5    C CB  . LYS A 1 1   ? -6.622  21.282  55.987  1.00 14.21 ? 1   LYS A CB  1 
ATOM   6    C CG  . LYS A 1 1   ? -5.956  19.832  56.119  1.00 17.15 ? 1   LYS A CG  1 
ATOM   7    C CD  . LYS A 1 1   ? -4.710  19.589  55.161  1.00 18.17 ? 1   LYS A CD  1 
ATOM   8    C CE  . LYS A 1 1   ? -4.079  18.207  54.796  1.00 14.24 ? 1   LYS A CE  1 
ATOM   9    N NZ  . LYS A 1 1   ? -3.753  17.480  56.025  1.00 13.74 ? 1   LYS A NZ  1 
ATOM   10   N N   . SER A 1 2   ? -7.591  19.576  53.347  1.00 23.01 ? 2   SER A N   1 
ATOM   11   C CA  . SER A 1 2   ? -8.241  18.547  52.510  1.00 25.04 ? 2   SER A CA  1 
ATOM   12   C C   . SER A 1 2   ? -9.399  17.647  52.995  1.00 25.48 ? 2   SER A C   1 
ATOM   13   O O   . SER A 1 2   ? -9.108  16.517  53.376  1.00 25.52 ? 2   SER A O   1 
ATOM   14   C CB  . SER A 1 2   ? -7.156  17.564  51.956  1.00 25.94 ? 2   SER A CB  1 
ATOM   15   O OG  . SER A 1 2   ? -7.691  16.462  51.147  1.00 29.27 ? 2   SER A OG  1 
ATOM   16   N N   . LYS A 1 3   ? -10.682 18.057  52.845  1.00 26.09 ? 3   LYS A N   1 
ATOM   17   C CA  . LYS A 1 3   ? -11.510 17.136  52.016  1.00 26.17 ? 3   LYS A CA  1 
ATOM   18   C C   . LYS A 1 3   ? -11.319 15.565  52.157  1.00 24.10 ? 3   LYS A C   1 
ATOM   19   O O   . LYS A 1 3   ? -12.034 14.837  52.867  1.00 24.95 ? 3   LYS A O   1 
ATOM   20   C CB  . LYS A 1 3   ? -11.277 17.445  50.458  1.00 27.55 ? 3   LYS A CB  1 
ATOM   21   C CG  . LYS A 1 3   ? -11.620 18.769  49.681  1.00 26.39 ? 3   LYS A CG  1 
ATOM   22   C CD  . LYS A 1 3   ? -10.885 20.015  50.110  1.00 23.98 ? 3   LYS A CD  1 
ATOM   23   C CE  . LYS A 1 3   ? -11.702 21.011  50.857  1.00 21.74 ? 3   LYS A CE  1 
ATOM   24   N NZ  . LYS A 1 3   ? -11.805 22.087  49.887  1.00 21.72 ? 3   LYS A NZ  1 
ATOM   25   N N   . LEU A 1 4   ? -10.294 15.103  51.337  1.00 18.99 ? 4   LEU A N   1 
ATOM   26   C CA  . LEU A 1 4   ? -10.171 13.669  50.888  1.00 14.72 ? 4   LEU A CA  1 
ATOM   27   C C   . LEU A 1 4   ? -10.211 12.506  51.959  1.00 10.93 ? 4   LEU A C   1 
ATOM   28   O O   . LEU A 1 4   ? -9.668  12.643  53.058  1.00 9.79  ? 4   LEU A O   1 
ATOM   29   C CB  . LEU A 1 4   ? -8.849  13.385  50.093  1.00 10.05 ? 4   LEU A CB  1 
ATOM   30   C CG  . LEU A 1 4   ? -8.709  13.293  48.520  1.00 11.43 ? 4   LEU A CG  1 
ATOM   31   C CD1 . LEU A 1 4   ? -9.860  12.671  47.671  1.00 13.05 ? 4   LEU A CD1 1 
ATOM   32   C CD2 . LEU A 1 4   ? -8.090  14.538  47.848  1.00 7.93  ? 4   LEU A CD2 1 
ATOM   33   N N   . PRO A 1 5   ? -10.775 11.313  51.553  1.00 7.11  ? 5   PRO A N   1 
ATOM   34   C CA  . PRO A 1 5   ? -10.548 10.108  52.385  1.00 5.88  ? 5   PRO A CA  1 
ATOM   35   C C   . PRO A 1 5   ? -9.099  9.993   52.766  1.00 5.49  ? 5   PRO A C   1 
ATOM   36   O O   . PRO A 1 5   ? -8.205  10.618  52.207  1.00 5.87  ? 5   PRO A O   1 
ATOM   37   C CB  . PRO A 1 5   ? -11.044 8.909   51.580  1.00 6.36  ? 5   PRO A CB  1 
ATOM   38   C CG  . PRO A 1 5   ? -11.667 9.538   50.281  1.00 12.75 ? 5   PRO A CG  1 
ATOM   39   C CD  . PRO A 1 5   ? -11.610 11.049  50.362  1.00 7.67  ? 5   PRO A CD  1 
ATOM   40   N N   . LYS A 1 6   ? -8.861  9.162   53.731  1.00 7.86  ? 6   LYS A N   1 
ATOM   41   C CA  . LYS A 1 6   ? -7.517  9.321   54.278  1.00 9.36  ? 6   LYS A CA  1 
ATOM   42   C C   . LYS A 1 6   ? -6.238  8.673   53.633  1.00 13.75 ? 6   LYS A C   1 
ATOM   43   O O   . LYS A 1 6   ? -5.271  9.391   53.465  1.00 18.01 ? 6   LYS A O   1 
ATOM   44   C CB  . LYS A 1 6   ? -7.705  9.131   55.742  1.00 11.99 ? 6   LYS A CB  1 
ATOM   45   C CG  . LYS A 1 6   ? -6.867  10.120  56.489  1.00 15.46 ? 6   LYS A CG  1 
ATOM   46   C CD  . LYS A 1 6   ? -5.585  9.425   57.001  1.00 15.00 ? 6   LYS A CD  1 
ATOM   47   C CE  . LYS A 1 6   ? -5.742  7.954   57.450  1.00 16.82 ? 6   LYS A CE  1 
ATOM   48   N NZ  . LYS A 1 6   ? -6.921  7.787   58.323  1.00 21.43 ? 6   LYS A NZ  1 
ATOM   49   N N   . PRO A 1 7   ? -6.199  7.342   53.218  1.00 12.07 ? 7   PRO A N   1 
ATOM   50   C CA  . PRO A 1 7   ? -5.166  6.838   52.266  1.00 10.14 ? 7   PRO A CA  1 
ATOM   51   C C   . PRO A 1 7   ? -5.186  7.453   50.844  1.00 12.18 ? 7   PRO A C   1 
ATOM   52   O O   . PRO A 1 7   ? -4.188  7.742   50.194  1.00 11.61 ? 7   PRO A O   1 
ATOM   53   C CB  . PRO A 1 7   ? -5.365  5.322   52.180  1.00 7.20  ? 7   PRO A CB  1 
ATOM   54   C CG  . PRO A 1 7   ? -6.698  5.047   52.803  1.00 15.11 ? 7   PRO A CG  1 
ATOM   55   C CD  . PRO A 1 7   ? -7.037  6.242   53.674  1.00 11.52 ? 7   PRO A CD  1 
ATOM   56   N N   . VAL A 1 8   ? -6.428  7.933   50.432  1.00 12.70 ? 8   VAL A N   1 
ATOM   57   C CA  . VAL A 1 8   ? -6.090  8.946   49.372  1.00 9.25  ? 8   VAL A CA  1 
ATOM   58   C C   . VAL A 1 8   ? -5.090  10.114  49.604  1.00 12.28 ? 8   VAL A C   1 
ATOM   59   O O   . VAL A 1 8   ? -4.104  10.241  48.908  1.00 13.63 ? 8   VAL A O   1 
ATOM   60   C CB  . VAL A 1 8   ? -7.256  9.371   48.529  1.00 6.77  ? 8   VAL A CB  1 
ATOM   61   C CG1 . VAL A 1 8   ? -6.754  10.130  47.300  1.00 4.38  ? 8   VAL A CG1 1 
ATOM   62   C CG2 . VAL A 1 8   ? -7.902  8.072   48.116  1.00 2.75  ? 8   VAL A CG2 1 
ATOM   63   N N   . GLN A 1 9   ? -5.318  10.919  50.659  1.00 12.81 ? 9   GLN A N   1 
ATOM   64   C CA  . GLN A 1 9   ? -4.195  11.760  51.125  1.00 15.54 ? 9   GLN A CA  1 
ATOM   65   C C   . GLN A 1 9   ? -2.815  11.138  51.271  1.00 14.89 ? 9   GLN A C   1 
ATOM   66   O O   . GLN A 1 9   ? -1.815  11.738  50.899  1.00 16.89 ? 9   GLN A O   1 
ATOM   67   C CB  . GLN A 1 9   ? -4.542  12.393  52.422  1.00 19.65 ? 9   GLN A CB  1 
ATOM   68   C CG  . GLN A 1 9   ? -6.034  12.680  52.411  1.00 28.05 ? 9   GLN A CG  1 
ATOM   69   C CD  . GLN A 1 9   ? -6.291  13.902  53.233  1.00 36.79 ? 9   GLN A CD  1 
ATOM   70   O OE1 . GLN A 1 9   ? -5.438  14.752  53.363  1.00 37.00 ? 9   GLN A OE1 1 
ATOM   71   N NE2 . GLN A 1 9   ? -7.489  13.982  53.731  1.00 38.73 ? 9   GLN A NE2 1 
ATOM   72   N N   . ASP A 1 10  ? -2.743  9.920   51.796  1.00 15.85 ? 10  ASP A N   1 
ATOM   73   C CA  . ASP A 1 10  ? -1.358  9.449   51.915  1.00 14.29 ? 10  ASP A CA  1 
ATOM   74   C C   . ASP A 1 10  ? -0.704  9.089   50.591  1.00 14.48 ? 10  ASP A C   1 
ATOM   75   O O   . ASP A 1 10  ? 0.437   9.535   50.352  1.00 13.66 ? 10  ASP A O   1 
ATOM   76   C CB  . ASP A 1 10  ? -1.091  8.360   53.030  1.00 14.65 ? 10  ASP A CB  1 
ATOM   77   C CG  . ASP A 1 10  ? -1.666  8.764   54.380  1.00 8.80  ? 10  ASP A CG  1 
ATOM   78   O OD1 . ASP A 1 10  ? -0.991  9.388   55.292  1.00 2.00  ? 10  ASP A OD1 1 
ATOM   79   O OD2 . ASP A 1 10  ? -2.871  8.415   54.393  1.00 4.08  ? 10  ASP A OD2 1 
ATOM   80   N N   . LEU A 1 11  ? -1.587  8.442   49.729  1.00 11.92 ? 11  LEU A N   1 
ATOM   81   C CA  . LEU A 1 11  ? -1.305  8.151   48.307  1.00 12.01 ? 11  LEU A CA  1 
ATOM   82   C C   . LEU A 1 11  ? -0.758  9.352   47.553  1.00 13.32 ? 11  LEU A C   1 
ATOM   83   O O   . LEU A 1 11  ? 0.350   9.272   47.019  1.00 15.42 ? 11  LEU A O   1 
ATOM   84   C CB  . LEU A 1 11  ? -2.546  7.746   47.511  1.00 12.01 ? 11  LEU A CB  1 
ATOM   85   C CG  . LEU A 1 11  ? -2.267  7.318   46.069  1.00 7.55  ? 11  LEU A CG  1 
ATOM   86   C CD1 . LEU A 1 11  ? -1.507  5.999   46.221  1.00 12.66 ? 11  LEU A CD1 1 
ATOM   87   C CD2 . LEU A 1 11  ? -3.482  7.311   45.191  1.00 2.06  ? 11  LEU A CD2 1 
ATOM   88   N N   . ILE A 1 12  ? -1.565  10.490  47.566  1.00 8.91  ? 12  ILE A N   1 
ATOM   89   C CA  . ILE A 1 12  ? -0.892  11.742  47.192  1.00 7.31  ? 12  ILE A CA  1 
ATOM   90   C C   . ILE A 1 12  ? 0.547   11.871  47.822  1.00 8.53  ? 12  ILE A C   1 
ATOM   91   O O   . ILE A 1 12  ? 1.473   11.410  47.161  1.00 13.01 ? 12  ILE A O   1 
ATOM   92   C CB  . ILE A 1 12  ? -1.702  13.082  47.270  1.00 3.08  ? 12  ILE A CB  1 
ATOM   93   C CG1 . ILE A 1 12  ? -3.194  12.924  47.300  1.00 6.88  ? 12  ILE A CG1 1 
ATOM   94   C CG2 . ILE A 1 12  ? -1.312  13.904  46.055  1.00 2.00  ? 12  ILE A CG2 1 
ATOM   95   C CD1 . ILE A 1 12  ? -3.740  12.275  46.030  1.00 6.39  ? 12  ILE A CD1 1 
ATOM   96   N N   . LYS A 1 13  ? 0.731   12.355  49.080  1.00 7.08  ? 13  LYS A N   1 
ATOM   97   C CA  . LYS A 1 13  ? 2.092   12.407  49.706  1.00 10.72 ? 13  LYS A CA  1 
ATOM   98   C C   . LYS A 1 13  ? 3.159   11.262  49.387  1.00 12.36 ? 13  LYS A C   1 
ATOM   99   O O   . LYS A 1 13  ? 4.371   11.517  49.381  1.00 13.59 ? 13  LYS A O   1 
ATOM   100  C CB  . LYS A 1 13  ? 2.049   12.616  51.317  1.00 15.92 ? 13  LYS A CB  1 
ATOM   101  C CG  . LYS A 1 13  ? 1.059   13.642  51.986  1.00 15.16 ? 13  LYS A CG  1 
ATOM   102  C CD  . LYS A 1 13  ? 0.661   13.540  53.515  1.00 13.45 ? 13  LYS A CD  1 
ATOM   103  C CE  . LYS A 1 13  ? -0.211  12.325  53.986  1.00 15.34 ? 13  LYS A CE  1 
ATOM   104  N NZ  . LYS A 1 13  ? 0.393   11.342  54.939  1.00 15.50 ? 13  LYS A NZ  1 
ATOM   105  N N   . MET A 1 14  ? 2.684   10.006  49.069  1.00 9.39  ? 14  MET A N   1 
ATOM   106  C CA  . MET A 1 14  ? 3.660   9.007   48.578  1.00 5.92  ? 14  MET A CA  1 
ATOM   107  C C   . MET A 1 14  ? 4.052   9.187   47.073  1.00 3.50  ? 14  MET A C   1 
ATOM   108  O O   . MET A 1 14  ? 5.189   9.301   46.629  1.00 3.54  ? 14  MET A O   1 
ATOM   109  C CB  . MET A 1 14  ? 3.104   7.622   49.004  1.00 4.55  ? 14  MET A CB  1 
ATOM   110  C CG  . MET A 1 14  ? 3.192   6.555   47.923  1.00 2.00  ? 14  MET A CG  1 
ATOM   111  S SD  . MET A 1 14  ? 3.486   4.919   48.567  1.00 12.64 ? 14  MET A SD  1 
ATOM   112  C CE  . MET A 1 14  ? 1.955   4.178   49.128  1.00 5.05  ? 14  MET A CE  1 
ATOM   113  N N   . ILE A 1 15  ? 2.959   9.238   46.290  1.00 7.09  ? 15  ILE A N   1 
ATOM   114  C CA  . ILE A 1 15  ? 3.284   9.323   44.841  1.00 12.44 ? 15  ILE A CA  1 
ATOM   115  C C   . ILE A 1 15  ? 3.726   10.682  44.280  1.00 14.35 ? 15  ILE A C   1 
ATOM   116  O O   . ILE A 1 15  ? 4.098   10.873  43.133  1.00 16.48 ? 15  ILE A O   1 
ATOM   117  C CB  . ILE A 1 15  ? 2.192   8.593   43.965  1.00 9.40  ? 15  ILE A CB  1 
ATOM   118  C CG1 . ILE A 1 15  ? 0.877   9.366   43.910  1.00 5.05  ? 15  ILE A CG1 1 
ATOM   119  C CG2 . ILE A 1 15  ? 1.911   7.290   44.634  1.00 11.74 ? 15  ILE A CG2 1 
ATOM   120  C CD1 . ILE A 1 15  ? -0.365  8.466   43.704  1.00 2.00  ? 15  ILE A CD1 1 
ATOM   121  N N   . PHE A 1 16  ? 3.535   11.670  45.154  1.00 13.88 ? 16  PHE A N   1 
ATOM   122  C CA  . PHE A 1 16  ? 3.893   13.003  44.754  1.00 11.60 ? 16  PHE A CA  1 
ATOM   123  C C   . PHE A 1 16  ? 5.137   13.562  45.406  1.00 11.36 ? 16  PHE A C   1 
ATOM   124  O O   . PHE A 1 16  ? 5.293   14.793  45.412  1.00 9.26  ? 16  PHE A O   1 
ATOM   125  C CB  . PHE A 1 16  ? 2.727   13.999  44.931  1.00 7.77  ? 16  PHE A CB  1 
ATOM   126  C CG  . PHE A 1 16  ? 2.154   14.316  43.521  1.00 7.81  ? 16  PHE A CG  1 
ATOM   127  C CD1 . PHE A 1 16  ? 3.012   14.896  42.538  1.00 2.65  ? 16  PHE A CD1 1 
ATOM   128  C CD2 . PHE A 1 16  ? 0.821   14.051  43.187  1.00 2.01  ? 16  PHE A CD2 1 
ATOM   129  C CE1 . PHE A 1 16  ? 2.518   15.428  41.360  1.00 2.00  ? 16  PHE A CE1 1 
ATOM   130  C CE2 . PHE A 1 16  ? 0.304   14.534  41.985  1.00 2.00  ? 16  PHE A CE2 1 
ATOM   131  C CZ  . PHE A 1 16  ? 1.126   15.326  41.156  1.00 2.71  ? 16  PHE A CZ  1 
ATOM   132  N N   . ASP A 1 17  ? 5.976   12.658  46.027  1.00 12.59 ? 17  ASP A N   1 
ATOM   133  C CA  . ASP A 1 17  ? 6.972   13.371  46.807  1.00 10.38 ? 17  ASP A CA  1 
ATOM   134  C C   . ASP A 1 17  ? 8.441   13.628  46.426  1.00 9.95  ? 17  ASP A C   1 
ATOM   135  O O   . ASP A 1 17  ? 9.157   12.684  46.160  1.00 11.48 ? 17  ASP A O   1 
ATOM   136  C CB  . ASP A 1 17  ? 6.871   12.894  48.208  1.00 11.04 ? 17  ASP A CB  1 
ATOM   137  C CG  . ASP A 1 17  ? 7.670   11.692  48.202  1.00 14.66 ? 17  ASP A CG  1 
ATOM   138  O OD1 . ASP A 1 17  ? 7.061   10.758  47.725  1.00 16.28 ? 17  ASP A OD1 1 
ATOM   139  O OD2 . ASP A 1 17  ? 8.869   11.711  48.550  1.00 21.66 ? 17  ASP A OD2 1 
ATOM   140  N N   . VAL A 1 18  ? 8.941   14.924  46.571  1.00 7.36  ? 18  VAL A N   1 
ATOM   141  C CA  . VAL A 1 18  ? 10.274  15.162  45.960  1.00 5.93  ? 18  VAL A CA  1 
ATOM   142  C C   . VAL A 1 18  ? 11.462  14.277  46.378  1.00 8.68  ? 18  VAL A C   1 
ATOM   143  O O   . VAL A 1 18  ? 12.331  13.918  45.571  1.00 10.12 ? 18  VAL A O   1 
ATOM   144  C CB  . VAL A 1 18  ? 10.646  16.612  45.890  1.00 2.91  ? 18  VAL A CB  1 
ATOM   145  C CG1 . VAL A 1 18  ? 11.843  16.887  44.961  1.00 2.00  ? 18  VAL A CG1 1 
ATOM   146  C CG2 . VAL A 1 18  ? 9.429   17.415  45.428  1.00 3.67  ? 18  VAL A CG2 1 
ATOM   147  N N   . GLU A 1 19  ? 11.466  13.881  47.639  1.00 9.74  ? 19  GLU A N   1 
ATOM   148  C CA  . GLU A 1 19  ? 12.713  13.198  48.011  1.00 14.14 ? 19  GLU A CA  1 
ATOM   149  C C   . GLU A 1 19  ? 13.012  12.023  47.207  1.00 11.92 ? 19  GLU A C   1 
ATOM   150  O O   . GLU A 1 19  ? 14.079  11.951  46.658  1.00 9.30  ? 19  GLU A O   1 
ATOM   151  C CB  . GLU A 1 19  ? 12.637  12.691  49.448  1.00 23.37 ? 19  GLU A CB  1 
ATOM   152  C CG  . GLU A 1 19  ? 13.908  12.640  50.382  1.00 27.83 ? 19  GLU A CG  1 
ATOM   153  C CD  . GLU A 1 19  ? 14.875  11.379  50.450  1.00 29.41 ? 19  GLU A CD  1 
ATOM   154  O OE1 . GLU A 1 19  ? 15.631  11.022  49.465  1.00 29.72 ? 19  GLU A OE1 1 
ATOM   155  O OE2 . GLU A 1 19  ? 14.930  10.782  51.555  1.00 25.39 ? 19  GLU A OE2 1 
ATOM   156  N N   . SER A 1 20  ? 11.971  11.159  47.116  1.00 13.73 ? 20  SER A N   1 
ATOM   157  C CA  . SER A 1 20  ? 12.136  9.856   46.431  1.00 14.77 ? 20  SER A CA  1 
ATOM   158  C C   . SER A 1 20  ? 12.448  9.840   44.977  1.00 14.13 ? 20  SER A C   1 
ATOM   159  O O   . SER A 1 20  ? 13.294  9.053   44.534  1.00 22.96 ? 20  SER A O   1 
ATOM   160  C CB  . SER A 1 20  ? 10.979  8.942   46.511  1.00 17.80 ? 20  SER A CB  1 
ATOM   161  O OG  . SER A 1 20  ? 9.930   9.616   47.209  1.00 25.37 ? 20  SER A OG  1 
ATOM   162  N N   . MET A 1 21  ? 11.993  10.966  44.346  1.00 12.56 ? 21  MET A N   1 
ATOM   163  C CA  . MET A 1 21  ? 12.438  11.206  42.989  1.00 11.49 ? 21  MET A CA  1 
ATOM   164  C C   . MET A 1 21  ? 13.971  11.202  42.882  1.00 13.77 ? 21  MET A C   1 
ATOM   165  O O   . MET A 1 21  ? 14.644  10.490  42.125  1.00 19.44 ? 21  MET A O   1 
ATOM   166  C CB  . MET A 1 21  ? 11.786  12.448  42.470  1.00 8.57  ? 21  MET A CB  1 
ATOM   167  C CG  . MET A 1 21  ? 10.280  12.407  42.380  1.00 7.31  ? 21  MET A CG  1 
ATOM   168  S SD  . MET A 1 21  ? 9.799   14.044  41.887  1.00 15.11 ? 21  MET A SD  1 
ATOM   169  C CE  . MET A 1 21  ? 8.246   14.446  42.786  1.00 8.68  ? 21  MET A CE  1 
ATOM   170  N N   . LYS A 1 22  ? 14.611  11.986  43.777  1.00 14.48 ? 22  LYS A N   1 
ATOM   171  C CA  . LYS A 1 22  ? 16.070  11.824  43.776  1.00 11.59 ? 22  LYS A CA  1 
ATOM   172  C C   . LYS A 1 22  ? 16.592  10.397  43.979  1.00 12.42 ? 22  LYS A C   1 
ATOM   173  O O   . LYS A 1 22  ? 17.352  9.864   43.147  1.00 16.28 ? 22  LYS A O   1 
ATOM   174  C CB  . LYS A 1 22  ? 16.801  12.889  44.606  1.00 13.66 ? 22  LYS A CB  1 
ATOM   175  C CG  . LYS A 1 22  ? 15.894  14.107  44.539  1.00 16.60 ? 22  LYS A CG  1 
ATOM   176  C CD  . LYS A 1 22  ? 16.436  15.490  44.919  1.00 27.08 ? 22  LYS A CD  1 
ATOM   177  C CE  . LYS A 1 22  ? 15.252  16.284  45.531  1.00 22.71 ? 22  LYS A CE  1 
ATOM   178  N NZ  . LYS A 1 22  ? 15.466  17.717  45.408  1.00 21.97 ? 22  LYS A NZ  1 
ATOM   179  N N   . LYS A 1 23  ? 16.028  9.756   44.974  1.00 7.56  ? 23  LYS A N   1 
ATOM   180  C CA  . LYS A 1 23  ? 16.352  8.352   45.176  1.00 7.32  ? 23  LYS A CA  1 
ATOM   181  C C   . LYS A 1 23  ? 16.400  7.291   43.981  1.00 8.76  ? 23  LYS A C   1 
ATOM   182  O O   . LYS A 1 23  ? 17.301  6.454   43.832  1.00 7.09  ? 23  LYS A O   1 
ATOM   183  C CB  . LYS A 1 23  ? 15.355  7.981   46.255  1.00 12.70 ? 23  LYS A CB  1 
ATOM   184  C CG  . LYS A 1 23  ? 15.628  8.276   47.760  1.00 12.27 ? 23  LYS A CG  1 
ATOM   185  C CD  . LYS A 1 23  ? 16.655  7.417   48.516  1.00 8.81  ? 23  LYS A CD  1 
ATOM   186  C CE  . LYS A 1 23  ? 16.281  6.016   48.121  1.00 16.67 ? 23  LYS A CE  1 
ATOM   187  N NZ  . LYS A 1 23  ? 16.435  5.074   49.243  1.00 24.51 ? 23  LYS A NZ  1 
ATOM   188  N N   . ALA A 1 24  ? 15.398  7.375   43.050  1.00 10.69 ? 24  ALA A N   1 
ATOM   189  C CA  . ALA A 1 24  ? 15.414  6.501   41.828  1.00 12.87 ? 24  ALA A CA  1 
ATOM   190  C C   . ALA A 1 24  ? 16.622  6.717   40.864  1.00 13.90 ? 24  ALA A C   1 
ATOM   191  O O   . ALA A 1 24  ? 17.380  5.848   40.430  1.00 10.39 ? 24  ALA A O   1 
ATOM   192  C CB  . ALA A 1 24  ? 14.099  6.756   41.111  1.00 9.32  ? 24  ALA A CB  1 
ATOM   193  N N   . MET A 1 25  ? 16.736  8.050   40.595  1.00 13.98 ? 25  MET A N   1 
ATOM   194  C CA  . MET A 1 25  ? 17.797  8.751   39.849  1.00 11.06 ? 25  MET A CA  1 
ATOM   195  C C   . MET A 1 25  ? 19.203  8.368   40.323  1.00 8.81  ? 25  MET A C   1 
ATOM   196  O O   . MET A 1 25  ? 19.987  7.826   39.532  1.00 10.16 ? 25  MET A O   1 
ATOM   197  C CB  . MET A 1 25  ? 17.549  10.305  39.876  1.00 10.50 ? 25  MET A CB  1 
ATOM   198  C CG  . MET A 1 25  ? 16.082  10.668  39.637  1.00 11.00 ? 25  MET A CG  1 
ATOM   199  S SD  . MET A 1 25  ? 15.687  12.292  38.901  1.00 5.51  ? 25  MET A SD  1 
ATOM   200  C CE  . MET A 1 25  ? 17.270  13.029  39.193  1.00 13.25 ? 25  MET A CE  1 
ATOM   201  N N   . VAL A 1 26  ? 19.384  8.586   41.665  1.00 9.35  ? 26  VAL A N   1 
ATOM   202  C CA  . VAL A 1 26  ? 20.465  7.908   42.443  1.00 11.12 ? 26  VAL A CA  1 
ATOM   203  C C   . VAL A 1 26  ? 20.729  6.443   42.146  1.00 13.85 ? 26  VAL A C   1 
ATOM   204  O O   . VAL A 1 26  ? 21.783  6.087   41.650  1.00 14.42 ? 26  VAL A O   1 
ATOM   205  C CB  . VAL A 1 26  ? 20.357  8.214   43.973  1.00 9.35  ? 26  VAL A CB  1 
ATOM   206  C CG1 . VAL A 1 26  ? 20.863  7.177   44.941  1.00 8.26  ? 26  VAL A CG1 1 
ATOM   207  C CG2 . VAL A 1 26  ? 21.149  9.475   44.385  1.00 11.70 ? 26  VAL A CG2 1 
ATOM   208  N N   . GLU A 1 27  ? 19.699  5.650   42.356  1.00 19.00 ? 27  GLU A N   1 
ATOM   209  C CA  . GLU A 1 27  ? 19.903  4.241   41.875  1.00 20.61 ? 27  GLU A CA  1 
ATOM   210  C C   . GLU A 1 27  ? 20.007  3.859   40.344  1.00 19.87 ? 27  GLU A C   1 
ATOM   211  O O   . GLU A 1 27  ? 20.259  2.746   39.896  1.00 19.69 ? 27  GLU A O   1 
ATOM   212  C CB  . GLU A 1 27  ? 18.864  3.273   42.549  1.00 24.29 ? 27  GLU A CB  1 
ATOM   213  C CG  . GLU A 1 27  ? 18.215  3.709   43.877  1.00 28.43 ? 27  GLU A CG  1 
ATOM   214  C CD  . GLU A 1 27  ? 17.362  2.606   44.512  1.00 32.69 ? 27  GLU A CD  1 
ATOM   215  O OE1 . GLU A 1 27  ? 17.404  1.420   44.178  1.00 33.98 ? 27  GLU A OE1 1 
ATOM   216  O OE2 . GLU A 1 27  ? 16.585  2.993   45.362  1.00 37.56 ? 27  GLU A OE2 1 
ATOM   217  N N   . TYR A 1 28  ? 19.682  4.882   39.500  1.00 16.86 ? 28  TYR A N   1 
ATOM   218  C CA  . TYR A 1 28  ? 20.146  4.567   38.165  1.00 12.35 ? 28  TYR A CA  1 
ATOM   219  C C   . TYR A 1 28  ? 21.554  4.969   37.841  1.00 9.31  ? 28  TYR A C   1 
ATOM   220  O O   . TYR A 1 28  ? 21.999  4.633   36.762  1.00 13.33 ? 28  TYR A O   1 
ATOM   221  C CB  . TYR A 1 28  ? 19.174  5.071   37.125  1.00 8.69  ? 28  TYR A CB  1 
ATOM   222  C CG  . TYR A 1 28  ? 18.012  4.129   36.877  1.00 7.09  ? 28  TYR A CG  1 
ATOM   223  C CD1 . TYR A 1 28  ? 18.209  2.759   36.404  1.00 10.38 ? 28  TYR A CD1 1 
ATOM   224  C CD2 . TYR A 1 28  ? 16.740  4.645   37.138  1.00 2.21  ? 28  TYR A CD2 1 
ATOM   225  C CE1 . TYR A 1 28  ? 17.145  1.865   36.434  1.00 13.33 ? 28  TYR A CE1 1 
ATOM   226  C CE2 . TYR A 1 28  ? 15.670  3.799   37.237  1.00 2.00  ? 28  TYR A CE2 1 
ATOM   227  C CZ  . TYR A 1 28  ? 15.898  2.392   37.005  1.00 9.54  ? 28  TYR A CZ  1 
ATOM   228  O OH  . TYR A 1 28  ? 14.906  1.500   37.351  1.00 2.00  ? 28  TYR A OH  1 
ATOM   229  N N   . GLU A 1 29  ? 22.229  5.681   38.797  1.00 4.84  ? 29  GLU A N   1 
ATOM   230  C CA  . GLU A 1 29  ? 23.626  6.313   38.883  1.00 7.35  ? 29  GLU A CA  1 
ATOM   231  C C   . GLU A 1 29  ? 23.821  7.810   38.679  1.00 3.72  ? 29  GLU A C   1 
ATOM   232  O O   . GLU A 1 29  ? 24.841  8.421   38.403  1.00 2.00  ? 29  GLU A O   1 
ATOM   233  C CB  . GLU A 1 29  ? 24.782  5.722   38.084  1.00 9.86  ? 29  GLU A CB  1 
ATOM   234  C CG  . GLU A 1 29  ? 25.758  4.869   38.890  1.00 13.95 ? 29  GLU A CG  1 
ATOM   235  C CD  . GLU A 1 29  ? 25.448  3.430   38.527  1.00 18.10 ? 29  GLU A CD  1 
ATOM   236  O OE1 . GLU A 1 29  ? 24.247  3.074   38.425  1.00 20.74 ? 29  GLU A OE1 1 
ATOM   237  O OE2 . GLU A 1 29  ? 26.435  2.696   38.383  1.00 16.94 ? 29  GLU A OE2 1 
ATOM   238  N N   . ILE A 1 30  ? 22.635  8.372   38.724  1.00 4.51  ? 30  ILE A N   1 
ATOM   239  C CA  . ILE A 1 30  ? 22.559  9.668   38.065  1.00 8.56  ? 30  ILE A CA  1 
ATOM   240  C C   . ILE A 1 30  ? 23.035  10.695  38.984  1.00 8.91  ? 30  ILE A C   1 
ATOM   241  O O   . ILE A 1 30  ? 22.765  10.643  40.177  1.00 15.66 ? 30  ILE A O   1 
ATOM   242  C CB  . ILE A 1 30  ? 21.149  9.949   37.503  1.00 9.12  ? 30  ILE A CB  1 
ATOM   243  C CG1 . ILE A 1 30  ? 21.092  9.188   36.172  1.00 6.36  ? 30  ILE A CG1 1 
ATOM   244  C CG2 . ILE A 1 30  ? 20.800  11.491  37.448  1.00 9.30  ? 30  ILE A CG2 1 
ATOM   245  C CD1 . ILE A 1 30  ? 19.653  9.149   35.872  1.00 4.94  ? 30  ILE A CD1 1 
ATOM   246  N N   . ASP A 1 31  ? 23.810  11.590  38.403  1.00 11.88 ? 31  ASP A N   1 
ATOM   247  C CA  . ASP A 1 31  ? 24.652  12.374  39.316  1.00 14.85 ? 31  ASP A CA  1 
ATOM   248  C C   . ASP A 1 31  ? 24.009  13.682  39.806  1.00 16.75 ? 31  ASP A C   1 
ATOM   249  O O   . ASP A 1 31  ? 24.390  14.773  39.402  1.00 15.96 ? 31  ASP A O   1 
ATOM   250  C CB  . ASP A 1 31  ? 25.901  12.558  38.506  1.00 17.34 ? 31  ASP A CB  1 
ATOM   251  C CG  . ASP A 1 31  ? 27.063  13.240  39.145  1.00 18.07 ? 31  ASP A CG  1 
ATOM   252  O OD1 . ASP A 1 31  ? 28.187  12.901  38.767  1.00 19.85 ? 31  ASP A OD1 1 
ATOM   253  O OD2 . ASP A 1 31  ? 26.836  14.148  39.953  1.00 23.93 ? 31  ASP A OD2 1 
ATOM   254  N N   . LEU A 1 32  ? 22.997  13.518  40.675  1.00 19.17 ? 32  LEU A N   1 
ATOM   255  C CA  . LEU A 1 32  ? 22.216  14.702  41.044  1.00 21.48 ? 32  LEU A CA  1 
ATOM   256  C C   . LEU A 1 32  ? 22.960  16.081  41.131  1.00 23.72 ? 32  LEU A C   1 
ATOM   257  O O   . LEU A 1 32  ? 22.491  17.160  40.785  1.00 26.49 ? 32  LEU A O   1 
ATOM   258  C CB  . LEU A 1 32  ? 21.595  14.397  42.376  1.00 22.57 ? 32  LEU A CB  1 
ATOM   259  C CG  . LEU A 1 32  ? 20.329  13.545  42.452  1.00 23.19 ? 32  LEU A CG  1 
ATOM   260  C CD1 . LEU A 1 32  ? 20.206  12.898  43.875  1.00 22.31 ? 32  LEU A CD1 1 
ATOM   261  C CD2 . LEU A 1 32  ? 19.075  14.310  41.961  1.00 17.58 ? 32  LEU A CD2 1 
ATOM   262  N N   . GLN A 1 33  ? 24.227  15.945  41.584  1.00 25.03 ? 33  GLN A N   1 
ATOM   263  C CA  . GLN A 1 33  ? 25.047  17.119  41.839  1.00 27.55 ? 33  GLN A CA  1 
ATOM   264  C C   . GLN A 1 33  ? 25.760  17.687  40.591  1.00 26.19 ? 33  GLN A C   1 
ATOM   265  O O   . GLN A 1 33  ? 25.955  18.885  40.451  1.00 19.74 ? 33  GLN A O   1 
ATOM   266  C CB  . GLN A 1 33  ? 25.874  16.903  43.214  1.00 33.93 ? 33  GLN A CB  1 
ATOM   267  C CG  . GLN A 1 33  ? 25.484  17.704  44.600  1.00 35.18 ? 33  GLN A CG  1 
ATOM   268  C CD  . GLN A 1 33  ? 26.412  18.889  45.204  1.00 35.43 ? 33  GLN A CD  1 
ATOM   269  O OE1 . GLN A 1 33  ? 26.078  19.864  45.810  1.00 35.29 ? 33  GLN A OE1 1 
ATOM   270  N NE2 . GLN A 1 33  ? 27.688  18.820  45.112  1.00 36.74 ? 33  GLN A NE2 1 
ATOM   271  N N   . LYS A 1 34  ? 26.019  16.736  39.636  1.00 26.44 ? 34  LYS A N   1 
ATOM   272  C CA  . LYS A 1 34  ? 26.062  17.327  38.244  1.00 25.20 ? 34  LYS A CA  1 
ATOM   273  C C   . LYS A 1 34  ? 24.727  17.936  37.735  1.00 24.35 ? 34  LYS A C   1 
ATOM   274  O O   . LYS A 1 34  ? 24.562  19.147  37.729  1.00 23.25 ? 34  LYS A O   1 
ATOM   275  C CB  . LYS A 1 34  ? 26.771  16.515  37.124  1.00 21.84 ? 34  LYS A CB  1 
ATOM   276  C CG  . LYS A 1 34  ? 28.228  16.131  37.505  1.00 25.96 ? 34  LYS A CG  1 
ATOM   277  C CD  . LYS A 1 34  ? 29.272  15.642  36.447  1.00 29.32 ? 34  LYS A CD  1 
ATOM   278  C CE  . LYS A 1 34  ? 29.396  16.411  35.052  1.00 33.35 ? 34  LYS A CE  1 
ATOM   279  N NZ  . LYS A 1 34  ? 30.456  17.458  35.006  1.00 32.29 ? 34  LYS A NZ  1 
ATOM   280  N N   . MET A 1 35  ? 23.792  16.995  37.379  1.00 21.75 ? 35  MET A N   1 
ATOM   281  C CA  . MET A 1 35  ? 22.396  17.064  36.832  1.00 18.80 ? 35  MET A CA  1 
ATOM   282  C C   . MET A 1 35  ? 21.170  16.956  37.875  1.00 17.68 ? 35  MET A C   1 
ATOM   283  O O   . MET A 1 35  ? 20.570  15.961  38.329  1.00 15.69 ? 35  MET A O   1 
ATOM   284  C CB  . MET A 1 35  ? 22.474  16.061  35.627  1.00 22.04 ? 35  MET A CB  1 
ATOM   285  C CG  . MET A 1 35  ? 21.386  16.047  34.539  1.00 24.79 ? 35  MET A CG  1 
ATOM   286  S SD  . MET A 1 35  ? 19.775  15.092  34.793  1.00 35.64 ? 35  MET A SD  1 
ATOM   287  C CE  . MET A 1 35  ? 20.020  13.460  34.007  1.00 24.24 ? 35  MET A CE  1 
ATOM   288  N N   . PRO A 1 36  ? 20.787  18.171  38.270  1.00 16.28 ? 36  PRO A N   1 
ATOM   289  C CA  . PRO A 1 36  ? 19.686  18.362  39.253  1.00 16.17 ? 36  PRO A CA  1 
ATOM   290  C C   . PRO A 1 36  ? 18.342  18.102  38.577  1.00 16.33 ? 36  PRO A C   1 
ATOM   291  O O   . PRO A 1 36  ? 18.103  18.599  37.490  1.00 16.06 ? 36  PRO A O   1 
ATOM   292  C CB  . PRO A 1 36  ? 19.668  19.854  39.580  1.00 18.20 ? 36  PRO A CB  1 
ATOM   293  C CG  . PRO A 1 36  ? 20.910  20.408  38.927  1.00 16.51 ? 36  PRO A CG  1 
ATOM   294  C CD  . PRO A 1 36  ? 21.349  19.399  37.806  1.00 16.89 ? 36  PRO A CD  1 
ATOM   295  N N   . LEU A 1 37  ? 17.436  17.306  39.203  1.00 15.17 ? 37  LEU A N   1 
ATOM   296  C CA  . LEU A 1 37  ? 16.091  17.305  38.537  1.00 12.53 ? 37  LEU A CA  1 
ATOM   297  C C   . LEU A 1 37  ? 15.131  18.522  38.650  1.00 10.14 ? 37  LEU A C   1 
ATOM   298  O O   . LEU A 1 37  ? 13.941  18.349  38.662  1.00 9.06  ? 37  LEU A O   1 
ATOM   299  C CB  . LEU A 1 37  ? 15.205  16.034  38.710  1.00 12.86 ? 37  LEU A CB  1 
ATOM   300  C CG  . LEU A 1 37  ? 14.916  15.718  40.203  1.00 14.23 ? 37  LEU A CG  1 
ATOM   301  C CD1 . LEU A 1 37  ? 15.487  16.731  41.234  1.00 12.19 ? 37  LEU A CD1 1 
ATOM   302  C CD2 . LEU A 1 37  ? 13.408  15.374  40.372  1.00 10.87 ? 37  LEU A CD2 1 
ATOM   303  N N   . GLY A 1 38  ? 15.709  19.696  38.619  1.00 11.10 ? 38  GLY A N   1 
ATOM   304  C CA  . GLY A 1 38  ? 15.251  20.702  37.700  1.00 16.77 ? 38  GLY A CA  1 
ATOM   305  C C   . GLY A 1 38  ? 15.761  20.516  36.263  1.00 19.75 ? 38  GLY A C   1 
ATOM   306  O O   . GLY A 1 38  ? 14.988  20.549  35.360  1.00 24.87 ? 38  GLY A O   1 
ATOM   307  N N   . LYS A 1 39  ? 17.022  20.194  36.017  1.00 17.42 ? 39  LYS A N   1 
ATOM   308  C CA  . LYS A 1 39  ? 17.255  19.611  34.631  1.00 15.02 ? 39  LYS A CA  1 
ATOM   309  C C   . LYS A 1 39  ? 16.219  18.855  33.769  1.00 13.77 ? 39  LYS A C   1 
ATOM   310  O O   . LYS A 1 39  ? 16.456  18.609  32.604  1.00 15.27 ? 39  LYS A O   1 
ATOM   311  C CB  . LYS A 1 39  ? 18.409  18.538  34.522  1.00 16.93 ? 39  LYS A CB  1 
ATOM   312  C CG  . LYS A 1 39  ? 19.357  18.713  33.292  1.00 23.44 ? 39  LYS A CG  1 
ATOM   313  C CD  . LYS A 1 39  ? 19.791  20.211  33.046  1.00 21.22 ? 39  LYS A CD  1 
ATOM   314  C CE  . LYS A 1 39  ? 20.484  20.344  31.687  1.00 18.84 ? 39  LYS A CE  1 
ATOM   315  N NZ  . LYS A 1 39  ? 20.156  21.660  31.170  1.00 13.70 ? 39  LYS A NZ  1 
ATOM   316  N N   . LEU A 1 40  ? 15.270  18.153  34.476  1.00 12.96 ? 40  LEU A N   1 
ATOM   317  C CA  . LEU A 1 40  ? 15.020  16.847  33.812  1.00 10.71 ? 40  LEU A CA  1 
ATOM   318  C C   . LEU A 1 40  ? 14.354  17.154  32.547  1.00 13.44 ? 40  LEU A C   1 
ATOM   319  O O   . LEU A 1 40  ? 13.321  17.752  32.742  1.00 11.76 ? 40  LEU A O   1 
ATOM   320  C CB  . LEU A 1 40  ? 14.003  15.884  34.420  1.00 7.51  ? 40  LEU A CB  1 
ATOM   321  C CG  . LEU A 1 40  ? 14.792  14.768  35.005  1.00 4.82  ? 40  LEU A CG  1 
ATOM   322  C CD1 . LEU A 1 40  ? 13.881  13.692  35.659  1.00 10.71 ? 40  LEU A CD1 1 
ATOM   323  C CD2 . LEU A 1 40  ? 15.770  14.215  34.001  1.00 5.17  ? 40  LEU A CD2 1 
ATOM   324  N N   . SER A 1 41  ? 14.839  16.779  31.349  1.00 12.46 ? 41  SER A N   1 
ATOM   325  C CA  . SER A 1 41  ? 13.896  17.489  30.430  1.00 14.28 ? 41  SER A CA  1 
ATOM   326  C C   . SER A 1 41  ? 13.507  16.567  29.394  1.00 13.92 ? 41  SER A C   1 
ATOM   327  O O   . SER A 1 41  ? 14.222  15.613  29.205  1.00 11.07 ? 41  SER A O   1 
ATOM   328  C CB  . SER A 1 41  ? 14.489  18.686  29.753  1.00 10.65 ? 41  SER A CB  1 
ATOM   329  O OG  . SER A 1 41  ? 15.858  18.241  29.587  1.00 19.00 ? 41  SER A OG  1 
ATOM   330  N N   . LYS A 1 42  ? 12.338  16.821  28.798  1.00 14.27 ? 42  LYS A N   1 
ATOM   331  C CA  . LYS A 1 42  ? 11.713  15.786  27.872  1.00 13.68 ? 42  LYS A CA  1 
ATOM   332  C C   . LYS A 1 42  ? 12.485  15.553  26.558  1.00 14.24 ? 42  LYS A C   1 
ATOM   333  O O   . LYS A 1 42  ? 13.064  14.539  26.219  1.00 17.04 ? 42  LYS A O   1 
ATOM   334  C CB  . LYS A 1 42  ? 10.215  16.004  27.541  1.00 8.09  ? 42  LYS A CB  1 
ATOM   335  C CG  . LYS A 1 42  ? 9.731   17.208  28.320  1.00 6.32  ? 42  LYS A CG  1 
ATOM   336  C CD  . LYS A 1 42  ? 8.424   17.835  27.849  1.00 7.38  ? 42  LYS A CD  1 
ATOM   337  C CE  . LYS A 1 42  ? 8.026   19.142  28.588  1.00 9.87  ? 42  LYS A CE  1 
ATOM   338  N NZ  . LYS A 1 42  ? 7.361   19.952  27.520  1.00 15.73 ? 42  LYS A NZ  1 
ATOM   339  N N   . ARG A 1 43  ? 12.660  16.703  25.954  1.00 14.39 ? 43  ARG A N   1 
ATOM   340  C CA  . ARG A 1 43  ? 13.996  17.149  25.574  1.00 16.78 ? 43  ARG A CA  1 
ATOM   341  C C   . ARG A 1 43  ? 15.315  16.336  25.937  1.00 20.42 ? 43  ARG A C   1 
ATOM   342  O O   . ARG A 1 43  ? 15.717  15.435  25.177  1.00 23.56 ? 43  ARG A O   1 
ATOM   343  C CB  . ARG A 1 43  ? 14.179  18.641  25.866  1.00 20.82 ? 43  ARG A CB  1 
ATOM   344  C CG  . ARG A 1 43  ? 13.014  19.640  26.098  1.00 22.91 ? 43  ARG A CG  1 
ATOM   345  C CD  . ARG A 1 43  ? 11.734  19.208  26.855  1.00 26.50 ? 43  ARG A CD  1 
ATOM   346  N NE  . ARG A 1 43  ? 11.285  19.992  27.937  1.00 29.08 ? 43  ARG A NE  1 
ATOM   347  C CZ  . ARG A 1 43  ? 11.000  21.307  27.847  1.00 31.59 ? 43  ARG A CZ  1 
ATOM   348  N NH1 . ARG A 1 43  ? 11.410  22.187  26.909  1.00 32.97 ? 43  ARG A NH1 1 
ATOM   349  N NH2 . ARG A 1 43  ? 10.262  21.820  28.798  1.00 28.26 ? 43  ARG A NH2 1 
ATOM   350  N N   . GLN A 1 44  ? 16.009  16.633  27.070  1.00 16.17 ? 44  GLN A N   1 
ATOM   351  C CA  . GLN A 1 44  ? 17.331  15.984  27.113  1.00 10.53 ? 44  GLN A CA  1 
ATOM   352  C C   . GLN A 1 44  ? 17.283  14.511  27.289  1.00 7.71  ? 44  GLN A C   1 
ATOM   353  O O   . GLN A 1 44  ? 18.148  13.738  26.893  1.00 9.17  ? 44  GLN A O   1 
ATOM   354  C CB  . GLN A 1 44  ? 18.350  16.727  28.024  1.00 9.84  ? 44  GLN A CB  1 
ATOM   355  C CG  . GLN A 1 44  ? 19.424  16.017  28.858  1.00 14.02 ? 44  GLN A CG  1 
ATOM   356  C CD  . GLN A 1 44  ? 18.868  15.647  30.246  1.00 13.70 ? 44  GLN A CD  1 
ATOM   357  O OE1 . GLN A 1 44  ? 17.726  15.777  30.669  1.00 16.54 ? 44  GLN A OE1 1 
ATOM   358  N NE2 . GLN A 1 44  ? 19.774  15.123  31.041  1.00 14.34 ? 44  GLN A NE2 1 
ATOM   359  N N   . ILE A 1 45  ? 16.141  14.089  27.847  1.00 9.27  ? 45  ILE A N   1 
ATOM   360  C CA  . ILE A 1 45  ? 15.891  12.640  27.831  1.00 9.88  ? 45  ILE A CA  1 
ATOM   361  C C   . ILE A 1 45  ? 15.639  12.042  26.413  1.00 14.59 ? 45  ILE A C   1 
ATOM   362  O O   . ILE A 1 45  ? 16.127  11.001  26.015  1.00 20.40 ? 45  ILE A O   1 
ATOM   363  C CB  . ILE A 1 45  ? 14.672  12.250  28.709  1.00 5.14  ? 45  ILE A CB  1 
ATOM   364  C CG1 . ILE A 1 45  ? 14.529  12.770  30.116  1.00 2.00  ? 45  ILE A CG1 1 
ATOM   365  C CG2 . ILE A 1 45  ? 14.550  10.733  28.655  1.00 10.08 ? 45  ILE A CG2 1 
ATOM   366  C CD1 . ILE A 1 45  ? 13.104  12.826  30.721  1.00 7.96  ? 45  ILE A CD1 1 
ATOM   367  N N   . GLN A 1 46  ? 14.806  12.704  25.616  1.00 14.76 ? 46  GLN A N   1 
ATOM   368  C CA  . GLN A 1 46  ? 14.543  12.170  24.286  1.00 11.93 ? 46  GLN A CA  1 
ATOM   369  C C   . GLN A 1 46  ? 15.812  12.031  23.435  1.00 10.83 ? 46  GLN A C   1 
ATOM   370  O O   . GLN A 1 46  ? 16.093  10.914  23.009  1.00 11.95 ? 46  GLN A O   1 
ATOM   371  C CB  . GLN A 1 46  ? 13.266  12.806  23.698  1.00 15.07 ? 46  GLN A CB  1 
ATOM   372  C CG  . GLN A 1 46  ? 13.362  14.135  22.933  1.00 11.23 ? 46  GLN A CG  1 
ATOM   373  C CD  . GLN A 1 46  ? 12.058  14.952  23.041  1.00 17.73 ? 46  GLN A CD  1 
ATOM   374  O OE1 . GLN A 1 46  ? 12.028  16.139  22.771  1.00 14.15 ? 46  GLN A OE1 1 
ATOM   375  N NE2 . GLN A 1 46  ? 11.007  14.375  23.530  1.00 19.24 ? 46  GLN A NE2 1 
ATOM   376  N N   . ALA A 1 47  ? 16.671  13.106  23.438  1.00 8.56  ? 47  ALA A N   1 
ATOM   377  C CA  . ALA A 1 47  ? 18.068  12.997  22.901  1.00 8.33  ? 47  ALA A CA  1 
ATOM   378  C C   . ALA A 1 47  ? 18.900  11.881  23.325  1.00 9.87  ? 47  ALA A C   1 
ATOM   379  O O   . ALA A 1 47  ? 19.599  11.272  22.550  1.00 16.46 ? 47  ALA A O   1 
ATOM   380  C CB  . ALA A 1 47  ? 19.105  14.049  23.282  1.00 10.38 ? 47  ALA A CB  1 
ATOM   381  N N   . ALA A 1 48  ? 18.820  11.560  24.628  1.00 10.08 ? 48  ALA A N   1 
ATOM   382  C CA  . ALA A 1 48  ? 19.488  10.325  25.088  1.00 7.99  ? 48  ALA A CA  1 
ATOM   383  C C   . ALA A 1 48  ? 19.013  9.013   24.539  1.00 9.15  ? 48  ALA A C   1 
ATOM   384  O O   . ALA A 1 48  ? 19.744  8.013   24.527  1.00 13.01 ? 48  ALA A O   1 
ATOM   385  C CB  . ALA A 1 48  ? 19.429  10.174  26.591  1.00 5.46  ? 48  ALA A CB  1 
ATOM   386  N N   . TYR A 1 49  ? 17.738  9.066   24.096  1.00 6.15  ? 49  TYR A N   1 
ATOM   387  C CA  . TYR A 1 49  ? 17.146  7.804   23.522  1.00 7.30  ? 49  TYR A CA  1 
ATOM   388  C C   . TYR A 1 49  ? 17.662  7.394   22.057  1.00 6.86  ? 49  TYR A C   1 
ATOM   389  O O   . TYR A 1 49  ? 18.003  6.285   21.596  1.00 5.66  ? 49  TYR A O   1 
ATOM   390  C CB  . TYR A 1 49  ? 15.579  7.906   23.662  1.00 5.72  ? 49  TYR A CB  1 
ATOM   391  C CG  . TYR A 1 49  ? 14.849  7.361   24.893  1.00 8.09  ? 49  TYR A CG  1 
ATOM   392  C CD1 . TYR A 1 49  ? 15.008  6.045   25.396  1.00 8.10  ? 49  TYR A CD1 1 
ATOM   393  C CD2 . TYR A 1 49  ? 13.929  8.266   25.422  1.00 9.21  ? 49  TYR A CD2 1 
ATOM   394  C CE1 . TYR A 1 49  ? 14.134  5.621   26.456  1.00 10.51 ? 49  TYR A CE1 1 
ATOM   395  C CE2 . TYR A 1 49  ? 13.058  7.851   26.458  1.00 12.90 ? 49  TYR A CE2 1 
ATOM   396  C CZ  . TYR A 1 49  ? 13.143  6.523   26.934  1.00 12.54 ? 49  TYR A CZ  1 
ATOM   397  O OH  . TYR A 1 49  ? 12.195  6.143   27.865  1.00 17.86 ? 49  TYR A OH  1 
ATOM   398  N N   . SER A 1 50  ? 17.842  8.566   21.439  1.00 2.00  ? 50  SER A N   1 
ATOM   399  C CA  . SER A 1 50  ? 18.581  8.546   20.176  1.00 6.93  ? 50  SER A CA  1 
ATOM   400  C C   . SER A 1 50  ? 20.037  8.255   20.191  1.00 7.17  ? 50  SER A C   1 
ATOM   401  O O   . SER A 1 50  ? 20.508  7.440   19.421  1.00 4.12  ? 50  SER A O   1 
ATOM   402  C CB  . SER A 1 50  ? 18.370  9.749   19.221  1.00 8.29  ? 50  SER A CB  1 
ATOM   403  O OG  . SER A 1 50  ? 17.377  10.581  19.790  1.00 15.90 ? 50  SER A OG  1 
ATOM   404  N N   . ILE A 1 51  ? 20.771  8.831   21.144  1.00 10.12 ? 51  ILE A N   1 
ATOM   405  C CA  . ILE A 1 51  ? 22.062  8.132   21.293  1.00 12.66 ? 51  ILE A CA  1 
ATOM   406  C C   . ILE A 1 51  ? 22.023  6.622   21.702  1.00 16.49 ? 51  ILE A C   1 
ATOM   407  O O   . ILE A 1 51  ? 22.560  5.839   20.921  1.00 20.84 ? 51  ILE A O   1 
ATOM   408  C CB  . ILE A 1 51  ? 23.042  8.839   22.156  1.00 9.22  ? 51  ILE A CB  1 
ATOM   409  C CG1 . ILE A 1 51  ? 22.745  10.271  21.980  1.00 8.30  ? 51  ILE A CG1 1 
ATOM   410  C CG2 . ILE A 1 51  ? 24.452  8.462   21.767  1.00 6.04  ? 51  ILE A CG2 1 
ATOM   411  C CD1 . ILE A 1 51  ? 23.578  10.928  23.071  1.00 9.59  ? 51  ILE A CD1 1 
ATOM   412  N N   . LEU A 1 52  ? 21.353  6.171   22.815  1.00 16.51 ? 52  LEU A N   1 
ATOM   413  C CA  . LEU A 1 52  ? 21.312  4.685   22.860  1.00 13.58 ? 52  LEU A CA  1 
ATOM   414  C C   . LEU A 1 52  ? 20.823  3.894   21.572  1.00 11.42 ? 52  LEU A C   1 
ATOM   415  O O   . LEU A 1 52  ? 21.291  2.827   21.196  1.00 6.42  ? 52  LEU A O   1 
ATOM   416  C CB  . LEU A 1 52  ? 20.456  4.229   24.019  1.00 10.47 ? 52  LEU A CB  1 
ATOM   417  C CG  . LEU A 1 52  ? 20.873  4.825   25.298  1.00 8.78  ? 52  LEU A CG  1 
ATOM   418  C CD1 . LEU A 1 52  ? 19.767  4.647   26.294  1.00 13.80 ? 52  LEU A CD1 1 
ATOM   419  C CD2 . LEU A 1 52  ? 22.207  4.238   25.744  1.00 14.83 ? 52  LEU A CD2 1 
ATOM   420  N N   . SER A 1 53  ? 19.881  4.526   20.840  1.00 10.40 ? 53  SER A N   1 
ATOM   421  C CA  . SER A 1 53  ? 19.635  3.928   19.524  1.00 11.11 ? 53  SER A CA  1 
ATOM   422  C C   . SER A 1 53  ? 20.724  3.992   18.425  1.00 11.43 ? 53  SER A C   1 
ATOM   423  O O   . SER A 1 53  ? 21.075  2.972   17.822  1.00 10.24 ? 53  SER A O   1 
ATOM   424  C CB  . SER A 1 53  ? 18.322  4.395   19.033  1.00 7.95  ? 53  SER A CB  1 
ATOM   425  O OG  . SER A 1 53  ? 18.013  3.634   17.901  1.00 12.33 ? 53  SER A OG  1 
ATOM   426  N N   . GLU A 1 54  ? 21.380  5.210   18.348  1.00 8.41  ? 54  GLU A N   1 
ATOM   427  C CA  . GLU A 1 54  ? 22.717  5.331   17.718  1.00 9.47  ? 54  GLU A CA  1 
ATOM   428  C C   . GLU A 1 54  ? 23.604  4.091   18.022  1.00 7.72  ? 54  GLU A C   1 
ATOM   429  O O   . GLU A 1 54  ? 23.937  3.338   17.123  1.00 10.67 ? 54  GLU A O   1 
ATOM   430  C CB  . GLU A 1 54  ? 23.461  6.711   17.912  1.00 14.17 ? 54  GLU A CB  1 
ATOM   431  C CG  . GLU A 1 54  ? 23.053  8.038   17.200  1.00 21.41 ? 54  GLU A CG  1 
ATOM   432  C CD  . GLU A 1 54  ? 23.103  9.385   18.021  1.00 26.19 ? 54  GLU A CD  1 
ATOM   433  O OE1 . GLU A 1 54  ? 22.066  9.968   18.297  1.00 25.46 ? 54  GLU A OE1 1 
ATOM   434  O OE2 . GLU A 1 54  ? 24.164  9.932   18.357  1.00 31.65 ? 54  GLU A OE2 1 
ATOM   435  N N   . VAL A 1 55  ? 23.925  3.817   19.266  1.00 5.98  ? 55  VAL A N   1 
ATOM   436  C CA  . VAL A 1 55  ? 24.811  2.734   19.550  1.00 6.74  ? 55  VAL A CA  1 
ATOM   437  C C   . VAL A 1 55  ? 24.270  1.389   19.076  1.00 11.16 ? 55  VAL A C   1 
ATOM   438  O O   . VAL A 1 55  ? 25.001  0.405   18.856  1.00 14.70 ? 55  VAL A O   1 
ATOM   439  C CB  . VAL A 1 55  ? 25.151  2.783   21.046  1.00 6.97  ? 55  VAL A CB  1 
ATOM   440  C CG1 . VAL A 1 55  ? 24.891  1.547   21.934  1.00 7.05  ? 55  VAL A CG1 1 
ATOM   441  C CG2 . VAL A 1 55  ? 26.592  3.239   21.183  1.00 10.39 ? 55  VAL A CG2 1 
ATOM   442  N N   . GLN A 1 56  ? 22.924  1.374   18.893  1.00 14.83 ? 56  GLN A N   1 
ATOM   443  C CA  . GLN A 1 56  ? 22.484  -0.015  18.622  1.00 18.07 ? 56  GLN A CA  1 
ATOM   444  C C   . GLN A 1 56  ? 22.687  -0.426  17.247  1.00 20.76 ? 56  GLN A C   1 
ATOM   445  O O   . GLN A 1 56  ? 23.240  -1.519  17.103  1.00 26.50 ? 56  GLN A O   1 
ATOM   446  C CB  . GLN A 1 56  ? 21.155  -0.646  19.074  1.00 18.96 ? 56  GLN A CB  1 
ATOM   447  C CG  . GLN A 1 56  ? 21.529  -1.952  19.808  1.00 22.33 ? 56  GLN A CG  1 
ATOM   448  C CD  . GLN A 1 56  ? 20.556  -2.274  20.949  1.00 27.33 ? 56  GLN A CD  1 
ATOM   449  O OE1 . GLN A 1 56  ? 19.549  -1.657  21.253  1.00 33.30 ? 56  GLN A OE1 1 
ATOM   450  N NE2 . GLN A 1 56  ? 20.899  -3.331  21.678  1.00 28.64 ? 56  GLN A NE2 1 
ATOM   451  N N   . GLN A 1 57  ? 22.383  0.534   16.280  1.00 22.64 ? 57  GLN A N   1 
ATOM   452  C CA  . GLN A 1 57  ? 22.608  0.210   14.827  1.00 16.59 ? 57  GLN A CA  1 
ATOM   453  C C   . GLN A 1 57  ? 23.957  -0.307  14.889  1.00 12.85 ? 57  GLN A C   1 
ATOM   454  O O   . GLN A 1 57  ? 24.176  -1.493  14.870  1.00 10.10 ? 57  GLN A O   1 
ATOM   455  C CB  . GLN A 1 57  ? 22.401  1.362   13.778  1.00 18.15 ? 57  GLN A CB  1 
ATOM   456  C CG  . GLN A 1 57  ? 22.784  1.349   12.217  1.00 26.73 ? 57  GLN A CG  1 
ATOM   457  C CD  . GLN A 1 57  ? 23.471  0.113   11.396  1.00 31.80 ? 57  GLN A CD  1 
ATOM   458  O OE1 . GLN A 1 57  ? 24.673  0.058   11.263  1.00 31.13 ? 57  GLN A OE1 1 
ATOM   459  N NE2 . GLN A 1 57  ? 22.738  -0.850  10.780  1.00 26.62 ? 57  GLN A NE2 1 
ATOM   460  N N   . ALA A 1 58  ? 24.813  0.639   15.280  1.00 9.08  ? 58  ALA A N   1 
ATOM   461  C CA  . ALA A 1 58  ? 26.237  0.308   15.144  1.00 10.90 ? 58  ALA A CA  1 
ATOM   462  C C   . ALA A 1 58  ? 26.747  -0.962  15.815  1.00 13.08 ? 58  ALA A C   1 
ATOM   463  O O   . ALA A 1 58  ? 27.644  -1.686  15.371  1.00 10.29 ? 58  ALA A O   1 
ATOM   464  C CB  . ALA A 1 58  ? 27.067  1.498   15.572  1.00 5.23  ? 58  ALA A CB  1 
ATOM   465  N N   . VAL A 1 59  ? 26.079  -1.257  16.926  1.00 16.07 ? 59  VAL A N   1 
ATOM   466  C CA  . VAL A 1 59  ? 26.702  -2.503  17.438  1.00 20.21 ? 59  VAL A CA  1 
ATOM   467  C C   . VAL A 1 59  ? 26.362  -3.766  16.637  1.00 22.78 ? 59  VAL A C   1 
ATOM   468  O O   . VAL A 1 59  ? 27.279  -4.373  16.124  1.00 22.13 ? 59  VAL A O   1 
ATOM   469  C CB  . VAL A 1 59  ? 26.875  -2.678  18.999  1.00 20.85 ? 59  VAL A CB  1 
ATOM   470  C CG1 . VAL A 1 59  ? 27.775  -3.901  19.204  1.00 19.77 ? 59  VAL A CG1 1 
ATOM   471  C CG2 . VAL A 1 59  ? 27.357  -1.354  19.695  1.00 22.16 ? 59  VAL A CG2 1 
ATOM   472  N N   . SER A 1 60  ? 25.046  -3.896  16.409  1.00 24.29 ? 60  SER A N   1 
ATOM   473  C CA  . SER A 1 60  ? 24.643  -4.972  15.457  1.00 26.24 ? 60  SER A CA  1 
ATOM   474  C C   . SER A 1 60  ? 25.134  -4.793  13.991  1.00 29.40 ? 60  SER A C   1 
ATOM   475  O O   . SER A 1 60  ? 25.558  -5.673  13.249  1.00 37.93 ? 60  SER A O   1 
ATOM   476  C CB  . SER A 1 60  ? 23.236  -5.541  15.741  1.00 25.19 ? 60  SER A CB  1 
ATOM   477  O OG  . SER A 1 60  ? 23.007  -5.708  17.200  1.00 30.16 ? 60  SER A OG  1 
ATOM   478  N N   . GLN A 1 61  ? 25.411  -3.529  13.662  1.00 30.75 ? 61  GLN A N   1 
ATOM   479  C CA  . GLN A 1 61  ? 26.283  -3.409  12.480  1.00 28.54 ? 61  GLN A CA  1 
ATOM   480  C C   . GLN A 1 61  ? 27.743  -3.027  12.530  1.00 26.78 ? 61  GLN A C   1 
ATOM   481  O O   . GLN A 1 61  ? 28.088  -1.904  12.233  1.00 23.79 ? 61  GLN A O   1 
ATOM   482  C CB  . GLN A 1 61  ? 25.636  -2.583  11.374  1.00 31.27 ? 61  GLN A CB  1 
ATOM   483  C CG  . GLN A 1 61  ? 25.310  -3.564  10.228  1.00 39.84 ? 61  GLN A CG  1 
ATOM   484  C CD  . GLN A 1 61  ? 23.966  -4.267  10.437  1.00 40.45 ? 61  GLN A CD  1 
ATOM   485  O OE1 . GLN A 1 61  ? 22.975  -3.570  10.208  1.00 45.70 ? 61  GLN A OE1 1 
ATOM   486  N NE2 . GLN A 1 61  ? 23.941  -5.586  10.748  1.00 40.24 ? 61  GLN A NE2 1 
ATOM   487  N N   . GLY A 1 62  ? 28.612  -4.014  12.902  1.00 25.70 ? 62  GLY A N   1 
ATOM   488  C CA  . GLY A 1 62  ? 30.080  -3.721  13.089  1.00 26.43 ? 62  GLY A CA  1 
ATOM   489  C C   . GLY A 1 62  ? 30.554  -2.366  13.765  1.00 26.31 ? 62  GLY A C   1 
ATOM   490  O O   . GLY A 1 62  ? 30.573  -2.201  14.995  1.00 23.57 ? 62  GLY A O   1 
ATOM   491  N N   . SER A 1 63  ? 30.697  -1.328  12.822  1.00 30.21 ? 63  SER A N   1 
ATOM   492  C CA  . SER A 1 63  ? 30.960  0.108   13.181  1.00 29.53 ? 63  SER A CA  1 
ATOM   493  C C   . SER A 1 63  ? 32.413  0.470   13.402  1.00 28.34 ? 63  SER A C   1 
ATOM   494  O O   . SER A 1 63  ? 33.199  -0.254  13.968  1.00 29.90 ? 63  SER A O   1 
ATOM   495  C CB  . SER A 1 63  ? 30.216  0.642   14.464  1.00 28.18 ? 63  SER A CB  1 
ATOM   496  O OG  . SER A 1 63  ? 30.284  2.088   14.706  1.00 30.96 ? 63  SER A OG  1 
ATOM   497  N N   . SER A 1 64  ? 32.766  1.695   13.006  1.00 27.53 ? 64  SER A N   1 
ATOM   498  C CA  . SER A 1 64  ? 33.984  2.212   13.676  1.00 24.89 ? 64  SER A CA  1 
ATOM   499  C C   . SER A 1 64  ? 34.083  1.907   15.202  1.00 24.17 ? 64  SER A C   1 
ATOM   500  O O   . SER A 1 64  ? 33.153  2.302   15.935  1.00 26.43 ? 64  SER A O   1 
ATOM   501  C CB  . SER A 1 64  ? 33.830  3.729   13.447  1.00 27.93 ? 64  SER A CB  1 
ATOM   502  O OG  . SER A 1 64  ? 34.940  4.513   13.879  1.00 30.64 ? 64  SER A OG  1 
ATOM   503  N N   . ASP A 1 65  ? 35.143  1.280   15.719  1.00 20.69 ? 65  ASP A N   1 
ATOM   504  C CA  . ASP A 1 65  ? 35.168  1.313   17.243  1.00 19.35 ? 65  ASP A CA  1 
ATOM   505  C C   . ASP A 1 65  ? 35.536  2.734   17.834  1.00 20.46 ? 65  ASP A C   1 
ATOM   506  O O   . ASP A 1 65  ? 34.902  3.244   18.746  1.00 21.42 ? 65  ASP A O   1 
ATOM   507  C CB  . ASP A 1 65  ? 36.061  0.269   17.862  1.00 18.24 ? 65  ASP A CB  1 
ATOM   508  C CG  . ASP A 1 65  ? 35.646  -1.097  17.362  1.00 18.25 ? 65  ASP A CG  1 
ATOM   509  O OD1 . ASP A 1 65  ? 35.322  -1.166  16.129  1.00 17.21 ? 65  ASP A OD1 1 
ATOM   510  O OD2 . ASP A 1 65  ? 35.678  -2.113  18.184  1.00 13.70 ? 65  ASP A OD2 1 
ATOM   511  N N   . SER A 1 66  ? 36.420  3.462   17.098  1.00 24.05 ? 66  SER A N   1 
ATOM   512  C CA  . SER A 1 66  ? 36.241  4.945   17.043  1.00 23.85 ? 66  SER A CA  1 
ATOM   513  C C   . SER A 1 66  ? 34.847  5.656   16.790  1.00 22.28 ? 66  SER A C   1 
ATOM   514  O O   . SER A 1 66  ? 34.775  6.864   16.461  1.00 22.27 ? 66  SER A O   1 
ATOM   515  C CB  . SER A 1 66  ? 37.105  5.685   15.951  1.00 27.15 ? 66  SER A CB  1 
ATOM   516  O OG  . SER A 1 66  ? 38.458  5.235   15.656  1.00 27.67 ? 66  SER A OG  1 
ATOM   517  N N   . GLN A 1 67  ? 33.744  4.870   16.895  1.00 21.83 ? 67  GLN A N   1 
ATOM   518  C CA  . GLN A 1 67  ? 32.431  5.519   16.978  1.00 22.97 ? 67  GLN A CA  1 
ATOM   519  C C   . GLN A 1 67  ? 31.855  5.189   18.344  1.00 24.37 ? 67  GLN A C   1 
ATOM   520  O O   . GLN A 1 67  ? 31.335  5.959   19.156  1.00 24.13 ? 67  GLN A O   1 
ATOM   521  C CB  . GLN A 1 67  ? 31.469  4.946   15.849  1.00 26.56 ? 67  GLN A CB  1 
ATOM   522  C CG  . GLN A 1 67  ? 30.197  5.665   15.419  1.00 23.47 ? 67  GLN A CG  1 
ATOM   523  C CD  . GLN A 1 67  ? 30.666  7.072   15.121  1.00 26.96 ? 67  GLN A CD  1 
ATOM   524  O OE1 . GLN A 1 67  ? 31.681  7.285   14.491  1.00 32.92 ? 67  GLN A OE1 1 
ATOM   525  N NE2 . GLN A 1 67  ? 29.946  8.080   15.592  1.00 26.64 ? 67  GLN A NE2 1 
ATOM   526  N N   . ILE A 1 68  ? 31.909  3.858   18.525  1.00 22.39 ? 68  ILE A N   1 
ATOM   527  C CA  . ILE A 1 68  ? 31.323  3.373   19.771  1.00 21.19 ? 68  ILE A CA  1 
ATOM   528  C C   . ILE A 1 68  ? 31.673  3.983   21.080  1.00 21.05 ? 68  ILE A C   1 
ATOM   529  O O   . ILE A 1 68  ? 30.826  4.568   21.710  1.00 22.53 ? 68  ILE A O   1 
ATOM   530  C CB  . ILE A 1 68  ? 31.427  1.892   19.751  1.00 20.32 ? 68  ILE A CB  1 
ATOM   531  C CG1 . ILE A 1 68  ? 30.347  1.632   18.645  1.00 21.90 ? 68  ILE A CG1 1 
ATOM   532  C CG2 . ILE A 1 68  ? 31.080  1.335   21.140  1.00 21.32 ? 68  ILE A CG2 1 
ATOM   533  C CD1 . ILE A 1 68  ? 29.022  2.389   18.834  1.00 27.32 ? 68  ILE A CD1 1 
ATOM   534  N N   . LEU A 1 69  ? 32.932  3.914   21.394  1.00 22.97 ? 69  LEU A N   1 
ATOM   535  C CA  . LEU A 1 69  ? 33.425  4.805   22.440  1.00 19.67 ? 69  LEU A CA  1 
ATOM   536  C C   . LEU A 1 69  ? 33.016  6.295   22.425  1.00 16.60 ? 69  LEU A C   1 
ATOM   537  O O   . LEU A 1 69  ? 32.584  6.781   23.465  1.00 12.66 ? 69  LEU A O   1 
ATOM   538  C CB  . LEU A 1 69  ? 34.870  4.455   22.831  1.00 17.23 ? 69  LEU A CB  1 
ATOM   539  C CG  . LEU A 1 69  ? 35.819  3.568   22.044  1.00 19.32 ? 69  LEU A CG  1 
ATOM   540  C CD1 . LEU A 1 69  ? 37.252  4.078   22.370  1.00 19.81 ? 69  LEU A CD1 1 
ATOM   541  C CD2 . LEU A 1 69  ? 35.535  2.042   22.190  1.00 19.96 ? 69  LEU A CD2 1 
ATOM   542  N N   . ASP A 1 70  ? 32.841  6.905   21.263  1.00 14.72 ? 70  ASP A N   1 
ATOM   543  C CA  . ASP A 1 70  ? 32.281  8.182   21.639  1.00 18.09 ? 70  ASP A CA  1 
ATOM   544  C C   . ASP A 1 70  ? 30.803  8.195   21.721  1.00 17.44 ? 70  ASP A C   1 
ATOM   545  O O   . ASP A 1 70  ? 30.141  9.199   21.948  1.00 21.85 ? 70  ASP A O   1 
ATOM   546  C CB  . ASP A 1 70  ? 32.550  9.318   20.697  1.00 22.53 ? 70  ASP A CB  1 
ATOM   547  C CG  . ASP A 1 70  ? 34.026  9.563   20.544  1.00 30.76 ? 70  ASP A CG  1 
ATOM   548  O OD1 . ASP A 1 70  ? 34.740  9.912   21.540  1.00 33.19 ? 70  ASP A OD1 1 
ATOM   549  O OD2 . ASP A 1 70  ? 34.421  9.384   19.386  1.00 31.86 ? 70  ASP A OD2 1 
ATOM   550  N N   . LEU A 1 71  ? 30.168  7.077   21.482  1.00 16.24 ? 71  LEU A N   1 
ATOM   551  C CA  . LEU A 1 71  ? 28.730  7.357   21.645  1.00 14.31 ? 71  LEU A CA  1 
ATOM   552  C C   . LEU A 1 71  ? 28.203  7.149   23.017  1.00 14.28 ? 71  LEU A C   1 
ATOM   553  O O   . LEU A 1 71  ? 27.328  7.857   23.498  1.00 16.56 ? 71  LEU A O   1 
ATOM   554  C CB  . LEU A 1 71  ? 27.820  6.558   20.767  1.00 13.99 ? 71  LEU A CB  1 
ATOM   555  C CG  . LEU A 1 71  ? 27.664  6.805   19.298  1.00 9.11  ? 71  LEU A CG  1 
ATOM   556  C CD1 . LEU A 1 71  ? 27.366  5.424   18.716  1.00 2.00  ? 71  LEU A CD1 1 
ATOM   557  C CD2 . LEU A 1 71  ? 26.537  7.806   19.080  1.00 6.52  ? 71  LEU A CD2 1 
ATOM   558  N N   . SER A 1 72  ? 28.925  6.212   23.625  1.00 16.09 ? 72  SER A N   1 
ATOM   559  C CA  . SER A 1 72  ? 29.151  6.219   25.069  1.00 18.30 ? 72  SER A CA  1 
ATOM   560  C C   . SER A 1 72  ? 29.558  7.580   25.639  1.00 18.55 ? 72  SER A C   1 
ATOM   561  O O   . SER A 1 72  ? 28.784  8.275   26.269  1.00 18.67 ? 72  SER A O   1 
ATOM   562  C CB  . SER A 1 72  ? 30.159  5.144   25.481  1.00 20.09 ? 72  SER A CB  1 
ATOM   563  O OG  . SER A 1 72  ? 29.899  3.856   24.864  1.00 24.12 ? 72  SER A OG  1 
ATOM   564  N N   . ASN A 1 73  ? 30.732  8.020   25.308  1.00 19.10 ? 73  ASN A N   1 
ATOM   565  C CA  . ASN A 1 73  ? 30.989  9.405   25.692  1.00 20.82 ? 73  ASN A CA  1 
ATOM   566  C C   . ASN A 1 73  ? 29.949  10.470  25.337  1.00 22.43 ? 73  ASN A C   1 
ATOM   567  O O   . ASN A 1 73  ? 29.641  11.365  26.107  1.00 21.94 ? 73  ASN A O   1 
ATOM   568  C CB  . ASN A 1 73  ? 32.471  9.802   25.448  1.00 23.15 ? 73  ASN A CB  1 
ATOM   569  C CG  . ASN A 1 73  ? 33.275  9.165   26.581  1.00 25.12 ? 73  ASN A CG  1 
ATOM   570  O OD1 . ASN A 1 73  ? 32.971  9.526   27.715  1.00 34.26 ? 73  ASN A OD1 1 
ATOM   571  N ND2 . ASN A 1 73  ? 34.196  8.206   26.304  1.00 23.01 ? 73  ASN A ND2 1 
ATOM   572  N N   . ARG A 1 74  ? 29.288  10.283  24.234  1.00 21.13 ? 74  ARG A N   1 
ATOM   573  C CA  . ARG A 1 74  ? 28.094  11.144  24.118  1.00 21.03 ? 74  ARG A CA  1 
ATOM   574  C C   . ARG A 1 74  ? 26.938  10.938  25.128  1.00 18.77 ? 74  ARG A C   1 
ATOM   575  O O   . ARG A 1 74  ? 26.287  11.826  25.699  1.00 16.85 ? 74  ARG A O   1 
ATOM   576  C CB  . ARG A 1 74  ? 27.515  11.079  22.747  1.00 22.58 ? 74  ARG A CB  1 
ATOM   577  C CG  . ARG A 1 74  ? 27.222  12.562  22.538  1.00 23.45 ? 74  ARG A CG  1 
ATOM   578  C CD  . ARG A 1 74  ? 27.060  12.836  20.999  1.00 26.21 ? 74  ARG A CD  1 
ATOM   579  N NE  . ARG A 1 74  ? 27.876  11.959  20.104  1.00 33.59 ? 74  ARG A NE  1 
ATOM   580  C CZ  . ARG A 1 74  ? 29.194  12.027  19.666  1.00 32.72 ? 74  ARG A CZ  1 
ATOM   581  N NH1 . ARG A 1 74  ? 30.089  13.016  19.824  1.00 30.47 ? 74  ARG A NH1 1 
ATOM   582  N NH2 . ARG A 1 74  ? 29.614  10.975  18.970  1.00 34.92 ? 74  ARG A NH2 1 
ATOM   583  N N   . PHE A 1 75  ? 26.733  9.606   25.401  1.00 14.80 ? 75  PHE A N   1 
ATOM   584  C CA  . PHE A 1 75  ? 25.656  9.220   26.301  1.00 11.27 ? 75  PHE A CA  1 
ATOM   585  C C   . PHE A 1 75  ? 25.855  9.804   27.678  1.00 12.68 ? 75  PHE A C   1 
ATOM   586  O O   . PHE A 1 75  ? 24.962  10.252  28.419  1.00 15.60 ? 75  PHE A O   1 
ATOM   587  C CB  . PHE A 1 75  ? 25.507  7.703   26.425  1.00 10.10 ? 75  PHE A CB  1 
ATOM   588  C CG  . PHE A 1 75  ? 24.371  7.318   27.401  1.00 5.17  ? 75  PHE A CG  1 
ATOM   589  C CD1 . PHE A 1 75  ? 23.050  7.364   26.957  1.00 2.41  ? 75  PHE A CD1 1 
ATOM   590  C CD2 . PHE A 1 75  ? 24.647  6.941   28.746  1.00 6.11  ? 75  PHE A CD2 1 
ATOM   591  C CE1 . PHE A 1 75  ? 22.025  6.945   27.812  1.00 2.15  ? 75  PHE A CE1 1 
ATOM   592  C CE2 . PHE A 1 75  ? 23.609  6.584   29.621  1.00 2.00  ? 75  PHE A CE2 1 
ATOM   593  C CZ  . PHE A 1 75  ? 22.319  6.542   29.141  1.00 2.00  ? 75  PHE A CZ  1 
ATOM   594  N N   . TYR A 1 76  ? 27.162  9.810   27.979  1.00 8.99  ? 76  TYR A N   1 
ATOM   595  C CA  . TYR A 1 76  ? 27.462  10.454  29.238  1.00 7.01  ? 76  TYR A CA  1 
ATOM   596  C C   . TYR A 1 76  ? 27.176  11.936  29.217  1.00 9.33  ? 76  TYR A C   1 
ATOM   597  O O   . TYR A 1 76  ? 26.118  12.253  29.732  1.00 10.97 ? 76  TYR A O   1 
ATOM   598  C CB  . TYR A 1 76  ? 28.714  9.882   29.728  1.00 3.11  ? 76  TYR A CB  1 
ATOM   599  C CG  . TYR A 1 76  ? 28.245  8.447   29.964  1.00 2.00  ? 76  TYR A CG  1 
ATOM   600  C CD1 . TYR A 1 76  ? 27.204  8.194   30.892  1.00 2.57  ? 76  TYR A CD1 1 
ATOM   601  C CD2 . TYR A 1 76  ? 28.821  7.347   29.258  1.00 2.00  ? 76  TYR A CD2 1 
ATOM   602  C CE1 . TYR A 1 76  ? 26.935  6.870   31.303  1.00 3.11  ? 76  TYR A CE1 1 
ATOM   603  C CE2 . TYR A 1 76  ? 28.508  6.026   29.616  1.00 2.00  ? 76  TYR A CE2 1 
ATOM   604  C CZ  . TYR A 1 76  ? 27.669  5.815   30.726  1.00 6.35  ? 76  TYR A CZ  1 
ATOM   605  O OH  . TYR A 1 76  ? 27.630  4.541   31.307  1.00 8.58  ? 76  TYR A OH  1 
ATOM   606  N N   . THR A 1 77  ? 27.996  12.776  28.594  1.00 7.42  ? 77  THR A N   1 
ATOM   607  C CA  . THR A 1 77  ? 27.731  14.227  28.724  1.00 8.50  ? 77  THR A CA  1 
ATOM   608  C C   . THR A 1 77  ? 26.258  14.691  29.041  1.00 7.27  ? 77  THR A C   1 
ATOM   609  O O   . THR A 1 77  ? 25.883  15.380  29.986  1.00 6.25  ? 77  THR A O   1 
ATOM   610  C CB  . THR A 1 77  ? 28.294  14.749  27.368  1.00 13.43 ? 77  THR A CB  1 
ATOM   611  O OG1 . THR A 1 77  ? 29.720  14.445  27.316  1.00 14.03 ? 77  THR A OG1 1 
ATOM   612  C CG2 . THR A 1 77  ? 27.863  16.166  26.781  1.00 14.52 ? 77  THR A CG2 1 
ATOM   613  N N   . LEU A 1 78  ? 25.430  14.126  28.173  1.00 7.27  ? 78  LEU A N   1 
ATOM   614  C CA  . LEU A 1 78  ? 24.046  14.536  28.147  1.00 8.95  ? 78  LEU A CA  1 
ATOM   615  C C   . LEU A 1 78  ? 23.247  14.031  29.311  1.00 12.14 ? 78  LEU A C   1 
ATOM   616  O O   . LEU A 1 78  ? 22.409  14.774  29.835  1.00 13.76 ? 78  LEU A O   1 
ATOM   617  C CB  . LEU A 1 78  ? 23.506  13.857  26.946  1.00 12.57 ? 78  LEU A CB  1 
ATOM   618  C CG  . LEU A 1 78  ? 22.089  14.203  26.556  1.00 13.17 ? 78  LEU A CG  1 
ATOM   619  C CD1 . LEU A 1 78  ? 21.966  15.622  25.948  1.00 13.35 ? 78  LEU A CD1 1 
ATOM   620  C CD2 . LEU A 1 78  ? 21.718  13.117  25.561  1.00 15.72 ? 78  LEU A CD2 1 
ATOM   621  N N   . ILE A 1 79  ? 23.547  12.700  29.708  1.00 11.15 ? 79  ILE A N   1 
ATOM   622  C CA  . ILE A 1 79  ? 23.144  12.182  31.015  1.00 8.75  ? 79  ILE A CA  1 
ATOM   623  C C   . ILE A 1 79  ? 24.187  11.805  32.024  1.00 11.26 ? 79  ILE A C   1 
ATOM   624  O O   . ILE A 1 79  ? 24.446  10.650  32.380  1.00 6.20  ? 79  ILE A O   1 
ATOM   625  C CB  . ILE A 1 79  ? 22.290  10.980  30.860  1.00 9.56  ? 79  ILE A CB  1 
ATOM   626  C CG1 . ILE A 1 79  ? 21.422  10.940  29.616  1.00 12.36 ? 79  ILE A CG1 1 
ATOM   627  C CG2 . ILE A 1 79  ? 21.441  10.826  32.116  1.00 9.23  ? 79  ILE A CG2 1 
ATOM   628  C CD1 . ILE A 1 79  ? 20.031  11.519  29.864  1.00 11.57 ? 79  ILE A CD1 1 
ATOM   629  N N   . PRO A 1 80  ? 24.691  12.869  32.694  1.00 15.21 ? 80  PRO A N   1 
ATOM   630  C CA  . PRO A 1 80  ? 25.790  12.779  33.732  1.00 12.96 ? 80  PRO A CA  1 
ATOM   631  C C   . PRO A 1 80  ? 25.641  11.740  34.851  1.00 13.34 ? 80  PRO A C   1 
ATOM   632  O O   . PRO A 1 80  ? 24.858  11.906  35.793  1.00 12.79 ? 80  PRO A O   1 
ATOM   633  C CB  . PRO A 1 80  ? 25.836  14.150  34.398  1.00 12.67 ? 80  PRO A CB  1 
ATOM   634  C CG  . PRO A 1 80  ? 25.181  14.992  33.329  1.00 17.75 ? 80  PRO A CG  1 
ATOM   635  C CD  . PRO A 1 80  ? 24.060  14.178  32.685  1.00 18.60 ? 80  PRO A CD  1 
ATOM   636  N N   . HIS A 1 81  ? 26.479  10.708  34.685  1.00 12.33 ? 81  HIS A N   1 
ATOM   637  C CA  . HIS A 1 81  ? 26.756  9.719   35.796  1.00 9.58  ? 81  HIS A CA  1 
ATOM   638  C C   . HIS A 1 81  ? 27.675  10.122  37.141  1.00 8.88  ? 81  HIS A C   1 
ATOM   639  O O   . HIS A 1 81  ? 28.781  10.638  37.067  1.00 6.85  ? 81  HIS A O   1 
ATOM   640  C CB  . HIS A 1 81  ? 27.123  8.341   35.076  1.00 8.40  ? 81  HIS A CB  1 
ATOM   641  C CG  . HIS A 1 81  ? 25.901  7.746   34.372  1.00 2.00  ? 81  HIS A CG  1 
ATOM   642  N ND1 . HIS A 1 81  ? 24.872  8.456   33.871  1.00 2.00  ? 81  HIS A ND1 1 
ATOM   643  C CD2 . HIS A 1 81  ? 25.561  6.388   34.377  1.00 2.00  ? 81  HIS A CD2 1 
ATOM   644  C CE1 . HIS A 1 81  ? 23.892  7.585   33.605  1.00 2.00  ? 81  HIS A CE1 1 
ATOM   645  N NE2 . HIS A 1 81  ? 24.328  6.306   33.930  1.00 2.00  ? 81  HIS A NE2 1 
ATOM   646  N N   . ASP A 1 82  ? 27.122  9.859   38.365  1.00 9.80  ? 82  ASP A N   1 
ATOM   647  C CA  . ASP A 1 82  ? 27.992  9.662   39.539  1.00 9.06  ? 82  ASP A CA  1 
ATOM   648  C C   . ASP A 1 82  ? 28.267  8.208   39.772  1.00 11.11 ? 82  ASP A C   1 
ATOM   649  O O   . ASP A 1 82  ? 27.379  7.428   40.146  1.00 10.25 ? 82  ASP A O   1 
ATOM   650  C CB  . ASP A 1 82  ? 27.225  10.329  40.639  1.00 6.40  ? 82  ASP A CB  1 
ATOM   651  C CG  . ASP A 1 82  ? 27.776  10.346  42.054  1.00 3.75  ? 82  ASP A CG  1 
ATOM   652  O OD1 . ASP A 1 82  ? 27.860  11.426  42.689  1.00 2.00  ? 82  ASP A OD1 1 
ATOM   653  O OD2 . ASP A 1 82  ? 27.998  9.261   42.569  1.00 2.00  ? 82  ASP A OD2 1 
ATOM   654  N N   . PHE A 1 83  ? 29.427  7.919   39.195  1.00 15.39 ? 83  PHE A N   1 
ATOM   655  C CA  . PHE A 1 83  ? 30.090  6.659   38.845  1.00 19.54 ? 83  PHE A CA  1 
ATOM   656  C C   . PHE A 1 83  ? 31.112  5.824   39.653  1.00 22.85 ? 83  PHE A C   1 
ATOM   657  O O   . PHE A 1 83  ? 31.533  4.824   39.040  1.00 27.95 ? 83  PHE A O   1 
ATOM   658  C CB  . PHE A 1 83  ? 30.750  6.742   37.402  1.00 19.14 ? 83  PHE A CB  1 
ATOM   659  C CG  . PHE A 1 83  ? 30.067  5.751   36.452  1.00 18.27 ? 83  PHE A CG  1 
ATOM   660  C CD1 . PHE A 1 83  ? 29.100  4.880   37.001  1.00 16.51 ? 83  PHE A CD1 1 
ATOM   661  C CD2 . PHE A 1 83  ? 30.283  5.785   35.057  1.00 16.54 ? 83  PHE A CD2 1 
ATOM   662  C CE1 . PHE A 1 83  ? 28.190  4.240   36.167  1.00 14.08 ? 83  PHE A CE1 1 
ATOM   663  C CE2 . PHE A 1 83  ? 29.329  5.163   34.226  1.00 11.24 ? 83  PHE A CE2 1 
ATOM   664  C CZ  . PHE A 1 83  ? 28.253  4.469   34.790  1.00 13.74 ? 83  PHE A CZ  1 
ATOM   665  N N   . GLY A 1 84  ? 31.567  6.188   40.890  1.00 23.67 ? 84  GLY A N   1 
ATOM   666  C CA  . GLY A 1 84  ? 32.411  7.392   40.849  1.00 22.74 ? 84  GLY A CA  1 
ATOM   667  C C   . GLY A 1 84  ? 33.341  7.905   42.020  1.00 25.26 ? 84  GLY A C   1 
ATOM   668  O O   . GLY A 1 84  ? 33.557  9.097   42.337  1.00 22.74 ? 84  GLY A O   1 
ATOM   669  N N   . MET A 1 85  ? 34.178  6.881   42.384  1.00 25.94 ? 85  MET A N   1 
ATOM   670  C CA  . MET A 1 85  ? 34.739  6.339   41.132  1.00 27.07 ? 85  MET A CA  1 
ATOM   671  C C   . MET A 1 85  ? 34.542  4.874   40.629  1.00 27.17 ? 85  MET A C   1 
ATOM   672  O O   . MET A 1 85  ? 33.465  4.357   40.551  1.00 27.25 ? 85  MET A O   1 
ATOM   673  C CB  . MET A 1 85  ? 36.031  7.160   40.742  1.00 28.87 ? 85  MET A CB  1 
ATOM   674  C CG  . MET A 1 85  ? 36.465  8.497   41.500  1.00 30.06 ? 85  MET A CG  1 
ATOM   675  S SD  . MET A 1 85  ? 36.951  8.361   43.261  1.00 31.78 ? 85  MET A SD  1 
ATOM   676  C CE  . MET A 1 85  ? 37.144  10.097  43.706  1.00 27.29 ? 85  MET A CE  1 
ATOM   677  N N   . LYS A 1 86  ? 35.530  4.280   39.983  1.00 27.84 ? 86  LYS A N   1 
ATOM   678  C CA  . LYS A 1 86  ? 35.223  3.142   39.041  1.00 27.87 ? 86  LYS A CA  1 
ATOM   679  C C   . LYS A 1 86  ? 34.921  3.229   37.426  1.00 27.71 ? 86  LYS A C   1 
ATOM   680  O O   . LYS A 1 86  ? 34.878  4.273   36.737  1.00 30.79 ? 86  LYS A O   1 
ATOM   681  C CB  . LYS A 1 86  ? 34.565  1.974   39.769  1.00 25.08 ? 86  LYS A CB  1 
ATOM   682  C CG  . LYS A 1 86  ? 35.583  0.836   39.639  1.00 30.31 ? 86  LYS A CG  1 
ATOM   683  C CD  . LYS A 1 86  ? 34.886  -0.493  39.875  1.00 36.14 ? 86  LYS A CD  1 
ATOM   684  C CE  . LYS A 1 86  ? 33.477  -0.324  40.566  1.00 40.63 ? 86  LYS A CE  1 
ATOM   685  N NZ  . LYS A 1 86  ? 32.923  -1.633  41.036  1.00 42.43 ? 86  LYS A NZ  1 
ATOM   686  N N   . LYS A 1 87  ? 34.951  2.020   36.762  1.00 27.19 ? 87  LYS A N   1 
ATOM   687  C CA  . LYS A 1 87  ? 35.292  2.071   35.284  1.00 21.63 ? 87  LYS A CA  1 
ATOM   688  C C   . LYS A 1 87  ? 34.129  1.998   34.345  1.00 17.46 ? 87  LYS A C   1 
ATOM   689  O O   . LYS A 1 87  ? 33.584  0.940   34.176  1.00 18.56 ? 87  LYS A O   1 
ATOM   690  C CB  . LYS A 1 87  ? 36.347  1.034   34.774  1.00 18.57 ? 87  LYS A CB  1 
ATOM   691  C CG  . LYS A 1 87  ? 37.145  1.700   33.612  1.00 22.06 ? 87  LYS A CG  1 
ATOM   692  C CD  . LYS A 1 87  ? 38.719  1.513   33.733  1.00 27.71 ? 87  LYS A CD  1 
ATOM   693  C CE  . LYS A 1 87  ? 39.747  2.206   32.710  1.00 26.05 ? 87  LYS A CE  1 
ATOM   694  N NZ  . LYS A 1 87  ? 39.906  3.689   32.704  1.00 23.96 ? 87  LYS A NZ  1 
ATOM   695  N N   . PRO A 1 88  ? 33.727  3.144   33.855  1.00 15.97 ? 88  PRO A N   1 
ATOM   696  C CA  . PRO A 1 88  ? 32.395  3.247   33.285  1.00 14.90 ? 88  PRO A CA  1 
ATOM   697  C C   . PRO A 1 88  ? 32.082  2.194   32.215  1.00 16.12 ? 88  PRO A C   1 
ATOM   698  O O   . PRO A 1 88  ? 32.919  1.541   31.579  1.00 18.98 ? 88  PRO A O   1 
ATOM   699  C CB  . PRO A 1 88  ? 32.415  4.692   32.755  1.00 12.03 ? 88  PRO A CB  1 
ATOM   700  C CG  . PRO A 1 88  ? 33.289  5.471   33.699  1.00 12.92 ? 88  PRO A CG  1 
ATOM   701  C CD  . PRO A 1 88  ? 34.402  4.425   33.882  1.00 14.52 ? 88  PRO A CD  1 
ATOM   702  N N   . PRO A 1 89  ? 30.788  1.992   32.068  1.00 16.65 ? 89  PRO A N   1 
ATOM   703  C CA  . PRO A 1 89  ? 30.295  0.969   31.110  1.00 17.14 ? 89  PRO A CA  1 
ATOM   704  C C   . PRO A 1 89  ? 30.021  1.442   29.681  1.00 17.67 ? 89  PRO A C   1 
ATOM   705  O O   . PRO A 1 89  ? 29.292  2.400   29.383  1.00 20.55 ? 89  PRO A O   1 
ATOM   706  C CB  . PRO A 1 89  ? 28.960  0.461   31.675  1.00 16.16 ? 89  PRO A CB  1 
ATOM   707  C CG  . PRO A 1 89  ? 28.823  1.238   32.978  1.00 18.10 ? 89  PRO A CG  1 
ATOM   708  C CD  . PRO A 1 89  ? 29.786  2.421   32.992  1.00 19.12 ? 89  PRO A CD  1 
ATOM   709  N N   . LEU A 1 90  ? 30.580  0.586   28.828  1.00 17.98 ? 90  LEU A N   1 
ATOM   710  C CA  . LEU A 1 90  ? 30.496  0.689   27.418  1.00 19.48 ? 90  LEU A CA  1 
ATOM   711  C C   . LEU A 1 90  ? 29.238  0.123   26.604  1.00 18.84 ? 90  LEU A C   1 
ATOM   712  O O   . LEU A 1 90  ? 28.651  -0.981  26.583  1.00 17.55 ? 90  LEU A O   1 
ATOM   713  C CB  . LEU A 1 90  ? 31.916  0.427   26.978  1.00 18.93 ? 90  LEU A CB  1 
ATOM   714  C CG  . LEU A 1 90  ? 32.839  1.658   26.820  1.00 20.39 ? 90  LEU A CG  1 
ATOM   715  C CD1 . LEU A 1 90  ? 33.226  1.990   25.356  1.00 21.72 ? 90  LEU A CD1 1 
ATOM   716  C CD2 . LEU A 1 90  ? 32.499  2.982   27.540  1.00 20.08 ? 90  LEU A CD2 1 
ATOM   717  N N   . LEU A 1 91  ? 28.741  1.144   25.870  1.00 19.20 ? 91  LEU A N   1 
ATOM   718  C CA  . LEU A 1 91  ? 27.542  0.960   25.067  1.00 19.36 ? 91  LEU A CA  1 
ATOM   719  C C   . LEU A 1 91  ? 27.791  0.231   23.658  1.00 21.77 ? 91  LEU A C   1 
ATOM   720  O O   . LEU A 1 91  ? 27.782  0.769   22.550  1.00 18.12 ? 91  LEU A O   1 
ATOM   721  C CB  . LEU A 1 91  ? 26.913  2.352   25.164  1.00 17.09 ? 91  LEU A CB  1 
ATOM   722  C CG  . LEU A 1 91  ? 26.897  2.796   26.632  1.00 14.61 ? 91  LEU A CG  1 
ATOM   723  C CD1 . LEU A 1 91  ? 26.194  4.138   26.833  1.00 13.32 ? 91  LEU A CD1 1 
ATOM   724  C CD2 . LEU A 1 91  ? 26.305  1.731   27.594  1.00 19.58 ? 91  LEU A CD2 1 
ATOM   725  N N   . ASN A 1 92  ? 28.095  -1.074  23.834  1.00 19.96 ? 92  ASN A N   1 
ATOM   726  C CA  . ASN A 1 92  ? 28.738  -1.795  22.746  1.00 19.84 ? 92  ASN A CA  1 
ATOM   727  C C   . ASN A 1 92  ? 28.546  -3.253  22.949  1.00 21.80 ? 92  ASN A C   1 
ATOM   728  O O   . ASN A 1 92  ? 29.483  -4.045  22.879  1.00 27.21 ? 92  ASN A O   1 
ATOM   729  C CB  . ASN A 1 92  ? 30.258  -1.620  22.723  1.00 20.88 ? 92  ASN A CB  1 
ATOM   730  C CG  . ASN A 1 92  ? 31.025  -1.670  24.111  1.00 23.74 ? 92  ASN A CG  1 
ATOM   731  O OD1 . ASN A 1 92  ? 31.805  -0.771  24.464  1.00 26.18 ? 92  ASN A OD1 1 
ATOM   732  N ND2 . ASN A 1 92  ? 30.626  -2.665  24.996  1.00 20.83 ? 92  ASN A ND2 1 
ATOM   733  N N   . ASN A 1 93  ? 27.292  -3.484  23.407  1.00 19.18 ? 93  ASN A N   1 
ATOM   734  C CA  . ASN A 1 93  ? 26.709  -4.799  23.821  1.00 19.37 ? 93  ASN A CA  1 
ATOM   735  C C   . ASN A 1 93  ? 25.170  -4.694  24.039  1.00 20.46 ? 93  ASN A C   1 
ATOM   736  O O   . ASN A 1 93  ? 24.646  -3.595  24.273  1.00 19.95 ? 93  ASN A O   1 
ATOM   737  C CB  . ASN A 1 93  ? 27.483  -4.969  25.097  1.00 20.02 ? 93  ASN A CB  1 
ATOM   738  C CG  . ASN A 1 93  ? 26.610  -5.380  26.160  1.00 20.80 ? 93  ASN A CG  1 
ATOM   739  O OD1 . ASN A 1 93  ? 26.135  -6.467  26.120  1.00 21.68 ? 93  ASN A OD1 1 
ATOM   740  N ND2 . ASN A 1 93  ? 26.264  -4.522  27.080  1.00 24.08 ? 93  ASN A ND2 1 
ATOM   741  N N   . ALA A 1 94  ? 24.471  -5.807  24.166  1.00 19.16 ? 94  ALA A N   1 
ATOM   742  C CA  . ALA A 1 94  ? 23.026  -5.414  24.280  1.00 17.17 ? 94  ALA A CA  1 
ATOM   743  C C   . ALA A 1 94  ? 22.643  -4.946  25.644  1.00 15.91 ? 94  ALA A C   1 
ATOM   744  O O   . ALA A 1 94  ? 22.051  -3.899  25.893  1.00 18.52 ? 94  ALA A O   1 
ATOM   745  C CB  . ALA A 1 94  ? 21.944  -6.414  23.738  1.00 15.28 ? 94  ALA A CB  1 
ATOM   746  N N   . ASP A 1 95  ? 23.184  -5.753  26.589  1.00 17.93 ? 95  ASP A N   1 
ATOM   747  C CA  . ASP A 1 95  ? 22.984  -5.555  28.042  1.00 15.59 ? 95  ASP A CA  1 
ATOM   748  C C   . ASP A 1 95  ? 23.249  -4.223  28.578  1.00 16.22 ? 95  ASP A C   1 
ATOM   749  O O   . ASP A 1 95  ? 22.254  -3.508  28.652  1.00 17.59 ? 95  ASP A O   1 
ATOM   750  C CB  . ASP A 1 95  ? 23.749  -6.431  28.955  1.00 12.31 ? 95  ASP A CB  1 
ATOM   751  C CG  . ASP A 1 95  ? 23.006  -7.714  28.849  1.00 12.65 ? 95  ASP A CG  1 
ATOM   752  O OD1 . ASP A 1 95  ? 22.095  -7.894  29.699  1.00 15.32 ? 95  ASP A OD1 1 
ATOM   753  O OD2 . ASP A 1 95  ? 23.351  -8.488  27.901  1.00 11.76 ? 95  ASP A OD2 1 
ATOM   754  N N   . SER A 1 96  ? 24.503  -3.858  28.929  1.00 19.22 ? 96  SER A N   1 
ATOM   755  C CA  . SER A 1 96  ? 24.561  -2.470  29.402  1.00 22.12 ? 96  SER A CA  1 
ATOM   756  C C   . SER A 1 96  ? 23.640  -1.433  28.701  1.00 23.70 ? 96  SER A C   1 
ATOM   757  O O   . SER A 1 96  ? 23.078  -0.508  29.278  1.00 27.40 ? 96  SER A O   1 
ATOM   758  C CB  . SER A 1 96  ? 26.014  -1.902  29.624  1.00 23.89 ? 96  SER A CB  1 
ATOM   759  O OG  . SER A 1 96  ? 26.779  -2.448  30.765  1.00 27.58 ? 96  SER A OG  1 
ATOM   760  N N   . VAL A 1 97  ? 23.398  -1.651  27.401  1.00 24.15 ? 97  VAL A N   1 
ATOM   761  C CA  . VAL A 1 97  ? 22.505  -0.658  26.802  1.00 20.52 ? 97  VAL A CA  1 
ATOM   762  C C   . VAL A 1 97  ? 21.083  -0.729  27.297  1.00 19.33 ? 97  VAL A C   1 
ATOM   763  O O   . VAL A 1 97  ? 20.478  0.235   27.782  1.00 19.67 ? 97  VAL A O   1 
ATOM   764  C CB  . VAL A 1 97  ? 22.786  -0.537  25.295  1.00 19.42 ? 97  VAL A CB  1 
ATOM   765  C CG1 . VAL A 1 97  ? 21.904  -1.320  24.436  1.00 21.87 ? 97  VAL A CG1 1 
ATOM   766  C CG2 . VAL A 1 97  ? 22.595  0.878   24.869  1.00 15.94 ? 97  VAL A CG2 1 
ATOM   767  N N   . GLN A 1 98  ? 20.597  -1.958  27.330  1.00 18.40 ? 98  GLN A N   1 
ATOM   768  C CA  . GLN A 1 98  ? 19.190  -2.004  27.850  1.00 16.74 ? 98  GLN A CA  1 
ATOM   769  C C   . GLN A 1 98  ? 18.957  -1.399  29.279  1.00 14.33 ? 98  GLN A C   1 
ATOM   770  O O   . GLN A 1 98  ? 18.095  -0.573  29.604  1.00 12.40 ? 98  GLN A O   1 
ATOM   771  C CB  . GLN A 1 98  ? 18.345  -3.314  27.514  1.00 15.62 ? 98  GLN A CB  1 
ATOM   772  C CG  . GLN A 1 98  ? 18.891  -4.728  27.501  1.00 17.76 ? 98  GLN A CG  1 
ATOM   773  C CD  . GLN A 1 98  ? 19.120  -5.282  26.086  1.00 20.56 ? 98  GLN A CD  1 
ATOM   774  O OE1 . GLN A 1 98  ? 19.675  -4.481  25.228  1.00 16.01 ? 98  GLN A OE1 1 
ATOM   775  N NE2 . GLN A 1 98  ? 18.841  -6.631  25.909  1.00 23.61 ? 98  GLN A NE2 1 
ATOM   776  N N   . ALA A 1 99  ? 19.946  -1.787  30.127  1.00 13.96 ? 99  ALA A N   1 
ATOM   777  C CA  . ALA A 1 99  ? 20.148  -1.061  31.475  1.00 9.20  ? 99  ALA A CA  1 
ATOM   778  C C   . ALA A 1 99  ? 19.892  0.351   31.475  1.00 6.97  ? 99  ALA A C   1 
ATOM   779  O O   . ALA A 1 99  ? 19.224  0.792   32.365  1.00 9.94  ? 99  ALA A O   1 
ATOM   780  C CB  . ALA A 1 99  ? 21.569  -1.053  32.071  1.00 2.00  ? 99  ALA A CB  1 
ATOM   781  N N   . LYS A 1 100 ? 20.359  1.033   30.443  1.00 3.99  ? 100 LYS A N   1 
ATOM   782  C CA  . LYS A 1 100 ? 20.150  2.470   30.365  1.00 2.13  ? 100 LYS A CA  1 
ATOM   783  C C   . LYS A 1 100 ? 18.834  2.850   29.688  1.00 2.00  ? 100 LYS A C   1 
ATOM   784  O O   . LYS A 1 100 ? 18.176  3.870   29.850  1.00 2.00  ? 100 LYS A O   1 
ATOM   785  C CB  . LYS A 1 100 ? 21.462  3.223   29.927  1.00 2.00  ? 100 LYS A CB  1 
ATOM   786  C CG  . LYS A 1 100 ? 22.950  2.758   30.229  1.00 2.00  ? 100 LYS A CG  1 
ATOM   787  C CD  . LYS A 1 100 ? 23.516  2.612   31.687  1.00 2.00  ? 100 LYS A CD  1 
ATOM   788  C CE  . LYS A 1 100 ? 23.365  3.777   32.666  1.00 4.65  ? 100 LYS A CE  1 
ATOM   789  N NZ  . LYS A 1 100 ? 22.005  4.195   33.125  1.00 2.00  ? 100 LYS A NZ  1 
ATOM   790  N N   . VAL A 1 101 ? 18.390  1.876   28.998  1.00 2.86  ? 101 VAL A N   1 
ATOM   791  C CA  . VAL A 1 101 ? 16.979  2.090   28.655  1.00 5.58  ? 101 VAL A CA  1 
ATOM   792  C C   . VAL A 1 101 ? 15.875  2.177   29.755  1.00 8.39  ? 101 VAL A C   1 
ATOM   793  O O   . VAL A 1 101 ? 15.049  3.108   29.720  1.00 7.41  ? 101 VAL A O   1 
ATOM   794  C CB  . VAL A 1 101 ? 16.681  1.191   27.434  1.00 6.50  ? 101 VAL A CB  1 
ATOM   795  C CG1 . VAL A 1 101 ? 15.800  -0.021  27.688  1.00 8.67  ? 101 VAL A CG1 1 
ATOM   796  C CG2 . VAL A 1 101 ? 16.173  2.129   26.349  1.00 8.31  ? 101 VAL A CG2 1 
ATOM   797  N N   . GLU A 1 102 ? 15.940  1.255   30.834  1.00 11.99 ? 102 GLU A N   1 
ATOM   798  C CA  . GLU A 1 102 ? 15.095  1.555   32.051  1.00 9.14  ? 102 GLU A CA  1 
ATOM   799  C C   . GLU A 1 102 ? 15.277  2.924   32.743  1.00 6.20  ? 102 GLU A C   1 
ATOM   800  O O   . GLU A 1 102 ? 14.333  3.681   33.036  1.00 2.00  ? 102 GLU A O   1 
ATOM   801  C CB  . GLU A 1 102 ? 14.922  0.420   33.130  1.00 10.91 ? 102 GLU A CB  1 
ATOM   802  C CG  . GLU A 1 102 ? 16.052  -0.575  32.889  1.00 21.63 ? 102 GLU A CG  1 
ATOM   803  C CD  . GLU A 1 102 ? 15.552  -1.976  32.561  1.00 26.78 ? 102 GLU A CD  1 
ATOM   804  O OE1 . GLU A 1 102 ? 16.347  -2.913  32.278  1.00 29.70 ? 102 GLU A OE1 1 
ATOM   805  O OE2 . GLU A 1 102 ? 14.324  -2.114  32.608  1.00 27.69 ? 102 GLU A OE2 1 
ATOM   806  N N   . MET A 1 103 ? 16.564  3.244   32.922  1.00 3.75  ? 103 MET A N   1 
ATOM   807  C CA  . MET A 1 103 ? 16.644  4.541   33.594  1.00 5.09  ? 103 MET A CA  1 
ATOM   808  C C   . MET A 1 103 ? 15.861  5.630   32.929  1.00 5.93  ? 103 MET A C   1 
ATOM   809  O O   . MET A 1 103 ? 15.071  6.198   33.647  1.00 14.53 ? 103 MET A O   1 
ATOM   810  C CB  . MET A 1 103 ? 18.090  5.031   33.902  1.00 4.20  ? 103 MET A CB  1 
ATOM   811  C CG  . MET A 1 103 ? 18.565  6.500   34.202  1.00 7.19  ? 103 MET A CG  1 
ATOM   812  S SD  . MET A 1 103 ? 20.262  6.484   33.618  1.00 3.04  ? 103 MET A SD  1 
ATOM   813  C CE  . MET A 1 103 ? 19.638  6.609   31.918  1.00 6.18  ? 103 MET A CE  1 
ATOM   814  N N   . LEU A 1 104 ? 16.019  5.799   31.586  1.00 5.35  ? 104 LEU A N   1 
ATOM   815  C CA  . LEU A 1 104 ? 15.180  6.765   30.805  1.00 2.70  ? 104 LEU A CA  1 
ATOM   816  C C   . LEU A 1 104 ? 13.710  6.577   30.806  1.00 3.91  ? 104 LEU A C   1 
ATOM   817  O O   . LEU A 1 104 ? 13.047  7.590   30.848  1.00 2.00  ? 104 LEU A O   1 
ATOM   818  C CB  . LEU A 1 104 ? 15.683  6.859   29.432  1.00 2.00  ? 104 LEU A CB  1 
ATOM   819  C CG  . LEU A 1 104 ? 17.177  7.332   29.357  1.00 2.00  ? 104 LEU A CG  1 
ATOM   820  C CD1 . LEU A 1 104 ? 17.788  7.127   27.873  1.00 6.07  ? 104 LEU A CD1 1 
ATOM   821  C CD2 . LEU A 1 104 ? 17.315  8.839   29.854  1.00 2.00  ? 104 LEU A CD2 1 
ATOM   822  N N   . ASP A 1 105 ? 13.252  5.280   30.895  1.00 8.02  ? 105 ASP A N   1 
ATOM   823  C CA  . ASP A 1 105 ? 11.804  5.059   31.025  1.00 4.38  ? 105 ASP A CA  1 
ATOM   824  C C   . ASP A 1 105 ? 11.231  5.779   32.169  1.00 2.00  ? 105 ASP A C   1 
ATOM   825  O O   . ASP A 1 105 ? 10.445  6.690   32.142  1.00 2.54  ? 105 ASP A O   1 
ATOM   826  C CB  . ASP A 1 105 ? 11.317  3.605   30.872  1.00 5.13  ? 105 ASP A CB  1 
ATOM   827  C CG  . ASP A 1 105 ? 11.377  2.917   29.419  1.00 5.61  ? 105 ASP A CG  1 
ATOM   828  O OD1 . ASP A 1 105 ? 11.843  3.502   28.359  1.00 6.92  ? 105 ASP A OD1 1 
ATOM   829  O OD2 . ASP A 1 105 ? 10.964  1.705   29.374  1.00 6.46  ? 105 ASP A OD2 1 
ATOM   830  N N   . ASN A 1 106 ? 11.922  5.438   33.247  1.00 4.39  ? 106 ASN A N   1 
ATOM   831  C CA  . ASN A 1 106 ? 11.732  6.068   34.551  1.00 8.31  ? 106 ASN A CA  1 
ATOM   832  C C   . ASN A 1 106 ? 11.938  7.602   34.570  1.00 10.85 ? 106 ASN A C   1 
ATOM   833  O O   . ASN A 1 106 ? 11.021  8.366   34.829  1.00 15.02 ? 106 ASN A O   1 
ATOM   834  C CB  . ASN A 1 106 ? 12.515  5.382   35.647  1.00 5.47  ? 106 ASN A CB  1 
ATOM   835  C CG  . ASN A 1 106 ? 12.128  3.945   35.710  1.00 7.21  ? 106 ASN A CG  1 
ATOM   836  O OD1 . ASN A 1 106 ? 11.249  3.392   36.334  1.00 3.48  ? 106 ASN A OD1 1 
ATOM   837  N ND2 . ASN A 1 106 ? 13.034  3.231   35.141  1.00 5.33  ? 106 ASN A ND2 1 
ATOM   838  N N   . LEU A 1 107 ? 13.117  8.063   34.186  1.00 11.53 ? 107 LEU A N   1 
ATOM   839  C CA  . LEU A 1 107 ? 13.190  9.468   33.876  1.00 7.26  ? 107 LEU A CA  1 
ATOM   840  C C   . LEU A 1 107 ? 11.999  10.171  33.237  1.00 7.79  ? 107 LEU A C   1 
ATOM   841  O O   . LEU A 1 107 ? 11.524  11.249  33.567  1.00 5.00  ? 107 LEU A O   1 
ATOM   842  C CB  . LEU A 1 107 ? 14.478  9.669   33.092  1.00 2.25  ? 107 LEU A CB  1 
ATOM   843  C CG  . LEU A 1 107 ? 15.703  9.549   34.023  1.00 2.76  ? 107 LEU A CG  1 
ATOM   844  C CD1 . LEU A 1 107 ? 16.974  10.034  33.322  1.00 2.00  ? 107 LEU A CD1 1 
ATOM   845  C CD2 . LEU A 1 107 ? 15.462  10.431  35.333  1.00 5.78  ? 107 LEU A CD2 1 
ATOM   846  N N   . LEU A 1 108 ? 11.415  9.398   32.323  1.00 9.75  ? 108 LEU A N   1 
ATOM   847  C CA  . LEU A 1 108 ? 10.158  9.932   31.845  1.00 10.56 ? 108 LEU A CA  1 
ATOM   848  C C   . LEU A 1 108 ? 8.980   10.101  32.910  1.00 11.39 ? 108 LEU A C   1 
ATOM   849  O O   . LEU A 1 108 ? 8.693   11.221  33.301  1.00 11.03 ? 108 LEU A O   1 
ATOM   850  C CB  . LEU A 1 108 ? 9.858   9.201   30.507  1.00 10.44 ? 108 LEU A CB  1 
ATOM   851  C CG  . LEU A 1 108 ? 10.638  9.370   29.196  1.00 10.17 ? 108 LEU A CG  1 
ATOM   852  C CD1 . LEU A 1 108 ? 9.930   8.427   28.163  1.00 9.27  ? 108 LEU A CD1 1 
ATOM   853  C CD2 . LEU A 1 108 ? 10.882  10.875  28.907  1.00 11.25 ? 108 LEU A CD2 1 
ATOM   854  N N   . ASP A 1 109 ? 8.425   9.051   33.480  1.00 6.00  ? 109 ASP A N   1 
ATOM   855  C CA  . ASP A 1 109 ? 7.467   9.321   34.523  1.00 8.32  ? 109 ASP A CA  1 
ATOM   856  C C   . ASP A 1 109 ? 7.944   10.296  35.793  1.00 11.04 ? 109 ASP A C   1 
ATOM   857  O O   . ASP A 1 109 ? 7.254   11.212  36.332  1.00 9.01  ? 109 ASP A O   1 
ATOM   858  C CB  . ASP A 1 109 ? 7.070   7.879   34.893  1.00 2.75  ? 109 ASP A CB  1 
ATOM   859  C CG  . ASP A 1 109 ? 5.838   7.326   34.172  1.00 8.88  ? 109 ASP A CG  1 
ATOM   860  O OD1 . ASP A 1 109 ? 5.367   8.095   33.366  1.00 10.14 ? 109 ASP A OD1 1 
ATOM   861  O OD2 . ASP A 1 109 ? 5.372   6.171   34.361  1.00 9.00  ? 109 ASP A OD2 1 
ATOM   862  N N   . ILE A 1 110 ? 9.227   10.054  36.312  1.00 8.10  ? 110 ILE A N   1 
ATOM   863  C CA  . ILE A 1 110 ? 9.747   11.047  37.242  1.00 5.40  ? 110 ILE A CA  1 
ATOM   864  C C   . ILE A 1 110 ? 9.741   12.468  36.838  1.00 7.55  ? 110 ILE A C   1 
ATOM   865  O O   . ILE A 1 110 ? 9.237   13.227  37.667  1.00 7.57  ? 110 ILE A O   1 
ATOM   866  C CB  . ILE A 1 110 ? 11.101  10.768  37.520  1.00 3.66  ? 110 ILE A CB  1 
ATOM   867  C CG1 . ILE A 1 110 ? 10.926  9.521   38.348  1.00 6.36  ? 110 ILE A CG1 1 
ATOM   868  C CG2 . ILE A 1 110 ? 11.887  11.842  38.301  1.00 2.69  ? 110 ILE A CG2 1 
ATOM   869  C CD1 . ILE A 1 110 ? 12.352  9.406   38.953  1.00 6.20  ? 110 ILE A CD1 1 
ATOM   870  N N   . GLU A 1 111 ? 10.226  12.796  35.560  1.00 6.67  ? 111 GLU A N   1 
ATOM   871  C CA  . GLU A 1 111 ? 9.938   14.146  35.004  1.00 7.46  ? 111 GLU A CA  1 
ATOM   872  C C   . GLU A 1 111 ? 8.504   14.442  35.089  1.00 9.35  ? 111 GLU A C   1 
ATOM   873  O O   . GLU A 1 111 ? 8.135   15.480  35.585  1.00 10.99 ? 111 GLU A O   1 
ATOM   874  C CB  . GLU A 1 111 ? 10.222  14.318  33.573  1.00 9.21  ? 111 GLU A CB  1 
ATOM   875  C CG  . GLU A 1 111 ? 10.419  15.641  32.798  1.00 14.42 ? 111 GLU A CG  1 
ATOM   876  C CD  . GLU A 1 111 ? 9.251   16.583  32.397  1.00 12.09 ? 111 GLU A CD  1 
ATOM   877  O OE1 . GLU A 1 111 ? 8.240   16.185  31.779  1.00 8.60  ? 111 GLU A OE1 1 
ATOM   878  O OE2 . GLU A 1 111 ? 9.461   17.742  32.685  1.00 11.54 ? 111 GLU A OE2 1 
ATOM   879  N N   . VAL A 1 112 ? 7.696   13.484  34.733  1.00 11.78 ? 112 VAL A N   1 
ATOM   880  C CA  . VAL A 1 112 ? 6.322   14.035  34.531  1.00 8.82  ? 112 VAL A CA  1 
ATOM   881  C C   . VAL A 1 112 ? 5.702   14.368  35.894  1.00 11.07 ? 112 VAL A C   1 
ATOM   882  O O   . VAL A 1 112 ? 4.954   15.309  36.032  1.00 10.89 ? 112 VAL A O   1 
ATOM   883  C CB  . VAL A 1 112 ? 5.345   13.113  33.749  1.00 4.60  ? 112 VAL A CB  1 
ATOM   884  C CG1 . VAL A 1 112 ? 4.173   13.909  33.327  1.00 2.00  ? 112 VAL A CG1 1 
ATOM   885  C CG2 . VAL A 1 112 ? 5.887   12.194  32.688  1.00 2.00  ? 112 VAL A CG2 1 
ATOM   886  N N   . ALA A 1 113 ? 6.140   13.583  36.930  1.00 13.07 ? 113 ALA A N   1 
ATOM   887  C CA  . ALA A 1 113 ? 5.932   13.751  38.398  1.00 15.43 ? 113 ALA A CA  1 
ATOM   888  C C   . ALA A 1 113 ? 6.340   15.123  38.981  1.00 16.43 ? 113 ALA A C   1 
ATOM   889  O O   . ALA A 1 113 ? 5.630   15.878  39.616  1.00 19.60 ? 113 ALA A O   1 
ATOM   890  C CB  . ALA A 1 113 ? 6.742   12.692  39.078  1.00 17.72 ? 113 ALA A CB  1 
ATOM   891  N N   . TYR A 1 114 ? 7.587   15.452  38.739  1.00 18.91 ? 114 TYR A N   1 
ATOM   892  C CA  . TYR A 1 114 ? 8.105   16.743  39.291  1.00 19.92 ? 114 TYR A CA  1 
ATOM   893  C C   . TYR A 1 114 ? 7.729   17.943  38.420  1.00 20.16 ? 114 TYR A C   1 
ATOM   894  O O   . TYR A 1 114 ? 7.185   18.939  38.845  1.00 23.27 ? 114 TYR A O   1 
ATOM   895  C CB  . TYR A 1 114 ? 9.660   16.560  39.493  1.00 21.62 ? 114 TYR A CB  1 
ATOM   896  C CG  . TYR A 1 114 ? 10.407  17.716  40.054  1.00 19.82 ? 114 TYR A CG  1 
ATOM   897  C CD1 . TYR A 1 114 ? 10.178  18.121  41.375  1.00 21.45 ? 114 TYR A CD1 1 
ATOM   898  C CD2 . TYR A 1 114 ? 11.274  18.420  39.193  1.00 22.44 ? 114 TYR A CD2 1 
ATOM   899  C CE1 . TYR A 1 114 ? 10.758  19.351  41.801  1.00 21.62 ? 114 TYR A CE1 1 
ATOM   900  C CE2 . TYR A 1 114 ? 11.886  19.617  39.642  1.00 22.49 ? 114 TYR A CE2 1 
ATOM   901  C CZ  . TYR A 1 114 ? 11.674  20.025  40.963  1.00 19.11 ? 114 TYR A CZ  1 
ATOM   902  O OH  . TYR A 1 114 ? 12.483  21.002  41.426  1.00 17.44 ? 114 TYR A OH  1 
ATOM   903  N N   . SER A 1 115 ? 7.903   17.642  37.155  1.00 18.00 ? 115 SER A N   1 
ATOM   904  C CA  . SER A 1 115 ? 7.364   18.637  36.273  1.00 18.06 ? 115 SER A CA  1 
ATOM   905  C C   . SER A 1 115 ? 5.874   18.901  36.340  1.00 13.92 ? 115 SER A C   1 
ATOM   906  O O   . SER A 1 115 ? 5.382   19.995  36.423  1.00 14.23 ? 115 SER A O   1 
ATOM   907  C CB  . SER A 1 115 ? 7.999   18.655  34.929  1.00 19.46 ? 115 SER A CB  1 
ATOM   908  O OG  . SER A 1 115 ? 7.383   19.646  34.203  1.00 25.29 ? 115 SER A OG  1 
ATOM   909  N N   . LEU A 1 116 ? 5.225   17.800  36.716  1.00 15.67 ? 116 LEU A N   1 
ATOM   910  C CA  . LEU A 1 116 ? 3.803   17.909  37.163  1.00 18.10 ? 116 LEU A CA  1 
ATOM   911  C C   . LEU A 1 116 ? 3.612   19.034  38.199  1.00 21.57 ? 116 LEU A C   1 
ATOM   912  O O   . LEU A 1 116 ? 3.264   20.184  37.912  1.00 20.35 ? 116 LEU A O   1 
ATOM   913  C CB  . LEU A 1 116 ? 3.309   16.530  37.686  1.00 14.69 ? 116 LEU A CB  1 
ATOM   914  C CG  . LEU A 1 116 ? 1.905   16.133  37.279  1.00 12.45 ? 116 LEU A CG  1 
ATOM   915  C CD1 . LEU A 1 116 ? 0.905   17.268  37.501  1.00 17.35 ? 116 LEU A CD1 1 
ATOM   916  C CD2 . LEU A 1 116 ? 1.604   15.821  35.820  1.00 7.60  ? 116 LEU A CD2 1 
ATOM   917  N N   . LEU A 1 117 ? 4.064   18.627  39.462  1.00 25.09 ? 117 LEU A N   1 
ATOM   918  C CA  . LEU A 1 117 ? 4.340   19.554  40.568  1.00 27.26 ? 117 LEU A CA  1 
ATOM   919  C C   . LEU A 1 117 ? 4.363   21.054  40.320  1.00 29.98 ? 117 LEU A C   1 
ATOM   920  O O   . LEU A 1 117 ? 3.347   21.694  40.474  1.00 29.49 ? 117 LEU A O   1 
ATOM   921  C CB  . LEU A 1 117 ? 5.629   19.024  41.207  1.00 19.43 ? 117 LEU A CB  1 
ATOM   922  C CG  . LEU A 1 117 ? 5.503   18.670  42.673  1.00 16.64 ? 117 LEU A CG  1 
ATOM   923  C CD1 . LEU A 1 117 ? 4.103   18.110  42.971  1.00 11.34 ? 117 LEU A CD1 1 
ATOM   924  C CD2 . LEU A 1 117 ? 6.726   17.885  43.191  1.00 14.64 ? 117 LEU A CD2 1 
ATOM   925  N N   . ARG A 1 118 ? 5.490   21.560  39.792  1.00 29.90 ? 118 ARG A N   1 
ATOM   926  C CA  . ARG A 1 118 ? 5.548   23.000  39.339  1.00 26.41 ? 118 ARG A CA  1 
ATOM   927  C C   . ARG A 1 118 ? 4.261   23.885  39.049  1.00 22.83 ? 118 ARG A C   1 
ATOM   928  O O   . ARG A 1 118 ? 4.147   24.979  39.513  1.00 21.25 ? 118 ARG A O   1 
ATOM   929  C CB  . ARG A 1 118 ? 6.853   23.299  38.460  1.00 24.46 ? 118 ARG A CB  1 
ATOM   930  C CG  . ARG A 1 118 ? 7.978   22.597  39.357  1.00 31.88 ? 118 ARG A CG  1 
ATOM   931  C CD  . ARG A 1 118 ? 9.554   22.623  39.463  1.00 28.70 ? 118 ARG A CD  1 
ATOM   932  N NE  . ARG A 1 118 ? 10.017  23.875  40.050  1.00 28.09 ? 118 ARG A NE  1 
ATOM   933  C CZ  . ARG A 1 118 ? 11.219  24.515  39.937  1.00 27.65 ? 118 ARG A CZ  1 
ATOM   934  N NH1 . ARG A 1 118 ? 12.311  24.000  39.312  1.00 24.27 ? 118 ARG A NH1 1 
ATOM   935  N NH2 . ARG A 1 118 ? 11.222  25.747  40.517  1.00 22.25 ? 118 ARG A NH2 1 
ATOM   936  N N   . GLY A 1 119 ? 3.186   23.310  38.475  1.00 23.62 ? 119 GLY A N   1 
ATOM   937  C CA  . GLY A 1 119 ? 1.958   24.180  38.269  1.00 26.95 ? 119 GLY A CA  1 
ATOM   938  C C   . GLY A 1 119 ? 1.153   24.920  39.439  1.00 26.94 ? 119 GLY A C   1 
ATOM   939  O O   . GLY A 1 119 ? 1.431   25.998  39.924  1.00 21.48 ? 119 GLY A O   1 
ATOM   940  N N   . GLY A 1 120 ? 0.164   24.224  39.960  1.00 30.09 ? 120 GLY A N   1 
ATOM   941  C CA  . GLY A 1 120 ? -1.051  24.893  40.519  1.00 30.34 ? 120 GLY A CA  1 
ATOM   942  C C   . GLY A 1 120 ? -1.065  26.033  41.589  1.00 31.04 ? 120 GLY A C   1 
ATOM   943  O O   . GLY A 1 120 ? -2.083  26.665  41.939  1.00 26.25 ? 120 GLY A O   1 
ATOM   944  N N   . SER A 1 121 ? 0.119   26.204  42.166  1.00 29.08 ? 121 SER A N   1 
ATOM   945  C CA  . SER A 1 121 ? -0.096  26.475  43.571  1.00 33.46 ? 121 SER A CA  1 
ATOM   946  C C   . SER A 1 121 ? 0.937   27.362  44.255  1.00 34.23 ? 121 SER A C   1 
ATOM   947  O O   . SER A 1 121 ? 1.849   27.004  44.962  1.00 37.26 ? 121 SER A O   1 
ATOM   948  C CB  . SER A 1 121 ? -0.236  25.203  44.353  1.00 34.81 ? 121 SER A CB  1 
ATOM   949  O OG  . SER A 1 121 ? -1.505  25.222  44.881  1.00 41.18 ? 121 SER A OG  1 
ATOM   950  N N   . ASP A 1 122 ? 0.752   28.650  44.129  1.00 36.62 ? 122 ASP A N   1 
ATOM   951  C CA  . ASP A 1 122 ? 0.771   29.162  45.563  1.00 34.35 ? 122 ASP A CA  1 
ATOM   952  C C   . ASP A 1 122 ? -0.449  28.789  46.636  1.00 31.75 ? 122 ASP A C   1 
ATOM   953  O O   . ASP A 1 122 ? -1.190  29.518  47.263  1.00 29.35 ? 122 ASP A O   1 
ATOM   954  C CB  . ASP A 1 122 ? 1.441   30.598  45.542  1.00 35.70 ? 122 ASP A CB  1 
ATOM   955  C CG  . ASP A 1 122 ? 0.937   31.617  44.458  1.00 38.65 ? 122 ASP A CG  1 
ATOM   956  O OD1 . ASP A 1 122 ? 0.546   31.178  43.344  1.00 38.48 ? 122 ASP A OD1 1 
ATOM   957  O OD2 . ASP A 1 122 ? 0.943   32.850  44.750  1.00 38.12 ? 122 ASP A OD2 1 
ATOM   958  N N   . ASP A 1 123 ? -0.696  27.472  46.628  1.00 28.68 ? 123 ASP A N   1 
ATOM   959  C CA  . ASP A 1 123 ? -1.987  27.072  47.183  1.00 26.23 ? 123 ASP A CA  1 
ATOM   960  C C   . ASP A 1 123 ? -2.156  25.672  47.865  1.00 26.48 ? 123 ASP A C   1 
ATOM   961  O O   . ASP A 1 123 ? -1.815  24.566  47.475  1.00 26.41 ? 123 ASP A O   1 
ATOM   962  C CB  . ASP A 1 123 ? -3.140  27.232  46.145  1.00 21.80 ? 123 ASP A CB  1 
ATOM   963  C CG  . ASP A 1 123 ? -3.695  28.591  46.412  1.00 21.62 ? 123 ASP A CG  1 
ATOM   964  O OD1 . ASP A 1 123 ? -3.671  29.451  45.533  1.00 22.54 ? 123 ASP A OD1 1 
ATOM   965  O OD2 . ASP A 1 123 ? -4.137  28.791  47.531  1.00 20.94 ? 123 ASP A OD2 1 
ATOM   966  N N   . SER A 1 124 ? -2.934  25.587  48.927  1.00 28.66 ? 124 SER A N   1 
ATOM   967  C CA  . SER A 1 124 ? -3.544  26.540  49.864  1.00 28.30 ? 124 SER A CA  1 
ATOM   968  C C   . SER A 1 124 ? -5.050  26.397  49.847  1.00 31.38 ? 124 SER A C   1 
ATOM   969  O O   . SER A 1 124 ? -5.425  25.902  50.892  1.00 30.40 ? 124 SER A O   1 
ATOM   970  C CB  . SER A 1 124 ? -2.949  27.996  50.098  1.00 23.29 ? 124 SER A CB  1 
ATOM   971  O OG  . SER A 1 124 ? -3.932  28.875  50.608  1.00 16.56 ? 124 SER A OG  1 
ATOM   972  N N   . SER A 1 125 ? -5.877  26.683  48.758  1.00 33.21 ? 125 SER A N   1 
ATOM   973  C CA  . SER A 1 125 ? -7.250  26.973  49.250  1.00 37.06 ? 125 SER A CA  1 
ATOM   974  C C   . SER A 1 125 ? -8.563  26.270  48.729  1.00 40.36 ? 125 SER A C   1 
ATOM   975  O O   . SER A 1 125 ? -9.610  26.909  48.443  1.00 43.92 ? 125 SER A O   1 
ATOM   976  C CB  . SER A 1 125 ? -7.444  28.502  49.344  1.00 34.93 ? 125 SER A CB  1 
ATOM   977  O OG  . SER A 1 125 ? -6.229  29.055  48.839  1.00 38.91 ? 125 SER A OG  1 
ATOM   978  N N   . LYS A 1 126 ? -8.518  24.911  48.706  1.00 38.92 ? 126 LYS A N   1 
ATOM   979  C CA  . LYS A 1 126 ? -7.561  24.010  48.056  1.00 36.32 ? 126 LYS A CA  1 
ATOM   980  C C   . LYS A 1 126 ? -6.015  23.790  48.572  1.00 33.54 ? 126 LYS A C   1 
ATOM   981  O O   . LYS A 1 126 ? -4.904  24.024  48.042  1.00 31.62 ? 126 LYS A O   1 
ATOM   982  C CB  . LYS A 1 126 ? -7.965  24.228  46.563  1.00 36.85 ? 126 LYS A CB  1 
ATOM   983  C CG  . LYS A 1 126 ? -9.292  23.579  45.980  1.00 33.17 ? 126 LYS A CG  1 
ATOM   984  C CD  . LYS A 1 126 ? -9.620  24.115  44.559  1.00 33.39 ? 126 LYS A CD  1 
ATOM   985  C CE  . LYS A 1 126 ? -10.269 23.041  43.606  1.00 34.45 ? 126 LYS A CE  1 
ATOM   986  N NZ  . LYS A 1 126 ? -10.568 23.643  42.259  1.00 36.21 ? 126 LYS A NZ  1 
ATOM   987  N N   . ASP A 1 127 ? -5.912  23.255  49.778  1.00 29.30 ? 127 ASP A N   1 
ATOM   988  C CA  . ASP A 1 127 ? -4.577  22.786  50.165  1.00 24.11 ? 127 ASP A CA  1 
ATOM   989  C C   . ASP A 1 127 ? -3.745  21.737  49.255  1.00 22.19 ? 127 ASP A C   1 
ATOM   990  O O   . ASP A 1 127 ? -4.218  21.212  48.226  1.00 22.32 ? 127 ASP A O   1 
ATOM   991  C CB  . ASP A 1 127 ? -4.851  22.430  51.615  1.00 20.42 ? 127 ASP A CB  1 
ATOM   992  C CG  . ASP A 1 127 ? -5.581  21.128  51.695  1.00 18.82 ? 127 ASP A CG  1 
ATOM   993  O OD1 . ASP A 1 127 ? -4.994  20.165  52.186  1.00 12.94 ? 127 ASP A OD1 1 
ATOM   994  O OD2 . ASP A 1 127 ? -6.715  21.093  51.247  1.00 17.11 ? 127 ASP A OD2 1 
ATOM   995  N N   . PRO A 1 128 ? -2.465  21.371  49.739  1.00 19.63 ? 128 PRO A N   1 
ATOM   996  C CA  . PRO A 1 128 ? -1.494  20.443  48.993  1.00 20.90 ? 128 PRO A CA  1 
ATOM   997  C C   . PRO A 1 128 ? -1.794  18.893  48.825  1.00 21.64 ? 128 PRO A C   1 
ATOM   998  O O   . PRO A 1 128 ? -1.052  17.989  48.426  1.00 23.82 ? 128 PRO A O   1 
ATOM   999  C CB  . PRO A 1 128 ? -0.140  20.725  49.669  1.00 15.97 ? 128 PRO A CB  1 
ATOM   1000 C CG  . PRO A 1 128 ? -0.336  22.164  50.125  1.00 15.59 ? 128 PRO A CG  1 
ATOM   1001 C CD  . PRO A 1 128 ? -1.701  22.035  50.773  1.00 15.49 ? 128 PRO A CD  1 
ATOM   1002 N N   . ILE A 1 129 ? -3.030  18.573  49.239  1.00 21.87 ? 129 ILE A N   1 
ATOM   1003 C CA  . ILE A 1 129 ? -3.547  17.312  48.775  1.00 21.48 ? 129 ILE A CA  1 
ATOM   1004 C C   . ILE A 1 129 ? -4.536  17.560  47.695  1.00 22.93 ? 129 ILE A C   1 
ATOM   1005 O O   . ILE A 1 129 ? -4.624  16.869  46.683  1.00 28.98 ? 129 ILE A O   1 
ATOM   1006 C CB  . ILE A 1 129 ? -4.199  16.651  49.904  1.00 21.19 ? 129 ILE A CB  1 
ATOM   1007 C CG1 . ILE A 1 129 ? -3.166  16.521  51.094  1.00 17.15 ? 129 ILE A CG1 1 
ATOM   1008 C CG2 . ILE A 1 129 ? -4.790  15.367  49.319  1.00 19.32 ? 129 ILE A CG2 1 
ATOM   1009 C CD1 . ILE A 1 129 ? -1.655  16.297  50.856  1.00 13.59 ? 129 ILE A CD1 1 
ATOM   1010 N N   . ASP A 1 130 ? -5.312  18.624  47.835  1.00 24.17 ? 130 ASP A N   1 
ATOM   1011 C CA  . ASP A 1 130 ? -6.195  18.620  46.701  1.00 23.84 ? 130 ASP A CA  1 
ATOM   1012 C C   . ASP A 1 130 ? -5.830  19.355  45.502  1.00 24.14 ? 130 ASP A C   1 
ATOM   1013 O O   . ASP A 1 130 ? -6.693  19.839  44.874  1.00 29.38 ? 130 ASP A O   1 
ATOM   1014 C CB  . ASP A 1 130 ? -7.624  18.957  47.027  1.00 26.42 ? 130 ASP A CB  1 
ATOM   1015 C CG  . ASP A 1 130 ? -7.809  18.475  48.417  1.00 31.69 ? 130 ASP A CG  1 
ATOM   1016 O OD1 . ASP A 1 130 ? -7.382  17.331  48.728  1.00 30.77 ? 130 ASP A OD1 1 
ATOM   1017 O OD2 . ASP A 1 130 ? -8.322  19.299  49.177  1.00 36.56 ? 130 ASP A OD2 1 
ATOM   1018 N N   . VAL A 1 131 ? -4.599  19.386  45.204  1.00 22.03 ? 131 VAL A N   1 
ATOM   1019 C CA  . VAL A 1 131 ? -4.222  20.255  44.060  1.00 22.09 ? 131 VAL A CA  1 
ATOM   1020 C C   . VAL A 1 131 ? -3.310  19.335  43.186  1.00 24.93 ? 131 VAL A C   1 
ATOM   1021 O O   . VAL A 1 131 ? -3.632  18.846  42.123  1.00 30.49 ? 131 VAL A O   1 
ATOM   1022 C CB  . VAL A 1 131 ? -3.656  21.568  44.675  1.00 18.43 ? 131 VAL A CB  1 
ATOM   1023 C CG1 . VAL A 1 131 ? -2.753  22.309  43.703  1.00 19.86 ? 131 VAL A CG1 1 
ATOM   1024 C CG2 . VAL A 1 131 ? -4.731  22.416  45.420  1.00 11.95 ? 131 VAL A CG2 1 
ATOM   1025 N N   . ASN A 1 132 ? -2.330  18.724  43.860  1.00 21.77 ? 132 ASN A N   1 
ATOM   1026 C CA  . ASN A 1 132 ? -1.790  17.444  43.324  1.00 18.22 ? 132 ASN A CA  1 
ATOM   1027 C C   . ASN A 1 132 ? -2.729  16.252  42.833  1.00 19.17 ? 132 ASN A C   1 
ATOM   1028 O O   . ASN A 1 132 ? -2.945  16.094  41.662  1.00 22.27 ? 132 ASN A O   1 
ATOM   1029 C CB  . ASN A 1 132 ? -0.800  16.988  44.347  1.00 22.76 ? 132 ASN A CB  1 
ATOM   1030 C CG  . ASN A 1 132 ? 0.036   18.138  44.679  1.00 24.80 ? 132 ASN A CG  1 
ATOM   1031 O OD1 . ASN A 1 132 ? 0.021   19.078  43.904  1.00 31.13 ? 132 ASN A OD1 1 
ATOM   1032 N ND2 . ASN A 1 132 ? 0.788   17.995  45.730  1.00 23.90 ? 132 ASN A ND2 1 
ATOM   1033 N N   . TYR A 1 133 ? -3.355  15.429  43.728  1.00 15.93 ? 133 TYR A N   1 
ATOM   1034 C CA  . TYR A 1 133 ? -4.690  14.838  43.426  1.00 20.23 ? 133 TYR A CA  1 
ATOM   1035 C C   . TYR A 1 133 ? -5.569  15.575  42.473  1.00 23.28 ? 133 TYR A C   1 
ATOM   1036 O O   . TYR A 1 133 ? -6.316  14.842  41.873  1.00 25.34 ? 133 TYR A O   1 
ATOM   1037 C CB  . TYR A 1 133 ? -5.687  14.620  44.590  1.00 19.12 ? 133 TYR A CB  1 
ATOM   1038 C CG  . TYR A 1 133 ? -6.968  13.753  44.368  1.00 15.80 ? 133 TYR A CG  1 
ATOM   1039 C CD1 . TYR A 1 133 ? -6.924  12.344  44.131  1.00 15.62 ? 133 TYR A CD1 1 
ATOM   1040 C CD2 . TYR A 1 133 ? -8.239  14.408  44.433  1.00 15.71 ? 133 TYR A CD2 1 
ATOM   1041 C CE1 . TYR A 1 133 ? -8.104  11.638  43.795  1.00 10.99 ? 133 TYR A CE1 1 
ATOM   1042 C CE2 . TYR A 1 133 ? -9.418  13.697  44.184  1.00 13.34 ? 133 TYR A CE2 1 
ATOM   1043 C CZ  . TYR A 1 133 ? -9.338  12.350  43.727  1.00 13.27 ? 133 TYR A CZ  1 
ATOM   1044 O OH  . TYR A 1 133 ? -10.406 11.651  43.142  1.00 10.55 ? 133 TYR A OH  1 
ATOM   1045 N N   . GLU A 1 134 ? -5.535  16.942  42.347  1.00 21.99 ? 134 GLU A N   1 
ATOM   1046 C CA  . GLU A 1 134 ? -6.417  17.587  41.335  1.00 24.19 ? 134 GLU A CA  1 
ATOM   1047 C C   . GLU A 1 134 ? -6.105  17.631  39.838  1.00 21.09 ? 134 GLU A C   1 
ATOM   1048 O O   . GLU A 1 134 ? -6.949  17.240  39.027  1.00 22.84 ? 134 GLU A O   1 
ATOM   1049 C CB  . GLU A 1 134 ? -6.809  18.976  41.774  1.00 29.86 ? 134 GLU A CB  1 
ATOM   1050 C CG  . GLU A 1 134 ? -8.079  19.519  41.077  1.00 35.38 ? 134 GLU A CG  1 
ATOM   1051 C CD  . GLU A 1 134 ? -9.269  19.319  42.026  1.00 36.76 ? 134 GLU A CD  1 
ATOM   1052 O OE1 . GLU A 1 134 ? -9.544  20.206  42.862  1.00 37.41 ? 134 GLU A OE1 1 
ATOM   1053 O OE2 . GLU A 1 134 ? -9.891  18.263  41.925  1.00 37.04 ? 134 GLU A OE2 1 
ATOM   1054 N N   . LYS A 1 135 ? -4.792  17.881  39.653  1.00 18.54 ? 135 LYS A N   1 
ATOM   1055 C CA  . LYS A 1 135 ? -3.809  17.539  38.572  1.00 15.21 ? 135 LYS A CA  1 
ATOM   1056 C C   . LYS A 1 135 ? -3.581  16.034  38.314  1.00 14.39 ? 135 LYS A C   1 
ATOM   1057 O O   . LYS A 1 135 ? -2.992  15.623  37.324  1.00 16.70 ? 135 LYS A O   1 
ATOM   1058 C CB  . LYS A 1 135 ? -2.349  17.981  38.852  1.00 12.38 ? 135 LYS A CB  1 
ATOM   1059 C CG  . LYS A 1 135 ? -2.220  19.346  39.617  1.00 13.59 ? 135 LYS A CG  1 
ATOM   1060 C CD  . LYS A 1 135 ? -1.253  20.543  39.304  1.00 16.92 ? 135 LYS A CD  1 
ATOM   1061 C CE  . LYS A 1 135 ? 0.129   20.479  39.990  1.00 18.03 ? 135 LYS A CE  1 
ATOM   1062 N NZ  . LYS A 1 135 ? 1.034   19.519  39.384  1.00 18.05 ? 135 LYS A NZ  1 
ATOM   1063 N N   . LEU A 1 136 ? -4.075  15.118  39.158  1.00 12.42 ? 136 LEU A N   1 
ATOM   1064 C CA  . LEU A 1 136 ? -3.833  13.737  38.772  1.00 8.18  ? 136 LEU A CA  1 
ATOM   1065 C C   . LEU A 1 136 ? -4.568  13.354  37.486  1.00 9.16  ? 136 LEU A C   1 
ATOM   1066 O O   . LEU A 1 136 ? -4.143  12.525  36.676  1.00 12.36 ? 136 LEU A O   1 
ATOM   1067 C CB  . LEU A 1 136 ? -4.018  12.747  39.941  1.00 2.00  ? 136 LEU A CB  1 
ATOM   1068 C CG  . LEU A 1 136 ? -2.966  12.675  41.090  1.00 7.79  ? 136 LEU A CG  1 
ATOM   1069 C CD1 . LEU A 1 136 ? -3.176  11.466  42.016  1.00 11.35 ? 136 LEU A CD1 1 
ATOM   1070 C CD2 . LEU A 1 136 ? -1.555  12.351  40.632  1.00 3.28  ? 136 LEU A CD2 1 
ATOM   1071 N N   . LYS A 1 137 ? -5.695  14.125  37.304  1.00 8.29  ? 137 LYS A N   1 
ATOM   1072 C CA  . LYS A 1 137 ? -6.964  13.868  36.548  1.00 4.60  ? 137 LYS A CA  1 
ATOM   1073 C C   . LYS A 1 137 ? -7.382  12.471  36.487  1.00 8.22  ? 137 LYS A C   1 
ATOM   1074 O O   . LYS A 1 137 ? -7.311  11.708  35.547  1.00 12.99 ? 137 LYS A O   1 
ATOM   1075 C CB  . LYS A 1 137 ? -7.092  14.449  35.210  1.00 2.00  ? 137 LYS A CB  1 
ATOM   1076 C CG  . LYS A 1 137 ? -6.735  15.917  35.200  1.00 5.66  ? 137 LYS A CG  1 
ATOM   1077 C CD  . LYS A 1 137 ? -7.882  16.912  35.553  1.00 9.12  ? 137 LYS A CD  1 
ATOM   1078 C CE  . LYS A 1 137 ? -7.537  18.370  35.191  1.00 9.99  ? 137 LYS A CE  1 
ATOM   1079 N NZ  . LYS A 1 137 ? -6.133  18.737  35.586  1.00 18.42 ? 137 LYS A NZ  1 
ATOM   1080 N N   . THR A 1 138 ? -7.757  12.072  37.658  1.00 12.47 ? 138 THR A N   1 
ATOM   1081 C CA  . THR A 1 138 ? -8.017  10.658  38.020  1.00 12.76 ? 138 THR A CA  1 
ATOM   1082 C C   . THR A 1 138 ? -8.876  10.693  39.355  1.00 9.59  ? 138 THR A C   1 
ATOM   1083 O O   . THR A 1 138 ? -8.666  11.631  40.126  1.00 9.62  ? 138 THR A O   1 
ATOM   1084 C CB  . THR A 1 138 ? -6.700  9.981   38.473  1.00 12.58 ? 138 THR A CB  1 
ATOM   1085 O OG1 . THR A 1 138 ? -5.523  10.662  38.057  1.00 17.54 ? 138 THR A OG1 1 
ATOM   1086 C CG2 . THR A 1 138 ? -6.709  8.491   38.271  1.00 9.39  ? 138 THR A CG2 1 
ATOM   1087 N N   . ASP A 1 139 ? -9.758  9.692   39.585  1.00 7.68  ? 139 ASP A N   1 
ATOM   1088 C CA  . ASP A 1 139 ? -10.512 9.803   40.834  1.00 9.29  ? 139 ASP A CA  1 
ATOM   1089 C C   . ASP A 1 139 ? -10.216 8.594   41.682  1.00 9.30  ? 139 ASP A C   1 
ATOM   1090 O O   . ASP A 1 139 ? -9.857  7.543   41.119  1.00 2.00  ? 139 ASP A O   1 
ATOM   1091 C CB  . ASP A 1 139 ? -12.003 10.065  40.497  1.00 10.64 ? 139 ASP A CB  1 
ATOM   1092 C CG  . ASP A 1 139 ? -13.148 9.372   41.270  1.00 13.75 ? 139 ASP A CG  1 
ATOM   1093 O OD1 . ASP A 1 139 ? -14.012 9.999   41.894  1.00 18.08 ? 139 ASP A OD1 1 
ATOM   1094 O OD2 . ASP A 1 139 ? -13.240 8.173   41.149  1.00 20.91 ? 139 ASP A OD2 1 
ATOM   1095 N N   . ILE A 1 140 ? -10.250 8.749   43.059  1.00 10.26 ? 140 ILE A N   1 
ATOM   1096 C CA  . ILE A 1 140 ? -9.791  7.578   43.760  1.00 2.90  ? 140 ILE A CA  1 
ATOM   1097 C C   . ILE A 1 140 ? -10.571 6.895   44.948  1.00 2.00  ? 140 ILE A C   1 
ATOM   1098 O O   . ILE A 1 140 ? -10.624 7.180   46.124  1.00 3.44  ? 140 ILE A O   1 
ATOM   1099 C CB  . ILE A 1 140 ? -8.271  7.887   43.937  1.00 11.59 ? 140 ILE A CB  1 
ATOM   1100 C CG1 . ILE A 1 140 ? -7.508  8.683   42.759  1.00 14.04 ? 140 ILE A CG1 1 
ATOM   1101 C CG2 . ILE A 1 140 ? -7.507  6.604   44.419  1.00 7.26  ? 140 ILE A CG2 1 
ATOM   1102 C CD1 . ILE A 1 140 ? -5.994  8.555   42.590  1.00 10.36 ? 140 ILE A CD1 1 
ATOM   1103 N N   . LYS A 1 141 ? -11.207 5.810   44.584  1.00 5.95  ? 141 LYS A N   1 
ATOM   1104 C CA  . LYS A 1 141 ? -12.209 5.282   45.603  1.00 7.67  ? 141 LYS A CA  1 
ATOM   1105 C C   . LYS A 1 141 ? -11.530 4.343   46.605  1.00 7.35  ? 141 LYS A C   1 
ATOM   1106 O O   . LYS A 1 141 ? -10.581 3.711   46.110  1.00 12.96 ? 141 LYS A O   1 
ATOM   1107 C CB  . LYS A 1 141 ? -13.315 4.373   44.951  1.00 6.46  ? 141 LYS A CB  1 
ATOM   1108 C CG  . LYS A 1 141 ? -14.777 4.848   44.740  1.00 8.16  ? 141 LYS A CG  1 
ATOM   1109 C CD  . LYS A 1 141 ? -14.870 6.189   44.015  1.00 10.13 ? 141 LYS A CD  1 
ATOM   1110 C CE  . LYS A 1 141 ? -15.458 7.335   44.847  1.00 12.17 ? 141 LYS A CE  1 
ATOM   1111 N NZ  . LYS A 1 141 ? -15.245 8.698   44.259  1.00 16.18 ? 141 LYS A NZ  1 
ATOM   1112 N N   . VAL A 1 142 ? -11.923 4.178   47.902  1.00 6.82  ? 142 VAL A N   1 
ATOM   1113 C CA  . VAL A 1 142 ? -11.027 3.289   48.673  1.00 2.00  ? 142 VAL A CA  1 
ATOM   1114 C C   . VAL A 1 142 ? -11.761 2.061   48.727  1.00 2.00  ? 142 VAL A C   1 
ATOM   1115 O O   . VAL A 1 142 ? -12.779 2.027   49.258  1.00 2.00  ? 142 VAL A O   1 
ATOM   1116 C CB  . VAL A 1 142 ? -10.673 3.803   50.107  1.00 6.30  ? 142 VAL A CB  1 
ATOM   1117 C CG1 . VAL A 1 142 ? -9.892  2.854   50.993  1.00 2.61  ? 142 VAL A CG1 1 
ATOM   1118 C CG2 . VAL A 1 142 ? -9.916  5.101   50.166  1.00 6.82  ? 142 VAL A CG2 1 
ATOM   1119 N N   . VAL A 1 143 ? -11.340 0.987   48.140  1.00 2.00  ? 143 VAL A N   1 
ATOM   1120 C CA  . VAL A 1 143 ? -12.286 -0.128  48.249  1.00 7.09  ? 143 VAL A CA  1 
ATOM   1121 C C   . VAL A 1 143 ? -12.300 -0.480  49.666  1.00 11.08 ? 143 VAL A C   1 
ATOM   1122 O O   . VAL A 1 143 ? -11.213 -0.767  50.116  1.00 12.34 ? 143 VAL A O   1 
ATOM   1123 C CB  . VAL A 1 143 ? -11.731 -1.385  47.611  1.00 4.80  ? 143 VAL A CB  1 
ATOM   1124 C CG1 . VAL A 1 143 ? -12.594 -2.652  47.840  1.00 4.50  ? 143 VAL A CG1 1 
ATOM   1125 C CG2 . VAL A 1 143 ? -11.493 -1.223  46.147  1.00 5.17  ? 143 VAL A CG2 1 
ATOM   1126 N N   . ASP A 1 144 ? -13.505 -0.523  50.273  1.00 15.61 ? 144 ASP A N   1 
ATOM   1127 C CA  . ASP A 1 144 ? -13.735 -1.166  51.584  1.00 16.16 ? 144 ASP A CA  1 
ATOM   1128 C C   . ASP A 1 144 ? -13.163 -2.555  51.703  1.00 16.32 ? 144 ASP A C   1 
ATOM   1129 O O   . ASP A 1 144 ? -13.697 -3.571  51.430  1.00 20.38 ? 144 ASP A O   1 
ATOM   1130 C CB  . ASP A 1 144 ? -15.215 -1.220  51.971  1.00 20.08 ? 144 ASP A CB  1 
ATOM   1131 C CG  . ASP A 1 144 ? -15.486 -1.431  53.554  1.00 30.13 ? 144 ASP A CG  1 
ATOM   1132 O OD1 . ASP A 1 144 ? -15.164 -2.463  54.207  1.00 31.52 ? 144 ASP A OD1 1 
ATOM   1133 O OD2 . ASP A 1 144 ? -16.018 -0.529  54.183  1.00 35.13 ? 144 ASP A OD2 1 
ATOM   1134 N N   . ARG A 1 145 ? -11.972 -2.684  52.092  1.00 18.03 ? 145 ARG A N   1 
ATOM   1135 C CA  . ARG A 1 145 ? -11.677 -3.777  53.031  1.00 18.24 ? 145 ARG A CA  1 
ATOM   1136 C C   . ARG A 1 145 ? -12.516 -5.090  53.197  1.00 16.34 ? 145 ARG A C   1 
ATOM   1137 O O   . ARG A 1 145 ? -12.144 -6.214  52.868  1.00 18.33 ? 145 ARG A O   1 
ATOM   1138 C CB  . ARG A 1 145 ? -11.340 -3.040  54.325  1.00 18.56 ? 145 ARG A CB  1 
ATOM   1139 C CG  . ARG A 1 145 ? -11.346 -1.456  54.165  1.00 23.84 ? 145 ARG A CG  1 
ATOM   1140 C CD  . ARG A 1 145 ? -12.649 -0.582  54.444  1.00 29.16 ? 145 ARG A CD  1 
ATOM   1141 N NE  . ARG A 1 145 ? -12.668 0.916   54.237  1.00 32.80 ? 145 ARG A NE  1 
ATOM   1142 C CZ  . ARG A 1 145 ? -13.589 1.858   54.747  1.00 30.04 ? 145 ARG A CZ  1 
ATOM   1143 N NH1 . ARG A 1 145 ? -14.811 1.570   55.194  1.00 28.95 ? 145 ARG A NH1 1 
ATOM   1144 N NH2 . ARG A 1 145 ? -13.244 3.146   54.822  1.00 33.03 ? 145 ARG A NH2 1 
ATOM   1145 N N   . ASP A 1 146 ? -13.680 -4.980  53.796  1.00 19.25 ? 146 ASP A N   1 
ATOM   1146 C CA  . ASP A 1 146 ? -14.542 -6.169  53.922  1.00 19.94 ? 146 ASP A CA  1 
ATOM   1147 C C   . ASP A 1 146 ? -15.252 -6.695  52.625  1.00 19.73 ? 146 ASP A C   1 
ATOM   1148 O O   . ASP A 1 146 ? -16.004 -7.660  52.580  1.00 21.90 ? 146 ASP A O   1 
ATOM   1149 C CB  . ASP A 1 146 ? -15.345 -6.016  55.288  1.00 19.77 ? 146 ASP A CB  1 
ATOM   1150 C CG  . ASP A 1 146 ? -14.442 -6.789  56.265  1.00 20.88 ? 146 ASP A CG  1 
ATOM   1151 O OD1 . ASP A 1 146 ? -14.697 -7.955  56.615  1.00 23.54 ? 146 ASP A OD1 1 
ATOM   1152 O OD2 . ASP A 1 146 ? -13.389 -6.240  56.560  1.00 21.49 ? 146 ASP A OD2 1 
ATOM   1153 N N   . SER A 1 147 ? -14.779 -6.141  51.512  1.00 13.58 ? 147 SER A N   1 
ATOM   1154 C CA  . SER A 1 147 ? -15.828 -6.368  50.496  1.00 16.24 ? 147 SER A CA  1 
ATOM   1155 C C   . SER A 1 147 ? -15.527 -7.642  49.810  1.00 17.20 ? 147 SER A C   1 
ATOM   1156 O O   . SER A 1 147 ? -14.335 -7.885  49.652  1.00 22.94 ? 147 SER A O   1 
ATOM   1157 C CB  . SER A 1 147 ? -15.809 -5.458  49.288  1.00 20.32 ? 147 SER A CB  1 
ATOM   1158 O OG  . SER A 1 147 ? -15.645 -4.048  49.525  1.00 14.39 ? 147 SER A OG  1 
ATOM   1159 N N   . GLU A 1 148 ? -16.482 -8.443  49.335  1.00 15.57 ? 148 GLU A N   1 
ATOM   1160 C CA  . GLU A 1 148 ? -15.947 -9.431  48.368  1.00 15.42 ? 148 GLU A CA  1 
ATOM   1161 C C   . GLU A 1 148 ? -14.936 -8.867  47.296  1.00 15.80 ? 148 GLU A C   1 
ATOM   1162 O O   . GLU A 1 148 ? -13.984 -9.565  46.932  1.00 16.89 ? 148 GLU A O   1 
ATOM   1163 C CB  . GLU A 1 148 ? -17.016 -10.323 47.669  1.00 15.85 ? 148 GLU A CB  1 
ATOM   1164 C CG  . GLU A 1 148 ? -17.115 -11.860 47.822  1.00 14.71 ? 148 GLU A CG  1 
ATOM   1165 C CD  . GLU A 1 148 ? -18.009 -12.237 49.079  1.00 18.32 ? 148 GLU A CD  1 
ATOM   1166 O OE1 . GLU A 1 148 ? -17.915 -13.434 49.467  1.00 19.38 ? 148 GLU A OE1 1 
ATOM   1167 O OE2 . GLU A 1 148 ? -18.784 -11.424 49.676  1.00 14.97 ? 148 GLU A OE2 1 
ATOM   1168 N N   . GLU A 1 149 ? -15.116 -7.583  46.887  1.00 11.73 ? 149 GLU A N   1 
ATOM   1169 C CA  . GLU A 1 149 ? -14.177 -7.009  45.973  1.00 6.60  ? 149 GLU A CA  1 
ATOM   1170 C C   . GLU A 1 149 ? -12.783 -6.900  46.406  1.00 6.41  ? 149 GLU A C   1 
ATOM   1171 O O   . GLU A 1 149 ? -11.960 -7.601  45.830  1.00 10.09 ? 149 GLU A O   1 
ATOM   1172 C CB  . GLU A 1 149 ? -14.659 -5.845  45.155  1.00 4.26  ? 149 GLU A CB  1 
ATOM   1173 C CG  . GLU A 1 149 ? -14.807 -4.326  45.345  1.00 2.00  ? 149 GLU A CG  1 
ATOM   1174 C CD  . GLU A 1 149 ? -14.498 -3.716  43.966  1.00 4.27  ? 149 GLU A CD  1 
ATOM   1175 O OE1 . GLU A 1 149 ? -14.730 -2.534  43.742  1.00 2.00  ? 149 GLU A OE1 1 
ATOM   1176 O OE2 . GLU A 1 149 ? -14.013 -4.485  43.120  1.00 14.00 ? 149 GLU A OE2 1 
ATOM   1177 N N   . ALA A 1 150 ? -12.515 -6.149  47.538  1.00 5.57  ? 150 ALA A N   1 
ATOM   1178 C CA  . ALA A 1 150 ? -11.223 -6.361  48.241  1.00 2.00  ? 150 ALA A CA  1 
ATOM   1179 C C   . ALA A 1 150 ? -10.756 -7.775  48.589  1.00 2.46  ? 150 ALA A C   1 
ATOM   1180 O O   . ALA A 1 150 ? -9.597  -8.136  48.430  1.00 8.50  ? 150 ALA A O   1 
ATOM   1181 C CB  . ALA A 1 150 ? -11.095 -5.399  49.438  1.00 2.00  ? 150 ALA A CB  1 
ATOM   1182 N N   . GLU A 1 151 ? -11.707 -8.594  48.973  1.00 2.00  ? 151 GLU A N   1 
ATOM   1183 C CA  . GLU A 1 151 ? -11.474 -10.046 49.044  1.00 4.38  ? 151 GLU A CA  1 
ATOM   1184 C C   . GLU A 1 151 ? -10.909 -10.796 47.889  1.00 2.26  ? 151 GLU A C   1 
ATOM   1185 O O   . GLU A 1 151 ? -9.845  -11.389 48.037  1.00 2.00  ? 151 GLU A O   1 
ATOM   1186 C CB  . GLU A 1 151 ? -12.641 -10.928 49.539  1.00 8.94  ? 151 GLU A CB  1 
ATOM   1187 C CG  . GLU A 1 151 ? -12.830 -11.075 51.073  1.00 20.08 ? 151 GLU A CG  1 
ATOM   1188 C CD  . GLU A 1 151 ? -13.335 -9.793  51.858  1.00 21.89 ? 151 GLU A CD  1 
ATOM   1189 O OE1 . GLU A 1 151 ? -12.646 -8.720  51.965  1.00 20.15 ? 151 GLU A OE1 1 
ATOM   1190 O OE2 . GLU A 1 151 ? -14.462 -9.946  52.387  1.00 20.36 ? 151 GLU A OE2 1 
ATOM   1191 N N   . ILE A 1 152 ? -11.635 -10.732 46.763  1.00 3.37  ? 152 ILE A N   1 
ATOM   1192 C CA  . ILE A 1 152 ? -11.169 -11.294 45.442  1.00 6.72  ? 152 ILE A CA  1 
ATOM   1193 C C   . ILE A 1 152 ? -9.722  -10.919 45.108  1.00 3.92  ? 152 ILE A C   1 
ATOM   1194 O O   . ILE A 1 152 ? -8.850  -11.763 45.154  1.00 6.38  ? 152 ILE A O   1 
ATOM   1195 C CB  . ILE A 1 152 ? -12.046 -10.962 44.123  1.00 7.52  ? 152 ILE A CB  1 
ATOM   1196 C CG1 . ILE A 1 152 ? -13.575 -11.201 44.090  1.00 11.18 ? 152 ILE A CG1 1 
ATOM   1197 C CG2 . ILE A 1 152 ? -11.387 -11.665 42.914  1.00 10.11 ? 152 ILE A CG2 1 
ATOM   1198 C CD1 . ILE A 1 152 ? -13.880 -12.627 44.486  1.00 7.80  ? 152 ILE A CD1 1 
ATOM   1199 N N   . ILE A 1 153 ? -9.515  -9.629  44.925  1.00 2.00  ? 153 ILE A N   1 
ATOM   1200 C CA  . ILE A 1 153 ? -8.194  -8.989  44.881  1.00 2.00  ? 153 ILE A CA  1 
ATOM   1201 C C   . ILE A 1 153 ? -6.999  -9.477  45.658  1.00 2.86  ? 153 ILE A C   1 
ATOM   1202 O O   . ILE A 1 153 ? -5.988  -9.804  45.053  1.00 2.00  ? 153 ILE A O   1 
ATOM   1203 C CB  . ILE A 1 153 ? -8.305  -7.505  45.133  1.00 2.00  ? 153 ILE A CB  1 
ATOM   1204 C CG1 . ILE A 1 153 ? -9.572  -6.861  44.595  1.00 2.00  ? 153 ILE A CG1 1 
ATOM   1205 C CG2 . ILE A 1 153 ? -7.027  -6.920  44.599  1.00 4.51  ? 153 ILE A CG2 1 
ATOM   1206 C CD1 . ILE A 1 153 ? -9.635  -5.381  44.667  1.00 2.00  ? 153 ILE A CD1 1 
ATOM   1207 N N   . ARG A 1 154 ? -7.226  -9.542  47.031  1.00 5.55  ? 154 ARG A N   1 
ATOM   1208 C CA  . ARG A 1 154 ? -6.339  -10.280 47.939  1.00 2.18  ? 154 ARG A CA  1 
ATOM   1209 C C   . ARG A 1 154 ? -6.165  -11.755 47.676  1.00 4.55  ? 154 ARG A C   1 
ATOM   1210 O O   . ARG A 1 154 ? -5.052  -12.207 47.856  1.00 6.65  ? 154 ARG A O   1 
ATOM   1211 C CB  . ARG A 1 154 ? -6.548  -10.024 49.409  1.00 2.00  ? 154 ARG A CB  1 
ATOM   1212 C CG  . ARG A 1 154 ? -6.253  -8.650  50.038  1.00 4.22  ? 154 ARG A CG  1 
ATOM   1213 C CD  . ARG A 1 154 ? -7.425  -7.970  50.831  1.00 7.96  ? 154 ARG A CD  1 
ATOM   1214 N NE  . ARG A 1 154 ? -8.057  -8.898  51.817  1.00 9.56  ? 154 ARG A NE  1 
ATOM   1215 C CZ  . ARG A 1 154 ? -9.380  -8.889  52.070  1.00 8.54  ? 154 ARG A CZ  1 
ATOM   1216 N NH1 . ARG A 1 154 ? -10.010 -9.931  52.579  1.00 9.34  ? 154 ARG A NH1 1 
ATOM   1217 N NH2 . ARG A 1 154 ? -10.058 -7.816  51.830  1.00 4.49  ? 154 ARG A NH2 1 
ATOM   1218 N N   . LYS A 1 155 ? -7.193  -12.536 47.163  1.00 5.82  ? 155 LYS A N   1 
ATOM   1219 C CA  . LYS A 1 155 ? -6.819  -13.907 46.601  1.00 5.23  ? 155 LYS A CA  1 
ATOM   1220 C C   . LYS A 1 155 ? -5.773  -13.872 45.493  1.00 2.00  ? 155 LYS A C   1 
ATOM   1221 O O   . LYS A 1 155 ? -4.735  -14.460 45.456  1.00 2.00  ? 155 LYS A O   1 
ATOM   1222 C CB  . LYS A 1 155 ? -8.009  -14.690 46.022  1.00 10.72 ? 155 LYS A CB  1 
ATOM   1223 C CG  . LYS A 1 155 ? -8.972  -15.218 47.116  1.00 15.53 ? 155 LYS A CG  1 
ATOM   1224 C CD  . LYS A 1 155 ? -10.383 -15.904 46.863  1.00 11.36 ? 155 LYS A CD  1 
ATOM   1225 C CE  . LYS A 1 155 ? -11.122 -16.462 48.171  1.00 7.33  ? 155 LYS A CE  1 
ATOM   1226 N NZ  . LYS A 1 155 ? -12.179 -15.534 48.688  1.00 2.76  ? 155 LYS A NZ  1 
ATOM   1227 N N   . TYR A 1 156 ? -6.025  -12.963 44.604  1.00 2.00  ? 156 TYR A N   1 
ATOM   1228 C CA  . TYR A 1 156 ? -5.100  -12.716 43.538  1.00 6.01  ? 156 TYR A CA  1 
ATOM   1229 C C   . TYR A 1 156 ? -3.661  -12.340 43.869  1.00 5.81  ? 156 TYR A C   1 
ATOM   1230 O O   . TYR A 1 156 ? -2.728  -12.759 43.182  1.00 2.00  ? 156 TYR A O   1 
ATOM   1231 C CB  . TYR A 1 156 ? -5.718  -11.641 42.612  1.00 8.86  ? 156 TYR A CB  1 
ATOM   1232 C CG  . TYR A 1 156 ? -5.239  -11.611 41.165  1.00 9.92  ? 156 TYR A CG  1 
ATOM   1233 C CD1 . TYR A 1 156 ? -4.368  -12.570 40.605  1.00 13.62 ? 156 TYR A CD1 1 
ATOM   1234 C CD2 . TYR A 1 156 ? -5.734  -10.581 40.389  1.00 6.19  ? 156 TYR A CD2 1 
ATOM   1235 C CE1 . TYR A 1 156 ? -4.004  -12.528 39.248  1.00 9.54  ? 156 TYR A CE1 1 
ATOM   1236 C CE2 . TYR A 1 156 ? -5.364  -10.484 39.049  1.00 6.12  ? 156 TYR A CE2 1 
ATOM   1237 C CZ  . TYR A 1 156 ? -4.507  -11.466 38.524  1.00 6.05  ? 156 TYR A CZ  1 
ATOM   1238 O OH  . TYR A 1 156 ? -4.133  -11.383 37.231  1.00 9.00  ? 156 TYR A OH  1 
ATOM   1239 N N   . VAL A 1 157 ? -3.466  -11.518 44.948  1.00 7.46  ? 157 VAL A N   1 
ATOM   1240 C CA  . VAL A 1 157 ? -2.043  -11.416 45.329  1.00 6.71  ? 157 VAL A CA  1 
ATOM   1241 C C   . VAL A 1 157 ? -1.464  -12.702 45.983  1.00 11.28 ? 157 VAL A C   1 
ATOM   1242 O O   . VAL A 1 157 ? -0.341  -13.153 45.739  1.00 13.18 ? 157 VAL A O   1 
ATOM   1243 C CB  . VAL A 1 157 ? -1.943  -10.215 46.211  1.00 2.92  ? 157 VAL A CB  1 
ATOM   1244 C CG1 . VAL A 1 157 ? -0.468  -9.884  46.572  1.00 2.00  ? 157 VAL A CG1 1 
ATOM   1245 C CG2 . VAL A 1 157 ? -2.607  -9.077  45.424  1.00 2.00  ? 157 VAL A CG2 1 
ATOM   1246 N N   . LYS A 1 158 ? -2.429  -13.308 46.690  1.00 12.16 ? 158 LYS A N   1 
ATOM   1247 C CA  . LYS A 1 158 ? -2.141  -14.517 47.332  1.00 13.19 ? 158 LYS A CA  1 
ATOM   1248 C C   . LYS A 1 158 ? -1.561  -15.576 46.422  1.00 13.41 ? 158 LYS A C   1 
ATOM   1249 O O   . LYS A 1 158 ? -0.381  -16.001 46.499  1.00 17.10 ? 158 LYS A O   1 
ATOM   1250 C CB  . LYS A 1 158 ? -3.407  -14.957 47.993  1.00 18.90 ? 158 LYS A CB  1 
ATOM   1251 C CG  . LYS A 1 158 ? -3.433  -16.396 48.618  1.00 19.13 ? 158 LYS A CG  1 
ATOM   1252 C CD  . LYS A 1 158 ? -2.340  -16.692 49.639  1.00 19.53 ? 158 LYS A CD  1 
ATOM   1253 C CE  . LYS A 1 158 ? -2.765  -17.950 50.391  1.00 19.65 ? 158 LYS A CE  1 
ATOM   1254 N NZ  . LYS A 1 158 ? -2.719  -19.176 49.536  1.00 22.51 ? 158 LYS A NZ  1 
ATOM   1255 N N   . ASN A 1 159 ? -2.485  -16.004 45.564  1.00 11.04 ? 159 ASN A N   1 
ATOM   1256 C CA  . ASN A 1 159 ? -2.242  -17.212 44.788  1.00 4.95  ? 159 ASN A CA  1 
ATOM   1257 C C   . ASN A 1 159 ? -1.233  -17.123 43.720  1.00 3.04  ? 159 ASN A C   1 
ATOM   1258 O O   . ASN A 1 159 ? -0.859  -18.093 43.105  1.00 2.00  ? 159 ASN A O   1 
ATOM   1259 C CB  . ASN A 1 159 ? -3.518  -17.727 44.133  1.00 5.88  ? 159 ASN A CB  1 
ATOM   1260 C CG  . ASN A 1 159 ? -4.530  -17.840 45.202  1.00 4.03  ? 159 ASN A CG  1 
ATOM   1261 O OD1 . ASN A 1 159 ? -5.113  -16.831 45.529  1.00 11.96 ? 159 ASN A OD1 1 
ATOM   1262 N ND2 . ASN A 1 159 ? -4.638  -19.034 45.678  1.00 2.00  ? 159 ASN A ND2 1 
ATOM   1263 N N   . THR A 1 160 ? -0.844  -15.932 43.492  1.00 2.00  ? 160 THR A N   1 
ATOM   1264 C CA  . THR A 1 160 ? 0.047   -15.755 42.369  1.00 2.00  ? 160 THR A CA  1 
ATOM   1265 C C   . THR A 1 160 ? 1.313   -15.056 42.825  1.00 2.00  ? 160 THR A C   1 
ATOM   1266 O O   . THR A 1 160 ? 2.153   -14.566 42.062  1.00 2.00  ? 160 THR A O   1 
ATOM   1267 C CB  . THR A 1 160 ? -0.680  -14.838 41.418  1.00 3.05  ? 160 THR A CB  1 
ATOM   1268 O OG1 . THR A 1 160 ? -0.805  -13.514 42.011  1.00 2.60  ? 160 THR A OG1 1 
ATOM   1269 C CG2 . THR A 1 160 ? -2.027  -15.385 40.863  1.00 2.00  ? 160 THR A CG2 1 
ATOM   1270 N N   . HIS A 1 161 ? 1.393   -14.999 44.204  1.00 5.82  ? 161 HIS A N   1 
ATOM   1271 C CA  . HIS A 1 161 ? 2.676   -15.009 44.848  1.00 4.42  ? 161 HIS A CA  1 
ATOM   1272 C C   . HIS A 1 161 ? 3.449   -16.225 44.506  1.00 4.47  ? 161 HIS A C   1 
ATOM   1273 O O   . HIS A 1 161 ? 3.121   -17.355 44.734  1.00 8.49  ? 161 HIS A O   1 
ATOM   1274 C CB  . HIS A 1 161 ? 2.614   -14.648 46.377  1.00 2.47  ? 161 HIS A CB  1 
ATOM   1275 C CG  . HIS A 1 161 ? 3.896   -13.783 46.805  1.00 2.00  ? 161 HIS A CG  1 
ATOM   1276 N ND1 . HIS A 1 161 ? 5.233   -13.942 46.441  1.00 2.00  ? 161 HIS A ND1 1 
ATOM   1277 C CD2 . HIS A 1 161 ? 3.837   -12.545 47.416  1.00 2.00  ? 161 HIS A CD2 1 
ATOM   1278 C CE1 . HIS A 1 161 ? 5.895   -12.833 46.794  1.00 3.79  ? 161 HIS A CE1 1 
ATOM   1279 N NE2 . HIS A 1 161 ? 5.050   -11.940 47.393  1.00 8.15  ? 161 HIS A NE2 1 
ATOM   1280 N N   . ALA A 1 162 ? 4.494   -15.971 43.847  1.00 7.45  ? 162 ALA A N   1 
ATOM   1281 C CA  . ALA A 1 162 ? 5.068   -17.172 43.267  1.00 9.79  ? 162 ALA A CA  1 
ATOM   1282 C C   . ALA A 1 162 ? 6.221   -17.924 44.058  1.00 10.73 ? 162 ALA A C   1 
ATOM   1283 O O   . ALA A 1 162 ? 7.234   -17.306 44.295  1.00 12.71 ? 162 ALA A O   1 
ATOM   1284 C CB  . ALA A 1 162 ? 5.494   -16.687 41.858  1.00 16.09 ? 162 ALA A CB  1 
ATOM   1285 N N   . THR A 1 163 ? 6.111   -19.231 44.483  1.00 15.20 ? 163 THR A N   1 
ATOM   1286 C CA  . THR A 1 163 ? 7.342   -20.056 44.407  1.00 17.62 ? 163 THR A CA  1 
ATOM   1287 C C   . THR A 1 163 ? 8.790   -19.362 44.503  1.00 18.71 ? 163 THR A C   1 
ATOM   1288 O O   . THR A 1 163 ? 9.268   -18.908 45.555  1.00 20.00 ? 163 THR A O   1 
ATOM   1289 C CB  . THR A 1 163 ? 7.164   -20.662 43.022  1.00 17.74 ? 163 THR A CB  1 
ATOM   1290 O OG1 . THR A 1 163 ? 6.540   -19.698 42.053  1.00 20.01 ? 163 THR A OG1 1 
ATOM   1291 C CG2 . THR A 1 163 ? 6.341   -21.955 43.124  1.00 21.25 ? 163 THR A CG2 1 
ATOM   1292 N N   . THR A 1 164 ? 9.456   -19.176 43.306  1.00 19.73 ? 164 THR A N   1 
ATOM   1293 C CA  . THR A 1 164 ? 10.716  -18.362 43.158  1.00 16.88 ? 164 THR A CA  1 
ATOM   1294 C C   . THR A 1 164 ? 10.777  -16.975 43.824  1.00 15.64 ? 164 THR A C   1 
ATOM   1295 O O   . THR A 1 164 ? 11.753  -16.498 44.321  1.00 14.26 ? 164 THR A O   1 
ATOM   1296 C CB  . THR A 1 164 ? 11.112  -18.221 41.638  1.00 15.35 ? 164 THR A CB  1 
ATOM   1297 O OG1 . THR A 1 164 ? 10.284  -17.244 41.044  1.00 15.39 ? 164 THR A OG1 1 
ATOM   1298 C CG2 . THR A 1 164 ? 10.849  -19.481 40.861  1.00 11.12 ? 164 THR A CG2 1 
ATOM   1299 N N   . HIS A 1 165 ? 9.685   -16.302 43.865  1.00 16.07 ? 165 HIS A N   1 
ATOM   1300 C CA  . HIS A 1 165 ? 9.810   -15.000 44.516  1.00 17.52 ? 165 HIS A CA  1 
ATOM   1301 C C   . HIS A 1 165 ? 8.913   -14.535 45.655  1.00 19.44 ? 165 HIS A C   1 
ATOM   1302 O O   . HIS A 1 165 ? 8.641   -13.371 45.860  1.00 19.47 ? 165 HIS A O   1 
ATOM   1303 C CB  . HIS A 1 165 ? 10.074  -13.812 43.649  1.00 13.49 ? 165 HIS A CB  1 
ATOM   1304 C CG  . HIS A 1 165 ? 9.626   -13.684 42.212  1.00 14.11 ? 165 HIS A CG  1 
ATOM   1305 N ND1 . HIS A 1 165 ? 9.919   -14.451 41.175  1.00 6.27  ? 165 HIS A ND1 1 
ATOM   1306 C CD2 . HIS A 1 165 ? 8.952   -12.580 41.725  1.00 7.84  ? 165 HIS A CD2 1 
ATOM   1307 C CE1 . HIS A 1 165 ? 9.452   -13.869 40.066  1.00 6.26  ? 165 HIS A CE1 1 
ATOM   1308 N NE2 . HIS A 1 165 ? 8.820   -12.697 40.398  1.00 9.06  ? 165 HIS A NE2 1 
ATOM   1309 N N   . ASN A 1 166 ? 8.566   -15.562 46.476  1.00 22.85 ? 166 ASN A N   1 
ATOM   1310 C CA  . ASN A 1 166 ? 9.294   -15.850 47.779  1.00 22.26 ? 166 ASN A CA  1 
ATOM   1311 C C   . ASN A 1 166 ? 10.884  -16.109 47.779  1.00 19.96 ? 166 ASN A C   1 
ATOM   1312 O O   . ASN A 1 166 ? 11.433  -17.196 47.607  1.00 17.33 ? 166 ASN A O   1 
ATOM   1313 C CB  . ASN A 1 166 ? 8.466   -16.967 48.503  1.00 22.40 ? 166 ASN A CB  1 
ATOM   1314 C CG  . ASN A 1 166 ? 7.053   -16.463 48.991  1.00 26.23 ? 166 ASN A CG  1 
ATOM   1315 O OD1 . ASN A 1 166 ? 7.026   -15.720 49.981  1.00 27.64 ? 166 ASN A OD1 1 
ATOM   1316 N ND2 . ASN A 1 166 ? 5.892   -16.897 48.339  1.00 19.90 ? 166 ASN A ND2 1 
ATOM   1317 N N   . ALA A 1 167 ? 11.599  -15.016 47.995  1.00 17.69 ? 167 ALA A N   1 
ATOM   1318 C CA  . ALA A 1 167 ? 10.984  -14.208 49.068  1.00 20.22 ? 167 ALA A CA  1 
ATOM   1319 C C   . ALA A 1 167 ? 11.544  -12.816 49.183  1.00 21.34 ? 167 ALA A C   1 
ATOM   1320 O O   . ALA A 1 167 ? 12.539  -12.605 48.509  1.00 23.61 ? 167 ALA A O   1 
ATOM   1321 C CB  . ALA A 1 167 ? 11.215  -14.878 50.389  1.00 20.90 ? 167 ALA A CB  1 
ATOM   1322 N N   . TYR A 1 168 ? 11.056  -11.856 49.986  1.00 17.45 ? 168 TYR A N   1 
ATOM   1323 C CA  . TYR A 1 168 ? 9.749   -11.343 50.412  1.00 14.26 ? 168 TYR A CA  1 
ATOM   1324 C C   . TYR A 1 168 ? 8.318   -11.994 50.280  1.00 15.53 ? 168 TYR A C   1 
ATOM   1325 O O   . TYR A 1 168 ? 7.950   -12.716 49.342  1.00 11.33 ? 168 TYR A O   1 
ATOM   1326 C CB  . TYR A 1 168 ? 9.834   -9.880  49.890  1.00 13.00 ? 168 TYR A CB  1 
ATOM   1327 C CG  . TYR A 1 168 ? 9.394   -9.696  48.432  1.00 14.44 ? 168 TYR A CG  1 
ATOM   1328 C CD1 . TYR A 1 168 ? 7.996   -9.498  48.266  1.00 16.97 ? 168 TYR A CD1 1 
ATOM   1329 C CD2 . TYR A 1 168 ? 10.280  -9.852  47.354  1.00 13.34 ? 168 TYR A CD2 1 
ATOM   1330 C CE1 . TYR A 1 168 ? 7.383   -9.548  47.025  1.00 18.21 ? 168 TYR A CE1 1 
ATOM   1331 C CE2 . TYR A 1 168 ? 9.671   -9.814  46.079  1.00 11.02 ? 168 TYR A CE2 1 
ATOM   1332 C CZ  . TYR A 1 168 ? 8.285   -9.542  45.959  1.00 11.59 ? 168 TYR A CZ  1 
ATOM   1333 O OH  . TYR A 1 168 ? 7.750   -9.038  44.803  1.00 16.71 ? 168 TYR A OH  1 
ATOM   1334 N N   . ASP A 1 169 ? 7.499   -11.587 51.242  1.00 16.08 ? 169 ASP A N   1 
ATOM   1335 C CA  . ASP A 1 169 ? 6.102   -12.010 51.132  1.00 21.05 ? 169 ASP A CA  1 
ATOM   1336 C C   . ASP A 1 169 ? 5.224   -10.853 51.364  1.00 17.65 ? 169 ASP A C   1 
ATOM   1337 O O   . ASP A 1 169 ? 5.682   -9.749  51.593  1.00 17.18 ? 169 ASP A O   1 
ATOM   1338 C CB  . ASP A 1 169 ? 5.699   -13.276 51.957  1.00 29.05 ? 169 ASP A CB  1 
ATOM   1339 C CG  . ASP A 1 169 ? 4.740   -14.309 51.191  1.00 39.59 ? 169 ASP A CG  1 
ATOM   1340 O OD1 . ASP A 1 169 ? 4.695   -14.301 49.938  1.00 42.69 ? 169 ASP A OD1 1 
ATOM   1341 O OD2 . ASP A 1 169 ? 4.058   -15.140 51.852  1.00 42.58 ? 169 ASP A OD2 1 
ATOM   1342 N N   . LEU A 1 170 ? 3.960   -10.980 51.148  1.00 18.58 ? 170 LEU A N   1 
ATOM   1343 C CA  . LEU A 1 170 ? 3.412   -9.690  50.618  1.00 22.20 ? 170 LEU A CA  1 
ATOM   1344 C C   . LEU A 1 170 ? 2.119   -9.211  51.288  1.00 23.68 ? 170 LEU A C   1 
ATOM   1345 O O   . LEU A 1 170 ? 1.379   -10.056 51.703  1.00 21.20 ? 170 LEU A O   1 
ATOM   1346 C CB  . LEU A 1 170 ? 3.288   -9.814  49.063  1.00 21.87 ? 170 LEU A CB  1 
ATOM   1347 C CG  . LEU A 1 170 ? 3.240   -8.684  48.011  1.00 18.37 ? 170 LEU A CG  1 
ATOM   1348 C CD1 . LEU A 1 170 ? 4.308   -7.651  48.191  1.00 18.11 ? 170 LEU A CD1 1 
ATOM   1349 C CD2 . LEU A 1 170 ? 3.313   -9.224  46.584  1.00 15.44 ? 170 LEU A CD2 1 
ATOM   1350 N N   . GLU A 1 171 ? 1.890   -7.866  51.479  1.00 22.77 ? 171 GLU A N   1 
ATOM   1351 C CA  . GLU A 1 171 ? 0.497   -7.565  51.906  1.00 22.29 ? 171 GLU A CA  1 
ATOM   1352 C C   . GLU A 1 171 ? -0.312  -6.252  51.650  1.00 20.43 ? 171 GLU A C   1 
ATOM   1353 O O   . GLU A 1 171 ? 0.213   -5.155  51.381  1.00 23.05 ? 171 GLU A O   1 
ATOM   1354 C CB  . GLU A 1 171 ? 0.193   -7.976  53.359  1.00 23.10 ? 171 GLU A CB  1 
ATOM   1355 C CG  . GLU A 1 171 ? 1.361   -8.157  54.350  1.00 28.21 ? 171 GLU A CG  1 
ATOM   1356 C CD  . GLU A 1 171 ? 1.774   -6.898  55.183  1.00 31.75 ? 171 GLU A CD  1 
ATOM   1357 O OE1 . GLU A 1 171 ? 1.247   -5.791  54.938  1.00 35.71 ? 171 GLU A OE1 1 
ATOM   1358 O OE2 . GLU A 1 171 ? 2.640   -7.045  56.083  1.00 30.99 ? 171 GLU A OE2 1 
ATOM   1359 N N   . VAL A 1 172 ? -1.640  -6.350  51.749  1.00 15.10 ? 172 VAL A N   1 
ATOM   1360 C CA  . VAL A 1 172 ? -2.353  -5.209  51.154  1.00 9.63  ? 172 VAL A CA  1 
ATOM   1361 C C   . VAL A 1 172 ? -2.671  -4.073  52.131  1.00 9.42  ? 172 VAL A C   1 
ATOM   1362 O O   . VAL A 1 172 ? -3.505  -4.027  52.992  1.00 8.62  ? 172 VAL A O   1 
ATOM   1363 C CB  . VAL A 1 172 ? -3.654  -5.538  50.240  1.00 4.94  ? 172 VAL A CB  1 
ATOM   1364 C CG1 . VAL A 1 172 ? -4.150  -4.354  49.508  1.00 4.56  ? 172 VAL A CG1 1 
ATOM   1365 C CG2 . VAL A 1 172 ? -3.512  -6.574  49.195  1.00 2.00  ? 172 VAL A CG2 1 
ATOM   1366 N N   . ILE A 1 173 ? -2.022  -2.973  51.847  1.00 7.78  ? 173 ILE A N   1 
ATOM   1367 C CA  . ILE A 1 173 ? -2.254  -1.956  52.855  1.00 5.23  ? 173 ILE A CA  1 
ATOM   1368 C C   . ILE A 1 173 ? -3.532  -1.256  52.704  1.00 4.68  ? 173 ILE A C   1 
ATOM   1369 O O   . ILE A 1 173 ? -4.316  -1.289  53.623  1.00 6.60  ? 173 ILE A O   1 
ATOM   1370 C CB  . ILE A 1 173 ? -1.047  -1.057  52.862  1.00 7.20  ? 173 ILE A CB  1 
ATOM   1371 C CG1 . ILE A 1 173 ? 0.193   -1.848  53.347  1.00 7.48  ? 173 ILE A CG1 1 
ATOM   1372 C CG2 . ILE A 1 173 ? -1.215  0.030   53.857  1.00 11.07 ? 173 ILE A CG2 1 
ATOM   1373 C CD1 . ILE A 1 173 ? 1.412   -1.004  53.165  1.00 12.47 ? 173 ILE A CD1 1 
ATOM   1374 N N   . ASP A 1 174 ? -3.659  -0.684  51.504  1.00 3.63  ? 174 ASP A N   1 
ATOM   1375 C CA  . ASP A 1 174 ? -4.932  -0.109  51.005  1.00 2.00  ? 174 ASP A CA  1 
ATOM   1376 C C   . ASP A 1 174 ? -5.371  -0.591  49.637  1.00 4.39  ? 174 ASP A C   1 
ATOM   1377 O O   . ASP A 1 174 ? -4.514  -0.952  48.797  1.00 6.63  ? 174 ASP A O   1 
ATOM   1378 C CB  . ASP A 1 174 ? -4.775  1.369   50.735  1.00 2.00  ? 174 ASP A CB  1 
ATOM   1379 C CG  . ASP A 1 174 ? -4.645  1.986   52.042  1.00 5.70  ? 174 ASP A CG  1 
ATOM   1380 O OD1 . ASP A 1 174 ? -3.767  2.887   52.197  1.00 5.17  ? 174 ASP A OD1 1 
ATOM   1381 O OD2 . ASP A 1 174 ? -5.429  1.522   52.927  1.00 13.40 ? 174 ASP A OD2 1 
ATOM   1382 N N   . ILE A 1 175 ? -6.671  -0.475  49.339  1.00 2.32  ? 175 ILE A N   1 
ATOM   1383 C CA  . ILE A 1 175 ? -6.975  -0.881  47.975  1.00 5.94  ? 175 ILE A CA  1 
ATOM   1384 C C   . ILE A 1 175 ? -7.839  0.030   47.118  1.00 7.61  ? 175 ILE A C   1 
ATOM   1385 O O   . ILE A 1 175 ? -9.058  0.021   47.084  1.00 7.26  ? 175 ILE A O   1 
ATOM   1386 C CB  . ILE A 1 175 ? -7.197  -2.475  47.907  1.00 9.45  ? 175 ILE A CB  1 
ATOM   1387 C CG1 . ILE A 1 175 ? -8.233  -3.216  47.165  1.00 7.15  ? 175 ILE A CG1 1 
ATOM   1388 C CG2 . ILE A 1 175 ? -7.146  -3.117  49.321  1.00 5.63  ? 175 ILE A CG2 1 
ATOM   1389 C CD1 . ILE A 1 175 ? -7.903  -4.641  47.610  1.00 7.33  ? 175 ILE A CD1 1 
ATOM   1390 N N   . PHE A 1 176 ? -7.101  0.887   46.313  1.00 8.21  ? 176 PHE A N   1 
ATOM   1391 C CA  . PHE A 1 176 ? -7.915  1.943   45.592  1.00 6.39  ? 176 PHE A CA  1 
ATOM   1392 C C   . PHE A 1 176 ? -8.463  1.544   44.242  1.00 7.28  ? 176 PHE A C   1 
ATOM   1393 O O   . PHE A 1 176 ? -7.777  1.046   43.365  1.00 10.76 ? 176 PHE A O   1 
ATOM   1394 C CB  . PHE A 1 176 ? -7.256  3.281   45.254  1.00 4.75  ? 176 PHE A CB  1 
ATOM   1395 C CG  . PHE A 1 176 ? -6.323  3.792   46.347  1.00 2.12  ? 176 PHE A CG  1 
ATOM   1396 C CD1 . PHE A 1 176 ? -6.694  4.952   47.057  1.00 2.00  ? 176 PHE A CD1 1 
ATOM   1397 C CD2 . PHE A 1 176 ? -5.107  3.125   46.657  1.00 4.35  ? 176 PHE A CD2 1 
ATOM   1398 C CE1 . PHE A 1 176 ? -5.917  5.308   48.197  1.00 5.83  ? 176 PHE A CE1 1 
ATOM   1399 C CE2 . PHE A 1 176 ? -4.325  3.524   47.741  1.00 2.00  ? 176 PHE A CE2 1 
ATOM   1400 C CZ  . PHE A 1 176 ? -4.795  4.551   48.540  1.00 4.94  ? 176 PHE A CZ  1 
ATOM   1401 N N   . LYS A 1 177 ? -9.762  1.801   44.118  1.00 2.48  ? 177 LYS A N   1 
ATOM   1402 C CA  . LYS A 1 177 ? -10.381 1.796   42.765  1.00 5.45  ? 177 LYS A CA  1 
ATOM   1403 C C   . LYS A 1 177 ? -10.176 3.146   41.988  1.00 6.71  ? 177 LYS A C   1 
ATOM   1404 O O   . LYS A 1 177 ? -10.217 4.198   42.621  1.00 8.58  ? 177 LYS A O   1 
ATOM   1405 C CB  . LYS A 1 177 ? -11.840 1.421   42.945  1.00 10.08 ? 177 LYS A CB  1 
ATOM   1406 C CG  . LYS A 1 177 ? -12.753 1.566   41.728  1.00 14.17 ? 177 LYS A CG  1 
ATOM   1407 C CD  . LYS A 1 177 ? -12.323 0.750   40.465  1.00 20.42 ? 177 LYS A CD  1 
ATOM   1408 C CE  . LYS A 1 177 ? -13.070 1.413   39.253  1.00 20.27 ? 177 LYS A CE  1 
ATOM   1409 N NZ  . LYS A 1 177 ? -13.275 2.906   39.455  1.00 27.45 ? 177 LYS A NZ  1 
ATOM   1410 N N   . ILE A 1 178 ? -9.894  3.025   40.645  1.00 2.34  ? 178 ILE A N   1 
ATOM   1411 C CA  . ILE A 1 178 ? -9.683  4.201   39.777  1.00 3.92  ? 178 ILE A CA  1 
ATOM   1412 C C   . ILE A 1 178 ? -10.329 4.360   38.468  1.00 8.98  ? 178 ILE A C   1 
ATOM   1413 O O   . ILE A 1 178 ? -10.129 3.451   37.691  1.00 10.91 ? 178 ILE A O   1 
ATOM   1414 C CB  . ILE A 1 178 ? -8.372  4.435   39.185  1.00 3.38  ? 178 ILE A CB  1 
ATOM   1415 C CG1 . ILE A 1 178 ? -7.228  3.408   39.053  1.00 9.50  ? 178 ILE A CG1 1 
ATOM   1416 C CG2 . ILE A 1 178 ? -8.093  5.826   39.677  1.00 9.70  ? 178 ILE A CG2 1 
ATOM   1417 C CD1 . ILE A 1 178 ? -5.872  4.026   39.617  1.00 2.00  ? 178 ILE A CD1 1 
ATOM   1418 N N   . GLU A 1 179 ? -10.972 5.524   38.236  1.00 8.83  ? 179 GLU A N   1 
ATOM   1419 C CA  . GLU A 1 179 ? -11.271 5.862   36.847  1.00 7.67  ? 179 GLU A CA  1 
ATOM   1420 C C   . GLU A 1 179 ? -10.433 7.011   36.458  1.00 5.69  ? 179 GLU A C   1 
ATOM   1421 O O   . GLU A 1 179 ? -10.689 8.107   36.948  1.00 2.00  ? 179 GLU A O   1 
ATOM   1422 C CB  . GLU A 1 179 ? -12.754 6.151   36.479  1.00 7.86  ? 179 GLU A CB  1 
ATOM   1423 C CG  . GLU A 1 179 ? -13.763 6.617   37.570  1.00 12.76 ? 179 GLU A CG  1 
ATOM   1424 C CD  . GLU A 1 179 ? -14.635 5.546   38.279  1.00 15.00 ? 179 GLU A CD  1 
ATOM   1425 O OE1 . GLU A 1 179 ? -14.770 4.438   37.713  1.00 14.40 ? 179 GLU A OE1 1 
ATOM   1426 O OE2 . GLU A 1 179 ? -15.196 5.850   39.384  1.00 8.13  ? 179 GLU A OE2 1 
ATOM   1427 N N   . ARG A 1 180 ? -9.393  6.787   35.668  1.00 9.30  ? 180 ARG A N   1 
ATOM   1428 C CA  . ARG A 1 180 ? -8.982  8.081   35.142  1.00 11.06 ? 180 ARG A CA  1 
ATOM   1429 C C   . ARG A 1 180 ? -9.669  8.749   33.907  1.00 14.51 ? 180 ARG A C   1 
ATOM   1430 O O   . ARG A 1 180 ? -10.357 8.198   33.046  1.00 16.28 ? 180 ARG A O   1 
ATOM   1431 C CB  . ARG A 1 180 ? -7.490  8.166   34.998  1.00 5.29  ? 180 ARG A CB  1 
ATOM   1432 C CG  . ARG A 1 180 ? -6.762  6.963   34.450  1.00 7.32  ? 180 ARG A CG  1 
ATOM   1433 C CD  . ARG A 1 180 ? -5.263  7.259   34.211  1.00 6.01  ? 180 ARG A CD  1 
ATOM   1434 N NE  . ARG A 1 180 ? -4.997  7.361   32.784  1.00 2.01  ? 180 ARG A NE  1 
ATOM   1435 C CZ  . ARG A 1 180 ? -4.897  8.580   32.329  1.00 7.07  ? 180 ARG A CZ  1 
ATOM   1436 N NH1 . ARG A 1 180 ? -5.157  9.663   33.109  1.00 6.88  ? 180 ARG A NH1 1 
ATOM   1437 N NH2 . ARG A 1 180 ? -4.522  8.664   31.051  1.00 11.09 ? 180 ARG A NH2 1 
ATOM   1438 N N   . GLU A 1 181 ? -9.537  10.063  33.891  1.00 15.78 ? 181 GLU A N   1 
ATOM   1439 C CA  . GLU A 1 181 ? -10.557 10.909  33.233  1.00 20.03 ? 181 GLU A CA  1 
ATOM   1440 C C   . GLU A 1 181 ? -10.815 10.646  31.657  1.00 23.20 ? 181 GLU A C   1 
ATOM   1441 O O   . GLU A 1 181 ? -9.966  10.830  30.813  1.00 22.99 ? 181 GLU A O   1 
ATOM   1442 C CB  . GLU A 1 181 ? -10.235 12.382  33.612  1.00 18.28 ? 181 GLU A CB  1 
ATOM   1443 C CG  . GLU A 1 181 ? -11.201 13.523  33.244  1.00 18.90 ? 181 GLU A CG  1 
ATOM   1444 C CD  . GLU A 1 181 ? -10.491 14.746  32.529  1.00 20.88 ? 181 GLU A CD  1 
ATOM   1445 O OE1 . GLU A 1 181 ? -11.165 15.813  32.357  1.00 20.67 ? 181 GLU A OE1 1 
ATOM   1446 O OE2 . GLU A 1 181 ? -9.287  14.644  32.115  1.00 19.35 ? 181 GLU A OE2 1 
ATOM   1447 N N   . GLY A 1 182 ? -12.028 10.208  31.311  1.00 26.00 ? 182 GLY A N   1 
ATOM   1448 C CA  . GLY A 1 182 ? -11.997 9.906   29.865  1.00 22.36 ? 182 GLY A CA  1 
ATOM   1449 C C   . GLY A 1 182 ? -11.324 8.614   29.338  1.00 23.67 ? 182 GLY A C   1 
ATOM   1450 O O   . GLY A 1 182 ? -11.651 8.155   28.255  1.00 23.77 ? 182 GLY A O   1 
ATOM   1451 N N   . GLU A 1 183 ? -10.511 7.922   30.175  1.00 19.63 ? 183 GLU A N   1 
ATOM   1452 C CA  . GLU A 1 183 ? -10.143 6.606   29.693  1.00 11.19 ? 183 GLU A CA  1 
ATOM   1453 C C   . GLU A 1 183 ? -11.300 5.577   29.379  1.00 9.63  ? 183 GLU A C   1 
ATOM   1454 O O   . GLU A 1 183 ? -11.109 4.635   28.661  1.00 9.62  ? 183 GLU A O   1 
ATOM   1455 C CB  . GLU A 1 183 ? -8.953  6.204   30.536  1.00 5.34  ? 183 GLU A CB  1 
ATOM   1456 C CG  . GLU A 1 183 ? -8.070  4.980   30.076  1.00 6.80  ? 183 GLU A CG  1 
ATOM   1457 C CD  . GLU A 1 183 ? -7.042  4.455   31.117  1.00 3.58  ? 183 GLU A CD  1 
ATOM   1458 O OE1 . GLU A 1 183 ? -7.165  3.362   31.585  1.00 2.00  ? 183 GLU A OE1 1 
ATOM   1459 O OE2 . GLU A 1 183 ? -6.113  5.156   31.452  1.00 2.00  ? 183 GLU A OE2 1 
ATOM   1460 N N   . CYS A 1 184 ? -12.541 5.834   29.738  1.00 10.60 ? 184 CYS A N   1 
ATOM   1461 C CA  . CYS A 1 184 ? -13.544 4.923   29.150  1.00 10.59 ? 184 CYS A CA  1 
ATOM   1462 C C   . CYS A 1 184 ? -13.784 4.908   27.643  1.00 12.03 ? 184 CYS A C   1 
ATOM   1463 O O   . CYS A 1 184 ? -13.500 3.948   26.939  1.00 16.72 ? 184 CYS A O   1 
ATOM   1464 C CB  . CYS A 1 184 ? -14.957 5.019   29.777  1.00 13.72 ? 184 CYS A CB  1 
ATOM   1465 S SG  . CYS A 1 184 ? -15.452 3.296   29.796  1.00 19.12 ? 184 CYS A SG  1 
ATOM   1466 N N   . GLN A 1 185 ? -14.227 6.107   27.167  1.00 12.58 ? 185 GLN A N   1 
ATOM   1467 C CA  . GLN A 1 185 ? -13.875 6.493   25.795  1.00 13.54 ? 185 GLN A CA  1 
ATOM   1468 C C   . GLN A 1 185 ? -12.762 5.787   24.967  1.00 13.68 ? 185 GLN A C   1 
ATOM   1469 O O   . GLN A 1 185 ? -12.978 4.910   24.130  1.00 18.96 ? 185 GLN A O   1 
ATOM   1470 C CB  . GLN A 1 185 ? -13.660 8.032   25.635  1.00 13.32 ? 185 GLN A CB  1 
ATOM   1471 C CG  . GLN A 1 185 ? -14.950 8.934   25.510  1.00 12.44 ? 185 GLN A CG  1 
ATOM   1472 C CD  . GLN A 1 185 ? -16.058 8.199   24.687  1.00 16.10 ? 185 GLN A CD  1 
ATOM   1473 O OE1 . GLN A 1 185 ? -16.911 7.497   25.190  1.00 25.15 ? 185 GLN A OE1 1 
ATOM   1474 N NE2 . GLN A 1 185 ? -15.986 8.287   23.369  1.00 14.70 ? 185 GLN A NE2 1 
ATOM   1475 N N   . ARG A 1 186 ? -11.531 6.245   25.199  1.00 9.24  ? 186 ARG A N   1 
ATOM   1476 C CA  . ARG A 1 186 ? -10.459 5.586   24.434  1.00 6.76  ? 186 ARG A CA  1 
ATOM   1477 C C   . ARG A 1 186 ? -10.477 4.029   24.294  1.00 5.75  ? 186 ARG A C   1 
ATOM   1478 O O   . ARG A 1 186 ? -10.230 3.406   23.279  1.00 4.52  ? 186 ARG A O   1 
ATOM   1479 C CB  . ARG A 1 186 ? -9.193  6.014   25.160  1.00 11.07 ? 186 ARG A CB  1 
ATOM   1480 C CG  . ARG A 1 186 ? -7.870  6.338   24.487  1.00 8.29  ? 186 ARG A CG  1 
ATOM   1481 C CD  . ARG A 1 186 ? -6.729  6.501   25.489  1.00 2.00  ? 186 ARG A CD  1 
ATOM   1482 N NE  . ARG A 1 186 ? -6.550  5.208   26.103  1.00 2.00  ? 186 ARG A NE  1 
ATOM   1483 C CZ  . ARG A 1 186 ? -5.541  4.856   26.948  1.00 2.00  ? 186 ARG A CZ  1 
ATOM   1484 N NH1 . ARG A 1 186 ? -4.568  5.698   27.315  1.00 2.00  ? 186 ARG A NH1 1 
ATOM   1485 N NH2 . ARG A 1 186 ? -5.573  3.576   27.367  1.00 7.46  ? 186 ARG A NH2 1 
ATOM   1486 N N   . TYR A 1 187 ? -10.809 3.427   25.454  1.00 6.24  ? 187 TYR A N   1 
ATOM   1487 C CA  . TYR A 1 187 ? -10.817 1.979   25.598  1.00 7.29  ? 187 TYR A CA  1 
ATOM   1488 C C   . TYR A 1 187 ? -11.988 1.440   24.936  1.00 8.16  ? 187 TYR A C   1 
ATOM   1489 O O   . TYR A 1 187 ? -11.965 0.328   24.453  1.00 6.23  ? 187 TYR A O   1 
ATOM   1490 C CB  . TYR A 1 187 ? -10.818 1.477   27.033  1.00 4.41  ? 187 TYR A CB  1 
ATOM   1491 C CG  . TYR A 1 187 ? -10.683 -0.078  27.171  1.00 11.54 ? 187 TYR A CG  1 
ATOM   1492 C CD1 . TYR A 1 187 ? -9.483  -0.740  26.722  1.00 12.09 ? 187 TYR A CD1 1 
ATOM   1493 C CD2 . TYR A 1 187 ? -11.733 -0.833  27.794  1.00 6.38  ? 187 TYR A CD2 1 
ATOM   1494 C CE1 . TYR A 1 187 ? -9.337  -2.128  26.798  1.00 6.88  ? 187 TYR A CE1 1 
ATOM   1495 C CE2 . TYR A 1 187 ? -11.548 -2.187  28.067  1.00 2.00  ? 187 TYR A CE2 1 
ATOM   1496 C CZ  . TYR A 1 187 ? -10.363 -2.790  27.505  1.00 2.37  ? 187 TYR A CZ  1 
ATOM   1497 O OH  . TYR A 1 187 ? -10.241 -4.141  27.657  1.00 6.92  ? 187 TYR A OH  1 
ATOM   1498 N N   . LYS A 1 188 ? -13.022 2.309   24.874  1.00 8.09  ? 188 LYS A N   1 
ATOM   1499 C CA  . LYS A 1 188 ? -14.297 1.961   24.196  1.00 10.50 ? 188 LYS A CA  1 
ATOM   1500 C C   . LYS A 1 188 ? -14.201 0.894   23.067  1.00 9.91  ? 188 LYS A C   1 
ATOM   1501 O O   . LYS A 1 188 ? -14.683 -0.218  23.218  1.00 11.39 ? 188 LYS A O   1 
ATOM   1502 C CB  . LYS A 1 188 ? -15.353 3.141   24.067  1.00 7.84  ? 188 LYS A CB  1 
ATOM   1503 C CG  . LYS A 1 188 ? -16.530 2.499   24.843  1.00 13.13 ? 188 LYS A CG  1 
ATOM   1504 C CD  . LYS A 1 188 ? -17.805 3.324   25.270  1.00 17.72 ? 188 LYS A CD  1 
ATOM   1505 C CE  . LYS A 1 188 ? -18.555 2.923   26.646  1.00 17.68 ? 188 LYS A CE  1 
ATOM   1506 N NZ  . LYS A 1 188 ? -19.187 1.569   26.711  1.00 20.79 ? 188 LYS A NZ  1 
ATOM   1507 N N   . PRO A 1 189 ? -13.426 1.277   22.014  1.00 7.49  ? 189 PRO A N   1 
ATOM   1508 C CA  . PRO A 1 189 ? -13.089 0.350   20.895  1.00 5.55  ? 189 PRO A CA  1 
ATOM   1509 C C   . PRO A 1 189 ? -12.870 -1.078  21.266  1.00 9.27  ? 189 PRO A C   1 
ATOM   1510 O O   . PRO A 1 189 ? -13.674 -1.994  21.151  1.00 16.57 ? 189 PRO A O   1 
ATOM   1511 C CB  . PRO A 1 189 ? -11.813 0.960   20.432  1.00 5.83  ? 189 PRO A CB  1 
ATOM   1512 C CG  . PRO A 1 189 ? -11.914 2.468   20.720  1.00 7.99  ? 189 PRO A CG  1 
ATOM   1513 C CD  . PRO A 1 189 ? -12.897 2.626   21.852  1.00 3.77  ? 189 PRO A CD  1 
ATOM   1514 N N   . PHE A 1 190 ? -11.816 -1.053  22.161  1.00 9.58  ? 190 PHE A N   1 
ATOM   1515 C CA  . PHE A 1 190 ? -11.279 -2.225  22.888  1.00 6.35  ? 190 PHE A CA  1 
ATOM   1516 C C   . PHE A 1 190 ? -12.143 -2.860  23.986  1.00 8.58  ? 190 PHE A C   1 
ATOM   1517 O O   . PHE A 1 190 ? -11.999 -4.008  24.343  1.00 8.43  ? 190 PHE A O   1 
ATOM   1518 C CB  . PHE A 1 190 ? -9.868  -1.877  23.314  1.00 2.97  ? 190 PHE A CB  1 
ATOM   1519 C CG  . PHE A 1 190 ? -9.026  -1.615  22.058  1.00 2.69  ? 190 PHE A CG  1 
ATOM   1520 C CD1 . PHE A 1 190 ? -8.616  -2.693  21.287  1.00 2.83  ? 190 PHE A CD1 1 
ATOM   1521 C CD2 . PHE A 1 190 ? -8.707  -0.281  21.703  1.00 2.72  ? 190 PHE A CD2 1 
ATOM   1522 C CE1 . PHE A 1 190 ? -7.875  -2.425  20.141  1.00 3.48  ? 190 PHE A CE1 1 
ATOM   1523 C CE2 . PHE A 1 190 ? -7.968  -0.007  20.534  1.00 2.00  ? 190 PHE A CE2 1 
ATOM   1524 C CZ  . PHE A 1 190 ? -7.541  -1.101  19.751  1.00 2.27  ? 190 PHE A CZ  1 
ATOM   1525 N N   . LYS A 1 191 ? -13.158 -2.137  24.464  1.00 8.29  ? 191 LYS A N   1 
ATOM   1526 C CA  . LYS A 1 191 ? -14.184 -2.870  25.269  1.00 6.89  ? 191 LYS A CA  1 
ATOM   1527 C C   . LYS A 1 191 ? -14.835 -4.039  24.549  1.00 10.17 ? 191 LYS A C   1 
ATOM   1528 O O   . LYS A 1 191 ? -15.517 -4.842  25.142  1.00 14.51 ? 191 LYS A O   1 
ATOM   1529 C CB  . LYS A 1 191 ? -15.374 -2.019  25.566  1.00 5.02  ? 191 LYS A CB  1 
ATOM   1530 C CG  . LYS A 1 191 ? -15.190 -0.953  26.631  1.00 12.84 ? 191 LYS A CG  1 
ATOM   1531 C CD  . LYS A 1 191 ? -15.891 -1.446  27.937  1.00 16.53 ? 191 LYS A CD  1 
ATOM   1532 C CE  . LYS A 1 191 ? -16.768 -0.376  28.692  1.00 17.19 ? 191 LYS A CE  1 
ATOM   1533 N NZ  . LYS A 1 191 ? -15.988 0.847   29.115  1.00 13.91 ? 191 LYS A NZ  1 
ATOM   1534 N N   . GLN A 1 192 ? -14.561 -4.179  23.202  1.00 13.22 ? 192 GLN A N   1 
ATOM   1535 C CA  . GLN A 1 192 ? -15.167 -5.362  22.542  1.00 12.27 ? 192 GLN A CA  1 
ATOM   1536 C C   . GLN A 1 192 ? -14.228 -6.113  21.678  1.00 10.74 ? 192 GLN A C   1 
ATOM   1537 O O   . GLN A 1 192 ? -14.579 -6.647  20.659  1.00 5.67  ? 192 GLN A O   1 
ATOM   1538 C CB  . GLN A 1 192 ? -16.302 -4.875  21.656  1.00 16.17 ? 192 GLN A CB  1 
ATOM   1539 C CG  . GLN A 1 192 ? -17.604 -4.396  22.372  1.00 20.77 ? 192 GLN A CG  1 
ATOM   1540 C CD  . GLN A 1 192 ? -18.476 -3.621  21.393  1.00 22.08 ? 192 GLN A CD  1 
ATOM   1541 O OE1 . GLN A 1 192 ? -18.347 -2.381  21.285  1.00 24.74 ? 192 GLN A OE1 1 
ATOM   1542 N NE2 . GLN A 1 192 ? -19.281 -4.368  20.676  1.00 21.24 ? 192 GLN A NE2 1 
ATOM   1543 N N   . LEU A 1 193 ? -12.965 -6.145  22.127  1.00 12.64 ? 193 LEU A N   1 
ATOM   1544 C CA  . LEU A 1 193 ? -12.065 -7.200  21.601  1.00 11.84 ? 193 LEU A CA  1 
ATOM   1545 C C   . LEU A 1 193 ? -12.129 -8.562  22.393  1.00 11.77 ? 193 LEU A C   1 
ATOM   1546 O O   . LEU A 1 193 ? -12.189 -8.570  23.638  1.00 13.26 ? 193 LEU A O   1 
ATOM   1547 C CB  . LEU A 1 193 ? -10.622 -6.632  21.394  1.00 12.35 ? 193 LEU A CB  1 
ATOM   1548 C CG  . LEU A 1 193 ? -9.489  -7.701  21.152  1.00 13.19 ? 193 LEU A CG  1 
ATOM   1549 C CD1 . LEU A 1 193 ? -9.582  -8.546  19.878  1.00 12.46 ? 193 LEU A CD1 1 
ATOM   1550 C CD2 . LEU A 1 193 ? -8.162  -6.989  21.208  1.00 16.04 ? 193 LEU A CD2 1 
ATOM   1551 N N   . HIS A 1 194 ? -12.075 -9.743  21.695  1.00 10.11 ? 194 HIS A N   1 
ATOM   1552 C CA  . HIS A 1 194 ? -12.117 -10.895 22.635  1.00 6.35  ? 194 HIS A CA  1 
ATOM   1553 C C   . HIS A 1 194 ? -10.846 -11.068 23.474  1.00 4.02  ? 194 HIS A C   1 
ATOM   1554 O O   . HIS A 1 194 ? -9.972  -10.244 23.459  1.00 2.00  ? 194 HIS A O   1 
ATOM   1555 C CB  . HIS A 1 194 ? -12.329 -12.153 21.919  1.00 6.54  ? 194 HIS A CB  1 
ATOM   1556 C CG  . HIS A 1 194 ? -11.422 -12.243 20.785  1.00 2.00  ? 194 HIS A CG  1 
ATOM   1557 N ND1 . HIS A 1 194 ? -11.204 -11.401 19.771  1.00 2.00  ? 194 HIS A ND1 1 
ATOM   1558 C CD2 . HIS A 1 194 ? -10.671 -13.404 20.624  1.00 2.66  ? 194 HIS A CD2 1 
ATOM   1559 C CE1 . HIS A 1 194 ? -10.297 -12.118 18.985  1.00 2.00  ? 194 HIS A CE1 1 
ATOM   1560 N NE2 . HIS A 1 194 ? -9.942  -13.352 19.500  1.00 2.00  ? 194 HIS A NE2 1 
ATOM   1561 N N   . ASN A 1 195 ? -10.689 -12.118 24.236  1.00 5.05  ? 195 ASN A N   1 
ATOM   1562 C CA  . ASN A 1 195 ? -9.571  -12.192 25.142  1.00 3.37  ? 195 ASN A CA  1 
ATOM   1563 C C   . ASN A 1 195 ? -9.074  -10.957 25.950  1.00 3.52  ? 195 ASN A C   1 
ATOM   1564 O O   . ASN A 1 195 ? -7.878  -10.698 25.882  1.00 5.40  ? 195 ASN A O   1 
ATOM   1565 C CB  . ASN A 1 195 ? -8.511  -12.986 24.397  1.00 2.00  ? 195 ASN A CB  1 
ATOM   1566 C CG  . ASN A 1 195 ? -7.486  -13.478 25.348  1.00 2.00  ? 195 ASN A CG  1 
ATOM   1567 O OD1 . ASN A 1 195 ? -7.733  -13.653 26.531  1.00 5.15  ? 195 ASN A OD1 1 
ATOM   1568 N ND2 . ASN A 1 195 ? -6.328  -13.632 24.777  1.00 4.47  ? 195 ASN A ND2 1 
ATOM   1569 N N   . ARG A 1 196 ? -9.993  -10.262 26.739  1.00 2.72  ? 196 ARG A N   1 
ATOM   1570 C CA  . ARG A 1 196 ? -9.648  -9.266  27.831  1.00 3.87  ? 196 ARG A CA  1 
ATOM   1571 C C   . ARG A 1 196 ? -9.341  -9.726  29.295  1.00 2.64  ? 196 ARG A C   1 
ATOM   1572 O O   . ARG A 1 196 ? -10.032 -10.598 29.752  1.00 13.08 ? 196 ARG A O   1 
ATOM   1573 C CB  . ARG A 1 196 ? -10.852 -8.389  27.855  1.00 2.00  ? 196 ARG A CB  1 
ATOM   1574 C CG  . ARG A 1 196 ? -10.556 -7.230  26.947  1.00 2.32  ? 196 ARG A CG  1 
ATOM   1575 C CD  . ARG A 1 196 ? -11.711 -6.805  26.045  1.00 4.26  ? 196 ARG A CD  1 
ATOM   1576 N NE  . ARG A 1 196 ? -12.797 -6.100  26.768  1.00 11.08 ? 196 ARG A NE  1 
ATOM   1577 C CZ  . ARG A 1 196 ? -13.980 -6.737  27.109  1.00 12.12 ? 196 ARG A CZ  1 
ATOM   1578 N NH1 . ARG A 1 196 ? -14.403 -7.935  26.646  1.00 10.15 ? 196 ARG A NH1 1 
ATOM   1579 N NH2 . ARG A 1 196 ? -14.766 -6.117  28.002  1.00 2.00  ? 196 ARG A NH2 1 
ATOM   1580 N N   . ARG A 1 197 ? -8.292  -9.208  30.027  1.00 2.00  ? 197 ARG A N   1 
ATOM   1581 C CA  . ARG A 1 197 ? -7.709  -9.895  31.266  1.00 2.00  ? 197 ARG A CA  1 
ATOM   1582 C C   . ARG A 1 197 ? -7.199  -8.994  32.224  1.00 2.00  ? 197 ARG A C   1 
ATOM   1583 O O   . ARG A 1 197 ? -6.579  -8.064  31.806  1.00 2.00  ? 197 ARG A O   1 
ATOM   1584 C CB  . ARG A 1 197 ? -6.460  -10.713 31.237  1.00 2.00  ? 197 ARG A CB  1 
ATOM   1585 C CG  . ARG A 1 197 ? -6.755  -12.043 30.626  1.00 2.70  ? 197 ARG A CG  1 
ATOM   1586 C CD  . ARG A 1 197 ? -5.954  -13.283 31.113  1.00 2.00  ? 197 ARG A CD  1 
ATOM   1587 N NE  . ARG A 1 197 ? -6.159  -14.564 30.352  1.00 2.28  ? 197 ARG A NE  1 
ATOM   1588 C CZ  . ARG A 1 197 ? -5.385  -14.607 29.185  1.00 3.37  ? 197 ARG A CZ  1 
ATOM   1589 N NH1 . ARG A 1 197 ? -4.552  -13.585 28.934  1.00 2.00  ? 197 ARG A NH1 1 
ATOM   1590 N NH2 . ARG A 1 197 ? -5.417  -15.615 28.303  1.00 2.29  ? 197 ARG A NH2 1 
ATOM   1591 N N   . LEU A 1 198 ? -7.496  -9.245  33.506  1.00 2.00  ? 198 LEU A N   1 
ATOM   1592 C CA  . LEU A 1 198 ? -6.991  -8.337  34.571  1.00 2.69  ? 198 LEU A CA  1 
ATOM   1593 C C   . LEU A 1 198 ? -5.608  -8.713  34.866  1.00 5.90  ? 198 LEU A C   1 
ATOM   1594 O O   . LEU A 1 198 ? -5.340  -9.807  35.319  1.00 10.94 ? 198 LEU A O   1 
ATOM   1595 C CB  . LEU A 1 198 ? -7.738  -8.489  35.893  1.00 2.00  ? 198 LEU A CB  1 
ATOM   1596 C CG  . LEU A 1 198 ? -7.949  -7.341  36.887  1.00 2.00  ? 198 LEU A CG  1 
ATOM   1597 C CD1 . LEU A 1 198 ? -8.453  -6.059  36.276  1.00 2.00  ? 198 LEU A CD1 1 
ATOM   1598 C CD2 . LEU A 1 198 ? -8.945  -7.850  37.918  1.00 7.33  ? 198 LEU A CD2 1 
ATOM   1599 N N   . LEU A 1 199 ? -4.738  -7.807  34.576  1.00 2.00  ? 199 LEU A N   1 
ATOM   1600 C CA  . LEU A 1 199 ? -3.393  -8.239  34.869  1.00 2.00  ? 199 LEU A CA  1 
ATOM   1601 C C   . LEU A 1 199 ? -2.586  -7.246  35.629  1.00 5.03  ? 199 LEU A C   1 
ATOM   1602 O O   . LEU A 1 199 ? -2.817  -6.039  35.612  1.00 6.20  ? 199 LEU A O   1 
ATOM   1603 C CB  . LEU A 1 199 ? -2.692  -8.554  33.594  1.00 2.00  ? 199 LEU A CB  1 
ATOM   1604 C CG  . LEU A 1 199 ? -3.282  -9.638  32.726  1.00 2.00  ? 199 LEU A CG  1 
ATOM   1605 C CD1 . LEU A 1 199 ? -2.663  -9.248  31.430  1.00 2.00  ? 199 LEU A CD1 1 
ATOM   1606 C CD2 . LEU A 1 199 ? -3.065  -11.145 32.983  1.00 2.00  ? 199 LEU A CD2 1 
ATOM   1607 N N   . TRP A 1 200 ? -1.584  -7.736  36.327  1.00 5.29  ? 200 TRP A N   1 
ATOM   1608 C CA  . TRP A 1 200 ? -0.747  -6.672  36.981  1.00 3.00  ? 200 TRP A CA  1 
ATOM   1609 C C   . TRP A 1 200 ? 0.185   -5.849  36.055  1.00 2.50  ? 200 TRP A C   1 
ATOM   1610 O O   . TRP A 1 200 ? 0.907   -6.389  35.252  1.00 5.84  ? 200 TRP A O   1 
ATOM   1611 C CB  . TRP A 1 200 ? 0.081   -7.309  38.053  1.00 2.00  ? 200 TRP A CB  1 
ATOM   1612 C CG  . TRP A 1 200 ? -0.660  -8.308  38.854  1.00 3.81  ? 200 TRP A CG  1 
ATOM   1613 C CD1 . TRP A 1 200 ? -0.940  -9.664  38.579  1.00 3.76  ? 200 TRP A CD1 1 
ATOM   1614 C CD2 . TRP A 1 200 ? -1.537  -8.084  40.017  1.00 6.80  ? 200 TRP A CD2 1 
ATOM   1615 N NE1 . TRP A 1 200 ? -1.727  -10.298 39.476  1.00 2.00  ? 200 TRP A NE1 1 
ATOM   1616 C CE2 . TRP A 1 200 ? -1.826  -9.304  40.540  1.00 2.95  ? 200 TRP A CE2 1 
ATOM   1617 C CE3 . TRP A 1 200 ? -1.495  -6.932  40.806  1.00 11.63 ? 200 TRP A CE3 1 
ATOM   1618 C CZ2 . TRP A 1 200 ? -2.792  -9.398  41.563  1.00 9.05  ? 200 TRP A CZ2 1 
ATOM   1619 C CZ3 . TRP A 1 200 ? -2.391  -6.994  41.911  1.00 5.88  ? 200 TRP A CZ3 1 
ATOM   1620 C CH2 . TRP A 1 200 ? -2.862  -8.197  42.347  1.00 3.99  ? 200 TRP A CH2 1 
ATOM   1621 N N   . HIS A 1 201 ? 0.135   -4.528  36.158  1.00 3.03  ? 201 HIS A N   1 
ATOM   1622 C CA  . HIS A 1 201 ? 1.245   -3.596  35.804  1.00 4.00  ? 201 HIS A CA  1 
ATOM   1623 C C   . HIS A 1 201 ? 2.153   -3.077  37.004  1.00 4.81  ? 201 HIS A C   1 
ATOM   1624 O O   . HIS A 1 201 ? 1.951   -2.032  37.616  1.00 2.00  ? 201 HIS A O   1 
ATOM   1625 C CB  . HIS A 1 201 ? 0.702   -2.404  34.998  1.00 3.22  ? 201 HIS A CB  1 
ATOM   1626 C CG  . HIS A 1 201 ? 1.973   -1.849  34.472  1.00 2.00  ? 201 HIS A CG  1 
ATOM   1627 N ND1 . HIS A 1 201 ? 2.744   -2.462  33.546  1.00 2.00  ? 201 HIS A ND1 1 
ATOM   1628 C CD2 . HIS A 1 201 ? 2.624   -0.693  34.872  1.00 2.97  ? 201 HIS A CD2 1 
ATOM   1629 C CE1 . HIS A 1 201 ? 3.858   -1.691  33.380  1.00 2.00  ? 201 HIS A CE1 1 
ATOM   1630 N NE2 . HIS A 1 201 ? 3.804   -0.589  34.198  1.00 2.00  ? 201 HIS A NE2 1 
ATOM   1631 N N   . GLY A 1 202 ? 3.198   -3.793  37.415  1.00 5.42  ? 202 GLY A N   1 
ATOM   1632 C CA  . GLY A 1 202 ? 4.013   -3.171  38.534  1.00 4.98  ? 202 GLY A CA  1 
ATOM   1633 C C   . GLY A 1 202 ? 5.161   -2.165  38.187  1.00 5.74  ? 202 GLY A C   1 
ATOM   1634 O O   . GLY A 1 202 ? 5.937   -2.306  37.277  1.00 7.71  ? 202 GLY A O   1 
ATOM   1635 N N   . SER A 1 203 ? 5.232   -1.105  38.912  1.00 2.89  ? 203 SER A N   1 
ATOM   1636 C CA  . SER A 1 203 ? 6.202   -0.095  38.489  1.00 4.12  ? 203 SER A CA  1 
ATOM   1637 C C   . SER A 1 203 ? 6.856   0.671   39.693  1.00 6.46  ? 203 SER A C   1 
ATOM   1638 O O   . SER A 1 203 ? 6.289   0.804   40.770  1.00 8.04  ? 203 SER A O   1 
ATOM   1639 C CB  . SER A 1 203 ? 5.248   0.787   37.659  1.00 5.20  ? 203 SER A CB  1 
ATOM   1640 O OG  . SER A 1 203 ? 5.814   1.740   36.725  1.00 2.00  ? 203 SER A OG  1 
ATOM   1641 N N   . ARG A 1 204 ? 8.015   1.295   39.530  1.00 6.66  ? 204 ARG A N   1 
ATOM   1642 C CA  . ARG A 1 204 ? 8.446   2.054   40.752  1.00 6.00  ? 204 ARG A CA  1 
ATOM   1643 C C   . ARG A 1 204 ? 7.733   3.370   41.061  1.00 6.90  ? 204 ARG A C   1 
ATOM   1644 O O   . ARG A 1 204 ? 8.224   4.452   40.830  1.00 8.46  ? 204 ARG A O   1 
ATOM   1645 C CB  . ARG A 1 204 ? 10.029  2.104   40.907  1.00 2.00  ? 204 ARG A CB  1 
ATOM   1646 C CG  . ARG A 1 204 ? 10.762  3.406   40.461  1.00 2.00  ? 204 ARG A CG  1 
ATOM   1647 C CD  . ARG A 1 204 ? 12.176  3.310   39.877  1.00 3.95  ? 204 ARG A CD  1 
ATOM   1648 N NE  . ARG A 1 204 ? 13.163  3.134   40.933  1.00 2.00  ? 204 ARG A NE  1 
ATOM   1649 C CZ  . ARG A 1 204 ? 13.739  1.933   40.998  1.00 2.00  ? 204 ARG A CZ  1 
ATOM   1650 N NH1 . ARG A 1 204 ? 14.458  1.746   42.127  1.00 6.37  ? 204 ARG A NH1 1 
ATOM   1651 N NH2 . ARG A 1 204 ? 13.622  0.978   39.985  1.00 2.75  ? 204 ARG A NH2 1 
ATOM   1652 N N   . THR A 1 205 ? 6.488   3.326   41.574  1.00 7.42  ? 205 THR A N   1 
ATOM   1653 C CA  . THR A 1 205 ? 5.929   4.444   42.467  1.00 7.43  ? 205 THR A CA  1 
ATOM   1654 C C   . THR A 1 205 ? 6.005   5.931   42.229  1.00 3.28  ? 205 THR A C   1 
ATOM   1655 O O   . THR A 1 205 ? 4.911   6.472   42.200  1.00 8.16  ? 205 THR A O   1 
ATOM   1656 C CB  . THR A 1 205 ? 6.302   4.373   43.932  1.00 6.95  ? 205 THR A CB  1 
ATOM   1657 O OG1 . THR A 1 205 ? 7.598   4.950   43.955  1.00 23.08 ? 205 THR A OG1 1 
ATOM   1658 C CG2 . THR A 1 205 ? 6.189   2.889   44.443  1.00 9.99  ? 205 THR A CG2 1 
ATOM   1659 N N   . THR A 1 206 ? 7.191   6.456   42.017  1.00 2.00  ? 206 THR A N   1 
ATOM   1660 C CA  . THR A 1 206 ? 7.762   7.613   41.243  1.00 9.85  ? 206 THR A CA  1 
ATOM   1661 C C   . THR A 1 206 ? 7.325   7.919   39.774  1.00 12.78 ? 206 THR A C   1 
ATOM   1662 O O   . THR A 1 206 ? 7.306   9.031   39.308  1.00 15.42 ? 206 THR A O   1 
ATOM   1663 C CB  . THR A 1 206 ? 9.328   7.394   41.129  1.00 13.57 ? 206 THR A CB  1 
ATOM   1664 O OG1 . THR A 1 206 ? 9.650   6.544   39.879  1.00 15.55 ? 206 THR A OG1 1 
ATOM   1665 C CG2 . THR A 1 206 ? 10.056  6.880   42.436  1.00 5.98  ? 206 THR A CG2 1 
ATOM   1666 N N   . ASN A 1 207 ? 6.978   6.819   39.085  1.00 11.19 ? 207 ASN A N   1 
ATOM   1667 C CA  . ASN A 1 207 ? 6.121   6.457   37.976  1.00 7.93  ? 207 ASN A CA  1 
ATOM   1668 C C   . ASN A 1 207 ? 4.602   6.820   37.990  1.00 6.40  ? 207 ASN A C   1 
ATOM   1669 O O   . ASN A 1 207 ? 4.095   7.459   37.084  1.00 10.68 ? 207 ASN A O   1 
ATOM   1670 C CB  . ASN A 1 207 ? 6.235   4.930   37.837  1.00 8.15  ? 207 ASN A CB  1 
ATOM   1671 C CG  . ASN A 1 207 ? 7.483   4.580   37.003  1.00 2.83  ? 207 ASN A CG  1 
ATOM   1672 O OD1 . ASN A 1 207 ? 8.062   5.462   36.393  1.00 12.27 ? 207 ASN A OD1 1 
ATOM   1673 N ND2 . ASN A 1 207 ? 7.934   3.313   36.943  1.00 2.00  ? 207 ASN A ND2 1 
ATOM   1674 N N   . PHE A 1 208 ? 3.863   6.409   39.042  1.00 4.79  ? 208 PHE A N   1 
ATOM   1675 C CA  . PHE A 1 208 ? 2.404   6.667   39.280  1.00 3.19  ? 208 PHE A CA  1 
ATOM   1676 C C   . PHE A 1 208 ? 1.978   8.147   39.402  1.00 4.95  ? 208 PHE A C   1 
ATOM   1677 O O   . PHE A 1 208 ? 0.924   8.489   38.915  1.00 10.48 ? 208 PHE A O   1 
ATOM   1678 C CB  . PHE A 1 208 ? 1.692   5.889   40.458  1.00 4.13  ? 208 PHE A CB  1 
ATOM   1679 C CG  . PHE A 1 208 ? 1.892   4.363   40.411  1.00 3.10  ? 208 PHE A CG  1 
ATOM   1680 C CD1 . PHE A 1 208 ? 3.188   3.833   40.636  1.00 3.57  ? 208 PHE A CD1 1 
ATOM   1681 C CD2 . PHE A 1 208 ? 0.824   3.523   40.142  1.00 2.00  ? 208 PHE A CD2 1 
ATOM   1682 C CE1 . PHE A 1 208 ? 3.400   2.451   40.465  1.00 4.72  ? 208 PHE A CE1 1 
ATOM   1683 C CE2 . PHE A 1 208 ? 1.058   2.162   40.011  1.00 6.58  ? 208 PHE A CE2 1 
ATOM   1684 C CZ  . PHE A 1 208 ? 2.337   1.615   40.140  1.00 2.35  ? 208 PHE A CZ  1 
ATOM   1685 N N   . ALA A 1 209 ? 2.820   9.013   39.973  1.00 5.64  ? 209 ALA A N   1 
ATOM   1686 C CA  . ALA A 1 209 ? 2.490   10.370  39.555  1.00 4.95  ? 209 ALA A CA  1 
ATOM   1687 C C   . ALA A 1 209 ? 2.142   10.661  38.058  1.00 3.03  ? 209 ALA A C   1 
ATOM   1688 O O   . ALA A 1 209 ? 1.137   11.262  37.756  1.00 2.00  ? 209 ALA A O   1 
ATOM   1689 C CB  . ALA A 1 209 ? 3.686   11.146  39.981  1.00 11.91 ? 209 ALA A CB  1 
ATOM   1690 N N   . GLY A 1 210 ? 2.948   10.113  37.101  1.00 7.67  ? 210 GLY A N   1 
ATOM   1691 C CA  . GLY A 1 210 ? 2.474   10.243  35.661  1.00 3.21  ? 210 GLY A CA  1 
ATOM   1692 C C   . GLY A 1 210 ? 1.785   9.040   34.896  1.00 5.14  ? 210 GLY A C   1 
ATOM   1693 O O   . GLY A 1 210 ? 1.180   9.119   33.859  1.00 4.45  ? 210 GLY A O   1 
ATOM   1694 N N   . ILE A 1 211 ? 1.853   7.839   35.464  1.00 2.00  ? 211 ILE A N   1 
ATOM   1695 C CA  . ILE A 1 211 ? 0.831   6.937   35.121  1.00 2.00  ? 211 ILE A CA  1 
ATOM   1696 C C   . ILE A 1 211 ? -0.515  7.373   35.610  1.00 2.00  ? 211 ILE A C   1 
ATOM   1697 O O   . ILE A 1 211 ? -1.501  6.882   35.113  1.00 10.22 ? 211 ILE A O   1 
ATOM   1698 C CB  . ILE A 1 211 ? 1.098   5.750   35.895  1.00 2.00  ? 211 ILE A CB  1 
ATOM   1699 C CG1 . ILE A 1 211 ? 2.498   5.292   35.679  1.00 2.70  ? 211 ILE A CG1 1 
ATOM   1700 C CG2 . ILE A 1 211 ? 0.075   4.599   35.656  1.00 2.00  ? 211 ILE A CG2 1 
ATOM   1701 C CD1 . ILE A 1 211 ? 2.704   4.022   36.529  1.00 8.09  ? 211 ILE A CD1 1 
ATOM   1702 N N   . LEU A 1 212 ? -0.665  8.242   36.618  1.00 3.52  ? 212 LEU A N   1 
ATOM   1703 C CA  . LEU A 1 212 ? -2.087  8.486   36.868  1.00 2.19  ? 212 LEU A CA  1 
ATOM   1704 C C   . LEU A 1 212 ? -2.615  9.656   36.081  1.00 3.04  ? 212 LEU A C   1 
ATOM   1705 O O   . LEU A 1 212 ? -3.739  9.647   35.591  1.00 2.00  ? 212 LEU A O   1 
ATOM   1706 C CB  . LEU A 1 212 ? -2.459  8.629   38.330  1.00 5.14  ? 212 LEU A CB  1 
ATOM   1707 C CG  . LEU A 1 212 ? -2.581  7.304   39.061  1.00 2.51  ? 212 LEU A CG  1 
ATOM   1708 C CD1 . LEU A 1 212 ? -1.630  7.253   40.272  1.00 2.00  ? 212 LEU A CD1 1 
ATOM   1709 C CD2 . LEU A 1 212 ? -4.012  7.236   39.552  1.00 6.21  ? 212 LEU A CD2 1 
ATOM   1710 N N   . SER A 1 213 ? -1.693  10.596  35.923  1.00 2.00  ? 213 SER A N   1 
ATOM   1711 C CA  . SER A 1 213 ? -1.915  11.537  34.827  1.00 2.74  ? 213 SER A CA  1 
ATOM   1712 C C   . SER A 1 213 ? -1.740  11.094  33.366  1.00 6.48  ? 213 SER A C   1 
ATOM   1713 O O   . SER A 1 213 ? -2.502  11.312  32.457  1.00 7.10  ? 213 SER A O   1 
ATOM   1714 C CB  . SER A 1 213 ? -1.015  12.781  34.952  1.00 7.57  ? 213 SER A CB  1 
ATOM   1715 O OG  . SER A 1 213 ? 0.401   12.402  35.121  1.00 18.74 ? 213 SER A OG  1 
ATOM   1716 N N   . GLN A 1 214 ? -0.670  10.467  33.069  1.00 10.45 ? 214 GLN A N   1 
ATOM   1717 C CA  . GLN A 1 214 ? -0.580  10.168  31.662  1.00 7.75  ? 214 GLN A CA  1 
ATOM   1718 C C   . GLN A 1 214 ? -1.121  8.821   31.261  1.00 9.26  ? 214 GLN A C   1 
ATOM   1719 O O   . GLN A 1 214 ? -0.849  8.431   30.182  1.00 12.00 ? 214 GLN A O   1 
ATOM   1720 C CB  . GLN A 1 214 ? 0.822   10.334  31.003  1.00 10.38 ? 214 GLN A CB  1 
ATOM   1721 C CG  . GLN A 1 214 ? 1.535   11.665  30.690  1.00 16.88 ? 214 GLN A CG  1 
ATOM   1722 C CD  . GLN A 1 214 ? 0.561   12.520  29.974  1.00 15.96 ? 214 GLN A CD  1 
ATOM   1723 O OE1 . GLN A 1 214 ? 0.474   12.475  28.774  1.00 21.58 ? 214 GLN A OE1 1 
ATOM   1724 N NE2 . GLN A 1 214 ? -0.194  13.347  30.680  1.00 16.64 ? 214 GLN A NE2 1 
ATOM   1725 N N   . GLY A 1 215 ? -1.831  8.081   32.146  1.00 10.60 ? 215 GLY A N   1 
ATOM   1726 C CA  . GLY A 1 215 ? -1.973  6.670   31.753  1.00 5.72  ? 215 GLY A CA  1 
ATOM   1727 C C   . GLY A 1 215 ? -0.682  5.934   31.523  1.00 5.12  ? 215 GLY A C   1 
ATOM   1728 O O   . GLY A 1 215 ? 0.381   6.497   31.296  1.00 10.14 ? 215 GLY A O   1 
ATOM   1729 N N   . LEU A 1 216 ? -0.742  4.627   31.739  1.00 4.57  ? 216 LEU A N   1 
ATOM   1730 C CA  . LEU A 1 216 ? 0.412   3.880   31.280  1.00 2.28  ? 216 LEU A CA  1 
ATOM   1731 C C   . LEU A 1 216 ? 0.843   4.058   29.851  1.00 8.97  ? 216 LEU A C   1 
ATOM   1732 O O   . LEU A 1 216 ? 0.052   4.368   29.028  1.00 11.04 ? 216 LEU A O   1 
ATOM   1733 C CB  . LEU A 1 216 ? 0.056   2.493   31.323  1.00 4.63  ? 216 LEU A CB  1 
ATOM   1734 C CG  . LEU A 1 216 ? 0.238   2.004   32.716  1.00 3.93  ? 216 LEU A CG  1 
ATOM   1735 C CD1 . LEU A 1 216 ? -0.104  0.530   32.803  1.00 3.52  ? 216 LEU A CD1 1 
ATOM   1736 C CD2 . LEU A 1 216 ? 1.651   2.385   33.270  1.00 13.16 ? 216 LEU A CD2 1 
ATOM   1737 N N   . ARG A 1 217 ? 2.093   3.815   29.505  1.00 6.77  ? 217 ARG A N   1 
ATOM   1738 C CA  . ARG A 1 217 ? 2.552   4.486   28.256  1.00 5.27  ? 217 ARG A CA  1 
ATOM   1739 C C   . ARG A 1 217 ? 3.529   3.687   27.423  1.00 4.82  ? 217 ARG A C   1 
ATOM   1740 O O   . ARG A 1 217 ? 3.782   2.601   27.822  1.00 10.22 ? 217 ARG A O   1 
ATOM   1741 C CB  . ARG A 1 217 ? 3.239   5.727   28.658  1.00 5.20  ? 217 ARG A CB  1 
ATOM   1742 C CG  . ARG A 1 217 ? 2.576   6.842   27.983  1.00 4.66  ? 217 ARG A CG  1 
ATOM   1743 C CD  . ARG A 1 217 ? 2.910   8.144   28.634  1.00 9.72  ? 217 ARG A CD  1 
ATOM   1744 N NE  . ARG A 1 217 ? 2.399   7.946   29.980  1.00 19.07 ? 217 ARG A NE  1 
ATOM   1745 C CZ  . ARG A 1 217 ? 3.327   7.997   31.019  1.00 16.21 ? 217 ARG A CZ  1 
ATOM   1746 N NH1 . ARG A 1 217 ? 4.481   8.770   30.942  1.00 18.70 ? 217 ARG A NH1 1 
ATOM   1747 N NH2 . ARG A 1 217 ? 3.090   7.203   32.050  1.00 10.33 ? 217 ARG A NH2 1 
ATOM   1748 N N   . ILE A 1 218 ? 4.085   4.142   26.324  1.00 2.00  ? 218 ILE A N   1 
ATOM   1749 C CA  . ILE A 1 218 ? 5.105   3.297   25.679  1.00 2.41  ? 218 ILE A CA  1 
ATOM   1750 C C   . ILE A 1 218 ? 6.285   4.094   25.119  1.00 2.00  ? 218 ILE A C   1 
ATOM   1751 O O   . ILE A 1 218 ? 6.189   5.256   24.849  1.00 2.92  ? 218 ILE A O   1 
ATOM   1752 C CB  . ILE A 1 218 ? 4.544   2.368   24.579  1.00 2.00  ? 218 ILE A CB  1 
ATOM   1753 C CG1 . ILE A 1 218 ? 5.028   2.713   23.185  1.00 2.00  ? 218 ILE A CG1 1 
ATOM   1754 C CG2 . ILE A 1 218 ? 3.010   2.241   24.434  1.00 2.00  ? 218 ILE A CG2 1 
ATOM   1755 C CD1 . ILE A 1 218 ? 4.449   1.621   22.272  1.00 11.31 ? 218 ILE A CD1 1 
ATOM   1756 N N   . ALA A 1 219 ? 7.391   3.467   25.031  1.00 2.00  ? 219 ALA A N   1 
ATOM   1757 C CA  . ALA A 1 219 ? 8.611   4.223   24.804  1.00 2.00  ? 219 ALA A CA  1 
ATOM   1758 C C   . ALA A 1 219 ? 8.593   5.213   23.595  1.00 4.86  ? 219 ALA A C   1 
ATOM   1759 O O   . ALA A 1 219 ? 7.913   5.054   22.624  1.00 6.21  ? 219 ALA A O   1 
ATOM   1760 C CB  . ALA A 1 219 ? 9.749   3.177   24.816  1.00 2.50  ? 219 ALA A CB  1 
ATOM   1761 N N   . PRO A 1 220 ? 9.360   6.320   23.596  1.00 3.89  ? 220 PRO A N   1 
ATOM   1762 C CA  . PRO A 1 220 ? 9.068   7.204   22.512  1.00 6.32  ? 220 PRO A CA  1 
ATOM   1763 C C   . PRO A 1 220 ? 9.726   6.518   21.351  1.00 11.69 ? 220 PRO A C   1 
ATOM   1764 O O   . PRO A 1 220 ? 10.769  5.852   21.550  1.00 13.64 ? 220 PRO A O   1 
ATOM   1765 C CB  . PRO A 1 220 ? 9.900   8.477   22.857  1.00 6.30  ? 220 PRO A CB  1 
ATOM   1766 C CG  . PRO A 1 220 ? 11.072  7.975   23.711  1.00 10.42 ? 220 PRO A CG  1 
ATOM   1767 C CD  . PRO A 1 220 ? 10.458  6.796   24.468  1.00 8.24  ? 220 PRO A CD  1 
ATOM   1768 N N   . PRO A 1 221 ? 9.224   6.968   20.133  1.00 15.36 ? 221 PRO A N   1 
ATOM   1769 C CA  . PRO A 1 221 ? 9.886   6.758   18.839  1.00 12.30 ? 221 PRO A CA  1 
ATOM   1770 C C   . PRO A 1 221 ? 11.340  6.681   19.025  1.00 12.67 ? 221 PRO A C   1 
ATOM   1771 O O   . PRO A 1 221 ? 12.007  5.694   18.727  1.00 15.27 ? 221 PRO A O   1 
ATOM   1772 C CB  . PRO A 1 221 ? 9.444   7.980   18.036  1.00 10.07 ? 221 PRO A CB  1 
ATOM   1773 C CG  . PRO A 1 221 ? 8.726   8.947   19.006  1.00 14.44 ? 221 PRO A CG  1 
ATOM   1774 C CD  . PRO A 1 221 ? 8.095   7.934   19.978  1.00 17.71 ? 221 PRO A CD  1 
ATOM   1775 N N   . GLU A 1 222 ? 11.874  7.755   19.594  1.00 12.19 ? 222 GLU A N   1 
ATOM   1776 C CA  . GLU A 1 222 ? 13.360  7.697   19.743  1.00 10.30 ? 222 GLU A CA  1 
ATOM   1777 C C   . GLU A 1 222 ? 14.120  6.439   20.300  1.00 11.16 ? 222 GLU A C   1 
ATOM   1778 O O   . GLU A 1 222 ? 15.334  6.294   20.120  1.00 14.59 ? 222 GLU A O   1 
ATOM   1779 C CB  . GLU A 1 222 ? 13.972  8.967   20.403  1.00 13.16 ? 222 GLU A CB  1 
ATOM   1780 C CG  . GLU A 1 222 ? 13.809  10.210  19.515  1.00 12.64 ? 222 GLU A CG  1 
ATOM   1781 C CD  . GLU A 1 222 ? 12.552  10.977  19.839  1.00 11.76 ? 222 GLU A CD  1 
ATOM   1782 O OE1 . GLU A 1 222 ? 11.560  10.344  20.174  1.00 15.29 ? 222 GLU A OE1 1 
ATOM   1783 O OE2 . GLU A 1 222 ? 12.552  12.208  19.782  1.00 13.52 ? 222 GLU A OE2 1 
ATOM   1784 N N   . ALA A 1 223 ? 13.343  5.612   21.047  1.00 9.90  ? 223 ALA A N   1 
ATOM   1785 C CA  . ALA A 1 223 ? 13.992  4.577   21.827  1.00 11.98 ? 223 ALA A CA  1 
ATOM   1786 C C   . ALA A 1 223 ? 14.273  3.251   21.102  1.00 13.23 ? 223 ALA A C   1 
ATOM   1787 O O   . ALA A 1 223 ? 13.451  2.771   20.356  1.00 16.16 ? 223 ALA A O   1 
ATOM   1788 C CB  . ALA A 1 223 ? 13.190  4.349   23.077  1.00 6.75  ? 223 ALA A CB  1 
ATOM   1789 N N   . PRO A 1 224 ? 15.449  2.619   21.389  1.00 10.01 ? 224 PRO A N   1 
ATOM   1790 C CA  . PRO A 1 224 ? 15.938  1.328   20.905  1.00 7.47  ? 224 PRO A CA  1 
ATOM   1791 C C   . PRO A 1 224 ? 14.871  0.327   20.956  1.00 7.55  ? 224 PRO A C   1 
ATOM   1792 O O   . PRO A 1 224 ? 14.491  -0.095  22.054  1.00 10.37 ? 224 PRO A O   1 
ATOM   1793 C CB  . PRO A 1 224 ? 16.914  0.849   21.980  1.00 2.00  ? 224 PRO A CB  1 
ATOM   1794 C CG  . PRO A 1 224 ? 17.450  2.138   22.437  1.00 6.43  ? 224 PRO A CG  1 
ATOM   1795 C CD  . PRO A 1 224 ? 16.342  3.153   22.355  1.00 12.39 ? 224 PRO A CD  1 
ATOM   1796 N N   . VAL A 1 225 ? 14.379  -0.145  19.817  1.00 11.32 ? 225 VAL A N   1 
ATOM   1797 C CA  . VAL A 1 225 ? 13.495  -1.273  20.011  1.00 8.41  ? 225 VAL A CA  1 
ATOM   1798 C C   . VAL A 1 225 ? 14.171  -2.525  20.460  1.00 7.12  ? 225 VAL A C   1 
ATOM   1799 O O   . VAL A 1 225 ? 13.514  -3.358  21.082  1.00 10.01 ? 225 VAL A O   1 
ATOM   1800 C CB  . VAL A 1 225 ? 12.482  -1.480  18.876  1.00 6.04  ? 225 VAL A CB  1 
ATOM   1801 C CG1 . VAL A 1 225 ? 13.076  -2.270  17.776  1.00 14.40 ? 225 VAL A CG1 1 
ATOM   1802 C CG2 . VAL A 1 225 ? 11.252  -2.272  19.161  1.00 2.00  ? 225 VAL A CG2 1 
ATOM   1803 N N   . THR A 1 226 ? 15.549  -2.477  20.356  1.00 5.69  ? 226 THR A N   1 
ATOM   1804 C CA  . THR A 1 226 ? 16.324  -3.482  21.172  1.00 5.21  ? 226 THR A CA  1 
ATOM   1805 C C   . THR A 1 226 ? 16.372  -3.336  22.673  1.00 6.82  ? 226 THR A C   1 
ATOM   1806 O O   . THR A 1 226 ? 16.672  -4.211  23.435  1.00 9.90  ? 226 THR A O   1 
ATOM   1807 C CB  . THR A 1 226 ? 17.715  -3.737  20.718  1.00 2.00  ? 226 THR A CB  1 
ATOM   1808 O OG1 . THR A 1 226 ? 17.824  -3.020  19.520  1.00 3.41  ? 226 THR A OG1 1 
ATOM   1809 C CG2 . THR A 1 226 ? 17.985  -5.270  20.486  1.00 2.00  ? 226 THR A CG2 1 
ATOM   1810 N N   . GLY A 1 227 ? 15.927  -2.188  23.129  1.00 8.47  ? 227 GLY A N   1 
ATOM   1811 C CA  . GLY A 1 227 ? 15.996  -2.015  24.568  1.00 7.61  ? 227 GLY A CA  1 
ATOM   1812 C C   . GLY A 1 227 ? 15.136  -2.865  25.451  1.00 9.07  ? 227 GLY A C   1 
ATOM   1813 O O   . GLY A 1 227 ? 15.306  -2.748  26.647  1.00 11.69 ? 227 GLY A O   1 
ATOM   1814 N N   . TYR A 1 228 ? 14.233  -3.646  24.795  1.00 6.15  ? 228 TYR A N   1 
ATOM   1815 C CA  . TYR A 1 228 ? 13.078  -4.317  25.431  1.00 5.84  ? 228 TYR A CA  1 
ATOM   1816 C C   . TYR A 1 228 ? 12.690  -5.804  24.996  1.00 6.56  ? 228 TYR A C   1 
ATOM   1817 O O   . TYR A 1 228 ? 12.509  -6.074  23.789  1.00 8.46  ? 228 TYR A O   1 
ATOM   1818 C CB  . TYR A 1 228 ? 11.859  -3.420  25.072  1.00 4.93  ? 228 TYR A CB  1 
ATOM   1819 C CG  . TYR A 1 228 ? 12.067  -1.909  25.076  1.00 2.81  ? 228 TYR A CG  1 
ATOM   1820 C CD1 . TYR A 1 228 ? 12.735  -1.230  24.018  1.00 3.68  ? 228 TYR A CD1 1 
ATOM   1821 C CD2 . TYR A 1 228 ? 11.604  -1.213  26.230  1.00 8.61  ? 228 TYR A CD2 1 
ATOM   1822 C CE1 . TYR A 1 228 ? 13.107  0.118   24.243  1.00 2.00  ? 228 TYR A CE1 1 
ATOM   1823 C CE2 . TYR A 1 228 ? 11.940  0.147   26.426  1.00 8.91  ? 228 TYR A CE2 1 
ATOM   1824 C CZ  . TYR A 1 228 ? 12.702  0.742   25.424  1.00 2.00  ? 228 TYR A CZ  1 
ATOM   1825 O OH  . TYR A 1 228 ? 13.089  2.016   25.567  1.00 2.00  ? 228 TYR A OH  1 
ATOM   1826 N N   . MET A 1 229 ? 12.451  -6.764  25.938  1.00 2.00  ? 229 MET A N   1 
ATOM   1827 C CA  . MET A 1 229 ? 12.221  -8.137  25.373  1.00 2.00  ? 229 MET A CA  1 
ATOM   1828 C C   . MET A 1 229 ? 11.243  -8.324  24.320  1.00 2.00  ? 229 MET A C   1 
ATOM   1829 O O   . MET A 1 229 ? 11.474  -9.064  23.367  1.00 2.00  ? 229 MET A O   1 
ATOM   1830 C CB  . MET A 1 229 ? 12.002  -9.299  26.342  1.00 4.77  ? 229 MET A CB  1 
ATOM   1831 C CG  . MET A 1 229 ? 11.913  -10.773 25.934  1.00 2.00  ? 229 MET A CG  1 
ATOM   1832 S SD  . MET A 1 229 ? 11.994  -11.732 27.431  1.00 2.00  ? 229 MET A SD  1 
ATOM   1833 C CE  . MET A 1 229 ? 12.252  -13.450 26.802  1.00 2.00  ? 229 MET A CE  1 
ATOM   1834 N N   . PHE A 1 230 ? 10.141  -7.618  24.465  1.00 2.83  ? 230 PHE A N   1 
ATOM   1835 C CA  . PHE A 1 230 ? 9.304   -7.672  23.262  1.00 2.00  ? 230 PHE A CA  1 
ATOM   1836 C C   . PHE A 1 230 ? 9.132   -6.334  22.415  1.00 3.00  ? 230 PHE A C   1 
ATOM   1837 O O   . PHE A 1 230 ? 8.087   -5.863  21.942  1.00 8.36  ? 230 PHE A O   1 
ATOM   1838 C CB  . PHE A 1 230 ? 8.086   -8.483  23.644  1.00 2.00  ? 230 PHE A CB  1 
ATOM   1839 C CG  . PHE A 1 230 ? 8.470   -9.852  24.170  1.00 2.00  ? 230 PHE A CG  1 
ATOM   1840 C CD1 . PHE A 1 230 ? 8.803   -10.897 23.295  1.00 2.00  ? 230 PHE A CD1 1 
ATOM   1841 C CD2 . PHE A 1 230 ? 8.414   -10.139 25.536  1.00 5.28  ? 230 PHE A CD2 1 
ATOM   1842 C CE1 . PHE A 1 230 ? 8.848   -12.222 23.759  1.00 2.00  ? 230 PHE A CE1 1 
ATOM   1843 C CE2 . PHE A 1 230 ? 8.488   -11.465 26.023  1.00 7.10  ? 230 PHE A CE2 1 
ATOM   1844 C CZ  . PHE A 1 230 ? 8.589   -12.478 25.095  1.00 2.36  ? 230 PHE A CZ  1 
ATOM   1845 N N   . GLY A 1 231 ? 10.258  -5.672  22.200  1.00 3.71  ? 231 GLY A N   1 
ATOM   1846 C CA  . GLY A 1 231 ? 9.945   -4.336  21.764  1.00 3.55  ? 231 GLY A CA  1 
ATOM   1847 C C   . GLY A 1 231 ? 8.977   -3.391  22.591  1.00 4.01  ? 231 GLY A C   1 
ATOM   1848 O O   . GLY A 1 231 ? 8.596   -3.570  23.736  1.00 2.02  ? 231 GLY A O   1 
ATOM   1849 N N   . LYS A 1 232 ? 8.652   -2.324  21.918  1.00 4.51  ? 232 LYS A N   1 
ATOM   1850 C CA  . LYS A 1 232 ? 8.032   -1.420  22.833  1.00 5.75  ? 232 LYS A CA  1 
ATOM   1851 C C   . LYS A 1 232 ? 6.559   -1.308  22.635  1.00 6.55  ? 232 LYS A C   1 
ATOM   1852 O O   . LYS A 1 232 ? 5.950   -0.863  21.661  1.00 6.15  ? 232 LYS A O   1 
ATOM   1853 C CB  . LYS A 1 232 ? 8.833   -0.124  23.006  1.00 8.33  ? 232 LYS A CB  1 
ATOM   1854 C CG  . LYS A 1 232 ? 8.972   0.891   21.814  1.00 5.12  ? 232 LYS A CG  1 
ATOM   1855 C CD  . LYS A 1 232 ? 10.319  0.943   21.079  1.00 2.00  ? 232 LYS A CD  1 
ATOM   1856 C CE  . LYS A 1 232 ? 10.423  1.995   19.955  1.00 2.00  ? 232 LYS A CE  1 
ATOM   1857 N NZ  . LYS A 1 232 ? 10.133  3.396   20.252  1.00 2.00  ? 232 LYS A NZ  1 
ATOM   1858 N N   . GLY A 1 233 ? 6.010   -1.986  23.631  1.00 6.76  ? 233 GLY A N   1 
ATOM   1859 C CA  . GLY A 1 233 ? 4.646   -1.658  23.957  1.00 8.48  ? 233 GLY A CA  1 
ATOM   1860 C C   . GLY A 1 233 ? 4.442   -1.367  25.413  1.00 8.31  ? 233 GLY A C   1 
ATOM   1861 O O   . GLY A 1 233 ? 5.083   -0.558  26.027  1.00 8.96  ? 233 GLY A O   1 
ATOM   1862 N N   . ILE A 1 234 ? 3.455   -2.140  25.891  1.00 4.24  ? 234 ILE A N   1 
ATOM   1863 C CA  . ILE A 1 234 ? 3.090   -2.072  27.323  1.00 7.41  ? 234 ILE A CA  1 
ATOM   1864 C C   . ILE A 1 234 ? 2.905   -3.432  28.092  1.00 9.17  ? 234 ILE A C   1 
ATOM   1865 O O   . ILE A 1 234 ? 1.978   -4.200  27.815  1.00 7.56  ? 234 ILE A O   1 
ATOM   1866 C CB  . ILE A 1 234 ? 1.853   -1.241  27.404  1.00 4.85  ? 234 ILE A CB  1 
ATOM   1867 C CG1 . ILE A 1 234 ? 2.151   0.169   27.072  1.00 2.00  ? 234 ILE A CG1 1 
ATOM   1868 C CG2 . ILE A 1 234 ? 1.233   -1.356  28.782  1.00 2.00  ? 234 ILE A CG2 1 
ATOM   1869 C CD1 . ILE A 1 234 ? 0.906   0.907   26.591  1.00 2.00  ? 234 ILE A CD1 1 
ATOM   1870 N N   . TYR A 1 235 ? 3.899   -3.722  28.963  1.00 6.99  ? 235 TYR A N   1 
ATOM   1871 C CA  . TYR A 1 235 ? 4.099   -5.040  29.564  1.00 2.00  ? 235 TYR A CA  1 
ATOM   1872 C C   . TYR A 1 235 ? 3.341   -5.336  30.856  1.00 3.46  ? 235 TYR A C   1 
ATOM   1873 O O   . TYR A 1 235 ? 3.005   -4.477  31.682  1.00 5.96  ? 235 TYR A O   1 
ATOM   1874 C CB  . TYR A 1 235 ? 5.546   -5.290  29.916  1.00 2.00  ? 235 TYR A CB  1 
ATOM   1875 C CG  . TYR A 1 235 ? 6.418   -5.397  28.664  1.00 2.00  ? 235 TYR A CG  1 
ATOM   1876 C CD1 . TYR A 1 235 ? 6.518   -4.284  27.821  1.00 2.00  ? 235 TYR A CD1 1 
ATOM   1877 C CD2 . TYR A 1 235 ? 7.091   -6.606  28.405  1.00 2.45  ? 235 TYR A CD2 1 
ATOM   1878 C CE1 . TYR A 1 235 ? 7.391   -4.330  26.783  1.00 2.00  ? 235 TYR A CE1 1 
ATOM   1879 C CE2 . TYR A 1 235 ? 7.895   -6.665  27.287  1.00 2.94  ? 235 TYR A CE2 1 
ATOM   1880 C CZ  . TYR A 1 235 ? 8.086   -5.502  26.492  1.00 2.00  ? 235 TYR A CZ  1 
ATOM   1881 O OH  . TYR A 1 235 ? 8.892   -5.546  25.350  1.00 7.74  ? 235 TYR A OH  1 
ATOM   1882 N N   . PHE A 1 236 ? 2.973   -6.598  30.956  1.00 2.00  ? 236 PHE A N   1 
ATOM   1883 C CA  . PHE A 1 236 ? 1.918   -6.848  31.952  1.00 2.00  ? 236 PHE A CA  1 
ATOM   1884 C C   . PHE A 1 236 ? 2.152   -8.229  32.445  1.00 3.23  ? 236 PHE A C   1 
ATOM   1885 O O   . PHE A 1 236 ? 2.673   -9.076  31.738  1.00 5.36  ? 236 PHE A O   1 
ATOM   1886 C CB  . PHE A 1 236 ? 0.492   -6.842  31.368  1.00 2.00  ? 236 PHE A CB  1 
ATOM   1887 C CG  . PHE A 1 236 ? -0.166  -5.475  31.162  1.00 2.00  ? 236 PHE A CG  1 
ATOM   1888 C CD1 . PHE A 1 236 ? -0.335  -5.005  29.858  1.00 2.00  ? 236 PHE A CD1 1 
ATOM   1889 C CD2 . PHE A 1 236 ? -0.615  -4.660  32.206  1.00 2.59  ? 236 PHE A CD2 1 
ATOM   1890 C CE1 . PHE A 1 236 ? -0.747  -3.669  29.658  1.00 3.07  ? 236 PHE A CE1 1 
ATOM   1891 C CE2 . PHE A 1 236 ? -1.144  -3.348  31.987  1.00 2.00  ? 236 PHE A CE2 1 
ATOM   1892 C CZ  . PHE A 1 236 ? -1.103  -2.814  30.723  1.00 2.00  ? 236 PHE A CZ  1 
ATOM   1893 N N   . ALA A 1 237 ? 1.737   -8.512  33.681  1.00 3.09  ? 237 ALA A N   1 
ATOM   1894 C CA  . ALA A 1 237 ? 1.954   -9.911  34.202  1.00 2.00  ? 237 ALA A CA  1 
ATOM   1895 C C   . ALA A 1 237 ? 0.733   -10.742 34.749  1.00 4.90  ? 237 ALA A C   1 
ATOM   1896 O O   . ALA A 1 237 ? -0.283  -10.199 35.142  1.00 4.14  ? 237 ALA A O   1 
ATOM   1897 C CB  . ALA A 1 237 ? 3.197   -9.938  35.193  1.00 2.00  ? 237 ALA A CB  1 
ATOM   1898 N N   . ASP A 1 238 ? 0.873   -12.050 34.781  1.00 4.62  ? 238 ASP A N   1 
ATOM   1899 C CA  . ASP A 1 238 ? -0.275  -12.612 35.522  1.00 2.00  ? 238 ASP A CA  1 
ATOM   1900 C C   . ASP A 1 238 ? -0.001  -13.105 36.870  1.00 5.81  ? 238 ASP A C   1 
ATOM   1901 O O   . ASP A 1 238 ? -0.960  -13.400 37.538  1.00 9.62  ? 238 ASP A O   1 
ATOM   1902 C CB  . ASP A 1 238 ? -1.076  -13.803 35.027  1.00 2.10  ? 238 ASP A CB  1 
ATOM   1903 C CG  . ASP A 1 238 ? -0.282  -14.752 34.144  1.00 15.48 ? 238 ASP A CG  1 
ATOM   1904 O OD1 . ASP A 1 238 ? 0.860   -15.056 34.409  1.00 18.10 ? 238 ASP A OD1 1 
ATOM   1905 O OD2 . ASP A 1 238 ? -0.793  -15.224 33.157  1.00 16.34 ? 238 ASP A OD2 1 
ATOM   1906 N N   . MET A 1 239 ? 1.291   -13.198 37.234  1.00 4.17  ? 239 MET A N   1 
ATOM   1907 C CA  . MET A 1 239 ? 1.713   -13.587 38.571  1.00 2.00  ? 239 MET A CA  1 
ATOM   1908 C C   . MET A 1 239 ? 2.009   -12.342 39.372  1.00 2.00  ? 239 MET A C   1 
ATOM   1909 O O   . MET A 1 239 ? 2.523   -11.481 38.682  1.00 2.52  ? 239 MET A O   1 
ATOM   1910 C CB  . MET A 1 239 ? 2.977   -14.418 38.551  1.00 2.00  ? 239 MET A CB  1 
ATOM   1911 C CG  . MET A 1 239 ? 3.042   -15.777 37.877  1.00 2.00  ? 239 MET A CG  1 
ATOM   1912 S SD  . MET A 1 239 ? 2.006   -17.121 38.507  1.00 5.90  ? 239 MET A SD  1 
ATOM   1913 C CE  . MET A 1 239 ? 2.597   -17.399 40.223  1.00 4.89  ? 239 MET A CE  1 
ATOM   1914 N N   . VAL A 1 240 ? 1.713   -12.223 40.726  1.00 2.91  ? 240 VAL A N   1 
ATOM   1915 C CA  . VAL A 1 240 ? 1.780   -10.812 41.095  1.00 3.16  ? 240 VAL A CA  1 
ATOM   1916 C C   . VAL A 1 240 ? 3.109   -10.333 41.339  1.00 4.99  ? 240 VAL A C   1 
ATOM   1917 O O   . VAL A 1 240 ? 3.363   -9.165  41.040  1.00 11.72 ? 240 VAL A O   1 
ATOM   1918 C CB  . VAL A 1 240 ? 0.899   -10.293 42.205  1.00 2.00  ? 240 VAL A CB  1 
ATOM   1919 C CG1 . VAL A 1 240 ? 1.146   -11.119 43.404  1.00 10.54 ? 240 VAL A CG1 1 
ATOM   1920 C CG2 . VAL A 1 240 ? 0.907   -8.838  42.629  1.00 5.25  ? 240 VAL A CG2 1 
ATOM   1921 N N   . SER A 1 241 ? 3.933   -11.361 41.793  1.00 6.58  ? 241 SER A N   1 
ATOM   1922 C CA  . SER A 1 241 ? 5.410   -11.388 41.696  1.00 2.00  ? 241 SER A CA  1 
ATOM   1923 C C   . SER A 1 241 ? 6.174   -10.744 40.478  1.00 7.76  ? 241 SER A C   1 
ATOM   1924 O O   . SER A 1 241 ? 6.621   -9.618  40.755  1.00 12.87 ? 241 SER A O   1 
ATOM   1925 C CB  . SER A 1 241 ? 5.910   -12.805 41.760  1.00 2.00  ? 241 SER A CB  1 
ATOM   1926 O OG  . SER A 1 241 ? 5.806   -13.436 42.988  1.00 2.00  ? 241 SER A OG  1 
ATOM   1927 N N   . LYS A 1 242 ? 6.318   -11.381 39.151  1.00 6.39  ? 242 LYS A N   1 
ATOM   1928 C CA  . LYS A 1 242 ? 7.004   -10.674 37.965  1.00 7.50  ? 242 LYS A CA  1 
ATOM   1929 C C   . LYS A 1 242 ? 6.870   -9.092  37.929  1.00 6.76  ? 242 LYS A C   1 
ATOM   1930 O O   . LYS A 1 242 ? 7.806   -8.346  37.662  1.00 2.00  ? 242 LYS A O   1 
ATOM   1931 C CB  . LYS A 1 242 ? 6.832   -11.352 36.534  1.00 4.97  ? 242 LYS A CB  1 
ATOM   1932 C CG  . LYS A 1 242 ? 8.036   -11.365 35.498  1.00 11.06 ? 242 LYS A CG  1 
ATOM   1933 C CD  . LYS A 1 242 ? 8.668   -12.780 34.741  1.00 14.43 ? 242 LYS A CD  1 
ATOM   1934 C CE  . LYS A 1 242 ? 10.210  -13.371 34.695  1.00 2.00  ? 242 LYS A CE  1 
ATOM   1935 N NZ  . LYS A 1 242 ? 10.507  -14.569 33.975  1.00 2.00  ? 242 LYS A NZ  1 
ATOM   1936 N N   . SER A 1 243 ? 5.635   -8.653  38.291  1.00 11.25 ? 243 SER A N   1 
ATOM   1937 C CA  . SER A 1 243 ? 5.346   -7.227  38.456  1.00 12.57 ? 243 SER A CA  1 
ATOM   1938 C C   . SER A 1 243 ? 5.749   -6.545  39.713  1.00 12.83 ? 243 SER A C   1 
ATOM   1939 O O   . SER A 1 243 ? 6.162   -5.387  39.731  1.00 15.96 ? 243 SER A O   1 
ATOM   1940 C CB  . SER A 1 243 ? 3.909   -6.831  38.550  1.00 9.69  ? 243 SER A CB  1 
ATOM   1941 O OG  . SER A 1 243 ? 3.226   -7.441  37.523  1.00 12.51 ? 243 SER A OG  1 
ATOM   1942 N N   . ALA A 1 244 ? 5.551   -7.307  40.770  1.00 11.58 ? 244 ALA A N   1 
ATOM   1943 C CA  . ALA A 1 244 ? 5.853   -6.678  42.027  1.00 10.93 ? 244 ALA A CA  1 
ATOM   1944 C C   . ALA A 1 244 ? 7.333   -6.396  42.163  1.00 11.80 ? 244 ALA A C   1 
ATOM   1945 O O   . ALA A 1 244 ? 7.663   -5.319  42.606  1.00 14.85 ? 244 ALA A O   1 
ATOM   1946 C CB  . ALA A 1 244 ? 5.377   -7.541  43.181  1.00 10.06 ? 244 ALA A CB  1 
ATOM   1947 N N   . ASN A 1 245 ? 8.153   -7.309  41.646  1.00 6.86  ? 245 ASN A N   1 
ATOM   1948 C CA  . ASN A 1 245 ? 9.557   -6.986  41.605  1.00 3.78  ? 245 ASN A CA  1 
ATOM   1949 C C   . ASN A 1 245 ? 9.841   -5.619  41.071  1.00 2.04  ? 245 ASN A C   1 
ATOM   1950 O O   . ASN A 1 245 ? 10.548  -4.809  41.574  1.00 3.91  ? 245 ASN A O   1 
ATOM   1951 C CB  . ASN A 1 245 ? 10.151  -8.118  40.882  1.00 10.46 ? 245 ASN A CB  1 
ATOM   1952 C CG  . ASN A 1 245 ? 11.068  -8.819  41.882  1.00 20.50 ? 245 ASN A CG  1 
ATOM   1953 O OD1 . ASN A 1 245 ? 12.121  -8.241  42.140  1.00 25.67 ? 245 ASN A OD1 1 
ATOM   1954 N ND2 . ASN A 1 245 ? 10.685  -10.052 42.344  1.00 15.77 ? 245 ASN A ND2 1 
ATOM   1955 N N   . TYR A 1 246 ? 9.110   -5.230  40.100  1.00 2.00  ? 246 TYR A N   1 
ATOM   1956 C CA  . TYR A 1 246 ? 9.435   -3.910  39.537  1.00 2.00  ? 246 TYR A CA  1 
ATOM   1957 C C   . TYR A 1 246 ? 9.129   -2.701  40.494  1.00 11.23 ? 246 TYR A C   1 
ATOM   1958 O O   . TYR A 1 246 ? 9.053   -1.500  40.207  1.00 13.37 ? 246 TYR A O   1 
ATOM   1959 C CB  . TYR A 1 246 ? 8.590   -3.861  38.230  1.00 5.70  ? 246 TYR A CB  1 
ATOM   1960 C CG  . TYR A 1 246 ? 9.107   -4.727  37.066  1.00 4.39  ? 246 TYR A CG  1 
ATOM   1961 C CD1 . TYR A 1 246 ? 10.246  -4.399  36.267  1.00 7.75  ? 246 TYR A CD1 1 
ATOM   1962 C CD2 . TYR A 1 246 ? 8.403   -5.937  36.826  1.00 6.95  ? 246 TYR A CD2 1 
ATOM   1963 C CE1 . TYR A 1 246 ? 10.761  -5.277  35.296  1.00 9.06  ? 246 TYR A CE1 1 
ATOM   1964 C CE2 . TYR A 1 246 ? 8.920   -6.827  35.876  1.00 10.22 ? 246 TYR A CE2 1 
ATOM   1965 C CZ  . TYR A 1 246 ? 10.110  -6.526  35.128  1.00 10.69 ? 246 TYR A CZ  1 
ATOM   1966 O OH  . TYR A 1 246 ? 10.675  -7.476  34.288  1.00 14.51 ? 246 TYR A OH  1 
ATOM   1967 N N   . CYS A 1 247 ? 8.763   -3.013  41.758  1.00 9.35  ? 247 CYS A N   1 
ATOM   1968 C CA  . CYS A 1 247 ? 8.604   -1.785  42.452  1.00 5.33  ? 247 CYS A CA  1 
ATOM   1969 C C   . CYS A 1 247 ? 9.911   -1.240  42.961  1.00 8.61  ? 247 CYS A C   1 
ATOM   1970 O O   . CYS A 1 247 ? 10.044  -0.067  43.135  1.00 8.85  ? 247 CYS A O   1 
ATOM   1971 C CB  . CYS A 1 247 ? 7.447   -1.838  43.404  1.00 3.44  ? 247 CYS A CB  1 
ATOM   1972 S SG  . CYS A 1 247 ? 6.185   -3.126  43.365  1.00 2.00  ? 247 CYS A SG  1 
ATOM   1973 N N   . HIS A 1 248 ? 10.884  -2.155  43.164  1.00 13.87 ? 248 HIS A N   1 
ATOM   1974 C CA  . HIS A 1 248 ? 12.244  -1.798  43.696  1.00 15.06 ? 248 HIS A CA  1 
ATOM   1975 C C   . HIS A 1 248 ? 12.096  -1.185  45.092  1.00 15.06 ? 248 HIS A C   1 
ATOM   1976 O O   . HIS A 1 248 ? 12.367  -0.108  45.542  1.00 16.07 ? 248 HIS A O   1 
ATOM   1977 C CB  . HIS A 1 248 ? 13.117  -1.013  42.637  1.00 16.11 ? 248 HIS A CB  1 
ATOM   1978 C CG  . HIS A 1 248 ? 13.259  -1.715  41.234  1.00 18.85 ? 248 HIS A CG  1 
ATOM   1979 N ND1 . HIS A 1 248 ? 12.563  -1.419  40.117  1.00 17.12 ? 248 HIS A ND1 1 
ATOM   1980 C CD2 . HIS A 1 248 ? 14.179  -2.729  40.856  1.00 15.40 ? 248 HIS A CD2 1 
ATOM   1981 C CE1 . HIS A 1 248 ? 13.068  -2.224  39.130  1.00 17.93 ? 248 HIS A CE1 1 
ATOM   1982 N NE2 . HIS A 1 248 ? 14.081  -3.042  39.543  1.00 11.86 ? 248 HIS A NE2 1 
ATOM   1983 N N   . THR A 1 249 ? 11.359  -2.006  45.785  1.00 17.24 ? 249 THR A N   1 
ATOM   1984 C CA  . THR A 1 249 ? 11.064  -1.810  47.180  1.00 11.41 ? 249 THR A CA  1 
ATOM   1985 C C   . THR A 1 249 ? 12.067  -2.614  47.928  1.00 14.58 ? 249 THR A C   1 
ATOM   1986 O O   . THR A 1 249 ? 12.304  -3.788  47.878  1.00 18.82 ? 249 THR A O   1 
ATOM   1987 C CB  . THR A 1 249 ? 9.623   -2.196  47.643  1.00 5.97  ? 249 THR A CB  1 
ATOM   1988 O OG1 . THR A 1 249 ? 9.210   -3.569  47.445  1.00 2.00  ? 249 THR A OG1 1 
ATOM   1989 C CG2 . THR A 1 249 ? 8.608   -1.166  47.161  1.00 5.46  ? 249 THR A CG2 1 
ATOM   1990 N N   . SER A 1 250 ? 12.697  -1.888  48.733  1.00 14.71 ? 250 SER A N   1 
ATOM   1991 C CA  . SER A 1 250 ? 13.714  -2.568  49.450  1.00 14.66 ? 250 SER A CA  1 
ATOM   1992 C C   . SER A 1 250 ? 13.471  -2.445  50.905  1.00 11.31 ? 250 SER A C   1 
ATOM   1993 O O   . SER A 1 250 ? 12.462  -1.965  51.484  1.00 7.97  ? 250 SER A O   1 
ATOM   1994 C CB  . SER A 1 250 ? 15.025  -1.975  49.013  1.00 20.98 ? 250 SER A CB  1 
ATOM   1995 O OG  . SER A 1 250 ? 14.831  -0.579  48.713  1.00 29.41 ? 250 SER A OG  1 
ATOM   1996 N N   . GLN A 1 251 ? 14.595  -2.947  51.483  1.00 8.70  ? 251 GLN A N   1 
ATOM   1997 C CA  . GLN A 1 251 ? 14.615  -2.945  52.940  1.00 5.11  ? 251 GLN A CA  1 
ATOM   1998 C C   . GLN A 1 251 ? 14.338  -1.586  53.561  1.00 5.82  ? 251 GLN A C   1 
ATOM   1999 O O   . GLN A 1 251 ? 14.109  -1.666  54.737  1.00 10.89 ? 251 GLN A O   1 
ATOM   2000 C CB  . GLN A 1 251 ? 15.876  -3.565  53.340  1.00 4.25  ? 251 GLN A CB  1 
ATOM   2001 C CG  . GLN A 1 251 ? 15.855  -4.986  52.999  1.00 12.33 ? 251 GLN A CG  1 
ATOM   2002 C CD  . GLN A 1 251 ? 15.081  -5.960  53.928  1.00 18.07 ? 251 GLN A CD  1 
ATOM   2003 O OE1 . GLN A 1 251 ? 15.185  -7.212  53.855  1.00 16.34 ? 251 GLN A OE1 1 
ATOM   2004 N NE2 . GLN A 1 251 ? 14.301  -5.234  54.800  1.00 21.86 ? 251 GLN A NE2 1 
ATOM   2005 N N   . GLY A 1 252 ? 14.374  -0.389  52.782  1.00 6.11  ? 252 GLY A N   1 
ATOM   2006 C CA  . GLY A 1 252 ? 13.521  0.724   53.146  1.00 4.29  ? 252 GLY A CA  1 
ATOM   2007 C C   . GLY A 1 252 ? 13.579  2.127   52.417  1.00 10.39 ? 252 GLY A C   1 
ATOM   2008 O O   . GLY A 1 252 ? 14.586  2.821   52.399  1.00 11.88 ? 252 GLY A O   1 
ATOM   2009 N N   . ASP A 1 253 ? 12.450  2.632   51.800  1.00 9.95  ? 253 ASP A N   1 
ATOM   2010 C CA  . ASP A 1 253 ? 11.101  2.008   51.494  1.00 11.55 ? 253 ASP A CA  1 
ATOM   2011 C C   . ASP A 1 253 ? 10.985  0.538   51.199  1.00 12.51 ? 253 ASP A C   1 
ATOM   2012 O O   . ASP A 1 253 ? 11.651  0.107   50.278  1.00 13.05 ? 253 ASP A O   1 
ATOM   2013 C CB  . ASP A 1 253 ? 10.327  2.628   50.295  1.00 11.82 ? 253 ASP A CB  1 
ATOM   2014 C CG  . ASP A 1 253 ? 11.304  3.531   49.512  1.00 13.02 ? 253 ASP A CG  1 
ATOM   2015 O OD1 . ASP A 1 253 ? 11.290  4.774   49.811  1.00 11.55 ? 253 ASP A OD1 1 
ATOM   2016 O OD2 . ASP A 1 253 ? 12.060  2.962   48.651  1.00 7.83  ? 253 ASP A OD2 1 
ATOM   2017 N N   . PRO A 1 254 ? 10.103  -0.149  52.017  1.00 10.84 ? 254 PRO A N   1 
ATOM   2018 C CA  . PRO A 1 254 ? 9.565   -1.526  51.761  1.00 9.27  ? 254 PRO A CA  1 
ATOM   2019 C C   . PRO A 1 254 ? 8.093   -1.481  51.164  1.00 5.94  ? 254 PRO A C   1 
ATOM   2020 O O   . PRO A 1 254 ? 7.316   -2.419  51.229  1.00 3.75  ? 254 PRO A O   1 
ATOM   2021 C CB  . PRO A 1 254 ? 9.483   -2.100  53.175  1.00 10.24 ? 254 PRO A CB  1 
ATOM   2022 C CG  . PRO A 1 254 ? 8.716   -0.932  53.777  1.00 11.95 ? 254 PRO A CG  1 
ATOM   2023 C CD  . PRO A 1 254 ? 9.508   0.327   53.282  1.00 11.89 ? 254 PRO A CD  1 
ATOM   2024 N N   . ILE A 1 255 ? 7.711   -0.279  50.666  1.00 5.84  ? 255 ILE A N   1 
ATOM   2025 C CA  . ILE A 1 255 ? 6.282   -0.055  50.472  1.00 2.00  ? 255 ILE A CA  1 
ATOM   2026 C C   . ILE A 1 255 ? 6.024   0.434   49.061  1.00 3.30  ? 255 ILE A C   1 
ATOM   2027 O O   . ILE A 1 255 ? 6.903   1.171   48.647  1.00 5.03  ? 255 ILE A O   1 
ATOM   2028 C CB  . ILE A 1 255 ? 5.763   0.926   51.505  1.00 2.00  ? 255 ILE A CB  1 
ATOM   2029 C CG1 . ILE A 1 255 ? 5.357   -0.097  52.500  1.00 2.00  ? 255 ILE A CG1 1 
ATOM   2030 C CG2 . ILE A 1 255 ? 4.549   1.801   51.110  1.00 2.00  ? 255 ILE A CG2 1 
ATOM   2031 C CD1 . ILE A 1 255 ? 5.270   0.559   53.849  1.00 5.51  ? 255 ILE A CD1 1 
ATOM   2032 N N   . GLY A 1 256 ? 4.950   0.000   48.361  1.00 2.00  ? 256 GLY A N   1 
ATOM   2033 C CA  . GLY A 1 256 ? 5.088   0.037   46.911  1.00 2.00  ? 256 GLY A CA  1 
ATOM   2034 C C   . GLY A 1 256 ? 3.848   -0.195  46.134  1.00 2.20  ? 256 GLY A C   1 
ATOM   2035 O O   . GLY A 1 256 ? 3.147   -1.167  46.353  1.00 3.09  ? 256 GLY A O   1 
ATOM   2036 N N   . LEU A 1 257 ? 3.573   0.755   45.224  1.00 2.00  ? 257 LEU A N   1 
ATOM   2037 C CA  . LEU A 1 257 ? 2.337   0.657   44.375  1.00 2.00  ? 257 LEU A CA  1 
ATOM   2038 C C   . LEU A 1 257 ? 2.227   -0.498  43.313  1.00 2.00  ? 257 LEU A C   1 
ATOM   2039 O O   . LEU A 1 257 ? 3.217   -0.965  42.843  1.00 2.00  ? 257 LEU A O   1 
ATOM   2040 C CB  . LEU A 1 257 ? 2.251   2.008   43.794  1.00 2.00  ? 257 LEU A CB  1 
ATOM   2041 C CG  . LEU A 1 257 ? 1.911   3.035   44.804  1.00 2.05  ? 257 LEU A CG  1 
ATOM   2042 C CD1 . LEU A 1 257 ? 2.255   4.229   44.003  1.00 2.00  ? 257 LEU A CD1 1 
ATOM   2043 C CD2 . LEU A 1 257 ? 0.428   3.100   45.204  1.00 5.83  ? 257 LEU A CD2 1 
ATOM   2044 N N   . ILE A 1 258 ? 1.088   -1.016  43.026  1.00 2.00  ? 258 ILE A N   1 
ATOM   2045 C CA  . ILE A 1 258 ? 0.820   -1.839  41.815  1.00 3.23  ? 258 ILE A CA  1 
ATOM   2046 C C   . ILE A 1 258 ? -0.558  -1.773  41.025  1.00 7.59  ? 258 ILE A C   1 
ATOM   2047 O O   . ILE A 1 258 ? -1.652  -1.672  41.596  1.00 9.72  ? 258 ILE A O   1 
ATOM   2048 C CB  . ILE A 1 258 ? 1.299   -3.304  41.837  1.00 2.00  ? 258 ILE A CB  1 
ATOM   2049 C CG1 . ILE A 1 258 ? 0.324   -4.334  42.177  1.00 5.47  ? 258 ILE A CG1 1 
ATOM   2050 C CG2 . ILE A 1 258 ? 2.481   -3.646  42.728  1.00 2.00  ? 258 ILE A CG2 1 
ATOM   2051 C CD1 . ILE A 1 258 ? 1.160   -5.322  41.372  1.00 2.00  ? 258 ILE A CD1 1 
ATOM   2052 N N   . LEU A 1 259 ? -0.443  -1.786  39.647  1.00 7.56  ? 259 LEU A N   1 
ATOM   2053 C CA  . LEU A 1 259 ? -1.720  -1.566  38.959  1.00 3.95  ? 259 LEU A CA  1 
ATOM   2054 C C   . LEU A 1 259 ? -2.379  -2.854  38.790  1.00 5.91  ? 259 LEU A C   1 
ATOM   2055 O O   . LEU A 1 259 ? -1.711  -3.855  38.591  1.00 11.45 ? 259 LEU A O   1 
ATOM   2056 C CB  . LEU A 1 259 ? -1.617  -0.828  37.604  1.00 2.00  ? 259 LEU A CB  1 
ATOM   2057 C CG  . LEU A 1 259 ? -1.048  0.528   37.918  1.00 2.00  ? 259 LEU A CG  1 
ATOM   2058 C CD1 . LEU A 1 259 ? -0.512  1.408   36.849  1.00 2.00  ? 259 LEU A CD1 1 
ATOM   2059 C CD2 . LEU A 1 259 ? -2.110  1.315   38.563  1.00 4.86  ? 259 LEU A CD2 1 
ATOM   2060 N N   . LEU A 1 260 ? -3.703  -2.806  38.768  1.00 8.21  ? 260 LEU A N   1 
ATOM   2061 C CA  . LEU A 1 260 ? -4.325  -3.992  38.064  1.00 5.26  ? 260 LEU A CA  1 
ATOM   2062 C C   . LEU A 1 260 ? -5.031  -3.511  36.739  1.00 2.00  ? 260 LEU A C   1 
ATOM   2063 O O   . LEU A 1 260 ? -6.079  -2.894  36.860  1.00 4.32  ? 260 LEU A O   1 
ATOM   2064 C CB  . LEU A 1 260 ? -5.346  -4.745  38.963  1.00 2.00  ? 260 LEU A CB  1 
ATOM   2065 C CG  . LEU A 1 260 ? -4.942  -5.937  39.761  1.00 2.00  ? 260 LEU A CG  1 
ATOM   2066 C CD1 . LEU A 1 260 ? -5.991  -6.253  40.830  1.00 2.00  ? 260 LEU A CD1 1 
ATOM   2067 C CD2 . LEU A 1 260 ? -4.701  -7.079  38.809  1.00 2.00  ? 260 LEU A CD2 1 
ATOM   2068 N N   . GLY A 1 261 ? -4.448  -3.750  35.547  1.00 2.00  ? 261 GLY A N   1 
ATOM   2069 C CA  . GLY A 1 261 ? -5.096  -3.290  34.319  1.00 2.00  ? 261 GLY A CA  1 
ATOM   2070 C C   . GLY A 1 261 ? -6.101  -4.281  33.765  1.00 4.86  ? 261 GLY A C   1 
ATOM   2071 O O   . GLY A 1 261 ? -5.899  -5.483  33.805  1.00 11.24 ? 261 GLY A O   1 
ATOM   2072 N N   . GLU A 1 262 ? -7.188  -3.728  33.167  1.00 2.00  ? 262 GLU A N   1 
ATOM   2073 C CA  . GLU A 1 262 ? -7.903  -4.483  32.088  1.00 2.00  ? 262 GLU A CA  1 
ATOM   2074 C C   . GLU A 1 262 ? -7.160  -4.464  30.762  1.00 3.72  ? 262 GLU A C   1 
ATOM   2075 O O   . GLU A 1 262 ? -6.793  -3.435  30.255  1.00 10.56 ? 262 GLU A O   1 
ATOM   2076 C CB  . GLU A 1 262 ? -9.290  -3.903  31.870  1.00 2.05  ? 262 GLU A CB  1 
ATOM   2077 C CG  . GLU A 1 262 ? -10.236 -4.949  31.309  1.00 5.06  ? 262 GLU A CG  1 
ATOM   2078 C CD  . GLU A 1 262 ? -11.643 -4.294  31.042  1.00 8.38  ? 262 GLU A CD  1 
ATOM   2079 O OE1 . GLU A 1 262 ? -11.817 -3.084  31.306  1.00 2.63  ? 262 GLU A OE1 1 
ATOM   2080 O OE2 . GLU A 1 262 ? -12.569 -5.002  30.576  1.00 6.20  ? 262 GLU A OE2 1 
ATOM   2081 N N   . VAL A 1 263 ? -6.827  -5.626  30.257  1.00 3.89  ? 263 VAL A N   1 
ATOM   2082 C CA  . VAL A 1 263 ? -6.203  -5.465  28.998  1.00 2.00  ? 263 VAL A CA  1 
ATOM   2083 C C   . VAL A 1 263 ? -6.808  -6.308  28.021  1.00 4.82  ? 263 VAL A C   1 
ATOM   2084 O O   . VAL A 1 263 ? -7.079  -7.463  28.282  1.00 6.38  ? 263 VAL A O   1 
ATOM   2085 C CB  . VAL A 1 263 ? -4.718  -5.374  28.800  1.00 2.00  ? 263 VAL A CB  1 
ATOM   2086 C CG1 . VAL A 1 263 ? -4.080  -4.463  29.732  1.00 2.00  ? 263 VAL A CG1 1 
ATOM   2087 C CG2 . VAL A 1 263 ? -3.918  -6.540  29.076  1.00 2.00  ? 263 VAL A CG2 1 
ATOM   2088 N N   . ALA A 1 264 ? -7.063  -5.604  26.865  1.00 3.39  ? 264 ALA A N   1 
ATOM   2089 C CA  . ALA A 1 264 ? -7.577  -6.044  25.544  1.00 2.00  ? 264 ALA A CA  1 
ATOM   2090 C C   . ALA A 1 264 ? -6.551  -6.748  24.650  1.00 3.36  ? 264 ALA A C   1 
ATOM   2091 O O   . ALA A 1 264 ? -6.027  -6.240  23.661  1.00 6.06  ? 264 ALA A O   1 
ATOM   2092 C CB  . ALA A 1 264 ? -8.283  -4.868  24.824  1.00 2.00  ? 264 ALA A CB  1 
ATOM   2093 N N   . LEU A 1 265 ? -6.305  -7.986  25.110  1.00 2.00  ? 265 LEU A N   1 
ATOM   2094 C CA  . LEU A 1 265 ? -5.408  -8.867  24.407  1.00 2.00  ? 265 LEU A CA  1 
ATOM   2095 C C   . LEU A 1 265 ? -5.848  -9.372  23.048  1.00 4.79  ? 265 LEU A C   1 
ATOM   2096 O O   . LEU A 1 265 ? -4.976  -9.590  22.239  1.00 11.33 ? 265 LEU A O   1 
ATOM   2097 C CB  . LEU A 1 265 ? -4.882  -10.067 25.275  1.00 2.22  ? 265 LEU A CB  1 
ATOM   2098 C CG  . LEU A 1 265 ? -4.117  -9.648  26.552  1.00 3.81  ? 265 LEU A CG  1 
ATOM   2099 C CD1 . LEU A 1 265 ? -3.525  -10.797 27.282  1.00 2.89  ? 265 LEU A CD1 1 
ATOM   2100 C CD2 . LEU A 1 265 ? -2.989  -8.667  26.285  1.00 5.43  ? 265 LEU A CD2 1 
ATOM   2101 N N   . GLY A 1 266 ? -7.110  -9.626  22.774  1.00 2.00  ? 266 GLY A N   1 
ATOM   2102 C CA  . GLY A 1 266 ? -7.377  -10.497 21.634  1.00 2.00  ? 266 GLY A CA  1 
ATOM   2103 C C   . GLY A 1 266 ? -6.474  -11.651 21.127  1.00 2.00  ? 266 GLY A C   1 
ATOM   2104 O O   . GLY A 1 266 ? -6.249  -12.649 21.795  1.00 2.00  ? 266 GLY A O   1 
ATOM   2105 N N   . ASN A 1 267 ? -5.958  -11.476 19.897  1.00 5.35  ? 267 ASN A N   1 
ATOM   2106 C CA  . ASN A 1 267 ? -5.191  -12.640 19.499  1.00 2.00  ? 267 ASN A CA  1 
ATOM   2107 C C   . ASN A 1 267 ? -3.725  -12.592 19.830  1.00 3.70  ? 267 ASN A C   1 
ATOM   2108 O O   . ASN A 1 267 ? -2.918  -11.807 19.299  1.00 3.87  ? 267 ASN A O   1 
ATOM   2109 C CB  . ASN A 1 267 ? -5.240  -13.107 17.968  1.00 3.72  ? 267 ASN A CB  1 
ATOM   2110 C CG  . ASN A 1 267 ? -6.549  -13.171 17.241  1.00 2.00  ? 267 ASN A CG  1 
ATOM   2111 O OD1 . ASN A 1 267 ? -7.386  -14.049 17.368  1.00 6.77  ? 267 ASN A OD1 1 
ATOM   2112 N ND2 . ASN A 1 267 ? -6.696  -12.077 16.617  1.00 2.00  ? 267 ASN A ND2 1 
ATOM   2113 N N   . MET A 1 268 ? -3.437  -13.502 20.784  1.00 2.81  ? 268 MET A N   1 
ATOM   2114 C CA  . MET A 1 268 ? -2.074  -13.580 21.371  1.00 2.00  ? 268 MET A CA  1 
ATOM   2115 C C   . MET A 1 268 ? -0.904  -14.117 20.515  1.00 2.00  ? 268 MET A C   1 
ATOM   2116 O O   . MET A 1 268 ? -0.805  -15.203 19.984  1.00 2.86  ? 268 MET A O   1 
ATOM   2117 C CB  . MET A 1 268 ? -2.187  -14.266 22.719  1.00 2.00  ? 268 MET A CB  1 
ATOM   2118 C CG  . MET A 1 268 ? -2.430  -13.339 23.951  1.00 2.00  ? 268 MET A CG  1 
ATOM   2119 S SD  . MET A 1 268 ? -3.464  -14.341 25.072  1.00 2.00  ? 268 MET A SD  1 
ATOM   2120 C CE  . MET A 1 268 ? -2.621  -15.925 24.823  1.00 4.85  ? 268 MET A CE  1 
ATOM   2121 N N   . TYR A 1 269 ? 0.056   -13.260 20.394  1.00 4.30  ? 269 TYR A N   1 
ATOM   2122 C CA  . TYR A 1 269 ? 1.180   -13.865 19.605  1.00 4.91  ? 269 TYR A CA  1 
ATOM   2123 C C   . TYR A 1 269 ? 2.079   -14.694 20.515  1.00 4.02  ? 269 TYR A C   1 
ATOM   2124 O O   . TYR A 1 269 ? 2.702   -14.187 21.438  1.00 9.39  ? 269 TYR A O   1 
ATOM   2125 C CB  . TYR A 1 269 ? 1.918   -12.763 18.714  1.00 2.18  ? 269 TYR A CB  1 
ATOM   2126 C CG  . TYR A 1 269 ? 2.899   -13.276 17.715  1.00 2.00  ? 269 TYR A CG  1 
ATOM   2127 C CD1 . TYR A 1 269 ? 2.858   -14.618 17.414  1.00 2.00  ? 269 TYR A CD1 1 
ATOM   2128 C CD2 . TYR A 1 269 ? 3.842   -12.391 17.175  1.00 2.00  ? 269 TYR A CD2 1 
ATOM   2129 C CE1 . TYR A 1 269 ? 3.892   -15.156 16.691  1.00 2.00  ? 269 TYR A CE1 1 
ATOM   2130 C CE2 . TYR A 1 269 ? 4.873   -12.968 16.460  1.00 2.00  ? 269 TYR A CE2 1 
ATOM   2131 C CZ  . TYR A 1 269 ? 4.939   -14.363 16.235  1.00 2.00  ? 269 TYR A CZ  1 
ATOM   2132 O OH  . TYR A 1 269 ? 5.929   -15.055 15.591  1.00 2.00  ? 269 TYR A OH  1 
ATOM   2133 N N   . GLU A 1 270 ? 2.058   -15.955 20.319  1.00 2.00  ? 270 GLU A N   1 
ATOM   2134 C CA  . GLU A 1 270 ? 2.790   -16.539 21.425  1.00 3.12  ? 270 GLU A CA  1 
ATOM   2135 C C   . GLU A 1 270 ? 4.201   -16.813 21.032  1.00 2.00  ? 270 GLU A C   1 
ATOM   2136 O O   . GLU A 1 270 ? 4.432   -17.296 19.922  1.00 5.01  ? 270 GLU A O   1 
ATOM   2137 C CB  . GLU A 1 270 ? 2.055   -17.678 22.080  1.00 5.16  ? 270 GLU A CB  1 
ATOM   2138 C CG  . GLU A 1 270 ? 0.788   -17.300 22.827  1.00 2.00  ? 270 GLU A CG  1 
ATOM   2139 C CD  . GLU A 1 270 ? 0.018   -18.546 23.219  1.00 5.05  ? 270 GLU A CD  1 
ATOM   2140 O OE1 . GLU A 1 270 ? 0.302   -19.673 22.765  1.00 9.04  ? 270 GLU A OE1 1 
ATOM   2141 O OE2 . GLU A 1 270 ? -0.879  -18.408 24.047  1.00 8.28  ? 270 GLU A OE2 1 
ATOM   2142 N N   . LEU A 1 271 ? 5.082   -16.349 21.974  1.00 2.00  ? 271 LEU A N   1 
ATOM   2143 C CA  . LEU A 1 271 ? 6.506   -16.122 21.762  1.00 5.81  ? 271 LEU A CA  1 
ATOM   2144 C C   . LEU A 1 271 ? 7.446   -16.631 22.901  1.00 9.00  ? 271 LEU A C   1 
ATOM   2145 O O   . LEU A 1 271 ? 7.060   -16.790 24.062  1.00 11.71 ? 271 LEU A O   1 
ATOM   2146 C CB  . LEU A 1 271 ? 6.640   -14.608 21.479  1.00 4.34  ? 271 LEU A CB  1 
ATOM   2147 C CG  . LEU A 1 271 ? 6.467   -14.242 19.974  1.00 2.00  ? 271 LEU A CG  1 
ATOM   2148 C CD1 . LEU A 1 271 ? 7.246   -13.043 19.482  1.00 2.00  ? 271 LEU A CD1 1 
ATOM   2149 C CD2 . LEU A 1 271 ? 6.735   -15.434 19.108  1.00 3.76  ? 271 LEU A CD2 1 
ATOM   2150 N N   . LYS A 1 272 ? 8.696   -16.924 22.664  1.00 8.98  ? 272 LYS A N   1 
ATOM   2151 C CA  . LYS A 1 272 ? 9.384   -17.436 23.878  1.00 2.25  ? 272 LYS A CA  1 
ATOM   2152 C C   . LYS A 1 272 ? 10.749  -16.828 24.109  1.00 6.84  ? 272 LYS A C   1 
ATOM   2153 O O   . LYS A 1 272 ? 11.321  -16.832 25.216  1.00 6.87  ? 272 LYS A O   1 
ATOM   2154 C CB  . LYS A 1 272 ? 9.643   -18.933 23.831  1.00 5.33  ? 272 LYS A CB  1 
ATOM   2155 C CG  . LYS A 1 272 ? 8.391   -19.625 24.152  1.00 5.36  ? 272 LYS A CG  1 
ATOM   2156 C CD  . LYS A 1 272 ? 8.415   -20.675 23.061  1.00 2.00  ? 272 LYS A CD  1 
ATOM   2157 C CE  . LYS A 1 272 ? 8.771   -22.082 23.506  1.00 2.00  ? 272 LYS A CE  1 
ATOM   2158 N NZ  . LYS A 1 272 ? 8.095   -23.012 22.610  1.00 2.91  ? 272 LYS A NZ  1 
ATOM   2159 N N   . HIS A 1 273 ? 11.249  -16.310 23.014  1.00 4.62  ? 273 HIS A N   1 
ATOM   2160 C CA  . HIS A 1 273 ? 12.465  -15.616 23.145  1.00 2.27  ? 273 HIS A CA  1 
ATOM   2161 C C   . HIS A 1 273 ? 12.077  -14.341 22.675  1.00 2.86  ? 273 HIS A C   1 
ATOM   2162 O O   . HIS A 1 273 ? 10.889  -14.053 22.515  1.00 2.00  ? 273 HIS A O   1 
ATOM   2163 C CB  . HIS A 1 273 ? 13.449  -16.258 22.314  1.00 3.73  ? 273 HIS A CB  1 
ATOM   2164 C CG  . HIS A 1 273 ? 13.387  -17.671 22.772  1.00 2.00  ? 273 HIS A CG  1 
ATOM   2165 N ND1 . HIS A 1 273 ? 13.695  -18.090 24.026  1.00 3.64  ? 273 HIS A ND1 1 
ATOM   2166 C CD2 . HIS A 1 273 ? 13.034  -18.740 22.019  1.00 2.00  ? 273 HIS A CD2 1 
ATOM   2167 C CE1 . HIS A 1 273 ? 13.543  -19.426 24.050  1.00 3.62  ? 273 HIS A CE1 1 
ATOM   2168 N NE2 . HIS A 1 273 ? 13.147  -19.800 22.828  1.00 2.00  ? 273 HIS A NE2 1 
ATOM   2169 N N   . ALA A 1 274 ? 13.134  -13.475 22.637  1.00 3.96  ? 274 ALA A N   1 
ATOM   2170 C CA  . ALA A 1 274 ? 12.854  -12.056 22.374  1.00 2.38  ? 274 ALA A CA  1 
ATOM   2171 C C   . ALA A 1 274 ? 12.517  -11.830 20.907  1.00 2.00  ? 274 ALA A C   1 
ATOM   2172 O O   . ALA A 1 274 ? 13.137  -12.339 19.987  1.00 9.64  ? 274 ALA A O   1 
ATOM   2173 C CB  . ALA A 1 274 ? 13.922  -11.101 22.872  1.00 2.00  ? 274 ALA A CB  1 
ATOM   2174 N N   . SER A 1 275 ? 11.499  -11.005 20.743  1.00 2.00  ? 275 SER A N   1 
ATOM   2175 C CA  . SER A 1 275 ? 11.162  -10.428 19.438  1.00 2.21  ? 275 SER A CA  1 
ATOM   2176 C C   . SER A 1 275 ? 11.132  -8.942  19.364  1.00 2.00  ? 275 SER A C   1 
ATOM   2177 O O   . SER A 1 275 ? 10.308  -8.347  19.986  1.00 2.00  ? 275 SER A O   1 
ATOM   2178 C CB  . SER A 1 275 ? 9.845   -11.096 18.985  1.00 6.65  ? 275 SER A CB  1 
ATOM   2179 O OG  . SER A 1 275 ? 9.296   -10.615 17.739  1.00 8.43  ? 275 SER A OG  1 
ATOM   2180 N N   . HIS A 1 276 ? 12.082  -8.366  18.689  1.00 3.46  ? 276 HIS A N   1 
ATOM   2181 C CA  . HIS A 1 276 ? 12.130  -6.928  18.785  1.00 3.94  ? 276 HIS A CA  1 
ATOM   2182 C C   . HIS A 1 276 ? 11.111  -5.939  18.195  1.00 7.73  ? 276 HIS A C   1 
ATOM   2183 O O   . HIS A 1 276 ? 11.443  -4.855  17.767  1.00 12.41 ? 276 HIS A O   1 
ATOM   2184 C CB  . HIS A 1 276 ? 13.566  -6.443  18.545  1.00 2.00  ? 276 HIS A CB  1 
ATOM   2185 C CG  . HIS A 1 276 ? 14.458  -6.830  19.709  1.00 2.00  ? 276 HIS A CG  1 
ATOM   2186 N ND1 . HIS A 1 276 ? 14.187  -6.466  20.987  1.00 2.00  ? 276 HIS A ND1 1 
ATOM   2187 C CD2 . HIS A 1 276 ? 15.418  -7.830  19.712  1.00 2.00  ? 276 HIS A CD2 1 
ATOM   2188 C CE1 . HIS A 1 276 ? 14.891  -7.280  21.811  1.00 2.00  ? 276 HIS A CE1 1 
ATOM   2189 N NE2 . HIS A 1 276 ? 15.637  -8.089  21.038  1.00 6.20  ? 276 HIS A NE2 1 
ATOM   2190 N N   . ILE A 1 277 ? 9.798   -6.252  18.341  1.00 6.94  ? 277 ILE A N   1 
ATOM   2191 C CA  . ILE A 1 277 ? 8.779   -5.554  17.585  1.00 4.08  ? 277 ILE A CA  1 
ATOM   2192 C C   . ILE A 1 277 ? 8.272   -4.267  18.071  1.00 2.00  ? 277 ILE A C   1 
ATOM   2193 O O   . ILE A 1 277 ? 8.816   -3.649  18.949  1.00 2.00  ? 277 ILE A O   1 
ATOM   2194 C CB  . ILE A 1 277 ? 7.615   -6.401  17.186  1.00 3.12  ? 277 ILE A CB  1 
ATOM   2195 C CG1 . ILE A 1 277 ? 6.392   -6.734  18.019  1.00 2.00  ? 277 ILE A CG1 1 
ATOM   2196 C CG2 . ILE A 1 277 ? 8.362   -7.557  16.607  1.00 12.97 ? 277 ILE A CG2 1 
ATOM   2197 C CD1 . ILE A 1 277 ? 6.419   -8.224  18.343  1.00 2.00  ? 277 ILE A CD1 1 
ATOM   2198 N N   . SER A 1 278 ? 7.186   -3.817  17.434  1.00 5.42  ? 278 SER A N   1 
ATOM   2199 C CA  . SER A 1 278 ? 6.529   -2.458  17.618  1.00 8.23  ? 278 SER A CA  1 
ATOM   2200 C C   . SER A 1 278 ? 5.427   -2.433  16.596  1.00 11.59 ? 278 SER A C   1 
ATOM   2201 O O   . SER A 1 278 ? 4.371   -1.819  16.795  1.00 13.91 ? 278 SER A O   1 
ATOM   2202 C CB  . SER A 1 278 ? 7.305   -1.170  17.310  1.00 7.25  ? 278 SER A CB  1 
ATOM   2203 O OG  . SER A 1 278 ? 7.556   -1.228  15.927  1.00 13.40 ? 278 SER A OG  1 
ATOM   2204 N N   . LYS A 1 279 ? 5.722   -3.296  15.535  1.00 13.48 ? 279 LYS A N   1 
ATOM   2205 C CA  . LYS A 1 279 ? 4.692   -3.726  14.541  1.00 15.70 ? 279 LYS A CA  1 
ATOM   2206 C C   . LYS A 1 279 ? 4.151   -5.127  14.788  1.00 13.30 ? 279 LYS A C   1 
ATOM   2207 O O   . LYS A 1 279 ? 4.878   -6.111  14.955  1.00 11.69 ? 279 LYS A O   1 
ATOM   2208 C CB  . LYS A 1 279 ? 5.190   -3.508  13.065  1.00 17.83 ? 279 LYS A CB  1 
ATOM   2209 C CG  . LYS A 1 279 ? 6.723   -3.675  13.036  1.00 22.38 ? 279 LYS A CG  1 
ATOM   2210 C CD  . LYS A 1 279 ? 7.397   -3.922  11.676  1.00 22.16 ? 279 LYS A CD  1 
ATOM   2211 C CE  . LYS A 1 279 ? 7.377   -5.390  11.147  1.00 26.17 ? 279 LYS A CE  1 
ATOM   2212 N NZ  . LYS A 1 279 ? 5.988   -5.725  10.928  1.00 26.19 ? 279 LYS A NZ  1 
ATOM   2213 N N   . LEU A 1 280 ? 2.839   -5.154  14.968  1.00 13.27 ? 280 LEU A N   1 
ATOM   2214 C CA  . LEU A 1 280 ? 2.392   -6.526  15.290  1.00 15.02 ? 280 LEU A CA  1 
ATOM   2215 C C   . LEU A 1 280 ? 1.783   -7.096  14.038  1.00 15.46 ? 280 LEU A C   1 
ATOM   2216 O O   . LEU A 1 280 ? 0.956   -6.410  13.553  1.00 14.58 ? 280 LEU A O   1 
ATOM   2217 C CB  . LEU A 1 280 ? 1.407   -6.373  16.513  1.00 13.44 ? 280 LEU A CB  1 
ATOM   2218 C CG  . LEU A 1 280 ? 0.835   -7.424  17.446  1.00 9.19  ? 280 LEU A CG  1 
ATOM   2219 C CD1 . LEU A 1 280 ? 1.539   -8.762  17.551  1.00 9.88  ? 280 LEU A CD1 1 
ATOM   2220 C CD2 . LEU A 1 280 ? 0.643   -6.737  18.725  1.00 7.70  ? 280 LEU A CD2 1 
ATOM   2221 N N   . PRO A 1 281 ? 2.145   -8.339  13.581  1.00 14.30 ? 281 PRO A N   1 
ATOM   2222 C CA  . PRO A 1 281 ? 1.663   -8.898  12.268  1.00 10.93 ? 281 PRO A CA  1 
ATOM   2223 C C   . PRO A 1 281 ? 0.126   -8.979  12.184  1.00 9.63  ? 281 PRO A C   1 
ATOM   2224 O O   . PRO A 1 281 ? -0.624  -8.851  13.123  1.00 18.35 ? 281 PRO A O   1 
ATOM   2225 C CB  . PRO A 1 281 ? 2.177   -10.312 12.328  1.00 10.80 ? 281 PRO A CB  1 
ATOM   2226 C CG  . PRO A 1 281 ? 2.088   -10.644 13.802  1.00 12.57 ? 281 PRO A CG  1 
ATOM   2227 C CD  . PRO A 1 281 ? 2.730   -9.386  14.378  1.00 12.03 ? 281 PRO A CD  1 
ATOM   2228 N N   . LYS A 1 282 ? -0.393  -9.249  11.059  1.00 7.90  ? 282 LYS A N   1 
ATOM   2229 C CA  . LYS A 1 282 ? -1.764  -8.870  10.987  1.00 4.54  ? 282 LYS A CA  1 
ATOM   2230 C C   . LYS A 1 282 ? -2.772  -9.791  11.735  1.00 5.09  ? 282 LYS A C   1 
ATOM   2231 O O   . LYS A 1 282 ? -2.551  -10.948 11.900  1.00 9.94  ? 282 LYS A O   1 
ATOM   2232 C CB  . LYS A 1 282 ? -1.830  -8.625  9.461   1.00 9.86  ? 282 LYS A CB  1 
ATOM   2233 C CG  . LYS A 1 282 ? -0.707  -7.581  8.976   1.00 6.07  ? 282 LYS A CG  1 
ATOM   2234 C CD  . LYS A 1 282 ? 0.686   -7.939  8.410   1.00 6.90  ? 282 LYS A CD  1 
ATOM   2235 C CE  . LYS A 1 282 ? 1.294   -6.721  7.646   1.00 3.25  ? 282 LYS A CE  1 
ATOM   2236 N NZ  . LYS A 1 282 ? 0.405   -5.522  7.667   1.00 2.00  ? 282 LYS A NZ  1 
ATOM   2237 N N   . GLY A 1 283 ? -3.868  -9.196  12.287  1.00 3.33  ? 283 GLY A N   1 
ATOM   2238 C CA  . GLY A 1 283 ? -4.697  -10.202 12.917  1.00 2.00  ? 283 GLY A CA  1 
ATOM   2239 C C   . GLY A 1 283 ? -4.232  -10.582 14.276  1.00 7.11  ? 283 GLY A C   1 
ATOM   2240 O O   . GLY A 1 283 ? -4.881  -11.201 15.095  1.00 12.10 ? 283 GLY A O   1 
ATOM   2241 N N   . LYS A 1 284 ? -2.964  -10.122 14.608  1.00 3.01  ? 284 LYS A N   1 
ATOM   2242 C CA  . LYS A 1 284 ? -2.599  -10.345 16.001  1.00 2.00  ? 284 LYS A CA  1 
ATOM   2243 C C   . LYS A 1 284 ? -2.622  -9.130  16.803  1.00 2.00  ? 284 LYS A C   1 
ATOM   2244 O O   . LYS A 1 284 ? -2.035  -8.146  16.473  1.00 2.00  ? 284 LYS A O   1 
ATOM   2245 C CB  . LYS A 1 284 ? -1.319  -11.048 16.186  1.00 2.00  ? 284 LYS A CB  1 
ATOM   2246 C CG  . LYS A 1 284 ? -1.026  -12.194 15.260  1.00 2.00  ? 284 LYS A CG  1 
ATOM   2247 C CD  . LYS A 1 284 ? -0.460  -13.451 15.762  1.00 2.27  ? 284 LYS A CD  1 
ATOM   2248 C CE  . LYS A 1 284 ? -1.362  -13.878 16.822  1.00 5.81  ? 284 LYS A CE  1 
ATOM   2249 N NZ  . LYS A 1 284 ? -1.235  -15.355 16.917  1.00 10.93 ? 284 LYS A NZ  1 
ATOM   2250 N N   . HIS A 1 285 ? -3.306  -9.186  18.009  1.00 5.88  ? 285 HIS A N   1 
ATOM   2251 C CA  . HIS A 1 285 ? -3.463  -7.909  18.776  1.00 2.00  ? 285 HIS A CA  1 
ATOM   2252 C C   . HIS A 1 285 ? -2.807  -7.706  20.134  1.00 5.39  ? 285 HIS A C   1 
ATOM   2253 O O   . HIS A 1 285 ? -3.145  -6.775  20.817  1.00 6.76  ? 285 HIS A O   1 
ATOM   2254 C CB  . HIS A 1 285 ? -4.817  -7.188  18.656  1.00 2.00  ? 285 HIS A CB  1 
ATOM   2255 C CG  . HIS A 1 285 ? -5.793  -8.052  17.834  1.00 3.79  ? 285 HIS A CG  1 
ATOM   2256 N ND1 . HIS A 1 285 ? -6.893  -8.641  18.351  1.00 11.74 ? 285 HIS A ND1 1 
ATOM   2257 C CD2 . HIS A 1 285 ? -5.705  -8.576  16.531  1.00 2.00  ? 285 HIS A CD2 1 
ATOM   2258 C CE1 . HIS A 1 285 ? -7.448  -9.493  17.463  1.00 8.05  ? 285 HIS A CE1 1 
ATOM   2259 N NE2 . HIS A 1 285 ? -6.688  -9.430  16.394  1.00 2.00  ? 285 HIS A NE2 1 
ATOM   2260 N N   . SER A 1 286 ? -1.757  -8.512  20.428  1.00 3.63  ? 286 SER A N   1 
ATOM   2261 C CA  . SER A 1 286 ? -0.928  -8.482  21.642  1.00 2.00  ? 286 SER A CA  1 
ATOM   2262 C C   . SER A 1 286 ? 0.095   -9.630  21.523  1.00 4.62  ? 286 SER A C   1 
ATOM   2263 O O   . SER A 1 286 ? -0.063  -10.643 20.813  1.00 2.00  ? 286 SER A O   1 
ATOM   2264 C CB  . SER A 1 286 ? -1.704  -8.844  22.875  1.00 2.00  ? 286 SER A CB  1 
ATOM   2265 O OG  . SER A 1 286 ? -2.302  -10.164 22.720  1.00 2.00  ? 286 SER A OG  1 
ATOM   2266 N N   . VAL A 1 287 ? 1.203   -9.427  22.283  1.00 2.53  ? 287 VAL A N   1 
ATOM   2267 C CA  . VAL A 1 287 ? 2.223   -10.483 22.381  1.00 2.00  ? 287 VAL A CA  1 
ATOM   2268 C C   . VAL A 1 287 ? 2.143   -11.294 23.651  1.00 4.90  ? 287 VAL A C   1 
ATOM   2269 O O   . VAL A 1 287 ? 1.983   -10.623 24.632  1.00 13.46 ? 287 VAL A O   1 
ATOM   2270 C CB  . VAL A 1 287 ? 3.582   -9.847  22.267  1.00 2.44  ? 287 VAL A CB  1 
ATOM   2271 C CG1 . VAL A 1 287 ? 4.619   -10.925 22.510  1.00 4.94  ? 287 VAL A CG1 1 
ATOM   2272 C CG2 . VAL A 1 287 ? 3.783   -9.170  20.931  1.00 3.15  ? 287 VAL A CG2 1 
ATOM   2273 N N   . LYS A 1 288 ? 2.230   -12.596 23.557  1.00 2.00  ? 288 LYS A N   1 
ATOM   2274 C CA  . LYS A 1 288 ? 2.520   -13.370 24.736  1.00 2.78  ? 288 LYS A CA  1 
ATOM   2275 C C   . LYS A 1 288 ? 3.952   -14.201 24.971  1.00 6.16  ? 288 LYS A C   1 
ATOM   2276 O O   . LYS A 1 288 ? 4.287   -15.237 24.377  1.00 6.28  ? 288 LYS A O   1 
ATOM   2277 C CB  . LYS A 1 288 ? 1.205   -14.094 24.779  1.00 4.24  ? 288 LYS A CB  1 
ATOM   2278 C CG  . LYS A 1 288 ? 0.527   -14.456 26.096  1.00 2.35  ? 288 LYS A CG  1 
ATOM   2279 C CD  . LYS A 1 288 ? 0.740   -15.932 26.395  1.00 2.00  ? 288 LYS A CD  1 
ATOM   2280 C CE  . LYS A 1 288 ? 0.401   -16.295 27.881  1.00 2.96  ? 288 LYS A CE  1 
ATOM   2281 N NZ  . LYS A 1 288 ? -0.054  -17.734 28.045  1.00 11.22 ? 288 LYS A NZ  1 
ATOM   2282 N N   . GLY A 1 289 ? 4.815   -13.626 25.809  1.00 2.00  ? 289 GLY A N   1 
ATOM   2283 C CA  . GLY A 1 289 ? 5.704   -14.502 26.542  1.00 3.79  ? 289 GLY A CA  1 
ATOM   2284 C C   . GLY A 1 289 ? 5.130   -15.668 27.369  1.00 4.78  ? 289 GLY A C   1 
ATOM   2285 O O   . GLY A 1 289 ? 4.310   -15.716 28.226  1.00 3.78  ? 289 GLY A O   1 
ATOM   2286 N N   . LEU A 1 290 ? 5.709   -16.771 27.016  1.00 2.40  ? 290 LEU A N   1 
ATOM   2287 C CA  . LEU A 1 290 ? 5.117   -18.043 27.491  1.00 2.74  ? 290 LEU A CA  1 
ATOM   2288 C C   . LEU A 1 290 ? 6.119   -18.575 28.458  1.00 3.29  ? 290 LEU A C   1 
ATOM   2289 O O   . LEU A 1 290 ? 7.119   -19.262 28.161  1.00 4.03  ? 290 LEU A O   1 
ATOM   2290 C CB  . LEU A 1 290 ? 4.992   -19.094 26.337  1.00 2.00  ? 290 LEU A CB  1 
ATOM   2291 C CG  . LEU A 1 290 ? 3.866   -18.944 25.306  1.00 2.00  ? 290 LEU A CG  1 
ATOM   2292 C CD1 . LEU A 1 290 ? 4.127   -19.894 24.152  1.00 2.33  ? 290 LEU A CD1 1 
ATOM   2293 C CD2 . LEU A 1 290 ? 2.546   -19.029 26.013  1.00 2.44  ? 290 LEU A CD2 1 
ATOM   2294 N N   . GLY A 1 291 ? 5.956   -18.007 29.665  1.00 2.81  ? 291 GLY A N   1 
ATOM   2295 C CA  . GLY A 1 291 ? 6.620   -18.519 30.827  1.00 6.59  ? 291 GLY A CA  1 
ATOM   2296 C C   . GLY A 1 291 ? 6.134   -19.899 31.289  1.00 9.71  ? 291 GLY A C   1 
ATOM   2297 O O   . GLY A 1 291 ? 4.921   -20.079 31.308  1.00 11.83 ? 291 GLY A O   1 
ATOM   2298 N N   . LYS A 1 292 ? 7.093   -20.767 31.762  1.00 9.00  ? 292 LYS A N   1 
ATOM   2299 C CA  . LYS A 1 292 ? 6.666   -21.967 32.455  1.00 10.32 ? 292 LYS A CA  1 
ATOM   2300 C C   . LYS A 1 292 ? 5.717   -22.069 33.722  1.00 11.92 ? 292 LYS A C   1 
ATOM   2301 O O   . LYS A 1 292 ? 5.148   -23.058 34.067  1.00 14.13 ? 292 LYS A O   1 
ATOM   2302 C CB  . LYS A 1 292 ? 7.835   -22.842 32.659  1.00 11.49 ? 292 LYS A CB  1 
ATOM   2303 C CG  . LYS A 1 292 ? 9.073   -22.440 33.377  1.00 15.74 ? 292 LYS A CG  1 
ATOM   2304 C CD  . LYS A 1 292 ? 9.959   -23.702 33.408  1.00 18.75 ? 292 LYS A CD  1 
ATOM   2305 C CE  . LYS A 1 292 ? 11.401  -23.378 33.103  1.00 19.95 ? 292 LYS A CE  1 
ATOM   2306 N NZ  . LYS A 1 292 ? 11.955  -24.654 32.810  1.00 13.64 ? 292 LYS A NZ  1 
ATOM   2307 N N   . THR A 1 293 ? 5.403   -21.003 34.401  1.00 7.71  ? 293 THR A N   1 
ATOM   2308 C CA  . THR A 1 293 ? 4.299   -21.201 35.335  1.00 5.54  ? 293 THR A CA  1 
ATOM   2309 C C   . THR A 1 293 ? 2.969   -20.613 34.775  1.00 6.31  ? 293 THR A C   1 
ATOM   2310 O O   . THR A 1 293 ? 2.739   -19.430 34.535  1.00 3.07  ? 293 THR A O   1 
ATOM   2311 C CB  . THR A 1 293 ? 4.756   -20.695 36.788  1.00 6.67  ? 293 THR A CB  1 
ATOM   2312 O OG1 . THR A 1 293 ? 5.870   -21.416 37.223  1.00 2.55  ? 293 THR A OG1 1 
ATOM   2313 C CG2 . THR A 1 293 ? 3.719   -20.865 37.928  1.00 7.16  ? 293 THR A CG2 1 
ATOM   2314 N N   . THR A 1 294 ? 1.996   -21.475 34.594  1.00 8.15  ? 294 THR A N   1 
ATOM   2315 C CA  . THR A 1 294 ? 0.716   -20.696 34.467  1.00 11.81 ? 294 THR A CA  1 
ATOM   2316 C C   . THR A 1 294 ? -0.219  -20.746 35.700  1.00 11.81 ? 294 THR A C   1 
ATOM   2317 O O   . THR A 1 294 ? -0.589  -21.818 36.197  1.00 14.48 ? 294 THR A O   1 
ATOM   2318 C CB  . THR A 1 294 ? -0.172  -21.092 33.229  1.00 13.11 ? 294 THR A CB  1 
ATOM   2319 O OG1 . THR A 1 294 ? 0.654   -21.255 32.124  1.00 22.62 ? 294 THR A OG1 1 
ATOM   2320 C CG2 . THR A 1 294 ? -1.306  -20.198 32.748  1.00 16.61 ? 294 THR A CG2 1 
ATOM   2321 N N   . PRO A 1 295 ? -0.690  -19.576 36.116  1.00 14.17 ? 295 PRO A N   1 
ATOM   2322 C CA  . PRO A 1 295 ? -1.944  -19.500 36.842  1.00 16.57 ? 295 PRO A CA  1 
ATOM   2323 C C   . PRO A 1 295 ? -2.951  -20.565 36.426  1.00 16.32 ? 295 PRO A C   1 
ATOM   2324 O O   . PRO A 1 295 ? -3.530  -20.580 35.372  1.00 20.61 ? 295 PRO A O   1 
ATOM   2325 C CB  . PRO A 1 295 ? -2.532  -18.184 36.454  1.00 16.41 ? 295 PRO A CB  1 
ATOM   2326 C CG  . PRO A 1 295 ? -1.317  -17.376 36.241  1.00 19.97 ? 295 PRO A CG  1 
ATOM   2327 C CD  . PRO A 1 295 ? -0.311  -18.313 35.627  1.00 18.52 ? 295 PRO A CD  1 
ATOM   2328 N N   . ASP A 1 296 ? -3.117  -21.511 37.337  1.00 17.91 ? 296 ASP A N   1 
ATOM   2329 C CA  . ASP A 1 296 ? -3.929  -22.647 37.071  1.00 16.70 ? 296 ASP A CA  1 
ATOM   2330 C C   . ASP A 1 296 ? -5.228  -22.466 36.352  1.00 15.76 ? 296 ASP A C   1 
ATOM   2331 O O   . ASP A 1 296 ? -6.192  -22.290 37.116  1.00 18.70 ? 296 ASP A O   1 
ATOM   2332 C CB  . ASP A 1 296 ? -4.341  -23.176 38.410  1.00 16.50 ? 296 ASP A CB  1 
ATOM   2333 C CG  . ASP A 1 296 ? -4.952  -24.508 38.281  1.00 6.93  ? 296 ASP A CG  1 
ATOM   2334 O OD1 . ASP A 1 296 ? -4.802  -25.160 37.279  1.00 8.15  ? 296 ASP A OD1 1 
ATOM   2335 O OD2 . ASP A 1 296 ? -5.557  -24.890 39.219  1.00 12.71 ? 296 ASP A OD2 1 
ATOM   2336 N N   . PRO A 1 297 ? -5.239  -22.668 34.927  1.00 12.42 ? 297 PRO A N   1 
ATOM   2337 C CA  . PRO A 1 297 ? -6.426  -22.721 34.092  1.00 9.32  ? 297 PRO A CA  1 
ATOM   2338 C C   . PRO A 1 297 ? -7.725  -22.792 34.849  1.00 10.80 ? 297 PRO A C   1 
ATOM   2339 O O   . PRO A 1 297 ? -8.540  -21.873 34.937  1.00 8.67  ? 297 PRO A O   1 
ATOM   2340 C CB  . PRO A 1 297 ? -6.088  -24.035 33.429  1.00 9.27  ? 297 PRO A CB  1 
ATOM   2341 C CG  . PRO A 1 297 ? -4.623  -24.402 33.654  1.00 11.55 ? 297 PRO A CG  1 
ATOM   2342 C CD  . PRO A 1 297 ? -4.103  -23.110 34.181  1.00 10.71 ? 297 PRO A CD  1 
ATOM   2343 N N   . SER A 1 298 ? -7.746  -23.954 35.501  1.00 12.51 ? 298 SER A N   1 
ATOM   2344 C CA  . SER A 1 298 ? -8.790  -24.339 36.404  1.00 17.14 ? 298 SER A CA  1 
ATOM   2345 C C   . SER A 1 298 ? -9.669  -23.335 37.106  1.00 17.02 ? 298 SER A C   1 
ATOM   2346 O O   . SER A 1 298 ? -10.884 -23.338 37.023  1.00 19.81 ? 298 SER A O   1 
ATOM   2347 C CB  . SER A 1 298 ? -8.236  -25.215 37.505  1.00 23.59 ? 298 SER A CB  1 
ATOM   2348 O OG  . SER A 1 298 ? -7.035  -25.846 37.091  1.00 21.89 ? 298 SER A OG  1 
ATOM   2349 N N   . ALA A 1 299 ? -8.986  -22.441 37.909  1.00 15.55 ? 299 ALA A N   1 
ATOM   2350 C CA  . ALA A 1 299 ? -9.590  -21.348 38.700  1.00 11.11 ? 299 ALA A CA  1 
ATOM   2351 C C   . ALA A 1 299 ? -9.973  -20.005 38.002  1.00 11.60 ? 299 ALA A C   1 
ATOM   2352 O O   . ALA A 1 299 ? -9.977  -18.963 38.636  1.00 8.88  ? 299 ALA A O   1 
ATOM   2353 C CB  . ALA A 1 299 ? -8.571  -20.983 39.719  1.00 9.21  ? 299 ALA A CB  1 
ATOM   2354 N N   . ASN A 1 300 ? -10.257 -19.956 36.693  1.00 13.05 ? 300 ASN A N   1 
ATOM   2355 C CA  . ASN A 1 300 ? -10.242 -18.613 36.119  1.00 15.53 ? 300 ASN A CA  1 
ATOM   2356 C C   . ASN A 1 300 ? -11.537 -17.784 36.034  1.00 15.56 ? 300 ASN A C   1 
ATOM   2357 O O   . ASN A 1 300 ? -12.126 -17.585 34.968  1.00 18.48 ? 300 ASN A O   1 
ATOM   2358 C CB  . ASN A 1 300 ? -9.690  -18.696 34.741  1.00 19.07 ? 300 ASN A CB  1 
ATOM   2359 C CG  . ASN A 1 300 ? -8.587  -17.675 34.615  1.00 25.01 ? 300 ASN A CG  1 
ATOM   2360 O OD1 . ASN A 1 300 ? -8.763  -16.510 34.286  1.00 26.07 ? 300 ASN A OD1 1 
ATOM   2361 N ND2 . ASN A 1 300 ? -7.382  -18.218 34.885  1.00 30.81 ? 300 ASN A ND2 1 
ATOM   2362 N N   . ILE A 1 301 ? -11.946 -17.240 37.209  1.00 15.13 ? 301 ILE A N   1 
ATOM   2363 C CA  . ILE A 1 301 ? -12.983 -16.219 37.467  1.00 9.77  ? 301 ILE A CA  1 
ATOM   2364 C C   . ILE A 1 301 ? -13.147 -15.341 36.266  1.00 9.51  ? 301 ILE A C   1 
ATOM   2365 O O   . ILE A 1 301 ? -12.083 -14.996 35.781  1.00 10.10 ? 301 ILE A O   1 
ATOM   2366 C CB  . ILE A 1 301 ? -12.407 -15.438 38.649  1.00 5.52  ? 301 ILE A CB  1 
ATOM   2367 C CG1 . ILE A 1 301 ? -13.023 -16.308 39.694  1.00 3.37  ? 301 ILE A CG1 1 
ATOM   2368 C CG2 . ILE A 1 301 ? -12.849 -13.992 38.797  1.00 2.00  ? 301 ILE A CG2 1 
ATOM   2369 C CD1 . ILE A 1 301 ? -12.702 -15.966 41.150  1.00 10.52 ? 301 ILE A CD1 1 
ATOM   2370 N N   . SER A 1 302 ? -14.414 -14.901 35.936  1.00 10.87 ? 302 SER A N   1 
ATOM   2371 C CA  . SER A 1 302 ? -14.517 -13.601 35.154  1.00 9.80  ? 302 SER A CA  1 
ATOM   2372 C C   . SER A 1 302 ? -15.590 -12.588 35.297  1.00 9.65  ? 302 SER A C   1 
ATOM   2373 O O   . SER A 1 302 ? -16.589 -12.568 34.600  1.00 16.90 ? 302 SER A O   1 
ATOM   2374 C CB  . SER A 1 302 ? -14.735 -13.873 33.700  1.00 10.96 ? 302 SER A CB  1 
ATOM   2375 O OG  . SER A 1 302 ? -15.447 -15.098 33.709  1.00 15.63 ? 302 SER A OG  1 
ATOM   2376 N N   . LEU A 1 303 ? -15.370 -11.626 36.161  1.00 9.04  ? 303 LEU A N   1 
ATOM   2377 C CA  . LEU A 1 303 ? -16.390 -10.528 36.327  1.00 10.24 ? 303 LEU A CA  1 
ATOM   2378 C C   . LEU A 1 303 ? -16.519 -9.786  35.010  1.00 9.05  ? 303 LEU A C   1 
ATOM   2379 O O   . LEU A 1 303 ? -15.481 -9.748  34.379  1.00 11.22 ? 303 LEU A O   1 
ATOM   2380 C CB  . LEU A 1 303 ? -16.110 -9.704  37.655  1.00 13.74 ? 303 LEU A CB  1 
ATOM   2381 C CG  . LEU A 1 303 ? -14.950 -8.686  37.888  1.00 10.68 ? 303 LEU A CG  1 
ATOM   2382 C CD1 . LEU A 1 303 ? -13.495 -9.169  37.574  1.00 10.32 ? 303 LEU A CD1 1 
ATOM   2383 C CD2 . LEU A 1 303 ? -15.251 -7.270  37.354  1.00 10.43 ? 303 LEU A CD2 1 
ATOM   2384 N N   . ASP A 1 304 ? -17.734 -9.420  34.580  1.00 7.04  ? 304 ASP A N   1 
ATOM   2385 C CA  . ASP A 1 304 ? -17.952 -8.815  33.250  1.00 7.96  ? 304 ASP A CA  1 
ATOM   2386 C C   . ASP A 1 304 ? -17.031 -9.294  32.133  1.00 9.59  ? 304 ASP A C   1 
ATOM   2387 O O   . ASP A 1 304 ? -16.312 -8.629  31.434  1.00 11.23 ? 304 ASP A O   1 
ATOM   2388 C CB  . ASP A 1 304 ? -17.560 -7.407  33.279  1.00 12.50 ? 304 ASP A CB  1 
ATOM   2389 C CG  . ASP A 1 304 ? -18.061 -6.582  34.387  1.00 17.57 ? 304 ASP A CG  1 
ATOM   2390 O OD1 . ASP A 1 304 ? -18.381 -5.422  34.078  1.00 20.01 ? 304 ASP A OD1 1 
ATOM   2391 O OD2 . ASP A 1 304 ? -18.016 -7.084  35.513  1.00 16.54 ? 304 ASP A OD2 1 
ATOM   2392 N N   . GLY A 1 305 ? -16.835 -10.626 32.144  1.00 11.15 ? 305 GLY A N   1 
ATOM   2393 C CA  . GLY A 1 305 ? -16.220 -11.023 30.866  1.00 6.95  ? 305 GLY A CA  1 
ATOM   2394 C C   . GLY A 1 305 ? -14.816 -10.453 30.468  1.00 6.12  ? 305 GLY A C   1 
ATOM   2395 O O   . GLY A 1 305 ? -14.295 -10.437 29.326  1.00 3.95  ? 305 GLY A O   1 
ATOM   2396 N N   . VAL A 1 306 ? -14.124 -10.206 31.633  1.00 4.17  ? 306 VAL A N   1 
ATOM   2397 C CA  . VAL A 1 306 ? -12.662 -10.059 31.674  1.00 3.89  ? 306 VAL A CA  1 
ATOM   2398 C C   . VAL A 1 306 ? -12.056 -11.280 32.288  1.00 2.00  ? 306 VAL A C   1 
ATOM   2399 O O   . VAL A 1 306 ? -12.612 -11.788 33.212  1.00 5.41  ? 306 VAL A O   1 
ATOM   2400 C CB  . VAL A 1 306 ? -12.361 -8.810  32.411  1.00 2.00  ? 306 VAL A CB  1 
ATOM   2401 C CG1 . VAL A 1 306 ? -11.200 -8.288  31.707  1.00 5.44  ? 306 VAL A CG1 1 
ATOM   2402 C CG2 . VAL A 1 306 ? -13.327 -7.654  32.252  1.00 2.00  ? 306 VAL A CG2 1 
ATOM   2403 N N   . ASP A 1 307 ? -11.026 -11.830 31.821  1.00 2.00  ? 307 ASP A N   1 
ATOM   2404 C CA  . ASP A 1 307 ? -10.739 -12.986 32.612  1.00 2.00  ? 307 ASP A CA  1 
ATOM   2405 C C   . ASP A 1 307 ? -9.912  -12.540 33.746  1.00 2.00  ? 307 ASP A C   1 
ATOM   2406 O O   . ASP A 1 307 ? -9.146  -11.571 33.612  1.00 11.11 ? 307 ASP A O   1 
ATOM   2407 C CB  . ASP A 1 307 ? -10.074 -14.065 31.790  1.00 9.75  ? 307 ASP A CB  1 
ATOM   2408 C CG  . ASP A 1 307 ? -10.760 -14.173 30.390  1.00 15.76 ? 307 ASP A CG  1 
ATOM   2409 O OD1 . ASP A 1 307 ? -10.016 -13.926 29.388  1.00 19.14 ? 307 ASP A OD1 1 
ATOM   2410 O OD2 . ASP A 1 307 ? -12.009 -14.473 30.315  1.00 21.24 ? 307 ASP A OD2 1 
ATOM   2411 N N   . VAL A 1 308 ? -10.066 -13.198 34.920  1.00 3.42  ? 308 VAL A N   1 
ATOM   2412 C CA  . VAL A 1 308 ? -9.038  -12.992 35.921  1.00 2.00  ? 308 VAL A CA  1 
ATOM   2413 C C   . VAL A 1 308 ? -8.352  -14.272 36.390  1.00 4.52  ? 308 VAL A C   1 
ATOM   2414 O O   . VAL A 1 308 ? -8.975  -15.164 36.958  1.00 3.65  ? 308 VAL A O   1 
ATOM   2415 C CB  . VAL A 1 308 ? -9.656  -12.226 37.039  1.00 2.00  ? 308 VAL A CB  1 
ATOM   2416 C CG1 . VAL A 1 308 ? -8.558  -11.689 37.948  1.00 3.77  ? 308 VAL A CG1 1 
ATOM   2417 C CG2 . VAL A 1 308 ? -10.714 -11.188 36.538  1.00 2.00  ? 308 VAL A CG2 1 
ATOM   2418 N N   . PRO A 1 309 ? -7.030  -14.319 36.157  1.00 6.24  ? 309 PRO A N   1 
ATOM   2419 C CA  . PRO A 1 309 ? -6.254  -15.509 36.403  1.00 7.75  ? 309 PRO A CA  1 
ATOM   2420 C C   . PRO A 1 309 ? -5.701  -15.625 37.911  1.00 10.93 ? 309 PRO A C   1 
ATOM   2421 O O   . PRO A 1 309 ? -4.523  -15.801 38.213  1.00 11.62 ? 309 PRO A O   1 
ATOM   2422 C CB  . PRO A 1 309 ? -5.258  -15.344 35.248  1.00 10.51 ? 309 PRO A CB  1 
ATOM   2423 C CG  . PRO A 1 309 ? -4.776  -13.933 35.439  1.00 7.00  ? 309 PRO A CG  1 
ATOM   2424 C CD  . PRO A 1 309 ? -6.109  -13.260 35.759  1.00 7.79  ? 309 PRO A CD  1 
ATOM   2425 N N   . LEU A 1 310 ? -6.651  -15.541 38.882  1.00 9.99  ? 310 LEU A N   1 
ATOM   2426 C CA  . LEU A 1 310 ? -6.328  -15.634 40.318  1.00 7.91  ? 310 LEU A CA  1 
ATOM   2427 C C   . LEU A 1 310 ? -6.194  -16.991 40.830  1.00 6.41  ? 310 LEU A C   1 
ATOM   2428 O O   . LEU A 1 310 ? -6.636  -17.406 41.888  1.00 8.64  ? 310 LEU A O   1 
ATOM   2429 C CB  . LEU A 1 310 ? -7.161  -14.871 41.285  1.00 8.62  ? 310 LEU A CB  1 
ATOM   2430 C CG  . LEU A 1 310 ? -8.517  -14.966 40.817  1.00 6.30  ? 310 LEU A CG  1 
ATOM   2431 C CD1 . LEU A 1 310 ? -9.327  -16.114 41.330  1.00 9.71  ? 310 LEU A CD1 1 
ATOM   2432 C CD2 . LEU A 1 310 ? -9.086  -13.614 41.052  1.00 12.98 ? 310 LEU A CD2 1 
ATOM   2433 N N   . GLY A 1 311 ? -5.482  -17.648 39.967  1.00 3.47  ? 311 GLY A N   1 
ATOM   2434 C CA  . GLY A 1 311 ? -5.335  -19.061 40.107  1.00 4.50  ? 311 GLY A CA  1 
ATOM   2435 C C   . GLY A 1 311 ? -3.874  -19.342 40.380  1.00 5.79  ? 311 GLY A C   1 
ATOM   2436 O O   . GLY A 1 311 ? -3.051  -18.453 40.304  1.00 5.61  ? 311 GLY A O   1 
ATOM   2437 N N   . THR A 1 312 ? -3.571  -20.571 40.721  1.00 5.86  ? 312 THR A N   1 
ATOM   2438 C CA  . THR A 1 312 ? -2.325  -20.432 41.427  1.00 8.06  ? 312 THR A CA  1 
ATOM   2439 C C   . THR A 1 312 ? -1.120  -21.045 40.824  1.00 7.53  ? 312 THR A C   1 
ATOM   2440 O O   . THR A 1 312 ? -1.285  -22.000 40.081  1.00 4.04  ? 312 THR A O   1 
ATOM   2441 C CB  . THR A 1 312 ? -2.472  -21.040 42.796  1.00 10.99 ? 312 THR A CB  1 
ATOM   2442 O OG1 . THR A 1 312 ? -1.306  -20.682 43.508  1.00 19.59 ? 312 THR A OG1 1 
ATOM   2443 C CG2 . THR A 1 312 ? -2.753  -22.555 42.821  1.00 15.37 ? 312 THR A CG2 1 
ATOM   2444 N N   . GLY A 1 313 ? 0.067   -20.555 41.223  1.00 9.24  ? 313 GLY A N   1 
ATOM   2445 C CA  . GLY A 1 313 ? 1.324   -21.199 40.770  1.00 9.96  ? 313 GLY A CA  1 
ATOM   2446 C C   . GLY A 1 313 ? 1.289   -22.657 40.336  1.00 8.78  ? 313 GLY A C   1 
ATOM   2447 O O   . GLY A 1 313 ? 1.533   -23.352 41.312  1.00 8.18  ? 313 GLY A O   1 
ATOM   2448 N N   . ILE A 1 314 ? 0.945   -22.989 38.959  1.00 5.32  ? 314 ILE A N   1 
ATOM   2449 C CA  . ILE A 1 314 ? 0.908   -24.318 38.267  1.00 5.24  ? 314 ILE A CA  1 
ATOM   2450 C C   . ILE A 1 314 ? 1.928   -24.430 37.169  1.00 6.57  ? 314 ILE A C   1 
ATOM   2451 O O   . ILE A 1 314 ? 2.248   -23.418 36.585  1.00 9.00  ? 314 ILE A O   1 
ATOM   2452 C CB  . ILE A 1 314 ? -0.436  -24.550 37.498  1.00 2.00  ? 314 ILE A CB  1 
ATOM   2453 C CG1 . ILE A 1 314 ? -1.214  -25.601 38.147  1.00 2.79  ? 314 ILE A CG1 1 
ATOM   2454 C CG2 . ILE A 1 314 ? -0.519  -25.080 36.067  1.00 2.00  ? 314 ILE A CG2 1 
ATOM   2455 C CD1 . ILE A 1 314 ? -1.718  -24.830 39.372  1.00 7.19  ? 314 ILE A CD1 1 
ATOM   2456 N N   . SER A 1 315 ? 2.246   -25.608 36.714  1.00 8.43  ? 315 SER A N   1 
ATOM   2457 C CA  . SER A 1 315 ? 3.288   -25.551 35.676  1.00 7.96  ? 315 SER A CA  1 
ATOM   2458 C C   . SER A 1 315 ? 2.857   -25.715 34.218  1.00 6.33  ? 315 SER A C   1 
ATOM   2459 O O   . SER A 1 315 ? 1.974   -26.481 33.887  1.00 12.15 ? 315 SER A O   1 
ATOM   2460 C CB  . SER A 1 315 ? 4.079   -26.637 36.127  1.00 6.65  ? 315 SER A CB  1 
ATOM   2461 O OG  . SER A 1 315 ? 3.245   -27.808 36.068  1.00 13.62 ? 315 SER A OG  1 
ATOM   2462 N N   . SER A 1 316 ? 3.208   -24.717 33.330  1.00 7.08  ? 316 SER A N   1 
ATOM   2463 C CA  . SER A 1 316 ? 2.635   -24.680 31.951  1.00 4.53  ? 316 SER A CA  1 
ATOM   2464 C C   . SER A 1 316 ? 3.356   -25.697 31.249  1.00 6.49  ? 316 SER A C   1 
ATOM   2465 O O   . SER A 1 316 ? 4.401   -26.077 31.690  1.00 7.51  ? 316 SER A O   1 
ATOM   2466 C CB  . SER A 1 316 ? 2.886   -23.401 31.095  1.00 4.44  ? 316 SER A CB  1 
ATOM   2467 O OG  . SER A 1 316 ? 4.268   -23.117 30.660  1.00 7.91  ? 316 SER A OG  1 
ATOM   2468 N N   . GLY A 1 317 ? 2.917   -26.120 30.091  1.00 5.13  ? 317 GLY A N   1 
ATOM   2469 C CA  . GLY A 1 317 ? 3.994   -27.099 29.588  1.00 4.89  ? 317 GLY A CA  1 
ATOM   2470 C C   . GLY A 1 317 ? 5.327   -26.538 28.950  1.00 3.20  ? 317 GLY A C   1 
ATOM   2471 O O   . GLY A 1 317 ? 6.250   -27.208 28.454  1.00 3.58  ? 317 GLY A O   1 
ATOM   2472 N N   . VAL A 1 318 ? 5.404   -25.197 28.878  1.00 2.84  ? 318 VAL A N   1 
ATOM   2473 C CA  . VAL A 1 318 ? 6.662   -24.764 28.322  1.00 3.66  ? 318 VAL A CA  1 
ATOM   2474 C C   . VAL A 1 318 ? 7.934   -24.955 29.195  1.00 6.21  ? 318 VAL A C   1 
ATOM   2475 O O   . VAL A 1 318 ? 8.206   -24.101 30.032  1.00 9.92  ? 318 VAL A O   1 
ATOM   2476 C CB  . VAL A 1 318 ? 6.309   -23.396 27.916  1.00 2.00  ? 318 VAL A CB  1 
ATOM   2477 C CG1 . VAL A 1 318 ? 7.335   -22.616 27.162  1.00 2.00  ? 318 VAL A CG1 1 
ATOM   2478 C CG2 . VAL A 1 318 ? 5.293   -23.639 26.813  1.00 3.81  ? 318 VAL A CG2 1 
ATOM   2479 N N   . ASN A 1 319 ? 8.757   -26.057 28.924  1.00 7.76  ? 319 ASN A N   1 
ATOM   2480 C CA  . ASN A 1 319 ? 10.159  -26.065 29.484  1.00 11.79 ? 319 ASN A CA  1 
ATOM   2481 C C   . ASN A 1 319 ? 11.211  -25.213 28.718  1.00 11.95 ? 319 ASN A C   1 
ATOM   2482 O O   . ASN A 1 319 ? 11.419  -24.088 29.130  1.00 14.68 ? 319 ASN A O   1 
ATOM   2483 C CB  . ASN A 1 319 ? 10.601  -27.479 29.834  1.00 17.69 ? 319 ASN A CB  1 
ATOM   2484 C CG  . ASN A 1 319 ? 10.726  -28.358 28.556  1.00 27.20 ? 319 ASN A CG  1 
ATOM   2485 O OD1 . ASN A 1 319 ? 11.681  -28.328 27.808  1.00 36.27 ? 319 ASN A OD1 1 
ATOM   2486 N ND2 . ASN A 1 319 ? 9.668   -28.932 28.013  1.00 29.91 ? 319 ASN A ND2 1 
ATOM   2487 N N   . ASP A 1 320 ? 11.661  -25.635 27.520  1.00 15.26 ? 320 ASP A N   1 
ATOM   2488 C CA  . ASP A 1 320 ? 11.884  -24.841 26.268  1.00 13.54 ? 320 ASP A CA  1 
ATOM   2489 C C   . ASP A 1 320 ? 11.932  -23.228 26.092  1.00 11.66 ? 320 ASP A C   1 
ATOM   2490 O O   . ASP A 1 320 ? 11.839  -22.669 25.005  1.00 12.85 ? 320 ASP A O   1 
ATOM   2491 C CB  . ASP A 1 320 ? 11.027  -25.448 25.176  1.00 13.80 ? 320 ASP A CB  1 
ATOM   2492 C CG  . ASP A 1 320 ? 9.571   -25.806 25.681  1.00 22.14 ? 320 ASP A CG  1 
ATOM   2493 O OD1 . ASP A 1 320 ? 9.061   -26.956 25.694  1.00 19.72 ? 320 ASP A OD1 1 
ATOM   2494 O OD2 . ASP A 1 320 ? 8.916   -24.875 26.083  1.00 30.65 ? 320 ASP A OD2 1 
ATOM   2495 N N   . THR A 1 321 ? 12.025  -22.377 27.116  1.00 7.29  ? 321 THR A N   1 
ATOM   2496 C CA  . THR A 1 321 ? 11.632  -20.997 26.794  1.00 6.42  ? 321 THR A CA  1 
ATOM   2497 C C   . THR A 1 321 ? 12.576  -19.976 27.410  1.00 9.43  ? 321 THR A C   1 
ATOM   2498 O O   . THR A 1 321 ? 13.526  -20.398 28.056  1.00 13.86 ? 321 THR A O   1 
ATOM   2499 C CB  . THR A 1 321 ? 10.178  -20.730 27.176  1.00 2.00  ? 321 THR A CB  1 
ATOM   2500 O OG1 . THR A 1 321 ? 9.988   -19.387 27.669  1.00 3.79  ? 321 THR A OG1 1 
ATOM   2501 C CG2 . THR A 1 321 ? 9.927   -21.611 28.369  1.00 2.00  ? 321 THR A CG2 1 
ATOM   2502 N N   . SER A 1 322 ? 12.407  -18.642 27.228  1.00 10.30 ? 322 SER A N   1 
ATOM   2503 C CA  . SER A 1 322 ? 13.308  -17.720 28.018  1.00 10.12 ? 322 SER A CA  1 
ATOM   2504 C C   . SER A 1 322 ? 12.681  -17.068 29.233  1.00 10.40 ? 322 SER A C   1 
ATOM   2505 O O   . SER A 1 322 ? 13.109  -16.086 29.805  1.00 13.33 ? 322 SER A O   1 
ATOM   2506 C CB  . SER A 1 322 ? 14.017  -16.489 27.333  1.00 12.01 ? 322 SER A CB  1 
ATOM   2507 O OG  . SER A 1 322 ? 14.882  -16.777 26.161  1.00 21.81 ? 322 SER A OG  1 
ATOM   2508 N N   . LEU A 1 323 ? 11.581  -17.633 29.617  1.00 8.35  ? 323 LEU A N   1 
ATOM   2509 C CA  . LEU A 1 323 ? 10.937  -16.904 30.674  1.00 2.00  ? 323 LEU A CA  1 
ATOM   2510 C C   . LEU A 1 323 ? 10.530  -17.952 31.660  1.00 3.27  ? 323 LEU A C   1 
ATOM   2511 O O   . LEU A 1 323 ? 10.424  -19.128 31.303  1.00 7.05  ? 323 LEU A O   1 
ATOM   2512 C CB  . LEU A 1 323 ? 9.636   -16.273 30.127  1.00 2.00  ? 323 LEU A CB  1 
ATOM   2513 C CG  . LEU A 1 323 ? 9.662   -15.018 29.233  1.00 2.17  ? 323 LEU A CG  1 
ATOM   2514 C CD1 . LEU A 1 323 ? 8.243   -14.645 29.044  1.00 2.00  ? 323 LEU A CD1 1 
ATOM   2515 C CD2 . LEU A 1 323 ? 10.357  -13.747 29.611  1.00 2.00  ? 323 LEU A CD2 1 
ATOM   2516 N N   . LEU A 1 324 ? 10.170  -17.459 32.856  1.00 6.36  ? 324 LEU A N   1 
ATOM   2517 C CA  . LEU A 1 324 ? 9.467   -18.508 33.641  1.00 4.20  ? 324 LEU A CA  1 
ATOM   2518 C C   . LEU A 1 324 ? 8.044   -18.324 34.032  1.00 6.46  ? 324 LEU A C   1 
ATOM   2519 O O   . LEU A 1 324 ? 7.326   -19.213 34.281  1.00 8.49  ? 324 LEU A O   1 
ATOM   2520 C CB  . LEU A 1 324 ? 10.336  -19.243 34.730  1.00 2.69  ? 324 LEU A CB  1 
ATOM   2521 C CG  . LEU A 1 324 ? 11.060  -18.551 35.830  1.00 2.00  ? 324 LEU A CG  1 
ATOM   2522 C CD1 . LEU A 1 324 ? 11.519  -17.175 35.501  1.00 2.00  ? 324 LEU A CD1 1 
ATOM   2523 C CD2 . LEU A 1 324 ? 10.148  -18.387 36.975  1.00 2.00  ? 324 LEU A CD2 1 
ATOM   2524 N N   . TYR A 1 325 ? 7.590   -17.122 33.928  1.00 7.55  ? 325 TYR A N   1 
ATOM   2525 C CA  . TYR A 1 325 ? 6.169   -16.717 33.977  1.00 7.04  ? 325 TYR A CA  1 
ATOM   2526 C C   . TYR A 1 325 ? 5.674   -16.001 32.686  1.00 6.90  ? 325 TYR A C   1 
ATOM   2527 O O   . TYR A 1 325 ? 6.475   -15.424 31.988  1.00 5.51  ? 325 TYR A O   1 
ATOM   2528 C CB  . TYR A 1 325 ? 5.856   -15.794 35.171  1.00 5.19  ? 325 TYR A CB  1 
ATOM   2529 C CG  . TYR A 1 325 ? 6.523   -16.343 36.385  1.00 2.00  ? 325 TYR A CG  1 
ATOM   2530 C CD1 . TYR A 1 325 ? 5.917   -17.380 37.061  1.00 4.88  ? 325 TYR A CD1 1 
ATOM   2531 C CD2 . TYR A 1 325 ? 7.747   -15.787 36.840  1.00 2.00  ? 325 TYR A CD2 1 
ATOM   2532 C CE1 . TYR A 1 325 ? 6.516   -17.834 38.238  1.00 5.70  ? 325 TYR A CE1 1 
ATOM   2533 C CE2 . TYR A 1 325 ? 8.360   -16.211 38.028  1.00 2.03  ? 325 TYR A CE2 1 
ATOM   2534 C CZ  . TYR A 1 325 ? 7.699   -17.229 38.687  1.00 2.00  ? 325 TYR A CZ  1 
ATOM   2535 O OH  . TYR A 1 325 ? 8.165   -17.684 39.829  1.00 2.00  ? 325 TYR A OH  1 
ATOM   2536 N N   . ASN A 1 326 ? 4.367   -16.010 32.484  1.00 8.10  ? 326 ASN A N   1 
ATOM   2537 C CA  . ASN A 1 326 ? 3.839   -15.314 31.316  1.00 6.73  ? 326 ASN A CA  1 
ATOM   2538 C C   . ASN A 1 326 ? 4.138   -13.839 31.344  1.00 4.80  ? 326 ASN A C   1 
ATOM   2539 O O   . ASN A 1 326 ? 4.296   -13.343 32.421  1.00 9.15  ? 326 ASN A O   1 
ATOM   2540 C CB  . ASN A 1 326 ? 2.369   -15.607 31.337  1.00 3.11  ? 326 ASN A CB  1 
ATOM   2541 C CG  . ASN A 1 326 ? 2.055   -17.098 31.125  1.00 10.02 ? 326 ASN A CG  1 
ATOM   2542 O OD1 . ASN A 1 326 ? 0.941   -17.515 31.221  1.00 14.61 ? 326 ASN A OD1 1 
ATOM   2543 N ND2 . ASN A 1 326 ? 3.009   -18.026 30.967  1.00 17.36 ? 326 ASN A ND2 1 
ATOM   2544 N N   . GLU A 1 327 ? 4.199   -13.165 30.275  1.00 3.85  ? 327 GLU A N   1 
ATOM   2545 C CA  . GLU A 1 327 ? 4.298   -11.698 29.977  1.00 2.82  ? 327 GLU A CA  1 
ATOM   2546 C C   . GLU A 1 327 ? 3.495   -11.068 28.775  1.00 3.40  ? 327 GLU A C   1 
ATOM   2547 O O   . GLU A 1 327 ? 4.060   -10.706 27.766  1.00 5.79  ? 327 GLU A O   1 
ATOM   2548 C CB  . GLU A 1 327 ? 5.734   -11.565 29.580  1.00 2.00  ? 327 GLU A CB  1 
ATOM   2549 C CG  . GLU A 1 327 ? 6.360   -10.200 29.548  1.00 4.73  ? 327 GLU A CG  1 
ATOM   2550 C CD  . GLU A 1 327 ? 7.818   -10.461 29.328  1.00 10.19 ? 327 GLU A CD  1 
ATOM   2551 O OE1 . GLU A 1 327 ? 8.463   -9.665  28.614  1.00 9.88  ? 327 GLU A OE1 1 
ATOM   2552 O OE2 . GLU A 1 327 ? 8.301   -11.452 29.885  1.00 16.80 ? 327 GLU A OE2 1 
ATOM   2553 N N   . TYR A 1 328 ? 2.227   -10.769 29.000  1.00 4.36  ? 328 TYR A N   1 
ATOM   2554 C CA  . TYR A 1 328 ? 1.388   -10.021 28.057  1.00 2.82  ? 328 TYR A CA  1 
ATOM   2555 C C   . TYR A 1 328 ? 1.766   -8.568  27.618  1.00 3.84  ? 328 TYR A C   1 
ATOM   2556 O O   . TYR A 1 328 ? 1.961   -7.629  28.392  1.00 10.94 ? 328 TYR A O   1 
ATOM   2557 C CB  . TYR A 1 328 ? 0.013   -9.985  28.719  1.00 2.93  ? 328 TYR A CB  1 
ATOM   2558 C CG  . TYR A 1 328 ? -0.352  -11.351 29.384  1.00 2.00  ? 328 TYR A CG  1 
ATOM   2559 C CD1 . TYR A 1 328 ? 0.011   -11.611 30.706  1.00 2.00  ? 328 TYR A CD1 1 
ATOM   2560 C CD2 . TYR A 1 328 ? -1.060  -12.308 28.655  1.00 2.22  ? 328 TYR A CD2 1 
ATOM   2561 C CE1 . TYR A 1 328 ? -0.253  -12.828 31.259  1.00 2.00  ? 328 TYR A CE1 1 
ATOM   2562 C CE2 . TYR A 1 328 ? -1.300  -13.545 29.164  1.00 2.00  ? 328 TYR A CE2 1 
ATOM   2563 C CZ  . TYR A 1 328 ? -0.832  -13.810 30.447  1.00 3.25  ? 328 TYR A CZ  1 
ATOM   2564 O OH  . TYR A 1 328 ? -0.897  -15.123 30.912  1.00 3.75  ? 328 TYR A OH  1 
ATOM   2565 N N   . ILE A 1 329 ? 1.841   -8.306  26.284  1.00 3.32  ? 329 ILE A N   1 
ATOM   2566 C CA  . ILE A 1 329 ? 2.198   -6.981  25.778  1.00 2.00  ? 329 ILE A CA  1 
ATOM   2567 C C   . ILE A 1 329 ? 1.211   -6.520  24.789  1.00 2.00  ? 329 ILE A C   1 
ATOM   2568 O O   . ILE A 1 329 ? 0.754   -7.361  24.039  1.00 5.34  ? 329 ILE A O   1 
ATOM   2569 C CB  . ILE A 1 329 ? 3.599   -6.939  25.122  1.00 2.00  ? 329 ILE A CB  1 
ATOM   2570 C CG1 . ILE A 1 329 ? 4.498   -7.763  25.969  1.00 2.00  ? 329 ILE A CG1 1 
ATOM   2571 C CG2 . ILE A 1 329 ? 4.220   -5.548  24.882  1.00 2.00  ? 329 ILE A CG2 1 
ATOM   2572 C CD1 . ILE A 1 329 ? 4.718   -9.088  25.261  1.00 2.00  ? 329 ILE A CD1 1 
ATOM   2573 N N   . VAL A 1 330 ? 0.920   -5.201  24.791  1.00 6.36  ? 330 VAL A N   1 
ATOM   2574 C CA  . VAL A 1 330 ? 0.020   -4.523  23.800  1.00 2.00  ? 330 VAL A CA  1 
ATOM   2575 C C   . VAL A 1 330 ? 0.548   -3.246  23.129  1.00 2.00  ? 330 VAL A C   1 
ATOM   2576 O O   . VAL A 1 330 ? 1.132   -2.381  23.751  1.00 3.96  ? 330 VAL A O   1 
ATOM   2577 C CB  . VAL A 1 330 ? -1.430  -4.289  24.294  1.00 2.00  ? 330 VAL A CB  1 
ATOM   2578 C CG1 . VAL A 1 330 ? -2.191  -5.547  24.729  1.00 2.00  ? 330 VAL A CG1 1 
ATOM   2579 C CG2 . VAL A 1 330 ? -1.346  -3.238  25.322  1.00 2.00  ? 330 VAL A CG2 1 
ATOM   2580 N N   . TYR A 1 331 ? 0.432   -3.196  21.778  1.00 5.23  ? 331 TYR A N   1 
ATOM   2581 C CA  . TYR A 1 331 ? 1.194   -2.058  21.223  1.00 4.90  ? 331 TYR A CA  1 
ATOM   2582 C C   . TYR A 1 331 ? 0.401   -0.825  20.791  1.00 6.43  ? 331 TYR A C   1 
ATOM   2583 O O   . TYR A 1 331 ? 0.975   -0.037  20.101  1.00 11.61 ? 331 TYR A O   1 
ATOM   2584 C CB  . TYR A 1 331 ? 2.141   -2.463  20.114  1.00 6.43  ? 331 TYR A CB  1 
ATOM   2585 C CG  . TYR A 1 331 ? 2.971   -3.687  20.408  1.00 2.13  ? 331 TYR A CG  1 
ATOM   2586 C CD1 . TYR A 1 331 ? 2.456   -4.973  20.696  1.00 2.00  ? 331 TYR A CD1 1 
ATOM   2587 C CD2 . TYR A 1 331 ? 4.338   -3.452  20.375  1.00 2.91  ? 331 TYR A CD2 1 
ATOM   2588 C CE1 . TYR A 1 331 ? 3.333   -6.018  20.953  1.00 2.00  ? 331 TYR A CE1 1 
ATOM   2589 C CE2 . TYR A 1 331 ? 5.220   -4.510  20.701  1.00 2.00  ? 331 TYR A CE2 1 
ATOM   2590 C CZ  . TYR A 1 331 ? 4.700   -5.780  20.952  1.00 2.00  ? 331 TYR A CZ  1 
ATOM   2591 O OH  . TYR A 1 331 ? 5.623   -6.734  21.177  1.00 2.00  ? 331 TYR A OH  1 
ATOM   2592 N N   . ASP A 1 332 ? -0.847  -0.631  21.226  1.00 7.98  ? 332 ASP A N   1 
ATOM   2593 C CA  . ASP A 1 332 ? -1.042  0.731   21.609  1.00 2.00  ? 332 ASP A CA  1 
ATOM   2594 C C   . ASP A 1 332 ? -1.833  1.076   22.865  1.00 5.05  ? 332 ASP A C   1 
ATOM   2595 O O   . ASP A 1 332 ? -2.454  0.305   23.596  1.00 2.00  ? 332 ASP A O   1 
ATOM   2596 C CB  . ASP A 1 332 ? -1.714  1.465   20.553  1.00 9.67  ? 332 ASP A CB  1 
ATOM   2597 C CG  . ASP A 1 332 ? -3.169  1.114   20.498  1.00 13.86 ? 332 ASP A CG  1 
ATOM   2598 O OD1 . ASP A 1 332 ? -4.039  2.011   20.520  1.00 16.53 ? 332 ASP A OD1 1 
ATOM   2599 O OD2 . ASP A 1 332 ? -3.351  -0.087  20.450  1.00 11.65 ? 332 ASP A OD2 1 
ATOM   2600 N N   . ILE A 1 333 ? -1.834  2.351   23.056  1.00 6.01  ? 333 ILE A N   1 
ATOM   2601 C CA  . ILE A 1 333 ? -2.219  2.612   24.402  1.00 2.47  ? 333 ILE A CA  1 
ATOM   2602 C C   . ILE A 1 333 ? -3.697  2.429   24.630  1.00 2.92  ? 333 ILE A C   1 
ATOM   2603 O O   . ILE A 1 333 ? -4.234  1.974   25.614  1.00 5.24  ? 333 ILE A O   1 
ATOM   2604 C CB  . ILE A 1 333 ? -1.554  3.937   24.767  1.00 2.00  ? 333 ILE A CB  1 
ATOM   2605 C CG1 . ILE A 1 333 ? -1.714  5.013   23.690  1.00 2.00  ? 333 ILE A CG1 1 
ATOM   2606 C CG2 . ILE A 1 333 ? -0.030  3.804   25.111  1.00 2.00  ? 333 ILE A CG2 1 
ATOM   2607 C CD1 . ILE A 1 333 ? -1.585  6.384   24.292  1.00 9.40  ? 333 ILE A CD1 1 
ATOM   2608 N N   . ALA A 1 334 ? -4.432  2.626   23.606  1.00 5.99  ? 334 ALA A N   1 
ATOM   2609 C CA  . ALA A 1 334 ? -5.888  2.456   23.822  1.00 6.30  ? 334 ALA A CA  1 
ATOM   2610 C C   . ALA A 1 334 ? -6.393  1.074   24.358  1.00 4.23  ? 334 ALA A C   1 
ATOM   2611 O O   . ALA A 1 334 ? -7.407  0.881   25.058  1.00 4.16  ? 334 ALA A O   1 
ATOM   2612 C CB  . ALA A 1 334 ? -6.590  2.668   22.544  1.00 2.00  ? 334 ALA A CB  1 
ATOM   2613 N N   . GLN A 1 335 ? -5.551  0.109   24.030  1.00 2.00  ? 335 GLN A N   1 
ATOM   2614 C CA  . GLN A 1 335 ? -5.936  -1.190  24.451  1.00 2.00  ? 335 GLN A CA  1 
ATOM   2615 C C   . GLN A 1 335 ? -5.881  -1.458  25.983  1.00 3.02  ? 335 GLN A C   1 
ATOM   2616 O O   . GLN A 1 335 ? -5.953  -2.617  26.403  1.00 2.00  ? 335 GLN A O   1 
ATOM   2617 C CB  . GLN A 1 335 ? -4.924  -1.935  23.680  1.00 2.00  ? 335 GLN A CB  1 
ATOM   2618 C CG  . GLN A 1 335 ? -5.419  -3.158  22.973  1.00 8.53  ? 335 GLN A CG  1 
ATOM   2619 C CD  . GLN A 1 335 ? -4.361  -3.457  21.957  1.00 2.00  ? 335 GLN A CD  1 
ATOM   2620 O OE1 . GLN A 1 335 ? -3.476  -2.653  21.809  1.00 2.00  ? 335 GLN A OE1 1 
ATOM   2621 N NE2 . GLN A 1 335 ? -4.491  -4.551  21.235  1.00 2.00  ? 335 GLN A NE2 1 
ATOM   2622 N N   . VAL A 1 336 ? -5.631  -0.370  26.797  1.00 5.77  ? 336 VAL A N   1 
ATOM   2623 C CA  . VAL A 1 336 ? -5.625  -0.494  28.268  1.00 4.21  ? 336 VAL A CA  1 
ATOM   2624 C C   . VAL A 1 336 ? -6.532  0.423   29.068  1.00 4.64  ? 336 VAL A C   1 
ATOM   2625 O O   . VAL A 1 336 ? -6.817  1.593   28.809  1.00 6.30  ? 336 VAL A O   1 
ATOM   2626 C CB  . VAL A 1 336 ? -4.284  -0.670  29.121  1.00 4.69  ? 336 VAL A CB  1 
ATOM   2627 C CG1 . VAL A 1 336 ? -3.061  -1.221  28.393  1.00 3.71  ? 336 VAL A CG1 1 
ATOM   2628 C CG2 . VAL A 1 336 ? -3.848  0.382   30.139  1.00 5.61  ? 336 VAL A CG2 1 
ATOM   2629 N N   . ASN A 1 337 ? -7.006  -0.220  30.076  1.00 3.78  ? 337 ASN A N   1 
ATOM   2630 C CA  . ASN A 1 337 ? -7.711  0.538   31.069  1.00 3.72  ? 337 ASN A CA  1 
ATOM   2631 C C   . ASN A 1 337 ? -7.392  0.194   32.547  1.00 4.44  ? 337 ASN A C   1 
ATOM   2632 O O   . ASN A 1 337 ? -7.498  -0.952  33.052  1.00 8.81  ? 337 ASN A O   1 
ATOM   2633 C CB  . ASN A 1 337 ? -9.053  0.124   30.599  1.00 5.43  ? 337 ASN A CB  1 
ATOM   2634 C CG  . ASN A 1 337 ? -10.095 0.952   31.136  1.00 7.24  ? 337 ASN A CG  1 
ATOM   2635 O OD1 . ASN A 1 337 ? -11.024 0.394   31.607  1.00 4.26  ? 337 ASN A OD1 1 
ATOM   2636 N ND2 . ASN A 1 337 ? -9.837  2.221   31.056  1.00 9.56  ? 337 ASN A ND2 1 
ATOM   2637 N N   . LEU A 1 338 ? -6.868  1.233   33.161  1.00 7.19  ? 338 LEU A N   1 
ATOM   2638 C CA  . LEU A 1 338 ? -6.624  1.034   34.562  1.00 10.70 ? 338 LEU A CA  1 
ATOM   2639 C C   . LEU A 1 338 ? -7.837  0.756   35.562  1.00 12.30 ? 338 LEU A C   1 
ATOM   2640 O O   . LEU A 1 338 ? -8.846  1.441   35.644  1.00 16.58 ? 338 LEU A O   1 
ATOM   2641 C CB  . LEU A 1 338 ? -5.721  2.189   35.034  1.00 9.58  ? 338 LEU A CB  1 
ATOM   2642 C CG  . LEU A 1 338 ? -4.310  2.392   34.490  1.00 10.04 ? 338 LEU A CG  1 
ATOM   2643 C CD1 . LEU A 1 338 ? -3.595  3.474   35.306  1.00 11.29 ? 338 LEU A CD1 1 
ATOM   2644 C CD2 . LEU A 1 338 ? -3.448  1.144   34.322  1.00 5.09  ? 338 LEU A CD2 1 
ATOM   2645 N N   . LYS A 1 339 ? -7.734  -0.347  36.341  1.00 10.67 ? 339 LYS A N   1 
ATOM   2646 C CA  . LYS A 1 339 ? -8.916  -0.587  37.205  1.00 9.97  ? 339 LYS A CA  1 
ATOM   2647 C C   . LYS A 1 339 ? -8.617  -0.328  38.664  1.00 10.85 ? 339 LYS A C   1 
ATOM   2648 O O   . LYS A 1 339 ? -8.892  0.706   39.262  1.00 9.45  ? 339 LYS A O   1 
ATOM   2649 C CB  . LYS A 1 339 ? -9.553  -1.947  37.057  1.00 9.56  ? 339 LYS A CB  1 
ATOM   2650 C CG  . LYS A 1 339 ? -9.692  -2.506  35.645  1.00 10.46 ? 339 LYS A CG  1 
ATOM   2651 C CD  . LYS A 1 339 ? -10.529 -1.770  34.660  1.00 12.59 ? 339 LYS A CD  1 
ATOM   2652 C CE  . LYS A 1 339 ? -11.923 -2.125  34.915  1.00 15.07 ? 339 LYS A CE  1 
ATOM   2653 N NZ  . LYS A 1 339 ? -12.816 -1.344  34.010  1.00 22.19 ? 339 LYS A NZ  1 
ATOM   2654 N N   . TYR A 1 340 ? -7.925  -1.270  39.276  1.00 10.03 ? 340 TYR A N   1 
ATOM   2655 C CA  . TYR A 1 340 ? -7.381  -0.937  40.614  1.00 10.32 ? 340 TYR A CA  1 
ATOM   2656 C C   . TYR A 1 340 ? -5.910  -0.341  40.807  1.00 11.39 ? 340 TYR A C   1 
ATOM   2657 O O   . TYR A 1 340 ? -4.942  -0.678  40.136  1.00 11.78 ? 340 TYR A O   1 
ATOM   2658 C CB  . TYR A 1 340 ? -7.492  -2.299  41.213  1.00 10.41 ? 340 TYR A CB  1 
ATOM   2659 C CG  . TYR A 1 340 ? -8.877  -2.815  41.098  1.00 8.41  ? 340 TYR A CG  1 
ATOM   2660 C CD1 . TYR A 1 340 ? -9.837  -2.192  41.923  1.00 15.54 ? 340 TYR A CD1 1 
ATOM   2661 C CD2 . TYR A 1 340 ? -9.145  -3.937  40.288  1.00 7.67  ? 340 TYR A CD2 1 
ATOM   2662 C CE1 . TYR A 1 340 ? -11.125 -2.721  41.968  1.00 16.20 ? 340 TYR A CE1 1 
ATOM   2663 C CE2 . TYR A 1 340 ? -10.446 -4.442  40.283  1.00 14.82 ? 340 TYR A CE2 1 
ATOM   2664 C CZ  . TYR A 1 340 ? -11.452 -3.724  41.016  1.00 13.90 ? 340 TYR A CZ  1 
ATOM   2665 O OH  . TYR A 1 340 ? -12.791 -3.884  40.699  1.00 15.05 ? 340 TYR A OH  1 
ATOM   2666 N N   . LEU A 1 341 ? -5.719  0.492   41.823  1.00 11.93 ? 341 LEU A N   1 
ATOM   2667 C CA  . LEU A 1 341 ? -4.462  0.408   42.606  1.00 15.71 ? 341 LEU A CA  1 
ATOM   2668 C C   . LEU A 1 341 ? -4.569  -0.448  43.942  1.00 17.80 ? 341 LEU A C   1 
ATOM   2669 O O   . LEU A 1 341 ? -5.634  -0.719  44.548  1.00 21.59 ? 341 LEU A O   1 
ATOM   2670 C CB  . LEU A 1 341 ? -4.048  1.806   43.097  1.00 10.53 ? 341 LEU A CB  1 
ATOM   2671 C CG  . LEU A 1 341 ? -2.843  2.539   42.488  1.00 5.28  ? 341 LEU A CG  1 
ATOM   2672 C CD1 . LEU A 1 341 ? -2.540  3.952   43.007  1.00 2.00  ? 341 LEU A CD1 1 
ATOM   2673 C CD2 . LEU A 1 341 ? -1.728  1.543   42.723  1.00 2.00  ? 341 LEU A CD2 1 
ATOM   2674 N N   . LEU A 1 342 ? -3.329  -0.822  44.420  1.00 16.32 ? 342 LEU A N   1 
ATOM   2675 C CA  . LEU A 1 342 ? -3.085  -1.489  45.728  1.00 9.79  ? 342 LEU A CA  1 
ATOM   2676 C C   . LEU A 1 342 ? -1.833  -0.890  46.271  1.00 9.32  ? 342 LEU A C   1 
ATOM   2677 O O   . LEU A 1 342 ? -0.819  -0.821  45.608  1.00 5.66  ? 342 LEU A O   1 
ATOM   2678 C CB  . LEU A 1 342 ? -2.790  -2.965  45.579  1.00 5.99  ? 342 LEU A CB  1 
ATOM   2679 C CG  . LEU A 1 342 ? -3.856  -4.015  45.162  1.00 6.88  ? 342 LEU A CG  1 
ATOM   2680 C CD1 . LEU A 1 342 ? -5.003  -3.574  44.183  1.00 2.00  ? 342 LEU A CD1 1 
ATOM   2681 C CD2 . LEU A 1 342 ? -3.137  -5.428  45.026  1.00 2.00  ? 342 LEU A CD2 1 
ATOM   2682 N N   . LYS A 1 343 ? -1.901  -0.451  47.532  1.00 9.38  ? 343 LYS A N   1 
ATOM   2683 C CA  . LYS A 1 343 ? -0.578  -0.305  48.221  1.00 10.68 ? 343 LYS A CA  1 
ATOM   2684 C C   . LYS A 1 343 ? 0.032   -1.552  48.927  1.00 11.47 ? 343 LYS A C   1 
ATOM   2685 O O   . LYS A 1 343 ? -0.549  -2.270  49.717  1.00 7.68  ? 343 LYS A O   1 
ATOM   2686 C CB  . LYS A 1 343 ? -0.538  1.043   48.963  1.00 11.35 ? 343 LYS A CB  1 
ATOM   2687 C CG  . LYS A 1 343 ? -0.015  1.195   50.386  1.00 14.09 ? 343 LYS A CG  1 
ATOM   2688 C CD  . LYS A 1 343 ? -0.610  2.493   50.998  1.00 18.17 ? 343 LYS A CD  1 
ATOM   2689 C CE  . LYS A 1 343 ? 0.124   3.134   52.170  1.00 17.68 ? 343 LYS A CE  1 
ATOM   2690 N NZ  . LYS A 1 343 ? -0.621  4.293   52.585  1.00 11.70 ? 343 LYS A NZ  1 
ATOM   2691 N N   . LEU A 1 344 ? 1.226   -1.847  48.473  1.00 12.22 ? 344 LEU A N   1 
ATOM   2692 C CA  . LEU A 1 344 ? 1.919   -2.999  49.074  1.00 10.82 ? 344 LEU A CA  1 
ATOM   2693 C C   . LEU A 1 344 ? 2.991   -2.754  50.154  1.00 10.40 ? 344 LEU A C   1 
ATOM   2694 O O   . LEU A 1 344 ? 3.682   -1.749  50.250  1.00 13.67 ? 344 LEU A O   1 
ATOM   2695 C CB  . LEU A 1 344 ? 2.286   -4.067  48.052  1.00 6.17  ? 344 LEU A CB  1 
ATOM   2696 C CG  . LEU A 1 344 ? 0.909   -4.609  47.660  1.00 2.00  ? 344 LEU A CG  1 
ATOM   2697 C CD1 . LEU A 1 344 ? 0.366   -3.995  46.363  1.00 2.00  ? 344 LEU A CD1 1 
ATOM   2698 C CD2 . LEU A 1 344 ? 0.924   -6.154  47.618  1.00 7.89  ? 344 LEU A CD2 1 
ATOM   2699 N N   . LYS A 1 345 ? 2.939   -3.684  51.101  1.00 5.77  ? 345 LYS A N   1 
ATOM   2700 C CA  . LYS A 1 345 ? 3.972   -3.697  52.067  1.00 4.18  ? 345 LYS A CA  1 
ATOM   2701 C C   . LYS A 1 345 ? 4.573   -4.877  51.589  1.00 4.27  ? 345 LYS A C   1 
ATOM   2702 O O   . LYS A 1 345 ? 3.963   -5.927  51.592  1.00 6.77  ? 345 LYS A O   1 
ATOM   2703 C CB  . LYS A 1 345 ? 3.508   -3.988  53.498  1.00 9.72  ? 345 LYS A CB  1 
ATOM   2704 C CG  . LYS A 1 345 ? 4.313   -3.347  54.692  1.00 10.18 ? 345 LYS A CG  1 
ATOM   2705 C CD  . LYS A 1 345 ? 3.835   -3.760  56.090  1.00 16.22 ? 345 LYS A CD  1 
ATOM   2706 C CE  . LYS A 1 345 ? 4.790   -4.784  56.727  1.00 20.43 ? 345 LYS A CE  1 
ATOM   2707 N NZ  . LYS A 1 345 ? 5.024   -5.931  55.850  1.00 24.91 ? 345 LYS A NZ  1 
ATOM   2708 N N   . PHE A 1 346 ? 5.746   -4.580  51.134  1.00 5.98  ? 346 PHE A N   1 
ATOM   2709 C CA  . PHE A 1 346 ? 6.839   -5.551  51.154  1.00 7.95  ? 346 PHE A CA  1 
ATOM   2710 C C   . PHE A 1 346 ? 7.241   -5.930  52.635  1.00 7.64  ? 346 PHE A C   1 
ATOM   2711 O O   . PHE A 1 346 ? 7.054   -5.142  53.545  1.00 12.22 ? 346 PHE A O   1 
ATOM   2712 C CB  . PHE A 1 346 ? 7.941   -5.043  50.108  1.00 9.16  ? 346 PHE A CB  1 
ATOM   2713 C CG  . PHE A 1 346 ? 7.433   -5.121  48.629  1.00 9.03  ? 346 PHE A CG  1 
ATOM   2714 C CD1 . PHE A 1 346 ? 6.575   -4.101  48.082  1.00 11.06 ? 346 PHE A CD1 1 
ATOM   2715 C CD2 . PHE A 1 346 ? 7.782   -6.200  47.800  1.00 10.30 ? 346 PHE A CD2 1 
ATOM   2716 C CE1 . PHE A 1 346 ? 6.004   -4.167  46.795  1.00 5.54  ? 346 PHE A CE1 1 
ATOM   2717 C CE2 . PHE A 1 346 ? 7.237   -6.272  46.484  1.00 14.25 ? 346 PHE A CE2 1 
ATOM   2718 C CZ  . PHE A 1 346 ? 6.309   -5.293  46.024  1.00 11.44 ? 346 PHE A CZ  1 
ATOM   2719 N N   . ASN A 1 347 ? 7.511   -7.203  52.835  1.00 3.36  ? 347 ASN A N   1 
ATOM   2720 C CA  . ASN A 1 347 ? 7.707   -7.831  54.124  1.00 4.72  ? 347 ASN A CA  1 
ATOM   2721 C C   . ASN A 1 347 ? 8.749   -8.876  53.860  1.00 3.88  ? 347 ASN A C   1 
ATOM   2722 O O   . ASN A 1 347 ? 8.584   -9.925  53.235  1.00 3.89  ? 347 ASN A O   1 
ATOM   2723 C CB  . ASN A 1 347 ? 6.410   -8.437  54.697  1.00 7.80  ? 347 ASN A CB  1 
ATOM   2724 C CG  . ASN A 1 347 ? 6.332   -8.399  56.250  1.00 9.98  ? 347 ASN A CG  1 
ATOM   2725 O OD1 . ASN A 1 347 ? 7.298   -8.109  56.993  1.00 9.70  ? 347 ASN A OD1 1 
ATOM   2726 N ND2 . ASN A 1 347 ? 5.057   -8.657  56.792  1.00 8.81  ? 347 ASN A ND2 1 
ATOM   2727 N N   . PHE A 1 348 ? 9.948   -8.424  54.141  1.00 7.23  ? 348 PHE A N   1 
ATOM   2728 C CA  . PHE A 1 348 ? 10.986  -9.230  53.530  1.00 8.48  ? 348 PHE A CA  1 
ATOM   2729 C C   . PHE A 1 348 ? 11.409  -10.394 54.301  1.00 12.06 ? 348 PHE A C   1 
ATOM   2730 O O   . PHE A 1 348 ? 12.230  -10.166 55.141  1.00 15.57 ? 348 PHE A O   1 
ATOM   2731 C CB  . PHE A 1 348 ? 12.114  -8.318  53.363  1.00 6.73  ? 348 PHE A CB  1 
ATOM   2732 C CG  . PHE A 1 348 ? 11.852  -7.660  52.024  1.00 5.52  ? 348 PHE A CG  1 
ATOM   2733 C CD1 . PHE A 1 348 ? 11.141  -6.411  51.911  1.00 2.00  ? 348 PHE A CD1 1 
ATOM   2734 C CD2 . PHE A 1 348 ? 12.435  -8.270  50.902  1.00 2.41  ? 348 PHE A CD2 1 
ATOM   2735 C CE1 . PHE A 1 348 ? 11.231  -5.608  50.810  1.00 2.00  ? 348 PHE A CE1 1 
ATOM   2736 C CE2 . PHE A 1 348 ? 12.557  -7.416  49.787  1.00 2.00  ? 348 PHE A CE2 1 
ATOM   2737 C CZ  . PHE A 1 348 ? 12.052  -6.077  49.807  1.00 2.00  ? 348 PHE A CZ  1 
ATOM   2738 N N   . LYS A 1 349 ? 10.909  -11.611 54.055  1.00 16.01 ? 349 LYS A N   1 
ATOM   2739 C CA  . LYS A 1 349 ? 11.331  -12.860 54.747  1.00 17.06 ? 349 LYS A CA  1 
ATOM   2740 C C   . LYS A 1 349 ? 12.670  -12.832 55.519  1.00 13.73 ? 349 LYS A C   1 
ATOM   2741 O O   . LYS A 1 349 ? 13.637  -12.219 55.085  1.00 15.77 ? 349 LYS A O   1 
ATOM   2742 C CB  . LYS A 1 349 ? 11.239  -14.061 53.773  1.00 14.89 ? 349 LYS A CB  1 
ATOM   2743 C CG  . LYS A 1 349 ? 11.095  -15.359 54.513  1.00 18.80 ? 349 LYS A CG  1 
ATOM   2744 C CD  . LYS A 1 349 ? 11.395  -16.763 53.881  1.00 25.50 ? 349 LYS A CD  1 
ATOM   2745 C CE  . LYS A 1 349 ? 11.806  -17.888 54.881  1.00 24.82 ? 349 LYS A CE  1 
ATOM   2746 N NZ  . LYS A 1 349 ? 11.014  -19.126 54.708  1.00 26.08 ? 349 LYS A NZ  1 
ATOM   2747 N N   . THR A 1 350 ? 12.675  -13.580 56.625  1.00 15.29 ? 350 THR A N   1 
ATOM   2748 C CA  . THR A 1 350 ? 13.757  -14.182 57.479  1.00 15.00 ? 350 THR A CA  1 
ATOM   2749 C C   . THR A 1 350 ? 14.192  -15.801 57.272  1.00 17.02 ? 350 THR A C   1 
ATOM   2750 O O   . THR A 1 350 ? 13.631  -16.774 57.857  1.00 21.47 ? 350 THR A O   1 
ATOM   2751 C CB  . THR A 1 350 ? 13.202  -13.673 58.887  1.00 15.26 ? 350 THR A CB  1 
ATOM   2752 O OG1 . THR A 1 350 ? 11.717  -13.766 58.842  1.00 14.70 ? 350 THR A OG1 1 
ATOM   2753 C CG2 . THR A 1 350 ? 13.750  -12.148 59.060  1.00 4.50  ? 350 THR A CG2 1 
ATOM   2754 O OXT . THR A 1 350 ? 15.095  -16.127 56.454  1.00 14.21 ? 350 THR A OXT 1 
ATOM   2755 N N   . LYS B 1 1   ? 39.058  9.035   -14.769 1.00 17.49 ? 1   LYS B N   1 
ATOM   2756 C CA  . LYS B 1 1   ? 39.082  10.484  -14.446 1.00 19.02 ? 1   LYS B CA  1 
ATOM   2757 C C   . LYS B 1 1   ? 37.668  11.127  -14.757 1.00 21.31 ? 1   LYS B C   1 
ATOM   2758 O O   . LYS B 1 1   ? 36.719  10.323  -14.769 1.00 21.96 ? 1   LYS B O   1 
ATOM   2759 C CB  . LYS B 1 1   ? 40.447  11.124  -14.770 1.00 15.61 ? 1   LYS B CB  1 
ATOM   2760 C CG  . LYS B 1 1   ? 40.674  12.674  -14.799 1.00 15.41 ? 1   LYS B CG  1 
ATOM   2761 C CD  . LYS B 1 1   ? 41.013  13.611  -13.545 1.00 18.63 ? 1   LYS B CD  1 
ATOM   2762 C CE  . LYS B 1 1   ? 40.680  15.182  -13.554 1.00 10.60 ? 1   LYS B CE  1 
ATOM   2763 N NZ  . LYS B 1 1   ? 39.461  15.420  -14.383 1.00 13.32 ? 1   LYS B NZ  1 
ATOM   2764 N N   . SER B 1 2   ? 37.478  12.487  -14.969 1.00 23.34 ? 2   SER B N   1 
ATOM   2765 C CA  . SER B 1 2   ? 36.069  13.098  -15.080 1.00 23.70 ? 2   SER B CA  1 
ATOM   2766 C C   . SER B 1 2   ? 35.615  13.851  -16.353 1.00 24.89 ? 2   SER B C   1 
ATOM   2767 O O   . SER B 1 2   ? 36.343  14.643  -16.959 1.00 25.06 ? 2   SER B O   1 
ATOM   2768 C CB  . SER B 1 2   ? 35.596  14.084  -13.865 1.00 25.48 ? 2   SER B CB  1 
ATOM   2769 O OG  . SER B 1 2   ? 34.513  15.052  -14.049 1.00 18.46 ? 2   SER B OG  1 
ATOM   2770 N N   . LYS B 1 3   ? 34.315  13.559  -16.587 1.00 25.17 ? 3   LYS B N   1 
ATOM   2771 C CA  . LYS B 1 3   ? 33.342  14.128  -17.592 1.00 24.51 ? 3   LYS B CA  1 
ATOM   2772 C C   . LYS B 1 3   ? 32.947  15.673  -17.526 1.00 25.43 ? 3   LYS B C   1 
ATOM   2773 O O   . LYS B 1 3   ? 32.353  16.183  -18.445 1.00 25.73 ? 3   LYS B O   1 
ATOM   2774 C CB  . LYS B 1 3   ? 32.037  13.200  -17.597 1.00 24.05 ? 3   LYS B CB  1 
ATOM   2775 C CG  . LYS B 1 3   ? 32.207  11.631  -17.299 1.00 24.29 ? 3   LYS B CG  1 
ATOM   2776 C CD  . LYS B 1 3   ? 31.470  11.065  -15.991 1.00 22.72 ? 3   LYS B CD  1 
ATOM   2777 C CE  . LYS B 1 3   ? 32.016  9.894   -15.086 1.00 17.76 ? 3   LYS B CE  1 
ATOM   2778 N NZ  . LYS B 1 3   ? 32.013  8.580   -15.752 1.00 23.80 ? 3   LYS B NZ  1 
ATOM   2779 N N   . LEU B 1 4   ? 33.168  16.330  -16.330 1.00 23.10 ? 4   LEU B N   1 
ATOM   2780 C CA  . LEU B 1 4   ? 32.587  17.644  -15.891 1.00 16.47 ? 4   LEU B CA  1 
ATOM   2781 C C   . LEU B 1 4   ? 33.262  18.878  -16.302 1.00 11.58 ? 4   LEU B C   1 
ATOM   2782 O O   . LEU B 1 4   ? 34.351  19.174  -15.859 1.00 8.84  ? 4   LEU B O   1 
ATOM   2783 C CB  . LEU B 1 4   ? 32.835  17.907  -14.445 1.00 15.52 ? 4   LEU B CB  1 
ATOM   2784 C CG  . LEU B 1 4   ? 31.696  18.115  -13.528 1.00 17.46 ? 4   LEU B CG  1 
ATOM   2785 C CD1 . LEU B 1 4   ? 30.485  17.152  -13.715 1.00 17.37 ? 4   LEU B CD1 1 
ATOM   2786 C CD2 . LEU B 1 4   ? 32.388  18.054  -12.179 1.00 18.63 ? 4   LEU B CD2 1 
ATOM   2787 N N   . PRO B 1 5   ? 32.545  19.702  -17.038 1.00 8.91  ? 5   PRO B N   1 
ATOM   2788 C CA  . PRO B 1 5   ? 33.279  20.898  -17.622 1.00 9.62  ? 5   PRO B CA  1 
ATOM   2789 C C   . PRO B 1 5   ? 34.315  21.563  -16.696 1.00 9.39  ? 5   PRO B C   1 
ATOM   2790 O O   . PRO B 1 5   ? 34.107  21.716  -15.507 1.00 9.83  ? 5   PRO B O   1 
ATOM   2791 C CB  . PRO B 1 5   ? 32.136  21.786  -18.025 1.00 8.55  ? 5   PRO B CB  1 
ATOM   2792 C CG  . PRO B 1 5   ? 30.815  21.040  -17.571 1.00 12.46 ? 5   PRO B CG  1 
ATOM   2793 C CD  . PRO B 1 5   ? 31.125  19.564  -17.338 1.00 13.09 ? 5   PRO B CD  1 
ATOM   2794 N N   . LYS B 1 6   ? 35.446  21.917  -17.230 1.00 7.78  ? 6   LYS B N   1 
ATOM   2795 C CA  . LYS B 1 6   ? 36.508  22.504  -16.392 1.00 14.61 ? 6   LYS B CA  1 
ATOM   2796 C C   . LYS B 1 6   ? 35.979  23.320  -15.220 1.00 15.88 ? 6   LYS B C   1 
ATOM   2797 O O   . LYS B 1 6   ? 36.321  22.983  -14.105 1.00 18.97 ? 6   LYS B O   1 
ATOM   2798 C CB  . LYS B 1 6   ? 37.542  23.413  -17.195 1.00 18.95 ? 6   LYS B CB  1 
ATOM   2799 C CG  . LYS B 1 6   ? 38.749  24.147  -16.493 1.00 27.24 ? 6   LYS B CG  1 
ATOM   2800 C CD  . LYS B 1 6   ? 39.705  25.108  -17.325 1.00 32.80 ? 6   LYS B CD  1 
ATOM   2801 C CE  . LYS B 1 6   ? 40.610  24.359  -18.351 1.00 34.67 ? 6   LYS B CE  1 
ATOM   2802 N NZ  . LYS B 1 6   ? 41.767  25.131  -18.817 1.00 33.71 ? 6   LYS B NZ  1 
ATOM   2803 N N   . PRO B 1 7   ? 35.131  24.367  -15.446 1.00 15.36 ? 7   PRO B N   1 
ATOM   2804 C CA  . PRO B 1 7   ? 34.657  25.189  -14.272 1.00 13.44 ? 7   PRO B CA  1 
ATOM   2805 C C   . PRO B 1 7   ? 33.983  24.442  -13.081 1.00 11.59 ? 7   PRO B C   1 
ATOM   2806 O O   . PRO B 1 7   ? 34.311  24.409  -11.928 1.00 14.94 ? 7   PRO B O   1 
ATOM   2807 C CB  . PRO B 1 7   ? 33.693  26.158  -15.060 1.00 17.40 ? 7   PRO B CB  1 
ATOM   2808 C CG  . PRO B 1 7   ? 33.242  25.430  -16.361 1.00 15.62 ? 7   PRO B CG  1 
ATOM   2809 C CD  . PRO B 1 7   ? 34.632  24.924  -16.724 1.00 15.95 ? 7   PRO B CD  1 
ATOM   2810 N N   . VAL B 1 8   ? 33.062  23.622  -13.470 1.00 9.06  ? 8   VAL B N   1 
ATOM   2811 C CA  . VAL B 1 8   ? 32.535  22.704  -12.459 1.00 6.09  ? 8   VAL B CA  1 
ATOM   2812 C C   . VAL B 1 8   ? 33.490  21.723  -11.764 1.00 9.45  ? 8   VAL B C   1 
ATOM   2813 O O   . VAL B 1 8   ? 33.379  21.525  -10.561 1.00 14.91 ? 8   VAL B O   1 
ATOM   2814 C CB  . VAL B 1 8   ? 31.361  22.023  -13.070 1.00 2.00  ? 8   VAL B CB  1 
ATOM   2815 C CG1 . VAL B 1 8   ? 30.726  20.930  -12.281 1.00 5.14  ? 8   VAL B CG1 1 
ATOM   2816 C CG2 . VAL B 1 8   ? 30.432  23.231  -12.979 1.00 2.00  ? 8   VAL B CG2 1 
ATOM   2817 N N   . GLN B 1 9   ? 34.441  21.090  -12.533 1.00 12.75 ? 9   GLN B N   1 
ATOM   2818 C CA  . GLN B 1 9   ? 35.468  20.210  -11.897 1.00 9.21  ? 9   GLN B CA  1 
ATOM   2819 C C   . GLN B 1 9   ? 36.074  21.018  -10.756 1.00 5.11  ? 9   GLN B C   1 
ATOM   2820 O O   . GLN B 1 9   ? 35.912  20.680  -9.579  1.00 8.88  ? 9   GLN B O   1 
ATOM   2821 C CB  . GLN B 1 9   ? 36.670  19.723  -12.777 1.00 14.09 ? 9   GLN B CB  1 
ATOM   2822 C CG  . GLN B 1 9   ? 36.828  19.066  -14.179 1.00 22.68 ? 9   GLN B CG  1 
ATOM   2823 C CD  . GLN B 1 9   ? 36.419  17.604  -14.209 1.00 32.15 ? 9   GLN B CD  1 
ATOM   2824 O OE1 . GLN B 1 9   ? 36.072  17.007  -13.210 1.00 35.38 ? 9   GLN B OE1 1 
ATOM   2825 N NE2 . GLN B 1 9   ? 36.236  17.020  -15.391 1.00 38.86 ? 9   GLN B NE2 1 
ATOM   2826 N N   . ASP B 1 10  ? 36.543  22.155  -11.165 1.00 2.97  ? 10  ASP B N   1 
ATOM   2827 C CA  . ASP B 1 10  ? 36.791  23.064  -10.099 1.00 6.01  ? 10  ASP B CA  1 
ATOM   2828 C C   . ASP B 1 10  ? 35.781  23.140  -8.903  1.00 7.10  ? 10  ASP B C   1 
ATOM   2829 O O   . ASP B 1 10  ? 35.876  22.462  -7.833  1.00 7.63  ? 10  ASP B O   1 
ATOM   2830 C CB  . ASP B 1 10  ? 37.266  24.437  -10.660 1.00 6.54  ? 10  ASP B CB  1 
ATOM   2831 C CG  . ASP B 1 10  ? 38.725  24.317  -11.152 1.00 8.03  ? 10  ASP B CG  1 
ATOM   2832 O OD1 . ASP B 1 10  ? 39.341  25.300  -11.667 1.00 4.59  ? 10  ASP B OD1 1 
ATOM   2833 O OD2 . ASP B 1 10  ? 39.235  23.173  -10.984 1.00 13.88 ? 10  ASP B OD2 1 
ATOM   2834 N N   . LEU B 1 11  ? 34.802  23.996  -9.109  1.00 9.14  ? 11  LEU B N   1 
ATOM   2835 C CA  . LEU B 1 11  ? 33.875  24.130  -7.917  1.00 8.89  ? 11  LEU B CA  1 
ATOM   2836 C C   . LEU B 1 11  ? 33.550  22.886  -6.999  1.00 11.91 ? 11  LEU B C   1 
ATOM   2837 O O   . LEU B 1 11  ? 33.802  22.900  -5.809  1.00 12.55 ? 11  LEU B O   1 
ATOM   2838 C CB  . LEU B 1 11  ? 32.677  24.920  -8.448  1.00 4.14  ? 11  LEU B CB  1 
ATOM   2839 C CG  . LEU B 1 11  ? 31.555  25.009  -7.509  1.00 6.01  ? 11  LEU B CG  1 
ATOM   2840 C CD1 . LEU B 1 11  ? 31.154  26.474  -7.394  1.00 11.23 ? 11  LEU B CD1 1 
ATOM   2841 C CD2 . LEU B 1 11  ? 30.457  23.984  -7.890  1.00 2.00  ? 11  LEU B CD2 1 
ATOM   2842 N N   . ILE B 1 12  ? 33.058  21.760  -7.603  1.00 14.62 ? 12  ILE B N   1 
ATOM   2843 C CA  . ILE B 1 12  ? 32.854  20.506  -6.874  1.00 14.97 ? 12  ILE B CA  1 
ATOM   2844 C C   . ILE B 1 12  ? 33.982  20.296  -5.876  1.00 15.47 ? 12  ILE B C   1 
ATOM   2845 O O   . ILE B 1 12  ? 33.864  20.280  -4.666  1.00 16.56 ? 12  ILE B O   1 
ATOM   2846 C CB  . ILE B 1 12  ? 32.813  19.275  -7.856  1.00 13.32 ? 12  ILE B CB  1 
ATOM   2847 C CG1 . ILE B 1 12  ? 31.624  19.493  -8.718  1.00 16.49 ? 12  ILE B CG1 1 
ATOM   2848 C CG2 . ILE B 1 12  ? 32.690  17.760  -7.368  1.00 13.67 ? 12  ILE B CG2 1 
ATOM   2849 C CD1 . ILE B 1 12  ? 30.466  19.112  -7.842  1.00 17.87 ? 12  ILE B CD1 1 
ATOM   2850 N N   . LYS B 1 13  ? 35.167  20.200  -6.473  1.00 15.76 ? 13  LYS B N   1 
ATOM   2851 C CA  . LYS B 1 13  ? 36.326  19.950  -5.582  1.00 17.24 ? 13  LYS B CA  1 
ATOM   2852 C C   . LYS B 1 13  ? 36.526  21.014  -4.531  1.00 15.42 ? 13  LYS B C   1 
ATOM   2853 O O   . LYS B 1 13  ? 36.509  20.769  -3.366  1.00 11.57 ? 13  LYS B O   1 
ATOM   2854 C CB  . LYS B 1 13  ? 37.676  19.878  -6.369  1.00 23.37 ? 13  LYS B CB  1 
ATOM   2855 C CG  . LYS B 1 13  ? 38.073  18.510  -6.851  1.00 25.14 ? 13  LYS B CG  1 
ATOM   2856 C CD  . LYS B 1 13  ? 39.527  18.393  -7.267  1.00 27.37 ? 13  LYS B CD  1 
ATOM   2857 C CE  . LYS B 1 13  ? 39.818  18.697  -8.703  1.00 28.24 ? 13  LYS B CE  1 
ATOM   2858 N NZ  . LYS B 1 13  ? 39.818  20.147  -8.732  1.00 30.76 ? 13  LYS B NZ  1 
ATOM   2859 N N   . MET B 1 14  ? 36.636  22.208  -5.040  1.00 18.78 ? 14  MET B N   1 
ATOM   2860 C CA  . MET B 1 14  ? 36.702  23.318  -4.117  1.00 25.52 ? 14  MET B CA  1 
ATOM   2861 C C   . MET B 1 14  ? 35.920  23.351  -2.777  1.00 26.75 ? 14  MET B C   1 
ATOM   2862 O O   . MET B 1 14  ? 36.498  23.299  -1.694  1.00 30.74 ? 14  MET B O   1 
ATOM   2863 C CB  . MET B 1 14  ? 36.251  24.490  -4.913  1.00 27.06 ? 14  MET B CB  1 
ATOM   2864 C CG  . MET B 1 14  ? 37.389  25.397  -5.170  1.00 27.44 ? 14  MET B CG  1 
ATOM   2865 S SD  . MET B 1 14  ? 36.641  26.558  -4.153  1.00 25.03 ? 14  MET B SD  1 
ATOM   2866 C CE  . MET B 1 14  ? 36.273  27.849  -5.343  1.00 23.49 ? 14  MET B CE  1 
ATOM   2867 N N   . ILE B 1 15  ? 34.526  23.420  -2.914  1.00 23.94 ? 15  ILE B N   1 
ATOM   2868 C CA  . ILE B 1 15  ? 33.647  23.274  -1.728  1.00 18.27 ? 15  ILE B CA  1 
ATOM   2869 C C   . ILE B 1 15  ? 34.041  22.059  -0.838  1.00 19.22 ? 15  ILE B C   1 
ATOM   2870 O O   . ILE B 1 15  ? 34.333  22.142  0.306   1.00 19.78 ? 15  ILE B O   1 
ATOM   2871 C CB  . ILE B 1 15  ? 32.154  23.217  -2.190  1.00 16.62 ? 15  ILE B CB  1 
ATOM   2872 C CG1 . ILE B 1 15  ? 31.887  22.045  -3.105  1.00 15.73 ? 15  ILE B CG1 1 
ATOM   2873 C CG2 . ILE B 1 15  ? 31.680  24.414  -3.000  1.00 10.62 ? 15  ILE B CG2 1 
ATOM   2874 C CD1 . ILE B 1 15  ? 30.413  21.782  -3.352  1.00 15.03 ? 15  ILE B CD1 1 
ATOM   2875 N N   . PHE B 1 16  ? 34.152  20.898  -1.399  1.00 21.11 ? 16  PHE B N   1 
ATOM   2876 C CA  . PHE B 1 16  ? 34.714  19.826  -0.621  1.00 23.51 ? 16  PHE B CA  1 
ATOM   2877 C C   . PHE B 1 16  ? 36.235  19.876  -0.433  1.00 26.47 ? 16  PHE B C   1 
ATOM   2878 O O   . PHE B 1 16  ? 36.817  18.806  -0.226  1.00 27.22 ? 16  PHE B O   1 
ATOM   2879 C CB  . PHE B 1 16  ? 34.568  18.419  -1.236  1.00 21.70 ? 16  PHE B CB  1 
ATOM   2880 C CG  . PHE B 1 16  ? 33.170  17.986  -1.572  1.00 23.95 ? 16  PHE B CG  1 
ATOM   2881 C CD1 . PHE B 1 16  ? 32.829  16.641  -1.384  1.00 23.58 ? 16  PHE B CD1 1 
ATOM   2882 C CD2 . PHE B 1 16  ? 32.264  18.895  -2.098  1.00 20.64 ? 16  PHE B CD2 1 
ATOM   2883 C CE1 . PHE B 1 16  ? 31.536  16.234  -1.685  1.00 20.30 ? 16  PHE B CE1 1 
ATOM   2884 C CE2 . PHE B 1 16  ? 30.997  18.484  -2.445  1.00 22.07 ? 16  PHE B CE2 1 
ATOM   2885 C CZ  . PHE B 1 16  ? 30.636  17.163  -2.194  1.00 17.55 ? 16  PHE B CZ  1 
ATOM   2886 N N   . ASP B 1 17  ? 36.866  21.071  -0.452  1.00 27.51 ? 17  ASP B N   1 
ATOM   2887 C CA  . ASP B 1 17  ? 38.222  21.162  0.123   1.00 25.12 ? 17  ASP B CA  1 
ATOM   2888 C C   . ASP B 1 17  ? 38.300  21.011  1.693   1.00 25.66 ? 17  ASP B C   1 
ATOM   2889 O O   . ASP B 1 17  ? 38.234  21.948  2.486   1.00 26.55 ? 17  ASP B O   1 
ATOM   2890 C CB  . ASP B 1 17  ? 39.008  22.387  -0.458  1.00 24.51 ? 17  ASP B CB  1 
ATOM   2891 C CG  . ASP B 1 17  ? 40.534  22.384  -0.074  1.00 28.15 ? 17  ASP B CG  1 
ATOM   2892 O OD1 . ASP B 1 17  ? 41.143  23.494  -0.046  1.00 29.46 ? 17  ASP B OD1 1 
ATOM   2893 O OD2 . ASP B 1 17  ? 41.076  21.257  0.172   1.00 28.85 ? 17  ASP B OD2 1 
ATOM   2894 N N   . VAL B 1 18  ? 38.509  19.727  2.100   1.00 25.91 ? 18  VAL B N   1 
ATOM   2895 C CA  . VAL B 1 18  ? 39.015  19.366  3.472   1.00 21.79 ? 18  VAL B CA  1 
ATOM   2896 C C   . VAL B 1 18  ? 40.336  19.869  4.088   1.00 21.25 ? 18  VAL B C   1 
ATOM   2897 O O   . VAL B 1 18  ? 40.517  19.840  5.284   1.00 20.23 ? 18  VAL B O   1 
ATOM   2898 C CB  . VAL B 1 18  ? 38.608  17.995  3.997   1.00 16.77 ? 18  VAL B CB  1 
ATOM   2899 C CG1 . VAL B 1 18  ? 37.708  17.346  2.995   1.00 15.70 ? 18  VAL B CG1 1 
ATOM   2900 C CG2 . VAL B 1 18  ? 39.739  17.065  4.219   1.00 17.65 ? 18  VAL B CG2 1 
ATOM   2901 N N   . GLU B 1 19  ? 41.139  20.524  3.290   1.00 20.12 ? 19  GLU B N   1 
ATOM   2902 C CA  . GLU B 1 19  ? 41.879  21.582  3.991   1.00 21.23 ? 19  GLU B CA  1 
ATOM   2903 C C   . GLU B 1 19  ? 41.005  22.629  4.666   1.00 21.32 ? 19  GLU B C   1 
ATOM   2904 O O   . GLU B 1 19  ? 40.914  22.656  5.879   1.00 23.08 ? 19  GLU B O   1 
ATOM   2905 C CB  . GLU B 1 19  ? 42.856  22.157  2.988   1.00 22.57 ? 19  GLU B CB  1 
ATOM   2906 C CG  . GLU B 1 19  ? 43.993  23.018  3.397   1.00 29.43 ? 19  GLU B CG  1 
ATOM   2907 C CD  . GLU B 1 19  ? 43.599  24.500  3.584   1.00 34.33 ? 19  GLU B CD  1 
ATOM   2908 O OE1 . GLU B 1 19  ? 44.248  25.427  3.053   1.00 35.29 ? 19  GLU B OE1 1 
ATOM   2909 O OE2 . GLU B 1 19  ? 42.654  24.769  4.319   1.00 33.05 ? 19  GLU B OE2 1 
ATOM   2910 N N   . SER B 1 20  ? 40.353  23.529  3.880   1.00 19.85 ? 20  SER B N   1 
ATOM   2911 C CA  . SER B 1 20  ? 39.831  24.923  4.342   1.00 17.72 ? 20  SER B CA  1 
ATOM   2912 C C   . SER B 1 20  ? 38.724  24.921  5.399   1.00 11.13 ? 20  SER B C   1 
ATOM   2913 O O   . SER B 1 20  ? 38.543  25.690  6.317   1.00 3.57  ? 20  SER B O   1 
ATOM   2914 C CB  . SER B 1 20  ? 39.376  25.802  3.146   1.00 19.68 ? 20  SER B CB  1 
ATOM   2915 O OG  . SER B 1 20  ? 38.999  24.876  2.135   1.00 29.35 ? 20  SER B OG  1 
ATOM   2916 N N   . MET B 1 21  ? 38.103  23.693  5.340   1.00 7.40  ? 21  MET B N   1 
ATOM   2917 C CA  . MET B 1 21  ? 37.711  23.018  6.576   1.00 9.82  ? 21  MET B CA  1 
ATOM   2918 C C   . MET B 1 21  ? 38.355  23.329  8.093   1.00 13.25 ? 21  MET B C   1 
ATOM   2919 O O   . MET B 1 21  ? 38.025  24.282  8.843   1.00 15.61 ? 21  MET B O   1 
ATOM   2920 C CB  . MET B 1 21  ? 37.535  21.577  6.127   1.00 6.92  ? 21  MET B CB  1 
ATOM   2921 C CG  . MET B 1 21  ? 36.044  21.378  6.093   1.00 10.57 ? 21  MET B CG  1 
ATOM   2922 S SD  . MET B 1 21  ? 35.438  19.805  5.450   1.00 18.66 ? 21  MET B SD  1 
ATOM   2923 C CE  . MET B 1 21  ? 35.664  20.636  3.819   1.00 15.55 ? 21  MET B CE  1 
ATOM   2924 N N   . LYS B 1 22  ? 39.347  22.420  8.428   1.00 11.59 ? 22  LYS B N   1 
ATOM   2925 C CA  . LYS B 1 22  ? 40.346  22.697  9.470   1.00 7.22  ? 22  LYS B CA  1 
ATOM   2926 C C   . LYS B 1 22  ? 40.803  24.166  9.501   1.00 7.56  ? 22  LYS B C   1 
ATOM   2927 O O   . LYS B 1 22  ? 40.768  24.833  10.554  1.00 9.07  ? 22  LYS B O   1 
ATOM   2928 C CB  . LYS B 1 22  ? 41.473  21.689  9.463   1.00 3.21  ? 22  LYS B CB  1 
ATOM   2929 C CG  . LYS B 1 22  ? 41.597  21.002  8.102   1.00 6.19  ? 22  LYS B CG  1 
ATOM   2930 C CD  . LYS B 1 22  ? 42.200  19.585  7.909   1.00 7.12  ? 22  LYS B CD  1 
ATOM   2931 C CE  . LYS B 1 22  ? 43.213  19.457  6.758   1.00 10.91 ? 22  LYS B CE  1 
ATOM   2932 N NZ  . LYS B 1 22  ? 43.632  18.053  6.607   1.00 3.09  ? 22  LYS B NZ  1 
ATOM   2933 N N   . LYS B 1 23  ? 41.157  24.651  8.302   1.00 9.14  ? 23  LYS B N   1 
ATOM   2934 C CA  . LYS B 1 23  ? 41.626  26.037  8.296   1.00 9.25  ? 23  LYS B CA  1 
ATOM   2935 C C   . LYS B 1 23  ? 40.621  26.936  8.992   1.00 8.84  ? 23  LYS B C   1 
ATOM   2936 O O   . LYS B 1 23  ? 40.890  27.528  10.039  1.00 6.33  ? 23  LYS B O   1 
ATOM   2937 C CB  . LYS B 1 23  ? 41.906  26.364  6.845   1.00 15.10 ? 23  LYS B CB  1 
ATOM   2938 C CG  . LYS B 1 23  ? 42.350  27.794  6.566   1.00 19.74 ? 23  LYS B CG  1 
ATOM   2939 C CD  . LYS B 1 23  ? 43.810  28.138  6.759   1.00 28.49 ? 23  LYS B CD  1 
ATOM   2940 C CE  . LYS B 1 23  ? 43.952  29.670  6.834   1.00 32.26 ? 23  LYS B CE  1 
ATOM   2941 N NZ  . LYS B 1 23  ? 43.060  30.282  7.859   1.00 33.55 ? 23  LYS B NZ  1 
ATOM   2942 N N   . ALA B 1 24  ? 39.340  26.831  8.562   1.00 10.62 ? 24  ALA B N   1 
ATOM   2943 C CA  . ALA B 1 24  ? 38.285  27.661  9.249   1.00 12.80 ? 24  ALA B CA  1 
ATOM   2944 C C   . ALA B 1 24  ? 38.320  27.611  10.794  1.00 12.64 ? 24  ALA B C   1 
ATOM   2945 O O   . ALA B 1 24  ? 38.277  28.567  11.587  1.00 12.04 ? 24  ALA B O   1 
ATOM   2946 C CB  . ALA B 1 24  ? 36.821  27.287  8.851   1.00 15.44 ? 24  ALA B CB  1 
ATOM   2947 N N   . MET B 1 25  ? 38.426  26.304  11.158  1.00 16.63 ? 25  MET B N   1 
ATOM   2948 C CA  . MET B 1 25  ? 38.557  25.824  12.534  1.00 14.55 ? 25  MET B CA  1 
ATOM   2949 C C   . MET B 1 25  ? 39.520  26.573  13.381  1.00 14.90 ? 25  MET B C   1 
ATOM   2950 O O   . MET B 1 25  ? 39.070  27.388  14.198  1.00 15.36 ? 25  MET B O   1 
ATOM   2951 C CB  . MET B 1 25  ? 38.597  24.324  12.631  1.00 11.25 ? 25  MET B CB  1 
ATOM   2952 C CG  . MET B 1 25  ? 37.114  24.130  12.420  1.00 8.64  ? 25  MET B CG  1 
ATOM   2953 S SD  . MET B 1 25  ? 36.852  22.391  12.297  1.00 10.24 ? 25  MET B SD  1 
ATOM   2954 C CE  . MET B 1 25  ? 35.588  22.373  13.604  1.00 11.49 ? 25  MET B CE  1 
ATOM   2955 N N   . VAL B 1 26  ? 40.776  26.386  12.956  1.00 17.34 ? 26  VAL B N   1 
ATOM   2956 C CA  . VAL B 1 26  ? 41.865  27.236  13.536  1.00 21.63 ? 26  VAL B CA  1 
ATOM   2957 C C   . VAL B 1 26  ? 41.418  28.572  14.116  1.00 20.84 ? 26  VAL B C   1 
ATOM   2958 O O   . VAL B 1 26  ? 41.582  28.832  15.272  1.00 20.42 ? 26  VAL B O   1 
ATOM   2959 C CB  . VAL B 1 26  ? 43.207  27.515  12.713  1.00 26.13 ? 26  VAL B CB  1 
ATOM   2960 C CG1 . VAL B 1 26  ? 44.429  27.408  13.656  1.00 29.93 ? 26  VAL B CG1 1 
ATOM   2961 C CG2 . VAL B 1 26  ? 43.535  26.792  11.398  1.00 25.26 ? 26  VAL B CG2 1 
ATOM   2962 N N   . GLU B 1 27  ? 40.770  29.366  13.249  1.00 19.94 ? 27  GLU B N   1 
ATOM   2963 C CA  . GLU B 1 27  ? 40.494  30.738  13.665  1.00 20.69 ? 27  GLU B CA  1 
ATOM   2964 C C   . GLU B 1 27  ? 39.223  30.949  14.435  1.00 21.25 ? 27  GLU B C   1 
ATOM   2965 O O   . GLU B 1 27  ? 38.834  32.110  14.503  1.00 25.09 ? 27  GLU B O   1 
ATOM   2966 C CB  . GLU B 1 27  ? 40.470  31.717  12.486  1.00 20.16 ? 27  GLU B CB  1 
ATOM   2967 C CG  . GLU B 1 27  ? 39.574  31.269  11.294  1.00 24.75 ? 27  GLU B CG  1 
ATOM   2968 C CD  . GLU B 1 27  ? 40.275  30.943  9.956   1.00 24.47 ? 27  GLU B CD  1 
ATOM   2969 O OE1 . GLU B 1 27  ? 40.979  31.779  9.375   1.00 25.66 ? 27  GLU B OE1 1 
ATOM   2970 O OE2 . GLU B 1 27  ? 40.039  29.867  9.456   1.00 24.56 ? 27  GLU B OE2 1 
ATOM   2971 N N   . TYR B 1 28  ? 38.604  29.840  14.977  1.00 21.84 ? 28  TYR B N   1 
ATOM   2972 C CA  . TYR B 1 28  ? 37.501  30.094  15.957  1.00 19.07 ? 28  TYR B CA  1 
ATOM   2973 C C   . TYR B 1 28  ? 37.698  30.655  17.441  1.00 15.95 ? 28  TYR B C   1 
ATOM   2974 O O   . TYR B 1 28  ? 37.244  31.712  17.840  1.00 17.32 ? 28  TYR B O   1 
ATOM   2975 C CB  . TYR B 1 28  ? 36.406  29.013  15.855  1.00 19.47 ? 28  TYR B CB  1 
ATOM   2976 C CG  . TYR B 1 28  ? 35.546  29.403  14.637  1.00 22.68 ? 28  TYR B CG  1 
ATOM   2977 C CD1 . TYR B 1 28  ? 34.951  30.683  14.480  1.00 22.22 ? 28  TYR B CD1 1 
ATOM   2978 C CD2 . TYR B 1 28  ? 35.371  28.431  13.648  1.00 23.14 ? 28  TYR B CD2 1 
ATOM   2979 C CE1 . TYR B 1 28  ? 34.108  30.933  13.361  1.00 21.21 ? 28  TYR B CE1 1 
ATOM   2980 C CE2 . TYR B 1 28  ? 34.561  28.678  12.515  1.00 19.28 ? 28  TYR B CE2 1 
ATOM   2981 C CZ  . TYR B 1 28  ? 33.883  29.899  12.394  1.00 20.25 ? 28  TYR B CZ  1 
ATOM   2982 O OH  . TYR B 1 28  ? 32.965  30.012  11.356  1.00 11.68 ? 28  TYR B OH  1 
ATOM   2983 N N   . GLU B 1 29  ? 38.471  29.953  18.307  1.00 12.78 ? 29  GLU B N   1 
ATOM   2984 C CA  . GLU B 1 29  ? 39.672  29.325  17.803  1.00 8.68  ? 29  GLU B CA  1 
ATOM   2985 C C   . GLU B 1 29  ? 39.590  27.846  17.945  1.00 7.87  ? 29  GLU B C   1 
ATOM   2986 O O   . GLU B 1 29  ? 40.535  27.313  18.388  1.00 6.03  ? 29  GLU B O   1 
ATOM   2987 C CB  . GLU B 1 29  ? 40.880  30.100  18.356  1.00 8.28  ? 29  GLU B CB  1 
ATOM   2988 C CG  . GLU B 1 29  ? 40.568  31.520  17.926  1.00 13.73 ? 29  GLU B CG  1 
ATOM   2989 C CD  . GLU B 1 29  ? 41.164  32.624  18.749  1.00 15.72 ? 29  GLU B CD  1 
ATOM   2990 O OE1 . GLU B 1 29  ? 41.328  33.754  18.245  1.00 18.56 ? 29  GLU B OE1 1 
ATOM   2991 O OE2 . GLU B 1 29  ? 41.502  32.344  19.893  1.00 20.96 ? 29  GLU B OE2 1 
ATOM   2992 N N   . ILE B 1 30  ? 38.412  27.196  17.711  1.00 9.74  ? 30  ILE B N   1 
ATOM   2993 C CA  . ILE B 1 30  ? 38.262  25.708  18.035  1.00 12.40 ? 30  ILE B CA  1 
ATOM   2994 C C   . ILE B 1 30  ? 39.555  24.911  18.082  1.00 15.32 ? 30  ILE B C   1 
ATOM   2995 O O   . ILE B 1 30  ? 40.444  25.174  17.295  1.00 13.91 ? 30  ILE B O   1 
ATOM   2996 C CB  . ILE B 1 30  ? 37.317  24.889  17.103  1.00 2.97  ? 30  ILE B CB  1 
ATOM   2997 C CG1 . ILE B 1 30  ? 35.958  25.531  16.993  1.00 11.01 ? 30  ILE B CG1 1 
ATOM   2998 C CG2 . ILE B 1 30  ? 37.085  23.398  17.425  1.00 2.00  ? 30  ILE B CG2 1 
ATOM   2999 C CD1 . ILE B 1 30  ? 35.112  24.779  15.932  1.00 12.45 ? 30  ILE B CD1 1 
ATOM   3000 N N   . ASP B 1 31  ? 39.616  24.072  19.070  1.00 18.79 ? 31  ASP B N   1 
ATOM   3001 C CA  . ASP B 1 31  ? 40.820  23.331  19.354  1.00 22.23 ? 31  ASP B CA  1 
ATOM   3002 C C   . ASP B 1 31  ? 41.220  22.296  18.432  1.00 24.13 ? 31  ASP B C   1 
ATOM   3003 O O   . ASP B 1 31  ? 41.049  21.106  18.756  1.00 22.42 ? 31  ASP B O   1 
ATOM   3004 C CB  . ASP B 1 31  ? 40.791  22.568  20.667  1.00 25.32 ? 31  ASP B CB  1 
ATOM   3005 C CG  . ASP B 1 31  ? 41.771  23.091  21.700  1.00 27.94 ? 31  ASP B CG  1 
ATOM   3006 O OD1 . ASP B 1 31  ? 41.325  23.288  22.832  1.00 30.08 ? 31  ASP B OD1 1 
ATOM   3007 O OD2 . ASP B 1 31  ? 42.947  23.279  21.365  1.00 29.37 ? 31  ASP B OD2 1 
ATOM   3008 N N   . LEU B 1 32  ? 42.030  22.897  17.539  1.00 24.67 ? 32  LEU B N   1 
ATOM   3009 C CA  . LEU B 1 32  ? 42.691  22.077  16.535  1.00 25.54 ? 32  LEU B CA  1 
ATOM   3010 C C   . LEU B 1 32  ? 43.667  20.983  16.933  1.00 27.22 ? 32  LEU B C   1 
ATOM   3011 O O   . LEU B 1 32  ? 44.436  20.420  16.125  1.00 28.99 ? 32  LEU B O   1 
ATOM   3012 C CB  . LEU B 1 32  ? 43.379  22.964  15.507  1.00 24.34 ? 32  LEU B CB  1 
ATOM   3013 C CG  . LEU B 1 32  ? 42.397  23.132  14.324  1.00 23.29 ? 32  LEU B CG  1 
ATOM   3014 C CD1 . LEU B 1 32  ? 42.991  24.088  13.326  1.00 19.32 ? 32  LEU B CD1 1 
ATOM   3015 C CD2 . LEU B 1 32  ? 41.806  21.752  13.771  1.00 18.43 ? 32  LEU B CD2 1 
ATOM   3016 N N   . GLN B 1 33  ? 43.712  20.740  18.279  1.00 28.40 ? 33  GLN B N   1 
ATOM   3017 C CA  . GLN B 1 33  ? 44.133  19.351  18.481  1.00 28.29 ? 33  GLN B CA  1 
ATOM   3018 C C   . GLN B 1 33  ? 43.208  18.263  19.097  1.00 26.84 ? 33  GLN B C   1 
ATOM   3019 O O   . GLN B 1 33  ? 43.625  17.076  19.135  1.00 24.81 ? 33  GLN B O   1 
ATOM   3020 C CB  . GLN B 1 33  ? 45.578  19.395  19.044  1.00 28.02 ? 33  GLN B CB  1 
ATOM   3021 C CG  . GLN B 1 33  ? 46.564  20.480  18.458  1.00 24.20 ? 33  GLN B CG  1 
ATOM   3022 C CD  . GLN B 1 33  ? 47.605  19.795  17.531  1.00 26.99 ? 33  GLN B CD  1 
ATOM   3023 O OE1 . GLN B 1 33  ? 48.285  20.335  16.659  1.00 29.34 ? 33  GLN B OE1 1 
ATOM   3024 N NE2 . GLN B 1 33  ? 47.820  18.499  17.802  1.00 25.94 ? 33  GLN B NE2 1 
ATOM   3025 N N   . LYS B 1 34  ? 42.118  18.860  19.773  1.00 27.30 ? 34  LYS B N   1 
ATOM   3026 C CA  . LYS B 1 34  ? 41.039  18.040  20.451  1.00 25.12 ? 34  LYS B CA  1 
ATOM   3027 C C   . LYS B 1 34  ? 39.727  17.847  19.671  1.00 26.45 ? 34  LYS B C   1 
ATOM   3028 O O   . LYS B 1 34  ? 38.961  16.917  19.969  1.00 21.97 ? 34  LYS B O   1 
ATOM   3029 C CB  . LYS B 1 34  ? 40.478  18.414  21.859  1.00 24.09 ? 34  LYS B CB  1 
ATOM   3030 C CG  . LYS B 1 34  ? 41.457  18.532  23.015  1.00 28.77 ? 34  LYS B CG  1 
ATOM   3031 C CD  . LYS B 1 34  ? 42.043  19.929  23.476  1.00 32.10 ? 34  LYS B CD  1 
ATOM   3032 C CE  . LYS B 1 34  ? 41.321  20.674  24.686  1.00 34.82 ? 34  LYS B CE  1 
ATOM   3033 N NZ  . LYS B 1 34  ? 42.138  21.584  25.575  1.00 30.43 ? 34  LYS B NZ  1 
ATOM   3034 N N   . MET B 1 35  ? 39.328  18.866  18.777  1.00 26.35 ? 35  MET B N   1 
ATOM   3035 C CA  . MET B 1 35  ? 38.016  18.346  18.251  1.00 27.72 ? 35  MET B CA  1 
ATOM   3036 C C   . MET B 1 35  ? 37.866  18.314  16.762  1.00 25.28 ? 35  MET B C   1 
ATOM   3037 O O   . MET B 1 35  ? 37.203  19.042  16.047  1.00 25.87 ? 35  MET B O   1 
ATOM   3038 C CB  . MET B 1 35  ? 36.689  18.431  19.179  1.00 30.06 ? 35  MET B CB  1 
ATOM   3039 C CG  . MET B 1 35  ? 35.230  17.943  18.895  1.00 28.92 ? 35  MET B CG  1 
ATOM   3040 S SD  . MET B 1 35  ? 34.042  19.403  18.877  1.00 38.27 ? 35  MET B SD  1 
ATOM   3041 C CE  . MET B 1 35  ? 34.740  20.467  17.583  1.00 18.30 ? 35  MET B CE  1 
ATOM   3042 N N   . PRO B 1 36  ? 38.324  17.098  16.418  1.00 22.31 ? 36  PRO B N   1 
ATOM   3043 C CA  . PRO B 1 36  ? 38.932  16.988  15.130  1.00 22.03 ? 36  PRO B CA  1 
ATOM   3044 C C   . PRO B 1 36  ? 37.856  16.984  14.083  1.00 20.74 ? 36  PRO B C   1 
ATOM   3045 O O   . PRO B 1 36  ? 36.855  16.302  14.340  1.00 22.80 ? 36  PRO B O   1 
ATOM   3046 C CB  . PRO B 1 36  ? 39.551  15.602  15.328  1.00 24.17 ? 36  PRO B CB  1 
ATOM   3047 C CG  . PRO B 1 36  ? 38.605  14.786  16.189  1.00 20.48 ? 36  PRO B CG  1 
ATOM   3048 C CD  . PRO B 1 36  ? 38.315  15.850  17.216  1.00 22.81 ? 36  PRO B CD  1 
ATOM   3049 N N   . LEU B 1 37  ? 38.207  17.565  12.856  1.00 21.99 ? 37  LEU B N   1 
ATOM   3050 C CA  . LEU B 1 37  ? 37.359  17.273  11.673  1.00 20.25 ? 37  LEU B CA  1 
ATOM   3051 C C   . LEU B 1 37  ? 36.591  15.946  11.783  1.00 16.76 ? 37  LEU B C   1 
ATOM   3052 O O   . LEU B 1 37  ? 35.389  15.933  11.954  1.00 10.72 ? 37  LEU B O   1 
ATOM   3053 C CB  . LEU B 1 37  ? 38.085  17.418  10.323  1.00 21.04 ? 37  LEU B CB  1 
ATOM   3054 C CG  . LEU B 1 37  ? 37.995  18.664  9.362   1.00 24.05 ? 37  LEU B CG  1 
ATOM   3055 C CD1 . LEU B 1 37  ? 38.513  18.328  7.980   1.00 26.77 ? 37  LEU B CD1 1 
ATOM   3056 C CD2 . LEU B 1 37  ? 36.630  19.244  9.031   1.00 27.54 ? 37  LEU B CD2 1 
ATOM   3057 N N   . GLY B 1 38  ? 37.291  14.808  11.809  1.00 12.06 ? 38  GLY B N   1 
ATOM   3058 C CA  . GLY B 1 38  ? 36.439  13.667  11.920  1.00 9.13  ? 38  GLY B CA  1 
ATOM   3059 C C   . GLY B 1 38  ? 35.422  13.500  12.989  1.00 8.56  ? 38  GLY B C   1 
ATOM   3060 O O   . GLY B 1 38  ? 34.325  12.888  12.908  1.00 9.81  ? 38  GLY B O   1 
ATOM   3061 N N   . LYS B 1 39  ? 35.852  14.118  14.091  1.00 15.31 ? 39  LYS B N   1 
ATOM   3062 C CA  . LYS B 1 39  ? 34.884  13.989  15.196  1.00 18.09 ? 39  LYS B CA  1 
ATOM   3063 C C   . LYS B 1 39  ? 33.619  14.808  15.237  1.00 18.05 ? 39  LYS B C   1 
ATOM   3064 O O   . LYS B 1 39  ? 32.665  14.230  15.694  1.00 20.53 ? 39  LYS B O   1 
ATOM   3065 C CB  . LYS B 1 39  ? 35.398  13.842  16.680  1.00 16.18 ? 39  LYS B CB  1 
ATOM   3066 C CG  . LYS B 1 39  ? 36.230  12.627  17.207  1.00 18.12 ? 39  LYS B CG  1 
ATOM   3067 C CD  . LYS B 1 39  ? 35.994  12.326  18.766  1.00 15.91 ? 39  LYS B CD  1 
ATOM   3068 C CE  . LYS B 1 39  ? 37.039  11.443  19.515  1.00 16.01 ? 39  LYS B CE  1 
ATOM   3069 N NZ  . LYS B 1 39  ? 37.817  12.297  20.437  1.00 9.82  ? 39  LYS B NZ  1 
ATOM   3070 N N   . LEU B 1 40  ? 33.634  16.042  14.770  1.00 18.76 ? 40  LEU B N   1 
ATOM   3071 C CA  . LEU B 1 40  ? 32.402  16.834  14.579  1.00 16.45 ? 40  LEU B CA  1 
ATOM   3072 C C   . LEU B 1 40  ? 31.051  16.144  14.570  1.00 12.14 ? 40  LEU B C   1 
ATOM   3073 O O   . LEU B 1 40  ? 30.754  15.165  13.971  1.00 9.46  ? 40  LEU B O   1 
ATOM   3074 C CB  . LEU B 1 40  ? 32.478  17.621  13.272  1.00 18.85 ? 40  LEU B CB  1 
ATOM   3075 C CG  . LEU B 1 40  ? 33.241  18.893  13.429  1.00 16.58 ? 40  LEU B CG  1 
ATOM   3076 C CD1 . LEU B 1 40  ? 32.825  19.897  12.317  1.00 20.31 ? 40  LEU B CD1 1 
ATOM   3077 C CD2 . LEU B 1 40  ? 32.976  19.414  14.849  1.00 17.56 ? 40  LEU B CD2 1 
ATOM   3078 N N   . SER B 1 41  ? 30.190  16.808  15.181  1.00 11.13 ? 41  SER B N   1 
ATOM   3079 C CA  . SER B 1 41  ? 28.910  16.118  15.076  1.00 12.52 ? 41  SER B CA  1 
ATOM   3080 C C   . SER B 1 41  ? 27.628  17.032  14.826  1.00 15.75 ? 41  SER B C   1 
ATOM   3081 O O   . SER B 1 41  ? 27.497  18.229  15.172  1.00 16.36 ? 41  SER B O   1 
ATOM   3082 C CB  . SER B 1 41  ? 28.865  15.390  16.396  1.00 15.03 ? 41  SER B CB  1 
ATOM   3083 O OG  . SER B 1 41  ? 27.546  15.035  16.952  1.00 15.08 ? 41  SER B OG  1 
ATOM   3084 N N   . LYS B 1 42  ? 26.623  16.356  14.270  1.00 16.05 ? 42  LYS B N   1 
ATOM   3085 C CA  . LYS B 1 42  ? 25.327  17.009  14.292  1.00 17.31 ? 42  LYS B CA  1 
ATOM   3086 C C   . LYS B 1 42  ? 24.840  17.337  15.677  1.00 16.36 ? 42  LYS B C   1 
ATOM   3087 O O   . LYS B 1 42  ? 24.593  18.418  16.114  1.00 15.57 ? 42  LYS B O   1 
ATOM   3088 C CB  . LYS B 1 42  ? 24.342  16.248  13.326  1.00 22.03 ? 42  LYS B CB  1 
ATOM   3089 C CG  . LYS B 1 42  ? 24.873  14.916  12.614  1.00 23.72 ? 42  LYS B CG  1 
ATOM   3090 C CD  . LYS B 1 42  ? 24.020  13.631  12.785  1.00 27.33 ? 42  LYS B CD  1 
ATOM   3091 C CE  . LYS B 1 42  ? 24.558  12.437  12.005  1.00 27.91 ? 42  LYS B CE  1 
ATOM   3092 N NZ  . LYS B 1 42  ? 23.473  11.629  11.444  1.00 29.67 ? 42  LYS B NZ  1 
ATOM   3093 N N   . ARG B 1 43  ? 24.914  16.322  16.484  1.00 17.86 ? 43  ARG B N   1 
ATOM   3094 C CA  . ARG B 1 43  ? 24.447  16.466  17.865  1.00 17.08 ? 43  ARG B CA  1 
ATOM   3095 C C   . ARG B 1 43  ? 25.325  17.415  18.778  1.00 15.58 ? 43  ARG B C   1 
ATOM   3096 O O   . ARG B 1 43  ? 24.895  18.349  19.471  1.00 8.66  ? 43  ARG B O   1 
ATOM   3097 C CB  . ARG B 1 43  ? 24.314  15.070  18.490  1.00 20.28 ? 43  ARG B CB  1 
ATOM   3098 C CG  . ARG B 1 43  ? 23.517  13.846  17.967  1.00 25.05 ? 43  ARG B CG  1 
ATOM   3099 C CD  . ARG B 1 43  ? 23.710  13.286  16.511  1.00 27.53 ? 43  ARG B CD  1 
ATOM   3100 N NE  . ARG B 1 43  ? 25.082  13.529  15.986  1.00 29.79 ? 43  ARG B NE  1 
ATOM   3101 C CZ  . ARG B 1 43  ? 25.729  12.726  15.134  1.00 29.55 ? 43  ARG B CZ  1 
ATOM   3102 N NH1 . ARG B 1 43  ? 25.039  11.587  14.881  1.00 29.76 ? 43  ARG B NH1 1 
ATOM   3103 N NH2 . ARG B 1 43  ? 26.960  13.037  14.610  1.00 19.78 ? 43  ARG B NH2 1 
ATOM   3104 N N   . GLN B 1 44  ? 26.670  17.172  18.617  1.00 11.72 ? 44  GLN B N   1 
ATOM   3105 C CA  . GLN B 1 44  ? 27.433  17.933  19.575  1.00 12.00 ? 44  GLN B CA  1 
ATOM   3106 C C   . GLN B 1 44  ? 27.462  19.417  19.481  1.00 13.47 ? 44  GLN B C   1 
ATOM   3107 O O   . GLN B 1 44  ? 27.796  20.082  20.460  1.00 16.67 ? 44  GLN B O   1 
ATOM   3108 C CB  . GLN B 1 44  ? 28.820  17.403  19.732  1.00 16.07 ? 44  GLN B CB  1 
ATOM   3109 C CG  . GLN B 1 44  ? 29.819  18.132  18.826  1.00 11.52 ? 44  GLN B CG  1 
ATOM   3110 C CD  . GLN B 1 44  ? 31.190  17.617  19.196  1.00 8.98  ? 44  GLN B CD  1 
ATOM   3111 O OE1 . GLN B 1 44  ? 31.893  16.987  18.387  1.00 8.68  ? 44  GLN B OE1 1 
ATOM   3112 N NE2 . GLN B 1 44  ? 31.501  17.871  20.520  1.00 13.45 ? 44  GLN B NE2 1 
ATOM   3113 N N   . ILE B 1 45  ? 27.004  19.837  18.236  1.00 14.82 ? 45  ILE B N   1 
ATOM   3114 C CA  . ILE B 1 45  ? 26.396  21.170  17.882  1.00 13.56 ? 45  ILE B CA  1 
ATOM   3115 C C   . ILE B 1 45  ? 25.011  21.540  18.422  1.00 17.47 ? 45  ILE B C   1 
ATOM   3116 O O   . ILE B 1 45  ? 24.790  22.663  18.759  1.00 24.08 ? 45  ILE B O   1 
ATOM   3117 C CB  . ILE B 1 45  ? 26.508  21.483  16.372  1.00 10.52 ? 45  ILE B CB  1 
ATOM   3118 C CG1 . ILE B 1 45  ? 27.918  21.161  15.903  1.00 7.66  ? 45  ILE B CG1 1 
ATOM   3119 C CG2 . ILE B 1 45  ? 26.280  22.954  16.209  1.00 11.08 ? 45  ILE B CG2 1 
ATOM   3120 C CD1 . ILE B 1 45  ? 28.280  21.880  14.622  1.00 8.92  ? 45  ILE B CD1 1 
ATOM   3121 N N   . GLN B 1 46  ? 24.107  20.621  18.592  1.00 18.70 ? 46  GLN B N   1 
ATOM   3122 C CA  . GLN B 1 46  ? 22.846  20.927  19.306  1.00 21.83 ? 46  GLN B CA  1 
ATOM   3123 C C   . GLN B 1 46  ? 22.674  21.117  20.927  1.00 20.62 ? 46  GLN B C   1 
ATOM   3124 O O   . GLN B 1 46  ? 22.119  22.026  21.569  1.00 24.54 ? 46  GLN B O   1 
ATOM   3125 C CB  . GLN B 1 46  ? 21.918  19.914  18.645  1.00 26.34 ? 46  GLN B CB  1 
ATOM   3126 C CG  . GLN B 1 46  ? 21.538  20.414  17.235  1.00 22.19 ? 46  GLN B CG  1 
ATOM   3127 C CD  . GLN B 1 46  ? 20.959  19.209  16.477  1.00 25.57 ? 46  GLN B CD  1 
ATOM   3128 O OE1 . GLN B 1 46  ? 21.557  18.125  16.365  1.00 28.80 ? 46  GLN B OE1 1 
ATOM   3129 N NE2 . GLN B 1 46  ? 19.784  19.501  15.932  1.00 24.59 ? 46  GLN B NE2 1 
ATOM   3130 N N   . ALA B 1 47  ? 23.459  20.263  21.564  1.00 16.90 ? 47  ALA B N   1 
ATOM   3131 C CA  . ALA B 1 47  ? 24.051  20.498  22.841  1.00 12.03 ? 47  ALA B CA  1 
ATOM   3132 C C   . ALA B 1 47  ? 24.697  21.849  22.693  1.00 11.29 ? 47  ALA B C   1 
ATOM   3133 O O   . ALA B 1 47  ? 24.170  22.850  23.134  1.00 13.35 ? 47  ALA B O   1 
ATOM   3134 C CB  . ALA B 1 47  ? 25.048  19.355  23.018  1.00 12.62 ? 47  ALA B CB  1 
ATOM   3135 N N   . ALA B 1 48  ? 25.790  21.950  21.963  1.00 6.12  ? 48  ALA B N   1 
ATOM   3136 C CA  . ALA B 1 48  ? 26.292  23.314  22.046  1.00 5.19  ? 48  ALA B CA  1 
ATOM   3137 C C   . ALA B 1 48  ? 25.408  24.515  21.694  1.00 8.08  ? 48  ALA B C   1 
ATOM   3138 O O   . ALA B 1 48  ? 25.673  25.635  22.071  1.00 15.65 ? 48  ALA B O   1 
ATOM   3139 C CB  . ALA B 1 48  ? 27.580  23.438  21.324  1.00 2.71  ? 48  ALA B CB  1 
ATOM   3140 N N   . TYR B 1 49  ? 24.292  24.292  20.981  1.00 5.73  ? 49  TYR B N   1 
ATOM   3141 C CA  . TYR B 1 49  ? 23.447  25.462  20.787  1.00 8.03  ? 49  TYR B CA  1 
ATOM   3142 C C   . TYR B 1 49  ? 22.647  25.792  22.041  1.00 7.10  ? 49  TYR B C   1 
ATOM   3143 O O   . TYR B 1 49  ? 22.341  26.912  22.436  1.00 11.07 ? 49  TYR B O   1 
ATOM   3144 C CB  . TYR B 1 49  ? 22.533  25.299  19.556  1.00 11.43 ? 49  TYR B CB  1 
ATOM   3145 C CG  . TYR B 1 49  ? 23.121  25.753  18.210  1.00 14.26 ? 49  TYR B CG  1 
ATOM   3146 C CD1 . TYR B 1 49  ? 23.654  27.029  17.910  1.00 10.78 ? 49  TYR B CD1 1 
ATOM   3147 C CD2 . TYR B 1 49  ? 23.105  24.807  17.222  1.00 18.39 ? 49  TYR B CD2 1 
ATOM   3148 C CE1 . TYR B 1 49  ? 23.920  27.394  16.581  1.00 11.87 ? 49  TYR B CE1 1 
ATOM   3149 C CE2 . TYR B 1 49  ? 23.532  25.109  15.915  1.00 19.34 ? 49  TYR B CE2 1 
ATOM   3150 C CZ  . TYR B 1 49  ? 23.767  26.442  15.584  1.00 18.45 ? 49  TYR B CZ  1 
ATOM   3151 O OH  . TYR B 1 49  ? 23.777  26.814  14.222  1.00 15.04 ? 49  TYR B OH  1 
ATOM   3152 N N   . SER B 1 50  ? 22.316  24.709  22.700  1.00 7.98  ? 50  SER B N   1 
ATOM   3153 C CA  . SER B 1 50  ? 21.277  24.983  23.712  1.00 10.04 ? 50  SER B CA  1 
ATOM   3154 C C   . SER B 1 50  ? 21.761  25.362  25.061  1.00 12.35 ? 50  SER B C   1 
ATOM   3155 O O   . SER B 1 50  ? 21.123  26.132  25.750  1.00 8.85  ? 50  SER B O   1 
ATOM   3156 C CB  . SER B 1 50  ? 20.255  23.901  23.967  1.00 7.29  ? 50  SER B CB  1 
ATOM   3157 O OG  . SER B 1 50  ? 21.117  22.927  24.385  1.00 3.90  ? 50  SER B OG  1 
ATOM   3158 N N   . ILE B 1 51  ? 22.982  24.932  25.367  1.00 15.98 ? 51  ILE B N   1 
ATOM   3159 C CA  . ILE B 1 51  ? 23.756  25.868  26.180  1.00 10.95 ? 51  ILE B CA  1 
ATOM   3160 C C   . ILE B 1 51  ? 23.988  27.317  25.719  1.00 7.76  ? 51  ILE B C   1 
ATOM   3161 O O   . ILE B 1 51  ? 23.721  28.158  26.525  1.00 5.18  ? 51  ILE B O   1 
ATOM   3162 C CB  . ILE B 1 51  ? 25.105  25.313  26.567  1.00 5.38  ? 51  ILE B CB  1 
ATOM   3163 C CG1 . ILE B 1 51  ? 24.976  23.990  27.289  1.00 8.99  ? 51  ILE B CG1 1 
ATOM   3164 C CG2 . ILE B 1 51  ? 25.868  26.381  27.371  1.00 5.58  ? 51  ILE B CG2 1 
ATOM   3165 C CD1 . ILE B 1 51  ? 26.435  23.638  27.218  1.00 15.53 ? 51  ILE B CD1 1 
ATOM   3166 N N   . LEU B 1 52  ? 24.437  27.696  24.548  1.00 7.31  ? 52  LEU B N   1 
ATOM   3167 C CA  . LEU B 1 52  ? 24.336  29.174  24.337  1.00 3.49  ? 52  LEU B CA  1 
ATOM   3168 C C   . LEU B 1 52  ? 22.985  29.782  24.630  1.00 3.00  ? 52  LEU B C   1 
ATOM   3169 O O   . LEU B 1 52  ? 22.811  30.953  24.918  1.00 2.00  ? 52  LEU B O   1 
ATOM   3170 C CB  . LEU B 1 52  ? 24.687  29.607  22.884  1.00 5.78  ? 52  LEU B CB  1 
ATOM   3171 C CG  . LEU B 1 52  ? 26.079  29.103  22.572  1.00 4.91  ? 52  LEU B CG  1 
ATOM   3172 C CD1 . LEU B 1 52  ? 26.501  28.998  21.112  1.00 3.73  ? 52  LEU B CD1 1 
ATOM   3173 C CD2 . LEU B 1 52  ? 26.972  29.818  23.603  1.00 8.75  ? 52  LEU B CD2 1 
ATOM   3174 N N   . SER B 1 53  ? 22.018  28.879  24.545  1.00 5.31  ? 53  SER B N   1 
ATOM   3175 C CA  . SER B 1 53  ? 20.643  29.294  24.730  1.00 10.58 ? 53  SER B CA  1 
ATOM   3176 C C   . SER B 1 53  ? 20.165  29.553  26.156  1.00 12.91 ? 53  SER B C   1 
ATOM   3177 O O   . SER B 1 53  ? 19.834  30.623  26.680  1.00 16.07 ? 53  SER B O   1 
ATOM   3178 C CB  . SER B 1 53  ? 19.792  28.280  24.055  1.00 12.49 ? 53  SER B CB  1 
ATOM   3179 O OG  . SER B 1 53  ? 18.774  28.975  23.427  1.00 17.83 ? 53  SER B OG  1 
ATOM   3180 N N   . GLU B 1 54  ? 20.402  28.486  26.865  1.00 14.66 ? 54  GLU B N   1 
ATOM   3181 C CA  . GLU B 1 54  ? 20.655  28.724  28.296  1.00 17.29 ? 54  GLU B CA  1 
ATOM   3182 C C   . GLU B 1 54  ? 21.492  29.862  28.858  1.00 14.54 ? 54  GLU B C   1 
ATOM   3183 O O   . GLU B 1 54  ? 20.981  30.666  29.590  1.00 17.26 ? 54  GLU B O   1 
ATOM   3184 C CB  . GLU B 1 54  ? 20.978  27.427  28.926  1.00 22.78 ? 54  GLU B CB  1 
ATOM   3185 C CG  . GLU B 1 54  ? 19.527  27.074  28.784  1.00 26.53 ? 54  GLU B CG  1 
ATOM   3186 C CD  . GLU B 1 54  ? 19.293  25.670  29.104  1.00 32.96 ? 54  GLU B CD  1 
ATOM   3187 O OE1 . GLU B 1 54  ? 19.876  25.144  30.093  1.00 31.96 ? 54  GLU B OE1 1 
ATOM   3188 O OE2 . GLU B 1 54  ? 18.490  25.148  28.308  1.00 38.19 ? 54  GLU B OE2 1 
ATOM   3189 N N   . VAL B 1 55  ? 22.717  29.998  28.453  1.00 11.51 ? 55  VAL B N   1 
ATOM   3190 C CA  . VAL B 1 55  ? 23.263  31.321  28.500  1.00 9.80  ? 55  VAL B CA  1 
ATOM   3191 C C   . VAL B 1 55  ? 22.340  32.468  28.272  1.00 12.46 ? 55  VAL B C   1 
ATOM   3192 O O   . VAL B 1 55  ? 22.269  33.358  29.093  1.00 18.48 ? 55  VAL B O   1 
ATOM   3193 C CB  . VAL B 1 55  ? 24.444  31.428  27.589  1.00 11.05 ? 55  VAL B CB  1 
ATOM   3194 C CG1 . VAL B 1 55  ? 25.041  32.834  27.479  1.00 5.70  ? 55  VAL B CG1 1 
ATOM   3195 C CG2 . VAL B 1 55  ? 25.470  30.420  28.067  1.00 14.36 ? 55  VAL B CG2 1 
ATOM   3196 N N   . GLN B 1 56  ? 21.570  32.480  27.197  1.00 12.34 ? 56  GLN B N   1 
ATOM   3197 C CA  . GLN B 1 56  ? 20.956  33.779  27.291  1.00 13.80 ? 56  GLN B CA  1 
ATOM   3198 C C   . GLN B 1 56  ? 19.695  33.931  28.114  1.00 14.56 ? 56  GLN B C   1 
ATOM   3199 O O   . GLN B 1 56  ? 19.310  35.023  28.542  1.00 14.54 ? 56  GLN B O   1 
ATOM   3200 C CB  . GLN B 1 56  ? 21.288  34.717  26.086  1.00 18.07 ? 56  GLN B CB  1 
ATOM   3201 C CG  . GLN B 1 56  ? 22.577  35.494  26.561  1.00 23.79 ? 56  GLN B CG  1 
ATOM   3202 C CD  . GLN B 1 56  ? 23.074  36.742  25.807  1.00 27.33 ? 56  GLN B CD  1 
ATOM   3203 O OE1 . GLN B 1 56  ? 23.141  36.803  24.606  1.00 30.84 ? 56  GLN B OE1 1 
ATOM   3204 N NE2 . GLN B 1 56  ? 23.356  37.749  26.557  1.00 25.28 ? 56  GLN B NE2 1 
ATOM   3205 N N   . GLN B 1 57  ? 19.070  32.742  28.371  1.00 15.19 ? 57  GLN B N   1 
ATOM   3206 C CA  . GLN B 1 57  ? 17.832  32.717  29.263  1.00 17.18 ? 57  GLN B CA  1 
ATOM   3207 C C   . GLN B 1 57  ? 18.080  32.878  30.782  1.00 11.70 ? 57  GLN B C   1 
ATOM   3208 O O   . GLN B 1 57  ? 17.638  33.815  31.430  1.00 14.08 ? 57  GLN B O   1 
ATOM   3209 C CB  . GLN B 1 57  ? 16.667  31.759  28.818  1.00 17.67 ? 57  GLN B CB  1 
ATOM   3210 C CG  . GLN B 1 57  ? 16.475  30.549  29.787  1.00 27.31 ? 57  GLN B CG  1 
ATOM   3211 C CD  . GLN B 1 57  ? 14.986  30.254  30.058  1.00 34.18 ? 57  GLN B CD  1 
ATOM   3212 O OE1 . GLN B 1 57  ? 14.569  30.011  31.189  1.00 38.79 ? 57  GLN B OE1 1 
ATOM   3213 N NE2 . GLN B 1 57  ? 14.150  30.371  29.034  1.00 39.00 ? 57  GLN B NE2 1 
ATOM   3214 N N   . ALA B 1 58  ? 19.100  32.144  31.153  1.00 8.64  ? 58  ALA B N   1 
ATOM   3215 C CA  . ALA B 1 58  ? 19.834  32.688  32.308  1.00 3.03  ? 58  ALA B CA  1 
ATOM   3216 C C   . ALA B 1 58  ? 20.177  34.110  32.245  1.00 2.00  ? 58  ALA B C   1 
ATOM   3217 O O   . ALA B 1 58  ? 19.811  34.886  33.043  1.00 2.00  ? 58  ALA B O   1 
ATOM   3218 C CB  . ALA B 1 58  ? 21.178  32.089  32.511  1.00 5.59  ? 58  ALA B CB  1 
ATOM   3219 N N   . VAL B 1 59  ? 20.877  34.484  31.239  1.00 4.40  ? 59  VAL B N   1 
ATOM   3220 C CA  . VAL B 1 59  ? 21.288  35.888  31.393  1.00 4.75  ? 59  VAL B CA  1 
ATOM   3221 C C   . VAL B 1 59  ? 20.191  36.873  31.568  1.00 4.70  ? 59  VAL B C   1 
ATOM   3222 O O   . VAL B 1 59  ? 20.489  37.831  32.190  1.00 8.89  ? 59  VAL B O   1 
ATOM   3223 C CB  . VAL B 1 59  ? 22.274  36.367  30.343  1.00 3.11  ? 59  VAL B CB  1 
ATOM   3224 C CG1 . VAL B 1 59  ? 22.480  37.826  30.336  1.00 3.54  ? 59  VAL B CG1 1 
ATOM   3225 C CG2 . VAL B 1 59  ? 23.604  35.656  30.307  1.00 4.52  ? 59  VAL B CG2 1 
ATOM   3226 N N   . SER B 1 60  ? 18.958  36.651  31.121  1.00 4.18  ? 60  SER B N   1 
ATOM   3227 C CA  . SER B 1 60  ? 17.957  37.774  31.222  1.00 5.13  ? 60  SER B CA  1 
ATOM   3228 C C   . SER B 1 60  ? 16.814  37.629  32.237  1.00 4.54  ? 60  SER B C   1 
ATOM   3229 O O   . SER B 1 60  ? 16.056  38.517  32.544  1.00 6.16  ? 60  SER B O   1 
ATOM   3230 C CB  . SER B 1 60  ? 17.390  38.241  29.841  1.00 2.00  ? 60  SER B CB  1 
ATOM   3231 O OG  . SER B 1 60  ? 17.210  37.121  28.913  1.00 4.47  ? 60  SER B OG  1 
ATOM   3232 N N   . GLN B 1 61  ? 16.746  36.453  32.757  1.00 2.86  ? 61  GLN B N   1 
ATOM   3233 C CA  . GLN B 1 61  ? 15.999  36.348  34.021  1.00 4.92  ? 61  GLN B CA  1 
ATOM   3234 C C   . GLN B 1 61  ? 16.735  36.510  35.436  1.00 7.20  ? 61  GLN B C   1 
ATOM   3235 O O   . GLN B 1 61  ? 16.302  36.074  36.495  1.00 11.27 ? 61  GLN B O   1 
ATOM   3236 C CB  . GLN B 1 61  ? 15.652  35.019  33.620  1.00 2.44  ? 61  GLN B CB  1 
ATOM   3237 C CG  . GLN B 1 61  ? 14.418  34.231  33.923  1.00 3.16  ? 61  GLN B CG  1 
ATOM   3238 C CD  . GLN B 1 61  ? 14.367  33.769  32.554  1.00 2.00  ? 61  GLN B CD  1 
ATOM   3239 O OE1 . GLN B 1 61  ? 14.455  32.622  32.222  1.00 2.00  ? 61  GLN B OE1 1 
ATOM   3240 N NE2 . GLN B 1 61  ? 14.163  34.779  31.710  1.00 2.00  ? 61  GLN B NE2 1 
ATOM   3241 N N   . GLY B 1 62  ? 17.870  37.264  35.354  1.00 6.37  ? 62  GLY B N   1 
ATOM   3242 C CA  . GLY B 1 62  ? 18.836  37.315  36.399  1.00 2.14  ? 62  GLY B CA  1 
ATOM   3243 C C   . GLY B 1 62  ? 19.115  35.980  37.045  1.00 5.43  ? 62  GLY B C   1 
ATOM   3244 O O   . GLY B 1 62  ? 19.359  35.885  38.242  1.00 11.77 ? 62  GLY B O   1 
ATOM   3245 N N   . SER B 1 63  ? 19.191  34.908  36.266  1.00 2.00  ? 63  SER B N   1 
ATOM   3246 C CA  . SER B 1 63  ? 19.673  33.735  37.000  1.00 5.33  ? 63  SER B CA  1 
ATOM   3247 C C   . SER B 1 63  ? 21.029  33.938  37.693  1.00 6.86  ? 63  SER B C   1 
ATOM   3248 O O   . SER B 1 63  ? 21.737  34.921  37.491  1.00 2.34  ? 63  SER B O   1 
ATOM   3249 C CB  . SER B 1 63  ? 19.547  32.622  35.968  1.00 5.25  ? 63  SER B CB  1 
ATOM   3250 O OG  . SER B 1 63  ? 20.683  31.786  35.786  1.00 20.16 ? 63  SER B OG  1 
ATOM   3251 N N   . SER B 1 64  ? 21.534  33.070  38.531  1.00 10.23 ? 64  SER B N   1 
ATOM   3252 C CA  . SER B 1 64  ? 22.747  33.586  39.196  1.00 10.70 ? 64  SER B CA  1 
ATOM   3253 C C   . SER B 1 64  ? 24.017  33.659  38.480  1.00 11.74 ? 64  SER B C   1 
ATOM   3254 O O   . SER B 1 64  ? 24.528  32.847  37.717  1.00 13.17 ? 64  SER B O   1 
ATOM   3255 C CB  . SER B 1 64  ? 23.147  33.021  40.522  1.00 9.07  ? 64  SER B CB  1 
ATOM   3256 O OG  . SER B 1 64  ? 23.231  31.603  40.421  1.00 13.30 ? 64  SER B OG  1 
ATOM   3257 N N   . ASP B 1 65  ? 24.627  34.807  38.771  1.00 16.70 ? 65  ASP B N   1 
ATOM   3258 C CA  . ASP B 1 65  ? 26.018  35.119  38.368  1.00 17.82 ? 65  ASP B CA  1 
ATOM   3259 C C   . ASP B 1 65  ? 26.980  33.893  38.235  1.00 15.41 ? 65  ASP B C   1 
ATOM   3260 O O   . ASP B 1 65  ? 27.627  33.636  37.265  1.00 17.58 ? 65  ASP B O   1 
ATOM   3261 C CB  . ASP B 1 65  ? 26.537  36.216  39.317  1.00 24.82 ? 65  ASP B CB  1 
ATOM   3262 C CG  . ASP B 1 65  ? 26.947  35.521  40.680  1.00 31.31 ? 65  ASP B CG  1 
ATOM   3263 O OD1 . ASP B 1 65  ? 26.144  34.734  41.245  1.00 36.43 ? 65  ASP B OD1 1 
ATOM   3264 O OD2 . ASP B 1 65  ? 28.083  35.724  41.147  1.00 32.04 ? 65  ASP B OD2 1 
ATOM   3265 N N   . SER B 1 66  ? 26.910  33.038  39.209  1.00 10.68 ? 66  SER B N   1 
ATOM   3266 C CA  . SER B 1 66  ? 27.230  31.638  39.236  1.00 5.50  ? 66  SER B CA  1 
ATOM   3267 C C   . SER B 1 66  ? 26.755  30.901  38.074  1.00 3.37  ? 66  SER B C   1 
ATOM   3268 O O   . SER B 1 66  ? 27.570  30.571  37.235  1.00 6.23  ? 66  SER B O   1 
ATOM   3269 C CB  . SER B 1 66  ? 26.655  31.025  40.524  1.00 4.62  ? 66  SER B CB  1 
ATOM   3270 O OG  . SER B 1 66  ? 26.246  32.129  41.383  1.00 4.98  ? 66  SER B OG  1 
ATOM   3271 N N   . GLN B 1 67  ? 25.466  30.594  38.005  1.00 2.02  ? 67  GLN B N   1 
ATOM   3272 C CA  . GLN B 1 67  ? 25.110  29.759  36.839  1.00 5.85  ? 67  GLN B CA  1 
ATOM   3273 C C   . GLN B 1 67  ? 25.666  30.165  35.443  1.00 6.34  ? 67  GLN B C   1 
ATOM   3274 O O   . GLN B 1 67  ? 26.366  29.383  34.803  1.00 2.00  ? 67  GLN B O   1 
ATOM   3275 C CB  . GLN B 1 67  ? 23.652  29.324  36.731  1.00 9.68  ? 67  GLN B CB  1 
ATOM   3276 C CG  . GLN B 1 67  ? 23.311  28.346  35.537  1.00 21.65 ? 67  GLN B CG  1 
ATOM   3277 C CD  . GLN B 1 67  ? 23.892  26.861  35.385  1.00 22.90 ? 67  GLN B CD  1 
ATOM   3278 O OE1 . GLN B 1 67  ? 23.353  25.804  35.721  1.00 21.07 ? 67  GLN B OE1 1 
ATOM   3279 N NE2 . GLN B 1 67  ? 25.035  26.768  34.710  1.00 28.46 ? 67  GLN B NE2 1 
ATOM   3280 N N   . ILE B 1 68  ? 25.420  31.484  35.128  1.00 9.88  ? 68  ILE B N   1 
ATOM   3281 C CA  . ILE B 1 68  ? 26.245  32.073  34.053  1.00 6.08  ? 68  ILE B CA  1 
ATOM   3282 C C   . ILE B 1 68  ? 27.637  31.476  33.858  1.00 4.64  ? 68  ILE B C   1 
ATOM   3283 O O   . ILE B 1 68  ? 27.779  30.721  32.912  1.00 2.00  ? 68  ILE B O   1 
ATOM   3284 C CB  . ILE B 1 68  ? 26.187  33.609  33.831  1.00 2.00  ? 68  ILE B CB  1 
ATOM   3285 C CG1 . ILE B 1 68  ? 24.828  34.056  33.409  1.00 2.00  ? 68  ILE B CG1 1 
ATOM   3286 C CG2 . ILE B 1 68  ? 26.833  33.990  32.518  1.00 4.28  ? 68  ILE B CG2 1 
ATOM   3287 C CD1 . ILE B 1 68  ? 23.861  34.664  34.420  1.00 9.44  ? 68  ILE B CD1 1 
ATOM   3288 N N   . LEU B 1 69  ? 28.517  31.713  34.797  1.00 4.18  ? 69  LEU B N   1 
ATOM   3289 C CA  . LEU B 1 69  ? 29.901  31.299  34.742  1.00 5.00  ? 69  LEU B CA  1 
ATOM   3290 C C   . LEU B 1 69  ? 30.057  29.818  34.494  1.00 9.69  ? 69  LEU B C   1 
ATOM   3291 O O   . LEU B 1 69  ? 30.930  29.238  33.867  1.00 10.37 ? 69  LEU B O   1 
ATOM   3292 C CB  . LEU B 1 69  ? 30.288  31.748  36.086  1.00 2.86  ? 69  LEU B CB  1 
ATOM   3293 C CG  . LEU B 1 69  ? 31.531  31.265  36.699  1.00 2.00  ? 69  LEU B CG  1 
ATOM   3294 C CD1 . LEU B 1 69  ? 31.390  29.941  37.580  1.00 2.10  ? 69  LEU B CD1 1 
ATOM   3295 C CD2 . LEU B 1 69  ? 32.480  31.446  35.568  1.00 2.00  ? 69  LEU B CD2 1 
ATOM   3296 N N   . ASP B 1 70  ? 29.092  29.076  35.004  1.00 14.20 ? 70  ASP B N   1 
ATOM   3297 C CA  . ASP B 1 70  ? 29.350  27.630  34.635  1.00 20.40 ? 70  ASP B CA  1 
ATOM   3298 C C   . ASP B 1 70  ? 28.802  27.257  33.342  1.00 18.94 ? 70  ASP B C   1 
ATOM   3299 O O   . ASP B 1 70  ? 29.440  26.557  32.649  1.00 19.25 ? 70  ASP B O   1 
ATOM   3300 C CB  . ASP B 1 70  ? 29.255  26.401  35.681  1.00 24.93 ? 70  ASP B CB  1 
ATOM   3301 C CG  . ASP B 1 70  ? 30.735  26.098  36.170  1.00 31.85 ? 70  ASP B CG  1 
ATOM   3302 O OD1 . ASP B 1 70  ? 31.302  25.100  35.676  1.00 40.99 ? 70  ASP B OD1 1 
ATOM   3303 O OD2 . ASP B 1 70  ? 31.322  26.852  36.993  1.00 31.36 ? 70  ASP B OD2 1 
ATOM   3304 N N   . LEU B 1 71  ? 27.652  27.820  32.950  1.00 18.87 ? 71  LEU B N   1 
ATOM   3305 C CA  . LEU B 1 71  ? 27.139  27.521  31.577  1.00 15.97 ? 71  LEU B CA  1 
ATOM   3306 C C   . LEU B 1 71  ? 28.179  27.848  30.482  1.00 13.22 ? 71  LEU B C   1 
ATOM   3307 O O   . LEU B 1 71  ? 28.508  27.037  29.631  1.00 15.89 ? 71  LEU B O   1 
ATOM   3308 C CB  . LEU B 1 71  ? 25.792  28.264  31.310  1.00 10.38 ? 71  LEU B CB  1 
ATOM   3309 C CG  . LEU B 1 71  ? 24.543  27.879  32.114  1.00 7.21  ? 71  LEU B CG  1 
ATOM   3310 C CD1 . LEU B 1 71  ? 23.586  29.052  32.143  1.00 11.09 ? 71  LEU B CD1 1 
ATOM   3311 C CD2 . LEU B 1 71  ? 23.870  26.625  31.643  1.00 2.00  ? 71  LEU B CD2 1 
ATOM   3312 N N   . SER B 1 72  ? 28.758  29.058  30.666  1.00 11.88 ? 72  SER B N   1 
ATOM   3313 C CA  . SER B 1 72  ? 29.943  29.415  29.882  1.00 6.26  ? 72  SER B CA  1 
ATOM   3314 C C   . SER B 1 72  ? 30.991  28.324  29.945  1.00 8.75  ? 72  SER B C   1 
ATOM   3315 O O   . SER B 1 72  ? 31.692  28.019  28.993  1.00 11.27 ? 72  SER B O   1 
ATOM   3316 C CB  . SER B 1 72  ? 30.551  30.797  30.316  1.00 3.59  ? 72  SER B CB  1 
ATOM   3317 O OG  . SER B 1 72  ? 31.894  30.931  29.806  1.00 2.00  ? 72  SER B OG  1 
ATOM   3318 N N   . ASN B 1 73  ? 31.061  27.704  31.133  1.00 10.26 ? 73  ASN B N   1 
ATOM   3319 C CA  . ASN B 1 73  ? 32.042  26.647  31.263  1.00 9.37  ? 73  ASN B CA  1 
ATOM   3320 C C   . ASN B 1 73  ? 31.700  25.464  30.509  1.00 9.38  ? 73  ASN B C   1 
ATOM   3321 O O   . ASN B 1 73  ? 32.498  24.909  29.810  1.00 11.65 ? 73  ASN B O   1 
ATOM   3322 C CB  . ASN B 1 73  ? 32.359  26.295  32.709  1.00 15.32 ? 73  ASN B CB  1 
ATOM   3323 C CG  . ASN B 1 73  ? 33.715  26.885  32.889  1.00 19.24 ? 73  ASN B CG  1 
ATOM   3324 O OD1 . ASN B 1 73  ? 34.703  26.403  32.306  1.00 21.32 ? 73  ASN B OD1 1 
ATOM   3325 N ND2 . ASN B 1 73  ? 33.732  28.035  33.609  1.00 13.95 ? 73  ASN B ND2 1 
ATOM   3326 N N   . ARG B 1 74  ? 30.393  25.268  30.559  1.00 8.70  ? 74  ARG B N   1 
ATOM   3327 C CA  . ARG B 1 74  ? 29.869  23.979  30.234  1.00 4.23  ? 74  ARG B CA  1 
ATOM   3328 C C   . ARG B 1 74  ? 29.592  23.719  28.886  1.00 2.00  ? 74  ARG B C   1 
ATOM   3329 O O   . ARG B 1 74  ? 29.512  22.563  28.613  1.00 2.00  ? 74  ARG B O   1 
ATOM   3330 C CB  . ARG B 1 74  ? 28.663  23.534  30.941  1.00 3.95  ? 74  ARG B CB  1 
ATOM   3331 C CG  . ARG B 1 74  ? 27.319  23.599  30.396  1.00 6.84  ? 74  ARG B CG  1 
ATOM   3332 C CD  . ARG B 1 74  ? 26.847  22.397  31.233  1.00 8.46  ? 74  ARG B CD  1 
ATOM   3333 N NE  . ARG B 1 74  ? 25.405  22.224  31.418  1.00 8.49  ? 74  ARG B NE  1 
ATOM   3334 C CZ  . ARG B 1 74  ? 24.825  23.074  32.270  1.00 16.34 ? 74  ARG B CZ  1 
ATOM   3335 N NH1 . ARG B 1 74  ? 25.454  24.108  32.881  1.00 16.21 ? 74  ARG B NH1 1 
ATOM   3336 N NH2 . ARG B 1 74  ? 23.540  22.815  32.543  1.00 19.38 ? 74  ARG B NH2 1 
ATOM   3337 N N   . PHE B 1 75  ? 29.551  24.818  28.104  1.00 2.00  ? 75  PHE B N   1 
ATOM   3338 C CA  . PHE B 1 75  ? 29.805  25.015  26.660  1.00 4.69  ? 75  PHE B CA  1 
ATOM   3339 C C   . PHE B 1 75  ? 31.179  24.540  26.241  1.00 5.46  ? 75  PHE B C   1 
ATOM   3340 O O   . PHE B 1 75  ? 31.250  23.421  25.825  1.00 2.11  ? 75  PHE B O   1 
ATOM   3341 C CB  . PHE B 1 75  ? 29.840  26.546  26.471  1.00 6.15  ? 75  PHE B CB  1 
ATOM   3342 C CG  . PHE B 1 75  ? 30.006  26.992  25.025  1.00 2.42  ? 75  PHE B CG  1 
ATOM   3343 C CD1 . PHE B 1 75  ? 29.067  26.443  24.113  1.00 4.10  ? 75  PHE B CD1 1 
ATOM   3344 C CD2 . PHE B 1 75  ? 31.045  27.868  24.624  1.00 3.08  ? 75  PHE B CD2 1 
ATOM   3345 C CE1 . PHE B 1 75  ? 29.161  26.768  22.784  1.00 5.46  ? 75  PHE B CE1 1 
ATOM   3346 C CE2 . PHE B 1 75  ? 31.123  28.195  23.264  1.00 9.71  ? 75  PHE B CE2 1 
ATOM   3347 C CZ  . PHE B 1 75  ? 30.175  27.633  22.373  1.00 6.06  ? 75  PHE B CZ  1 
ATOM   3348 N N   . TYR B 1 76  ? 32.205  25.415  26.376  1.00 5.38  ? 76  TYR B N   1 
ATOM   3349 C CA  . TYR B 1 76  ? 33.627  25.046  26.303  1.00 11.17 ? 76  TYR B CA  1 
ATOM   3350 C C   . TYR B 1 76  ? 34.116  23.685  26.988  1.00 11.69 ? 76  TYR B C   1 
ATOM   3351 O O   . TYR B 1 76  ? 35.264  23.491  27.224  1.00 13.19 ? 76  TYR B O   1 
ATOM   3352 C CB  . TYR B 1 76  ? 34.488  26.108  26.945  1.00 9.91  ? 76  TYR B CB  1 
ATOM   3353 C CG  . TYR B 1 76  ? 34.465  27.439  26.245  1.00 7.32  ? 76  TYR B CG  1 
ATOM   3354 C CD1 . TYR B 1 76  ? 35.111  27.614  25.025  1.00 6.99  ? 76  TYR B CD1 1 
ATOM   3355 C CD2 . TYR B 1 76  ? 33.884  28.535  26.892  1.00 10.42 ? 76  TYR B CD2 1 
ATOM   3356 C CE1 . TYR B 1 76  ? 35.290  28.857  24.445  1.00 8.78  ? 76  TYR B CE1 1 
ATOM   3357 C CE2 . TYR B 1 76  ? 34.020  29.842  26.334  1.00 5.45  ? 76  TYR B CE2 1 
ATOM   3358 C CZ  . TYR B 1 76  ? 34.792  29.953  25.148  1.00 4.24  ? 76  TYR B CZ  1 
ATOM   3359 O OH  . TYR B 1 76  ? 35.093  31.218  24.706  1.00 8.13  ? 76  TYR B OH  1 
ATOM   3360 N N   . THR B 1 77  ? 33.222  22.889  27.464  1.00 14.91 ? 77  THR B N   1 
ATOM   3361 C CA  . THR B 1 77  ? 33.719  21.550  27.742  1.00 18.63 ? 77  THR B CA  1 
ATOM   3362 C C   . THR B 1 77  ? 33.485  20.655  26.391  1.00 17.92 ? 77  THR B C   1 
ATOM   3363 O O   . THR B 1 77  ? 34.097  19.631  26.099  1.00 20.06 ? 77  THR B O   1 
ATOM   3364 C CB  . THR B 1 77  ? 32.773  20.902  28.760  1.00 22.19 ? 77  THR B CB  1 
ATOM   3365 O OG1 . THR B 1 77  ? 32.367  21.933  29.665  1.00 21.98 ? 77  THR B OG1 1 
ATOM   3366 C CG2 . THR B 1 77  ? 33.254  19.563  29.075  1.00 25.90 ? 77  THR B CG2 1 
ATOM   3367 N N   . LEU B 1 78  ? 32.257  21.050  25.874  1.00 18.20 ? 78  LEU B N   1 
ATOM   3368 C CA  . LEU B 1 78  ? 31.529  20.737  24.639  1.00 14.74 ? 78  LEU B CA  1 
ATOM   3369 C C   . LEU B 1 78  ? 32.155  20.983  23.288  1.00 10.71 ? 78  LEU B C   1 
ATOM   3370 O O   . LEU B 1 78  ? 32.142  20.106  22.407  1.00 4.77  ? 78  LEU B O   1 
ATOM   3371 C CB  . LEU B 1 78  ? 30.117  21.248  24.524  1.00 16.43 ? 78  LEU B CB  1 
ATOM   3372 C CG  . LEU B 1 78  ? 28.972  20.276  24.506  1.00 16.69 ? 78  LEU B CG  1 
ATOM   3373 C CD1 . LEU B 1 78  ? 29.371  18.740  24.563  1.00 18.49 ? 78  LEU B CD1 1 
ATOM   3374 C CD2 . LEU B 1 78  ? 27.785  20.670  25.497  1.00 22.02 ? 78  LEU B CD2 1 
ATOM   3375 N N   . ILE B 1 79  ? 32.440  22.272  23.099  1.00 7.67  ? 79  ILE B N   1 
ATOM   3376 C CA  . ILE B 1 79  ? 33.100  22.499  21.811  1.00 5.61  ? 79  ILE B CA  1 
ATOM   3377 C C   . ILE B 1 79  ? 34.504  23.065  22.150  1.00 5.63  ? 79  ILE B C   1 
ATOM   3378 O O   . ILE B 1 79  ? 34.622  24.279  22.293  1.00 7.10  ? 79  ILE B O   1 
ATOM   3379 C CB  . ILE B 1 79  ? 32.149  23.475  20.954  1.00 7.40  ? 79  ILE B CB  1 
ATOM   3380 C CG1 . ILE B 1 79  ? 30.861  22.809  20.507  1.00 2.00  ? 79  ILE B CG1 1 
ATOM   3381 C CG2 . ILE B 1 79  ? 32.545  24.370  19.774  1.00 7.48  ? 79  ILE B CG2 1 
ATOM   3382 C CD1 . ILE B 1 79  ? 30.930  21.394  20.038  1.00 2.00  ? 79  ILE B CD1 1 
ATOM   3383 N N   . PRO B 1 80  ? 35.489  22.098  22.098  1.00 3.93  ? 80  PRO B N   1 
ATOM   3384 C CA  . PRO B 1 80  ? 36.893  22.240  22.526  1.00 3.20  ? 80  PRO B CA  1 
ATOM   3385 C C   . PRO B 1 80  ? 37.726  23.275  21.902  1.00 6.18  ? 80  PRO B C   1 
ATOM   3386 O O   . PRO B 1 80  ? 37.763  23.216  20.707  1.00 5.87  ? 80  PRO B O   1 
ATOM   3387 C CB  . PRO B 1 80  ? 37.433  20.888  22.121  1.00 8.74  ? 80  PRO B CB  1 
ATOM   3388 C CG  . PRO B 1 80  ? 36.301  19.871  22.325  1.00 6.14  ? 80  PRO B CG  1 
ATOM   3389 C CD  . PRO B 1 80  ? 35.128  20.693  21.815  1.00 5.93  ? 80  PRO B CD  1 
ATOM   3390 N N   . HIS B 1 81  ? 38.375  24.212  22.570  1.00 7.61  ? 81  HIS B N   1 
ATOM   3391 C CA  . HIS B 1 81  ? 38.893  25.431  21.949  1.00 12.88 ? 81  HIS B CA  1 
ATOM   3392 C C   . HIS B 1 81  ? 40.423  25.671  22.019  1.00 17.09 ? 81  HIS B C   1 
ATOM   3393 O O   . HIS B 1 81  ? 40.917  25.658  23.085  1.00 18.10 ? 81  HIS B O   1 
ATOM   3394 C CB  . HIS B 1 81  ? 38.229  26.659  22.633  1.00 14.42 ? 81  HIS B CB  1 
ATOM   3395 C CG  . HIS B 1 81  ? 36.991  27.176  21.859  1.00 20.13 ? 81  HIS B CG  1 
ATOM   3396 N ND1 . HIS B 1 81  ? 35.890  26.400  21.673  1.00 20.07 ? 81  HIS B ND1 1 
ATOM   3397 C CD2 . HIS B 1 81  ? 36.741  28.437  21.245  1.00 18.85 ? 81  HIS B CD2 1 
ATOM   3398 C CE1 . HIS B 1 81  ? 34.930  27.105  20.964  1.00 19.77 ? 81  HIS B CE1 1 
ATOM   3399 N NE2 . HIS B 1 81  ? 35.478  28.351  20.712  1.00 21.87 ? 81  HIS B NE2 1 
ATOM   3400 N N   . ASP B 1 82  ? 41.291  25.944  20.968  1.00 21.03 ? 82  ASP B N   1 
ATOM   3401 C CA  . ASP B 1 82  ? 42.756  26.262  21.141  1.00 23.73 ? 82  ASP B CA  1 
ATOM   3402 C C   . ASP B 1 82  ? 42.971  27.642  21.689  1.00 23.80 ? 82  ASP B C   1 
ATOM   3403 O O   . ASP B 1 82  ? 43.525  28.520  21.019  1.00 24.26 ? 82  ASP B O   1 
ATOM   3404 C CB  . ASP B 1 82  ? 43.621  26.276  19.838  1.00 31.70 ? 82  ASP B CB  1 
ATOM   3405 C CG  . ASP B 1 82  ? 45.123  26.720  19.983  1.00 36.89 ? 82  ASP B CG  1 
ATOM   3406 O OD1 . ASP B 1 82  ? 45.787  26.221  20.897  1.00 43.32 ? 82  ASP B OD1 1 
ATOM   3407 O OD2 . ASP B 1 82  ? 45.626  27.577  19.225  1.00 43.12 ? 82  ASP B OD2 1 
ATOM   3408 N N   . PHE B 1 83  ? 42.432  27.843  22.916  1.00 24.66 ? 83  PHE B N   1 
ATOM   3409 C CA  . PHE B 1 83  ? 42.402  29.265  23.278  1.00 24.67 ? 83  PHE B CA  1 
ATOM   3410 C C   . PHE B 1 83  ? 43.640  29.957  23.812  1.00 22.77 ? 83  PHE B C   1 
ATOM   3411 O O   . PHE B 1 83  ? 43.602  31.094  24.213  1.00 17.82 ? 83  PHE B O   1 
ATOM   3412 C CB  . PHE B 1 83  ? 41.208  29.499  24.099  1.00 26.59 ? 83  PHE B CB  1 
ATOM   3413 C CG  . PHE B 1 83  ? 40.128  30.215  23.341  1.00 24.56 ? 83  PHE B CG  1 
ATOM   3414 C CD1 . PHE B 1 83  ? 40.445  31.222  22.417  1.00 25.93 ? 83  PHE B CD1 1 
ATOM   3415 C CD2 . PHE B 1 83  ? 38.782  29.943  23.660  1.00 23.05 ? 83  PHE B CD2 1 
ATOM   3416 C CE1 . PHE B 1 83  ? 39.427  32.048  21.890  1.00 26.37 ? 83  PHE B CE1 1 
ATOM   3417 C CE2 . PHE B 1 83  ? 37.760  30.748  23.142  1.00 21.75 ? 83  PHE B CE2 1 
ATOM   3418 C CZ  . PHE B 1 83  ? 38.102  31.806  22.280  1.00 25.61 ? 83  PHE B CZ  1 
ATOM   3419 N N   . GLY B 1 84  ? 44.708  29.216  23.817  1.00 20.71 ? 84  GLY B N   1 
ATOM   3420 C CA  . GLY B 1 84  ? 45.732  28.897  22.831  1.00 22.82 ? 84  GLY B CA  1 
ATOM   3421 C C   . GLY B 1 84  ? 47.211  29.357  23.019  1.00 23.89 ? 84  GLY B C   1 
ATOM   3422 O O   . GLY B 1 84  ? 48.092  29.145  22.149  1.00 26.80 ? 84  GLY B O   1 
ATOM   3423 N N   . MET B 1 85  ? 47.467  30.071  24.168  1.00 24.80 ? 85  MET B N   1 
ATOM   3424 C CA  . MET B 1 85  ? 46.940  29.696  25.533  1.00 26.17 ? 85  MET B CA  1 
ATOM   3425 C C   . MET B 1 85  ? 46.226  30.812  26.520  1.00 28.06 ? 85  MET B C   1 
ATOM   3426 O O   . MET B 1 85  ? 46.471  30.876  27.730  1.00 30.14 ? 85  MET B O   1 
ATOM   3427 C CB  . MET B 1 85  ? 47.984  28.790  26.206  1.00 22.29 ? 85  MET B CB  1 
ATOM   3428 C CG  . MET B 1 85  ? 48.971  28.062  25.264  1.00 24.16 ? 85  MET B CG  1 
ATOM   3429 S SD  . MET B 1 85  ? 50.072  29.025  24.070  1.00 34.45 ? 85  MET B SD  1 
ATOM   3430 C CE  . MET B 1 85  ? 51.391  27.863  23.531  1.00 26.31 ? 85  MET B CE  1 
ATOM   3431 N N   . LYS B 1 86  ? 45.449  31.797  25.882  1.00 25.88 ? 86  LYS B N   1 
ATOM   3432 C CA  . LYS B 1 86  ? 44.671  32.893  26.534  1.00 21.14 ? 86  LYS B CA  1 
ATOM   3433 C C   . LYS B 1 86  ? 43.421  32.466  27.360  1.00 19.21 ? 86  LYS B C   1 
ATOM   3434 O O   . LYS B 1 86  ? 42.848  31.407  27.082  1.00 18.17 ? 86  LYS B O   1 
ATOM   3435 C CB  . LYS B 1 86  ? 44.295  33.843  25.382  1.00 22.81 ? 86  LYS B CB  1 
ATOM   3436 C CG  . LYS B 1 86  ? 42.954  34.659  25.456  1.00 21.42 ? 86  LYS B CG  1 
ATOM   3437 C CD  . LYS B 1 86  ? 42.655  35.643  26.633  1.00 19.70 ? 86  LYS B CD  1 
ATOM   3438 C CE  . LYS B 1 86  ? 43.704  36.754  26.700  1.00 19.73 ? 86  LYS B CE  1 
ATOM   3439 N NZ  . LYS B 1 86  ? 43.537  37.746  25.631  1.00 24.92 ? 86  LYS B NZ  1 
ATOM   3440 N N   . LYS B 1 87  ? 42.988  33.311  28.357  1.00 18.71 ? 87  LYS B N   1 
ATOM   3441 C CA  . LYS B 1 87  ? 41.855  32.945  29.234  1.00 19.92 ? 87  LYS B CA  1 
ATOM   3442 C C   . LYS B 1 87  ? 40.611  33.045  28.479  1.00 19.33 ? 87  LYS B C   1 
ATOM   3443 O O   . LYS B 1 87  ? 40.143  34.067  28.014  1.00 24.16 ? 87  LYS B O   1 
ATOM   3444 C CB  . LYS B 1 87  ? 41.646  33.734  30.511  1.00 22.46 ? 87  LYS B CB  1 
ATOM   3445 C CG  . LYS B 1 87  ? 42.613  33.275  31.615  1.00 28.80 ? 87  LYS B CG  1 
ATOM   3446 C CD  . LYS B 1 87  ? 44.124  33.359  31.213  1.00 32.39 ? 87  LYS B CD  1 
ATOM   3447 C CE  . LYS B 1 87  ? 44.938  32.089  31.510  1.00 30.28 ? 87  LYS B CE  1 
ATOM   3448 N NZ  . LYS B 1 87  ? 44.933  31.995  32.986  1.00 36.31 ? 87  LYS B NZ  1 
ATOM   3449 N N   . PRO B 1 88  ? 40.211  31.779  28.129  1.00 15.77 ? 88  PRO B N   1 
ATOM   3450 C CA  . PRO B 1 88  ? 39.503  31.544  26.823  1.00 13.15 ? 88  PRO B CA  1 
ATOM   3451 C C   . PRO B 1 88  ? 38.095  32.079  26.857  1.00 14.20 ? 88  PRO B C   1 
ATOM   3452 O O   . PRO B 1 88  ? 37.238  31.471  27.466  1.00 15.17 ? 88  PRO B O   1 
ATOM   3453 C CB  . PRO B 1 88  ? 39.493  30.038  26.880  1.00 9.89  ? 88  PRO B CB  1 
ATOM   3454 C CG  . PRO B 1 88  ? 39.505  29.620  28.343  1.00 16.76 ? 88  PRO B CG  1 
ATOM   3455 C CD  . PRO B 1 88  ? 40.483  30.594  28.926  1.00 13.19 ? 88  PRO B CD  1 
ATOM   3456 N N   . PRO B 1 89  ? 37.853  33.203  26.219  1.00 13.11 ? 89  PRO B N   1 
ATOM   3457 C CA  . PRO B 1 89  ? 36.672  34.068  26.542  1.00 13.37 ? 89  PRO B CA  1 
ATOM   3458 C C   . PRO B 1 89  ? 35.323  33.620  26.999  1.00 12.99 ? 89  PRO B C   1 
ATOM   3459 O O   . PRO B 1 89  ? 34.675  32.686  26.509  1.00 12.75 ? 89  PRO B O   1 
ATOM   3460 C CB  . PRO B 1 89  ? 36.531  34.900  25.268  1.00 14.17 ? 89  PRO B CB  1 
ATOM   3461 C CG  . PRO B 1 89  ? 38.028  35.153  24.898  1.00 16.14 ? 89  PRO B CG  1 
ATOM   3462 C CD  . PRO B 1 89  ? 38.775  33.814  25.290  1.00 14.75 ? 89  PRO B CD  1 
ATOM   3463 N N   . LEU B 1 90  ? 34.882  34.486  27.926  1.00 16.45 ? 90  LEU B N   1 
ATOM   3464 C CA  . LEU B 1 90  ? 33.697  34.003  28.715  1.00 22.62 ? 90  LEU B CA  1 
ATOM   3465 C C   . LEU B 1 90  ? 32.245  34.587  28.451  1.00 22.71 ? 90  LEU B C   1 
ATOM   3466 O O   . LEU B 1 90  ? 31.956  35.728  28.032  1.00 21.48 ? 90  LEU B O   1 
ATOM   3467 C CB  . LEU B 1 90  ? 34.079  33.642  30.219  1.00 25.75 ? 90  LEU B CB  1 
ATOM   3468 C CG  . LEU B 1 90  ? 35.048  32.422  30.669  1.00 30.26 ? 90  LEU B CG  1 
ATOM   3469 C CD1 . LEU B 1 90  ? 34.603  30.954  30.507  1.00 27.97 ? 90  LEU B CD1 1 
ATOM   3470 C CD2 . LEU B 1 90  ? 36.511  32.447  30.176  1.00 28.03 ? 90  LEU B CD2 1 
ATOM   3471 N N   . LEU B 1 91  ? 31.333  33.586  28.453  1.00 19.49 ? 91  LEU B N   1 
ATOM   3472 C CA  . LEU B 1 91  ? 30.106  33.725  27.716  1.00 16.83 ? 91  LEU B CA  1 
ATOM   3473 C C   . LEU B 1 91  ? 28.926  34.431  28.397  1.00 20.74 ? 91  LEU B C   1 
ATOM   3474 O O   . LEU B 1 91  ? 27.979  33.721  28.693  1.00 24.07 ? 91  LEU B O   1 
ATOM   3475 C CB  . LEU B 1 91  ? 29.689  32.349  27.328  1.00 10.91 ? 91  LEU B CB  1 
ATOM   3476 C CG  . LEU B 1 91  ? 30.572  31.777  26.207  1.00 11.51 ? 91  LEU B CG  1 
ATOM   3477 C CD1 . LEU B 1 91  ? 29.904  30.488  25.701  1.00 5.68  ? 91  LEU B CD1 1 
ATOM   3478 C CD2 . LEU B 1 91  ? 30.883  32.732  25.062  1.00 13.19 ? 91  LEU B CD2 1 
ATOM   3479 N N   . ASN B 1 92  ? 28.942  35.768  28.625  1.00 22.00 ? 92  ASN B N   1 
ATOM   3480 C CA  . ASN B 1 92  ? 27.946  36.464  29.504  1.00 20.40 ? 92  ASN B CA  1 
ATOM   3481 C C   . ASN B 1 92  ? 27.388  37.865  28.974  1.00 18.12 ? 92  ASN B C   1 
ATOM   3482 O O   . ASN B 1 92  ? 26.950  38.860  29.583  1.00 18.12 ? 92  ASN B O   1 
ATOM   3483 C CB  . ASN B 1 92  ? 28.612  36.594  30.887  1.00 27.32 ? 92  ASN B CB  1 
ATOM   3484 C CG  . ASN B 1 92  ? 30.119  36.965  30.760  1.00 34.28 ? 92  ASN B CG  1 
ATOM   3485 O OD1 . ASN B 1 92  ? 31.042  36.174  30.776  1.00 38.43 ? 92  ASN B OD1 1 
ATOM   3486 N ND2 . ASN B 1 92  ? 30.445  38.206  30.411  1.00 33.38 ? 92  ASN B ND2 1 
ATOM   3487 N N   . ASN B 1 93  ? 27.573  37.837  27.676  1.00 13.56 ? 93  ASN B N   1 
ATOM   3488 C CA  . ASN B 1 93  ? 27.456  38.983  26.861  1.00 11.28 ? 93  ASN B CA  1 
ATOM   3489 C C   . ASN B 1 93  ? 26.486  38.578  25.672  1.00 8.80  ? 93  ASN B C   1 
ATOM   3490 O O   . ASN B 1 93  ? 25.873  37.503  25.616  1.00 4.96  ? 93  ASN B O   1 
ATOM   3491 C CB  . ASN B 1 93  ? 28.951  39.013  26.799  1.00 14.05 ? 93  ASN B CB  1 
ATOM   3492 C CG  . ASN B 1 93  ? 29.312  40.082  25.885  1.00 15.52 ? 93  ASN B CG  1 
ATOM   3493 O OD1 . ASN B 1 93  ? 28.433  40.817  25.514  1.00 20.39 ? 93  ASN B OD1 1 
ATOM   3494 N ND2 . ASN B 1 93  ? 30.594  40.533  25.867  1.00 10.87 ? 93  ASN B ND2 1 
ATOM   3495 N N   . ALA B 1 94  ? 26.290  39.490  24.744  1.00 4.74  ? 94  ALA B N   1 
ATOM   3496 C CA  . ALA B 1 94  ? 25.717  38.859  23.560  1.00 2.28  ? 94  ALA B CA  1 
ATOM   3497 C C   . ALA B 1 94  ? 26.549  38.975  22.430  1.00 2.38  ? 94  ALA B C   1 
ATOM   3498 O O   . ALA B 1 94  ? 26.410  38.247  21.446  1.00 2.00  ? 94  ALA B O   1 
ATOM   3499 C CB  . ALA B 1 94  ? 24.361  39.435  23.248  1.00 4.33  ? 94  ALA B CB  1 
ATOM   3500 N N   . ASP B 1 95  ? 27.482  39.950  22.576  1.00 5.62  ? 95  ASP B N   1 
ATOM   3501 C CA  . ASP B 1 95  ? 28.628  39.760  21.739  1.00 8.24  ? 95  ASP B CA  1 
ATOM   3502 C C   . ASP B 1 95  ? 29.164  38.253  21.562  1.00 7.36  ? 95  ASP B C   1 
ATOM   3503 O O   . ASP B 1 95  ? 28.655  37.456  20.710  1.00 7.76  ? 95  ASP B O   1 
ATOM   3504 C CB  . ASP B 1 95  ? 29.736  40.799  21.903  1.00 11.24 ? 95  ASP B CB  1 
ATOM   3505 C CG  . ASP B 1 95  ? 29.144  42.138  22.423  1.00 20.79 ? 95  ASP B CG  1 
ATOM   3506 O OD1 . ASP B 1 95  ? 29.298  43.223  21.820  1.00 27.82 ? 95  ASP B OD1 1 
ATOM   3507 O OD2 . ASP B 1 95  ? 28.563  42.166  23.519  1.00 25.87 ? 95  ASP B OD2 1 
ATOM   3508 N N   . SER B 1 96  ? 30.208  37.948  22.345  1.00 8.53  ? 96  SER B N   1 
ATOM   3509 C CA  . SER B 1 96  ? 30.508  36.502  22.403  1.00 10.04 ? 96  SER B CA  1 
ATOM   3510 C C   . SER B 1 96  ? 29.396  35.484  22.275  1.00 9.59  ? 96  SER B C   1 
ATOM   3511 O O   . SER B 1 96  ? 29.760  34.438  21.747  1.00 12.28 ? 96  SER B O   1 
ATOM   3512 C CB  . SER B 1 96  ? 31.260  36.011  23.669  1.00 5.04  ? 96  SER B CB  1 
ATOM   3513 O OG  . SER B 1 96  ? 31.923  37.067  24.436  1.00 14.62 ? 96  SER B OG  1 
ATOM   3514 N N   . VAL B 1 97  ? 28.118  35.734  22.639  1.00 7.47  ? 97  VAL B N   1 
ATOM   3515 C CA  . VAL B 1 97  ? 27.300  34.620  22.261  1.00 6.47  ? 97  VAL B CA  1 
ATOM   3516 C C   . VAL B 1 97  ? 26.924  34.432  20.789  1.00 9.97  ? 97  VAL B C   1 
ATOM   3517 O O   . VAL B 1 97  ? 27.020  33.252  20.408  1.00 17.99 ? 97  VAL B O   1 
ATOM   3518 C CB  . VAL B 1 97  ? 26.195  34.509  23.191  1.00 6.09  ? 97  VAL B CB  1 
ATOM   3519 C CG1 . VAL B 1 97  ? 25.134  33.498  22.699  1.00 4.91  ? 97  VAL B CG1 1 
ATOM   3520 C CG2 . VAL B 1 97  ? 26.956  34.139  24.471  1.00 2.49  ? 97  VAL B CG2 1 
ATOM   3521 N N   . GLN B 1 98  ? 26.728  35.615  19.995  1.00 6.04  ? 98  GLN B N   1 
ATOM   3522 C CA  . GLN B 1 98  ? 26.802  35.524  18.523  1.00 4.65  ? 98  GLN B CA  1 
ATOM   3523 C C   . GLN B 1 98  ? 28.074  34.902  17.931  1.00 3.12  ? 98  GLN B C   1 
ATOM   3524 O O   . GLN B 1 98  ? 28.025  33.909  17.264  1.00 2.11  ? 98  GLN B O   1 
ATOM   3525 C CB  . GLN B 1 98  ? 26.499  36.782  17.799  1.00 9.46  ? 98  GLN B CB  1 
ATOM   3526 C CG  . GLN B 1 98  ? 26.082  37.909  18.714  1.00 22.23 ? 98  GLN B CG  1 
ATOM   3527 C CD  . GLN B 1 98  ? 24.697  37.714  19.296  1.00 26.27 ? 98  GLN B CD  1 
ATOM   3528 O OE1 . GLN B 1 98  ? 24.370  36.726  19.938  1.00 27.08 ? 98  GLN B OE1 1 
ATOM   3529 N NE2 . GLN B 1 98  ? 23.803  38.685  19.015  1.00 34.98 ? 98  GLN B NE2 1 
ATOM   3530 N N   . ALA B 1 99  ? 29.295  35.327  18.257  1.00 2.00  ? 99  ALA B N   1 
ATOM   3531 C CA  . ALA B 1 99  ? 30.373  34.475  17.654  1.00 2.00  ? 99  ALA B CA  1 
ATOM   3532 C C   . ALA B 1 99  ? 30.288  33.004  17.819  1.00 3.50  ? 99  ALA B C   1 
ATOM   3533 O O   . ALA B 1 99  ? 30.411  32.227  16.902  1.00 7.24  ? 99  ALA B O   1 
ATOM   3534 C CB  . ALA B 1 99  ? 31.834  34.658  18.064  1.00 2.00  ? 99  ALA B CB  1 
ATOM   3535 N N   . LYS B 1 100 ? 29.896  32.632  19.040  1.00 2.00  ? 100 LYS B N   1 
ATOM   3536 C CA  . LYS B 1 100 ? 29.791  31.220  19.253  1.00 4.26  ? 100 LYS B CA  1 
ATOM   3537 C C   . LYS B 1 100 ? 28.597  30.726  18.499  1.00 7.13  ? 100 LYS B C   1 
ATOM   3538 O O   . LYS B 1 100 ? 28.626  29.620  17.989  1.00 6.68  ? 100 LYS B O   1 
ATOM   3539 C CB  . LYS B 1 100 ? 29.909  30.897  20.746  1.00 2.00  ? 100 LYS B CB  1 
ATOM   3540 C CG  . LYS B 1 100 ? 30.851  31.782  21.601  1.00 2.00  ? 100 LYS B CG  1 
ATOM   3541 C CD  . LYS B 1 100 ? 32.302  32.208  21.288  1.00 2.00  ? 100 LYS B CD  1 
ATOM   3542 C CE  . LYS B 1 100 ? 32.964  30.855  21.000  1.00 4.11  ? 100 LYS B CE  1 
ATOM   3543 N NZ  . LYS B 1 100 ? 34.298  30.890  20.337  1.00 2.00  ? 100 LYS B NZ  1 
ATOM   3544 N N   . VAL B 1 101 ? 27.594  31.636  18.342  1.00 6.06  ? 101 VAL B N   1 
ATOM   3545 C CA  . VAL B 1 101 ? 26.455  31.236  17.507  1.00 5.83  ? 101 VAL B CA  1 
ATOM   3546 C C   . VAL B 1 101 ? 26.866  31.004  16.024  1.00 3.00  ? 101 VAL B C   1 
ATOM   3547 O O   . VAL B 1 101 ? 26.527  29.967  15.462  1.00 2.03  ? 101 VAL B O   1 
ATOM   3548 C CB  . VAL B 1 101 ? 25.065  32.049  17.704  1.00 6.59  ? 101 VAL B CB  1 
ATOM   3549 C CG1 . VAL B 1 101 ? 23.809  31.406  17.071  1.00 6.84  ? 101 VAL B CG1 1 
ATOM   3550 C CG2 . VAL B 1 101 ? 24.695  32.097  19.154  1.00 9.15  ? 101 VAL B CG2 1 
ATOM   3551 N N   . GLU B 1 102 ? 27.687  31.979  15.528  1.00 2.63  ? 102 GLU B N   1 
ATOM   3552 C CA  . GLU B 1 102 ? 28.013  32.115  14.112  1.00 6.30  ? 102 GLU B CA  1 
ATOM   3553 C C   . GLU B 1 102 ? 28.831  30.988  13.535  1.00 8.50  ? 102 GLU B C   1 
ATOM   3554 O O   . GLU B 1 102 ? 28.465  30.209  12.614  1.00 11.26 ? 102 GLU B O   1 
ATOM   3555 C CB  . GLU B 1 102 ? 28.529  33.517  13.718  1.00 12.94 ? 102 GLU B CB  1 
ATOM   3556 C CG  . GLU B 1 102 ? 27.479  34.694  13.611  1.00 21.64 ? 102 GLU B CG  1 
ATOM   3557 C CD  . GLU B 1 102 ? 28.087  36.114  13.323  1.00 25.64 ? 102 GLU B CD  1 
ATOM   3558 O OE1 . GLU B 1 102 ? 28.943  36.270  12.452  1.00 29.97 ? 102 GLU B OE1 1 
ATOM   3559 O OE2 . GLU B 1 102 ? 27.715  37.098  13.959  1.00 26.45 ? 102 GLU B OE2 1 
ATOM   3560 N N   . MET B 1 103 ? 29.851  30.810  14.385  1.00 5.06  ? 103 MET B N   1 
ATOM   3561 C CA  . MET B 1 103 ? 30.428  29.490  14.576  1.00 2.00  ? 103 MET B CA  1 
ATOM   3562 C C   . MET B 1 103 ? 29.611  28.251  14.392  1.00 2.78  ? 103 MET B C   1 
ATOM   3563 O O   . MET B 1 103 ? 30.180  27.330  13.893  1.00 5.69  ? 103 MET B O   1 
ATOM   3564 C CB  . MET B 1 103 ? 31.157  29.486  15.853  1.00 2.04  ? 103 MET B CB  1 
ATOM   3565 C CG  . MET B 1 103 ? 32.486  28.844  15.628  1.00 2.73  ? 103 MET B CG  1 
ATOM   3566 S SD  . MET B 1 103 ? 32.800  27.512  16.810  1.00 17.23 ? 103 MET B SD  1 
ATOM   3567 C CE  . MET B 1 103 ? 31.159  27.560  17.583  1.00 12.13 ? 103 MET B CE  1 
ATOM   3568 N N   . LEU B 1 104 ? 28.340  28.149  14.745  1.00 4.43  ? 104 LEU B N   1 
ATOM   3569 C CA  . LEU B 1 104 ? 27.771  26.807  14.971  1.00 4.11  ? 104 LEU B CA  1 
ATOM   3570 C C   . LEU B 1 104 ? 26.993  26.229  13.856  1.00 6.07  ? 104 LEU B C   1 
ATOM   3571 O O   . LEU B 1 104 ? 26.985  25.069  13.531  1.00 7.18  ? 104 LEU B O   1 
ATOM   3572 C CB  . LEU B 1 104 ? 27.033  26.688  16.320  1.00 4.22  ? 104 LEU B CB  1 
ATOM   3573 C CG  . LEU B 1 104 ? 27.978  26.304  17.566  1.00 4.43  ? 104 LEU B CG  1 
ATOM   3574 C CD1 . LEU B 1 104 ? 27.353  26.235  19.004  1.00 2.00  ? 104 LEU B CD1 1 
ATOM   3575 C CD2 . LEU B 1 104 ? 28.895  25.135  17.219  1.00 2.00  ? 104 LEU B CD2 1 
ATOM   3576 N N   . ASP B 1 105 ? 26.458  27.234  13.187  1.00 5.48  ? 105 ASP B N   1 
ATOM   3577 C CA  . ASP B 1 105 ? 25.963  27.501  11.843  1.00 6.42  ? 105 ASP B CA  1 
ATOM   3578 C C   . ASP B 1 105 ? 27.088  27.145  10.815  1.00 4.99  ? 105 ASP B C   1 
ATOM   3579 O O   . ASP B 1 105 ? 27.143  26.053  10.166  1.00 2.00  ? 105 ASP B O   1 
ATOM   3580 C CB  . ASP B 1 105 ? 25.717  29.029  11.927  1.00 6.83  ? 105 ASP B CB  1 
ATOM   3581 C CG  . ASP B 1 105 ? 24.384  29.579  12.602  1.00 9.60  ? 105 ASP B CG  1 
ATOM   3582 O OD1 . ASP B 1 105 ? 23.727  28.953  13.493  1.00 2.00  ? 105 ASP B OD1 1 
ATOM   3583 O OD2 . ASP B 1 105 ? 23.979  30.724  12.152  1.00 9.96  ? 105 ASP B OD2 1 
ATOM   3584 N N   . ASN B 1 106 ? 28.062  28.143  10.803  1.00 6.21  ? 106 ASN B N   1 
ATOM   3585 C CA  . ASN B 1 106 ? 29.226  27.835  9.952   1.00 10.07 ? 106 ASN B CA  1 
ATOM   3586 C C   . ASN B 1 106 ? 30.031  26.577  10.219  1.00 14.51 ? 106 ASN B C   1 
ATOM   3587 O O   . ASN B 1 106 ? 30.949  26.516  9.420   1.00 21.85 ? 106 ASN B O   1 
ATOM   3588 C CB  . ASN B 1 106 ? 30.385  28.779  9.980   1.00 6.94  ? 106 ASN B CB  1 
ATOM   3589 C CG  . ASN B 1 106 ? 30.190  30.098  9.319   1.00 15.27 ? 106 ASN B CG  1 
ATOM   3590 O OD1 . ASN B 1 106 ? 30.463  30.297  8.145   1.00 16.27 ? 106 ASN B OD1 1 
ATOM   3591 N ND2 . ASN B 1 106 ? 29.825  31.065  10.136  1.00 17.64 ? 106 ASN B ND2 1 
ATOM   3592 N N   . LEU B 1 107 ? 29.717  25.677  11.257  1.00 12.87 ? 107 LEU B N   1 
ATOM   3593 C CA  . LEU B 1 107 ? 30.157  24.256  11.384  1.00 10.37 ? 107 LEU B CA  1 
ATOM   3594 C C   . LEU B 1 107 ? 29.128  23.278  11.150  1.00 12.40 ? 107 LEU B C   1 
ATOM   3595 O O   . LEU B 1 107 ? 29.518  22.157  10.927  1.00 12.13 ? 107 LEU B O   1 
ATOM   3596 C CB  . LEU B 1 107 ? 30.582  23.637  12.727  1.00 2.00  ? 107 LEU B CB  1 
ATOM   3597 C CG  . LEU B 1 107 ? 31.717  24.504  13.318  1.00 4.69  ? 107 LEU B CG  1 
ATOM   3598 C CD1 . LEU B 1 107 ? 31.690  24.503  14.842  1.00 2.41  ? 107 LEU B CD1 1 
ATOM   3599 C CD2 . LEU B 1 107 ? 33.158  24.384  12.711  1.00 6.49  ? 107 LEU B CD2 1 
ATOM   3600 N N   . LEU B 1 108 ? 27.866  23.752  11.191  1.00 13.33 ? 108 LEU B N   1 
ATOM   3601 C CA  . LEU B 1 108 ? 26.670  22.937  10.828  1.00 10.50 ? 108 LEU B CA  1 
ATOM   3602 C C   . LEU B 1 108 ? 26.670  22.451  9.343   1.00 11.61 ? 108 LEU B C   1 
ATOM   3603 O O   . LEU B 1 108 ? 26.445  21.317  9.130   1.00 12.69 ? 108 LEU B O   1 
ATOM   3604 C CB  . LEU B 1 108 ? 25.339  23.615  11.249  1.00 5.37  ? 108 LEU B CB  1 
ATOM   3605 C CG  . LEU B 1 108 ? 24.700  22.985  12.476  1.00 7.54  ? 108 LEU B CG  1 
ATOM   3606 C CD1 . LEU B 1 108 ? 23.208  23.352  12.670  1.00 4.01  ? 108 LEU B CD1 1 
ATOM   3607 C CD2 . LEU B 1 108 ? 25.026  21.470  12.495  1.00 4.61  ? 108 LEU B CD2 1 
ATOM   3608 N N   . ASP B 1 109 ? 27.065  23.340  8.376   1.00 13.22 ? 109 ASP B N   1 
ATOM   3609 C CA  . ASP B 1 109 ? 27.343  22.717  7.028   1.00 11.46 ? 109 ASP B CA  1 
ATOM   3610 C C   . ASP B 1 109 ? 28.787  22.207  6.696   1.00 12.63 ? 109 ASP B C   1 
ATOM   3611 O O   . ASP B 1 109 ? 28.992  21.205  6.082   1.00 16.01 ? 109 ASP B O   1 
ATOM   3612 C CB  . ASP B 1 109 ? 27.116  23.679  5.869   1.00 4.81  ? 109 ASP B CB  1 
ATOM   3613 C CG  . ASP B 1 109 ? 25.764  24.275  5.705   1.00 8.40  ? 109 ASP B CG  1 
ATOM   3614 O OD1 . ASP B 1 109 ? 24.801  23.484  5.918   1.00 11.69 ? 109 ASP B OD1 1 
ATOM   3615 O OD2 . ASP B 1 109 ? 25.750  25.486  5.328   1.00 7.25  ? 109 ASP B OD2 1 
ATOM   3616 N N   . ILE B 1 110 ? 29.883  22.835  7.101   1.00 11.48 ? 110 ILE B N   1 
ATOM   3617 C CA  . ILE B 1 110 ? 30.948  21.878  7.489   1.00 8.03  ? 110 ILE B CA  1 
ATOM   3618 C C   . ILE B 1 110 ? 30.707  20.431  8.027   1.00 7.44  ? 110 ILE B C   1 
ATOM   3619 O O   . ILE B 1 110 ? 31.237  19.443  7.497   1.00 4.56  ? 110 ILE B O   1 
ATOM   3620 C CB  . ILE B 1 110 ? 31.990  22.522  8.381   1.00 8.92  ? 110 ILE B CB  1 
ATOM   3621 C CG1 . ILE B 1 110 ? 32.492  23.818  7.682   1.00 10.45 ? 110 ILE B CG1 1 
ATOM   3622 C CG2 . ILE B 1 110 ? 33.100  21.461  8.640   1.00 2.00  ? 110 ILE B CG2 1 
ATOM   3623 C CD1 . ILE B 1 110 ? 33.606  24.468  8.467   1.00 5.99  ? 110 ILE B CD1 1 
ATOM   3624 N N   . GLU B 1 111 ? 29.888  20.253  9.068   1.00 11.23 ? 111 GLU B N   1 
ATOM   3625 C CA  . GLU B 1 111 ? 29.585  18.793  9.099   1.00 11.92 ? 111 GLU B CA  1 
ATOM   3626 C C   . GLU B 1 111 ? 28.938  18.200  7.842   1.00 12.56 ? 111 GLU B C   1 
ATOM   3627 O O   . GLU B 1 111 ? 29.071  17.011  7.604   1.00 15.36 ? 111 GLU B O   1 
ATOM   3628 C CB  . GLU B 1 111 ? 29.181  18.091  10.414  1.00 8.56  ? 111 GLU B CB  1 
ATOM   3629 C CG  . GLU B 1 111 ? 27.704  17.943  10.438  1.00 8.82  ? 111 GLU B CG  1 
ATOM   3630 C CD  . GLU B 1 111 ? 27.105  16.585  10.121  1.00 14.80 ? 111 GLU B CD  1 
ATOM   3631 O OE1 . GLU B 1 111 ? 25.895  16.516  9.840   1.00 19.15 ? 111 GLU B OE1 1 
ATOM   3632 O OE2 . GLU B 1 111 ? 27.809  15.572  10.253  1.00 16.73 ? 111 GLU B OE2 1 
ATOM   3633 N N   . VAL B 1 112 ? 28.433  19.033  6.934   1.00 11.63 ? 112 VAL B N   1 
ATOM   3634 C CA  . VAL B 1 112 ? 28.166  18.371  5.638   1.00 9.80  ? 112 VAL B CA  1 
ATOM   3635 C C   . VAL B 1 112 ? 29.367  18.198  4.696   1.00 8.09  ? 112 VAL B C   1 
ATOM   3636 O O   . VAL B 1 112 ? 29.616  17.071  4.299   1.00 4.03  ? 112 VAL B O   1 
ATOM   3637 C CB  . VAL B 1 112 ? 26.778  18.662  4.861   1.00 11.44 ? 112 VAL B CB  1 
ATOM   3638 C CG1 . VAL B 1 112 ? 26.377  17.544  3.891   1.00 16.65 ? 112 VAL B CG1 1 
ATOM   3639 C CG2 . VAL B 1 112 ? 25.497  18.627  5.709   1.00 12.09 ? 112 VAL B CG2 1 
ATOM   3640 N N   . ALA B 1 113 ? 30.140  19.235  4.370   1.00 8.81  ? 113 ALA B N   1 
ATOM   3641 C CA  . ALA B 1 113 ? 31.222  18.994  3.450   1.00 7.73  ? 113 ALA B CA  1 
ATOM   3642 C C   . ALA B 1 113 ? 31.988  17.688  3.717   1.00 13.06 ? 113 ALA B C   1 
ATOM   3643 O O   . ALA B 1 113 ? 31.568  16.617  3.187   1.00 10.40 ? 113 ALA B O   1 
ATOM   3644 C CB  . ALA B 1 113 ? 32.093  20.204  3.193   1.00 2.00  ? 113 ALA B CB  1 
ATOM   3645 N N   . TYR B 1 114 ? 32.944  17.785  4.727   1.00 16.03 ? 114 TYR B N   1 
ATOM   3646 C CA  . TYR B 1 114 ? 33.216  16.613  5.681   1.00 16.72 ? 114 TYR B CA  1 
ATOM   3647 C C   . TYR B 1 114 ? 32.394  15.289  5.614   1.00 14.61 ? 114 TYR B C   1 
ATOM   3648 O O   . TYR B 1 114 ? 32.831  14.323  5.034   1.00 16.77 ? 114 TYR B O   1 
ATOM   3649 C CB  . TYR B 1 114 ? 33.185  16.971  7.203   1.00 20.29 ? 114 TYR B CB  1 
ATOM   3650 C CG  . TYR B 1 114 ? 34.183  16.006  7.860   1.00 30.98 ? 114 TYR B CG  1 
ATOM   3651 C CD1 . TYR B 1 114 ? 35.559  16.341  7.998   1.00 29.51 ? 114 TYR B CD1 1 
ATOM   3652 C CD2 . TYR B 1 114 ? 33.729  14.725  8.214   1.00 31.52 ? 114 TYR B CD2 1 
ATOM   3653 C CE1 . TYR B 1 114 ? 36.524  15.338  8.055   1.00 33.13 ? 114 TYR B CE1 1 
ATOM   3654 C CE2 . TYR B 1 114 ? 34.659  13.703  8.302   1.00 34.83 ? 114 TYR B CE2 1 
ATOM   3655 C CZ  . TYR B 1 114 ? 36.012  14.015  7.996   1.00 37.40 ? 114 TYR B CZ  1 
ATOM   3656 O OH  . TYR B 1 114 ? 36.777  12.937  7.529   1.00 38.37 ? 114 TYR B OH  1 
ATOM   3657 N N   . SER B 1 115 ? 31.196  15.251  6.258   1.00 14.29 ? 115 SER B N   1 
ATOM   3658 C CA  . SER B 1 115 ? 30.340  13.991  6.332   1.00 11.73 ? 115 SER B CA  1 
ATOM   3659 C C   . SER B 1 115 ? 30.012  13.482  4.933   1.00 12.40 ? 115 SER B C   1 
ATOM   3660 O O   . SER B 1 115 ? 29.833  12.292  4.625   1.00 17.80 ? 115 SER B O   1 
ATOM   3661 C CB  . SER B 1 115 ? 28.893  14.159  6.880   1.00 10.89 ? 115 SER B CB  1 
ATOM   3662 O OG  . SER B 1 115 ? 28.650  13.550  8.146   1.00 12.28 ? 115 SER B OG  1 
ATOM   3663 N N   . LEU B 1 116 ? 29.936  14.547  4.085   1.00 10.43 ? 116 LEU B N   1 
ATOM   3664 C CA  . LEU B 1 116 ? 29.436  14.183  2.782   1.00 10.27 ? 116 LEU B CA  1 
ATOM   3665 C C   . LEU B 1 116 ? 30.473  13.355  2.061   1.00 11.39 ? 116 LEU B C   1 
ATOM   3666 O O   . LEU B 1 116 ? 30.394  12.145  1.827   1.00 9.36  ? 116 LEU B O   1 
ATOM   3667 C CB  . LEU B 1 116 ? 28.901  15.355  1.912   1.00 9.01  ? 116 LEU B CB  1 
ATOM   3668 C CG  . LEU B 1 116 ? 27.354  15.473  1.530   1.00 4.22  ? 116 LEU B CG  1 
ATOM   3669 C CD1 . LEU B 1 116 ? 27.341  16.606  0.456   1.00 10.61 ? 116 LEU B CD1 1 
ATOM   3670 C CD2 . LEU B 1 116 ? 26.516  14.212  1.209   1.00 5.72  ? 116 LEU B CD2 1 
ATOM   3671 N N   . LEU B 1 117 ? 31.517  14.096  1.838   1.00 13.81 ? 117 LEU B N   1 
ATOM   3672 C CA  . LEU B 1 117 ? 32.572  13.258  1.283   1.00 16.82 ? 117 LEU B CA  1 
ATOM   3673 C C   . LEU B 1 117 ? 33.016  11.979  2.066   1.00 22.52 ? 117 LEU B C   1 
ATOM   3674 O O   . LEU B 1 117 ? 33.091  10.885  1.513   1.00 25.26 ? 117 LEU B O   1 
ATOM   3675 C CB  . LEU B 1 117 ? 33.597  14.269  0.823   1.00 12.42 ? 117 LEU B CB  1 
ATOM   3676 C CG  . LEU B 1 117 ? 34.962  14.239  1.335   1.00 8.35  ? 117 LEU B CG  1 
ATOM   3677 C CD1 . LEU B 1 117 ? 35.578  12.964  0.760   1.00 2.36  ? 117 LEU B CD1 1 
ATOM   3678 C CD2 . LEU B 1 117 ? 35.566  15.649  1.144   1.00 2.00  ? 117 LEU B CD2 1 
ATOM   3679 N N   . ARG B 1 118 ? 33.200  12.175  3.414   1.00 25.70 ? 118 ARG B N   1 
ATOM   3680 C CA  . ARG B 1 118 ? 33.979  11.128  4.060   1.00 29.18 ? 118 ARG B CA  1 
ATOM   3681 C C   . ARG B 1 118 ? 33.221  9.823   4.185   1.00 30.48 ? 118 ARG B C   1 
ATOM   3682 O O   . ARG B 1 118 ? 33.556  8.782   3.648   1.00 32.77 ? 118 ARG B O   1 
ATOM   3683 C CB  . ARG B 1 118 ? 34.799  11.670  5.252   1.00 25.43 ? 118 ARG B CB  1 
ATOM   3684 C CG  . ARG B 1 118 ? 36.227  11.143  5.089   1.00 27.26 ? 118 ARG B CG  1 
ATOM   3685 C CD  . ARG B 1 118 ? 36.301  9.828   5.966   1.00 30.68 ? 118 ARG B CD  1 
ATOM   3686 N NE  . ARG B 1 118 ? 36.857  8.530   5.471   1.00 28.78 ? 118 ARG B NE  1 
ATOM   3687 C CZ  . ARG B 1 118 ? 36.560  7.396   6.169   1.00 26.70 ? 118 ARG B CZ  1 
ATOM   3688 N NH1 . ARG B 1 118 ? 35.947  7.397   7.368   1.00 22.86 ? 118 ARG B NH1 1 
ATOM   3689 N NH2 . ARG B 1 118 ? 36.829  6.222   5.625   1.00 28.66 ? 118 ARG B NH2 1 
ATOM   3690 N N   . GLY B 1 119 ? 32.053  9.920   4.795   1.00 30.91 ? 119 GLY B N   1 
ATOM   3691 C CA  . GLY B 1 119 ? 31.331  8.627   4.728   1.00 32.60 ? 119 GLY B CA  1 
ATOM   3692 C C   . GLY B 1 119 ? 30.865  8.163   3.343   1.00 32.86 ? 119 GLY B C   1 
ATOM   3693 O O   . GLY B 1 119 ? 30.237  7.114   3.271   1.00 34.92 ? 119 GLY B O   1 
ATOM   3694 N N   . GLY B 1 120 ? 31.115  9.073   2.325   1.00 34.08 ? 120 GLY B N   1 
ATOM   3695 C CA  . GLY B 1 120 ? 30.613  9.090   0.936   1.00 31.85 ? 120 GLY B CA  1 
ATOM   3696 C C   . GLY B 1 120 ? 31.140  7.877   0.188   1.00 30.74 ? 120 GLY B C   1 
ATOM   3697 O O   . GLY B 1 120 ? 30.442  6.862   0.137   1.00 28.72 ? 120 GLY B O   1 
ATOM   3698 N N   . SER B 1 121 ? 32.344  8.082   -0.425  1.00 31.05 ? 121 SER B N   1 
ATOM   3699 C CA  . SER B 1 121 ? 32.889  7.142   -1.493  1.00 30.51 ? 121 SER B CA  1 
ATOM   3700 C C   . SER B 1 121 ? 34.325  6.582   -1.191  1.00 30.35 ? 121 SER B C   1 
ATOM   3701 O O   . SER B 1 121 ? 35.088  7.123   -0.436  1.00 30.40 ? 121 SER B O   1 
ATOM   3702 C CB  . SER B 1 121 ? 32.824  7.852   -2.946  1.00 30.83 ? 121 SER B CB  1 
ATOM   3703 O OG  . SER B 1 121 ? 33.208  7.063   -4.142  1.00 26.82 ? 121 SER B OG  1 
ATOM   3704 N N   . ASP B 1 122 ? 34.763  5.553   -1.909  1.00 29.16 ? 122 ASP B N   1 
ATOM   3705 C CA  . ASP B 1 122 ? 36.234  5.534   -2.087  1.00 27.19 ? 122 ASP B CA  1 
ATOM   3706 C C   . ASP B 1 122 ? 36.658  5.205   -3.536  1.00 28.65 ? 122 ASP B C   1 
ATOM   3707 O O   . ASP B 1 122 ? 37.432  4.327   -3.886  1.00 29.15 ? 122 ASP B O   1 
ATOM   3708 C CB  . ASP B 1 122 ? 36.891  4.601   -1.126  1.00 23.44 ? 122 ASP B CB  1 
ATOM   3709 C CG  . ASP B 1 122 ? 36.160  3.246   -1.287  1.00 26.10 ? 122 ASP B CG  1 
ATOM   3710 O OD1 . ASP B 1 122 ? 35.092  3.026   -0.636  1.00 20.82 ? 122 ASP B OD1 1 
ATOM   3711 O OD2 . ASP B 1 122 ? 36.675  2.431   -2.104  1.00 30.16 ? 122 ASP B OD2 1 
ATOM   3712 N N   . ASP B 1 123 ? 36.045  5.955   -4.454  1.00 30.24 ? 123 ASP B N   1 
ATOM   3713 C CA  . ASP B 1 123 ? 36.102  5.560   -5.894  1.00 29.30 ? 123 ASP B CA  1 
ATOM   3714 C C   . ASP B 1 123 ? 36.850  6.576   -6.834  1.00 31.98 ? 123 ASP B C   1 
ATOM   3715 O O   . ASP B 1 123 ? 36.492  7.763   -6.858  1.00 29.09 ? 123 ASP B O   1 
ATOM   3716 C CB  . ASP B 1 123 ? 34.704  5.035   -6.356  1.00 22.57 ? 123 ASP B CB  1 
ATOM   3717 C CG  . ASP B 1 123 ? 34.353  4.026   -5.251  1.00 25.72 ? 123 ASP B CG  1 
ATOM   3718 O OD1 . ASP B 1 123 ? 33.616  4.369   -4.296  1.00 24.61 ? 123 ASP B OD1 1 
ATOM   3719 O OD2 . ASP B 1 123 ? 34.889  2.914   -5.298  1.00 26.48 ? 123 ASP B OD2 1 
ATOM   3720 N N   . SER B 1 124 ? 37.969  6.149   -7.574  1.00 33.71 ? 124 SER B N   1 
ATOM   3721 C CA  . SER B 1 124 ? 38.322  4.775   -8.113  1.00 37.28 ? 124 SER B CA  1 
ATOM   3722 C C   . SER B 1 124 ? 37.524  4.236   -9.357  1.00 38.36 ? 124 SER B C   1 
ATOM   3723 O O   . SER B 1 124 ? 37.733  4.749   -10.434 1.00 42.45 ? 124 SER B O   1 
ATOM   3724 C CB  . SER B 1 124 ? 38.570  3.615   -7.066  1.00 41.69 ? 124 SER B CB  1 
ATOM   3725 O OG  . SER B 1 124 ? 37.365  2.909   -6.612  1.00 44.54 ? 124 SER B OG  1 
ATOM   3726 N N   . SER B 1 125 ? 36.555  3.250   -9.240  1.00 40.00 ? 125 SER B N   1 
ATOM   3727 C CA  . SER B 1 125 ? 35.572  2.866   -10.333 1.00 39.84 ? 125 SER B CA  1 
ATOM   3728 C C   . SER B 1 125 ? 34.986  3.989   -11.319 1.00 41.32 ? 125 SER B C   1 
ATOM   3729 O O   . SER B 1 125 ? 35.109  4.031   -12.565 1.00 39.53 ? 125 SER B O   1 
ATOM   3730 C CB  . SER B 1 125 ? 34.360  2.037   -9.745  1.00 38.81 ? 125 SER B CB  1 
ATOM   3731 O OG  . SER B 1 125 ? 33.290  2.893   -9.143  1.00 35.17 ? 125 SER B OG  1 
ATOM   3732 N N   . LYS B 1 126 ? 34.306  4.935   -10.564 1.00 44.35 ? 126 LYS B N   1 
ATOM   3733 C CA  . LYS B 1 126 ? 34.068  6.338   -10.953 1.00 42.00 ? 126 LYS B CA  1 
ATOM   3734 C C   . LYS B 1 126 ? 35.035  7.134   -10.135 1.00 39.59 ? 126 LYS B C   1 
ATOM   3735 O O   . LYS B 1 126 ? 35.308  6.760   -9.000  1.00 40.39 ? 126 LYS B O   1 
ATOM   3736 C CB  . LYS B 1 126 ? 32.673  6.968   -10.648 1.00 43.53 ? 126 LYS B CB  1 
ATOM   3737 C CG  . LYS B 1 126 ? 31.439  6.080   -10.425 1.00 44.14 ? 126 LYS B CG  1 
ATOM   3738 C CD  . LYS B 1 126 ? 30.126  6.891   -10.380 1.00 45.17 ? 126 LYS B CD  1 
ATOM   3739 C CE  . LYS B 1 126 ? 29.158  6.625   -11.558 1.00 42.49 ? 126 LYS B CE  1 
ATOM   3740 N NZ  . LYS B 1 126 ? 28.668  5.192   -11.607 1.00 47.31 ? 126 LYS B NZ  1 
ATOM   3741 N N   . ASP B 1 127 ? 35.515  8.204   -10.772 1.00 34.83 ? 127 ASP B N   1 
ATOM   3742 C CA  . ASP B 1 127 ? 36.582  8.983   -10.136 1.00 30.04 ? 127 ASP B CA  1 
ATOM   3743 C C   . ASP B 1 127 ? 36.035  9.781   -9.018  1.00 28.89 ? 127 ASP B C   1 
ATOM   3744 O O   . ASP B 1 127 ? 34.822  10.021  -8.951  1.00 28.80 ? 127 ASP B O   1 
ATOM   3745 C CB  . ASP B 1 127 ? 37.351  9.742   -11.230 1.00 25.98 ? 127 ASP B CB  1 
ATOM   3746 C CG  . ASP B 1 127 ? 37.220  11.219  -11.159 1.00 21.35 ? 127 ASP B CG  1 
ATOM   3747 O OD1 . ASP B 1 127 ? 37.551  11.790  -10.147 1.00 15.92 ? 127 ASP B OD1 1 
ATOM   3748 O OD2 . ASP B 1 127 ? 36.749  11.830  -12.111 1.00 22.44 ? 127 ASP B OD2 1 
ATOM   3749 N N   . PRO B 1 128 ? 36.995  10.169  -8.140  1.00 27.92 ? 128 PRO B N   1 
ATOM   3750 C CA  . PRO B 1 128 ? 36.624  11.104  -7.052  1.00 26.81 ? 128 PRO B CA  1 
ATOM   3751 C C   . PRO B 1 128 ? 35.391  11.968  -7.333  1.00 25.20 ? 128 PRO B C   1 
ATOM   3752 O O   . PRO B 1 128 ? 34.247  11.756  -6.873  1.00 26.47 ? 128 PRO B O   1 
ATOM   3753 C CB  . PRO B 1 128 ? 37.941  11.894  -6.868  1.00 27.74 ? 128 PRO B CB  1 
ATOM   3754 C CG  . PRO B 1 128 ? 39.081  10.892  -7.207  1.00 31.83 ? 128 PRO B CG  1 
ATOM   3755 C CD  . PRO B 1 128 ? 38.443  9.836   -8.111  1.00 29.45 ? 128 PRO B CD  1 
ATOM   3756 N N   . ILE B 1 129 ? 35.740  12.967  -8.191  1.00 22.73 ? 129 ILE B N   1 
ATOM   3757 C CA  . ILE B 1 129 ? 34.815  14.075  -8.495  1.00 20.91 ? 129 ILE B CA  1 
ATOM   3758 C C   . ILE B 1 129 ? 33.437  13.469  -8.820  1.00 20.25 ? 129 ILE B C   1 
ATOM   3759 O O   . ILE B 1 129 ? 32.485  13.692  -8.086  1.00 22.06 ? 129 ILE B O   1 
ATOM   3760 C CB  . ILE B 1 129 ? 35.371  14.978  -9.604  1.00 22.00 ? 129 ILE B CB  1 
ATOM   3761 C CG1 . ILE B 1 129 ? 36.297  16.104  -9.248  1.00 18.90 ? 129 ILE B CG1 1 
ATOM   3762 C CG2 . ILE B 1 129 ? 34.305  15.649  -10.415 1.00 25.54 ? 129 ILE B CG2 1 
ATOM   3763 C CD1 . ILE B 1 129 ? 37.040  15.695  -7.980  1.00 22.87 ? 129 ILE B CD1 1 
ATOM   3764 N N   . ASP B 1 130 ? 33.359  12.619  -9.888  1.00 20.28 ? 130 ASP B N   1 
ATOM   3765 C CA  . ASP B 1 130 ? 31.941  12.395  -10.297 1.00 19.83 ? 130 ASP B CA  1 
ATOM   3766 C C   . ASP B 1 130 ? 31.079  11.824  -9.170  1.00 22.92 ? 130 ASP B C   1 
ATOM   3767 O O   . ASP B 1 130 ? 29.937  12.197  -9.110  1.00 25.99 ? 130 ASP B O   1 
ATOM   3768 C CB  . ASP B 1 130 ? 31.741  11.757  -11.728 1.00 19.98 ? 130 ASP B CB  1 
ATOM   3769 C CG  . ASP B 1 130 ? 32.667  12.517  -12.737 1.00 15.21 ? 130 ASP B CG  1 
ATOM   3770 O OD1 . ASP B 1 130 ? 32.804  13.797  -12.739 1.00 13.32 ? 130 ASP B OD1 1 
ATOM   3771 O OD2 . ASP B 1 130 ? 33.304  11.785  -13.474 1.00 12.68 ? 130 ASP B OD2 1 
ATOM   3772 N N   . VAL B 1 131 ? 31.707  11.086  -8.154  1.00 23.07 ? 131 VAL B N   1 
ATOM   3773 C CA  . VAL B 1 131 ? 31.033  10.762  -6.852  1.00 22.03 ? 131 VAL B CA  1 
ATOM   3774 C C   . VAL B 1 131 ? 30.839  11.940  -5.849  1.00 24.00 ? 131 VAL B C   1 
ATOM   3775 O O   . VAL B 1 131 ? 29.804  12.079  -5.203  1.00 24.16 ? 131 VAL B O   1 
ATOM   3776 C CB  . VAL B 1 131 ? 31.652  9.508   -6.203  1.00 19.26 ? 131 VAL B CB  1 
ATOM   3777 C CG1 . VAL B 1 131 ? 30.713  8.821   -5.213  1.00 15.98 ? 131 VAL B CG1 1 
ATOM   3778 C CG2 . VAL B 1 131 ? 32.075  8.514   -7.271  1.00 21.49 ? 131 VAL B CG2 1 
ATOM   3779 N N   . ASN B 1 132 ? 31.821  12.851  -5.842  1.00 24.20 ? 132 ASN B N   1 
ATOM   3780 C CA  . ASN B 1 132 ? 31.393  14.137  -5.200  1.00 23.42 ? 132 ASN B CA  1 
ATOM   3781 C C   . ASN B 1 132 ? 30.112  14.921  -5.758  1.00 24.22 ? 132 ASN B C   1 
ATOM   3782 O O   . ASN B 1 132 ? 29.044  14.985  -5.087  1.00 23.41 ? 132 ASN B O   1 
ATOM   3783 C CB  . ASN B 1 132 ? 32.569  15.078  -4.827  1.00 22.19 ? 132 ASN B CB  1 
ATOM   3784 C CG  . ASN B 1 132 ? 33.403  14.234  -3.879  1.00 22.66 ? 132 ASN B CG  1 
ATOM   3785 O OD1 . ASN B 1 132 ? 32.850  13.469  -3.048  1.00 21.13 ? 132 ASN B OD1 1 
ATOM   3786 N ND2 . ASN B 1 132 ? 34.734  14.377  -4.062  1.00 22.77 ? 132 ASN B ND2 1 
ATOM   3787 N N   . TYR B 1 133 ? 30.230  15.450  -7.044  1.00 20.55 ? 133 TYR B N   1 
ATOM   3788 C CA  . TYR B 1 133 ? 28.997  15.895  -7.746  1.00 19.55 ? 133 TYR B CA  1 
ATOM   3789 C C   . TYR B 1 133 ? 27.652  15.025  -7.784  1.00 14.58 ? 133 TYR B C   1 
ATOM   3790 O O   . TYR B 1 133 ? 26.551  15.523  -7.538  1.00 12.18 ? 133 TYR B O   1 
ATOM   3791 C CB  . TYR B 1 133 ? 29.507  16.334  -9.088  1.00 20.51 ? 133 TYR B CB  1 
ATOM   3792 C CG  . TYR B 1 133 ? 28.339  16.763  -9.895  1.00 18.07 ? 133 TYR B CG  1 
ATOM   3793 C CD1 . TYR B 1 133 ? 27.844  18.059  -9.686  1.00 20.15 ? 133 TYR B CD1 1 
ATOM   3794 C CD2 . TYR B 1 133 ? 27.769  15.888  -10.820 1.00 16.73 ? 133 TYR B CD2 1 
ATOM   3795 C CE1 . TYR B 1 133 ? 26.796  18.516  -10.507 1.00 13.66 ? 133 TYR B CE1 1 
ATOM   3796 C CE2 . TYR B 1 133 ? 26.653  16.276  -11.557 1.00 14.42 ? 133 TYR B CE2 1 
ATOM   3797 C CZ  . TYR B 1 133 ? 26.199  17.604  -11.427 1.00 11.03 ? 133 TYR B CZ  1 
ATOM   3798 O OH  . TYR B 1 133 ? 25.145  18.067  -12.147 1.00 17.62 ? 133 TYR B OH  1 
ATOM   3799 N N   . GLU B 1 134 ? 27.820  13.719  -7.940  1.00 13.95 ? 134 GLU B N   1 
ATOM   3800 C CA  . GLU B 1 134 ? 26.763  12.854  -7.495  1.00 15.35 ? 134 GLU B CA  1 
ATOM   3801 C C   . GLU B 1 134 ? 26.193  13.048  -6.033  1.00 15.49 ? 134 GLU B C   1 
ATOM   3802 O O   . GLU B 1 134 ? 24.977  13.118  -5.818  1.00 18.56 ? 134 GLU B O   1 
ATOM   3803 C CB  . GLU B 1 134 ? 27.199  11.441  -7.866  1.00 19.20 ? 134 GLU B CB  1 
ATOM   3804 C CG  . GLU B 1 134 ? 26.676  10.497  -9.059  1.00 24.03 ? 134 GLU B CG  1 
ATOM   3805 C CD  . GLU B 1 134 ? 26.718  10.960  -10.569 1.00 26.34 ? 134 GLU B CD  1 
ATOM   3806 O OE1 . GLU B 1 134 ? 26.992  10.133  -11.464 1.00 31.22 ? 134 GLU B OE1 1 
ATOM   3807 O OE2 . GLU B 1 134 ? 26.414  12.124  -10.850 1.00 28.08 ? 134 GLU B OE2 1 
ATOM   3808 N N   . LYS B 1 135 ? 27.036  13.202  -4.955  1.00 15.62 ? 135 LYS B N   1 
ATOM   3809 C CA  . LYS B 1 135 ? 26.383  13.359  -3.581  1.00 13.40 ? 135 LYS B CA  1 
ATOM   3810 C C   . LYS B 1 135 ? 25.838  14.808  -3.348  1.00 13.71 ? 135 LYS B C   1 
ATOM   3811 O O   . LYS B 1 135 ? 24.940  15.163  -2.579  1.00 13.53 ? 135 LYS B O   1 
ATOM   3812 C CB  . LYS B 1 135 ? 27.250  12.889  -2.302  1.00 10.95 ? 135 LYS B CB  1 
ATOM   3813 C CG  . LYS B 1 135 ? 27.254  11.394  -1.875  1.00 9.53  ? 135 LYS B CG  1 
ATOM   3814 C CD  . LYS B 1 135 ? 28.685  10.799  -1.855  1.00 13.20 ? 135 LYS B CD  1 
ATOM   3815 C CE  . LYS B 1 135 ? 29.840  11.914  -1.859  1.00 21.43 ? 135 LYS B CE  1 
ATOM   3816 N NZ  . LYS B 1 135 ? 31.276  11.451  -1.694  1.00 23.18 ? 135 LYS B NZ  1 
ATOM   3817 N N   . LEU B 1 136 ? 26.363  15.725  -4.143  1.00 12.23 ? 136 LEU B N   1 
ATOM   3818 C CA  . LEU B 1 136 ? 25.595  16.959  -3.982  1.00 11.33 ? 136 LEU B CA  1 
ATOM   3819 C C   . LEU B 1 136 ? 24.068  16.866  -4.180  1.00 13.70 ? 136 LEU B C   1 
ATOM   3820 O O   . LEU B 1 136 ? 23.390  17.822  -3.955  1.00 15.94 ? 136 LEU B O   1 
ATOM   3821 C CB  . LEU B 1 136 ? 26.164  17.890  -5.023  1.00 9.87  ? 136 LEU B CB  1 
ATOM   3822 C CG  . LEU B 1 136 ? 27.513  18.277  -4.568  1.00 7.22  ? 136 LEU B CG  1 
ATOM   3823 C CD1 . LEU B 1 136 ? 28.226  18.944  -5.692  1.00 7.19  ? 136 LEU B CD1 1 
ATOM   3824 C CD2 . LEU B 1 136 ? 27.274  19.274  -3.431  1.00 10.94 ? 136 LEU B CD2 1 
ATOM   3825 N N   . LYS B 1 137 ? 23.573  15.758  -4.749  1.00 13.15 ? 137 LYS B N   1 
ATOM   3826 C CA  . LYS B 1 137 ? 22.281  15.939  -5.422  1.00 13.51 ? 137 LYS B CA  1 
ATOM   3827 C C   . LYS B 1 137 ? 21.848  17.296  -6.015  1.00 11.97 ? 137 LYS B C   1 
ATOM   3828 O O   . LYS B 1 137 ? 20.718  17.749  -6.083  1.00 15.11 ? 137 LYS B O   1 
ATOM   3829 C CB  . LYS B 1 137 ? 21.146  15.325  -4.632  1.00 12.27 ? 137 LYS B CB  1 
ATOM   3830 C CG  . LYS B 1 137 ? 21.166  13.796  -4.378  1.00 15.27 ? 137 LYS B CG  1 
ATOM   3831 C CD  . LYS B 1 137 ? 21.993  13.193  -3.241  1.00 14.28 ? 137 LYS B CD  1 
ATOM   3832 C CE  . LYS B 1 137 ? 21.201  12.018  -2.631  1.00 17.43 ? 137 LYS B CE  1 
ATOM   3833 N NZ  . LYS B 1 137 ? 21.278  10.724  -3.411  1.00 13.64 ? 137 LYS B NZ  1 
ATOM   3834 N N   . THR B 1 138 ? 22.864  17.872  -6.598  1.00 11.79 ? 138 THR B N   1 
ATOM   3835 C CA  . THR B 1 138 ? 22.562  18.946  -7.547  1.00 11.06 ? 138 THR B CA  1 
ATOM   3836 C C   . THR B 1 138 ? 22.935  18.815  -9.093  1.00 13.44 ? 138 THR B C   1 
ATOM   3837 O O   . THR B 1 138 ? 23.650  17.884  -9.515  1.00 12.75 ? 138 THR B O   1 
ATOM   3838 C CB  . THR B 1 138 ? 22.927  20.235  -6.851  1.00 9.81  ? 138 THR B CB  1 
ATOM   3839 O OG1 . THR B 1 138 ? 21.646  20.489  -6.389  1.00 8.61  ? 138 THR B OG1 1 
ATOM   3840 C CG2 . THR B 1 138 ? 23.587  21.430  -7.601  1.00 2.00  ? 138 THR B CG2 1 
ATOM   3841 N N   . ASP B 1 139 ? 22.370  19.821  -9.856  1.00 10.41 ? 139 ASP B N   1 
ATOM   3842 C CA  . ASP B 1 139 ? 22.723  20.017  -11.237 1.00 11.67 ? 139 ASP B CA  1 
ATOM   3843 C C   . ASP B 1 139 ? 23.388  21.390  -11.754 1.00 9.12  ? 139 ASP B C   1 
ATOM   3844 O O   . ASP B 1 139 ? 22.700  22.415  -11.743 1.00 7.80  ? 139 ASP B O   1 
ATOM   3845 C CB  . ASP B 1 139 ? 21.517  19.412  -12.083 1.00 16.54 ? 139 ASP B CB  1 
ATOM   3846 C CG  . ASP B 1 139 ? 21.931  19.245  -13.579 1.00 21.77 ? 139 ASP B CG  1 
ATOM   3847 O OD1 . ASP B 1 139 ? 22.444  18.192  -14.051 1.00 19.49 ? 139 ASP B OD1 1 
ATOM   3848 O OD2 . ASP B 1 139 ? 21.783  20.267  -14.225 1.00 24.80 ? 139 ASP B OD2 1 
ATOM   3849 N N   . ILE B 1 140 ? 24.716  21.380  -12.143 1.00 5.61  ? 140 ILE B N   1 
ATOM   3850 C CA  . ILE B 1 140 ? 25.333  22.693  -12.096 1.00 5.24  ? 140 ILE B CA  1 
ATOM   3851 C C   . ILE B 1 140 ? 25.865  23.029  -13.458 1.00 7.20  ? 140 ILE B C   1 
ATOM   3852 O O   . ILE B 1 140 ? 27.045  22.843  -13.800 1.00 9.31  ? 140 ILE B O   1 
ATOM   3853 C CB  . ILE B 1 140 ? 26.607  22.985  -11.238 1.00 6.30  ? 140 ILE B CB  1 
ATOM   3854 C CG1 . ILE B 1 140 ? 27.253  22.015  -10.220 1.00 9.88  ? 140 ILE B CG1 1 
ATOM   3855 C CG2 . ILE B 1 140 ? 26.692  24.447  -10.798 1.00 2.00  ? 140 ILE B CG2 1 
ATOM   3856 C CD1 . ILE B 1 140 ? 26.750  21.914  -8.799  1.00 7.92  ? 140 ILE B CD1 1 
ATOM   3857 N N   . LYS B 1 141 ? 24.984  23.686  -14.246 1.00 10.95 ? 141 LYS B N   1 
ATOM   3858 C CA  . LYS B 1 141 ? 25.338  24.083  -15.623 1.00 11.73 ? 141 LYS B CA  1 
ATOM   3859 C C   . LYS B 1 141 ? 26.103  25.347  -15.917 1.00 10.41 ? 141 LYS B C   1 
ATOM   3860 O O   . LYS B 1 141 ? 26.023  26.320  -15.191 1.00 11.84 ? 141 LYS B O   1 
ATOM   3861 C CB  . LYS B 1 141 ? 24.053  24.026  -16.407 1.00 15.74 ? 141 LYS B CB  1 
ATOM   3862 C CG  . LYS B 1 141 ? 23.521  22.555  -16.534 1.00 18.19 ? 141 LYS B CG  1 
ATOM   3863 C CD  . LYS B 1 141 ? 22.056  22.438  -17.082 1.00 21.86 ? 141 LYS B CD  1 
ATOM   3864 C CE  . LYS B 1 141 ? 21.817  21.466  -18.260 1.00 25.04 ? 141 LYS B CE  1 
ATOM   3865 N NZ  . LYS B 1 141 ? 21.774  20.017  -17.925 1.00 22.69 ? 141 LYS B NZ  1 
ATOM   3866 N N   . VAL B 1 142 ? 26.907  25.345  -16.990 1.00 8.44  ? 142 VAL B N   1 
ATOM   3867 C CA  . VAL B 1 142 ? 27.684  26.608  -17.143 1.00 7.32  ? 142 VAL B CA  1 
ATOM   3868 C C   . VAL B 1 142 ? 27.101  27.847  -17.863 1.00 6.85  ? 142 VAL B C   1 
ATOM   3869 O O   . VAL B 1 142 ? 27.236  28.027  -19.056 1.00 8.93  ? 142 VAL B O   1 
ATOM   3870 C CB  . VAL B 1 142 ? 29.068  26.353  -17.622 1.00 5.78  ? 142 VAL B CB  1 
ATOM   3871 C CG1 . VAL B 1 142 ? 29.741  27.720  -17.451 1.00 15.33 ? 142 VAL B CG1 1 
ATOM   3872 C CG2 . VAL B 1 142 ? 29.788  25.355  -16.728 1.00 2.00  ? 142 VAL B CG2 1 
ATOM   3873 N N   . VAL B 1 143 ? 26.438  28.747  -17.114 1.00 6.22  ? 143 VAL B N   1 
ATOM   3874 C CA  . VAL B 1 143 ? 25.857  29.897  -17.862 1.00 6.94  ? 143 VAL B CA  1 
ATOM   3875 C C   . VAL B 1 143 ? 26.904  30.451  -18.646 1.00 9.10  ? 143 VAL B C   1 
ATOM   3876 O O   . VAL B 1 143 ? 28.024  30.641  -18.175 1.00 13.42 ? 143 VAL B O   1 
ATOM   3877 C CB  . VAL B 1 143 ? 25.426  31.064  -17.015 1.00 7.34  ? 143 VAL B CB  1 
ATOM   3878 C CG1 . VAL B 1 143 ? 24.871  32.307  -17.647 1.00 5.64  ? 143 VAL B CG1 1 
ATOM   3879 C CG2 . VAL B 1 143 ? 24.335  30.523  -16.161 1.00 10.80 ? 143 VAL B CG2 1 
ATOM   3880 N N   . ASP B 1 144 ? 26.492  30.469  -19.905 1.00 11.21 ? 144 ASP B N   1 
ATOM   3881 C CA  . ASP B 1 144 ? 27.392  30.870  -21.029 1.00 12.60 ? 144 ASP B CA  1 
ATOM   3882 C C   . ASP B 1 144 ? 27.818  32.301  -21.096 1.00 9.58  ? 144 ASP B C   1 
ATOM   3883 O O   . ASP B 1 144 ? 27.034  33.228  -21.013 1.00 9.04  ? 144 ASP B O   1 
ATOM   3884 C CB  . ASP B 1 144 ? 26.679  30.453  -22.283 1.00 15.87 ? 144 ASP B CB  1 
ATOM   3885 C CG  . ASP B 1 144 ? 27.352  30.747  -23.615 1.00 15.58 ? 144 ASP B CG  1 
ATOM   3886 O OD1 . ASP B 1 144 ? 27.264  31.942  -24.115 1.00 13.76 ? 144 ASP B OD1 1 
ATOM   3887 O OD2 . ASP B 1 144 ? 27.882  29.709  -24.140 1.00 17.30 ? 144 ASP B OD2 1 
ATOM   3888 N N   . ARG B 1 145 ? 29.138  32.437  -21.241 1.00 7.45  ? 145 ARG B N   1 
ATOM   3889 C CA  . ARG B 1 145 ? 29.594  33.750  -20.733 1.00 8.00  ? 145 ARG B CA  1 
ATOM   3890 C C   . ARG B 1 145 ? 29.039  34.920  -21.393 1.00 14.03 ? 145 ARG B C   1 
ATOM   3891 O O   . ARG B 1 145 ? 29.072  35.963  -20.822 1.00 14.94 ? 145 ARG B O   1 
ATOM   3892 C CB  . ARG B 1 145 ? 31.066  34.235  -20.756 1.00 2.21  ? 145 ARG B CB  1 
ATOM   3893 C CG  . ARG B 1 145 ? 31.940  33.136  -20.253 1.00 5.97  ? 145 ARG B CG  1 
ATOM   3894 C CD  . ARG B 1 145 ? 32.080  32.016  -21.252 1.00 13.83 ? 145 ARG B CD  1 
ATOM   3895 N NE  . ARG B 1 145 ? 31.394  30.744  -20.986 1.00 17.62 ? 145 ARG B NE  1 
ATOM   3896 C CZ  . ARG B 1 145 ? 31.268  29.994  -22.122 1.00 18.97 ? 145 ARG B CZ  1 
ATOM   3897 N NH1 . ARG B 1 145 ? 31.636  30.505  -23.362 1.00 23.55 ? 145 ARG B NH1 1 
ATOM   3898 N NH2 . ARG B 1 145 ? 30.788  28.716  -21.996 1.00 20.75 ? 145 ARG B NH2 1 
ATOM   3899 N N   . ASP B 1 146 ? 28.649  34.610  -22.629 1.00 22.63 ? 146 ASP B N   1 
ATOM   3900 C CA  . ASP B 1 146 ? 28.157  35.624  -23.602 1.00 31.90 ? 146 ASP B CA  1 
ATOM   3901 C C   . ASP B 1 146 ? 26.706  35.412  -24.126 1.00 32.57 ? 146 ASP B C   1 
ATOM   3902 O O   . ASP B 1 146 ? 26.143  36.169  -24.903 1.00 35.80 ? 146 ASP B O   1 
ATOM   3903 C CB  . ASP B 1 146 ? 29.137  35.879  -24.809 1.00 38.59 ? 146 ASP B CB  1 
ATOM   3904 C CG  . ASP B 1 146 ? 30.320  36.795  -24.413 1.00 42.40 ? 146 ASP B CG  1 
ATOM   3905 O OD1 . ASP B 1 146 ? 31.471  36.465  -24.734 1.00 44.63 ? 146 ASP B OD1 1 
ATOM   3906 O OD2 . ASP B 1 146 ? 30.056  37.815  -23.797 1.00 40.50 ? 146 ASP B OD2 1 
ATOM   3907 N N   . SER B 1 147 ? 26.104  34.327  -23.613 1.00 30.31 ? 147 SER B N   1 
ATOM   3908 C CA  . SER B 1 147 ? 24.707  34.324  -23.109 1.00 22.53 ? 147 SER B CA  1 
ATOM   3909 C C   . SER B 1 147 ? 24.240  35.484  -22.294 1.00 19.74 ? 147 SER B C   1 
ATOM   3910 O O   . SER B 1 147 ? 25.033  36.062  -21.584 1.00 15.00 ? 147 SER B O   1 
ATOM   3911 C CB  . SER B 1 147 ? 24.433  33.084  -22.239 1.00 18.46 ? 147 SER B CB  1 
ATOM   3912 O OG  . SER B 1 147 ? 23.289  33.344  -21.460 1.00 18.95 ? 147 SER B OG  1 
ATOM   3913 N N   . GLU B 1 148 ? 22.915  35.750  -22.457 1.00 21.13 ? 148 GLU B N   1 
ATOM   3914 C CA  . GLU B 1 148 ? 22.395  37.044  -21.953 1.00 24.05 ? 148 GLU B CA  1 
ATOM   3915 C C   . GLU B 1 148 ? 22.010  37.059  -20.546 1.00 23.24 ? 148 GLU B C   1 
ATOM   3916 O O   . GLU B 1 148 ? 22.038  38.140  -19.954 1.00 24.15 ? 148 GLU B O   1 
ATOM   3917 C CB  . GLU B 1 148 ? 21.292  37.827  -22.746 1.00 25.40 ? 148 GLU B CB  1 
ATOM   3918 C CG  . GLU B 1 148 ? 21.898  38.455  -24.073 1.00 27.63 ? 148 GLU B CG  1 
ATOM   3919 C CD  . GLU B 1 148 ? 20.912  38.909  -25.162 1.00 20.49 ? 148 GLU B CD  1 
ATOM   3920 O OE1 . GLU B 1 148 ? 20.561  40.105  -25.204 1.00 18.47 ? 148 GLU B OE1 1 
ATOM   3921 O OE2 . GLU B 1 148 ? 20.539  38.036  -25.954 1.00 22.79 ? 148 GLU B OE2 1 
ATOM   3922 N N   . GLU B 1 149 ? 21.788  35.810  -20.026 1.00 20.57 ? 149 GLU B N   1 
ATOM   3923 C CA  . GLU B 1 149 ? 21.728  35.789  -18.533 1.00 13.23 ? 149 GLU B CA  1 
ATOM   3924 C C   . GLU B 1 149 ? 22.992  36.322  -18.033 1.00 11.09 ? 149 GLU B C   1 
ATOM   3925 O O   . GLU B 1 149 ? 22.922  37.436  -17.556 1.00 15.72 ? 149 GLU B O   1 
ATOM   3926 C CB  . GLU B 1 149 ? 21.586  34.477  -17.825 1.00 14.82 ? 149 GLU B CB  1 
ATOM   3927 C CG  . GLU B 1 149 ? 20.388  33.755  -18.382 1.00 17.98 ? 149 GLU B CG  1 
ATOM   3928 C CD  . GLU B 1 149 ? 20.614  32.328  -17.988 1.00 20.17 ? 149 GLU B CD  1 
ATOM   3929 O OE1 . GLU B 1 149 ? 21.607  31.657  -18.402 1.00 23.42 ? 149 GLU B OE1 1 
ATOM   3930 O OE2 . GLU B 1 149 ? 19.756  31.901  -17.218 1.00 23.96 ? 149 GLU B OE2 1 
ATOM   3931 N N   . ALA B 1 150 ? 24.114  35.637  -18.311 1.00 2.89  ? 150 ALA B N   1 
ATOM   3932 C CA  . ALA B 1 150 ? 25.380  36.294  -17.912 1.00 7.21  ? 150 ALA B CA  1 
ATOM   3933 C C   . ALA B 1 150 ? 25.461  37.796  -17.923 1.00 9.21  ? 150 ALA B C   1 
ATOM   3934 O O   . ALA B 1 150 ? 25.715  38.449  -16.925 1.00 12.46 ? 150 ALA B O   1 
ATOM   3935 C CB  . ALA B 1 150 ? 26.536  35.957  -18.798 1.00 7.33  ? 150 ALA B CB  1 
ATOM   3936 N N   . GLU B 1 151 ? 25.046  38.309  -19.086 1.00 11.28 ? 151 GLU B N   1 
ATOM   3937 C CA  . GLU B 1 151 ? 25.043  39.788  -19.309 1.00 12.40 ? 151 GLU B CA  1 
ATOM   3938 C C   . GLU B 1 151 ? 24.227  40.445  -18.118 1.00 9.82  ? 151 GLU B C   1 
ATOM   3939 O O   . GLU B 1 151 ? 24.636  41.306  -17.370 1.00 3.93  ? 151 GLU B O   1 
ATOM   3940 C CB  . GLU B 1 151 ? 24.516  39.866  -20.822 1.00 13.95 ? 151 GLU B CB  1 
ATOM   3941 C CG  . GLU B 1 151 ? 24.463  41.136  -21.728 1.00 28.92 ? 151 GLU B CG  1 
ATOM   3942 C CD  . GLU B 1 151 ? 25.580  41.282  -22.851 1.00 36.27 ? 151 GLU B CD  1 
ATOM   3943 O OE1 . GLU B 1 151 ? 25.447  42.153  -23.768 1.00 38.07 ? 151 GLU B OE1 1 
ATOM   3944 O OE2 . GLU B 1 151 ? 26.581  40.534  -22.792 1.00 43.83 ? 151 GLU B OE2 1 
ATOM   3945 N N   . ILE B 1 152 ? 23.001  39.933  -17.901 1.00 8.24  ? 152 ILE B N   1 
ATOM   3946 C CA  . ILE B 1 152 ? 22.186  40.434  -16.776 1.00 11.06 ? 152 ILE B CA  1 
ATOM   3947 C C   . ILE B 1 152 ? 22.741  40.175  -15.295 1.00 9.99  ? 152 ILE B C   1 
ATOM   3948 O O   . ILE B 1 152 ? 22.823  41.014  -14.375 1.00 9.70  ? 152 ILE B O   1 
ATOM   3949 C CB  . ILE B 1 152 ? 20.736  39.888  -16.954 1.00 14.76 ? 152 ILE B CB  1 
ATOM   3950 C CG1 . ILE B 1 152 ? 19.668  40.956  -16.977 1.00 21.83 ? 152 ILE B CG1 1 
ATOM   3951 C CG2 . ILE B 1 152 ? 20.256  39.019  -15.786 1.00 15.68 ? 152 ILE B CG2 1 
ATOM   3952 C CD1 . ILE B 1 152 ? 18.447  40.096  -17.366 1.00 19.09 ? 152 ILE B CD1 1 
ATOM   3953 N N   . ILE B 1 153 ? 23.194  38.914  -15.127 1.00 7.97  ? 153 ILE B N   1 
ATOM   3954 C CA  . ILE B 1 153 ? 23.720  38.692  -13.792 1.00 4.53  ? 153 ILE B CA  1 
ATOM   3955 C C   . ILE B 1 153 ? 24.878  39.692  -13.469 1.00 3.23  ? 153 ILE B C   1 
ATOM   3956 O O   . ILE B 1 153 ? 24.834  40.554  -12.599 1.00 5.95  ? 153 ILE B O   1 
ATOM   3957 C CB  . ILE B 1 153 ? 24.072  37.228  -13.600 1.00 2.00  ? 153 ILE B CB  1 
ATOM   3958 C CG1 . ILE B 1 153 ? 22.826  36.479  -13.867 1.00 2.00  ? 153 ILE B CG1 1 
ATOM   3959 C CG2 . ILE B 1 153 ? 24.494  37.006  -12.177 1.00 3.71  ? 153 ILE B CG2 1 
ATOM   3960 C CD1 . ILE B 1 153 ? 22.976  35.062  -14.423 1.00 2.00  ? 153 ILE B CD1 1 
ATOM   3961 N N   . ARG B 1 154 ? 25.876  39.673  -14.363 1.00 2.00  ? 154 ARG B N   1 
ATOM   3962 C CA  . ARG B 1 154 ? 26.918  40.676  -14.144 1.00 5.82  ? 154 ARG B CA  1 
ATOM   3963 C C   . ARG B 1 154 ? 26.459  42.067  -13.951 1.00 7.40  ? 154 ARG B C   1 
ATOM   3964 O O   . ARG B 1 154 ? 26.901  42.836  -13.153 1.00 4.21  ? 154 ARG B O   1 
ATOM   3965 C CB  . ARG B 1 154 ? 28.112  40.537  -15.064 1.00 5.21  ? 154 ARG B CB  1 
ATOM   3966 C CG  . ARG B 1 154 ? 28.753  39.146  -14.869 1.00 16.11 ? 154 ARG B CG  1 
ATOM   3967 C CD  . ARG B 1 154 ? 30.040  39.037  -15.699 1.00 20.25 ? 154 ARG B CD  1 
ATOM   3968 N NE  . ARG B 1 154 ? 29.653  39.167  -17.089 1.00 24.84 ? 154 ARG B NE  1 
ATOM   3969 C CZ  . ARG B 1 154 ? 29.195  38.037  -17.800 1.00 29.64 ? 154 ARG B CZ  1 
ATOM   3970 N NH1 . ARG B 1 154 ? 28.629  38.216  -19.022 1.00 28.87 ? 154 ARG B NH1 1 
ATOM   3971 N NH2 . ARG B 1 154 ? 29.349  36.777  -17.293 1.00 28.08 ? 154 ARG B NH2 1 
ATOM   3972 N N   . LYS B 1 155 ? 25.323  42.326  -14.553 1.00 14.16 ? 155 LYS B N   1 
ATOM   3973 C CA  . LYS B 1 155 ? 24.686  43.636  -14.331 1.00 17.69 ? 155 LYS B CA  1 
ATOM   3974 C C   . LYS B 1 155 ? 24.324  43.779  -12.878 1.00 15.05 ? 155 LYS B C   1 
ATOM   3975 O O   . LYS B 1 155 ? 24.628  44.813  -12.296 1.00 20.75 ? 155 LYS B O   1 
ATOM   3976 C CB  . LYS B 1 155 ? 23.392  43.846  -15.190 1.00 22.68 ? 155 LYS B CB  1 
ATOM   3977 C CG  . LYS B 1 155 ? 22.853  45.228  -15.636 1.00 28.07 ? 155 LYS B CG  1 
ATOM   3978 C CD  . LYS B 1 155 ? 21.681  45.079  -16.686 1.00 32.65 ? 155 LYS B CD  1 
ATOM   3979 C CE  . LYS B 1 155 ? 22.115  44.010  -17.762 1.00 38.77 ? 155 LYS B CE  1 
ATOM   3980 N NZ  . LYS B 1 155 ? 21.130  43.654  -18.841 1.00 39.10 ? 155 LYS B NZ  1 
ATOM   3981 N N   . TYR B 1 156 ? 23.641  42.708  -12.350 1.00 10.58 ? 156 TYR B N   1 
ATOM   3982 C CA  . TYR B 1 156 ? 23.123  42.756  -10.968 1.00 7.21  ? 156 TYR B CA  1 
ATOM   3983 C C   . TYR B 1 156 ? 24.258  42.849  -9.961  1.00 6.68  ? 156 TYR B C   1 
ATOM   3984 O O   . TYR B 1 156 ? 24.150  43.649  -9.024  1.00 4.52  ? 156 TYR B O   1 
ATOM   3985 C CB  . TYR B 1 156 ? 22.329  41.530  -10.555 1.00 8.78  ? 156 TYR B CB  1 
ATOM   3986 C CG  . TYR B 1 156 ? 21.503  41.693  -9.262  1.00 8.58  ? 156 TYR B CG  1 
ATOM   3987 C CD1 . TYR B 1 156 ? 21.278  42.864  -8.483  1.00 10.86 ? 156 TYR B CD1 1 
ATOM   3988 C CD2 . TYR B 1 156 ? 20.908  40.560  -8.810  1.00 2.00  ? 156 TYR B CD2 1 
ATOM   3989 C CE1 . TYR B 1 156 ? 20.504  42.793  -7.262  1.00 4.76  ? 156 TYR B CE1 1 
ATOM   3990 C CE2 . TYR B 1 156 ? 20.268  40.441  -7.600  1.00 2.00  ? 156 TYR B CE2 1 
ATOM   3991 C CZ  . TYR B 1 156 ? 19.917  41.593  -6.911  1.00 2.00  ? 156 TYR B CZ  1 
ATOM   3992 O OH  . TYR B 1 156 ? 18.850  41.536  -6.054  1.00 2.00  ? 156 TYR B OH  1 
ATOM   3993 N N   . VAL B 1 157 ? 25.365  42.073  -10.263 1.00 8.24  ? 157 VAL B N   1 
ATOM   3994 C CA  . VAL B 1 157 ? 26.680  42.337  -9.618  1.00 9.91  ? 157 VAL B CA  1 
ATOM   3995 C C   . VAL B 1 157 ? 27.216  43.803  -9.703  1.00 13.03 ? 157 VAL B C   1 
ATOM   3996 O O   . VAL B 1 157 ? 26.995  44.614  -8.814  1.00 15.96 ? 157 VAL B O   1 
ATOM   3997 C CB  . VAL B 1 157 ? 27.781  41.326  -9.931  1.00 6.96  ? 157 VAL B CB  1 
ATOM   3998 C CG1 . VAL B 1 157 ? 28.882  41.507  -8.864  1.00 6.20  ? 157 VAL B CG1 1 
ATOM   3999 C CG2 . VAL B 1 157 ? 27.440  39.882  -9.728  1.00 2.00  ? 157 VAL B CG2 1 
ATOM   4000 N N   . LYS B 1 158 ? 27.704  44.214  -10.850 1.00 12.39 ? 158 LYS B N   1 
ATOM   4001 C CA  . LYS B 1 158 ? 27.843  45.669  -10.950 1.00 11.68 ? 158 LYS B CA  1 
ATOM   4002 C C   . LYS B 1 158 ? 26.906  46.750  -10.350 1.00 11.18 ? 158 LYS B C   1 
ATOM   4003 O O   . LYS B 1 158 ? 27.317  47.735  -9.814  1.00 11.17 ? 158 LYS B O   1 
ATOM   4004 C CB  . LYS B 1 158 ? 28.180  45.884  -12.405 1.00 11.00 ? 158 LYS B CB  1 
ATOM   4005 C CG  . LYS B 1 158 ? 27.225  46.740  -13.165 1.00 10.51 ? 158 LYS B CG  1 
ATOM   4006 C CD  . LYS B 1 158 ? 27.657  48.206  -13.113 1.00 13.43 ? 158 LYS B CD  1 
ATOM   4007 C CE  . LYS B 1 158 ? 29.173  48.363  -12.751 1.00 13.34 ? 158 LYS B CE  1 
ATOM   4008 N NZ  . LYS B 1 158 ? 30.181  47.917  -13.777 1.00 18.57 ? 158 LYS B NZ  1 
ATOM   4009 N N   . ASN B 1 159 ? 25.631  46.682  -10.436 1.00 13.50 ? 159 ASN B N   1 
ATOM   4010 C CA  . ASN B 1 159 ? 25.005  47.818  -9.733  1.00 17.00 ? 159 ASN B CA  1 
ATOM   4011 C C   . ASN B 1 159 ? 24.586  47.757  -8.257  1.00 20.11 ? 159 ASN B C   1 
ATOM   4012 O O   . ASN B 1 159 ? 23.942  48.666  -7.739  1.00 20.54 ? 159 ASN B O   1 
ATOM   4013 C CB  . ASN B 1 159 ? 23.724  48.235  -10.376 1.00 19.67 ? 159 ASN B CB  1 
ATOM   4014 C CG  . ASN B 1 159 ? 23.674  48.163  -11.862 1.00 25.60 ? 159 ASN B CG  1 
ATOM   4015 O OD1 . ASN B 1 159 ? 24.568  47.770  -12.609 1.00 25.38 ? 159 ASN B OD1 1 
ATOM   4016 N ND2 . ASN B 1 159 ? 22.527  48.694  -12.277 1.00 26.18 ? 159 ASN B ND2 1 
ATOM   4017 N N   . THR B 1 160 ? 24.740  46.579  -7.650  1.00 20.92 ? 160 THR B N   1 
ATOM   4018 C CA  . THR B 1 160 ? 24.360  46.578  -6.217  1.00 17.49 ? 160 THR B CA  1 
ATOM   4019 C C   . THR B 1 160 ? 25.499  46.177  -5.188  1.00 18.47 ? 160 THR B C   1 
ATOM   4020 O O   . THR B 1 160 ? 25.286  45.790  -4.045  1.00 15.58 ? 160 THR B O   1 
ATOM   4021 C CB  . THR B 1 160 ? 23.074  45.760  -6.090  1.00 15.01 ? 160 THR B CB  1 
ATOM   4022 O OG1 . THR B 1 160 ? 23.294  44.431  -6.564  1.00 14.28 ? 160 THR B OG1 1 
ATOM   4023 C CG2 . THR B 1 160 ? 22.056  46.297  -7.047  1.00 9.91  ? 160 THR B CG2 1 
ATOM   4024 N N   . HIS B 1 161 ? 26.785  46.282  -5.605  1.00 19.05 ? 161 HIS B N   1 
ATOM   4025 C CA  . HIS B 1 161 ? 27.689  46.742  -4.536  1.00 17.87 ? 161 HIS B CA  1 
ATOM   4026 C C   . HIS B 1 161 ? 27.235  47.967  -3.651  1.00 20.31 ? 161 HIS B C   1 
ATOM   4027 O O   . HIS B 1 161 ? 26.125  48.479  -3.767  1.00 21.84 ? 161 HIS B O   1 
ATOM   4028 C CB  . HIS B 1 161 ? 29.106  46.960  -5.095  1.00 14.89 ? 161 HIS B CB  1 
ATOM   4029 C CG  . HIS B 1 161 ? 30.157  45.914  -4.694  1.00 17.70 ? 161 HIS B CG  1 
ATOM   4030 N ND1 . HIS B 1 161 ? 31.381  46.338  -4.380  1.00 17.77 ? 161 HIS B ND1 1 
ATOM   4031 C CD2 . HIS B 1 161 ? 30.178  44.471  -4.718  1.00 11.64 ? 161 HIS B CD2 1 
ATOM   4032 C CE1 . HIS B 1 161 ? 32.165  45.241  -4.266  1.00 14.20 ? 161 HIS B CE1 1 
ATOM   4033 N NE2 . HIS B 1 161 ? 31.440  44.093  -4.458  1.00 9.52  ? 161 HIS B NE2 1 
ATOM   4034 N N   . ALA B 1 162 ? 28.160  48.264  -2.643  1.00 20.47 ? 162 ALA B N   1 
ATOM   4035 C CA  . ALA B 1 162 ? 27.945  49.628  -2.085  1.00 18.76 ? 162 ALA B CA  1 
ATOM   4036 C C   . ALA B 1 162 ? 29.308  50.304  -1.744  1.00 21.04 ? 162 ALA B C   1 
ATOM   4037 O O   . ALA B 1 162 ? 30.203  49.539  -1.402  1.00 24.55 ? 162 ALA B O   1 
ATOM   4038 C CB  . ALA B 1 162 ? 27.214  49.480  -0.802  1.00 9.43  ? 162 ALA B CB  1 
ATOM   4039 N N   . THR B 1 163 ? 29.480  51.683  -1.801  1.00 22.40 ? 163 THR B N   1 
ATOM   4040 C CA  . THR B 1 163 ? 30.150  52.542  -0.785  1.00 22.80 ? 163 THR B CA  1 
ATOM   4041 C C   . THR B 1 163 ? 30.278  51.874  0.543   1.00 23.18 ? 163 THR B C   1 
ATOM   4042 O O   . THR B 1 163 ? 29.911  50.729  0.745   1.00 20.43 ? 163 THR B O   1 
ATOM   4043 C CB  . THR B 1 163 ? 29.239  53.651  -0.314  1.00 25.35 ? 163 THR B CB  1 
ATOM   4044 O OG1 . THR B 1 163 ? 27.897  53.048  -0.177  1.00 27.36 ? 163 THR B OG1 1 
ATOM   4045 C CG2 . THR B 1 163 ? 29.360  55.012  -1.066  1.00 25.60 ? 163 THR B CG2 1 
ATOM   4046 N N   . THR B 1 164 ? 30.806  52.582  1.587   1.00 24.95 ? 164 THR B N   1 
ATOM   4047 C CA  . THR B 1 164 ? 31.274  51.712  2.722   1.00 26.10 ? 164 THR B CA  1 
ATOM   4048 C C   . THR B 1 164 ? 32.117  50.510  2.170   1.00 29.18 ? 164 THR B C   1 
ATOM   4049 O O   . THR B 1 164 ? 32.609  50.692  1.055   1.00 27.73 ? 164 THR B O   1 
ATOM   4050 C CB  . THR B 1 164 ? 30.206  51.415  3.859   1.00 18.34 ? 164 THR B CB  1 
ATOM   4051 O OG1 . THR B 1 164 ? 30.019  50.030  4.154   1.00 19.44 ? 164 THR B OG1 1 
ATOM   4052 C CG2 . THR B 1 164 ? 28.896  52.187  3.878   1.00 18.59 ? 164 THR B CG2 1 
ATOM   4053 N N   . HIS B 1 165 ? 32.211  49.335  2.840   1.00 30.47 ? 165 HIS B N   1 
ATOM   4054 C CA  . HIS B 1 165 ? 32.822  48.175  2.108   1.00 29.19 ? 165 HIS B CA  1 
ATOM   4055 C C   . HIS B 1 165 ? 33.080  48.107  0.573   1.00 26.26 ? 165 HIS B C   1 
ATOM   4056 O O   . HIS B 1 165 ? 32.417  47.380  -0.181  1.00 26.35 ? 165 HIS B O   1 
ATOM   4057 C CB  . HIS B 1 165 ? 32.223  46.819  2.547   1.00 30.60 ? 165 HIS B CB  1 
ATOM   4058 C CG  . HIS B 1 165 ? 30.731  46.655  2.208   1.00 32.00 ? 165 HIS B CG  1 
ATOM   4059 N ND1 . HIS B 1 165 ? 29.781  47.552  2.511   1.00 36.84 ? 165 HIS B ND1 1 
ATOM   4060 C CD2 . HIS B 1 165 ? 30.093  45.547  1.656   1.00 35.00 ? 165 HIS B CD2 1 
ATOM   4061 C CE1 . HIS B 1 165 ? 28.556  47.021  2.197   1.00 34.70 ? 165 HIS B CE1 1 
ATOM   4062 N NE2 . HIS B 1 165 ? 28.756  45.786  1.671   1.00 38.03 ? 165 HIS B NE2 1 
ATOM   4063 N N   . ASN B 1 166 ? 34.159  48.820  0.298   1.00 26.94 ? 166 ASN B N   1 
ATOM   4064 C CA  . ASN B 1 166 ? 34.717  48.869  -1.012  1.00 30.05 ? 166 ASN B CA  1 
ATOM   4065 C C   . ASN B 1 166 ? 36.284  48.927  -0.962  1.00 31.23 ? 166 ASN B C   1 
ATOM   4066 O O   . ASN B 1 166 ? 37.018  49.844  -0.623  1.00 33.62 ? 166 ASN B O   1 
ATOM   4067 C CB  . ASN B 1 166 ? 34.003  50.018  -1.772  1.00 34.90 ? 166 ASN B CB  1 
ATOM   4068 C CG  . ASN B 1 166 ? 33.444  49.622  -3.196  1.00 34.97 ? 166 ASN B CG  1 
ATOM   4069 O OD1 . ASN B 1 166 ? 32.333  49.120  -3.375  1.00 34.74 ? 166 ASN B OD1 1 
ATOM   4070 N ND2 . ASN B 1 166 ? 34.416  49.697  -4.169  1.00 35.54 ? 166 ASN B ND2 1 
ATOM   4071 N N   . ALA B 1 167 ? 36.711  47.731  -1.468  1.00 26.44 ? 167 ALA B N   1 
ATOM   4072 C CA  . ALA B 1 167 ? 38.039  47.222  -1.234  1.00 25.70 ? 167 ALA B CA  1 
ATOM   4073 C C   . ALA B 1 167 ? 38.053  45.846  -0.636  1.00 25.33 ? 167 ALA B C   1 
ATOM   4074 O O   . ALA B 1 167 ? 38.500  45.622  0.486   1.00 26.64 ? 167 ALA B O   1 
ATOM   4075 C CB  . ALA B 1 167 ? 38.963  47.997  -0.265  1.00 23.85 ? 167 ALA B CB  1 
ATOM   4076 N N   . TYR B 1 168 ? 37.591  44.837  -1.407  1.00 24.88 ? 168 TYR B N   1 
ATOM   4077 C CA  . TYR B 1 168 ? 37.282  44.693  -2.890  1.00 22.84 ? 168 TYR B CA  1 
ATOM   4078 C C   . TYR B 1 168 ? 36.363  45.516  -3.820  1.00 24.09 ? 168 TYR B C   1 
ATOM   4079 O O   . TYR B 1 168 ? 35.422  46.185  -3.351  1.00 26.07 ? 168 TYR B O   1 
ATOM   4080 C CB  . TYR B 1 168 ? 36.747  43.299  -3.192  1.00 22.63 ? 168 TYR B CB  1 
ATOM   4081 C CG  . TYR B 1 168 ? 35.430  43.182  -2.462  1.00 19.05 ? 168 TYR B CG  1 
ATOM   4082 C CD1 . TYR B 1 168 ? 34.246  43.428  -3.164  1.00 18.74 ? 168 TYR B CD1 1 
ATOM   4083 C CD2 . TYR B 1 168 ? 35.400  42.758  -1.097  1.00 16.79 ? 168 TYR B CD2 1 
ATOM   4084 C CE1 . TYR B 1 168 ? 33.034  43.108  -2.536  1.00 18.49 ? 168 TYR B CE1 1 
ATOM   4085 C CE2 . TYR B 1 168 ? 34.176  42.442  -0.488  1.00 16.87 ? 168 TYR B CE2 1 
ATOM   4086 C CZ  . TYR B 1 168 ? 32.976  42.699  -1.218  1.00 17.89 ? 168 TYR B CZ  1 
ATOM   4087 O OH  . TYR B 1 168 ? 31.735  42.683  -0.621  1.00 23.82 ? 168 TYR B OH  1 
ATOM   4088 N N   . ASP B 1 169 ? 36.640  45.171  -5.142  1.00 22.53 ? 169 ASP B N   1 
ATOM   4089 C CA  . ASP B 1 169 ? 35.736  45.298  -6.310  1.00 19.70 ? 169 ASP B CA  1 
ATOM   4090 C C   . ASP B 1 169 ? 35.343  43.978  -7.105  1.00 21.65 ? 169 ASP B C   1 
ATOM   4091 O O   . ASP B 1 169 ? 36.007  42.934  -7.159  1.00 20.47 ? 169 ASP B O   1 
ATOM   4092 C CB  . ASP B 1 169 ? 36.038  46.524  -7.226  1.00 16.73 ? 169 ASP B CB  1 
ATOM   4093 C CG  . ASP B 1 169 ? 35.155  47.779  -6.933  1.00 16.54 ? 169 ASP B CG  1 
ATOM   4094 O OD1 . ASP B 1 169 ? 35.745  48.793  -6.787  1.00 18.22 ? 169 ASP B OD1 1 
ATOM   4095 O OD2 . ASP B 1 169 ? 33.929  47.836  -6.842  1.00 19.92 ? 169 ASP B OD2 1 
ATOM   4096 N N   . LEU B 1 170 ? 34.132  43.961  -7.708  1.00 20.95 ? 170 LEU B N   1 
ATOM   4097 C CA  . LEU B 1 170 ? 33.811  42.567  -7.628  1.00 20.86 ? 170 LEU B CA  1 
ATOM   4098 C C   . LEU B 1 170 ? 33.983  41.646  -8.868  1.00 22.34 ? 170 LEU B C   1 
ATOM   4099 O O   . LEU B 1 170 ? 33.162  40.809  -9.205  1.00 26.36 ? 170 LEU B O   1 
ATOM   4100 C CB  . LEU B 1 170 ? 32.606  42.529  -6.654  1.00 17.66 ? 170 LEU B CB  1 
ATOM   4101 C CG  . LEU B 1 170 ? 32.267  41.228  -5.909  1.00 17.35 ? 170 LEU B CG  1 
ATOM   4102 C CD1 . LEU B 1 170 ? 33.405  40.556  -5.289  1.00 14.80 ? 170 LEU B CD1 1 
ATOM   4103 C CD2 . LEU B 1 170 ? 31.274  41.299  -4.845  1.00 14.95 ? 170 LEU B CD2 1 
ATOM   4104 N N   . GLU B 1 171 ? 35.149  41.710  -9.570  1.00 20.05 ? 171 GLU B N   1 
ATOM   4105 C CA  . GLU B 1 171 ? 35.247  40.759  -10.780 1.00 21.26 ? 171 GLU B CA  1 
ATOM   4106 C C   . GLU B 1 171 ? 34.533  39.339  -10.822 1.00 17.88 ? 171 GLU B C   1 
ATOM   4107 O O   . GLU B 1 171 ? 34.625  38.525  -9.911  1.00 15.73 ? 171 GLU B O   1 
ATOM   4108 C CB  . GLU B 1 171 ? 36.719  40.553  -11.371 1.00 25.39 ? 171 GLU B CB  1 
ATOM   4109 C CG  . GLU B 1 171 ? 37.485  39.157  -11.465 1.00 28.76 ? 171 GLU B CG  1 
ATOM   4110 C CD  . GLU B 1 171 ? 38.567  39.206  -12.606 1.00 31.41 ? 171 GLU B CD  1 
ATOM   4111 O OE1 . GLU B 1 171 ? 38.493  40.172  -13.408 1.00 34.31 ? 171 GLU B OE1 1 
ATOM   4112 O OE2 . GLU B 1 171 ? 39.437  38.291  -12.734 1.00 26.98 ? 171 GLU B OE2 1 
ATOM   4113 N N   . VAL B 1 172 ? 33.873  39.046  -11.952 1.00 14.08 ? 172 VAL B N   1 
ATOM   4114 C CA  . VAL B 1 172 ? 33.165  37.766  -11.933 1.00 11.03 ? 172 VAL B CA  1 
ATOM   4115 C C   . VAL B 1 172 ? 33.821  36.572  -12.530 1.00 8.75  ? 172 VAL B C   1 
ATOM   4116 O O   . VAL B 1 172 ? 34.140  36.472  -13.684 1.00 11.12 ? 172 VAL B O   1 
ATOM   4117 C CB  . VAL B 1 172 ? 31.762  37.833  -12.544 1.00 12.27 ? 172 VAL B CB  1 
ATOM   4118 C CG1 . VAL B 1 172 ? 31.000  36.561  -12.024 1.00 8.08  ? 172 VAL B CG1 1 
ATOM   4119 C CG2 . VAL B 1 172 ? 31.032  39.203  -12.309 1.00 13.61 ? 172 VAL B CG2 1 
ATOM   4120 N N   . ILE B 1 173 ? 33.958  35.571  -11.735 1.00 10.57 ? 173 ILE B N   1 
ATOM   4121 C CA  . ILE B 1 173 ? 34.553  34.472  -12.533 1.00 10.93 ? 173 ILE B CA  1 
ATOM   4122 C C   . ILE B 1 173 ? 33.742  33.340  -13.040 1.00 11.89 ? 173 ILE B C   1 
ATOM   4123 O O   . ILE B 1 173 ? 34.083  32.954  -14.118 1.00 12.36 ? 173 ILE B O   1 
ATOM   4124 C CB  . ILE B 1 173 ? 35.934  33.938  -12.051 1.00 9.39  ? 173 ILE B CB  1 
ATOM   4125 C CG1 . ILE B 1 173 ? 36.550  34.729  -10.926 1.00 12.20 ? 173 ILE B CG1 1 
ATOM   4126 C CG2 . ILE B 1 173 ? 37.003  33.999  -13.107 1.00 16.67 ? 173 ILE B CG2 1 
ATOM   4127 C CD1 . ILE B 1 173 ? 36.153  34.008  -9.667  1.00 20.43 ? 173 ILE B CD1 1 
ATOM   4128 N N   . ASP B 1 174 ? 32.721  32.808  -12.350 1.00 12.94 ? 174 ASP B N   1 
ATOM   4129 C CA  . ASP B 1 174 ? 31.893  31.839  -13.127 1.00 14.81 ? 174 ASP B CA  1 
ATOM   4130 C C   . ASP B 1 174 ? 30.370  31.823  -12.930 1.00 17.01 ? 174 ASP B C   1 
ATOM   4131 O O   . ASP B 1 174 ? 29.896  32.193  -11.872 1.00 20.95 ? 174 ASP B O   1 
ATOM   4132 C CB  . ASP B 1 174 ? 32.384  30.423  -13.037 1.00 17.85 ? 174 ASP B CB  1 
ATOM   4133 C CG  . ASP B 1 174 ? 33.757  30.526  -13.547 1.00 21.15 ? 174 ASP B CG  1 
ATOM   4134 O OD1 . ASP B 1 174 ? 34.656  30.858  -12.762 1.00 25.90 ? 174 ASP B OD1 1 
ATOM   4135 O OD2 . ASP B 1 174 ? 33.924  30.420  -14.759 1.00 29.49 ? 174 ASP B OD2 1 
ATOM   4136 N N   . ILE B 1 175 ? 29.541  31.438  -13.923 1.00 15.67 ? 175 ILE B N   1 
ATOM   4137 C CA  . ILE B 1 175 ? 28.159  31.659  -13.534 1.00 14.56 ? 175 ILE B CA  1 
ATOM   4138 C C   . ILE B 1 175 ? 27.126  30.540  -13.661 1.00 17.65 ? 175 ILE B C   1 
ATOM   4139 O O   . ILE B 1 175 ? 25.979  30.845  -13.514 1.00 18.73 ? 175 ILE B O   1 
ATOM   4140 C CB  . ILE B 1 175 ? 27.499  32.925  -14.116 1.00 11.47 ? 175 ILE B CB  1 
ATOM   4141 C CG1 . ILE B 1 175 ? 28.440  34.046  -14.352 1.00 8.39  ? 175 ILE B CG1 1 
ATOM   4142 C CG2 . ILE B 1 175 ? 26.486  33.665  -13.246 1.00 12.60 ? 175 ILE B CG2 1 
ATOM   4143 C CD1 . ILE B 1 175 ? 27.614  34.930  -15.308 1.00 7.26  ? 175 ILE B CD1 1 
ATOM   4144 N N   . PHE B 1 176 ? 27.471  29.278  -13.917 1.00 17.71 ? 176 PHE B N   1 
ATOM   4145 C CA  . PHE B 1 176 ? 26.590  28.345  -13.152 1.00 16.11 ? 176 PHE B CA  1 
ATOM   4146 C C   . PHE B 1 176 ? 24.999  28.355  -12.996 1.00 15.80 ? 176 PHE B C   1 
ATOM   4147 O O   . PHE B 1 176 ? 24.292  29.251  -12.599 1.00 17.41 ? 176 PHE B O   1 
ATOM   4148 C CB  . PHE B 1 176 ? 27.029  28.371  -11.697 1.00 14.75 ? 176 PHE B CB  1 
ATOM   4149 C CG  . PHE B 1 176 ? 28.485  28.115  -11.589 1.00 15.50 ? 176 PHE B CG  1 
ATOM   4150 C CD1 . PHE B 1 176 ? 28.919  26.796  -11.719 1.00 12.10 ? 176 PHE B CD1 1 
ATOM   4151 C CD2 . PHE B 1 176 ? 29.341  29.194  -11.249 1.00 16.92 ? 176 PHE B CD2 1 
ATOM   4152 C CE1 . PHE B 1 176 ? 30.224  26.516  -11.290 1.00 9.22  ? 176 PHE B CE1 1 
ATOM   4153 C CE2 . PHE B 1 176 ? 30.650  28.898  -10.818 1.00 16.57 ? 176 PHE B CE2 1 
ATOM   4154 C CZ  . PHE B 1 176 ? 31.029  27.548  -10.788 1.00 12.63 ? 176 PHE B CZ  1 
ATOM   4155 N N   . LYS B 1 177 ? 24.402  27.208  -13.146 1.00 15.24 ? 177 LYS B N   1 
ATOM   4156 C CA  . LYS B 1 177 ? 22.964  27.357  -12.893 1.00 14.79 ? 177 LYS B CA  1 
ATOM   4157 C C   . LYS B 1 177 ? 22.560  26.161  -12.128 1.00 16.66 ? 177 LYS B C   1 
ATOM   4158 O O   . LYS B 1 177 ? 23.165  25.151  -12.538 1.00 20.30 ? 177 LYS B O   1 
ATOM   4159 C CB  . LYS B 1 177 ? 22.249  27.562  -14.293 1.00 17.04 ? 177 LYS B CB  1 
ATOM   4160 C CG  . LYS B 1 177 ? 20.938  27.064  -14.841 1.00 17.82 ? 177 LYS B CG  1 
ATOM   4161 C CD  . LYS B 1 177 ? 19.675  27.422  -14.172 1.00 18.42 ? 177 LYS B CD  1 
ATOM   4162 C CE  . LYS B 1 177 ? 18.740  26.283  -14.581 1.00 17.49 ? 177 LYS B CE  1 
ATOM   4163 N NZ  . LYS B 1 177 ? 19.236  24.958  -14.078 1.00 18.84 ? 177 LYS B NZ  1 
ATOM   4164 N N   . ILE B 1 178 ? 21.629  26.252  -11.065 1.00 13.25 ? 178 ILE B N   1 
ATOM   4165 C CA  . ILE B 1 178 ? 21.526  25.081  -10.194 1.00 7.22  ? 178 ILE B CA  1 
ATOM   4166 C C   . ILE B 1 178 ? 20.223  24.341  -9.944  1.00 6.00  ? 178 ILE B C   1 
ATOM   4167 O O   . ILE B 1 178 ? 19.370  24.971  -9.369  1.00 6.05  ? 178 ILE B O   1 
ATOM   4168 C CB  . ILE B 1 178 ? 22.100  25.482  -8.864  1.00 4.18  ? 178 ILE B CB  1 
ATOM   4169 C CG1 . ILE B 1 178 ? 22.791  26.812  -8.745  1.00 8.58  ? 178 ILE B CG1 1 
ATOM   4170 C CG2 . ILE B 1 178 ? 23.149  24.533  -8.494  1.00 3.21  ? 178 ILE B CG2 1 
ATOM   4171 C CD1 . ILE B 1 178 ? 22.632  27.336  -7.281  1.00 14.36 ? 178 ILE B CD1 1 
ATOM   4172 N N   . GLU B 1 179 ? 20.084  23.036  -10.181 1.00 2.82  ? 179 GLU B N   1 
ATOM   4173 C CA  . GLU B 1 179 ? 18.931  22.603  -9.338  1.00 5.79  ? 179 GLU B CA  1 
ATOM   4174 C C   . GLU B 1 179 ? 18.908  21.637  -8.082  1.00 8.31  ? 179 GLU B C   1 
ATOM   4175 O O   . GLU B 1 179 ? 19.254  20.469  -8.206  1.00 14.39 ? 179 GLU B O   1 
ATOM   4176 C CB  . GLU B 1 179 ? 17.726  22.383  -10.227 1.00 12.58 ? 179 GLU B CB  1 
ATOM   4177 C CG  . GLU B 1 179 ? 17.146  20.966  -10.464 1.00 22.07 ? 179 GLU B CG  1 
ATOM   4178 C CD  . GLU B 1 179 ? 16.857  20.901  -11.970 1.00 30.03 ? 179 GLU B CD  1 
ATOM   4179 O OE1 . GLU B 1 179 ? 16.017  21.707  -12.460 1.00 28.77 ? 179 GLU B OE1 1 
ATOM   4180 O OE2 . GLU B 1 179 ? 17.540  20.075  -12.641 1.00 33.72 ? 179 GLU B OE2 1 
ATOM   4181 N N   . ARG B 1 180 ? 18.460  22.077  -6.851  1.00 4.13  ? 180 ARG B N   1 
ATOM   4182 C CA  . ARG B 1 180 ? 18.447  20.945  -5.897  1.00 6.27  ? 180 ARG B CA  1 
ATOM   4183 C C   . ARG B 1 180 ? 17.308  19.922  -6.105  1.00 7.85  ? 180 ARG B C   1 
ATOM   4184 O O   . ARG B 1 180 ? 16.245  20.494  -6.292  1.00 4.75  ? 180 ARG B O   1 
ATOM   4185 C CB  . ARG B 1 180 ? 18.630  21.262  -4.378  1.00 3.80  ? 180 ARG B CB  1 
ATOM   4186 C CG  . ARG B 1 180 ? 19.790  22.133  -3.787  1.00 7.07  ? 180 ARG B CG  1 
ATOM   4187 C CD  . ARG B 1 180 ? 19.933  22.261  -2.257  1.00 9.55  ? 180 ARG B CD  1 
ATOM   4188 N NE  . ARG B 1 180 ? 18.626  22.526  -1.661  1.00 13.73 ? 180 ARG B NE  1 
ATOM   4189 C CZ  . ARG B 1 180 ? 17.891  21.486  -1.163  1.00 16.63 ? 180 ARG B CZ  1 
ATOM   4190 N NH1 . ARG B 1 180 ? 18.452  20.297  -1.004  1.00 17.67 ? 180 ARG B NH1 1 
ATOM   4191 N NH2 . ARG B 1 180 ? 16.584  21.641  -0.905  1.00 13.20 ? 180 ARG B NH2 1 
ATOM   4192 N N   . GLU B 1 181 ? 17.579  18.528  -6.165  1.00 9.55  ? 181 GLU B N   1 
ATOM   4193 C CA  . GLU B 1 181 ? 16.560  17.494  -6.402  1.00 14.15 ? 181 GLU B CA  1 
ATOM   4194 C C   . GLU B 1 181 ? 15.439  17.710  -5.461  1.00 13.87 ? 181 GLU B C   1 
ATOM   4195 O O   . GLU B 1 181 ? 15.585  18.415  -4.486  1.00 17.44 ? 181 GLU B O   1 
ATOM   4196 C CB  . GLU B 1 181 ? 17.136  16.118  -6.241  1.00 20.21 ? 181 GLU B CB  1 
ATOM   4197 C CG  . GLU B 1 181 ? 17.349  15.136  -7.416  1.00 32.38 ? 181 GLU B CG  1 
ATOM   4198 C CD  . GLU B 1 181 ? 16.512  13.846  -7.162  1.00 39.04 ? 181 GLU B CD  1 
ATOM   4199 O OE1 . GLU B 1 181 ? 16.958  12.746  -7.447  1.00 44.94 ? 181 GLU B OE1 1 
ATOM   4200 O OE2 . GLU B 1 181 ? 15.388  13.920  -6.682  1.00 46.07 ? 181 GLU B OE2 1 
ATOM   4201 N N   . GLY B 1 182 ? 14.231  17.279  -5.909  1.00 14.34 ? 182 GLY B N   1 
ATOM   4202 C CA  . GLY B 1 182 ? 13.011  17.786  -5.260  1.00 10.63 ? 182 GLY B CA  1 
ATOM   4203 C C   . GLY B 1 182 ? 12.769  19.287  -4.899  1.00 9.62  ? 182 GLY B C   1 
ATOM   4204 O O   . GLY B 1 182 ? 11.669  19.545  -4.472  1.00 7.18  ? 182 GLY B O   1 
ATOM   4205 N N   . GLU B 1 183 ? 13.677  20.244  -5.053  1.00 8.14  ? 183 GLU B N   1 
ATOM   4206 C CA  . GLU B 1 183 ? 13.351  21.681  -4.786  1.00 13.11 ? 183 GLU B CA  1 
ATOM   4207 C C   . GLU B 1 183 ? 12.310  22.491  -5.561  1.00 14.99 ? 183 GLU B C   1 
ATOM   4208 O O   . GLU B 1 183 ? 11.382  23.061  -4.970  1.00 17.40 ? 183 GLU B O   1 
ATOM   4209 C CB  . GLU B 1 183 ? 14.488  22.704  -4.973  1.00 15.26 ? 183 GLU B CB  1 
ATOM   4210 C CG  . GLU B 1 183 ? 15.288  22.902  -3.710  1.00 19.74 ? 183 GLU B CG  1 
ATOM   4211 C CD  . GLU B 1 183 ? 15.451  24.334  -3.504  1.00 18.78 ? 183 GLU B CD  1 
ATOM   4212 O OE1 . GLU B 1 183 ? 14.858  24.788  -2.578  1.00 25.83 ? 183 GLU B OE1 1 
ATOM   4213 O OE2 . GLU B 1 183 ? 16.124  24.982  -4.260  1.00 21.04 ? 183 GLU B OE2 1 
ATOM   4214 N N   . CYS B 1 184 ? 12.466  22.575  -6.976  1.00 12.04 ? 184 CYS B N   1 
ATOM   4215 C CA  . CYS B 1 184 ? 11.136  23.071  -7.556  1.00 9.54  ? 184 CYS B CA  1 
ATOM   4216 C C   . CYS B 1 184 ? 9.884   22.429  -6.898  1.00 6.69  ? 184 CYS B C   1 
ATOM   4217 O O   . CYS B 1 184 ? 8.911   23.132  -6.651  1.00 4.36  ? 184 CYS B O   1 
ATOM   4218 C CB  . CYS B 1 184 ? 10.921  23.278  -9.115  1.00 7.61  ? 184 CYS B CB  1 
ATOM   4219 S SG  . CYS B 1 184 ? 10.214  25.072  -9.427  1.00 19.12 ? 184 CYS B SG  1 
ATOM   4220 N N   . GLN B 1 185 ? 10.029  21.094  -6.497  1.00 2.97  ? 185 GLN B N   1 
ATOM   4221 C CA  . GLN B 1 185 ? 8.801   20.512  -6.026  1.00 6.23  ? 185 GLN B CA  1 
ATOM   4222 C C   . GLN B 1 185 ? 8.307   21.065  -4.739  1.00 7.95  ? 185 GLN B C   1 
ATOM   4223 O O   . GLN B 1 185 ? 7.187   21.520  -4.567  1.00 9.18  ? 185 GLN B O   1 
ATOM   4224 C CB  . GLN B 1 185 ? 8.781   18.984  -6.173  1.00 9.21  ? 185 GLN B CB  1 
ATOM   4225 C CG  . GLN B 1 185 ? 7.429   18.233  -6.557  1.00 14.91 ? 185 GLN B CG  1 
ATOM   4226 C CD  . GLN B 1 185 ? 6.634   18.772  -7.830  1.00 15.50 ? 185 GLN B CD  1 
ATOM   4227 O OE1 . GLN B 1 185 ? 7.028   19.107  -8.958  1.00 18.54 ? 185 GLN B OE1 1 
ATOM   4228 N NE2 . GLN B 1 185 ? 5.345   18.874  -7.573  1.00 17.60 ? 185 GLN B NE2 1 
ATOM   4229 N N   . ARG B 1 186 ? 9.272   21.081  -3.859  1.00 10.82 ? 186 ARG B N   1 
ATOM   4230 C CA  . ARG B 1 186 ? 9.327   21.955  -2.645  1.00 12.27 ? 186 ARG B CA  1 
ATOM   4231 C C   . ARG B 1 186 ? 8.807   23.419  -2.681  1.00 11.26 ? 186 ARG B C   1 
ATOM   4232 O O   . ARG B 1 186 ? 7.866   23.678  -1.925  1.00 15.58 ? 186 ARG B O   1 
ATOM   4233 C CB  . ARG B 1 186 ? 10.681  21.746  -1.847  1.00 14.07 ? 186 ARG B CB  1 
ATOM   4234 C CG  . ARG B 1 186 ? 10.354  21.630  -0.340  1.00 17.82 ? 186 ARG B CG  1 
ATOM   4235 C CD  . ARG B 1 186 ? 11.501  21.927  0.582   1.00 20.90 ? 186 ARG B CD  1 
ATOM   4236 N NE  . ARG B 1 186 ? 12.053  23.246  0.244   1.00 20.59 ? 186 ARG B NE  1 
ATOM   4237 C CZ  . ARG B 1 186 ? 13.396  23.485  0.329   1.00 21.86 ? 186 ARG B CZ  1 
ATOM   4238 N NH1 . ARG B 1 186 ? 14.241  22.563  0.718   1.00 22.14 ? 186 ARG B NH1 1 
ATOM   4239 N NH2 . ARG B 1 186 ? 13.865  24.660  0.004   1.00 21.92 ? 186 ARG B NH2 1 
ATOM   4240 N N   . TYR B 1 187 ? 9.348   24.193  -3.673  1.00 5.19  ? 187 TYR B N   1 
ATOM   4241 C CA  . TYR B 1 187 ? 9.070   25.570  -3.978  1.00 3.74  ? 187 TYR B CA  1 
ATOM   4242 C C   . TYR B 1 187 ? 7.844   25.813  -4.810  1.00 5.73  ? 187 TYR B C   1 
ATOM   4243 O O   . TYR B 1 187 ? 7.444   26.934  -5.140  1.00 6.36  ? 187 TYR B O   1 
ATOM   4244 C CB  . TYR B 1 187 ? 10.274  26.257  -4.647  1.00 4.43  ? 187 TYR B CB  1 
ATOM   4245 C CG  . TYR B 1 187 ? 10.107  27.755  -4.931  1.00 4.63  ? 187 TYR B CG  1 
ATOM   4246 C CD1 . TYR B 1 187 ? 9.902   28.665  -3.850  1.00 4.11  ? 187 TYR B CD1 1 
ATOM   4247 C CD2 . TYR B 1 187 ? 10.176  28.236  -6.237  1.00 5.04  ? 187 TYR B CD2 1 
ATOM   4248 C CE1 . TYR B 1 187 ? 9.797   30.038  -4.062  1.00 2.00  ? 187 TYR B CE1 1 
ATOM   4249 C CE2 . TYR B 1 187 ? 10.221  29.605  -6.439  1.00 2.00  ? 187 TYR B CE2 1 
ATOM   4250 C CZ  . TYR B 1 187 ? 10.018  30.447  -5.351  1.00 2.00  ? 187 TYR B CZ  1 
ATOM   4251 O OH  . TYR B 1 187 ? 10.048  31.782  -5.619  1.00 9.91  ? 187 TYR B OH  1 
ATOM   4252 N N   . LYS B 1 188 ? 7.130   24.749  -5.197  1.00 5.99  ? 188 LYS B N   1 
ATOM   4253 C CA  . LYS B 1 188 ? 5.959   25.227  -5.926  1.00 5.80  ? 188 LYS B CA  1 
ATOM   4254 C C   . LYS B 1 188 ? 4.747   25.770  -5.147  1.00 8.04  ? 188 LYS B C   1 
ATOM   4255 O O   . LYS B 1 188 ? 4.232   26.810  -5.546  1.00 11.84 ? 188 LYS B O   1 
ATOM   4256 C CB  . LYS B 1 188 ? 5.713   24.430  -7.245  1.00 3.17  ? 188 LYS B CB  1 
ATOM   4257 C CG  . LYS B 1 188 ? 5.702   22.896  -7.386  1.00 7.21  ? 188 LYS B CG  1 
ATOM   4258 C CD  . LYS B 1 188 ? 5.457   22.482  -8.809  1.00 8.05  ? 188 LYS B CD  1 
ATOM   4259 C CE  . LYS B 1 188 ? 6.472   23.155  -9.755  1.00 11.98 ? 188 LYS B CE  1 
ATOM   4260 N NZ  . LYS B 1 188 ? 7.846   22.681  -9.441  1.00 15.46 ? 188 LYS B NZ  1 
ATOM   4261 N N   . PRO B 1 189 ? 4.252   25.222  -4.016  1.00 6.94  ? 189 PRO B N   1 
ATOM   4262 C CA  . PRO B 1 189 ? 3.108   25.923  -3.445  1.00 7.70  ? 189 PRO B CA  1 
ATOM   4263 C C   . PRO B 1 189 ? 3.395   27.425  -3.244  1.00 9.34  ? 189 PRO B C   1 
ATOM   4264 O O   . PRO B 1 189 ? 2.532   28.268  -3.344  1.00 9.66  ? 189 PRO B O   1 
ATOM   4265 C CB  . PRO B 1 189 ? 2.783   25.112  -2.164  1.00 6.04  ? 189 PRO B CB  1 
ATOM   4266 C CG  . PRO B 1 189 ? 3.337   23.746  -2.450  1.00 5.43  ? 189 PRO B CG  1 
ATOM   4267 C CD  . PRO B 1 189 ? 4.606   24.074  -3.253  1.00 7.52  ? 189 PRO B CD  1 
ATOM   4268 N N   . PHE B 1 190 ? 4.698   27.751  -3.028  1.00 11.59 ? 190 PHE B N   1 
ATOM   4269 C CA  . PHE B 1 190 ? 4.990   29.105  -2.613  1.00 7.24  ? 190 PHE B CA  1 
ATOM   4270 C C   . PHE B 1 190 ? 5.094   30.040  -3.727  1.00 4.53  ? 190 PHE B C   1 
ATOM   4271 O O   . PHE B 1 190 ? 4.878   31.194  -3.507  1.00 5.49  ? 190 PHE B O   1 
ATOM   4272 C CB  . PHE B 1 190 ? 6.246   29.161  -1.667  1.00 4.35  ? 190 PHE B CB  1 
ATOM   4273 C CG  . PHE B 1 190 ? 5.957   28.611  -0.228  1.00 7.27  ? 190 PHE B CG  1 
ATOM   4274 C CD1 . PHE B 1 190 ? 5.612   29.550  0.809   1.00 8.82  ? 190 PHE B CD1 1 
ATOM   4275 C CD2 . PHE B 1 190 ? 5.985   27.196  0.018   1.00 4.56  ? 190 PHE B CD2 1 
ATOM   4276 C CE1 . PHE B 1 190 ? 5.247   29.023  2.079   1.00 10.47 ? 190 PHE B CE1 1 
ATOM   4277 C CE2 . PHE B 1 190 ? 5.550   26.703  1.248   1.00 5.62  ? 190 PHE B CE2 1 
ATOM   4278 C CZ  . PHE B 1 190 ? 5.174   27.610  2.283   1.00 7.36  ? 190 PHE B CZ  1 
ATOM   4279 N N   . LYS B 1 191 ? 5.414   29.588  -4.911  1.00 3.16  ? 191 LYS B N   1 
ATOM   4280 C CA  . LYS B 1 191 ? 5.392   30.618  -5.961  1.00 5.20  ? 191 LYS B CA  1 
ATOM   4281 C C   . LYS B 1 191 ? 3.936   31.129  -6.262  1.00 9.73  ? 191 LYS B C   1 
ATOM   4282 O O   . LYS B 1 191 ? 3.691   32.218  -6.713  1.00 13.42 ? 191 LYS B O   1 
ATOM   4283 C CB  . LYS B 1 191 ? 5.855   30.005  -7.299  1.00 2.96  ? 191 LYS B CB  1 
ATOM   4284 C CG  . LYS B 1 191 ? 7.104   29.137  -7.358  1.00 5.34  ? 191 LYS B CG  1 
ATOM   4285 C CD  . LYS B 1 191 ? 7.236   28.056  -8.479  1.00 8.19  ? 191 LYS B CD  1 
ATOM   4286 C CE  . LYS B 1 191 ? 6.955   28.368  -9.978  1.00 11.87 ? 191 LYS B CE  1 
ATOM   4287 N NZ  . LYS B 1 191 ? 7.179   27.132  -10.803 1.00 10.81 ? 191 LYS B NZ  1 
ATOM   4288 N N   . GLN B 1 192 ? 2.921   30.330  -5.975  1.00 12.57 ? 192 GLN B N   1 
ATOM   4289 C CA  . GLN B 1 192 ? 1.695   31.057  -6.203  1.00 12.79 ? 192 GLN B CA  1 
ATOM   4290 C C   . GLN B 1 192 ? 1.471   32.407  -5.464  1.00 11.72 ? 192 GLN B C   1 
ATOM   4291 O O   . GLN B 1 192 ? 0.966   33.361  -6.013  1.00 17.47 ? 192 GLN B O   1 
ATOM   4292 C CB  . GLN B 1 192 ? 0.482   30.082  -6.360  1.00 19.94 ? 192 GLN B CB  1 
ATOM   4293 C CG  . GLN B 1 192 ? 0.544   29.172  -7.693  1.00 25.45 ? 192 GLN B CG  1 
ATOM   4294 C CD  . GLN B 1 192 ? -0.078  29.535  -9.149  1.00 33.27 ? 192 GLN B CD  1 
ATOM   4295 O OE1 . GLN B 1 192 ? -0.338  28.659  -10.016 1.00 32.06 ? 192 GLN B OE1 1 
ATOM   4296 N NE2 . GLN B 1 192 ? -0.231  30.828  -9.360  1.00 39.18 ? 192 GLN B NE2 1 
ATOM   4297 N N   . LEU B 1 193 ? 1.993   32.585  -4.292  1.00 11.61 ? 193 LEU B N   1 
ATOM   4298 C CA  . LEU B 1 193 ? 1.860   33.842  -3.520  1.00 11.87 ? 193 LEU B CA  1 
ATOM   4299 C C   . LEU B 1 193 ? 2.629   35.033  -4.050  1.00 12.25 ? 193 LEU B C   1 
ATOM   4300 O O   . LEU B 1 193 ? 3.672   34.846  -4.641  1.00 9.92  ? 193 LEU B O   1 
ATOM   4301 C CB  . LEU B 1 193 ? 2.514   33.452  -2.219  1.00 11.25 ? 193 LEU B CB  1 
ATOM   4302 C CG  . LEU B 1 193 ? 3.031   34.468  -1.172  1.00 6.65  ? 193 LEU B CG  1 
ATOM   4303 C CD1 . LEU B 1 193 ? 1.903   34.729  -0.195  1.00 8.40  ? 193 LEU B CD1 1 
ATOM   4304 C CD2 . LEU B 1 193 ? 4.330   34.092  -0.485  1.00 2.00  ? 193 LEU B CD2 1 
ATOM   4305 N N   . HIS B 1 194 ? 2.168   36.278  -3.769  1.00 11.14 ? 194 HIS B N   1 
ATOM   4306 C CA  . HIS B 1 194 ? 2.961   37.453  -4.311  1.00 7.81  ? 194 HIS B CA  1 
ATOM   4307 C C   . HIS B 1 194 ? 4.459   37.504  -3.941  1.00 6.20  ? 194 HIS B C   1 
ATOM   4308 O O   . HIS B 1 194 ? 4.845   36.881  -2.921  1.00 9.36  ? 194 HIS B O   1 
ATOM   4309 C CB  . HIS B 1 194 ? 2.250   38.851  -4.012  1.00 2.91  ? 194 HIS B CB  1 
ATOM   4310 C CG  . HIS B 1 194 ? 1.981   39.224  -2.562  1.00 5.54  ? 194 HIS B CG  1 
ATOM   4311 N ND1 . HIS B 1 194 ? 1.786   38.269  -1.622  1.00 9.49  ? 194 HIS B ND1 1 
ATOM   4312 C CD2 . HIS B 1 194 ? 1.817   40.488  -1.938  1.00 7.29  ? 194 HIS B CD2 1 
ATOM   4313 C CE1 . HIS B 1 194 ? 1.509   38.876  -0.451  1.00 2.44  ? 194 HIS B CE1 1 
ATOM   4314 N NE2 . HIS B 1 194 ? 1.516   40.195  -0.643  1.00 4.27  ? 194 HIS B NE2 1 
ATOM   4315 N N   . ASN B 1 195 ? 5.206   38.353  -4.665  1.00 8.70  ? 195 ASN B N   1 
ATOM   4316 C CA  . ASN B 1 195 ? 6.338   39.066  -4.074  1.00 6.98  ? 195 ASN B CA  1 
ATOM   4317 C C   . ASN B 1 195 ? 7.610   38.308  -4.071  1.00 8.52  ? 195 ASN B C   1 
ATOM   4318 O O   . ASN B 1 195 ? 8.413   38.416  -3.152  1.00 15.14 ? 195 ASN B O   1 
ATOM   4319 C CB  . ASN B 1 195 ? 6.032   39.597  -2.716  1.00 2.50  ? 195 ASN B CB  1 
ATOM   4320 C CG  . ASN B 1 195 ? 6.169   41.064  -2.830  1.00 2.00  ? 195 ASN B CG  1 
ATOM   4321 O OD1 . ASN B 1 195 ? 7.223   41.485  -3.211  1.00 2.00  ? 195 ASN B OD1 1 
ATOM   4322 N ND2 . ASN B 1 195 ? 5.249   41.810  -2.315  1.00 8.08  ? 195 ASN B ND2 1 
ATOM   4323 N N   . ARG B 1 196 ? 7.814   37.448  -5.091  1.00 3.05  ? 196 ARG B N   1 
ATOM   4324 C CA  . ARG B 1 196 ? 9.201   36.901  -5.316  1.00 3.90  ? 196 ARG B CA  1 
ATOM   4325 C C   . ARG B 1 196 ? 10.378  37.776  -5.794  1.00 2.00  ? 196 ARG B C   1 
ATOM   4326 O O   . ARG B 1 196 ? 10.453  38.159  -6.909  1.00 9.35  ? 196 ARG B O   1 
ATOM   4327 C CB  . ARG B 1 196 ? 9.309   35.673  -6.198  1.00 4.46  ? 196 ARG B CB  1 
ATOM   4328 C CG  . ARG B 1 196 ? 8.203   34.732  -5.779  1.00 4.22  ? 196 ARG B CG  1 
ATOM   4329 C CD  . ARG B 1 196 ? 7.133   34.524  -6.848  1.00 7.11  ? 196 ARG B CD  1 
ATOM   4330 N NE  . ARG B 1 196 ? 7.270   33.163  -7.306  1.00 7.59  ? 196 ARG B NE  1 
ATOM   4331 C CZ  . ARG B 1 196 ? 6.998   32.963  -8.583  1.00 11.83 ? 196 ARG B CZ  1 
ATOM   4332 N NH1 . ARG B 1 196 ? 6.202   33.764  -9.241  1.00 14.36 ? 196 ARG B NH1 1 
ATOM   4333 N NH2 . ARG B 1 196 ? 7.534   31.971  -9.207  1.00 12.11 ? 196 ARG B NH2 1 
ATOM   4334 N N   . ARG B 1 197 ? 11.368  37.997  -4.894  1.00 2.00  ? 197 ARG B N   1 
ATOM   4335 C CA  . ARG B 1 197 ? 12.579  38.547  -5.505  1.00 4.29  ? 197 ARG B CA  1 
ATOM   4336 C C   . ARG B 1 197 ? 13.700  37.622  -5.747  1.00 5.01  ? 197 ARG B C   1 
ATOM   4337 O O   . ARG B 1 197 ? 13.783  36.550  -5.218  1.00 5.38  ? 197 ARG B O   1 
ATOM   4338 C CB  . ARG B 1 197 ? 13.135  39.779  -4.827  1.00 5.14  ? 197 ARG B CB  1 
ATOM   4339 C CG  . ARG B 1 197 ? 12.184  40.965  -4.776  1.00 7.67  ? 197 ARG B CG  1 
ATOM   4340 C CD  . ARG B 1 197 ? 12.796  41.936  -3.699  1.00 4.29  ? 197 ARG B CD  1 
ATOM   4341 N NE  . ARG B 1 197 ? 12.006  42.938  -2.929  1.00 2.00  ? 197 ARG B NE  1 
ATOM   4342 C CZ  . ARG B 1 197 ? 10.703  43.281  -2.940  1.00 9.08  ? 197 ARG B CZ  1 
ATOM   4343 N NH1 . ARG B 1 197 ? 9.752   42.565  -3.484  1.00 11.15 ? 197 ARG B NH1 1 
ATOM   4344 N NH2 . ARG B 1 197 ? 10.298  44.372  -2.286  1.00 13.01 ? 197 ARG B NH2 1 
ATOM   4345 N N   . LEU B 1 198 ? 14.556  38.057  -6.609  1.00 3.59  ? 198 LEU B N   1 
ATOM   4346 C CA  . LEU B 1 198 ? 15.834  37.378  -6.677  1.00 5.57  ? 198 LEU B CA  1 
ATOM   4347 C C   . LEU B 1 198 ? 16.900  38.193  -5.929  1.00 7.13  ? 198 LEU B C   1 
ATOM   4348 O O   . LEU B 1 198 ? 17.221  39.357  -6.180  1.00 3.68  ? 198 LEU B O   1 
ATOM   4349 C CB  . LEU B 1 198 ? 16.169  37.005  -8.175  1.00 2.00  ? 198 LEU B CB  1 
ATOM   4350 C CG  . LEU B 1 198 ? 17.502  36.410  -8.545  1.00 3.56  ? 198 LEU B CG  1 
ATOM   4351 C CD1 . LEU B 1 198 ? 17.391  34.960  -8.783  1.00 2.00  ? 198 LEU B CD1 1 
ATOM   4352 C CD2 . LEU B 1 198 ? 18.116  37.211  -9.651  1.00 2.00  ? 198 LEU B CD2 1 
ATOM   4353 N N   . LEU B 1 199 ? 17.382  37.501  -4.907  1.00 2.91  ? 199 LEU B N   1 
ATOM   4354 C CA  . LEU B 1 199 ? 18.303  38.236  -4.028  1.00 4.41  ? 199 LEU B CA  1 
ATOM   4355 C C   . LEU B 1 199 ? 19.530  37.445  -3.759  1.00 8.71  ? 199 LEU B C   1 
ATOM   4356 O O   . LEU B 1 199 ? 19.497  36.219  -4.074  1.00 11.35 ? 199 LEU B O   1 
ATOM   4357 C CB  . LEU B 1 199 ? 17.732  38.371  -2.652  1.00 6.96  ? 199 LEU B CB  1 
ATOM   4358 C CG  . LEU B 1 199 ? 16.421  39.002  -2.814  1.00 4.69  ? 199 LEU B CG  1 
ATOM   4359 C CD1 . LEU B 1 199 ? 15.511  38.133  -1.977  1.00 9.44  ? 199 LEU B CD1 1 
ATOM   4360 C CD2 . LEU B 1 199 ? 16.454  40.507  -2.580  1.00 6.45  ? 199 LEU B CD2 1 
ATOM   4361 N N   . TRP B 1 200 ? 20.547  38.166  -3.090  1.00 5.27  ? 200 TRP B N   1 
ATOM   4362 C CA  . TRP B 1 200 ? 21.698  37.261  -2.859  1.00 5.97  ? 200 TRP B CA  1 
ATOM   4363 C C   . TRP B 1 200 ? 21.800  36.780  -1.486  1.00 7.11  ? 200 TRP B C   1 
ATOM   4364 O O   . TRP B 1 200 ? 21.359  37.482  -0.607  1.00 10.65 ? 200 TRP B O   1 
ATOM   4365 C CB  . TRP B 1 200 ? 23.127  37.592  -3.281  1.00 6.00  ? 200 TRP B CB  1 
ATOM   4366 C CG  . TRP B 1 200 ? 23.235  38.602  -4.324  1.00 5.08  ? 200 TRP B CG  1 
ATOM   4367 C CD1 . TRP B 1 200 ? 22.845  39.868  -4.091  1.00 2.00  ? 200 TRP B CD1 1 
ATOM   4368 C CD2 . TRP B 1 200 ? 23.624  38.647  -5.752  1.00 4.76  ? 200 TRP B CD2 1 
ATOM   4369 N NE1 . TRP B 1 200 ? 23.021  40.718  -5.108  1.00 2.00  ? 200 TRP B NE1 1 
ATOM   4370 C CE2 . TRP B 1 200 ? 23.660  40.031  -6.115  1.00 5.01  ? 200 TRP B CE2 1 
ATOM   4371 C CE3 . TRP B 1 200 ? 24.422  37.747  -6.466  1.00 5.16  ? 200 TRP B CE3 1 
ATOM   4372 C CZ2 . TRP B 1 200 ? 23.994  40.467  -7.409  1.00 11.07 ? 200 TRP B CZ2 1 
ATOM   4373 C CZ3 . TRP B 1 200 ? 24.883  38.184  -7.727  1.00 6.07  ? 200 TRP B CZ3 1 
ATOM   4374 C CH2 . TRP B 1 200 ? 24.754  39.518  -8.153  1.00 7.79  ? 200 TRP B CH2 1 
ATOM   4375 N N   . HIS B 1 201 ? 22.369  35.604  -1.388  1.00 5.18  ? 201 HIS B N   1 
ATOM   4376 C CA  . HIS B 1 201 ? 22.748  34.950  -0.193  1.00 6.00  ? 201 HIS B CA  1 
ATOM   4377 C C   . HIS B 1 201 ? 24.242  34.548  -0.154  1.00 5.84  ? 201 HIS B C   1 
ATOM   4378 O O   . HIS B 1 201 ? 24.593  33.399  -0.475  1.00 2.00  ? 201 HIS B O   1 
ATOM   4379 C CB  . HIS B 1 201 ? 21.794  33.737  0.002   1.00 8.82  ? 201 HIS B CB  1 
ATOM   4380 C CG  . HIS B 1 201 ? 22.018  33.072  1.405   1.00 11.62 ? 201 HIS B CG  1 
ATOM   4381 N ND1 . HIS B 1 201 ? 21.510  33.524  2.566   1.00 9.48  ? 201 HIS B ND1 1 
ATOM   4382 C CD2 . HIS B 1 201 ? 22.851  32.008  1.750   1.00 15.97 ? 201 HIS B CD2 1 
ATOM   4383 C CE1 . HIS B 1 201 ? 22.045  32.783  3.563   1.00 7.46  ? 201 HIS B CE1 1 
ATOM   4384 N NE2 . HIS B 1 201 ? 22.847  31.849  3.090   1.00 9.34  ? 201 HIS B NE2 1 
ATOM   4385 N N   . GLY B 1 202 ? 25.062  35.526  0.352   1.00 8.24  ? 202 GLY B N   1 
ATOM   4386 C CA  . GLY B 1 202 ? 26.544  35.332  0.649   1.00 8.75  ? 202 GLY B CA  1 
ATOM   4387 C C   . GLY B 1 202 ? 26.943  34.447  1.794   1.00 9.98  ? 202 GLY B C   1 
ATOM   4388 O O   . GLY B 1 202 ? 26.272  34.419  2.785   1.00 13.62 ? 202 GLY B O   1 
ATOM   4389 N N   . SER B 1 203 ? 27.892  33.621  1.547   1.00 12.65 ? 203 SER B N   1 
ATOM   4390 C CA  . SER B 1 203 ? 28.091  32.452  2.375   1.00 15.68 ? 203 SER B CA  1 
ATOM   4391 C C   . SER B 1 203 ? 29.472  31.872  2.026   1.00 19.59 ? 203 SER B C   1 
ATOM   4392 O O   . SER B 1 203 ? 30.141  32.330  1.089   1.00 18.98 ? 203 SER B O   1 
ATOM   4393 C CB  . SER B 1 203 ? 26.916  31.423  2.262   1.00 15.12 ? 203 SER B CB  1 
ATOM   4394 O OG  . SER B 1 203 ? 26.745  30.325  3.214   1.00 12.06 ? 203 SER B OG  1 
ATOM   4395 N N   . ARG B 1 204 ? 29.890  30.791  2.752   1.00 19.43 ? 204 ARG B N   1 
ATOM   4396 C CA  . ARG B 1 204 ? 31.302  30.444  2.623   1.00 15.69 ? 204 ARG B CA  1 
ATOM   4397 C C   . ARG B 1 204 ? 31.535  29.045  2.274   1.00 14.69 ? 204 ARG B C   1 
ATOM   4398 O O   . ARG B 1 204 ? 30.663  28.235  2.504   1.00 14.53 ? 204 ARG B O   1 
ATOM   4399 C CB  . ARG B 1 204 ? 32.199  30.892  3.755   1.00 15.40 ? 204 ARG B CB  1 
ATOM   4400 C CG  . ARG B 1 204 ? 31.705  31.000  5.194   1.00 19.51 ? 204 ARG B CG  1 
ATOM   4401 C CD  . ARG B 1 204 ? 32.899  31.417  6.151   1.00 26.43 ? 204 ARG B CD  1 
ATOM   4402 N NE  . ARG B 1 204 ? 33.514  30.403  7.043   1.00 27.20 ? 204 ARG B NE  1 
ATOM   4403 C CZ  . ARG B 1 204 ? 34.282  30.863  8.040   1.00 26.88 ? 204 ARG B CZ  1 
ATOM   4404 N NH1 . ARG B 1 204 ? 34.864  30.070  8.935   1.00 28.15 ? 204 ARG B NH1 1 
ATOM   4405 N NH2 . ARG B 1 204 ? 34.443  32.160  8.179   1.00 31.08 ? 204 ARG B NH2 1 
ATOM   4406 N N   . THR B 1 205 ? 32.679  28.803  1.621   1.00 12.04 ? 205 THR B N   1 
ATOM   4407 C CA  . THR B 1 205 ? 32.782  27.655  0.766   1.00 11.34 ? 205 THR B CA  1 
ATOM   4408 C C   . THR B 1 205 ? 32.809  26.311  1.444   1.00 14.22 ? 205 THR B C   1 
ATOM   4409 O O   . THR B 1 205 ? 32.442  25.260  0.916   1.00 20.72 ? 205 THR B O   1 
ATOM   4410 C CB  . THR B 1 205 ? 33.947  27.824  -0.137  1.00 7.44  ? 205 THR B CB  1 
ATOM   4411 O OG1 . THR B 1 205 ? 35.020  27.168  0.430   1.00 16.56 ? 205 THR B OG1 1 
ATOM   4412 C CG2 . THR B 1 205 ? 34.447  29.266  -0.367  1.00 8.15  ? 205 THR B CG2 1 
ATOM   4413 N N   . THR B 1 206 ? 33.099  26.371  2.733   1.00 16.13 ? 206 THR B N   1 
ATOM   4414 C CA  . THR B 1 206 ? 32.826  25.126  3.512   1.00 14.21 ? 206 THR B CA  1 
ATOM   4415 C C   . THR B 1 206 ? 31.376  24.669  3.821   1.00 16.28 ? 206 THR B C   1 
ATOM   4416 O O   . THR B 1 206 ? 31.068  23.516  4.164   1.00 13.13 ? 206 THR B O   1 
ATOM   4417 C CB  . THR B 1 206 ? 33.741  25.108  4.754   1.00 11.46 ? 206 THR B CB  1 
ATOM   4418 O OG1 . THR B 1 206 ? 34.316  26.412  5.029   1.00 2.00  ? 206 THR B OG1 1 
ATOM   4419 C CG2 . THR B 1 206 ? 34.838  24.105  4.393   1.00 9.64  ? 206 THR B CG2 1 
ATOM   4420 N N   . ASN B 1 207 ? 30.483  25.711  3.655   1.00 15.32 ? 207 ASN B N   1 
ATOM   4421 C CA  . ASN B 1 207 ? 28.992  25.638  3.666   1.00 15.20 ? 207 ASN B CA  1 
ATOM   4422 C C   . ASN B 1 207 ? 28.288  25.041  2.365   1.00 14.69 ? 207 ASN B C   1 
ATOM   4423 O O   . ASN B 1 207 ? 27.635  23.998  2.309   1.00 17.00 ? 207 ASN B O   1 
ATOM   4424 C CB  . ASN B 1 207 ? 28.552  27.074  4.033   1.00 13.76 ? 207 ASN B CB  1 
ATOM   4425 C CG  . ASN B 1 207 ? 28.513  27.109  5.521   1.00 11.55 ? 207 ASN B CG  1 
ATOM   4426 O OD1 . ASN B 1 207 ? 28.465  26.036  6.076   1.00 13.99 ? 207 ASN B OD1 1 
ATOM   4427 N ND2 . ASN B 1 207 ? 28.594  28.288  6.151   1.00 8.80  ? 207 ASN B ND2 1 
ATOM   4428 N N   . PHE B 1 208 ? 28.585  25.771  1.272   1.00 12.06 ? 208 PHE B N   1 
ATOM   4429 C CA  . PHE B 1 208 ? 28.336  25.389  -0.124  1.00 10.67 ? 208 PHE B CA  1 
ATOM   4430 C C   . PHE B 1 208 ? 28.197  23.957  -0.647  1.00 13.30 ? 208 PHE B C   1 
ATOM   4431 O O   . PHE B 1 208 ? 27.185  23.684  -1.331  1.00 13.29 ? 208 PHE B O   1 
ATOM   4432 C CB  . PHE B 1 208 ? 29.191  26.202  -1.033  1.00 6.01  ? 208 PHE B CB  1 
ATOM   4433 C CG  . PHE B 1 208 ? 28.542  27.541  -1.261  1.00 2.00  ? 208 PHE B CG  1 
ATOM   4434 C CD1 . PHE B 1 208 ? 29.272  28.673  -0.818  1.00 4.62  ? 208 PHE B CD1 1 
ATOM   4435 C CD2 . PHE B 1 208 ? 27.291  27.679  -1.930  1.00 2.00  ? 208 PHE B CD2 1 
ATOM   4436 C CE1 . PHE B 1 208 ? 28.749  29.978  -0.998  1.00 5.20  ? 208 PHE B CE1 1 
ATOM   4437 C CE2 . PHE B 1 208 ? 26.766  28.966  -2.058  1.00 5.34  ? 208 PHE B CE2 1 
ATOM   4438 C CZ  . PHE B 1 208 ? 27.468  30.102  -1.556  1.00 2.01  ? 208 PHE B CZ  1 
ATOM   4439 N N   . ALA B 1 209 ? 29.133  23.005  -0.198  1.00 16.48 ? 209 ALA B N   1 
ATOM   4440 C CA  . ALA B 1 209 ? 28.476  21.624  -0.382  1.00 17.16 ? 209 ALA B CA  1 
ATOM   4441 C C   . ALA B 1 209 ? 27.237  21.238  0.418   1.00 13.48 ? 209 ALA B C   1 
ATOM   4442 O O   . ALA B 1 209 ? 26.392  20.567  -0.110  1.00 17.10 ? 209 ALA B O   1 
ATOM   4443 C CB  . ALA B 1 209 ? 29.262  20.314  -0.128  1.00 16.07 ? 209 ALA B CB  1 
ATOM   4444 N N   . GLY B 1 210 ? 27.166  21.676  1.690   1.00 11.35 ? 210 GLY B N   1 
ATOM   4445 C CA  . GLY B 1 210 ? 25.975  21.378  2.459   1.00 5.58  ? 210 GLY B CA  1 
ATOM   4446 C C   . GLY B 1 210 ? 24.757  22.204  2.126   1.00 11.04 ? 210 GLY B C   1 
ATOM   4447 O O   . GLY B 1 210 ? 23.635  21.703  2.205   1.00 17.06 ? 210 GLY B O   1 
ATOM   4448 N N   . ILE B 1 211 ? 25.019  23.515  1.700   1.00 9.47  ? 211 ILE B N   1 
ATOM   4449 C CA  . ILE B 1 211 ? 23.959  24.286  0.964   1.00 8.41  ? 211 ILE B CA  1 
ATOM   4450 C C   . ILE B 1 211 ? 23.460  23.750  -0.436  1.00 11.61 ? 211 ILE B C   1 
ATOM   4451 O O   . ILE B 1 211 ? 22.254  23.713  -0.734  1.00 14.78 ? 211 ILE B O   1 
ATOM   4452 C CB  . ILE B 1 211 ? 24.329  25.772  0.744   1.00 6.01  ? 211 ILE B CB  1 
ATOM   4453 C CG1 . ILE B 1 211 ? 25.061  26.530  1.795   1.00 3.54  ? 211 ILE B CG1 1 
ATOM   4454 C CG2 . ILE B 1 211 ? 23.101  26.615  0.227   1.00 2.00  ? 211 ILE B CG2 1 
ATOM   4455 C CD1 . ILE B 1 211 ? 25.460  27.878  1.143   1.00 5.15  ? 211 ILE B CD1 1 
ATOM   4456 N N   . LEU B 1 212 ? 24.401  23.270  -1.324  1.00 10.78 ? 212 LEU B N   1 
ATOM   4457 C CA  . LEU B 1 212 ? 23.827  22.478  -2.454  1.00 9.55  ? 212 LEU B CA  1 
ATOM   4458 C C   . LEU B 1 212 ? 23.441  21.060  -2.107  1.00 9.51  ? 212 LEU B C   1 
ATOM   4459 O O   . LEU B 1 212 ? 23.047  20.435  -3.040  1.00 10.64 ? 212 LEU B O   1 
ATOM   4460 C CB  . LEU B 1 212 ? 24.814  22.252  -3.548  1.00 4.19  ? 212 LEU B CB  1 
ATOM   4461 C CG  . LEU B 1 212 ? 25.621  23.487  -3.734  1.00 2.00  ? 212 LEU B CG  1 
ATOM   4462 C CD1 . LEU B 1 212 ? 26.821  23.453  -4.716  1.00 2.00  ? 212 LEU B CD1 1 
ATOM   4463 C CD2 . LEU B 1 212 ? 24.499  24.436  -4.099  1.00 5.64  ? 212 LEU B CD2 1 
ATOM   4464 N N   . SER B 1 213 ? 23.589  20.631  -0.845  1.00 10.58 ? 213 SER B N   1 
ATOM   4465 C CA  . SER B 1 213 ? 23.076  19.323  -0.459  1.00 11.49 ? 213 SER B CA  1 
ATOM   4466 C C   . SER B 1 213 ? 21.766  19.247  0.200   1.00 12.71 ? 213 SER B C   1 
ATOM   4467 O O   . SER B 1 213 ? 21.049  18.289  0.129   1.00 9.92  ? 213 SER B O   1 
ATOM   4468 C CB  . SER B 1 213 ? 23.995  18.432  0.466   1.00 16.39 ? 213 SER B CB  1 
ATOM   4469 O OG  . SER B 1 213 ? 24.587  19.031  1.701   1.00 19.88 ? 213 SER B OG  1 
ATOM   4470 N N   . GLN B 1 214 ? 21.536  20.289  1.000   1.00 10.76 ? 214 GLN B N   1 
ATOM   4471 C CA  . GLN B 1 214 ? 20.193  20.571  1.457   1.00 12.74 ? 214 GLN B CA  1 
ATOM   4472 C C   . GLN B 1 214 ? 19.621  22.016  1.591   1.00 11.08 ? 214 GLN B C   1 
ATOM   4473 O O   . GLN B 1 214 ? 18.682  22.204  2.390   1.00 9.72  ? 214 GLN B O   1 
ATOM   4474 C CB  . GLN B 1 214 ? 19.563  19.807  2.595   1.00 19.17 ? 214 GLN B CB  1 
ATOM   4475 C CG  . GLN B 1 214 ? 20.023  20.031  3.969   1.00 25.39 ? 214 GLN B CG  1 
ATOM   4476 C CD  . GLN B 1 214 ? 21.074  19.054  4.111   1.00 26.05 ? 214 GLN B CD  1 
ATOM   4477 O OE1 . GLN B 1 214 ? 22.233  19.295  3.793   1.00 19.45 ? 214 GLN B OE1 1 
ATOM   4478 N NE2 . GLN B 1 214 ? 20.546  17.883  4.474   1.00 26.22 ? 214 GLN B NE2 1 
ATOM   4479 N N   . GLY B 1 215 ? 20.326  22.850  0.750   1.00 6.42  ? 215 GLY B N   1 
ATOM   4480 C CA  . GLY B 1 215 ? 19.921  24.276  0.587   1.00 2.37  ? 215 GLY B CA  1 
ATOM   4481 C C   . GLY B 1 215 ? 19.768  25.166  1.792   1.00 2.00  ? 215 GLY B C   1 
ATOM   4482 O O   . GLY B 1 215 ? 19.684  24.706  2.933   1.00 2.00  ? 215 GLY B O   1 
ATOM   4483 N N   . LEU B 1 216 ? 19.884  26.480  1.535   1.00 2.07  ? 216 LEU B N   1 
ATOM   4484 C CA  . LEU B 1 216 ? 19.571  27.339  2.677   1.00 3.53  ? 216 LEU B CA  1 
ATOM   4485 C C   . LEU B 1 216 ? 18.592  26.772  3.738   1.00 5.56  ? 216 LEU B C   1 
ATOM   4486 O O   . LEU B 1 216 ? 17.448  26.527  3.482   1.00 5.41  ? 216 LEU B O   1 
ATOM   4487 C CB  . LEU B 1 216 ? 19.134  28.658  2.134   1.00 2.00  ? 216 LEU B CB  1 
ATOM   4488 C CG  . LEU B 1 216 ? 20.304  29.139  1.274   1.00 2.00  ? 216 LEU B CG  1 
ATOM   4489 C CD1 . LEU B 1 216 ? 20.114  30.628  0.966   1.00 2.00  ? 216 LEU B CD1 1 
ATOM   4490 C CD2 . LEU B 1 216 ? 21.650  28.976  1.883   1.00 2.00  ? 216 LEU B CD2 1 
ATOM   4491 N N   . ARG B 1 217 ? 19.076  26.412  4.933   1.00 6.53  ? 217 ARG B N   1 
ATOM   4492 C CA  . ARG B 1 217 ? 18.225  25.963  6.060   1.00 8.52  ? 217 ARG B CA  1 
ATOM   4493 C C   . ARG B 1 217 ? 18.250  26.838  7.316   1.00 7.83  ? 217 ARG B C   1 
ATOM   4494 O O   . ARG B 1 217 ? 18.882  27.882  7.206   1.00 10.65 ? 217 ARG B O   1 
ATOM   4495 C CB  . ARG B 1 217 ? 18.737  24.717  6.638   1.00 10.86 ? 217 ARG B CB  1 
ATOM   4496 C CG  . ARG B 1 217 ? 17.858  23.501  6.442   1.00 16.08 ? 217 ARG B CG  1 
ATOM   4497 C CD  . ARG B 1 217 ? 18.765  22.266  6.290   1.00 17.78 ? 217 ARG B CD  1 
ATOM   4498 N NE  . ARG B 1 217 ? 19.792  22.664  5.332   1.00 20.69 ? 217 ARG B NE  1 
ATOM   4499 C CZ  . ARG B 1 217 ? 21.115  22.561  5.589   1.00 20.51 ? 217 ARG B CZ  1 
ATOM   4500 N NH1 . ARG B 1 217 ? 21.517  21.780  6.645   1.00 19.11 ? 217 ARG B NH1 1 
ATOM   4501 N NH2 . ARG B 1 217 ? 21.921  23.285  4.744   1.00 20.61 ? 217 ARG B NH2 1 
ATOM   4502 N N   . ILE B 1 218 ? 17.555  26.442  8.458   1.00 5.74  ? 218 ILE B N   1 
ATOM   4503 C CA  . ILE B 1 218 ? 17.486  27.306  9.642   1.00 2.67  ? 218 ILE B CA  1 
ATOM   4504 C C   . ILE B 1 218 ? 17.964  26.792  10.905  1.00 2.00  ? 218 ILE B C   1 
ATOM   4505 O O   . ILE B 1 218 ? 17.845  25.615  11.173  1.00 5.04  ? 218 ILE B O   1 
ATOM   4506 C CB  . ILE B 1 218 ? 16.161  28.026  9.932   1.00 2.00  ? 218 ILE B CB  1 
ATOM   4507 C CG1 . ILE B 1 218 ? 14.780  27.534  9.527   1.00 2.03  ? 218 ILE B CG1 1 
ATOM   4508 C CG2 . ILE B 1 218 ? 16.282  29.334  9.210   1.00 8.02  ? 218 ILE B CG2 1 
ATOM   4509 C CD1 . ILE B 1 218 ? 14.070  28.346  8.388   1.00 2.00  ? 218 ILE B CD1 1 
ATOM   4510 N N   . ALA B 1 219 ? 18.538  27.678  11.689  1.00 2.00  ? 219 ALA B N   1 
ATOM   4511 C CA  . ALA B 1 219 ? 19.091  27.108  12.946  1.00 2.00  ? 219 ALA B CA  1 
ATOM   4512 C C   . ALA B 1 219 ? 18.251  25.974  13.669  1.00 2.00  ? 219 ALA B C   1 
ATOM   4513 O O   . ALA B 1 219 ? 17.017  26.073  13.683  1.00 6.10  ? 219 ALA B O   1 
ATOM   4514 C CB  . ALA B 1 219 ? 19.271  28.233  13.993  1.00 3.31  ? 219 ALA B CB  1 
ATOM   4515 N N   . PRO B 1 220 ? 18.925  24.949  14.352  1.00 2.00  ? 220 PRO B N   1 
ATOM   4516 C CA  . PRO B 1 220 ? 18.062  23.907  14.999  1.00 2.00  ? 220 PRO B CA  1 
ATOM   4517 C C   . PRO B 1 220 ? 17.227  24.510  16.141  1.00 5.08  ? 220 PRO B C   1 
ATOM   4518 O O   . PRO B 1 220 ? 17.457  25.671  16.460  1.00 9.17  ? 220 PRO B O   1 
ATOM   4519 C CB  . PRO B 1 220 ? 19.089  22.885  15.377  1.00 2.00  ? 220 PRO B CB  1 
ATOM   4520 C CG  . PRO B 1 220 ? 20.429  23.393  14.849  1.00 3.42  ? 220 PRO B CG  1 
ATOM   4521 C CD  . PRO B 1 220 ? 20.322  24.862  14.563  1.00 2.00  ? 220 PRO B CD  1 
ATOM   4522 N N   . PRO B 1 221 ? 16.249  23.824  16.789  1.00 2.29  ? 221 PRO B N   1 
ATOM   4523 C CA  . PRO B 1 221 ? 15.430  24.483  17.813  1.00 2.00  ? 221 PRO B CA  1 
ATOM   4524 C C   . PRO B 1 221 ? 16.178  24.936  18.982  1.00 3.71  ? 221 PRO B C   1 
ATOM   4525 O O   . PRO B 1 221 ? 16.216  26.125  19.237  1.00 8.83  ? 221 PRO B O   1 
ATOM   4526 C CB  . PRO B 1 221 ? 14.394  23.523  18.169  1.00 2.86  ? 221 PRO B CB  1 
ATOM   4527 C CG  . PRO B 1 221 ? 14.327  22.590  16.955  1.00 5.49  ? 221 PRO B CG  1 
ATOM   4528 C CD  . PRO B 1 221 ? 15.757  22.511  16.481  1.00 5.16  ? 221 PRO B CD  1 
ATOM   4529 N N   . GLU B 1 222 ? 17.055  24.043  19.514  1.00 2.00  ? 222 GLU B N   1 
ATOM   4530 C CA  . GLU B 1 222 ? 18.224  24.568  20.286  1.00 2.00  ? 222 GLU B CA  1 
ATOM   4531 C C   . GLU B 1 222 ? 18.963  25.941  20.117  1.00 7.39  ? 222 GLU B C   1 
ATOM   4532 O O   . GLU B 1 222 ? 19.225  26.611  21.102  1.00 13.34 ? 222 GLU B O   1 
ATOM   4533 C CB  . GLU B 1 222 ? 19.315  23.603  20.216  1.00 2.00  ? 222 GLU B CB  1 
ATOM   4534 C CG  . GLU B 1 222 ? 18.880  22.238  20.667  1.00 3.86  ? 222 GLU B CG  1 
ATOM   4535 C CD  . GLU B 1 222 ? 18.370  21.212  19.580  1.00 6.57  ? 222 GLU B CD  1 
ATOM   4536 O OE1 . GLU B 1 222 ? 19.184  20.613  18.913  1.00 9.49  ? 222 GLU B OE1 1 
ATOM   4537 O OE2 . GLU B 1 222 ? 17.171  20.910  19.509  1.00 8.99  ? 222 GLU B OE2 1 
ATOM   4538 N N   . ALA B 1 223 ? 19.389  26.382  18.906  1.00 7.21  ? 223 ALA B N   1 
ATOM   4539 C CA  . ALA B 1 223 ? 20.113  27.709  18.841  1.00 7.18  ? 223 ALA B CA  1 
ATOM   4540 C C   . ALA B 1 223 ? 19.321  28.989  19.232  1.00 9.31  ? 223 ALA B C   1 
ATOM   4541 O O   . ALA B 1 223 ? 18.106  29.098  19.148  1.00 9.87  ? 223 ALA B O   1 
ATOM   4542 C CB  . ALA B 1 223 ? 20.561  27.986  17.473  1.00 2.00  ? 223 ALA B CB  1 
ATOM   4543 N N   . PRO B 1 224 ? 19.998  30.058  19.751  1.00 8.36  ? 224 PRO B N   1 
ATOM   4544 C CA  . PRO B 1 224 ? 19.116  31.086  20.318  1.00 2.00  ? 224 PRO B CA  1 
ATOM   4545 C C   . PRO B 1 224 ? 18.507  32.004  19.308  1.00 2.61  ? 224 PRO B C   1 
ATOM   4546 O O   . PRO B 1 224 ? 19.178  32.687  18.522  1.00 2.00  ? 224 PRO B O   1 
ATOM   4547 C CB  . PRO B 1 224 ? 20.056  31.790  21.353  1.00 6.70  ? 224 PRO B CB  1 
ATOM   4548 C CG  . PRO B 1 224 ? 21.490  31.386  21.088  1.00 6.14  ? 224 PRO B CG  1 
ATOM   4549 C CD  . PRO B 1 224 ? 21.403  30.398  19.909  1.00 3.18  ? 224 PRO B CD  1 
ATOM   4550 N N   . VAL B 1 225 ? 17.178  32.106  19.485  1.00 3.62  ? 225 VAL B N   1 
ATOM   4551 C CA  . VAL B 1 225 ? 16.552  33.212  18.727  1.00 2.00  ? 225 VAL B CA  1 
ATOM   4552 C C   . VAL B 1 225 ? 17.193  34.568  18.906  1.00 2.00  ? 225 VAL B C   1 
ATOM   4553 O O   . VAL B 1 225 ? 17.369  35.364  18.017  1.00 5.28  ? 225 VAL B O   1 
ATOM   4554 C CB  . VAL B 1 225 ? 15.058  33.350  18.869  1.00 3.45  ? 225 VAL B CB  1 
ATOM   4555 C CG1 . VAL B 1 225 ? 14.456  34.267  17.837  1.00 4.75  ? 225 VAL B CG1 1 
ATOM   4556 C CG2 . VAL B 1 225 ? 14.379  32.007  18.627  1.00 8.49  ? 225 VAL B CG2 1 
ATOM   4557 N N   . THR B 1 226 ? 17.710  34.785  20.096  1.00 4.76  ? 226 THR B N   1 
ATOM   4558 C CA  . THR B 1 226 ? 18.321  36.119  20.304  1.00 4.35  ? 226 THR B CA  1 
ATOM   4559 C C   . THR B 1 226 ? 19.576  36.243  19.591  1.00 6.73  ? 226 THR B C   1 
ATOM   4560 O O   . THR B 1 226 ? 20.031  37.345  19.531  1.00 12.67 ? 226 THR B O   1 
ATOM   4561 C CB  . THR B 1 226 ? 18.725  36.332  21.705  1.00 2.00  ? 226 THR B CB  1 
ATOM   4562 O OG1 . THR B 1 226 ? 18.082  35.334  22.386  1.00 2.00  ? 226 THR B OG1 1 
ATOM   4563 C CG2 . THR B 1 226 ? 18.366  37.519  22.528  1.00 2.00  ? 226 THR B CG2 1 
ATOM   4564 N N   . GLY B 1 227 ? 20.128  35.177  19.069  1.00 5.65  ? 227 GLY B N   1 
ATOM   4565 C CA  . GLY B 1 227 ? 21.448  35.421  18.489  1.00 5.45  ? 227 GLY B CA  1 
ATOM   4566 C C   . GLY B 1 227 ? 21.523  35.192  16.990  1.00 8.67  ? 227 GLY B C   1 
ATOM   4567 O O   . GLY B 1 227 ? 22.161  34.182  16.585  1.00 11.65 ? 227 GLY B O   1 
ATOM   4568 N N   . TYR B 1 228 ? 20.601  36.070  16.377  1.00 6.62  ? 228 TYR B N   1 
ATOM   4569 C CA  . TYR B 1 228 ? 20.261  36.366  14.941  1.00 4.75  ? 228 TYR B CA  1 
ATOM   4570 C C   . TYR B 1 228 ? 19.379  37.658  14.832  1.00 3.80  ? 228 TYR B C   1 
ATOM   4571 O O   . TYR B 1 228 ? 18.461  37.691  15.672  1.00 3.19  ? 228 TYR B O   1 
ATOM   4572 C CB  . TYR B 1 228 ? 19.449  35.253  14.213  1.00 4.35  ? 228 TYR B CB  1 
ATOM   4573 C CG  . TYR B 1 228 ? 20.043  33.877  14.265  1.00 5.10  ? 228 TYR B CG  1 
ATOM   4574 C CD1 . TYR B 1 228 ? 19.291  32.879  14.886  1.00 3.95  ? 228 TYR B CD1 1 
ATOM   4575 C CD2 . TYR B 1 228 ? 21.359  33.667  13.803  1.00 7.82  ? 228 TYR B CD2 1 
ATOM   4576 C CE1 . TYR B 1 228 ? 19.930  31.687  15.150  1.00 3.70  ? 228 TYR B CE1 1 
ATOM   4577 C CE2 . TYR B 1 228 ? 22.020  32.493  14.104  1.00 6.17  ? 228 TYR B CE2 1 
ATOM   4578 C CZ  . TYR B 1 228 ? 21.233  31.528  14.721  1.00 5.24  ? 228 TYR B CZ  1 
ATOM   4579 O OH  . TYR B 1 228 ? 21.727  30.286  14.864  1.00 5.11  ? 228 TYR B OH  1 
ATOM   4580 N N   . MET B 1 229 ? 19.586  38.668  13.905  1.00 2.00  ? 229 MET B N   1 
ATOM   4581 C CA  . MET B 1 229 ? 19.014  40.013  13.973  1.00 2.00  ? 229 MET B CA  1 
ATOM   4582 C C   . MET B 1 229 ? 17.485  40.151  14.149  1.00 3.71  ? 229 MET B C   1 
ATOM   4583 O O   . MET B 1 229 ? 16.764  40.956  14.763  1.00 2.00  ? 229 MET B O   1 
ATOM   4584 C CB  . MET B 1 229 ? 19.544  40.870  12.824  1.00 4.89  ? 229 MET B CB  1 
ATOM   4585 C CG  . MET B 1 229 ? 18.904  42.241  12.957  1.00 2.42  ? 229 MET B CG  1 
ATOM   4586 S SD  . MET B 1 229 ? 19.818  43.621  12.306  1.00 2.00  ? 229 MET B SD  1 
ATOM   4587 C CE  . MET B 1 229 ? 18.480  44.661  12.738  1.00 2.00  ? 229 MET B CE  1 
ATOM   4588 N N   . PHE B 1 230 ? 16.946  39.149  13.499  1.00 4.29  ? 230 PHE B N   1 
ATOM   4589 C CA  . PHE B 1 230 ? 15.520  38.983  13.264  1.00 2.00  ? 230 PHE B CA  1 
ATOM   4590 C C   . PHE B 1 230 ? 15.331  37.521  13.430  1.00 2.00  ? 230 PHE B C   1 
ATOM   4591 O O   . PHE B 1 230 ? 15.412  36.845  12.474  1.00 3.77  ? 230 PHE B O   1 
ATOM   4592 C CB  . PHE B 1 230 ? 15.178  39.417  11.850  1.00 2.00  ? 230 PHE B CB  1 
ATOM   4593 C CG  . PHE B 1 230 ? 15.436  40.791  11.425  1.00 2.00  ? 230 PHE B CG  1 
ATOM   4594 C CD1 . PHE B 1 230 ? 14.768  41.866  12.028  1.00 4.26  ? 230 PHE B CD1 1 
ATOM   4595 C CD2 . PHE B 1 230 ? 16.345  41.030  10.410  1.00 2.00  ? 230 PHE B CD2 1 
ATOM   4596 C CE1 . PHE B 1 230 ? 15.006  43.225  11.613  1.00 2.00  ? 230 PHE B CE1 1 
ATOM   4597 C CE2 . PHE B 1 230 ? 16.569  42.375  9.963   1.00 5.92  ? 230 PHE B CE2 1 
ATOM   4598 C CZ  . PHE B 1 230 ? 15.886  43.478  10.537  1.00 2.00  ? 230 PHE B CZ  1 
ATOM   4599 N N   . GLY B 1 231 ? 15.265  37.013  14.594  1.00 2.69  ? 231 GLY B N   1 
ATOM   4600 C CA  . GLY B 1 231 ? 15.147  35.564  14.680  1.00 3.44  ? 231 GLY B CA  1 
ATOM   4601 C C   . GLY B 1 231 ? 15.669  34.635  13.607  1.00 8.10  ? 231 GLY B C   1 
ATOM   4602 O O   . GLY B 1 231 ? 16.654  34.892  12.950  1.00 5.39  ? 231 GLY B O   1 
ATOM   4603 N N   . LYS B 1 232 ? 15.046  33.476  13.477  1.00 10.42 ? 232 LYS B N   1 
ATOM   4604 C CA  . LYS B 1 232 ? 15.617  32.430  12.640  1.00 10.20 ? 232 LYS B CA  1 
ATOM   4605 C C   . LYS B 1 232 ? 14.901  32.058  11.369  1.00 9.21  ? 232 LYS B C   1 
ATOM   4606 O O   . LYS B 1 232 ? 14.603  31.003  10.911  1.00 6.87  ? 232 LYS B O   1 
ATOM   4607 C CB  . LYS B 1 232 ? 16.099  31.236  13.393  1.00 9.60  ? 232 LYS B CB  1 
ATOM   4608 C CG  . LYS B 1 232 ? 16.202  31.577  14.848  1.00 2.78  ? 232 LYS B CG  1 
ATOM   4609 C CD  . LYS B 1 232 ? 16.955  30.554  15.602  1.00 3.84  ? 232 LYS B CD  1 
ATOM   4610 C CE  . LYS B 1 232 ? 16.195  29.288  15.875  1.00 2.00  ? 232 LYS B CE  1 
ATOM   4611 N NZ  . LYS B 1 232 ? 15.596  29.629  17.155  1.00 9.99  ? 232 LYS B NZ  1 
ATOM   4612 N N   . GLY B 1 233 ? 14.986  33.050  10.554  1.00 13.61 ? 233 GLY B N   1 
ATOM   4613 C CA  . GLY B 1 233 ? 14.912  32.530  9.183   1.00 8.99  ? 233 GLY B CA  1 
ATOM   4614 C C   . GLY B 1 233 ? 16.132  32.353  8.276   1.00 8.06  ? 233 GLY B C   1 
ATOM   4615 O O   . GLY B 1 233 ? 17.249  32.097  8.670   1.00 10.87 ? 233 GLY B O   1 
ATOM   4616 N N   . ILE B 1 234 ? 15.859  32.545  6.950   1.00 7.40  ? 234 ILE B N   1 
ATOM   4617 C CA  . ILE B 1 234 ? 16.964  32.653  5.998   1.00 6.23  ? 234 ILE B CA  1 
ATOM   4618 C C   . ILE B 1 234 ? 17.069  34.078  5.620   1.00 5.74  ? 234 ILE B C   1 
ATOM   4619 O O   . ILE B 1 234 ? 16.067  34.805  5.714   1.00 9.56  ? 234 ILE B O   1 
ATOM   4620 C CB  . ILE B 1 234 ? 16.809  31.740  4.822   1.00 2.00  ? 234 ILE B CB  1 
ATOM   4621 C CG1 . ILE B 1 234 ? 16.198  30.479  5.339   1.00 2.00  ? 234 ILE B CG1 1 
ATOM   4622 C CG2 . ILE B 1 234 ? 18.239  31.552  4.525   1.00 2.00  ? 234 ILE B CG2 1 
ATOM   4623 C CD1 . ILE B 1 234 ? 16.249  29.361  4.365   1.00 2.00  ? 234 ILE B CD1 1 
ATOM   4624 N N   . TYR B 1 235 ? 18.336  34.434  5.318   1.00 2.00  ? 235 TYR B N   1 
ATOM   4625 C CA  . TYR B 1 235 ? 18.630  35.860  5.368   1.00 2.40  ? 235 TYR B CA  1 
ATOM   4626 C C   . TYR B 1 235 ? 19.086  36.260  3.903   1.00 5.47  ? 235 TYR B C   1 
ATOM   4627 O O   . TYR B 1 235 ? 19.780  35.520  3.217   1.00 6.76  ? 235 TYR B O   1 
ATOM   4628 C CB  . TYR B 1 235 ? 19.741  36.125  6.543   1.00 2.00  ? 235 TYR B CB  1 
ATOM   4629 C CG  . TYR B 1 235 ? 19.223  36.182  7.966   1.00 2.00  ? 235 TYR B CG  1 
ATOM   4630 C CD1 . TYR B 1 235 ? 18.770  35.114  8.761   1.00 4.30  ? 235 TYR B CD1 1 
ATOM   4631 C CD2 . TYR B 1 235 ? 19.096  37.443  8.424   1.00 4.44  ? 235 TYR B CD2 1 
ATOM   4632 C CE1 . TYR B 1 235 ? 18.112  35.336  9.986   1.00 2.00  ? 235 TYR B CE1 1 
ATOM   4633 C CE2 . TYR B 1 235 ? 18.497  37.707  9.651   1.00 2.00  ? 235 TYR B CE2 1 
ATOM   4634 C CZ  . TYR B 1 235 ? 18.076  36.665  10.464  1.00 2.00  ? 235 TYR B CZ  1 
ATOM   4635 O OH  . TYR B 1 235 ? 17.681  37.067  11.717  1.00 3.52  ? 235 TYR B OH  1 
ATOM   4636 N N   . PHE B 1 236 ? 18.676  37.433  3.448   1.00 2.00  ? 236 PHE B N   1 
ATOM   4637 C CA  . PHE B 1 236 ? 19.054  37.674  2.098   1.00 2.00  ? 236 PHE B CA  1 
ATOM   4638 C C   . PHE B 1 236 ? 19.314  39.107  2.005   1.00 2.00  ? 236 PHE B C   1 
ATOM   4639 O O   . PHE B 1 236 ? 18.739  39.880  2.754   1.00 3.78  ? 236 PHE B O   1 
ATOM   4640 C CB  . PHE B 1 236 ? 17.878  37.286  1.240   1.00 2.72  ? 236 PHE B CB  1 
ATOM   4641 C CG  . PHE B 1 236 ? 17.706  35.830  1.118   1.00 2.44  ? 236 PHE B CG  1 
ATOM   4642 C CD1 . PHE B 1 236 ? 16.736  35.191  1.842   1.00 2.00  ? 236 PHE B CD1 1 
ATOM   4643 C CD2 . PHE B 1 236 ? 18.519  35.123  0.225   1.00 7.01  ? 236 PHE B CD2 1 
ATOM   4644 C CE1 . PHE B 1 236 ? 16.473  33.847  1.610   1.00 2.00  ? 236 PHE B CE1 1 
ATOM   4645 C CE2 . PHE B 1 236 ? 18.266  33.768  -0.003  1.00 2.95  ? 236 PHE B CE2 1 
ATOM   4646 C CZ  . PHE B 1 236 ? 17.187  33.162  0.647   1.00 2.00  ? 236 PHE B CZ  1 
ATOM   4647 N N   . ALA B 1 237 ? 20.119  39.453  1.056   1.00 2.00  ? 237 ALA B N   1 
ATOM   4648 C CA  . ALA B 1 237 ? 19.863  40.852  0.656   1.00 4.55  ? 237 ALA B CA  1 
ATOM   4649 C C   . ALA B 1 237 ? 19.793  41.213  -0.879  1.00 6.76  ? 237 ALA B C   1 
ATOM   4650 O O   . ALA B 1 237 ? 19.925  40.282  -1.687  1.00 6.58  ? 237 ALA B O   1 
ATOM   4651 C CB  . ALA B 1 237 ? 20.829  41.779  1.378   1.00 5.14  ? 237 ALA B CB  1 
ATOM   4652 N N   . ASP B 1 238 ? 19.462  42.542  -1.033  1.00 7.17  ? 238 ASP B N   1 
ATOM   4653 C CA  . ASP B 1 238 ? 19.596  43.346  -2.259  1.00 4.76  ? 238 ASP B CA  1 
ATOM   4654 C C   . ASP B 1 238 ? 20.780  44.315  -2.456  1.00 11.63 ? 238 ASP B C   1 
ATOM   4655 O O   . ASP B 1 238 ? 20.530  45.310  -3.105  1.00 16.22 ? 238 ASP B O   1 
ATOM   4656 C CB  . ASP B 1 238 ? 18.332  43.952  -2.810  1.00 4.67  ? 238 ASP B CB  1 
ATOM   4657 C CG  . ASP B 1 238 ? 17.743  45.046  -1.999  1.00 6.75  ? 238 ASP B CG  1 
ATOM   4658 O OD1 . ASP B 1 238 ? 18.329  45.517  -1.063  1.00 7.23  ? 238 ASP B OD1 1 
ATOM   4659 O OD2 . ASP B 1 238 ? 16.634  45.433  -2.301  1.00 5.04  ? 238 ASP B OD2 1 
ATOM   4660 N N   . MET B 1 239 ? 21.951  43.926  -1.874  1.00 13.28 ? 239 MET B N   1 
ATOM   4661 C CA  . MET B 1 239 ? 23.363  44.280  -2.261  1.00 10.64 ? 239 MET B CA  1 
ATOM   4662 C C   . MET B 1 239 ? 24.307  43.083  -2.675  1.00 11.37 ? 239 MET B C   1 
ATOM   4663 O O   . MET B 1 239 ? 24.441  42.032  -2.065  1.00 10.29 ? 239 MET B O   1 
ATOM   4664 C CB  . MET B 1 239 ? 24.152  45.019  -1.151  1.00 9.57  ? 239 MET B CB  1 
ATOM   4665 C CG  . MET B 1 239 ? 23.500  46.387  -0.916  1.00 15.31 ? 239 MET B CG  1 
ATOM   4666 S SD  . MET B 1 239 ? 23.159  47.141  -2.561  1.00 23.11 ? 239 MET B SD  1 
ATOM   4667 C CE  . MET B 1 239 ? 21.715  48.169  -2.129  1.00 8.51  ? 239 MET B CE  1 
ATOM   4668 N N   . VAL B 1 240 ? 25.170  43.225  -3.646  1.00 12.96 ? 240 VAL B N   1 
ATOM   4669 C CA  . VAL B 1 240 ? 26.059  42.058  -3.769  1.00 15.93 ? 240 VAL B CA  1 
ATOM   4670 C C   . VAL B 1 240 ? 27.145  41.914  -2.643  1.00 17.29 ? 240 VAL B C   1 
ATOM   4671 O O   . VAL B 1 240 ? 26.967  41.044  -1.809  1.00 20.90 ? 240 VAL B O   1 
ATOM   4672 C CB  . VAL B 1 240 ? 26.556  41.688  -5.228  1.00 17.08 ? 240 VAL B CB  1 
ATOM   4673 C CG1 . VAL B 1 240 ? 27.325  42.841  -6.000  1.00 10.93 ? 240 VAL B CG1 1 
ATOM   4674 C CG2 . VAL B 1 240 ? 27.102  40.180  -5.149  1.00 14.09 ? 240 VAL B CG2 1 
ATOM   4675 N N   . SER B 1 241 ? 28.198  42.804  -2.539  1.00 14.66 ? 241 SER B N   1 
ATOM   4676 C CA  . SER B 1 241 ? 28.716  43.240  -1.222  1.00 12.50 ? 241 SER B CA  1 
ATOM   4677 C C   . SER B 1 241 ? 28.046  42.904  0.209   1.00 10.68 ? 241 SER B C   1 
ATOM   4678 O O   . SER B 1 241 ? 28.571  42.027  0.879   1.00 13.72 ? 241 SER B O   1 
ATOM   4679 C CB  . SER B 1 241 ? 28.928  44.724  -1.452  1.00 15.84 ? 241 SER B CB  1 
ATOM   4680 O OG  . SER B 1 241 ? 27.685  45.405  -1.572  1.00 21.42 ? 241 SER B OG  1 
ATOM   4681 N N   . LYS B 1 242 ? 26.851  43.555  0.652   1.00 7.95  ? 242 LYS B N   1 
ATOM   4682 C CA  . LYS B 1 242 ? 26.149  43.133  1.954   1.00 2.10  ? 242 LYS B CA  1 
ATOM   4683 C C   . LYS B 1 242 ? 26.132  41.636  1.966   1.00 2.00  ? 242 LYS B C   1 
ATOM   4684 O O   . LYS B 1 242 ? 26.332  40.864  2.874   1.00 2.00  ? 242 LYS B O   1 
ATOM   4685 C CB  . LYS B 1 242 ? 24.713  43.695  2.378   1.00 3.84  ? 242 LYS B CB  1 
ATOM   4686 C CG  . LYS B 1 242 ? 24.057  43.954  3.804   1.00 2.00  ? 242 LYS B CG  1 
ATOM   4687 C CD  . LYS B 1 242 ? 24.515  45.273  4.685   1.00 10.92 ? 242 LYS B CD  1 
ATOM   4688 C CE  . LYS B 1 242 ? 24.069  45.475  6.320   1.00 9.95  ? 242 LYS B CE  1 
ATOM   4689 N NZ  . LYS B 1 242 ? 24.000  46.718  7.141   1.00 2.00  ? 242 LYS B NZ  1 
ATOM   4690 N N   . SER B 1 243 ? 26.017  41.219  0.782   1.00 3.41  ? 243 SER B N   1 
ATOM   4691 C CA  . SER B 1 243 ? 25.838  39.786  0.896   1.00 6.72  ? 243 SER B CA  1 
ATOM   4692 C C   . SER B 1 243 ? 27.104  38.999  0.913   1.00 7.37  ? 243 SER B C   1 
ATOM   4693 O O   . SER B 1 243 ? 27.193  37.843  1.332   1.00 12.07 ? 243 SER B O   1 
ATOM   4694 C CB  . SER B 1 243 ? 24.676  39.301  -0.044  1.00 8.66  ? 243 SER B CB  1 
ATOM   4695 O OG  . SER B 1 243 ? 23.973  38.129  0.465   1.00 6.11  ? 243 SER B OG  1 
ATOM   4696 N N   . ALA B 1 244 ? 28.114  39.716  0.395   1.00 5.86  ? 244 ALA B N   1 
ATOM   4697 C CA  . ALA B 1 244 ? 29.234  38.994  -0.224  1.00 5.10  ? 244 ALA B CA  1 
ATOM   4698 C C   . ALA B 1 244 ? 30.283  38.699  0.886   1.00 7.08  ? 244 ALA B C   1 
ATOM   4699 O O   . ALA B 1 244 ? 30.825  37.626  1.218   1.00 5.64  ? 244 ALA B O   1 
ATOM   4700 C CB  . ALA B 1 244 ? 29.714  39.808  -1.503  1.00 2.00  ? 244 ALA B CB  1 
ATOM   4701 N N   . ASN B 1 245 ? 30.325  39.823  1.712   1.00 7.17  ? 245 ASN B N   1 
ATOM   4702 C CA  . ASN B 1 245 ? 31.062  39.706  3.023   1.00 4.98  ? 245 ASN B CA  1 
ATOM   4703 C C   . ASN B 1 245 ? 30.986  38.370  3.853   1.00 4.75  ? 245 ASN B C   1 
ATOM   4704 O O   . ASN B 1 245 ? 31.929  37.791  4.308   1.00 6.18  ? 245 ASN B O   1 
ATOM   4705 C CB  . ASN B 1 245 ? 30.770  40.925  3.859   1.00 2.00  ? 245 ASN B CB  1 
ATOM   4706 C CG  . ASN B 1 245 ? 30.754  42.176  3.024   1.00 2.00  ? 245 ASN B CG  1 
ATOM   4707 O OD1 . ASN B 1 245 ? 31.150  42.229  1.887   1.00 2.00  ? 245 ASN B OD1 1 
ATOM   4708 N ND2 . ASN B 1 245 ? 30.382  43.312  3.581   1.00 2.00  ? 245 ASN B ND2 1 
ATOM   4709 N N   . TYR B 1 246 ? 29.845  37.744  3.924   1.00 2.00  ? 246 TYR B N   1 
ATOM   4710 C CA  . TYR B 1 246 ? 29.755  36.351  4.545   1.00 5.21  ? 246 TYR B CA  1 
ATOM   4711 C C   . TYR B 1 246 ? 30.372  35.209  3.676   1.00 10.20 ? 246 TYR B C   1 
ATOM   4712 O O   . TYR B 1 246 ? 30.303  34.033  3.765   1.00 12.58 ? 246 TYR B O   1 
ATOM   4713 C CB  . TYR B 1 246 ? 28.280  36.085  4.924   1.00 2.00  ? 246 TYR B CB  1 
ATOM   4714 C CG  . TYR B 1 246 ? 27.657  37.328  5.578   1.00 2.00  ? 246 TYR B CG  1 
ATOM   4715 C CD1 . TYR B 1 246 ? 27.318  37.308  6.937   1.00 2.00  ? 246 TYR B CD1 1 
ATOM   4716 C CD2 . TYR B 1 246 ? 27.437  38.504  4.830   1.00 2.00  ? 246 TYR B CD2 1 
ATOM   4717 C CE1 . TYR B 1 246 ? 26.553  38.299  7.534   1.00 2.00  ? 246 TYR B CE1 1 
ATOM   4718 C CE2 . TYR B 1 246 ? 26.776  39.562  5.444   1.00 2.00  ? 246 TYR B CE2 1 
ATOM   4719 C CZ  . TYR B 1 246 ? 26.168  39.351  6.710   1.00 2.00  ? 246 TYR B CZ  1 
ATOM   4720 O OH  . TYR B 1 246 ? 25.175  40.143  7.133   1.00 3.19  ? 246 TYR B OH  1 
ATOM   4721 N N   . CYS B 1 247 ? 31.159  35.645  2.735   1.00 10.90 ? 247 CYS B N   1 
ATOM   4722 C CA  . CYS B 1 247 ? 31.921  34.638  2.029   1.00 16.02 ? 247 CYS B CA  1 
ATOM   4723 C C   . CYS B 1 247 ? 33.316  34.608  2.663   1.00 19.92 ? 247 CYS B C   1 
ATOM   4724 O O   . CYS B 1 247 ? 34.035  33.631  2.629   1.00 23.64 ? 247 CYS B O   1 
ATOM   4725 C CB  . CYS B 1 247 ? 31.942  34.926  0.527   1.00 20.28 ? 247 CYS B CB  1 
ATOM   4726 S SG  . CYS B 1 247 ? 30.478  34.793  -0.675  1.00 21.21 ? 247 CYS B SG  1 
ATOM   4727 N N   . HIS B 1 248 ? 33.708  35.739  3.363   1.00 23.32 ? 248 HIS B N   1 
ATOM   4728 C CA  . HIS B 1 248 ? 34.926  35.692  4.212   1.00 22.87 ? 248 HIS B CA  1 
ATOM   4729 C C   . HIS B 1 248 ? 36.181  35.598  3.376   1.00 23.25 ? 248 HIS B C   1 
ATOM   4730 O O   . HIS B 1 248 ? 37.063  34.753  3.488   1.00 25.09 ? 248 HIS B O   1 
ATOM   4731 C CB  . HIS B 1 248 ? 34.831  34.621  5.410   1.00 20.48 ? 248 HIS B CB  1 
ATOM   4732 C CG  . HIS B 1 248 ? 33.709  35.143  6.248   1.00 21.70 ? 248 HIS B CG  1 
ATOM   4733 N ND1 . HIS B 1 248 ? 32.687  34.448  6.820   1.00 26.78 ? 248 HIS B ND1 1 
ATOM   4734 C CD2 . HIS B 1 248 ? 33.493  36.523  6.396   1.00 25.78 ? 248 HIS B CD2 1 
ATOM   4735 C CE1 . HIS B 1 248 ? 31.808  35.408  7.340   1.00 31.51 ? 248 HIS B CE1 1 
ATOM   4736 N NE2 . HIS B 1 248 ? 32.328  36.680  7.054   1.00 30.21 ? 248 HIS B NE2 1 
ATOM   4737 N N   . THR B 1 249 ? 36.232  36.545  2.487   1.00 22.39 ? 249 THR B N   1 
ATOM   4738 C CA  . THR B 1 249 ? 37.449  36.260  1.747   1.00 20.23 ? 249 THR B CA  1 
ATOM   4739 C C   . THR B 1 249 ? 38.590  37.112  2.259   1.00 20.89 ? 249 THR B C   1 
ATOM   4740 O O   . THR B 1 249 ? 38.439  38.160  2.839   1.00 18.24 ? 249 THR B O   1 
ATOM   4741 C CB  . THR B 1 249 ? 37.281  36.067  0.182   1.00 20.86 ? 249 THR B CB  1 
ATOM   4742 O OG1 . THR B 1 249 ? 36.418  36.990  -0.486  1.00 18.75 ? 249 THR B OG1 1 
ATOM   4743 C CG2 . THR B 1 249 ? 36.778  34.608  -0.117  1.00 20.76 ? 249 THR B CG2 1 
ATOM   4744 N N   . SER B 1 250 ? 39.754  36.610  1.982   1.00 24.84 ? 250 SER B N   1 
ATOM   4745 C CA  . SER B 1 250 ? 40.896  37.540  2.039   1.00 31.66 ? 250 SER B CA  1 
ATOM   4746 C C   . SER B 1 250 ? 42.105  37.049  1.261   1.00 32.30 ? 250 SER B C   1 
ATOM   4747 O O   . SER B 1 250 ? 42.177  35.837  1.042   1.00 32.56 ? 250 SER B O   1 
ATOM   4748 C CB  . SER B 1 250 ? 41.323  37.476  3.462   1.00 33.27 ? 250 SER B CB  1 
ATOM   4749 O OG  . SER B 1 250 ? 42.550  38.141  3.587   1.00 32.52 ? 250 SER B OG  1 
ATOM   4750 N N   . GLN B 1 251 ? 43.087  37.929  0.890   1.00 33.51 ? 251 GLN B N   1 
ATOM   4751 C CA  . GLN B 1 251 ? 44.050  37.467  -0.135  1.00 34.49 ? 251 GLN B CA  1 
ATOM   4752 C C   . GLN B 1 251 ? 44.811  36.131  -0.158  1.00 34.84 ? 251 GLN B C   1 
ATOM   4753 O O   . GLN B 1 251 ? 46.020  36.167  -0.223  1.00 39.51 ? 251 GLN B O   1 
ATOM   4754 C CB  . GLN B 1 251 ? 45.083  38.491  -0.469  1.00 33.16 ? 251 GLN B CB  1 
ATOM   4755 C CG  . GLN B 1 251 ? 45.533  39.393  0.650   1.00 31.53 ? 251 GLN B CG  1 
ATOM   4756 C CD  . GLN B 1 251 ? 44.750  40.702  0.500   1.00 35.79 ? 251 GLN B CD  1 
ATOM   4757 O OE1 . GLN B 1 251 ? 43.753  40.944  1.210   1.00 32.38 ? 251 GLN B OE1 1 
ATOM   4758 N NE2 . GLN B 1 251 ? 45.263  41.533  -0.447  1.00 35.46 ? 251 GLN B NE2 1 
ATOM   4759 N N   . GLY B 1 252 ? 44.129  34.968  -0.163  1.00 35.32 ? 252 GLY B N   1 
ATOM   4760 C CA  . GLY B 1 252 ? 44.779  33.681  -0.280  1.00 31.80 ? 252 GLY B CA  1 
ATOM   4761 C C   . GLY B 1 252 ? 43.944  32.756  0.522   1.00 31.00 ? 252 GLY B C   1 
ATOM   4762 O O   . GLY B 1 252 ? 44.154  32.685  1.721   1.00 36.25 ? 252 GLY B O   1 
ATOM   4763 N N   . ASP B 1 253 ? 43.034  31.989  -0.162  1.00 28.51 ? 253 ASP B N   1 
ATOM   4764 C CA  . ASP B 1 253 ? 41.596  32.215  -0.439  1.00 23.26 ? 253 ASP B CA  1 
ATOM   4765 C C   . ASP B 1 253 ? 40.965  33.597  -0.574  1.00 21.53 ? 253 ASP B C   1 
ATOM   4766 O O   . ASP B 1 253 ? 40.477  34.137  0.423   1.00 20.79 ? 253 ASP B O   1 
ATOM   4767 C CB  . ASP B 1 253 ? 40.863  31.211  0.500   1.00 22.52 ? 253 ASP B CB  1 
ATOM   4768 C CG  . ASP B 1 253 ? 39.294  31.187  0.496   1.00 22.68 ? 253 ASP B CG  1 
ATOM   4769 O OD1 . ASP B 1 253 ? 38.763  30.052  0.592   1.00 25.26 ? 253 ASP B OD1 1 
ATOM   4770 O OD2 . ASP B 1 253 ? 38.625  32.257  0.470   1.00 21.76 ? 253 ASP B OD2 1 
ATOM   4771 N N   . PRO B 1 254 ? 40.976  34.160  -1.840  1.00 19.73 ? 254 PRO B N   1 
ATOM   4772 C CA  . PRO B 1 254 ? 40.130  35.307  -2.210  1.00 16.96 ? 254 PRO B CA  1 
ATOM   4773 C C   . PRO B 1 254 ? 39.101  35.100  -3.372  1.00 16.51 ? 254 PRO B C   1 
ATOM   4774 O O   . PRO B 1 254 ? 38.280  35.977  -3.680  1.00 14.49 ? 254 PRO B O   1 
ATOM   4775 C CB  . PRO B 1 254 ? 41.259  36.361  -2.252  1.00 16.87 ? 254 PRO B CB  1 
ATOM   4776 C CG  . PRO B 1 254 ? 42.455  35.582  -2.967  1.00 16.99 ? 254 PRO B CG  1 
ATOM   4777 C CD  . PRO B 1 254 ? 41.988  34.071  -2.895  1.00 17.90 ? 254 PRO B CD  1 
ATOM   4778 N N   . ILE B 1 255 ? 38.988  33.850  -3.912  1.00 14.84 ? 255 ILE B N   1 
ATOM   4779 C CA  . ILE B 1 255 ? 37.766  33.431  -4.587  1.00 17.96 ? 255 ILE B CA  1 
ATOM   4780 C C   . ILE B 1 255 ? 36.519  32.978  -3.743  1.00 18.04 ? 255 ILE B C   1 
ATOM   4781 O O   . ILE B 1 255 ? 36.500  31.936  -3.080  1.00 22.50 ? 255 ILE B O   1 
ATOM   4782 C CB  . ILE B 1 255 ? 38.065  32.228  -5.497  1.00 20.66 ? 255 ILE B CB  1 
ATOM   4783 C CG1 . ILE B 1 255 ? 39.240  32.227  -6.460  1.00 26.84 ? 255 ILE B CG1 1 
ATOM   4784 C CG2 . ILE B 1 255 ? 36.846  32.000  -6.348  1.00 22.34 ? 255 ILE B CG2 1 
ATOM   4785 C CD1 . ILE B 1 255 ? 39.024  32.960  -7.797  1.00 22.28 ? 255 ILE B CD1 1 
ATOM   4786 N N   . GLY B 1 256 ? 35.442  33.824  -3.943  1.00 18.03 ? 256 GLY B N   1 
ATOM   4787 C CA  . GLY B 1 256 ? 34.098  33.689  -3.346  1.00 16.08 ? 256 GLY B CA  1 
ATOM   4788 C C   . GLY B 1 256 ? 33.325  32.583  -4.041  1.00 13.29 ? 256 GLY B C   1 
ATOM   4789 O O   . GLY B 1 256 ? 33.732  32.101  -5.069  1.00 14.77 ? 256 GLY B O   1 
ATOM   4790 N N   . LEU B 1 257 ? 32.235  32.187  -3.459  1.00 5.83  ? 257 LEU B N   1 
ATOM   4791 C CA  . LEU B 1 257 ? 31.043  31.569  -3.990  1.00 5.28  ? 257 LEU B CA  1 
ATOM   4792 C C   . LEU B 1 257 ? 29.778  32.197  -3.372  1.00 9.27  ? 257 LEU B C   1 
ATOM   4793 O O   . LEU B 1 257 ? 29.707  32.435  -2.190  1.00 7.32  ? 257 LEU B O   1 
ATOM   4794 C CB  . LEU B 1 257 ? 30.873  30.166  -3.559  1.00 4.28  ? 257 LEU B CB  1 
ATOM   4795 C CG  . LEU B 1 257 ? 32.043  29.293  -3.847  1.00 2.00  ? 257 LEU B CG  1 
ATOM   4796 C CD1 . LEU B 1 257 ? 31.683  27.837  -3.481  1.00 2.00  ? 257 LEU B CD1 1 
ATOM   4797 C CD2 . LEU B 1 257 ? 32.435  29.333  -5.322  1.00 3.77  ? 257 LEU B CD2 1 
ATOM   4798 N N   . ILE B 1 258 ? 28.701  32.380  -4.185  1.00 12.12 ? 258 ILE B N   1 
ATOM   4799 C CA  . ILE B 1 258 ? 27.497  33.174  -3.777  1.00 12.68 ? 258 ILE B CA  1 
ATOM   4800 C C   . ILE B 1 258 ? 26.118  32.801  -4.418  1.00 11.02 ? 258 ILE B C   1 
ATOM   4801 O O   . ILE B 1 258 ? 25.822  33.184  -5.534  1.00 15.10 ? 258 ILE B O   1 
ATOM   4802 C CB  . ILE B 1 258 ? 27.784  34.723  -3.882  1.00 10.28 ? 258 ILE B CB  1 
ATOM   4803 C CG1 . ILE B 1 258 ? 26.637  35.512  -3.203  1.00 12.83 ? 258 ILE B CG1 1 
ATOM   4804 C CG2 . ILE B 1 258 ? 27.965  35.214  -5.322  1.00 11.64 ? 258 ILE B CG2 1 
ATOM   4805 C CD1 . ILE B 1 258 ? 26.954  36.997  -3.198  1.00 9.20  ? 258 ILE B CD1 1 
ATOM   4806 N N   . LEU B 1 259 ? 25.250  32.122  -3.713  1.00 8.16  ? 259 LEU B N   1 
ATOM   4807 C CA  . LEU B 1 259 ? 23.949  32.156  -4.408  1.00 9.49  ? 259 LEU B CA  1 
ATOM   4808 C C   . LEU B 1 259 ? 23.207  33.438  -4.817  1.00 8.45  ? 259 LEU B C   1 
ATOM   4809 O O   . LEU B 1 259 ? 23.282  34.532  -4.264  1.00 6.61  ? 259 LEU B O   1 
ATOM   4810 C CB  . LEU B 1 259 ? 22.968  31.444  -3.610  1.00 14.59 ? 259 LEU B CB  1 
ATOM   4811 C CG  . LEU B 1 259 ? 23.655  30.176  -3.241  1.00 20.90 ? 259 LEU B CG  1 
ATOM   4812 C CD1 . LEU B 1 259 ? 23.175  29.663  -1.908  1.00 27.40 ? 259 LEU B CD1 1 
ATOM   4813 C CD2 . LEU B 1 259 ? 23.499  29.187  -4.378  1.00 22.52 ? 259 LEU B CD2 1 
ATOM   4814 N N   . LEU B 1 260 ? 22.328  33.167  -5.761  1.00 9.02  ? 260 LEU B N   1 
ATOM   4815 C CA  . LEU B 1 260 ? 21.086  33.950  -5.856  1.00 9.15  ? 260 LEU B CA  1 
ATOM   4816 C C   . LEU B 1 260 ? 19.884  33.095  -5.730  1.00 8.77  ? 260 LEU B C   1 
ATOM   4817 O O   . LEU B 1 260 ? 19.926  31.956  -6.187  1.00 15.23 ? 260 LEU B O   1 
ATOM   4818 C CB  . LEU B 1 260 ? 20.786  34.506  -7.187  1.00 6.15  ? 260 LEU B CB  1 
ATOM   4819 C CG  . LEU B 1 260 ? 21.407  35.798  -7.627  1.00 2.00  ? 260 LEU B CG  1 
ATOM   4820 C CD1 . LEU B 1 260 ? 21.749  35.584  -9.081  1.00 2.00  ? 260 LEU B CD1 1 
ATOM   4821 C CD2 . LEU B 1 260 ? 20.629  36.998  -7.198  1.00 2.00  ? 260 LEU B CD2 1 
ATOM   4822 N N   . GLY B 1 261 ? 18.856  33.716  -5.064  1.00 4.95  ? 261 GLY B N   1 
ATOM   4823 C CA  . GLY B 1 261 ? 17.676  32.998  -4.546  1.00 2.35  ? 261 GLY B CA  1 
ATOM   4824 C C   . GLY B 1 261 ? 16.352  33.549  -5.103  1.00 5.67  ? 261 GLY B C   1 
ATOM   4825 O O   . GLY B 1 261 ? 16.081  34.733  -5.090  1.00 11.24 ? 261 GLY B O   1 
ATOM   4826 N N   . GLU B 1 262 ? 15.511  32.676  -5.616  1.00 5.19  ? 262 GLU B N   1 
ATOM   4827 C CA  . GLU B 1 262 ? 14.211  33.240  -5.840  1.00 2.00  ? 262 GLU B CA  1 
ATOM   4828 C C   . GLU B 1 262 ? 13.626  33.014  -4.527  1.00 4.28  ? 262 GLU B C   1 
ATOM   4829 O O   . GLU B 1 262 ? 13.620  31.891  -4.046  1.00 9.26  ? 262 GLU B O   1 
ATOM   4830 C CB  . GLU B 1 262 ? 13.551  32.449  -6.962  1.00 5.22  ? 262 GLU B CB  1 
ATOM   4831 C CG  . GLU B 1 262 ? 12.108  32.822  -7.434  1.00 14.58 ? 262 GLU B CG  1 
ATOM   4832 C CD  . GLU B 1 262 ? 11.454  32.044  -8.472  1.00 16.62 ? 262 GLU B CD  1 
ATOM   4833 O OE1 . GLU B 1 262 ? 10.599  32.608  -9.234  1.00 20.72 ? 262 GLU B OE1 1 
ATOM   4834 O OE2 . GLU B 1 262 ? 11.829  30.841  -9.025  1.00 17.35 ? 262 GLU B OE2 1 
ATOM   4835 N N   . VAL B 1 263 ? 13.227  34.080  -3.921  1.00 2.93  ? 263 VAL B N   1 
ATOM   4836 C CA  . VAL B 1 263 ? 12.429  33.903  -2.725  1.00 2.00  ? 263 VAL B CA  1 
ATOM   4837 C C   . VAL B 1 263 ? 11.042  34.546  -2.768  1.00 2.00  ? 263 VAL B C   1 
ATOM   4838 O O   . VAL B 1 263 ? 10.694  35.673  -3.025  1.00 2.08  ? 263 VAL B O   1 
ATOM   4839 C CB  . VAL B 1 263 ? 13.359  34.039  -1.455  1.00 2.00  ? 263 VAL B CB  1 
ATOM   4840 C CG1 . VAL B 1 263 ? 14.655  34.728  -1.698  1.00 2.62  ? 263 VAL B CG1 1 
ATOM   4841 C CG2 . VAL B 1 263 ? 12.801  34.397  -0.125  1.00 4.50  ? 263 VAL B CG2 1 
ATOM   4842 N N   . ALA B 1 264 ? 10.170  33.658  -2.449  1.00 2.76  ? 264 ALA B N   1 
ATOM   4843 C CA  . ALA B 1 264 ? 8.800   34.098  -2.185  1.00 2.00  ? 264 ALA B CA  1 
ATOM   4844 C C   . ALA B 1 264 ? 8.486   34.911  -0.928  1.00 2.06  ? 264 ALA B C   1 
ATOM   4845 O O   . ALA B 1 264 ? 8.110   34.454  0.137   1.00 6.50  ? 264 ALA B O   1 
ATOM   4846 C CB  . ALA B 1 264 ? 7.940   32.874  -2.133  1.00 2.00  ? 264 ALA B CB  1 
ATOM   4847 N N   . LEU B 1 265 ? 8.712   36.194  -1.086  1.00 2.78  ? 265 LEU B N   1 
ATOM   4848 C CA  . LEU B 1 265 ? 8.458   37.025  0.088   1.00 5.27  ? 265 LEU B CA  1 
ATOM   4849 C C   . LEU B 1 265 ? 7.017   37.221  0.572   1.00 3.70  ? 265 LEU B C   1 
ATOM   4850 O O   . LEU B 1 265 ? 6.678   37.344  1.719   1.00 8.39  ? 265 LEU B O   1 
ATOM   4851 C CB  . LEU B 1 265 ? 9.065   38.342  -0.348  1.00 6.63  ? 265 LEU B CB  1 
ATOM   4852 C CG  . LEU B 1 265 ? 10.602  38.490  -0.349  1.00 4.23  ? 265 LEU B CG  1 
ATOM   4853 C CD1 . LEU B 1 265 ? 11.082  39.794  -1.039  1.00 2.00  ? 265 LEU B CD1 1 
ATOM   4854 C CD2 . LEU B 1 265 ? 11.158  38.095  1.119   1.00 4.79  ? 265 LEU B CD2 1 
ATOM   4855 N N   . GLY B 1 266 ? 6.095   37.298  -0.343  1.00 2.00  ? 266 GLY B N   1 
ATOM   4856 C CA  . GLY B 1 266 ? 4.738   37.649  0.132   1.00 2.00  ? 266 GLY B CA  1 
ATOM   4857 C C   . GLY B 1 266 ? 4.464   38.991  0.816   1.00 4.10  ? 266 GLY B C   1 
ATOM   4858 O O   . GLY B 1 266 ? 4.790   40.051  0.370   1.00 9.32  ? 266 GLY B O   1 
ATOM   4859 N N   . ASN B 1 267 ? 3.823   38.875  1.948   1.00 5.10  ? 267 ASN B N   1 
ATOM   4860 C CA  . ASN B 1 267 ? 3.631   40.214  2.619   1.00 5.42  ? 267 ASN B CA  1 
ATOM   4861 C C   . ASN B 1 267 ? 4.660   40.510  3.802   1.00 9.31  ? 267 ASN B C   1 
ATOM   4862 O O   . ASN B 1 267 ? 4.871   39.671  4.696   1.00 9.96  ? 267 ASN B O   1 
ATOM   4863 C CB  . ASN B 1 267 ? 2.105   40.183  2.919   1.00 5.40  ? 267 ASN B CB  1 
ATOM   4864 C CG  . ASN B 1 267 ? 1.478   41.186  3.795   1.00 4.42  ? 267 ASN B CG  1 
ATOM   4865 O OD1 . ASN B 1 267 ? 0.900   40.862  4.790   1.00 4.49  ? 267 ASN B OD1 1 
ATOM   4866 N ND2 . ASN B 1 267 ? 1.692   42.429  3.480   1.00 8.12  ? 267 ASN B ND2 1 
ATOM   4867 N N   . MET B 1 268 ? 5.373   41.668  3.680   1.00 9.23  ? 268 MET B N   1 
ATOM   4868 C CA  . MET B 1 268 ? 6.694   41.878  4.294   1.00 5.32  ? 268 MET B CA  1 
ATOM   4869 C C   . MET B 1 268 ? 6.586   42.542  5.618   1.00 8.29  ? 268 MET B C   1 
ATOM   4870 O O   . MET B 1 268 ? 5.902   43.498  5.869   1.00 7.65  ? 268 MET B O   1 
ATOM   4871 C CB  . MET B 1 268 ? 7.634   42.751  3.499   1.00 2.00  ? 268 MET B CB  1 
ATOM   4872 C CG  . MET B 1 268 ? 8.215   41.866  2.447   1.00 2.00  ? 268 MET B CG  1 
ATOM   4873 S SD  . MET B 1 268 ? 9.169   42.594  1.013   1.00 4.16  ? 268 MET B SD  1 
ATOM   4874 C CE  . MET B 1 268 ? 8.915   44.358  0.718   1.00 5.23  ? 268 MET B CE  1 
ATOM   4875 N N   . TYR B 1 269 ? 7.342   41.950  6.546   1.00 8.51  ? 269 TYR B N   1 
ATOM   4876 C CA  . TYR B 1 269 ? 7.399   42.719  7.797   1.00 9.64  ? 269 TYR B CA  1 
ATOM   4877 C C   . TYR B 1 269 ? 8.577   43.703  7.834   1.00 9.70  ? 269 TYR B C   1 
ATOM   4878 O O   . TYR B 1 269 ? 9.778   43.438  7.684   1.00 8.57  ? 269 TYR B O   1 
ATOM   4879 C CB  . TYR B 1 269 ? 7.350   41.709  8.946   1.00 4.38  ? 269 TYR B CB  1 
ATOM   4880 C CG  . TYR B 1 269 ? 6.960   42.294  10.271  1.00 7.06  ? 269 TYR B CG  1 
ATOM   4881 C CD1 . TYR B 1 269 ? 6.010   43.348  10.267  1.00 9.14  ? 269 TYR B CD1 1 
ATOM   4882 C CD2 . TYR B 1 269 ? 7.469   41.679  11.433  1.00 3.82  ? 269 TYR B CD2 1 
ATOM   4883 C CE1 . TYR B 1 269 ? 5.381   43.623  11.501  1.00 5.99  ? 269 TYR B CE1 1 
ATOM   4884 C CE2 . TYR B 1 269 ? 6.929   42.053  12.677  1.00 3.05  ? 269 TYR B CE2 1 
ATOM   4885 C CZ  . TYR B 1 269 ? 5.907   43.045  12.709  1.00 7.61  ? 269 TYR B CZ  1 
ATOM   4886 O OH  . TYR B 1 269 ? 5.468   43.656  13.893  1.00 2.00  ? 269 TYR B OH  1 
ATOM   4887 N N   . GLU B 1 270 ? 8.125   44.933  7.932   1.00 10.33 ? 270 GLU B N   1 
ATOM   4888 C CA  . GLU B 1 270 ? 9.133   46.018  7.666   1.00 13.71 ? 270 GLU B CA  1 
ATOM   4889 C C   . GLU B 1 270 ? 9.913   46.613  8.885   1.00 14.32 ? 270 GLU B C   1 
ATOM   4890 O O   . GLU B 1 270 ? 9.779   47.764  9.255   1.00 17.44 ? 270 GLU B O   1 
ATOM   4891 C CB  . GLU B 1 270 ? 8.506   47.182  6.830   1.00 14.70 ? 270 GLU B CB  1 
ATOM   4892 C CG  . GLU B 1 270 ? 8.171   46.693  5.434   1.00 13.96 ? 270 GLU B CG  1 
ATOM   4893 C CD  . GLU B 1 270 ? 7.906   47.801  4.480   1.00 16.53 ? 270 GLU B CD  1 
ATOM   4894 O OE1 . GLU B 1 270 ? 8.342   48.906  4.762   1.00 18.62 ? 270 GLU B OE1 1 
ATOM   4895 O OE2 . GLU B 1 270 ? 7.292   47.545  3.429   1.00 14.29 ? 270 GLU B OE2 1 
ATOM   4896 N N   . LEU B 1 271 ? 10.735  45.766  9.515   1.00 10.23 ? 271 LEU B N   1 
ATOM   4897 C CA  . LEU B 1 271 ? 11.257  46.143  10.834  1.00 5.84  ? 271 LEU B CA  1 
ATOM   4898 C C   . LEU B 1 271 ? 12.301  47.248  10.685  1.00 10.01 ? 271 LEU B C   1 
ATOM   4899 O O   . LEU B 1 271 ? 13.007  47.281  9.647   1.00 12.85 ? 271 LEU B O   1 
ATOM   4900 C CB  . LEU B 1 271 ? 11.767  44.870  11.420  1.00 2.00  ? 271 LEU B CB  1 
ATOM   4901 C CG  . LEU B 1 271 ? 10.526  44.054  11.599  1.00 2.00  ? 271 LEU B CG  1 
ATOM   4902 C CD1 . LEU B 1 271 ? 10.906  42.746  12.163  1.00 2.00  ? 271 LEU B CD1 1 
ATOM   4903 C CD2 . LEU B 1 271 ? 9.432   44.616  12.488  1.00 2.00  ? 271 LEU B CD2 1 
ATOM   4904 N N   . LYS B 1 272 ? 12.354  48.171  11.661  1.00 11.59 ? 272 LYS B N   1 
ATOM   4905 C CA  . LYS B 1 272 ? 13.532  49.022  11.403  1.00 10.55 ? 272 LYS B CA  1 
ATOM   4906 C C   . LYS B 1 272 ? 14.719  48.752  12.241  1.00 10.95 ? 272 LYS B C   1 
ATOM   4907 O O   . LYS B 1 272 ? 15.780  49.314  12.052  1.00 12.29 ? 272 LYS B O   1 
ATOM   4908 C CB  . LYS B 1 272 ? 13.326  50.512  11.358  1.00 9.59  ? 272 LYS B CB  1 
ATOM   4909 C CG  . LYS B 1 272 ? 12.158  51.041  10.528  1.00 11.48 ? 272 LYS B CG  1 
ATOM   4910 C CD  . LYS B 1 272 ? 12.063  52.574  10.429  1.00 16.21 ? 272 LYS B CD  1 
ATOM   4911 C CE  . LYS B 1 272 ? 10.640  53.047  10.170  1.00 20.45 ? 272 LYS B CE  1 
ATOM   4912 N NZ  . LYS B 1 272 ? 10.755  54.470  9.791   1.00 26.29 ? 272 LYS B NZ  1 
ATOM   4913 N N   . HIS B 1 273 ? 14.594  47.781  13.122  1.00 8.20  ? 273 HIS B N   1 
ATOM   4914 C CA  . HIS B 1 273 ? 15.748  47.304  13.873  1.00 6.48  ? 273 HIS B CA  1 
ATOM   4915 C C   . HIS B 1 273 ? 15.532  45.959  14.517  1.00 3.59  ? 273 HIS B C   1 
ATOM   4916 O O   . HIS B 1 273 ? 14.483  45.377  14.356  1.00 2.00  ? 273 HIS B O   1 
ATOM   4917 C CB  . HIS B 1 273 ? 16.050  47.995  15.151  1.00 6.89  ? 273 HIS B CB  1 
ATOM   4918 C CG  . HIS B 1 273 ? 15.894  49.441  15.052  1.00 7.96  ? 273 HIS B CG  1 
ATOM   4919 N ND1 . HIS B 1 273 ? 16.945  50.202  14.872  1.00 14.74 ? 273 HIS B ND1 1 
ATOM   4920 C CD2 . HIS B 1 273 ? 14.708  50.137  15.030  1.00 2.10  ? 273 HIS B CD2 1 
ATOM   4921 C CE1 . HIS B 1 273 ? 16.381  51.435  14.711  1.00 11.50 ? 273 HIS B CE1 1 
ATOM   4922 N NE2 . HIS B 1 273 ? 15.022  51.403  14.806  1.00 4.55  ? 273 HIS B NE2 1 
ATOM   4923 N N   . ALA B 1 274 ? 16.547  45.403  15.266  1.00 4.05  ? 274 ALA B N   1 
ATOM   4924 C CA  . ALA B 1 274 ? 16.320  43.955  15.544  1.00 7.08  ? 274 ALA B CA  1 
ATOM   4925 C C   . ALA B 1 274 ? 14.901  43.481  16.161  1.00 7.94  ? 274 ALA B C   1 
ATOM   4926 O O   . ALA B 1 274 ? 14.049  44.221  16.707  1.00 6.34  ? 274 ALA B O   1 
ATOM   4927 C CB  . ALA B 1 274 ? 17.516  43.395  16.367  1.00 2.00  ? 274 ALA B CB  1 
ATOM   4928 N N   . SER B 1 275 ? 14.673  42.133  16.014  1.00 5.44  ? 275 SER B N   1 
ATOM   4929 C CA  . SER B 1 275 ? 13.371  41.523  16.224  1.00 2.00  ? 275 SER B CA  1 
ATOM   4930 C C   . SER B 1 275 ? 13.682  40.130  16.315  1.00 2.00  ? 275 SER B C   1 
ATOM   4931 O O   . SER B 1 275 ? 13.922  39.535  15.320  1.00 2.00  ? 275 SER B O   1 
ATOM   4932 C CB  . SER B 1 275 ? 12.495  41.645  14.995  1.00 2.00  ? 275 SER B CB  1 
ATOM   4933 O OG  . SER B 1 275 ? 11.979  43.012  14.974  1.00 10.40 ? 275 SER B OG  1 
ATOM   4934 N N   . HIS B 1 276 ? 13.786  39.601  17.526  1.00 4.30  ? 276 HIS B N   1 
ATOM   4935 C CA  . HIS B 1 276 ? 14.061  38.156  17.629  1.00 4.52  ? 276 HIS B CA  1 
ATOM   4936 C C   . HIS B 1 276 ? 12.820  37.345  17.533  1.00 5.86  ? 276 HIS B C   1 
ATOM   4937 O O   . HIS B 1 276 ? 12.146  37.162  18.537  1.00 6.89  ? 276 HIS B O   1 
ATOM   4938 C CB  . HIS B 1 276 ? 14.836  37.846  18.930  1.00 6.89  ? 276 HIS B CB  1 
ATOM   4939 C CG  . HIS B 1 276 ? 16.032  38.732  18.907  1.00 2.00  ? 276 HIS B CG  1 
ATOM   4940 N ND1 . HIS B 1 276 ? 17.157  38.508  18.218  1.00 2.00  ? 276 HIS B ND1 1 
ATOM   4941 C CD2 . HIS B 1 276 ? 16.082  40.009  19.440  1.00 2.00  ? 276 HIS B CD2 1 
ATOM   4942 C CE1 . HIS B 1 276 ? 17.920  39.646  18.295  1.00 2.03  ? 276 HIS B CE1 1 
ATOM   4943 N NE2 . HIS B 1 276 ? 17.240  40.562  19.059  1.00 2.00  ? 276 HIS B NE2 1 
ATOM   4944 N N   . ILE B 1 277 ? 12.537  36.913  16.322  1.00 5.27  ? 277 ILE B N   1 
ATOM   4945 C CA  . ILE B 1 277 ? 11.236  36.231  16.299  1.00 6.41  ? 277 ILE B CA  1 
ATOM   4946 C C   . ILE B 1 277 ? 11.199  34.840  15.839  1.00 7.03  ? 277 ILE B C   1 
ATOM   4947 O O   . ILE B 1 277 ? 12.161  34.107  15.514  1.00 2.00  ? 277 ILE B O   1 
ATOM   4948 C CB  . ILE B 1 277 ? 10.098  37.005  15.642  1.00 2.01  ? 277 ILE B CB  1 
ATOM   4949 C CG1 . ILE B 1 277 ? 10.469  37.852  14.418  1.00 2.00  ? 277 ILE B CG1 1 
ATOM   4950 C CG2 . ILE B 1 277 ? 9.470   38.017  16.569  1.00 6.39  ? 277 ILE B CG2 1 
ATOM   4951 C CD1 . ILE B 1 277 ? 10.125  37.170  13.148  1.00 2.00  ? 277 ILE B CD1 1 
ATOM   4952 N N   . SER B 1 278 ? 9.936   34.488  16.013  1.00 11.85 ? 278 SER B N   1 
ATOM   4953 C CA  . SER B 1 278 ? 9.911   33.052  15.857  1.00 15.05 ? 278 SER B CA  1 
ATOM   4954 C C   . SER B 1 278 ? 9.110   32.593  14.672  1.00 16.71 ? 278 SER B C   1 
ATOM   4955 O O   . SER B 1 278 ? 9.650   32.153  13.680  1.00 14.43 ? 278 SER B O   1 
ATOM   4956 C CB  . SER B 1 278 ? 9.494   32.442  17.162  1.00 18.94 ? 278 SER B CB  1 
ATOM   4957 O OG  . SER B 1 278 ? 8.820   33.448  17.939  1.00 14.18 ? 278 SER B OG  1 
ATOM   4958 N N   . LYS B 1 279 ? 7.847   32.991  14.935  1.00 15.84 ? 279 LYS B N   1 
ATOM   4959 C CA  . LYS B 1 279 ? 6.805   33.090  13.967  1.00 17.54 ? 279 LYS B CA  1 
ATOM   4960 C C   . LYS B 1 279 ? 6.523   34.548  13.758  1.00 15.82 ? 279 LYS B C   1 
ATOM   4961 O O   . LYS B 1 279 ? 6.366   35.433  14.624  1.00 16.80 ? 279 LYS B O   1 
ATOM   4962 C CB  . LYS B 1 279 ? 5.480   32.485  14.497  1.00 20.68 ? 279 LYS B CB  1 
ATOM   4963 C CG  . LYS B 1 279 ? 4.866   33.041  15.851  1.00 24.00 ? 279 LYS B CG  1 
ATOM   4964 C CD  . LYS B 1 279 ? 3.423   33.716  15.720  1.00 23.06 ? 279 LYS B CD  1 
ATOM   4965 C CE  . LYS B 1 279 ? 2.832   34.526  16.940  1.00 18.46 ? 279 LYS B CE  1 
ATOM   4966 N NZ  . LYS B 1 279 ? 1.831   35.574  16.574  1.00 10.25 ? 279 LYS B NZ  1 
ATOM   4967 N N   . LEU B 1 280 ? 6.308   34.812  12.531  1.00 12.95 ? 280 LEU B N   1 
ATOM   4968 C CA  . LEU B 1 280 ? 5.618   36.086  12.205  1.00 9.23  ? 280 LEU B CA  1 
ATOM   4969 C C   . LEU B 1 280 ? 4.165   36.046  12.685  1.00 6.14  ? 280 LEU B C   1 
ATOM   4970 O O   . LEU B 1 280 ? 3.697   34.950  12.971  1.00 5.72  ? 280 LEU B O   1 
ATOM   4971 C CB  . LEU B 1 280 ? 5.604   36.058  10.702  1.00 8.67  ? 280 LEU B CB  1 
ATOM   4972 C CG  . LEU B 1 280 ? 6.757   36.611  9.961   1.00 2.00  ? 280 LEU B CG  1 
ATOM   4973 C CD1 . LEU B 1 280 ? 7.687   37.135  10.987  1.00 2.00  ? 280 LEU B CD1 1 
ATOM   4974 C CD2 . LEU B 1 280 ? 7.169   35.812  8.739   1.00 2.00  ? 280 LEU B CD2 1 
ATOM   4975 N N   . PRO B 1 281 ? 3.569   37.211  12.691  1.00 2.94  ? 281 PRO B N   1 
ATOM   4976 C CA  . PRO B 1 281 ? 2.114   37.329  12.930  1.00 4.14  ? 281 PRO B CA  1 
ATOM   4977 C C   . PRO B 1 281 ? 1.347   37.002  11.671  1.00 4.16  ? 281 PRO B C   1 
ATOM   4978 O O   . PRO B 1 281 ? 1.723   37.239  10.587  1.00 13.41 ? 281 PRO B O   1 
ATOM   4979 C CB  . PRO B 1 281 ? 2.311   38.773  13.543  1.00 2.00  ? 281 PRO B CB  1 
ATOM   4980 C CG  . PRO B 1 281 ? 3.200   39.661  12.699  1.00 2.00  ? 281 PRO B CG  1 
ATOM   4981 C CD  . PRO B 1 281 ? 4.211   38.532  12.421  1.00 2.00  ? 281 PRO B CD  1 
ATOM   4982 N N   . LYS B 1 282 ? 0.309   36.246  11.817  1.00 2.00  ? 282 LYS B N   1 
ATOM   4983 C CA  . LYS B 1 282 ? -0.788  36.199  10.688  1.00 2.00  ? 282 LYS B CA  1 
ATOM   4984 C C   . LYS B 1 282 ? -0.634  37.637  9.688   1.00 6.99  ? 282 LYS B C   1 
ATOM   4985 O O   . LYS B 1 282 ? -0.607  38.623  10.066  1.00 6.55  ? 282 LYS B O   1 
ATOM   4986 C CB  . LYS B 1 282 ? -2.199  36.394  11.434  1.00 2.00  ? 282 LYS B CB  1 
ATOM   4987 C CG  . LYS B 1 282 ? -2.485  35.089  12.246  1.00 2.05  ? 282 LYS B CG  1 
ATOM   4988 C CD  . LYS B 1 282 ? -2.631  35.357  13.718  1.00 9.73  ? 282 LYS B CD  1 
ATOM   4989 C CE  . LYS B 1 282 ? -1.369  35.513  14.781  1.00 14.85 ? 282 LYS B CE  1 
ATOM   4990 N NZ  . LYS B 1 282 ? -0.535  34.293  15.164  1.00 15.81 ? 282 LYS B NZ  1 
ATOM   4991 N N   . GLY B 1 283 ? -0.523  36.871  8.361   1.00 4.54  ? 283 GLY B N   1 
ATOM   4992 C CA  . GLY B 1 283 ? -0.688  37.939  7.366   1.00 2.81  ? 283 GLY B CA  1 
ATOM   4993 C C   . GLY B 1 283 ? 0.528   38.450  6.805   1.00 9.79  ? 283 GLY B C   1 
ATOM   4994 O O   . GLY B 1 283 ? 0.553   38.789  5.596   1.00 12.79 ? 283 GLY B O   1 
ATOM   4995 N N   . LYS B 1 284 ? 1.589   38.354  7.643   1.00 8.11  ? 284 LYS B N   1 
ATOM   4996 C CA  . LYS B 1 284 ? 2.927   38.687  7.237   1.00 2.00  ? 284 LYS B CA  1 
ATOM   4997 C C   . LYS B 1 284 ? 3.736   37.457  7.048   1.00 2.00  ? 284 LYS B C   1 
ATOM   4998 O O   . LYS B 1 284 ? 3.713   36.802  8.000   1.00 2.00  ? 284 LYS B O   1 
ATOM   4999 C CB  . LYS B 1 284 ? 3.548   39.455  8.358   1.00 2.00  ? 284 LYS B CB  1 
ATOM   5000 C CG  . LYS B 1 284 ? 2.890   40.713  8.613   1.00 2.00  ? 284 LYS B CG  1 
ATOM   5001 C CD  . LYS B 1 284 ? 3.451   41.722  7.724   1.00 2.31  ? 284 LYS B CD  1 
ATOM   5002 C CE  . LYS B 1 284 ? 2.877   43.053  8.154   1.00 8.51  ? 284 LYS B CE  1 
ATOM   5003 N NZ  . LYS B 1 284 ? 3.437   44.152  7.332   1.00 2.00  ? 284 LYS B NZ  1 
ATOM   5004 N N   . HIS B 1 285 ? 4.483   37.306  5.934   1.00 3.35  ? 285 HIS B N   1 
ATOM   5005 C CA  . HIS B 1 285 ? 5.161   36.066  5.380   1.00 6.00  ? 285 HIS B CA  1 
ATOM   5006 C C   . HIS B 1 285 ? 6.733   36.145  5.257   1.00 6.82  ? 285 HIS B C   1 
ATOM   5007 O O   . HIS B 1 285 ? 7.497   35.283  4.839   1.00 8.77  ? 285 HIS B O   1 
ATOM   5008 C CB  . HIS B 1 285 ? 4.702   35.722  3.863   1.00 3.19  ? 285 HIS B CB  1 
ATOM   5009 C CG  . HIS B 1 285 ? 3.164   35.719  3.763   1.00 2.00  ? 285 HIS B CG  1 
ATOM   5010 N ND1 . HIS B 1 285 ? 2.425   36.828  3.916   1.00 2.00  ? 285 HIS B ND1 1 
ATOM   5011 C CD2 . HIS B 1 285 ? 2.257   34.634  3.692   1.00 2.00  ? 285 HIS B CD2 1 
ATOM   5012 C CE1 . HIS B 1 285 ? 1.128   36.479  3.976   1.00 2.00  ? 285 HIS B CE1 1 
ATOM   5013 N NE2 . HIS B 1 285 ? 1.005   35.158  3.828   1.00 2.00  ? 285 HIS B NE2 1 
ATOM   5014 N N   . SER B 1 286 ? 7.240   37.331  5.543   1.00 5.57  ? 286 SER B N   1 
ATOM   5015 C CA  . SER B 1 286 ? 8.646   37.564  5.545   1.00 3.09  ? 286 SER B CA  1 
ATOM   5016 C C   . SER B 1 286 ? 8.834   38.850  6.359   1.00 7.62  ? 286 SER B C   1 
ATOM   5017 O O   . SER B 1 286 ? 7.908   39.456  6.902   1.00 12.13 ? 286 SER B O   1 
ATOM   5018 C CB  . SER B 1 286 ? 9.104   37.631  4.130   1.00 2.00  ? 286 SER B CB  1 
ATOM   5019 O OG  . SER B 1 286 ? 8.971   38.964  3.602   1.00 2.59  ? 286 SER B OG  1 
ATOM   5020 N N   . VAL B 1 287 ? 10.100  39.197  6.437   1.00 5.06  ? 287 VAL B N   1 
ATOM   5021 C CA  . VAL B 1 287 ? 10.584  40.416  7.099   1.00 4.21  ? 287 VAL B CA  1 
ATOM   5022 C C   . VAL B 1 287 ? 11.506  41.057  6.063   1.00 5.48  ? 287 VAL B C   1 
ATOM   5023 O O   . VAL B 1 287 ? 12.457  40.522  5.468   1.00 4.52  ? 287 VAL B O   1 
ATOM   5024 C CB  . VAL B 1 287 ? 11.473  40.061  8.405   1.00 2.00  ? 287 VAL B CB  1 
ATOM   5025 C CG1 . VAL B 1 287 ? 12.253  41.198  9.013   1.00 2.00  ? 287 VAL B CG1 1 
ATOM   5026 C CG2 . VAL B 1 287 ? 10.894  39.197  9.489   1.00 2.00  ? 287 VAL B CG2 1 
ATOM   5027 N N   . LYS B 1 288 ? 11.114  42.284  5.877   1.00 2.00  ? 288 LYS B N   1 
ATOM   5028 C CA  . LYS B 1 288 ? 12.153  43.101  5.424   1.00 5.44  ? 288 LYS B CA  1 
ATOM   5029 C C   . LYS B 1 288 ? 12.577  44.026  6.587   1.00 8.03  ? 288 LYS B C   1 
ATOM   5030 O O   . LYS B 1 288 ? 11.867  44.914  7.168   1.00 9.11  ? 288 LYS B O   1 
ATOM   5031 C CB  . LYS B 1 288 ? 11.609  43.992  4.334   1.00 3.05  ? 288 LYS B CB  1 
ATOM   5032 C CG  . LYS B 1 288 ? 12.616  44.653  3.418   1.00 2.00  ? 288 LYS B CG  1 
ATOM   5033 C CD  . LYS B 1 288 ? 12.005  45.823  2.632   1.00 2.00  ? 288 LYS B CD  1 
ATOM   5034 C CE  . LYS B 1 288 ? 12.961  46.543  1.641   1.00 5.18  ? 288 LYS B CE  1 
ATOM   5035 N NZ  . LYS B 1 288 ? 12.515  47.867  0.985   1.00 8.59  ? 288 LYS B NZ  1 
ATOM   5036 N N   . GLY B 1 289 ? 13.945  43.859  6.797   1.00 4.64  ? 289 GLY B N   1 
ATOM   5037 C CA  . GLY B 1 289 ? 14.547  45.004  7.425   1.00 4.48  ? 289 GLY B CA  1 
ATOM   5038 C C   . GLY B 1 289 ? 14.992  46.052  6.424   1.00 3.66  ? 289 GLY B C   1 
ATOM   5039 O O   . GLY B 1 289 ? 15.702  45.810  5.449   1.00 2.00  ? 289 GLY B O   1 
ATOM   5040 N N   . LEU B 1 290 ? 14.525  47.216  6.890   1.00 2.36  ? 290 LEU B N   1 
ATOM   5041 C CA  . LEU B 1 290 ? 14.860  48.501  6.257   1.00 2.60  ? 290 LEU B CA  1 
ATOM   5042 C C   . LEU B 1 290 ? 16.235  49.107  6.133   1.00 5.01  ? 290 LEU B C   1 
ATOM   5043 O O   . LEU B 1 290 ? 17.195  48.437  6.290   1.00 9.67  ? 290 LEU B O   1 
ATOM   5044 C CB  . LEU B 1 290 ? 13.817  49.569  6.550   1.00 2.00  ? 290 LEU B CB  1 
ATOM   5045 C CG  . LEU B 1 290 ? 12.369  49.128  6.107   1.00 2.00  ? 290 LEU B CG  1 
ATOM   5046 C CD1 . LEU B 1 290 ? 11.305  50.212  6.224   1.00 8.98  ? 290 LEU B CD1 1 
ATOM   5047 C CD2 . LEU B 1 290 ? 12.144  48.372  4.802   1.00 2.00  ? 290 LEU B CD2 1 
ATOM   5048 N N   . GLY B 1 291 ? 16.412  50.332  5.756   1.00 6.80  ? 291 GLY B N   1 
ATOM   5049 C CA  . GLY B 1 291 ? 17.695  50.640  5.142   1.00 9.93  ? 291 GLY B CA  1 
ATOM   5050 C C   . GLY B 1 291 ? 17.865  52.183  4.829   1.00 12.33 ? 291 GLY B C   1 
ATOM   5051 O O   . GLY B 1 291 ? 17.044  53.092  4.840   1.00 9.59  ? 291 GLY B O   1 
ATOM   5052 N N   . LYS B 1 292 ? 19.128  52.532  4.728   1.00 12.98 ? 292 LYS B N   1 
ATOM   5053 C CA  . LYS B 1 292 ? 19.243  53.863  4.187   1.00 15.08 ? 292 LYS B CA  1 
ATOM   5054 C C   . LYS B 1 292 ? 19.669  53.787  2.711   1.00 13.04 ? 292 LYS B C   1 
ATOM   5055 O O   . LYS B 1 292 ? 20.005  54.756  2.041   1.00 18.56 ? 292 LYS B O   1 
ATOM   5056 C CB  . LYS B 1 292 ? 20.252  54.632  5.035   1.00 15.65 ? 292 LYS B CB  1 
ATOM   5057 C CG  . LYS B 1 292 ? 19.997  55.301  6.386   1.00 18.98 ? 292 LYS B CG  1 
ATOM   5058 C CD  . LYS B 1 292 ? 21.270  56.118  6.680   1.00 17.70 ? 292 LYS B CD  1 
ATOM   5059 C CE  . LYS B 1 292 ? 21.159  57.369  7.607   1.00 22.07 ? 292 LYS B CE  1 
ATOM   5060 N NZ  . LYS B 1 292 ? 20.735  57.049  9.013   1.00 29.56 ? 292 LYS B NZ  1 
ATOM   5061 N N   . THR B 1 293 ? 19.690  52.569  2.196   1.00 7.48  ? 293 THR B N   1 
ATOM   5062 C CA  . THR B 1 293 ? 19.861  52.284  0.755   1.00 6.70  ? 293 THR B CA  1 
ATOM   5063 C C   . THR B 1 293 ? 19.182  51.062  0.264   1.00 3.75  ? 293 THR B C   1 
ATOM   5064 O O   . THR B 1 293 ? 19.458  49.949  0.665   1.00 2.00  ? 293 THR B O   1 
ATOM   5065 C CB  . THR B 1 293 ? 21.346  52.125  0.370   1.00 10.50 ? 293 THR B CB  1 
ATOM   5066 O OG1 . THR B 1 293 ? 22.077  53.313  0.812   1.00 12.10 ? 293 THR B OG1 1 
ATOM   5067 C CG2 . THR B 1 293 ? 21.671  51.759  -1.064  1.00 10.86 ? 293 THR B CG2 1 
ATOM   5068 N N   . THR B 1 294 ? 18.331  51.287  -0.714  1.00 2.77  ? 294 THR B N   1 
ATOM   5069 C CA  . THR B 1 294 ? 17.629  50.381  -1.681  1.00 4.09  ? 294 THR B CA  1 
ATOM   5070 C C   . THR B 1 294 ? 18.266  50.424  -3.101  1.00 2.71  ? 294 THR B C   1 
ATOM   5071 O O   . THR B 1 294 ? 18.563  51.517  -3.554  1.00 2.40  ? 294 THR B O   1 
ATOM   5072 C CB  . THR B 1 294 ? 16.268  51.006  -1.845  1.00 6.10  ? 294 THR B CB  1 
ATOM   5073 O OG1 . THR B 1 294 ? 16.425  52.417  -1.569  1.00 9.63  ? 294 THR B OG1 1 
ATOM   5074 C CG2 . THR B 1 294 ? 15.173  50.394  -1.009  1.00 3.09  ? 294 THR B CG2 1 
ATOM   5075 N N   . PRO B 1 295 ? 18.486  49.298  -3.861  1.00 2.00  ? 295 PRO B N   1 
ATOM   5076 C CA  . PRO B 1 295 ? 18.331  49.314  -5.296  1.00 3.22  ? 295 PRO B CA  1 
ATOM   5077 C C   . PRO B 1 295 ? 17.376  50.378  -5.722  1.00 6.41  ? 295 PRO B C   1 
ATOM   5078 O O   . PRO B 1 295 ? 16.297  50.281  -5.146  1.00 8.80  ? 295 PRO B O   1 
ATOM   5079 C CB  . PRO B 1 295 ? 17.736  47.954  -5.547  1.00 4.26  ? 295 PRO B CB  1 
ATOM   5080 C CG  . PRO B 1 295 ? 18.668  47.056  -4.837  1.00 2.00  ? 295 PRO B CG  1 
ATOM   5081 C CD  . PRO B 1 295 ? 18.632  47.861  -3.567  1.00 5.16  ? 295 PRO B CD  1 
ATOM   5082 N N   . ASP B 1 296 ? 17.870  51.383  -6.580  1.00 7.14  ? 296 ASP B N   1 
ATOM   5083 C CA  . ASP B 1 296 ? 16.971  52.256  -7.249  1.00 13.51 ? 296 ASP B CA  1 
ATOM   5084 C C   . ASP B 1 296 ? 15.947  51.531  -8.026  1.00 17.57 ? 296 ASP B C   1 
ATOM   5085 O O   . ASP B 1 296 ? 16.214  51.142  -9.149  1.00 19.88 ? 296 ASP B O   1 
ATOM   5086 C CB  . ASP B 1 296 ? 17.696  53.068  -8.284  1.00 16.30 ? 296 ASP B CB  1 
ATOM   5087 C CG  . ASP B 1 296 ? 16.753  53.942  -9.223  1.00 19.76 ? 296 ASP B CG  1 
ATOM   5088 O OD1 . ASP B 1 296 ? 15.637  54.334  -8.830  1.00 22.11 ? 296 ASP B OD1 1 
ATOM   5089 O OD2 . ASP B 1 296 ? 17.130  54.195  -10.372 1.00 15.14 ? 296 ASP B OD2 1 
ATOM   5090 N N   . PRO B 1 297 ? 14.750  51.582  -7.479  1.00 18.64 ? 297 PRO B N   1 
ATOM   5091 C CA  . PRO B 1 297 ? 13.677  50.795  -7.945  1.00 17.87 ? 297 PRO B CA  1 
ATOM   5092 C C   . PRO B 1 297 ? 13.348  51.086  -9.373  1.00 17.24 ? 297 PRO B C   1 
ATOM   5093 O O   . PRO B 1 297 ? 12.884  50.244  -10.106 1.00 20.72 ? 297 PRO B O   1 
ATOM   5094 C CB  . PRO B 1 297 ? 12.527  51.103  -6.958  1.00 21.40 ? 297 PRO B CB  1 
ATOM   5095 C CG  . PRO B 1 297 ? 12.966  52.298  -6.141  1.00 17.19 ? 297 PRO B CG  1 
ATOM   5096 C CD  . PRO B 1 297 ? 14.454  52.267  -6.285  1.00 17.61 ? 297 PRO B CD  1 
ATOM   5097 N N   . SER B 1 298 ? 13.528  52.335  -9.829  1.00 17.55 ? 298 SER B N   1 
ATOM   5098 C CA  . SER B 1 298 ? 13.349  52.691  -11.277 1.00 16.15 ? 298 SER B CA  1 
ATOM   5099 C C   . SER B 1 298 ? 13.942  51.722  -12.310 1.00 12.44 ? 298 SER B C   1 
ATOM   5100 O O   . SER B 1 298 ? 13.565  51.634  -13.500 1.00 9.14  ? 298 SER B O   1 
ATOM   5101 C CB  . SER B 1 298 ? 13.915  54.107  -11.670 1.00 19.16 ? 298 SER B CB  1 
ATOM   5102 O OG  . SER B 1 298 ? 12.900  55.099  -12.035 1.00 23.74 ? 298 SER B OG  1 
ATOM   5103 N N   . ALA B 1 299 ? 14.944  50.997  -11.727 1.00 7.73  ? 299 ALA B N   1 
ATOM   5104 C CA  . ALA B 1 299 ? 15.385  49.968  -12.626 1.00 6.38  ? 299 ALA B CA  1 
ATOM   5105 C C   . ALA B 1 299 ? 15.180  48.588  -12.269 1.00 7.06  ? 299 ALA B C   1 
ATOM   5106 O O   . ALA B 1 299 ? 16.106  47.855  -12.555 1.00 2.00  ? 299 ALA B O   1 
ATOM   5107 C CB  . ALA B 1 299 ? 16.853  50.001  -12.893 1.00 6.13  ? 299 ALA B CB  1 
ATOM   5108 N N   . ASN B 1 300 ? 13.970  48.227  -11.802 1.00 9.73  ? 300 ASN B N   1 
ATOM   5109 C CA  . ASN B 1 300 ? 13.759  46.753  -11.671 1.00 13.48 ? 300 ASN B CA  1 
ATOM   5110 C C   . ASN B 1 300 ? 13.648  45.904  -13.007 1.00 15.32 ? 300 ASN B C   1 
ATOM   5111 O O   . ASN B 1 300 ? 12.657  45.988  -13.703 1.00 17.43 ? 300 ASN B O   1 
ATOM   5112 C CB  . ASN B 1 300 ? 12.476  46.493  -10.834 1.00 18.14 ? 300 ASN B CB  1 
ATOM   5113 C CG  . ASN B 1 300 ? 12.975  45.874  -9.562  1.00 23.22 ? 300 ASN B CG  1 
ATOM   5114 O OD1 . ASN B 1 300 ? 13.346  44.700  -9.524  1.00 27.16 ? 300 ASN B OD1 1 
ATOM   5115 N ND2 . ASN B 1 300 ? 13.151  46.748  -8.592  1.00 26.09 ? 300 ASN B ND2 1 
ATOM   5116 N N   . ILE B 1 301 ? 14.562  44.985  -13.298 1.00 14.18 ? 301 ILE B N   1 
ATOM   5117 C CA  . ILE B 1 301 ? 13.993  43.969  -14.250 1.00 13.71 ? 301 ILE B CA  1 
ATOM   5118 C C   . ILE B 1 301 ? 12.720  43.195  -13.824 1.00 14.64 ? 301 ILE B C   1 
ATOM   5119 O O   . ILE B 1 301 ? 12.939  42.228  -13.054 1.00 18.19 ? 301 ILE B O   1 
ATOM   5120 C CB  . ILE B 1 301 ? 15.119  42.952  -14.598 1.00 10.64 ? 301 ILE B CB  1 
ATOM   5121 C CG1 . ILE B 1 301 ? 15.948  43.902  -15.427 1.00 6.83  ? 301 ILE B CG1 1 
ATOM   5122 C CG2 . ILE B 1 301 ? 14.748  41.633  -15.359 1.00 2.39  ? 301 ILE B CG2 1 
ATOM   5123 C CD1 . ILE B 1 301 ? 17.179  43.130  -15.839 1.00 10.18 ? 301 ILE B CD1 1 
ATOM   5124 N N   . SER B 1 302 ? 11.504  43.544  -14.286 1.00 17.30 ? 302 SER B N   1 
ATOM   5125 C CA  . SER B 1 302 ? 10.333  42.647  -13.881 1.00 15.09 ? 302 SER B CA  1 
ATOM   5126 C C   . SER B 1 302 ? 10.177  41.197  -14.281 1.00 13.18 ? 302 SER B C   1 
ATOM   5127 O O   . SER B 1 302 ? 9.151   40.639  -14.495 1.00 15.07 ? 302 SER B O   1 
ATOM   5128 C CB  . SER B 1 302 ? 8.906   43.079  -14.119 1.00 15.99 ? 302 SER B CB  1 
ATOM   5129 O OG  . SER B 1 302 ? 8.180   43.202  -12.903 1.00 14.93 ? 302 SER B OG  1 
ATOM   5130 N N   . LEU B 1 303 ? 11.309  40.503  -14.399 1.00 11.98 ? 303 LEU B N   1 
ATOM   5131 C CA  . LEU B 1 303 ? 11.169  39.322  -15.208 1.00 16.29 ? 303 LEU B CA  1 
ATOM   5132 C C   . LEU B 1 303 ? 10.481  38.049  -14.802 1.00 13.63 ? 303 LEU B C   1 
ATOM   5133 O O   . LEU B 1 303 ? 10.884  37.398  -13.887 1.00 17.85 ? 303 LEU B O   1 
ATOM   5134 C CB  . LEU B 1 303 ? 12.501  39.236  -15.989 1.00 16.98 ? 303 LEU B CB  1 
ATOM   5135 C CG  . LEU B 1 303 ? 13.341  37.977  -16.077 1.00 17.47 ? 303 LEU B CG  1 
ATOM   5136 C CD1 . LEU B 1 303 ? 14.485  38.609  -16.797 1.00 13.26 ? 303 LEU B CD1 1 
ATOM   5137 C CD2 . LEU B 1 303 ? 13.825  37.261  -14.791 1.00 18.57 ? 303 LEU B CD2 1 
ATOM   5138 N N   . ASP B 1 304 ? 9.505   37.650  -15.601 1.00 13.34 ? 304 ASP B N   1 
ATOM   5139 C CA  . ASP B 1 304 ? 8.654   36.460  -15.297 1.00 12.54 ? 304 ASP B CA  1 
ATOM   5140 C C   . ASP B 1 304 ? 7.675   36.757  -14.184 1.00 11.74 ? 304 ASP B C   1 
ATOM   5141 O O   . ASP B 1 304 ? 6.984   35.857  -13.807 1.00 13.68 ? 304 ASP B O   1 
ATOM   5142 C CB  . ASP B 1 304 ? 9.372   34.959  -15.014 1.00 21.79 ? 304 ASP B CB  1 
ATOM   5143 C CG  . ASP B 1 304 ? 10.716  34.174  -15.754 1.00 29.83 ? 304 ASP B CG  1 
ATOM   5144 O OD1 . ASP B 1 304 ? 11.618  33.560  -15.103 1.00 23.97 ? 304 ASP B OD1 1 
ATOM   5145 O OD2 . ASP B 1 304 ? 10.935  34.123  -17.088 1.00 30.80 ? 304 ASP B OD2 1 
ATOM   5146 N N   . GLY B 1 305 ? 7.603   37.940  -13.657 1.00 11.11 ? 305 GLY B N   1 
ATOM   5147 C CA  . GLY B 1 305 ? 6.895   37.947  -12.373 1.00 6.28  ? 305 GLY B CA  1 
ATOM   5148 C C   . GLY B 1 305 ? 7.850   37.630  -11.079 1.00 8.54  ? 305 GLY B C   1 
ATOM   5149 O O   . GLY B 1 305 ? 7.346   37.158  -10.052 1.00 8.99  ? 305 GLY B O   1 
ATOM   5150 N N   . VAL B 1 306 ? 9.108   37.578  -11.362 1.00 4.62  ? 306 VAL B N   1 
ATOM   5151 C CA  . VAL B 1 306 ? 10.237  37.708  -10.375 1.00 2.00  ? 306 VAL B CA  1 
ATOM   5152 C C   . VAL B 1 306 ? 11.046  39.051  -10.589 1.00 2.00  ? 306 VAL B C   1 
ATOM   5153 O O   . VAL B 1 306 ? 11.593  39.479  -11.479 1.00 3.52  ? 306 VAL B O   1 
ATOM   5154 C CB  . VAL B 1 306 ? 11.180  36.579  -10.288 1.00 2.00  ? 306 VAL B CB  1 
ATOM   5155 C CG1 . VAL B 1 306 ? 12.038  36.728  -9.112  1.00 11.13 ? 306 VAL B CG1 1 
ATOM   5156 C CG2 . VAL B 1 306 ? 10.918  35.030  -10.067 1.00 2.00  ? 306 VAL B CG2 1 
ATOM   5157 N N   . ASP B 1 307 ? 10.798  39.714  -9.583  1.00 2.00  ? 307 ASP B N   1 
ATOM   5158 C CA  . ASP B 1 307 ? 11.745  40.845  -9.356  1.00 2.00  ? 307 ASP B CA  1 
ATOM   5159 C C   . ASP B 1 307 ? 13.257  40.594  -9.192  1.00 2.26  ? 307 ASP B C   1 
ATOM   5160 O O   . ASP B 1 307 ? 13.774  39.810  -8.412  1.00 3.68  ? 307 ASP B O   1 
ATOM   5161 C CB  . ASP B 1 307 ? 11.286  41.376  -8.075  1.00 5.73  ? 307 ASP B CB  1 
ATOM   5162 C CG  . ASP B 1 307 ? 9.892   41.958  -8.167  1.00 3.75  ? 307 ASP B CG  1 
ATOM   5163 O OD1 . ASP B 1 307 ? 9.140   41.726  -7.187  1.00 2.00  ? 307 ASP B OD1 1 
ATOM   5164 O OD2 . ASP B 1 307 ? 9.689   42.613  -9.240  1.00 11.09 ? 307 ASP B OD2 1 
ATOM   5165 N N   . VAL B 1 308 ? 13.976  41.459  -9.909  1.00 2.97  ? 308 VAL B N   1 
ATOM   5166 C CA  . VAL B 1 308 ? 15.431  41.377  -9.828  1.00 3.52  ? 308 VAL B CA  1 
ATOM   5167 C C   . VAL B 1 308 ? 16.100  42.722  -9.579  1.00 3.31  ? 308 VAL B C   1 
ATOM   5168 O O   . VAL B 1 308 ? 16.313  43.320  -10.641 1.00 2.00  ? 308 VAL B O   1 
ATOM   5169 C CB  . VAL B 1 308 ? 16.135  40.887  -11.085 1.00 2.00  ? 308 VAL B CB  1 
ATOM   5170 C CG1 . VAL B 1 308 ? 17.675  40.689  -10.752 1.00 2.00  ? 308 VAL B CG1 1 
ATOM   5171 C CG2 . VAL B 1 308 ? 15.351  39.754  -11.752 1.00 2.00  ? 308 VAL B CG2 1 
ATOM   5172 N N   . PRO B 1 309 ? 16.354  43.159  -8.229  1.00 2.22  ? 309 PRO B N   1 
ATOM   5173 C CA  . PRO B 1 309 ? 16.475  44.591  -7.937  1.00 4.24  ? 309 PRO B CA  1 
ATOM   5174 C C   . PRO B 1 309 ? 17.736  45.332  -8.386  1.00 4.71  ? 309 PRO B C   1 
ATOM   5175 O O   . PRO B 1 309 ? 18.536  45.656  -7.556  1.00 3.15  ? 309 PRO B O   1 
ATOM   5176 C CB  . PRO B 1 309 ? 16.283  44.479  -6.487  1.00 4.50  ? 309 PRO B CB  1 
ATOM   5177 C CG  . PRO B 1 309 ? 15.549  43.219  -6.100  1.00 2.00  ? 309 PRO B CG  1 
ATOM   5178 C CD  . PRO B 1 309 ? 16.312  42.380  -6.987  1.00 2.00  ? 309 PRO B CD  1 
ATOM   5179 N N   . LEU B 1 310 ? 18.029  45.529  -9.692  1.00 3.27  ? 310 LEU B N   1 
ATOM   5180 C CA  . LEU B 1 310 ? 19.398  45.865  -10.013 1.00 2.00  ? 310 LEU B CA  1 
ATOM   5181 C C   . LEU B 1 310 ? 19.779  47.312  -10.019 1.00 2.00  ? 310 LEU B C   1 
ATOM   5182 O O   . LEU B 1 310 ? 20.863  47.752  -10.387 1.00 2.00  ? 310 LEU B O   1 
ATOM   5183 C CB  . LEU B 1 310 ? 19.918  45.301  -11.268 1.00 2.00  ? 310 LEU B CB  1 
ATOM   5184 C CG  . LEU B 1 310 ? 19.063  44.382  -11.991 1.00 2.00  ? 310 LEU B CG  1 
ATOM   5185 C CD1 . LEU B 1 310 ? 18.182  45.195  -12.821 1.00 4.73  ? 310 LEU B CD1 1 
ATOM   5186 C CD2 . LEU B 1 310 ? 19.839  43.586  -13.006 1.00 2.00  ? 310 LEU B CD2 1 
ATOM   5187 N N   . GLY B 1 311 ? 18.832  48.116  -9.586  1.00 5.17  ? 311 GLY B N   1 
ATOM   5188 C CA  . GLY B 1 311 ? 19.181  49.563  -9.525  1.00 7.49  ? 311 GLY B CA  1 
ATOM   5189 C C   . GLY B 1 311 ? 20.305  49.975  -8.500  1.00 4.89  ? 311 GLY B C   1 
ATOM   5190 O O   . GLY B 1 311 ? 20.112  50.248  -7.347  1.00 4.77  ? 311 GLY B O   1 
ATOM   5191 N N   . THR B 1 312 ? 21.497  50.078  -8.991  1.00 2.00  ? 312 THR B N   1 
ATOM   5192 C CA  . THR B 1 312 ? 22.317  51.166  -8.440  1.00 6.30  ? 312 THR B CA  1 
ATOM   5193 C C   . THR B 1 312 ? 21.992  51.886  -7.053  1.00 4.63  ? 312 THR B C   1 
ATOM   5194 O O   . THR B 1 312 ? 21.030  52.665  -6.924  1.00 7.63  ? 312 THR B O   1 
ATOM   5195 C CB  . THR B 1 312 ? 22.388  52.173  -9.587  1.00 11.32 ? 312 THR B CB  1 
ATOM   5196 O OG1 . THR B 1 312 ? 23.258  51.705  -10.653 1.00 16.21 ? 312 THR B OG1 1 
ATOM   5197 C CG2 . THR B 1 312 ? 22.701  53.598  -9.180  1.00 12.85 ? 312 THR B CG2 1 
ATOM   5198 N N   . GLY B 1 313 ? 22.795  51.512  -6.015  1.00 7.79  ? 313 GLY B N   1 
ATOM   5199 C CA  . GLY B 1 313 ? 22.692  52.013  -4.637  1.00 8.03  ? 313 GLY B CA  1 
ATOM   5200 C C   . GLY B 1 313 ? 22.086  53.348  -4.676  1.00 10.78 ? 313 GLY B C   1 
ATOM   5201 O O   . GLY B 1 313 ? 22.569  54.318  -5.242  1.00 12.01 ? 313 GLY B O   1 
ATOM   5202 N N   . ILE B 1 314 ? 20.843  53.397  -4.172  1.00 9.20  ? 314 ILE B N   1 
ATOM   5203 C CA  . ILE B 1 314 ? 20.227  54.753  -3.987  1.00 9.21  ? 314 ILE B CA  1 
ATOM   5204 C C   . ILE B 1 314 ? 19.672  54.844  -2.626  1.00 8.43  ? 314 ILE B C   1 
ATOM   5205 O O   . ILE B 1 314 ? 19.233  53.950  -1.934  1.00 10.76 ? 314 ILE B O   1 
ATOM   5206 C CB  . ILE B 1 314 ? 19.242  55.243  -5.136  1.00 11.97 ? 314 ILE B CB  1 
ATOM   5207 C CG1 . ILE B 1 314 ? 20.025  55.605  -6.373  1.00 14.76 ? 314 ILE B CG1 1 
ATOM   5208 C CG2 . ILE B 1 314 ? 18.344  56.414  -4.889  1.00 9.50  ? 314 ILE B CG2 1 
ATOM   5209 C CD1 . ILE B 1 314 ? 19.198  56.171  -7.533  1.00 17.85 ? 314 ILE B CD1 1 
ATOM   5210 N N   . SER B 1 315 ? 19.907  56.052  -2.197  1.00 9.22  ? 315 SER B N   1 
ATOM   5211 C CA  . SER B 1 315 ? 19.413  56.384  -0.871  1.00 9.57  ? 315 SER B CA  1 
ATOM   5212 C C   . SER B 1 315 ? 17.918  56.132  -0.722  1.00 9.46  ? 315 SER B C   1 
ATOM   5213 O O   . SER B 1 315 ? 17.257  56.172  -1.681  1.00 8.89  ? 315 SER B O   1 
ATOM   5214 C CB  . SER B 1 315 ? 19.486  57.837  -0.676  1.00 9.43  ? 315 SER B CB  1 
ATOM   5215 O OG  . SER B 1 315 ? 19.259  58.099  0.700   1.00 15.95 ? 315 SER B OG  1 
ATOM   5216 N N   . SER B 1 316 ? 17.430  55.872  0.450   1.00 10.57 ? 316 SER B N   1 
ATOM   5217 C CA  . SER B 1 316 ? 15.986  55.555  0.560   1.00 12.64 ? 316 SER B CA  1 
ATOM   5218 C C   . SER B 1 316 ? 15.269  56.551  1.364   1.00 14.82 ? 316 SER B C   1 
ATOM   5219 O O   . SER B 1 316 ? 15.920  57.355  2.062   1.00 16.32 ? 316 SER B O   1 
ATOM   5220 C CB  . SER B 1 316 ? 15.829  54.308  1.434   1.00 17.57 ? 316 SER B CB  1 
ATOM   5221 O OG  . SER B 1 316 ? 16.700  54.319  2.623   1.00 12.50 ? 316 SER B OG  1 
ATOM   5222 N N   . GLY B 1 317 ? 13.991  56.331  1.522   1.00 15.82 ? 317 GLY B N   1 
ATOM   5223 C CA  . GLY B 1 317 ? 13.517  57.243  2.586   1.00 19.07 ? 317 GLY B CA  1 
ATOM   5224 C C   . GLY B 1 317 ? 13.819  57.186  4.135   1.00 20.75 ? 317 GLY B C   1 
ATOM   5225 O O   . GLY B 1 317 ? 13.117  57.782  4.903   1.00 18.72 ? 317 GLY B O   1 
ATOM   5226 N N   . VAL B 1 318 ? 14.883  56.522  4.642   1.00 21.34 ? 318 VAL B N   1 
ATOM   5227 C CA  . VAL B 1 318 ? 14.709  56.010  6.086   1.00 20.30 ? 318 VAL B CA  1 
ATOM   5228 C C   . VAL B 1 318 ? 15.744  56.401  7.186   1.00 21.91 ? 318 VAL B C   1 
ATOM   5229 O O   . VAL B 1 318 ? 16.632  55.587  7.549   1.00 23.40 ? 318 VAL B O   1 
ATOM   5230 C CB  . VAL B 1 318 ? 14.687  54.438  6.091   1.00 14.03 ? 318 VAL B CB  1 
ATOM   5231 C CG1 . VAL B 1 318 ? 14.218  53.693  7.398   1.00 8.98  ? 318 VAL B CG1 1 
ATOM   5232 C CG2 . VAL B 1 318 ? 14.032  53.937  4.805   1.00 15.26 ? 318 VAL B CG2 1 
ATOM   5233 N N   . ASN B 1 319 ? 15.759  57.663  7.644   1.00 26.14 ? 319 ASN B N   1 
ATOM   5234 C CA  . ASN B 1 319 ? 17.183  57.750  8.011   1.00 29.31 ? 319 ASN B CA  1 
ATOM   5235 C C   . ASN B 1 319 ? 17.610  57.770  9.497   1.00 30.27 ? 319 ASN B C   1 
ATOM   5236 O O   . ASN B 1 319 ? 18.027  58.799  10.037  1.00 32.33 ? 319 ASN B O   1 
ATOM   5237 C CB  . ASN B 1 319 ? 18.096  58.390  6.912   1.00 28.07 ? 319 ASN B CB  1 
ATOM   5238 C CG  . ASN B 1 319 ? 18.629  59.736  7.263   1.00 26.58 ? 319 ASN B CG  1 
ATOM   5239 O OD1 . ASN B 1 319 ? 18.010  60.539  7.950   1.00 18.70 ? 319 ASN B OD1 1 
ATOM   5240 N ND2 . ASN B 1 319 ? 19.796  59.909  6.600   1.00 24.14 ? 319 ASN B ND2 1 
ATOM   5241 N N   . ASP B 1 320 ? 17.493  56.492  10.046  1.00 30.25 ? 320 ASP B N   1 
ATOM   5242 C CA  . ASP B 1 320 ? 16.930  56.146  11.410  1.00 27.70 ? 320 ASP B CA  1 
ATOM   5243 C C   . ASP B 1 320 ? 16.761  54.617  11.871  1.00 24.09 ? 320 ASP B C   1 
ATOM   5244 O O   . ASP B 1 320 ? 16.166  54.240  12.856  1.00 25.70 ? 320 ASP B O   1 
ATOM   5245 C CB  . ASP B 1 320 ? 15.562  56.784  11.599  1.00 32.59 ? 320 ASP B CB  1 
ATOM   5246 C CG  . ASP B 1 320 ? 14.564  56.002  10.775  1.00 40.72 ? 320 ASP B CG  1 
ATOM   5247 O OD1 . ASP B 1 320 ? 14.131  56.486  9.730   1.00 44.45 ? 320 ASP B OD1 1 
ATOM   5248 O OD2 . ASP B 1 320 ? 14.255  54.891  11.178  1.00 45.80 ? 320 ASP B OD2 1 
ATOM   5249 N N   . THR B 1 321 ? 17.242  53.733  11.017  1.00 18.26 ? 321 THR B N   1 
ATOM   5250 C CA  . THR B 1 321 ? 17.200  52.256  11.139  1.00 10.81 ? 321 THR B CA  1 
ATOM   5251 C C   . THR B 1 321 ? 18.454  51.673  11.791  1.00 9.74  ? 321 THR B C   1 
ATOM   5252 O O   . THR B 1 321 ? 19.441  52.376  11.838  1.00 4.07  ? 321 THR B O   1 
ATOM   5253 C CB  . THR B 1 321 ? 17.017  51.653  9.755   1.00 3.42  ? 321 THR B CB  1 
ATOM   5254 O OG1 . THR B 1 321 ? 17.812  50.535  9.483   1.00 2.00  ? 321 THR B OG1 1 
ATOM   5255 C CG2 . THR B 1 321 ? 17.342  52.684  8.699   1.00 5.79  ? 321 THR B CG2 1 
ATOM   5256 N N   . SER B 1 322 ? 18.394  50.365  12.220  1.00 8.37  ? 322 SER B N   1 
ATOM   5257 C CA  . SER B 1 322 ? 19.664  49.668  12.536  1.00 5.59  ? 322 SER B CA  1 
ATOM   5258 C C   . SER B 1 322 ? 20.365  49.238  11.234  1.00 6.61  ? 322 SER B C   1 
ATOM   5259 O O   . SER B 1 322 ? 21.244  48.442  11.141  1.00 5.77  ? 322 SER B O   1 
ATOM   5260 C CB  . SER B 1 322 ? 19.641  48.372  13.495  1.00 9.02  ? 322 SER B CB  1 
ATOM   5261 O OG  . SER B 1 322 ? 19.232  48.306  14.972  1.00 2.97  ? 322 SER B OG  1 
ATOM   5262 N N   . LEU B 1 323 ? 19.989  49.711  10.056  1.00 10.32 ? 323 LEU B N   1 
ATOM   5263 C CA  . LEU B 1 323 ? 20.536  48.953  8.927   1.00 12.57 ? 323 LEU B CA  1 
ATOM   5264 C C   . LEU B 1 323 ? 20.976  49.877  7.777   1.00 16.22 ? 323 LEU B C   1 
ATOM   5265 O O   . LEU B 1 323 ? 20.223  50.695  7.235   1.00 16.54 ? 323 LEU B O   1 
ATOM   5266 C CB  . LEU B 1 323 ? 19.570  47.841  8.430   1.00 7.80  ? 323 LEU B CB  1 
ATOM   5267 C CG  . LEU B 1 323 ? 19.202  46.611  9.279   1.00 8.35  ? 323 LEU B CG  1 
ATOM   5268 C CD1 . LEU B 1 323 ? 18.106  45.724  8.701   1.00 2.00  ? 323 LEU B CD1 1 
ATOM   5269 C CD2 . LEU B 1 323 ? 20.434  45.786  9.536   1.00 14.67 ? 323 LEU B CD2 1 
ATOM   5270 N N   . LEU B 1 324 ? 22.229  49.764  7.301   1.00 15.77 ? 324 LEU B N   1 
ATOM   5271 C CA  . LEU B 1 324 ? 22.559  50.639  6.125   1.00 13.12 ? 324 LEU B CA  1 
ATOM   5272 C C   . LEU B 1 324 ? 21.932  50.264  4.773   1.00 12.41 ? 324 LEU B C   1 
ATOM   5273 O O   . LEU B 1 324 ? 21.463  51.052  4.008   1.00 18.19 ? 324 LEU B O   1 
ATOM   5274 C CB  . LEU B 1 324 ? 23.980  50.487  5.746   1.00 13.29 ? 324 LEU B CB  1 
ATOM   5275 C CG  . LEU B 1 324 ? 24.959  50.685  6.842   1.00 3.12  ? 324 LEU B CG  1 
ATOM   5276 C CD1 . LEU B 1 324 ? 26.331  50.454  6.212   1.00 2.00  ? 324 LEU B CD1 1 
ATOM   5277 C CD2 . LEU B 1 324 ? 24.742  52.112  7.404   1.00 3.89  ? 324 LEU B CD2 1 
ATOM   5278 N N   . TYR B 1 325 ? 21.948  48.979  4.593   1.00 10.43 ? 325 TYR B N   1 
ATOM   5279 C CA  . TYR B 1 325 ? 21.213  48.216  3.608   1.00 13.06 ? 325 TYR B CA  1 
ATOM   5280 C C   . TYR B 1 325 ? 20.401  47.038  4.110   1.00 12.02 ? 325 TYR B C   1 
ATOM   5281 O O   . TYR B 1 325 ? 20.874  45.982  4.507   1.00 12.33 ? 325 TYR B O   1 
ATOM   5282 C CB  . TYR B 1 325 ? 22.165  47.550  2.631   1.00 16.24 ? 325 TYR B CB  1 
ATOM   5283 C CG  . TYR B 1 325 ? 23.330  48.394  2.303   1.00 14.65 ? 325 TYR B CG  1 
ATOM   5284 C CD1 . TYR B 1 325 ? 23.166  49.630  1.714   1.00 17.94 ? 325 TYR B CD1 1 
ATOM   5285 C CD2 . TYR B 1 325 ? 24.544  47.838  2.651   1.00 14.35 ? 325 TYR B CD2 1 
ATOM   5286 C CE1 . TYR B 1 325 ? 24.271  50.435  1.498   1.00 19.41 ? 325 TYR B CE1 1 
ATOM   5287 C CE2 . TYR B 1 325 ? 25.667  48.630  2.464   1.00 16.44 ? 325 TYR B CE2 1 
ATOM   5288 C CZ  . TYR B 1 325 ? 25.526  49.943  1.919   1.00 16.52 ? 325 TYR B CZ  1 
ATOM   5289 O OH  . TYR B 1 325 ? 26.676  50.715  1.847   1.00 20.21 ? 325 TYR B OH  1 
ATOM   5290 N N   . ASN B 1 326 ? 19.135  47.313  3.886   1.00 11.14 ? 326 ASN B N   1 
ATOM   5291 C CA  . ASN B 1 326 ? 18.122  46.482  3.276   1.00 7.41  ? 326 ASN B CA  1 
ATOM   5292 C C   . ASN B 1 326 ? 18.319  44.985  3.262   1.00 4.59  ? 326 ASN B C   1 
ATOM   5293 O O   . ASN B 1 326 ? 19.187  44.541  2.568   1.00 7.23  ? 326 ASN B O   1 
ATOM   5294 C CB  . ASN B 1 326 ? 17.945  47.118  1.940   1.00 8.89  ? 326 ASN B CB  1 
ATOM   5295 C CG  . ASN B 1 326 ? 16.516  47.051  1.591   1.00 3.67  ? 326 ASN B CG  1 
ATOM   5296 O OD1 . ASN B 1 326 ? 16.197  46.030  1.005   1.00 5.88  ? 326 ASN B OD1 1 
ATOM   5297 N ND2 . ASN B 1 326 ? 15.742  48.081  1.880   1.00 2.00  ? 326 ASN B ND2 1 
ATOM   5298 N N   . GLU B 1 327 ? 17.486  44.235  4.033   1.00 2.00  ? 327 GLU B N   1 
ATOM   5299 C CA  . GLU B 1 327 ? 17.590  42.825  4.372   1.00 2.00  ? 327 GLU B CA  1 
ATOM   5300 C C   . GLU B 1 327 ? 16.294  42.010  4.387   1.00 2.79  ? 327 GLU B C   1 
ATOM   5301 O O   . GLU B 1 327 ? 15.210  42.531  4.603   1.00 8.67  ? 327 GLU B O   1 
ATOM   5302 C CB  . GLU B 1 327 ? 18.096  42.992  5.730   1.00 2.24  ? 327 GLU B CB  1 
ATOM   5303 C CG  . GLU B 1 327 ? 18.605  41.719  6.265   1.00 4.15  ? 327 GLU B CG  1 
ATOM   5304 C CD  . GLU B 1 327 ? 19.349  42.059  7.459   1.00 2.00  ? 327 GLU B CD  1 
ATOM   5305 O OE1 . GLU B 1 327 ? 19.152  41.296  8.414   1.00 2.00  ? 327 GLU B OE1 1 
ATOM   5306 O OE2 . GLU B 1 327 ? 20.097  43.019  7.445   1.00 2.00  ? 327 GLU B OE2 1 
ATOM   5307 N N   . TYR B 1 328 ? 16.427  40.724  4.202   1.00 2.00  ? 328 TYR B N   1 
ATOM   5308 C CA  . TYR B 1 328 ? 15.181  40.045  3.984   1.00 7.01  ? 328 TYR B CA  1 
ATOM   5309 C C   . TYR B 1 328 ? 15.142  38.587  4.492   1.00 10.63 ? 328 TYR B C   1 
ATOM   5310 O O   . TYR B 1 328 ? 16.111  37.841  4.414   1.00 11.94 ? 328 TYR B O   1 
ATOM   5311 C CB  . TYR B 1 328 ? 14.948  39.796  2.470   1.00 8.39  ? 328 TYR B CB  1 
ATOM   5312 C CG  . TYR B 1 328 ? 14.890  40.913  1.480   1.00 2.00  ? 328 TYR B CG  1 
ATOM   5313 C CD1 . TYR B 1 328 ? 15.967  41.359  0.772   1.00 2.00  ? 328 TYR B CD1 1 
ATOM   5314 C CD2 . TYR B 1 328 ? 13.629  41.433  1.330   1.00 2.00  ? 328 TYR B CD2 1 
ATOM   5315 C CE1 . TYR B 1 328 ? 15.812  42.527  0.038   1.00 2.00  ? 328 TYR B CE1 1 
ATOM   5316 C CE2 . TYR B 1 328 ? 13.443  42.544  0.571   1.00 2.00  ? 328 TYR B CE2 1 
ATOM   5317 C CZ  . TYR B 1 328 ? 14.560  43.140  0.039   1.00 3.46  ? 328 TYR B CZ  1 
ATOM   5318 O OH  . TYR B 1 328 ? 14.288  44.378  -0.456  1.00 8.63  ? 328 TYR B OH  1 
ATOM   5319 N N   . ILE B 1 329 ? 14.000  38.136  4.988   1.00 8.79  ? 329 ILE B N   1 
ATOM   5320 C CA  . ILE B 1 329 ? 14.298  36.937  5.766   1.00 5.08  ? 329 ILE B CA  1 
ATOM   5321 C C   . ILE B 1 329 ? 13.104  36.102  5.647   1.00 7.89  ? 329 ILE B C   1 
ATOM   5322 O O   . ILE B 1 329 ? 12.043  36.695  5.707   1.00 6.96  ? 329 ILE B O   1 
ATOM   5323 C CB  . ILE B 1 329 ? 14.519  37.123  7.346   1.00 4.39  ? 329 ILE B CB  1 
ATOM   5324 C CG1 . ILE B 1 329 ? 15.663  37.883  7.800   1.00 5.38  ? 329 ILE B CG1 1 
ATOM   5325 C CG2 . ILE B 1 329 ? 14.737  35.913  8.267   1.00 2.00  ? 329 ILE B CG2 1 
ATOM   5326 C CD1 . ILE B 1 329 ? 14.898  39.103  8.080   1.00 15.13 ? 329 ILE B CD1 1 
ATOM   5327 N N   . VAL B 1 330 ? 13.230  34.770  5.591   1.00 9.85  ? 330 VAL B N   1 
ATOM   5328 C CA  . VAL B 1 330 ? 12.007  33.935  5.718   1.00 9.40  ? 330 VAL B CA  1 
ATOM   5329 C C   . VAL B 1 330 ? 12.011  32.853  6.855   1.00 12.15 ? 330 VAL B C   1 
ATOM   5330 O O   . VAL B 1 330 ? 13.057  32.376  7.175   1.00 17.37 ? 330 VAL B O   1 
ATOM   5331 C CB  . VAL B 1 330 ? 11.787  33.185  4.378   1.00 2.00  ? 330 VAL B CB  1 
ATOM   5332 C CG1 . VAL B 1 330 ? 11.234  34.031  3.301   1.00 2.00  ? 330 VAL B CG1 1 
ATOM   5333 C CG2 . VAL B 1 330 ? 13.045  32.565  3.857   1.00 2.00  ? 330 VAL B CG2 1 
ATOM   5334 N N   . TYR B 1 331 ? 10.885  32.410  7.401   1.00 9.47  ? 331 TYR B N   1 
ATOM   5335 C CA  . TYR B 1 331 ? 10.714  31.388  8.487   1.00 5.40  ? 331 TYR B CA  1 
ATOM   5336 C C   . TYR B 1 331 ? 10.211  29.985  8.023   1.00 2.00  ? 331 TYR B C   1 
ATOM   5337 O O   . TYR B 1 331 ? 10.025  29.027  8.710   1.00 2.00  ? 331 TYR B O   1 
ATOM   5338 C CB  . TYR B 1 331 ? 9.799   32.052  9.584   1.00 8.56  ? 331 TYR B CB  1 
ATOM   5339 C CG  . TYR B 1 331 ? 10.357  33.425  10.007  1.00 2.00  ? 331 TYR B CG  1 
ATOM   5340 C CD1 . TYR B 1 331 ? 10.066  34.533  9.248   1.00 2.00  ? 331 TYR B CD1 1 
ATOM   5341 C CD2 . TYR B 1 331 ? 11.228  33.569  11.067  1.00 2.00  ? 331 TYR B CD2 1 
ATOM   5342 C CE1 . TYR B 1 331 ? 10.690  35.766  9.474   1.00 2.00  ? 331 TYR B CE1 1 
ATOM   5343 C CE2 . TYR B 1 331 ? 11.912  34.766  11.269  1.00 2.00  ? 331 TYR B CE2 1 
ATOM   5344 C CZ  . TYR B 1 331 ? 11.644  35.847  10.467  1.00 2.00  ? 331 TYR B CZ  1 
ATOM   5345 O OH  . TYR B 1 331 ? 12.271  37.034  10.595  1.00 2.00  ? 331 TYR B OH  1 
ATOM   5346 N N   . ASP B 1 332 ? 10.151  29.804  6.693   1.00 2.00  ? 332 ASP B N   1 
ATOM   5347 C CA  . ASP B 1 332 ? 9.904   28.478  6.071   1.00 2.00  ? 332 ASP B CA  1 
ATOM   5348 C C   . ASP B 1 332 ? 10.869  28.002  4.957   1.00 2.00  ? 332 ASP B C   1 
ATOM   5349 O O   . ASP B 1 332 ? 10.979  28.500  3.826   1.00 2.00  ? 332 ASP B O   1 
ATOM   5350 C CB  . ASP B 1 332 ? 8.470   28.351  5.644   1.00 2.00  ? 332 ASP B CB  1 
ATOM   5351 C CG  . ASP B 1 332 ? 8.191   26.956  5.083   1.00 2.44  ? 332 ASP B CG  1 
ATOM   5352 O OD1 . ASP B 1 332 ? 9.079   26.149  4.926   1.00 3.08  ? 332 ASP B OD1 1 
ATOM   5353 O OD2 . ASP B 1 332 ? 7.048   26.635  4.852   1.00 4.98  ? 332 ASP B OD2 1 
ATOM   5354 N N   . ILE B 1 333 ? 11.618  26.943  5.302   1.00 5.70  ? 333 ILE B N   1 
ATOM   5355 C CA  . ILE B 1 333 ? 12.596  26.520  4.263   1.00 7.47  ? 333 ILE B CA  1 
ATOM   5356 C C   . ILE B 1 333 ? 12.136  26.377  2.724   1.00 8.64  ? 333 ILE B C   1 
ATOM   5357 O O   . ILE B 1 333 ? 12.827  26.685  1.777   1.00 11.58 ? 333 ILE B O   1 
ATOM   5358 C CB  . ILE B 1 333 ? 13.511  25.338  4.738   1.00 8.90  ? 333 ILE B CB  1 
ATOM   5359 C CG1 . ILE B 1 333 ? 12.920  23.936  4.775   1.00 7.18  ? 333 ILE B CG1 1 
ATOM   5360 C CG2 . ILE B 1 333 ? 14.286  25.650  6.021   1.00 8.54  ? 333 ILE B CG2 1 
ATOM   5361 C CD1 . ILE B 1 333 ? 14.010  22.930  5.218   1.00 9.46  ? 333 ILE B CD1 1 
ATOM   5362 N N   . ALA B 1 334 ? 10.890  26.003  2.583   1.00 5.99  ? 334 ALA B N   1 
ATOM   5363 C CA  . ALA B 1 334 ? 10.200  25.719  1.318   1.00 2.60  ? 334 ALA B CA  1 
ATOM   5364 C C   . ALA B 1 334 ? 10.089  26.936  0.361   1.00 5.41  ? 334 ALA B C   1 
ATOM   5365 O O   . ALA B 1 334 ? 9.442   26.997  -0.691  1.00 5.17  ? 334 ALA B O   1 
ATOM   5366 C CB  . ALA B 1 334 ? 8.801   25.212  1.732   1.00 2.41  ? 334 ALA B CB  1 
ATOM   5367 N N   . GLN B 1 335 ? 10.570  28.046  0.974   1.00 3.58  ? 335 GLN B N   1 
ATOM   5368 C CA  . GLN B 1 335 ? 10.137  29.305  0.364   1.00 2.00  ? 335 GLN B CA  1 
ATOM   5369 C C   . GLN B 1 335 ? 11.305  29.911  -0.317  1.00 2.00  ? 335 GLN B C   1 
ATOM   5370 O O   . GLN B 1 335 ? 11.457  31.117  -0.401  1.00 2.00  ? 335 GLN B O   1 
ATOM   5371 C CB  . GLN B 1 335 ? 9.431   30.120  1.462   1.00 2.00  ? 335 GLN B CB  1 
ATOM   5372 C CG  . GLN B 1 335 ? 8.708   31.456  1.229   1.00 5.82  ? 335 GLN B CG  1 
ATOM   5373 C CD  . GLN B 1 335 ? 8.201   31.942  2.589   1.00 7.35  ? 335 GLN B CD  1 
ATOM   5374 O OE1 . GLN B 1 335 ? 8.224   31.151  3.490   1.00 10.04 ? 335 GLN B OE1 1 
ATOM   5375 N NE2 . GLN B 1 335 ? 7.830   33.223  2.766   1.00 4.66  ? 335 GLN B NE2 1 
ATOM   5376 N N   . VAL B 1 336 ? 12.093  28.962  -0.778  1.00 2.00  ? 336 VAL B N   1 
ATOM   5377 C CA  . VAL B 1 336 ? 13.169  29.258  -1.650  1.00 3.23  ? 336 VAL B CA  1 
ATOM   5378 C C   . VAL B 1 336 ? 13.349  28.209  -2.754  1.00 4.92  ? 336 VAL B C   1 
ATOM   5379 O O   . VAL B 1 336 ? 12.891  27.118  -2.767  1.00 2.00  ? 336 VAL B O   1 
ATOM   5380 C CB  . VAL B 1 336 ? 14.523  29.844  -1.044  1.00 3.66  ? 336 VAL B CB  1 
ATOM   5381 C CG1 . VAL B 1 336 ? 14.605  30.155  0.447   1.00 5.13  ? 336 VAL B CG1 1 
ATOM   5382 C CG2 . VAL B 1 336 ? 15.871  29.270  -1.423  1.00 2.58  ? 336 VAL B CG2 1 
ATOM   5383 N N   . ASN B 1 337 ? 13.946  28.701  -3.801  1.00 4.05  ? 337 ASN B N   1 
ATOM   5384 C CA  . ASN B 1 337 ? 14.315  27.975  -5.007  1.00 2.00  ? 337 ASN B CA  1 
ATOM   5385 C C   . ASN B 1 337 ? 15.689  28.456  -5.429  1.00 4.69  ? 337 ASN B C   1 
ATOM   5386 O O   . ASN B 1 337 ? 16.057  29.643  -5.646  1.00 3.09  ? 337 ASN B O   1 
ATOM   5387 C CB  . ASN B 1 337 ? 13.386  28.345  -6.160  1.00 5.61  ? 337 ASN B CB  1 
ATOM   5388 C CG  . ASN B 1 337 ? 13.314  27.204  -7.222  1.00 7.07  ? 337 ASN B CG  1 
ATOM   5389 O OD1 . ASN B 1 337 ? 14.178  26.359  -7.382  1.00 9.05  ? 337 ASN B OD1 1 
ATOM   5390 N ND2 . ASN B 1 337 ? 12.311  27.350  -7.954  1.00 6.25  ? 337 ASN B ND2 1 
ATOM   5391 N N   . LEU B 1 338 ? 16.477  27.457  -5.507  1.00 6.73  ? 338 LEU B N   1 
ATOM   5392 C CA  . LEU B 1 338 ? 17.820  28.015  -5.563  1.00 10.06 ? 338 LEU B CA  1 
ATOM   5393 C C   . LEU B 1 338 ? 18.387  28.244  -7.096  1.00 10.64 ? 338 LEU B C   1 
ATOM   5394 O O   . LEU B 1 338 ? 18.594  27.251  -7.823  1.00 16.64 ? 338 LEU B O   1 
ATOM   5395 C CB  . LEU B 1 338 ? 18.511  27.048  -4.553  1.00 8.27  ? 338 LEU B CB  1 
ATOM   5396 C CG  . LEU B 1 338 ? 19.546  27.568  -3.578  1.00 15.32 ? 338 LEU B CG  1 
ATOM   5397 C CD1 . LEU B 1 338 ? 20.418  26.350  -3.263  1.00 18.06 ? 338 LEU B CD1 1 
ATOM   5398 C CD2 . LEU B 1 338 ? 20.221  28.866  -3.961  1.00 15.47 ? 338 LEU B CD2 1 
ATOM   5399 N N   . LYS B 1 339 ? 18.545  29.521  -7.559  1.00 5.28  ? 339 LYS B N   1 
ATOM   5400 C CA  . LYS B 1 339 ? 18.710  29.772  -9.008  1.00 2.00  ? 339 LYS B CA  1 
ATOM   5401 C C   . LYS B 1 339 ? 20.135  29.753  -9.697  1.00 4.77  ? 339 LYS B C   1 
ATOM   5402 O O   . LYS B 1 339 ? 20.577  28.938  -10.530 1.00 10.82 ? 339 LYS B O   1 
ATOM   5403 C CB  . LYS B 1 339 ? 18.174  31.116  -9.355  1.00 3.45  ? 339 LYS B CB  1 
ATOM   5404 C CG  . LYS B 1 339 ? 16.721  31.319  -9.585  1.00 4.71  ? 339 LYS B CG  1 
ATOM   5405 C CD  . LYS B 1 339 ? 16.212  30.008  -10.178 1.00 4.11  ? 339 LYS B CD  1 
ATOM   5406 C CE  . LYS B 1 339 ? 14.704  30.216  -10.681 1.00 7.23  ? 339 LYS B CE  1 
ATOM   5407 N NZ  . LYS B 1 339 ? 13.901  29.043  -10.956 1.00 11.08 ? 339 LYS B NZ  1 
ATOM   5408 N N   . TYR B 1 340 ? 20.974  30.681  -9.210  1.00 2.19  ? 340 TYR B N   1 
ATOM   5409 C CA  . TYR B 1 340 ? 22.339  30.779  -9.709  1.00 4.74  ? 340 TYR B CA  1 
ATOM   5410 C C   . TYR B 1 340 ? 23.485  30.760  -8.643  1.00 6.92  ? 340 TYR B C   1 
ATOM   5411 O O   . TYR B 1 340 ? 23.630  31.631  -7.803  1.00 14.06 ? 340 TYR B O   1 
ATOM   5412 C CB  . TYR B 1 340 ? 22.303  32.132  -10.169 1.00 2.00  ? 340 TYR B CB  1 
ATOM   5413 C CG  . TYR B 1 340 ? 21.402  32.218  -11.327 1.00 4.53  ? 340 TYR B CG  1 
ATOM   5414 C CD1 . TYR B 1 340 ? 21.889  31.734  -12.553 1.00 3.98  ? 340 TYR B CD1 1 
ATOM   5415 C CD2 . TYR B 1 340 ? 20.157  32.867  -11.218 1.00 2.00  ? 340 TYR B CD2 1 
ATOM   5416 C CE1 . TYR B 1 340 ? 21.140  31.970  -13.706 1.00 7.21  ? 340 TYR B CE1 1 
ATOM   5417 C CE2 . TYR B 1 340 ? 19.391  33.063  -12.379 1.00 2.00  ? 340 TYR B CE2 1 
ATOM   5418 C CZ  . TYR B 1 340 ? 19.901  32.623  -13.632 1.00 8.72  ? 340 TYR B CZ  1 
ATOM   5419 O OH  . TYR B 1 340 ? 19.199  32.800  -14.852 1.00 16.67 ? 340 TYR B OH  1 
ATOM   5420 N N   . LEU B 1 341 ? 24.383  29.821  -8.620  1.00 3.53  ? 341 LEU B N   1 
ATOM   5421 C CA  . LEU B 1 341 ? 25.571  30.118  -7.773  1.00 4.17  ? 341 LEU B CA  1 
ATOM   5422 C C   . LEU B 1 341 ? 26.721  30.882  -8.391  1.00 3.60  ? 341 LEU B C   1 
ATOM   5423 O O   . LEU B 1 341 ? 27.549  30.214  -8.932  1.00 5.00  ? 341 LEU B O   1 
ATOM   5424 C CB  . LEU B 1 341 ? 26.045  28.701  -7.379  1.00 7.83  ? 341 LEU B CB  1 
ATOM   5425 C CG  . LEU B 1 341 ? 27.180  28.374  -6.419  1.00 3.29  ? 341 LEU B CG  1 
ATOM   5426 C CD1 . LEU B 1 341 ? 27.210  26.858  -6.321  1.00 2.00  ? 341 LEU B CD1 1 
ATOM   5427 C CD2 . LEU B 1 341 ? 28.477  29.188  -6.626  1.00 4.72  ? 341 LEU B CD2 1 
ATOM   5428 N N   . LEU B 1 342 ? 26.895  32.183  -8.354  1.00 6.36  ? 342 LEU B N   1 
ATOM   5429 C CA  . LEU B 1 342 ? 28.157  32.721  -8.980  1.00 4.59  ? 342 LEU B CA  1 
ATOM   5430 C C   . LEU B 1 342 ? 29.486  32.262  -8.278  1.00 6.69  ? 342 LEU B C   1 
ATOM   5431 O O   . LEU B 1 342 ? 29.574  32.089  -7.076  1.00 13.51 ? 342 LEU B O   1 
ATOM   5432 C CB  . LEU B 1 342 ? 28.303  34.243  -8.911  1.00 2.00  ? 342 LEU B CB  1 
ATOM   5433 C CG  . LEU B 1 342 ? 27.402  35.124  -9.786  1.00 2.00  ? 342 LEU B CG  1 
ATOM   5434 C CD1 . LEU B 1 342 ? 25.981  34.641  -9.820  1.00 2.08  ? 342 LEU B CD1 1 
ATOM   5435 C CD2 . LEU B 1 342 ? 27.582  36.631  -9.579  1.00 2.00  ? 342 LEU B CD2 1 
ATOM   5436 N N   . LYS B 1 343 ? 30.582  32.156  -9.047  1.00 7.04  ? 343 LYS B N   1 
ATOM   5437 C CA  . LYS B 1 343 ? 31.927  32.127  -8.419  1.00 6.91  ? 343 LYS B CA  1 
ATOM   5438 C C   . LYS B 1 343 ? 32.584  33.470  -8.412  1.00 5.18  ? 343 LYS B C   1 
ATOM   5439 O O   . LYS B 1 343 ? 32.911  34.040  -9.463  1.00 8.08  ? 343 LYS B O   1 
ATOM   5440 C CB  . LYS B 1 343 ? 32.833  31.265  -9.261  1.00 6.61  ? 343 LYS B CB  1 
ATOM   5441 C CG  . LYS B 1 343 ? 34.321  31.026  -8.801  1.00 11.84 ? 343 LYS B CG  1 
ATOM   5442 C CD  . LYS B 1 343 ? 34.637  29.500  -9.030  1.00 14.61 ? 343 LYS B CD  1 
ATOM   5443 C CE  . LYS B 1 343 ? 36.061  29.014  -8.766  1.00 20.70 ? 343 LYS B CE  1 
ATOM   5444 N NZ  . LYS B 1 343 ? 37.156  29.421  -9.659  1.00 17.85 ? 343 LYS B NZ  1 
ATOM   5445 N N   . LEU B 1 344 ? 32.707  34.077  -7.248  1.00 2.08  ? 344 LEU B N   1 
ATOM   5446 C CA  . LEU B 1 344 ? 33.167  35.464  -7.494  1.00 2.00  ? 344 LEU B CA  1 
ATOM   5447 C C   . LEU B 1 344 ? 34.701  35.768  -7.239  1.00 4.18  ? 344 LEU B C   1 
ATOM   5448 O O   . LEU B 1 344 ? 35.516  35.004  -6.699  1.00 5.33  ? 344 LEU B O   1 
ATOM   5449 C CB  . LEU B 1 344 ? 32.141  36.089  -6.669  1.00 3.01  ? 344 LEU B CB  1 
ATOM   5450 C CG  . LEU B 1 344 ? 32.146  37.546  -6.379  1.00 6.71  ? 344 LEU B CG  1 
ATOM   5451 C CD1 . LEU B 1 344 ? 32.031  38.114  -7.779  1.00 2.00  ? 344 LEU B CD1 1 
ATOM   5452 C CD2 . LEU B 1 344 ? 31.102  38.032  -5.306  1.00 2.00  ? 344 LEU B CD2 1 
ATOM   5453 N N   . LYS B 1 345 ? 35.110  36.948  -7.689  1.00 8.24  ? 345 LYS B N   1 
ATOM   5454 C CA  . LYS B 1 345 ? 36.485  37.346  -7.415  1.00 15.00 ? 345 LYS B CA  1 
ATOM   5455 C C   . LYS B 1 345 ? 36.504  38.708  -6.755  1.00 19.59 ? 345 LYS B C   1 
ATOM   5456 O O   . LYS B 1 345 ? 36.254  39.848  -7.185  1.00 18.12 ? 345 LYS B O   1 
ATOM   5457 C CB  . LYS B 1 345 ? 37.494  37.288  -8.583  1.00 14.46 ? 345 LYS B CB  1 
ATOM   5458 C CG  . LYS B 1 345 ? 38.884  36.560  -8.513  1.00 17.95 ? 345 LYS B CG  1 
ATOM   5459 C CD  . LYS B 1 345 ? 40.021  37.299  -7.830  1.00 18.60 ? 345 LYS B CD  1 
ATOM   5460 C CE  . LYS B 1 345 ? 40.489  38.582  -8.561  1.00 24.26 ? 345 LYS B CE  1 
ATOM   5461 N NZ  . LYS B 1 345 ? 39.484  39.621  -8.950  1.00 25.24 ? 345 LYS B NZ  1 
ATOM   5462 N N   . PHE B 1 346 ? 36.822  38.328  -5.502  1.00 22.38 ? 346 PHE B N   1 
ATOM   5463 C CA  . PHE B 1 346 ? 37.181  39.460  -4.600  1.00 25.32 ? 346 PHE B CA  1 
ATOM   5464 C C   . PHE B 1 346 ? 38.606  40.015  -5.015  1.00 28.48 ? 346 PHE B C   1 
ATOM   5465 O O   . PHE B 1 346 ? 39.679  39.433  -5.043  1.00 31.18 ? 346 PHE B O   1 
ATOM   5466 C CB  . PHE B 1 346 ? 37.290  38.954  -3.097  1.00 25.18 ? 346 PHE B CB  1 
ATOM   5467 C CG  . PHE B 1 346 ? 35.907  38.735  -2.933  1.00 21.27 ? 346 PHE B CG  1 
ATOM   5468 C CD1 . PHE B 1 346 ? 35.504  37.432  -3.290  1.00 18.70 ? 346 PHE B CD1 1 
ATOM   5469 C CD2 . PHE B 1 346 ? 35.179  39.838  -2.486  1.00 16.02 ? 346 PHE B CD2 1 
ATOM   5470 C CE1 . PHE B 1 346 ? 34.172  37.194  -3.205  1.00 18.59 ? 346 PHE B CE1 1 
ATOM   5471 C CE2 . PHE B 1 346 ? 33.829  39.544  -2.318  1.00 19.87 ? 346 PHE B CE2 1 
ATOM   5472 C CZ  . PHE B 1 346 ? 33.338  38.285  -2.828  1.00 20.90 ? 346 PHE B CZ  1 
ATOM   5473 N N   . ASN B 1 347 ? 38.515  41.391  -5.085  1.00 28.66 ? 347 ASN B N   1 
ATOM   5474 C CA  . ASN B 1 347 ? 39.767  41.899  -5.485  1.00 26.17 ? 347 ASN B CA  1 
ATOM   5475 C C   . ASN B 1 347 ? 40.176  43.183  -4.725  1.00 22.59 ? 347 ASN B C   1 
ATOM   5476 O O   . ASN B 1 347 ? 39.492  44.197  -4.726  1.00 20.20 ? 347 ASN B O   1 
ATOM   5477 C CB  . ASN B 1 347 ? 39.318  41.973  -6.884  1.00 29.29 ? 347 ASN B CB  1 
ATOM   5478 C CG  . ASN B 1 347 ? 40.426  42.023  -7.853  1.00 28.85 ? 347 ASN B CG  1 
ATOM   5479 O OD1 . ASN B 1 347 ? 41.442  41.388  -7.799  1.00 25.85 ? 347 ASN B OD1 1 
ATOM   5480 N ND2 . ASN B 1 347 ? 40.151  42.732  -8.891  1.00 32.21 ? 347 ASN B ND2 1 
ATOM   5481 N N   . PHE B 1 348 ? 41.239  43.089  -3.963  1.00 19.38 ? 348 PHE B N   1 
ATOM   5482 C CA  . PHE B 1 348 ? 41.032  44.032  -2.849  1.00 18.37 ? 348 PHE B CA  1 
ATOM   5483 C C   . PHE B 1 348 ? 41.692  45.398  -2.981  1.00 21.54 ? 348 PHE B C   1 
ATOM   5484 O O   . PHE B 1 348 ? 42.931  45.489  -2.944  1.00 25.68 ? 348 PHE B O   1 
ATOM   5485 C CB  . PHE B 1 348 ? 41.204  43.498  -1.437  1.00 12.23 ? 348 PHE B CB  1 
ATOM   5486 C CG  . PHE B 1 348 ? 40.521  42.187  -1.086  1.00 5.88  ? 348 PHE B CG  1 
ATOM   5487 C CD1 . PHE B 1 348 ? 41.178  40.929  -1.325  1.00 10.45 ? 348 PHE B CD1 1 
ATOM   5488 C CD2 . PHE B 1 348 ? 39.220  42.153  -0.534  1.00 2.00  ? 348 PHE B CD2 1 
ATOM   5489 C CE1 . PHE B 1 348 ? 40.574  39.651  -1.094  1.00 5.29  ? 348 PHE B CE1 1 
ATOM   5490 C CE2 . PHE B 1 348 ? 38.594  40.875  -0.361  1.00 2.00  ? 348 PHE B CE2 1 
ATOM   5491 C CZ  . PHE B 1 348 ? 39.253  39.652  -0.626  1.00 2.00  ? 348 PHE B CZ  1 
ATOM   5492 N N   . LYS B 1 349 ? 40.800  46.425  -3.098  1.00 24.20 ? 349 LYS B N   1 
ATOM   5493 C CA  . LYS B 1 349 ? 41.160  47.877  -3.350  1.00 20.74 ? 349 LYS B CA  1 
ATOM   5494 C C   . LYS B 1 349 ? 41.957  48.369  -2.201  1.00 20.67 ? 349 LYS B C   1 
ATOM   5495 O O   . LYS B 1 349 ? 42.542  47.607  -1.448  1.00 16.19 ? 349 LYS B O   1 
ATOM   5496 C CB  . LYS B 1 349 ? 39.815  48.677  -3.636  1.00 19.36 ? 349 LYS B CB  1 
ATOM   5497 C CG  . LYS B 1 349 ? 39.584  50.117  -4.135  1.00 13.59 ? 349 LYS B CG  1 
ATOM   5498 C CD  . LYS B 1 349 ? 39.286  50.908  -2.854  1.00 10.24 ? 349 LYS B CD  1 
ATOM   5499 C CE  . LYS B 1 349 ? 38.455  52.197  -2.777  1.00 4.68  ? 349 LYS B CE  1 
ATOM   5500 N NZ  . LYS B 1 349 ? 38.973  52.669  -1.453  1.00 18.56 ? 349 LYS B NZ  1 
ATOM   5501 N N   . THR B 1 350 ? 41.850  49.701  -2.029  1.00 24.54 ? 350 THR B N   1 
ATOM   5502 C CA  . THR B 1 350 ? 42.896  50.738  -2.187  1.00 26.21 ? 350 THR B CA  1 
ATOM   5503 C C   . THR B 1 350 ? 42.738  51.695  -0.973  1.00 27.35 ? 350 THR B C   1 
ATOM   5504 O O   . THR B 1 350 ? 43.254  52.839  -0.949  1.00 32.68 ? 350 THR B O   1 
ATOM   5505 C CB  . THR B 1 350 ? 42.950  51.554  -3.599  1.00 23.80 ? 350 THR B CB  1 
ATOM   5506 O OG1 . THR B 1 350 ? 42.050  52.693  -3.687  1.00 24.59 ? 350 THR B OG1 1 
ATOM   5507 C CG2 . THR B 1 350 ? 43.069  50.750  -4.920  1.00 19.24 ? 350 THR B CG2 1 
ATOM   5508 O OXT . THR B 1 350 ? 42.056  51.294  -0.031  1.00 24.44 ? 350 THR B OXT 1 
HETATM 5509 C C1  . FRM C 2 .   ? 7.037   -7.574  32.427  1.00 2.36  ? 501 FRM A C1  1 
HETATM 5510 C C2  . FRM C 2 .   ? 7.643   -6.362  32.552  1.00 2.00  ? 501 FRM A C2  1 
HETATM 5511 C C3  . FRM C 2 .   ? 7.128   -5.514  33.493  1.00 2.00  ? 501 FRM A C3  1 
HETATM 5512 C C4  . FRM C 2 .   ? 6.083   -5.863  34.305  1.00 2.00  ? 501 FRM A C4  1 
HETATM 5513 C C5  . FRM C 2 .   ? 5.448   -7.071  34.231  1.00 2.00  ? 501 FRM A C5  1 
HETATM 5514 C C6  . FRM C 2 .   ? 5.945   -7.907  33.254  1.00 3.34  ? 501 FRM A C6  1 
HETATM 5515 N N10 . FRM C 2 .   ? 7.627   -4.277  33.569  1.00 2.00  ? 501 FRM A N10 1 
HETATM 5516 C C11 . FRM C 2 .   ? 7.072   -3.303  34.244  1.00 2.00  ? 501 FRM A C11 1 
HETATM 5517 N N12 . FRM C 2 .   ? 6.008   -3.586  34.952  1.00 2.00  ? 501 FRM A N12 1 
HETATM 5518 C C13 . FRM C 2 .   ? 5.618   -4.825  35.148  1.00 2.00  ? 501 FRM A C13 1 
HETATM 5519 O O14 . FRM C 2 .   ? 4.825   -5.065  36.013  1.00 11.59 ? 501 FRM A O14 1 
HETATM 5520 C C17 . FRM C 2 .   ? 7.829   -2.023  34.414  1.00 2.00  ? 501 FRM A C17 1 
HETATM 5521 C C20 . FRM C 2 .   ? 6.942   -0.786  34.515  1.00 6.21  ? 501 FRM A C20 1 
HETATM 5522 C C23 . FRM C 2 .   ? 7.010   0.111   33.323  1.00 7.15  ? 501 FRM A C23 1 
HETATM 5523 N N26 . FRM C 2 .   ? 8.328   0.727   33.388  1.00 9.43  ? 501 FRM A N26 1 
HETATM 5524 C C29 . FRM C 2 .   ? 9.101   0.719   32.153  1.00 11.82 ? 501 FRM A C29 1 
HETATM 5525 C C30 . FRM C 2 .   ? 8.458   1.653   31.191  1.00 17.33 ? 501 FRM A C30 1 
HETATM 5526 C C31 . FRM C 2 .   ? 7.733   2.691   31.538  1.00 16.57 ? 501 FRM A C31 1 
HETATM 5527 C C32 . FRM C 2 .   ? 7.474   2.915   33.009  1.00 12.42 ? 501 FRM A C32 1 
HETATM 5528 C C33 . FRM C 2 .   ? 8.331   2.040   33.909  1.00 13.92 ? 501 FRM A C33 1 
HETATM 5529 C C40 . FRM C 2 .   ? 7.385   3.769   30.604  1.00 15.29 ? 501 FRM A C40 1 
HETATM 5530 C C42 . FRM C 2 .   ? 8.018   4.008   29.398  1.00 8.15  ? 501 FRM A C42 1 
HETATM 5531 C C43 . FRM C 2 .   ? 7.799   5.239   28.833  1.00 7.01  ? 501 FRM A C43 1 
HETATM 5532 C C44 . FRM C 2 .   ? 7.012   6.178   29.463  1.00 9.50  ? 501 FRM A C44 1 
HETATM 5533 C C45 . FRM C 2 .   ? 6.366   5.971   30.627  1.00 13.40 ? 501 FRM A C45 1 
HETATM 5534 C C46 . FRM C 2 .   ? 6.526   4.731   31.136  1.00 16.39 ? 501 FRM A C46 1 
HETATM 5535 C C7  . FRM C 2 .   ? 8.828   -6.010  31.705  1.00 2.16  ? 501 FRM A C7  1 
HETATM 5536 F F1  . FRM C 2 .   ? 6.717   7.318   28.871  1.00 17.56 ? 501 FRM A F1  1 
HETATM 5537 C C1  . FRM D 2 .   ? 21.744  39.508  6.293   1.00 2.00  ? 502 FRM B C1  1 
HETATM 5538 C C2  . FRM D 2 .   ? 22.492  38.405  6.775   1.00 2.00  ? 502 FRM B C2  1 
HETATM 5539 C C3  . FRM D 2 .   ? 23.176  37.597  5.934   1.00 2.00  ? 502 FRM B C3  1 
HETATM 5540 C C4  . FRM D 2 .   ? 23.016  37.791  4.550   1.00 2.00  ? 502 FRM B C4  1 
HETATM 5541 C C5  . FRM D 2 .   ? 22.283  38.900  4.056   1.00 2.82  ? 502 FRM B C5  1 
HETATM 5542 C C6  . FRM D 2 .   ? 21.649  39.780  4.951   1.00 2.00  ? 502 FRM B C6  1 
HETATM 5543 N N10 . FRM D 2 .   ? 24.016  36.638  6.411   1.00 6.18  ? 502 FRM B N10 1 
HETATM 5544 C C11 . FRM D 2 .   ? 24.234  35.545  5.668   1.00 2.00  ? 502 FRM B C11 1 
HETATM 5545 N N12 . FRM D 2 .   ? 23.955  35.608  4.351   1.00 4.43  ? 502 FRM B N12 1 
HETATM 5546 C C13 . FRM D 2 .   ? 23.604  36.730  3.705   1.00 2.00  ? 502 FRM B C13 1 
HETATM 5547 O O14 . FRM D 2 .   ? 23.788  36.787  2.512   1.00 2.00  ? 502 FRM B O14 1 
HETATM 5548 C C17 . FRM D 2 .   ? 24.408  34.144  6.211   1.00 2.00  ? 502 FRM B C17 1 
HETATM 5549 C C20 . FRM D 2 .   ? 25.759  33.731  6.666   1.00 2.00  ? 502 FRM B C20 1 
HETATM 5550 C C23 . FRM D 2 .   ? 25.749  32.656  7.725   1.00 4.79  ? 502 FRM B C23 1 
HETATM 5551 N N26 . FRM D 2 .   ? 25.130  31.365  7.528   1.00 2.00  ? 502 FRM B N26 1 
HETATM 5552 C C29 . FRM D 2 .   ? 25.889  30.261  8.008   1.00 3.84  ? 502 FRM B C29 1 
HETATM 5553 C C30 . FRM D 2 .   ? 25.200  28.938  7.923   1.00 2.43  ? 502 FRM B C30 1 
HETATM 5554 C C31 . FRM D 2 .   ? 23.948  28.819  8.330   1.00 2.42  ? 502 FRM B C31 1 
HETATM 5555 C C32 . FRM D 2 .   ? 23.154  30.078  8.447   1.00 4.19  ? 502 FRM B C32 1 
HETATM 5556 C C33 . FRM D 2 .   ? 23.735  31.228  7.670   1.00 7.26  ? 502 FRM B C33 1 
HETATM 5557 C C40 . FRM D 2 .   ? 23.357  27.564  8.679   1.00 2.81  ? 502 FRM B C40 1 
HETATM 5558 C C42 . FRM D 2 .   ? 22.231  27.511  9.469   1.00 5.84  ? 502 FRM B C42 1 
HETATM 5559 C C43 . FRM D 2 .   ? 21.616  26.312  9.785   1.00 4.00  ? 502 FRM B C43 1 
HETATM 5560 C C44 . FRM D 2 .   ? 22.145  25.153  9.258   1.00 4.59  ? 502 FRM B C44 1 
HETATM 5561 C C45 . FRM D 2 .   ? 23.339  25.179  8.560   1.00 6.62  ? 502 FRM B C45 1 
HETATM 5562 C C46 . FRM D 2 .   ? 23.923  26.401  8.291   1.00 5.64  ? 502 FRM B C46 1 
HETATM 5563 C C7  . FRM D 2 .   ? 22.555  38.154  8.204   1.00 2.00  ? 502 FRM B C7  1 
HETATM 5564 F F1  . FRM D 2 .   ? 21.480  24.008  9.281   1.00 9.57  ? 502 FRM B F1  1 
HETATM 5565 O O   . HOH E 3 .   ? -3.815  -18.338 33.075  1.00 7.97  ? 502 HOH A O   1 
HETATM 5566 O O   . HOH E 3 .   ? -5.691  -6.738  12.706  1.00 2.00  ? 503 HOH A O   1 
HETATM 5567 O O   . HOH E 3 .   ? 10.901  22.039  37.058  1.00 7.42  ? 504 HOH A O   1 
HETATM 5568 O O   . HOH E 3 .   ? -6.977  9.797   27.880  1.00 13.12 ? 505 HOH A O   1 
HETATM 5569 O O   . HOH E 3 .   ? -1.548  19.232  34.543  1.00 13.95 ? 506 HOH A O   1 
HETATM 5570 O O   . HOH E 3 .   ? 8.040   0.580   25.819  1.00 11.15 ? 507 HOH A O   1 
HETATM 5571 O O   . HOH E 3 .   ? 37.949  0.896   15.489  1.00 7.16  ? 508 HOH A O   1 
HETATM 5572 O O   . HOH E 3 .   ? 10.553  -6.902  28.762  1.00 11.29 ? 509 HOH A O   1 
HETATM 5573 O O   . HOH E 3 .   ? 8.805   20.054  32.062  1.00 12.07 ? 510 HOH A O   1 
HETATM 5574 O O   . HOH E 3 .   ? 12.147  -22.515 56.313  1.00 16.22 ? 511 HOH A O   1 
HETATM 5575 O O   . HOH E 3 .   ? 3.547   -20.938 28.299  1.00 30.66 ? 512 HOH A O   1 
HETATM 5576 O O   . HOH E 3 .   ? 19.735  10.591  48.160  1.00 9.23  ? 513 HOH A O   1 
HETATM 5577 O O   . HOH E 3 .   ? -3.899  -8.193  54.504  1.00 17.89 ? 514 HOH A O   1 
HETATM 5578 O O   . HOH E 3 .   ? 11.751  -6.655  45.266  1.00 10.35 ? 515 HOH A O   1 
HETATM 5579 O O   . HOH E 3 .   ? 33.330  -0.889  21.415  1.00 16.37 ? 516 HOH A O   1 
HETATM 5580 O O   . HOH E 3 .   ? 11.054  -21.231 38.282  1.00 27.91 ? 517 HOH A O   1 
HETATM 5581 O O   . HOH E 3 .   ? 10.755  -2.055  37.341  1.00 16.09 ? 518 HOH A O   1 
HETATM 5582 O O   . HOH E 3 .   ? 11.327  -10.552 30.844  1.00 23.66 ? 519 HOH A O   1 
HETATM 5583 O O   . HOH E 3 .   ? -19.639 -7.101  25.199  1.00 17.98 ? 520 HOH A O   1 
HETATM 5584 O O   . HOH E 3 .   ? 23.761  -9.505  22.660  1.00 8.68  ? 521 HOH A O   1 
HETATM 5585 O O   . HOH E 3 .   ? 25.510  15.116  23.369  1.00 14.08 ? 522 HOH A O   1 
HETATM 5586 O O   . HOH E 3 .   ? 5.411   -27.701 34.044  1.00 6.09  ? 523 HOH A O   1 
HETATM 5587 O O   . HOH E 3 .   ? 30.968  12.262  39.298  1.00 28.23 ? 524 HOH A O   1 
HETATM 5588 O O   . HOH E 3 .   ? -16.458 -4.008  52.669  1.00 19.69 ? 525 HOH A O   1 
HETATM 5589 O O   . HOH E 3 .   ? 7.857   -13.031 54.414  1.00 25.68 ? 526 HOH A O   1 
HETATM 5590 O O   . HOH E 3 .   ? 7.884   -24.624 40.057  1.00 41.38 ? 527 HOH A O   1 
HETATM 5591 O O   . HOH E 3 .   ? 1.720   -12.539 50.485  1.00 10.81 ? 528 HOH A O   1 
HETATM 5592 O O   . HOH E 3 .   ? 3.217   -13.452 27.735  1.00 11.17 ? 529 HOH A O   1 
HETATM 5593 O O   . HOH E 3 .   ? 15.440  14.945  50.435  1.00 25.92 ? 530 HOH A O   1 
HETATM 5594 O O   . HOH E 3 .   ? -5.303  20.998  40.278  1.00 29.10 ? 531 HOH A O   1 
HETATM 5595 O O   . HOH E 3 .   ? 14.505  8.507   52.492  1.00 20.47 ? 532 HOH A O   1 
HETATM 5596 O O   . HOH E 3 .   ? -13.281 -23.147 34.248  1.00 34.79 ? 533 HOH A O   1 
HETATM 5597 O O   . HOH E 3 .   ? -17.313 -3.922  39.821  1.00 27.86 ? 534 HOH A O   1 
HETATM 5598 O O   . HOH E 3 .   ? -4.284  31.984  46.536  1.00 26.10 ? 535 HOH A O   1 
HETATM 5599 O O   . HOH E 3 .   ? -2.593  5.745   50.883  1.00 7.03  ? 536 HOH A O   1 
HETATM 5600 O O   . HOH E 3 .   ? -1.574  6.602   28.054  1.00 16.97 ? 537 HOH A O   1 
HETATM 5601 O O   . HOH E 3 .   ? 33.096  -4.341  14.694  1.00 24.42 ? 538 HOH A O   1 
HETATM 5602 O O   . HOH E 3 .   ? 4.419   16.549  30.409  1.00 15.78 ? 539 HOH A O   1 
HETATM 5603 O O   . HOH E 3 .   ? 5.814   8.078   24.676  1.00 18.24 ? 540 HOH A O   1 
HETATM 5604 O O   . HOH E 3 .   ? 12.552  -27.029 34.184  1.00 9.88  ? 541 HOH A O   1 
HETATM 5605 O O   . HOH E 3 .   ? 16.349  20.819  42.554  1.00 17.42 ? 542 HOH A O   1 
HETATM 5606 O O   . HOH E 3 .   ? -2.906  -9.813  51.324  1.00 20.10 ? 543 HOH A O   1 
HETATM 5607 O O   . HOH E 3 .   ? 32.607  -1.253  29.576  1.00 11.62 ? 544 HOH A O   1 
HETATM 5608 O O   . HOH E 3 .   ? 22.713  14.038  46.248  1.00 23.32 ? 545 HOH A O   1 
HETATM 5609 O O   . HOH E 3 .   ? 34.232  7.031   29.770  1.00 23.23 ? 546 HOH A O   1 
HETATM 5610 O O   . HOH E 3 .   ? -15.030 3.377   52.677  1.00 22.18 ? 547 HOH A O   1 
HETATM 5611 O O   . HOH E 3 .   ? 6.543   22.875  32.024  1.00 23.67 ? 548 HOH A O   1 
HETATM 5612 O O   . HOH E 3 .   ? 9.640   0.906   15.101  1.00 15.78 ? 549 HOH A O   1 
HETATM 5613 O O   . HOH E 3 .   ? 26.860  -6.558  20.686  1.00 25.10 ? 550 HOH A O   1 
HETATM 5614 O O   . HOH E 3 .   ? -8.493  -0.163  51.576  1.00 24.59 ? 551 HOH A O   1 
HETATM 5615 O O   . HOH E 3 .   ? 17.598  19.887  26.875  1.00 12.65 ? 552 HOH A O   1 
HETATM 5616 O O   . HOH E 3 .   ? -9.028  4.218   34.300  1.00 3.49  ? 553 HOH A O   1 
HETATM 5617 O O   . HOH E 3 .   ? -15.212 3.355   47.979  1.00 27.15 ? 554 HOH A O   1 
HETATM 5618 O O   . HOH E 3 .   ? -12.674 -7.788  41.910  1.00 15.53 ? 555 HOH A O   1 
HETATM 5619 O O   . HOH E 3 .   ? 24.098  -1.426  35.819  1.00 28.92 ? 556 HOH A O   1 
HETATM 5620 O O   . HOH E 3 .   ? 9.955   -15.587 59.858  1.00 33.73 ? 557 HOH A O   1 
HETATM 5621 O O   . HOH E 3 .   ? -4.465  -18.410 27.163  1.00 15.54 ? 558 HOH A O   1 
HETATM 5622 O O   . HOH E 3 .   ? 5.834   -2.104  9.248   1.00 20.34 ? 559 HOH A O   1 
HETATM 5623 O O   . HOH E 3 .   ? 17.698  17.661  48.783  1.00 24.42 ? 560 HOH A O   1 
HETATM 5624 O O   . HOH E 3 .   ? -2.397  24.554  37.144  1.00 24.63 ? 561 HOH A O   1 
HETATM 5625 O O   . HOH E 3 .   ? 0.764   29.702  49.647  1.00 22.91 ? 562 HOH A O   1 
HETATM 5626 O O   . HOH E 3 .   ? -15.437 8.108   33.660  1.00 23.10 ? 563 HOH A O   1 
HETATM 5627 O O   . HOH E 3 .   ? -8.697  22.477  50.440  1.00 9.03  ? 564 HOH A O   1 
HETATM 5628 O O   . HOH E 3 .   ? 10.919  -5.674  54.604  1.00 17.72 ? 565 HOH A O   1 
HETATM 5629 O O   . HOH E 3 .   ? 1.011   23.985  47.380  1.00 24.95 ? 566 HOH A O   1 
HETATM 5630 O O   . HOH E 3 .   ? 16.819  13.688  18.845  1.00 30.00 ? 567 HOH A O   1 
HETATM 5631 O O   . HOH E 3 .   ? 34.014  13.299  22.378  1.00 27.66 ? 568 HOH A O   1 
HETATM 5632 O O   . HOH E 3 .   ? 39.492  11.736  45.911  1.00 22.29 ? 569 HOH A O   1 
HETATM 5633 O O   . HOH E 3 .   ? 22.524  0.866   40.895  1.00 21.75 ? 570 HOH A O   1 
HETATM 5634 O O   . HOH E 3 .   ? 14.952  -25.891 27.186  1.00 25.92 ? 571 HOH A O   1 
HETATM 5635 O O   . HOH E 3 .   ? -7.572  27.468  44.097  1.00 18.46 ? 572 HOH A O   1 
HETATM 5636 O O   . HOH E 3 .   ? -13.971 1.407   31.442  1.00 24.67 ? 573 HOH A O   1 
HETATM 5637 O O   . HOH E 3 .   ? 12.228  -2.185  30.310  1.00 23.44 ? 574 HOH A O   1 
HETATM 5638 O O   . HOH E 3 .   ? -10.692 -27.087 35.488  1.00 32.37 ? 575 HOH A O   1 
HETATM 5639 O O   . HOH E 3 .   ? -11.068 9.322   56.784  1.00 10.14 ? 576 HOH A O   1 
HETATM 5640 O O   . HOH E 3 .   ? -17.821 -6.934  46.922  1.00 19.86 ? 577 HOH A O   1 
HETATM 5641 O O   . HOH E 3 .   ? -12.357 13.150  41.662  1.00 28.90 ? 578 HOH A O   1 
HETATM 5642 O O   . HOH E 3 .   ? -8.623  32.912  48.843  1.00 33.73 ? 579 HOH A O   1 
HETATM 5643 O O   . HOH E 3 .   ? -3.693  -13.041 13.769  1.00 16.02 ? 580 HOH A O   1 
HETATM 5644 O O   . HOH E 3 .   ? 9.172   13.323  25.299  1.00 9.85  ? 581 HOH A O   1 
HETATM 5645 O O   . HOH E 3 .   ? 5.840   11.113  29.586  1.00 20.19 ? 582 HOH A O   1 
HETATM 5646 O O   . HOH E 3 .   ? 15.730  -1.997  44.842  1.00 20.88 ? 583 HOH A O   1 
HETATM 5647 O O   . HOH E 3 .   ? -7.291  22.315  43.382  1.00 21.18 ? 584 HOH A O   1 
HETATM 5648 O O   . HOH E 3 .   ? -9.081  27.587  52.471  1.00 23.29 ? 585 HOH A O   1 
HETATM 5649 O O   . HOH E 3 .   ? 35.766  7.088   21.487  1.00 24.09 ? 586 HOH A O   1 
HETATM 5650 O O   . HOH E 3 .   ? 30.156  8.812   41.524  1.00 13.60 ? 587 HOH A O   1 
HETATM 5651 O O   . HOH E 3 .   ? -18.532 -7.270  30.043  1.00 25.41 ? 588 HOH A O   1 
HETATM 5652 O O   . HOH E 3 .   ? -14.959 -4.305  29.722  1.00 26.69 ? 589 HOH A O   1 
HETATM 5653 O O   . HOH E 3 .   ? 0.809   20.652  46.375  1.00 30.31 ? 590 HOH A O   1 
HETATM 5654 O O   . HOH E 3 .   ? -23.518 -2.494  19.586  1.00 28.31 ? 591 HOH A O   1 
HETATM 5655 O O   . HOH E 3 .   ? 0.034   3.792   21.338  1.00 23.20 ? 592 HOH A O   1 
HETATM 5656 O O   . HOH E 3 .   ? 35.688  2.915   43.216  1.00 26.27 ? 593 HOH A O   1 
HETATM 5657 O O   . HOH E 3 .   ? -12.156 -2.466  19.068  1.00 10.05 ? 594 HOH A O   1 
HETATM 5658 O O   . HOH E 3 .   ? -3.195  -3.825  57.804  1.00 24.09 ? 595 HOH A O   1 
HETATM 5659 O O   . HOH E 3 .   ? -14.099 -3.785  33.650  1.00 22.26 ? 596 HOH A O   1 
HETATM 5660 O O   . HOH E 3 .   ? 12.479  21.879  30.657  1.00 31.29 ? 597 HOH A O   1 
HETATM 5661 O O   . HOH E 3 .   ? 5.656   28.945  37.827  1.00 21.85 ? 598 HOH A O   1 
HETATM 5662 O O   . HOH E 3 .   ? 27.965  1.243   35.630  1.00 16.99 ? 599 HOH A O   1 
HETATM 5663 O O   . HOH E 3 .   ? 11.208  4.285   44.270  1.00 19.25 ? 600 HOH A O   1 
HETATM 5664 O O   . HOH E 3 .   ? 37.220  13.897  42.578  1.00 34.12 ? 601 HOH A O   1 
HETATM 5665 O O   . HOH E 3 .   ? -16.990 -11.414 53.166  1.00 21.56 ? 602 HOH A O   1 
HETATM 5666 O O   . HOH E 3 .   ? 6.947   4.453   19.574  1.00 15.14 ? 603 HOH A O   1 
HETATM 5667 O O   . HOH E 3 .   ? 8.805   12.273  19.445  1.00 26.68 ? 604 HOH A O   1 
HETATM 5668 O O   . HOH E 3 .   ? 22.300  23.121  41.590  1.00 25.29 ? 605 HOH A O   1 
HETATM 5669 O O   . HOH E 3 .   ? -12.779 10.798  47.377  1.00 25.80 ? 606 HOH A O   1 
HETATM 5670 O O   . HOH E 3 .   ? -17.312 11.370  44.234  1.00 15.07 ? 607 HOH A O   1 
HETATM 5671 O O   . HOH E 3 .   ? 15.847  -8.782  29.898  1.00 25.80 ? 608 HOH A O   1 
HETATM 5672 O O   . HOH E 3 .   ? 26.467  19.240  28.172  1.00 26.93 ? 609 HOH A O   1 
HETATM 5673 O O   . HOH E 3 .   ? -9.273  -0.565  17.011  1.00 21.95 ? 610 HOH A O   1 
HETATM 5674 O O   . HOH E 3 .   ? -7.685  21.430  35.369  1.00 20.24 ? 611 HOH A O   1 
HETATM 5675 O O   . HOH E 3 .   ? -19.147 -0.884  25.960  1.00 31.44 ? 612 HOH A O   1 
HETATM 5676 O O   . HOH E 3 .   ? -0.500  -15.093 12.736  1.00 36.87 ? 613 HOH A O   1 
HETATM 5677 O O   . HOH E 3 .   ? 8.682   22.240  43.888  1.00 23.68 ? 614 HOH A O   1 
HETATM 5678 O O   . HOH E 3 .   ? 9.589   9.614   43.650  1.00 24.95 ? 615 HOH A O   1 
HETATM 5679 O O   . HOH E 3 .   ? -14.764 7.676   48.301  1.00 15.36 ? 616 HOH A O   1 
HETATM 5680 O O   . HOH E 3 .   ? 4.382   -1.182  30.285  1.00 26.53 ? 617 HOH A O   1 
HETATM 5681 O O   . HOH E 3 .   ? -1.747  -5.243  13.110  1.00 27.13 ? 618 HOH A O   1 
HETATM 5682 O O   . HOH E 3 .   ? 16.944  22.035  32.106  1.00 28.90 ? 619 HOH A O   1 
HETATM 5683 O O   . HOH E 3 .   ? 19.114  -8.417  21.639  1.00 28.15 ? 620 HOH A O   1 
HETATM 5684 O O   . HOH E 3 .   ? 16.891  -8.656  25.965  1.00 13.34 ? 621 HOH A O   1 
HETATM 5685 O O   . HOH E 3 .   ? 8.108   -18.782 54.632  1.00 32.64 ? 622 HOH A O   1 
HETATM 5686 O O   . HOH E 3 .   ? -20.899 -6.320  21.332  1.00 34.63 ? 623 HOH A O   1 
HETATM 5687 O O   . HOH E 3 .   ? -11.113 -9.993  17.080  1.00 22.58 ? 624 HOH A O   1 
HETATM 5688 O O   . HOH E 3 .   ? -2.160  13.784  57.431  1.00 34.19 ? 625 HOH A O   1 
HETATM 5689 O O   . HOH F 3 .   ? 16.833  46.921  -16.395 1.00 19.26 ? 503 HOH B O   1 
HETATM 5690 O O   . HOH F 3 .   ? 39.338  20.807  16.217  1.00 15.17 ? 504 HOH B O   1 
HETATM 5691 O O   . HOH F 3 .   ? 19.609  22.227  10.804  1.00 4.82  ? 505 HOH B O   1 
HETATM 5692 O O   . HOH F 3 .   ? 17.688  53.100  17.969  1.00 14.56 ? 506 HOH B O   1 
HETATM 5693 O O   . HOH F 3 .   ? 9.809   35.709  20.035  1.00 2.00  ? 507 HOH B O   1 
HETATM 5694 O O   . HOH F 3 .   ? 3.304   34.242  7.963   1.00 2.00  ? 508 HOH B O   1 
HETATM 5695 O O   . HOH F 3 .   ? 0.037   42.014  9.312   1.00 36.41 ? 509 HOH B O   1 
HETATM 5696 O O   . HOH F 3 .   ? 34.534  27.202  -11.057 1.00 17.84 ? 510 HOH B O   1 
HETATM 5697 O O   . HOH F 3 .   ? 9.741   46.978  -1.742  1.00 6.25  ? 511 HOH B O   1 
HETATM 5698 O O   . HOH F 3 .   ? 35.524  31.115  1.888   1.00 2.00  ? 512 HOH B O   1 
HETATM 5699 O O   . HOH F 3 .   ? 11.713  31.259  -13.541 1.00 8.48  ? 513 HOH B O   1 
HETATM 5700 O O   . HOH F 3 .   ? 14.350  47.940  -3.921  1.00 7.89  ? 514 HOH B O   1 
HETATM 5701 O O   . HOH F 3 .   ? 18.054  36.694  -15.730 1.00 15.63 ? 515 HOH B O   1 
HETATM 5702 O O   . HOH F 3 .   ? 25.254  20.230  -20.720 1.00 22.99 ? 516 HOH B O   1 
HETATM 5703 O O   . HOH F 3 .   ? 12.446  28.394  18.645  1.00 7.93  ? 517 HOH B O   1 
HETATM 5704 O O   . HOH F 3 .   ? 30.859  42.257  -12.824 1.00 14.03 ? 518 HOH B O   1 
HETATM 5705 O O   . HOH F 3 .   ? 28.991  32.764  5.416   1.00 17.37 ? 519 HOH B O   1 
HETATM 5706 O O   . HOH F 3 .   ? 32.050  33.080  32.559  1.00 20.47 ? 520 HOH B O   1 
HETATM 5707 O O   . HOH F 3 .   ? 17.203  19.911  15.960  1.00 20.03 ? 521 HOH B O   1 
HETATM 5708 O O   . HOH F 3 .   ? 15.724  51.194  3.013   1.00 6.62  ? 522 HOH B O   1 
HETATM 5709 O O   . HOH F 3 .   ? 35.644  51.161  1.083   1.00 15.71 ? 523 HOH B O   1 
HETATM 5710 O O   . HOH F 3 .   ? 35.808  19.585  12.042  1.00 2.00  ? 524 HOH B O   1 
HETATM 5711 O O   . HOH F 3 .   ? 31.053  50.463  -6.795  1.00 21.87 ? 525 HOH B O   1 
HETATM 5712 O O   . HOH F 3 .   ? 12.584  19.081  -8.289  1.00 20.15 ? 526 HOH B O   1 
HETATM 5713 O O   . HOH F 3 .   ? 25.929  53.371  2.004   1.00 21.15 ? 527 HOH B O   1 
HETATM 5714 O O   . HOH F 3 .   ? 13.915  56.731  -8.677  1.00 16.43 ? 528 HOH B O   1 
HETATM 5715 O O   . HOH F 3 .   ? 1.980   30.335  -11.508 1.00 21.81 ? 529 HOH B O   1 
HETATM 5716 O O   . HOH F 3 .   ? 39.842  13.902  -10.342 1.00 20.82 ? 530 HOH B O   1 
HETATM 5717 O O   . HOH F 3 .   ? 13.181  29.431  12.133  1.00 2.00  ? 531 HOH B O   1 
HETATM 5718 O O   . HOH F 3 .   ? 22.223  40.173  26.829  1.00 23.38 ? 532 HOH B O   1 
HETATM 5719 O O   . HOH F 3 .   ? 40.597  23.691  -3.013  1.00 22.60 ? 533 HOH B O   1 
HETATM 5720 O O   . HOH F 3 .   ? 8.931   53.985  5.401   1.00 30.46 ? 534 HOH B O   1 
HETATM 5721 O O   . HOH F 3 .   ? 18.355  26.690  -1.078  1.00 19.58 ? 535 HOH B O   1 
HETATM 5722 O O   . HOH F 3 .   ? 7.794   30.931  12.373  1.00 5.71  ? 536 HOH B O   1 
HETATM 5723 O O   . HOH F 3 .   ? 6.108   43.460  0.326   1.00 18.84 ? 537 HOH B O   1 
HETATM 5724 O O   . HOH F 3 .   ? 6.346   38.196  -7.637  1.00 27.81 ? 538 HOH B O   1 
HETATM 5725 O O   . HOH F 3 .   ? 18.379  16.219  -3.563  1.00 14.25 ? 539 HOH B O   1 
HETATM 5726 O O   . HOH F 3 .   ? 34.338  18.126  -20.556 1.00 24.30 ? 540 HOH B O   1 
HETATM 5727 O O   . HOH F 3 .   ? 31.892  56.983  -0.709  1.00 25.44 ? 541 HOH B O   1 
HETATM 5728 O O   . HOH F 3 .   ? -3.362  34.013  18.340  1.00 19.67 ? 542 HOH B O   1 
HETATM 5729 O O   . HOH F 3 .   ? 25.473  19.154  8.629   1.00 23.97 ? 543 HOH B O   1 
HETATM 5730 O O   . HOH F 3 .   ? 6.503   30.578  9.025   1.00 25.63 ? 544 HOH B O   1 
HETATM 5731 O O   . HOH F 3 .   ? 6.373   31.638  -12.878 1.00 18.85 ? 545 HOH B O   1 
HETATM 5732 O O   . HOH F 3 .   ? 28.798  42.087  -18.911 1.00 22.67 ? 546 HOH B O   1 
HETATM 5733 O O   . HOH F 3 .   ? 47.987  32.859  30.734  1.00 19.27 ? 547 HOH B O   1 
HETATM 5734 O O   . HOH F 3 .   ? 17.042  33.436  35.384  1.00 26.08 ? 548 HOH B O   1 
HETATM 5735 O O   . HOH F 3 .   ? 28.336  12.229  -12.861 1.00 18.37 ? 549 HOH B O   1 
HETATM 5736 O O   . HOH F 3 .   ? 41.801  17.142  16.732  1.00 12.29 ? 550 HOH B O   1 
HETATM 5737 O O   . HOH F 3 .   ? 10.250  55.693  0.738   1.00 23.23 ? 551 HOH B O   1 
HETATM 5738 O O   . HOH F 3 .   ? 44.888  15.994  -12.321 1.00 27.27 ? 552 HOH B O   1 
HETATM 5739 O O   . HOH F 3 .   ? 14.605  22.344  22.008  1.00 23.12 ? 553 HOH B O   1 
HETATM 5740 O O   . HOH F 3 .   ? 22.271  14.691  10.442  1.00 15.65 ? 554 HOH B O   1 
HETATM 5741 O O   . HOH F 3 .   ? 41.524  30.603  -4.266  1.00 14.45 ? 555 HOH B O   1 
HETATM 5742 O O   . HOH F 3 .   ? 39.060  12.390  11.294  1.00 29.60 ? 556 HOH B O   1 
HETATM 5743 O O   . HOH F 3 .   ? 13.928  57.526  -1.587  1.00 24.55 ? 557 HOH B O   1 
HETATM 5744 O O   . HOH F 3 .   ? 12.390  48.750  14.404  1.00 16.35 ? 558 HOH B O   1 
HETATM 5745 O O   . HOH F 3 .   ? 39.870  19.970  -13.172 1.00 14.79 ? 559 HOH B O   1 
HETATM 5746 O O   . HOH F 3 .   ? 2.430   44.228  -1.486  1.00 27.28 ? 560 HOH B O   1 
HETATM 5747 O O   . HOH F 3 .   ? 44.200  39.983  -10.087 1.00 23.14 ? 561 HOH B O   1 
HETATM 5748 O O   . HOH F 3 .   ? 44.813  27.511  26.154  1.00 20.22 ? 562 HOH B O   1 
HETATM 5749 O O   . HOH F 3 .   ? 23.328  34.408  -11.810 1.00 21.95 ? 563 HOH B O   1 
HETATM 5750 O O   . HOH F 3 .   ? 21.038  30.241  39.661  1.00 28.15 ? 564 HOH B O   1 
HETATM 5751 O O   . HOH F 3 .   ? 46.305  44.822  0.756   1.00 22.18 ? 565 HOH B O   1 
HETATM 5752 O O   . HOH F 3 .   ? 15.433  48.598  -9.025  1.00 17.04 ? 566 HOH B O   1 
HETATM 5753 O O   . HOH F 3 .   ? 43.888  31.926  17.648  1.00 26.89 ? 567 HOH B O   1 
HETATM 5754 O O   . HOH F 3 .   ? 39.238  4.782   5.604   1.00 18.04 ? 568 HOH B O   1 
HETATM 5755 O O   . HOH F 3 .   ? 3.353   30.471  4.075   1.00 17.51 ? 569 HOH B O   1 
HETATM 5756 O O   . HOH F 3 .   ? 14.729  54.220  -4.147  1.00 27.92 ? 570 HOH B O   1 
HETATM 5757 O O   . HOH F 3 .   ? 26.401  51.220  -6.255  1.00 28.78 ? 571 HOH B O   1 
HETATM 5758 O O   . HOH F 3 .   ? 44.260  25.534  16.655  1.00 17.85 ? 572 HOH B O   1 
HETATM 5759 O O   . HOH F 3 .   ? 31.340  37.049  -1.387  1.00 2.10  ? 573 HOH B O   1 
HETATM 5760 O O   . HOH F 3 .   ? 20.557  42.363  16.603  1.00 11.63 ? 574 HOH B O   1 
HETATM 5761 O O   . HOH F 3 .   ? 12.834  58.684  8.939   1.00 13.40 ? 575 HOH B O   1 
HETATM 5762 O O   . HOH F 3 .   ? 8.027   40.661  -11.810 1.00 15.50 ? 576 HOH B O   1 
HETATM 5763 O O   . HOH F 3 .   ? 11.736  24.333  -2.432  1.00 19.67 ? 577 HOH B O   1 
HETATM 5764 O O   . HOH F 3 .   ? 14.463  19.127  -0.581  1.00 18.11 ? 578 HOH B O   1 
HETATM 5765 O O   . HOH F 3 .   ? 17.423  31.182  -13.336 1.00 24.97 ? 579 HOH B O   1 
HETATM 5766 O O   . HOH F 3 .   ? 35.234  40.120  3.204   1.00 12.57 ? 580 HOH B O   1 
HETATM 5767 O O   . HOH F 3 .   ? 28.726  37.813  24.348  1.00 21.58 ? 581 HOH B O   1 
HETATM 5768 O O   . HOH F 3 .   ? 22.170  42.306  10.170  1.00 32.54 ? 582 HOH B O   1 
HETATM 5769 O O   . HOH F 3 .   ? 43.439  36.288  29.701  1.00 29.56 ? 583 HOH B O   1 
HETATM 5770 O O   . HOH F 3 .   ? 46.507  29.260  9.550   1.00 27.93 ? 584 HOH B O   1 
HETATM 5771 O O   . HOH F 3 .   ? 27.339  52.911  9.567   1.00 25.78 ? 585 HOH B O   1 
HETATM 5772 O O   . HOH F 3 .   ? 28.223  4.789   -6.734  1.00 21.44 ? 586 HOH B O   1 
HETATM 5773 O O   . HOH F 3 .   ? 34.878  32.842  18.184  1.00 20.47 ? 587 HOH B O   1 
HETATM 5774 O O   . HOH F 3 .   ? 22.539  46.576  12.790  1.00 27.15 ? 588 HOH B O   1 
HETATM 5775 O O   . HOH F 3 .   ? 41.951  38.736  -4.487  1.00 25.00 ? 589 HOH B O   1 
HETATM 5776 O O   . HOH F 3 .   ? 22.498  38.277  -9.033  1.00 19.01 ? 590 HOH B O   1 
HETATM 5777 O O   . HOH F 3 .   ? 20.163  10.941  11.442  1.00 23.48 ? 591 HOH B O   1 
HETATM 5778 O O   . HOH F 3 .   ? 26.002  17.902  -15.730 1.00 25.86 ? 592 HOH B O   1 
HETATM 5779 O O   . HOH F 3 .   ? 32.191  21.826  33.183  1.00 33.22 ? 593 HOH B O   1 
HETATM 5780 O O   . HOH F 3 .   ? 41.910  16.861  -16.892 1.00 26.96 ? 594 HOH B O   1 
HETATM 5781 O O   . HOH F 3 .   ? 40.241  7.968   -12.755 1.00 29.75 ? 595 HOH B O   1 
HETATM 5782 O O   . HOH F 3 .   ? 22.849  60.740  5.321   1.00 13.27 ? 596 HOH B O   1 
HETATM 5783 O O   . HOH F 3 .   ? 4.121   47.124  5.001   1.00 24.30 ? 597 HOH B O   1 
HETATM 5784 O O   . HOH F 3 .   ? 21.593  38.205  12.106  1.00 10.52 ? 598 HOH B O   1 
HETATM 5785 O O   . HOH F 3 .   ? 30.999  21.039  38.285  1.00 21.13 ? 599 HOH B O   1 
HETATM 5786 O O   . HOH F 3 .   ? 24.995  35.727  15.398  1.00 17.63 ? 600 HOH B O   1 
HETATM 5787 O O   . HOH F 3 .   ? 29.520  45.108  -7.419  1.00 31.82 ? 601 HOH B O   1 
HETATM 5788 O O   . HOH F 3 .   ? 21.361  32.082  10.219  1.00 27.24 ? 602 HOH B O   1 
HETATM 5789 O O   . HOH F 3 .   ? 17.797  39.814  37.083  1.00 15.27 ? 603 HOH B O   1 
HETATM 5790 O O   . HOH F 3 .   ? 44.457  24.058  -17.606 1.00 19.73 ? 604 HOH B O   1 
HETATM 5791 O O   . HOH F 3 .   ? 16.906  42.500  -22.159 1.00 20.19 ? 605 HOH B O   1 
HETATM 5792 O O   . HOH F 3 .   ? 40.028  23.363  25.573  1.00 30.74 ? 606 HOH B O   1 
HETATM 5793 O O   . HOH F 3 .   ? 42.847  25.821  -10.525 1.00 20.68 ? 607 HOH B O   1 
HETATM 5794 O O   . HOH F 3 .   ? 14.078  19.560  -13.473 1.00 22.77 ? 608 HOH B O   1 
HETATM 5795 O O   . HOH F 3 .   ? 34.623  35.212  11.691  1.00 21.56 ? 609 HOH B O   1 
HETATM 5796 O O   . HOH F 3 .   ? 39.254  14.651  21.373  1.00 16.05 ? 610 HOH B O   1 
HETATM 5797 O O   . HOH F 3 .   ? 9.982   50.145  2.056   1.00 21.96 ? 611 HOH B O   1 
HETATM 5798 O O   . HOH F 3 .   ? 21.495  42.122  -3.738  1.00 13.70 ? 612 HOH B O   1 
HETATM 5799 O O   . HOH F 3 .   ? 7.434   41.171  15.099  1.00 26.95 ? 613 HOH B O   1 
HETATM 5800 O O   . HOH F 3 .   ? 9.351   45.067  -6.350  1.00 25.05 ? 614 HOH B O   1 
HETATM 5801 O O   . HOH F 3 .   ? 39.365  28.089  4.924   1.00 24.40 ? 615 HOH B O   1 
HETATM 5802 O O   . HOH F 3 .   ? 36.958  9.356   1.373   1.00 17.51 ? 616 HOH B O   1 
HETATM 5803 O O   . HOH F 3 .   ? 30.167  41.094  7.927   1.00 22.83 ? 617 HOH B O   1 
HETATM 5804 O O   . HOH F 3 .   ? 3.690   46.347  10.798  1.00 17.86 ? 618 HOH B O   1 
HETATM 5805 O O   . HOH F 3 .   ? 39.818  46.938  -5.923  1.00 18.76 ? 619 HOH B O   1 
HETATM 5806 O O   . HOH F 3 .   ? 24.172  49.734  -2.619  1.00 23.71 ? 620 HOH B O   1 
HETATM 5807 O O   . HOH F 3 .   ? 33.305  27.402  -20.268 1.00 28.61 ? 621 HOH B O   1 
HETATM 5808 O O   . HOH F 3 .   ? 29.488  35.176  9.926   1.00 32.45 ? 622 HOH B O   1 
HETATM 5809 O O   . HOH F 3 .   ? 12.887  36.546  13.231  1.00 17.40 ? 623 HOH B O   1 
HETATM 5810 O O   . HOH F 3 .   ? 20.384  17.649  21.229  1.00 25.79 ? 624 HOH B O   1 
HETATM 5811 O O   . HOH F 3 .   ? 3.153   41.083  -5.648  1.00 21.93 ? 625 HOH B O   1 
HETATM 5812 O O   . HOH F 3 .   ? 8.774   23.306  5.348   1.00 37.00 ? 626 HOH B O   1 
HETATM 5813 O O   . HOH F 3 .   ? 25.013  44.602  -21.987 1.00 19.06 ? 627 HOH B O   1 
HETATM 5814 O O   . HOH F 3 .   ? 26.216  42.666  5.865   1.00 15.20 ? 628 HOH B O   1 
HETATM 5815 O O   . HOH F 3 .   ? 13.966  25.619  -13.193 1.00 27.84 ? 629 HOH B O   1 
HETATM 5816 O O   . HOH F 3 .   ? 29.742  40.521  -23.470 1.00 24.89 ? 630 HOH B O   1 
HETATM 5817 O O   . HOH F 3 .   ? 35.133  21.744  24.893  1.00 29.22 ? 631 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   1   1   LYS LYS A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   LYS 3   3   3   LYS LYS A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   PRO 7   7   7   PRO PRO A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   GLN 9   9   9   GLN GLN A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  ILE 12  12  12  ILE ILE A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  MET 14  14  14  MET MET A . n 
A 1 15  ILE 15  15  15  ILE ILE A . n 
A 1 16  PHE 16  16  16  PHE PHE A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  GLU 19  19  19  GLU GLU A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  MET 21  21  21  MET MET A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  MET 25  25  25  MET MET A . n 
A 1 26  VAL 26  26  26  VAL VAL A . n 
A 1 27  GLU 27  27  27  GLU GLU A . n 
A 1 28  TYR 28  28  28  TYR TYR A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  ASP 31  31  31  ASP ASP A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  GLN 33  33  33  GLN GLN A . n 
A 1 34  LYS 34  34  34  LYS LYS A . n 
A 1 35  MET 35  35  35  MET MET A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  GLY 38  38  38  GLY GLY A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  ARG 43  43  43  ARG ARG A . n 
A 1 44  GLN 44  44  44  GLN GLN A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  GLN 46  46  46  GLN GLN A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  TYR 49  49  49  TYR TYR A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  ILE 51  51  51  ILE ILE A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  GLN 56  56  56  GLN GLN A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  GLN 61  61  61  GLN GLN A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  GLN 67  67  67  GLN GLN A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  ASN 73  73  73  ASN ASN A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  TYR 76  76  76  TYR TYR A . n 
A 1 77  THR 77  77  77  THR THR A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  ILE 79  79  79  ILE ILE A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  HIS 81  81  81  HIS HIS A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  LYS 87  87  87  LYS LYS A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ASN 92  92  92  ASN ASN A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  GLN 98  98  98  GLN GLN A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 MET 103 103 103 MET MET A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ASP 109 109 109 ASP ASP A . n 
A 1 110 ILE 110 110 110 ILE ILE A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 SER 115 115 115 SER SER A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 ARG 118 118 118 ARG ARG A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 ASP 127 127 127 ASP ASP A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 ASN 132 132 132 ASN ASN A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 LYS 135 135 135 LYS LYS A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 ASP 139 139 139 ASP ASP A . n 
A 1 140 ILE 140 140 140 ILE ILE A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 VAL 143 143 143 VAL VAL A . n 
A 1 144 ASP 144 144 144 ASP ASP A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 GLU 148 148 148 GLU GLU A . n 
A 1 149 GLU 149 149 149 GLU GLU A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 GLU 151 151 151 GLU GLU A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 TYR 156 156 156 TYR TYR A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 ASN 159 159 159 ASN ASN A . n 
A 1 160 THR 160 160 160 THR THR A . n 
A 1 161 HIS 161 161 161 HIS HIS A . n 
A 1 162 ALA 162 162 162 ALA ALA A . n 
A 1 163 THR 163 163 163 THR THR A . n 
A 1 164 THR 164 164 164 THR THR A . n 
A 1 165 HIS 165 165 165 HIS HIS A . n 
A 1 166 ASN 166 166 166 ASN ASN A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 TYR 168 168 168 TYR TYR A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 GLU 171 171 171 GLU GLU A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 ILE 173 173 173 ILE ILE A . n 
A 1 174 ASP 174 174 174 ASP ASP A . n 
A 1 175 ILE 175 175 175 ILE ILE A . n 
A 1 176 PHE 176 176 176 PHE PHE A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 ILE 178 178 178 ILE ILE A . n 
A 1 179 GLU 179 179 179 GLU GLU A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 GLU 181 181 181 GLU GLU A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 GLU 183 183 183 GLU GLU A . n 
A 1 184 CYS 184 184 184 CYS CYS A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 ARG 186 186 186 ARG ARG A . n 
A 1 187 TYR 187 187 187 TYR TYR A . n 
A 1 188 LYS 188 188 188 LYS LYS A . n 
A 1 189 PRO 189 189 189 PRO PRO A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 LYS 191 191 191 LYS LYS A . n 
A 1 192 GLN 192 192 192 GLN GLN A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 HIS 194 194 194 HIS HIS A . n 
A 1 195 ASN 195 195 195 ASN ASN A . n 
A 1 196 ARG 196 196 196 ARG ARG A . n 
A 1 197 ARG 197 197 197 ARG ARG A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 TRP 200 200 200 TRP TRP A . n 
A 1 201 HIS 201 201 201 HIS HIS A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ARG 204 204 204 ARG ARG A . n 
A 1 205 THR 205 205 205 THR THR A . n 
A 1 206 THR 206 206 206 THR THR A . n 
A 1 207 ASN 207 207 207 ASN ASN A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 ALA 209 209 209 ALA ALA A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 ILE 211 211 211 ILE ILE A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 GLN 214 214 214 GLN GLN A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 ARG 217 217 217 ARG ARG A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 ALA 219 219 219 ALA ALA A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 PRO 221 221 221 PRO PRO A . n 
A 1 222 GLU 222 222 222 GLU GLU A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 PRO 224 224 224 PRO PRO A . n 
A 1 225 VAL 225 225 225 VAL VAL A . n 
A 1 226 THR 226 226 226 THR THR A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 TYR 228 228 228 TYR TYR A . n 
A 1 229 MET 229 229 229 MET MET A . n 
A 1 230 PHE 230 230 230 PHE PHE A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 LYS 232 232 232 LYS LYS A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 ILE 234 234 234 ILE ILE A . n 
A 1 235 TYR 235 235 235 TYR TYR A . n 
A 1 236 PHE 236 236 236 PHE PHE A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 ASP 238 238 238 ASP ASP A . n 
A 1 239 MET 239 239 239 MET MET A . n 
A 1 240 VAL 240 240 240 VAL VAL A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 LYS 242 242 242 LYS LYS A . n 
A 1 243 SER 243 243 243 SER SER A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
A 1 246 TYR 246 246 246 TYR TYR A . n 
A 1 247 CYS 247 247 247 CYS CYS A . n 
A 1 248 HIS 248 248 248 HIS HIS A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 SER 250 250 250 SER SER A . n 
A 1 251 GLN 251 251 251 GLN GLN A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 ASP 253 253 253 ASP ASP A . n 
A 1 254 PRO 254 254 254 PRO PRO A . n 
A 1 255 ILE 255 255 255 ILE ILE A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 LEU 257 257 257 LEU LEU A . n 
A 1 258 ILE 258 258 258 ILE ILE A . n 
A 1 259 LEU 259 259 259 LEU LEU A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 GLY 261 261 261 GLY GLY A . n 
A 1 262 GLU 262 262 262 GLU GLU A . n 
A 1 263 VAL 263 263 263 VAL VAL A . n 
A 1 264 ALA 264 264 264 ALA ALA A . n 
A 1 265 LEU 265 265 265 LEU LEU A . n 
A 1 266 GLY 266 266 266 GLY GLY A . n 
A 1 267 ASN 267 267 267 ASN ASN A . n 
A 1 268 MET 268 268 268 MET MET A . n 
A 1 269 TYR 269 269 269 TYR TYR A . n 
A 1 270 GLU 270 270 270 GLU GLU A . n 
A 1 271 LEU 271 271 271 LEU LEU A . n 
A 1 272 LYS 272 272 272 LYS LYS A . n 
A 1 273 HIS 273 273 273 HIS HIS A . n 
A 1 274 ALA 274 274 274 ALA ALA A . n 
A 1 275 SER 275 275 275 SER SER A . n 
A 1 276 HIS 276 276 276 HIS HIS A . n 
A 1 277 ILE 277 277 277 ILE ILE A . n 
A 1 278 SER 278 278 278 SER SER A . n 
A 1 279 LYS 279 279 279 LYS LYS A . n 
A 1 280 LEU 280 280 280 LEU LEU A . n 
A 1 281 PRO 281 281 281 PRO PRO A . n 
A 1 282 LYS 282 282 282 LYS LYS A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 LYS 284 284 284 LYS LYS A . n 
A 1 285 HIS 285 285 285 HIS HIS A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 VAL 287 287 287 VAL VAL A . n 
A 1 288 LYS 288 288 288 LYS LYS A . n 
A 1 289 GLY 289 289 289 GLY GLY A . n 
A 1 290 LEU 290 290 290 LEU LEU A . n 
A 1 291 GLY 291 291 291 GLY GLY A . n 
A 1 292 LYS 292 292 292 LYS LYS A . n 
A 1 293 THR 293 293 293 THR THR A . n 
A 1 294 THR 294 294 294 THR THR A . n 
A 1 295 PRO 295 295 295 PRO PRO A . n 
A 1 296 ASP 296 296 296 ASP ASP A . n 
A 1 297 PRO 297 297 297 PRO PRO A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 ASN 300 300 300 ASN ASN A . n 
A 1 301 ILE 301 301 301 ILE ILE A . n 
A 1 302 SER 302 302 302 SER SER A . n 
A 1 303 LEU 303 303 303 LEU LEU A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 VAL 306 306 306 VAL VAL A . n 
A 1 307 ASP 307 307 307 ASP ASP A . n 
A 1 308 VAL 308 308 308 VAL VAL A . n 
A 1 309 PRO 309 309 309 PRO PRO A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 GLY 311 311 311 GLY GLY A . n 
A 1 312 THR 312 312 312 THR THR A . n 
A 1 313 GLY 313 313 313 GLY GLY A . n 
A 1 314 ILE 314 314 314 ILE ILE A . n 
A 1 315 SER 315 315 315 SER SER A . n 
A 1 316 SER 316 316 316 SER SER A . n 
A 1 317 GLY 317 317 317 GLY GLY A . n 
A 1 318 VAL 318 318 318 VAL VAL A . n 
A 1 319 ASN 319 319 319 ASN ASN A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 THR 321 321 321 THR THR A . n 
A 1 322 SER 322 322 322 SER SER A . n 
A 1 323 LEU 323 323 323 LEU LEU A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 TYR 325 325 325 TYR TYR A . n 
A 1 326 ASN 326 326 326 ASN ASN A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 TYR 328 328 328 TYR TYR A . n 
A 1 329 ILE 329 329 329 ILE ILE A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 TYR 331 331 331 TYR TYR A . n 
A 1 332 ASP 332 332 332 ASP ASP A . n 
A 1 333 ILE 333 333 333 ILE ILE A . n 
A 1 334 ALA 334 334 334 ALA ALA A . n 
A 1 335 GLN 335 335 335 GLN GLN A . n 
A 1 336 VAL 336 336 336 VAL VAL A . n 
A 1 337 ASN 337 337 337 ASN ASN A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 LYS 339 339 339 LYS LYS A . n 
A 1 340 TYR 340 340 340 TYR TYR A . n 
A 1 341 LEU 341 341 341 LEU LEU A . n 
A 1 342 LEU 342 342 342 LEU LEU A . n 
A 1 343 LYS 343 343 343 LYS LYS A . n 
A 1 344 LEU 344 344 344 LEU LEU A . n 
A 1 345 LYS 345 345 345 LYS LYS A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 ASN 347 347 347 ASN ASN A . n 
A 1 348 PHE 348 348 348 PHE PHE A . n 
A 1 349 LYS 349 349 349 LYS LYS A . n 
A 1 350 THR 350 350 350 THR THR A . n 
B 1 1   LYS 1   1   1   LYS LYS B . n 
B 1 2   SER 2   2   2   SER SER B . n 
B 1 3   LYS 3   3   3   LYS LYS B . n 
B 1 4   LEU 4   4   4   LEU LEU B . n 
B 1 5   PRO 5   5   5   PRO PRO B . n 
B 1 6   LYS 6   6   6   LYS LYS B . n 
B 1 7   PRO 7   7   7   PRO PRO B . n 
B 1 8   VAL 8   8   8   VAL VAL B . n 
B 1 9   GLN 9   9   9   GLN GLN B . n 
B 1 10  ASP 10  10  10  ASP ASP B . n 
B 1 11  LEU 11  11  11  LEU LEU B . n 
B 1 12  ILE 12  12  12  ILE ILE B . n 
B 1 13  LYS 13  13  13  LYS LYS B . n 
B 1 14  MET 14  14  14  MET MET B . n 
B 1 15  ILE 15  15  15  ILE ILE B . n 
B 1 16  PHE 16  16  16  PHE PHE B . n 
B 1 17  ASP 17  17  17  ASP ASP B . n 
B 1 18  VAL 18  18  18  VAL VAL B . n 
B 1 19  GLU 19  19  19  GLU GLU B . n 
B 1 20  SER 20  20  20  SER SER B . n 
B 1 21  MET 21  21  21  MET MET B . n 
B 1 22  LYS 22  22  22  LYS LYS B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  MET 25  25  25  MET MET B . n 
B 1 26  VAL 26  26  26  VAL VAL B . n 
B 1 27  GLU 27  27  27  GLU GLU B . n 
B 1 28  TYR 28  28  28  TYR TYR B . n 
B 1 29  GLU 29  29  29  GLU GLU B . n 
B 1 30  ILE 30  30  30  ILE ILE B . n 
B 1 31  ASP 31  31  31  ASP ASP B . n 
B 1 32  LEU 32  32  32  LEU LEU B . n 
B 1 33  GLN 33  33  33  GLN GLN B . n 
B 1 34  LYS 34  34  34  LYS LYS B . n 
B 1 35  MET 35  35  35  MET MET B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  LEU 37  37  37  LEU LEU B . n 
B 1 38  GLY 38  38  38  GLY GLY B . n 
B 1 39  LYS 39  39  39  LYS LYS B . n 
B 1 40  LEU 40  40  40  LEU LEU B . n 
B 1 41  SER 41  41  41  SER SER B . n 
B 1 42  LYS 42  42  42  LYS LYS B . n 
B 1 43  ARG 43  43  43  ARG ARG B . n 
B 1 44  GLN 44  44  44  GLN GLN B . n 
B 1 45  ILE 45  45  45  ILE ILE B . n 
B 1 46  GLN 46  46  46  GLN GLN B . n 
B 1 47  ALA 47  47  47  ALA ALA B . n 
B 1 48  ALA 48  48  48  ALA ALA B . n 
B 1 49  TYR 49  49  49  TYR TYR B . n 
B 1 50  SER 50  50  50  SER SER B . n 
B 1 51  ILE 51  51  51  ILE ILE B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  SER 53  53  53  SER SER B . n 
B 1 54  GLU 54  54  54  GLU GLU B . n 
B 1 55  VAL 55  55  55  VAL VAL B . n 
B 1 56  GLN 56  56  56  GLN GLN B . n 
B 1 57  GLN 57  57  57  GLN GLN B . n 
B 1 58  ALA 58  58  58  ALA ALA B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  SER 60  60  60  SER SER B . n 
B 1 61  GLN 61  61  61  GLN GLN B . n 
B 1 62  GLY 62  62  62  GLY GLY B . n 
B 1 63  SER 63  63  63  SER SER B . n 
B 1 64  SER 64  64  64  SER SER B . n 
B 1 65  ASP 65  65  65  ASP ASP B . n 
B 1 66  SER 66  66  66  SER SER B . n 
B 1 67  GLN 67  67  67  GLN GLN B . n 
B 1 68  ILE 68  68  68  ILE ILE B . n 
B 1 69  LEU 69  69  69  LEU LEU B . n 
B 1 70  ASP 70  70  70  ASP ASP B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  SER 72  72  72  SER SER B . n 
B 1 73  ASN 73  73  73  ASN ASN B . n 
B 1 74  ARG 74  74  74  ARG ARG B . n 
B 1 75  PHE 75  75  75  PHE PHE B . n 
B 1 76  TYR 76  76  76  TYR TYR B . n 
B 1 77  THR 77  77  77  THR THR B . n 
B 1 78  LEU 78  78  78  LEU LEU B . n 
B 1 79  ILE 79  79  79  ILE ILE B . n 
B 1 80  PRO 80  80  80  PRO PRO B . n 
B 1 81  HIS 81  81  81  HIS HIS B . n 
B 1 82  ASP 82  82  82  ASP ASP B . n 
B 1 83  PHE 83  83  83  PHE PHE B . n 
B 1 84  GLY 84  84  84  GLY GLY B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  LYS 86  86  86  LYS LYS B . n 
B 1 87  LYS 87  87  87  LYS LYS B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  PRO 89  89  89  PRO PRO B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  LEU 91  91  91  LEU LEU B . n 
B 1 92  ASN 92  92  92  ASN ASN B . n 
B 1 93  ASN 93  93  93  ASN ASN B . n 
B 1 94  ALA 94  94  94  ALA ALA B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  SER 96  96  96  SER SER B . n 
B 1 97  VAL 97  97  97  VAL VAL B . n 
B 1 98  GLN 98  98  98  GLN GLN B . n 
B 1 99  ALA 99  99  99  ALA ALA B . n 
B 1 100 LYS 100 100 100 LYS LYS B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 GLU 102 102 102 GLU GLU B . n 
B 1 103 MET 103 103 103 MET MET B . n 
B 1 104 LEU 104 104 104 LEU LEU B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 ASN 106 106 106 ASN ASN B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 ASP 109 109 109 ASP ASP B . n 
B 1 110 ILE 110 110 110 ILE ILE B . n 
B 1 111 GLU 111 111 111 GLU GLU B . n 
B 1 112 VAL 112 112 112 VAL VAL B . n 
B 1 113 ALA 113 113 113 ALA ALA B . n 
B 1 114 TYR 114 114 114 TYR TYR B . n 
B 1 115 SER 115 115 115 SER SER B . n 
B 1 116 LEU 116 116 116 LEU LEU B . n 
B 1 117 LEU 117 117 117 LEU LEU B . n 
B 1 118 ARG 118 118 118 ARG ARG B . n 
B 1 119 GLY 119 119 119 GLY GLY B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 SER 121 121 121 SER SER B . n 
B 1 122 ASP 122 122 122 ASP ASP B . n 
B 1 123 ASP 123 123 123 ASP ASP B . n 
B 1 124 SER 124 124 124 SER SER B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 LYS 126 126 126 LYS LYS B . n 
B 1 127 ASP 127 127 127 ASP ASP B . n 
B 1 128 PRO 128 128 128 PRO PRO B . n 
B 1 129 ILE 129 129 129 ILE ILE B . n 
B 1 130 ASP 130 130 130 ASP ASP B . n 
B 1 131 VAL 131 131 131 VAL VAL B . n 
B 1 132 ASN 132 132 132 ASN ASN B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 GLU 134 134 134 GLU GLU B . n 
B 1 135 LYS 135 135 135 LYS LYS B . n 
B 1 136 LEU 136 136 136 LEU LEU B . n 
B 1 137 LYS 137 137 137 LYS LYS B . n 
B 1 138 THR 138 138 138 THR THR B . n 
B 1 139 ASP 139 139 139 ASP ASP B . n 
B 1 140 ILE 140 140 140 ILE ILE B . n 
B 1 141 LYS 141 141 141 LYS LYS B . n 
B 1 142 VAL 142 142 142 VAL VAL B . n 
B 1 143 VAL 143 143 143 VAL VAL B . n 
B 1 144 ASP 144 144 144 ASP ASP B . n 
B 1 145 ARG 145 145 145 ARG ARG B . n 
B 1 146 ASP 146 146 146 ASP ASP B . n 
B 1 147 SER 147 147 147 SER SER B . n 
B 1 148 GLU 148 148 148 GLU GLU B . n 
B 1 149 GLU 149 149 149 GLU GLU B . n 
B 1 150 ALA 150 150 150 ALA ALA B . n 
B 1 151 GLU 151 151 151 GLU GLU B . n 
B 1 152 ILE 152 152 152 ILE ILE B . n 
B 1 153 ILE 153 153 153 ILE ILE B . n 
B 1 154 ARG 154 154 154 ARG ARG B . n 
B 1 155 LYS 155 155 155 LYS LYS B . n 
B 1 156 TYR 156 156 156 TYR TYR B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 LYS 158 158 158 LYS LYS B . n 
B 1 159 ASN 159 159 159 ASN ASN B . n 
B 1 160 THR 160 160 160 THR THR B . n 
B 1 161 HIS 161 161 161 HIS HIS B . n 
B 1 162 ALA 162 162 162 ALA ALA B . n 
B 1 163 THR 163 163 163 THR THR B . n 
B 1 164 THR 164 164 164 THR THR B . n 
B 1 165 HIS 165 165 165 HIS HIS B . n 
B 1 166 ASN 166 166 166 ASN ASN B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 TYR 168 168 168 TYR TYR B . n 
B 1 169 ASP 169 169 169 ASP ASP B . n 
B 1 170 LEU 170 170 170 LEU LEU B . n 
B 1 171 GLU 171 171 171 GLU GLU B . n 
B 1 172 VAL 172 172 172 VAL VAL B . n 
B 1 173 ILE 173 173 173 ILE ILE B . n 
B 1 174 ASP 174 174 174 ASP ASP B . n 
B 1 175 ILE 175 175 175 ILE ILE B . n 
B 1 176 PHE 176 176 176 PHE PHE B . n 
B 1 177 LYS 177 177 177 LYS LYS B . n 
B 1 178 ILE 178 178 178 ILE ILE B . n 
B 1 179 GLU 179 179 179 GLU GLU B . n 
B 1 180 ARG 180 180 180 ARG ARG B . n 
B 1 181 GLU 181 181 181 GLU GLU B . n 
B 1 182 GLY 182 182 182 GLY GLY B . n 
B 1 183 GLU 183 183 183 GLU GLU B . n 
B 1 184 CYS 184 184 184 CYS CYS B . n 
B 1 185 GLN 185 185 185 GLN GLN B . n 
B 1 186 ARG 186 186 186 ARG ARG B . n 
B 1 187 TYR 187 187 187 TYR TYR B . n 
B 1 188 LYS 188 188 188 LYS LYS B . n 
B 1 189 PRO 189 189 189 PRO PRO B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 LYS 191 191 191 LYS LYS B . n 
B 1 192 GLN 192 192 192 GLN GLN B . n 
B 1 193 LEU 193 193 193 LEU LEU B . n 
B 1 194 HIS 194 194 194 HIS HIS B . n 
B 1 195 ASN 195 195 195 ASN ASN B . n 
B 1 196 ARG 196 196 196 ARG ARG B . n 
B 1 197 ARG 197 197 197 ARG ARG B . n 
B 1 198 LEU 198 198 198 LEU LEU B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 TRP 200 200 200 TRP TRP B . n 
B 1 201 HIS 201 201 201 HIS HIS B . n 
B 1 202 GLY 202 202 202 GLY GLY B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 ARG 204 204 204 ARG ARG B . n 
B 1 205 THR 205 205 205 THR THR B . n 
B 1 206 THR 206 206 206 THR THR B . n 
B 1 207 ASN 207 207 207 ASN ASN B . n 
B 1 208 PHE 208 208 208 PHE PHE B . n 
B 1 209 ALA 209 209 209 ALA ALA B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 ILE 211 211 211 ILE ILE B . n 
B 1 212 LEU 212 212 212 LEU LEU B . n 
B 1 213 SER 213 213 213 SER SER B . n 
B 1 214 GLN 214 214 214 GLN GLN B . n 
B 1 215 GLY 215 215 215 GLY GLY B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 ARG 217 217 217 ARG ARG B . n 
B 1 218 ILE 218 218 218 ILE ILE B . n 
B 1 219 ALA 219 219 219 ALA ALA B . n 
B 1 220 PRO 220 220 220 PRO PRO B . n 
B 1 221 PRO 221 221 221 PRO PRO B . n 
B 1 222 GLU 222 222 222 GLU GLU B . n 
B 1 223 ALA 223 223 223 ALA ALA B . n 
B 1 224 PRO 224 224 224 PRO PRO B . n 
B 1 225 VAL 225 225 225 VAL VAL B . n 
B 1 226 THR 226 226 226 THR THR B . n 
B 1 227 GLY 227 227 227 GLY GLY B . n 
B 1 228 TYR 228 228 228 TYR TYR B . n 
B 1 229 MET 229 229 229 MET MET B . n 
B 1 230 PHE 230 230 230 PHE PHE B . n 
B 1 231 GLY 231 231 231 GLY GLY B . n 
B 1 232 LYS 232 232 232 LYS LYS B . n 
B 1 233 GLY 233 233 233 GLY GLY B . n 
B 1 234 ILE 234 234 234 ILE ILE B . n 
B 1 235 TYR 235 235 235 TYR TYR B . n 
B 1 236 PHE 236 236 236 PHE PHE B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 ASP 238 238 238 ASP ASP B . n 
B 1 239 MET 239 239 239 MET MET B . n 
B 1 240 VAL 240 240 240 VAL VAL B . n 
B 1 241 SER 241 241 241 SER SER B . n 
B 1 242 LYS 242 242 242 LYS LYS B . n 
B 1 243 SER 243 243 243 SER SER B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ASN 245 245 245 ASN ASN B . n 
B 1 246 TYR 246 246 246 TYR TYR B . n 
B 1 247 CYS 247 247 247 CYS CYS B . n 
B 1 248 HIS 248 248 248 HIS HIS B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 SER 250 250 250 SER SER B . n 
B 1 251 GLN 251 251 251 GLN GLN B . n 
B 1 252 GLY 252 252 252 GLY GLY B . n 
B 1 253 ASP 253 253 253 ASP ASP B . n 
B 1 254 PRO 254 254 254 PRO PRO B . n 
B 1 255 ILE 255 255 255 ILE ILE B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 LEU 257 257 257 LEU LEU B . n 
B 1 258 ILE 258 258 258 ILE ILE B . n 
B 1 259 LEU 259 259 259 LEU LEU B . n 
B 1 260 LEU 260 260 260 LEU LEU B . n 
B 1 261 GLY 261 261 261 GLY GLY B . n 
B 1 262 GLU 262 262 262 GLU GLU B . n 
B 1 263 VAL 263 263 263 VAL VAL B . n 
B 1 264 ALA 264 264 264 ALA ALA B . n 
B 1 265 LEU 265 265 265 LEU LEU B . n 
B 1 266 GLY 266 266 266 GLY GLY B . n 
B 1 267 ASN 267 267 267 ASN ASN B . n 
B 1 268 MET 268 268 268 MET MET B . n 
B 1 269 TYR 269 269 269 TYR TYR B . n 
B 1 270 GLU 270 270 270 GLU GLU B . n 
B 1 271 LEU 271 271 271 LEU LEU B . n 
B 1 272 LYS 272 272 272 LYS LYS B . n 
B 1 273 HIS 273 273 273 HIS HIS B . n 
B 1 274 ALA 274 274 274 ALA ALA B . n 
B 1 275 SER 275 275 275 SER SER B . n 
B 1 276 HIS 276 276 276 HIS HIS B . n 
B 1 277 ILE 277 277 277 ILE ILE B . n 
B 1 278 SER 278 278 278 SER SER B . n 
B 1 279 LYS 279 279 279 LYS LYS B . n 
B 1 280 LEU 280 280 280 LEU LEU B . n 
B 1 281 PRO 281 281 281 PRO PRO B . n 
B 1 282 LYS 282 282 282 LYS LYS B . n 
B 1 283 GLY 283 283 283 GLY GLY B . n 
B 1 284 LYS 284 284 284 LYS LYS B . n 
B 1 285 HIS 285 285 285 HIS HIS B . n 
B 1 286 SER 286 286 286 SER SER B . n 
B 1 287 VAL 287 287 287 VAL VAL B . n 
B 1 288 LYS 288 288 288 LYS LYS B . n 
B 1 289 GLY 289 289 289 GLY GLY B . n 
B 1 290 LEU 290 290 290 LEU LEU B . n 
B 1 291 GLY 291 291 291 GLY GLY B . n 
B 1 292 LYS 292 292 292 LYS LYS B . n 
B 1 293 THR 293 293 293 THR THR B . n 
B 1 294 THR 294 294 294 THR THR B . n 
B 1 295 PRO 295 295 295 PRO PRO B . n 
B 1 296 ASP 296 296 296 ASP ASP B . n 
B 1 297 PRO 297 297 297 PRO PRO B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 ALA 299 299 299 ALA ALA B . n 
B 1 300 ASN 300 300 300 ASN ASN B . n 
B 1 301 ILE 301 301 301 ILE ILE B . n 
B 1 302 SER 302 302 302 SER SER B . n 
B 1 303 LEU 303 303 303 LEU LEU B . n 
B 1 304 ASP 304 304 304 ASP ASP B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 VAL 306 306 306 VAL VAL B . n 
B 1 307 ASP 307 307 307 ASP ASP B . n 
B 1 308 VAL 308 308 308 VAL VAL B . n 
B 1 309 PRO 309 309 309 PRO PRO B . n 
B 1 310 LEU 310 310 310 LEU LEU B . n 
B 1 311 GLY 311 311 311 GLY GLY B . n 
B 1 312 THR 312 312 312 THR THR B . n 
B 1 313 GLY 313 313 313 GLY GLY B . n 
B 1 314 ILE 314 314 314 ILE ILE B . n 
B 1 315 SER 315 315 315 SER SER B . n 
B 1 316 SER 316 316 316 SER SER B . n 
B 1 317 GLY 317 317 317 GLY GLY B . n 
B 1 318 VAL 318 318 318 VAL VAL B . n 
B 1 319 ASN 319 319 319 ASN ASN B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 THR 321 321 321 THR THR B . n 
B 1 322 SER 322 322 322 SER SER B . n 
B 1 323 LEU 323 323 323 LEU LEU B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 TYR 325 325 325 TYR TYR B . n 
B 1 326 ASN 326 326 326 ASN ASN B . n 
B 1 327 GLU 327 327 327 GLU GLU B . n 
B 1 328 TYR 328 328 328 TYR TYR B . n 
B 1 329 ILE 329 329 329 ILE ILE B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 TYR 331 331 331 TYR TYR B . n 
B 1 332 ASP 332 332 332 ASP ASP B . n 
B 1 333 ILE 333 333 333 ILE ILE B . n 
B 1 334 ALA 334 334 334 ALA ALA B . n 
B 1 335 GLN 335 335 335 GLN GLN B . n 
B 1 336 VAL 336 336 336 VAL VAL B . n 
B 1 337 ASN 337 337 337 ASN ASN B . n 
B 1 338 LEU 338 338 338 LEU LEU B . n 
B 1 339 LYS 339 339 339 LYS LYS B . n 
B 1 340 TYR 340 340 340 TYR TYR B . n 
B 1 341 LEU 341 341 341 LEU LEU B . n 
B 1 342 LEU 342 342 342 LEU LEU B . n 
B 1 343 LYS 343 343 343 LYS LYS B . n 
B 1 344 LEU 344 344 344 LEU LEU B . n 
B 1 345 LYS 345 345 345 LYS LYS B . n 
B 1 346 PHE 346 346 346 PHE PHE B . n 
B 1 347 ASN 347 347 347 ASN ASN B . n 
B 1 348 PHE 348 348 348 PHE PHE B . n 
B 1 349 LYS 349 349 349 LYS LYS B . n 
B 1 350 THR 350 350 350 THR THR B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-01-27 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
AMoRE     phasing          . ? 3 
CNX       refinement       . ? 4 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 CE1 A TYR 28  ? ? CZ  A TYR 28  ? ? 1.469 1.381 0.088  0.013 N 
2  1 NE  A ARG 145 ? ? CZ  A ARG 145 ? ? 1.413 1.326 0.087  0.013 N 
3  1 CB  A HIS 161 ? ? CG  A HIS 161 ? ? 1.605 1.496 0.109  0.018 N 
4  1 NE1 A TRP 200 ? ? CE2 A TRP 200 ? ? 1.459 1.371 0.088  0.013 N 
5  1 C   A SER 241 ? ? N   A LYS 242 ? ? 1.479 1.336 0.143  0.023 Y 
6  1 CG  A LYS 242 ? ? CD  A LYS 242 ? ? 1.725 1.520 0.205  0.034 N 
7  1 CG  A HIS 248 ? ? CD2 A HIS 248 ? ? 1.420 1.354 0.066  0.009 N 
8  1 CA  A SER 315 ? ? CB  A SER 315 ? ? 1.417 1.525 -0.108 0.015 N 
9  1 CA  A THR 350 ? ? C   A THR 350 ? ? 1.689 1.525 0.164  0.026 N 
10 1 CA  B SER 2   ? ? CB  B SER 2   ? ? 1.635 1.525 0.110  0.015 N 
11 1 CG  B HIS 81  ? ? CD2 B HIS 81  ? ? 1.425 1.354 0.071  0.009 N 
12 1 CA  B SER 121 ? ? CB  B SER 121 ? ? 1.618 1.525 0.093  0.015 N 
13 1 CB  B SER 125 ? ? OG  B SER 125 ? ? 1.497 1.418 0.079  0.013 N 
14 1 NE  B ARG 154 ? ? CZ  B ARG 154 ? ? 1.411 1.326 0.085  0.013 N 
15 1 CG  B HIS 161 ? ? CD2 B HIS 161 ? ? 1.443 1.354 0.089  0.009 N 
16 1 CB  B CYS 184 ? ? SG  B CYS 184 ? ? 1.953 1.818 0.135  0.017 N 
17 1 CG  B HIS 194 ? ? CD2 B HIS 194 ? ? 1.419 1.354 0.065  0.009 N 
18 1 CD  B LYS 242 ? ? CE  B LYS 242 ? ? 1.707 1.508 0.199  0.025 N 
19 1 CD  B GLU 262 ? ? OE2 B GLU 262 ? ? 1.376 1.252 0.124  0.011 N 
20 1 CA  B LYS 282 ? ? C   B LYS 282 ? ? 1.758 1.525 0.233  0.026 N 
21 1 C   B LYS 282 ? ? O   B LYS 282 ? ? 1.056 1.229 -0.173 0.019 N 
22 1 C   B LYS 282 ? ? N   B GLY 283 ? ? 1.536 1.336 0.200  0.023 Y 
23 1 CG  B HIS 285 ? ? CD2 B HIS 285 ? ? 1.416 1.354 0.062  0.009 N 
24 1 CA  B ASP 304 ? ? CB  B ASP 304 ? ? 1.688 1.535 0.153  0.022 N 
25 1 CB  B ASP 304 ? ? CG  B ASP 304 ? ? 1.723 1.513 0.210  0.021 N 
26 1 CA  B GLY 305 ? ? C   B GLY 305 ? ? 1.639 1.514 0.125  0.016 N 
27 1 CB  B SER 322 ? ? OG  B SER 322 ? ? 1.534 1.418 0.116  0.013 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1   1 CA  A LYS 3   ? ? CB  A LYS 3   ? ? CG  A LYS 3   ? ? 127.57 113.40 14.17  2.20 N 
2   1 C   A PRO 7   ? ? N   A VAL 8   ? ? CA  A VAL 8   ? ? 103.88 121.70 -17.82 2.50 Y 
3   1 CB  A ASP 10  ? ? CG  A ASP 10  ? ? OD1 A ASP 10  ? ? 123.76 118.30 5.46   0.90 N 
4   1 CB  A ASP 10  ? ? CG  A ASP 10  ? ? OD2 A ASP 10  ? ? 107.35 118.30 -10.95 0.90 N 
5   1 CG  A MET 14  ? ? SD  A MET 14  ? ? CE  A MET 14  ? ? 110.60 100.20 10.40  1.60 N 
6   1 CB  A ASP 17  ? ? CG  A ASP 17  ? ? OD1 A ASP 17  ? ? 111.41 118.30 -6.89  0.90 N 
7   1 CB  A TYR 28  ? ? CG  A TYR 28  ? ? CD2 A TYR 28  ? ? 115.96 121.00 -5.04  0.60 N 
8   1 CB  A LYS 39  ? ? CA  A LYS 39  ? ? C   A LYS 39  ? ? 96.83  110.40 -13.57 2.00 N 
9   1 C   A LEU 40  ? ? N   A SER 41  ? ? CA  A SER 41  ? ? 100.80 121.70 -20.90 2.50 Y 
10  1 NE  A ARG 43  ? ? CZ  A ARG 43  ? ? NH1 A ARG 43  ? ? 128.16 120.30 7.86   0.50 N 
11  1 NE  A ARG 43  ? ? CZ  A ARG 43  ? ? NH2 A ARG 43  ? ? 116.94 120.30 -3.36  0.50 N 
12  1 CB  A ALA 47  ? ? CA  A ALA 47  ? ? C   A ALA 47  ? ? 93.87  110.10 -16.23 1.50 N 
13  1 N   A ALA 47  ? ? CA  A ALA 47  ? ? CB  A ALA 47  ? ? 119.56 110.10 9.46   1.40 N 
14  1 CB  A TYR 49  ? ? CG  A TYR 49  ? ? CD2 A TYR 49  ? ? 112.85 121.00 -8.15  0.60 N 
15  1 CA  A TYR 49  ? ? C   A TYR 49  ? ? N   A SER 50  ? ? 103.95 117.20 -13.25 2.20 Y 
16  1 N   A GLN 56  ? ? CA  A GLN 56  ? ? CB  A GLN 56  ? ? 125.94 110.60 15.34  1.80 N 
17  1 CA  A GLN 57  ? ? CB  A GLN 57  ? ? CG  A GLN 57  ? ? 127.65 113.40 14.25  2.20 N 
18  1 C   A ALA 58  ? ? N   A VAL 59  ? ? CA  A VAL 59  ? ? 105.29 121.70 -16.41 2.50 Y 
19  1 N   A SER 64  ? ? CA  A SER 64  ? ? CB  A SER 64  ? ? 101.18 110.50 -9.32  1.50 N 
20  1 CA  A ILE 68  ? ? CB  A ILE 68  ? ? CG1 A ILE 68  ? ? 97.28  111.00 -13.72 1.90 N 
21  1 C   A LEU 69  ? ? N   A ASP 70  ? ? CA  A ASP 70  ? ? 103.31 121.70 -18.39 2.50 Y 
22  1 CB  A ASP 70  ? ? CG  A ASP 70  ? ? OD2 A ASP 70  ? ? 112.65 118.30 -5.65  0.90 N 
23  1 CA  A ARG 74  ? ? CB  A ARG 74  ? ? CG  A ARG 74  ? ? 99.11  113.40 -14.29 2.20 N 
24  1 CD  A ARG 74  ? ? NE  A ARG 74  ? ? CZ  A ARG 74  ? ? 132.62 123.60 9.02   1.40 N 
25  1 NE  A ARG 74  ? ? CZ  A ARG 74  ? ? NH1 A ARG 74  ? ? 129.09 120.30 8.79   0.50 N 
26  1 NE  A ARG 74  ? ? CZ  A ARG 74  ? ? NH2 A ARG 74  ? ? 115.19 120.30 -5.11  0.50 N 
27  1 CB  A TYR 76  ? ? CA  A TYR 76  ? ? C   A TYR 76  ? ? 123.46 110.40 13.06  2.00 N 
28  1 CA  A TYR 76  ? ? CB  A TYR 76  ? ? CG  A TYR 76  ? ? 99.00  113.40 -14.40 1.90 N 
29  1 CA  A THR 77  ? ? CB  A THR 77  ? ? CG2 A THR 77  ? ? 121.39 112.40 8.99   1.40 N 
30  1 N   A PHE 83  ? ? CA  A PHE 83  ? ? C   A PHE 83  ? ? 129.62 111.00 18.62  2.70 N 
31  1 C   A GLY 84  ? ? N   A MET 85  ? ? CA  A MET 85  ? ? 106.33 121.70 -15.37 2.50 Y 
32  1 N   A LYS 86  ? ? CA  A LYS 86  ? ? C   A LYS 86  ? ? 127.61 111.00 16.61  2.70 N 
33  1 CB  A LEU 90  ? ? CA  A LEU 90  ? ? C   A LEU 90  ? ? 121.96 110.20 11.76  1.90 N 
34  1 CA  A LEU 90  ? ? C   A LEU 90  ? ? O   A LEU 90  ? ? 133.56 120.10 13.46  2.10 N 
35  1 CB  A LEU 91  ? ? CA  A LEU 91  ? ? C   A LEU 91  ? ? 122.15 110.20 11.95  1.90 N 
36  1 N   A ASN 93  ? ? CA  A ASN 93  ? ? CB  A ASN 93  ? ? 97.68  110.60 -12.92 1.80 N 
37  1 CB  A ALA 99  ? ? CA  A ALA 99  ? ? C   A ALA 99  ? ? 99.17  110.10 -10.93 1.50 N 
38  1 CA  A MET 103 ? ? CB  A MET 103 ? ? CG  A MET 103 ? ? 127.73 113.30 14.43  1.70 N 
39  1 CG  A MET 103 ? ? SD  A MET 103 ? ? CE  A MET 103 ? ? 88.80  100.20 -11.40 1.60 N 
40  1 CB  A ASP 105 ? ? CG  A ASP 105 ? ? OD1 A ASP 105 ? ? 123.95 118.30 5.65   0.90 N 
41  1 N   A ASP 109 ? ? CA  A ASP 109 ? ? CB  A ASP 109 ? ? 99.77  110.60 -10.83 1.80 N 
42  1 CB  A ASP 109 ? ? CG  A ASP 109 ? ? OD2 A ASP 109 ? ? 123.94 118.30 5.64   0.90 N 
43  1 CA  A ILE 110 ? ? CB  A ILE 110 ? ? CG1 A ILE 110 ? ? 99.24  111.00 -11.76 1.90 N 
44  1 CA  A GLU 111 ? ? CB  A GLU 111 ? ? CG  A GLU 111 ? ? 127.82 113.40 14.42  2.20 N 
45  1 CB  A ARG 118 ? ? CG  A ARG 118 ? ? CD  A ARG 118 ? ? 137.00 111.60 25.40  2.60 N 
46  1 NE  A ARG 118 ? ? CZ  A ARG 118 ? ? NH1 A ARG 118 ? ? 124.55 120.30 4.25   0.50 N 
47  1 NE  A ARG 118 ? ? CZ  A ARG 118 ? ? NH2 A ARG 118 ? ? 112.98 120.30 -7.32  0.50 N 
48  1 C   A SER 121 ? ? N   A ASP 122 ? ? CA  A ASP 122 ? ? 103.81 121.70 -17.89 2.50 Y 
49  1 O   A ASP 123 ? ? C   A ASP 123 ? ? N   A SER 124 ? ? 111.31 122.70 -11.39 1.60 Y 
50  1 N   A SER 124 ? ? CA  A SER 124 ? ? CB  A SER 124 ? ? 122.17 110.50 11.67  1.50 N 
51  1 CB  A LYS 126 ? ? CA  A LYS 126 ? ? C   A LYS 126 ? ? 124.17 110.40 13.77  2.00 N 
52  1 N   A LYS 126 ? ? CA  A LYS 126 ? ? CB  A LYS 126 ? ? 99.74  110.60 -10.86 1.80 N 
53  1 O   A LYS 126 ? ? C   A LYS 126 ? ? N   A ASP 127 ? ? 113.08 122.70 -9.62  1.60 Y 
54  1 N   A ASP 127 ? ? CA  A ASP 127 ? ? CB  A ASP 127 ? ? 99.36  110.60 -11.24 1.80 N 
55  1 C   A ILE 129 ? ? N   A ASP 130 ? ? CA  A ASP 130 ? ? 105.92 121.70 -15.78 2.50 Y 
56  1 CB  A LYS 135 ? ? CG  A LYS 135 ? ? CD  A LYS 135 ? ? 128.04 111.60 16.44  2.60 N 
57  1 CB  A ASP 144 ? ? CG  A ASP 144 ? ? OD1 A ASP 144 ? ? 124.68 118.30 6.38   0.90 N 
58  1 NE  A ARG 145 ? ? CZ  A ARG 145 ? ? NH1 A ARG 145 ? ? 125.08 120.30 4.78   0.50 N 
59  1 C   A ASP 146 ? ? N   A SER 147 ? ? CA  A SER 147 ? ? 105.00 121.70 -16.70 2.50 Y 
60  1 CB  A SER 147 ? ? CA  A SER 147 ? ? C   A SER 147 ? ? 98.36  110.10 -11.74 1.90 N 
61  1 CA  A GLU 149 ? ? CB  A GLU 149 ? ? CG  A GLU 149 ? ? 136.80 113.40 23.40  2.20 N 
62  1 CB  A TYR 156 ? ? CG  A TYR 156 ? ? CD2 A TYR 156 ? ? 115.80 121.00 -5.20  0.60 N 
63  1 CA  A HIS 165 ? ? CB  A HIS 165 ? ? CG  A HIS 165 ? ? 124.54 113.60 10.94  1.70 N 
64  1 C   A ALA 167 ? ? N   A TYR 168 ? ? CA  A TYR 168 ? ? 138.33 121.70 16.63  2.50 Y 
65  1 CB  A TYR 168 ? ? CG  A TYR 168 ? ? CD1 A TYR 168 ? ? 114.19 121.00 -6.81  0.60 N 
66  1 CG  A TYR 168 ? ? CD2 A TYR 168 ? ? CE2 A TYR 168 ? ? 114.69 121.30 -6.61  0.80 N 
67  1 CD1 A TYR 168 ? ? CE1 A TYR 168 ? ? CZ  A TYR 168 ? ? 113.45 119.80 -6.35  0.90 N 
68  1 N   A TYR 168 ? ? CA  A TYR 168 ? ? C   A TYR 168 ? ? 129.75 111.00 18.75  2.70 N 
69  1 N   A GLU 171 ? ? CA  A GLU 171 ? ? C   A GLU 171 ? ? 127.41 111.00 16.41  2.70 N 
70  1 CA  A ILE 175 ? ? CB  A ILE 175 ? ? CG1 A ILE 175 ? ? 127.99 111.00 16.99  1.90 N 
71  1 CB  A ILE 178 ? ? CA  A ILE 178 ? ? C   A ILE 178 ? ? 90.93  111.60 -20.67 2.00 N 
72  1 CA  A ILE 178 ? ? CB  A ILE 178 ? ? CG1 A ILE 178 ? ? 126.50 111.00 15.50  1.90 N 
73  1 C   A GLU 179 ? ? N   A ARG 180 ? ? CA  A ARG 180 ? ? 106.66 121.70 -15.04 2.50 Y 
74  1 CD  A ARG 180 ? ? NE  A ARG 180 ? ? CZ  A ARG 180 ? ? 114.92 123.60 -8.68  1.40 N 
75  1 NE  A ARG 180 ? ? CZ  A ARG 180 ? ? NH2 A ARG 180 ? ? 114.47 120.30 -5.83  0.50 N 
76  1 C   A GLU 181 ? ? N   A GLY 182 ? ? CA  A GLY 182 ? ? 107.55 122.30 -14.75 2.10 Y 
77  1 CA  A CYS 184 ? ? CB  A CYS 184 ? ? SG  A CYS 184 ? ? 101.34 114.00 -12.66 1.80 N 
78  1 NE  A ARG 186 ? ? CZ  A ARG 186 ? ? NH2 A ARG 186 ? ? 114.89 120.30 -5.41  0.50 N 
79  1 CA  A LYS 188 ? ? CB  A LYS 188 ? ? CG  A LYS 188 ? ? 99.01  113.40 -14.39 2.20 N 
80  1 CB  A HIS 194 ? ? CG  A HIS 194 ? ? CD2 A HIS 194 ? ? 118.56 129.70 -11.14 1.60 N 
81  1 NE  A ARG 196 ? ? CZ  A ARG 196 ? ? NH1 A ARG 196 ? ? 126.15 120.30 5.85   0.50 N 
82  1 NE  A ARG 196 ? ? CZ  A ARG 196 ? ? NH2 A ARG 196 ? ? 116.83 120.30 -3.47  0.50 N 
83  1 CB  A ARG 197 ? ? CA  A ARG 197 ? ? C   A ARG 197 ? ? 93.48  110.40 -16.92 2.00 N 
84  1 N   A ARG 197 ? ? CA  A ARG 197 ? ? CB  A ARG 197 ? ? 123.25 110.60 12.65  1.80 N 
85  1 CD  A ARG 197 ? ? NE  A ARG 197 ? ? CZ  A ARG 197 ? ? 111.86 123.60 -11.74 1.40 N 
86  1 NE  A ARG 197 ? ? CZ  A ARG 197 ? ? NH2 A ARG 197 ? ? 123.94 120.30 3.64   0.50 N 
87  1 CB  A LEU 199 ? ? CG  A LEU 199 ? ? CD1 A LEU 199 ? ? 98.63  111.00 -12.37 1.70 N 
88  1 CB  A LEU 199 ? ? CG  A LEU 199 ? ? CD2 A LEU 199 ? ? 123.40 111.00 12.40  1.70 N 
89  1 CD1 A TRP 200 ? ? CG  A TRP 200 ? ? CD2 A TRP 200 ? ? 100.47 106.30 -5.83  0.80 N 
90  1 CD1 A TRP 200 ? ? NE1 A TRP 200 ? ? CE2 A TRP 200 ? ? 101.77 109.00 -7.23  0.90 N 
91  1 NE1 A TRP 200 ? ? CE2 A TRP 200 ? ? CZ2 A TRP 200 ? ? 122.00 130.40 -8.40  1.10 N 
92  1 CG  A TRP 200 ? ? CD2 A TRP 200 ? ? CE3 A TRP 200 ? ? 123.59 133.90 -10.31 0.90 N 
93  1 CA  A HIS 201 ? ? CB  A HIS 201 ? ? CG  A HIS 201 ? ? 99.98  113.60 -13.62 1.70 N 
94  1 N   A SER 203 ? ? CA  A SER 203 ? ? CB  A SER 203 ? ? 98.07  110.50 -12.43 1.50 N 
95  1 NE  A ARG 204 ? ? CZ  A ARG 204 ? ? NH1 A ARG 204 ? ? 113.27 120.30 -7.03  0.50 N 
96  1 N   A THR 205 ? ? CA  A THR 205 ? ? C   A THR 205 ? ? 127.42 111.00 16.42  2.70 N 
97  1 C   A THR 205 ? ? N   A THR 206 ? ? CA  A THR 206 ? ? 137.11 121.70 15.41  2.50 Y 
98  1 C   A THR 206 ? ? N   A ASN 207 ? ? CA  A ASN 207 ? ? 138.64 121.70 16.94  2.50 Y 
99  1 NE  A ARG 217 ? ? CZ  A ARG 217 ? ? NH2 A ARG 217 ? ? 116.09 120.30 -4.21  0.50 N 
100 1 C   A ALA 223 ? ? N   A PRO 224 ? ? CA  A PRO 224 ? ? 128.81 119.30 9.51   1.50 Y 
101 1 CG1 A VAL 225 ? ? CB  A VAL 225 ? ? CG2 A VAL 225 ? ? 100.94 110.90 -9.96  1.60 N 
102 1 CB  A TYR 228 ? ? CG  A TYR 228 ? ? CD2 A TYR 228 ? ? 116.21 121.00 -4.79  0.60 N 
103 1 CA  A MET 229 ? ? CB  A MET 229 ? ? CG  A MET 229 ? ? 124.81 113.30 11.51  1.70 N 
104 1 C   A PHE 230 ? ? N   A GLY 231 ? ? CA  A GLY 231 ? ? 109.17 122.30 -13.13 2.10 Y 
105 1 CB  A ASP 238 ? ? CA  A ASP 238 ? ? C   A ASP 238 ? ? 97.76  110.40 -12.64 2.00 N 
106 1 N   A ASP 238 ? ? CA  A ASP 238 ? ? CB  A ASP 238 ? ? 123.01 110.60 12.41  1.80 N 
107 1 CA  A VAL 240 ? ? CB  A VAL 240 ? ? CG2 A VAL 240 ? ? 122.20 110.90 11.30  1.50 N 
108 1 CG  A LYS 242 ? ? CD  A LYS 242 ? ? CE  A LYS 242 ? ? 130.37 111.90 18.47  3.00 N 
109 1 CB  A SER 243 ? ? CA  A SER 243 ? ? C   A SER 243 ? ? 94.93  110.10 -15.17 1.90 N 
110 1 CB  A TYR 246 ? ? CG  A TYR 246 ? ? CD2 A TYR 246 ? ? 116.13 121.00 -4.87  0.60 N 
111 1 CA  A CYS 247 ? ? CB  A CYS 247 ? ? SG  A CYS 247 ? ? 123.47 114.20 9.27   1.10 N 
112 1 CA  A HIS 248 ? ? C   A HIS 248 ? ? O   A HIS 248 ? ? 132.85 120.10 12.75  2.10 N 
113 1 CA  A ILE 255 ? ? CB  A ILE 255 ? ? CG1 A ILE 255 ? ? 96.00  111.00 -15.00 1.90 N 
114 1 CB  A LEU 257 ? ? CG  A LEU 257 ? ? CD1 A LEU 257 ? ? 97.89  111.00 -13.11 1.70 N 
115 1 CB  A ILE 258 ? ? CG1 A ILE 258 ? ? CD1 A ILE 258 ? ? 88.17  113.90 -25.73 2.80 N 
116 1 CB  A LEU 259 ? ? CG  A LEU 259 ? ? CD1 A LEU 259 ? ? 121.38 111.00 10.38  1.70 N 
117 1 CG1 A VAL 263 ? ? CB  A VAL 263 ? ? CG2 A VAL 263 ? ? 98.10  110.90 -12.80 1.60 N 
118 1 CG  A TYR 269 ? ? CD2 A TYR 269 ? ? CE2 A TYR 269 ? ? 115.98 121.30 -5.32  0.80 N 
119 1 C   A TYR 269 ? ? N   A GLU 270 ? ? CA  A GLU 270 ? ? 105.82 121.70 -15.88 2.50 Y 
120 1 CA  A HIS 273 ? ? CB  A HIS 273 ? ? CG  A HIS 273 ? ? 102.57 113.60 -11.03 1.70 N 
121 1 CA  A ILE 277 ? ? CB  A ILE 277 ? ? CG1 A ILE 277 ? ? 127.31 111.00 16.31  1.90 N 
122 1 CA  A ILE 277 ? ? CB  A ILE 277 ? ? CG2 A ILE 277 ? ? 98.78  110.90 -12.12 2.00 N 
123 1 N   A SER 278 ? ? CA  A SER 278 ? ? CB  A SER 278 ? ? 120.48 110.50 9.98   1.50 N 
124 1 CA  A LEU 280 ? ? CB  A LEU 280 ? ? CG  A LEU 280 ? ? 130.15 115.30 14.85  2.30 N 
125 1 CB  A LYS 282 ? ? CA  A LYS 282 ? ? C   A LYS 282 ? ? 122.68 110.40 12.28  2.00 N 
126 1 N   A LYS 282 ? ? CA  A LYS 282 ? ? CB  A LYS 282 ? ? 97.65  110.60 -12.95 1.80 N 
127 1 C   A LYS 282 ? ? N   A GLY 283 ? ? CA  A GLY 283 ? ? 109.46 122.30 -12.84 2.10 Y 
128 1 N   A LYS 288 ? ? CA  A LYS 288 ? ? CB  A LYS 288 ? ? 96.10  110.60 -14.50 1.80 N 
129 1 CA  A GLY 289 ? ? C   A GLY 289 ? ? O   A GLY 289 ? ? 132.50 120.60 11.90  1.80 N 
130 1 N   A LYS 292 ? ? CA  A LYS 292 ? ? C   A LYS 292 ? ? 127.67 111.00 16.67  2.70 N 
131 1 CA  A THR 294 ? ? CB  A THR 294 ? ? CG2 A THR 294 ? ? 121.40 112.40 9.00   1.40 N 
132 1 N   A PRO 297 ? ? CA  A PRO 297 ? ? CB  A PRO 297 ? ? 95.81  103.30 -7.49  1.20 N 
133 1 CA  A ILE 301 ? ? CB  A ILE 301 ? ? CG1 A ILE 301 ? ? 95.05  111.00 -15.95 1.90 N 
134 1 CB  A SER 302 ? ? CA  A SER 302 ? ? C   A SER 302 ? ? 96.46  110.10 -13.64 1.90 N 
135 1 C   A ASP 304 ? ? N   A GLY 305 ? ? CA  A GLY 305 ? ? 108.69 122.30 -13.61 2.10 Y 
136 1 CG1 A VAL 306 ? ? CB  A VAL 306 ? ? CG2 A VAL 306 ? ? 100.62 110.90 -10.28 1.60 N 
137 1 C   A GLY 311 ? ? N   A THR 312 ? ? CA  A THR 312 ? ? 103.72 121.70 -17.98 2.50 Y 
138 1 CA  A GLY 313 ? ? C   A GLY 313 ? ? O   A GLY 313 ? ? 108.20 120.60 -12.40 1.80 N 
139 1 CG1 A ILE 314 ? ? CB  A ILE 314 ? ? CG2 A ILE 314 ? ? 97.91  111.40 -13.49 2.20 N 
140 1 CA  A ILE 314 ? ? CB  A ILE 314 ? ? CG2 A ILE 314 ? ? 123.91 110.90 13.01  2.00 N 
141 1 N   A SER 315 ? ? CA  A SER 315 ? ? CB  A SER 315 ? ? 98.11  110.50 -12.39 1.50 N 
142 1 C   A SER 316 ? ? N   A GLY 317 ? ? CA  A GLY 317 ? ? 105.06 122.30 -17.24 2.10 Y 
143 1 CG1 A VAL 318 ? ? CB  A VAL 318 ? ? CG2 A VAL 318 ? ? 100.16 110.90 -10.74 1.60 N 
144 1 CB  A ASP 320 ? ? CG  A ASP 320 ? ? OD1 A ASP 320 ? ? 125.68 118.30 7.38   0.90 N 
145 1 N   A ASP 320 ? ? CA  A ASP 320 ? ? C   A ASP 320 ? ? 128.40 111.00 17.40  2.70 N 
146 1 N   A SER 322 ? ? CA  A SER 322 ? ? CB  A SER 322 ? ? 121.13 110.50 10.63  1.50 N 
147 1 CB  A LEU 323 ? ? CG  A LEU 323 ? ? CD2 A LEU 323 ? ? 123.55 111.00 12.55  1.70 N 
148 1 CB  A TYR 331 ? ? CG  A TYR 331 ? ? CD2 A TYR 331 ? ? 113.59 121.00 -7.41  0.60 N 
149 1 CB  A TYR 331 ? ? CG  A TYR 331 ? ? CD1 A TYR 331 ? ? 125.25 121.00 4.25   0.60 N 
150 1 CB  A ASP 332 ? ? CG  A ASP 332 ? ? OD2 A ASP 332 ? ? 112.24 118.30 -6.06  0.90 N 
151 1 N   A GLN 335 ? ? CA  A GLN 335 ? ? CB  A GLN 335 ? ? 96.96  110.60 -13.64 1.80 N 
152 1 CA  A VAL 336 ? ? CB  A VAL 336 ? ? CG2 A VAL 336 ? ? 121.27 110.90 10.37  1.50 N 
153 1 N   A ASN 337 ? ? CA  A ASN 337 ? ? CB  A ASN 337 ? ? 94.47  110.60 -16.13 1.80 N 
154 1 N   A TYR 340 ? ? CA  A TYR 340 ? ? CB  A TYR 340 ? ? 97.47  110.60 -13.13 1.80 N 
155 1 CB  A TYR 340 ? ? CG  A TYR 340 ? ? CD1 A TYR 340 ? ? 115.89 121.00 -5.11  0.60 N 
156 1 CB  A PHE 348 ? ? CG  A PHE 348 ? ? CD2 A PHE 348 ? ? 116.48 120.80 -4.32  0.70 N 
157 1 CG  A PHE 348 ? ? CD2 A PHE 348 ? ? CE2 A PHE 348 ? ? 113.88 120.80 -6.92  1.10 N 
158 1 N   A THR 350 ? ? CA  A THR 350 ? ? CB  A THR 350 ? ? 97.07  110.30 -13.23 1.90 N 
159 1 CB  B LYS 1   ? ? CA  B LYS 1   ? ? C   B LYS 1   ? ? 125.48 110.40 15.08  2.00 N 
160 1 CB  B LEU 4   ? ? CA  B LEU 4   ? ? C   B LEU 4   ? ? 92.69  110.20 -17.51 1.90 N 
161 1 CA  B VAL 8   ? ? CB  B VAL 8   ? ? CG2 B VAL 8   ? ? 95.36  110.90 -15.54 1.50 N 
162 1 CA  B GLN 9   ? ? CB  B GLN 9   ? ? CG  B GLN 9   ? ? 135.63 113.40 22.23  2.20 N 
163 1 CA  B ILE 12  ? ? CB  B ILE 12  ? ? CG2 B ILE 12  ? ? 123.58 110.90 12.68  2.00 N 
164 1 CB  B MET 14  ? ? CG  B MET 14  ? ? SD  B MET 14  ? ? 88.65  112.40 -23.75 3.00 N 
165 1 CG  B MET 21  ? ? SD  B MET 21  ? ? CE  B MET 21  ? ? 83.18  100.20 -17.02 1.60 N 
166 1 CA  B MET 25  ? ? CB  B MET 25  ? ? CG  B MET 25  ? ? 95.34  113.30 -17.96 1.70 N 
167 1 CA  B VAL 26  ? ? CB  B VAL 26  ? ? CG2 B VAL 26  ? ? 122.53 110.90 11.63  1.50 N 
168 1 CB  B TYR 28  ? ? CG  B TYR 28  ? ? CD2 B TYR 28  ? ? 116.94 121.00 -4.06  0.60 N 
169 1 O   B ASP 31  ? ? C   B ASP 31  ? ? N   B LEU 32  ? ? 132.96 122.70 10.26  1.60 Y 
170 1 N   B LYS 34  ? ? CA  B LYS 34  ? ? CB  B LYS 34  ? ? 121.99 110.60 11.39  1.80 N 
171 1 C   B LYS 34  ? ? N   B MET 35  ? ? CA  B MET 35  ? ? 102.59 121.70 -19.11 2.50 Y 
172 1 CA  B MET 35  ? ? CB  B MET 35  ? ? CG  B MET 35  ? ? 130.01 113.30 16.71  1.70 N 
173 1 N   B SER 41  ? ? CA  B SER 41  ? ? CB  B SER 41  ? ? 101.05 110.50 -9.45  1.50 N 
174 1 CA  B ARG 43  ? ? CB  B ARG 43  ? ? CG  B ARG 43  ? ? 128.66 113.40 15.26  2.20 N 
175 1 NE  B ARG 43  ? ? CZ  B ARG 43  ? ? NH1 B ARG 43  ? ? 112.15 120.30 -8.15  0.50 N 
176 1 CB  B TYR 49  ? ? CG  B TYR 49  ? ? CD2 B TYR 49  ? ? 115.06 121.00 -5.94  0.60 N 
177 1 CB  B TYR 49  ? ? CG  B TYR 49  ? ? CD1 B TYR 49  ? ? 126.58 121.00 5.58   0.60 N 
178 1 CB  B ILE 51  ? ? CG1 B ILE 51  ? ? CD1 B ILE 51  ? ? 95.71  113.90 -18.19 2.80 N 
179 1 CA  B GLU 54  ? ? CB  B GLU 54  ? ? CG  B GLU 54  ? ? 87.41  113.40 -25.99 2.20 N 
180 1 C   B VAL 55  ? ? N   B GLN 56  ? ? CA  B GLN 56  ? ? 101.74 121.70 -19.96 2.50 Y 
181 1 CB  B GLN 56  ? ? CA  B GLN 56  ? ? C   B GLN 56  ? ? 122.41 110.40 12.01  2.00 N 
182 1 CB  B ALA 58  ? ? CA  B ALA 58  ? ? C   B ALA 58  ? ? 100.69 110.10 -9.41  1.50 N 
183 1 N   B GLN 61  ? ? CA  B GLN 61  ? ? CB  B GLN 61  ? ? 87.06  110.60 -23.54 1.80 N 
184 1 CA  B GLN 61  ? ? CB  B GLN 61  ? ? CG  B GLN 61  ? ? 129.26 113.40 15.86  2.20 N 
185 1 CB  B GLN 61  ? ? CG  B GLN 61  ? ? CD  B GLN 61  ? ? 90.32  111.60 -21.28 2.60 N 
186 1 CG1 B ILE 68  ? ? CB  B ILE 68  ? ? CG2 B ILE 68  ? ? 93.90  111.40 -17.50 2.20 N 
187 1 N   B LEU 69  ? ? CA  B LEU 69  ? ? CB  B LEU 69  ? ? 97.46  110.40 -12.94 2.00 N 
188 1 CB  B LEU 69  ? ? CG  B LEU 69  ? ? CD2 B LEU 69  ? ? 100.53 111.00 -10.47 1.70 N 
189 1 N   B ASP 70  ? ? CA  B ASP 70  ? ? CB  B ASP 70  ? ? 123.93 110.60 13.33  1.80 N 
190 1 CB  B ARG 74  ? ? CG  B ARG 74  ? ? CD  B ARG 74  ? ? 92.57  111.60 -19.03 2.60 N 
191 1 NE  B ARG 74  ? ? CZ  B ARG 74  ? ? NH1 B ARG 74  ? ? 124.84 120.30 4.54   0.50 N 
192 1 NE  B ARG 74  ? ? CZ  B ARG 74  ? ? NH2 B ARG 74  ? ? 115.06 120.30 -5.24  0.50 N 
193 1 CB  B PHE 75  ? ? CG  B PHE 75  ? ? CD1 B PHE 75  ? ? 115.14 120.80 -5.66  0.70 N 
194 1 OG1 B THR 77  ? ? CB  B THR 77  ? ? CG2 B THR 77  ? ? 128.25 110.00 18.25  2.30 N 
195 1 CA  B ILE 79  ? ? CB  B ILE 79  ? ? CG2 B ILE 79  ? ? 127.67 110.90 16.77  2.00 N 
196 1 CB  B ASN 93  ? ? CA  B ASN 93  ? ? C   B ASN 93  ? ? 125.78 110.40 15.38  2.00 N 
197 1 N   B ASN 93  ? ? CA  B ASN 93  ? ? CB  B ASN 93  ? ? 87.56  110.60 -23.04 1.80 N 
198 1 CA  B VAL 97  ? ? CB  B VAL 97  ? ? CG2 B VAL 97  ? ? 100.12 110.90 -10.78 1.50 N 
199 1 CB  B ALA 99  ? ? CA  B ALA 99  ? ? C   B ALA 99  ? ? 98.26  110.10 -11.84 1.50 N 
200 1 N   B ALA 99  ? ? CA  B ALA 99  ? ? CB  B ALA 99  ? ? 120.73 110.10 10.63  1.40 N 
201 1 CB  B LYS 100 ? ? CG  B LYS 100 ? ? CD  B LYS 100 ? ? 128.09 111.60 16.49  2.60 N 
202 1 C   B LEU 104 ? ? N   B ASP 105 ? ? CA  B ASP 105 ? ? 138.11 121.70 16.41  2.50 Y 
203 1 CB  B ASP 105 ? ? CG  B ASP 105 ? ? OD1 B ASP 105 ? ? 124.02 118.30 5.72   0.90 N 
204 1 CB  B ASN 106 ? ? CA  B ASN 106 ? ? C   B ASN 106 ? ? 96.25  110.40 -14.15 2.00 N 
205 1 CB  B LEU 107 ? ? CA  B LEU 107 ? ? C   B LEU 107 ? ? 93.79  110.20 -16.41 1.90 N 
206 1 N   B LEU 107 ? ? CA  B LEU 107 ? ? CB  B LEU 107 ? ? 122.59 110.40 12.19  2.00 N 
207 1 C   B ILE 110 ? ? N   B GLU 111 ? ? CA  B GLU 111 ? ? 105.73 121.70 -15.97 2.50 Y 
208 1 CG1 B VAL 112 ? ? CB  B VAL 112 ? ? CG2 B VAL 112 ? ? 96.57  110.90 -14.33 1.60 N 
209 1 NE  B ARG 118 ? ? CZ  B ARG 118 ? ? NH1 B ARG 118 ? ? 123.64 120.30 3.34   0.50 N 
210 1 CA  B GLU 134 ? ? CB  B GLU 134 ? ? CG  B GLU 134 ? ? 129.15 113.40 15.75  2.20 N 
211 1 CA  B THR 138 ? ? CB  B THR 138 ? ? OG1 B THR 138 ? ? 94.98  109.00 -14.02 2.10 N 
212 1 CA  B THR 138 ? ? CB  B THR 138 ? ? CG2 B THR 138 ? ? 122.38 112.40 9.98   1.40 N 
213 1 CB  B ASP 139 ? ? CG  B ASP 139 ? ? OD1 B ASP 139 ? ? 123.72 118.30 5.42   0.90 N 
214 1 CB  B ASP 139 ? ? CG  B ASP 139 ? ? OD2 B ASP 139 ? ? 112.72 118.30 -5.58  0.90 N 
215 1 CA  B ILE 140 ? ? CB  B ILE 140 ? ? CG1 B ILE 140 ? ? 125.74 111.00 14.74  1.90 N 
216 1 CA  B VAL 143 ? ? CB  B VAL 143 ? ? CG1 B VAL 143 ? ? 120.74 110.90 9.84   1.50 N 
217 1 CB  B ASP 144 ? ? CG  B ASP 144 ? ? OD2 B ASP 144 ? ? 112.72 118.30 -5.58  0.90 N 
218 1 CB  B ARG 145 ? ? CA  B ARG 145 ? ? C   B ARG 145 ? ? 95.97  110.40 -14.43 2.00 N 
219 1 N   B ARG 145 ? ? CA  B ARG 145 ? ? CB  B ARG 145 ? ? 124.41 110.60 13.81  1.80 N 
220 1 CD  B ARG 145 ? ? NE  B ARG 145 ? ? CZ  B ARG 145 ? ? 111.56 123.60 -12.04 1.40 N 
221 1 CB  B ALA 150 ? ? CA  B ALA 150 ? ? C   B ALA 150 ? ? 100.32 110.10 -9.78  1.50 N 
222 1 CA  B GLU 151 ? ? CB  B GLU 151 ? ? CG  B GLU 151 ? ? 126.74 113.40 13.34  2.20 N 
223 1 CB  B TYR 156 ? ? CG  B TYR 156 ? ? CD2 B TYR 156 ? ? 115.19 121.00 -5.81  0.60 N 
224 1 CB  B TYR 156 ? ? CG  B TYR 156 ? ? CD1 B TYR 156 ? ? 129.03 121.00 8.03   0.60 N 
225 1 CG1 B VAL 157 ? ? CB  B VAL 157 ? ? CG2 B VAL 157 ? ? 100.47 110.90 -10.43 1.60 N 
226 1 N   B LYS 158 ? ? CA  B LYS 158 ? ? C   B LYS 158 ? ? 127.47 111.00 16.47  2.70 N 
227 1 N   B TYR 168 ? ? CA  B TYR 168 ? ? C   B TYR 168 ? ? 131.08 111.00 20.08  2.70 N 
228 1 CB  B ASP 169 ? ? CG  B ASP 169 ? ? OD2 B ASP 169 ? ? 127.89 118.30 9.59   0.90 N 
229 1 C   B ASP 169 ? ? N   B LEU 170 ? ? CA  B LEU 170 ? ? 100.83 121.70 -20.87 2.50 Y 
230 1 CB  B LEU 170 ? ? CA  B LEU 170 ? ? C   B LEU 170 ? ? 124.95 110.20 14.75  1.90 N 
231 1 C   B VAL 172 ? ? N   B ILE 173 ? ? CA  B ILE 173 ? ? 106.68 121.70 -15.02 2.50 Y 
232 1 N   B PHE 176 ? ? CA  B PHE 176 ? ? C   B PHE 176 ? ? 129.27 111.00 18.27  2.70 N 
233 1 CA  B LYS 177 ? ? CB  B LYS 177 ? ? CG  B LYS 177 ? ? 132.17 113.40 18.77  2.20 N 
234 1 C   B ILE 178 ? ? N   B GLU 179 ? ? CA  B GLU 179 ? ? 105.31 121.70 -16.39 2.50 Y 
235 1 N   B GLU 179 ? ? CA  B GLU 179 ? ? C   B GLU 179 ? ? 129.47 111.00 18.47  2.70 N 
236 1 CB  B GLU 183 ? ? CA  B GLU 183 ? ? C   B GLU 183 ? ? 95.11  110.40 -15.29 2.00 N 
237 1 N   B CYS 184 ? ? CA  B CYS 184 ? ? CB  B CYS 184 ? ? 122.08 110.80 11.28  1.50 N 
238 1 CD  B ARG 197 ? ? NE  B ARG 197 ? ? CZ  B ARG 197 ? ? 132.81 123.60 9.21   1.40 N 
239 1 NE  B ARG 197 ? ? CZ  B ARG 197 ? ? NH1 B ARG 197 ? ? 124.53 120.30 4.23   0.50 N 
240 1 N   B TRP 200 ? ? CA  B TRP 200 ? ? CB  B TRP 200 ? ? 123.47 110.60 12.87  1.80 N 
241 1 CB  B TRP 200 ? ? CG  B TRP 200 ? ? CD2 B TRP 200 ? ? 137.01 126.60 10.41  1.30 N 
242 1 CB  B PHE 208 ? ? CG  B PHE 208 ? ? CD1 B PHE 208 ? ? 116.16 120.80 -4.64  0.70 N 
243 1 C   B PHE 208 ? ? N   B ALA 209 ? ? CA  B ALA 209 ? ? 106.53 121.70 -15.17 2.50 Y 
244 1 CB  B ALA 209 ? ? CA  B ALA 209 ? ? C   B ALA 209 ? ? 96.44  110.10 -13.66 1.50 N 
245 1 N   B ALA 209 ? ? CA  B ALA 209 ? ? CB  B ALA 209 ? ? 121.49 110.10 11.39  1.40 N 
246 1 CB  B LEU 212 ? ? CG  B LEU 212 ? ? CD2 B LEU 212 ? ? 98.54  111.00 -12.46 1.70 N 
247 1 N   B GLN 214 ? ? CA  B GLN 214 ? ? CB  B GLN 214 ? ? 121.83 110.60 11.23  1.80 N 
248 1 NH1 B ARG 217 ? ? CZ  B ARG 217 ? ? NH2 B ARG 217 ? ? 126.92 119.40 7.52   1.10 N 
249 1 NE  B ARG 217 ? ? CZ  B ARG 217 ? ? NH2 B ARG 217 ? ? 114.65 120.30 -5.65  0.50 N 
250 1 CA  B ILE 218 ? ? CB  B ILE 218 ? ? CG1 B ILE 218 ? ? 125.56 111.00 14.56  1.90 N 
251 1 N   B GLU 222 ? ? CA  B GLU 222 ? ? C   B GLU 222 ? ? 128.30 111.00 17.30  2.70 N 
252 1 CA  B THR 226 ? ? CB  B THR 226 ? ? CG2 B THR 226 ? ? 125.09 112.40 12.69  1.40 N 
253 1 O   B GLY 227 ? ? C   B GLY 227 ? ? N   B TYR 228 ? ? 133.49 122.70 10.79  1.60 Y 
254 1 CB  B TYR 228 ? ? CG  B TYR 228 ? ? CD1 B TYR 228 ? ? 117.27 121.00 -3.73  0.60 N 
255 1 CG  B MET 229 ? ? SD  B MET 229 ? ? CE  B MET 229 ? ? 88.73  100.20 -11.47 1.60 N 
256 1 CA  B MET 229 ? ? C   B MET 229 ? ? O   B MET 229 ? ? 133.48 120.10 13.38  2.10 N 
257 1 C   B LYS 232 ? ? N   B GLY 233 ? ? CA  B GLY 233 ? ? 108.37 122.30 -13.93 2.10 Y 
258 1 CA  B ILE 234 ? ? CB  B ILE 234 ? ? CG2 B ILE 234 ? ? 97.80  110.90 -13.10 2.00 N 
259 1 CB  B TYR 235 ? ? CG  B TYR 235 ? ? CD2 B TYR 235 ? ? 112.74 121.00 -8.26  0.60 N 
260 1 CB  B TYR 235 ? ? CG  B TYR 235 ? ? CD1 B TYR 235 ? ? 127.76 121.00 6.76   0.60 N 
261 1 O   B ALA 237 ? ? C   B ALA 237 ? ? N   B ASP 238 ? ? 132.60 122.70 9.90   1.60 Y 
262 1 O   B MET 239 ? ? C   B MET 239 ? ? N   B VAL 240 ? ? 113.06 122.70 -9.64  1.60 Y 
263 1 CG1 B VAL 240 ? ? CB  B VAL 240 ? ? CG2 B VAL 240 ? ? 122.80 110.90 11.90  1.60 N 
264 1 N   B LYS 242 ? ? CA  B LYS 242 ? ? CB  B LYS 242 ? ? 122.53 110.60 11.93  1.80 N 
265 1 CA  B LYS 242 ? ? CB  B LYS 242 ? ? CG  B LYS 242 ? ? 131.69 113.40 18.29  2.20 N 
266 1 CD  B LYS 242 ? ? CE  B LYS 242 ? ? NZ  B LYS 242 ? ? 129.65 111.70 17.95  2.30 N 
267 1 C   B LYS 242 ? ? N   B SER 243 ? ? CA  B SER 243 ? ? 105.34 121.70 -16.36 2.50 Y 
268 1 CA  B CYS 247 ? ? CB  B CYS 247 ? ? SG  B CYS 247 ? ? 126.72 114.20 12.52  1.10 N 
269 1 CA  B HIS 248 ? ? CB  B HIS 248 ? ? CG  B HIS 248 ? ? 103.25 113.60 -10.35 1.70 N 
270 1 C   B HIS 248 ? ? N   B THR 249 ? ? CA  B THR 249 ? ? 103.79 121.70 -17.91 2.50 Y 
271 1 CB  B LEU 260 ? ? CA  B LEU 260 ? ? C   B LEU 260 ? ? 97.44  110.20 -12.76 1.90 N 
272 1 OE1 B GLU 262 ? ? CD  B GLU 262 ? ? OE2 B GLU 262 ? ? 109.20 123.30 -14.10 1.20 N 
273 1 CA  B VAL 263 ? ? CB  B VAL 263 ? ? CG2 B VAL 263 ? ? 121.27 110.90 10.37  1.50 N 
274 1 CG  B MET 268 ? ? SD  B MET 268 ? ? CE  B MET 268 ? ? 115.70 100.20 15.50  1.60 N 
275 1 CD1 B TYR 269 ? ? CG  B TYR 269 ? ? CD2 B TYR 269 ? ? 124.62 117.90 6.72   1.10 N 
276 1 CG  B TYR 269 ? ? CD1 B TYR 269 ? ? CE1 B TYR 269 ? ? 116.13 121.30 -5.17  0.80 N 
277 1 CB  B HIS 273 ? ? CA  B HIS 273 ? ? C   B HIS 273 ? ? 94.40  110.40 -16.00 2.00 N 
278 1 CA  B ILE 277 ? ? C   B ILE 277 ? ? N   B SER 278 ? ? 103.62 117.20 -13.58 2.20 Y 
279 1 C   B ILE 277 ? ? N   B SER 278 ? ? CA  B SER 278 ? ? 105.48 121.70 -16.22 2.50 Y 
280 1 O   B SER 278 ? ? C   B SER 278 ? ? N   B LYS 279 ? ? 133.09 122.70 10.39  1.60 Y 
281 1 CB  B PRO 281 ? ? CA  B PRO 281 ? ? C   B PRO 281 ? ? 125.75 111.70 14.05  2.10 N 
282 1 N   B PRO 281 ? ? CA  B PRO 281 ? ? CB  B PRO 281 ? ? 90.74  103.30 -12.56 1.20 N 
283 1 CA  B LYS 282 ? ? C   B LYS 282 ? ? N   B GLY 283 ? ? 95.15  116.20 -21.05 2.00 Y 
284 1 O   B LYS 282 ? ? C   B LYS 282 ? ? N   B GLY 283 ? ? 140.60 123.20 17.40  1.70 Y 
285 1 C   B LYS 282 ? ? N   B GLY 283 ? ? CA  B GLY 283 ? ? 102.38 122.30 -19.92 2.10 Y 
286 1 CA  B LYS 292 ? ? CB  B LYS 292 ? ? CG  B LYS 292 ? ? 126.96 113.40 13.56  2.20 N 
287 1 CA  B PRO 295 ? ? N   B PRO 295 ? ? CD  B PRO 295 ? ? 102.69 111.70 -9.01  1.40 N 
288 1 CA  B ILE 301 ? ? CB  B ILE 301 ? ? CG1 B ILE 301 ? ? 96.25  111.00 -14.75 1.90 N 
289 1 CB  B SER 302 ? ? CA  B SER 302 ? ? C   B SER 302 ? ? 97.77  110.10 -12.33 1.90 N 
290 1 N   B SER 302 ? ? CA  B SER 302 ? ? CB  B SER 302 ? ? 120.93 110.50 10.43  1.50 N 
291 1 CB  B LEU 303 ? ? CG  B LEU 303 ? ? CD1 B LEU 303 ? ? 95.80  111.00 -15.20 1.70 N 
292 1 CA  B ASP 304 ? ? CB  B ASP 304 ? ? CG  B ASP 304 ? ? 131.67 113.40 18.27  2.20 N 
293 1 OD1 B ASP 304 ? ? CG  B ASP 304 ? ? OD2 B ASP 304 ? ? 111.84 123.30 -11.46 1.90 N 
294 1 CB  B ASP 304 ? ? CG  B ASP 304 ? ? OD2 B ASP 304 ? ? 124.53 118.30 6.23   0.90 N 
295 1 CG1 B VAL 306 ? ? CB  B VAL 306 ? ? CG2 B VAL 306 ? ? 94.84  110.90 -16.06 1.60 N 
296 1 CA  B VAL 306 ? ? CB  B VAL 306 ? ? CG2 B VAL 306 ? ? 130.59 110.90 19.69  1.50 N 
297 1 C   B SER 316 ? ? N   B GLY 317 ? ? CA  B GLY 317 ? ? 107.25 122.30 -15.05 2.10 Y 
298 1 N   B GLY 317 ? ? CA  B GLY 317 ? ? C   B GLY 317 ? ? 128.46 113.10 15.36  2.50 N 
299 1 C   B VAL 318 ? ? N   B ASN 319 ? ? CA  B ASN 319 ? ? 98.70  121.70 -23.00 2.50 Y 
300 1 CA  B SER 322 ? ? CB  B SER 322 ? ? OG  B SER 322 ? ? 127.67 111.20 16.47  2.70 N 
301 1 O   B SER 322 ? ? C   B SER 322 ? ? N   B LEU 323 ? ? 112.30 122.70 -10.40 1.60 Y 
302 1 CB  B LEU 324 ? ? CA  B LEU 324 ? ? C   B LEU 324 ? ? 98.14  110.20 -12.06 1.90 N 
303 1 CB  B TYR 325 ? ? CG  B TYR 325 ? ? CD2 B TYR 325 ? ? 114.09 121.00 -6.91  0.60 N 
304 1 CD1 B TYR 325 ? ? CG  B TYR 325 ? ? CD2 B TYR 325 ? ? 125.00 117.90 7.10   1.10 N 
305 1 N   B GLU 327 ? ? CA  B GLU 327 ? ? CB  B GLU 327 ? ? 97.52  110.60 -13.08 1.80 N 
306 1 CB  B TYR 328 ? ? CG  B TYR 328 ? ? CD2 B TYR 328 ? ? 113.05 121.00 -7.95  0.60 N 
307 1 CG1 B ILE 329 ? ? CB  B ILE 329 ? ? CG2 B ILE 329 ? ? 96.51  111.40 -14.89 2.20 N 
308 1 CB  B ILE 329 ? ? CG1 B ILE 329 ? ? CD1 B ILE 329 ? ? 94.84  113.90 -19.06 2.80 N 
309 1 CA  B VAL 336 ? ? CB  B VAL 336 ? ? CG2 B VAL 336 ? ? 121.44 110.90 10.54  1.50 N 
310 1 C   B ASN 337 ? ? N   B LEU 338 ? ? CA  B LEU 338 ? ? 105.80 121.70 -15.90 2.50 Y 
311 1 CB  B LEU 338 ? ? CA  B LEU 338 ? ? C   B LEU 338 ? ? 122.36 110.20 12.16  1.90 N 
312 1 N   B TYR 340 ? ? CA  B TYR 340 ? ? CB  B TYR 340 ? ? 98.64  110.60 -11.96 1.80 N 
313 1 CB  B TYR 340 ? ? CG  B TYR 340 ? ? CD1 B TYR 340 ? ? 117.05 121.00 -3.95  0.60 N 
314 1 N   B LEU 344 ? ? CA  B LEU 344 ? ? CB  B LEU 344 ? ? 95.10  110.40 -15.30 2.00 N 
315 1 CB  B LEU 344 ? ? CG  B LEU 344 ? ? CD1 B LEU 344 ? ? 100.78 111.00 -10.22 1.70 N 
316 1 CA  B LYS 345 ? ? C   B LYS 345 ? ? N   B PHE 346 ? ? 98.90  117.20 -18.30 2.20 Y 
317 1 CA  B PHE 346 ? ? CB  B PHE 346 ? ? CG  B PHE 346 ? ? 95.29  113.90 -18.61 2.40 N 
318 1 CB  B PHE 346 ? ? CG  B PHE 346 ? ? CD2 B PHE 346 ? ? 115.24 120.80 -5.56  0.70 N 
319 1 CD1 B PHE 346 ? ? CG  B PHE 346 ? ? CD2 B PHE 346 ? ? 131.50 118.30 13.20  1.30 N 
320 1 CB  B PHE 346 ? ? CG  B PHE 346 ? ? CD1 B PHE 346 ? ? 113.24 120.80 -7.56  0.70 N 
321 1 CG  B PHE 346 ? ? CD2 B PHE 346 ? ? CE2 B PHE 346 ? ? 112.20 120.80 -8.60  1.10 N 
322 1 N   B ASN 347 ? ? CA  B ASN 347 ? ? CB  B ASN 347 ? ? 90.97  110.60 -19.63 1.80 N 
323 1 C   B ASN 347 ? ? N   B PHE 348 ? ? CA  B PHE 348 ? ? 106.23 121.70 -15.47 2.50 Y 
324 1 CA  B LYS 349 ? ? CB  B LYS 349 ? ? CG  B LYS 349 ? ? 130.90 113.40 17.50  2.20 N 
325 1 CD  B LYS 349 ? ? CE  B LYS 349 ? ? NZ  B LYS 349 ? ? 96.99  111.70 -14.71 2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 SER A 2   ? ? -42.46  89.23   
2   1 LYS A 3   ? ? 38.74   -85.98  
3   1 PRO A 5   ? ? -46.23  164.82  
4   1 ILE A 12  ? ? -41.69  -84.75  
5   1 LYS A 13  ? ? -34.59  -28.40  
6   1 GLU A 29  ? ? 101.35  12.95   
7   1 LEU A 32  ? ? -33.93  -34.68  
8   1 LYS A 34  ? ? -63.97  -74.48  
9   1 LEU A 37  ? ? -73.85  37.93   
10  1 LYS A 39  ? ? -26.53  -30.12  
11  1 ARG A 43  ? ? -3.88   -93.52  
12  1 GLN A 61  ? ? -105.88 78.25   
13  1 SER A 63  ? ? 84.91   144.91  
14  1 SER A 66  ? ? -46.10  13.25   
15  1 TYR A 76  ? ? -66.47  -75.73  
16  1 THR A 77  ? ? -24.91  -51.55  
17  1 PRO A 80  ? ? -49.78  107.07  
18  1 MET A 85  ? ? -118.62 -144.91 
19  1 LYS A 86  ? ? 91.54   166.86  
20  1 ASN A 92  ? ? -160.23 39.60   
21  1 ASP A 95  ? ? -50.98  -84.91  
22  1 SER A 96  ? ? -36.55  -32.20  
23  1 LEU A 107 ? ? -34.47  -39.53  
24  1 LEU A 116 ? ? -48.72  -77.35  
25  1 LEU A 117 ? ? -10.13  -80.62  
26  1 ARG A 118 ? ? -18.19  -37.16  
27  1 ASP A 122 ? ? -68.51  49.24   
28  1 SER A 124 ? ? 120.98  -65.44  
29  1 LYS A 126 ? ? 71.82   63.74   
30  1 ASP A 127 ? ? -54.59  179.68  
31  1 PRO A 128 ? ? -69.49  8.31    
32  1 ASP A 130 ? ? -92.48  35.08   
33  1 VAL A 131 ? ? -131.74 -50.15  
34  1 ASN A 132 ? ? -47.20  -76.86  
35  1 TYR A 133 ? ? -25.88  -30.48  
36  1 LYS A 137 ? ? 31.10   69.04   
37  1 ASP A 144 ? ? -48.75  88.18   
38  1 ARG A 145 ? ? 24.07   -72.93  
39  1 THR A 163 ? ? 27.41   -100.96 
40  1 ASN A 166 ? ? -56.56  92.94   
41  1 TYR A 168 ? ? 15.31   151.84  
42  1 GLN A 185 ? ? -14.91  -84.19  
43  1 LYS A 188 ? ? -26.15  -62.62  
44  1 LYS A 191 ? ? -56.61  -8.90   
45  1 ASN A 195 ? ? 39.68   54.11   
46  1 THR A 205 ? ? 46.39   -53.94  
47  1 PRO A 221 ? ? -29.33  -58.12  
48  1 SER A 241 ? ? -33.92  -78.99  
49  1 TYR A 246 ? ? -68.59  7.64    
50  1 ASP A 253 ? ? -31.65  124.06  
51  1 HIS A 276 ? ? -69.32  43.26   
52  1 SER A 278 ? ? 175.75  -25.05  
53  1 SER A 286 ? ? 177.79  156.89  
54  1 PRO A 295 ? ? -31.98  107.84  
55  1 ASP A 296 ? ? -41.54  95.50   
56  1 PRO A 297 ? ? -10.44  -65.28  
57  1 SER A 298 ? ? -23.61  -59.40  
58  1 ILE A 301 ? ? -26.82  142.93  
59  1 ASP A 304 ? ? 33.18   42.59   
60  1 LEU A 310 ? ? -82.68  44.73   
61  1 ASN A 319 ? ? -79.05  -72.42  
62  1 ASP A 320 ? ? 13.55   13.25   
63  1 GLN A 335 ? ? -69.75  7.99    
64  1 LYS A 339 ? ? -109.15 -76.60  
65  1 LYS A 349 ? ? -16.95  145.54  
66  1 PRO B 5   ? ? -39.34  137.86  
67  1 ASP B 10  ? ? -39.36  -88.33  
68  1 PHE B 16  ? ? -75.63  28.07   
69  1 ASP B 17  ? ? -69.39  92.12   
70  1 VAL B 18  ? ? -57.12  -8.61   
71  1 GLU B 19  ? ? -58.69  -72.65  
72  1 MET B 21  ? ? -20.82  -97.65  
73  1 VAL B 26  ? ? -23.57  -57.24  
74  1 ILE B 30  ? ? -23.40  137.77  
75  1 ASP B 31  ? ? -69.99  90.95   
76  1 LEU B 32  ? ? -61.69  8.31    
77  1 LEU B 37  ? ? -24.82  -65.38  
78  1 LEU B 40  ? ? -15.97  139.63  
79  1 ALA B 47  ? ? -50.46  -72.74  
80  1 SER B 63  ? ? -56.00  170.94  
81  1 ASP B 65  ? ? -29.56  -45.16  
82  1 SER B 66  ? ? -43.24  -76.70  
83  1 ILE B 68  ? ? -27.84  -69.84  
84  1 PHE B 75  ? ? -56.38  -86.02  
85  1 TYR B 76  ? ? -40.15  6.97    
86  1 PRO B 89  ? ? -33.55  141.21  
87  1 ASP B 95  ? ? -39.29  -98.94  
88  1 SER B 96  ? ? -31.49  -27.71  
89  1 MET B 103 ? ? -28.58  -37.29  
90  1 ASP B 105 ? ? -54.22  -76.43  
91  1 ASN B 106 ? ? -57.83  -0.11   
92  1 ILE B 110 ? ? -27.68  -52.90  
93  1 ALA B 113 ? ? -42.17  -81.40  
94  1 TYR B 114 ? ? -3.04   -83.33  
95  1 SER B 124 ? ? 73.65   -105.52 
96  1 PRO B 128 ? ? -23.68  -76.49  
97  1 LYS B 137 ? ? 27.54   40.28   
98  1 VAL B 157 ? ? -52.52  -75.08  
99  1 HIS B 161 ? ? -45.93  177.62  
100 1 THR B 163 ? ? -17.95  -176.28 
101 1 THR B 164 ? ? 46.36   -153.47 
102 1 HIS B 165 ? ? -13.73  77.49   
103 1 ALA B 167 ? ? 125.04  66.63   
104 1 LEU B 170 ? ? -101.50 47.78   
105 1 GLU B 171 ? ? -31.59  134.24  
106 1 PHE B 176 ? ? 46.88   134.05  
107 1 ASN B 195 ? ? 85.30   31.83   
108 1 PHE B 208 ? ? -24.43  -44.89  
109 1 GLN B 214 ? ? -141.15 23.68   
110 1 LEU B 216 ? ? -26.66  108.14  
111 1 ALA B 219 ? ? -38.88  146.30  
112 1 GLU B 222 ? ? -28.34  -49.96  
113 1 LYS B 232 ? ? -111.99 68.00   
114 1 SER B 241 ? ? -7.76   -74.18  
115 1 ASN B 245 ? ? -37.65  -39.99  
116 1 GLN B 251 ? ? -48.29  58.74   
117 1 ASP B 253 ? ? 29.25   88.24   
118 1 SER B 275 ? ? -165.21 98.37   
119 1 LYS B 282 ? ? -19.92  126.05  
120 1 LEU B 290 ? ? -62.72  -168.63 
121 1 PRO B 295 ? ? -25.67  119.62  
122 1 ASP B 296 ? ? -54.23  107.28  
123 1 ILE B 301 ? ? -57.51  100.56  
124 1 SER B 302 ? ? -64.08  33.44   
125 1 THR B 312 ? ? 18.48   103.88  
126 1 ASN B 319 ? ? -108.22 74.89   
127 1 ASP B 320 ? ? 175.64  4.93    
128 1 ASN B 326 ? ? 21.82   111.46  
129 1 LYS B 349 ? ? -62.98  -153.62 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1  1 SER A 2   ? ? LYS A 3   ? ? 120.42  
2  1 LEU A 37  ? ? GLY A 38  ? ? 128.21  
3  1 LYS A 39  ? ? LEU A 40  ? ? -139.60 
4  1 LYS A 42  ? ? ARG A 43  ? ? 125.12  
5  1 ASP A 65  ? ? SER A 66  ? ? 144.31  
6  1 LEU A 71  ? ? SER A 72  ? ? 148.63  
7  1 PHE A 83  ? ? GLY A 84  ? ? -68.13  
8  1 GLY A 84  ? ? MET A 85  ? ? 47.80   
9  1 GLY A 119 ? ? GLY A 120 ? ? -149.74 
10 1 GLY A 120 ? ? SER A 121 ? ? -141.06 
11 1 SER A 121 ? ? ASP A 122 ? ? 126.74  
12 1 SER A 125 ? ? LYS A 126 ? ? -55.28  
13 1 ASN A 132 ? ? TYR A 133 ? ? 147.59  
14 1 ASP A 144 ? ? ARG A 145 ? ? 139.30  
15 1 THR A 160 ? ? HIS A 161 ? ? 149.51  
16 1 ALA A 162 ? ? THR A 163 ? ? 142.76  
17 1 HIS A 165 ? ? ASN A 166 ? ? 97.44   
18 1 ASN A 166 ? ? ALA A 167 ? ? 42.21   
19 1 ALA A 167 ? ? TYR A 168 ? ? -40.82  
20 1 ASP A 169 ? ? LEU A 170 ? ? -145.29 
21 1 CYS A 184 ? ? GLN A 185 ? ? 149.47  
22 1 THR A 205 ? ? THR A 206 ? ? 149.29  
23 1 GLN A 251 ? ? GLY A 252 ? ? 149.56  
24 1 ASN A 319 ? ? ASP A 320 ? ? 136.68  
25 1 TYR A 331 ? ? ASP A 332 ? ? 136.55  
26 1 TYR A 340 ? ? LEU A 341 ? ? 140.48  
27 1 VAL B 18  ? ? GLU B 19  ? ? 146.18  
28 1 SER B 20  ? ? MET B 21  ? ? 139.55  
29 1 TYR B 28  ? ? GLU B 29  ? ? 38.63   
30 1 MET B 35  ? ? PRO B 36  ? ? -149.52 
31 1 GLN B 46  ? ? ALA B 47  ? ? 149.57  
32 1 SER B 50  ? ? ILE B 51  ? ? 144.10  
33 1 PHE B 83  ? ? GLY B 84  ? ? 85.35   
34 1 GLY B 84  ? ? MET B 85  ? ? 44.22   
35 1 LYS B 87  ? ? PRO B 88  ? ? -146.14 
36 1 GLU B 102 ? ? MET B 103 ? ? 148.46  
37 1 ASP B 109 ? ? ILE B 110 ? ? 142.13  
38 1 ALA B 113 ? ? TYR B 114 ? ? 144.17  
39 1 ASP B 146 ? ? SER B 147 ? ? 135.17  
40 1 THR B 160 ? ? HIS B 161 ? ? 143.10  
41 1 ALA B 162 ? ? THR B 163 ? ? 134.40  
42 1 ASP B 169 ? ? LEU B 170 ? ? -148.97 
43 1 ILE B 175 ? ? PHE B 176 ? ? 142.61  
44 1 HIS B 194 ? ? ASN B 195 ? ? 146.10  
45 1 VAL B 240 ? ? SER B 241 ? ? 142.84  
46 1 GLY B 252 ? ? ASP B 253 ? ? -94.72  
47 1 LEU B 259 ? ? LEU B 260 ? ? 149.05  
48 1 THR B 294 ? ? PRO B 295 ? ? 143.98  
49 1 GLY B 311 ? ? THR B 312 ? ? 142.92  
50 1 ASN B 319 ? ? ASP B 320 ? ? -137.33 
51 1 TYR B 325 ? ? ASN B 326 ? ? 131.83  
52 1 ASN B 347 ? ? PHE B 348 ? ? -149.39 
53 1 LYS B 349 ? ? THR B 350 ? ? -113.67 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 LYS A 39  ? ? 10.05  
2 1 VAL A 131 ? ? -11.22 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1 PHE A 16  ? ? 0.093 'SIDE CHAIN' 
2  1 TYR A 28  ? ? 0.177 'SIDE CHAIN' 
3  1 ARG A 43  ? ? 0.088 'SIDE CHAIN' 
4  1 TYR A 49  ? ? 0.077 'SIDE CHAIN' 
5  1 TYR A 76  ? ? 0.163 'SIDE CHAIN' 
6  1 PHE A 83  ? ? 0.130 'SIDE CHAIN' 
7  1 TYR A 133 ? ? 0.127 'SIDE CHAIN' 
8  1 ARG A 145 ? ? 0.098 'SIDE CHAIN' 
9  1 ARG A 154 ? ? 0.116 'SIDE CHAIN' 
10 1 TYR A 168 ? ? 0.128 'SIDE CHAIN' 
11 1 ARG A 217 ? ? 0.171 'SIDE CHAIN' 
12 1 TYR A 228 ? ? 0.083 'SIDE CHAIN' 
13 1 PHE A 230 ? ? 0.104 'SIDE CHAIN' 
14 1 TYR A 246 ? ? 0.077 'SIDE CHAIN' 
15 1 TYR A 269 ? ? 0.097 'SIDE CHAIN' 
16 1 HIS A 276 ? ? 0.095 'SIDE CHAIN' 
17 1 TYR A 328 ? ? 0.093 'SIDE CHAIN' 
18 1 TYR A 340 ? ? 0.134 'SIDE CHAIN' 
19 1 PHE A 348 ? ? 0.142 'SIDE CHAIN' 
20 1 TYR B 28  ? ? 0.067 'SIDE CHAIN' 
21 1 TYR B 49  ? ? 0.158 'SIDE CHAIN' 
22 1 TYR B 76  ? ? 0.105 'SIDE CHAIN' 
23 1 ASN B 93  ? ? 0.071 'SIDE CHAIN' 
24 1 TYR B 114 ? ? 0.320 'SIDE CHAIN' 
25 1 TYR B 156 ? ? 0.128 'SIDE CHAIN' 
26 1 PHE B 176 ? ? 0.103 'SIDE CHAIN' 
27 1 ARG B 196 ? ? 0.137 'SIDE CHAIN' 
28 1 ARG B 217 ? ? 0.080 'SIDE CHAIN' 
29 1 TYR B 246 ? ? 0.180 'SIDE CHAIN' 
30 1 TYR B 328 ? ? 0.129 'SIDE CHAIN' 
31 1 TYR B 331 ? ? 0.080 'SIDE CHAIN' 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '2-{3-[4-(4-FLUOROPHENYL)-3,6-DIHYDRO-1(2H)-PYRIDINYL]PROPYL}-8-METHYL-4(3H)-QUINAZOLINONE' FRM 
3 water                                                                                       HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 FRM 1   501 1   FRM FR2 A . 
D 2 FRM 1   502 2   FRM FR2 B . 
E 3 HOH 1   502 1   HOH TIP A . 
E 3 HOH 2   503 2   HOH TIP A . 
E 3 HOH 3   504 3   HOH TIP A . 
E 3 HOH 4   505 4   HOH TIP A . 
E 3 HOH 5   506 7   HOH TIP A . 
E 3 HOH 6   507 13  HOH TIP A . 
E 3 HOH 7   508 14  HOH TIP A . 
E 3 HOH 8   509 15  HOH TIP A . 
E 3 HOH 9   510 18  HOH TIP A . 
E 3 HOH 10  511 20  HOH TIP A . 
E 3 HOH 11  512 23  HOH TIP A . 
E 3 HOH 12  513 24  HOH TIP A . 
E 3 HOH 13  514 25  HOH TIP A . 
E 3 HOH 14  515 27  HOH TIP A . 
E 3 HOH 15  516 31  HOH TIP A . 
E 3 HOH 16  517 32  HOH TIP A . 
E 3 HOH 17  518 34  HOH TIP A . 
E 3 HOH 18  519 36  HOH TIP A . 
E 3 HOH 19  520 39  HOH TIP A . 
E 3 HOH 20  521 41  HOH TIP A . 
E 3 HOH 21  522 42  HOH TIP A . 
E 3 HOH 22  523 43  HOH TIP A . 
E 3 HOH 23  524 46  HOH TIP A . 
E 3 HOH 24  525 48  HOH TIP A . 
E 3 HOH 25  526 49  HOH TIP A . 
E 3 HOH 26  527 55  HOH TIP A . 
E 3 HOH 27  528 56  HOH TIP A . 
E 3 HOH 28  529 58  HOH TIP A . 
E 3 HOH 29  530 60  HOH TIP A . 
E 3 HOH 30  531 63  HOH TIP A . 
E 3 HOH 31  532 64  HOH TIP A . 
E 3 HOH 32  533 65  HOH TIP A . 
E 3 HOH 33  534 67  HOH TIP A . 
E 3 HOH 34  535 68  HOH TIP A . 
E 3 HOH 35  536 69  HOH TIP A . 
E 3 HOH 36  537 70  HOH TIP A . 
E 3 HOH 37  538 73  HOH TIP A . 
E 3 HOH 38  539 74  HOH TIP A . 
E 3 HOH 39  540 75  HOH TIP A . 
E 3 HOH 40  541 77  HOH TIP A . 
E 3 HOH 41  542 78  HOH TIP A . 
E 3 HOH 42  543 80  HOH TIP A . 
E 3 HOH 43  544 84  HOH TIP A . 
E 3 HOH 44  545 85  HOH TIP A . 
E 3 HOH 45  546 89  HOH TIP A . 
E 3 HOH 46  547 94  HOH TIP A . 
E 3 HOH 47  548 97  HOH TIP A . 
E 3 HOH 48  549 98  HOH TIP A . 
E 3 HOH 49  550 100 HOH TIP A . 
E 3 HOH 50  551 101 HOH TIP A . 
E 3 HOH 51  552 102 HOH TIP A . 
E 3 HOH 52  553 105 HOH TIP A . 
E 3 HOH 53  554 112 HOH TIP A . 
E 3 HOH 54  555 113 HOH TIP A . 
E 3 HOH 55  556 114 HOH TIP A . 
E 3 HOH 56  557 115 HOH TIP A . 
E 3 HOH 57  558 117 HOH TIP A . 
E 3 HOH 58  559 119 HOH TIP A . 
E 3 HOH 59  560 120 HOH TIP A . 
E 3 HOH 60  561 127 HOH TIP A . 
E 3 HOH 61  562 129 HOH TIP A . 
E 3 HOH 62  563 131 HOH TIP A . 
E 3 HOH 63  564 133 HOH TIP A . 
E 3 HOH 64  565 136 HOH TIP A . 
E 3 HOH 65  566 142 HOH TIP A . 
E 3 HOH 66  567 143 HOH TIP A . 
E 3 HOH 67  568 145 HOH TIP A . 
E 3 HOH 68  569 146 HOH TIP A . 
E 3 HOH 69  570 148 HOH TIP A . 
E 3 HOH 70  571 149 HOH TIP A . 
E 3 HOH 71  572 153 HOH TIP A . 
E 3 HOH 72  573 159 HOH TIP A . 
E 3 HOH 73  574 162 HOH TIP A . 
E 3 HOH 74  575 164 HOH TIP A . 
E 3 HOH 75  576 165 HOH TIP A . 
E 3 HOH 76  577 167 HOH TIP A . 
E 3 HOH 77  578 168 HOH TIP A . 
E 3 HOH 78  579 170 HOH TIP A . 
E 3 HOH 79  580 174 HOH TIP A . 
E 3 HOH 80  581 175 HOH TIP A . 
E 3 HOH 81  582 176 HOH TIP A . 
E 3 HOH 82  583 179 HOH TIP A . 
E 3 HOH 83  584 181 HOH TIP A . 
E 3 HOH 84  585 182 HOH TIP A . 
E 3 HOH 85  586 185 HOH TIP A . 
E 3 HOH 86  587 186 HOH TIP A . 
E 3 HOH 87  588 187 HOH TIP A . 
E 3 HOH 88  589 188 HOH TIP A . 
E 3 HOH 89  590 193 HOH TIP A . 
E 3 HOH 90  591 194 HOH TIP A . 
E 3 HOH 91  592 195 HOH TIP A . 
E 3 HOH 92  593 198 HOH TIP A . 
E 3 HOH 93  594 199 HOH TIP A . 
E 3 HOH 94  595 201 HOH TIP A . 
E 3 HOH 95  596 202 HOH TIP A . 
E 3 HOH 96  597 203 HOH TIP A . 
E 3 HOH 97  598 204 HOH TIP A . 
E 3 HOH 98  599 208 HOH TIP A . 
E 3 HOH 99  600 209 HOH TIP A . 
E 3 HOH 100 601 211 HOH TIP A . 
E 3 HOH 101 602 213 HOH TIP A . 
E 3 HOH 102 603 214 HOH TIP A . 
E 3 HOH 103 604 218 HOH TIP A . 
E 3 HOH 104 605 223 HOH TIP A . 
E 3 HOH 105 606 224 HOH TIP A . 
E 3 HOH 106 607 225 HOH TIP A . 
E 3 HOH 107 608 227 HOH TIP A . 
E 3 HOH 108 609 228 HOH TIP A . 
E 3 HOH 109 610 229 HOH TIP A . 
E 3 HOH 110 611 230 HOH TIP A . 
E 3 HOH 111 612 231 HOH TIP A . 
E 3 HOH 112 613 234 HOH TIP A . 
E 3 HOH 113 614 236 HOH TIP A . 
E 3 HOH 114 615 237 HOH TIP A . 
E 3 HOH 115 616 238 HOH TIP A . 
E 3 HOH 116 617 240 HOH TIP A . 
E 3 HOH 117 618 242 HOH TIP A . 
E 3 HOH 118 619 244 HOH TIP A . 
E 3 HOH 119 620 247 HOH TIP A . 
E 3 HOH 120 621 248 HOH TIP A . 
E 3 HOH 121 622 249 HOH TIP A . 
E 3 HOH 122 623 250 HOH TIP A . 
E 3 HOH 123 624 252 HOH TIP A . 
E 3 HOH 124 625 253 HOH TIP A . 
F 3 HOH 1   503 5   HOH TIP B . 
F 3 HOH 2   504 6   HOH TIP B . 
F 3 HOH 3   505 8   HOH TIP B . 
F 3 HOH 4   506 9   HOH TIP B . 
F 3 HOH 5   507 10  HOH TIP B . 
F 3 HOH 6   508 11  HOH TIP B . 
F 3 HOH 7   509 12  HOH TIP B . 
F 3 HOH 8   510 16  HOH TIP B . 
F 3 HOH 9   511 17  HOH TIP B . 
F 3 HOH 10  512 19  HOH TIP B . 
F 3 HOH 11  513 21  HOH TIP B . 
F 3 HOH 12  514 22  HOH TIP B . 
F 3 HOH 13  515 26  HOH TIP B . 
F 3 HOH 14  516 28  HOH TIP B . 
F 3 HOH 15  517 29  HOH TIP B . 
F 3 HOH 16  518 30  HOH TIP B . 
F 3 HOH 17  519 33  HOH TIP B . 
F 3 HOH 18  520 35  HOH TIP B . 
F 3 HOH 19  521 37  HOH TIP B . 
F 3 HOH 20  522 38  HOH TIP B . 
F 3 HOH 21  523 40  HOH TIP B . 
F 3 HOH 22  524 44  HOH TIP B . 
F 3 HOH 23  525 45  HOH TIP B . 
F 3 HOH 24  526 47  HOH TIP B . 
F 3 HOH 25  527 50  HOH TIP B . 
F 3 HOH 26  528 51  HOH TIP B . 
F 3 HOH 27  529 52  HOH TIP B . 
F 3 HOH 28  530 53  HOH TIP B . 
F 3 HOH 29  531 54  HOH TIP B . 
F 3 HOH 30  532 57  HOH TIP B . 
F 3 HOH 31  533 59  HOH TIP B . 
F 3 HOH 32  534 61  HOH TIP B . 
F 3 HOH 33  535 62  HOH TIP B . 
F 3 HOH 34  536 66  HOH TIP B . 
F 3 HOH 35  537 71  HOH TIP B . 
F 3 HOH 36  538 72  HOH TIP B . 
F 3 HOH 37  539 76  HOH TIP B . 
F 3 HOH 38  540 79  HOH TIP B . 
F 3 HOH 39  541 81  HOH TIP B . 
F 3 HOH 40  542 82  HOH TIP B . 
F 3 HOH 41  543 83  HOH TIP B . 
F 3 HOH 42  544 86  HOH TIP B . 
F 3 HOH 43  545 87  HOH TIP B . 
F 3 HOH 44  546 88  HOH TIP B . 
F 3 HOH 45  547 90  HOH TIP B . 
F 3 HOH 46  548 91  HOH TIP B . 
F 3 HOH 47  549 92  HOH TIP B . 
F 3 HOH 48  550 93  HOH TIP B . 
F 3 HOH 49  551 95  HOH TIP B . 
F 3 HOH 50  552 96  HOH TIP B . 
F 3 HOH 51  553 99  HOH TIP B . 
F 3 HOH 52  554 103 HOH TIP B . 
F 3 HOH 53  555 104 HOH TIP B . 
F 3 HOH 54  556 106 HOH TIP B . 
F 3 HOH 55  557 107 HOH TIP B . 
F 3 HOH 56  558 108 HOH TIP B . 
F 3 HOH 57  559 109 HOH TIP B . 
F 3 HOH 58  560 110 HOH TIP B . 
F 3 HOH 59  561 111 HOH TIP B . 
F 3 HOH 60  562 116 HOH TIP B . 
F 3 HOH 61  563 118 HOH TIP B . 
F 3 HOH 62  564 121 HOH TIP B . 
F 3 HOH 63  565 122 HOH TIP B . 
F 3 HOH 64  566 123 HOH TIP B . 
F 3 HOH 65  567 124 HOH TIP B . 
F 3 HOH 66  568 125 HOH TIP B . 
F 3 HOH 67  569 126 HOH TIP B . 
F 3 HOH 68  570 128 HOH TIP B . 
F 3 HOH 69  571 130 HOH TIP B . 
F 3 HOH 70  572 132 HOH TIP B . 
F 3 HOH 71  573 134 HOH TIP B . 
F 3 HOH 72  574 135 HOH TIP B . 
F 3 HOH 73  575 137 HOH TIP B . 
F 3 HOH 74  576 138 HOH TIP B . 
F 3 HOH 75  577 139 HOH TIP B . 
F 3 HOH 76  578 140 HOH TIP B . 
F 3 HOH 77  579 141 HOH TIP B . 
F 3 HOH 78  580 144 HOH TIP B . 
F 3 HOH 79  581 147 HOH TIP B . 
F 3 HOH 80  582 150 HOH TIP B . 
F 3 HOH 81  583 151 HOH TIP B . 
F 3 HOH 82  584 152 HOH TIP B . 
F 3 HOH 83  585 154 HOH TIP B . 
F 3 HOH 84  586 155 HOH TIP B . 
F 3 HOH 85  587 156 HOH TIP B . 
F 3 HOH 86  588 157 HOH TIP B . 
F 3 HOH 87  589 158 HOH TIP B . 
F 3 HOH 88  590 160 HOH TIP B . 
F 3 HOH 89  591 161 HOH TIP B . 
F 3 HOH 90  592 163 HOH TIP B . 
F 3 HOH 91  593 166 HOH TIP B . 
F 3 HOH 92  594 169 HOH TIP B . 
F 3 HOH 93  595 171 HOH TIP B . 
F 3 HOH 94  596 172 HOH TIP B . 
F 3 HOH 95  597 173 HOH TIP B . 
F 3 HOH 96  598 177 HOH TIP B . 
F 3 HOH 97  599 178 HOH TIP B . 
F 3 HOH 98  600 180 HOH TIP B . 
F 3 HOH 99  601 183 HOH TIP B . 
F 3 HOH 100 602 184 HOH TIP B . 
F 3 HOH 101 603 189 HOH TIP B . 
F 3 HOH 102 604 190 HOH TIP B . 
F 3 HOH 103 605 191 HOH TIP B . 
F 3 HOH 104 606 192 HOH TIP B . 
F 3 HOH 105 607 196 HOH TIP B . 
F 3 HOH 106 608 197 HOH TIP B . 
F 3 HOH 107 609 200 HOH TIP B . 
F 3 HOH 108 610 205 HOH TIP B . 
F 3 HOH 109 611 206 HOH TIP B . 
F 3 HOH 110 612 207 HOH TIP B . 
F 3 HOH 111 613 210 HOH TIP B . 
F 3 HOH 112 614 212 HOH TIP B . 
F 3 HOH 113 615 215 HOH TIP B . 
F 3 HOH 114 616 216 HOH TIP B . 
F 3 HOH 115 617 217 HOH TIP B . 
F 3 HOH 116 618 219 HOH TIP B . 
F 3 HOH 117 619 220 HOH TIP B . 
F 3 HOH 118 620 221 HOH TIP B . 
F 3 HOH 119 621 222 HOH TIP B . 
F 3 HOH 120 622 226 HOH TIP B . 
F 3 HOH 121 623 232 HOH TIP B . 
F 3 HOH 122 624 233 HOH TIP B . 
F 3 HOH 123 625 235 HOH TIP B . 
F 3 HOH 124 626 239 HOH TIP B . 
F 3 HOH 125 627 241 HOH TIP B . 
F 3 HOH 126 628 243 HOH TIP B . 
F 3 HOH 127 629 245 HOH TIP B . 
F 3 HOH 128 630 246 HOH TIP B . 
F 3 HOH 129 631 251 HOH TIP B . 
#