data_1UMZ
# 
_entry.id   1UMZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1UMZ         
PDBE  EBI-13424    
WWPDB D_1290013424 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1UN1 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'XYLOGLUCAN ENDOTRANSGLYCOSYLASE NATIVE STRUCTURE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1UMZ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2003-09-03 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Johansson, P.'  1 
'Brumer, H.'     2 
'Kallas, A.M.'   3 
'Henriksson, H.' 4 
'Denman, S.E.'   5 
'Teeri, T.T.'    6 
'Jones, T.A.'    7 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structures of a Poplar Xyloglucan Endotransglycosylase Reveal Details of Transglycosylation Acceptor Binding' 
_citation.journal_abbrev            'Plant Cell' 
_citation.journal_volume            16 
_citation.page_first                874 
_citation.page_last                 ? 
_citation.year                      2004 
_citation.journal_id_ASTM           PLCEEW 
_citation.country                   US 
_citation.journal_id_ISSN           1040-4651 
_citation.journal_id_CSD            2109 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15020748 
_citation.pdbx_database_id_DOI      10.1105/TPC.020065 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Johansson, P.'  1 ? 
primary 'Brumer, H.'     2 ? 
primary 'Baumann, M.J.'  3 ? 
primary 'Kallas, A.M.'   4 ? 
primary 'Henriksson, H.' 5 ? 
primary 'Denman, S.E.'   6 ? 
primary 'Teeri, T.T.'    7 ? 
primary 'Jones, T.A.'    8 ? 
# 
_cell.entry_id           1UMZ 
_cell.length_a           188.162 
_cell.length_b           188.162 
_cell.length_c           45.896 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1UMZ 
_symmetry.space_group_name_H-M             'P 63' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                173 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer  man 'XYLOGLUCAN ENDOTRANSGLYCOSYLASE' 32531.570 2   2.4.1.207 ? ? ? 
2 branched man 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   2   
?         ? ? ? 
3 branched man 
;alpha-D-xylopyranose-(1-6)-beta-D-glucopyranose-(1-4)-[beta-D-galactopyranose-(1-2)-alpha-D-xylopyranose-(1-6)]beta-D-glucopyranose-(1-4)-beta-D-glucopyranose
;
930.808   2   ?         ? ? ? 
4 water    nat water 18.015    245 ?         ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;(UNK)ETAAFAALRKPVDVAFGRNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDSAGT
VTAFYLSSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKEFHYYSVLWNMYMIVFLVDDVPIRV
FKNCKDLGVKFPFNQPMKIYSSLWNADDWATRGGLEKTDWSKAPFIASYRSFHIDGCEASVEAKFCATQGARWWDQKEFQ
DLDAFQYRRLSWVRQKYTIYNYCTDRSRYPSMPPECKRDRDI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;XETAAFAALRKPVDVAFGRNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDSAGTVTAF
YLSSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKEFHYYSVLWNMYMIVFLVDDVPIRVFKNC
KDLGVKFPFNQPMKIYSSLWNADDWATRGGLEKTDWSKAPFIASYRSFHIDGCEASVEAKFCATQGARWWDQKEFQDLDA
FQYRRLSWVRQKYTIYNYCTDRSRYPSMPPECKRDRDI
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   UNK n 
1 2   GLU n 
1 3   THR n 
1 4   ALA n 
1 5   ALA n 
1 6   PHE n 
1 7   ALA n 
1 8   ALA n 
1 9   LEU n 
1 10  ARG n 
1 11  LYS n 
1 12  PRO n 
1 13  VAL n 
1 14  ASP n 
1 15  VAL n 
1 16  ALA n 
1 17  PHE n 
1 18  GLY n 
1 19  ARG n 
1 20  ASN n 
1 21  TYR n 
1 22  VAL n 
1 23  PRO n 
1 24  THR n 
1 25  TRP n 
1 26  ALA n 
1 27  PHE n 
1 28  ASP n 
1 29  HIS n 
1 30  ILE n 
1 31  LYS n 
1 32  TYR n 
1 33  PHE n 
1 34  ASN n 
1 35  GLY n 
1 36  GLY n 
1 37  ASN n 
1 38  GLU n 
1 39  ILE n 
1 40  GLN n 
1 41  LEU n 
1 42  HIS n 
1 43  LEU n 
1 44  ASP n 
1 45  LYS n 
1 46  TYR n 
1 47  THR n 
1 48  GLY n 
1 49  THR n 
1 50  GLY n 
1 51  PHE n 
1 52  GLN n 
1 53  SER n 
1 54  LYS n 
1 55  GLY n 
1 56  SER n 
1 57  TYR n 
1 58  LEU n 
1 59  PHE n 
1 60  GLY n 
1 61  HIS n 
1 62  PHE n 
1 63  SER n 
1 64  MET n 
1 65  GLN n 
1 66  MET n 
1 67  LYS n 
1 68  LEU n 
1 69  VAL n 
1 70  PRO n 
1 71  GLY n 
1 72  ASP n 
1 73  SER n 
1 74  ALA n 
1 75  GLY n 
1 76  THR n 
1 77  VAL n 
1 78  THR n 
1 79  ALA n 
1 80  PHE n 
1 81  TYR n 
1 82  LEU n 
1 83  SER n 
1 84  SER n 
1 85  GLN n 
1 86  ASN n 
1 87  SER n 
1 88  GLU n 
1 89  HIS n 
1 90  ASP n 
1 91  GLU n 
1 92  ILE n 
1 93  ASP n 
1 94  PHE n 
1 95  GLU n 
1 96  PHE n 
1 97  LEU n 
1 98  GLY n 
1 99  ASN n 
1 100 ARG n 
1 101 THR n 
1 102 GLY n 
1 103 GLN n 
1 104 PRO n 
1 105 TYR n 
1 106 ILE n 
1 107 LEU n 
1 108 GLN n 
1 109 THR n 
1 110 ASN n 
1 111 VAL n 
1 112 PHE n 
1 113 THR n 
1 114 GLY n 
1 115 GLY n 
1 116 LYS n 
1 117 GLY n 
1 118 ASP n 
1 119 ARG n 
1 120 GLU n 
1 121 GLN n 
1 122 ARG n 
1 123 ILE n 
1 124 TYR n 
1 125 LEU n 
1 126 TRP n 
1 127 PHE n 
1 128 ASP n 
1 129 PRO n 
1 130 THR n 
1 131 LYS n 
1 132 GLU n 
1 133 PHE n 
1 134 HIS n 
1 135 TYR n 
1 136 TYR n 
1 137 SER n 
1 138 VAL n 
1 139 LEU n 
1 140 TRP n 
1 141 ASN n 
1 142 MET n 
1 143 TYR n 
1 144 MET n 
1 145 ILE n 
1 146 VAL n 
1 147 PHE n 
1 148 LEU n 
1 149 VAL n 
1 150 ASP n 
1 151 ASP n 
1 152 VAL n 
1 153 PRO n 
1 154 ILE n 
1 155 ARG n 
1 156 VAL n 
1 157 PHE n 
1 158 LYS n 
1 159 ASN n 
1 160 CYS n 
1 161 LYS n 
1 162 ASP n 
1 163 LEU n 
1 164 GLY n 
1 165 VAL n 
1 166 LYS n 
1 167 PHE n 
1 168 PRO n 
1 169 PHE n 
1 170 ASN n 
1 171 GLN n 
1 172 PRO n 
1 173 MET n 
1 174 LYS n 
1 175 ILE n 
1 176 TYR n 
1 177 SER n 
1 178 SER n 
1 179 LEU n 
1 180 TRP n 
1 181 ASN n 
1 182 ALA n 
1 183 ASP n 
1 184 ASP n 
1 185 TRP n 
1 186 ALA n 
1 187 THR n 
1 188 ARG n 
1 189 GLY n 
1 190 GLY n 
1 191 LEU n 
1 192 GLU n 
1 193 LYS n 
1 194 THR n 
1 195 ASP n 
1 196 TRP n 
1 197 SER n 
1 198 LYS n 
1 199 ALA n 
1 200 PRO n 
1 201 PHE n 
1 202 ILE n 
1 203 ALA n 
1 204 SER n 
1 205 TYR n 
1 206 ARG n 
1 207 SER n 
1 208 PHE n 
1 209 HIS n 
1 210 ILE n 
1 211 ASP n 
1 212 GLY n 
1 213 CYS n 
1 214 GLU n 
1 215 ALA n 
1 216 SER n 
1 217 VAL n 
1 218 GLU n 
1 219 ALA n 
1 220 LYS n 
1 221 PHE n 
1 222 CYS n 
1 223 ALA n 
1 224 THR n 
1 225 GLN n 
1 226 GLY n 
1 227 ALA n 
1 228 ARG n 
1 229 TRP n 
1 230 TRP n 
1 231 ASP n 
1 232 GLN n 
1 233 LYS n 
1 234 GLU n 
1 235 PHE n 
1 236 GLN n 
1 237 ASP n 
1 238 LEU n 
1 239 ASP n 
1 240 ALA n 
1 241 PHE n 
1 242 GLN n 
1 243 TYR n 
1 244 ARG n 
1 245 ARG n 
1 246 LEU n 
1 247 SER n 
1 248 TRP n 
1 249 VAL n 
1 250 ARG n 
1 251 GLN n 
1 252 LYS n 
1 253 TYR n 
1 254 THR n 
1 255 ILE n 
1 256 TYR n 
1 257 ASN n 
1 258 TYR n 
1 259 CYS n 
1 260 THR n 
1 261 ASP n 
1 262 ARG n 
1 263 SER n 
1 264 ARG n 
1 265 TYR n 
1 266 PRO n 
1 267 SER n 
1 268 MET n 
1 269 PRO n 
1 270 PRO n 
1 271 GLU n 
1 272 CYS n 
1 273 LYS n 
1 274 ARG n 
1 275 ASP n 
1 276 ARG n 
1 277 ASP n 
1 278 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'EUROPEAN ASPEN' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'POPULUS TREMULA' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     113636 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'PICHIA PASTORIS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PPIC9 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 1UMZ   1 ? ? 1UMZ   ? 
2 UNP Q8GZD5 1 ? ? Q8GZD5 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1UMZ A 1 ? 6   ? 1UMZ   -6 ? -1  ? -6 -1  
2 2 1UMZ A 7 ? 278 ? Q8GZD5 23 ? 294 ? 1  272 
3 1 1UMZ B 1 ? 6   ? 1UMZ   -6 ? -1  ? -6 -1  
4 2 1UMZ B 7 ? 278 ? Q8GZD5 23 ? 294 ? 1  272 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
BGC 'D-saccharide, beta linking'  . beta-D-glucopyranose                     ? 'C6 H12 O6'      180.156 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                     ? 'C6 H12 O6'      180.156 
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GAL 'D-saccharide, beta linking'  . beta-D-galactopyranose                   ? 'C6 H12 O6'      180.156 
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
UNK 'L-peptide linking'           . UNKNOWN                                  ? 'C4 H9 N O2'     103.120 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146 
XYS 'D-saccharide, alpha linking' . alpha-D-xylopyranose                     ? 'C5 H10 O5'      150.130 
# 
_exptl.entry_id          1UMZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.0 
_exptl_crystal.density_percent_sol   68 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '10 MG ML-1 PROTEIN SOLUTION 1:1 WITH 1.0 M NAOAC AND 0.2 M IMIDAZOLE PH 6.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2002-09-15 
_diffrn_detector.details                'TOROIDAL MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DIAMOND (111), GE (220)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.933 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1UMZ 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            1.800 
_reflns.number_obs                   83886 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            0.06300 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.4000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.610 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.83 
_reflns_shell.percent_possible_all   71.7 
_reflns_shell.Rmerge_I_obs           0.66200 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.000 
_reflns_shell.pdbx_redundancy        2.20 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1UMZ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     79649 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             28.99 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    96.7 
_refine.ls_R_factor_obs                          0.203 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.201 
_refine.ls_R_factor_R_free                       0.222 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  4215 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.946 
_refine.B_iso_mean                               27.91 
_refine.aniso_B[1][1]                            0.00000 
_refine.aniso_B[2][2]                            0.00000 
_refine.aniso_B[3][3]                            0.00000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1UN1' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.106 
_refine.pdbx_overall_ESU_R_Free                  0.101 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4417 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         202 
_refine_hist.number_atoms_solvent             245 
_refine_hist.number_atoms_total               4864 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        28.99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014 0.021 ? 4769 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.000 0.020 ? 3955 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.562 1.961 ? 6489 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            4.163 3.000 ? 9145 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.929 5.000 ? 529  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.093 0.200 ? 682  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.007 0.020 ? 5163 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.010 0.020 ? 1092 'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.221 0.200 ? 831  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.288 0.200 ? 4437 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.121 0.200 ? 2290 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.204 0.200 ? 248  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.169 0.200 ? 7    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.269 0.200 ? 51   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.094 0.200 ? 3    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.038 1.500 ? 2639 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.935 2.000 ? 4246 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.478 3.000 ? 2130 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.918 4.500 ? 2242 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.85 
_refine_ls_shell.number_reflns_R_work             4400 
_refine_ls_shell.R_factor_R_work                  0.2720 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3020 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             230 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.844600 
_struct_ncs_oper.matrix[1][2]   0.533500 
_struct_ncs_oper.matrix[1][3]   0.045600 
_struct_ncs_oper.matrix[2][1]   -0.528600 
_struct_ncs_oper.matrix[2][2]   0.844300 
_struct_ncs_oper.matrix[2][3]   -0.087500 
_struct_ncs_oper.matrix[3][1]   -0.085200 
_struct_ncs_oper.matrix[3][2]   0.049800 
_struct_ncs_oper.matrix[3][3]   0.995100 
_struct_ncs_oper.vector[1]      -1.29480 
_struct_ncs_oper.vector[2]      1.23610 
_struct_ncs_oper.vector[3]      10.36060 
# 
_struct.entry_id                  1UMZ 
_struct.title                     'Xyloglucan endotransglycosylase in complex with the xyloglucan nonasaccharide XLLG.' 
_struct.pdbx_descriptor           'XYLOGLUCAN ENDOTRANSGLYCOSYLASE (E.C.2.4.1.207)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UMZ 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
'GLYCOSIDE HYDROLASE, XET, XTH, XEH, TRANSGLYCOSYLATION, XYLOGLUCAN, TRANSFERASE, GLYCOSYLTRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 16  ? ASN A 20  ? ALA A 10  ASN A 14  1 ? 5  
HELX_P HELX_P2  2  ALA A 26  ? ASP A 28  ? ALA A 20  ASP A 22  5 ? 3  
HELX_P HELX_P3  3  ASN A 34  ? GLY A 36  ? ASN A 28  GLY A 30  5 ? 3  
HELX_P HELX_P4  4  CYS A 160 ? GLY A 164 ? CYS A 154 GLY A 158 5 ? 5  
HELX_P HELX_P5  5  THR A 187 ? LEU A 191 ? THR A 181 LEU A 185 5 ? 5  
HELX_P HELX_P6  6  ASP A 195 ? ALA A 199 ? ASP A 189 ALA A 193 5 ? 5  
HELX_P HELX_P7  7  ARG A 228 ? GLN A 232 ? ARG A 222 GLN A 226 5 ? 5  
HELX_P HELX_P8  8  GLN A 232 ? GLN A 236 ? GLN A 226 GLN A 230 5 ? 5  
HELX_P HELX_P9  9  ASP A 239 ? TYR A 253 ? ASP A 233 TYR A 247 1 ? 15 
HELX_P HELX_P10 10 CYS A 259 ? ASP A 261 ? CYS A 253 ASP A 255 5 ? 3  
HELX_P HELX_P11 11 PRO A 270 ? ARG A 276 ? PRO A 264 ARG A 270 1 ? 7  
HELX_P HELX_P12 12 ALA B 16  ? ASN B 20  ? ALA B 10  ASN B 14  1 ? 5  
HELX_P HELX_P13 13 ALA B 26  ? ASP B 28  ? ALA B 20  ASP B 22  5 ? 3  
HELX_P HELX_P14 14 CYS B 160 ? GLY B 164 ? CYS B 154 GLY B 158 5 ? 5  
HELX_P HELX_P15 15 THR B 187 ? LEU B 191 ? THR B 181 LEU B 185 5 ? 5  
HELX_P HELX_P16 16 ASP B 195 ? ALA B 199 ? ASP B 189 ALA B 193 5 ? 5  
HELX_P HELX_P17 17 ARG B 228 ? GLN B 232 ? ARG B 222 GLN B 226 5 ? 5  
HELX_P HELX_P18 18 GLN B 232 ? GLN B 236 ? GLN B 226 GLN B 230 5 ? 5  
HELX_P HELX_P19 19 ASP B 239 ? TYR B 253 ? ASP B 233 TYR B 247 1 ? 15 
HELX_P HELX_P20 20 CYS B 259 ? ASP B 261 ? CYS B 253 ASP B 255 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 213 SG  ? ? ? 1_555 A CYS 222 SG ? ? A CYS 207 A CYS 216 1_555 ? ? ? ? ? ? ? 2.186 ? ?               
disulf2  disulf ?    ? A CYS 259 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 253 A CYS 266 1_555 ? ? ? ? ? ? ? 2.063 ? ?               
disulf3  disulf ?    ? B CYS 213 SG  ? ? ? 1_555 B CYS 222 SG ? ? B CYS 207 B CYS 216 1_555 ? ? ? ? ? ? ? 2.662 ? ?               
disulf4  disulf ?    ? B CYS 259 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 253 B CYS 266 1_555 ? ? ? ? ? ? ? 2.075 ? ?               
covale1  covale one  ? A ASN 99  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 93  C NAG 1   1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
covale2  covale one  ? B ASN 99  ND2 ? ? ? 1_555 E NAG .   C1 ? ? B ASN 93  E NAG 1   1_555 ? ? ? ? ? ? ? 1.428 ? N-Glycosylation 
covale3  covale one  ? B GLN 103 NE2 ? ? ? 1_555 E NAG .   O6 ? ? B GLN 97  E NAG 1   1_555 ? ? ? ? ? ? ? 1.919 ? ?               
covale4  covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.448 ? ?               
covale5  covale both ? C NAG .   O4  ? ? ? 1_555 C BMA .   C1 ? ? C NAG 2   C BMA 3   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale6  covale both ? D BGC .   O4  ? ? ? 1_555 D BGC .   C1 ? ? D BGC 1   D BGC 2   1_555 ? ? ? ? ? ? ? 1.436 ? ?               
covale7  covale both ? D BGC .   O4  ? ? ? 1_555 D BGC .   C1 ? ? D BGC 2   D BGC 3   1_555 ? ? ? ? ? ? ? 1.453 ? ?               
covale8  covale both ? D BGC .   O6  ? ? ? 1_555 D XYS .   C1 ? ? D BGC 2   D XYS 5   1_555 ? ? ? ? ? ? ? 1.764 ? ?               
covale9  covale both ? D BGC .   O6  ? ? ? 1_555 D XYS .   C1 ? ? D BGC 3   D XYS 4   1_555 ? ? ? ? ? ? ? 1.443 ? ?               
covale10 covale both ? D XYS .   O2  ? ? ? 1_555 D GAL .   C1 ? ? D XYS 5   D GAL 6   1_555 ? ? ? ? ? ? ? 1.450 ? ?               
covale11 covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? E NAG 1   E NAG 2   1_555 ? ? ? ? ? ? ? 1.440 ? ?               
covale12 covale both ? E NAG .   O4  ? ? ? 1_555 E BMA .   C1 ? ? E NAG 2   E BMA 3   1_555 ? ? ? ? ? ? ? 1.434 ? ?               
covale13 covale both ? F BGC .   O4  ? ? ? 1_555 F BGC .   C1 ? ? F BGC 1   F BGC 2   1_555 ? ? ? ? ? ? ? 1.440 ? ?               
covale14 covale both ? F BGC .   O4  ? ? ? 1_555 F BGC .   C1 ? ? F BGC 2   F BGC 3   1_555 ? ? ? ? ? ? ? 1.441 ? ?               
covale15 covale both ? F BGC .   O6  ? ? ? 1_555 F XYS .   C1 ? ? F BGC 2   F XYS 5   1_555 ? ? ? ? ? ? ? 1.644 ? ?               
covale16 covale both ? F BGC .   O6  ? ? ? 1_555 F XYS .   C1 ? ? F BGC 3   F XYS 4   1_555 ? ? ? ? ? ? ? 1.452 ? ?               
covale17 covale both ? F XYS .   O2  ? ? ? 1_555 F GAL .   C1 ? ? F XYS 5   F GAL 6   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 199 A . ? ALA 193 A PRO 200 A ? PRO 194 A 1 3.01  
2 ALA 199 B . ? ALA 193 B PRO 200 B ? PRO 194 B 1 10.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 8 ? 
AB ? 7 ? 
BA ? 8 ? 
BB ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AA 6 7 ? anti-parallel 
AA 7 8 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AB 6 7 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BA 5 6 ? anti-parallel 
BA 6 7 ? anti-parallel 
BA 7 8 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BB 4 5 ? anti-parallel 
BB 5 6 ? anti-parallel 
BB 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 TYR A 21  ? TRP A 25  ? TYR A 15  TRP A 19  
AA 2 THR A 49  ? SER A 53  ? THR A 43  SER A 47  
AA 3 LYS A 174 ? ASN A 181 ? LYS A 168 ASN A 175 
AA 4 THR A 76  ? SER A 83  ? THR A 70  SER A 77  
AA 5 GLU A 91  ? LEU A 97  ? GLU A 85  LEU A 91  
AA 6 ILE A 106 ? PHE A 112 ? ILE A 100 PHE A 106 
AA 7 GLN A 121 ? ILE A 123 ? GLN A 115 ILE A 117 
AA 8 THR A 254 ? ASN A 257 ? THR A 248 ASN A 251 
AB 1 ILE A 30  ? PHE A 33  ? ILE A 24  PHE A 27  
AB 2 GLU A 38  ? LEU A 43  ? GLU A 32  LEU A 37  
AB 3 PHE A 201 ? GLU A 214 ? PHE A 195 GLU A 208 
AB 4 TYR A 57  ? LYS A 67  ? TYR A 51  LYS A 61  
AB 5 HIS A 134 ? TRP A 140 ? HIS A 128 TRP A 134 
AB 6 MET A 144 ? VAL A 149 ? MET A 138 VAL A 143 
AB 7 VAL A 152 ? LYS A 158 ? VAL A 146 LYS A 152 
BA 1 TYR B 21  ? TRP B 25  ? TYR B 15  TRP B 19  
BA 2 THR B 49  ? SER B 53  ? THR B 43  SER B 47  
BA 3 LYS B 174 ? ASN B 181 ? LYS B 168 ASN B 175 
BA 4 THR B 76  ? SER B 83  ? THR B 70  SER B 77  
BA 5 GLU B 91  ? LEU B 97  ? GLU B 85  LEU B 91  
BA 6 ILE B 106 ? PHE B 112 ? ILE B 100 PHE B 106 
BA 7 GLN B 121 ? ILE B 123 ? GLN B 115 ILE B 117 
BA 8 THR B 254 ? ASN B 257 ? THR B 248 ASN B 251 
BB 1 ILE B 30  ? PHE B 33  ? ILE B 24  PHE B 27  
BB 2 GLU B 38  ? LEU B 43  ? GLU B 32  LEU B 37  
BB 3 PHE B 201 ? GLU B 214 ? PHE B 195 GLU B 208 
BB 4 TYR B 57  ? LYS B 67  ? TYR B 51  LYS B 61  
BB 5 HIS B 134 ? TRP B 140 ? HIS B 128 TRP B 134 
BB 6 MET B 144 ? VAL B 149 ? MET B 138 VAL B 143 
BB 7 VAL B 152 ? LYS B 158 ? VAL B 146 LYS B 152 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N THR A 24  ? N THR A 18  O GLY A 50  ? O GLY A 44  
AA 2 3 N SER A 53  ? N SER A 47  O ILE A 175 ? O ILE A 169 
AA 3 4 N TRP A 180 ? N TRP A 174 O VAL A 77  ? O VAL A 71  
AA 4 5 N LEU A 82  ? N LEU A 76  O ILE A 92  ? O ILE A 86  
AA 5 6 N LEU A 97  ? N LEU A 91  O ILE A 106 ? O ILE A 100 
AA 6 7 N THR A 109 ? N THR A 103 O GLN A 121 ? O GLN A 115 
AA 7 8 O ARG A 122 ? O ARG A 116 N ILE A 255 ? N ILE A 249 
AB 1 2 N PHE A 33  ? N PHE A 27  O GLU A 38  ? O GLU A 32  
AB 2 3 N LEU A 43  ? N LEU A 37  O PHE A 201 ? O PHE A 195 
AB 3 4 O CYS A 213 ? O CYS A 207 N LEU A 58  ? N LEU A 52  
AB 4 5 N MET A 66  ? N MET A 60  O HIS A 134 ? O HIS A 128 
AB 5 6 N LEU A 139 ? N LEU A 133 O VAL A 146 ? O VAL A 140 
AB 6 7 N VAL A 149 ? N VAL A 143 O VAL A 152 ? O VAL A 146 
BA 1 2 N THR B 24  ? N THR B 18  O GLY B 50  ? O GLY B 44  
BA 2 3 N SER B 53  ? N SER B 47  O ILE B 175 ? O ILE B 169 
BA 3 4 N TRP B 180 ? N TRP B 174 O VAL B 77  ? O VAL B 71  
BA 4 5 N LEU B 82  ? N LEU B 76  O ILE B 92  ? O ILE B 86  
BA 5 6 N LEU B 97  ? N LEU B 91  O ILE B 106 ? O ILE B 100 
BA 6 7 N THR B 109 ? N THR B 103 O GLN B 121 ? O GLN B 115 
BA 7 8 O ARG B 122 ? O ARG B 116 N ILE B 255 ? N ILE B 249 
BB 1 2 N PHE B 33  ? N PHE B 27  O GLU B 38  ? O GLU B 32  
BB 2 3 N LEU B 43  ? N LEU B 37  O PHE B 201 ? O PHE B 195 
BB 3 4 O CYS B 213 ? O CYS B 207 N LEU B 58  ? N LEU B 52  
BB 4 5 N MET B 66  ? N MET B 60  O HIS B 134 ? O HIS B 128 
BB 5 6 N LEU B 139 ? N LEU B 133 O VAL B 146 ? O VAL B 140 
BB 6 7 N VAL B 149 ? N VAL B 143 O VAL B 152 ? O VAL B 146 
# 
_database_PDB_matrix.entry_id          1UMZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1UMZ 
_atom_sites.fract_transf_matrix[1][1]   0.005314 
_atom_sites.fract_transf_matrix[1][2]   0.003068 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006137 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021788 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 12  ? 59.503 58.647 -7.137  1.00   50.94 ? 6    PRO A N   1 
ATOM   2    C CA  . PRO A 1 12  ? 60.143 57.301 -7.033  1.00   50.43 ? 6    PRO A CA  1 
ATOM   3    C C   . PRO A 1 12  ? 60.708 56.794 -8.363  1.00   49.88 ? 6    PRO A C   1 
ATOM   4    O O   . PRO A 1 12  ? 59.982 56.759 -9.354  1.00   49.70 ? 6    PRO A O   1 
ATOM   5    C CB  . PRO A 1 12  ? 58.986 56.407 -6.564  1.00   50.53 ? 6    PRO A CB  1 
ATOM   6    C CG  . PRO A 1 12  ? 58.087 57.345 -5.785  1.00   50.82 ? 6    PRO A CG  1 
ATOM   7    C CD  . PRO A 1 12  ? 58.160 58.653 -6.525  1.00   51.11 ? 6    PRO A CD  1 
ATOM   8    N N   . VAL A 1 13  ? 61.985 56.406 -8.359  1.00   49.20 ? 7    VAL A N   1 
ATOM   9    C CA  . VAL A 1 13  ? 62.655 55.795 -9.511  1.00   48.63 ? 7    VAL A CA  1 
ATOM   10   C C   . VAL A 1 13  ? 62.724 54.270 -9.331  1.00   47.27 ? 7    VAL A C   1 
ATOM   11   O O   . VAL A 1 13  ? 63.252 53.779 -8.328  1.00   47.81 ? 7    VAL A O   1 
ATOM   12   C CB  . VAL A 1 13  ? 64.095 56.338 -9.668  1.00   48.69 ? 7    VAL A CB  1 
ATOM   13   C CG1 . VAL A 1 13  ? 64.710 55.876 -10.989 1.00   49.58 ? 7    VAL A CG1 1 
ATOM   14   C CG2 . VAL A 1 13  ? 64.115 57.871 -9.557  1.00   49.32 ? 7    VAL A CG2 1 
ATOM   15   N N   . ASP A 1 14  ? 62.211 53.527 -10.308 1.00   45.69 ? 8    ASP A N   1 
ATOM   16   C CA  . ASP A 1 14  ? 62.205 52.061 -10.241 1.00   44.17 ? 8    ASP A CA  1 
ATOM   17   C C   . ASP A 1 14  ? 63.583 51.482 -10.544 1.00   42.43 ? 8    ASP A C   1 
ATOM   18   O O   . ASP A 1 14  ? 64.197 51.817 -11.563 1.00   42.35 ? 8    ASP A O   1 
ATOM   19   C CB  . ASP A 1 14  ? 61.187 51.467 -11.215 1.00   44.51 ? 8    ASP A CB  1 
ATOM   20   C CG  . ASP A 1 14  ? 59.768 51.939 -10.946 1.00   45.69 ? 8    ASP A CG  1 
ATOM   21   O OD1 . ASP A 1 14  ? 59.450 52.372 -9.813  1.00   45.53 ? 8    ASP A OD1 1 
ATOM   22   O OD2 . ASP A 1 14  ? 58.894 51.907 -11.829 1.00   49.67 ? 8    ASP A OD2 1 
ATOM   23   N N   . VAL A 1 15  ? 64.054 50.601 -9.663  1.00   39.28 ? 9    VAL A N   1 
ATOM   24   C CA  . VAL A 1 15  ? 65.341 49.931 -9.810  1.00   37.32 ? 9    VAL A CA  1 
ATOM   25   C C   . VAL A 1 15  ? 65.148 48.430 -9.576  1.00   35.68 ? 9    VAL A C   1 
ATOM   26   O O   . VAL A 1 15  ? 64.032 47.986 -9.245  1.00   34.43 ? 9    VAL A O   1 
ATOM   27   C CB  . VAL A 1 15  ? 66.383 50.491 -8.822  1.00   37.56 ? 9    VAL A CB  1 
ATOM   28   C CG1 . VAL A 1 15  ? 66.579 52.014 -9.013  1.00   37.81 ? 9    VAL A CG1 1 
ATOM   29   C CG2 . VAL A 1 15  ? 65.994 50.182 -7.352  1.00   37.43 ? 9    VAL A CG2 1 
ATOM   30   N N   . ALA A 1 16  ? 66.216 47.647 -9.748  1.00   33.35 ? 10   ALA A N   1 
ATOM   31   C CA  . ALA A 1 16  ? 66.117 46.207 -9.517  1.00   32.19 ? 10   ALA A CA  1 
ATOM   32   C C   . ALA A 1 16  ? 66.250 45.939 -8.023  1.00   30.37 ? 10   ALA A C   1 
ATOM   33   O O   . ALA A 1 16  ? 66.957 46.654 -7.317  1.00   29.64 ? 10   ALA A O   1 
ATOM   34   C CB  . ALA A 1 16  ? 67.186 45.441 -10.262 1.00   32.52 ? 10   ALA A CB  1 
ATOM   35   N N   . PHE A 1 17  ? 65.599 44.872 -7.588  1.00   28.55 ? 11   PHE A N   1 
ATOM   36   C CA  . PHE A 1 17  ? 65.635 44.414 -6.197  1.00   27.91 ? 11   PHE A CA  1 
ATOM   37   C C   . PHE A 1 17  ? 67.053 44.398 -5.622  1.00   28.81 ? 11   PHE A C   1 
ATOM   38   O O   . PHE A 1 17  ? 67.310 44.982 -4.570  1.00   27.73 ? 11   PHE A O   1 
ATOM   39   C CB  . PHE A 1 17  ? 64.990 43.023 -6.125  1.00   26.72 ? 11   PHE A CB  1 
ATOM   40   C CG  . PHE A 1 17  ? 65.150 42.319 -4.793  1.00   26.54 ? 11   PHE A CG  1 
ATOM   41   C CD1 . PHE A 1 17  ? 66.274 41.561 -4.518  1.00   27.11 ? 11   PHE A CD1 1 
ATOM   42   C CD2 . PHE A 1 17  ? 64.140 42.383 -3.842  1.00   25.56 ? 11   PHE A CD2 1 
ATOM   43   C CE1 . PHE A 1 17  ? 66.409 40.896 -3.287  1.00   27.54 ? 11   PHE A CE1 1 
ATOM   44   C CE2 . PHE A 1 17  ? 64.261 41.705 -2.620  1.00   24.53 ? 11   PHE A CE2 1 
ATOM   45   C CZ  . PHE A 1 17  ? 65.391 40.981 -2.344  1.00   26.49 ? 11   PHE A CZ  1 
ATOM   46   N N   . GLY A 1 18  ? 67.984 43.769 -6.343  1.00   29.23 ? 12   GLY A N   1 
ATOM   47   C CA  . GLY A 1 18  ? 69.328 43.542 -5.850  1.00   29.86 ? 12   GLY A CA  1 
ATOM   48   C C   . GLY A 1 18  ? 70.200 44.779 -5.675  1.00   30.58 ? 12   GLY A C   1 
ATOM   49   O O   . GLY A 1 18  ? 71.230 44.716 -5.009  1.00   31.08 ? 12   GLY A O   1 
ATOM   50   N N   . ARG A 1 19  ? 69.783 45.908 -6.228  1.00   31.13 ? 13   ARG A N   1 
ATOM   51   C CA  . ARG A 1 19  ? 70.466 47.160 -5.977  1.00   31.53 ? 13   ARG A CA  1 
ATOM   52   C C   . ARG A 1 19  ? 70.368 47.577 -4.500  1.00   30.43 ? 13   ARG A C   1 
ATOM   53   O O   . ARG A 1 19  ? 71.329 48.079 -3.939  1.00   30.14 ? 13   ARG A O   1 
ATOM   54   C CB  . ARG A 1 19  ? 69.899 48.275 -6.849  1.00   32.90 ? 13   ARG A CB  1 
ATOM   55   C CG  . ARG A 1 19  ? 70.531 49.627 -6.548  1.00   37.71 ? 13   ARG A CG  1 
ATOM   56   C CD  . ARG A 1 19  ? 70.081 50.784 -7.419  1.00   43.61 ? 13   ARG A CD  1 
ATOM   57   N NE  . ARG A 1 19  ? 71.080 51.861 -7.385  1.00   49.26 ? 13   ARG A NE  1 
ATOM   58   C CZ  . ARG A 1 19  ? 71.972 52.129 -8.352  1.00   52.46 ? 13   ARG A CZ  1 
ATOM   59   N NH1 . ARG A 1 19  ? 72.009 51.418 -9.480  1.00   53.71 ? 13   ARG A NH1 1 
ATOM   60   N NH2 . ARG A 1 19  ? 72.834 53.132 -8.187  1.00   53.71 ? 13   ARG A NH2 1 
ATOM   61   N N   . ASN A 1 20  ? 69.204 47.366 -3.889  1.00   27.99 ? 14   ASN A N   1 
ATOM   62   C CA  . ASN A 1 20  ? 68.915 47.927 -2.569  1.00   26.49 ? 14   ASN A CA  1 
ATOM   63   C C   . ASN A 1 20  ? 68.619 46.897 -1.482  1.00   25.00 ? 14   ASN A C   1 
ATOM   64   O O   . ASN A 1 20  ? 68.685 47.238 -0.307  1.00   24.38 ? 14   ASN A O   1 
ATOM   65   C CB  . ASN A 1 20  ? 67.712 48.863 -2.673  1.00   26.60 ? 14   ASN A CB  1 
ATOM   66   C CG  . ASN A 1 20  ? 68.056 50.232 -3.289  1.00   28.05 ? 14   ASN A CG  1 
ATOM   67   O OD1 . ASN A 1 20  ? 67.203 50.884 -3.869  1.00   30.19 ? 14   ASN A OD1 1 
ATOM   68   N ND2 . ASN A 1 20  ? 69.276 50.664 -3.121  1.00   29.02 ? 14   ASN A ND2 1 
ATOM   69   N N   . TYR A 1 21  ? 68.284 45.661 -1.863  1.00   23.52 ? 15   TYR A N   1 
ATOM   70   C CA  . TYR A 1 21  ? 67.726 44.659 -0.946  1.00   22.68 ? 15   TYR A CA  1 
ATOM   71   C C   . TYR A 1 21  ? 68.429 43.300 -1.013  1.00   24.31 ? 15   TYR A C   1 
ATOM   72   O O   . TYR A 1 21  ? 69.035 42.939 -2.040  1.00   24.03 ? 15   TYR A O   1 
ATOM   73   C CB  . TYR A 1 21  ? 66.258 44.460 -1.257  1.00   22.33 ? 15   TYR A CB  1 
ATOM   74   C CG  . TYR A 1 21  ? 65.424 45.659 -0.880  1.00   20.85 ? 15   TYR A CG  1 
ATOM   75   C CD1 . TYR A 1 21  ? 65.047 45.869 0.443   1.00   19.50 ? 15   TYR A CD1 1 
ATOM   76   C CD2 . TYR A 1 21  ? 65.017 46.564 -1.809  1.00   18.81 ? 15   TYR A CD2 1 
ATOM   77   C CE1 . TYR A 1 21  ? 64.316 46.936 0.797   1.00   21.16 ? 15   TYR A CE1 1 
ATOM   78   C CE2 . TYR A 1 21  ? 64.283 47.686 -1.463  1.00   20.73 ? 15   TYR A CE2 1 
ATOM   79   C CZ  . TYR A 1 21  ? 63.928 47.861 -0.144  1.00   21.91 ? 15   TYR A CZ  1 
ATOM   80   O OH  . TYR A 1 21  ? 63.187 48.946 0.252   1.00   23.04 ? 15   TYR A OH  1 
ATOM   81   N N   . VAL A 1 22  ? 68.369 42.561 0.089   1.00   23.62 ? 16   VAL A N   1 
ATOM   82   C CA  . VAL A 1 22  ? 68.796 41.176 0.128   1.00   24.64 ? 16   VAL A CA  1 
ATOM   83   C C   . VAL A 1 22  ? 67.703 40.322 0.749   1.00   24.95 ? 16   VAL A C   1 
ATOM   84   O O   . VAL A 1 22  ? 67.013 40.783 1.671   1.00   23.61 ? 16   VAL A O   1 
ATOM   85   C CB  . VAL A 1 22  ? 70.111 40.990 0.912   1.00   24.69 ? 16   VAL A CB  1 
ATOM   86   C CG1 . VAL A 1 22  ? 71.290 41.607 0.115   1.00   28.14 ? 16   VAL A CG1 1 
ATOM   87   C CG2 . VAL A 1 22  ? 70.032 41.593 2.322   1.00   25.69 ? 16   VAL A CG2 1 
ATOM   88   N N   . PRO A 1 23  ? 67.570 39.076 0.306   1.00   24.89 ? 17   PRO A N   1 
ATOM   89   C CA  . PRO A 1 23  ? 66.619 38.163 0.928   1.00   24.98 ? 17   PRO A CA  1 
ATOM   90   C C   . PRO A 1 23  ? 67.117 37.792 2.293   1.00   26.33 ? 17   PRO A C   1 
ATOM   91   O O   . PRO A 1 23  ? 68.342 37.764 2.515   1.00   26.08 ? 17   PRO A O   1 
ATOM   92   C CB  . PRO A 1 23  ? 66.604 36.940 -0.008  1.00   26.28 ? 17   PRO A CB  1 
ATOM   93   C CG  . PRO A 1 23  ? 67.786 37.043 -0.852  1.00   26.01 ? 17   PRO A CG  1 
ATOM   94   C CD  . PRO A 1 23  ? 68.323 38.438 -0.792  1.00   26.42 ? 17   PRO A CD  1 
ATOM   95   N N   . THR A 1 24  ? 66.212 37.546 3.231   1.00   25.61 ? 18   THR A N   1 
ATOM   96   C CA  . THR A 1 24  ? 66.682 37.045 4.525   1.00   26.87 ? 18   THR A CA  1 
ATOM   97   C C   . THR A 1 24  ? 66.202 35.684 4.909   1.00   26.57 ? 18   THR A C   1 
ATOM   98   O O   . THR A 1 24  ? 66.900 35.007 5.673   1.00   28.80 ? 18   THR A O   1 
ATOM   99   C CB  . THR A 1 24  ? 66.349 38.011 5.628   1.00   27.12 ? 18   THR A CB  1 
ATOM   100  O OG1 . THR A 1 24  ? 64.948 38.199 5.676   1.00   29.38 ? 18   THR A OG1 1 
ATOM   101  C CG2 . THR A 1 24  ? 66.895 39.379 5.300   1.00   29.53 ? 18   THR A CG2 1 
ATOM   102  N N   . TRP A 1 25  ? 65.045 35.261 4.415   1.00   24.62 ? 19   TRP A N   1 
ATOM   103  C CA  . TRP A 1 25  ? 64.463 33.981 4.799   1.00   24.53 ? 19   TRP A CA  1 
ATOM   104  C C   . TRP A 1 25  ? 63.787 33.305 3.622   1.00   25.35 ? 19   TRP A C   1 
ATOM   105  O O   . TRP A 1 25  ? 63.025 33.927 2.896   1.00   24.30 ? 19   TRP A O   1 
ATOM   106  C CB  . TRP A 1 25  ? 63.457 34.142 5.959   1.00   23.83 ? 19   TRP A CB  1 
ATOM   107  C CG  . TRP A 1 25  ? 62.971 32.848 6.456   1.00   23.49 ? 19   TRP A CG  1 
ATOM   108  C CD1 . TRP A 1 25  ? 61.828 32.224 6.131   1.00   19.69 ? 19   TRP A CD1 1 
ATOM   109  C CD2 . TRP A 1 25  ? 63.690 31.947 7.306   1.00   19.45 ? 19   TRP A CD2 1 
ATOM   110  N NE1 . TRP A 1 25  ? 61.751 31.005 6.759   1.00   22.33 ? 19   TRP A NE1 1 
ATOM   111  C CE2 . TRP A 1 25  ? 62.899 30.795 7.459   1.00   21.81 ? 19   TRP A CE2 1 
ATOM   112  C CE3 . TRP A 1 25  ? 64.919 32.005 7.951   1.00   20.54 ? 19   TRP A CE3 1 
ATOM   113  C CZ2 . TRP A 1 25  ? 63.282 29.710 8.261   1.00   21.91 ? 19   TRP A CZ2 1 
ATOM   114  C CZ3 . TRP A 1 25  ? 65.308 30.911 8.746   1.00   22.08 ? 19   TRP A CZ3 1 
ATOM   115  C CH2 . TRP A 1 25  ? 64.486 29.805 8.894   1.00   21.44 ? 19   TRP A CH2 1 
ATOM   116  N N   . ALA A 1 26  ? 64.008 31.996 3.507   1.00   26.06 ? 20   ALA A N   1 
ATOM   117  C CA  . ALA A 1 26  ? 63.395 31.168 2.461   1.00   26.83 ? 20   ALA A CA  1 
ATOM   118  C C   . ALA A 1 26  ? 63.656 31.770 1.081   1.00   27.93 ? 20   ALA A C   1 
ATOM   119  O O   . ALA A 1 26  ? 62.752 32.222 0.382   1.00   27.51 ? 20   ALA A O   1 
ATOM   120  C CB  . ALA A 1 26  ? 61.900 30.944 2.723   1.00   26.95 ? 20   ALA A CB  1 
ATOM   121  N N   . PHE A 1 27  ? 64.930 31.755 0.689   1.00   28.85 ? 21   PHE A N   1 
ATOM   122  C CA  . PHE A 1 27  ? 65.385 32.352 -0.569  1.00   29.92 ? 21   PHE A CA  1 
ATOM   123  C C   . PHE A 1 27  ? 64.665 31.788 -1.770  1.00   29.60 ? 21   PHE A C   1 
ATOM   124  O O   . PHE A 1 27  ? 64.463 32.489 -2.756  1.00   31.29 ? 21   PHE A O   1 
ATOM   125  C CB  . PHE A 1 27  ? 66.874 32.092 -0.791  1.00   30.89 ? 21   PHE A CB  1 
ATOM   126  C CG  . PHE A 1 27  ? 67.787 32.810 0.154   1.00   34.23 ? 21   PHE A CG  1 
ATOM   127  C CD1 . PHE A 1 27  ? 67.323 33.481 1.284   1.00   36.04 ? 21   PHE A CD1 1 
ATOM   128  C CD2 . PHE A 1 27  ? 69.152 32.765 -0.068  1.00   38.24 ? 21   PHE A CD2 1 
ATOM   129  C CE1 . PHE A 1 27  ? 68.190 34.108 2.134   1.00   36.38 ? 21   PHE A CE1 1 
ATOM   130  C CE2 . PHE A 1 27  ? 70.015 33.398 0.783   1.00   41.04 ? 21   PHE A CE2 1 
ATOM   131  C CZ  . PHE A 1 27  ? 69.525 34.075 1.889   1.00   40.12 ? 21   PHE A CZ  1 
ATOM   132  N N   . ASP A 1 28  ? 64.275 30.529 -1.690  1.00   28.94 ? 22   ASP A N   1 
ATOM   133  C CA  . ASP A 1 28  ? 63.587 29.869 -2.803  1.00   29.30 ? 22   ASP A CA  1 
ATOM   134  C C   . ASP A 1 28  ? 62.108 30.256 -2.910  1.00   27.54 ? 22   ASP A C   1 
ATOM   135  O O   . ASP A 1 28  ? 61.427 29.884 -3.863  1.00   26.91 ? 22   ASP A O   1 
ATOM   136  C CB  . ASP A 1 28  ? 63.802 28.370 -2.709  1.00   30.17 ? 22   ASP A CB  1 
ATOM   137  C CG  . ASP A 1 28  ? 63.200 27.707 -1.488  1.00   34.32 ? 22   ASP A CG  1 
ATOM   138  O OD1 . ASP A 1 28  ? 62.956 28.406 -0.496  1.00   35.02 ? 22   ASP A OD1 1 
ATOM   139  O OD2 . ASP A 1 28  ? 62.971 26.493 -1.530  1.00   40.58 ? 22   ASP A OD2 1 
ATOM   140  N N   . HIS A 1 29  ? 61.648 31.030 -1.930  1.00   25.10 ? 23   HIS A N   1 
ATOM   141  C CA  . HIS A 1 29  ? 60.256 31.499 -1.929  1.00   22.84 ? 23   HIS A CA  1 
ATOM   142  C C   . HIS A 1 29  ? 60.156 32.899 -2.516  1.00   22.44 ? 23   HIS A C   1 
ATOM   143  O O   . HIS A 1 29  ? 59.062 33.466 -2.562  1.00   21.66 ? 23   HIS A O   1 
ATOM   144  C CB  . HIS A 1 29  ? 59.651 31.452 -0.521  1.00   22.67 ? 23   HIS A CB  1 
ATOM   145  C CG  . HIS A 1 29  ? 59.215 30.007 -0.216  1.00   23.59 ? 23   HIS A CG  1 
ATOM   146  N ND1 . HIS A 1 29  ? 57.920 29.647 0.034   1.00   27.85 ? 23   HIS A ND1 1 
ATOM   147  C CD2 . HIS A 1 29  ? 59.938 28.859 -0.145  1.00   23.75 ? 23   HIS A CD2 1 
ATOM   148  C CE1 . HIS A 1 29  ? 57.860 28.343 0.267   1.00   27.03 ? 23   HIS A CE1 1 
ATOM   149  N NE2 . HIS A 1 29  ? 59.076 27.843 0.171   1.00   28.61 ? 23   HIS A NE2 1 
ATOM   150  N N   . ILE A 1 30  ? 61.276 33.438 -2.995  1.00   22.06 ? 24   ILE A N   1 
ATOM   151  C CA  . ILE A 1 30  ? 61.294 34.726 -3.687  1.00   22.68 ? 24   ILE A CA  1 
ATOM   152  C C   . ILE A 1 30  ? 61.568 34.401 -5.156  1.00   24.15 ? 24   ILE A C   1 
ATOM   153  O O   . ILE A 1 30  ? 62.608 33.849 -5.489  1.00   25.49 ? 24   ILE A O   1 
ATOM   154  C CB  . ILE A 1 30  ? 62.337 35.705 -3.153  1.00   22.80 ? 24   ILE A CB  1 
ATOM   155  C CG1 . ILE A 1 30  ? 62.021 35.948 -1.675  1.00   23.99 ? 24   ILE A CG1 1 
ATOM   156  C CG2 . ILE A 1 30  ? 62.309 37.025 -3.910  1.00   22.80 ? 24   ILE A CG2 1 
ATOM   157  C CD1 . ILE A 1 30  ? 62.927 36.961 -1.018  1.00   25.82 ? 24   ILE A CD1 1 
ATOM   158  N N   . LYS A 1 31  ? 60.638 34.758 -6.025  1.00   24.90 ? 25   LYS A N   1 
ATOM   159  C CA  . LYS A 1 31  ? 60.777 34.550 -7.473  1.00   25.16 ? 25   LYS A CA  1 
ATOM   160  C C   . LYS A 1 31  ? 61.123 35.892 -8.087  1.00   25.21 ? 25   LYS A C   1 
ATOM   161  O O   . LYS A 1 31  ? 60.442 36.886 -7.813  1.00   22.86 ? 25   LYS A O   1 
ATOM   162  C CB  . LYS A 1 31  ? 59.482 34.006 -8.066  1.00   26.00 ? 25   LYS A CB  1 
ATOM   163  C CG  . LYS A 1 31  ? 58.817 32.966 -7.196  1.00   30.50 ? 25   LYS A CG  1 
ATOM   164  C CD  . LYS A 1 31  ? 59.370 31.569 -7.489  1.00   35.54 ? 25   LYS A CD  1 
ATOM   165  C CE  . LYS A 1 31  ? 59.602 30.790 -6.217  1.00   38.65 ? 25   LYS A CE  1 
ATOM   166  N NZ  . LYS A 1 31  ? 58.350 30.171 -5.709  1.00   40.31 ? 25   LYS A NZ  1 
ATOM   167  N N   . TYR A 1 32  ? 62.199 35.922 -8.885  1.00   25.48 ? 26   TYR A N   1 
ATOM   168  C CA  . TYR A 1 32  ? 62.679 37.137 -9.540  1.00   26.16 ? 26   TYR A CA  1 
ATOM   169  C C   . TYR A 1 32  ? 62.293 37.162 -11.018 1.00   27.92 ? 26   TYR A C   1 
ATOM   170  O O   . TYR A 1 32  ? 62.544 36.206 -11.746 1.00   27.70 ? 26   TYR A O   1 
ATOM   171  C CB  . TYR A 1 32  ? 64.203 37.238 -9.403  1.00   27.26 ? 26   TYR A CB  1 
ATOM   172  C CG  . TYR A 1 32  ? 64.706 37.203 -7.958  1.00   29.45 ? 26   TYR A CG  1 
ATOM   173  C CD1 . TYR A 1 32  ? 64.826 36.029 -7.248  1.00   31.70 ? 26   TYR A CD1 1 
ATOM   174  C CD2 . TYR A 1 32  ? 65.048 38.385 -7.310  1.00   33.80 ? 26   TYR A CD2 1 
ATOM   175  C CE1 . TYR A 1 32  ? 65.282 36.016 -5.928  1.00   34.37 ? 26   TYR A CE1 1 
ATOM   176  C CE2 . TYR A 1 32  ? 65.507 38.381 -6.011  1.00   35.38 ? 26   TYR A CE2 1 
ATOM   177  C CZ  . TYR A 1 32  ? 65.624 37.202 -5.303  1.00   35.10 ? 26   TYR A CZ  1 
ATOM   178  O OH  . TYR A 1 32  ? 66.065 37.203 -3.996  1.00   38.81 ? 26   TYR A OH  1 
ATOM   179  N N   . PHE A 1 33  ? 61.704 38.266 -11.468 1.00   27.68 ? 27   PHE A N   1 
ATOM   180  C CA  . PHE A 1 33  ? 61.276 38.422 -12.853 1.00   28.86 ? 27   PHE A CA  1 
ATOM   181  C C   . PHE A 1 33  ? 61.927 39.641 -13.421 1.00   30.26 ? 27   PHE A C   1 
ATOM   182  O O   . PHE A 1 33  ? 62.271 40.576 -12.690 1.00   28.23 ? 27   PHE A O   1 
ATOM   183  C CB  . PHE A 1 33  ? 59.773 38.570 -12.948 1.00   28.98 ? 27   PHE A CB  1 
ATOM   184  C CG  . PHE A 1 33  ? 59.012 37.373 -12.494 1.00   27.33 ? 27   PHE A CG  1 
ATOM   185  C CD1 . PHE A 1 33  ? 58.720 37.194 -11.135 1.00   27.39 ? 27   PHE A CD1 1 
ATOM   186  C CD2 . PHE A 1 33  ? 58.595 36.410 -13.404 1.00   26.76 ? 27   PHE A CD2 1 
ATOM   187  C CE1 . PHE A 1 33  ? 57.993 36.081 -10.713 1.00   27.57 ? 27   PHE A CE1 1 
ATOM   188  C CE2 . PHE A 1 33  ? 57.876 35.306 -13.007 1.00   26.30 ? 27   PHE A CE2 1 
ATOM   189  C CZ  . PHE A 1 33  ? 57.571 35.129 -11.643 1.00   30.51 ? 27   PHE A CZ  1 
ATOM   190  N N   . ASN A 1 34  ? 62.109 39.650 -14.748 1.00   31.96 ? 28   ASN A N   1 
ATOM   191  C CA  . ASN A 1 34  ? 62.688 40.806 -15.437 1.00   32.95 ? 28   ASN A CA  1 
ATOM   192  C C   . ASN A 1 34  ? 63.939 41.340 -14.743 1.00   32.79 ? 28   ASN A C   1 
ATOM   193  O O   . ASN A 1 34  ? 64.079 42.553 -14.479 1.00   32.26 ? 28   ASN A O   1 
ATOM   194  C CB  . ASN A 1 34  ? 61.638 41.902 -15.594 1.00   34.19 ? 28   ASN A CB  1 
ATOM   195  C CG  . ASN A 1 34  ? 60.444 41.462 -16.451 1.00   39.28 ? 28   ASN A CG  1 
ATOM   196  O OD1 . ASN A 1 34  ? 59.293 41.716 -16.087 1.00   46.38 ? 28   ASN A OD1 1 
ATOM   197  N ND2 . ASN A 1 34  ? 60.724 40.826 -17.586 1.00   44.77 ? 28   ASN A ND2 1 
ATOM   198  N N   . GLY A 1 35  ? 64.857 40.430 -14.432 1.00   32.53 ? 29   GLY A N   1 
ATOM   199  C CA  . GLY A 1 35  ? 66.116 40.788 -13.812 1.00   32.53 ? 29   GLY A CA  1 
ATOM   200  C C   . GLY A 1 35  ? 66.024 41.269 -12.353 1.00   33.00 ? 29   GLY A C   1 
ATOM   201  O O   . GLY A 1 35  ? 66.966 41.867 -11.831 1.00   33.08 ? 29   GLY A O   1 
ATOM   202  N N   . GLY A 1 36  ? 64.915 40.962 -11.689 1.00   32.42 ? 30   GLY A N   1 
ATOM   203  C CA  . GLY A 1 36  ? 64.661 41.479 -10.350 1.00   31.94 ? 30   GLY A CA  1 
ATOM   204  C C   . GLY A 1 36  ? 63.899 42.791 -10.327 1.00   31.22 ? 30   GLY A C   1 
ATOM   205  O O   . GLY A 1 36  ? 63.694 43.346 -9.235  1.00   30.79 ? 30   GLY A O   1 
ATOM   206  N N   . ASN A 1 37  ? 63.467 43.304 -11.483 1.00   29.41 ? 31   ASN A N   1 
ATOM   207  C CA  . ASN A 1 37  ? 62.609 44.490 -11.486 1.00   29.17 ? 31   ASN A CA  1 
ATOM   208  C C   . ASN A 1 37  ? 61.215 44.218 -10.893 1.00   28.06 ? 31   ASN A C   1 
ATOM   209  O O   . ASN A 1 37  ? 60.498 45.155 -10.525 1.00   27.98 ? 31   ASN A O   1 
ATOM   210  C CB  . ASN A 1 37  ? 62.484 45.103 -12.885 1.00   30.20 ? 31   ASN A CB  1 
ATOM   211  C CG  . ASN A 1 37  ? 63.762 45.782 -13.347 1.00   31.03 ? 31   ASN A CG  1 
ATOM   212  O OD1 . ASN A 1 37  ? 64.584 46.231 -12.552 1.00   35.76 ? 31   ASN A OD1 1 
ATOM   213  N ND2 . ASN A 1 37  ? 63.944 45.848 -14.663 1.00   36.39 ? 31   ASN A ND2 1 
ATOM   214  N N   . GLU A 1 38  ? 60.824 42.942 -10.852 1.00   26.75 ? 32   GLU A N   1 
ATOM   215  C CA  . GLU A 1 38  ? 59.612 42.488 -10.173 1.00   26.22 ? 32   GLU A CA  1 
ATOM   216  C C   . GLU A 1 38  ? 59.949 41.218 -9.401  1.00   25.86 ? 32   GLU A C   1 
ATOM   217  O O   . GLU A 1 38  ? 60.709 40.354 -9.887  1.00   25.61 ? 32   GLU A O   1 
ATOM   218  C CB  . GLU A 1 38  ? 58.449 42.276 -11.145 1.00   26.86 ? 32   GLU A CB  1 
ATOM   219  C CG  . GLU A 1 38  ? 57.195 41.622 -10.535 1.00   29.16 ? 32   GLU A CG  1 
ATOM   220  C CD  . GLU A 1 38  ? 55.936 41.655 -11.408 1.00   32.85 ? 32   GLU A CD  1 
ATOM   221  O OE1 . GLU A 1 38  ? 55.891 42.425 -12.386 1.00   37.18 ? 32   GLU A OE1 1 
ATOM   222  O OE2 . GLU A 1 38  ? 54.959 40.922 -11.096 1.00   35.58 ? 32   GLU A OE2 1 
ATOM   223  N N   . ILE A 1 39  ? 59.469 41.118 -8.158  1.00   23.69 ? 33   ILE A N   1 
ATOM   224  C CA  . ILE A 1 39  ? 59.604 39.875 -7.411  1.00   22.16 ? 33   ILE A CA  1 
ATOM   225  C C   . ILE A 1 39  ? 58.267 39.401 -6.858  1.00   21.19 ? 33   ILE A C   1 
ATOM   226  O O   . ILE A 1 39  ? 57.320 40.202 -6.703  1.00   20.56 ? 33   ILE A O   1 
ATOM   227  C CB  . ILE A 1 39  ? 60.656 39.956 -6.290  1.00   23.63 ? 33   ILE A CB  1 
ATOM   228  C CG1 . ILE A 1 39  ? 60.155 40.840 -5.174  1.00   23.76 ? 33   ILE A CG1 1 
ATOM   229  C CG2 . ILE A 1 39  ? 62.065 40.338 -6.783  1.00   24.00 ? 33   ILE A CG2 1 
ATOM   230  C CD1 . ILE A 1 39  ? 60.826 40.561 -3.875  1.00   27.77 ? 33   ILE A CD1 1 
ATOM   231  N N   . GLN A 1 40  ? 58.167 38.102 -6.602  1.00   19.58 ? 34   GLN A N   1 
ATOM   232  C CA  . GLN A 1 40  ? 57.018 37.509 -5.956  1.00   20.43 ? 34   GLN A CA  1 
ATOM   233  C C   . GLN A 1 40  ? 57.481 36.841 -4.693  1.00   20.06 ? 34   GLN A C   1 
ATOM   234  O O   . GLN A 1 40  ? 58.496 36.125 -4.687  1.00   21.76 ? 34   GLN A O   1 
ATOM   235  C CB  . GLN A 1 40  ? 56.350 36.452 -6.843  1.00   21.16 ? 34   GLN A CB  1 
ATOM   236  C CG  . GLN A 1 40  ? 55.599 37.018 -7.992  1.00   23.49 ? 34   GLN A CG  1 
ATOM   237  C CD  . GLN A 1 40  ? 54.982 35.931 -8.842  1.00   25.99 ? 34   GLN A CD  1 
ATOM   238  O OE1 . GLN A 1 40  ? 55.227 34.729 -8.634  1.00   30.86 ? 34   GLN A OE1 1 
ATOM   239  N NE2 . GLN A 1 40  ? 54.190 36.334 -9.773  1.00   28.55 ? 34   GLN A NE2 1 
ATOM   240  N N   . LEU A 1 41  ? 56.802 37.129 -3.584  1.00   19.10 ? 35   LEU A N   1 
ATOM   241  C CA  . LEU A 1 41  ? 56.993 36.419 -2.340  1.00   18.54 ? 35   LEU A CA  1 
ATOM   242  C C   . LEU A 1 41  ? 55.889 35.375 -2.197  1.00   18.61 ? 35   LEU A C   1 
ATOM   243  O O   . LEU A 1 41  ? 54.704 35.668 -2.383  1.00   19.25 ? 35   LEU A O   1 
ATOM   244  C CB  . LEU A 1 41  ? 56.910 37.372 -1.119  1.00   17.88 ? 35   LEU A CB  1 
ATOM   245  C CG  . LEU A 1 41  ? 57.866 38.549 -0.994  1.00   22.67 ? 35   LEU A CG  1 
ATOM   246  C CD1 . LEU A 1 41  ? 57.866 39.128 0.427   1.00   20.79 ? 35   LEU A CD1 1 
ATOM   247  C CD2 . LEU A 1 41  ? 59.271 38.312 -1.403  1.00   22.40 ? 35   LEU A CD2 1 
ATOM   248  N N   . HIS A 1 42  ? 56.284 34.148 -1.863  1.00   18.93 ? 36   HIS A N   1 
ATOM   249  C CA  . HIS A 1 42  ? 55.405 33.000 -1.726  1.00   19.53 ? 36   HIS A CA  1 
ATOM   250  C C   . HIS A 1 42  ? 55.327 32.557 -0.255  1.00   19.53 ? 36   HIS A C   1 
ATOM   251  O O   . HIS A 1 42  ? 56.348 32.539 0.453   1.00   20.94 ? 36   HIS A O   1 
ATOM   252  C CB  . HIS A 1 42  ? 55.960 31.830 -2.566  1.00   20.51 ? 36   HIS A CB  1 
ATOM   253  C CG  . HIS A 1 42  ? 55.678 31.955 -4.031  1.00   21.50 ? 36   HIS A CG  1 
ATOM   254  N ND1 . HIS A 1 42  ? 55.896 33.111 -4.735  1.00   27.10 ? 36   HIS A ND1 1 
ATOM   255  C CD2 . HIS A 1 42  ? 55.142 31.074 -4.912  1.00   24.21 ? 36   HIS A CD2 1 
ATOM   256  C CE1 . HIS A 1 42  ? 55.517 32.934 -6.007  1.00   23.30 ? 36   HIS A CE1 1 
ATOM   257  N NE2 . HIS A 1 42  ? 55.087 31.701 -6.137  1.00   26.16 ? 36   HIS A NE2 1 
ATOM   258  N N   . LEU A 1 43  ? 54.124 32.186 0.148   1.00   19.52 ? 37   LEU A N   1 
ATOM   259  C CA  . LEU A 1 43  ? 53.801 31.678 1.480   1.00   20.65 ? 37   LEU A CA  1 
ATOM   260  C C   . LEU A 1 43  ? 53.030 30.361 1.358   1.00   22.00 ? 37   LEU A C   1 
ATOM   261  O O   . LEU A 1 43  ? 52.007 30.276 0.643   1.00   21.80 ? 37   LEU A O   1 
ATOM   262  C CB  . LEU A 1 43  ? 52.944 32.693 2.248   1.00   19.20 ? 37   LEU A CB  1 
ATOM   263  C CG  . LEU A 1 43  ? 52.187 32.279 3.490   1.00   20.08 ? 37   LEU A CG  1 
ATOM   264  C CD1 . LEU A 1 43  ? 53.228 31.927 4.568   1.00   19.45 ? 37   LEU A CD1 1 
ATOM   265  C CD2 . LEU A 1 43  ? 51.236 33.356 3.983   1.00   19.12 ? 37   LEU A CD2 1 
ATOM   266  N N   . ASP A 1 44  ? 53.530 29.330 2.039   1.00   22.95 ? 38   ASP A N   1 
ATOM   267  C CA  . ASP A 1 44  ? 52.810 28.064 2.136   1.00   23.91 ? 38   ASP A CA  1 
ATOM   268  C C   . ASP A 1 44  ? 52.854 27.604 3.591   1.00   24.40 ? 38   ASP A C   1 
ATOM   269  O O   . ASP A 1 44  ? 53.363 28.316 4.443   1.00   23.30 ? 38   ASP A O   1 
ATOM   270  C CB  . ASP A 1 44  ? 53.410 27.007 1.175   1.00   24.76 ? 38   ASP A CB  1 
ATOM   271  C CG  . ASP A 1 44  ? 54.873 26.766 1.404   1.00   26.26 ? 38   ASP A CG  1 
ATOM   272  O OD1 . ASP A 1 44  ? 55.324 26.669 2.572   1.00   25.63 ? 38   ASP A OD1 1 
ATOM   273  O OD2 . ASP A 1 44  ? 55.676 26.691 0.450   1.00   31.71 ? 38   ASP A OD2 1 
ATOM   274  N N   . LYS A 1 45  ? 52.337 26.417 3.881   1.00   24.86 ? 39   LYS A N   1 
ATOM   275  C CA  . LYS A 1 45  ? 52.201 26.015 5.283   1.00   26.36 ? 39   LYS A CA  1 
ATOM   276  C C   . LYS A 1 45  ? 53.527 25.848 6.012   1.00   25.14 ? 39   LYS A C   1 
ATOM   277  O O   . LYS A 1 45  ? 53.550 25.906 7.229   1.00   26.68 ? 39   LYS A O   1 
ATOM   278  C CB  . LYS A 1 45  ? 51.375 24.736 5.419   1.00   27.71 ? 39   LYS A CB  1 
ATOM   279  C CG  . LYS A 1 45  ? 51.983 23.564 4.676   1.00   31.34 ? 39   LYS A CG  1 
ATOM   280  C CD  . LYS A 1 45  ? 50.957 22.461 4.406   1.00   37.02 ? 39   LYS A CD  1 
ATOM   281  C CE  . LYS A 1 45  ? 50.610 21.692 5.651   1.00   41.12 ? 39   LYS A CE  1 
ATOM   282  N NZ  . LYS A 1 45  ? 49.796 20.450 5.319   1.00   43.98 ? 39   LYS A NZ  1 
ATOM   283  N N   . TYR A 1 46  ? 54.620 25.663 5.301   1.00   24.51 ? 40   TYR A N   1 
ATOM   284  C CA  . TYR A 1 46  ? 55.936 25.501 5.946   1.00   24.43 ? 40   TYR A CA  1 
ATOM   285  C C   . TYR A 1 46  ? 56.646 26.808 6.183   1.00   23.54 ? 40   TYR A C   1 
ATOM   286  O O   . TYR A 1 46  ? 57.414 26.951 7.130   1.00   22.63 ? 40   TYR A O   1 
ATOM   287  C CB  . TYR A 1 46  ? 56.845 24.637 5.080   1.00   24.61 ? 40   TYR A CB  1 
ATOM   288  C CG  . TYR A 1 46  ? 56.259 23.261 4.904   1.00   27.71 ? 40   TYR A CG  1 
ATOM   289  C CD1 . TYR A 1 46  ? 56.292 22.338 5.948   1.00   31.09 ? 40   TYR A CD1 1 
ATOM   290  C CD2 . TYR A 1 46  ? 55.642 22.897 3.710   1.00   30.29 ? 40   TYR A CD2 1 
ATOM   291  C CE1 . TYR A 1 46  ? 55.730 21.061 5.804   1.00   31.75 ? 40   TYR A CE1 1 
ATOM   292  C CE2 . TYR A 1 46  ? 55.063 21.634 3.563   1.00   33.55 ? 40   TYR A CE2 1 
ATOM   293  C CZ  . TYR A 1 46  ? 55.116 20.730 4.617   1.00   33.21 ? 40   TYR A CZ  1 
ATOM   294  O OH  . TYR A 1 46  ? 54.557 19.484 4.475   1.00   37.87 ? 40   TYR A OH  1 
ATOM   295  N N   . THR A 1 47  ? 56.474 27.747 5.250   1.00   21.68 ? 41   THR A N   1 
ATOM   296  C CA  . THR A 1 47  ? 57.219 28.985 5.368   1.00   20.53 ? 41   THR A CA  1 
ATOM   297  C C   . THR A 1 47  ? 56.624 30.120 4.545   1.00   19.23 ? 41   THR A C   1 
ATOM   298  O O   . THR A 1 47  ? 56.065 29.886 3.488   1.00   19.50 ? 41   THR A O   1 
ATOM   299  C CB  . THR A 1 47  ? 58.695 28.747 5.031   1.00   20.09 ? 41   THR A CB  1 
ATOM   300  O OG1 . THR A 1 47  ? 59.460 29.926 5.289   1.00   21.08 ? 41   THR A OG1 1 
ATOM   301  C CG2 . THR A 1 47  ? 58.915 28.442 3.544   1.00   22.50 ? 41   THR A CG2 1 
ATOM   302  N N   . GLY A 1 48  ? 56.772 31.333 5.062   1.00   19.81 ? 42   GLY A N   1 
ATOM   303  C CA  . GLY A 1 48  ? 56.718 32.544 4.271   1.00   19.72 ? 42   GLY A CA  1 
ATOM   304  C C   . GLY A 1 48  ? 58.118 32.982 3.919   1.00   20.02 ? 42   GLY A C   1 
ATOM   305  O O   . GLY A 1 48  ? 59.054 32.176 3.841   1.00   20.80 ? 42   GLY A O   1 
ATOM   306  N N   . THR A 1 49  ? 58.301 34.277 3.706   1.00   17.82 ? 43   THR A N   1 
ATOM   307  C CA  . THR A 1 49  ? 59.575 34.787 3.247   1.00   18.49 ? 43   THR A CA  1 
ATOM   308  C C   . THR A 1 49  ? 59.666 36.275 3.513   1.00   19.36 ? 43   THR A C   1 
ATOM   309  O O   . THR A 1 49  ? 58.664 36.931 3.850   1.00   18.78 ? 43   THR A O   1 
ATOM   310  C CB  . THR A 1 49  ? 59.771 34.426 1.733   1.00   19.41 ? 43   THR A CB  1 
ATOM   311  O OG1 . THR A 1 49  ? 61.070 34.852 1.278   1.00   21.35 ? 43   THR A OG1 1 
ATOM   312  C CG2 . THR A 1 49  ? 58.757 35.176 0.916   1.00   20.99 ? 43   THR A CG2 1 
ATOM   313  N N   . GLY A 1 50  ? 60.864 36.800 3.385   1.00   19.14 ? 44   GLY A N   1 
ATOM   314  C CA  . GLY A 1 50  ? 61.116 38.198 3.590   1.00   19.75 ? 44   GLY A CA  1 
ATOM   315  C C   . GLY A 1 50  ? 62.465 38.636 3.094   1.00   19.95 ? 44   GLY A C   1 
ATOM   316  O O   . GLY A 1 50  ? 63.360 37.811 2.764   1.00   19.77 ? 44   GLY A O   1 
ATOM   317  N N   . PHE A 1 51  ? 62.623 39.945 3.069   1.00   17.57 ? 45   PHE A N   1 
ATOM   318  C CA  . PHE A 1 51  ? 63.828 40.578 2.619   1.00   18.74 ? 45   PHE A CA  1 
ATOM   319  C C   . PHE A 1 51  ? 64.055 41.878 3.351   1.00   18.65 ? 45   PHE A C   1 
ATOM   320  O O   . PHE A 1 51  ? 63.168 42.354 4.039   1.00   19.09 ? 45   PHE A O   1 
ATOM   321  C CB  . PHE A 1 51  ? 63.788 40.762 1.079   1.00   18.42 ? 45   PHE A CB  1 
ATOM   322  C CG  . PHE A 1 51  ? 62.708 41.678 0.534   1.00   17.57 ? 45   PHE A CG  1 
ATOM   323  C CD1 . PHE A 1 51  ? 62.908 43.063 0.461   1.00   18.51 ? 45   PHE A CD1 1 
ATOM   324  C CD2 . PHE A 1 51  ? 61.552 41.165 -0.020  1.00   17.92 ? 45   PHE A CD2 1 
ATOM   325  C CE1 . PHE A 1 51  ? 61.992 43.895 -0.098  1.00   19.53 ? 45   PHE A CE1 1 
ATOM   326  C CE2 . PHE A 1 51  ? 60.597 42.003 -0.580  1.00   17.97 ? 45   PHE A CE2 1 
ATOM   327  C CZ  . PHE A 1 51  ? 60.814 43.371 -0.638  1.00   18.23 ? 45   PHE A CZ  1 
ATOM   328  N N   . GLN A 1 52  ? 65.238 42.438 3.207   1.00   18.95 ? 46   GLN A N   1 
ATOM   329  C CA  . GLN A 1 52  ? 65.575 43.670 3.902   1.00   20.25 ? 46   GLN A CA  1 
ATOM   330  C C   . GLN A 1 52  ? 66.600 44.459 3.134   1.00   20.70 ? 46   GLN A C   1 
ATOM   331  O O   . GLN A 1 52  ? 67.303 43.931 2.241   1.00   20.37 ? 46   GLN A O   1 
ATOM   332  C CB  . GLN A 1 52  ? 66.084 43.345 5.313   1.00   21.17 ? 46   GLN A CB  1 
ATOM   333  C CG  . GLN A 1 52  ? 67.454 42.692 5.357   1.00   23.53 ? 46   GLN A CG  1 
ATOM   334  C CD  . GLN A 1 52  ? 67.874 42.336 6.777   1.00   29.52 ? 46   GLN A CD  1 
ATOM   335  O OE1 . GLN A 1 52  ? 68.950 42.733 7.233   1.00   34.83 ? 46   GLN A OE1 1 
ATOM   336  N NE2 . GLN A 1 52  ? 67.042 41.584 7.465   1.00   30.44 ? 46   GLN A NE2 1 
ATOM   337  N N   . SER A 1 53  ? 66.671 45.745 3.449   1.00   20.19 ? 47   SER A N   1 
ATOM   338  C CA  . SER A 1 53  ? 67.597 46.632 2.782   1.00   20.17 ? 47   SER A CA  1 
ATOM   339  C C   . SER A 1 53  ? 69.019 46.324 3.197   1.00   21.68 ? 47   SER A C   1 
ATOM   340  O O   . SER A 1 53  ? 69.282 45.885 4.323   1.00   21.62 ? 47   SER A O   1 
ATOM   341  C CB  . SER A 1 53  ? 67.221 48.077 3.065   1.00   20.36 ? 47   SER A CB  1 
ATOM   342  O OG  . SER A 1 53  ? 67.328 48.427 4.442   1.00   18.79 ? 47   SER A OG  1 
ATOM   343  N N   . LYS A 1 54  ? 69.932 46.493 2.263   1.00   22.79 ? 48   LYS A N   1 
ATOM   344  C CA  . LYS A 1 54  ? 71.375 46.389 2.542   1.00   25.31 ? 48   LYS A CA  1 
ATOM   345  C C   . LYS A 1 54  ? 71.822 47.490 3.501   1.00   25.82 ? 48   LYS A C   1 
ATOM   346  O O   . LYS A 1 54  ? 72.612 47.240 4.398   1.00   28.01 ? 48   LYS A O   1 
ATOM   347  C CB  . LYS A 1 54  ? 72.174 46.481 1.244   1.00   25.53 ? 48   LYS A CB  1 
ATOM   348  C CG  . LYS A 1 54  ? 72.006 45.294 0.326   1.00   29.24 ? 48   LYS A CG  1 
ATOM   349  C CD  . LYS A 1 54  ? 72.639 45.575 -1.040  1.00   33.23 ? 48   LYS A CD  1 
ATOM   350  C CE  . LYS A 1 54  ? 72.675 44.351 -1.911  1.00   35.69 ? 48   LYS A CE  1 
ATOM   351  N NZ  . LYS A 1 54  ? 73.325 44.726 -3.204  1.00   36.95 ? 48   LYS A NZ  1 
ATOM   352  N N   . GLY A 1 55  ? 71.284 48.682 3.326   1.00   25.45 ? 49   GLY A N   1 
ATOM   353  C CA  . GLY A 1 55  ? 71.638 49.831 4.136   1.00   25.69 ? 49   GLY A CA  1 
ATOM   354  C C   . GLY A 1 55  ? 70.674 50.129 5.275   1.00   25.08 ? 49   GLY A C   1 
ATOM   355  O O   . GLY A 1 55  ? 69.565 49.574 5.320   1.00   23.68 ? 49   GLY A O   1 
ATOM   356  N N   . SER A 1 56  ? 71.152 50.955 6.215   1.00   25.64 ? 50   SER A N   1 
ATOM   357  C CA  . SER A 1 56  ? 70.363 51.576 7.304   1.00   25.93 ? 50   SER A CA  1 
ATOM   358  C C   . SER A 1 56  ? 70.296 53.077 7.074   1.00   25.04 ? 50   SER A C   1 
ATOM   359  O O   . SER A 1 56  ? 71.248 53.676 6.551   1.00   25.41 ? 50   SER A O   1 
ATOM   360  C CB  . SER A 1 56  ? 71.039 51.341 8.653   1.00   27.31 ? 50   SER A CB  1 
ATOM   361  O OG  . SER A 1 56  ? 71.055 49.958 8.924   1.00   33.40 ? 50   SER A OG  1 
ATOM   362  N N   . TYR A 1 57  ? 69.184 53.692 7.456   1.00   23.37 ? 51   TYR A N   1 
ATOM   363  C CA  . TYR A 1 57  ? 68.887 55.078 7.102   1.00   23.44 ? 51   TYR A CA  1 
ATOM   364  C C   . TYR A 1 57  ? 68.319 55.820 8.269   1.00   24.33 ? 51   TYR A C   1 
ATOM   365  O O   . TYR A 1 57  ? 67.569 55.250 9.056   1.00   22.29 ? 51   TYR A O   1 
ATOM   366  C CB  . TYR A 1 57  ? 67.876 55.131 5.941   1.00   23.55 ? 51   TYR A CB  1 
ATOM   367  C CG  . TYR A 1 57  ? 68.393 54.389 4.731   1.00   23.87 ? 51   TYR A CG  1 
ATOM   368  C CD1 . TYR A 1 57  ? 69.192 55.033 3.788   1.00   27.18 ? 51   TYR A CD1 1 
ATOM   369  C CD2 . TYR A 1 57  ? 68.157 53.028 4.566   1.00   24.73 ? 51   TYR A CD2 1 
ATOM   370  C CE1 . TYR A 1 57  ? 69.718 54.342 2.699   1.00   25.93 ? 51   TYR A CE1 1 
ATOM   371  C CE2 . TYR A 1 57  ? 68.698 52.317 3.464   1.00   23.61 ? 51   TYR A CE2 1 
ATOM   372  C CZ  . TYR A 1 57  ? 69.469 52.996 2.537   1.00   26.94 ? 51   TYR A CZ  1 
ATOM   373  O OH  . TYR A 1 57  ? 70.011 52.332 1.443   1.00   26.99 ? 51   TYR A OH  1 
ATOM   374  N N   . LEU A 1 58  ? 68.650 57.099 8.368   1.00   24.62 ? 52   LEU A N   1 
ATOM   375  C CA  . LEU A 1 58  ? 68.037 57.992 9.353   1.00   25.71 ? 52   LEU A CA  1 
ATOM   376  C C   . LEU A 1 58  ? 67.448 59.119 8.522   1.00   25.40 ? 52   LEU A C   1 
ATOM   377  O O   . LEU A 1 58  ? 68.165 59.997 8.058   1.00   25.58 ? 52   LEU A O   1 
ATOM   378  C CB  . LEU A 1 58  ? 69.082 58.471 10.387  1.00   26.85 ? 52   LEU A CB  1 
ATOM   379  C CG  . LEU A 1 58  ? 68.575 59.171 11.649  1.00   31.49 ? 52   LEU A CG  1 
ATOM   380  C CD1 . LEU A 1 58  ? 67.576 58.284 12.376  1.00   33.41 ? 52   LEU A CD1 1 
ATOM   381  C CD2 . LEU A 1 58  ? 69.760 59.563 12.579  1.00   33.86 ? 52   LEU A CD2 1 
ATOM   382  N N   . PHE A 1 59  ? 66.133 59.054 8.333   1.00   23.62 ? 53   PHE A N   1 
ATOM   383  C CA  . PHE A 1 59  ? 65.351 59.895 7.441   1.00   23.01 ? 53   PHE A CA  1 
ATOM   384  C C   . PHE A 1 59  ? 65.506 59.504 5.960   1.00   22.12 ? 53   PHE A C   1 
ATOM   385  O O   . PHE A 1 59  ? 66.534 58.972 5.547   1.00   23.36 ? 53   PHE A O   1 
ATOM   386  C CB  . PHE A 1 59  ? 65.638 61.392 7.656   1.00   23.31 ? 53   PHE A CB  1 
ATOM   387  C CG  . PHE A 1 59  ? 65.592 61.803 9.102   1.00   22.46 ? 53   PHE A CG  1 
ATOM   388  C CD1 . PHE A 1 59  ? 64.484 61.515 9.870   1.00   21.82 ? 53   PHE A CD1 1 
ATOM   389  C CD2 . PHE A 1 59  ? 66.678 62.421 9.695   1.00   27.00 ? 53   PHE A CD2 1 
ATOM   390  C CE1 . PHE A 1 59  ? 64.429 61.857 11.228  1.00   24.39 ? 53   PHE A CE1 1 
ATOM   391  C CE2 . PHE A 1 59  ? 66.632 62.787 11.039  1.00   26.58 ? 53   PHE A CE2 1 
ATOM   392  C CZ  . PHE A 1 59  ? 65.500 62.522 11.797  1.00   26.28 ? 53   PHE A CZ  1 
ATOM   393  N N   . GLY A 1 60  ? 64.469 59.795 5.205   1.00   22.37 ? 54   GLY A N   1 
ATOM   394  C CA  . GLY A 1 60  ? 64.413 59.513 3.772   1.00   22.68 ? 54   GLY A CA  1 
ATOM   395  C C   . GLY A 1 60  ? 63.031 59.307 3.232   1.00   22.61 ? 54   GLY A C   1 
ATOM   396  O O   . GLY A 1 60  ? 61.996 59.497 3.907   1.00   21.72 ? 54   GLY A O   1 
ATOM   397  N N   . HIS A 1 61  ? 63.021 58.904 1.954   1.00   22.97 ? 55   HIS A N   1 
ATOM   398  C CA  . HIS A 1 61  ? 61.825 58.665 1.184   1.00   23.21 ? 55   HIS A CA  1 
ATOM   399  C C   . HIS A 1 61  ? 61.958 57.257 0.654   1.00   21.86 ? 55   HIS A C   1 
ATOM   400  O O   . HIS A 1 61  ? 62.918 56.941 -0.022  1.00   22.16 ? 55   HIS A O   1 
ATOM   401  C CB  . HIS A 1 61  ? 61.748 59.636 0.015   1.00   23.90 ? 55   HIS A CB  1 
ATOM   402  C CG  . HIS A 1 61  ? 60.507 59.534 -0.820  1.00   25.37 ? 55   HIS A CG  1 
ATOM   403  N ND1 . HIS A 1 61  ? 60.511 59.774 -2.172  1.00   30.44 ? 55   HIS A ND1 1 
ATOM   404  C CD2 . HIS A 1 61  ? 59.228 59.218 -0.489  1.00   27.89 ? 55   HIS A CD2 1 
ATOM   405  C CE1 . HIS A 1 61  ? 59.279 59.614 -2.641  1.00   30.40 ? 55   HIS A CE1 1 
ATOM   406  N NE2 . HIS A 1 61  ? 58.481 59.319 -1.635  1.00   29.51 ? 55   HIS A NE2 1 
ATOM   407  N N   . PHE A 1 62  ? 61.003 56.408 1.006   1.00   21.71 ? 56   PHE A N   1 
ATOM   408  C CA  . PHE A 1 62  ? 61.079 54.957 0.803   1.00   20.83 ? 56   PHE A CA  1 
ATOM   409  C C   . PHE A 1 62  ? 59.779 54.525 0.149   1.00   20.79 ? 56   PHE A C   1 
ATOM   410  O O   . PHE A 1 62  ? 58.712 54.835 0.646   1.00   19.10 ? 56   PHE A O   1 
ATOM   411  C CB  . PHE A 1 62  ? 61.258 54.228 2.146   1.00   20.34 ? 56   PHE A CB  1 
ATOM   412  C CG  . PHE A 1 62  ? 62.347 54.789 2.983   1.00   19.40 ? 56   PHE A CG  1 
ATOM   413  C CD1 . PHE A 1 62  ? 63.655 54.381 2.808   1.00   20.62 ? 56   PHE A CD1 1 
ATOM   414  C CD2 . PHE A 1 62  ? 62.092 55.796 3.899   1.00   21.79 ? 56   PHE A CD2 1 
ATOM   415  C CE1 . PHE A 1 62  ? 64.688 54.951 3.565   1.00   22.35 ? 56   PHE A CE1 1 
ATOM   416  C CE2 . PHE A 1 62  ? 63.116 56.363 4.636   1.00   20.89 ? 56   PHE A CE2 1 
ATOM   417  C CZ  . PHE A 1 62  ? 64.406 55.934 4.480   1.00   21.42 ? 56   PHE A CZ  1 
ATOM   418  N N   . SER A 1 63  ? 59.844 53.807 -0.974  1.00   20.46 ? 57   SER A N   1 
ATOM   419  C CA  . SER A 1 63  ? 58.623 53.492 -1.719  1.00   21.45 ? 57   SER A CA  1 
ATOM   420  C C   . SER A 1 63  ? 58.730 52.118 -2.363  1.00   20.82 ? 57   SER A C   1 
ATOM   421  O O   . SER A 1 63  ? 59.803 51.717 -2.826  1.00   20.20 ? 57   SER A O   1 
ATOM   422  C CB  . SER A 1 63  ? 58.374 54.550 -2.792  1.00   22.66 ? 57   SER A CB  1 
ATOM   423  O OG  . SER A 1 63  ? 57.146 54.311 -3.450  1.00   28.53 ? 57   SER A OG  1 
ATOM   424  N N   . MET A 1 64  ? 57.613 51.425 -2.356  1.00   20.31 ? 58   MET A N   1 
ATOM   425  C CA  . MET A 1 64  ? 57.460 50.099 -2.928  1.00   21.10 ? 58   MET A CA  1 
ATOM   426  C C   . MET A 1 64  ? 56.171 50.072 -3.736  1.00   20.50 ? 58   MET A C   1 
ATOM   427  O O   . MET A 1 64  ? 55.097 50.489 -3.265  1.00   19.87 ? 58   MET A O   1 
ATOM   428  C CB  . MET A 1 64  ? 57.356 49.059 -1.810  1.00   21.67 ? 58   MET A CB  1 
ATOM   429  C CG  . MET A 1 64  ? 57.579 47.628 -2.226  1.00   24.02 ? 58   MET A CG  1 
ATOM   430  S SD  . MET A 1 64  ? 59.355 47.311 -2.667  1.00   26.63 ? 58   MET A SD  1 
ATOM   431  C CE  . MET A 1 64  ? 60.150 47.258 -1.147  1.00   24.79 ? 58   MET A CE  1 
ATOM   432  N N   . GLN A 1 65  ? 56.244 49.506 -4.942  1.00   19.04 ? 59   GLN A N   1 
ATOM   433  C CA  . GLN A 1 65  ? 55.042 49.133 -5.642  1.00   19.17 ? 59   GLN A CA  1 
ATOM   434  C C   . GLN A 1 65  ? 54.659 47.725 -5.255  1.00   18.30 ? 59   GLN A C   1 
ATOM   435  O O   . GLN A 1 65  ? 55.499 46.841 -5.274  1.00   18.77 ? 59   GLN A O   1 
ATOM   436  C CB  . GLN A 1 65  ? 55.283 49.153 -7.155  1.00   20.08 ? 59   GLN A CB  1 
ATOM   437  C CG  . GLN A 1 65  ? 54.907 50.413 -7.794  1.00   24.70 ? 59   GLN A CG  1 
ATOM   438  C CD  . GLN A 1 65  ? 54.964 50.277 -9.324  1.00   29.94 ? 59   GLN A CD  1 
ATOM   439  O OE1 . GLN A 1 65  ? 53.934 50.229 -9.972  1.00   33.01 ? 59   GLN A OE1 1 
ATOM   440  N NE2 . GLN A 1 65  ? 56.158 50.155 -9.859  1.00   31.74 ? 59   GLN A NE2 1 
ATOM   441  N N   . MET A 1 66  ? 53.426 47.532 -4.841  1.00   17.08 ? 60   MET A N   1 
ATOM   442  C CA  . MET A 1 66  ? 52.939 46.252 -4.413  1.00   17.73 ? 60   MET A CA  1 
ATOM   443  C C   . MET A 1 66  ? 51.604 45.885 -5.014  1.00   17.80 ? 60   MET A C   1 
ATOM   444  O O   . MET A 1 66  ? 50.709 46.737 -5.205  1.00   18.97 ? 60   MET A O   1 
ATOM   445  C CB  . MET A 1 66  ? 52.819 46.228 -2.865  1.00   17.00 ? 60   MET A CB  1 
ATOM   446  C CG  . MET A 1 66  ? 54.153 46.419 -2.207  1.00   16.87 ? 60   MET A CG  1 
ATOM   447  S SD  . MET A 1 66  ? 54.091 46.718 -0.385  1.00   18.40 ? 60   MET A SD  1 
ATOM   448  C CE  . MET A 1 66  ? 53.550 45.126 0.119   1.00   18.54 ? 60   MET A CE  1 
ATOM   449  N N   . LYS A 1 67  ? 51.441 44.587 -5.256  1.00   17.34 ? 61   LYS A N   1 
ATOM   450  C CA  . LYS A 1 67  ? 50.172 44.010 -5.705  1.00   18.84 ? 61   LYS A CA  1 
ATOM   451  C C   . LYS A 1 67  ? 49.929 42.826 -4.792  1.00   18.77 ? 61   LYS A C   1 
ATOM   452  O O   . LYS A 1 67  ? 50.776 41.950 -4.658  1.00   19.43 ? 61   LYS A O   1 
ATOM   453  C CB  . LYS A 1 67  ? 50.270 43.604 -7.194  1.00   18.93 ? 61   LYS A CB  1 
ATOM   454  C CG  . LYS A 1 67  ? 48.989 42.997 -7.748  1.00   21.95 ? 61   LYS A CG  1 
ATOM   455  C CD  . LYS A 1 67  ? 49.032 42.861 -9.297  1.00   27.74 ? 61   LYS A CD  1 
ATOM   456  C CE  . LYS A 1 67  ? 50.015 41.799 -9.730  1.00   31.40 ? 61   LYS A CE  1 
ATOM   457  N NZ  . LYS A 1 67  ? 50.169 41.708 -11.223 1.00   36.40 ? 61   LYS A NZ  1 
ATOM   458  N N   . LEU A 1 68  ? 48.804 42.853 -4.098  1.00   19.07 ? 62   LEU A N   1 
ATOM   459  C CA  . LEU A 1 68  ? 48.588 41.989 -2.967  1.00   19.08 ? 62   LEU A CA  1 
ATOM   460  C C   . LEU A 1 68  ? 48.055 40.596 -3.414  1.00   19.15 ? 62   LEU A C   1 
ATOM   461  O O   . LEU A 1 68  ? 47.900 40.306 -4.621  1.00   19.47 ? 62   LEU A O   1 
ATOM   462  C CB  . LEU A 1 68  ? 47.691 42.671 -1.952  1.00   18.61 ? 62   LEU A CB  1 
ATOM   463  C CG  . LEU A 1 68  ? 48.404 43.688 -1.016  1.00   21.90 ? 62   LEU A CG  1 
ATOM   464  C CD1 . LEU A 1 68  ? 49.322 42.957 -0.058  1.00   24.65 ? 62   LEU A CD1 1 
ATOM   465  C CD2 . LEU A 1 68  ? 49.224 44.706 -1.694  1.00   23.27 ? 62   LEU A CD2 1 
ATOM   466  N N   . VAL A 1 69  ? 47.895 39.722 -2.441  1.00   19.72 ? 63   VAL A N   1 
ATOM   467  C CA  . VAL A 1 69  ? 47.536 38.321 -2.655  1.00   19.51 ? 63   VAL A CA  1 
ATOM   468  C C   . VAL A 1 69  ? 46.095 38.223 -3.180  1.00   20.57 ? 63   VAL A C   1 
ATOM   469  O O   . VAL A 1 69  ? 45.164 38.621 -2.503  1.00   21.75 ? 63   VAL A O   1 
ATOM   470  C CB  . VAL A 1 69  ? 47.647 37.539 -1.340  1.00   19.74 ? 63   VAL A CB  1 
ATOM   471  C CG1 . VAL A 1 69  ? 47.205 36.094 -1.533  1.00   19.41 ? 63   VAL A CG1 1 
ATOM   472  C CG2 . VAL A 1 69  ? 49.080 37.610 -0.814  1.00   19.75 ? 63   VAL A CG2 1 
ATOM   473  N N   . PRO A 1 70  ? 45.919 37.670 -4.371  1.00   22.55 ? 64   PRO A N   1 
ATOM   474  C CA  . PRO A 1 70  ? 44.579 37.574 -4.969  1.00   23.83 ? 64   PRO A CA  1 
ATOM   475  C C   . PRO A 1 70  ? 43.746 36.455 -4.355  1.00   25.28 ? 64   PRO A C   1 
ATOM   476  O O   . PRO A 1 70  ? 44.295 35.633 -3.606  1.00   25.29 ? 64   PRO A O   1 
ATOM   477  C CB  . PRO A 1 70  ? 44.883 37.301 -6.450  1.00   23.70 ? 64   PRO A CB  1 
ATOM   478  C CG  . PRO A 1 70  ? 46.165 36.574 -6.459  1.00   24.53 ? 64   PRO A CG  1 
ATOM   479  C CD  . PRO A 1 70  ? 46.963 37.112 -5.248  1.00   22.25 ? 64   PRO A CD  1 
ATOM   480  N N   . GLY A 1 71  ? 42.444 36.404 -4.664  1.00   25.71 ? 65   GLY A N   1 
ATOM   481  C CA  . GLY A 1 71  ? 41.574 35.348 -4.162  1.00   25.99 ? 65   GLY A CA  1 
ATOM   482  C C   . GLY A 1 71  ? 41.429 35.268 -2.648  1.00   26.08 ? 65   GLY A C   1 
ATOM   483  O O   . GLY A 1 71  ? 41.178 36.261 -1.977  1.00   26.01 ? 65   GLY A O   1 
ATOM   484  N N   . ASP A 1 72  ? 41.545 34.069 -2.093  1.00   25.64 ? 66   ASP A N   1 
ATOM   485  C CA  . ASP A 1 72  ? 41.515 33.897 -0.641  1.00   26.87 ? 66   ASP A CA  1 
ATOM   486  C C   . ASP A 1 72  ? 42.903 34.210 -0.085  1.00   25.60 ? 66   ASP A C   1 
ATOM   487  O O   . ASP A 1 72  ? 43.860 33.481 -0.363  1.00   25.06 ? 66   ASP A O   1 
ATOM   488  C CB  . ASP A 1 72  ? 41.115 32.460 -0.279  1.00   27.55 ? 66   ASP A CB  1 
ATOM   489  C CG  . ASP A 1 72  ? 40.878 32.263 1.189   1.00   31.49 ? 66   ASP A CG  1 
ATOM   490  O OD1 . ASP A 1 72  ? 41.312 33.107 2.006   1.00   29.87 ? 66   ASP A OD1 1 
ATOM   491  O OD2 . ASP A 1 72  ? 40.255 31.271 1.637   1.00   35.23 ? 66   ASP A OD2 1 
ATOM   492  N N   . SER A 1 73  ? 42.979 35.279 0.707   1.00   24.28 ? 67   SER A N   1 
ATOM   493  C CA  . SER A 1 73  ? 44.208 35.707 1.380   1.00   22.95 ? 67   SER A CA  1 
ATOM   494  C C   . SER A 1 73  ? 44.017 35.764 2.898   1.00   22.70 ? 67   SER A C   1 
ATOM   495  O O   . SER A 1 73  ? 44.803 36.384 3.614   1.00   22.53 ? 67   SER A O   1 
ATOM   496  C CB  . SER A 1 73  ? 44.643 37.072 0.838   1.00   21.49 ? 67   SER A CB  1 
ATOM   497  O OG  . SER A 1 73  ? 43.610 38.036 0.999   1.00   21.93 ? 67   SER A OG  1 
ATOM   498  N N   . ALA A 1 74  ? 42.952 35.144 3.391   1.00   22.56 ? 68   ALA A N   1 
ATOM   499  C CA  . ALA A 1 74  ? 42.603 35.217 4.797   1.00   23.56 ? 68   ALA A CA  1 
ATOM   500  C C   . ALA A 1 74  ? 43.728 34.697 5.654   1.00   23.01 ? 68   ALA A C   1 
ATOM   501  O O   . ALA A 1 74  ? 44.377 33.693 5.308   1.00   23.51 ? 68   ALA A O   1 
ATOM   502  C CB  . ALA A 1 74  ? 41.321 34.423 5.088   1.00   24.29 ? 68   ALA A CB  1 
ATOM   503  N N   . GLY A 1 75  ? 43.963 35.414 6.748   1.00   23.36 ? 69   GLY A N   1 
ATOM   504  C CA  . GLY A 1 75  ? 44.972 35.067 7.718   1.00   24.08 ? 69   GLY A CA  1 
ATOM   505  C C   . GLY A 1 75  ? 46.380 35.501 7.366   1.00   23.41 ? 69   GLY A C   1 
ATOM   506  O O   . GLY A 1 75  ? 47.273 35.353 8.198   1.00   24.99 ? 69   GLY A O   1 
ATOM   507  N N   . THR A 1 76  ? 46.598 36.021 6.163   1.00   21.44 ? 70   THR A N   1 
ATOM   508  C CA  . THR A 1 76  ? 47.944 36.393 5.773   1.00   20.05 ? 70   THR A CA  1 
ATOM   509  C C   . THR A 1 76  ? 48.173 37.858 6.046   1.00   19.16 ? 70   THR A C   1 
ATOM   510  O O   . THR A 1 76  ? 47.232 38.682 5.939   1.00   18.99 ? 70   THR A O   1 
ATOM   511  C CB  . THR A 1 76  ? 48.225 36.087 4.287   1.00   20.35 ? 70   THR A CB  1 
ATOM   512  O OG1 . THR A 1 76  ? 47.451 36.950 3.429   1.00   20.22 ? 70   THR A OG1 1 
ATOM   513  C CG2 . THR A 1 76  ? 47.810 34.689 3.920   1.00   21.98 ? 70   THR A CG2 1 
ATOM   514  N N   . VAL A 1 77  ? 49.427 38.190 6.327   1.00   17.98 ? 71   VAL A N   1 
ATOM   515  C CA  . VAL A 1 77  ? 49.894 39.556 6.447   1.00   18.04 ? 71   VAL A CA  1 
ATOM   516  C C   . VAL A 1 77  ? 51.080 39.809 5.501   1.00   17.10 ? 71   VAL A C   1 
ATOM   517  O O   . VAL A 1 77  ? 52.083 39.097 5.536   1.00   16.55 ? 71   VAL A O   1 
ATOM   518  C CB  . VAL A 1 77  ? 50.283 39.879 7.891   1.00   18.94 ? 71   VAL A CB  1 
ATOM   519  C CG1 . VAL A 1 77  ? 50.802 41.286 8.021   1.00   20.55 ? 71   VAL A CG1 1 
ATOM   520  C CG2 . VAL A 1 77  ? 49.063 39.690 8.785   1.00   22.91 ? 71   VAL A CG2 1 
ATOM   521  N N   . THR A 1 78  ? 50.958 40.814 4.640   1.00   16.23 ? 72   THR A N   1 
ATOM   522  C CA  . THR A 1 78  ? 52.051 41.261 3.809   1.00   16.94 ? 72   THR A CA  1 
ATOM   523  C C   . THR A 1 78  ? 52.510 42.571 4.440   1.00   18.39 ? 72   THR A C   1 
ATOM   524  O O   . THR A 1 78  ? 51.685 43.503 4.616   1.00   15.93 ? 72   THR A O   1 
ATOM   525  C CB  . THR A 1 78  ? 51.545 41.499 2.378   1.00   16.85 ? 72   THR A CB  1 
ATOM   526  O OG1 . THR A 1 78  ? 50.950 40.305 1.876   1.00   17.35 ? 72   THR A OG1 1 
ATOM   527  C CG2 . THR A 1 78  ? 52.670 41.813 1.402   1.00   19.37 ? 72   THR A CG2 1 
ATOM   528  N N   . ALA A 1 79  ? 53.757 42.614 4.874   1.00   17.88 ? 73   ALA A N   1 
ATOM   529  C CA  . ALA A 1 79  ? 54.326 43.763 5.585   1.00   18.51 ? 73   ALA A CA  1 
ATOM   530  C C   . ALA A 1 79  ? 55.384 44.479 4.787   1.00   19.35 ? 73   ALA A C   1 
ATOM   531  O O   . ALA A 1 79  ? 56.146 43.878 4.049   1.00   20.24 ? 73   ALA A O   1 
ATOM   532  C CB  . ALA A 1 79  ? 54.856 43.326 6.944   1.00   18.50 ? 73   ALA A CB  1 
ATOM   533  N N   . PHE A 1 80  ? 55.392 45.807 4.853   1.00   17.16 ? 74   PHE A N   1 
ATOM   534  C CA  . PHE A 1 80  ? 56.415 46.647 4.293   1.00   16.78 ? 74   PHE A CA  1 
ATOM   535  C C   . PHE A 1 80  ? 56.663 47.665 5.385   1.00   16.69 ? 74   PHE A C   1 
ATOM   536  O O   . PHE A 1 80  ? 55.756 48.388 5.727   1.00   16.53 ? 74   PHE A O   1 
ATOM   537  C CB  . PHE A 1 80  ? 55.905 47.353 3.029   1.00   16.57 ? 74   PHE A CB  1 
ATOM   538  C CG  . PHE A 1 80  ? 56.754 48.484 2.536   1.00   16.91 ? 74   PHE A CG  1 
ATOM   539  C CD1 . PHE A 1 80  ? 58.117 48.348 2.356   1.00   21.04 ? 74   PHE A CD1 1 
ATOM   540  C CD2 . PHE A 1 80  ? 56.183 49.709 2.233   1.00   19.48 ? 74   PHE A CD2 1 
ATOM   541  C CE1 . PHE A 1 80  ? 58.863 49.399 1.890   1.00   21.76 ? 74   PHE A CE1 1 
ATOM   542  C CE2 . PHE A 1 80  ? 56.947 50.773 1.766   1.00   21.44 ? 74   PHE A CE2 1 
ATOM   543  C CZ  . PHE A 1 80  ? 58.268 50.624 1.592   1.00   22.85 ? 74   PHE A CZ  1 
ATOM   544  N N   . TYR A 1 81  ? 57.857 47.689 5.963   1.00   16.36 ? 75   TYR A N   1 
ATOM   545  C CA  . TYR A 1 81  ? 58.089 48.462 7.189   1.00   16.51 ? 75   TYR A CA  1 
ATOM   546  C C   . TYR A 1 81  ? 59.528 48.870 7.364   1.00   17.33 ? 75   TYR A C   1 
ATOM   547  O O   . TYR A 1 81  ? 60.437 48.319 6.713   1.00   16.93 ? 75   TYR A O   1 
ATOM   548  C CB  . TYR A 1 81  ? 57.565 47.710 8.416   1.00   16.90 ? 75   TYR A CB  1 
ATOM   549  C CG  . TYR A 1 81  ? 58.229 46.395 8.761   1.00   17.65 ? 75   TYR A CG  1 
ATOM   550  C CD1 . TYR A 1 81  ? 57.875 45.212 8.131   1.00   18.86 ? 75   TYR A CD1 1 
ATOM   551  C CD2 . TYR A 1 81  ? 59.172 46.331 9.795   1.00   19.18 ? 75   TYR A CD2 1 
ATOM   552  C CE1 . TYR A 1 81  ? 58.458 44.007 8.491   1.00   20.99 ? 75   TYR A CE1 1 
ATOM   553  C CE2 . TYR A 1 81  ? 59.781 45.124 10.141  1.00   22.09 ? 75   TYR A CE2 1 
ATOM   554  C CZ  . TYR A 1 81  ? 59.407 43.977 9.503   1.00   23.62 ? 75   TYR A CZ  1 
ATOM   555  O OH  . TYR A 1 81  ? 60.017 42.787 9.867   1.00   23.97 ? 75   TYR A OH  1 
ATOM   556  N N   . LEU A 1 82  ? 59.744 49.912 8.168   1.00   16.04 ? 76   LEU A N   1 
ATOM   557  C CA  . LEU A 1 82  ? 61.074 50.304 8.596   1.00   16.33 ? 76   LEU A CA  1 
ATOM   558  C C   . LEU A 1 82  ? 61.187 49.953 10.066  1.00   17.48 ? 76   LEU A C   1 
ATOM   559  O O   . LEU A 1 82  ? 60.232 50.118 10.802  1.00   17.11 ? 76   LEU A O   1 
ATOM   560  C CB  . LEU A 1 82  ? 61.312 51.793 8.425   1.00   17.58 ? 76   LEU A CB  1 
ATOM   561  C CG  . LEU A 1 82  ? 61.546 52.251 6.995   1.00   20.40 ? 76   LEU A CG  1 
ATOM   562  C CD1 . LEU A 1 82  ? 60.260 52.430 6.296   1.00   25.41 ? 76   LEU A CD1 1 
ATOM   563  C CD2 . LEU A 1 82  ? 62.312 53.521 6.957   1.00   26.19 ? 76   LEU A CD2 1 
ATOM   564  N N   . SER A 1 83  ? 62.341 49.457 10.473  1.00   18.21 ? 77   SER A N   1 
ATOM   565  C CA  . SER A 1 83  ? 62.585 49.220 11.897  1.00   19.60 ? 77   SER A CA  1 
ATOM   566  C C   . SER A 1 83  ? 64.050 49.414 12.287  1.00   20.62 ? 77   SER A C   1 
ATOM   567  O O   . SER A 1 83  ? 64.966 49.070 11.531  1.00   19.47 ? 77   SER A O   1 
ATOM   568  C CB  . SER A 1 83  ? 62.129 47.817 12.281  1.00   20.52 ? 77   SER A CB  1 
ATOM   569  O OG  . SER A 1 83  ? 62.309 47.555 13.691  1.00   22.65 ? 77   SER A OG  1 
ATOM   570  N N   . SER A 1 84  ? 64.277 49.955 13.483  1.00   22.39 ? 78   SER A N   1 
ATOM   571  C CA  . SER A 1 84  ? 65.629 49.984 14.059  1.00   24.90 ? 78   SER A CA  1 
ATOM   572  C C   . SER A 1 84  ? 65.906 48.620 14.699  1.00   28.46 ? 78   SER A C   1 
ATOM   573  O O   . SER A 1 84  ? 65.019 47.806 14.782  1.00   26.68 ? 78   SER A O   1 
ATOM   574  C CB  . SER A 1 84  ? 65.734 51.111 15.103  1.00   24.77 ? 78   SER A CB  1 
ATOM   575  O OG  . SER A 1 84  ? 64.852 50.874 16.181  1.00   22.98 ? 78   SER A OG  1 
ATOM   576  N N   . GLN A 1 85  ? 67.121 48.405 15.194  1.00   34.07 ? 79   GLN A N   1 
ATOM   577  C CA  . GLN A 1 85  ? 67.561 47.078 15.675  1.00   39.86 ? 79   GLN A CA  1 
ATOM   578  C C   . GLN A 1 85  ? 67.432 46.852 17.182  1.00   42.78 ? 79   GLN A C   1 
ATOM   579  O O   . GLN A 1 85  ? 67.061 45.753 17.636  1.00   45.08 ? 79   GLN A O   1 
ATOM   580  C CB  . GLN A 1 85  ? 69.054 46.850 15.317  1.00   40.61 ? 79   GLN A CB  1 
ATOM   581  C CG  . GLN A 1 85  ? 69.318 45.921 14.109  1.00   44.69 ? 79   GLN A CG  1 
ATOM   582  C CD  . GLN A 1 85  ? 68.502 44.613 14.125  1.00   49.07 ? 79   GLN A CD  1 
ATOM   583  O OE1 . GLN A 1 85  ? 68.942 43.591 14.676  1.00   52.48 ? 79   GLN A OE1 1 
ATOM   584  N NE2 . GLN A 1 85  ? 67.328 44.643 13.498  1.00   51.68 ? 79   GLN A NE2 1 
ATOM   585  N N   . ASN A 1 86  ? 67.798 47.860 17.963  1.00   45.48 ? 80   ASN A N   1 
ATOM   586  C CA  . ASN A 1 86  ? 67.996 47.639 19.402  1.00   47.01 ? 80   ASN A CA  1 
ATOM   587  C C   . ASN A 1 86  ? 66.665 47.417 20.100  1.00   46.74 ? 80   ASN A C   1 
ATOM   588  O O   . ASN A 1 86  ? 65.611 47.448 19.462  1.00   47.70 ? 80   ASN A O   1 
ATOM   589  C CB  . ASN A 1 86  ? 68.750 48.810 20.049  1.00   47.80 ? 80   ASN A CB  1 
ATOM   590  C CG  . ASN A 1 86  ? 70.027 49.196 19.292  1.00   51.07 ? 80   ASN A CG  1 
ATOM   591  O OD1 . ASN A 1 86  ? 70.549 48.434 18.459  1.00   55.94 ? 80   ASN A OD1 1 
ATOM   592  N ND2 . ASN A 1 86  ? 70.541 50.399 19.555  1.00   55.95 ? 80   ASN A ND2 1 
ATOM   593  N N   . SER A 1 87  ? 66.724 47.157 21.405  1.00   46.14 ? 81   SER A N   1 
ATOM   594  C CA  . SER A 1 87  ? 65.554 47.267 22.271  1.00   44.96 ? 81   SER A CA  1 
ATOM   595  C C   . SER A 1 87  ? 65.237 48.763 22.352  1.00   42.75 ? 81   SER A C   1 
ATOM   596  O O   . SER A 1 87  ? 66.080 49.591 21.975  1.00   43.17 ? 81   SER A O   1 
ATOM   597  C CB  . SER A 1 87  ? 65.852 46.720 23.661  1.00   45.77 ? 81   SER A CB  1 
ATOM   598  O OG  . SER A 1 87  ? 66.551 47.706 24.425  1.00   49.09 ? 81   SER A OG  1 
ATOM   599  N N   . GLU A 1 88  ? 64.046 49.103 22.845  1.00   39.29 ? 82   GLU A N   1 
ATOM   600  C CA  . GLU A 1 88  ? 63.482 50.446 22.691  1.00   37.13 ? 82   GLU A CA  1 
ATOM   601  C C   . GLU A 1 88  ? 63.445 50.853 21.197  1.00   33.59 ? 82   GLU A C   1 
ATOM   602  O O   . GLU A 1 88  ? 63.759 51.975 20.825  1.00   31.62 ? 82   GLU A O   1 
ATOM   603  C CB  . GLU A 1 88  ? 64.229 51.490 23.534  1.00   37.82 ? 82   GLU A CB  1 
ATOM   604  C CG  . GLU A 1 88  ? 64.360 51.108 25.009  1.00   41.54 ? 82   GLU A CG  1 
ATOM   605  C CD  . GLU A 1 88  ? 64.613 52.295 25.937  1.00   46.01 ? 82   GLU A CD  1 
ATOM   606  O OE1 . GLU A 1 88  ? 65.069 53.366 25.479  1.00   50.61 ? 82   GLU A OE1 1 
ATOM   607  O OE2 . GLU A 1 88  ? 64.354 52.158 27.153  1.00   51.51 ? 82   GLU A OE2 1 
ATOM   608  N N   . HIS A 1 89  ? 63.025 49.916 20.370  1.00   30.34 ? 83   HIS A N   1 
ATOM   609  C CA  . HIS A 1 89  ? 63.037 50.125 18.912  1.00   28.89 ? 83   HIS A CA  1 
ATOM   610  C C   . HIS A 1 89  ? 61.971 51.081 18.398  1.00   26.21 ? 83   HIS A C   1 
ATOM   611  O O   . HIS A 1 89  ? 60.912 51.310 19.031  1.00   24.66 ? 83   HIS A O   1 
ATOM   612  C CB  . HIS A 1 89  ? 63.008 48.780 18.172  1.00   28.46 ? 83   HIS A CB  1 
ATOM   613  C CG  . HIS A 1 89  ? 61.634 48.258 17.909  1.00   30.45 ? 83   HIS A CG  1 
ATOM   614  N ND1 . HIS A 1 89  ? 60.834 47.729 18.901  1.00   30.34 ? 83   HIS A ND1 1 
ATOM   615  C CD2 . HIS A 1 89  ? 60.931 48.142 16.752  1.00   30.78 ? 83   HIS A CD2 1 
ATOM   616  C CE1 . HIS A 1 89  ? 59.695 47.325 18.370  1.00   32.69 ? 83   HIS A CE1 1 
ATOM   617  N NE2 . HIS A 1 89  ? 59.726 47.569 17.071  1.00   32.99 ? 83   HIS A NE2 1 
ATOM   618  N N   . ASP A 1 90  ? 62.278 51.660 17.233  1.00   23.82 ? 84   ASP A N   1 
ATOM   619  C CA  . ASP A 1 90  ? 61.372 52.490 16.485  1.00   22.41 ? 84   ASP A CA  1 
ATOM   620  C C   . ASP A 1 90  ? 60.986 51.669 15.221  1.00   21.56 ? 84   ASP A C   1 
ATOM   621  O O   . ASP A 1 90  ? 61.776 50.861 14.747  1.00   20.13 ? 84   ASP A O   1 
ATOM   622  C CB  . ASP A 1 90  ? 62.044 53.777 16.002  1.00   22.56 ? 84   ASP A CB  1 
ATOM   623  C CG  . ASP A 1 90  ? 62.506 54.702 17.135  1.00   25.99 ? 84   ASP A CG  1 
ATOM   624  O OD1 . ASP A 1 90  ? 61.860 54.702 18.211  1.00   23.62 ? 84   ASP A OD1 1 
ATOM   625  O OD2 . ASP A 1 90  ? 63.509 55.448 17.013  1.00   26.46 ? 84   ASP A OD2 1 
ATOM   626  N N   . GLU A 1 91  ? 59.777 51.871 14.747  1.00   20.19 ? 85   GLU A N   1 
ATOM   627  C CA  . GLU A 1 91  ? 59.242 51.150 13.602  1.00   20.48 ? 85   GLU A CA  1 
ATOM   628  C C   . GLU A 1 91  ? 58.091 51.925 12.977  1.00   20.16 ? 85   GLU A C   1 
ATOM   629  O O   . GLU A 1 91  ? 57.283 52.530 13.659  1.00   19.60 ? 85   GLU A O   1 
ATOM   630  C CB  . GLU A 1 91  ? 58.810 49.755 14.070  1.00   21.56 ? 85   GLU A CB  1 
ATOM   631  C CG  . GLU A 1 91  ? 58.098 48.887 13.088  1.00   24.03 ? 85   GLU A CG  1 
ATOM   632  C CD  . GLU A 1 91  ? 57.844 47.481 13.609  1.00   28.68 ? 85   GLU A CD  1 
ATOM   633  O OE1 . GLU A 1 91  ? 58.319 47.091 14.706  1.00   30.76 ? 85   GLU A OE1 1 
ATOM   634  O OE2 . GLU A 1 91  ? 57.142 46.755 12.910  1.00   30.60 ? 85   GLU A OE2 1 
ATOM   635  N N   . ILE A 1 92  ? 58.020 51.874 11.645  1.00   18.71 ? 86   ILE A N   1 
ATOM   636  C CA  . ILE A 1 92  ? 56.983 52.494 10.863  1.00   18.53 ? 86   ILE A CA  1 
ATOM   637  C C   . ILE A 1 92  ? 56.432 51.348 9.986   1.00   19.05 ? 86   ILE A C   1 
ATOM   638  O O   . ILE A 1 92  ? 57.198 50.799 9.198   1.00   19.31 ? 86   ILE A O   1 
ATOM   639  C CB  . ILE A 1 92  ? 57.620 53.585 9.976   1.00   18.86 ? 86   ILE A CB  1 
ATOM   640  C CG1 . ILE A 1 92  ? 58.256 54.700 10.842  1.00   19.79 ? 86   ILE A CG1 1 
ATOM   641  C CG2 . ILE A 1 92  ? 56.618 54.152 8.996   1.00   20.28 ? 86   ILE A CG2 1 
ATOM   642  C CD1 . ILE A 1 92  ? 59.195 55.638 10.059  1.00   23.07 ? 86   ILE A CD1 1 
ATOM   643  N N   . ASP A 1 93  ? 55.152 51.006 10.118  1.00   18.27 ? 87   ASP A N   1 
ATOM   644  C CA  . ASP A 1 93  ? 54.576 49.783 9.503   1.00   19.11 ? 87   ASP A CA  1 
ATOM   645  C C   . ASP A 1 93  ? 53.430 50.008 8.533   1.00   18.62 ? 87   ASP A C   1 
ATOM   646  O O   . ASP A 1 93  ? 52.449 50.710 8.864   1.00   18.85 ? 87   ASP A O   1 
ATOM   647  C CB  . ASP A 1 93  ? 53.956 48.851 10.541  1.00   20.42 ? 87   ASP A CB  1 
ATOM   648  C CG  . ASP A 1 93  ? 54.919 48.354 11.552  1.00   25.94 ? 87   ASP A CG  1 
ATOM   649  O OD1 . ASP A 1 93  ? 56.019 47.855 11.187  1.00   27.58 ? 87   ASP A OD1 1 
ATOM   650  O OD2 . ASP A 1 93  ? 54.645 48.430 12.768  1.00   32.86 ? 87   ASP A OD2 1 
ATOM   651  N N   . PHE A 1 94  ? 53.500 49.321 7.380   1.00   16.87 ? 88   PHE A N   1 
ATOM   652  C CA  . PHE A 1 94  ? 52.352 48.961 6.553   1.00   16.93 ? 88   PHE A CA  1 
ATOM   653  C C   . PHE A 1 94  ? 52.143 47.448 6.706   1.00   17.48 ? 88   PHE A C   1 
ATOM   654  O O   . PHE A 1 94  ? 53.094 46.669 6.446   1.00   17.07 ? 88   PHE A O   1 
ATOM   655  C CB  . PHE A 1 94  ? 52.603 49.194 5.041   1.00   15.53 ? 88   PHE A CB  1 
ATOM   656  C CG  . PHE A 1 94  ? 52.607 50.626 4.577   1.00   17.92 ? 88   PHE A CG  1 
ATOM   657  C CD1 . PHE A 1 94  ? 53.755 51.350 4.517   1.00   19.61 ? 88   PHE A CD1 1 
ATOM   658  C CD2 . PHE A 1 94  ? 51.462 51.196 4.054   1.00   20.85 ? 88   PHE A CD2 1 
ATOM   659  C CE1 . PHE A 1 94  ? 53.753 52.640 4.017   1.00   21.06 ? 88   PHE A CE1 1 
ATOM   660  C CE2 . PHE A 1 94  ? 51.480 52.499 3.547   1.00   22.35 ? 88   PHE A CE2 1 
ATOM   661  C CZ  . PHE A 1 94  ? 52.631 53.193 3.529   1.00   18.54 ? 88   PHE A CZ  1 
ATOM   662  N N   . GLU A 1 95  ? 50.948 47.022 7.107   1.00   15.83 ? 89   GLU A N   1 
ATOM   663  C CA  . GLU A 1 95  ? 50.599 45.615 7.235   1.00   16.56 ? 89   GLU A CA  1 
ATOM   664  C C   . GLU A 1 95  ? 49.274 45.399 6.530   1.00   17.42 ? 89   GLU A C   1 
ATOM   665  O O   . GLU A 1 95  ? 48.232 45.941 6.934   1.00   17.21 ? 89   GLU A O   1 
ATOM   666  C CB  . GLU A 1 95  ? 50.561 45.170 8.713   1.00   16.39 ? 89   GLU A CB  1 
ATOM   667  C CG  . GLU A 1 95  ? 51.950 45.070 9.284   1.00   17.61 ? 89   GLU A CG  1 
ATOM   668  C CD  . GLU A 1 95  ? 51.999 44.984 10.793  1.00   27.21 ? 89   GLU A CD  1 
ATOM   669  O OE1 . GLU A 1 95  ? 51.762 46.035 11.439  1.00   29.58 ? 89   GLU A OE1 1 
ATOM   670  O OE2 . GLU A 1 95  ? 52.274 43.871 11.307  1.00   28.62 ? 89   GLU A OE2 1 
ATOM   671  N N   . PHE A 1 96  ? 49.328 44.657 5.425   1.00   16.54 ? 90   PHE A N   1 
ATOM   672  C CA  . PHE A 1 96  ? 48.151 44.364 4.607   1.00   16.33 ? 90   PHE A CA  1 
ATOM   673  C C   . PHE A 1 96  ? 47.555 43.063 5.056   1.00   16.82 ? 90   PHE A C   1 
ATOM   674  O O   . PHE A 1 96  ? 48.198 42.006 4.943   1.00   16.91 ? 90   PHE A O   1 
ATOM   675  C CB  . PHE A 1 96  ? 48.554 44.229 3.124   1.00   16.30 ? 90   PHE A CB  1 
ATOM   676  C CG  . PHE A 1 96  ? 49.085 45.504 2.503   1.00   15.70 ? 90   PHE A CG  1 
ATOM   677  C CD1 . PHE A 1 96  ? 50.429 45.835 2.574   1.00   16.03 ? 90   PHE A CD1 1 
ATOM   678  C CD2 . PHE A 1 96  ? 48.225 46.372 1.856   1.00   18.06 ? 90   PHE A CD2 1 
ATOM   679  C CE1 . PHE A 1 96  ? 50.912 46.970 1.978   1.00   17.40 ? 90   PHE A CE1 1 
ATOM   680  C CE2 . PHE A 1 96  ? 48.689 47.490 1.242   1.00   17.48 ? 90   PHE A CE2 1 
ATOM   681  C CZ  . PHE A 1 96  ? 50.036 47.822 1.320   1.00   17.31 ? 90   PHE A CZ  1 
ATOM   682  N N   . LEU A 1 97  ? 46.345 43.135 5.588   1.00   16.63 ? 91   LEU A N   1 
ATOM   683  C CA  . LEU A 1 97  ? 45.647 41.997 6.149   1.00   17.77 ? 91   LEU A CA  1 
ATOM   684  C C   . LEU A 1 97  ? 44.632 41.419 5.167   1.00   18.12 ? 91   LEU A C   1 
ATOM   685  O O   . LEU A 1 97  ? 43.657 42.090 4.743   1.00   19.07 ? 91   LEU A O   1 
ATOM   686  C CB  . LEU A 1 97  ? 45.010 42.409 7.496   1.00   18.54 ? 91   LEU A CB  1 
ATOM   687  C CG  . LEU A 1 97  ? 45.763 43.407 8.371   1.00   20.45 ? 91   LEU A CG  1 
ATOM   688  C CD1 . LEU A 1 97  ? 44.867 43.778 9.571   1.00   22.88 ? 91   LEU A CD1 1 
ATOM   689  C CD2 . LEU A 1 97  ? 47.080 42.833 8.830   1.00   21.86 ? 91   LEU A CD2 1 
ATOM   690  N N   . GLY A 1 98  ? 44.853 40.169 4.756   1.00   19.04 ? 92   GLY A N   1 
ATOM   691  C CA  . GLY A 1 98  ? 44.052 39.556 3.717   1.00   19.67 ? 92   GLY A CA  1 
ATOM   692  C C   . GLY A 1 98  ? 42.660 39.132 4.181   1.00   20.25 ? 92   GLY A C   1 
ATOM   693  O O   . GLY A 1 98  ? 42.261 39.335 5.333   1.00   20.54 ? 92   GLY A O   1 
ATOM   694  N N   . ASN A 1 99  ? 41.945 38.483 3.275   1.00   22.25 ? 93   ASN A N   1 
ATOM   695  C CA  . ASN A 1 99  ? 40.551 38.130 3.513   1.00   23.55 ? 93   ASN A CA  1 
ATOM   696  C C   . ASN A 1 99  ? 40.073 36.987 2.615   1.00   24.81 ? 93   ASN A C   1 
ATOM   697  O O   . ASN A 1 99  ? 40.678 36.682 1.622   1.00   25.06 ? 93   ASN A O   1 
ATOM   698  C CB  . ASN A 1 99  ? 39.676 39.374 3.274   1.00   23.89 ? 93   ASN A CB  1 
ATOM   699  C CG  . ASN A 1 99  ? 38.568 39.537 4.305   1.00   24.42 ? 93   ASN A CG  1 
ATOM   700  O OD1 . ASN A 1 99  ? 38.095 38.556 4.895   1.00   25.27 ? 93   ASN A OD1 1 
ATOM   701  N ND2 . ASN A 1 99  ? 38.118 40.798 4.487   1.00   24.87 ? 93   ASN A ND2 1 
ATOM   702  N N   . ARG A 1 100 ? 38.952 36.385 2.988   1.00   27.72 ? 94   ARG A N   1 
ATOM   703  C CA  . ARG A 1 100 ? 38.244 35.436 2.138   1.00   29.92 ? 94   ARG A CA  1 
ATOM   704  C C   . ARG A 1 100 ? 37.980 36.077 0.796   1.00   30.68 ? 94   ARG A C   1 
ATOM   705  O O   . ARG A 1 100 ? 37.890 37.303 0.691   1.00   30.15 ? 94   ARG A O   1 
ATOM   706  C CB  . ARG A 1 100 ? 36.896 35.059 2.751   1.00   30.30 ? 94   ARG A CB  1 
ATOM   707  C CG  . ARG A 1 100 ? 36.956 34.260 3.996   1.00   33.34 ? 94   ARG A CG  1 
ATOM   708  C CD  . ARG A 1 100 ? 37.468 32.843 3.794   1.00   35.53 ? 94   ARG A CD  1 
ATOM   709  N NE  . ARG A 1 100 ? 37.794 32.359 5.104   1.00   39.24 ? 94   ARG A NE  1 
ATOM   710  C CZ  . ARG A 1 100 ? 38.884 31.703 5.445   1.00   36.55 ? 94   ARG A CZ  1 
ATOM   711  N NH1 . ARG A 1 100 ? 39.800 31.322 4.555   1.00   38.37 ? 94   ARG A NH1 1 
ATOM   712  N NH2 . ARG A 1 100 ? 39.016 31.390 6.708   1.00   38.71 ? 94   ARG A NH2 1 
ATOM   713  N N   . THR A 1 101 ? 37.835 35.237 -0.225  1.00   32.25 ? 95   THR A N   1 
ATOM   714  C CA  . THR A 1 101 ? 37.614 35.704 -1.586  1.00   33.72 ? 95   THR A CA  1 
ATOM   715  C C   . THR A 1 101 ? 36.469 36.718 -1.657  1.00   33.47 ? 95   THR A C   1 
ATOM   716  O O   . THR A 1 101 ? 35.424 36.544 -1.015  1.00   33.27 ? 95   THR A O   1 
ATOM   717  C CB  . THR A 1 101 ? 37.341 34.519 -2.569  1.00   34.30 ? 95   THR A CB  1 
ATOM   718  O OG1 . THR A 1 101 ? 38.261 33.453 -2.323  1.00   38.06 ? 95   THR A OG1 1 
ATOM   719  C CG2 . THR A 1 101 ? 37.678 34.925 -3.956  1.00   35.25 ? 95   THR A CG2 1 
ATOM   720  N N   . GLY A 1 102 ? 36.712 37.802 -2.389  1.00   34.03 ? 96   GLY A N   1 
ATOM   721  C CA  . GLY A 1 102 ? 35.732 38.869 -2.572  1.00   33.93 ? 96   GLY A CA  1 
ATOM   722  C C   . GLY A 1 102 ? 35.445 39.742 -1.370  1.00   33.59 ? 96   GLY A C   1 
ATOM   723  O O   . GLY A 1 102 ? 34.525 40.574 -1.411  1.00   34.11 ? 96   GLY A O   1 
ATOM   724  N N   . GLN A 1 103 ? 36.196 39.565 -0.284  1.00   31.75 ? 97   GLN A N   1 
ATOM   725  C CA  . GLN A 1 103 ? 36.036 40.396 0.893   1.00   30.44 ? 97   GLN A CA  1 
ATOM   726  C C   . GLN A 1 103 ? 37.263 41.324 0.997   1.00   28.82 ? 97   GLN A C   1 
ATOM   727  O O   . GLN A 1 103 ? 38.335 40.987 0.489   1.00   28.23 ? 97   GLN A O   1 
ATOM   728  C CB  . GLN A 1 103 ? 35.848 39.539 2.144   1.00   31.02 ? 97   GLN A CB  1 
ATOM   729  C CG  . GLN A 1 103 ? 34.600 38.657 2.125   1.00   33.64 ? 97   GLN A CG  1 
ATOM   730  C CD  . GLN A 1 103 ? 33.311 39.483 2.074   1.00   37.44 ? 97   GLN A CD  1 
ATOM   731  O OE1 . GLN A 1 103 ? 33.172 40.458 2.805   1.00   39.38 ? 97   GLN A OE1 1 
ATOM   732  N NE2 . GLN A 1 103 ? 32.374 39.085 1.215   1.00   40.06 ? 97   GLN A NE2 1 
ATOM   733  N N   . PRO A 1 104 ? 37.098 42.504 1.587   1.00   27.11 ? 98   PRO A N   1 
ATOM   734  C CA  . PRO A 1 104 ? 38.126 43.551 1.491   1.00   25.29 ? 98   PRO A CA  1 
ATOM   735  C C   . PRO A 1 104 ? 39.384 43.342 2.335   1.00   23.17 ? 98   PRO A C   1 
ATOM   736  O O   . PRO A 1 104 ? 39.338 42.928 3.470   1.00   22.70 ? 98   PRO A O   1 
ATOM   737  C CB  . PRO A 1 104 ? 37.392 44.819 1.952   1.00   25.93 ? 98   PRO A CB  1 
ATOM   738  C CG  . PRO A 1 104 ? 36.214 44.382 2.678   1.00   26.90 ? 98   PRO A CG  1 
ATOM   739  C CD  . PRO A 1 104 ? 35.906 42.980 2.323   1.00   27.52 ? 98   PRO A CD  1 
ATOM   740  N N   . TYR A 1 105 ? 40.513 43.642 1.708   1.00   22.62 ? 99   TYR A N   1 
ATOM   741  C CA  . TYR A 1 105 ? 41.793 43.796 2.382   1.00   21.56 ? 99   TYR A CA  1 
ATOM   742  C C   . TYR A 1 105 ? 41.699 44.947 3.372   1.00   21.58 ? 99   TYR A C   1 
ATOM   743  O O   . TYR A 1 105 ? 40.996 45.953 3.126   1.00   20.70 ? 99   TYR A O   1 
ATOM   744  C CB  . TYR A 1 105 ? 42.862 44.150 1.360   1.00   20.82 ? 99   TYR A CB  1 
ATOM   745  C CG  . TYR A 1 105 ? 43.882 43.068 1.128   1.00   20.69 ? 99   TYR A CG  1 
ATOM   746  C CD1 . TYR A 1 105 ? 44.966 42.935 1.987   1.00   19.63 ? 99   TYR A CD1 1 
ATOM   747  C CD2 . TYR A 1 105 ? 43.786 42.193 0.043   1.00   22.66 ? 99   TYR A CD2 1 
ATOM   748  C CE1 . TYR A 1 105 ? 45.907 41.957 1.817   1.00   21.14 ? 99   TYR A CE1 1 
ATOM   749  C CE2 . TYR A 1 105 ? 44.758 41.211 -0.156  1.00   21.35 ? 99   TYR A CE2 1 
ATOM   750  C CZ  . TYR A 1 105 ? 45.803 41.091 0.743   1.00   21.36 ? 99   TYR A CZ  1 
ATOM   751  O OH  . TYR A 1 105 ? 46.805 40.136 0.629   1.00   22.85 ? 99   TYR A OH  1 
ATOM   752  N N   . ILE A 1 106 ? 42.444 44.836 4.466   1.00   20.62 ? 100  ILE A N   1 
ATOM   753  C CA  . ILE A 1 106 ? 42.687 46.002 5.332   1.00   19.95 ? 100  ILE A CA  1 
ATOM   754  C C   . ILE A 1 106 ? 44.134 46.438 5.181   1.00   19.43 ? 100  ILE A C   1 
ATOM   755  O O   . ILE A 1 106 ? 45.027 45.567 5.184   1.00   17.99 ? 100  ILE A O   1 
ATOM   756  C CB  . ILE A 1 106 ? 42.434 45.626 6.800   1.00   20.12 ? 100  ILE A CB  1 
ATOM   757  C CG1 . ILE A 1 106 ? 40.936 45.633 7.077   1.00   22.90 ? 100  ILE A CG1 1 
ATOM   758  C CG2 . ILE A 1 106 ? 43.110 46.608 7.759   1.00   21.14 ? 100  ILE A CG2 1 
ATOM   759  C CD1 . ILE A 1 106 ? 40.585 45.048 8.417   1.00   23.42 ? 100  ILE A CD1 1 
ATOM   760  N N   . LEU A 1 107 ? 44.393 47.732 5.061   1.00   18.61 ? 101  LEU A N   1 
ATOM   761  C CA  . LEU A 1 107 ? 45.741 48.256 5.245   1.00   18.09 ? 101  LEU A CA  1 
ATOM   762  C C   . LEU A 1 107 ? 45.861 48.809 6.681   1.00   19.34 ? 101  LEU A C   1 
ATOM   763  O O   . LEU A 1 107 ? 45.221 49.816 7.020   1.00   19.92 ? 101  LEU A O   1 
ATOM   764  C CB  . LEU A 1 107 ? 46.079 49.304 4.221   1.00   18.41 ? 101  LEU A CB  1 
ATOM   765  C CG  . LEU A 1 107 ? 47.433 49.977 4.380   1.00   19.59 ? 101  LEU A CG  1 
ATOM   766  C CD1 . LEU A 1 107 ? 48.577 48.905 4.529   1.00   21.37 ? 101  LEU A CD1 1 
ATOM   767  C CD2 . LEU A 1 107 ? 47.692 50.896 3.226   1.00   21.91 ? 101  LEU A CD2 1 
ATOM   768  N N   . GLN A 1 108 ? 46.621 48.118 7.515   1.00   18.53 ? 102  GLN A N   1 
ATOM   769  C CA  . GLN A 1 108 ? 46.957 48.585 8.864   1.00   18.62 ? 102  GLN A CA  1 
ATOM   770  C C   . GLN A 1 108 ? 48.283 49.317 8.870   1.00   20.06 ? 102  GLN A C   1 
ATOM   771  O O   . GLN A 1 108 ? 49.278 48.839 8.289   1.00   19.64 ? 102  GLN A O   1 
ATOM   772  C CB  . GLN A 1 108 ? 46.985 47.433 9.832   1.00   19.43 ? 102  GLN A CB  1 
ATOM   773  C CG  . GLN A 1 108 ? 47.247 47.889 11.305  1.00   19.36 ? 102  GLN A CG  1 
ATOM   774  C CD  . GLN A 1 108 ? 47.312 46.779 12.236  1.00   21.93 ? 102  GLN A CD  1 
ATOM   775  O OE1 . GLN A 1 108 ? 46.277 46.268 12.646  1.00   24.18 ? 102  GLN A OE1 1 
ATOM   776  N NE2 . GLN A 1 108 ? 48.529 46.340 12.576  1.00   21.38 ? 102  GLN A NE2 1 
ATOM   777  N N   . THR A 1 109 ? 48.324 50.478 9.532   1.00   18.87 ? 103  THR A N   1 
ATOM   778  C CA  . THR A 1 109 ? 49.559 51.178 9.791   1.00   18.84 ? 103  THR A CA  1 
ATOM   779  C C   . THR A 1 109 ? 49.770 51.249 11.313  1.00   20.02 ? 103  THR A C   1 
ATOM   780  O O   . THR A 1 109 ? 48.826 51.117 12.092  1.00   20.49 ? 103  THR A O   1 
ATOM   781  C CB  . THR A 1 109 ? 49.575 52.557 9.203   1.00   20.71 ? 103  THR A CB  1 
ATOM   782  O OG1 . THR A 1 109 ? 48.375 53.285 9.597   1.00   20.65 ? 103  THR A OG1 1 
ATOM   783  C CG2 . THR A 1 109 ? 49.549 52.505 7.669   1.00   19.52 ? 103  THR A CG2 1 
ATOM   784  N N   . ASN A 1 110 ? 51.018 51.439 11.685  1.00   19.92 ? 104  ASN A N   1 
ATOM   785  C CA  . ASN A 1 110 ? 51.418 51.480 13.102  1.00   20.36 ? 104  ASN A CA  1 
ATOM   786  C C   . ASN A 1 110 ? 52.741 52.221 13.202  1.00   20.41 ? 104  ASN A C   1 
ATOM   787  O O   . ASN A 1 110 ? 53.496 52.300 12.235  1.00   19.06 ? 104  ASN A O   1 
ATOM   788  C CB  . ASN A 1 110 ? 51.516 50.086 13.679  1.00   19.48 ? 104  ASN A CB  1 
ATOM   789  C CG  . ASN A 1 110 ? 51.328 50.040 15.212  1.00   21.24 ? 104  ASN A CG  1 
ATOM   790  O OD1 . ASN A 1 110 ? 51.213 51.081 15.873  1.00   22.13 ? 104  ASN A OD1 1 
ATOM   791  N ND2 . ASN A 1 110 ? 51.322 48.848 15.754  1.00   21.18 ? 104  ASN A ND2 1 
ATOM   792  N N   . VAL A 1 111 ? 52.997 52.805 14.375  1.00   20.82 ? 105  VAL A N   1 
ATOM   793  C CA  . VAL A 1 111 ? 54.236 53.503 14.638  1.00   21.96 ? 105  VAL A CA  1 
ATOM   794  C C   . VAL A 1 111 ? 54.701 53.089 16.021  1.00   22.89 ? 105  VAL A C   1 
ATOM   795  O O   . VAL A 1 111 ? 53.927 53.232 16.984  1.00   22.90 ? 105  VAL A O   1 
ATOM   796  C CB  . VAL A 1 111 ? 54.071 55.038 14.571  1.00   22.40 ? 105  VAL A CB  1 
ATOM   797  C CG1 . VAL A 1 111 ? 55.347 55.730 14.998  1.00   24.74 ? 105  VAL A CG1 1 
ATOM   798  C CG2 . VAL A 1 111 ? 53.657 55.484 13.185  1.00   23.80 ? 105  VAL A CG2 1 
ATOM   799  N N   . PHE A 1 112 ? 55.913 52.531 16.107  1.00   22.34 ? 106  PHE A N   1 
ATOM   800  C CA  . PHE A 1 112 ? 56.570 52.268 17.391  1.00   23.88 ? 106  PHE A CA  1 
ATOM   801  C C   . PHE A 1 112 ? 57.610 53.329 17.674  1.00   24.41 ? 106  PHE A C   1 
ATOM   802  O O   . PHE A 1 112 ? 58.422 53.636 16.818  1.00   22.10 ? 106  PHE A O   1 
ATOM   803  C CB  . PHE A 1 112 ? 57.266 50.897 17.412  1.00   23.99 ? 106  PHE A CB  1 
ATOM   804  C CG  . PHE A 1 112 ? 56.326 49.722 17.364  1.00   24.26 ? 106  PHE A CG  1 
ATOM   805  C CD1 . PHE A 1 112 ? 55.629 49.427 16.216  1.00   26.57 ? 106  PHE A CD1 1 
ATOM   806  C CD2 . PHE A 1 112 ? 56.176 48.885 18.465  1.00   28.67 ? 106  PHE A CD2 1 
ATOM   807  C CE1 . PHE A 1 112 ? 54.767 48.324 16.168  1.00   28.24 ? 106  PHE A CE1 1 
ATOM   808  C CE2 . PHE A 1 112 ? 55.318 47.795 18.426  1.00   29.07 ? 106  PHE A CE2 1 
ATOM   809  C CZ  . PHE A 1 112 ? 54.615 47.519 17.276  1.00   29.22 ? 106  PHE A CZ  1 
ATOM   810  N N   . THR A 1 113 ? 57.650 53.832 18.923  1.00   25.88 ? 107  THR A N   1 
ATOM   811  C CA  . THR A 1 113 ? 58.702 54.736 19.372  1.00   26.83 ? 107  THR A CA  1 
ATOM   812  C C   . THR A 1 113 ? 59.231 54.246 20.718  1.00   28.21 ? 107  THR A C   1 
ATOM   813  O O   . THR A 1 113 ? 58.447 54.065 21.648  1.00   28.12 ? 107  THR A O   1 
ATOM   814  C CB  . THR A 1 113 ? 58.159 56.150 19.565  1.00   27.96 ? 107  THR A CB  1 
ATOM   815  O OG1 . THR A 1 113 ? 56.969 56.096 20.374  1.00   28.07 ? 107  THR A OG1 1 
ATOM   816  C CG2 . THR A 1 113 ? 57.693 56.758 18.245  1.00   29.21 ? 107  THR A CG2 1 
ATOM   817  N N   . GLY A 1 114 ? 60.533 54.003 20.831  1.00   29.31 ? 108  GLY A N   1 
ATOM   818  C CA  . GLY A 1 114 ? 61.100 53.585 22.115  1.00   30.21 ? 108  GLY A CA  1 
ATOM   819  C C   . GLY A 1 114 ? 60.532 52.256 22.575  1.00   30.83 ? 108  GLY A C   1 
ATOM   820  O O   . GLY A 1 114 ? 60.411 52.008 23.768  1.00   31.26 ? 108  GLY A O   1 
ATOM   821  N N   . GLY A 1 115 ? 60.168 51.393 21.625  1.00   30.20 ? 109  GLY A N   1 
ATOM   822  C CA  . GLY A 1 115 ? 59.703 50.051 21.936  1.00   30.37 ? 109  GLY A CA  1 
ATOM   823  C C   . GLY A 1 115 ? 58.193 49.936 22.116  1.00   30.70 ? 109  GLY A C   1 
ATOM   824  O O   . GLY A 1 115 ? 57.671 48.827 22.227  1.00   32.12 ? 109  GLY A O   1 
ATOM   825  N N   . LYS A 1 116 ? 57.496 51.060 22.106  1.00   30.06 ? 110  LYS A N   1 
ATOM   826  C CA  . LYS A 1 116 ? 56.068 51.108 22.354  1.00   31.33 ? 110  LYS A CA  1 
ATOM   827  C C   . LYS A 1 116 ? 55.307 51.469 21.082  1.00   29.91 ? 110  LYS A C   1 
ATOM   828  O O   . LYS A 1 116 ? 55.532 52.528 20.505  1.00   28.04 ? 110  LYS A O   1 
ATOM   829  C CB  . LYS A 1 116 ? 55.769 52.159 23.418  1.00   31.89 ? 110  LYS A CB  1 
ATOM   830  C CG  . LYS A 1 116 ? 54.288 52.431 23.670  1.00   36.74 ? 110  LYS A CG  1 
ATOM   831  C CD  . LYS A 1 116 ? 53.619 51.317 24.489  1.00   41.70 ? 110  LYS A CD  1 
ATOM   832  C CE  . LYS A 1 116 ? 52.135 51.623 24.803  1.00   43.64 ? 110  LYS A CE  1 
ATOM   833  N NZ  . LYS A 1 116 ? 51.682 53.000 24.402  1.00   45.92 ? 110  LYS A NZ  1 
ATOM   834  N N   . GLY A 1 117 ? 54.433 50.567 20.659  1.00   30.30 ? 111  GLY A N   1 
ATOM   835  C CA  . GLY A 1 117 ? 53.507 50.815 19.560  1.00   30.23 ? 111  GLY A CA  1 
ATOM   836  C C   . GLY A 1 117 ? 52.086 51.193 19.980  1.00   30.84 ? 111  GLY A C   1 
ATOM   837  O O   . GLY A 1 117 ? 51.835 52.292 20.500  1.00   30.92 ? 111  GLY A O   1 
ATOM   838  N N   . ASP A 1 118 ? 51.151 50.292 19.698  1.00   30.84 ? 112  ASP A N   1 
ATOM   839  C CA  . ASP A 1 118 ? 49.706 50.503 19.958  1.00   30.90 ? 112  ASP A CA  1 
ATOM   840  C C   . ASP A 1 118 ? 49.152 51.723 19.308  1.00   29.95 ? 112  ASP A C   1 
ATOM   841  O O   . ASP A 1 118 ? 48.322 52.435 19.875  1.00   30.49 ? 112  ASP A O   1 
ATOM   842  C CB  . ASP A 1 118 ? 49.434 50.542 21.466  1.00   32.12 ? 112  ASP A CB  1 
ATOM   843  C CG  . ASP A 1 118 ? 49.966 49.351 22.147  1.00   32.58 ? 112  ASP A CG  1 
ATOM   844  O OD1 . ASP A 1 118 ? 49.387 48.259 21.997  1.00   39.69 ? 112  ASP A OD1 1 
ATOM   845  O OD2 . ASP A 1 118 ? 51.001 49.367 22.839  1.00   41.74 ? 112  ASP A OD2 1 
ATOM   846  N N   . ARG A 1 119 ? 49.620 52.000 18.102  1.00   26.68 ? 113  ARG A N   1 
ATOM   847  C CA  . ARG A 1 119 ? 49.119 53.124 17.397  1.00   25.29 ? 113  ARG A CA  1 
ATOM   848  C C   . ARG A 1 119 ? 48.530 52.642 16.077  1.00   23.87 ? 113  ARG A C   1 
ATOM   849  O O   . ARG A 1 119 ? 48.685 53.299 15.088  1.00   22.30 ? 113  ARG A O   1 
ATOM   850  C CB  . ARG A 1 119 ? 50.210 54.156 17.152  1.00   25.22 ? 113  ARG A CB  1 
ATOM   851  C CG  . ARG A 1 119 ? 50.860 54.817 18.391  1.00   26.26 ? 113  ARG A CG  1 
ATOM   852  C CD  . ARG A 1 119 ? 51.654 56.024 18.022  1.00   27.29 ? 113  ARG A CD  1 
ATOM   853  N NE  . ARG A 1 119 ? 52.295 56.726 19.139  1.00   30.27 ? 113  ARG A NE  1 
ATOM   854  C CZ  . ARG A 1 119 ? 53.464 56.410 19.689  1.00   33.59 ? 113  ARG A CZ  1 
ATOM   855  N NH1 . ARG A 1 119 ? 54.177 55.367 19.266  1.00   32.56 ? 113  ARG A NH1 1 
ATOM   856  N NH2 . ARG A 1 119 ? 53.941 57.159 20.681  1.00   34.39 ? 113  ARG A NH2 1 
ATOM   857  N N   . GLU A 1 120 ? 47.798 51.545 16.117  1.00   24.34 ? 114  GLU A N   1 
ATOM   858  C CA  . GLU A 1 120 ? 47.180 50.958 14.911  1.00   24.73 ? 114  GLU A CA  1 
ATOM   859  C C   . GLU A 1 120 ? 46.110 51.864 14.302  1.00   25.41 ? 114  GLU A C   1 
ATOM   860  O O   . GLU A 1 120 ? 45.251 52.419 15.011  1.00   26.43 ? 114  GLU A O   1 
ATOM   861  C CB  . GLU A 1 120 ? 46.550 49.591 15.216  1.00   24.45 ? 114  GLU A CB  1 
ATOM   862  C CG  . GLU A 1 120 ? 47.470 48.439 15.522  1.00   26.89 ? 114  GLU A CG  1 
ATOM   863  C CD  . GLU A 1 120 ? 47.844 48.269 16.996  1.00   30.04 ? 114  GLU A CD  1 
ATOM   864  O OE1 . GLU A 1 120 ? 47.623 49.199 17.801  1.00   31.22 ? 114  GLU A OE1 1 
ATOM   865  O OE2 . GLU A 1 120 ? 48.393 47.207 17.317  1.00   31.68 ? 114  GLU A OE2 1 
ATOM   866  N N   . GLN A 1 121 ? 46.154 52.059 12.989  1.00   24.66 ? 115  GLN A N   1 
ATOM   867  C CA  . GLN A 1 121 ? 45.007 52.519 12.242  1.00   23.61 ? 115  GLN A CA  1 
ATOM   868  C C   . GLN A 1 121 ? 44.762 51.469 11.168  1.00   24.27 ? 115  GLN A C   1 
ATOM   869  O O   . GLN A 1 121 ? 45.717 50.819 10.698  1.00   22.49 ? 115  GLN A O   1 
ATOM   870  C CB  . GLN A 1 121 ? 45.264 53.867 11.597  1.00   24.51 ? 115  GLN A CB  1 
ATOM   871  C CG  . GLN A 1 121 ? 45.544 54.986 12.586  1.00   26.39 ? 115  GLN A CG  1 
ATOM   872  C CD  . GLN A 1 121 ? 45.745 56.309 11.925  1.00   30.17 ? 115  GLN A CD  1 
ATOM   873  O OE1 . GLN A 1 121 ? 46.118 56.389 10.755  1.00   25.76 ? 115  GLN A OE1 1 
ATOM   874  N NE2 . GLN A 1 121 ? 45.493 57.389 12.685  1.00   32.53 ? 115  GLN A NE2 1 
ATOM   875  N N   . ARG A 1 122 ? 43.492 51.269 10.819  1.00   23.17 ? 116  ARG A N   1 
ATOM   876  C CA  . ARG A 1 122 ? 43.115 50.364 9.743   1.00   22.66 ? 116  ARG A CA  1 
ATOM   877  C C   . ARG A 1 122 ? 42.198 51.059 8.771   1.00   23.15 ? 116  ARG A C   1 
ATOM   878  O O   . ARG A 1 122 ? 41.200 51.711 9.161   1.00   23.93 ? 116  ARG A O   1 
ATOM   879  C CB  . ARG A 1 122 ? 42.421 49.141 10.298  1.00   22.71 ? 116  ARG A CB  1 
ATOM   880  C CG  . ARG A 1 122 ? 43.237 48.348 11.238  1.00   22.87 ? 116  ARG A CG  1 
ATOM   881  C CD  . ARG A 1 122 ? 42.540 47.111 11.759  1.00   24.73 ? 116  ARG A CD  1 
ATOM   882  N NE  . ARG A 1 122 ? 43.512 46.281 12.405  1.00   25.55 ? 116  ARG A NE  1 
ATOM   883  C CZ  . ARG A 1 122 ? 43.239 45.123 12.987  1.00   27.56 ? 116  ARG A CZ  1 
ATOM   884  N NH1 . ARG A 1 122 ? 41.995 44.672 13.004  1.00   29.55 ? 116  ARG A NH1 1 
ATOM   885  N NH2 . ARG A 1 122 ? 44.222 44.413 13.529  1.00   27.19 ? 116  ARG A NH2 1 
ATOM   886  N N   . ILE A 1 123 ? 42.513 50.935 7.490   1.00   21.93 ? 117  ILE A N   1 
ATOM   887  C CA  . ILE A 1 123 ? 41.695 51.477 6.422   1.00   21.22 ? 117  ILE A CA  1 
ATOM   888  C C   . ILE A 1 123 ? 41.355 50.386 5.413   1.00   22.82 ? 117  ILE A C   1 
ATOM   889  O O   . ILE A 1 123 ? 42.090 49.387 5.254   1.00   21.13 ? 117  ILE A O   1 
ATOM   890  C CB  . ILE A 1 123 ? 42.339 52.682 5.739   1.00   21.53 ? 117  ILE A CB  1 
ATOM   891  C CG1 . ILE A 1 123 ? 43.607 52.335 4.935   1.00   20.29 ? 117  ILE A CG1 1 
ATOM   892  C CG2 . ILE A 1 123 ? 42.716 53.764 6.768   1.00   21.43 ? 117  ILE A CG2 1 
ATOM   893  C CD1 . ILE A 1 123 ? 44.064 53.425 4.031   1.00   22.41 ? 117  ILE A CD1 1 
ATOM   894  N N   . TYR A 1 124 ? 40.233 50.589 4.743   1.00   22.60 ? 118  TYR A N   1 
ATOM   895  C CA  . TYR A 1 124 ? 39.995 49.979 3.456   1.00   23.13 ? 118  TYR A CA  1 
ATOM   896  C C   . TYR A 1 124 ? 40.574 50.879 2.392   1.00   22.82 ? 118  TYR A C   1 
ATOM   897  O O   . TYR A 1 124 ? 40.843 52.086 2.617   1.00   23.57 ? 118  TYR A O   1 
ATOM   898  C CB  . TYR A 1 124 ? 38.477 49.782 3.238   1.00   24.23 ? 118  TYR A CB  1 
ATOM   899  C CG  . TYR A 1 124 ? 37.794 48.728 4.063   1.00   25.11 ? 118  TYR A CG  1 
ATOM   900  C CD1 . TYR A 1 124 ? 38.477 47.641 4.624   1.00   26.61 ? 118  TYR A CD1 1 
ATOM   901  C CD2 . TYR A 1 124 ? 36.410 48.781 4.242   1.00   28.44 ? 118  TYR A CD2 1 
ATOM   902  C CE1 . TYR A 1 124 ? 37.804 46.678 5.366   1.00   27.11 ? 118  TYR A CE1 1 
ATOM   903  C CE2 . TYR A 1 124 ? 35.740 47.813 4.953   1.00   26.94 ? 118  TYR A CE2 1 
ATOM   904  C CZ  . TYR A 1 124 ? 36.412 46.773 5.517   1.00   28.35 ? 118  TYR A CZ  1 
ATOM   905  O OH  . TYR A 1 124 ? 35.679 45.844 6.228   1.00   28.57 ? 118  TYR A OH  1 
ATOM   906  N N   . LEU A 1 125 ? 40.780 50.321 1.203   1.00   22.26 ? 119  LEU A N   1 
ATOM   907  C CA  . LEU A 1 125 ? 41.331 51.057 0.107   1.00   22.72 ? 119  LEU A CA  1 
ATOM   908  C C   . LEU A 1 125 ? 40.236 51.388 -0.925  1.00   23.07 ? 119  LEU A C   1 
ATOM   909  O O   . LEU A 1 125 ? 39.191 50.765 -0.947  1.00   24.21 ? 119  LEU A O   1 
ATOM   910  C CB  . LEU A 1 125 ? 42.487 50.286 -0.563  1.00   22.99 ? 119  LEU A CB  1 
ATOM   911  C CG  . LEU A 1 125 ? 43.677 50.087 0.399   1.00   23.69 ? 119  LEU A CG  1 
ATOM   912  C CD1 . LEU A 1 125 ? 44.657 49.089 -0.188  1.00   24.63 ? 119  LEU A CD1 1 
ATOM   913  C CD2 . LEU A 1 125 ? 44.357 51.380 0.720   1.00   23.67 ? 119  LEU A CD2 1 
ATOM   914  N N   . TRP A 1 126 ? 40.535 52.376 -1.746  1.00   23.45 ? 120  TRP A N   1 
ATOM   915  C CA  . TRP A 1 126 ? 39.636 52.906 -2.794  1.00   24.54 ? 120  TRP A CA  1 
ATOM   916  C C   . TRP A 1 126 ? 39.910 52.271 -4.165  1.00   24.71 ? 120  TRP A C   1 
ATOM   917  O O   . TRP A 1 126 ? 39.608 52.833 -5.201  1.00   26.26 ? 120  TRP A O   1 
ATOM   918  C CB  . TRP A 1 126 ? 39.782 54.449 -2.829  1.00   24.10 ? 120  TRP A CB  1 
ATOM   919  C CG  . TRP A 1 126 ? 41.180 54.948 -2.887  1.00   23.64 ? 120  TRP A CG  1 
ATOM   920  C CD1 . TRP A 1 126 ? 41.888 55.234 -3.987  1.00   22.99 ? 120  TRP A CD1 1 
ATOM   921  C CD2 . TRP A 1 126 ? 42.055 55.179 -1.771  1.00   21.84 ? 120  TRP A CD2 1 
ATOM   922  N NE1 . TRP A 1 126 ? 43.144 55.662 -3.640  1.00   23.41 ? 120  TRP A NE1 1 
ATOM   923  C CE2 . TRP A 1 126 ? 43.278 55.599 -2.284  1.00   22.99 ? 120  TRP A CE2 1 
ATOM   924  C CE3 . TRP A 1 126 ? 41.917 55.043 -0.389  1.00   25.00 ? 120  TRP A CE3 1 
ATOM   925  C CZ2 . TRP A 1 126 ? 44.360 55.957 -1.470  1.00   21.84 ? 120  TRP A CZ2 1 
ATOM   926  C CZ3 . TRP A 1 126 ? 43.002 55.372 0.419   1.00   22.74 ? 120  TRP A CZ3 1 
ATOM   927  C CH2 . TRP A 1 126 ? 44.196 55.814 -0.133  1.00   22.75 ? 120  TRP A CH2 1 
ATOM   928  N N   . PHE A 1 127 ? 40.491 51.067 -4.146  1.00   24.79 ? 121  PHE A N   1 
ATOM   929  C CA  . PHE A 1 127 ? 40.775 50.221 -5.318  1.00   23.71 ? 121  PHE A CA  1 
ATOM   930  C C   . PHE A 1 127 ? 41.007 48.787 -4.760  1.00   24.68 ? 121  PHE A C   1 
ATOM   931  O O   . PHE A 1 127 ? 41.161 48.593 -3.524  1.00   23.08 ? 121  PHE A O   1 
ATOM   932  C CB  . PHE A 1 127 ? 42.009 50.694 -6.072  1.00   24.47 ? 121  PHE A CB  1 
ATOM   933  C CG  . PHE A 1 127 ? 43.216 50.848 -5.178  1.00   21.81 ? 121  PHE A CG  1 
ATOM   934  C CD1 . PHE A 1 127 ? 44.047 49.756 -4.901  1.00   21.00 ? 121  PHE A CD1 1 
ATOM   935  C CD2 . PHE A 1 127 ? 43.487 52.072 -4.583  1.00   23.25 ? 121  PHE A CD2 1 
ATOM   936  C CE1 . PHE A 1 127 ? 45.144 49.907 -4.049  1.00   21.96 ? 121  PHE A CE1 1 
ATOM   937  C CE2 . PHE A 1 127 ? 44.569 52.236 -3.732  1.00   24.30 ? 121  PHE A CE2 1 
ATOM   938  C CZ  . PHE A 1 127 ? 45.407 51.136 -3.465  1.00   23.31 ? 121  PHE A CZ  1 
ATOM   939  N N   . ASP A 1 128 ? 40.996 47.810 -5.653  1.00   24.70 ? 122  ASP A N   1 
ATOM   940  C CA  . ASP A 1 128 ? 41.267 46.427 -5.288  1.00   24.56 ? 122  ASP A CA  1 
ATOM   941  C C   . ASP A 1 128 ? 42.787 46.311 -5.325  1.00   22.70 ? 122  ASP A C   1 
ATOM   942  O O   . ASP A 1 128 ? 43.378 46.373 -6.393  1.00   22.24 ? 122  ASP A O   1 
ATOM   943  C CB  . ASP A 1 128 ? 40.655 45.483 -6.323  1.00   25.83 ? 122  ASP A CB  1 
ATOM   944  C CG  . ASP A 1 128 ? 40.898 44.023 -6.021  1.00   28.59 ? 122  ASP A CG  1 
ATOM   945  O OD1 . ASP A 1 128 ? 41.805 43.695 -5.210  1.00   28.00 ? 122  ASP A OD1 1 
ATOM   946  O OD2 . ASP A 1 128 ? 40.192 43.128 -6.541  1.00   31.96 ? 122  ASP A OD2 1 
ATOM   947  N N   . PRO A 1 129 ? 43.437 46.144 -4.184  1.00   21.49 ? 123  PRO A N   1 
ATOM   948  C CA  . PRO A 1 129 ? 44.906 46.157 -4.185  1.00   21.02 ? 123  PRO A CA  1 
ATOM   949  C C   . PRO A 1 129 ? 45.523 44.881 -4.769  1.00   21.57 ? 123  PRO A C   1 
ATOM   950  O O   . PRO A 1 129 ? 46.747 44.818 -4.878  1.00   21.02 ? 123  PRO A O   1 
ATOM   951  C CB  . PRO A 1 129 ? 45.256 46.301 -2.697  1.00   20.24 ? 123  PRO A CB  1 
ATOM   952  C CG  . PRO A 1 129 ? 44.137 45.622 -1.990  1.00   20.85 ? 123  PRO A CG  1 
ATOM   953  C CD  . PRO A 1 129 ? 42.896 45.954 -2.832  1.00   21.69 ? 123  PRO A CD  1 
ATOM   954  N N   . THR A 1 130 ? 44.701 43.893 -5.089  1.00   22.10 ? 124  THR A N   1 
ATOM   955  C CA  . THR A 1 130 ? 45.195 42.673 -5.734  1.00   23.01 ? 124  THR A CA  1 
ATOM   956  C C   . THR A 1 130 ? 45.193 42.726 -7.254  1.00   24.69 ? 124  THR A C   1 
ATOM   957  O O   . THR A 1 130 ? 45.744 41.832 -7.878  1.00   23.82 ? 124  THR A O   1 
ATOM   958  C CB  . THR A 1 130 ? 44.387 41.437 -5.279  1.00   22.85 ? 124  THR A CB  1 
ATOM   959  O OG1 . THR A 1 130 ? 43.054 41.466 -5.836  1.00   24.46 ? 124  THR A OG1 1 
ATOM   960  C CG2 . THR A 1 130 ? 44.172 41.409 -3.809  1.00   22.37 ? 124  THR A CG2 1 
ATOM   961  N N   . LYS A 1 131 ? 44.581 43.751 -7.845  1.00   26.13 ? 125  LYS A N   1 
ATOM   962  C CA  . LYS A 1 131 ? 44.358 43.811 -9.299  1.00   27.63 ? 125  LYS A CA  1 
ATOM   963  C C   . LYS A 1 131 ? 45.494 44.511 -10.070 1.00   27.13 ? 125  LYS A C   1 
ATOM   964  O O   . LYS A 1 131 ? 45.808 44.122 -11.174 1.00   26.58 ? 125  LYS A O   1 
ATOM   965  C CB  . LYS A 1 131 ? 42.991 44.468 -9.576  1.00   28.55 ? 125  LYS A CB  1 
ATOM   966  C CG  . LYS A 1 131 ? 42.453 44.253 -10.998 1.00   34.27 ? 125  LYS A CG  1 
ATOM   967  C CD  . LYS A 1 131 ? 41.437 45.348 -11.427 1.00   39.16 ? 125  LYS A CD  1 
ATOM   968  C CE  . LYS A 1 131 ? 42.054 46.363 -12.410 1.00   42.92 ? 125  LYS A CE  1 
ATOM   969  N NZ  . LYS A 1 131 ? 41.279 47.639 -12.463 1.00   44.88 ? 125  LYS A NZ  1 
ATOM   970  N N   . GLU A 1 132 ? 46.102 45.551 -9.487  1.00   26.42 ? 126  GLU A N   1 
ATOM   971  C CA  . GLU A 1 132 ? 47.206 46.289 -10.085 1.00   26.35 ? 126  GLU A CA  1 
ATOM   972  C C   . GLU A 1 132 ? 48.243 46.643 -9.019  1.00   24.36 ? 126  GLU A C   1 
ATOM   973  O O   . GLU A 1 132 ? 47.940 46.619 -7.820  1.00   24.57 ? 126  GLU A O   1 
ATOM   974  C CB  . GLU A 1 132 ? 46.741 47.641 -10.650 1.00   27.14 ? 126  GLU A CB  1 
ATOM   975  C CG  . GLU A 1 132 ? 45.573 47.603 -11.616 1.00   33.27 ? 126  GLU A CG  1 
ATOM   976  C CD  . GLU A 1 132 ? 45.925 47.006 -12.977 1.00   39.21 ? 126  GLU A CD  1 
ATOM   977  O OE1 . GLU A 1 132 ? 47.132 46.926 -13.323 1.00   43.19 ? 126  GLU A OE1 1 
ATOM   978  O OE2 . GLU A 1 132 ? 44.970 46.614 -13.709 1.00   44.60 ? 126  GLU A OE2 1 
ATOM   979  N N   . PHE A 1 133 ? 49.427 46.994 -9.465  1.00   23.51 ? 127  PHE A N   1 
ATOM   980  C CA  . PHE A 1 133 ? 50.456 47.559 -8.578  1.00   22.64 ? 127  PHE A CA  1 
ATOM   981  C C   . PHE A 1 133 ? 50.098 48.982 -8.220  1.00   23.29 ? 127  PHE A C   1 
ATOM   982  O O   . PHE A 1 133 ? 49.655 49.771 -9.079  1.00   23.93 ? 127  PHE A O   1 
ATOM   983  C CB  . PHE A 1 133 ? 51.807 47.559 -9.227  1.00   22.37 ? 127  PHE A CB  1 
ATOM   984  C CG  . PHE A 1 133 ? 52.421 46.201 -9.328  1.00   22.77 ? 127  PHE A CG  1 
ATOM   985  C CD1 . PHE A 1 133 ? 52.192 45.401 -10.441 1.00   24.37 ? 127  PHE A CD1 1 
ATOM   986  C CD2 . PHE A 1 133 ? 53.242 45.720 -8.303  1.00   22.31 ? 127  PHE A CD2 1 
ATOM   987  C CE1 . PHE A 1 133 ? 52.770 44.125 -10.525 1.00   25.82 ? 127  PHE A CE1 1 
ATOM   988  C CE2 . PHE A 1 133 ? 53.831 44.482 -8.388  1.00   21.81 ? 127  PHE A CE2 1 
ATOM   989  C CZ  . PHE A 1 133 ? 53.586 43.662 -9.490  1.00   26.15 ? 127  PHE A CZ  1 
ATOM   990  N N   . HIS A 1 134 ? 50.260 49.289 -6.940  1.00   21.37 ? 128  HIS A N   1 
ATOM   991  C CA  . HIS A 1 134 ? 50.121 50.642 -6.410  1.00   20.96 ? 128  HIS A CA  1 
ATOM   992  C C   . HIS A 1 134 ? 51.351 50.971 -5.567  1.00   21.11 ? 128  HIS A C   1 
ATOM   993  O O   . HIS A 1 134 ? 52.071 50.073 -5.155  1.00   19.24 ? 128  HIS A O   1 
ATOM   994  C CB  . HIS A 1 134 ? 48.868 50.748 -5.577  1.00   19.67 ? 128  HIS A CB  1 
ATOM   995  C CG  . HIS A 1 134 ? 47.602 50.650 -6.372  1.00   22.55 ? 128  HIS A CG  1 
ATOM   996  N ND1 . HIS A 1 134 ? 46.807 51.745 -6.630  1.00   24.94 ? 128  HIS A ND1 1 
ATOM   997  C CD2 . HIS A 1 134 ? 47.029 49.607 -7.020  1.00   24.73 ? 128  HIS A CD2 1 
ATOM   998  C CE1 . HIS A 1 134 ? 45.763 51.364 -7.343  1.00   26.42 ? 128  HIS A CE1 1 
ATOM   999  N NE2 . HIS A 1 134 ? 45.891 50.085 -7.622  1.00   26.16 ? 128  HIS A NE2 1 
ATOM   1000 N N   . TYR A 1 135 ? 51.622 52.265 -5.392  1.00   20.99 ? 129  TYR A N   1 
ATOM   1001 C CA  . TYR A 1 135 ? 52.781 52.725 -4.640  1.00   21.48 ? 129  TYR A CA  1 
ATOM   1002 C C   . TYR A 1 135 ? 52.391 52.889 -3.163  1.00   20.49 ? 129  TYR A C   1 
ATOM   1003 O O   . TYR A 1 135 ? 51.354 53.455 -2.810  1.00   21.05 ? 129  TYR A O   1 
ATOM   1004 C CB  . TYR A 1 135 ? 53.309 54.061 -5.184  1.00   23.18 ? 129  TYR A CB  1 
ATOM   1005 C CG  . TYR A 1 135 ? 54.167 53.921 -6.419  1.00   26.45 ? 129  TYR A CG  1 
ATOM   1006 C CD1 . TYR A 1 135 ? 55.509 53.619 -6.303  1.00   32.15 ? 129  TYR A CD1 1 
ATOM   1007 C CD2 . TYR A 1 135 ? 53.619 54.056 -7.708  1.00   32.94 ? 129  TYR A CD2 1 
ATOM   1008 C CE1 . TYR A 1 135 ? 56.314 53.454 -7.428  1.00   34.13 ? 129  TYR A CE1 1 
ATOM   1009 C CE2 . TYR A 1 135 ? 54.426 53.897 -8.855  1.00   34.23 ? 129  TYR A CE2 1 
ATOM   1010 C CZ  . TYR A 1 135 ? 55.771 53.597 -8.696  1.00   36.81 ? 129  TYR A CZ  1 
ATOM   1011 O OH  . TYR A 1 135 ? 56.621 53.414 -9.780  1.00   39.90 ? 129  TYR A OH  1 
ATOM   1012 N N   . TYR A 1 136 ? 53.243 52.406 -2.299  1.00   19.01 ? 130  TYR A N   1 
ATOM   1013 C CA  . TYR A 1 136 ? 53.084 52.532 -0.870  1.00   18.54 ? 130  TYR A CA  1 
ATOM   1014 C C   . TYR A 1 136 ? 54.395 53.162 -0.423  1.00   17.99 ? 130  TYR A C   1 
ATOM   1015 O O   . TYR A 1 136 ? 55.457 52.616 -0.689  1.00   18.09 ? 130  TYR A O   1 
ATOM   1016 C CB  . TYR A 1 136 ? 52.792 51.198 -0.212  1.00   17.74 ? 130  TYR A CB  1 
ATOM   1017 C CG  . TYR A 1 136 ? 51.511 50.592 -0.747  1.00   18.71 ? 130  TYR A CG  1 
ATOM   1018 C CD1 . TYR A 1 136 ? 50.267 50.987 -0.263  1.00   16.16 ? 130  TYR A CD1 1 
ATOM   1019 C CD2 . TYR A 1 136 ? 51.537 49.654 -1.762  1.00   16.06 ? 130  TYR A CD2 1 
ATOM   1020 C CE1 . TYR A 1 136 ? 49.096 50.465 -0.763  1.00   16.67 ? 130  TYR A CE1 1 
ATOM   1021 C CE2 . TYR A 1 136 ? 50.348 49.120 -2.292  1.00   16.52 ? 130  TYR A CE2 1 
ATOM   1022 C CZ  . TYR A 1 136 ? 49.135 49.523 -1.783  1.00   17.12 ? 130  TYR A CZ  1 
ATOM   1023 O OH  . TYR A 1 136 ? 47.981 48.998 -2.291  1.00   18.04 ? 130  TYR A OH  1 
ATOM   1024 N N   . SER A 1 137 ? 54.337 54.331 0.244   1.00   18.32 ? 131  SER A N   1 
ATOM   1025 C CA  . SER A 1 137 ? 55.518 55.119 0.505   1.00   20.03 ? 131  SER A CA  1 
ATOM   1026 C C   . SER A 1 137 ? 55.511 55.678 1.915   1.00   19.21 ? 131  SER A C   1 
ATOM   1027 O O   . SER A 1 137 ? 54.457 55.894 2.482   1.00   18.17 ? 131  SER A O   1 
ATOM   1028 C CB  . SER A 1 137 ? 55.588 56.327 -0.428  1.00   20.93 ? 131  SER A CB  1 
ATOM   1029 O OG  . SER A 1 137 ? 55.561 55.926 -1.786  1.00   27.22 ? 131  SER A OG  1 
ATOM   1030 N N   . VAL A 1 138 ? 56.716 55.904 2.406   1.00   19.98 ? 132  VAL A N   1 
ATOM   1031 C CA  . VAL A 1 138 ? 56.978 56.584 3.671   1.00   20.76 ? 132  VAL A CA  1 
ATOM   1032 C C   . VAL A 1 138 ? 57.886 57.764 3.356   1.00   21.07 ? 132  VAL A C   1 
ATOM   1033 O O   . VAL A 1 138 ? 58.928 57.588 2.727   1.00   20.23 ? 132  VAL A O   1 
ATOM   1034 C CB  . VAL A 1 138 ? 57.661 55.646 4.691   1.00   21.54 ? 132  VAL A CB  1 
ATOM   1035 C CG1 . VAL A 1 138 ? 58.037 56.411 5.977   1.00   22.87 ? 132  VAL A CG1 1 
ATOM   1036 C CG2 . VAL A 1 138 ? 56.780 54.479 5.021   1.00   21.94 ? 132  VAL A CG2 1 
ATOM   1037 N N   . LEU A 1 139 ? 57.487 58.965 3.798   1.00   21.24 ? 133  LEU A N   1 
ATOM   1038 C CA  . LEU A 1 139 ? 58.416 60.100 3.937   1.00   22.02 ? 133  LEU A CA  1 
ATOM   1039 C C   . LEU A 1 139 ? 58.671 60.283 5.419   1.00   21.31 ? 133  LEU A C   1 
ATOM   1040 O O   . LEU A 1 139 ? 57.721 60.465 6.167   1.00   21.79 ? 133  LEU A O   1 
ATOM   1041 C CB  . LEU A 1 139 ? 57.791 61.384 3.406   1.00   23.13 ? 133  LEU A CB  1 
ATOM   1042 C CG  . LEU A 1 139 ? 58.772 62.589 3.411   1.00   26.54 ? 133  LEU A CG  1 
ATOM   1043 C CD1 . LEU A 1 139 ? 59.930 62.347 2.490   1.00   28.09 ? 133  LEU A CD1 1 
ATOM   1044 C CD2 . LEU A 1 139 ? 58.038 63.852 2.994   1.00   31.83 ? 133  LEU A CD2 1 
ATOM   1045 N N   . TRP A 1 140 ? 59.933 60.234 5.808   1.00   20.85 ? 134  TRP A N   1 
ATOM   1046 C CA  . TRP A 1 140 ? 60.371 60.282 7.214   1.00   21.41 ? 134  TRP A CA  1 
ATOM   1047 C C   . TRP A 1 140 ? 61.436 61.354 7.309   1.00   22.06 ? 134  TRP A C   1 
ATOM   1048 O O   . TRP A 1 140 ? 62.527 61.216 6.753   1.00   21.67 ? 134  TRP A O   1 
ATOM   1049 C CB  . TRP A 1 140 ? 60.947 58.932 7.629   1.00   22.48 ? 134  TRP A CB  1 
ATOM   1050 C CG  . TRP A 1 140 ? 61.641 58.858 8.971   1.00   21.55 ? 134  TRP A CG  1 
ATOM   1051 C CD1 . TRP A 1 140 ? 61.346 59.574 10.101  1.00   22.20 ? 134  TRP A CD1 1 
ATOM   1052 C CD2 . TRP A 1 140 ? 62.689 57.963 9.329   1.00   21.57 ? 134  TRP A CD2 1 
ATOM   1053 N NE1 . TRP A 1 140 ? 62.181 59.205 11.127  1.00   22.01 ? 134  TRP A NE1 1 
ATOM   1054 C CE2 . TRP A 1 140 ? 63.019 58.216 10.680  1.00   22.64 ? 134  TRP A CE2 1 
ATOM   1055 C CE3 . TRP A 1 140 ? 63.396 56.960 8.641   1.00   20.68 ? 134  TRP A CE3 1 
ATOM   1056 C CZ2 . TRP A 1 140 ? 64.019 57.504 11.348  1.00   22.44 ? 134  TRP A CZ2 1 
ATOM   1057 C CZ3 . TRP A 1 140 ? 64.401 56.305 9.279   1.00   21.50 ? 134  TRP A CZ3 1 
ATOM   1058 C CH2 . TRP A 1 140 ? 64.705 56.574 10.629  1.00   22.50 ? 134  TRP A CH2 1 
ATOM   1059 N N   . ASN A 1 141 ? 61.101 62.447 7.992   1.00   23.30 ? 135  ASN A N   1 
ATOM   1060 C CA  . ASN A 1 141 ? 62.080 63.486 8.261   1.00   23.37 ? 135  ASN A CA  1 
ATOM   1061 C C   . ASN A 1 141 ? 61.951 63.925 9.721   1.00   23.05 ? 135  ASN A C   1 
ATOM   1062 O O   . ASN A 1 141 ? 61.205 63.341 10.482  1.00   23.05 ? 135  ASN A O   1 
ATOM   1063 C CB  . ASN A 1 141 ? 61.966 64.670 7.253   1.00   23.22 ? 135  ASN A CB  1 
ATOM   1064 C CG  . ASN A 1 141 ? 60.653 65.428 7.307   1.00   23.14 ? 135  ASN A CG  1 
ATOM   1065 O OD1 . ASN A 1 141 ? 60.286 66.085 6.313   1.00   31.15 ? 135  ASN A OD1 1 
ATOM   1066 N ND2 . ASN A 1 141 ? 59.952 65.381 8.397   1.00   22.54 ? 135  ASN A ND2 1 
ATOM   1067 N N   . MET A 1 142 ? 62.708 64.944 10.106  1.00   24.91 ? 136  MET A N   1 
ATOM   1068 C CA  . MET A 1 142 ? 62.750 65.373 11.507  1.00   25.89 ? 136  MET A CA  1 
ATOM   1069 C C   . MET A 1 142 ? 61.447 65.993 11.987  1.00   26.06 ? 136  MET A C   1 
ATOM   1070 O O   . MET A 1 142 ? 61.229 66.128 13.186  1.00   26.01 ? 136  MET A O   1 
ATOM   1071 C CB  . MET A 1 142 ? 63.910 66.365 11.716  1.00   26.58 ? 136  MET A CB  1 
ATOM   1072 C CG  . MET A 1 142 ? 63.774 67.631 10.920  1.00   28.43 ? 136  MET A CG  1 
ATOM   1073 S SD  . MET A 1 142 ? 65.291 68.630 11.112  1.00   34.62 ? 136  MET A SD  1 
ATOM   1074 C CE  . MET A 1 142 ? 65.762 68.894 9.536   1.00   32.80 ? 136  MET A CE  1 
ATOM   1075 N N   . TYR A 1 143 ? 60.584 66.378 11.055  1.00   25.79 ? 137  TYR A N   1 
ATOM   1076 C CA  . TYR A 1 143 ? 59.309 66.995 11.386  1.00   26.50 ? 137  TYR A CA  1 
ATOM   1077 C C   . TYR A 1 143 ? 58.153 66.026 11.492  1.00   25.68 ? 137  TYR A C   1 
ATOM   1078 O O   . TYR A 1 143 ? 57.193 66.262 12.218  1.00   24.55 ? 137  TYR A O   1 
ATOM   1079 C CB  . TYR A 1 143 ? 58.954 68.026 10.322  1.00   27.66 ? 137  TYR A CB  1 
ATOM   1080 C CG  . TYR A 1 143 ? 60.049 69.048 10.076  1.00   31.51 ? 137  TYR A CG  1 
ATOM   1081 C CD1 . TYR A 1 143 ? 60.249 70.086 10.978  1.00   36.44 ? 137  TYR A CD1 1 
ATOM   1082 C CD2 . TYR A 1 143 ? 60.866 68.985 8.951   1.00   35.00 ? 137  TYR A CD2 1 
ATOM   1083 C CE1 . TYR A 1 143 ? 61.239 71.035 10.780  1.00   39.24 ? 137  TYR A CE1 1 
ATOM   1084 C CE2 . TYR A 1 143 ? 61.882 69.945 8.738   1.00   39.24 ? 137  TYR A CE2 1 
ATOM   1085 C CZ  . TYR A 1 143 ? 62.057 70.961 9.676   1.00   41.56 ? 137  TYR A CZ  1 
ATOM   1086 O OH  . TYR A 1 143 ? 63.026 71.937 9.516   1.00   46.30 ? 137  TYR A OH  1 
ATOM   1087 N N   . MET A 1 144 ? 58.180 64.968 10.679  1.00   24.42 ? 138  MET A N   1 
ATOM   1088 C CA  . MET A 1 144 ? 57.001 64.123 10.567  1.00   23.51 ? 138  MET A CA  1 
ATOM   1089 C C   . MET A 1 144 ? 57.310 62.851 9.772   1.00   21.94 ? 138  MET A C   1 
ATOM   1090 O O   . MET A 1 144 ? 58.304 62.767 9.061   1.00   20.90 ? 138  MET A O   1 
ATOM   1091 C CB  . MET A 1 144 ? 55.856 64.858 9.872   1.00   23.28 ? 138  MET A CB  1 
ATOM   1092 C CG  . MET A 1 144 ? 56.138 65.263 8.465   1.00   26.67 ? 138  MET A CG  1 
ATOM   1093 S SD  . MET A 1 144 ? 54.722 66.090 7.679   1.00   33.10 ? 138  MET A SD  1 
ATOM   1094 C CE  . MET A 1 144 ? 55.377 66.480 6.153   1.00   29.10 ? 138  MET A CE  1 
ATOM   1095 N N   . ILE A 1 145 ? 56.418 61.900 9.930   1.00   22.33 ? 139  ILE A N   1 
ATOM   1096 C CA  . ILE A 1 145 ? 56.347 60.718 9.067   1.00   21.40 ? 139  ILE A CA  1 
ATOM   1097 C C   . ILE A 1 145 ? 55.035 60.755 8.341   1.00   21.07 ? 139  ILE A C   1 
ATOM   1098 O O   . ILE A 1 145 ? 53.992 60.874 8.961   1.00   21.51 ? 139  ILE A O   1 
ATOM   1099 C CB  . ILE A 1 145 ? 56.426 59.477 9.904   1.00   21.57 ? 139  ILE A CB  1 
ATOM   1100 C CG1 . ILE A 1 145 ? 57.823 59.348 10.500  1.00   23.00 ? 139  ILE A CG1 1 
ATOM   1101 C CG2 . ILE A 1 145 ? 56.091 58.200 9.047   1.00   21.89 ? 139  ILE A CG2 1 
ATOM   1102 C CD1 . ILE A 1 145 ? 57.840 58.512 11.790  1.00   25.14 ? 139  ILE A CD1 1 
ATOM   1103 N N   . VAL A 1 146 ? 55.078 60.638 7.018   1.00   21.23 ? 140  VAL A N   1 
ATOM   1104 C CA  . VAL A 1 146 ? 53.875 60.550 6.206   1.00   21.86 ? 140  VAL A CA  1 
ATOM   1105 C C   . VAL A 1 146 ? 53.802 59.159 5.534   1.00   20.95 ? 140  VAL A C   1 
ATOM   1106 O O   . VAL A 1 146 ? 54.781 58.721 4.958   1.00   20.65 ? 140  VAL A O   1 
ATOM   1107 C CB  . VAL A 1 146 ? 53.900 61.576 5.104   1.00   23.67 ? 140  VAL A CB  1 
ATOM   1108 C CG1 . VAL A 1 146 ? 52.547 61.636 4.403   1.00   24.40 ? 140  VAL A CG1 1 
ATOM   1109 C CG2 . VAL A 1 146 ? 54.254 62.960 5.696   1.00   26.36 ? 140  VAL A CG2 1 
ATOM   1110 N N   . PHE A 1 147 ? 52.643 58.528 5.648   1.00   20.64 ? 141  PHE A N   1 
ATOM   1111 C CA  . PHE A 1 147 ? 52.318 57.276 4.958   1.00   20.57 ? 141  PHE A CA  1 
ATOM   1112 C C   . PHE A 1 147 ? 51.467 57.639 3.747   1.00   20.48 ? 141  PHE A C   1 
ATOM   1113 O O   . PHE A 1 147 ? 50.415 58.298 3.890   1.00   20.76 ? 141  PHE A O   1 
ATOM   1114 C CB  . PHE A 1 147 ? 51.471 56.363 5.827   1.00   19.72 ? 141  PHE A CB  1 
ATOM   1115 C CG  . PHE A 1 147 ? 52.118 55.888 7.092   1.00   21.36 ? 141  PHE A CG  1 
ATOM   1116 C CD1 . PHE A 1 147 ? 52.305 56.745 8.176   1.00   22.20 ? 141  PHE A CD1 1 
ATOM   1117 C CD2 . PHE A 1 147 ? 52.448 54.542 7.250   1.00   20.66 ? 141  PHE A CD2 1 
ATOM   1118 C CE1 . PHE A 1 147 ? 52.851 56.275 9.368   1.00   22.40 ? 141  PHE A CE1 1 
ATOM   1119 C CE2 . PHE A 1 147 ? 53.001 54.075 8.462   1.00   22.27 ? 141  PHE A CE2 1 
ATOM   1120 C CZ  . PHE A 1 147 ? 53.195 54.955 9.506   1.00   24.07 ? 141  PHE A CZ  1 
ATOM   1121 N N   . LEU A 1 148 ? 51.892 57.222 2.562   1.00   20.88 ? 142  LEU A N   1 
ATOM   1122 C CA  . LEU A 1 148 ? 51.161 57.507 1.346   1.00   21.26 ? 142  LEU A CA  1 
ATOM   1123 C C   . LEU A 1 148 ? 50.779 56.228 0.577   1.00   21.91 ? 142  LEU A C   1 
ATOM   1124 O O   . LEU A 1 148 ? 51.539 55.268 0.536   1.00   19.57 ? 142  LEU A O   1 
ATOM   1125 C CB  . LEU A 1 148 ? 51.996 58.379 0.450   1.00   22.45 ? 142  LEU A CB  1 
ATOM   1126 C CG  . LEU A 1 148 ? 52.367 59.744 1.070   1.00   24.50 ? 142  LEU A CG  1 
ATOM   1127 C CD1 . LEU A 1 148 ? 53.824 59.786 1.359   1.00   26.87 ? 142  LEU A CD1 1 
ATOM   1128 C CD2 . LEU A 1 148 ? 51.975 60.866 0.140   1.00   27.90 ? 142  LEU A CD2 1 
ATOM   1129 N N   . VAL A 1 149 ? 49.596 56.256 -0.012  1.00   21.75 ? 143  VAL A N   1 
ATOM   1130 C CA  . VAL A 1 149 ? 49.128 55.264 -0.975  1.00   23.40 ? 143  VAL A CA  1 
ATOM   1131 C C   . VAL A 1 149 ? 48.989 56.033 -2.290  1.00   24.23 ? 143  VAL A C   1 
ATOM   1132 O O   . VAL A 1 149 ? 48.164 56.953 -2.383  1.00   25.11 ? 143  VAL A O   1 
ATOM   1133 C CB  . VAL A 1 149 ? 47.790 54.654 -0.551  1.00   23.22 ? 143  VAL A CB  1 
ATOM   1134 C CG1 . VAL A 1 149 ? 47.257 53.694 -1.628  1.00   24.37 ? 143  VAL A CG1 1 
ATOM   1135 C CG2 . VAL A 1 149 ? 47.891 53.934 0.775   1.00   23.73 ? 143  VAL A CG2 1 
ATOM   1136 N N   . ASP A 1 150 ? 49.814 55.693 -3.261  1.00   25.20 ? 144  ASP A N   1 
ATOM   1137 C CA  . ASP A 1 150 ? 50.002 56.468 -4.475  1.00   26.92 ? 144  ASP A CA  1 
ATOM   1138 C C   . ASP A 1 150 ? 50.317 57.915 -4.046  1.00   29.09 ? 144  ASP A C   1 
ATOM   1139 O O   . ASP A 1 150 ? 51.259 58.133 -3.289  1.00   28.39 ? 144  ASP A O   1 
ATOM   1140 C CB  . ASP A 1 150 ? 48.767 56.308 -5.370  1.00   27.11 ? 144  ASP A CB  1 
ATOM   1141 C CG  . ASP A 1 150 ? 48.556 54.846 -5.822  1.00   26.08 ? 144  ASP A CG  1 
ATOM   1142 O OD1 . ASP A 1 150 ? 49.549 54.190 -6.210  1.00   27.10 ? 144  ASP A OD1 1 
ATOM   1143 O OD2 . ASP A 1 150 ? 47.433 54.320 -5.875  1.00   27.25 ? 144  ASP A OD2 1 
ATOM   1144 N N   . ASP A 1 151 ? 49.505 58.879 -4.450  1.00   31.00 ? 145  ASP A N   1 
ATOM   1145 C CA  . ASP A 1 151 ? 49.716 60.269 -4.023  1.00   32.87 ? 145  ASP A CA  1 
ATOM   1146 C C   . ASP A 1 151 ? 48.850 60.681 -2.830  1.00   32.25 ? 145  ASP A C   1 
ATOM   1147 O O   . ASP A 1 151 ? 48.845 61.862 -2.450  1.00   34.43 ? 145  ASP A O   1 
ATOM   1148 C CB  . ASP A 1 151 ? 49.455 61.218 -5.217  1.00   34.38 ? 145  ASP A CB  1 
ATOM   1149 C CG  . ASP A 1 151 ? 48.111 60.974 -5.868  1.00   38.78 ? 145  ASP A CG  1 
ATOM   1150 O OD1 . ASP A 1 151 ? 47.224 60.369 -5.216  1.00   42.43 ? 145  ASP A OD1 1 
ATOM   1151 O OD2 . ASP A 1 151 ? 47.826 61.381 -7.029  1.00   46.94 ? 145  ASP A OD2 1 
ATOM   1152 N N   . VAL A 1 152 ? 48.109 59.745 -2.245  1.00   29.72 ? 146  VAL A N   1 
ATOM   1153 C CA  . VAL A 1 152 ? 47.249 60.040 -1.103  1.00   28.80 ? 146  VAL A CA  1 
ATOM   1154 C C   . VAL A 1 152 ? 47.903 59.778 0.258   1.00   28.73 ? 146  VAL A C   1 
ATOM   1155 O O   . VAL A 1 152 ? 48.327 58.669 0.541   1.00   26.35 ? 146  VAL A O   1 
ATOM   1156 C CB  . VAL A 1 152 ? 45.960 59.177 -1.166  1.00   28.72 ? 146  VAL A CB  1 
ATOM   1157 C CG1 . VAL A 1 152 ? 44.997 59.585 -0.060  1.00   27.49 ? 146  VAL A CG1 1 
ATOM   1158 C CG2 . VAL A 1 152 ? 45.302 59.311 -2.520  1.00   29.70 ? 146  VAL A CG2 1 
ATOM   1159 N N   . PRO A 1 153 ? 47.966 60.823 1.111   1.00   28.43 ? 147  PRO A N   1 
ATOM   1160 C CA  . PRO A 1 153 ? 48.442 60.616 2.451   1.00   27.92 ? 147  PRO A CA  1 
ATOM   1161 C C   . PRO A 1 153 ? 47.317 59.916 3.233   1.00   26.99 ? 147  PRO A C   1 
ATOM   1162 O O   . PRO A 1 153 ? 46.162 60.356 3.205   1.00   28.00 ? 147  PRO A O   1 
ATOM   1163 C CB  . PRO A 1 153 ? 48.700 62.018 3.002   1.00   28.21 ? 147  PRO A CB  1 
ATOM   1164 C CG  . PRO A 1 153 ? 48.592 62.961 1.842   1.00   29.17 ? 147  PRO A CG  1 
ATOM   1165 C CD  . PRO A 1 153 ? 47.858 62.253 0.747   1.00   28.70 ? 147  PRO A CD  1 
ATOM   1166 N N   . ILE A 1 154 ? 47.645 58.826 3.932   1.00   24.99 ? 148  ILE A N   1 
ATOM   1167 C CA  . ILE A 1 154 ? 46.655 58.138 4.737   1.00   24.08 ? 148  ILE A CA  1 
ATOM   1168 C C   . ILE A 1 154 ? 46.913 58.319 6.224   1.00   24.06 ? 148  ILE A C   1 
ATOM   1169 O O   . ILE A 1 154 ? 46.075 57.987 7.053   1.00   23.88 ? 148  ILE A O   1 
ATOM   1170 C CB  . ILE A 1 154 ? 46.614 56.625 4.396   1.00   23.78 ? 148  ILE A CB  1 
ATOM   1171 C CG1 . ILE A 1 154 ? 47.957 55.950 4.685   1.00   22.95 ? 148  ILE A CG1 1 
ATOM   1172 C CG2 . ILE A 1 154 ? 46.228 56.432 2.934   1.00   22.76 ? 148  ILE A CG2 1 
ATOM   1173 C CD1 . ILE A 1 154 ? 47.965 54.461 4.397   1.00   22.20 ? 148  ILE A CD1 1 
ATOM   1174 N N   . ARG A 1 155 ? 48.076 58.873 6.559   1.00   24.32 ? 149  ARG A N   1 
ATOM   1175 C CA  . ARG A 1 155 ? 48.407 59.083 7.935   1.00   25.31 ? 149  ARG A CA  1 
ATOM   1176 C C   . ARG A 1 155 ? 49.621 59.968 8.055   1.00   25.74 ? 149  ARG A C   1 
ATOM   1177 O O   . ARG A 1 155 ? 50.531 59.933 7.227   1.00   24.74 ? 149  ARG A O   1 
ATOM   1178 C CB  . ARG A 1 155 ? 48.603 57.723 8.614   1.00   25.64 ? 149  ARG A CB  1 
ATOM   1179 C CG  . ARG A 1 155 ? 49.515 57.696 9.828   1.00   25.90 ? 149  ARG A CG  1 
ATOM   1180 C CD  . ARG A 1 155 ? 49.311 56.417 10.573  1.00   24.87 ? 149  ARG A CD  1 
ATOM   1181 N NE  . ARG A 1 155 ? 49.608 56.573 11.979  1.00   25.09 ? 149  ARG A NE  1 
ATOM   1182 C CZ  . ARG A 1 155 ? 49.556 55.569 12.831  1.00   24.00 ? 149  ARG A CZ  1 
ATOM   1183 N NH1 . ARG A 1 155 ? 49.231 54.355 12.407  1.00   25.35 ? 149  ARG A NH1 1 
ATOM   1184 N NH2 . ARG A 1 155 ? 49.830 55.786 14.106  1.00   26.64 ? 149  ARG A NH2 1 
ATOM   1185 N N   . VAL A 1 156 ? 49.628 60.774 9.112   1.00   26.94 ? 150  VAL A N   1 
ATOM   1186 C CA  . VAL A 1 156 ? 50.787 61.564 9.445   1.00   28.01 ? 150  VAL A CA  1 
ATOM   1187 C C   . VAL A 1 156 ? 51.085 61.359 10.907  1.00   27.46 ? 150  VAL A C   1 
ATOM   1188 O O   . VAL A 1 156 ? 50.172 61.376 11.738  1.00   29.35 ? 150  VAL A O   1 
ATOM   1189 C CB  . VAL A 1 156 ? 50.632 63.095 9.199   1.00   29.14 ? 150  VAL A CB  1 
ATOM   1190 C CG1 . VAL A 1 156 ? 51.988 63.773 9.222   1.00   29.74 ? 150  VAL A CG1 1 
ATOM   1191 C CG2 . VAL A 1 156 ? 49.911 63.360 7.887   1.00   31.78 ? 150  VAL A CG2 1 
ATOM   1192 N N   . PHE A 1 157 ? 52.353 61.155 11.213  1.00   27.10 ? 151  PHE A N   1 
ATOM   1193 C CA  . PHE A 1 157 ? 52.798 61.067 12.597  1.00   26.87 ? 151  PHE A CA  1 
ATOM   1194 C C   . PHE A 1 157 ? 53.825 62.181 12.753  1.00   27.47 ? 151  PHE A C   1 
ATOM   1195 O O   . PHE A 1 157 ? 54.948 62.070 12.272  1.00   25.15 ? 151  PHE A O   1 
ATOM   1196 C CB  . PHE A 1 157 ? 53.374 59.693 12.933  1.00   26.80 ? 151  PHE A CB  1 
ATOM   1197 C CG  . PHE A 1 157 ? 53.705 59.516 14.381  1.00   26.73 ? 151  PHE A CG  1 
ATOM   1198 C CD1 . PHE A 1 157 ? 52.737 59.157 15.284  1.00   27.69 ? 151  PHE A CD1 1 
ATOM   1199 C CD2 . PHE A 1 157 ? 55.004 59.672 14.829  1.00   22.48 ? 151  PHE A CD2 1 
ATOM   1200 C CE1 . PHE A 1 157 ? 53.054 59.004 16.623  1.00   28.79 ? 151  PHE A CE1 1 
ATOM   1201 C CE2 . PHE A 1 157 ? 55.324 59.517 16.156  1.00   25.92 ? 151  PHE A CE2 1 
ATOM   1202 C CZ  . PHE A 1 157 ? 54.354 59.183 17.051  1.00   26.27 ? 151  PHE A CZ  1 
ATOM   1203 N N   . LYS A 1 158 ? 53.407 63.240 13.424  1.00   27.87 ? 152  LYS A N   1 
ATOM   1204 C CA  . LYS A 1 158 ? 54.237 64.386 13.610  1.00   29.28 ? 152  LYS A CA  1 
ATOM   1205 C C   . LYS A 1 158 ? 55.196 64.205 14.757  1.00   28.67 ? 152  LYS A C   1 
ATOM   1206 O O   . LYS A 1 158 ? 54.917 63.471 15.705  1.00   28.76 ? 152  LYS A O   1 
ATOM   1207 C CB  . LYS A 1 158 ? 53.413 65.619 13.922  1.00   30.11 ? 152  LYS A CB  1 
ATOM   1208 C CG  . LYS A 1 158 ? 52.474 66.058 12.816  1.00   33.46 ? 152  LYS A CG  1 
ATOM   1209 C CD  . LYS A 1 158 ? 53.182 66.848 11.731  1.00   38.22 ? 152  LYS A CD  1 
ATOM   1210 C CE  . LYS A 1 158 ? 52.476 68.159 11.475  1.00   41.77 ? 152  LYS A CE  1 
ATOM   1211 N NZ  . LYS A 1 158 ? 53.286 69.081 10.632  1.00   44.63 ? 152  LYS A NZ  1 
ATOM   1212 N N   . ASN A 1 159 ? 56.331 64.880 14.664  1.00   29.89 ? 153  ASN A N   1 
ATOM   1213 C CA  . ASN A 1 159 ? 57.272 64.983 15.769  1.00   30.31 ? 153  ASN A CA  1 
ATOM   1214 C C   . ASN A 1 159 ? 56.598 65.882 16.823  1.00   31.44 ? 153  ASN A C   1 
ATOM   1215 O O   . ASN A 1 159 ? 56.441 67.084 16.607  1.00   31.30 ? 153  ASN A O   1 
ATOM   1216 C CB  . ASN A 1 159 ? 58.590 65.580 15.267  1.00   29.93 ? 153  ASN A CB  1 
ATOM   1217 C CG  . ASN A 1 159 ? 59.590 65.824 16.368  1.00   30.40 ? 153  ASN A CG  1 
ATOM   1218 O OD1 . ASN A 1 159 ? 59.246 65.804 17.552  1.00   31.91 ? 153  ASN A OD1 1 
ATOM   1219 N ND2 . ASN A 1 159 ? 60.840 66.050 15.992  1.00   27.40 ? 153  ASN A ND2 1 
ATOM   1220 N N   . CYS A 1 160 ? 56.159 65.258 17.910  1.00   32.94 ? 154  CYS A N   1 
ATOM   1221 C CA  . CYS A 1 160 ? 55.486 65.922 19.027  1.00   34.40 ? 154  CYS A CA  1 
ATOM   1222 C C   . CYS A 1 160 ? 56.321 65.811 20.311  1.00   35.16 ? 154  CYS A C   1 
ATOM   1223 O O   . CYS A 1 160 ? 55.783 65.664 21.418  1.00   35.38 ? 154  CYS A O   1 
ATOM   1224 C CB  . CYS A 1 160 ? 54.095 65.300 19.226  1.00   34.74 ? 154  CYS A CB  1 
ATOM   1225 S SG  . CYS A 1 160 ? 52.957 65.576 17.853  1.00   36.23 ? 154  CYS A SG  1 
ATOM   1226 N N   . LYS A 1 161 ? 57.640 65.888 20.176  1.00   35.61 ? 155  LYS A N   1 
ATOM   1227 C CA  . LYS A 1 161 ? 58.518 65.807 21.337  1.00   37.13 ? 155  LYS A CA  1 
ATOM   1228 C C   . LYS A 1 161 ? 58.230 66.960 22.314  1.00   38.04 ? 155  LYS A C   1 
ATOM   1229 O O   . LYS A 1 161 ? 58.426 66.819 23.518  1.00   37.53 ? 155  LYS A O   1 
ATOM   1230 C CB  . LYS A 1 161 ? 59.992 65.797 20.903  1.00   37.57 ? 155  LYS A CB  1 
ATOM   1231 C CG  . LYS A 1 161 ? 60.388 64.509 20.137  1.00   39.99 ? 155  LYS A CG  1 
ATOM   1232 C CD  . LYS A 1 161 ? 61.829 64.074 20.316  1.00   43.34 ? 155  LYS A CD  1 
ATOM   1233 C CE  . LYS A 1 161 ? 62.807 65.158 19.995  1.00   45.20 ? 155  LYS A CE  1 
ATOM   1234 N NZ  . LYS A 1 161 ? 64.179 64.611 19.751  1.00   46.29 ? 155  LYS A NZ  1 
ATOM   1235 N N   . ASP A 1 162 ? 57.766 68.089 21.789  1.00   39.20 ? 156  ASP A N   1 
ATOM   1236 C CA  . ASP A 1 162 ? 57.359 69.235 22.625  1.00   40.86 ? 156  ASP A CA  1 
ATOM   1237 C C   . ASP A 1 162 ? 56.179 68.909 23.541  1.00   41.41 ? 156  ASP A C   1 
ATOM   1238 O O   . ASP A 1 162 ? 56.002 69.578 24.553  1.00   41.06 ? 156  ASP A O   1 
ATOM   1239 C CB  . ASP A 1 162 ? 57.002 70.455 21.763  1.00   41.11 ? 156  ASP A CB  1 
ATOM   1240 C CG  . ASP A 1 162 ? 55.898 70.152 20.777  1.00   44.21 ? 156  ASP A CG  1 
ATOM   1241 O OD1 . ASP A 1 162 ? 56.055 69.135 20.053  1.00   45.99 ? 156  ASP A OD1 1 
ATOM   1242 O OD2 . ASP A 1 162 ? 54.841 70.825 20.668  1.00   45.71 ? 156  ASP A OD2 1 
ATOM   1243 N N   . LEU A 1 163 ? 55.358 67.916 23.175  1.00   41.35 ? 157  LEU A N   1 
ATOM   1244 C CA  . LEU A 1 163 ? 54.256 67.449 24.028  1.00   41.48 ? 157  LEU A CA  1 
ATOM   1245 C C   . LEU A 1 163 ? 54.631 66.230 24.855  1.00   40.95 ? 157  LEU A C   1 
ATOM   1246 O O   . LEU A 1 163 ? 53.779 65.625 25.494  1.00   41.58 ? 157  LEU A O   1 
ATOM   1247 C CB  . LEU A 1 163 ? 53.001 67.154 23.194  1.00   41.74 ? 157  LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 163 ? 52.612 68.178 22.119  1.00   42.53 ? 157  LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 163 ? 51.439 67.668 21.309  1.00   44.09 ? 157  LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 163 ? 52.274 69.561 22.710  1.00   43.69 ? 157  LEU A CD2 1 
ATOM   1251 N N   . GLY A 1 164 ? 55.910 65.879 24.858  1.00   40.16 ? 158  GLY A N   1 
ATOM   1252 C CA  . GLY A 1 164 ? 56.405 64.728 25.582  1.00   39.73 ? 158  GLY A CA  1 
ATOM   1253 C C   . GLY A 1 164 ? 56.227 63.391 24.869  1.00   39.13 ? 158  GLY A C   1 
ATOM   1254 O O   . GLY A 1 164 ? 56.429 62.361 25.483  1.00   40.30 ? 158  GLY A O   1 
ATOM   1255 N N   . VAL A 1 165 ? 55.859 63.402 23.589  1.00   38.19 ? 159  VAL A N   1 
ATOM   1256 C CA  . VAL A 1 165 ? 55.731 62.167 22.803  1.00   36.60 ? 159  VAL A CA  1 
ATOM   1257 C C   . VAL A 1 165 ? 57.030 61.850 22.058  1.00   34.81 ? 159  VAL A C   1 
ATOM   1258 O O   . VAL A 1 165 ? 57.639 62.748 21.476  1.00   34.00 ? 159  VAL A O   1 
ATOM   1259 C CB  . VAL A 1 165 ? 54.579 62.251 21.780  1.00   36.57 ? 159  VAL A CB  1 
ATOM   1260 C CG1 . VAL A 1 165 ? 54.379 60.903 21.086  1.00   36.84 ? 159  VAL A CG1 1 
ATOM   1261 C CG2 . VAL A 1 165 ? 53.287 62.711 22.453  1.00   37.55 ? 159  VAL A CG2 1 
ATOM   1262 N N   . LYS A 1 166 ? 57.432 60.593 22.094  1.00   33.18 ? 160  LYS A N   1 
ATOM   1263 C CA  . LYS A 1 166 ? 58.626 60.183 21.382  1.00   32.55 ? 160  LYS A CA  1 
ATOM   1264 C C   . LYS A 1 166 ? 58.367 60.131 19.861  1.00   30.92 ? 160  LYS A C   1 
ATOM   1265 O O   . LYS A 1 166 ? 57.228 60.027 19.411  1.00   30.04 ? 160  LYS A O   1 
ATOM   1266 C CB  . LYS A 1 166 ? 59.102 58.840 21.887  1.00   33.02 ? 160  LYS A CB  1 
ATOM   1267 C CG  . LYS A 1 166 ? 59.763 58.905 23.247  1.00   35.03 ? 160  LYS A CG  1 
ATOM   1268 C CD  . LYS A 1 166 ? 59.713 57.548 23.913  1.00   37.40 ? 160  LYS A CD  1 
ATOM   1269 C CE  . LYS A 1 166 ? 60.337 57.569 25.295  1.00   40.56 ? 160  LYS A CE  1 
ATOM   1270 N NZ  . LYS A 1 166 ? 60.970 56.267 25.636  1.00   43.33 ? 160  LYS A NZ  1 
ATOM   1271 N N   . PHE A 1 167 ? 59.452 60.202 19.108  1.00   29.74 ? 161  PHE A N   1 
ATOM   1272 C CA  . PHE A 1 167 ? 59.429 60.215 17.672  1.00   28.15 ? 161  PHE A CA  1 
ATOM   1273 C C   . PHE A 1 167 ? 60.658 59.476 17.121  1.00   28.23 ? 161  PHE A C   1 
ATOM   1274 O O   . PHE A 1 167 ? 61.743 59.569 17.705  1.00   28.49 ? 161  PHE A O   1 
ATOM   1275 C CB  . PHE A 1 167 ? 59.453 61.659 17.190  1.00   27.96 ? 161  PHE A CB  1 
ATOM   1276 C CG  . PHE A 1 167 ? 59.430 61.849 15.690  1.00   25.77 ? 161  PHE A CG  1 
ATOM   1277 C CD1 . PHE A 1 167 ? 58.207 61.844 15.020  1.00   25.06 ? 161  PHE A CD1 1 
ATOM   1278 C CD2 . PHE A 1 167 ? 60.565 62.075 14.932  1.00   24.87 ? 161  PHE A CD2 1 
ATOM   1279 C CE1 . PHE A 1 167 ? 58.112 62.024 13.661  1.00   24.98 ? 161  PHE A CE1 1 
ATOM   1280 C CE2 . PHE A 1 167 ? 60.492 62.266 13.537  1.00   25.06 ? 161  PHE A CE2 1 
ATOM   1281 C CZ  . PHE A 1 167 ? 59.253 62.226 12.900  1.00   22.21 ? 161  PHE A CZ  1 
ATOM   1282 N N   . PRO A 1 168 ? 60.562 58.729 16.003  1.00   27.52 ? 162  PRO A N   1 
ATOM   1283 C CA  . PRO A 1 168 ? 61.745 58.060 15.437  1.00   27.16 ? 162  PRO A CA  1 
ATOM   1284 C C   . PRO A 1 168 ? 62.723 59.171 15.039  1.00   27.71 ? 162  PRO A C   1 
ATOM   1285 O O   . PRO A 1 168 ? 62.572 59.780 13.986  1.00   25.97 ? 162  PRO A O   1 
ATOM   1286 C CB  . PRO A 1 168 ? 61.211 57.308 14.227  1.00   26.96 ? 162  PRO A CB  1 
ATOM   1287 C CG  . PRO A 1 168 ? 59.916 57.967 13.896  1.00   27.72 ? 162  PRO A CG  1 
ATOM   1288 C CD  . PRO A 1 168 ? 59.368 58.516 15.186  1.00   27.35 ? 162  PRO A CD  1 
ATOM   1289 N N   . PHE A 1 169 ? 63.697 59.403 15.863  1.00   28.36 ? 163  PHE A N   1 
ATOM   1290 C CA  . PHE A 1 169 ? 64.554 60.519 15.639  1.00   29.39 ? 163  PHE A CA  1 
ATOM   1291 C C   . PHE A 1 169 ? 66.036 60.234 15.510  1.00   29.47 ? 163  PHE A C   1 
ATOM   1292 O O   . PHE A 1 169 ? 66.738 60.959 14.794  1.00   31.60 ? 163  PHE A O   1 
ATOM   1293 C CB  . PHE A 1 169 ? 64.276 61.509 16.754  1.00   29.46 ? 163  PHE A CB  1 
ATOM   1294 C CG  . PHE A 1 169 ? 64.814 62.856 16.516  1.00   31.44 ? 163  PHE A CG  1 
ATOM   1295 C CD1 . PHE A 1 169 ? 64.176 63.719 15.663  1.00   31.22 ? 163  PHE A CD1 1 
ATOM   1296 C CD2 . PHE A 1 169 ? 65.983 63.278 17.143  1.00   34.12 ? 163  PHE A CD2 1 
ATOM   1297 C CE1 . PHE A 1 169 ? 64.662 65.002 15.415  1.00   32.11 ? 163  PHE A CE1 1 
ATOM   1298 C CE2 . PHE A 1 169 ? 66.480 64.562 16.917  1.00   34.19 ? 163  PHE A CE2 1 
ATOM   1299 C CZ  . PHE A 1 169 ? 65.821 65.418 16.048  1.00   33.01 ? 163  PHE A CZ  1 
ATOM   1300 N N   . ASN A 1 170 ? 66.565 59.214 16.191  1.00   30.06 ? 164  ASN A N   1 
ATOM   1301 C CA  . ASN A 1 170 ? 67.990 58.949 16.062  1.00   30.76 ? 164  ASN A CA  1 
ATOM   1302 C C   . ASN A 1 170 ? 68.412 57.498 15.954  1.00   29.63 ? 164  ASN A C   1 
ATOM   1303 O O   . ASN A 1 170 ? 69.581 57.181 16.107  1.00   29.18 ? 164  ASN A O   1 
ATOM   1304 C CB  . ASN A 1 170 ? 68.774 59.605 17.184  1.00   32.81 ? 164  ASN A CB  1 
ATOM   1305 C CG  . ASN A 1 170 ? 68.207 59.284 18.511  1.00   34.95 ? 164  ASN A CG  1 
ATOM   1306 O OD1 . ASN A 1 170 ? 67.782 58.170 18.770  1.00   38.26 ? 164  ASN A OD1 1 
ATOM   1307 N ND2 . ASN A 1 170 ? 68.189 60.268 19.388  1.00   39.77 ? 164  ASN A ND2 1 
ATOM   1308 N N   . GLN A 1 171 ? 67.470 56.634 15.689  1.00   27.95 ? 165  GLN A N   1 
ATOM   1309 C CA  . GLN A 1 171 ? 67.854 55.248 15.501  1.00   26.96 ? 165  GLN A CA  1 
ATOM   1310 C C   . GLN A 1 171 ? 67.730 54.944 14.035  1.00   26.51 ? 165  GLN A C   1 
ATOM   1311 O O   . GLN A 1 171 ? 66.612 54.946 13.513  1.00   24.73 ? 165  GLN A O   1 
ATOM   1312 C CB  . GLN A 1 171 ? 66.988 54.340 16.356  1.00   27.87 ? 165  GLN A CB  1 
ATOM   1313 C CG  . GLN A 1 171 ? 66.985 54.708 17.822  1.00   28.97 ? 165  GLN A CG  1 
ATOM   1314 C CD  . GLN A 1 171 ? 66.327 53.653 18.698  1.00   33.82 ? 165  GLN A CD  1 
ATOM   1315 O OE1 . GLN A 1 171 ? 65.114 53.622 18.829  1.00   36.76 ? 165  GLN A OE1 1 
ATOM   1316 N NE2 . GLN A 1 171 ? 66.931 52.705 19.390  1.00   37.69 ? 165  GLN A NE2 1 
ATOM   1317 N N   . PRO A 1 172 ? 68.864 54.672 13.352  1.00   25.85 ? 166  PRO A N   1 
ATOM   1318 C CA  . PRO A 1 172 ? 68.790 54.294 11.937  1.00   24.42 ? 166  PRO A CA  1 
ATOM   1319 C C   . PRO A 1 172 ? 67.929 53.046 11.776  1.00   22.55 ? 166  PRO A C   1 
ATOM   1320 O O   . PRO A 1 172 ? 67.933 52.154 12.639  1.00   22.30 ? 166  PRO A O   1 
ATOM   1321 C CB  . PRO A 1 172 ? 70.240 53.992 11.554  1.00   24.91 ? 166  PRO A CB  1 
ATOM   1322 C CG  . PRO A 1 172 ? 71.053 54.707 12.575  1.00   26.36 ? 166  PRO A CG  1 
ATOM   1323 C CD  . PRO A 1 172 ? 70.254 54.745 13.849  1.00   26.00 ? 166  PRO A CD  1 
ATOM   1324 N N   . MET A 1 173 ? 67.210 52.981 10.666  1.00   21.34 ? 167  MET A N   1 
ATOM   1325 C CA  . MET A 1 173 ? 66.303 51.886 10.424  1.00   20.74 ? 167  MET A CA  1 
ATOM   1326 C C   . MET A 1 173 ? 66.608 51.227 9.088   1.00   20.97 ? 167  MET A C   1 
ATOM   1327 O O   . MET A 1 173 ? 67.073 51.883 8.160   1.00   20.24 ? 167  MET A O   1 
ATOM   1328 C CB  . MET A 1 173 ? 64.842 52.363 10.459  1.00   20.96 ? 167  MET A CB  1 
ATOM   1329 C CG  . MET A 1 173 ? 64.431 52.965 11.789  1.00   22.33 ? 167  MET A CG  1 
ATOM   1330 S SD  . MET A 1 173 ? 62.655 52.954 12.050  1.00   26.43 ? 167  MET A SD  1 
ATOM   1331 C CE  . MET A 1 173 ? 62.232 54.636 11.587  1.00   24.98 ? 167  MET A CE  1 
ATOM   1332 N N   . LYS A 1 174 ? 66.351 49.938 9.020   1.00   19.70 ? 168  LYS A N   1 
ATOM   1333 C CA  . LYS A 1 174 ? 66.378 49.203 7.751   1.00   20.12 ? 168  LYS A CA  1 
ATOM   1334 C C   . LYS A 1 174 ? 64.965 49.059 7.221   1.00   20.15 ? 168  LYS A C   1 
ATOM   1335 O O   . LYS A 1 174 ? 64.011 49.192 7.972   1.00   20.02 ? 168  LYS A O   1 
ATOM   1336 C CB  . LYS A 1 174 ? 67.023 47.845 7.994   1.00   19.90 ? 168  LYS A CB  1 
ATOM   1337 C CG  . LYS A 1 174 ? 68.499 47.918 8.135   1.00   23.57 ? 168  LYS A CG  1 
ATOM   1338 C CD  . LYS A 1 174 ? 69.130 46.554 8.103   1.00   28.09 ? 168  LYS A CD  1 
ATOM   1339 C CE  . LYS A 1 174 ? 70.614 46.689 7.782   1.00   31.52 ? 168  LYS A CE  1 
ATOM   1340 N NZ  . LYS A 1 174 ? 71.334 45.496 8.262   1.00   34.88 ? 168  LYS A NZ  1 
ATOM   1341 N N   . ILE A 1 175 ? 64.821 48.861 5.914   1.00   19.16 ? 169  ILE A N   1 
ATOM   1342 C CA  . ILE A 1 175 ? 63.550 48.569 5.307   1.00   19.81 ? 169  ILE A CA  1 
ATOM   1343 C C   . ILE A 1 175 ? 63.400 47.076 5.171   1.00   19.75 ? 169  ILE A C   1 
ATOM   1344 O O   . ILE A 1 175 ? 64.336 46.397 4.737   1.00   20.31 ? 169  ILE A O   1 
ATOM   1345 C CB  . ILE A 1 175 ? 63.450 49.230 3.933   1.00   20.17 ? 169  ILE A CB  1 
ATOM   1346 C CG1 . ILE A 1 175 ? 63.675 50.721 4.074   1.00   24.30 ? 169  ILE A CG1 1 
ATOM   1347 C CG2 . ILE A 1 175 ? 62.075 48.985 3.338   1.00   22.44 ? 169  ILE A CG2 1 
ATOM   1348 C CD1 . ILE A 1 175 ? 65.029 51.163 3.744   1.00   26.74 ? 169  ILE A CD1 1 
ATOM   1349 N N   . TYR A 1 176 ? 62.227 46.578 5.549   1.00   19.07 ? 170  TYR A N   1 
ATOM   1350 C CA  . TYR A 1 176 ? 61.873 45.177 5.577   1.00   18.36 ? 170  TYR A CA  1 
ATOM   1351 C C   . TYR A 1 176 ? 60.599 44.947 4.804   1.00   18.98 ? 170  TYR A C   1 
ATOM   1352 O O   . TYR A 1 176 ? 59.725 45.812 4.748   1.00   18.27 ? 170  TYR A O   1 
ATOM   1353 C CB  . TYR A 1 176 ? 61.630 44.703 7.022   1.00   18.96 ? 170  TYR A CB  1 
ATOM   1354 C CG  . TYR A 1 176 ? 62.858 44.769 7.903   1.00   19.96 ? 170  TYR A CG  1 
ATOM   1355 C CD1 . TYR A 1 176 ? 63.775 43.734 7.936   1.00   22.66 ? 170  TYR A CD1 1 
ATOM   1356 C CD2 . TYR A 1 176 ? 63.116 45.891 8.686   1.00   19.04 ? 170  TYR A CD2 1 
ATOM   1357 C CE1 . TYR A 1 176 ? 64.922 43.803 8.735   1.00   22.37 ? 170  TYR A CE1 1 
ATOM   1358 C CE2 . TYR A 1 176 ? 64.229 45.963 9.479   1.00   19.57 ? 170  TYR A CE2 1 
ATOM   1359 C CZ  . TYR A 1 176 ? 65.136 44.923 9.505   1.00   23.14 ? 170  TYR A CZ  1 
ATOM   1360 O OH  . TYR A 1 176 ? 66.256 45.009 10.291  1.00   23.96 ? 170  TYR A OH  1 
ATOM   1361 N N   . SER A 1 177 ? 60.482 43.765 4.215   1.00   18.19 ? 171  SER A N   1 
ATOM   1362 C CA  . SER A 1 177 ? 59.180 43.301 3.750   1.00   18.26 ? 171  SER A CA  1 
ATOM   1363 C C   . SER A 1 177 ? 59.085 41.808 3.949   1.00   18.03 ? 171  SER A C   1 
ATOM   1364 O O   . SER A 1 177 ? 60.101 41.095 3.950   1.00   18.73 ? 171  SER A O   1 
ATOM   1365 C CB  . SER A 1 177 ? 58.892 43.712 2.303   1.00   19.29 ? 171  SER A CB  1 
ATOM   1366 O OG  . SER A 1 177 ? 57.472 43.596 2.114   1.00   26.47 ? 171  SER A OG  1 
ATOM   1367 N N   . SER A 1 178 ? 57.874 41.329 4.167   1.00   17.86 ? 172  SER A N   1 
ATOM   1368 C CA  . SER A 1 178 ? 57.637 39.927 4.411   1.00   17.56 ? 172  SER A CA  1 
ATOM   1369 C C   . SER A 1 178 ? 56.207 39.528 4.155   1.00   17.22 ? 172  SER A C   1 
ATOM   1370 O O   . SER A 1 178 ? 55.311 40.356 4.099   1.00   16.29 ? 172  SER A O   1 
ATOM   1371 C CB  . SER A 1 178 ? 58.022 39.569 5.830   1.00   18.93 ? 172  SER A CB  1 
ATOM   1372 O OG  . SER A 1 178 ? 57.247 40.322 6.719   1.00   19.69 ? 172  SER A OG  1 
ATOM   1373 N N   . LEU A 1 179 ? 56.007 38.238 3.950   1.00   16.82 ? 173  LEU A N   1 
ATOM   1374 C CA  . LEU A 1 179 ? 54.699 37.666 3.803   1.00   17.64 ? 173  LEU A CA  1 
ATOM   1375 C C   . LEU A 1 179 ? 54.642 36.478 4.734   1.00   18.47 ? 173  LEU A C   1 
ATOM   1376 O O   . LEU A 1 179 ? 55.508 35.597 4.665   1.00   18.95 ? 173  LEU A O   1 
ATOM   1377 C CB  . LEU A 1 179 ? 54.464 37.207 2.353   1.00   17.50 ? 173  LEU A CB  1 
ATOM   1378 C CG  . LEU A 1 179 ? 53.205 36.367 2.126   1.00   18.99 ? 173  LEU A CG  1 
ATOM   1379 C CD1 . LEU A 1 179 ? 51.948 37.120 2.413   1.00   19.83 ? 173  LEU A CD1 1 
ATOM   1380 C CD2 . LEU A 1 179 ? 53.223 35.927 0.668   1.00   21.89 ? 173  LEU A CD2 1 
ATOM   1381 N N   . TRP A 1 180 ? 53.677 36.478 5.643   1.00   18.98 ? 174  TRP A N   1 
ATOM   1382 C CA  . TRP A 1 180 ? 53.573 35.444 6.669   1.00   20.07 ? 174  TRP A CA  1 
ATOM   1383 C C   . TRP A 1 180 ? 52.165 35.265 7.163   1.00   22.07 ? 174  TRP A C   1 
ATOM   1384 O O   . TRP A 1 180 ? 51.322 36.129 6.976   1.00   21.19 ? 174  TRP A O   1 
ATOM   1385 C CB  . TRP A 1 180 ? 54.458 35.779 7.867   1.00   20.77 ? 174  TRP A CB  1 
ATOM   1386 C CG  . TRP A 1 180 ? 55.042 34.579 8.535   1.00   25.18 ? 174  TRP A CG  1 
ATOM   1387 C CD1 . TRP A 1 180 ? 54.506 33.864 9.557   1.00   28.40 ? 174  TRP A CD1 1 
ATOM   1388 C CD2 . TRP A 1 180 ? 56.265 33.940 8.209   1.00   24.47 ? 174  TRP A CD2 1 
ATOM   1389 N NE1 . TRP A 1 180 ? 55.326 32.833 9.896   1.00   30.63 ? 174  TRP A NE1 1 
ATOM   1390 C CE2 . TRP A 1 180 ? 56.422 32.847 9.064   1.00   28.99 ? 174  TRP A CE2 1 
ATOM   1391 C CE3 . TRP A 1 180 ? 57.265 34.180 7.235   1.00   24.89 ? 174  TRP A CE3 1 
ATOM   1392 C CZ2 . TRP A 1 180 ? 57.518 31.969 8.996   1.00   29.07 ? 174  TRP A CZ2 1 
ATOM   1393 C CZ3 . TRP A 1 180 ? 58.339 33.302 7.178   1.00   26.73 ? 174  TRP A CZ3 1 
ATOM   1394 C CH2 . TRP A 1 180 ? 58.474 32.215 8.052   1.00   26.51 ? 174  TRP A CH2 1 
ATOM   1395 N N   . ASN A 1 181 ? 51.918 34.134 7.810   1.00   23.87 ? 175  ASN A N   1 
ATOM   1396 C CA  . ASN A 1 181 ? 50.614 33.860 8.387   1.00   25.49 ? 175  ASN A CA  1 
ATOM   1397 C C   . ASN A 1 181 ? 50.480 34.509 9.756   1.00   26.98 ? 175  ASN A C   1 
ATOM   1398 O O   . ASN A 1 181 ? 51.394 34.458 10.564  1.00   26.49 ? 175  ASN A O   1 
ATOM   1399 C CB  . ASN A 1 181 ? 50.422 32.355 8.606   1.00   27.28 ? 175  ASN A CB  1 
ATOM   1400 C CG  . ASN A 1 181 ? 49.165 32.027 9.407   1.00   29.32 ? 175  ASN A CG  1 
ATOM   1401 O OD1 . ASN A 1 181 ? 49.192 31.901 10.629  1.00   39.00 ? 175  ASN A OD1 1 
ATOM   1402 N ND2 . ASN A 1 181 ? 48.052 31.883 8.707   1.00   33.04 ? 175  ASN A ND2 1 
ATOM   1403 N N   . ALA A 1 182 ? 49.311 35.070 10.007  1.00   28.44 ? 176  ALA A N   1 
ATOM   1404 C CA  . ALA A 1 182 ? 49.011 35.658 11.285  1.00   30.54 ? 176  ALA A CA  1 
ATOM   1405 C C   . ALA A 1 182 ? 47.553 35.430 11.612  1.00   32.38 ? 176  ALA A C   1 
ATOM   1406 O O   . ALA A 1 182 ? 46.758 36.351 11.741  1.00   32.59 ? 176  ALA A O   1 
ATOM   1407 C CB  . ALA A 1 182 ? 49.320 37.147 11.284  1.00   31.36 ? 176  ALA A CB  1 
ATOM   1408 N N   . ASP A 1 183 ? 47.215 34.168 11.775  1.00   34.89 ? 177  ASP A N   1 
ATOM   1409 C CA  . ASP A 1 183 ? 45.884 33.617 12.056  1.00   37.44 ? 177  ASP A CA  1 
ATOM   1410 C C   . ASP A 1 183 ? 45.173 34.165 13.289  1.00   37.74 ? 177  ASP A C   1 
ATOM   1411 O O   . ASP A 1 183 ? 43.949 34.355 13.306  1.00   38.31 ? 177  ASP A O   1 
ATOM   1412 C CB  . ASP A 1 183 ? 46.015 32.127 12.277  1.00   37.78 ? 177  ASP A CB  1 
ATOM   1413 C CG  . ASP A 1 183 ? 45.617 31.327 11.095  1.00   39.92 ? 177  ASP A CG  1 
ATOM   1414 O OD1 . ASP A 1 183 ? 45.370 31.923 10.027  1.00   43.63 ? 177  ASP A OD1 1 
ATOM   1415 O OD2 . ASP A 1 183 ? 45.534 30.091 11.226  1.00   46.16 ? 177  ASP A OD2 1 
ATOM   1416 N N   . ASP A 1 184 ? 45.954 34.421 14.324  1.00   38.59 ? 178  ASP A N   1 
ATOM   1417 C CA  . ASP A 1 184 ? 45.442 34.876 15.606  1.00   38.82 ? 178  ASP A CA  1 
ATOM   1418 C C   . ASP A 1 184 ? 44.880 36.303 15.565  1.00   37.93 ? 178  ASP A C   1 
ATOM   1419 O O   . ASP A 1 184 ? 44.198 36.703 16.502  1.00   37.81 ? 178  ASP A O   1 
ATOM   1420 C CB  . ASP A 1 184 ? 46.525 34.760 16.692  1.00   39.73 ? 178  ASP A CB  1 
ATOM   1421 C CG  . ASP A 1 184 ? 47.873 35.325 16.290  1.00   43.57 ? 178  ASP A CG  1 
ATOM   1422 O OD1 . ASP A 1 184 ? 48.440 34.872 15.284  1.00   46.73 ? 178  ASP A OD1 1 
ATOM   1423 O OD2 . ASP A 1 184 ? 48.356 36.232 17.003  1.00   50.01 ? 178  ASP A OD2 1 
ATOM   1424 N N   . TRP A 1 185 ? 45.126 37.090 14.495  1.00   35.66 ? 179  TRP A N   1 
ATOM   1425 C CA  . TRP A 1 185 ? 44.569 38.447 14.530  1.00   34.45 ? 179  TRP A CA  1 
ATOM   1426 C C   . TRP A 1 185 ? 44.291 39.100 13.168  1.00   33.20 ? 179  TRP A C   1 
ATOM   1427 O O   . TRP A 1 185 ? 43.653 40.161 13.111  1.00   33.11 ? 179  TRP A O   1 
ATOM   1428 C CB  . TRP A 1 185 ? 45.575 39.357 15.297  1.00   34.02 ? 179  TRP A CB  1 
ATOM   1429 C CG  . TRP A 1 185 ? 46.929 39.576 14.662  1.00   33.57 ? 179  TRP A CG  1 
ATOM   1430 C CD1 . TRP A 1 185 ? 48.059 38.778 14.816  1.00   34.35 ? 179  TRP A CD1 1 
ATOM   1431 C CD2 . TRP A 1 185 ? 47.358 40.622 13.770  1.00   32.86 ? 179  TRP A CD2 1 
ATOM   1432 N NE1 . TRP A 1 185 ? 49.123 39.283 14.101  1.00   32.57 ? 179  TRP A NE1 1 
ATOM   1433 C CE2 . TRP A 1 185 ? 48.722 40.413 13.449  1.00   30.91 ? 179  TRP A CE2 1 
ATOM   1434 C CE3 . TRP A 1 185 ? 46.712 41.733 13.225  1.00   29.23 ? 179  TRP A CE3 1 
ATOM   1435 C CZ2 . TRP A 1 185 ? 49.430 41.257 12.597  1.00   31.24 ? 179  TRP A CZ2 1 
ATOM   1436 C CZ3 . TRP A 1 185 ? 47.429 42.579 12.397  1.00   29.27 ? 179  TRP A CZ3 1 
ATOM   1437 C CH2 . TRP A 1 185 ? 48.771 42.341 12.094  1.00   29.85 ? 179  TRP A CH2 1 
ATOM   1438 N N   . ALA A 1 186 ? 44.812 38.564 12.084  1.00   32.18 ? 180  ALA A N   1 
ATOM   1439 C CA  . ALA A 1 186 ? 44.753 39.247 10.781  1.00   31.32 ? 180  ALA A CA  1 
ATOM   1440 C C   . ALA A 1 186 ? 43.376 39.540 10.183  1.00   30.69 ? 180  ALA A C   1 
ATOM   1441 O O   . ALA A 1 186 ? 43.089 40.673 9.790   1.00   29.88 ? 180  ALA A O   1 
ATOM   1442 C CB  . ALA A 1 186 ? 45.549 38.438 9.772   1.00   31.78 ? 180  ALA A CB  1 
ATOM   1443 N N   . THR A 1 187 ? 42.579 38.509 10.074  1.00   30.17 ? 181  THR A N   1 
ATOM   1444 C CA  . THR A 1 187 ? 41.290 38.560 9.384   1.00   30.50 ? 181  THR A CA  1 
ATOM   1445 C C   . THR A 1 187 ? 40.110 38.391 10.338  1.00   31.42 ? 181  THR A C   1 
ATOM   1446 O O   . THR A 1 187 ? 40.012 37.427 11.079  1.00   30.50 ? 181  THR A O   1 
ATOM   1447 C CB  . THR A 1 187 ? 41.289 37.491 8.290   1.00   30.32 ? 181  THR A CB  1 
ATOM   1448 O OG1 . THR A 1 187 ? 42.515 37.599 7.554   1.00   30.08 ? 181  THR A OG1 1 
ATOM   1449 C CG2 . THR A 1 187 ? 40.106 37.681 7.364   1.00   30.19 ? 181  THR A CG2 1 
ATOM   1450 N N   . ARG A 1 188 ? 39.232 39.376 10.320  1.00   32.94 ? 182  ARG A N   1 
ATOM   1451 C CA  . ARG A 1 188 ? 38.075 39.454 11.217  1.00   34.56 ? 182  ARG A CA  1 
ATOM   1452 C C   . ARG A 1 188 ? 38.562 39.317 12.653  1.00   35.53 ? 182  ARG A C   1 
ATOM   1453 O O   . ARG A 1 188 ? 37.995 38.559 13.436  1.00   36.13 ? 182  ARG A O   1 
ATOM   1454 C CB  . ARG A 1 188 ? 37.026 38.409 10.870  1.00   34.84 ? 182  ARG A CB  1 
ATOM   1455 C CG  . ARG A 1 188 ? 36.332 38.670 9.529   1.00   36.12 ? 182  ARG A CG  1 
ATOM   1456 C CD  . ARG A 1 188 ? 35.188 37.703 9.266   1.00   39.27 ? 182  ARG A CD  1 
ATOM   1457 N NE  . ARG A 1 188 ? 34.135 37.828 10.287  1.00   40.70 ? 182  ARG A NE  1 
ATOM   1458 C CZ  . ARG A 1 188 ? 33.691 36.814 11.035  1.00   42.06 ? 182  ARG A CZ  1 
ATOM   1459 N NH1 . ARG A 1 188 ? 34.181 35.581 10.889  1.00   42.37 ? 182  ARG A NH1 1 
ATOM   1460 N NH2 . ARG A 1 188 ? 32.743 37.052 11.929  1.00   41.74 ? 182  ARG A NH2 1 
ATOM   1461 N N   . GLY A 1 189 ? 39.640 40.018 12.986  1.00   36.82 ? 183  GLY A N   1 
ATOM   1462 C CA  . GLY A 1 189 ? 40.196 40.046 14.327  1.00   37.82 ? 183  GLY A CA  1 
ATOM   1463 C C   . GLY A 1 189 ? 40.771 38.709 14.833  1.00   38.53 ? 183  GLY A C   1 
ATOM   1464 O O   . GLY A 1 189 ? 41.073 38.570 16.020  1.00   39.83 ? 183  GLY A O   1 
ATOM   1465 N N   . GLY A 1 190 ? 40.922 37.761 13.920  1.00   39.18 ? 184  GLY A N   1 
ATOM   1466 C CA  . GLY A 1 190 ? 41.447 36.461 14.235  1.00   39.19 ? 184  GLY A CA  1 
ATOM   1467 C C   . GLY A 1 190 ? 40.430 35.332 14.011  1.00   39.42 ? 184  GLY A C   1 
ATOM   1468 O O   . GLY A 1 190 ? 40.759 34.164 14.114  1.00   39.83 ? 184  GLY A O   1 
ATOM   1469 N N   . LEU A 1 191 ? 39.191 35.697 13.677  1.00   40.16 ? 185  LEU A N   1 
ATOM   1470 C CA  . LEU A 1 191 ? 38.137 34.698 13.501  1.00   40.33 ? 185  LEU A CA  1 
ATOM   1471 C C   . LEU A 1 191 ? 38.277 33.881 12.214  1.00   40.10 ? 185  LEU A C   1 
ATOM   1472 O O   . LEU A 1 191 ? 37.854 32.736 12.186  1.00   40.09 ? 185  LEU A O   1 
ATOM   1473 C CB  . LEU A 1 191 ? 36.751 35.349 13.559  1.00   41.10 ? 185  LEU A CB  1 
ATOM   1474 C CG  . LEU A 1 191 ? 36.298 35.846 14.943  1.00   42.33 ? 185  LEU A CG  1 
ATOM   1475 C CD1 . LEU A 1 191 ? 35.072 36.732 14.814  1.00   43.86 ? 185  LEU A CD1 1 
ATOM   1476 C CD2 . LEU A 1 191 ? 36.035 34.658 15.871  1.00   44.67 ? 185  LEU A CD2 1 
ATOM   1477 N N   . GLU A 1 192 ? 38.852 34.452 11.147  1.00   39.21 ? 186  GLU A N   1 
ATOM   1478 C CA  . GLU A 1 192 ? 39.019 33.717 9.884   1.00   38.96 ? 186  GLU A CA  1 
ATOM   1479 C C   . GLU A 1 192 ? 40.434 33.151 9.755   1.00   38.40 ? 186  GLU A C   1 
ATOM   1480 O O   . GLU A 1 192 ? 41.404 33.906 9.804   1.00   38.32 ? 186  GLU A O   1 
ATOM   1481 C CB  . GLU A 1 192 ? 38.756 34.618 8.687   1.00   39.14 ? 186  GLU A CB  1 
ATOM   1482 C CG  . GLU A 1 192 ? 37.353 35.199 8.609   1.00   41.48 ? 186  GLU A CG  1 
ATOM   1483 C CD  . GLU A 1 192 ? 36.285 34.154 8.317   1.00   43.16 ? 186  GLU A CD  1 
ATOM   1484 O OE1 . GLU A 1 192 ? 36.624 33.117 7.699   1.00   44.03 ? 186  GLU A OE1 1 
ATOM   1485 O OE2 . GLU A 1 192 ? 35.125 34.377 8.714   1.00   45.48 ? 186  GLU A OE2 1 
ATOM   1486 N N   . LYS A 1 193 ? 40.551 31.835 9.605   1.00   37.71 ? 187  LYS A N   1 
ATOM   1487 C CA  . LYS A 1 193 ? 41.856 31.166 9.593   1.00   36.83 ? 187  LYS A CA  1 
ATOM   1488 C C   . LYS A 1 193 ? 42.291 30.885 8.167   1.00   35.63 ? 187  LYS A C   1 
ATOM   1489 O O   . LYS A 1 193 ? 41.474 30.746 7.255   1.00   34.52 ? 187  LYS A O   1 
ATOM   1490 C CB  . LYS A 1 193 ? 41.827 29.845 10.391  1.00   37.23 ? 187  LYS A CB  1 
ATOM   1491 C CG  . LYS A 1 193 ? 41.279 29.980 11.822  1.00   38.37 ? 187  LYS A CG  1 
ATOM   1492 C CD  . LYS A 1 193 ? 42.208 30.776 12.714  1.00   38.35 ? 187  LYS A CD  1 
ATOM   1493 C CE  . LYS A 1 193 ? 41.686 30.872 14.138  1.00   40.29 ? 187  LYS A CE  1 
ATOM   1494 N NZ  . LYS A 1 193 ? 42.372 31.962 14.890  1.00   39.21 ? 187  LYS A NZ  1 
ATOM   1495 N N   . THR A 1 194 ? 43.597 30.783 7.974   1.00   35.08 ? 188  THR A N   1 
ATOM   1496 C CA  . THR A 1 194 ? 44.121 30.542 6.651   1.00   34.67 ? 188  THR A CA  1 
ATOM   1497 C C   . THR A 1 194 ? 43.675 29.179 6.170   1.00   35.44 ? 188  THR A C   1 
ATOM   1498 O O   . THR A 1 194 ? 43.704 28.211 6.929   1.00   36.54 ? 188  THR A O   1 
ATOM   1499 C CB  . THR A 1 194 ? 45.641 30.616 6.655   1.00   34.40 ? 188  THR A CB  1 
ATOM   1500 O OG1 . THR A 1 194 ? 46.042 31.937 7.019   1.00   33.07 ? 188  THR A OG1 1 
ATOM   1501 C CG2 . THR A 1 194 ? 46.187 30.422 5.273   1.00   33.47 ? 188  THR A CG2 1 
ATOM   1502 N N   . ASP A 1 195 ? 43.265 29.124 4.917   1.00   35.32 ? 189  ASP A N   1 
ATOM   1503 C CA  . ASP A 1 195 ? 42.938 27.893 4.253   1.00   36.23 ? 189  ASP A CA  1 
ATOM   1504 C C   . ASP A 1 195 ? 44.163 27.478 3.464   1.00   35.12 ? 189  ASP A C   1 
ATOM   1505 O O   . ASP A 1 195 ? 44.361 27.900 2.335   1.00   35.30 ? 189  ASP A O   1 
ATOM   1506 C CB  . ASP A 1 195 ? 41.724 28.097 3.330   1.00   36.32 ? 189  ASP A CB  1 
ATOM   1507 C CG  . ASP A 1 195 ? 41.302 26.823 2.623   1.00   38.66 ? 189  ASP A CG  1 
ATOM   1508 O OD1 . ASP A 1 195 ? 42.069 25.833 2.664   1.00   39.95 ? 189  ASP A OD1 1 
ATOM   1509 O OD2 . ASP A 1 195 ? 40.228 26.736 1.979   1.00   39.85 ? 189  ASP A OD2 1 
ATOM   1510 N N   . TRP A 1 196 ? 44.980 26.620 4.066   1.00   35.21 ? 190  TRP A N   1 
ATOM   1511 C CA  . TRP A 1 196 ? 46.247 26.198 3.462   1.00   34.86 ? 190  TRP A CA  1 
ATOM   1512 C C   . TRP A 1 196 ? 46.129 25.419 2.175   1.00   35.55 ? 190  TRP A C   1 
ATOM   1513 O O   . TRP A 1 196 ? 47.103 25.300 1.445   1.00   35.28 ? 190  TRP A O   1 
ATOM   1514 C CB  . TRP A 1 196 ? 47.096 25.438 4.474   1.00   34.50 ? 190  TRP A CB  1 
ATOM   1515 C CG  . TRP A 1 196 ? 47.488 26.334 5.552   1.00   32.82 ? 190  TRP A CG  1 
ATOM   1516 C CD1 . TRP A 1 196 ? 46.991 26.365 6.821   1.00   31.35 ? 190  TRP A CD1 1 
ATOM   1517 C CD2 . TRP A 1 196 ? 48.418 27.402 5.452   1.00   28.35 ? 190  TRP A CD2 1 
ATOM   1518 N NE1 . TRP A 1 196 ? 47.597 27.373 7.532   1.00   34.16 ? 190  TRP A NE1 1 
ATOM   1519 C CE2 . TRP A 1 196 ? 48.486 28.021 6.710   1.00   30.42 ? 190  TRP A CE2 1 
ATOM   1520 C CE3 . TRP A 1 196 ? 49.229 27.891 4.419   1.00   28.02 ? 190  TRP A CE3 1 
ATOM   1521 C CZ2 . TRP A 1 196 ? 49.321 29.104 6.966   1.00   28.46 ? 190  TRP A CZ2 1 
ATOM   1522 C CZ3 . TRP A 1 196 ? 50.049 28.971 4.677   1.00   25.83 ? 190  TRP A CZ3 1 
ATOM   1523 C CH2 . TRP A 1 196 ? 50.088 29.562 5.932   1.00   27.86 ? 190  TRP A CH2 1 
ATOM   1524 N N   . SER A 1 197 ? 44.930 24.947 1.853   1.00   36.28 ? 191  SER A N   1 
ATOM   1525 C CA  . SER A 1 197 ? 44.686 24.348 0.545   1.00   37.00 ? 191  SER A CA  1 
ATOM   1526 C C   . SER A 1 197 ? 44.696 25.391 -0.575  1.00   36.74 ? 191  SER A C   1 
ATOM   1527 O O   . SER A 1 197 ? 44.717 25.041 -1.741  1.00   36.17 ? 191  SER A O   1 
ATOM   1528 C CB  . SER A 1 197 ? 43.368 23.549 0.548   1.00   37.19 ? 191  SER A CB  1 
ATOM   1529 O OG  . SER A 1 197 ? 42.221 24.388 0.657   1.00   39.72 ? 191  SER A OG  1 
ATOM   1530 N N   . LYS A 1 198 ? 44.697 26.677 -0.212  1.00   36.64 ? 192  LYS A N   1 
ATOM   1531 C CA  . LYS A 1 198 ? 44.748 27.770 -1.187  1.00   36.16 ? 192  LYS A CA  1 
ATOM   1532 C C   . LYS A 1 198 ? 46.146 28.354 -1.383  1.00   35.18 ? 192  LYS A C   1 
ATOM   1533 O O   . LYS A 1 198 ? 46.298 29.394 -2.025  1.00   34.33 ? 192  LYS A O   1 
ATOM   1534 C CB  . LYS A 1 198 ? 43.798 28.894 -0.751  1.00   36.37 ? 192  LYS A CB  1 
ATOM   1535 C CG  . LYS A 1 198 ? 42.351 28.462 -0.497  1.00   39.37 ? 192  LYS A CG  1 
ATOM   1536 C CD  . LYS A 1 198 ? 41.734 27.849 -1.750  1.00   42.45 ? 192  LYS A CD  1 
ATOM   1537 C CE  . LYS A 1 198 ? 40.222 27.758 -1.608  1.00   45.03 ? 192  LYS A CE  1 
ATOM   1538 N NZ  . LYS A 1 198 ? 39.686 26.843 -2.650  1.00   48.05 ? 192  LYS A NZ  1 
ATOM   1539 N N   . ALA A 1 199 ? 47.167 27.680 -0.853  1.00   33.57 ? 193  ALA A N   1 
ATOM   1540 C CA  . ALA A 1 199 ? 48.549 28.076 -1.035  1.00   32.28 ? 193  ALA A CA  1 
ATOM   1541 C C   . ALA A 1 199 ? 49.011 27.691 -2.434  1.00   31.49 ? 193  ALA A C   1 
ATOM   1542 O O   . ALA A 1 199 ? 48.485 26.744 -2.984  1.00   32.83 ? 193  ALA A O   1 
ATOM   1543 C CB  . ALA A 1 199 ? 49.433 27.399 0.023   1.00   32.52 ? 193  ALA A CB  1 
ATOM   1544 N N   . PRO A 1 200 ? 50.030 28.339 -2.995  1.00   29.58 ? 194  PRO A N   1 
ATOM   1545 C CA  . PRO A 1 200 ? 50.820 29.392 -2.340  1.00   28.10 ? 194  PRO A CA  1 
ATOM   1546 C C   . PRO A 1 200 ? 50.141 30.747 -2.421  1.00   25.91 ? 194  PRO A C   1 
ATOM   1547 O O   . PRO A 1 200 ? 49.501 31.059 -3.434  1.00   25.85 ? 194  PRO A O   1 
ATOM   1548 C CB  . PRO A 1 200 ? 52.108 29.421 -3.167  1.00   27.74 ? 194  PRO A CB  1 
ATOM   1549 C CG  . PRO A 1 200 ? 51.673 29.005 -4.512  1.00   30.22 ? 194  PRO A CG  1 
ATOM   1550 C CD  . PRO A 1 200 ? 50.542 28.048 -4.334  1.00   30.06 ? 194  PRO A CD  1 
ATOM   1551 N N   . PHE A 1 201 ? 50.265 31.531 -1.355  1.00   24.25 ? 195  PHE A N   1 
ATOM   1552 C CA  . PHE A 1 201 ? 49.811 32.913 -1.358  1.00   22.25 ? 195  PHE A CA  1 
ATOM   1553 C C   . PHE A 1 201 ? 50.967 33.747 -1.893  1.00   21.20 ? 195  PHE A C   1 
ATOM   1554 O O   . PHE A 1 201 ? 52.105 33.602 -1.464  1.00   19.94 ? 195  PHE A O   1 
ATOM   1555 C CB  . PHE A 1 201 ? 49.398 33.326 0.045   1.00   22.17 ? 195  PHE A CB  1 
ATOM   1556 C CG  . PHE A 1 201 ? 48.356 32.409 0.675   1.00   23.49 ? 195  PHE A CG  1 
ATOM   1557 C CD1 . PHE A 1 201 ? 47.008 32.545 0.394   1.00   22.53 ? 195  PHE A CD1 1 
ATOM   1558 C CD2 . PHE A 1 201 ? 48.745 31.389 1.544   1.00   25.13 ? 195  PHE A CD2 1 
ATOM   1559 C CE1 . PHE A 1 201 ? 46.066 31.707 0.967   1.00   25.38 ? 195  PHE A CE1 1 
ATOM   1560 C CE2 . PHE A 1 201 ? 47.813 30.533 2.100   1.00   25.93 ? 195  PHE A CE2 1 
ATOM   1561 C CZ  . PHE A 1 201 ? 46.467 30.682 1.818   1.00   25.10 ? 195  PHE A CZ  1 
ATOM   1562 N N   . ILE A 1 202 ? 50.689 34.579 -2.898  1.00   20.16 ? 196  ILE A N   1 
ATOM   1563 C CA  . ILE A 1 202 ? 51.709 35.267 -3.615  1.00   20.13 ? 196  ILE A CA  1 
ATOM   1564 C C   . ILE A 1 202 ? 51.490 36.775 -3.570  1.00   20.18 ? 196  ILE A C   1 
ATOM   1565 O O   . ILE A 1 202 ? 50.455 37.275 -4.070  1.00   19.64 ? 196  ILE A O   1 
ATOM   1566 C CB  . ILE A 1 202 ? 51.753 34.815 -5.096  1.00   19.88 ? 196  ILE A CB  1 
ATOM   1567 C CG1 . ILE A 1 202 ? 52.108 33.316 -5.190  1.00   23.59 ? 196  ILE A CG1 1 
ATOM   1568 C CG2 . ILE A 1 202 ? 52.794 35.626 -5.831  1.00   20.37 ? 196  ILE A CG2 1 
ATOM   1569 C CD1 . ILE A 1 202 ? 51.745 32.701 -6.526  1.00   26.06 ? 196  ILE A CD1 1 
ATOM   1570 N N   . ALA A 1 203 ? 52.470 37.483 -3.019  1.00   19.62 ? 197  ALA A N   1 
ATOM   1571 C CA  . ALA A 1 203 ? 52.517 38.947 -3.058  1.00   18.48 ? 197  ALA A CA  1 
ATOM   1572 C C   . ALA A 1 203 ? 53.616 39.418 -3.980  1.00   18.72 ? 197  ALA A C   1 
ATOM   1573 O O   . ALA A 1 203 ? 54.730 38.859 -3.986  1.00   18.25 ? 197  ALA A O   1 
ATOM   1574 C CB  . ALA A 1 203 ? 52.756 39.513 -1.614  1.00   19.55 ? 197  ALA A CB  1 
ATOM   1575 N N   . SER A 1 204 ? 53.342 40.492 -4.723  1.00   17.73 ? 198  SER A N   1 
ATOM   1576 C CA  . SER A 1 204 ? 54.249 40.985 -5.740  1.00   18.02 ? 198  SER A CA  1 
ATOM   1577 C C   . SER A 1 204 ? 54.729 42.379 -5.444  1.00   19.21 ? 198  SER A C   1 
ATOM   1578 O O   . SER A 1 204 ? 53.959 43.238 -4.946  1.00   18.27 ? 198  SER A O   1 
ATOM   1579 C CB  . SER A 1 204 ? 53.575 40.953 -7.123  1.00   18.01 ? 198  SER A CB  1 
ATOM   1580 O OG  . SER A 1 204 ? 53.017 39.660 -7.397  1.00   21.05 ? 198  SER A OG  1 
ATOM   1581 N N   . TYR A 1 205 ? 55.988 42.608 -5.797  1.00   18.81 ? 199  TYR A N   1 
ATOM   1582 C CA  . TYR A 1 205 ? 56.672 43.861 -5.566  1.00   20.00 ? 199  TYR A CA  1 
ATOM   1583 C C   . TYR A 1 205 ? 57.445 44.353 -6.786  1.00   21.71 ? 199  TYR A C   1 
ATOM   1584 O O   . TYR A 1 205 ? 58.083 43.556 -7.485  1.00   22.26 ? 199  TYR A O   1 
ATOM   1585 C CB  . TYR A 1 205 ? 57.709 43.675 -4.461  1.00   20.17 ? 199  TYR A CB  1 
ATOM   1586 C CG  . TYR A 1 205 ? 57.173 43.263 -3.103  1.00   19.97 ? 199  TYR A CG  1 
ATOM   1587 C CD1 . TYR A 1 205 ? 56.617 42.001 -2.882  1.00   22.08 ? 199  TYR A CD1 1 
ATOM   1588 C CD2 . TYR A 1 205 ? 57.288 44.114 -2.029  1.00   21.25 ? 199  TYR A CD2 1 
ATOM   1589 C CE1 . TYR A 1 205 ? 56.152 41.654 -1.619  1.00   21.01 ? 199  TYR A CE1 1 
ATOM   1590 C CE2 . TYR A 1 205 ? 56.876 43.759 -0.798  1.00   22.45 ? 199  TYR A CE2 1 
ATOM   1591 C CZ  . TYR A 1 205 ? 56.314 42.525 -0.591  1.00   21.67 ? 199  TYR A CZ  1 
ATOM   1592 O OH  . TYR A 1 205 ? 55.893 42.210 0.690   1.00   22.77 ? 199  TYR A OH  1 
ATOM   1593 N N   . ARG A 1 206 ? 57.456 45.665 -6.966  1.00   21.94 ? 200  ARG A N   1 
ATOM   1594 C CA  . ARG A 1 206 ? 58.323 46.371 -7.897  1.00   23.51 ? 200  ARG A CA  1 
ATOM   1595 C C   . ARG A 1 206 ? 58.848 47.668 -7.267  1.00   24.33 ? 200  ARG A C   1 
ATOM   1596 O O   . ARG A 1 206 ? 58.439 48.058 -6.161  1.00   22.55 ? 200  ARG A O   1 
ATOM   1597 C CB  . ARG A 1 206 ? 57.551 46.782 -9.159  1.00   24.10 ? 200  ARG A CB  1 
ATOM   1598 C CG  . ARG A 1 206 ? 56.907 45.688 -9.943  1.00   27.99 ? 200  ARG A CG  1 
ATOM   1599 C CD  . ARG A 1 206 ? 56.249 46.249 -11.228 1.00   32.55 ? 200  ARG A CD  1 
ATOM   1600 N NE  . ARG A 1 206 ? 55.728 45.198 -12.094 1.00   38.05 ? 200  ARG A NE  1 
ATOM   1601 C CZ  . ARG A 1 206 ? 54.807 45.400 -13.052 1.00   41.14 ? 200  ARG A CZ  1 
ATOM   1602 N NH1 . ARG A 1 206 ? 54.332 46.618 -13.275 1.00   41.36 ? 200  ARG A NH1 1 
ATOM   1603 N NH2 . ARG A 1 206 ? 54.367 44.386 -13.800 1.00   42.85 ? 200  ARG A NH2 1 
ATOM   1604 N N   . SER A 1 207 ? 59.742 48.324 -8.007  1.00   23.52 ? 201  SER A N   1 
ATOM   1605 C CA  . SER A 1 207 ? 60.267 49.659 -7.710  1.00   25.65 ? 201  SER A CA  1 
ATOM   1606 C C   . SER A 1 207 ? 61.456 49.689 -6.736  1.00   25.07 ? 201  SER A C   1 
ATOM   1607 O O   . SER A 1 207 ? 62.536 50.169 -7.091  1.00   25.52 ? 201  SER A O   1 
ATOM   1608 C CB  . SER A 1 207 ? 59.165 50.655 -7.297  1.00   26.15 ? 201  SER A CB  1 
ATOM   1609 O OG  . SER A 1 207 ? 59.742 51.947 -7.168  1.00   29.40 ? 201  SER A OG  1 
ATOM   1610 N N   . PHE A 1 208 ? 61.270 49.232 -5.499  1.00   25.01 ? 202  PHE A N   1 
ATOM   1611 C CA  . PHE A 1 208 ? 62.390 49.081 -4.570  1.00   24.89 ? 202  PHE A CA  1 
ATOM   1612 C C   . PHE A 1 208 ? 63.167 50.359 -4.320  1.00   25.51 ? 202  PHE A C   1 
ATOM   1613 O O   . PHE A 1 208 ? 64.383 50.341 -4.133  1.00   26.71 ? 202  PHE A O   1 
ATOM   1614 C CB  . PHE A 1 208 ? 63.326 47.995 -5.079  1.00   24.57 ? 202  PHE A CB  1 
ATOM   1615 C CG  . PHE A 1 208 ? 62.612 46.729 -5.425  1.00   22.86 ? 202  PHE A CG  1 
ATOM   1616 C CD1 . PHE A 1 208 ? 62.070 45.938 -4.442  1.00   23.25 ? 202  PHE A CD1 1 
ATOM   1617 C CD2 . PHE A 1 208 ? 62.478 46.329 -6.762  1.00   24.80 ? 202  PHE A CD2 1 
ATOM   1618 C CE1 . PHE A 1 208 ? 61.416 44.781 -4.740  1.00   22.73 ? 202  PHE A CE1 1 
ATOM   1619 C CE2 . PHE A 1 208 ? 61.822 45.162 -7.074  1.00   23.71 ? 202  PHE A CE2 1 
ATOM   1620 C CZ  . PHE A 1 208 ? 61.275 44.388 -6.078  1.00   22.81 ? 202  PHE A CZ  1 
ATOM   1621 N N   . HIS A 1 209 ? 62.433 51.455 -4.311  1.00   26.17 ? 203  HIS A N   1 
ATOM   1622 C CA  . HIS A 1 209 ? 63.015 52.795 -4.246  1.00   26.32 ? 203  HIS A CA  1 
ATOM   1623 C C   . HIS A 1 209 ? 63.444 53.169 -2.830  1.00   25.42 ? 203  HIS A C   1 
ATOM   1624 O O   . HIS A 1 209 ? 62.619 53.152 -1.907  1.00   24.52 ? 203  HIS A O   1 
ATOM   1625 C CB  . HIS A 1 209 ? 61.982 53.786 -4.727  1.00   26.86 ? 203  HIS A CB  1 
ATOM   1626 C CG  . HIS A 1 209 ? 62.431 55.206 -4.642  1.00   30.05 ? 203  HIS A CG  1 
ATOM   1627 N ND1 . HIS A 1 209 ? 61.871 56.100 -3.754  1.00   33.51 ? 203  HIS A ND1 1 
ATOM   1628 C CD2 . HIS A 1 209 ? 63.399 55.879 -5.299  1.00   32.32 ? 203  HIS A CD2 1 
ATOM   1629 C CE1 . HIS A 1 209 ? 62.457 57.276 -3.887  1.00   33.60 ? 203  HIS A CE1 1 
ATOM   1630 N NE2 . HIS A 1 209 ? 63.393 57.173 -4.815  1.00   34.42 ? 203  HIS A NE2 1 
ATOM   1631 N N   . ILE A 1 210 ? 64.721 53.516 -2.684  1.00   25.40 ? 204  ILE A N   1 
ATOM   1632 C CA  . ILE A 1 210 ? 65.262 54.091 -1.455  1.00   25.30 ? 204  ILE A CA  1 
ATOM   1633 C C   . ILE A 1 210 ? 66.041 55.370 -1.771  1.00   26.05 ? 204  ILE A C   1 
ATOM   1634 O O   . ILE A 1 210 ? 67.016 55.353 -2.540  1.00   25.29 ? 204  ILE A O   1 
ATOM   1635 C CB  . ILE A 1 210 ? 66.191 53.109 -0.749  1.00   25.21 ? 204  ILE A CB  1 
ATOM   1636 C CG1 . ILE A 1 210 ? 65.437 51.810 -0.424  1.00   24.60 ? 204  ILE A CG1 1 
ATOM   1637 C CG2 . ILE A 1 210 ? 66.740 53.758 0.551   1.00   25.67 ? 204  ILE A CG2 1 
ATOM   1638 C CD1 . ILE A 1 210 ? 66.255 50.853 0.328   1.00   27.32 ? 204  ILE A CD1 1 
ATOM   1639 N N   . ASP A 1 211 ? 65.618 56.462 -1.157  1.00   26.30 ? 205  ASP A N   1 
ATOM   1640 C CA  . ASP A 1 211 ? 66.336 57.725 -1.214  1.00   27.69 ? 205  ASP A CA  1 
ATOM   1641 C C   . ASP A 1 211 ? 66.422 58.211 0.238   1.00   28.86 ? 205  ASP A C   1 
ATOM   1642 O O   . ASP A 1 211 ? 65.511 58.852 0.727   1.00   28.48 ? 205  ASP A O   1 
ATOM   1643 C CB  . ASP A 1 211 ? 65.547 58.676 -2.096  1.00   27.90 ? 205  ASP A CB  1 
ATOM   1644 C CG  . ASP A 1 211 ? 66.236 60.002 -2.338  1.00   29.88 ? 205  ASP A CG  1 
ATOM   1645 O OD1 . ASP A 1 211 ? 67.413 60.180 -1.984  1.00   30.11 ? 205  ASP A OD1 1 
ATOM   1646 O OD2 . ASP A 1 211 ? 65.617 60.921 -2.903  1.00   31.12 ? 205  ASP A OD2 1 
ATOM   1647 N N   . GLY A 1 212 ? 67.512 57.880 0.914   1.00   30.80 ? 206  GLY A N   1 
ATOM   1648 C CA  . GLY A 1 212 ? 67.643 58.207 2.322   1.00   33.20 ? 206  GLY A CA  1 
ATOM   1649 C C   . GLY A 1 212 ? 69.027 58.595 2.789   1.00   35.65 ? 206  GLY A C   1 
ATOM   1650 O O   . GLY A 1 212 ? 70.007 58.478 2.082   1.00   35.11 ? 206  GLY A O   1 
ATOM   1651 N N   . CYS A 1 213 ? 69.084 59.066 4.034   1.00   38.60 ? 207  CYS A N   1 
ATOM   1652 C CA  . CYS A 1 213 ? 70.321 59.452 4.654   1.00   41.88 ? 207  CYS A CA  1 
ATOM   1653 C C   . CYS A 1 213 ? 70.973 58.204 5.248   1.00   42.75 ? 207  CYS A C   1 
ATOM   1654 O O   . CYS A 1 213 ? 70.657 57.797 6.351   1.00   42.66 ? 207  CYS A O   1 
ATOM   1655 C CB  . CYS A 1 213 ? 70.057 60.494 5.741   1.00   42.56 ? 207  CYS A CB  1 
ATOM   1656 S SG  . CYS A 1 213 ? 71.075 61.995 5.607   1.00   49.95 ? 207  CYS A SG  1 
ATOM   1657 N N   . GLU A 1 214 ? 71.894 57.617 4.498   1.00   43.99 ? 208  GLU A N   1 
ATOM   1658 C CA  . GLU A 1 214 ? 72.584 56.409 4.927   1.00   46.66 ? 208  GLU A CA  1 
ATOM   1659 C C   . GLU A 1 214 ? 73.320 56.614 6.264   1.00   48.23 ? 208  GLU A C   1 
ATOM   1660 O O   . GLU A 1 214 ? 74.092 57.570 6.389   1.00   48.11 ? 208  GLU A O   1 
ATOM   1661 C CB  . GLU A 1 214 ? 73.572 55.961 3.852   1.00   46.91 ? 208  GLU A CB  1 
ATOM   1662 C CG  . GLU A 1 214 ? 73.203 54.677 3.136   1.00   49.25 ? 208  GLU A CG  1 
ATOM   1663 C CD  . GLU A 1 214 ? 74.358 53.692 3.088   1.00   52.37 ? 208  GLU A CD  1 
ATOM   1664 O OE1 . GLU A 1 214 ? 75.356 53.989 2.386   1.00   53.70 ? 208  GLU A OE1 1 
ATOM   1665 O OE2 . GLU A 1 214 ? 74.275 52.635 3.753   1.00   54.19 ? 208  GLU A OE2 1 
ATOM   1666 N N   . ALA A 1 215 ? 73.086 55.723 7.254   1.00   50.43 ? 209  ALA A N   1 
ATOM   1667 C CA  . ALA A 1 215 ? 73.662 55.840 8.598   1.00   52.76 ? 209  ALA A CA  1 
ATOM   1668 C C   . ALA A 1 215 ? 73.788 54.463 9.219   1.00   55.32 ? 209  ALA A C   1 
ATOM   1669 O O   . ALA A 1 215 ? 72.786 53.761 9.407   1.00   55.73 ? 209  ALA A O   1 
ATOM   1670 C CB  . ALA A 1 215 ? 72.809 56.728 9.491   1.00   52.97 ? 209  ALA A CB  1 
ATOM   1671 N N   . SER A 1 216 ? 75.015 54.080 9.521   1.00   57.94 ? 210  SER A N   1 
ATOM   1672 C CA  . SER A 1 216 ? 75.302 52.786 10.093  1.00   60.12 ? 210  SER A CA  1 
ATOM   1673 C C   . SER A 1 216 ? 74.754 52.693 11.524  1.00   61.74 ? 210  SER A C   1 
ATOM   1674 O O   . SER A 1 216 ? 74.519 53.714 12.161  1.00   62.28 ? 210  SER A O   1 
ATOM   1675 C CB  . SER A 1 216 ? 76.821 52.535 10.081  1.00   60.34 ? 210  SER A CB  1 
ATOM   1676 O OG  . SER A 1 216 ? 77.138 51.238 10.543  1.00   61.92 ? 210  SER A OG  1 
ATOM   1677 N N   . VAL A 1 217 ? 74.545 51.474 11.999  1.00   63.63 ? 211  VAL A N   1 
ATOM   1678 C CA  . VAL A 1 217 ? 74.151 51.277 13.388  1.00   65.17 ? 211  VAL A CA  1 
ATOM   1679 C C   . VAL A 1 217 ? 75.381 51.758 14.159  1.00   66.32 ? 211  VAL A C   1 
ATOM   1680 O O   . VAL A 1 217 ? 75.283 52.480 15.150  1.00   66.83 ? 211  VAL A O   1 
ATOM   1681 C CB  . VAL A 1 217 ? 73.771 49.805 13.723  1.00   65.29 ? 211  VAL A CB  1 
ATOM   1682 C CG1 . VAL A 1 217 ? 73.686 49.591 15.215  1.00   65.64 ? 211  VAL A CG1 1 
ATOM   1683 C CG2 . VAL A 1 217 ? 72.448 49.436 13.056  1.00   65.46 ? 211  VAL A CG2 1 
ATOM   1684 N N   . GLU A 1 218 ? 76.560 51.385 13.641  1.00   67.49 ? 212  GLU A N   1 
ATOM   1685 C CA  . GLU A 1 218 ? 77.861 51.814 14.183  1.00   68.37 ? 212  GLU A CA  1 
ATOM   1686 C C   . GLU A 1 218 ? 77.798 53.265 14.641  1.00   68.56 ? 212  GLU A C   1 
ATOM   1687 O O   . GLU A 1 218 ? 77.935 53.583 15.829  1.00   68.90 ? 212  GLU A O   1 
ATOM   1688 C CB  . GLU A 1 218 ? 78.927 51.603 13.115  1.00   68.64 ? 212  GLU A CB  1 
ATOM   1689 C CG  . GLU A 1 218 ? 80.375 51.722 13.565  1.00   70.04 ? 212  GLU A CG  1 
ATOM   1690 C CD  . GLU A 1 218 ? 80.883 50.538 14.370  1.00   71.61 ? 212  GLU A CD  1 
ATOM   1691 O OE1 . GLU A 1 218 ? 80.144 49.537 14.522  1.00   73.14 ? 212  GLU A OE1 1 
ATOM   1692 O OE2 . GLU A 1 218 ? 82.031 50.609 14.859  1.00   72.86 ? 212  GLU A OE2 1 
ATOM   1693 N N   . ALA A 1 219 ? 77.569 54.155 13.672  1.00   68.56 ? 213  ALA A N   1 
ATOM   1694 C CA  . ALA A 1 219 ? 77.399 55.586 13.931  1.00   68.38 ? 213  ALA A CA  1 
ATOM   1695 C C   . ALA A 1 219 ? 75.952 55.976 13.654  1.00   68.07 ? 213  ALA A C   1 
ATOM   1696 O O   . ALA A 1 219 ? 75.480 55.740 12.543  1.00   68.42 ? 213  ALA A O   1 
ATOM   1697 C CB  . ALA A 1 219 ? 78.336 56.425 13.062  1.00   68.27 ? 213  ALA A CB  1 
ATOM   1698 N N   . LYS A 1 220 ? 75.227 56.577 14.627  1.00   67.54 ? 214  LYS A N   1 
ATOM   1699 C CA  . LYS A 1 220 ? 73.889 57.039 14.379  1.00   66.86 ? 214  LYS A CA  1 
ATOM   1700 C C   . LYS A 1 220 ? 73.879 58.441 13.822  1.00   65.98 ? 214  LYS A C   1 
ATOM   1701 O O   . LYS A 1 220 ? 73.290 59.357 14.395  1.00   66.01 ? 214  LYS A O   1 
ATOM   1702 C CB  . LYS A 1 220 ? 72.998 57.022 15.632  1.00   67.03 ? 214  LYS A CB  1 
ATOM   1703 C CG  . LYS A 1 220 ? 73.087 55.736 16.478  1.00   67.73 ? 214  LYS A CG  1 
ATOM   1704 C CD  . LYS A 1 220 ? 72.889 54.448 15.685  0.0000 68.38 ? 214  LYS A CD  1 
ATOM   1705 C CE  . LYS A 1 220 ? 72.605 53.291 16.625  0.0000 68.84 ? 214  LYS A CE  1 
ATOM   1706 N NZ  . LYS A 1 220 ? 71.169 53.227 16.993  0.0000 69.35 ? 214  LYS A NZ  1 
ATOM   1707 N N   . PHE A 1 221 ? 74.550 58.634 12.688  1.00   64.67 ? 215  PHE A N   1 
ATOM   1708 C CA  . PHE A 1 221 ? 74.454 59.907 11.986  1.00   63.48 ? 215  PHE A CA  1 
ATOM   1709 C C   . PHE A 1 221 ? 74.750 59.748 10.494  1.00   61.50 ? 215  PHE A C   1 
ATOM   1710 O O   . PHE A 1 221 ? 75.381 58.778 10.056  1.00   61.54 ? 215  PHE A O   1 
ATOM   1711 C CB  . PHE A 1 221 ? 75.372 60.995 12.595  1.00   63.79 ? 215  PHE A CB  1 
ATOM   1712 C CG  . PHE A 1 221 ? 76.848 60.738 12.570  1.00   65.97 ? 215  PHE A CG  1 
ATOM   1713 C CD1 . PHE A 1 221 ? 77.634 60.969 11.435  1.00   67.97 ? 215  PHE A CD1 1 
ATOM   1714 C CD2 . PHE A 1 221 ? 77.462 60.234 13.721  1.00   67.86 ? 215  PHE A CD2 1 
ATOM   1715 C CE1 . PHE A 1 221 ? 78.999 60.682 11.438  1.00   68.37 ? 215  PHE A CE1 1 
ATOM   1716 C CE2 . PHE A 1 221 ? 78.832 59.943 13.732  1.00   68.57 ? 215  PHE A CE2 1 
ATOM   1717 C CZ  . PHE A 1 221 ? 79.600 60.165 12.587  1.00   68.80 ? 215  PHE A CZ  1 
ATOM   1718 N N   . CYS A 1 222 ? 74.246 60.689 9.732   1.00   59.07 ? 216  CYS A N   1 
ATOM   1719 C CA  . CYS A 1 222 ? 74.397 60.824 8.303   1.00   56.86 ? 216  CYS A CA  1 
ATOM   1720 C C   . CYS A 1 222 ? 75.095 62.146 8.121   1.00   55.58 ? 216  CYS A C   1 
ATOM   1721 O O   . CYS A 1 222 ? 74.654 63.133 8.696   1.00   54.47 ? 216  CYS A O   1 
ATOM   1722 C CB  . CYS A 1 222 ? 73.046 60.782 7.600   1.00   56.50 ? 216  CYS A CB  1 
ATOM   1723 S SG  . CYS A 1 222 ? 73.110 61.230 5.838   1.00   54.92 ? 216  CYS A SG  1 
ATOM   1724 N N   . ALA A 1 223 ? 76.166 62.189 7.334   1.00   54.32 ? 217  ALA A N   1 
ATOM   1725 C CA  . ALA A 1 223 ? 77.007 63.383 7.258   1.00   53.10 ? 217  ALA A CA  1 
ATOM   1726 C C   . ALA A 1 223 ? 76.359 64.536 6.494   1.00   52.06 ? 217  ALA A C   1 
ATOM   1727 O O   . ALA A 1 223 ? 76.844 65.667 6.569   1.00   52.47 ? 217  ALA A O   1 
ATOM   1728 C CB  . ALA A 1 223 ? 78.359 63.037 6.648   1.00   53.43 ? 217  ALA A CB  1 
ATOM   1729 N N   . THR A 1 224 ? 75.271 64.258 5.766   1.00   50.13 ? 218  THR A N   1 
ATOM   1730 C CA  . THR A 1 224 ? 74.540 65.285 5.018   1.00   48.47 ? 218  THR A CA  1 
ATOM   1731 C C   . THR A 1 224 ? 73.185 65.658 5.660   1.00   47.33 ? 218  THR A C   1 
ATOM   1732 O O   . THR A 1 224 ? 72.303 66.174 4.981   1.00   47.23 ? 218  THR A O   1 
ATOM   1733 C CB  . THR A 1 224 ? 74.336 64.818 3.561   1.00   48.60 ? 218  THR A CB  1 
ATOM   1734 O OG1 . THR A 1 224 ? 73.713 63.527 3.545   1.00   48.01 ? 218  THR A OG1 1 
ATOM   1735 C CG2 . THR A 1 224 ? 75.695 64.581 2.848   1.00   48.09 ? 218  THR A CG2 1 
ATOM   1736 N N   . GLN A 1 225 ? 73.051 65.439 6.970   1.00   45.74 ? 219  GLN A N   1 
ATOM   1737 C CA  . GLN A 1 225 ? 71.817 65.725 7.712   1.00   44.69 ? 219  GLN A CA  1 
ATOM   1738 C C   . GLN A 1 225 ? 71.503 67.219 7.736   1.00   44.96 ? 219  GLN A C   1 
ATOM   1739 O O   . GLN A 1 225 ? 72.373 68.036 8.046   1.00   45.17 ? 219  GLN A O   1 
ATOM   1740 C CB  . GLN A 1 225 ? 71.912 65.193 9.153   1.00   43.85 ? 219  GLN A CB  1 
ATOM   1741 C CG  . GLN A 1 225 ? 70.734 65.560 10.086  1.00   41.87 ? 219  GLN A CG  1 
ATOM   1742 C CD  . GLN A 1 225 ? 69.355 65.181 9.538   1.00   41.27 ? 219  GLN A CD  1 
ATOM   1743 O OE1 . GLN A 1 225 ? 68.349 65.918 9.736   1.00   39.82 ? 219  GLN A OE1 1 
ATOM   1744 N NE2 . GLN A 1 225 ? 69.291 64.032 8.859   1.00   35.61 ? 219  GLN A NE2 1 
ATOM   1745 N N   . GLY A 1 226 ? 70.249 67.549 7.437   1.00   44.55 ? 220  GLY A N   1 
ATOM   1746 C CA  . GLY A 1 226 ? 69.808 68.927 7.262   1.00   44.51 ? 220  GLY A CA  1 
ATOM   1747 C C   . GLY A 1 226 ? 70.005 69.499 5.864   1.00   44.12 ? 220  GLY A C   1 
ATOM   1748 O O   . GLY A 1 226 ? 69.424 70.518 5.550   1.00   44.63 ? 220  GLY A O   1 
ATOM   1749 N N   . ALA A 1 227 ? 70.825 68.861 5.029   1.00   44.06 ? 221  ALA A N   1 
ATOM   1750 C CA  . ALA A 1 227 ? 71.088 69.316 3.655   1.00   43.43 ? 221  ALA A CA  1 
ATOM   1751 C C   . ALA A 1 227 ? 70.298 68.541 2.592   1.00   42.56 ? 221  ALA A C   1 
ATOM   1752 O O   . ALA A 1 227 ? 70.554 68.677 1.390   1.00   43.49 ? 221  ALA A O   1 
ATOM   1753 C CB  . ALA A 1 227 ? 72.580 69.197 3.358   1.00   43.51 ? 221  ALA A CB  1 
ATOM   1754 N N   . ARG A 1 228 ? 69.346 67.716 3.026   1.00   40.60 ? 222  ARG A N   1 
ATOM   1755 C CA  . ARG A 1 228 ? 68.618 66.866 2.103   1.00   38.65 ? 222  ARG A CA  1 
ATOM   1756 C C   . ARG A 1 228 ? 67.359 67.558 1.635   1.00   36.69 ? 222  ARG A C   1 
ATOM   1757 O O   . ARG A 1 228 ? 66.828 68.442 2.310   1.00   35.71 ? 222  ARG A O   1 
ATOM   1758 C CB  . ARG A 1 228 ? 68.299 65.514 2.767   1.00   38.60 ? 222  ARG A CB  1 
ATOM   1759 C CG  . ARG A 1 228 ? 69.518 64.792 3.325   1.00   39.19 ? 222  ARG A CG  1 
ATOM   1760 C CD  . ARG A 1 228 ? 70.687 64.635 2.359   1.00   40.40 ? 222  ARG A CD  1 
ATOM   1761 N NE  . ARG A 1 228 ? 70.456 63.668 1.273   1.00   41.33 ? 222  ARG A NE  1 
ATOM   1762 C CZ  . ARG A 1 228 ? 70.907 62.399 1.254   1.00   41.11 ? 222  ARG A CZ  1 
ATOM   1763 N NH1 . ARG A 1 228 ? 71.606 61.878 2.245   1.00   41.15 ? 222  ARG A NH1 1 
ATOM   1764 N NH2 . ARG A 1 228 ? 70.629 61.654 0.195   1.00   42.56 ? 222  ARG A NH2 1 
ATOM   1765 N N   . TRP A 1 229 ? 66.855 67.143 0.478   1.00   35.55 ? 223  TRP A N   1 
ATOM   1766 C CA  . TRP A 1 229 ? 65.642 67.745 -0.043  1.00   34.32 ? 223  TRP A CA  1 
ATOM   1767 C C   . TRP A 1 229 ? 64.460 67.640 0.914   1.00   33.82 ? 223  TRP A C   1 
ATOM   1768 O O   . TRP A 1 229 ? 63.656 68.543 0.991   1.00   33.44 ? 223  TRP A O   1 
ATOM   1769 C CB  . TRP A 1 229 ? 65.307 67.216 -1.440  1.00   34.80 ? 223  TRP A CB  1 
ATOM   1770 C CG  . TRP A 1 229 ? 64.971 65.740 -1.591  1.00   32.89 ? 223  TRP A CG  1 
ATOM   1771 C CD1 . TRP A 1 229 ? 65.783 64.758 -2.084  1.00   32.98 ? 223  TRP A CD1 1 
ATOM   1772 C CD2 . TRP A 1 229 ? 63.717 65.119 -1.315  1.00   31.83 ? 223  TRP A CD2 1 
ATOM   1773 N NE1 . TRP A 1 229 ? 65.109 63.559 -2.114  1.00   33.11 ? 223  TRP A NE1 1 
ATOM   1774 C CE2 . TRP A 1 229 ? 63.833 63.756 -1.661  1.00   31.94 ? 223  TRP A CE2 1 
ATOM   1775 C CE3 . TRP A 1 229 ? 62.495 65.578 -0.823  1.00   30.43 ? 223  TRP A CE3 1 
ATOM   1776 C CZ2 . TRP A 1 229 ? 62.790 62.853 -1.495  1.00   32.04 ? 223  TRP A CZ2 1 
ATOM   1777 C CZ3 . TRP A 1 229 ? 61.452 64.683 -0.670  1.00   32.50 ? 223  TRP A CZ3 1 
ATOM   1778 C CH2 . TRP A 1 229 ? 61.605 63.334 -1.015  1.00   30.85 ? 223  TRP A CH2 1 
ATOM   1779 N N   . TRP A 1 230 ? 64.358 66.538 1.659   1.00   33.17 ? 224  TRP A N   1 
ATOM   1780 C CA  . TRP A 1 230 ? 63.284 66.365 2.638   1.00   32.88 ? 224  TRP A CA  1 
ATOM   1781 C C   . TRP A 1 230 ? 63.455 67.164 3.943   1.00   33.86 ? 224  TRP A C   1 
ATOM   1782 O O   . TRP A 1 230 ? 62.544 67.193 4.774   1.00   33.56 ? 224  TRP A O   1 
ATOM   1783 C CB  . TRP A 1 230 ? 63.115 64.868 2.986   1.00   32.42 ? 224  TRP A CB  1 
ATOM   1784 C CG  . TRP A 1 230 ? 64.359 64.182 3.424   1.00   29.41 ? 224  TRP A CG  1 
ATOM   1785 C CD1 . TRP A 1 230 ? 64.934 64.228 4.653   1.00   29.02 ? 224  TRP A CD1 1 
ATOM   1786 C CD2 . TRP A 1 230 ? 65.168 63.312 2.640   1.00   29.67 ? 224  TRP A CD2 1 
ATOM   1787 N NE1 . TRP A 1 230 ? 66.071 63.461 4.671   1.00   28.39 ? 224  TRP A NE1 1 
ATOM   1788 C CE2 . TRP A 1 230 ? 66.228 62.875 3.449   1.00   29.69 ? 224  TRP A CE2 1 
ATOM   1789 C CE3 . TRP A 1 230 ? 65.104 62.859 1.325   1.00   30.64 ? 224  TRP A CE3 1 
ATOM   1790 C CZ2 . TRP A 1 230 ? 67.208 62.023 2.992   1.00   30.46 ? 224  TRP A CZ2 1 
ATOM   1791 C CZ3 . TRP A 1 230 ? 66.075 62.019 0.870   1.00   30.44 ? 224  TRP A CZ3 1 
ATOM   1792 C CH2 . TRP A 1 230 ? 67.117 61.597 1.701   1.00   30.49 ? 224  TRP A CH2 1 
ATOM   1793 N N   . ASP A 1 231 ? 64.594 67.837 4.100   1.00   35.25 ? 225  ASP A N   1 
ATOM   1794 C CA  . ASP A 1 231 ? 64.881 68.688 5.259   1.00   36.63 ? 225  ASP A CA  1 
ATOM   1795 C C   . ASP A 1 231 ? 64.465 70.112 4.993   1.00   38.12 ? 225  ASP A C   1 
ATOM   1796 O O   . ASP A 1 231 ? 64.486 70.932 5.903   1.00   39.20 ? 225  ASP A O   1 
ATOM   1797 C CB  . ASP A 1 231 ? 66.363 68.709 5.611   1.00   36.64 ? 225  ASP A CB  1 
ATOM   1798 C CG  . ASP A 1 231 ? 66.852 67.385 6.070   1.00   35.77 ? 225  ASP A CG  1 
ATOM   1799 O OD1 . ASP A 1 231 ? 66.086 66.634 6.703   1.00   40.01 ? 225  ASP A OD1 1 
ATOM   1800 O OD2 . ASP A 1 231 ? 68.032 67.067 5.785   1.00   35.84 ? 225  ASP A OD2 1 
ATOM   1801 N N   . GLN A 1 232 ? 64.084 70.412 3.757   1.00   39.32 ? 226  GLN A N   1 
ATOM   1802 C CA  . GLN A 1 232 ? 63.709 71.773 3.387   1.00   39.91 ? 226  GLN A CA  1 
ATOM   1803 C C   . GLN A 1 232 ? 62.359 72.156 3.964   1.00   40.22 ? 226  GLN A C   1 
ATOM   1804 O O   . GLN A 1 232 ? 61.559 71.302 4.346   1.00   39.18 ? 226  GLN A O   1 
ATOM   1805 C CB  . GLN A 1 232 ? 63.837 71.941 1.873   1.00   40.19 ? 226  GLN A CB  1 
ATOM   1806 C CG  . GLN A 1 232 ? 65.217 71.570 1.296   1.00   42.15 ? 226  GLN A CG  1 
ATOM   1807 C CD  . GLN A 1 232 ? 66.420 72.127 2.078   1.00   46.30 ? 226  GLN A CD  1 
ATOM   1808 O OE1 . GLN A 1 232 ? 67.191 71.362 2.651   1.00   47.15 ? 226  GLN A OE1 1 
ATOM   1809 N NE2 . GLN A 1 232 ? 66.758 73.394 2.211   1.00   47.95 ? 226  GLN A NE2 1 
ATOM   1810 N N   . LYS A 1 233 ? 62.127 73.463 4.019   1.00   40.32 ? 227  LYS A N   1 
ATOM   1811 C CA  . LYS A 1 233 ? 60.909 74.066 4.584   1.00   40.24 ? 227  LYS A CA  1 
ATOM   1812 C C   . LYS A 1 233 ? 59.566 73.508 4.065   1.00   40.15 ? 227  LYS A C   1 
ATOM   1813 O O   . LYS A 1 233 ? 58.631 73.359 4.834   1.00   39.54 ? 227  LYS A O   1 
ATOM   1814 C CB  . LYS A 1 233 ? 60.939 75.579 4.344   1.00   40.78 ? 227  LYS A CB  1 
ATOM   1815 C CG  . LYS A 1 233 ? 59.689 76.294 4.850   0.0000 45.12 ? 227  LYS A CG  1 
ATOM   1816 C CD  . LYS A 1 233 ? 58.574 76.303 3.829   0.0000 48.25 ? 227  LYS A CD  1 
ATOM   1817 C CE  . LYS A 1 233 ? 57.224 76.536 4.471   0.0000 49.67 ? 227  LYS A CE  1 
ATOM   1818 N NZ  . LYS A 1 233 ? 57.217 77.781 5.283   0.0000 51.91 ? 227  LYS A NZ  1 
ATOM   1819 N N   . GLU A 1 234 ? 59.492 73.197 2.775   1.00   40.58 ? 228  GLU A N   1 
ATOM   1820 C CA  . GLU A 1 234 ? 58.255 72.701 2.152   1.00   41.60 ? 228  GLU A CA  1 
ATOM   1821 C C   . GLU A 1 234 ? 57.812 71.331 2.722   1.00   41.06 ? 228  GLU A C   1 
ATOM   1822 O O   . GLU A 1 234 ? 56.650 70.945 2.582   1.00   41.37 ? 228  GLU A O   1 
ATOM   1823 C CB  . GLU A 1 234 ? 58.416 72.561 0.622   1.00   42.21 ? 228  GLU A CB  1 
ATOM   1824 C CG  . GLU A 1 234 ? 59.195 73.671 -0.056  1.00   45.71 ? 228  GLU A CG  1 
ATOM   1825 C CD  . GLU A 1 234 ? 60.700 73.407 -0.171  1.00   49.20 ? 228  GLU A CD  1 
ATOM   1826 O OE1 . GLU A 1 234 ? 61.098 72.433 -0.845  1.00   53.13 ? 228  GLU A OE1 1 
ATOM   1827 O OE2 . GLU A 1 234 ? 61.468 74.177 0.441   1.00   50.31 ? 228  GLU A OE2 1 
ATOM   1828 N N   . PHE A 1 235 ? 58.733 70.614 3.361   1.00   40.04 ? 229  PHE A N   1 
ATOM   1829 C CA  . PHE A 1 235 ? 58.437 69.284 3.913   1.00   39.96 ? 229  PHE A CA  1 
ATOM   1830 C C   . PHE A 1 235 ? 58.270 69.261 5.425   1.00   39.81 ? 229  PHE A C   1 
ATOM   1831 O O   . PHE A 1 235 ? 58.384 68.231 6.063   1.00   39.39 ? 229  PHE A O   1 
ATOM   1832 C CB  . PHE A 1 235 ? 59.504 68.303 3.445   1.00   39.45 ? 229  PHE A CB  1 
ATOM   1833 C CG  . PHE A 1 235 ? 59.460 68.059 1.972   1.00   39.48 ? 229  PHE A CG  1 
ATOM   1834 C CD1 . PHE A 1 235 ? 58.483 67.239 1.427   1.00   40.51 ? 229  PHE A CD1 1 
ATOM   1835 C CD2 . PHE A 1 235 ? 60.369 68.662 1.120   1.00   40.16 ? 229  PHE A CD2 1 
ATOM   1836 C CE1 . PHE A 1 235 ? 58.425 67.013 0.067   1.00   39.73 ? 229  PHE A CE1 1 
ATOM   1837 C CE2 . PHE A 1 235 ? 60.316 68.439 -0.243  1.00   39.84 ? 229  PHE A CE2 1 
ATOM   1838 C CZ  . PHE A 1 235 ? 59.344 67.613 -0.768  1.00   40.41 ? 229  PHE A CZ  1 
ATOM   1839 N N   . GLN A 1 236 ? 57.985 70.432 5.994   1.00   39.43 ? 230  GLN A N   1 
ATOM   1840 C CA  . GLN A 1 236 ? 57.703 70.557 7.413   1.00   39.40 ? 230  GLN A CA  1 
ATOM   1841 C C   . GLN A 1 236 ? 56.262 70.212 7.708   1.00   38.99 ? 230  GLN A C   1 
ATOM   1842 O O   . GLN A 1 236 ? 55.907 69.944 8.846   1.00   38.34 ? 230  GLN A O   1 
ATOM   1843 C CB  . GLN A 1 236 ? 57.947 71.993 7.892   1.00   39.85 ? 230  GLN A CB  1 
ATOM   1844 C CG  . GLN A 1 236 ? 59.379 72.407 7.870   1.00   41.70 ? 230  GLN A CG  1 
ATOM   1845 C CD  . GLN A 1 236 ? 59.587 73.813 8.412   1.00   43.03 ? 230  GLN A CD  1 
ATOM   1846 O OE1 . GLN A 1 236 ? 58.623 74.522 8.715   1.00   43.30 ? 230  GLN A OE1 1 
ATOM   1847 N NE2 . GLN A 1 236 ? 60.846 74.211 8.543   1.00   43.30 ? 230  GLN A NE2 1 
ATOM   1848 N N   . ASP A 1 237 ? 55.422 70.273 6.683   1.00   39.29 ? 231  ASP A N   1 
ATOM   1849 C CA  . ASP A 1 237 ? 54.007 69.998 6.849   1.00   39.72 ? 231  ASP A CA  1 
ATOM   1850 C C   . ASP A 1 237 ? 53.376 69.601 5.528   1.00   39.45 ? 231  ASP A C   1 
ATOM   1851 O O   . ASP A 1 237 ? 53.918 69.876 4.474   1.00   39.43 ? 231  ASP A O   1 
ATOM   1852 C CB  . ASP A 1 237 ? 53.307 71.241 7.418   1.00   40.31 ? 231  ASP A CB  1 
ATOM   1853 C CG  . ASP A 1 237 ? 52.059 70.916 8.197   1.00   41.72 ? 231  ASP A CG  1 
ATOM   1854 O OD1 . ASP A 1 237 ? 51.766 69.728 8.479   1.00   43.88 ? 231  ASP A OD1 1 
ATOM   1855 O OD2 . ASP A 1 237 ? 51.273 71.808 8.568   1.00   45.98 ? 231  ASP A OD2 1 
ATOM   1856 N N   . LEU A 1 238 ? 52.238 68.924 5.593   1.00   40.01 ? 232  LEU A N   1 
ATOM   1857 C CA  . LEU A 1 238 ? 51.425 68.702 4.407   1.00   40.62 ? 232  LEU A CA  1 
ATOM   1858 C C   . LEU A 1 238 ? 50.742 70.034 4.025   1.00   41.52 ? 232  LEU A C   1 
ATOM   1859 O O   . LEU A 1 238 ? 50.418 70.839 4.897   1.00   40.99 ? 232  LEU A O   1 
ATOM   1860 C CB  . LEU A 1 238 ? 50.354 67.650 4.685   1.00   40.67 ? 232  LEU A CB  1 
ATOM   1861 C CG  . LEU A 1 238 ? 50.780 66.233 5.110   1.00   39.94 ? 232  LEU A CG  1 
ATOM   1862 C CD1 . LEU A 1 238 ? 49.544 65.403 5.275   1.00   39.98 ? 232  LEU A CD1 1 
ATOM   1863 C CD2 . LEU A 1 238 ? 51.724 65.613 4.103   1.00   39.73 ? 232  LEU A CD2 1 
ATOM   1864 N N   . ASP A 1 239 ? 50.514 70.252 2.739   1.00   42.46 ? 233  ASP A N   1 
ATOM   1865 C CA  . ASP A 1 239 ? 49.725 71.409 2.296   1.00   43.63 ? 233  ASP A CA  1 
ATOM   1866 C C   . ASP A 1 239 ? 48.216 71.129 2.417   1.00   44.13 ? 233  ASP A C   1 
ATOM   1867 O O   . ASP A 1 239 ? 47.799 69.999 2.732   1.00   43.74 ? 233  ASP A O   1 
ATOM   1868 C CB  . ASP A 1 239 ? 50.105 71.801 0.871   1.00   43.95 ? 233  ASP A CB  1 
ATOM   1869 C CG  . ASP A 1 239 ? 49.827 70.705 -0.126  1.00   45.25 ? 233  ASP A CG  1 
ATOM   1870 O OD1 . ASP A 1 239 ? 48.781 70.047 0.009   1.00   48.39 ? 233  ASP A OD1 1 
ATOM   1871 O OD2 . ASP A 1 239 ? 50.579 70.424 -1.072  1.00   49.11 ? 233  ASP A OD2 1 
ATOM   1872 N N   . ALA A 1 240 ? 47.393 72.151 2.170   1.00   43.64 ? 234  ALA A N   1 
ATOM   1873 C CA  . ALA A 1 240 ? 45.944 72.033 2.366   1.00   43.81 ? 234  ALA A CA  1 
ATOM   1874 C C   . ALA A 1 240 ? 45.301 70.942 1.502   1.00   43.38 ? 234  ALA A C   1 
ATOM   1875 O O   . ALA A 1 240 ? 44.362 70.292 1.936   1.00   43.05 ? 234  ALA A O   1 
ATOM   1876 C CB  . ALA A 1 240 ? 45.247 73.391 2.107   1.00   43.83 ? 234  ALA A CB  1 
ATOM   1877 N N   . PHE A 1 241 ? 45.790 70.766 0.282   1.00   43.81 ? 235  PHE A N   1 
ATOM   1878 C CA  . PHE A 1 241 ? 45.241 69.755 -0.621  1.00   44.70 ? 235  PHE A CA  1 
ATOM   1879 C C   . PHE A 1 241 ? 45.441 68.344 -0.041  1.00   44.15 ? 235  PHE A C   1 
ATOM   1880 O O   . PHE A 1 241 ? 44.519 67.522 -0.011  1.00   43.82 ? 235  PHE A O   1 
ATOM   1881 C CB  . PHE A 1 241 ? 45.929 69.860 -1.976  1.00   45.26 ? 235  PHE A CB  1 
ATOM   1882 C CG  . PHE A 1 241 ? 45.530 68.786 -2.953  1.00   48.92 ? 235  PHE A CG  1 
ATOM   1883 C CD1 . PHE A 1 241 ? 44.180 68.526 -3.225  1.00   51.78 ? 235  PHE A CD1 1 
ATOM   1884 C CD2 . PHE A 1 241 ? 46.505 68.034 -3.614  1.00   50.52 ? 235  PHE A CD2 1 
ATOM   1885 C CE1 . PHE A 1 241 ? 43.811 67.525 -4.140  1.00   52.67 ? 235  PHE A CE1 1 
ATOM   1886 C CE2 . PHE A 1 241 ? 46.143 67.039 -4.533  1.00   51.68 ? 235  PHE A CE2 1 
ATOM   1887 C CZ  . PHE A 1 241 ? 44.799 66.788 -4.799  1.00   52.43 ? 235  PHE A CZ  1 
ATOM   1888 N N   . GLN A 1 242 ? 46.655 68.102 0.435   1.00   43.42 ? 236  GLN A N   1 
ATOM   1889 C CA  . GLN A 1 242 ? 47.032 66.828 1.043   1.00   42.45 ? 236  GLN A CA  1 
ATOM   1890 C C   . GLN A 1 242 ? 46.253 66.552 2.326   1.00   42.24 ? 236  GLN A C   1 
ATOM   1891 O O   . GLN A 1 242 ? 45.885 65.406 2.594   1.00   41.70 ? 236  GLN A O   1 
ATOM   1892 C CB  . GLN A 1 242 ? 48.544 66.800 1.313   1.00   42.20 ? 236  GLN A CB  1 
ATOM   1893 C CG  . GLN A 1 242 ? 49.383 66.758 0.049   1.00   41.26 ? 236  GLN A CG  1 
ATOM   1894 C CD  . GLN A 1 242 ? 50.883 66.825 0.305   1.00   43.29 ? 236  GLN A CD  1 
ATOM   1895 O OE1 . GLN A 1 242 ? 51.654 66.106 -0.332  1.00   45.35 ? 236  GLN A OE1 1 
ATOM   1896 N NE2 . GLN A 1 242 ? 51.299 67.675 1.228   1.00   39.87 ? 236  GLN A NE2 1 
ATOM   1897 N N   . TYR A 1 243 ? 45.982 67.590 3.118   1.00   41.50 ? 237  TYR A N   1 
ATOM   1898 C CA  . TYR A 1 243 ? 45.181 67.434 4.335   1.00   41.18 ? 237  TYR A CA  1 
ATOM   1899 C C   . TYR A 1 243 ? 43.700 67.123 4.065   1.00   40.98 ? 237  TYR A C   1 
ATOM   1900 O O   . TYR A 1 243 ? 43.030 66.509 4.898   1.00   40.24 ? 237  TYR A O   1 
ATOM   1901 C CB  . TYR A 1 243 ? 45.283 68.687 5.199   1.00   41.42 ? 237  TYR A CB  1 
ATOM   1902 C CG  . TYR A 1 243 ? 46.442 68.682 6.155   1.00   42.55 ? 237  TYR A CG  1 
ATOM   1903 C CD1 . TYR A 1 243 ? 46.559 67.685 7.113   1.00   42.62 ? 237  TYR A CD1 1 
ATOM   1904 C CD2 . TYR A 1 243 ? 47.425 69.678 6.112   1.00   43.01 ? 237  TYR A CD2 1 
ATOM   1905 C CE1 . TYR A 1 243 ? 47.601 67.669 8.002   1.00   43.33 ? 237  TYR A CE1 1 
ATOM   1906 C CE2 . TYR A 1 243 ? 48.484 69.665 7.016   1.00   43.34 ? 237  TYR A CE2 1 
ATOM   1907 C CZ  . TYR A 1 243 ? 48.554 68.655 7.955   1.00   42.58 ? 237  TYR A CZ  1 
ATOM   1908 O OH  . TYR A 1 243 ? 49.577 68.595 8.853   1.00   44.58 ? 237  TYR A OH  1 
ATOM   1909 N N   . ARG A 1 244 ? 43.205 67.559 2.912   1.00   41.21 ? 238  ARG A N   1 
ATOM   1910 C CA  . ARG A 1 244 ? 41.821 67.313 2.523   1.00   41.57 ? 238  ARG A CA  1 
ATOM   1911 C C   . ARG A 1 244 ? 41.691 65.842 2.108   1.00   40.79 ? 238  ARG A C   1 
ATOM   1912 O O   . ARG A 1 244 ? 40.742 65.183 2.479   1.00   40.07 ? 238  ARG A O   1 
ATOM   1913 C CB  . ARG A 1 244 ? 41.392 68.236 1.371   1.00   41.96 ? 238  ARG A CB  1 
ATOM   1914 C CG  . ARG A 1 244 ? 41.062 69.667 1.809   1.00   44.24 ? 238  ARG A CG  1 
ATOM   1915 C CD  . ARG A 1 244 ? 40.358 70.546 0.749   1.00   46.43 ? 238  ARG A CD  1 
ATOM   1916 N NE  . ARG A 1 244 ? 41.129 70.735 -0.485  1.00   48.84 ? 238  ARG A NE  1 
ATOM   1917 C CZ  . ARG A 1 244 ? 42.055 71.681 -0.699  1.00   51.47 ? 238  ARG A CZ  1 
ATOM   1918 N NH1 . ARG A 1 244 ? 42.385 72.566 0.250   1.00   52.13 ? 238  ARG A NH1 1 
ATOM   1919 N NH2 . ARG A 1 244 ? 42.679 71.729 -1.880  1.00   51.94 ? 238  ARG A NH2 1 
ATOM   1920 N N   . ARG A 1 245 ? 42.666 65.359 1.340   1.00   40.58 ? 239  ARG A N   1 
ATOM   1921 C CA  . ARG A 1 245 ? 42.744 63.937 0.967   1.00   40.22 ? 239  ARG A CA  1 
ATOM   1922 C C   . ARG A 1 245 ? 42.844 63.078 2.206   1.00   38.85 ? 239  ARG A C   1 
ATOM   1923 O O   . ARG A 1 245 ? 42.129 62.085 2.315   1.00   39.55 ? 239  ARG A O   1 
ATOM   1924 C CB  . ARG A 1 245 ? 43.915 63.685 0.033   1.00   40.69 ? 239  ARG A CB  1 
ATOM   1925 C CG  . ARG A 1 245 ? 43.866 64.520 -1.223  1.00   43.67 ? 239  ARG A CG  1 
ATOM   1926 C CD  . ARG A 1 245 ? 44.043 63.758 -2.509  1.00   46.89 ? 239  ARG A CD  1 
ATOM   1927 N NE  . ARG A 1 245 ? 45.389 63.924 -3.041  1.00   50.08 ? 239  ARG A NE  1 
ATOM   1928 C CZ  . ARG A 1 245 ? 45.780 63.498 -4.236  1.00   53.07 ? 239  ARG A CZ  1 
ATOM   1929 N NH1 . ARG A 1 245 ? 44.930 62.878 -5.045  1.00   54.65 ? 239  ARG A NH1 1 
ATOM   1930 N NH2 . ARG A 1 245 ? 47.033 63.689 -4.626  1.00   54.68 ? 239  ARG A NH2 1 
ATOM   1931 N N   . LEU A 1 246 ? 43.673 63.488 3.170   1.00   37.33 ? 240  LEU A N   1 
ATOM   1932 C CA  . LEU A 1 246 ? 43.799 62.785 4.443   1.00   36.38 ? 240  LEU A CA  1 
ATOM   1933 C C   . LEU A 1 246 ? 42.473 62.748 5.203   1.00   36.34 ? 240  LEU A C   1 
ATOM   1934 O O   . LEU A 1 246 ? 42.099 61.732 5.765   1.00   34.65 ? 240  LEU A O   1 
ATOM   1935 C CB  . LEU A 1 246 ? 44.889 63.426 5.310   1.00   36.20 ? 240  LEU A CB  1 
ATOM   1936 C CG  . LEU A 1 246 ? 45.105 62.885 6.727   1.00   36.46 ? 240  LEU A CG  1 
ATOM   1937 C CD1 . LEU A 1 246 ? 45.451 61.397 6.714   1.00   37.27 ? 240  LEU A CD1 1 
ATOM   1938 C CD2 . LEU A 1 246 ? 46.182 63.667 7.458   1.00   35.20 ? 240  LEU A CD2 1 
ATOM   1939 N N   . SER A 1 247 ? 41.745 63.868 5.229   1.00   36.38 ? 241  SER A N   1 
ATOM   1940 C CA  . SER A 1 247 ? 40.501 63.908 5.991   1.00   36.20 ? 241  SER A CA  1 
ATOM   1941 C C   . SER A 1 247 ? 39.456 62.979 5.381   1.00   35.20 ? 241  SER A C   1 
ATOM   1942 O O   . SER A 1 247 ? 38.659 62.382 6.079   1.00   35.37 ? 241  SER A O   1 
ATOM   1943 C CB  . SER A 1 247 ? 39.941 65.343 6.081   1.00   36.72 ? 241  SER A CB  1 
ATOM   1944 O OG  . SER A 1 247 ? 38.949 65.349 7.099   1.00   38.24 ? 241  SER A OG  1 
ATOM   1945 N N   . TRP A 1 248 ? 39.488 62.853 4.077   1.00   34.84 ? 242  TRP A N   1 
ATOM   1946 C CA  . TRP A 1 248 ? 38.593 61.957 3.389   1.00   36.04 ? 242  TRP A CA  1 
ATOM   1947 C C   . TRP A 1 248 ? 38.883 60.494 3.792   1.00   34.94 ? 242  TRP A C   1 
ATOM   1948 O O   . TRP A 1 248 ? 37.951 59.737 4.032   1.00   34.40 ? 242  TRP A O   1 
ATOM   1949 C CB  . TRP A 1 248 ? 38.742 62.153 1.890   1.00   36.43 ? 242  TRP A CB  1 
ATOM   1950 C CG  . TRP A 1 248 ? 37.632 61.518 1.129   1.00   42.46 ? 242  TRP A CG  1 
ATOM   1951 C CD1 . TRP A 1 248 ? 37.720 60.432 0.306   1.00   44.46 ? 242  TRP A CD1 1 
ATOM   1952 C CD2 . TRP A 1 248 ? 36.247 61.909 1.130   1.00   47.74 ? 242  TRP A CD2 1 
ATOM   1953 N NE1 . TRP A 1 248 ? 36.482 60.125 -0.210  1.00   46.98 ? 242  TRP A NE1 1 
ATOM   1954 C CE2 . TRP A 1 248 ? 35.560 61.019 0.269   1.00   48.57 ? 242  TRP A CE2 1 
ATOM   1955 C CE3 . TRP A 1 248 ? 35.512 62.924 1.772   1.00   50.17 ? 242  TRP A CE3 1 
ATOM   1956 C CZ2 . TRP A 1 248 ? 34.177 61.106 0.035   1.00   50.75 ? 242  TRP A CZ2 1 
ATOM   1957 C CZ3 . TRP A 1 248 ? 34.134 63.018 1.533   1.00   51.01 ? 242  TRP A CZ3 1 
ATOM   1958 C CH2 . TRP A 1 248 ? 33.485 62.110 0.673   1.00   52.02 ? 242  TRP A CH2 1 
ATOM   1959 N N   . VAL A 1 249 ? 40.165 60.131 3.851   1.00   33.83 ? 243  VAL A N   1 
ATOM   1960 C CA  . VAL A 1 249 ? 40.545 58.793 4.299   1.00   32.38 ? 243  VAL A CA  1 
ATOM   1961 C C   . VAL A 1 249 ? 40.029 58.552 5.708   1.00   32.50 ? 243  VAL A C   1 
ATOM   1962 O O   . VAL A 1 249 ? 39.452 57.504 6.014   1.00   31.33 ? 243  VAL A O   1 
ATOM   1963 C CB  . VAL A 1 249 ? 42.097 58.614 4.236   1.00   31.69 ? 243  VAL A CB  1 
ATOM   1964 C CG1 . VAL A 1 249 ? 42.499 57.298 4.835   1.00   30.18 ? 243  VAL A CG1 1 
ATOM   1965 C CG2 . VAL A 1 249 ? 42.584 58.738 2.820   1.00   30.96 ? 243  VAL A CG2 1 
ATOM   1966 N N   . ARG A 1 250 ? 40.209 59.558 6.567   1.00   33.11 ? 244  ARG A N   1 
ATOM   1967 C CA  . ARG A 1 250 ? 39.736 59.510 7.924   1.00   34.47 ? 244  ARG A CA  1 
ATOM   1968 C C   . ARG A 1 250 ? 38.209 59.346 7.997   1.00   35.19 ? 244  ARG A C   1 
ATOM   1969 O O   . ARG A 1 250 ? 37.707 58.589 8.796   1.00   35.63 ? 244  ARG A O   1 
ATOM   1970 C CB  . ARG A 1 250 ? 40.158 60.785 8.683   1.00   34.84 ? 244  ARG A CB  1 
ATOM   1971 C CG  . ARG A 1 250 ? 41.649 60.952 8.982   1.00   35.89 ? 244  ARG A CG  1 
ATOM   1972 C CD  . ARG A 1 250 ? 42.107 60.223 10.236  1.00   36.31 ? 244  ARG A CD  1 
ATOM   1973 N NE  . ARG A 1 250 ? 42.173 58.803 9.918   1.00   37.11 ? 244  ARG A NE  1 
ATOM   1974 C CZ  . ARG A 1 250 ? 43.214 58.201 9.318   1.00   36.47 ? 244  ARG A CZ  1 
ATOM   1975 N NH1 . ARG A 1 250 ? 44.349 58.856 9.059   1.00   34.12 ? 244  ARG A NH1 1 
ATOM   1976 N NH2 . ARG A 1 250 ? 43.113 56.914 9.011   1.00   33.24 ? 244  ARG A NH2 1 
ATOM   1977 N N   . GLN A 1 251 ? 37.476 60.040 7.144   1.00   37.12 ? 245  GLN A N   1 
ATOM   1978 C CA  . GLN A 1 251 ? 36.012 60.072 7.273   1.00   38.32 ? 245  GLN A CA  1 
ATOM   1979 C C   . GLN A 1 251 ? 35.332 58.882 6.603   1.00   37.97 ? 245  GLN A C   1 
ATOM   1980 O O   . GLN A 1 251 ? 34.341 58.382 7.130   1.00   38.44 ? 245  GLN A O   1 
ATOM   1981 C CB  . GLN A 1 251 ? 35.455 61.389 6.712   1.00   39.31 ? 245  GLN A CB  1 
ATOM   1982 C CG  . GLN A 1 251 ? 35.814 62.623 7.561   1.00   42.12 ? 245  GLN A CG  1 
ATOM   1983 C CD  . GLN A 1 251 ? 35.637 62.388 9.051   1.00   46.09 ? 245  GLN A CD  1 
ATOM   1984 O OE1 . GLN A 1 251 ? 36.526 62.701 9.852   1.00   50.26 ? 245  GLN A OE1 1 
ATOM   1985 N NE2 . GLN A 1 251 ? 34.499 61.821 9.428   1.00   50.13 ? 245  GLN A NE2 1 
ATOM   1986 N N   . LYS A 1 252 ? 35.892 58.409 5.481   1.00   36.67 ? 246  LYS A N   1 
ATOM   1987 C CA  . LYS A 1 252 ? 35.213 57.420 4.626   1.00   36.01 ? 246  LYS A CA  1 
ATOM   1988 C C   . LYS A 1 252 ? 35.862 56.008 4.600   1.00   34.38 ? 246  LYS A C   1 
ATOM   1989 O O   . LYS A 1 252 ? 35.164 55.025 4.366   1.00   33.73 ? 246  LYS A O   1 
ATOM   1990 C CB  . LYS A 1 252 ? 35.124 57.946 3.201   1.00   36.10 ? 246  LYS A CB  1 
ATOM   1991 C CG  . LYS A 1 252 ? 34.230 59.225 3.030   0.0000 40.72 ? 246  LYS A CG  1 
ATOM   1992 C CD  . LYS A 1 252 ? 32.702 58.938 3.166   0.0000 44.90 ? 246  LYS A CD  1 
ATOM   1993 C CE  . LYS A 1 252 ? 31.863 60.261 3.262   0.0000 47.93 ? 246  LYS A CE  1 
ATOM   1994 N NZ  . LYS A 1 252 ? 30.421 60.101 2.845   0.0000 49.02 ? 246  LYS A NZ  1 
ATOM   1995 N N   . TYR A 1 253 ? 37.173 55.924 4.824   1.00   31.91 ? 247  TYR A N   1 
ATOM   1996 C CA  . TYR A 1 253 ? 37.913 54.668 4.596   1.00   30.49 ? 247  TYR A CA  1 
ATOM   1997 C C   . TYR A 1 253 ? 38.496 54.048 5.860   1.00   29.71 ? 247  TYR A C   1 
ATOM   1998 O O   . TYR A 1 253 ? 39.047 52.953 5.815   1.00   27.55 ? 247  TYR A O   1 
ATOM   1999 C CB  . TYR A 1 253 ? 38.999 54.910 3.556   1.00   30.24 ? 247  TYR A CB  1 
ATOM   2000 C CG  . TYR A 1 253 ? 38.425 54.996 2.190   1.00   30.05 ? 247  TYR A CG  1 
ATOM   2001 C CD1 . TYR A 1 253 ? 38.109 53.845 1.462   1.00   28.64 ? 247  TYR A CD1 1 
ATOM   2002 C CD2 . TYR A 1 253 ? 38.126 56.231 1.625   1.00   28.54 ? 247  TYR A CD2 1 
ATOM   2003 C CE1 . TYR A 1 253 ? 37.535 53.945 0.199   1.00   29.31 ? 247  TYR A CE1 1 
ATOM   2004 C CE2 . TYR A 1 253 ? 37.565 56.336 0.373   1.00   29.44 ? 247  TYR A CE2 1 
ATOM   2005 C CZ  . TYR A 1 253 ? 37.246 55.220 -0.324  1.00   30.74 ? 247  TYR A CZ  1 
ATOM   2006 O OH  . TYR A 1 253 ? 36.689 55.373 -1.570  1.00   30.58 ? 247  TYR A OH  1 
ATOM   2007 N N   . THR A 1 254 ? 38.332 54.714 7.005   1.00   28.86 ? 248  THR A N   1 
ATOM   2008 C CA  . THR A 1 254 ? 38.929 54.250 8.248   1.00   28.58 ? 248  THR A CA  1 
ATOM   2009 C C   . THR A 1 254 ? 37.981 53.425 9.075   1.00   29.96 ? 248  THR A C   1 
ATOM   2010 O O   . THR A 1 254 ? 36.906 53.892 9.459   1.00   29.94 ? 248  THR A O   1 
ATOM   2011 C CB  . THR A 1 254 ? 39.428 55.437 9.070   1.00   28.25 ? 248  THR A CB  1 
ATOM   2012 O OG1 . THR A 1 254 ? 40.349 56.188 8.292   1.00   27.92 ? 248  THR A OG1 1 
ATOM   2013 C CG2 . THR A 1 254 ? 40.196 54.990 10.241  1.00   27.25 ? 248  THR A CG2 1 
ATOM   2014 N N   . ILE A 1 255 ? 38.374 52.193 9.370   1.00   29.18 ? 249  ILE A N   1 
ATOM   2015 C CA  . ILE A 1 255 ? 37.549 51.314 10.165  1.00   30.31 ? 249  ILE A CA  1 
ATOM   2016 C C   . ILE A 1 255 ? 38.044 51.166 11.589  1.00   30.42 ? 249  ILE A C   1 
ATOM   2017 O O   . ILE A 1 255 ? 37.317 50.671 12.439  1.00   30.76 ? 249  ILE A O   1 
ATOM   2018 C CB  . ILE A 1 255 ? 37.389 49.947 9.480   1.00   30.99 ? 249  ILE A CB  1 
ATOM   2019 C CG1 . ILE A 1 255 ? 38.745 49.255 9.293   1.00   32.49 ? 249  ILE A CG1 1 
ATOM   2020 C CG2 . ILE A 1 255 ? 36.680 50.114 8.125   1.00   31.43 ? 249  ILE A CG2 1 
ATOM   2021 C CD1 . ILE A 1 255 ? 38.659 47.803 9.456   1.00   34.99 ? 249  ILE A CD1 1 
ATOM   2022 N N   . TYR A 1 256 ? 39.291 51.568 11.846  1.00   30.06 ? 250  TYR A N   1 
ATOM   2023 C CA  . TYR A 1 256 ? 39.851 51.544 13.193  1.00   30.12 ? 250  TYR A CA  1 
ATOM   2024 C C   . TYR A 1 256 ? 40.902 52.631 13.313  1.00   30.92 ? 250  TYR A C   1 
ATOM   2025 O O   . TYR A 1 256 ? 41.719 52.842 12.423  1.00   28.53 ? 250  TYR A O   1 
ATOM   2026 C CB  . TYR A 1 256 ? 40.444 50.187 13.618  1.00   29.72 ? 250  TYR A CB  1 
ATOM   2027 C CG  . TYR A 1 256 ? 41.003 50.280 15.025  1.00   31.33 ? 250  TYR A CG  1 
ATOM   2028 C CD1 . TYR A 1 256 ? 40.160 50.173 16.127  1.00   31.72 ? 250  TYR A CD1 1 
ATOM   2029 C CD2 . TYR A 1 256 ? 42.355 50.581 15.260  1.00   28.97 ? 250  TYR A CD2 1 
ATOM   2030 C CE1 . TYR A 1 256 ? 40.648 50.302 17.427  1.00   32.67 ? 250  TYR A CE1 1 
ATOM   2031 C CE2 . TYR A 1 256 ? 42.840 50.713 16.550  1.00   29.86 ? 250  TYR A CE2 1 
ATOM   2032 C CZ  . TYR A 1 256 ? 41.978 50.584 17.629  1.00   31.83 ? 250  TYR A CZ  1 
ATOM   2033 O OH  . TYR A 1 256 ? 42.460 50.719 18.905  1.00   31.12 ? 250  TYR A OH  1 
ATOM   2034 N N   . ASN A 1 257 ? 40.882 53.333 14.442  1.00   32.03 ? 251  ASN A N   1 
ATOM   2035 C CA  . ASN A 1 257 ? 41.792 54.455 14.637  1.00   33.04 ? 251  ASN A CA  1 
ATOM   2036 C C   . ASN A 1 257 ? 42.095 54.554 16.120  1.00   34.33 ? 251  ASN A C   1 
ATOM   2037 O O   . ASN A 1 257 ? 41.194 54.850 16.938  1.00   33.68 ? 251  ASN A O   1 
ATOM   2038 C CB  . ASN A 1 257 ? 41.173 55.718 14.070  1.00   34.09 ? 251  ASN A CB  1 
ATOM   2039 C CG  . ASN A 1 257 ? 42.026 56.951 14.273  1.00   35.52 ? 251  ASN A CG  1 
ATOM   2040 O OD1 . ASN A 1 257 ? 43.201 56.879 14.663  1.00   35.36 ? 251  ASN A OD1 1 
ATOM   2041 N ND2 . ASN A 1 257 ? 41.416 58.115 14.032  1.00   37.89 ? 251  ASN A ND2 1 
ATOM   2042 N N   . TYR A 1 258 ? 43.344 54.252 16.481  1.00   33.55 ? 252  TYR A N   1 
ATOM   2043 C CA  . TYR A 1 258 ? 43.720 54.211 17.885  1.00   34.61 ? 252  TYR A CA  1 
ATOM   2044 C C   . TYR A 1 258 ? 43.343 55.527 18.557  1.00   35.52 ? 252  TYR A C   1 
ATOM   2045 O O   . TYR A 1 258 ? 43.020 55.531 19.718  1.00   36.12 ? 252  TYR A O   1 
ATOM   2046 C CB  . TYR A 1 258 ? 45.217 53.898 18.106  1.00   33.98 ? 252  TYR A CB  1 
ATOM   2047 C CG  . TYR A 1 258 ? 46.158 55.052 17.843  1.00   33.92 ? 252  TYR A CG  1 
ATOM   2048 C CD1 . TYR A 1 258 ? 46.409 55.493 16.553  1.00   31.36 ? 252  TYR A CD1 1 
ATOM   2049 C CD2 . TYR A 1 258 ? 46.843 55.685 18.897  1.00   33.23 ? 252  TYR A CD2 1 
ATOM   2050 C CE1 . TYR A 1 258 ? 47.294 56.545 16.311  1.00   31.64 ? 252  TYR A CE1 1 
ATOM   2051 C CE2 . TYR A 1 258 ? 47.715 56.740 18.659  1.00   33.39 ? 252  TYR A CE2 1 
ATOM   2052 C CZ  . TYR A 1 258 ? 47.938 57.163 17.370  1.00   32.71 ? 252  TYR A CZ  1 
ATOM   2053 O OH  . TYR A 1 258 ? 48.809 58.201 17.121  1.00   33.63 ? 252  TYR A OH  1 
ATOM   2054 N N   . CYS A 1 259 ? 43.399 56.625 17.814  1.00   37.56 ? 253  CYS A N   1 
ATOM   2055 C CA  . CYS A 1 259 ? 43.162 57.960 18.361  1.00   39.52 ? 253  CYS A CA  1 
ATOM   2056 C C   . CYS A 1 259 ? 41.770 58.160 18.927  1.00   39.87 ? 253  CYS A C   1 
ATOM   2057 O O   . CYS A 1 259 ? 41.600 58.874 19.921  1.00   39.45 ? 253  CYS A O   1 
ATOM   2058 C CB  . CYS A 1 259 ? 43.413 59.014 17.297  1.00   40.19 ? 253  CYS A CB  1 
ATOM   2059 S SG  . CYS A 1 259 ? 45.179 59.367 17.126  1.00   46.12 ? 253  CYS A SG  1 
ATOM   2060 N N   . THR A 1 260 ? 40.782 57.543 18.298  1.00   39.93 ? 254  THR A N   1 
ATOM   2061 C CA  . THR A 1 260 ? 39.395 57.723 18.707  1.00   40.71 ? 254  THR A CA  1 
ATOM   2062 C C   . THR A 1 260 ? 38.888 56.498 19.433  1.00   40.93 ? 254  THR A C   1 
ATOM   2063 O O   . THR A 1 260 ? 37.700 56.371 19.637  1.00   41.94 ? 254  THR A O   1 
ATOM   2064 C CB  . THR A 1 260 ? 38.507 58.012 17.492  1.00   40.16 ? 254  THR A CB  1 
ATOM   2065 O OG1 . THR A 1 260 ? 38.618 56.944 16.544  1.00   40.40 ? 254  THR A OG1 1 
ATOM   2066 C CG2 . THR A 1 260 ? 38.980 59.225 16.733  1.00   40.98 ? 254  THR A CG2 1 
ATOM   2067 N N   . ASP A 1 261 ? 39.783 55.593 19.816  1.00   41.42 ? 255  ASP A N   1 
ATOM   2068 C CA  . ASP A 1 261 ? 39.407 54.382 20.537  1.00   41.79 ? 255  ASP A CA  1 
ATOM   2069 C C   . ASP A 1 261 ? 39.458 54.680 22.043  1.00   42.86 ? 255  ASP A C   1 
ATOM   2070 O O   . ASP A 1 261 ? 40.508 54.599 22.676  1.00   42.37 ? 255  ASP A O   1 
ATOM   2071 C CB  . ASP A 1 261 ? 40.355 53.241 20.173  1.00   41.67 ? 255  ASP A CB  1 
ATOM   2072 C CG  . ASP A 1 261 ? 40.016 51.932 20.870  1.00   41.93 ? 255  ASP A CG  1 
ATOM   2073 O OD1 . ASP A 1 261 ? 39.083 51.884 21.718  1.00   43.34 ? 255  ASP A OD1 1 
ATOM   2074 O OD2 . ASP A 1 261 ? 40.637 50.878 20.631  1.00   36.83 ? 255  ASP A OD2 1 
ATOM   2075 N N   . ARG A 1 262 ? 38.305 55.030 22.606  1.00   44.22 ? 256  ARG A N   1 
ATOM   2076 C CA  . ARG A 1 262 ? 38.223 55.478 24.006  1.00   45.14 ? 256  ARG A CA  1 
ATOM   2077 C C   . ARG A 1 262 ? 38.274 54.334 25.016  1.00   46.25 ? 256  ARG A C   1 
ATOM   2078 O O   . ARG A 1 262 ? 38.536 54.553 26.204  1.00   47.02 ? 256  ARG A O   1 
ATOM   2079 C CB  . ARG A 1 262 ? 36.964 56.323 24.195  1.00   44.88 ? 256  ARG A CB  1 
ATOM   2080 C CG  . ARG A 1 262 ? 37.014 57.630 23.417  1.00   44.67 ? 256  ARG A CG  1 
ATOM   2081 C CD  . ARG A 1 262 ? 37.880 58.686 24.069  1.00   44.85 ? 256  ARG A CD  1 
ATOM   2082 N NE  . ARG A 1 262 ? 38.330 59.684 23.108  1.00   45.94 ? 256  ARG A NE  1 
ATOM   2083 C CZ  . ARG A 1 262 ? 39.461 59.606 22.392  1.00   47.71 ? 256  ARG A CZ  1 
ATOM   2084 N NH1 . ARG A 1 262 ? 40.286 58.568 22.516  1.00   46.92 ? 256  ARG A NH1 1 
ATOM   2085 N NH2 . ARG A 1 262 ? 39.755 60.589 21.537  1.00   47.78 ? 256  ARG A NH2 1 
ATOM   2086 N N   . SER A 1 263 ? 38.047 53.114 24.537  1.00   47.24 ? 257  SER A N   1 
ATOM   2087 C CA  . SER A 1 263 ? 38.182 51.917 25.353  1.00   48.22 ? 257  SER A CA  1 
ATOM   2088 C C   . SER A 1 263 ? 39.640 51.622 25.717  1.00   48.73 ? 257  SER A C   1 
ATOM   2089 O O   . SER A 1 263 ? 39.930 51.174 26.828  1.00   48.68 ? 257  SER A O   1 
ATOM   2090 C CB  . SER A 1 263 ? 37.570 50.728 24.599  1.00   48.62 ? 257  SER A CB  1 
ATOM   2091 O OG  . SER A 1 263 ? 37.570 49.550 25.386  1.00   50.54 ? 257  SER A OG  1 
ATOM   2092 N N   . ARG A 1 264 ? 40.549 51.865 24.771  1.00   49.60 ? 258  ARG A N   1 
ATOM   2093 C CA  . ARG A 1 264 ? 41.993 51.624 24.956  1.00   49.89 ? 258  ARG A CA  1 
ATOM   2094 C C   . ARG A 1 264 ? 42.681 52.904 25.417  1.00   49.88 ? 258  ARG A C   1 
ATOM   2095 O O   . ARG A 1 264 ? 43.600 52.880 26.220  1.00   50.22 ? 258  ARG A O   1 
ATOM   2096 C CB  . ARG A 1 264 ? 42.640 51.120 23.637  1.00   50.09 ? 258  ARG A CB  1 
ATOM   2097 C CG  . ARG A 1 264 ? 43.183 49.676 23.690  1.00   50.54 ? 258  ARG A CG  1 
ATOM   2098 C CD  . ARG A 1 264 ? 44.507 49.418 22.917  1.00   52.11 ? 258  ARG A CD  1 
ATOM   2099 N NE  . ARG A 1 264 ? 44.446 49.843 21.521  1.00   50.93 ? 258  ARG A NE  1 
ATOM   2100 C CZ  . ARG A 1 264 ? 45.327 49.510 20.555  1.00   50.19 ? 258  ARG A CZ  1 
ATOM   2101 N NH1 . ARG A 1 264 ? 46.388 48.739 20.784  1.00   50.02 ? 258  ARG A NH1 1 
ATOM   2102 N NH2 . ARG A 1 264 ? 45.129 49.965 19.331  1.00   47.61 ? 258  ARG A NH2 1 
ATOM   2103 N N   . TYR A 1 265 ? 42.225 54.027 24.899  1.00   50.89 ? 259  TYR A N   1 
ATOM   2104 C CA  . TYR A 1 265 ? 42.761 55.328 25.273  1.00   51.86 ? 259  TYR A CA  1 
ATOM   2105 C C   . TYR A 1 265 ? 41.670 56.201 25.853  1.00   52.67 ? 259  TYR A C   1 
ATOM   2106 O O   . TYR A 1 265 ? 41.119 57.069 25.164  1.00   51.73 ? 259  TYR A O   1 
ATOM   2107 C CB  . TYR A 1 265 ? 43.406 55.998 24.057  1.00   52.04 ? 259  TYR A CB  1 
ATOM   2108 C CG  . TYR A 1 265 ? 44.653 55.262 23.634  1.00   51.82 ? 259  TYR A CG  1 
ATOM   2109 C CD1 . TYR A 1 265 ? 45.795 55.284 24.429  1.00   51.60 ? 259  TYR A CD1 1 
ATOM   2110 C CD2 . TYR A 1 265 ? 44.680 54.499 22.462  1.00   52.09 ? 259  TYR A CD2 1 
ATOM   2111 C CE1 . TYR A 1 265 ? 46.939 54.588 24.062  1.00   51.59 ? 259  TYR A CE1 1 
ATOM   2112 C CE2 . TYR A 1 265 ? 45.823 53.796 22.091  1.00   50.50 ? 259  TYR A CE2 1 
ATOM   2113 C CZ  . TYR A 1 265 ? 46.949 53.851 22.890  1.00   51.43 ? 259  TYR A CZ  1 
ATOM   2114 O OH  . TYR A 1 265 ? 48.087 53.168 22.539  1.00   48.33 ? 259  TYR A OH  1 
ATOM   2115 N N   . PRO A 1 266 ? 41.340 55.961 27.125  1.00   54.32 ? 260  PRO A N   1 
ATOM   2116 C CA  . PRO A 1 266 ? 40.480 56.902 27.847  1.00   55.05 ? 260  PRO A CA  1 
ATOM   2117 C C   . PRO A 1 266 ? 41.258 58.192 27.798  1.00   55.65 ? 260  PRO A C   1 
ATOM   2118 O O   . PRO A 1 266 ? 40.824 59.196 27.213  1.00   55.40 ? 260  PRO A O   1 
ATOM   2119 C CB  . PRO A 1 266 ? 40.395 56.320 29.268  1.00   55.22 ? 260  PRO A CB  1 
ATOM   2120 C CG  . PRO A 1 266 ? 40.899 54.909 29.190  1.00   55.19 ? 260  PRO A CG  1 
ATOM   2121 C CD  . PRO A 1 266 ? 41.766 54.821 27.962  1.00   54.40 ? 260  PRO A CD  1 
ATOM   2122 N N   . SER A 1 267 ? 42.475 58.105 28.333  1.00   55.94 ? 261  SER A N   1 
ATOM   2123 C CA  . SER A 1 267 ? 43.478 59.129 28.135  1.00   55.96 ? 261  SER A CA  1 
ATOM   2124 C C   . SER A 1 267 ? 43.934 59.031 26.668  1.00   55.72 ? 261  SER A C   1 
ATOM   2125 O O   . SER A 1 267 ? 44.686 58.122 26.308  1.00   55.81 ? 261  SER A O   1 
ATOM   2126 C CB  . SER A 1 267 ? 44.639 58.927 29.116  1.00   55.98 ? 261  SER A CB  1 
ATOM   2127 O OG  . SER A 1 267 ? 45.291 60.152 29.365  1.00   56.59 ? 261  SER A OG  1 
ATOM   2128 N N   . MET A 1 268 ? 43.425 59.954 25.842  1.00   54.88 ? 262  MET A N   1 
ATOM   2129 C CA  . MET A 1 268 ? 43.742 60.053 24.428  1.00   54.07 ? 262  MET A CA  1 
ATOM   2130 C C   . MET A 1 268 ? 45.212 60.519 24.161  1.00   53.05 ? 262  MET A C   1 
ATOM   2131 O O   . MET A 1 268 ? 45.684 61.454 24.810  1.00   52.97 ? 262  MET A O   1 
ATOM   2132 C CB  . MET A 1 268 ? 42.773 61.040 23.777  1.00   54.37 ? 262  MET A CB  1 
ATOM   2133 C CG  . MET A 1 268 ? 43.018 61.242 22.277  1.00   55.84 ? 262  MET A CG  1 
ATOM   2134 S SD  . MET A 1 268 ? 42.805 62.929 21.699  1.00   60.40 ? 262  MET A SD  1 
ATOM   2135 C CE  . MET A 1 268 ? 44.172 63.792 22.487  1.00   60.36 ? 262  MET A CE  1 
ATOM   2136 N N   . PRO A 1 269 ? 45.916 59.889 23.203  1.00   51.17 ? 263  PRO A N   1 
ATOM   2137 C CA  . PRO A 1 269 ? 47.304 60.274 22.861  1.00   49.23 ? 263  PRO A CA  1 
ATOM   2138 C C   . PRO A 1 269 ? 47.513 61.713 22.347  1.00   47.78 ? 263  PRO A C   1 
ATOM   2139 O O   . PRO A 1 269 ? 46.754 62.185 21.500  1.00   46.72 ? 263  PRO A O   1 
ATOM   2140 C CB  . PRO A 1 269 ? 47.684 59.265 21.761  1.00   49.57 ? 263  PRO A CB  1 
ATOM   2141 C CG  . PRO A 1 269 ? 46.782 58.097 21.984  1.00   49.94 ? 263  PRO A CG  1 
ATOM   2142 C CD  . PRO A 1 269 ? 45.472 58.730 22.397  1.00   51.10 ? 263  PRO A CD  1 
ATOM   2143 N N   . PRO A 1 270 ? 48.555 62.393 22.832  1.00   46.23 ? 264  PRO A N   1 
ATOM   2144 C CA  . PRO A 1 270 ? 48.795 63.810 22.495  1.00   45.79 ? 264  PRO A CA  1 
ATOM   2145 C C   . PRO A 1 270 ? 48.998 64.155 21.017  1.00   45.63 ? 264  PRO A C   1 
ATOM   2146 O O   . PRO A 1 270 ? 48.652 65.273 20.593  1.00   44.91 ? 264  PRO A O   1 
ATOM   2147 C CB  . PRO A 1 270 ? 50.070 64.146 23.285  1.00   45.92 ? 264  PRO A CB  1 
ATOM   2148 C CG  . PRO A 1 270 ? 50.162 63.108 24.346  1.00   45.97 ? 264  PRO A CG  1 
ATOM   2149 C CD  . PRO A 1 270 ? 49.566 61.872 23.770  1.00   46.49 ? 264  PRO A CD  1 
ATOM   2150 N N   . GLU A 1 271 ? 49.544 63.216 20.235  1.00   45.08 ? 265  GLU A N   1 
ATOM   2151 C CA  . GLU A 1 271 ? 49.827 63.469 18.815  1.00   45.10 ? 265  GLU A CA  1 
ATOM   2152 C C   . GLU A 1 271 ? 48.589 63.689 17.972  1.00   44.73 ? 265  GLU A C   1 
ATOM   2153 O O   . GLU A 1 271 ? 48.658 64.319 16.917  1.00   44.86 ? 265  GLU A O   1 
ATOM   2154 C CB  . GLU A 1 271 ? 50.572 62.292 18.154  1.00   45.31 ? 265  GLU A CB  1 
ATOM   2155 C CG  . GLU A 1 271 ? 51.423 61.449 19.070  1.00   46.42 ? 265  GLU A CG  1 
ATOM   2156 C CD  . GLU A 1 271 ? 50.678 60.310 19.741  1.00   46.66 ? 265  GLU A CD  1 
ATOM   2157 O OE1 . GLU A 1 271 ? 50.157 59.410 19.043  1.00   45.01 ? 265  GLU A OE1 1 
ATOM   2158 O OE2 . GLU A 1 271 ? 50.673 60.298 20.990  1.00   46.05 ? 265  GLU A OE2 1 
ATOM   2159 N N   . CYS A 1 272 ? 47.475 63.128 18.419  1.00   44.93 ? 266  CYS A N   1 
ATOM   2160 C CA  . CYS A 1 272 ? 46.283 62.966 17.587  1.00   45.30 ? 266  CYS A CA  1 
ATOM   2161 C C   . CYS A 1 272 ? 45.748 64.231 16.953  1.00   45.03 ? 266  CYS A C   1 
ATOM   2162 O O   . CYS A 1 272 ? 45.509 64.263 15.747  1.00   44.58 ? 266  CYS A O   1 
ATOM   2163 C CB  . CYS A 1 272 ? 45.183 62.261 18.384  1.00   45.67 ? 266  CYS A CB  1 
ATOM   2164 S SG  . CYS A 1 272 ? 45.615 60.538 18.767  1.00   47.83 ? 266  CYS A SG  1 
ATOM   2165 N N   . LYS A 1 273 ? 45.565 65.288 17.746  1.00   44.77 ? 267  LYS A N   1 
ATOM   2166 C CA  . LYS A 1 273 ? 44.995 66.515 17.203  1.00   44.46 ? 267  LYS A CA  1 
ATOM   2167 C C   . LYS A 1 273 ? 45.917 67.094 16.136  1.00   44.22 ? 267  LYS A C   1 
ATOM   2168 O O   . LYS A 1 273 ? 45.479 67.507 15.060  1.00   43.76 ? 267  LYS A O   1 
ATOM   2169 C CB  . LYS A 1 273 ? 44.688 67.530 18.333  1.00   44.28 ? 267  LYS A CB  1 
ATOM   2170 C CG  . LYS A 1 273 ? 44.972 66.895 19.732  0.0000 47.08 ? 267  LYS A CG  1 
ATOM   2171 C CD  . LYS A 1 273 ? 44.116 65.676 20.046  0.0000 49.09 ? 267  LYS A CD  1 
ATOM   2172 C CE  . LYS A 1 273 ? 42.752 66.080 20.581  0.0000 49.62 ? 267  LYS A CE  1 
ATOM   2173 N NZ  . LYS A 1 273 ? 41.805 64.934 20.621  0.0000 50.28 ? 267  LYS A NZ  1 
ATOM   2174 N N   . ARG A 1 274 ? 47.210 67.073 16.418  1.00   44.72 ? 268  ARG A N   1 
ATOM   2175 C CA  . ARG A 1 274 ? 48.220 67.575 15.493  1.00   45.51 ? 268  ARG A CA  1 
ATOM   2176 C C   . ARG A 1 274 ? 48.284 66.793 14.159  1.00   45.11 ? 268  ARG A C   1 
ATOM   2177 O O   . ARG A 1 274 ? 48.415 67.368 13.081  1.00   45.18 ? 268  ARG A O   1 
ATOM   2178 C CB  . ARG A 1 274 ? 49.575 67.474 16.179  1.00   45.81 ? 268  ARG A CB  1 
ATOM   2179 C CG  . ARG A 1 274 ? 50.483 68.618 15.916  1.00   48.97 ? 268  ARG A CG  1 
ATOM   2180 C CD  . ARG A 1 274 ? 51.433 68.819 17.055  1.00   51.75 ? 268  ARG A CD  1 
ATOM   2181 N NE  . ARG A 1 274 ? 52.205 70.036 16.908  1.00   54.97 ? 268  ARG A NE  1 
ATOM   2182 C CZ  . ARG A 1 274 ? 53.416 70.218 17.422  1.00   57.19 ? 268  ARG A CZ  1 
ATOM   2183 N NH1 . ARG A 1 274 ? 54.009 69.254 18.122  1.00   56.76 ? 268  ARG A NH1 1 
ATOM   2184 N NH2 . ARG A 1 274 ? 54.046 71.380 17.235  1.00   59.78 ? 268  ARG A NH2 1 
ATOM   2185 N N   . ASP A 1 275 ? 48.193 65.475 14.266  1.00   45.28 ? 269  ASP A N   1 
ATOM   2186 C CA  . ASP A 1 275 ? 48.204 64.571 13.101  1.00   45.15 ? 269  ASP A CA  1 
ATOM   2187 C C   . ASP A 1 275 ? 46.908 64.612 12.290  1.00   46.48 ? 269  ASP A C   1 
ATOM   2188 O O   . ASP A 1 275 ? 46.840 64.053 11.198  1.00   45.67 ? 269  ASP A O   1 
ATOM   2189 C CB  . ASP A 1 275 ? 48.419 63.144 13.581  1.00   44.59 ? 269  ASP A CB  1 
ATOM   2190 C CG  . ASP A 1 275 ? 49.770 62.951 14.216  1.00   41.96 ? 269  ASP A CG  1 
ATOM   2191 O OD1 . ASP A 1 275 ? 50.645 63.806 13.969  1.00   37.85 ? 269  ASP A OD1 1 
ATOM   2192 O OD2 . ASP A 1 275 ? 50.037 61.990 14.966  1.00   37.45 ? 269  ASP A OD2 1 
ATOM   2193 N N   . ARG A 1 276 ? 45.888 65.284 12.835  1.00   47.78 ? 270  ARG A N   1 
ATOM   2194 C CA  . ARG A 1 276 ? 44.553 65.358 12.238  1.00   49.05 ? 270  ARG A CA  1 
ATOM   2195 C C   . ARG A 1 276 ? 43.877 63.978 12.158  1.00   49.64 ? 270  ARG A C   1 
ATOM   2196 O O   . ARG A 1 276 ? 43.153 63.688 11.196  1.00   49.99 ? 270  ARG A O   1 
ATOM   2197 C CB  . ARG A 1 276 ? 44.586 66.048 10.871  1.00   49.13 ? 270  ARG A CB  1 
ATOM   2198 C CG  . ARG A 1 276 ? 45.640 67.156 10.705  1.00   51.45 ? 270  ARG A CG  1 
ATOM   2199 C CD  . ARG A 1 276 ? 45.196 68.563 11.066  1.00   53.17 ? 270  ARG A CD  1 
ATOM   2200 N NE  . ARG A 1 276 ? 45.002 69.391 9.869   1.00   56.17 ? 270  ARG A NE  1 
ATOM   2201 C CZ  . ARG A 1 276 ? 45.657 70.519 9.581   1.00   57.55 ? 270  ARG A CZ  1 
ATOM   2202 N NH1 . ARG A 1 276 ? 46.596 71.002 10.388  1.00   59.15 ? 270  ARG A NH1 1 
ATOM   2203 N NH2 . ARG A 1 276 ? 45.374 71.171 8.457   1.00   58.59 ? 270  ARG A NH2 1 
ATOM   2204 N N   . ASP A 1 277 ? 44.130 63.145 13.171  1.00   50.73 ? 271  ASP A N   1 
ATOM   2205 C CA  . ASP A 1 277 ? 43.457 61.855 13.362  1.00   51.92 ? 271  ASP A CA  1 
ATOM   2206 C C   . ASP A 1 277 ? 42.270 61.989 14.310  1.00   53.47 ? 271  ASP A C   1 
ATOM   2207 O O   . ASP A 1 277 ? 41.628 61.001 14.667  1.00   53.50 ? 271  ASP A O   1 
ATOM   2208 C CB  . ASP A 1 277 ? 44.428 60.820 13.962  1.00   51.71 ? 271  ASP A CB  1 
ATOM   2209 C CG  . ASP A 1 277 ? 45.541 60.409 13.001  1.00   51.03 ? 271  ASP A CG  1 
ATOM   2210 O OD1 . ASP A 1 277 ? 45.334 60.437 11.761  1.00   50.58 ? 271  ASP A OD1 1 
ATOM   2211 O OD2 . ASP A 1 277 ? 46.659 60.037 13.419  1.00   47.92 ? 271  ASP A OD2 1 
ATOM   2212 N N   . ILE A 1 278 ? 42.013 63.221 14.741  1.00   55.61 ? 272  ILE A N   1 
ATOM   2213 C CA  . ILE A 1 278 ? 40.994 63.529 15.748  1.00   56.95 ? 272  ILE A CA  1 
ATOM   2214 C C   . ILE A 1 278 ? 39.587 63.284 15.240  1.00   57.99 ? 272  ILE A C   1 
ATOM   2215 O O   . ILE A 1 278 ? 38.901 62.436 15.849  1.00   59.21 ? 272  ILE A O   1 
ATOM   2216 C CB  . ILE A 1 278 ? 41.103 65.002 16.251  1.00   57.03 ? 272  ILE A CB  1 
ATOM   2217 C CG1 . ILE A 1 278 ? 41.762 65.952 15.218  1.00   57.66 ? 272  ILE A CG1 1 
ATOM   2218 C CG2 . ILE A 1 278 ? 41.861 65.029 17.564  1.00   57.54 ? 272  ILE A CG2 1 
ATOM   2219 C CD1 . ILE A 1 278 ? 41.104 66.010 13.825  1.00   57.39 ? 272  ILE A CD1 1 
ATOM   2220 O OXT . ILE A 1 278 ? 39.176 63.931 14.273  1.00   58.67 ? 272  ILE A OXT 1 
ATOM   2221 N N   . VAL B 1 15  ? 30.742 75.403 -21.494 1.00   46.66 ? 9    VAL B N   1 
ATOM   2222 C CA  . VAL B 1 15  ? 32.181 75.518 -21.510 1.00   46.24 ? 9    VAL B CA  1 
ATOM   2223 C C   . VAL B 1 15  ? 32.841 74.189 -21.118 1.00   45.43 ? 9    VAL B C   1 
ATOM   2224 O O   . VAL B 1 15  ? 32.159 73.201 -20.831 1.00   45.88 ? 9    VAL B O   1 
ATOM   2225 C CB  . VAL B 1 15  ? 32.668 76.672 -20.576 1.00   46.51 ? 9    VAL B CB  1 
ATOM   2226 C CG1 . VAL B 1 15  ? 32.059 78.001 -21.001 1.00   46.72 ? 9    VAL B CG1 1 
ATOM   2227 C CG2 . VAL B 1 15  ? 32.330 76.355 -19.120 1.00   46.91 ? 9    VAL B CG2 1 
ATOM   2228 N N   . ALA B 1 16  ? 34.180 74.169 -21.103 1.00   43.80 ? 10   ALA B N   1 
ATOM   2229 C CA  . ALA B 1 16  ? 34.944 72.971 -20.740 1.00   42.62 ? 10   ALA B CA  1 
ATOM   2230 C C   . ALA B 1 16  ? 35.141 72.839 -19.225 1.00   41.11 ? 10   ALA B C   1 
ATOM   2231 O O   . ALA B 1 16  ? 35.278 73.832 -18.516 1.00   40.83 ? 10   ALA B O   1 
ATOM   2232 C CB  . ALA B 1 16  ? 36.306 72.989 -21.427 1.00   42.32 ? 10   ALA B CB  1 
ATOM   2233 N N   . PHE B 1 17  ? 35.116 71.589 -18.774 1.00   39.72 ? 11   PHE B N   1 
ATOM   2234 C CA  . PHE B 1 17  ? 35.273 71.238 -17.363 1.00   38.53 ? 11   PHE B CA  1 
ATOM   2235 C C   . PHE B 1 17  ? 36.444 71.947 -16.693 1.00   38.85 ? 11   PHE B C   1 
ATOM   2236 O O   . PHE B 1 17  ? 36.322 72.558 -15.621 1.00   37.77 ? 11   PHE B O   1 
ATOM   2237 C CB  . PHE B 1 17  ? 35.435 69.738 -17.242 1.00   38.01 ? 11   PHE B CB  1 
ATOM   2238 C CG  . PHE B 1 17  ? 35.757 69.271 -15.858 1.00   37.20 ? 11   PHE B CG  1 
ATOM   2239 C CD1 . PHE B 1 17  ? 34.736 68.939 -14.971 1.00   35.36 ? 11   PHE B CD1 1 
ATOM   2240 C CD2 . PHE B 1 17  ? 37.071 69.152 -15.439 1.00   35.83 ? 11   PHE B CD2 1 
ATOM   2241 C CE1 . PHE B 1 17  ? 35.024 68.483 -13.709 1.00   34.65 ? 11   PHE B CE1 1 
ATOM   2242 C CE2 . PHE B 1 17  ? 37.372 68.701 -14.152 1.00   36.57 ? 11   PHE B CE2 1 
ATOM   2243 C CZ  . PHE B 1 17  ? 36.333 68.364 -13.287 1.00   35.78 ? 11   PHE B CZ  1 
ATOM   2244 N N   . GLY B 1 18  ? 37.604 71.853 -17.360 1.00   39.08 ? 12   GLY B N   1 
ATOM   2245 C CA  . GLY B 1 18  ? 38.894 72.388 -16.899 1.00   39.02 ? 12   GLY B CA  1 
ATOM   2246 C C   . GLY B 1 18  ? 38.994 73.884 -16.606 1.00   39.12 ? 12   GLY B C   1 
ATOM   2247 O O   . GLY B 1 18  ? 39.869 74.334 -15.884 1.00   39.55 ? 12   GLY B O   1 
ATOM   2248 N N   . ARG B 1 19  ? 38.105 74.661 -17.211 1.00   39.86 ? 13   ARG B N   1 
ATOM   2249 C CA  . ARG B 1 19  ? 38.078 76.067 -17.004 1.00   40.64 ? 13   ARG B CA  1 
ATOM   2250 C C   . ARG B 1 19  ? 37.699 76.435 -15.548 1.00   39.09 ? 13   ARG B C   1 
ATOM   2251 O O   . ARG B 1 19  ? 38.321 77.288 -14.922 1.00   39.60 ? 13   ARG B O   1 
ATOM   2252 C CB  . ARG B 1 19  ? 37.103 76.713 -18.003 1.00   41.68 ? 13   ARG B CB  1 
ATOM   2253 C CG  . ARG B 1 19  ? 36.973 78.232 -17.877 1.00   45.93 ? 13   ARG B CG  1 
ATOM   2254 C CD  . ARG B 1 19  ? 36.270 78.866 -19.069 1.00   51.52 ? 13   ARG B CD  1 
ATOM   2255 N NE  . ARG B 1 19  ? 36.553 80.305 -19.124 1.00   56.08 ? 13   ARG B NE  1 
ATOM   2256 C CZ  . ARG B 1 19  ? 35.857 81.239 -18.483 1.00   59.10 ? 13   ARG B CZ  1 
ATOM   2257 N NH1 . ARG B 1 19  ? 34.810 80.910 -17.729 1.00   60.66 ? 13   ARG B NH1 1 
ATOM   2258 N NH2 . ARG B 1 19  ? 36.209 82.519 -18.592 1.00   60.26 ? 13   ARG B NH2 1 
ATOM   2259 N N   . ASN B 1 20  ? 36.647 75.781 -15.061 1.00   37.56 ? 14   ASN B N   1 
ATOM   2260 C CA  . ASN B 1 20  ? 36.021 76.136 -13.783 1.00   35.73 ? 14   ASN B CA  1 
ATOM   2261 C C   . ASN B 1 20  ? 36.231 75.135 -12.635 1.00   33.65 ? 14   ASN B C   1 
ATOM   2262 O O   . ASN B 1 20  ? 36.077 75.513 -11.485 1.00   32.72 ? 14   ASN B O   1 
ATOM   2263 C CB  . ASN B 1 20  ? 34.514 76.343 -13.999 1.00   36.25 ? 14   ASN B CB  1 
ATOM   2264 C CG  . ASN B 1 20  ? 34.177 77.671 -14.700 1.00   37.55 ? 14   ASN B CG  1 
ATOM   2265 O OD1 . ASN B 1 20  ? 33.187 77.760 -15.428 1.00   40.55 ? 14   ASN B OD1 1 
ATOM   2266 N ND2 . ASN B 1 20  ? 34.968 78.696 -14.448 1.00   35.87 ? 14   ASN B ND2 1 
ATOM   2267 N N   . TYR B 1 21  ? 36.591 73.893 -12.950 1.00   31.49 ? 15   TYR B N   1 
ATOM   2268 C CA  . TYR B 1 21  ? 36.526 72.775 -12.004 1.00   30.94 ? 15   TYR B CA  1 
ATOM   2269 C C   . TYR B 1 21  ? 37.827 71.967 -11.914 1.00   31.00 ? 15   TYR B C   1 
ATOM   2270 O O   . TYR B 1 21  ? 38.624 71.959 -12.862 1.00   31.17 ? 15   TYR B O   1 
ATOM   2271 C CB  . TYR B 1 21  ? 35.384 71.836 -12.430 1.00   30.57 ? 15   TYR B CB  1 
ATOM   2272 C CG  . TYR B 1 21  ? 34.014 72.457 -12.210 1.00   29.03 ? 15   TYR B CG  1 
ATOM   2273 C CD1 . TYR B 1 21  ? 33.471 72.509 -10.936 1.00   29.35 ? 15   TYR B CD1 1 
ATOM   2274 C CD2 . TYR B 1 21  ? 33.282 73.009 -13.258 1.00   31.32 ? 15   TYR B CD2 1 
ATOM   2275 C CE1 . TYR B 1 21  ? 32.220 73.097 -10.697 1.00   28.61 ? 15   TYR B CE1 1 
ATOM   2276 C CE2 . TYR B 1 21  ? 32.006 73.609 -13.028 1.00   29.63 ? 15   TYR B CE2 1 
ATOM   2277 C CZ  . TYR B 1 21  ? 31.495 73.636 -11.736 1.00   31.11 ? 15   TYR B CZ  1 
ATOM   2278 O OH  . TYR B 1 21  ? 30.252 74.191 -11.453 1.00   30.20 ? 15   TYR B OH  1 
ATOM   2279 N N   . VAL B 1 22  ? 38.014 71.290 -10.788 1.00   29.58 ? 16   VAL B N   1 
ATOM   2280 C CA  . VAL B 1 22  ? 39.084 70.306 -10.584 1.00   29.69 ? 16   VAL B CA  1 
ATOM   2281 C C   . VAL B 1 22  ? 38.529 69.077 -9.874  1.00   29.22 ? 16   VAL B C   1 
ATOM   2282 O O   . VAL B 1 22  ? 37.594 69.193 -9.062  1.00   26.11 ? 16   VAL B O   1 
ATOM   2283 C CB  . VAL B 1 22  ? 40.280 70.846 -9.710  1.00   30.13 ? 16   VAL B CB  1 
ATOM   2284 C CG1 . VAL B 1 22  ? 41.049 71.934 -10.426 1.00   30.87 ? 16   VAL B CG1 1 
ATOM   2285 C CG2 . VAL B 1 22  ? 39.823 71.368 -8.341  1.00   30.26 ? 16   VAL B CG2 1 
ATOM   2286 N N   . PRO B 1 23  ? 39.137 67.915 -10.102 1.00   28.81 ? 17   PRO B N   1 
ATOM   2287 C CA  . PRO B 1 23  ? 38.712 66.690 -9.413  1.00   29.18 ? 17   PRO B CA  1 
ATOM   2288 C C   . PRO B 1 23  ? 38.956 66.787 -7.919  1.00   29.56 ? 17   PRO B C   1 
ATOM   2289 O O   . PRO B 1 23  ? 39.848 67.514 -7.479  1.00   29.41 ? 17   PRO B O   1 
ATOM   2290 C CB  . PRO B 1 23  ? 39.574 65.580 -10.044 1.00   29.29 ? 17   PRO B CB  1 
ATOM   2291 C CG  . PRO B 1 23  ? 40.251 66.218 -11.233 1.00   29.96 ? 17   PRO B CG  1 
ATOM   2292 C CD  . PRO B 1 23  ? 40.293 67.685 -10.997 1.00   30.18 ? 17   PRO B CD  1 
ATOM   2293 N N   . THR B 1 24  ? 38.124 66.099 -7.156  1.00   29.64 ? 18   THR B N   1 
ATOM   2294 C CA  . THR B 1 24  ? 38.171 66.101 -5.696  1.00   30.73 ? 18   THR B CA  1 
ATOM   2295 C C   . THR B 1 24  ? 38.843 64.817 -5.206  1.00   30.67 ? 18   THR B C   1 
ATOM   2296 O O   . THR B 1 24  ? 39.693 64.854 -4.315  1.00   31.95 ? 18   THR B O   1 
ATOM   2297 C CB  . THR B 1 24  ? 36.731 66.151 -5.127  1.00   30.44 ? 18   THR B CB  1 
ATOM   2298 O OG1 . THR B 1 24  ? 36.097 67.374 -5.532  1.00   33.49 ? 18   THR B OG1 1 
ATOM   2299 C CG2 . THR B 1 24  ? 36.725 66.219 -3.618  1.00   32.94 ? 18   THR B CG2 1 
ATOM   2300 N N   . TRP B 1 25  ? 38.418 63.688 -5.775  1.00   29.02 ? 19   TRP B N   1 
ATOM   2301 C CA  . TRP B 1 25  ? 38.790 62.365 -5.306  1.00   28.89 ? 19   TRP B CA  1 
ATOM   2302 C C   . TRP B 1 25  ? 38.666 61.379 -6.450  1.00   29.49 ? 19   TRP B C   1 
ATOM   2303 O O   . TRP B 1 25  ? 37.776 61.512 -7.288  1.00   28.70 ? 19   TRP B O   1 
ATOM   2304 C CB  . TRP B 1 25  ? 37.889 61.956 -4.134  1.00   28.05 ? 19   TRP B CB  1 
ATOM   2305 C CG  . TRP B 1 25  ? 38.167 60.610 -3.569  1.00   28.08 ? 19   TRP B CG  1 
ATOM   2306 C CD1 . TRP B 1 25  ? 37.505 59.467 -3.817  1.00   26.73 ? 19   TRP B CD1 1 
ATOM   2307 C CD2 . TRP B 1 25  ? 39.230 60.277 -2.679  1.00   26.46 ? 19   TRP B CD2 1 
ATOM   2308 N NE1 . TRP B 1 25  ? 38.075 58.425 -3.118  1.00   29.00 ? 19   TRP B NE1 1 
ATOM   2309 C CE2 . TRP B 1 25  ? 39.133 58.906 -2.404  1.00   27.26 ? 19   TRP B CE2 1 
ATOM   2310 C CE3 . TRP B 1 25  ? 40.246 61.012 -2.070  1.00   27.04 ? 19   TRP B CE3 1 
ATOM   2311 C CZ2 . TRP B 1 25  ? 40.036 58.239 -1.555  1.00   29.27 ? 19   TRP B CZ2 1 
ATOM   2312 C CZ3 . TRP B 1 25  ? 41.138 60.348 -1.211  1.00   29.21 ? 19   TRP B CZ3 1 
ATOM   2313 C CH2 . TRP B 1 25  ? 41.011 58.987 -0.962  1.00   28.36 ? 19   TRP B CH2 1 
ATOM   2314 N N   . ALA B 1 26  ? 39.557 60.389 -6.480  1.00   30.14 ? 20   ALA B N   1 
ATOM   2315 C CA  . ALA B 1 26  ? 39.487 59.294 -7.429  1.00   30.85 ? 20   ALA B CA  1 
ATOM   2316 C C   . ALA B 1 26  ? 39.481 59.862 -8.844  1.00   32.32 ? 20   ALA B C   1 
ATOM   2317 O O   . ALA B 1 26  ? 38.508 59.756 -9.585  1.00   32.22 ? 20   ALA B O   1 
ATOM   2318 C CB  . ALA B 1 26  ? 38.277 58.409 -7.154  1.00   31.04 ? 20   ALA B CB  1 
ATOM   2319 N N   . PHE B 1 27  ? 40.602 60.486 -9.194  1.00   32.44 ? 21   PHE B N   1 
ATOM   2320 C CA  . PHE B 1 27  ? 40.759 61.217 -10.435 1.00   33.99 ? 21   PHE B CA  1 
ATOM   2321 C C   . PHE B 1 27  ? 40.516 60.313 -11.636 1.00   33.41 ? 21   PHE B C   1 
ATOM   2322 O O   . PHE B 1 27  ? 39.988 60.767 -12.656 1.00   33.09 ? 21   PHE B O   1 
ATOM   2323 C CB  . PHE B 1 27  ? 42.176 61.816 -10.540 1.00   35.11 ? 21   PHE B CB  1 
ATOM   2324 C CG  . PHE B 1 27  ? 42.459 62.961 -9.587  1.00   38.65 ? 21   PHE B CG  1 
ATOM   2325 C CD1 . PHE B 1 27  ? 41.681 63.196 -8.451  1.00   41.78 ? 21   PHE B CD1 1 
ATOM   2326 C CD2 . PHE B 1 27  ? 43.558 63.792 -9.824  1.00   43.02 ? 21   PHE B CD2 1 
ATOM   2327 C CE1 . PHE B 1 27  ? 41.975 64.256 -7.594  1.00   43.99 ? 21   PHE B CE1 1 
ATOM   2328 C CE2 . PHE B 1 27  ? 43.855 64.848 -8.980  1.00   43.82 ? 21   PHE B CE2 1 
ATOM   2329 C CZ  . PHE B 1 27  ? 43.067 65.080 -7.858  1.00   44.69 ? 21   PHE B CZ  1 
ATOM   2330 N N   . ASP B 1 28  ? 40.886 59.038 -11.498 1.00   33.09 ? 22   ASP B N   1 
ATOM   2331 C CA  . ASP B 1 28  ? 40.779 58.085 -12.594 1.00   33.97 ? 22   ASP B CA  1 
ATOM   2332 C C   . ASP B 1 28  ? 39.339 57.607 -12.811 1.00   32.99 ? 22   ASP B C   1 
ATOM   2333 O O   . ASP B 1 28  ? 39.068 56.880 -13.755 1.00   32.22 ? 22   ASP B O   1 
ATOM   2334 C CB  . ASP B 1 28  ? 41.753 56.898 -12.422 1.00   34.57 ? 22   ASP B CB  1 
ATOM   2335 C CG  . ASP B 1 28  ? 41.444 56.034 -11.216 1.00   37.74 ? 22   ASP B CG  1 
ATOM   2336 O OD1 . ASP B 1 28  ? 40.727 56.487 -10.290 1.00   36.53 ? 22   ASP B OD1 1 
ATOM   2337 O OD2 . ASP B 1 28  ? 41.901 54.872 -11.102 1.00   41.10 ? 22   ASP B OD2 1 
ATOM   2338 N N   . HIS B 1 29  ? 38.414 58.025 -11.938 1.00   31.62 ? 23   HIS B N   1 
ATOM   2339 C CA  . HIS B 1 29  ? 36.997 57.701 -12.118 1.00   30.39 ? 23   HIS B CA  1 
ATOM   2340 C C   . HIS B 1 29  ? 36.213 58.805 -12.802 1.00   29.75 ? 23   HIS B C   1 
ATOM   2341 O O   . HIS B 1 29  ? 34.988 58.710 -12.915 1.00   29.67 ? 23   HIS B O   1 
ATOM   2342 C CB  . HIS B 1 29  ? 36.373 57.392 -10.760 1.00   30.15 ? 23   HIS B CB  1 
ATOM   2343 C CG  . HIS B 1 29  ? 36.722 56.035 -10.262 1.00   31.06 ? 23   HIS B CG  1 
ATOM   2344 N ND1 . HIS B 1 29  ? 35.795 55.175 -9.730  1.00   33.49 ? 23   HIS B ND1 1 
ATOM   2345 C CD2 . HIS B 1 29  ? 37.900 55.372 -10.258 1.00   33.31 ? 23   HIS B CD2 1 
ATOM   2346 C CE1 . HIS B 1 29  ? 36.395 54.048 -9.392  1.00   35.87 ? 23   HIS B CE1 1 
ATOM   2347 N NE2 . HIS B 1 29  ? 37.676 54.147 -9.690  1.00   34.26 ? 23   HIS B NE2 1 
ATOM   2348 N N   . ILE B 1 30  ? 36.900 59.859 -13.205 1.00   29.31 ? 24   ILE B N   1 
ATOM   2349 C CA  . ILE B 1 30  ? 36.336 60.898 -14.039 1.00   29.37 ? 24   ILE B CA  1 
ATOM   2350 C C   . ILE B 1 30  ? 36.870 60.689 -15.455 1.00   30.58 ? 24   ILE B C   1 
ATOM   2351 O O   . ILE B 1 30  ? 38.079 60.779 -15.670 1.00   29.73 ? 24   ILE B O   1 
ATOM   2352 C CB  . ILE B 1 30  ? 36.722 62.258 -13.541 1.00   29.68 ? 24   ILE B CB  1 
ATOM   2353 C CG1 . ILE B 1 30  ? 36.312 62.420 -12.057 1.00   30.19 ? 24   ILE B CG1 1 
ATOM   2354 C CG2 . ILE B 1 30  ? 36.096 63.366 -14.438 1.00   29.24 ? 24   ILE B CG2 1 
ATOM   2355 C CD1 . ILE B 1 30  ? 36.705 63.727 -11.476 1.00   33.01 ? 24   ILE B CD1 1 
ATOM   2356 N N   . LYS B 1 31  ? 35.975 60.388 -16.391 1.00   30.88 ? 25   LYS B N   1 
ATOM   2357 C CA  . LYS B 1 31  ? 36.346 60.198 -17.804 1.00   32.57 ? 25   LYS B CA  1 
ATOM   2358 C C   . LYS B 1 31  ? 35.969 61.443 -18.583 1.00   33.77 ? 25   LYS B C   1 
ATOM   2359 O O   . LYS B 1 31  ? 34.836 61.939 -18.447 1.00   32.40 ? 25   LYS B O   1 
ATOM   2360 C CB  . LYS B 1 31  ? 35.612 59.008 -18.422 1.00   32.92 ? 25   LYS B CB  1 
ATOM   2361 C CG  . LYS B 1 31  ? 35.502 57.755 -17.615 1.00   36.56 ? 25   LYS B CG  1 
ATOM   2362 C CD  . LYS B 1 31  ? 36.833 57.156 -17.284 1.00   39.03 ? 25   LYS B CD  1 
ATOM   2363 C CE  . LYS B 1 31  ? 36.705 55.718 -16.845 1.00   41.48 ? 25   LYS B CE  1 
ATOM   2364 N NZ  . LYS B 1 31  ? 37.091 55.581 -15.413 1.00   43.34 ? 25   LYS B NZ  1 
ATOM   2365 N N   . TYR B 1 32  ? 36.883 61.946 -19.421 1.00   35.01 ? 26   TYR B N   1 
ATOM   2366 C CA  . TYR B 1 32  ? 36.699 63.210 -20.137 1.00   36.64 ? 26   TYR B CA  1 
ATOM   2367 C C   . TYR B 1 32  ? 36.415 62.959 -21.609 1.00   38.57 ? 26   TYR B C   1 
ATOM   2368 O O   . TYR B 1 32  ? 37.087 62.128 -22.234 1.00   38.43 ? 26   TYR B O   1 
ATOM   2369 C CB  . TYR B 1 32  ? 37.944 64.084 -19.999 1.00   36.84 ? 26   TYR B CB  1 
ATOM   2370 C CG  . TYR B 1 32  ? 38.299 64.433 -18.555 1.00   37.65 ? 26   TYR B CG  1 
ATOM   2371 C CD1 . TYR B 1 32  ? 38.978 63.529 -17.739 1.00   37.71 ? 26   TYR B CD1 1 
ATOM   2372 C CD2 . TYR B 1 32  ? 37.954 65.665 -18.010 1.00   39.49 ? 26   TYR B CD2 1 
ATOM   2373 C CE1 . TYR B 1 32  ? 39.310 63.841 -16.436 1.00   38.69 ? 26   TYR B CE1 1 
ATOM   2374 C CE2 . TYR B 1 32  ? 38.290 65.991 -16.691 1.00   39.41 ? 26   TYR B CE2 1 
ATOM   2375 C CZ  . TYR B 1 32  ? 38.958 65.070 -15.908 1.00   39.58 ? 26   TYR B CZ  1 
ATOM   2376 O OH  . TYR B 1 32  ? 39.271 65.374 -14.595 1.00   41.00 ? 26   TYR B OH  1 
ATOM   2377 N N   . PHE B 1 33  ? 35.415 63.660 -22.156 1.00   40.02 ? 27   PHE B N   1 
ATOM   2378 C CA  . PHE B 1 33  ? 34.999 63.511 -23.561 1.00   41.41 ? 27   PHE B CA  1 
ATOM   2379 C C   . PHE B 1 33  ? 34.945 64.880 -24.219 1.00   42.80 ? 27   PHE B C   1 
ATOM   2380 O O   . PHE B 1 33  ? 34.646 65.869 -23.565 1.00   42.65 ? 27   PHE B O   1 
ATOM   2381 C CB  . PHE B 1 33  ? 33.616 62.880 -23.682 1.00   41.29 ? 27   PHE B CB  1 
ATOM   2382 C CG  . PHE B 1 33  ? 33.534 61.488 -23.168 1.00   40.77 ? 27   PHE B CG  1 
ATOM   2383 C CD1 . PHE B 1 33  ? 33.411 61.242 -21.807 1.00   40.15 ? 27   PHE B CD1 1 
ATOM   2384 C CD2 . PHE B 1 33  ? 33.564 60.413 -24.040 1.00   38.51 ? 27   PHE B CD2 1 
ATOM   2385 C CE1 . PHE B 1 33  ? 33.337 59.939 -21.328 1.00   39.07 ? 27   PHE B CE1 1 
ATOM   2386 C CE2 . PHE B 1 33  ? 33.480 59.115 -23.571 1.00   39.39 ? 27   PHE B CE2 1 
ATOM   2387 C CZ  . PHE B 1 33  ? 33.369 58.871 -22.214 1.00   39.64 ? 27   PHE B CZ  1 
ATOM   2388 N N   . ASN B 1 34  ? 35.242 64.939 -25.514 1.00   44.39 ? 28   ASN B N   1 
ATOM   2389 C CA  . ASN B 1 34  ? 35.117 66.172 -26.293 1.00   45.70 ? 28   ASN B CA  1 
ATOM   2390 C C   . ASN B 1 34  ? 35.873 67.355 -25.689 1.00   46.01 ? 28   ASN B C   1 
ATOM   2391 O O   . ASN B 1 34  ? 35.351 68.471 -25.652 1.00   46.81 ? 28   ASN B O   1 
ATOM   2392 C CB  . ASN B 1 34  ? 33.639 66.551 -26.485 1.00   46.29 ? 28   ASN B CB  1 
ATOM   2393 C CG  . ASN B 1 34  ? 32.849 65.483 -27.224 1.00   48.84 ? 28   ASN B CG  1 
ATOM   2394 O OD1 . ASN B 1 34  ? 33.182 65.132 -28.359 1.00   51.62 ? 28   ASN B OD1 1 
ATOM   2395 N ND2 . ASN B 1 34  ? 31.784 64.981 -26.590 1.00   51.48 ? 28   ASN B ND2 1 
ATOM   2396 N N   . GLY B 1 35  ? 37.086 67.105 -25.204 1.00   46.09 ? 29   GLY B N   1 
ATOM   2397 C CA  . GLY B 1 35  ? 37.942 68.157 -24.674 1.00   46.15 ? 29   GLY B CA  1 
ATOM   2398 C C   . GLY B 1 35  ? 37.560 68.627 -23.275 1.00   46.17 ? 29   GLY B C   1 
ATOM   2399 O O   . GLY B 1 35  ? 37.913 69.745 -22.860 1.00   46.62 ? 29   GLY B O   1 
ATOM   2400 N N   . GLY B 1 36  ? 36.870 67.761 -22.535 1.00   45.67 ? 30   GLY B N   1 
ATOM   2401 C CA  . GLY B 1 36  ? 36.285 68.119 -21.260 1.00   44.99 ? 30   GLY B CA  1 
ATOM   2402 C C   . GLY B 1 36  ? 34.954 68.851 -21.362 1.00   44.60 ? 30   GLY B C   1 
ATOM   2403 O O   . GLY B 1 36  ? 34.483 69.412 -20.378 1.00   44.32 ? 30   GLY B O   1 
ATOM   2404 N N   . ASN B 1 37  ? 34.330 68.851 -22.535 1.00   43.52 ? 31   ASN B N   1 
ATOM   2405 C CA  . ASN B 1 37  ? 33.000 69.428 -22.665 1.00   42.91 ? 31   ASN B CA  1 
ATOM   2406 C C   . ASN B 1 37  ? 31.928 68.486 -22.111 1.00   41.45 ? 31   ASN B C   1 
ATOM   2407 O O   . ASN B 1 37  ? 30.803 68.911 -21.864 1.00   41.61 ? 31   ASN B O   1 
ATOM   2408 C CB  . ASN B 1 37  ? 32.691 69.799 -24.127 1.00   43.55 ? 31   ASN B CB  1 
ATOM   2409 C CG  . ASN B 1 37  ? 33.268 71.156 -24.531 1.00   44.67 ? 31   ASN B CG  1 
ATOM   2410 O OD1 . ASN B 1 37  ? 34.179 71.678 -23.899 1.00   47.92 ? 31   ASN B OD1 1 
ATOM   2411 N ND2 . ASN B 1 37  ? 32.742 71.717 -25.614 1.00   49.27 ? 31   ASN B ND2 1 
ATOM   2412 N N   . GLU B 1 38  ? 32.267 67.210 -21.949 1.00   39.48 ? 32   GLU B N   1 
ATOM   2413 C CA  . GLU B 1 38  ? 31.417 66.251 -21.233 1.00   38.53 ? 32   GLU B CA  1 
ATOM   2414 C C   . GLU B 1 38  ? 32.270 65.331 -20.381 1.00   36.84 ? 32   GLU B C   1 
ATOM   2415 O O   . GLU B 1 38  ? 33.316 64.841 -20.839 1.00   37.03 ? 32   GLU B O   1 
ATOM   2416 C CB  . GLU B 1 38  ? 30.582 65.403 -22.192 1.00   38.56 ? 32   GLU B CB  1 
ATOM   2417 C CG  . GLU B 1 38  ? 29.915 64.184 -21.556 1.00   39.74 ? 32   GLU B CG  1 
ATOM   2418 C CD  . GLU B 1 38  ? 28.889 63.512 -22.454 1.00   41.49 ? 32   GLU B CD  1 
ATOM   2419 O OE1 . GLU B 1 38  ? 28.501 64.130 -23.451 1.00   41.52 ? 32   GLU B OE1 1 
ATOM   2420 O OE2 . GLU B 1 38  ? 28.456 62.367 -22.149 1.00   43.99 ? 32   GLU B OE2 1 
ATOM   2421 N N   . ILE B 1 39  ? 31.849 65.093 -19.144 1.00   33.91 ? 33   ILE B N   1 
ATOM   2422 C CA  . ILE B 1 39  ? 32.532 64.147 -18.303 1.00   31.87 ? 33   ILE B CA  1 
ATOM   2423 C C   . ILE B 1 39  ? 31.567 63.111 -17.771 1.00   30.04 ? 33   ILE B C   1 
ATOM   2424 O O   . ILE B 1 39  ? 30.359 63.346 -17.682 1.00   28.17 ? 33   ILE B O   1 
ATOM   2425 C CB  . ILE B 1 39  ? 33.301 64.858 -17.167 1.00   32.42 ? 33   ILE B CB  1 
ATOM   2426 C CG1 . ILE B 1 39  ? 32.348 65.347 -16.086 1.00   33.56 ? 33   ILE B CG1 1 
ATOM   2427 C CG2 . ILE B 1 39  ? 34.137 66.020 -17.698 1.00   33.20 ? 33   ILE B CG2 1 
ATOM   2428 C CD1 . ILE B 1 39  ? 33.051 65.845 -14.887 1.00   35.03 ? 33   ILE B CD1 1 
ATOM   2429 N N   . GLN B 1 40  ? 32.099 61.944 -17.462 1.00   27.76 ? 34   GLN B N   1 
ATOM   2430 C CA  . GLN B 1 40  ? 31.374 60.925 -16.763 1.00   27.54 ? 34   GLN B CA  1 
ATOM   2431 C C   . GLN B 1 40  ? 32.051 60.690 -15.442 1.00   27.03 ? 34   GLN B C   1 
ATOM   2432 O O   . GLN B 1 40  ? 33.286 60.637 -15.376 1.00   27.45 ? 34   GLN B O   1 
ATOM   2433 C CB  . GLN B 1 40  ? 31.396 59.620 -17.524 1.00   27.88 ? 34   GLN B CB  1 
ATOM   2434 C CG  . GLN B 1 40  ? 30.694 59.638 -18.839 1.00   30.23 ? 34   GLN B CG  1 
ATOM   2435 C CD  . GLN B 1 40  ? 30.793 58.290 -19.499 1.00   32.26 ? 34   GLN B CD  1 
ATOM   2436 O OE1 . GLN B 1 40  ? 31.675 57.482 -19.149 1.00   37.55 ? 34   GLN B OE1 1 
ATOM   2437 N NE2 . GLN B 1 40  ? 29.884 58.007 -20.389 1.00   33.93 ? 34   GLN B NE2 1 
ATOM   2438 N N   . LEU B 1 41  ? 31.238 60.552 -14.396 1.00   24.80 ? 35   LEU B N   1 
ATOM   2439 C CA  . LEU B 1 41  ? 31.671 60.128 -13.096 1.00   24.44 ? 35   LEU B CA  1 
ATOM   2440 C C   . LEU B 1 41  ? 31.294 58.654 -12.932 1.00   24.05 ? 35   LEU B C   1 
ATOM   2441 O O   . LEU B 1 41  ? 30.161 58.238 -13.193 1.00   22.80 ? 35   LEU B O   1 
ATOM   2442 C CB  . LEU B 1 41  ? 30.982 60.999 -12.010 1.00   23.69 ? 35   LEU B CB  1 
ATOM   2443 C CG  . LEU B 1 41  ? 31.699 62.263 -11.570 1.00   26.91 ? 35   LEU B CG  1 
ATOM   2444 C CD1 . LEU B 1 41  ? 32.244 63.148 -12.647 1.00   29.20 ? 35   LEU B CD1 1 
ATOM   2445 C CD2 . LEU B 1 41  ? 30.833 63.072 -10.578 1.00   28.13 ? 35   LEU B CD2 1 
ATOM   2446 N N   . HIS B 1 42  ? 32.269 57.851 -12.511 1.00   23.01 ? 36   HIS B N   1 
ATOM   2447 C CA  . HIS B 1 42  ? 32.103 56.435 -12.270 1.00   23.65 ? 36   HIS B CA  1 
ATOM   2448 C C   . HIS B 1 42  ? 32.124 56.094 -10.783 1.00   23.62 ? 36   HIS B C   1 
ATOM   2449 O O   . HIS B 1 42  ? 32.980 56.579 -10.058 1.00   24.97 ? 36   HIS B O   1 
ATOM   2450 C CB  . HIS B 1 42  ? 33.249 55.670 -12.934 1.00   24.46 ? 36   HIS B CB  1 
ATOM   2451 C CG  . HIS B 1 42  ? 33.104 55.553 -14.414 1.00   27.03 ? 36   HIS B CG  1 
ATOM   2452 N ND1 . HIS B 1 42  ? 32.717 56.606 -15.212 1.00   30.31 ? 36   HIS B ND1 1 
ATOM   2453 C CD2 . HIS B 1 42  ? 33.308 54.503 -15.250 1.00   28.80 ? 36   HIS B CD2 1 
ATOM   2454 C CE1 . HIS B 1 42  ? 32.664 56.213 -16.476 1.00   31.17 ? 36   HIS B CE1 1 
ATOM   2455 N NE2 . HIS B 1 42  ? 33.004 54.932 -16.519 1.00   30.99 ? 36   HIS B NE2 1 
ATOM   2456 N N   . LEU B 1 43  ? 31.229 55.214 -10.373 1.00   22.05 ? 37   LEU B N   1 
ATOM   2457 C CA  . LEU B 1 43  ? 31.147 54.694 -9.019  1.00   22.95 ? 37   LEU B CA  1 
ATOM   2458 C C   . LEU B 1 43  ? 31.199 53.163 -9.043  1.00   24.37 ? 37   LEU B C   1 
ATOM   2459 O O   . LEU B 1 43  ? 30.481 52.526 -9.814  1.00   24.98 ? 37   LEU B O   1 
ATOM   2460 C CB  . LEU B 1 43  ? 29.840 55.175 -8.344  1.00   21.49 ? 37   LEU B CB  1 
ATOM   2461 C CG  . LEU B 1 43  ? 29.363 54.499 -7.068  1.00   21.53 ? 37   LEU B CG  1 
ATOM   2462 C CD1 . LEU B 1 43  ? 30.282 54.838 -5.929  1.00   23.41 ? 37   LEU B CD1 1 
ATOM   2463 C CD2 . LEU B 1 43  ? 27.896 54.904 -6.716  1.00   23.04 ? 37   LEU B CD2 1 
ATOM   2464 N N   . ASP B 1 44  ? 32.074 52.588 -8.213  1.00   25.69 ? 38   ASP B N   1 
ATOM   2465 C CA  . ASP B 1 44  ? 32.131 51.142 -7.953  1.00   26.86 ? 38   ASP B CA  1 
ATOM   2466 C C   . ASP B 1 44  ? 32.242 50.900 -6.454  1.00   27.26 ? 38   ASP B C   1 
ATOM   2467 O O   . ASP B 1 44  ? 32.247 51.847 -5.682  1.00   26.42 ? 38   ASP B O   1 
ATOM   2468 C CB  . ASP B 1 44  ? 33.265 50.477 -8.753  1.00   27.89 ? 38   ASP B CB  1 
ATOM   2469 C CG  . ASP B 1 44  ? 34.639 51.046 -8.426  1.00   30.58 ? 38   ASP B CG  1 
ATOM   2470 O OD1 . ASP B 1 44  ? 34.962 51.287 -7.237  1.00   29.79 ? 38   ASP B OD1 1 
ATOM   2471 O OD2 . ASP B 1 44  ? 35.461 51.298 -9.321  1.00   36.87 ? 38   ASP B OD2 1 
ATOM   2472 N N   . LYS B 1 45  ? 32.316 49.645 -6.017  1.00   27.72 ? 39   LYS B N   1 
ATOM   2473 C CA  . LYS B 1 45  ? 32.261 49.369 -4.586  1.00   29.14 ? 39   LYS B CA  1 
ATOM   2474 C C   . LYS B 1 45  ? 33.469 49.904 -3.813  1.00   28.79 ? 39   LYS B C   1 
ATOM   2475 O O   . LYS B 1 45  ? 33.411 50.016 -2.586  1.00   30.17 ? 39   LYS B O   1 
ATOM   2476 C CB  . LYS B 1 45  ? 32.059 47.875 -4.299  1.00   30.12 ? 39   LYS B CB  1 
ATOM   2477 C CG  . LYS B 1 45  ? 33.196 46.948 -4.800  1.00   33.32 ? 39   LYS B CG  1 
ATOM   2478 C CD  . LYS B 1 45  ? 33.043 45.544 -4.185  1.00   38.13 ? 39   LYS B CD  1 
ATOM   2479 C CE  . LYS B 1 45  ? 33.805 44.483 -4.986  1.00   41.71 ? 39   LYS B CE  1 
ATOM   2480 N NZ  . LYS B 1 45  ? 33.462 43.088 -4.520  1.00   42.97 ? 39   LYS B NZ  1 
ATOM   2481 N N   . TYR B 1 46  ? 34.534 50.268 -4.514  1.00   28.21 ? 40   TYR B N   1 
ATOM   2482 C CA  . TYR B 1 46  ? 35.738 50.773 -3.840  1.00   28.65 ? 40   TYR B CA  1 
ATOM   2483 C C   . TYR B 1 46  ? 35.685 52.264 -3.630  1.00   27.89 ? 40   TYR B C   1 
ATOM   2484 O O   . TYR B 1 46  ? 36.115 52.760 -2.610  1.00   27.47 ? 40   TYR B O   1 
ATOM   2485 C CB  . TYR B 1 46  ? 36.991 50.420 -4.631  1.00   28.97 ? 40   TYR B CB  1 
ATOM   2486 C CG  . TYR B 1 46  ? 37.160 48.926 -4.715  1.00   31.72 ? 40   TYR B CG  1 
ATOM   2487 C CD1 . TYR B 1 46  ? 37.548 48.199 -3.587  1.00   34.88 ? 40   TYR B CD1 1 
ATOM   2488 C CD2 . TYR B 1 46  ? 36.878 48.230 -5.889  1.00   34.16 ? 40   TYR B CD2 1 
ATOM   2489 C CE1 . TYR B 1 46  ? 37.686 46.813 -3.634  1.00   34.74 ? 40   TYR B CE1 1 
ATOM   2490 C CE2 . TYR B 1 46  ? 37.011 46.827 -5.933  1.00   34.49 ? 40   TYR B CE2 1 
ATOM   2491 C CZ  . TYR B 1 46  ? 37.409 46.144 -4.798  1.00   34.66 ? 40   TYR B CZ  1 
ATOM   2492 O OH  . TYR B 1 46  ? 37.543 44.773 -4.813  1.00   38.27 ? 40   TYR B OH  1 
ATOM   2493 N N   . THR B 1 47  ? 35.109 52.978 -4.592  1.00   27.11 ? 41   THR B N   1 
ATOM   2494 C CA  . THR B 1 47  ? 35.033 54.415 -4.479  1.00   26.28 ? 41   THR B CA  1 
ATOM   2495 C C   . THR B 1 47  ? 34.040 55.035 -5.441  1.00   25.38 ? 41   THR B C   1 
ATOM   2496 O O   . THR B 1 47  ? 33.799 54.502 -6.522  1.00   24.43 ? 41   THR B O   1 
ATOM   2497 C CB  . THR B 1 47  ? 36.425 55.024 -4.739  1.00   25.94 ? 41   THR B CB  1 
ATOM   2498 O OG1 . THR B 1 47  ? 36.414 56.423 -4.483  1.00   26.63 ? 41   THR B OG1 1 
ATOM   2499 C CG2 . THR B 1 47  ? 36.851 54.895 -6.174  1.00   27.03 ? 41   THR B CG2 1 
ATOM   2500 N N   . GLY B 1 48  ? 33.555 56.205 -5.029  1.00   25.27 ? 42   GLY B N   1 
ATOM   2501 C CA  . GLY B 1 48  ? 32.911 57.163 -5.905  1.00   24.83 ? 42   GLY B CA  1 
ATOM   2502 C C   . GLY B 1 48  ? 33.897 58.239 -6.325  1.00   25.34 ? 42   GLY B C   1 
ATOM   2503 O O   . GLY B 1 48  ? 35.129 58.076 -6.244  1.00   25.91 ? 42   GLY B O   1 
ATOM   2504 N N   . THR B 1 49  ? 33.388 59.358 -6.813  1.00   23.04 ? 43   THR B N   1 
ATOM   2505 C CA  . THR B 1 49  ? 34.250 60.408 -7.263  1.00   22.65 ? 43   THR B CA  1 
ATOM   2506 C C   . THR B 1 49  ? 33.475 61.712 -7.272  1.00   22.33 ? 43   THR B C   1 
ATOM   2507 O O   . THR B 1 49  ? 32.271 61.737 -7.002  1.00   21.06 ? 43   THR B O   1 
ATOM   2508 C CB  . THR B 1 49  ? 34.829 60.043 -8.672  1.00   23.53 ? 43   THR B CB  1 
ATOM   2509 O OG1 . THR B 1 49  ? 35.694 61.080 -9.155  1.00   24.43 ? 43   THR B OG1 1 
ATOM   2510 C CG2 . THR B 1 49  ? 33.731 59.937 -9.699  1.00   24.67 ? 43   THR B CG2 1 
ATOM   2511 N N   . GLY B 1 50  ? 34.173 62.791 -7.518  1.00   21.09 ? 44   GLY B N   1 
ATOM   2512 C CA  . GLY B 1 50  ? 33.557 64.099 -7.595  1.00   22.30 ? 44   GLY B CA  1 
ATOM   2513 C C   . GLY B 1 50  ? 34.533 65.169 -7.997  1.00   22.49 ? 44   GLY B C   1 
ATOM   2514 O O   . GLY B 1 50  ? 35.716 64.881 -8.211  1.00   21.92 ? 44   GLY B O   1 
ATOM   2515 N N   . PHE B 1 51  ? 34.029 66.380 -8.131  1.00   21.74 ? 45   PHE B N   1 
ATOM   2516 C CA  . PHE B 1 51  ? 34.804 67.550 -8.519  1.00   21.93 ? 45   PHE B CA  1 
ATOM   2517 C C   . PHE B 1 51  ? 34.285 68.800 -7.819  1.00   23.24 ? 45   PHE B C   1 
ATOM   2518 O O   . PHE B 1 51  ? 33.243 68.763 -7.156  1.00   22.03 ? 45   PHE B O   1 
ATOM   2519 C CB  . PHE B 1 51  ? 34.841 67.692 -10.039 1.00   22.83 ? 45   PHE B CB  1 
ATOM   2520 C CG  . PHE B 1 51  ? 33.496 67.880 -10.705 1.00   20.14 ? 45   PHE B CG  1 
ATOM   2521 C CD1 . PHE B 1 51  ? 32.999 69.145 -10.905 1.00   22.47 ? 45   PHE B CD1 1 
ATOM   2522 C CD2 . PHE B 1 51  ? 32.797 66.803 -11.187 1.00   20.12 ? 45   PHE B CD2 1 
ATOM   2523 C CE1 . PHE B 1 51  ? 31.804 69.344 -11.589 1.00   23.75 ? 45   PHE B CE1 1 
ATOM   2524 C CE2 . PHE B 1 51  ? 31.589 66.994 -11.870 1.00   20.80 ? 45   PHE B CE2 1 
ATOM   2525 C CZ  . PHE B 1 51  ? 31.112 68.255 -12.058 1.00   22.68 ? 45   PHE B CZ  1 
ATOM   2526 N N   . GLN B 1 52  ? 35.028 69.893 -7.934  1.00   22.99 ? 46   GLN B N   1 
ATOM   2527 C CA  . GLN B 1 52  ? 34.711 71.132 -7.252  1.00   23.43 ? 46   GLN B CA  1 
ATOM   2528 C C   . GLN B 1 52  ? 35.250 72.308 -8.017  1.00   23.78 ? 46   GLN B C   1 
ATOM   2529 O O   . GLN B 1 52  ? 36.214 72.190 -8.784  1.00   23.44 ? 46   GLN B O   1 
ATOM   2530 C CB  . GLN B 1 52  ? 35.314 71.144 -5.852  1.00   24.70 ? 46   GLN B CB  1 
ATOM   2531 C CG  . GLN B 1 52  ? 36.854 71.164 -5.814  1.00   26.48 ? 46   GLN B CG  1 
ATOM   2532 C CD  . GLN B 1 52  ? 37.358 70.996 -4.410  1.00   30.09 ? 46   GLN B CD  1 
ATOM   2533 O OE1 . GLN B 1 52  ? 37.121 69.960 -3.802  1.00   35.84 ? 46   GLN B OE1 1 
ATOM   2534 N NE2 . GLN B 1 52  ? 38.011 72.000 -3.883  1.00   31.46 ? 46   GLN B NE2 1 
ATOM   2535 N N   . SER B 1 53  ? 34.620 73.445 -7.830  1.00   22.73 ? 47   SER B N   1 
ATOM   2536 C CA  . SER B 1 53  ? 35.020 74.648 -8.517  1.00   23.30 ? 47   SER B CA  1 
ATOM   2537 C C   . SER B 1 53  ? 36.367 75.118 -7.955  1.00   23.72 ? 47   SER B C   1 
ATOM   2538 O O   . SER B 1 53  ? 36.696 74.888 -6.803  1.00   23.43 ? 47   SER B O   1 
ATOM   2539 C CB  . SER B 1 53  ? 33.950 75.733 -8.359  1.00   22.35 ? 47   SER B CB  1 
ATOM   2540 O OG  . SER B 1 53  ? 33.714 75.999 -6.999  1.00   20.61 ? 47   SER B OG  1 
ATOM   2541 N N   . LYS B 1 54  ? 37.132 75.761 -8.805  1.00   25.98 ? 48   LYS B N   1 
ATOM   2542 C CA  . LYS B 1 54  ? 38.387 76.386 -8.402  1.00   27.93 ? 48   LYS B CA  1 
ATOM   2543 C C   . LYS B 1 54  ? 38.090 77.552 -7.481  1.00   27.98 ? 48   LYS B C   1 
ATOM   2544 O O   . LYS B 1 54  ? 38.734 77.717 -6.457  1.00   29.18 ? 48   LYS B O   1 
ATOM   2545 C CB  . LYS B 1 54  ? 39.166 76.833 -9.647  1.00   28.54 ? 48   LYS B CB  1 
ATOM   2546 C CG  . LYS B 1 54  ? 39.567 75.671 -10.537 1.00   32.12 ? 48   LYS B CG  1 
ATOM   2547 C CD  . LYS B 1 54  ? 39.914 76.137 -11.964 1.00   37.64 ? 48   LYS B CD  1 
ATOM   2548 C CE  . LYS B 1 54  ? 41.065 75.361 -12.565 1.00   40.94 ? 48   LYS B CE  1 
ATOM   2549 N NZ  . LYS B 1 54  ? 40.705 74.827 -13.895 1.00   44.91 ? 48   LYS B NZ  1 
ATOM   2550 N N   . GLY B 1 55  ? 37.067 78.328 -7.812  1.00   28.06 ? 49   GLY B N   1 
ATOM   2551 C CA  . GLY B 1 55  ? 36.729 79.524 -7.060  1.00   27.85 ? 49   GLY B CA  1 
ATOM   2552 C C   . GLY B 1 55  ? 35.637 79.294 -6.018  1.00   26.99 ? 49   GLY B C   1 
ATOM   2553 O O   . GLY B 1 55  ? 34.981 78.249 -6.001  1.00   25.90 ? 49   GLY B O   1 
ATOM   2554 N N   . SER B 1 56  ? 35.493 80.262 -5.139  1.00   27.10 ? 50   SER B N   1 
ATOM   2555 C CA  . SER B 1 56  ? 34.349 80.367 -4.228  1.00   27.18 ? 50   SER B CA  1 
ATOM   2556 C C   . SER B 1 56  ? 33.539 81.571 -4.632  1.00   25.80 ? 50   SER B C   1 
ATOM   2557 O O   . SER B 1 56  ? 34.095 82.526 -5.172  1.00   25.96 ? 50   SER B O   1 
ATOM   2558 C CB  . SER B 1 56  ? 34.815 80.518 -2.788  1.00   27.85 ? 50   SER B CB  1 
ATOM   2559 O OG  . SER B 1 56  ? 35.355 79.304 -2.323  1.00   33.94 ? 50   SER B OG  1 
ATOM   2560 N N   . TYR B 1 57  ? 32.226 81.542 -4.354  1.00   23.58 ? 51   TYR B N   1 
ATOM   2561 C CA  . TYR B 1 57  ? 31.303 82.553 -4.848  1.00   23.30 ? 51   TYR B CA  1 
ATOM   2562 C C   . TYR B 1 57  ? 30.329 82.988 -3.789  1.00   23.43 ? 51   TYR B C   1 
ATOM   2563 O O   . TYR B 1 57  ? 29.946 82.195 -2.928  1.00   22.85 ? 51   TYR B O   1 
ATOM   2564 C CB  . TYR B 1 57  ? 30.525 82.039 -6.053  1.00   22.51 ? 51   TYR B CB  1 
ATOM   2565 C CG  . TYR B 1 57  ? 31.415 81.633 -7.164  1.00   23.97 ? 51   TYR B CG  1 
ATOM   2566 C CD1 . TYR B 1 57  ? 31.970 80.353 -7.209  1.00   24.73 ? 51   TYR B CD1 1 
ATOM   2567 C CD2 . TYR B 1 57  ? 31.739 82.527 -8.178  1.00   24.79 ? 51   TYR B CD2 1 
ATOM   2568 C CE1 . TYR B 1 57  ? 32.821 79.987 -8.217  1.00   26.46 ? 51   TYR B CE1 1 
ATOM   2569 C CE2 . TYR B 1 57  ? 32.597 82.156 -9.204  1.00   26.38 ? 51   TYR B CE2 1 
ATOM   2570 C CZ  . TYR B 1 57  ? 33.134 80.907 -9.212  1.00   26.56 ? 51   TYR B CZ  1 
ATOM   2571 O OH  . TYR B 1 57  ? 33.980 80.529 -10.216 1.00   28.03 ? 51   TYR B OH  1 
ATOM   2572 N N   . LEU B 1 58  ? 29.954 84.253 -3.837  1.00   22.88 ? 52   LEU B N   1 
ATOM   2573 C CA  . LEU B 1 58  ? 28.853 84.759 -3.046  1.00   23.75 ? 52   LEU B CA  1 
ATOM   2574 C C   . LEU B 1 58  ? 27.836 85.360 -4.002  1.00   23.72 ? 52   LEU B C   1 
ATOM   2575 O O   . LEU B 1 58  ? 28.055 86.452 -4.537  1.00   22.97 ? 52   LEU B O   1 
ATOM   2576 C CB  . LEU B 1 58  ? 29.367 85.786 -2.049  1.00   25.52 ? 52   LEU B CB  1 
ATOM   2577 C CG  . LEU B 1 58  ? 28.567 86.087 -0.801  1.00   29.93 ? 52   LEU B CG  1 
ATOM   2578 C CD1 . LEU B 1 58  ? 28.303 84.816 -0.007  1.00   32.03 ? 52   LEU B CD1 1 
ATOM   2579 C CD2 . LEU B 1 58  ? 29.376 87.078 0.061   1.00   33.56 ? 52   LEU B CD2 1 
ATOM   2580 N N   . PHE B 1 59  ? 26.738 84.624 -4.206  1.00   22.68 ? 53   PHE B N   1 
ATOM   2581 C CA  . PHE B 1 59  ? 25.680 84.937 -5.159  1.00   21.70 ? 53   PHE B CA  1 
ATOM   2582 C C   . PHE B 1 59  ? 26.032 84.604 -6.587  1.00   21.07 ? 53   PHE B C   1 
ATOM   2583 O O   . PHE B 1 59  ? 27.220 84.602 -6.988  1.00   21.88 ? 53   PHE B O   1 
ATOM   2584 C CB  . PHE B 1 59  ? 25.208 86.395 -5.026  1.00   22.25 ? 53   PHE B CB  1 
ATOM   2585 C CG  . PHE B 1 59  ? 24.882 86.791 -3.605  1.00   22.92 ? 53   PHE B CG  1 
ATOM   2586 C CD1 . PHE B 1 59  ? 23.937 86.069 -2.870  1.00   23.10 ? 53   PHE B CD1 1 
ATOM   2587 C CD2 . PHE B 1 59  ? 25.538 87.852 -2.996  1.00   24.15 ? 53   PHE B CD2 1 
ATOM   2588 C CE1 . PHE B 1 59  ? 23.647 86.416 -1.556  1.00   25.50 ? 53   PHE B CE1 1 
ATOM   2589 C CE2 . PHE B 1 59  ? 25.251 88.210 -1.687  1.00   23.23 ? 53   PHE B CE2 1 
ATOM   2590 C CZ  . PHE B 1 59  ? 24.300 87.508 -0.971  1.00   24.93 ? 53   PHE B CZ  1 
ATOM   2591 N N   . GLY B 1 60  ? 25.003 84.312 -7.377  1.00   20.71 ? 54   GLY B N   1 
ATOM   2592 C CA  . GLY B 1 60  ? 25.181 83.995 -8.773  1.00   21.00 ? 54   GLY B CA  1 
ATOM   2593 C C   . GLY B 1 60  ? 24.206 83.025 -9.380  1.00   21.53 ? 54   GLY B C   1 
ATOM   2594 O O   . GLY B 1 60  ? 23.192 82.658 -8.790  1.00   21.17 ? 54   GLY B O   1 
ATOM   2595 N N   . HIS B 1 61  ? 24.530 82.613 -10.588 1.00   20.85 ? 55   HIS B N   1 
ATOM   2596 C CA  . HIS B 1 61  ? 23.766 81.669 -11.368 1.00   21.99 ? 55   HIS B CA  1 
ATOM   2597 C C   . HIS B 1 61  ? 24.675 80.507 -11.739 1.00   21.96 ? 55   HIS B C   1 
ATOM   2598 O O   . HIS B 1 61  ? 25.712 80.691 -12.376 1.00   23.86 ? 55   HIS B O   1 
ATOM   2599 C CB  . HIS B 1 61  ? 23.240 82.382 -12.622 1.00   21.94 ? 55   HIS B CB  1 
ATOM   2600 C CG  . HIS B 1 61  ? 22.344 81.547 -13.474 1.00   26.10 ? 55   HIS B CG  1 
ATOM   2601 N ND1 . HIS B 1 61  ? 22.413 81.575 -14.852 1.00   29.23 ? 55   HIS B ND1 1 
ATOM   2602 C CD2 . HIS B 1 61  ? 21.347 80.687 -13.160 1.00   27.78 ? 55   HIS B CD2 1 
ATOM   2603 C CE1 . HIS B 1 61  ? 21.517 80.729 -15.348 1.00   32.06 ? 55   HIS B CE1 1 
ATOM   2604 N NE2 . HIS B 1 61  ? 20.854 80.188 -14.346 1.00   29.04 ? 55   HIS B NE2 1 
ATOM   2605 N N   . PHE B 1 62  ? 24.301 79.308 -11.309 1.00   20.77 ? 56   PHE B N   1 
ATOM   2606 C CA  . PHE B 1 62  ? 25.128 78.115 -11.410 1.00   20.53 ? 56   PHE B CA  1 
ATOM   2607 C C   . PHE B 1 62  ? 24.300 77.037 -12.079 1.00   22.21 ? 56   PHE B C   1 
ATOM   2608 O O   . PHE B 1 62  ? 23.186 76.740 -11.659 1.00   21.53 ? 56   PHE B O   1 
ATOM   2609 C CB  . PHE B 1 62  ? 25.561 77.684 -9.993  1.00   19.76 ? 56   PHE B CB  1 
ATOM   2610 C CG  . PHE B 1 62  ? 26.121 78.796 -9.192  1.00   18.93 ? 56   PHE B CG  1 
ATOM   2611 C CD1 . PHE B 1 62  ? 27.463 79.140 -9.301  1.00   20.84 ? 56   PHE B CD1 1 
ATOM   2612 C CD2 . PHE B 1 62  ? 25.319 79.580 -8.407  1.00   17.49 ? 56   PHE B CD2 1 
ATOM   2613 C CE1 . PHE B 1 62  ? 27.957 80.191 -8.590  1.00   20.62 ? 56   PHE B CE1 1 
ATOM   2614 C CE2 . PHE B 1 62  ? 25.816 80.622 -7.725  1.00   19.15 ? 56   PHE B CE2 1 
ATOM   2615 C CZ  . PHE B 1 62  ? 27.136 80.930 -7.791  1.00   21.31 ? 56   PHE B CZ  1 
ATOM   2616 N N   . SER B 1 63  ? 24.829 76.437 -13.128 1.00   21.76 ? 57   SER B N   1 
ATOM   2617 C CA  . SER B 1 63  ? 24.075 75.474 -13.896 1.00   23.75 ? 57   SER B CA  1 
ATOM   2618 C C   . SER B 1 63  ? 24.952 74.332 -14.345 1.00   24.04 ? 57   SER B C   1 
ATOM   2619 O O   . SER B 1 63  ? 26.139 74.518 -14.659 1.00   26.03 ? 57   SER B O   1 
ATOM   2620 C CB  . SER B 1 63  ? 23.393 76.159 -15.099 1.00   24.41 ? 57   SER B CB  1 
ATOM   2621 O OG  . SER B 1 63  ? 22.487 75.244 -15.686 1.00   29.36 ? 57   SER B OG  1 
ATOM   2622 N N   . MET B 1 64  ? 24.373 73.156 -14.355 1.00   23.67 ? 58   MET B N   1 
ATOM   2623 C CA  . MET B 1 64  ? 24.984 71.968 -14.878 1.00   24.06 ? 58   MET B CA  1 
ATOM   2624 C C   . MET B 1 64  ? 23.981 71.210 -15.723 1.00   23.85 ? 58   MET B C   1 
ATOM   2625 O O   . MET B 1 64  ? 22.816 71.067 -15.337 1.00   23.64 ? 58   MET B O   1 
ATOM   2626 C CB  . MET B 1 64  ? 25.407 71.093 -13.712 1.00   24.07 ? 58   MET B CB  1 
ATOM   2627 C CG  . MET B 1 64  ? 26.306 70.013 -14.100 1.00   28.13 ? 58   MET B CG  1 
ATOM   2628 S SD  . MET B 1 64  ? 27.999 70.664 -14.260 1.00   31.91 ? 58   MET B SD  1 
ATOM   2629 C CE  . MET B 1 64  ? 28.399 70.907 -12.583 1.00   30.86 ? 58   MET B CE  1 
ATOM   2630 N N   . GLN B 1 65  ? 24.416 70.708 -16.881 1.00   21.90 ? 59   GLN B N   1 
ATOM   2631 C CA  . GLN B 1 65  ? 23.631 69.749 -17.620 1.00   22.10 ? 59   GLN B CA  1 
ATOM   2632 C C   . GLN B 1 65  ? 24.005 68.355 -17.140 1.00   22.17 ? 59   GLN B C   1 
ATOM   2633 O O   . GLN B 1 65  ? 25.183 68.031 -17.101 1.00   24.02 ? 59   GLN B O   1 
ATOM   2634 C CB  . GLN B 1 65  ? 23.950 69.845 -19.129 1.00   23.07 ? 59   GLN B CB  1 
ATOM   2635 C CG  . GLN B 1 65  ? 22.872 70.426 -19.912 1.00   25.80 ? 59   GLN B CG  1 
ATOM   2636 C CD  . GLN B 1 65  ? 23.131 70.289 -21.410 1.00   28.79 ? 59   GLN B CD  1 
ATOM   2637 O OE1 . GLN B 1 65  ? 22.363 69.665 -22.113 1.00   35.29 ? 59   GLN B OE1 1 
ATOM   2638 N NE2 . GLN B 1 65  ? 24.201 70.870 -21.864 1.00   31.72 ? 59   GLN B NE2 1 
ATOM   2639 N N   . MET B 1 66  ? 23.036 67.538 -16.770 1.00   19.63 ? 60   MET B N   1 
ATOM   2640 C CA  . MET B 1 66  ? 23.283 66.220 -16.236 1.00   20.18 ? 60   MET B CA  1 
ATOM   2641 C C   . MET B 1 66  ? 22.360 65.173 -16.827 1.00   20.58 ? 60   MET B C   1 
ATOM   2642 O O   . MET B 1 66  ? 21.192 65.423 -17.097 1.00   20.50 ? 60   MET B O   1 
ATOM   2643 C CB  . MET B 1 66  ? 23.125 66.221 -14.679 1.00   19.73 ? 60   MET B CB  1 
ATOM   2644 C CG  . MET B 1 66  ? 24.021 67.202 -14.028 1.00   19.93 ? 60   MET B CG  1 
ATOM   2645 S SD  . MET B 1 66  ? 23.672 67.459 -12.232 1.00   20.81 ? 60   MET B SD  1 
ATOM   2646 C CE  . MET B 1 66  ? 23.911 65.911 -11.667 1.00   20.09 ? 60   MET B CE  1 
ATOM   2647 N N   . LYS B 1 67  ? 22.918 63.979 -17.001 1.00   20.12 ? 61   LYS B N   1 
ATOM   2648 C CA  . LYS B 1 67  ? 22.211 62.801 -17.383 1.00   21.01 ? 61   LYS B CA  1 
ATOM   2649 C C   . LYS B 1 67  ? 22.570 61.745 -16.382 1.00   20.96 ? 61   LYS B C   1 
ATOM   2650 O O   . LYS B 1 67  ? 23.758 61.444 -16.163 1.00   20.99 ? 61   LYS B O   1 
ATOM   2651 C CB  . LYS B 1 67  ? 22.589 62.365 -18.810 1.00   21.57 ? 61   LYS B CB  1 
ATOM   2652 C CG  . LYS B 1 67  ? 21.833 61.158 -19.259 1.00   24.34 ? 61   LYS B CG  1 
ATOM   2653 C CD  . LYS B 1 67  ? 21.860 60.987 -20.795 1.00   30.37 ? 61   LYS B CD  1 
ATOM   2654 C CE  . LYS B 1 67  ? 23.243 60.740 -21.282 1.00   34.19 ? 61   LYS B CE  1 
ATOM   2655 N NZ  . LYS B 1 67  ? 23.762 59.540 -20.660 1.00   36.93 ? 61   LYS B NZ  1 
ATOM   2656 N N   . LEU B 1 68  ? 21.543 61.196 -15.739 1.00   20.24 ? 62   LEU B N   1 
ATOM   2657 C CA  . LEU B 1 68  ? 21.713 60.373 -14.559 1.00   21.67 ? 62   LEU B CA  1 
ATOM   2658 C C   . LEU B 1 68  ? 22.026 58.906 -14.851 1.00   21.62 ? 62   LEU B C   1 
ATOM   2659 O O   . LEU B 1 68  ? 22.100 58.483 -16.019 1.00   22.73 ? 62   LEU B O   1 
ATOM   2660 C CB  . LEU B 1 68  ? 20.492 60.531 -13.634 1.00   21.90 ? 62   LEU B CB  1 
ATOM   2661 C CG  . LEU B 1 68  ? 20.514 61.791 -12.738 1.00   24.63 ? 62   LEU B CG  1 
ATOM   2662 C CD1 . LEU B 1 68  ? 21.608 61.748 -11.677 1.00   27.48 ? 62   LEU B CD1 1 
ATOM   2663 C CD2 . LEU B 1 68  ? 20.681 63.057 -13.466 1.00   25.30 ? 62   LEU B CD2 1 
ATOM   2664 N N   . VAL B 1 69  ? 22.211 58.129 -13.803 1.00   22.92 ? 63   VAL B N   1 
ATOM   2665 C CA  . VAL B 1 69  ? 22.661 56.745 -13.941 1.00   23.44 ? 63   VAL B CA  1 
ATOM   2666 C C   . VAL B 1 69  ? 21.563 55.853 -14.514 1.00   24.16 ? 63   VAL B C   1 
ATOM   2667 O O   . VAL B 1 69  ? 20.513 55.741 -13.911 1.00   23.69 ? 63   VAL B O   1 
ATOM   2668 C CB  . VAL B 1 69  ? 23.107 56.166 -12.586 1.00   23.13 ? 63   VAL B CB  1 
ATOM   2669 C CG1 . VAL B 1 69  ? 23.563 54.744 -12.763 1.00   23.60 ? 63   VAL B CG1 1 
ATOM   2670 C CG2 . VAL B 1 69  ? 24.219 57.044 -11.966 1.00   24.66 ? 63   VAL B CG2 1 
ATOM   2671 N N   . PRO B 1 70  ? 21.793 55.220 -15.678 1.00   26.27 ? 64   PRO B N   1 
ATOM   2672 C CA  . PRO B 1 70  ? 20.770 54.360 -16.299 1.00   26.98 ? 64   PRO B CA  1 
ATOM   2673 C C   . PRO B 1 70  ? 20.637 53.007 -15.619 1.00   27.98 ? 64   PRO B C   1 
ATOM   2674 O O   . PRO B 1 70  ? 21.486 52.626 -14.792 1.00   27.82 ? 64   PRO B O   1 
ATOM   2675 C CB  . PRO B 1 70  ? 21.270 54.205 -17.746 1.00   27.75 ? 64   PRO B CB  1 
ATOM   2676 C CG  . PRO B 1 70  ? 22.721 54.362 -17.689 1.00   28.81 ? 64   PRO B CG  1 
ATOM   2677 C CD  . PRO B 1 70  ? 23.012 55.285 -16.501 1.00   26.87 ? 64   PRO B CD  1 
ATOM   2678 N N   . GLY B 1 71  ? 19.561 52.286 -15.927 1.00   27.92 ? 65   GLY B N   1 
ATOM   2679 C CA  . GLY B 1 71  ? 19.355 50.952 -15.403 1.00   28.17 ? 65   GLY B CA  1 
ATOM   2680 C C   . GLY B 1 71  ? 19.162 50.916 -13.913 1.00   28.94 ? 65   GLY B C   1 
ATOM   2681 O O   . GLY B 1 71  ? 18.409 51.710 -13.380 1.00   29.65 ? 65   GLY B O   1 
ATOM   2682 N N   . ASP B 1 72  ? 19.815 49.972 -13.236 1.00   28.70 ? 66   ASP B N   1 
ATOM   2683 C CA  . ASP B 1 72  ? 19.774 49.890 -11.791 1.00   29.33 ? 66   ASP B CA  1 
ATOM   2684 C C   . ASP B 1 72  ? 20.742 50.942 -11.229 1.00   28.09 ? 66   ASP B C   1 
ATOM   2685 O O   . ASP B 1 72  ? 21.968 50.877 -11.422 1.00   28.53 ? 66   ASP B O   1 
ATOM   2686 C CB  . ASP B 1 72  ? 20.159 48.487 -11.316 1.00   30.18 ? 66   ASP B CB  1 
ATOM   2687 C CG  . ASP B 1 72  ? 19.885 48.249 -9.851  1.00   32.44 ? 66   ASP B CG  1 
ATOM   2688 O OD1 . ASP B 1 72  ? 19.723 49.191 -9.031  1.00   32.90 ? 66   ASP B OD1 1 
ATOM   2689 O OD2 . ASP B 1 72  ? 19.819 47.094 -9.389  1.00   38.23 ? 66   ASP B OD2 1 
ATOM   2690 N N   . SER B 1 73  ? 20.165 51.920 -10.543 1.00   27.10 ? 67   SER B N   1 
ATOM   2691 C CA  . SER B 1 73  ? 20.921 52.962 -9.857  1.00   24.84 ? 67   SER B CA  1 
ATOM   2692 C C   . SER B 1 73  ? 20.603 52.958 -8.359  1.00   23.96 ? 67   SER B C   1 
ATOM   2693 O O   . SER B 1 73  ? 20.925 53.911 -7.659  1.00   23.90 ? 67   SER B O   1 
ATOM   2694 C CB  . SER B 1 73  ? 20.609 54.312 -10.503 1.00   25.00 ? 67   SER B CB  1 
ATOM   2695 O OG  . SER B 1 73  ? 19.224 54.600 -10.446 1.00   22.93 ? 67   SER B OG  1 
ATOM   2696 N N   . ALA B 1 74  ? 19.978 51.897 -7.839  1.00   23.52 ? 68   ALA B N   1 
ATOM   2697 C CA  . ALA B 1 74  ? 19.536 51.892 -6.443  1.00   23.73 ? 68   ALA B CA  1 
ATOM   2698 C C   . ALA B 1 74  ? 20.706 52.084 -5.498  1.00   24.21 ? 68   ALA B C   1 
ATOM   2699 O O   . ALA B 1 74  ? 21.799 51.563 -5.747  1.00   26.42 ? 68   ALA B O   1 
ATOM   2700 C CB  . ALA B 1 74  ? 18.837 50.620 -6.098  1.00   24.75 ? 68   ALA B CB  1 
ATOM   2701 N N   . GLY B 1 75  ? 20.455 52.815 -4.429  1.00   23.96 ? 69   GLY B N   1 
ATOM   2702 C CA  . GLY B 1 75  ? 21.437 53.134 -3.418  1.00   24.71 ? 69   GLY B CA  1 
ATOM   2703 C C   . GLY B 1 75  ? 22.423 54.233 -3.786  1.00   24.05 ? 69   GLY B C   1 
ATOM   2704 O O   . GLY B 1 75  ? 23.195 54.631 -2.917  1.00   25.93 ? 69   GLY B O   1 
ATOM   2705 N N   . THR B 1 76  ? 22.415 54.733 -5.022  1.00   23.00 ? 70   THR B N   1 
ATOM   2706 C CA  . THR B 1 76  ? 23.363 55.768 -5.406  1.00   21.35 ? 70   THR B CA  1 
ATOM   2707 C C   . THR B 1 76  ? 22.803 57.179 -5.294  1.00   20.09 ? 70   THR B C   1 
ATOM   2708 O O   . THR B 1 76  ? 21.606 57.398 -5.459  1.00   20.35 ? 70   THR B O   1 
ATOM   2709 C CB  . THR B 1 76  ? 23.920 55.559 -6.799  1.00   21.64 ? 70   THR B CB  1 
ATOM   2710 O OG1 . THR B 1 76  ? 22.921 55.825 -7.780  1.00   22.43 ? 70   THR B OG1 1 
ATOM   2711 C CG2 . THR B 1 76  ? 24.356 54.122 -7.014  1.00   22.76 ? 70   THR B CG2 1 
ATOM   2712 N N   . VAL B 1 77  ? 23.687 58.122 -5.024  1.00   19.41 ? 71   VAL B N   1 
ATOM   2713 C CA  . VAL B 1 77  ? 23.344 59.538 -4.964  1.00   19.10 ? 71   VAL B CA  1 
ATOM   2714 C C   . VAL B 1 77  ? 24.278 60.288 -5.879  1.00   18.95 ? 71   VAL B C   1 
ATOM   2715 O O   . VAL B 1 77  ? 25.508 60.200 -5.734  1.00   18.51 ? 71   VAL B O   1 
ATOM   2716 C CB  . VAL B 1 77  ? 23.474 60.105 -3.529  1.00   20.07 ? 71   VAL B CB  1 
ATOM   2717 C CG1 . VAL B 1 77  ? 23.166 61.583 -3.472  1.00   20.27 ? 71   VAL B CG1 1 
ATOM   2718 C CG2 . VAL B 1 77  ? 22.581 59.342 -2.574  1.00   23.57 ? 71   VAL B CG2 1 
ATOM   2719 N N   . THR B 1 78  ? 23.702 61.012 -6.839  1.00   17.52 ? 72   THR B N   1 
ATOM   2720 C CA  . THR B 1 78  ? 24.419 61.940 -7.673  1.00   18.19 ? 72   THR B CA  1 
ATOM   2721 C C   . THR B 1 78  ? 24.086 63.326 -7.170  1.00   19.31 ? 72   THR B C   1 
ATOM   2722 O O   . THR B 1 78  ? 22.901 63.710 -7.109  1.00   16.95 ? 72   THR B O   1 
ATOM   2723 C CB  . THR B 1 78  ? 23.980 61.794 -9.138  1.00   18.60 ? 72   THR B CB  1 
ATOM   2724 O OG1 . THR B 1 78  ? 24.136 60.433 -9.562  1.00   20.66 ? 72   THR B OG1 1 
ATOM   2725 C CG2 . THR B 1 78  ? 24.856 62.585 -10.010 1.00   19.81 ? 72   THR B CG2 1 
ATOM   2726 N N   . ALA B 1 79  ? 25.108 64.068 -6.779  1.00   19.87 ? 73   ALA B N   1 
ATOM   2727 C CA  . ALA B 1 79  ? 24.944 65.368 -6.120  1.00   19.92 ? 73   ALA B CA  1 
ATOM   2728 C C   . ALA B 1 79  ? 25.532 66.486 -6.934  1.00   21.22 ? 73   ALA B C   1 
ATOM   2729 O O   . ALA B 1 79  ? 26.557 66.309 -7.594  1.00   21.24 ? 73   ALA B O   1 
ATOM   2730 C CB  . ALA B 1 79  ? 25.545 65.334 -4.753  1.00   21.51 ? 73   ALA B CB  1 
ATOM   2731 N N   . PHE B 1 80  ? 24.834 67.623 -6.952  1.00   18.51 ? 74   PHE B N   1 
ATOM   2732 C CA  . PHE B 1 80  ? 25.303 68.874 -7.517  1.00   17.83 ? 74   PHE B CA  1 
ATOM   2733 C C   . PHE B 1 80  ? 24.907 69.912 -6.496  1.00   17.50 ? 74   PHE B C   1 
ATOM   2734 O O   . PHE B 1 80  ? 23.720 70.096 -6.244  1.00   16.16 ? 74   PHE B O   1 
ATOM   2735 C CB  . PHE B 1 80  ? 24.627 69.137 -8.891  1.00   17.85 ? 74   PHE B CB  1 
ATOM   2736 C CG  . PHE B 1 80  ? 24.744 70.547 -9.385  1.00   18.31 ? 74   PHE B CG  1 
ATOM   2737 C CD1 . PHE B 1 80  ? 25.986 71.175 -9.464  1.00   21.48 ? 74   PHE B CD1 1 
ATOM   2738 C CD2 . PHE B 1 80  ? 23.620 71.253 -9.806  1.00   21.54 ? 74   PHE B CD2 1 
ATOM   2739 C CE1 . PHE B 1 80  ? 26.089 72.474 -9.908  1.00   23.11 ? 74   PHE B CE1 1 
ATOM   2740 C CE2 . PHE B 1 80  ? 23.735 72.565 -10.248 1.00   22.43 ? 74   PHE B CE2 1 
ATOM   2741 C CZ  . PHE B 1 80  ? 24.969 73.166 -10.308 1.00   23.56 ? 74   PHE B CZ  1 
ATOM   2742 N N   . TYR B 1 81  ? 25.867 70.557 -5.845  1.00   17.33 ? 75   TYR B N   1 
ATOM   2743 C CA  . TYR B 1 81  ? 25.552 71.424 -4.732  1.00   17.47 ? 75   TYR B CA  1 
ATOM   2744 C C   . TYR B 1 81  ? 26.573 72.534 -4.528  1.00   18.48 ? 75   TYR B C   1 
ATOM   2745 O O   . TYR B 1 81  ? 27.666 72.489 -5.102  1.00   18.59 ? 75   TYR B O   1 
ATOM   2746 C CB  . TYR B 1 81  ? 25.429 70.583 -3.461  1.00   18.27 ? 75   TYR B CB  1 
ATOM   2747 C CG  . TYR B 1 81  ? 26.679 69.845 -3.023  1.00   18.22 ? 75   TYR B CG  1 
ATOM   2748 C CD1 . TYR B 1 81  ? 27.029 68.636 -3.606  1.00   19.18 ? 75   TYR B CD1 1 
ATOM   2749 C CD2 . TYR B 1 81  ? 27.456 70.323 -1.973  1.00   19.26 ? 75   TYR B CD2 1 
ATOM   2750 C CE1 . TYR B 1 81  ? 28.146 67.896 -3.146  1.00   21.38 ? 75   TYR B CE1 1 
ATOM   2751 C CE2 . TYR B 1 81  ? 28.553 69.627 -1.529  1.00   21.45 ? 75   TYR B CE2 1 
ATOM   2752 C CZ  . TYR B 1 81  ? 28.895 68.422 -2.114  1.00   23.54 ? 75   TYR B CZ  1 
ATOM   2753 O OH  . TYR B 1 81  ? 30.010 67.769 -1.654  1.00   23.53 ? 75   TYR B OH  1 
ATOM   2754 N N   . LEU B 1 82  ? 26.180 73.548 -3.778  1.00   17.58 ? 76   LEU B N   1 
ATOM   2755 C CA  . LEU B 1 82  ? 27.068 74.597 -3.323  1.00   18.26 ? 76   LEU B CA  1 
ATOM   2756 C C   . LEU B 1 82  ? 27.217 74.448 -1.828  1.00   18.54 ? 76   LEU B C   1 
ATOM   2757 O O   . LEU B 1 82  ? 26.250 74.172 -1.156  1.00   17.12 ? 76   LEU B O   1 
ATOM   2758 C CB  . LEU B 1 82  ? 26.482 75.962 -3.575  1.00   19.49 ? 76   LEU B CB  1 
ATOM   2759 C CG  . LEU B 1 82  ? 26.639 76.373 -5.047  1.00   21.84 ? 76   LEU B CG  1 
ATOM   2760 C CD1 . LEU B 1 82  ? 25.519 75.801 -5.889  1.00   25.63 ? 76   LEU B CD1 1 
ATOM   2761 C CD2 . LEU B 1 82  ? 26.680 77.852 -5.123  1.00   28.54 ? 76   LEU B CD2 1 
ATOM   2762 N N   . SER B 1 83  ? 28.409 74.665 -1.323  1.00   18.94 ? 77   SER B N   1 
ATOM   2763 C CA  . SER B 1 83  ? 28.639 74.624 0.128   1.00   20.09 ? 77   SER B CA  1 
ATOM   2764 C C   . SER B 1 83  ? 29.785 75.519 0.557   1.00   21.23 ? 77   SER B C   1 
ATOM   2765 O O   . SER B 1 83  ? 30.763 75.633 -0.156  1.00   20.47 ? 77   SER B O   1 
ATOM   2766 C CB  . SER B 1 83  ? 28.920 73.190 0.579   1.00   20.38 ? 77   SER B CB  1 
ATOM   2767 O OG  . SER B 1 83  ? 29.053 73.163 2.010   1.00   20.64 ? 77   SER B OG  1 
ATOM   2768 N N   . SER B 1 84  ? 29.690 76.087 1.765   1.00   22.91 ? 78   SER B N   1 
ATOM   2769 C CA  . SER B 1 84  ? 30.789 76.834 2.410   1.00   25.26 ? 78   SER B CA  1 
ATOM   2770 C C   . SER B 1 84  ? 31.679 75.858 3.205   1.00   29.21 ? 78   SER B C   1 
ATOM   2771 O O   . SER B 1 84  ? 31.561 74.652 2.967   1.00   28.78 ? 78   SER B O   1 
ATOM   2772 C CB  . SER B 1 84  ? 30.255 77.994 3.272   1.00   24.70 ? 78   SER B CB  1 
ATOM   2773 O OG  . SER B 1 84  ? 29.524 77.494 4.375   1.00   22.78 ? 78   SER B OG  1 
ATOM   2774 N N   . GLN B 1 85  ? 32.565 76.250 4.118   1.00   34.85 ? 79   GLN B N   1 
ATOM   2775 C CA  . GLN B 1 85  ? 33.465 75.191 4.578   1.00   39.11 ? 79   GLN B CA  1 
ATOM   2776 C C   . GLN B 1 85  ? 33.503 75.020 6.085   1.00   42.38 ? 79   GLN B C   1 
ATOM   2777 O O   . GLN B 1 85  ? 34.319 74.288 6.638   1.00   44.02 ? 79   GLN B O   1 
ATOM   2778 C CB  . GLN B 1 85  ? 34.866 75.470 4.033   1.00   40.25 ? 79   GLN B CB  1 
ATOM   2779 C CG  . GLN B 1 85  ? 35.169 74.903 2.639   1.00   42.22 ? 79   GLN B CG  1 
ATOM   2780 C CD  . GLN B 1 85  ? 34.546 75.672 1.495   1.00   44.37 ? 79   GLN B CD  1 
ATOM   2781 O OE1 . GLN B 1 85  ? 33.611 75.187 0.871   1.00   41.43 ? 79   GLN B OE1 1 
ATOM   2782 N NE2 . GLN B 1 85  ? 34.914 76.868 1.067   1.00   44.26 ? 79   GLN B NE2 1 
ATOM   2783 N N   . ASN B 1 86  ? 32.610 75.753 6.773   1.00   45.10 ? 80   ASN B N   1 
ATOM   2784 C CA  . ASN B 1 86  ? 32.632 75.831 8.231   1.00   46.93 ? 80   ASN B CA  1 
ATOM   2785 C C   . ASN B 1 86  ? 31.642 74.969 8.980   1.00   47.26 ? 80   ASN B C   1 
ATOM   2786 O O   . ASN B 1 86  ? 30.780 74.289 8.430   1.00   48.50 ? 80   ASN B O   1 
ATOM   2787 C CB  . ASN B 1 86  ? 32.504 77.303 8.638   1.00   47.73 ? 80   ASN B CB  1 
ATOM   2788 C CG  . ASN B 1 86  ? 31.187 77.650 9.349   1.00   50.27 ? 80   ASN B CG  1 
ATOM   2789 O OD1 . ASN B 1 86  ? 30.722 76.906 10.211  1.00   54.00 ? 80   ASN B OD1 1 
ATOM   2790 N ND2 . ASN B 1 86  ? 30.608 78.781 8.976   1.00   52.56 ? 80   ASN B ND2 1 
ATOM   2791 N N   . SER B 1 87  ? 31.836 75.042 10.271  1.00   46.89 ? 81   SER B N   1 
ATOM   2792 C CA  . SER B 1 87  ? 31.092 74.273 11.248  1.00   46.18 ? 81   SER B CA  1 
ATOM   2793 C C   . SER B 1 87  ? 29.600 74.632 11.244  1.00   44.64 ? 81   SER B C   1 
ATOM   2794 O O   . SER B 1 87  ? 28.758 73.821 11.618  1.00   45.97 ? 81   SER B O   1 
ATOM   2795 C CB  . SER B 1 87  ? 31.674 74.488 12.655  1.00   46.78 ? 81   SER B CB  1 
ATOM   2796 O OG  . SER B 1 87  ? 32.641 75.524 12.653  1.00   49.00 ? 81   SER B OG  1 
ATOM   2797 N N   . GLU B 1 88  ? 29.305 75.834 10.810  1.00   40.93 ? 82   GLU B N   1 
ATOM   2798 C CA  . GLU B 1 88  ? 27.924 76.317 10.674  1.00   38.41 ? 82   GLU B CA  1 
ATOM   2799 C C   . GLU B 1 88  ? 27.823 76.764 9.254   1.00   34.71 ? 82   GLU B C   1 
ATOM   2800 O O   . GLU B 1 88  ? 27.523 77.909 8.955   1.00   33.95 ? 82   GLU B O   1 
ATOM   2801 C CB  . GLU B 1 88  ? 27.600 77.468 11.627  1.00   39.19 ? 82   GLU B CB  1 
ATOM   2802 C CG  . GLU B 1 88  ? 28.640 77.615 12.726  1.00   42.88 ? 82   GLU B CG  1 
ATOM   2803 C CD  . GLU B 1 88  ? 28.132 78.451 13.868  1.00   47.49 ? 82   GLU B CD  1 
ATOM   2804 O OE1 . GLU B 1 88  ? 26.946 78.873 13.832  1.00   52.22 ? 82   GLU B OE1 1 
ATOM   2805 O OE2 . GLU B 1 88  ? 28.908 78.682 14.806  1.00   52.14 ? 82   GLU B OE2 1 
ATOM   2806 N N   . HIS B 1 89  ? 28.092 75.823 8.396   1.00   31.19 ? 83   HIS B N   1 
ATOM   2807 C CA  . HIS B 1 89  ? 28.130 76.014 6.976   1.00   28.86 ? 83   HIS B CA  1 
ATOM   2808 C C   . HIS B 1 89  ? 26.750 76.232 6.353   1.00   26.80 ? 83   HIS B C   1 
ATOM   2809 O O   . HIS B 1 89  ? 25.735 75.845 6.905   1.00   24.80 ? 83   HIS B O   1 
ATOM   2810 C CB  . HIS B 1 89  ? 28.839 74.824 6.341   1.00   28.83 ? 83   HIS B CB  1 
ATOM   2811 C CG  . HIS B 1 89  ? 27.935 73.611 6.054   1.00   30.38 ? 83   HIS B CG  1 
ATOM   2812 N ND1 . HIS B 1 89  ? 27.087 73.074 6.988   1.00   31.24 ? 83   HIS B ND1 1 
ATOM   2813 C CD2 . HIS B 1 89  ? 27.777 72.899 4.912   1.00   32.58 ? 83   HIS B CD2 1 
ATOM   2814 C CE1 . HIS B 1 89  ? 26.433 72.068 6.419   1.00   33.64 ? 83   HIS B CE1 1 
ATOM   2815 N NE2 . HIS B 1 89  ? 26.839 71.956 5.155   1.00   32.23 ? 83   HIS B NE2 1 
ATOM   2816 N N   . ASP B 1 90  ? 26.763 76.858 5.189   1.00   24.13 ? 84   ASP B N   1 
ATOM   2817 C CA  . ASP B 1 90  ? 25.593 77.099 4.348   1.00   22.48 ? 84   ASP B CA  1 
ATOM   2818 C C   . ASP B 1 90  ? 25.751 76.140 3.158   1.00   20.71 ? 84   ASP B C   1 
ATOM   2819 O O   . ASP B 1 90  ? 26.870 75.849 2.723   1.00   19.02 ? 84   ASP B O   1 
ATOM   2820 C CB  . ASP B 1 90  ? 25.533 78.516 3.787   1.00   22.62 ? 84   ASP B CB  1 
ATOM   2821 C CG  . ASP B 1 90  ? 25.297 79.587 4.844   1.00   25.13 ? 84   ASP B CG  1 
ATOM   2822 O OD1 . ASP B 1 90  ? 24.772 79.261 5.916   1.00   25.04 ? 84   ASP B OD1 1 
ATOM   2823 O OD2 . ASP B 1 90  ? 25.651 80.760 4.581   1.00   24.74 ? 84   ASP B OD2 1 
ATOM   2824 N N   . GLU B 1 91  ? 24.637 75.669 2.644   1.00   19.49 ? 85   GLU B N   1 
ATOM   2825 C CA  . GLU B 1 91  ? 24.703 74.673 1.566   1.00   19.68 ? 85   GLU B CA  1 
ATOM   2826 C C   . GLU B 1 91  ? 23.377 74.642 0.801   1.00   19.20 ? 85   GLU B C   1 
ATOM   2827 O O   . GLU B 1 91  ? 22.292 74.794 1.372   1.00   17.56 ? 85   GLU B O   1 
ATOM   2828 C CB  . GLU B 1 91  ? 25.106 73.291 2.117   1.00   20.59 ? 85   GLU B CB  1 
ATOM   2829 C CG  . GLU B 1 91  ? 25.011 72.116 1.144   1.00   22.99 ? 85   GLU B CG  1 
ATOM   2830 C CD  . GLU B 1 91  ? 25.419 70.784 1.773   1.00   26.59 ? 85   GLU B CD  1 
ATOM   2831 O OE1 . GLU B 1 91  ? 25.879 70.760 2.942   1.00   28.82 ? 85   GLU B OE1 1 
ATOM   2832 O OE2 . GLU B 1 91  ? 25.275 69.757 1.105   1.00   26.37 ? 85   GLU B OE2 1 
ATOM   2833 N N   . ILE B 1 92  ? 23.478 74.465 -0.520  1.00   17.86 ? 86   ILE B N   1 
ATOM   2834 C CA  . ILE B 1 92  ? 22.312 74.397 -1.388  1.00   18.78 ? 86   ILE B CA  1 
ATOM   2835 C C   . ILE B 1 92  ? 22.484 73.110 -2.211  1.00   18.41 ? 86   ILE B C   1 
ATOM   2836 O O   . ILE B 1 92  ? 23.452 73.023 -2.967  1.00   16.62 ? 86   ILE B O   1 
ATOM   2837 C CB  . ILE B 1 92  ? 22.330 75.619 -2.333  1.00   18.93 ? 86   ILE B CB  1 
ATOM   2838 C CG1 . ILE B 1 92  ? 22.283 76.936 -1.547  1.00   22.39 ? 86   ILE B CG1 1 
ATOM   2839 C CG2 . ILE B 1 92  ? 21.227 75.520 -3.354  1.00   19.16 ? 86   ILE B CG2 1 
ATOM   2840 C CD1 . ILE B 1 92  ? 22.457 78.223 -2.410  1.00   23.21 ? 86   ILE B CD1 1 
ATOM   2841 N N   . ASP B 1 93  ? 21.574 72.140 -2.099  1.00   17.78 ? 87   ASP B N   1 
ATOM   2842 C CA  . ASP B 1 93  ? 21.776 70.786 -2.647  1.00   18.60 ? 87   ASP B CA  1 
ATOM   2843 C C   . ASP B 1 93  ? 20.751 70.338 -3.656  1.00   19.22 ? 87   ASP B C   1 
ATOM   2844 O O   . ASP B 1 93  ? 19.551 70.491 -3.405  1.00   18.42 ? 87   ASP B O   1 
ATOM   2845 C CB  . ASP B 1 93  ? 21.663 69.698 -1.581  1.00   20.05 ? 87   ASP B CB  1 
ATOM   2846 C CG  . ASP B 1 93  ? 22.638 69.836 -0.488  1.00   25.90 ? 87   ASP B CG  1 
ATOM   2847 O OD1 . ASP B 1 93  ? 23.868 69.920 -0.787  1.00   27.32 ? 87   ASP B OD1 1 
ATOM   2848 O OD2 . ASP B 1 93  ? 22.265 69.820 0.701   1.00   27.81 ? 87   ASP B OD2 1 
ATOM   2849 N N   . PHE B 1 94  ? 21.229 69.763 -4.778  1.00   17.33 ? 88   PHE B N   1 
ATOM   2850 C CA  . PHE B 1 94  ? 20.494 68.824 -5.615  1.00   17.03 ? 88   PHE B CA  1 
ATOM   2851 C C   . PHE B 1 94  ? 21.115 67.435 -5.334  1.00   17.01 ? 88   PHE B C   1 
ATOM   2852 O O   . PHE B 1 94  ? 22.348 67.255 -5.492  1.00   17.01 ? 88   PHE B O   1 
ATOM   2853 C CB  . PHE B 1 94  ? 20.695 69.076 -7.118  1.00   17.08 ? 88   PHE B CB  1 
ATOM   2854 C CG  . PHE B 1 94  ? 19.963 70.277 -7.699  1.00   16.73 ? 88   PHE B CG  1 
ATOM   2855 C CD1 . PHE B 1 94  ? 20.571 71.507 -7.786  1.00   20.71 ? 88   PHE B CD1 1 
ATOM   2856 C CD2 . PHE B 1 94  ? 18.744 70.122 -8.294  1.00   19.78 ? 88   PHE B CD2 1 
ATOM   2857 C CE1 . PHE B 1 94  ? 19.942 72.576 -8.398  1.00   20.06 ? 88   PHE B CE1 1 
ATOM   2858 C CE2 . PHE B 1 94  ? 18.089 71.190 -8.913  1.00   18.99 ? 88   PHE B CE2 1 
ATOM   2859 C CZ  . PHE B 1 94  ? 18.670 72.427 -8.929  1.00   18.13 ? 88   PHE B CZ  1 
ATOM   2860 N N   . GLU B 1 95  ? 20.299 66.453 -4.962  1.00   15.58 ? 89   GLU B N   1 
ATOM   2861 C CA  . GLU B 1 95  ? 20.751 65.072 -4.758  1.00   15.94 ? 89   GLU B CA  1 
ATOM   2862 C C   . GLU B 1 95  ? 19.783 64.134 -5.437  1.00   17.59 ? 89   GLU B C   1 
ATOM   2863 O O   . GLU B 1 95  ? 18.590 64.092 -5.077  1.00   16.87 ? 89   GLU B O   1 
ATOM   2864 C CB  . GLU B 1 95  ? 20.862 64.735 -3.264  1.00   16.92 ? 89   GLU B CB  1 
ATOM   2865 C CG  . GLU B 1 95  ? 21.997 65.490 -2.619  1.00   17.96 ? 89   GLU B CG  1 
ATOM   2866 C CD  . GLU B 1 95  ? 21.956 65.456 -1.108  1.00   25.37 ? 89   GLU B CD  1 
ATOM   2867 O OE1 . GLU B 1 95  ? 21.130 66.214 -0.504  1.00   26.04 ? 89   GLU B OE1 1 
ATOM   2868 O OE2 . GLU B 1 95  ? 22.758 64.680 -0.552  1.00   25.21 ? 89   GLU B OE2 1 
ATOM   2869 N N   . PHE B 1 96  ? 20.271 63.449 -6.470  1.00   16.07 ? 90   PHE B N   1 
ATOM   2870 C CA  . PHE B 1 96  ? 19.485 62.556 -7.297  1.00   15.80 ? 90   PHE B CA  1 
ATOM   2871 C C   . PHE B 1 96  ? 19.635 61.153 -6.725  1.00   16.77 ? 90   PHE B C   1 
ATOM   2872 O O   . PHE B 1 96  ? 20.733 60.607 -6.704  1.00   15.78 ? 90   PHE B O   1 
ATOM   2873 C CB  . PHE B 1 96  ? 19.988 62.589 -8.761  1.00   15.88 ? 90   PHE B CB  1 
ATOM   2874 C CG  . PHE B 1 96  ? 19.820 63.923 -9.455  1.00   17.30 ? 90   PHE B CG  1 
ATOM   2875 C CD1 . PHE B 1 96  ? 20.762 64.915 -9.349  1.00   16.42 ? 90   PHE B CD1 1 
ATOM   2876 C CD2 . PHE B 1 96  ? 18.685 64.169 -10.217 1.00   18.15 ? 90   PHE B CD2 1 
ATOM   2877 C CE1 . PHE B 1 96  ? 20.632 66.113 -9.968  1.00   19.27 ? 90   PHE B CE1 1 
ATOM   2878 C CE2 . PHE B 1 96  ? 18.544 65.382 -10.877 1.00   20.38 ? 90   PHE B CE2 1 
ATOM   2879 C CZ  . PHE B 1 96  ? 19.526 66.362 -10.746 1.00   19.99 ? 90   PHE B CZ  1 
ATOM   2880 N N   . LEU B 1 97  ? 18.542 60.614 -6.203  1.00   15.58 ? 91   LEU B N   1 
ATOM   2881 C CA  . LEU B 1 97  ? 18.470 59.313 -5.574  1.00   17.21 ? 91   LEU B CA  1 
ATOM   2882 C C   . LEU B 1 97  ? 18.028 58.260 -6.571  1.00   17.93 ? 91   LEU B C   1 
ATOM   2883 O O   . LEU B 1 97  ? 16.908 58.328 -7.104  1.00   17.83 ? 91   LEU B O   1 
ATOM   2884 C CB  . LEU B 1 97  ? 17.491 59.360 -4.403  1.00   17.40 ? 91   LEU B CB  1 
ATOM   2885 C CG  . LEU B 1 97  ? 17.539 60.620 -3.536  1.00   19.23 ? 91   LEU B CG  1 
ATOM   2886 C CD1 . LEU B 1 97  ? 16.549 60.516 -2.331  1.00   19.77 ? 91   LEU B CD1 1 
ATOM   2887 C CD2 . LEU B 1 97  ? 18.949 60.907 -3.052  1.00   19.82 ? 91   LEU B CD2 1 
ATOM   2888 N N   . GLY B 1 98  ? 18.886 57.282 -6.833  1.00   18.00 ? 92   GLY B N   1 
ATOM   2889 C CA  . GLY B 1 98  ? 18.596 56.272 -7.854  1.00   18.86 ? 92   GLY B CA  1 
ATOM   2890 C C   . GLY B 1 98  ? 17.611 55.205 -7.437  1.00   20.00 ? 92   GLY B C   1 
ATOM   2891 O O   . GLY B 1 98  ? 17.081 55.199 -6.331  1.00   19.93 ? 92   GLY B O   1 
ATOM   2892 N N   . ASN B 1 99  ? 17.363 54.262 -8.345  1.00   22.46 ? 93   ASN B N   1 
ATOM   2893 C CA  . ASN B 1 99  ? 16.369 53.239 -8.097  1.00   24.29 ? 93   ASN B CA  1 
ATOM   2894 C C   . ASN B 1 99  ? 16.680 51.970 -8.871  1.00   26.14 ? 93   ASN B C   1 
ATOM   2895 O O   . ASN B 1 99  ? 17.492 51.974 -9.812  1.00   26.70 ? 93   ASN B O   1 
ATOM   2896 C CB  . ASN B 1 99  ? 14.965 53.752 -8.515  1.00   23.56 ? 93   ASN B CB  1 
ATOM   2897 C CG  . ASN B 1 99  ? 13.869 53.377 -7.538  1.00   24.87 ? 93   ASN B CG  1 
ATOM   2898 O OD1 . ASN B 1 99  ? 13.928 52.339 -6.819  1.00   24.08 ? 93   ASN B OD1 1 
ATOM   2899 N ND2 . ASN B 1 99  ? 12.822 54.220 -7.502  1.00   23.07 ? 93   ASN B ND2 1 
ATOM   2900 N N   . ARG B 1 100 ? 15.980 50.908 -8.478  1.00   28.54 ? 94   ARG B N   1 
ATOM   2901 C CA  . ARG B 1 100 ? 15.966 49.658 -9.227  1.00   30.59 ? 94   ARG B CA  1 
ATOM   2902 C C   . ARG B 1 100 ? 15.505 49.950 -10.640 1.00   32.04 ? 94   ARG B C   1 
ATOM   2903 O O   . ARG B 1 100 ? 14.827 50.947 -10.889 1.00   31.94 ? 94   ARG B O   1 
ATOM   2904 C CB  . ARG B 1 100 ? 15.044 48.607 -8.575  1.00   31.63 ? 94   ARG B CB  1 
ATOM   2905 C CG  . ARG B 1 100 ? 15.291 48.340 -7.086  1.00   31.51 ? 94   ARG B CG  1 
ATOM   2906 C CD  . ARG B 1 100 ? 15.963 47.001 -6.792  1.00   34.26 ? 94   ARG B CD  1 
ATOM   2907 N NE  . ARG B 1 100 ? 17.390 47.020 -7.050  1.00   32.83 ? 94   ARG B NE  1 
ATOM   2908 C CZ  . ARG B 1 100 ? 18.352 47.028 -6.122  1.00   32.70 ? 94   ARG B CZ  1 
ATOM   2909 N NH1 . ARG B 1 100 ? 18.075 47.021 -4.824  1.00   32.33 ? 94   ARG B NH1 1 
ATOM   2910 N NH2 . ARG B 1 100 ? 19.616 47.040 -6.507  1.00   32.88 ? 94   ARG B NH2 1 
ATOM   2911 N N   . THR B 1 101 ? 15.881 49.080 -11.569 1.00   33.51 ? 95   THR B N   1 
ATOM   2912 C CA  . THR B 1 101 ? 15.641 49.303 -12.989 1.00   34.92 ? 95   THR B CA  1 
ATOM   2913 C C   . THR B 1 101 ? 14.152 49.528 -13.247 1.00   34.58 ? 95   THR B C   1 
ATOM   2914 O O   . THR B 1 101 ? 13.319 48.890 -12.637 1.00   34.56 ? 95   THR B O   1 
ATOM   2915 C CB  . THR B 1 101 ? 16.117 48.095 -13.823 1.00   35.51 ? 95   THR B CB  1 
ATOM   2916 O OG1 . THR B 1 101 ? 17.403 47.671 -13.355 1.00   40.52 ? 95   THR B OG1 1 
ATOM   2917 C CG2 . THR B 1 101 ? 16.344 48.512 -15.267 1.00   36.60 ? 95   THR B CG2 1 
ATOM   2918 N N   . GLY B 1 102 ? 13.850 50.477 -14.120 1.00   34.69 ? 96   GLY B N   1 
ATOM   2919 C CA  . GLY B 1 102 ? 12.482 50.839 -14.456 1.00   34.37 ? 96   GLY B CA  1 
ATOM   2920 C C   . GLY B 1 102 ? 11.692 51.614 -13.417 1.00   33.92 ? 96   GLY B C   1 
ATOM   2921 O O   . GLY B 1 102 ? 10.528 51.930 -13.662 1.00   34.35 ? 96   GLY B O   1 
ATOM   2922 N N   . GLN B 1 103 ? 12.294 51.918 -12.262 1.00   32.07 ? 97   GLN B N   1 
ATOM   2923 C CA  . GLN B 1 103 ? 11.610 52.611 -11.177 1.00   30.86 ? 97   GLN B CA  1 
ATOM   2924 C C   . GLN B 1 103 ? 12.158 54.042 -11.081 1.00   28.73 ? 97   GLN B C   1 
ATOM   2925 O O   . GLN B 1 103 ? 13.308 54.285 -11.400 1.00   27.26 ? 97   GLN B O   1 
ATOM   2926 C CB  . GLN B 1 103 ? 11.805 51.866 -9.857  1.00   31.38 ? 97   GLN B CB  1 
ATOM   2927 C CG  . GLN B 1 103 ? 11.118 50.487 -9.816  1.00   35.38 ? 97   GLN B CG  1 
ATOM   2928 C CD  . GLN B 1 103 ? 9.618  50.637 -9.656  1.00   38.95 ? 97   GLN B CD  1 
ATOM   2929 O OE1 . GLN B 1 103 ? 8.908  50.793 -10.624 1.00   45.79 ? 97   GLN B OE1 1 
ATOM   2930 N NE2 . GLN B 1 103 ? 9.157  50.658 -8.426  1.00   41.28 ? 97   GLN B NE2 1 
ATOM   2931 N N   . PRO B 1 104 ? 11.341 54.985 -10.655 1.00   26.45 ? 98   PRO B N   1 
ATOM   2932 C CA  . PRO B 1 104 ? 11.694 56.398 -10.817 1.00   25.57 ? 98   PRO B CA  1 
ATOM   2933 C C   . PRO B 1 104 ? 12.794 56.952 -9.905  1.00   23.59 ? 98   PRO B C   1 
ATOM   2934 O O   . PRO B 1 104 ? 12.836 56.661 -8.713  1.00   22.36 ? 98   PRO B O   1 
ATOM   2935 C CB  . PRO B 1 104 ? 10.367 57.121 -10.540 1.00   25.67 ? 98   PRO B CB  1 
ATOM   2936 C CG  . PRO B 1 104 ? 9.571  56.203 -9.726  1.00   26.62 ? 98   PRO B CG  1 
ATOM   2937 C CD  . PRO B 1 104 ? 10.009 54.810 -10.041 1.00   27.11 ? 98   PRO B CD  1 
ATOM   2938 N N   . TYR B 1 105 ? 13.649 57.788 -10.485 1.00   21.53 ? 99   TYR B N   1 
ATOM   2939 C CA  . TYR B 1 105 ? 14.559 58.628 -9.715  1.00   21.52 ? 99   TYR B CA  1 
ATOM   2940 C C   . TYR B 1 105 ? 13.785 59.589 -8.852  1.00   21.13 ? 99   TYR B C   1 
ATOM   2941 O O   . TYR B 1 105 ? 12.691 60.021 -9.251  1.00   20.93 ? 99   TYR B O   1 
ATOM   2942 C CB  . TYR B 1 105 ? 15.430 59.476 -10.658 1.00   21.53 ? 99   TYR B CB  1 
ATOM   2943 C CG  . TYR B 1 105 ? 16.867 59.060 -10.722 1.00   20.67 ? 99   TYR B CG  1 
ATOM   2944 C CD1 . TYR B 1 105 ? 17.781 59.556 -9.807  1.00   19.99 ? 99   TYR B CD1 1 
ATOM   2945 C CD2 . TYR B 1 105 ? 17.326 58.167 -11.701 1.00   19.78 ? 99   TYR B CD2 1 
ATOM   2946 C CE1 . TYR B 1 105 ? 19.102 59.183 -9.849  1.00   18.86 ? 99   TYR B CE1 1 
ATOM   2947 C CE2 . TYR B 1 105 ? 18.662 57.802 -11.753 1.00   19.95 ? 99   TYR B CE2 1 
ATOM   2948 C CZ  . TYR B 1 105 ? 19.543 58.300 -10.801 1.00   20.88 ? 99   TYR B CZ  1 
ATOM   2949 O OH  . TYR B 1 105 ? 20.896 57.976 -10.816 1.00   23.68 ? 99   TYR B OH  1 
ATOM   2950 N N   . ILE B 1 106 ? 14.359 59.949 -7.690  1.00   19.74 ? 100  ILE B N   1 
ATOM   2951 C CA  . ILE B 1 106 ? 13.934 61.122 -6.951  1.00   18.97 ? 100  ILE B CA  1 
ATOM   2952 C C   . ILE B 1 106 ? 14.958 62.235 -7.074  1.00   18.00 ? 100  ILE B C   1 
ATOM   2953 O O   . ILE B 1 106 ? 16.187 62.000 -6.997  1.00   18.04 ? 100  ILE B O   1 
ATOM   2954 C CB  . ILE B 1 106 ? 13.718 60.769 -5.443  1.00   18.53 ? 100  ILE B CB  1 
ATOM   2955 C CG1 . ILE B 1 106 ? 12.407 60.008 -5.275  1.00   21.37 ? 100  ILE B CG1 1 
ATOM   2956 C CG2 . ILE B 1 106 ? 13.703 62.018 -4.592  1.00   19.27 ? 100  ILE B CG2 1 
ATOM   2957 C CD1 . ILE B 1 106 ? 12.242 59.341 -3.928  1.00   23.58 ? 100  ILE B CD1 1 
ATOM   2958 N N   . LEU B 1 107 ? 14.489 63.460 -7.200  1.00   17.63 ? 101  LEU B N   1 
ATOM   2959 C CA  . LEU B 1 107 ? 15.349 64.624 -7.051  1.00   16.33 ? 101  LEU B CA  1 
ATOM   2960 C C   . LEU B 1 107 ? 15.042 65.234 -5.699  1.00   16.70 ? 101  LEU B C   1 
ATOM   2961 O O   . LEU B 1 107 ? 13.928 65.757 -5.461  1.00   15.08 ? 101  LEU B O   1 
ATOM   2962 C CB  . LEU B 1 107 ? 15.196 65.645 -8.167  1.00   17.09 ? 101  LEU B CB  1 
ATOM   2963 C CG  . LEU B 1 107 ? 15.933 66.963 -8.017  1.00   17.81 ? 101  LEU B CG  1 
ATOM   2964 C CD1 . LEU B 1 107 ? 17.447 66.656 -7.688  1.00   21.81 ? 101  LEU B CD1 1 
ATOM   2965 C CD2 . LEU B 1 107 ? 15.775 67.854 -9.257  1.00   19.32 ? 101  LEU B CD2 1 
ATOM   2966 N N   . GLN B 1 108 ? 16.004 65.099 -4.795  1.00   16.37 ? 102  GLN B N   1 
ATOM   2967 C CA  . GLN B 1 108 ? 15.937 65.729 -3.492  1.00   16.78 ? 102  GLN B CA  1 
ATOM   2968 C C   . GLN B 1 108 ? 16.684 67.057 -3.493  1.00   18.14 ? 102  GLN B C   1 
ATOM   2969 O O   . GLN B 1 108 ? 17.831 67.146 -3.970  1.00   17.05 ? 102  GLN B O   1 
ATOM   2970 C CB  . GLN B 1 108 ? 16.516 64.833 -2.420  1.00   17.15 ? 102  GLN B CB  1 
ATOM   2971 C CG  . GLN B 1 108 ? 16.376 65.434 -1.039  1.00   18.81 ? 102  GLN B CG  1 
ATOM   2972 C CD  . GLN B 1 108 ? 16.963 64.575 0.036   1.00   20.36 ? 102  GLN B CD  1 
ATOM   2973 O OE1 . GLN B 1 108 ? 16.334 63.639 0.475   1.00   21.19 ? 102  GLN B OE1 1 
ATOM   2974 N NE2 . GLN B 1 108 ? 18.191 64.889 0.460   1.00   20.78 ? 102  GLN B NE2 1 
ATOM   2975 N N   . THR B 1 109 ? 16.058 68.095 -2.925  1.00   16.76 ? 103  THR B N   1 
ATOM   2976 C CA  . THR B 1 109 ? 16.758 69.346 -2.661  1.00   15.90 ? 103  THR B CA  1 
ATOM   2977 C C   . THR B 1 109 ? 16.787 69.595 -1.159  1.00   17.10 ? 103  THR B C   1 
ATOM   2978 O O   . THR B 1 109 ? 16.000 69.026 -0.418  1.00   16.42 ? 103  THR B O   1 
ATOM   2979 C CB  . THR B 1 109 ? 16.120 70.533 -3.367  1.00   17.21 ? 103  THR B CB  1 
ATOM   2980 O OG1 . THR B 1 109 ? 14.710 70.593 -3.067  1.00   16.24 ? 103  THR B OG1 1 
ATOM   2981 C CG2 . THR B 1 109 ? 16.218 70.384 -4.925  1.00   15.25 ? 103  THR B CG2 1 
ATOM   2982 N N   . ASN B 1 110 ? 17.732 70.408 -0.739  1.00   16.52 ? 104  ASN B N   1 
ATOM   2983 C CA  . ASN B 1 110 ? 17.902 70.737 0.679   1.00   16.96 ? 104  ASN B CA  1 
ATOM   2984 C C   . ASN B 1 110 ? 18.623 72.071 0.773   1.00   17.81 ? 104  ASN B C   1 
ATOM   2985 O O   . ASN B 1 110 ? 19.316 72.507 -0.166  1.00   16.47 ? 104  ASN B O   1 
ATOM   2986 C CB  . ASN B 1 110 ? 18.642 69.590 1.331   1.00   16.36 ? 104  ASN B CB  1 
ATOM   2987 C CG  . ASN B 1 110 ? 18.449 69.487 2.851   1.00   18.16 ? 104  ASN B CG  1 
ATOM   2988 O OD1 . ASN B 1 110 ? 19.001 68.546 3.464   1.00   23.04 ? 104  ASN B OD1 1 
ATOM   2989 N ND2 . ASN B 1 110 ? 17.776 70.437 3.450   1.00   14.22 ? 104  ASN B ND2 1 
ATOM   2990 N N   . VAL B 1 111 ? 18.474 72.728 1.921   1.00   17.57 ? 105  VAL B N   1 
ATOM   2991 C CA  . VAL B 1 111 ? 19.106 73.996 2.180   1.00   18.24 ? 105  VAL B CA  1 
ATOM   2992 C C   . VAL B 1 111 ? 19.600 73.984 3.626   1.00   19.59 ? 105  VAL B C   1 
ATOM   2993 O O   . VAL B 1 111 ? 18.810 73.758 4.535   1.00   19.75 ? 105  VAL B O   1 
ATOM   2994 C CB  . VAL B 1 111 ? 18.129 75.194 2.013   1.00   18.69 ? 105  VAL B CB  1 
ATOM   2995 C CG1 . VAL B 1 111 ? 18.820 76.492 2.385   1.00   20.99 ? 105  VAL B CG1 1 
ATOM   2996 C CG2 . VAL B 1 111 ? 17.585 75.280 0.555   1.00   19.43 ? 105  VAL B CG2 1 
ATOM   2997 N N   . PHE B 1 112 ? 20.890 74.232 3.812   1.00   19.46 ? 106  PHE B N   1 
ATOM   2998 C CA  . PHE B 1 112 ? 21.499 74.382 5.137   1.00   20.88 ? 106  PHE B CA  1 
ATOM   2999 C C   . PHE B 1 112 ? 21.812 75.857 5.335   1.00   22.89 ? 106  PHE B C   1 
ATOM   3000 O O   . PHE B 1 112 ? 22.362 76.513 4.440   1.00   21.67 ? 106  PHE B O   1 
ATOM   3001 C CB  . PHE B 1 112 ? 22.811 73.591 5.232   1.00   21.22 ? 106  PHE B CB  1 
ATOM   3002 C CG  . PHE B 1 112 ? 22.663 72.088 5.158   1.00   23.41 ? 106  PHE B CG  1 
ATOM   3003 C CD1 . PHE B 1 112 ? 22.300 71.447 3.980   1.00   23.98 ? 106  PHE B CD1 1 
ATOM   3004 C CD2 . PHE B 1 112 ? 22.882 71.307 6.291   1.00   24.95 ? 106  PHE B CD2 1 
ATOM   3005 C CE1 . PHE B 1 112 ? 22.155 70.062 3.931   1.00   25.72 ? 106  PHE B CE1 1 
ATOM   3006 C CE2 . PHE B 1 112 ? 22.727 69.923 6.260   1.00   25.03 ? 106  PHE B CE2 1 
ATOM   3007 C CZ  . PHE B 1 112 ? 22.365 69.298 5.080   1.00   27.22 ? 106  PHE B CZ  1 
ATOM   3008 N N   . THR B 1 113 ? 21.505 76.377 6.536   1.00   23.67 ? 107  THR B N   1 
ATOM   3009 C CA  . THR B 1 113 ? 21.832 77.726 6.939   1.00   24.64 ? 107  THR B CA  1 
ATOM   3010 C C   . THR B 1 113 ? 22.416 77.635 8.338   1.00   26.90 ? 107  THR B C   1 
ATOM   3011 O O   . THR B 1 113 ? 21.758 77.110 9.251   1.00   26.00 ? 107  THR B O   1 
ATOM   3012 C CB  . THR B 1 113 ? 20.594 78.600 6.993   1.00   25.85 ? 107  THR B CB  1 
ATOM   3013 O OG1 . THR B 1 113 ? 19.576 77.946 7.774   1.00   26.66 ? 107  THR B OG1 1 
ATOM   3014 C CG2 . THR B 1 113 ? 19.974 78.796 5.602   1.00   24.69 ? 107  THR B CG2 1 
ATOM   3015 N N   . GLY B 1 114 ? 23.650 78.100 8.498   1.00   28.14 ? 108  GLY B N   1 
ATOM   3016 C CA  . GLY B 1 114 ? 24.294 78.109 9.801   1.00   29.33 ? 108  GLY B CA  1 
ATOM   3017 C C   . GLY B 1 114 ? 24.485 76.727 10.372  1.00   29.96 ? 108  GLY B C   1 
ATOM   3018 O O   . GLY B 1 114 ? 24.392 76.543 11.576  1.00   31.50 ? 108  GLY B O   1 
ATOM   3019 N N   . GLY B 1 115 ? 24.738 75.755 9.504   1.00   29.50 ? 109  GLY B N   1 
ATOM   3020 C CA  . GLY B 1 115 ? 24.977 74.388 9.872   1.00   29.53 ? 109  GLY B CA  1 
ATOM   3021 C C   . GLY B 1 115 ? 23.714 73.573 9.998   1.00   29.54 ? 109  GLY B C   1 
ATOM   3022 O O   . GLY B 1 115 ? 23.813 72.374 10.162  1.00   30.95 ? 109  GLY B O   1 
ATOM   3023 N N   . LYS B 1 116 ? 22.559 74.212 9.910   1.00   28.74 ? 110  LYS B N   1 
ATOM   3024 C CA  . LYS B 1 116 ? 21.275 73.554 10.081  1.00   29.57 ? 110  LYS B CA  1 
ATOM   3025 C C   . LYS B 1 116 ? 20.543 73.352 8.754   1.00   27.27 ? 110  LYS B C   1 
ATOM   3026 O O   . LYS B 1 116 ? 20.199 74.318 8.085   1.00   26.84 ? 110  LYS B O   1 
ATOM   3027 C CB  . LYS B 1 116 ? 20.404 74.399 11.006  1.00   30.13 ? 110  LYS B CB  1 
ATOM   3028 C CG  . LYS B 1 116 ? 19.056 73.764 11.383  1.00   35.76 ? 110  LYS B CG  1 
ATOM   3029 C CD  . LYS B 1 116 ? 19.230 72.367 12.004  1.00   39.90 ? 110  LYS B CD  1 
ATOM   3030 C CE  . LYS B 1 116 ? 17.926 71.800 12.583  1.00   41.55 ? 110  LYS B CE  1 
ATOM   3031 N NZ  . LYS B 1 116 ? 16.758 72.209 11.776  1.00   43.16 ? 110  LYS B NZ  1 
ATOM   3032 N N   . GLY B 1 117 ? 20.266 72.090 8.444   1.00   26.73 ? 111  GLY B N   1 
ATOM   3033 C CA  . GLY B 1 117 ? 19.497 71.694 7.275   1.00   26.02 ? 111  GLY B CA  1 
ATOM   3034 C C   . GLY B 1 117 ? 18.111 71.196 7.621   1.00   25.02 ? 111  GLY B C   1 
ATOM   3035 O O   . GLY B 1 117 ? 17.291 71.957 8.094   1.00   25.15 ? 111  GLY B O   1 
ATOM   3036 N N   . ASP B 1 118 ? 17.864 69.925 7.350   1.00   24.31 ? 112  ASP B N   1 
ATOM   3037 C CA  . ASP B 1 118 ? 16.583 69.297 7.609   1.00   24.38 ? 112  ASP B CA  1 
ATOM   3038 C C   . ASP B 1 118 ? 15.461 69.979 6.853   1.00   23.70 ? 112  ASP B C   1 
ATOM   3039 O O   . ASP B 1 118 ? 14.334 70.102 7.356   1.00   22.96 ? 112  ASP B O   1 
ATOM   3040 C CB  . ASP B 1 118 ? 16.331 69.245 9.143   1.00   25.00 ? 112  ASP B CB  1 
ATOM   3041 C CG  . ASP B 1 118 ? 17.305 68.363 9.830   1.00   27.54 ? 112  ASP B CG  1 
ATOM   3042 O OD1 . ASP B 1 118 ? 17.188 67.131 9.701   1.00   33.11 ? 112  ASP B OD1 1 
ATOM   3043 O OD2 . ASP B 1 118 ? 18.258 68.781 10.493  1.00   36.08 ? 112  ASP B OD2 1 
ATOM   3044 N N   . ARG B 1 119 ? 15.750 70.369 5.593   1.00   20.92 ? 113  ARG B N   1 
ATOM   3045 C CA  . ARG B 1 119 ? 14.763 71.035 4.748   1.00   20.00 ? 113  ARG B CA  1 
ATOM   3046 C C   . ARG B 1 119 ? 14.606 70.284 3.412   1.00   19.60 ? 113  ARG B C   1 
ATOM   3047 O O   . ARG B 1 119 ? 14.437 70.918 2.370   1.00   18.88 ? 113  ARG B O   1 
ATOM   3048 C CB  . ARG B 1 119 ? 15.141 72.495 4.475   1.00   19.86 ? 113  ARG B CB  1 
ATOM   3049 C CG  . ARG B 1 119 ? 15.336 73.420 5.669   1.00   21.42 ? 113  ARG B CG  1 
ATOM   3050 C CD  . ARG B 1 119 ? 15.411 74.854 5.244   1.00   23.60 ? 113  ARG B CD  1 
ATOM   3051 N NE  . ARG B 1 119 ? 15.465 75.829 6.341   1.00   24.32 ? 113  ARG B NE  1 
ATOM   3052 C CZ  . ARG B 1 119 ? 16.564 76.308 6.882   1.00   26.90 ? 113  ARG B CZ  1 
ATOM   3053 N NH1 . ARG B 1 119 ? 17.756 75.886 6.497   1.00   25.87 ? 113  ARG B NH1 1 
ATOM   3054 N NH2 . ARG B 1 119 ? 16.471 77.224 7.857   1.00   28.55 ? 113  ARG B NH2 1 
ATOM   3055 N N   . GLU B 1 120 ? 14.575 68.954 3.494   1.00   19.96 ? 114  GLU B N   1 
ATOM   3056 C CA  . GLU B 1 120 ? 14.439 68.081 2.339   1.00   20.14 ? 114  GLU B CA  1 
ATOM   3057 C C   . GLU B 1 120 ? 13.092 68.263 1.661   1.00   20.04 ? 114  GLU B C   1 
ATOM   3058 O O   . GLU B 1 120 ? 12.043 68.373 2.308   1.00   19.63 ? 114  GLU B O   1 
ATOM   3059 C CB  . GLU B 1 120 ? 14.591 66.596 2.708   1.00   21.46 ? 114  GLU B CB  1 
ATOM   3060 C CG  . GLU B 1 120 ? 15.958 66.123 3.144   1.00   22.17 ? 114  GLU B CG  1 
ATOM   3061 C CD  . GLU B 1 120 ? 16.222 66.220 4.639   1.00   24.60 ? 114  GLU B CD  1 
ATOM   3062 O OE1 . GLU B 1 120 ? 15.420 66.862 5.392   1.00   21.49 ? 114  GLU B OE1 1 
ATOM   3063 O OE2 . GLU B 1 120 ? 17.264 65.653 5.042   1.00   24.81 ? 114  GLU B OE2 1 
ATOM   3064 N N   . GLN B 1 121 ? 13.135 68.362 0.330   1.00   18.75 ? 115  GLN B N   1 
ATOM   3065 C CA  . GLN B 1 121 ? 11.976 68.164 -0.503  1.00   19.07 ? 115  GLN B CA  1 
ATOM   3066 C C   . GLN B 1 121 ? 12.353 67.120 -1.539  1.00   19.90 ? 115  GLN B C   1 
ATOM   3067 O O   . GLN B 1 121 ? 13.494 67.078 -1.994  1.00   20.14 ? 115  GLN B O   1 
ATOM   3068 C CB  . GLN B 1 121 ? 11.557 69.432 -1.206  1.00   19.51 ? 115  GLN B CB  1 
ATOM   3069 C CG  . GLN B 1 121 ? 11.125 70.548 -0.283  1.00   20.70 ? 115  GLN B CG  1 
ATOM   3070 C CD  . GLN B 1 121 ? 10.559 71.726 -1.026  1.00   23.97 ? 115  GLN B CD  1 
ATOM   3071 O OE1 . GLN B 1 121 ? 10.947 72.028 -2.180  1.00   21.94 ? 115  GLN B OE1 1 
ATOM   3072 N NE2 . GLN B 1 121 ? 9.621  72.412 -0.376  1.00   27.59 ? 115  GLN B NE2 1 
ATOM   3073 N N   . ARG B 1 122 ? 11.410 66.288 -1.924  1.00   18.53 ? 116  ARG B N   1 
ATOM   3074 C CA  . ARG B 1 122 ? 11.668 65.233 -2.890  1.00   17.77 ? 116  ARG B CA  1 
ATOM   3075 C C   . ARG B 1 122 ? 10.602 65.293 -3.954  1.00   18.76 ? 116  ARG B C   1 
ATOM   3076 O O   . ARG B 1 122 ? 9.404  65.336 -3.645  1.00   18.62 ? 116  ARG B O   1 
ATOM   3077 C CB  . ARG B 1 122 ? 11.628 63.880 -2.225  1.00   18.19 ? 116  ARG B CB  1 
ATOM   3078 C CG  . ARG B 1 122 ? 12.693 63.670 -1.185  1.00   18.60 ? 116  ARG B CG  1 
ATOM   3079 C CD  . ARG B 1 122 ? 12.730 62.309 -0.575  1.00   19.38 ? 116  ARG B CD  1 
ATOM   3080 N NE  . ARG B 1 122 ? 13.986 62.160 0.140   1.00   22.10 ? 116  ARG B NE  1 
ATOM   3081 C CZ  . ARG B 1 122 ? 14.312 61.075 0.845   1.00   24.10 ? 116  ARG B CZ  1 
ATOM   3082 N NH1 . ARG B 1 122 ? 13.481 60.038 0.908   1.00   25.25 ? 116  ARG B NH1 1 
ATOM   3083 N NH2 . ARG B 1 122 ? 15.499 61.013 1.441   1.00   24.77 ? 116  ARG B NH2 1 
ATOM   3084 N N   . ILE B 1 123 ? 11.026 65.343 -5.201  1.00   18.29 ? 117  ILE B N   1 
ATOM   3085 C CA  . ILE B 1 123 ? 10.108 65.278 -6.320  1.00   16.85 ? 117  ILE B CA  1 
ATOM   3086 C C   . ILE B 1 123 ? 10.476 64.136 -7.247  1.00   18.42 ? 117  ILE B C   1 
ATOM   3087 O O   . ILE B 1 123 ? 11.625 63.691 -7.276  1.00   18.52 ? 117  ILE B O   1 
ATOM   3088 C CB  . ILE B 1 123 ? 10.077 66.594 -7.102  1.00   17.29 ? 117  ILE B CB  1 
ATOM   3089 C CG1 . ILE B 1 123 ? 11.423 66.845 -7.838  1.00   16.57 ? 117  ILE B CG1 1 
ATOM   3090 C CG2 . ILE B 1 123 ? 9.730  67.775 -6.206  1.00   15.73 ? 117  ILE B CG2 1 
ATOM   3091 C CD1 . ILE B 1 123 ? 11.355 67.952 -8.819  1.00   17.78 ? 117  ILE B CD1 1 
ATOM   3092 N N   . TYR B 1 124 ? 9.499  63.662 -8.007  1.00   18.00 ? 118  TYR B N   1 
ATOM   3093 C CA  . TYR B 1 124 ? 9.749  62.919 -9.222  1.00   19.40 ? 118  TYR B CA  1 
ATOM   3094 C C   . TYR B 1 124 ? 9.881  63.927 -10.356 1.00   18.50 ? 118  TYR B C   1 
ATOM   3095 O O   . TYR B 1 124 ? 9.425  65.075 -10.260 1.00   18.98 ? 118  TYR B O   1 
ATOM   3096 C CB  . TYR B 1 124 ? 8.587  61.971 -9.546  1.00   19.34 ? 118  TYR B CB  1 
ATOM   3097 C CG  . TYR B 1 124 ? 8.443  60.771 -8.687  1.00   21.61 ? 118  TYR B CG  1 
ATOM   3098 C CD1 . TYR B 1 124 ? 9.531  60.201 -8.007  1.00   22.65 ? 118  TYR B CD1 1 
ATOM   3099 C CD2 . TYR B 1 124 ? 7.202  60.189 -8.513  1.00   26.54 ? 118  TYR B CD2 1 
ATOM   3100 C CE1 . TYR B 1 124 ? 9.378  59.085 -7.229  1.00   25.01 ? 118  TYR B CE1 1 
ATOM   3101 C CE2 . TYR B 1 124 ? 7.034  59.077 -7.732  1.00   26.18 ? 118  TYR B CE2 1 
ATOM   3102 C CZ  . TYR B 1 124 ? 8.121  58.510 -7.097  1.00   27.46 ? 118  TYR B CZ  1 
ATOM   3103 O OH  . TYR B 1 124 ? 7.935  57.398 -6.312  1.00   29.41 ? 118  TYR B OH  1 
ATOM   3104 N N   . LEU B 1 125 ? 10.456 63.501 -11.455 1.00   19.50 ? 119  LEU B N   1 
ATOM   3105 C CA  . LEU B 1 125 ? 10.615 64.357 -12.616 1.00   19.50 ? 119  LEU B CA  1 
ATOM   3106 C C   . LEU B 1 125 ? 9.587  64.018 -13.707 1.00   20.69 ? 119  LEU B C   1 
ATOM   3107 O O   . LEU B 1 125 ? 9.035  62.934 -13.728 1.00   22.69 ? 119  LEU B O   1 
ATOM   3108 C CB  . LEU B 1 125 ? 12.048 64.254 -13.142 1.00   20.46 ? 119  LEU B CB  1 
ATOM   3109 C CG  . LEU B 1 125 ? 13.078 64.822 -12.139 1.00   21.28 ? 119  LEU B CG  1 
ATOM   3110 C CD1 . LEU B 1 125 ? 14.466 64.426 -12.550 1.00   24.51 ? 119  LEU B CD1 1 
ATOM   3111 C CD2 . LEU B 1 125 ? 12.986 66.324 -12.002 1.00   22.59 ? 119  LEU B CD2 1 
ATOM   3112 N N   . TRP B 1 126 ? 9.384  64.964 -14.602 1.00   20.59 ? 120  TRP B N   1 
ATOM   3113 C CA  . TRP B 1 126 ? 8.405  64.879 -15.702 1.00   21.78 ? 120  TRP B CA  1 
ATOM   3114 C C   . TRP B 1 126 ? 9.045  64.371 -16.985 1.00   22.75 ? 120  TRP B C   1 
ATOM   3115 O O   . TRP B 1 126 ? 8.583  64.656 -18.114 1.00   23.35 ? 120  TRP B O   1 
ATOM   3116 C CB  . TRP B 1 126 ? 7.733  66.257 -15.895 1.00   20.75 ? 120  TRP B CB  1 
ATOM   3117 C CG  . TRP B 1 126 ? 8.645  67.400 -15.930 1.00   20.03 ? 120  TRP B CG  1 
ATOM   3118 C CD1 . TRP B 1 126 ? 9.207  67.957 -17.019 1.00   19.83 ? 120  TRP B CD1 1 
ATOM   3119 C CD2 . TRP B 1 126 ? 9.167  68.117 -14.797 1.00   18.80 ? 120  TRP B CD2 1 
ATOM   3120 N NE1 . TRP B 1 126 ? 10.019 68.999 -16.657 1.00   20.91 ? 120  TRP B NE1 1 
ATOM   3121 C CE2 . TRP B 1 126 ? 10.019 69.109 -15.293 1.00   20.41 ? 120  TRP B CE2 1 
ATOM   3122 C CE3 . TRP B 1 126 ? 8.999  68.005 -13.416 1.00   20.56 ? 120  TRP B CE3 1 
ATOM   3123 C CZ2 . TRP B 1 126 ? 10.701 70.001 -14.466 1.00   20.32 ? 120  TRP B CZ2 1 
ATOM   3124 C CZ3 . TRP B 1 126 ? 9.684  68.908 -12.581 1.00   19.69 ? 120  TRP B CZ3 1 
ATOM   3125 C CH2 . TRP B 1 126 ? 10.514 69.885 -13.123 1.00   18.03 ? 120  TRP B CH2 1 
ATOM   3126 N N   . PHE B 1 127 ? 10.123 63.601 -16.820 1.00   23.28 ? 121  PHE B N   1 
ATOM   3127 C CA  . PHE B 1 127 ? 10.905 63.011 -17.916 1.00   23.28 ? 121  PHE B CA  1 
ATOM   3128 C C   . PHE B 1 127 ? 11.793 61.928 -17.281 1.00   23.88 ? 121  PHE B C   1 
ATOM   3129 O O   . PHE B 1 127 ? 11.896 61.858 -16.048 1.00   21.95 ? 121  PHE B O   1 
ATOM   3130 C CB  . PHE B 1 127 ? 11.776 64.055 -18.634 1.00   23.89 ? 121  PHE B CB  1 
ATOM   3131 C CG  . PHE B 1 127 ? 12.642 64.889 -17.693 1.00   22.68 ? 121  PHE B CG  1 
ATOM   3132 C CD1 . PHE B 1 127 ? 13.896 64.444 -17.311 1.00   22.55 ? 121  PHE B CD1 1 
ATOM   3133 C CD2 . PHE B 1 127 ? 12.194 66.112 -17.201 1.00   21.43 ? 121  PHE B CD2 1 
ATOM   3134 C CE1 . PHE B 1 127 ? 14.692 65.208 -16.449 1.00   21.67 ? 121  PHE B CE1 1 
ATOM   3135 C CE2 . PHE B 1 127 ? 12.973 66.882 -16.327 1.00   24.22 ? 121  PHE B CE2 1 
ATOM   3136 C CZ  . PHE B 1 127 ? 14.232 66.423 -15.945 1.00   20.44 ? 121  PHE B CZ  1 
ATOM   3137 N N   . ASP B 1 128 ? 12.403 61.089 -18.112 1.00   24.21 ? 122  ASP B N   1 
ATOM   3138 C CA  . ASP B 1 128 ? 13.372 60.103 -17.636 1.00   24.86 ? 122  ASP B CA  1 
ATOM   3139 C C   . ASP B 1 128 ? 14.732 60.795 -17.600 1.00   23.78 ? 122  ASP B C   1 
ATOM   3140 O O   . ASP B 1 128 ? 15.286 61.113 -18.644 1.00   24.57 ? 122  ASP B O   1 
ATOM   3141 C CB  . ASP B 1 128 ? 13.404 58.908 -18.576 1.00   25.97 ? 122  ASP B CB  1 
ATOM   3142 C CG  . ASP B 1 128 ? 14.331 57.802 -18.104 1.00   29.90 ? 122  ASP B CG  1 
ATOM   3143 O OD1 . ASP B 1 128 ? 15.277 58.067 -17.296 1.00   26.99 ? 122  ASP B OD1 1 
ATOM   3144 O OD2 . ASP B 1 128 ? 14.164 56.621 -18.490 1.00   31.35 ? 122  ASP B OD2 1 
ATOM   3145 N N   . PRO B 1 129 ? 15.265 61.077 -16.410 1.00   21.95 ? 123  PRO B N   1 
ATOM   3146 C CA  . PRO B 1 129 ? 16.495 61.862 -16.305 1.00   21.37 ? 123  PRO B CA  1 
ATOM   3147 C C   . PRO B 1 129 ? 17.735 61.066 -16.706 1.00   21.91 ? 123  PRO B C   1 
ATOM   3148 O O   . PRO B 1 129 ? 18.807 61.646 -16.756 1.00   20.64 ? 123  PRO B O   1 
ATOM   3149 C CB  . PRO B 1 129 ? 16.569 62.220 -14.801 1.00   21.21 ? 123  PRO B CB  1 
ATOM   3150 C CG  . PRO B 1 129 ? 15.857 61.137 -14.133 1.00   21.23 ? 123  PRO B CG  1 
ATOM   3151 C CD  . PRO B 1 129 ? 14.748 60.684 -15.083 1.00   22.82 ? 123  PRO B CD  1 
ATOM   3152 N N   . THR B 1 130 ? 17.582 59.776 -16.968 1.00   23.46 ? 124  THR B N   1 
ATOM   3153 C CA  . THR B 1 130 ? 18.687 58.942 -17.480 1.00   25.18 ? 124  THR B CA  1 
ATOM   3154 C C   . THR B 1 130 ? 18.794 58.891 -19.006 1.00   27.21 ? 124  THR B C   1 
ATOM   3155 O O   . THR B 1 130 ? 19.798 58.385 -19.527 1.00   27.79 ? 124  THR B O   1 
ATOM   3156 C CB  . THR B 1 130 ? 18.592 57.491 -16.954 1.00   25.77 ? 124  THR B CB  1 
ATOM   3157 O OG1 . THR B 1 130 ? 17.534 56.757 -17.595 1.00   27.00 ? 124  THR B OG1 1 
ATOM   3158 C CG2 . THR B 1 130 ? 18.247 57.427 -15.494 1.00   25.56 ? 124  THR B CG2 1 
ATOM   3159 N N   . LYS B 1 131 ? 17.790 59.393 -19.720 1.00   28.20 ? 125  LYS B N   1 
ATOM   3160 C CA  . LYS B 1 131 ? 17.718 59.222 -21.181 1.00   29.35 ? 125  LYS B CA  1 
ATOM   3161 C C   . LYS B 1 131 ? 18.299 60.391 -21.940 1.00   30.23 ? 125  LYS B C   1 
ATOM   3162 O O   . LYS B 1 131 ? 18.719 60.232 -23.074 1.00   31.40 ? 125  LYS B O   1 
ATOM   3163 C CB  . LYS B 1 131 ? 16.274 58.979 -21.623 1.00   29.99 ? 125  LYS B CB  1 
ATOM   3164 C CG  . LYS B 1 131 ? 15.956 59.476 -23.036 0.0000 36.52 ? 125  LYS B CG  1 
ATOM   3165 C CD  . LYS B 1 131 ? 14.475 59.651 -23.346 0.0000 40.51 ? 125  LYS B CD  1 
ATOM   3166 C CE  . LYS B 1 131 ? 14.258 60.113 -24.793 0.0000 42.59 ? 125  LYS B CE  1 
ATOM   3167 N NZ  . LYS B 1 131 ? 14.217 61.594 -24.967 0.0000 44.04 ? 125  LYS B NZ  1 
ATOM   3168 N N   . GLU B 1 132 ? 18.325 61.577 -21.330 1.00   30.20 ? 126  GLU B N   1 
ATOM   3169 C CA  . GLU B 1 132 ? 18.850 62.775 -21.964 1.00   30.47 ? 126  GLU B CA  1 
ATOM   3170 C C   . GLU B 1 132 ? 19.431 63.732 -20.927 1.00   28.92 ? 126  GLU B C   1 
ATOM   3171 O O   . GLU B 1 132 ? 19.124 63.621 -19.746 1.00   27.49 ? 126  GLU B O   1 
ATOM   3172 C CB  . GLU B 1 132 ? 17.728 63.499 -22.719 1.00   32.36 ? 126  GLU B CB  1 
ATOM   3173 C CG  . GLU B 1 132 ? 18.224 64.597 -23.643 1.00   36.45 ? 126  GLU B CG  1 
ATOM   3174 C CD  . GLU B 1 132 ? 19.364 64.121 -24.537 1.00   41.71 ? 126  GLU B CD  1 
ATOM   3175 O OE1 . GLU B 1 132 ? 19.085 63.195 -25.349 1.00   46.12 ? 126  GLU B OE1 1 
ATOM   3176 O OE2 . GLU B 1 132 ? 20.511 64.652 -24.421 1.00   39.66 ? 126  GLU B OE2 1 
ATOM   3177 N N   . PHE B 1 133 ? 20.271 64.653 -21.373 1.00   27.77 ? 127  PHE B N   1 
ATOM   3178 C CA  . PHE B 1 133 ? 20.751 65.734 -20.522 1.00   26.59 ? 127  PHE B CA  1 
ATOM   3179 C C   . PHE B 1 133 ? 19.670 66.780 -20.282 1.00   25.62 ? 127  PHE B C   1 
ATOM   3180 O O   . PHE B 1 133 ? 18.963 67.203 -21.228 1.00   24.75 ? 127  PHE B O   1 
ATOM   3181 C CB  . PHE B 1 133 ? 21.955 66.402 -21.149 1.00   27.21 ? 127  PHE B CB  1 
ATOM   3182 C CG  . PHE B 1 133 ? 23.196 65.551 -21.134 1.00   28.81 ? 127  PHE B CG  1 
ATOM   3183 C CD1 . PHE B 1 133 ? 24.065 65.600 -20.050 1.00   27.22 ? 127  PHE B CD1 1 
ATOM   3184 C CD2 . PHE B 1 133 ? 23.497 64.700 -22.206 1.00   31.30 ? 127  PHE B CD2 1 
ATOM   3185 C CE1 . PHE B 1 133 ? 25.228 64.840 -20.031 1.00   30.27 ? 127  PHE B CE1 1 
ATOM   3186 C CE2 . PHE B 1 133 ? 24.663 63.916 -22.199 1.00   32.89 ? 127  PHE B CE2 1 
ATOM   3187 C CZ  . PHE B 1 133 ? 25.531 63.976 -21.115 1.00   32.49 ? 127  PHE B CZ  1 
ATOM   3188 N N   . HIS B 1 134 ? 19.524 67.196 -19.017 1.00   22.70 ? 128  HIS B N   1 
ATOM   3189 C CA  . HIS B 1 134 ? 18.711 68.337 -18.663 1.00   22.15 ? 128  HIS B CA  1 
ATOM   3190 C C   . HIS B 1 134 ? 19.541 69.330 -17.853 1.00   21.70 ? 128  HIS B C   1 
ATOM   3191 O O   . HIS B 1 134 ? 20.562 68.958 -17.276 1.00   22.16 ? 128  HIS B O   1 
ATOM   3192 C CB  . HIS B 1 134 ? 17.480 67.852 -17.870 1.00   21.76 ? 128  HIS B CB  1 
ATOM   3193 C CG  . HIS B 1 134 ? 16.550 67.027 -18.705 1.00   23.49 ? 128  HIS B CG  1 
ATOM   3194 N ND1 . HIS B 1 134 ? 15.442 67.571 -19.315 1.00   23.81 ? 128  HIS B ND1 1 
ATOM   3195 C CD2 . HIS B 1 134 ? 16.610 65.744 -19.113 1.00   22.39 ? 128  HIS B CD2 1 
ATOM   3196 C CE1 . HIS B 1 134 ? 14.823 66.635 -20.031 1.00   24.87 ? 128  HIS B CE1 1 
ATOM   3197 N NE2 . HIS B 1 134 ? 15.501 65.505 -19.904 1.00   24.67 ? 128  HIS B NE2 1 
ATOM   3198 N N   . TYR B 1 135 ? 19.088 70.575 -17.805 1.00   21.03 ? 129  TYR B N   1 
ATOM   3199 C CA  . TYR B 1 135 ? 19.733 71.614 -17.026 1.00   21.74 ? 129  TYR B CA  1 
ATOM   3200 C C   . TYR B 1 135 ? 19.208 71.600 -15.570 1.00   20.51 ? 129  TYR B C   1 
ATOM   3201 O O   . TYR B 1 135 ? 18.006 71.531 -15.312 1.00   20.37 ? 129  TYR B O   1 
ATOM   3202 C CB  . TYR B 1 135 ? 19.491 72.976 -17.613 1.00   23.55 ? 129  TYR B CB  1 
ATOM   3203 C CG  . TYR B 1 135 ? 20.347 73.255 -18.822 1.00   29.37 ? 129  TYR B CG  1 
ATOM   3204 C CD1 . TYR B 1 135 ? 21.623 73.792 -18.684 1.00   35.98 ? 129  TYR B CD1 1 
ATOM   3205 C CD2 . TYR B 1 135 ? 19.892 72.936 -20.100 1.00   36.74 ? 129  TYR B CD2 1 
ATOM   3206 C CE1 . TYR B 1 135 ? 22.428 74.048 -19.811 1.00   38.30 ? 129  TYR B CE1 1 
ATOM   3207 C CE2 . TYR B 1 135 ? 20.682 73.182 -21.224 1.00   38.35 ? 129  TYR B CE2 1 
ATOM   3208 C CZ  . TYR B 1 135 ? 21.947 73.728 -21.063 1.00   39.83 ? 129  TYR B CZ  1 
ATOM   3209 O OH  . TYR B 1 135 ? 22.738 73.960 -22.169 1.00   46.08 ? 129  TYR B OH  1 
ATOM   3210 N N   . TYR B 1 136 ? 20.131 71.684 -14.650 1.00   18.65 ? 130  TYR B N   1 
ATOM   3211 C CA  . TYR B 1 136 ? 19.812 71.837 -13.209 1.00   18.18 ? 130  TYR B CA  1 
ATOM   3212 C C   . TYR B 1 136 ? 20.584 73.058 -12.774 1.00   19.09 ? 130  TYR B C   1 
ATOM   3213 O O   . TYR B 1 136 ? 21.798 73.152 -13.011 1.00   19.12 ? 130  TYR B O   1 
ATOM   3214 C CB  . TYR B 1 136 ? 20.192 70.567 -12.457 1.00   18.16 ? 130  TYR B CB  1 
ATOM   3215 C CG  . TYR B 1 136 ? 19.492 69.348 -12.990 1.00   18.76 ? 130  TYR B CG  1 
ATOM   3216 C CD1 . TYR B 1 136 ? 18.168 69.052 -12.630 1.00   15.58 ? 130  TYR B CD1 1 
ATOM   3217 C CD2 . TYR B 1 136 ? 20.092 68.501 -13.928 1.00   15.27 ? 130  TYR B CD2 1 
ATOM   3218 C CE1 . TYR B 1 136 ? 17.513 67.960 -13.136 1.00   16.58 ? 130  TYR B CE1 1 
ATOM   3219 C CE2 . TYR B 1 136 ? 19.444 67.407 -14.406 1.00   16.90 ? 130  TYR B CE2 1 
ATOM   3220 C CZ  . TYR B 1 136 ? 18.140 67.135 -14.047 1.00   16.85 ? 130  TYR B CZ  1 
ATOM   3221 O OH  . TYR B 1 136 ? 17.484 66.018 -14.516 1.00   16.56 ? 130  TYR B OH  1 
ATOM   3222 N N   . SER B 1 137 ? 19.890 74.017 -12.163 1.00   18.07 ? 131  SER B N   1 
ATOM   3223 C CA  . SER B 1 137 ? 20.447 75.313 -11.934 1.00   19.73 ? 131  SER B CA  1 
ATOM   3224 C C   . SER B 1 137 ? 19.969 75.931 -10.619 1.00   19.34 ? 131  SER B C   1 
ATOM   3225 O O   . SER B 1 137 ? 18.905 75.616 -10.121 1.00   17.67 ? 131  SER B O   1 
ATOM   3226 C CB  . SER B 1 137 ? 20.195 76.203 -13.172 1.00   21.60 ? 131  SER B CB  1 
ATOM   3227 O OG  . SER B 1 137 ? 18.870 76.644 -13.215 1.00   29.29 ? 131  SER B OG  1 
ATOM   3228 N N   . VAL B 1 138 ? 20.823 76.773 -10.063 1.00   18.48 ? 132  VAL B N   1 
ATOM   3229 C CA  . VAL B 1 138 ? 20.587 77.542 -8.877  1.00   19.69 ? 132  VAL B CA  1 
ATOM   3230 C C   . VAL B 1 138 ? 20.760 79.014 -9.204  1.00   18.93 ? 132  VAL B C   1 
ATOM   3231 O O   . VAL B 1 138 ? 21.775 79.419 -9.813  1.00   18.62 ? 132  VAL B O   1 
ATOM   3232 C CB  . VAL B 1 138 ? 21.602 77.182 -7.787  1.00   20.34 ? 132  VAL B CB  1 
ATOM   3233 C CG1 . VAL B 1 138 ? 21.474 78.122 -6.586  1.00   22.90 ? 132  VAL B CG1 1 
ATOM   3234 C CG2 . VAL B 1 138 ? 21.452 75.730 -7.392  1.00   23.82 ? 132  VAL B CG2 1 
ATOM   3235 N N   . LEU B 1 139 ? 19.773 79.822 -8.849  1.00   18.81 ? 133  LEU B N   1 
ATOM   3236 C CA  . LEU B 1 139 ? 19.932 81.273 -8.811  1.00   20.30 ? 133  LEU B CA  1 
ATOM   3237 C C   . LEU B 1 139 ? 19.963 81.697 -7.362  1.00   21.16 ? 133  LEU B C   1 
ATOM   3238 O O   . LEU B 1 139 ? 19.069 81.347 -6.611  1.00   21.30 ? 133  LEU B O   1 
ATOM   3239 C CB  . LEU B 1 139 ? 18.792 81.984 -9.531  1.00   21.52 ? 133  LEU B CB  1 
ATOM   3240 C CG  . LEU B 1 139 ? 18.944 83.509 -9.652  1.00   25.80 ? 133  LEU B CG  1 
ATOM   3241 C CD1 . LEU B 1 139 ? 20.085 83.876 -10.581 1.00   27.29 ? 133  LEU B CD1 1 
ATOM   3242 C CD2 . LEU B 1 139 ? 17.625 84.083 -10.168 1.00   30.41 ? 133  LEU B CD2 1 
ATOM   3243 N N   . TRP B 1 140 ? 21.022 82.393 -6.962  1.00   19.60 ? 134  TRP B N   1 
ATOM   3244 C CA  . TRP B 1 140 ? 21.236 82.751 -5.566  1.00   19.95 ? 134  TRP B CA  1 
ATOM   3245 C C   . TRP B 1 140 ? 21.546 84.235 -5.514  1.00   21.17 ? 134  TRP B C   1 
ATOM   3246 O O   . TRP B 1 140 ? 22.560 84.670 -6.039  1.00   21.01 ? 134  TRP B O   1 
ATOM   3247 C CB  . TRP B 1 140 ? 22.364 81.889 -5.010  1.00   20.38 ? 134  TRP B CB  1 
ATOM   3248 C CG  . TRP B 1 140 ? 22.867 82.217 -3.671  1.00   19.26 ? 134  TRP B CG  1 
ATOM   3249 C CD1 . TRP B 1 140 ? 22.180 82.791 -2.650  1.00   20.31 ? 134  TRP B CD1 1 
ATOM   3250 C CD2 . TRP B 1 140 ? 24.208 82.045 -3.204  1.00   19.11 ? 134  TRP B CD2 1 
ATOM   3251 N NE1 . TRP B 1 140 ? 22.995 82.943 -1.552  1.00   21.24 ? 134  TRP B NE1 1 
ATOM   3252 C CE2 . TRP B 1 140 ? 24.248 82.492 -1.869  1.00   19.54 ? 134  TRP B CE2 1 
ATOM   3253 C CE3 . TRP B 1 140 ? 25.376 81.515 -3.770  1.00   19.43 ? 134  TRP B CE3 1 
ATOM   3254 C CZ2 . TRP B 1 140 ? 25.408 82.470 -1.112  1.00   21.35 ? 134  TRP B CZ2 1 
ATOM   3255 C CZ3 . TRP B 1 140 ? 26.519 81.488 -3.021  1.00   20.53 ? 134  TRP B CZ3 1 
ATOM   3256 C CH2 . TRP B 1 140 ? 26.531 81.964 -1.698  1.00   19.18 ? 134  TRP B CH2 1 
ATOM   3257 N N   . ASN B 1 141 ? 20.631 85.012 -4.947  1.00   22.11 ? 135  ASN B N   1 
ATOM   3258 C CA  . ASN B 1 141 ? 20.875 86.433 -4.648  1.00   22.37 ? 135  ASN B CA  1 
ATOM   3259 C C   . ASN B 1 141 ? 20.458 86.754 -3.227  1.00   23.84 ? 135  ASN B C   1 
ATOM   3260 O O   . ASN B 1 141 ? 20.136 85.868 -2.446  1.00   23.26 ? 135  ASN B O   1 
ATOM   3261 C CB  . ASN B 1 141 ? 20.213 87.357 -5.686  1.00   22.12 ? 135  ASN B CB  1 
ATOM   3262 C CG  . ASN B 1 141 ? 18.701 87.241 -5.718  1.00   23.18 ? 135  ASN B CG  1 
ATOM   3263 O OD1 . ASN B 1 141 ? 18.065 86.938 -4.715  1.00   22.79 ? 135  ASN B OD1 1 
ATOM   3264 N ND2 . ASN B 1 141 ? 18.115 87.526 -6.877  1.00   26.47 ? 135  ASN B ND2 1 
ATOM   3265 N N   . MET B 1 142 ? 20.494 88.027 -2.858  1.00   24.92 ? 136  MET B N   1 
ATOM   3266 C CA  . MET B 1 142 ? 20.225 88.410 -1.470  1.00   26.67 ? 136  MET B CA  1 
ATOM   3267 C C   . MET B 1 142 ? 18.758 88.201 -1.078  1.00   25.68 ? 136  MET B C   1 
ATOM   3268 O O   . MET B 1 142 ? 18.430 88.140 0.115   1.00   26.31 ? 136  MET B O   1 
ATOM   3269 C CB  . MET B 1 142 ? 20.651 89.874 -1.278  1.00   28.08 ? 136  MET B CB  1 
ATOM   3270 C CG  . MET B 1 142 ? 20.625 90.377 0.142   1.00   33.42 ? 136  MET B CG  1 
ATOM   3271 S SD  . MET B 1 142 ? 22.015 89.765 1.105   1.00   41.63 ? 136  MET B SD  1 
ATOM   3272 C CE  . MET B 1 142 ? 23.325 91.060 0.803   1.00   40.89 ? 136  MET B CE  1 
ATOM   3273 N N   . TYR B 1 143 ? 17.885 88.098 -2.076  1.00   25.22 ? 137  TYR B N   1 
ATOM   3274 C CA  . TYR B 1 143 ? 16.434 87.931 -1.890  1.00   25.44 ? 137  TYR B CA  1 
ATOM   3275 C C   . TYR B 1 143 ? 15.943 86.481 -1.782  1.00   23.73 ? 137  TYR B C   1 
ATOM   3276 O O   . TYR B 1 143 ? 14.987 86.192 -1.076  1.00   24.07 ? 137  TYR B O   1 
ATOM   3277 C CB  . TYR B 1 143 ? 15.687 88.605 -3.047  1.00   26.36 ? 137  TYR B CB  1 
ATOM   3278 C CG  . TYR B 1 143 ? 15.663 90.115 -2.872  1.00   30.59 ? 137  TYR B CG  1 
ATOM   3279 C CD1 . TYR B 1 143 ? 16.752 90.882 -3.225  1.00   34.78 ? 137  TYR B CD1 1 
ATOM   3280 C CD2 . TYR B 1 143 ? 14.564 90.746 -2.274  1.00   38.02 ? 137  TYR B CD2 1 
ATOM   3281 C CE1 . TYR B 1 143 ? 16.759 92.274 -3.035  1.00   37.21 ? 137  TYR B CE1 1 
ATOM   3282 C CE2 . TYR B 1 143 ? 14.555 92.148 -2.073  1.00   40.04 ? 137  TYR B CE2 1 
ATOM   3283 C CZ  . TYR B 1 143 ? 15.661 92.889 -2.462  1.00   39.46 ? 137  TYR B CZ  1 
ATOM   3284 O OH  . TYR B 1 143 ? 15.660 94.253 -2.263  1.00   45.41 ? 137  TYR B OH  1 
ATOM   3285 N N   . MET B 1 144 ? 16.575 85.580 -2.515  1.00   21.77 ? 138  MET B N   1 
ATOM   3286 C CA  . MET B 1 144 ? 16.076 84.219 -2.650  1.00   20.68 ? 138  MET B CA  1 
ATOM   3287 C C   . MET B 1 144 ? 17.093 83.292 -3.290  1.00   19.70 ? 138  MET B C   1 
ATOM   3288 O O   . MET B 1 144 ? 18.030 83.730 -3.938  1.00   19.79 ? 138  MET B O   1 
ATOM   3289 C CB  . MET B 1 144 ? 14.815 84.181 -3.507  1.00   21.66 ? 138  MET B CB  1 
ATOM   3290 C CG  . MET B 1 144 ? 15.017 84.588 -4.963  1.00   24.23 ? 138  MET B CG  1 
ATOM   3291 S SD  . MET B 1 144 ? 13.386 84.558 -5.839  1.00   29.33 ? 138  MET B SD  1 
ATOM   3292 C CE  . MET B 1 144 ? 13.838 85.076 -7.478  1.00   28.68 ? 138  MET B CE  1 
ATOM   3293 N N   . ILE B 1 145 ? 16.845 82.011 -3.131  1.00   19.06 ? 139  ILE B N   1 
ATOM   3294 C CA  . ILE B 1 145 ? 17.521 80.935 -3.837  1.00   18.69 ? 139  ILE B CA  1 
ATOM   3295 C C   . ILE B 1 145 ? 16.455 80.201 -4.632  1.00   18.86 ? 139  ILE B C   1 
ATOM   3296 O O   . ILE B 1 145 ? 15.452 79.781 -4.094  1.00   19.98 ? 139  ILE B O   1 
ATOM   3297 C CB  . ILE B 1 145 ? 18.177 79.998 -2.824  1.00   18.00 ? 139  ILE B CB  1 
ATOM   3298 C CG1 . ILE B 1 145 ? 19.347 80.688 -2.170  1.00   20.60 ? 139  ILE B CG1 1 
ATOM   3299 C CG2 . ILE B 1 145 ? 18.574 78.684 -3.490  1.00   18.59 ? 139  ILE B CG2 1 
ATOM   3300 C CD1 . ILE B 1 145 ? 19.796 80.099 -0.855  1.00   20.98 ? 139  ILE B CD1 1 
ATOM   3301 N N   . VAL B 1 146 ? 16.625 80.088 -5.944  1.00   17.66 ? 140  VAL B N   1 
ATOM   3302 C CA  . VAL B 1 146 ? 15.701 79.340 -6.779  1.00   17.94 ? 140  VAL B CA  1 
ATOM   3303 C C   . VAL B 1 146 ? 16.421 78.113 -7.368  1.00   17.31 ? 140  VAL B C   1 
ATOM   3304 O O   . VAL B 1 146 ? 17.575 78.223 -7.806  1.00   18.78 ? 140  VAL B O   1 
ATOM   3305 C CB  . VAL B 1 146 ? 15.199 80.186 -7.975  1.00   18.22 ? 140  VAL B CB  1 
ATOM   3306 C CG1 . VAL B 1 146 ? 14.084 79.472 -8.662  1.00   18.57 ? 140  VAL B CG1 1 
ATOM   3307 C CG2 . VAL B 1 146 ? 14.795 81.545 -7.516  1.00   20.51 ? 140  VAL B CG2 1 
ATOM   3308 N N   . PHE B 1 147 ? 15.775 76.968 -7.274  1.00   17.37 ? 141  PHE B N   1 
ATOM   3309 C CA  . PHE B 1 147 ? 16.224 75.710 -7.837  1.00   16.99 ? 141  PHE B CA  1 
ATOM   3310 C C   . PHE B 1 147 ? 15.406 75.504 -9.114  1.00   17.67 ? 141  PHE B C   1 
ATOM   3311 O O   . PHE B 1 147 ? 14.164 75.523 -9.082  1.00   17.15 ? 141  PHE B O   1 
ATOM   3312 C CB  . PHE B 1 147 ? 15.931 74.515 -6.918  1.00   16.99 ? 141  PHE B CB  1 
ATOM   3313 C CG  . PHE B 1 147 ? 16.646 74.522 -5.568  1.00   15.95 ? 141  PHE B CG  1 
ATOM   3314 C CD1 . PHE B 1 147 ? 16.277 75.402 -4.569  1.00   17.04 ? 141  PHE B CD1 1 
ATOM   3315 C CD2 . PHE B 1 147 ? 17.637 73.591 -5.303  1.00   18.77 ? 141  PHE B CD2 1 
ATOM   3316 C CE1 . PHE B 1 147 ? 16.867 75.378 -3.324  1.00   18.96 ? 141  PHE B CE1 1 
ATOM   3317 C CE2 . PHE B 1 147 ? 18.262 73.560 -4.036  1.00   19.23 ? 141  PHE B CE2 1 
ATOM   3318 C CZ  . PHE B 1 147 ? 17.871 74.467 -3.054  1.00   20.23 ? 141  PHE B CZ  1 
ATOM   3319 N N   . LEU B 1 148 ? 16.077 75.291 -10.242 1.00   17.31 ? 142  LEU B N   1 
ATOM   3320 C CA  . LEU B 1 148 ? 15.386 75.072 -11.503 1.00   17.72 ? 142  LEU B CA  1 
ATOM   3321 C C   . LEU B 1 148 ? 15.809 73.796 -12.180 1.00   18.22 ? 142  LEU B C   1 
ATOM   3322 O O   . LEU B 1 148 ? 16.989 73.398 -12.115 1.00   17.64 ? 142  LEU B O   1 
ATOM   3323 C CB  . LEU B 1 148 ? 15.643 76.233 -12.453 1.00   18.69 ? 142  LEU B CB  1 
ATOM   3324 C CG  . LEU B 1 148 ? 15.244 77.608 -11.898 1.00   21.25 ? 142  LEU B CG  1 
ATOM   3325 C CD1 . LEU B 1 148 ? 16.452 78.477 -11.607 1.00   22.45 ? 142  LEU B CD1 1 
ATOM   3326 C CD2 . LEU B 1 148 ? 14.282 78.301 -12.857 1.00   24.52 ? 142  LEU B CD2 1 
ATOM   3327 N N   . VAL B 1 149 ? 14.854 73.153 -12.822 1.00   17.96 ? 143  VAL B N   1 
ATOM   3328 C CA  . VAL B 1 149 ? 15.075 72.003 -13.690 1.00   19.31 ? 143  VAL B CA  1 
ATOM   3329 C C   . VAL B 1 149 ? 14.645 72.513 -15.057 1.00   21.12 ? 143  VAL B C   1 
ATOM   3330 O O   . VAL B 1 149 ? 13.484 72.916 -15.236 1.00   19.94 ? 143  VAL B O   1 
ATOM   3331 C CB  . VAL B 1 149 ? 14.217 70.808 -13.279 1.00   19.17 ? 143  VAL B CB  1 
ATOM   3332 C CG1 . VAL B 1 149 ? 14.301 69.671 -14.266 1.00   19.16 ? 143  VAL B CG1 1 
ATOM   3333 C CG2 . VAL B 1 149 ? 14.600 70.323 -11.886 1.00   19.78 ? 143  VAL B CG2 1 
ATOM   3334 N N   . ASP B 1 150 ? 15.584 72.553 -15.997 1.00   22.19 ? 144  ASP B N   1 
ATOM   3335 C CA  . ASP B 1 150 ? 15.391 73.307 -17.234 1.00   23.78 ? 144  ASP B CA  1 
ATOM   3336 C C   . ASP B 1 150 ? 14.860 74.711 -16.919 1.00   24.75 ? 144  ASP B C   1 
ATOM   3337 O O   . ASP B 1 150 ? 15.486 75.449 -16.195 1.00   24.95 ? 144  ASP B O   1 
ATOM   3338 C CB  . ASP B 1 150 ? 14.513 72.484 -18.190 1.00   23.60 ? 144  ASP B CB  1 
ATOM   3339 C CG  . ASP B 1 150 ? 15.139 71.153 -18.557 1.00   24.54 ? 144  ASP B CG  1 
ATOM   3340 O OD1 . ASP B 1 150 ? 16.378 71.103 -18.846 1.00   25.36 ? 144  ASP B OD1 1 
ATOM   3341 O OD2 . ASP B 1 150 ? 14.488 70.087 -18.598 1.00   24.21 ? 144  ASP B OD2 1 
ATOM   3342 N N   . ASP B 1 151 ? 13.695 75.099 -17.420 1.00   26.72 ? 145  ASP B N   1 
ATOM   3343 C CA  . ASP B 1 151 ? 13.135 76.417 -17.077 1.00   28.15 ? 145  ASP B CA  1 
ATOM   3344 C C   . ASP B 1 151 ? 12.110 76.409 -15.928 1.00   27.35 ? 145  ASP B C   1 
ATOM   3345 O O   . ASP B 1 151 ? 11.485 77.432 -15.632 1.00   28.13 ? 145  ASP B O   1 
ATOM   3346 C CB  . ASP B 1 151 ? 12.490 77.061 -18.334 1.00   29.83 ? 145  ASP B CB  1 
ATOM   3347 C CG  . ASP B 1 151 ? 11.500 76.139 -19.047 1.00   35.82 ? 145  ASP B CG  1 
ATOM   3348 O OD1 . ASP B 1 151 ? 11.416 74.900 -18.771 1.00   41.47 ? 145  ASP B OD1 1 
ATOM   3349 O OD2 . ASP B 1 151 ? 10.739 76.595 -19.947 1.00   43.83 ? 145  ASP B OD2 1 
ATOM   3350 N N   . VAL B 1 152 ? 11.919 75.264 -15.326 1.00   24.13 ? 146  VAL B N   1 
ATOM   3351 C CA  . VAL B 1 152 ? 10.923 75.104 -14.304 1.00   22.68 ? 146  VAL B CA  1 
ATOM   3352 C C   . VAL B 1 152 ? 11.462 75.317 -12.908 1.00   21.50 ? 146  VAL B C   1 
ATOM   3353 O O   . VAL B 1 152 ? 12.360 74.578 -12.504 1.00   20.29 ? 146  VAL B O   1 
ATOM   3354 C CB  . VAL B 1 152 ? 10.293 73.698 -14.384 1.00   22.07 ? 146  VAL B CB  1 
ATOM   3355 C CG1 . VAL B 1 152 ? 9.237  73.515 -13.320 1.00   22.23 ? 146  VAL B CG1 1 
ATOM   3356 C CG2 . VAL B 1 152 ? 9.716  73.469 -15.777 1.00   25.94 ? 146  VAL B CG2 1 
ATOM   3357 N N   . PRO B 1 153 ? 10.949 76.273 -12.119 1.00   21.21 ? 147  PRO B N   1 
ATOM   3358 C CA  . PRO B 1 153 ? 11.402 76.385 -10.739 1.00   20.64 ? 147  PRO B CA  1 
ATOM   3359 C C   . PRO B 1 153 ? 10.741 75.268 -9.943  1.00   20.64 ? 147  PRO B C   1 
ATOM   3360 O O   . PRO B 1 153 ? 9.525  75.088 -9.996  1.00   21.21 ? 147  PRO B O   1 
ATOM   3361 C CB  . PRO B 1 153 ? 10.870 77.742 -10.274 1.00   21.30 ? 147  PRO B CB  1 
ATOM   3362 C CG  . PRO B 1 153 ? 10.144 78.335 -11.449 1.00   22.13 ? 147  PRO B CG  1 
ATOM   3363 C CD  . PRO B 1 153 ? 9.893  77.236 -12.436 1.00   21.83 ? 147  PRO B CD  1 
ATOM   3364 N N   . ILE B 1 154 ? 11.562 74.504 -9.226  1.00   19.12 ? 148  ILE B N   1 
ATOM   3365 C CA  . ILE B 1 154 ? 11.033 73.422 -8.412  1.00   18.26 ? 148  ILE B CA  1 
ATOM   3366 C C   . ILE B 1 154 ? 10.984 73.771 -6.943  1.00   18.26 ? 148  ILE B C   1 
ATOM   3367 O O   . ILE B 1 154 ? 10.348 73.091 -6.156  1.00   18.54 ? 148  ILE B O   1 
ATOM   3368 C CB  . ILE B 1 154 ? 11.827 72.104 -8.641  1.00   17.14 ? 148  ILE B CB  1 
ATOM   3369 C CG1 . ILE B 1 154 ? 13.303 72.246 -8.265  1.00   16.86 ? 148  ILE B CG1 1 
ATOM   3370 C CG2 . ILE B 1 154 ? 11.702 71.659 -10.079 1.00   17.96 ? 148  ILE B CG2 1 
ATOM   3371 C CD1 . ILE B 1 154 ? 13.989 70.937 -7.943  1.00   17.64 ? 148  ILE B CD1 1 
ATOM   3372 N N   . ARG B 1 155 ? 11.644 74.870 -6.617  1.00   17.89 ? 149  ARG B N   1 
ATOM   3373 C CA  . ARG B 1 155 ? 11.738 75.292 -5.267  1.00   19.09 ? 149  ARG B CA  1 
ATOM   3374 C C   . ARG B 1 155 ? 12.288 76.714 -5.155  1.00   20.08 ? 149  ARG B C   1 
ATOM   3375 O O   . ARG B 1 155 ? 13.145 77.124 -5.932  1.00   18.55 ? 149  ARG B O   1 
ATOM   3376 C CB  . ARG B 1 155 ? 12.607 74.294 -4.510  1.00   20.20 ? 149  ARG B CB  1 
ATOM   3377 C CG  . ARG B 1 155 ? 12.942 74.733 -3.097  1.00   20.26 ? 149  ARG B CG  1 
ATOM   3378 C CD  . ARG B 1 155 ? 13.781 73.708 -2.403  1.00   18.87 ? 149  ARG B CD  1 
ATOM   3379 N NE  . ARG B 1 155 ? 13.767 73.958 -0.970  1.00   17.35 ? 149  ARG B NE  1 
ATOM   3380 C CZ  . ARG B 1 155 ? 14.118 73.107 -0.030  1.00   20.40 ? 149  ARG B CZ  1 
ATOM   3381 N NH1 . ARG B 1 155 ? 14.521 71.876 -0.344  1.00   18.53 ? 149  ARG B NH1 1 
ATOM   3382 N NH2 . ARG B 1 155 ? 14.057 73.485 1.250   1.00   21.94 ? 149  ARG B NH2 1 
ATOM   3383 N N   . VAL B 1 156 ? 11.757 77.473 -4.174  1.00   19.91 ? 150  VAL B N   1 
ATOM   3384 C CA  . VAL B 1 156 ? 12.310 78.790 -3.848  1.00   21.40 ? 150  VAL B CA  1 
ATOM   3385 C C   . VAL B 1 156 ? 12.521 78.854 -2.333  1.00   21.45 ? 150  VAL B C   1 
ATOM   3386 O O   . VAL B 1 156 ? 11.648 78.472 -1.572  1.00   22.45 ? 150  VAL B O   1 
ATOM   3387 C CB  . VAL B 1 156 ? 11.469 79.986 -4.395  1.00   22.77 ? 150  VAL B CB  1 
ATOM   3388 C CG1 . VAL B 1 156 ? 10.100 79.997 -3.720  1.00   24.97 ? 150  VAL B CG1 1 
ATOM   3389 C CG2 . VAL B 1 156 ? 12.205 81.304 -4.180  1.00   25.89 ? 150  VAL B CG2 1 
ATOM   3390 N N   . PHE B 1 157 ? 13.688 79.357 -1.923  1.00   20.20 ? 151  PHE B N   1 
ATOM   3391 C CA  . PHE B 1 157 ? 13.975 79.564 -0.510  1.00   20.73 ? 151  PHE B CA  1 
ATOM   3392 C C   . PHE B 1 157 ? 14.248 81.040 -0.348  1.00   22.08 ? 151  PHE B C   1 
ATOM   3393 O O   . PHE B 1 157 ? 15.300 81.535 -0.783  1.00   21.31 ? 151  PHE B O   1 
ATOM   3394 C CB  . PHE B 1 157 ? 15.160 78.722 -0.047  1.00   19.29 ? 151  PHE B CB  1 
ATOM   3395 C CG  . PHE B 1 157 ? 15.457 78.826 1.435   1.00   21.83 ? 151  PHE B CG  1 
ATOM   3396 C CD1 . PHE B 1 157 ? 14.724 78.136 2.355   1.00   24.75 ? 151  PHE B CD1 1 
ATOM   3397 C CD2 . PHE B 1 157 ? 16.469 79.633 1.894   1.00   19.62 ? 151  PHE B CD2 1 
ATOM   3398 C CE1 . PHE B 1 157 ? 14.994 78.229 3.715   1.00   25.12 ? 151  PHE B CE1 1 
ATOM   3399 C CE2 . PHE B 1 157 ? 16.734 79.723 3.254   1.00   21.82 ? 151  PHE B CE2 1 
ATOM   3400 C CZ  . PHE B 1 157 ? 16.001 79.029 4.181   1.00   21.86 ? 151  PHE B CZ  1 
ATOM   3401 N N   . LYS B 1 158 ? 13.307 81.754 0.251   1.00   22.90 ? 152  LYS B N   1 
ATOM   3402 C CA  . LYS B 1 158 ? 13.398 83.193 0.371   1.00   24.43 ? 152  LYS B CA  1 
ATOM   3403 C C   . LYS B 1 158 ? 14.182 83.601 1.596   1.00   24.52 ? 152  LYS B C   1 
ATOM   3404 O O   . LYS B 1 158 ? 14.261 82.861 2.572   1.00   25.30 ? 152  LYS B O   1 
ATOM   3405 C CB  . LYS B 1 158 ? 12.000 83.820 0.362   1.00   25.35 ? 152  LYS B CB  1 
ATOM   3406 C CG  . LYS B 1 158 ? 11.452 83.987 -1.027  1.00   29.08 ? 152  LYS B CG  1 
ATOM   3407 C CD  . LYS B 1 158 ? 9.989  84.373 -1.043  1.00   35.50 ? 152  LYS B CD  1 
ATOM   3408 C CE  . LYS B 1 158 ? 9.497  84.563 -2.460  1.00   38.45 ? 152  LYS B CE  1 
ATOM   3409 N NZ  . LYS B 1 158 ? 8.033  84.308 -2.589  1.00   42.66 ? 152  LYS B NZ  1 
ATOM   3410 N N   . ASN B 1 159 ? 14.773 84.785 1.522   1.00   25.65 ? 153  ASN B N   1 
ATOM   3411 C CA  . ASN B 1 159 ? 15.495 85.366 2.628   1.00   27.23 ? 153  ASN B CA  1 
ATOM   3412 C C   . ASN B 1 159 ? 14.430 85.931 3.582   1.00   29.04 ? 153  ASN B C   1 
ATOM   3413 O O   . ASN B 1 159 ? 13.800 86.945 3.283   1.00   29.69 ? 153  ASN B O   1 
ATOM   3414 C CB  . ASN B 1 159 ? 16.473 86.457 2.135   1.00   26.93 ? 153  ASN B CB  1 
ATOM   3415 C CG  . ASN B 1 159 ? 17.278 87.090 3.250   1.00   28.43 ? 153  ASN B CG  1 
ATOM   3416 O OD1 . ASN B 1 159 ? 18.255 87.823 2.995   1.00   31.33 ? 153  ASN B OD1 1 
ATOM   3417 N ND2 . ASN B 1 159 ? 16.883 86.834 4.491   1.00   26.87 ? 153  ASN B ND2 1 
ATOM   3418 N N   . CYS B 1 160 ? 14.232 85.225 4.686   1.00   30.79 ? 154  CYS B N   1 
ATOM   3419 C CA  . CYS B 1 160 ? 13.163 85.491 5.649   1.00   32.91 ? 154  CYS B CA  1 
ATOM   3420 C C   . CYS B 1 160 ? 13.754 85.980 6.967   1.00   34.91 ? 154  CYS B C   1 
ATOM   3421 O O   . CYS B 1 160 ? 13.308 85.580 8.043   1.00   34.66 ? 154  CYS B O   1 
ATOM   3422 C CB  . CYS B 1 160 ? 12.327 84.217 5.866   1.00   32.82 ? 154  CYS B CB  1 
ATOM   3423 S SG  . CYS B 1 160 ? 11.353 83.801 4.404   1.00   34.07 ? 154  CYS B SG  1 
ATOM   3424 N N   . LYS B 1 161 ? 14.766 86.845 6.865   1.00   37.54 ? 155  LYS B N   1 
ATOM   3425 C CA  . LYS B 1 161 ? 15.435 87.411 8.045   1.00   39.85 ? 155  LYS B CA  1 
ATOM   3426 C C   . LYS B 1 161 ? 14.422 88.063 8.984   1.00   40.77 ? 155  LYS B C   1 
ATOM   3427 O O   . LYS B 1 161 ? 14.552 87.960 10.202  1.00   41.36 ? 155  LYS B O   1 
ATOM   3428 C CB  . LYS B 1 161 ? 16.536 88.421 7.659   1.00   40.51 ? 155  LYS B CB  1 
ATOM   3429 C CG  . LYS B 1 161 ? 16.077 89.580 6.787   1.00   43.57 ? 155  LYS B CG  1 
ATOM   3430 C CD  . LYS B 1 161 ? 17.177 90.639 6.609   1.00   46.28 ? 155  LYS B CD  1 
ATOM   3431 C CE  . LYS B 1 161 ? 16.868 91.560 5.421   1.00   48.67 ? 155  LYS B CE  1 
ATOM   3432 N NZ  . LYS B 1 161 ? 17.483 91.077 4.125   1.00   49.52 ? 155  LYS B NZ  1 
ATOM   3433 N N   . ASP B 1 162 ? 13.399 88.700 8.418   1.00   41.62 ? 156  ASP B N   1 
ATOM   3434 C CA  . ASP B 1 162 ? 12.379 89.379 9.227   1.00   42.40 ? 156  ASP B CA  1 
ATOM   3435 C C   . ASP B 1 162 ? 11.491 88.408 10.019  1.00   42.09 ? 156  ASP B C   1 
ATOM   3436 O O   . ASP B 1 162 ? 10.870 88.791 11.012  1.00   42.58 ? 156  ASP B O   1 
ATOM   3437 C CB  . ASP B 1 162 ? 11.530 90.324 8.365   1.00   42.61 ? 156  ASP B CB  1 
ATOM   3438 C CG  . ASP B 1 162 ? 10.787 89.604 7.245   1.00   45.85 ? 156  ASP B CG  1 
ATOM   3439 O OD1 . ASP B 1 162 ? 11.424 88.835 6.460   1.00   48.40 ? 156  ASP B OD1 1 
ATOM   3440 O OD2 . ASP B 1 162 ? 9.561  89.757 7.066   1.00   48.38 ? 156  ASP B OD2 1 
ATOM   3441 N N   . LEU B 1 163 ? 11.427 87.152 9.583   1.00   41.12 ? 157  LEU B N   1 
ATOM   3442 C CA  . LEU B 1 163 ? 10.717 86.113 10.317  1.00   40.45 ? 157  LEU B CA  1 
ATOM   3443 C C   . LEU B 1 163 ? 11.633 85.304 11.213  1.00   39.40 ? 157  LEU B C   1 
ATOM   3444 O O   . LEU B 1 163 ? 11.210 84.299 11.769  1.00   40.36 ? 157  LEU B O   1 
ATOM   3445 C CB  . LEU B 1 163 ? 9.981  85.182 9.353   1.00   40.50 ? 157  LEU B CB  1 
ATOM   3446 C CG  . LEU B 1 163 ? 9.108  85.911 8.350   1.00   40.91 ? 157  LEU B CG  1 
ATOM   3447 C CD1 . LEU B 1 163 ? 8.456  84.934 7.387   1.00   41.53 ? 157  LEU B CD1 1 
ATOM   3448 C CD2 . LEU B 1 163 ? 8.062  86.754 9.075   1.00   42.38 ? 157  LEU B CD2 1 
ATOM   3449 N N   . GLY B 1 164 ? 12.882 85.728 11.347  1.00   38.21 ? 158  GLY B N   1 
ATOM   3450 C CA  . GLY B 1 164 ? 13.845 85.046 12.192  1.00   37.48 ? 158  GLY B CA  1 
ATOM   3451 C C   . GLY B 1 164 ? 14.546 83.854 11.572  1.00   36.53 ? 158  GLY B C   1 
ATOM   3452 O O   . GLY B 1 164 ? 15.229 83.114 12.278  1.00   37.25 ? 158  GLY B O   1 
ATOM   3453 N N   . VAL B 1 165 ? 14.388 83.653 10.261  1.00   35.19 ? 159  VAL B N   1 
ATOM   3454 C CA  . VAL B 1 165 ? 15.070 82.553 9.554   1.00   33.47 ? 159  VAL B CA  1 
ATOM   3455 C C   . VAL B 1 165 ? 16.407 83.011 8.914   1.00   31.50 ? 159  VAL B C   1 
ATOM   3456 O O   . VAL B 1 165 ? 16.491 84.084 8.319   1.00   30.50 ? 159  VAL B O   1 
ATOM   3457 C CB  . VAL B 1 165 ? 14.193 81.935 8.447   1.00   33.80 ? 159  VAL B CB  1 
ATOM   3458 C CG1 . VAL B 1 165 ? 14.772 80.560 7.990   1.00   33.09 ? 159  VAL B CG1 1 
ATOM   3459 C CG2 . VAL B 1 165 ? 12.754 81.758 8.918   1.00   33.80 ? 159  VAL B CG2 1 
ATOM   3460 N N   . LYS B 1 166 ? 17.437 82.194 9.069   1.00   29.66 ? 160  LYS B N   1 
ATOM   3461 C CA  . LYS B 1 166 ? 18.734 82.468 8.450   1.00   30.07 ? 160  LYS B CA  1 
ATOM   3462 C C   . LYS B 1 166 ? 18.658 82.227 6.943   1.00   28.19 ? 160  LYS B C   1 
ATOM   3463 O O   . LYS B 1 166 ? 17.766 81.544 6.466   1.00   28.95 ? 160  LYS B O   1 
ATOM   3464 C CB  . LYS B 1 166 ? 19.811 81.577 9.042   1.00   30.09 ? 160  LYS B CB  1 
ATOM   3465 C CG  . LYS B 1 166 ? 20.126 81.867 10.515  1.00   33.31 ? 160  LYS B CG  1 
ATOM   3466 C CD  . LYS B 1 166 ? 21.119 80.836 11.058  1.00   37.03 ? 160  LYS B CD  1 
ATOM   3467 C CE  . LYS B 1 166 ? 21.550 81.156 12.492  1.00   40.40 ? 160  LYS B CE  1 
ATOM   3468 N NZ  . LYS B 1 166 ? 22.224 82.487 12.516  1.00   43.05 ? 160  LYS B NZ  1 
ATOM   3469 N N   . PHE B 1 167 ? 19.628 82.775 6.222   1.00   27.38 ? 161  PHE B N   1 
ATOM   3470 C CA  . PHE B 1 167 ? 19.715 82.691 4.795   1.00   25.90 ? 161  PHE B CA  1 
ATOM   3471 C C   . PHE B 1 167 ? 21.164 82.784 4.393   1.00   26.05 ? 161  PHE B C   1 
ATOM   3472 O O   . PHE B 1 167 ? 21.902 83.540 5.025   1.00   25.44 ? 161  PHE B O   1 
ATOM   3473 C CB  . PHE B 1 167 ? 18.910 83.817 4.163   1.00   25.73 ? 161  PHE B CB  1 
ATOM   3474 C CG  . PHE B 1 167 ? 18.890 83.867 2.670   1.00   22.38 ? 161  PHE B CG  1 
ATOM   3475 C CD1 . PHE B 1 167 ? 17.960 83.108 1.964   1.00   21.62 ? 161  PHE B CD1 1 
ATOM   3476 C CD2 . PHE B 1 167 ? 19.752 84.694 1.966   1.00   21.98 ? 161  PHE B CD2 1 
ATOM   3477 C CE1 . PHE B 1 167 ? 17.918 83.153 0.572   1.00   21.54 ? 161  PHE B CE1 1 
ATOM   3478 C CE2 . PHE B 1 167 ? 19.750 84.716 0.597   1.00   21.68 ? 161  PHE B CE2 1 
ATOM   3479 C CZ  . PHE B 1 167 ? 18.839 83.939 -0.117  1.00   20.96 ? 161  PHE B CZ  1 
ATOM   3480 N N   . PRO B 1 168 ? 21.614 82.055 3.363   1.00   25.50 ? 162  PRO B N   1 
ATOM   3481 C CA  . PRO B 1 168 ? 23.023 82.136 2.952   1.00   25.12 ? 162  PRO B CA  1 
ATOM   3482 C C   . PRO B 1 168 ? 23.351 83.503 2.327   1.00   25.78 ? 162  PRO B C   1 
ATOM   3483 O O   . PRO B 1 168 ? 22.977 83.762 1.173   1.00   23.99 ? 162  PRO B O   1 
ATOM   3484 C CB  . PRO B 1 168 ? 23.154 81.004 1.923   1.00   24.87 ? 162  PRO B CB  1 
ATOM   3485 C CG  . PRO B 1 168 ? 21.938 80.145 2.089   1.00   25.24 ? 162  PRO B CG  1 
ATOM   3486 C CD  . PRO B 1 168 ? 20.858 81.050 2.610   1.00   25.51 ? 162  PRO B CD  1 
ATOM   3487 N N   . PHE B 1 169 ? 24.046 84.355 3.098   1.00   26.70 ? 163  PHE B N   1 
ATOM   3488 C CA  . PHE B 1 169 ? 24.342 85.704 2.587   1.00   27.91 ? 163  PHE B CA  1 
ATOM   3489 C C   . PHE B 1 169 ? 25.762 86.180 2.792   1.00   27.95 ? 163  PHE B C   1 
ATOM   3490 O O   . PHE B 1 169 ? 26.235 87.053 2.067   1.00   28.59 ? 163  PHE B O   1 
ATOM   3491 C CB  . PHE B 1 169 ? 23.358 86.723 3.171   1.00   28.43 ? 163  PHE B CB  1 
ATOM   3492 C CG  . PHE B 1 169 ? 23.705 87.179 4.558   1.00   31.00 ? 163  PHE B CG  1 
ATOM   3493 C CD1 . PHE B 1 169 ? 23.461 86.364 5.656   1.00   33.51 ? 163  PHE B CD1 1 
ATOM   3494 C CD2 . PHE B 1 169 ? 24.309 88.414 4.764   1.00   33.19 ? 163  PHE B CD2 1 
ATOM   3495 C CE1 . PHE B 1 169 ? 23.792 86.778 6.942   1.00   33.69 ? 163  PHE B CE1 1 
ATOM   3496 C CE2 . PHE B 1 169 ? 24.647 88.834 6.054   1.00   34.11 ? 163  PHE B CE2 1 
ATOM   3497 C CZ  . PHE B 1 169 ? 24.383 88.015 7.138   1.00   33.41 ? 163  PHE B CZ  1 
ATOM   3498 N N   . ASN B 1 170 ? 26.469 85.597 3.765   1.00   28.04 ? 164  ASN B N   1 
ATOM   3499 C CA  . ASN B 1 170 ? 27.845 86.029 3.999   1.00   28.34 ? 164  ASN B CA  1 
ATOM   3500 C C   . ASN B 1 170 ? 28.942 84.900 4.033   1.00   27.74 ? 164  ASN B C   1 
ATOM   3501 O O   . ASN B 1 170 ? 30.058 85.159 4.500   1.00   27.90 ? 164  ASN B O   1 
ATOM   3502 C CB  . ASN B 1 170 ? 27.887 86.891 5.263   1.00   28.72 ? 164  ASN B CB  1 
ATOM   3503 C CG  . ASN B 1 170 ? 27.733 86.155 6.578   1.00   30.48 ? 164  ASN B CG  1 
ATOM   3504 O OD1 . ASN B 1 170 ? 27.415 84.954 6.615   1.00   31.43 ? 164  ASN B OD1 1 
ATOM   3505 N ND2 . ASN B 1 170 ? 27.953 86.867 7.684   1.00   33.55 ? 164  ASN B ND2 1 
ATOM   3506 N N   . GLN B 1 171 ? 28.657 83.690 3.561   1.00   26.70 ? 165  GLN B N   1 
ATOM   3507 C CA  . GLN B 1 171 ? 29.657 82.627 3.557   1.00   26.12 ? 165  GLN B CA  1 
ATOM   3508 C C   . GLN B 1 171 ? 29.913 82.172 2.098   1.00   26.01 ? 165  GLN B C   1 
ATOM   3509 O O   . GLN B 1 171 ? 29.080 81.429 1.576   1.00   25.14 ? 165  GLN B O   1 
ATOM   3510 C CB  . GLN B 1 171 ? 29.201 81.450 4.437   1.00   27.16 ? 165  GLN B CB  1 
ATOM   3511 C CG  . GLN B 1 171 ? 28.989 81.840 5.891   1.00   29.41 ? 165  GLN B CG  1 
ATOM   3512 C CD  . GLN B 1 171 ? 28.324 80.743 6.712   1.00   34.73 ? 165  GLN B CD  1 
ATOM   3513 O OE1 . GLN B 1 171 ? 28.530 79.570 6.461   1.00   38.20 ? 165  GLN B OE1 1 
ATOM   3514 N NE2 . GLN B 1 171 ? 27.483 80.922 7.731   1.00   40.39 ? 165  GLN B NE2 1 
ATOM   3515 N N   . PRO B 1 172 ? 31.004 82.572 1.449   1.00   24.72 ? 166  PRO B N   1 
ATOM   3516 C CA  . PRO B 1 172 ? 31.242 82.138 0.067   1.00   24.67 ? 166  PRO B CA  1 
ATOM   3517 C C   . PRO B 1 172 ? 31.229 80.625 -0.071  1.00   23.52 ? 166  PRO B C   1 
ATOM   3518 O O   . PRO B 1 172 ? 31.753 79.902 0.783   1.00   23.54 ? 166  PRO B O   1 
ATOM   3519 C CB  . PRO B 1 172 ? 32.618 82.702 -0.275  1.00   24.92 ? 166  PRO B CB  1 
ATOM   3520 C CG  . PRO B 1 172 ? 32.849 83.811 0.702   1.00   26.71 ? 166  PRO B CG  1 
ATOM   3521 C CD  . PRO B 1 172 ? 32.019 83.523 1.931   1.00   26.30 ? 166  PRO B CD  1 
ATOM   3522 N N   . MET B 1 173 ? 30.604 80.146 -1.152  1.00   22.58 ? 167  MET B N   1 
ATOM   3523 C CA  . MET B 1 173 ? 30.508 78.716 -1.363  1.00   21.53 ? 167  MET B CA  1 
ATOM   3524 C C   . MET B 1 173 ? 31.225 78.285 -2.640  1.00   21.81 ? 167  MET B C   1 
ATOM   3525 O O   . MET B 1 173 ? 31.277 79.033 -3.620  1.00   21.15 ? 167  MET B O   1 
ATOM   3526 C CB  . MET B 1 173 ? 29.030 78.283 -1.450  1.00   21.56 ? 167  MET B CB  1 
ATOM   3527 C CG  . MET B 1 173 ? 28.075 78.910 -0.440  1.00   22.86 ? 167  MET B CG  1 
ATOM   3528 S SD  . MET B 1 173 ? 26.647 77.868 -0.104  1.00   28.07 ? 167  MET B SD  1 
ATOM   3529 C CE  . MET B 1 173 ? 25.301 78.934 -0.632  1.00   29.55 ? 167  MET B CE  1 
ATOM   3530 N N   . LYS B 1 174 ? 31.766 77.059 -2.619  1.00   20.55 ? 168  LYS B N   1 
ATOM   3531 C CA  . LYS B 1 174 ? 32.258 76.381 -3.803  1.00   21.45 ? 168  LYS B CA  1 
ATOM   3532 C C   . LYS B 1 174 ? 31.148 75.505 -4.373  1.00   20.70 ? 168  LYS B C   1 
ATOM   3533 O O   . LYS B 1 174 ? 30.182 75.152 -3.659  1.00   20.01 ? 168  LYS B O   1 
ATOM   3534 C CB  . LYS B 1 174 ? 33.465 75.489 -3.466  1.00   22.61 ? 168  LYS B CB  1 
ATOM   3535 C CG  . LYS B 1 174 ? 34.759 76.208 -3.188  1.00   27.66 ? 168  LYS B CG  1 
ATOM   3536 C CD  . LYS B 1 174 ? 35.925 75.192 -3.245  1.00   31.83 ? 168  LYS B CD  1 
ATOM   3537 C CE  . LYS B 1 174 ? 37.267 75.860 -3.478  1.00   37.28 ? 168  LYS B CE  1 
ATOM   3538 N NZ  . LYS B 1 174 ? 37.517 76.843 -2.406  1.00   41.56 ? 168  LYS B NZ  1 
ATOM   3539 N N   . ILE B 1 175 ? 31.266 75.188 -5.650  1.00   20.10 ? 169  ILE B N   1 
ATOM   3540 C CA  . ILE B 1 175 ? 30.346 74.314 -6.341  1.00   21.46 ? 169  ILE B CA  1 
ATOM   3541 C C   . ILE B 1 175 ? 30.987 72.923 -6.347  1.00   21.44 ? 169  ILE B C   1 
ATOM   3542 O O   . ILE B 1 175 ? 32.190 72.769 -6.605  1.00   22.26 ? 169  ILE B O   1 
ATOM   3543 C CB  . ILE B 1 175 ? 30.102 74.777 -7.790  1.00   22.60 ? 169  ILE B CB  1 
ATOM   3544 C CG1 . ILE B 1 175 ? 29.470 76.158 -7.843  1.00   26.93 ? 169  ILE B CG1 1 
ATOM   3545 C CG2 . ILE B 1 175 ? 29.208 73.761 -8.496  1.00   23.88 ? 169  ILE B CG2 1 
ATOM   3546 C CD1 . ILE B 1 175 ? 30.393 77.276 -7.751  1.00   30.98 ? 169  ILE B CD1 1 
ATOM   3547 N N   . TYR B 1 176 ? 30.197 71.925 -5.999  1.00   20.04 ? 170  TYR B N   1 
ATOM   3548 C CA  . TYR B 1 176 ? 30.630 70.545 -5.926  1.00   19.83 ? 170  TYR B CA  1 
ATOM   3549 C C   . TYR B 1 176 ? 29.719 69.648 -6.724  1.00   20.56 ? 170  TYR B C   1 
ATOM   3550 O O   . TYR B 1 176 ? 28.504 69.920 -6.869  1.00   19.81 ? 170  TYR B O   1 
ATOM   3551 C CB  . TYR B 1 176 ? 30.616 70.078 -4.478  1.00   19.95 ? 170  TYR B CB  1 
ATOM   3552 C CG  . TYR B 1 176 ? 31.547 70.789 -3.555  1.00   20.51 ? 170  TYR B CG  1 
ATOM   3553 C CD1 . TYR B 1 176 ? 32.842 70.330 -3.342  1.00   23.19 ? 170  TYR B CD1 1 
ATOM   3554 C CD2 . TYR B 1 176 ? 31.127 71.910 -2.848  1.00   20.98 ? 170  TYR B CD2 1 
ATOM   3555 C CE1 . TYR B 1 176 ? 33.687 70.978 -2.459  1.00   23.86 ? 170  TYR B CE1 1 
ATOM   3556 C CE2 . TYR B 1 176 ? 31.958 72.561 -1.993  1.00   22.23 ? 170  TYR B CE2 1 
ATOM   3557 C CZ  . TYR B 1 176 ? 33.258 72.094 -1.809  1.00   23.67 ? 170  TYR B CZ  1 
ATOM   3558 O OH  . TYR B 1 176 ? 34.058 72.765 -0.920  1.00   23.53 ? 170  TYR B OH  1 
ATOM   3559 N N   . SER B 1 177 ? 30.271 68.580 -7.283  1.00   20.09 ? 171  SER B N   1 
ATOM   3560 C CA  . SER B 1 177 ? 29.454 67.463 -7.700  1.00   20.84 ? 171  SER B CA  1 
ATOM   3561 C C   . SER B 1 177 ? 30.115 66.168 -7.321  1.00   21.08 ? 171  SER B C   1 
ATOM   3562 O O   . SER B 1 177 ? 31.351 66.078 -7.233  1.00   20.66 ? 171  SER B O   1 
ATOM   3563 C CB  . SER B 1 177 ? 29.128 67.418 -9.201  1.00   21.72 ? 171  SER B CB  1 
ATOM   3564 O OG  . SER B 1 177 ? 28.711 68.672 -9.724  1.00   28.54 ? 171  SER B OG  1 
ATOM   3565 N N   . SER B 1 178 ? 29.302 65.153 -7.108  1.00   20.37 ? 172  SER B N   1 
ATOM   3566 C CA  . SER B 1 178 ? 29.810 63.859 -6.723  1.00   20.98 ? 172  SER B CA  1 
ATOM   3567 C C   . SER B 1 178 ? 28.816 62.734 -6.986  1.00   21.36 ? 172  SER B C   1 
ATOM   3568 O O   . SER B 1 178 ? 27.612 62.948 -7.189  1.00   20.29 ? 172  SER B O   1 
ATOM   3569 C CB  . SER B 1 178 ? 30.211 63.872 -5.248  1.00   22.47 ? 172  SER B CB  1 
ATOM   3570 O OG  . SER B 1 178 ? 29.054 64.016 -4.450  1.00   23.22 ? 172  SER B OG  1 
ATOM   3571 N N   . LEU B 1 179 ? 29.343 61.526 -6.970  1.00   19.98 ? 173  LEU B N   1 
ATOM   3572 C CA  . LEU B 1 179 ? 28.588 60.319 -7.177  1.00   20.79 ? 173  LEU B CA  1 
ATOM   3573 C C   . LEU B 1 179 ? 29.108 59.327 -6.146  1.00   21.89 ? 173  LEU B C   1 
ATOM   3574 O O   . LEU B 1 179 ? 30.308 59.024 -6.109  1.00   20.14 ? 173  LEU B O   1 
ATOM   3575 C CB  . LEU B 1 179 ? 28.762 59.796 -8.594  1.00   21.68 ? 173  LEU B CB  1 
ATOM   3576 C CG  . LEU B 1 179 ? 28.113 58.436 -8.861  1.00   21.32 ? 173  LEU B CG  1 
ATOM   3577 C CD1 . LEU B 1 179 ? 26.591 58.481 -8.690  1.00   21.68 ? 173  LEU B CD1 1 
ATOM   3578 C CD2 . LEU B 1 179 ? 28.435 57.857 -10.229 1.00   23.32 ? 173  LEU B CD2 1 
ATOM   3579 N N   . TRP B 1 180 ? 28.225 58.898 -5.251  1.00   21.93 ? 174  TRP B N   1 
ATOM   3580 C CA  . TRP B 1 180 ? 28.590 58.090 -4.107  1.00   24.15 ? 174  TRP B CA  1 
ATOM   3581 C C   . TRP B 1 180 ? 27.450 57.175 -3.713  1.00   25.27 ? 174  TRP B C   1 
ATOM   3582 O O   . TRP B 1 180 ? 26.313 57.388 -4.093  1.00   23.42 ? 174  TRP B O   1 
ATOM   3583 C CB  . TRP B 1 180 ? 29.022 58.956 -2.908  1.00   24.72 ? 174  TRP B CB  1 
ATOM   3584 C CG  A TRP B 1 180 ? 28.022 60.094 -2.652  0.50   25.66 ? 174  TRP B CG  1 
ATOM   3585 C CG  B TRP B 1 180 ? 30.173 58.239 -2.155  0.50   27.65 ? 174  TRP B CG  1 
ATOM   3586 C CD1 A TRP B 1 180 ? 27.723 61.195 -3.458  0.50   26.65 ? 174  TRP B CD1 1 
ATOM   3587 C CD1 B TRP B 1 180 ? 30.034 57.355 -1.106  0.50   30.18 ? 174  TRP B CD1 1 
ATOM   3588 C CD2 A TRP B 1 180 ? 27.244 60.259 -1.459  0.50   27.65 ? 174  TRP B CD2 1 
ATOM   3589 C CD2 B TRP B 1 180 ? 31.597 58.357 -2.373  0.50   28.55 ? 174  TRP B CD2 1 
ATOM   3590 N NE1 A TRP B 1 180 ? 26.805 61.993 -2.820  0.50   29.19 ? 174  TRP B NE1 1 
ATOM   3591 N NE1 B TRP B 1 180 ? 31.265 56.914 -0.682  0.50   30.69 ? 174  TRP B NE1 1 
ATOM   3592 C CE2 A TRP B 1 180 ? 26.498 61.445 -1.595  0.50   27.01 ? 174  TRP B CE2 1 
ATOM   3593 C CE2 B TRP B 1 180 ? 32.239 57.509 -1.440  0.50   29.74 ? 174  TRP B CE2 1 
ATOM   3594 C CE3 A TRP B 1 180 ? 27.104 59.510 -0.275  0.50   28.34 ? 174  TRP B CE3 1 
ATOM   3595 C CE3 B TRP B 1 180 ? 32.393 59.103 -3.244  0.50   29.77 ? 174  TRP B CE3 1 
ATOM   3596 C CZ2 A TRP B 1 180 ? 25.621 61.888 -0.604  0.50   30.22 ? 174  TRP B CZ2 1 
ATOM   3597 C CZ2 B TRP B 1 180 ? 33.630 57.376 -1.372  0.50   29.72 ? 174  TRP B CZ2 1 
ATOM   3598 C CZ3 A TRP B 1 180 ? 26.243 59.949 0.695   0.50   29.52 ? 174  TRP B CZ3 1 
ATOM   3599 C CZ3 B TRP B 1 180 ? 33.775 58.972 -3.166  0.50   29.24 ? 174  TRP B CZ3 1 
ATOM   3600 C CH2 A TRP B 1 180 ? 25.509 61.128 0.528   0.50   29.50 ? 174  TRP B CH2 1 
ATOM   3601 C CH2 B TRP B 1 180 ? 34.375 58.108 -2.246  0.50   29.66 ? 174  TRP B CH2 1 
ATOM   3602 N N   . ASN B 1 181 ? 27.770 56.145 -2.943  1.00   26.71 ? 175  ASN B N   1 
ATOM   3603 C CA  . ASN B 1 181 ? 26.761 55.244 -2.402  1.00   28.57 ? 175  ASN B CA  1 
ATOM   3604 C C   . ASN B 1 181 ? 26.155 55.738 -1.104  1.00   28.80 ? 175  ASN B C   1 
ATOM   3605 O O   . ASN B 1 181 ? 26.856 56.278 -0.254  1.00   28.53 ? 175  ASN B O   1 
ATOM   3606 C CB  . ASN B 1 181 ? 27.372 53.873 -2.186  1.00   29.55 ? 175  ASN B CB  1 
ATOM   3607 C CG  . ASN B 1 181 ? 26.464 52.935 -1.433  1.00   31.39 ? 175  ASN B CG  1 
ATOM   3608 O OD1 . ASN B 1 181 ? 25.573 52.321 -2.006  1.00   34.02 ? 175  ASN B OD1 1 
ATOM   3609 N ND2 . ASN B 1 181 ? 26.684 52.814 -0.133  1.00   38.10 ? 175  ASN B ND2 1 
ATOM   3610 N N   . ALA B 1 182 ? 24.849 55.533 -0.930  1.00   29.24 ? 176  ALA B N   1 
ATOM   3611 C CA  . ALA B 1 182 ? 24.203 55.901 0.300   1.00   30.73 ? 176  ALA B CA  1 
ATOM   3612 C C   . ALA B 1 182 ? 23.071 54.906 0.549   1.00   32.21 ? 176  ALA B C   1 
ATOM   3613 O O   . ALA B 1 182 ? 21.901 55.256 0.577   1.00   31.82 ? 176  ALA B O   1 
ATOM   3614 C CB  . ALA B 1 182 ? 23.640 57.309 0.232   1.00   31.54 ? 176  ALA B CB  1 
ATOM   3615 N N   . ASP B 1 183 ? 23.491 53.648 0.712   1.00   33.00 ? 177  ASP B N   1 
ATOM   3616 C CA  . ASP B 1 183 ? 22.616 52.511 0.983   1.00   34.50 ? 177  ASP B CA  1 
ATOM   3617 C C   . ASP B 1 183 ? 21.624 52.720 2.110   1.00   33.81 ? 177  ASP B C   1 
ATOM   3618 O O   . ASP B 1 183 ? 20.498 52.195 2.085   1.00   34.85 ? 177  ASP B O   1 
ATOM   3619 C CB  . ASP B 1 183 ? 23.459 51.327 1.427   1.00   34.82 ? 177  ASP B CB  1 
ATOM   3620 C CG  . ASP B 1 183 ? 23.808 50.373 0.314   1.00   37.24 ? 177  ASP B CG  1 
ATOM   3621 O OD1 . ASP B 1 183 ? 23.526 50.694 -0.849  1.00   42.45 ? 177  ASP B OD1 1 
ATOM   3622 O OD2 . ASP B 1 183 ? 24.359 49.307 0.620   1.00   44.18 ? 177  ASP B OD2 1 
ATOM   3623 N N   . ASP B 1 184 ? 22.032 53.490 3.103   1.00   33.14 ? 178  ASP B N   1 
ATOM   3624 C CA  . ASP B 1 184 ? 21.263 53.644 4.335   1.00   33.24 ? 178  ASP B CA  1 
ATOM   3625 C C   . ASP B 1 184 ? 20.015 54.531 4.194   1.00   32.15 ? 178  ASP B C   1 
ATOM   3626 O O   . ASP B 1 184 ? 19.131 54.486 5.033   1.00   31.84 ? 178  ASP B O   1 
ATOM   3627 C CB  . ASP B 1 184 ? 22.163 54.132 5.501   1.00   34.05 ? 178  ASP B CB  1 
ATOM   3628 C CG  . ASP B 1 184 ? 23.054 55.333 5.139   1.00   37.22 ? 178  ASP B CG  1 
ATOM   3629 O OD1 . ASP B 1 184 ? 23.819 55.291 4.123   1.00   40.98 ? 178  ASP B OD1 1 
ATOM   3630 O OD2 . ASP B 1 184 ? 23.086 56.372 5.848   1.00   42.57 ? 178  ASP B OD2 1 
ATOM   3631 N N   . TRP B 1 185 ? 19.917 55.325 3.127   1.00   30.12 ? 179  TRP B N   1 
ATOM   3632 C CA  . TRP B 1 185 ? 18.777 56.221 3.005   1.00   28.62 ? 179  TRP B CA  1 
ATOM   3633 C C   . TRP B 1 185 ? 18.272 56.528 1.598   1.00   28.16 ? 179  TRP B C   1 
ATOM   3634 O O   . TRP B 1 185 ? 17.161 57.025 1.457   1.00   28.66 ? 179  TRP B O   1 
ATOM   3635 C CB  . TRP B 1 185 ? 19.081 57.531 3.716   1.00   28.04 ? 179  TRP B CB  1 
ATOM   3636 C CG  . TRP B 1 185 ? 20.216 58.383 3.141   1.00   27.34 ? 179  TRP B CG  1 
ATOM   3637 C CD1 . TRP B 1 185 ? 21.537 58.329 3.479   1.00   28.98 ? 179  TRP B CD1 1 
ATOM   3638 C CD2 . TRP B 1 185 ? 20.097 59.441 2.184   1.00   25.67 ? 179  TRP B CD2 1 
ATOM   3639 N NE1 . TRP B 1 185 ? 22.255 59.274 2.778   1.00   28.87 ? 179  TRP B NE1 1 
ATOM   3640 C CE2 . TRP B 1 185 ? 21.394 59.980 1.981   1.00   25.94 ? 179  TRP B CE2 1 
ATOM   3641 C CE3 . TRP B 1 185 ? 19.028 59.983 1.460   1.00   24.40 ? 179  TRP B CE3 1 
ATOM   3642 C CZ2 . TRP B 1 185 ? 21.645 61.014 1.077   1.00   25.43 ? 179  TRP B CZ2 1 
ATOM   3643 C CZ3 . TRP B 1 185 ? 19.269 61.035 0.602   1.00   24.91 ? 179  TRP B CZ3 1 
ATOM   3644 C CH2 . TRP B 1 185 ? 20.565 61.536 0.409   1.00   25.25 ? 179  TRP B CH2 1 
ATOM   3645 N N   . ALA B 1 186 ? 19.075 56.264 0.579   1.00   26.89 ? 180  ALA B N   1 
ATOM   3646 C CA  . ALA B 1 186 ? 18.796 56.815 -0.750  1.00   26.44 ? 180  ALA B CA  1 
ATOM   3647 C C   . ALA B 1 186 ? 17.544 56.243 -1.409  1.00   26.20 ? 180  ALA B C   1 
ATOM   3648 O O   . ALA B 1 186 ? 16.728 56.988 -1.955  1.00   26.01 ? 180  ALA B O   1 
ATOM   3649 C CB  . ALA B 1 186 ? 20.017 56.643 -1.675  1.00   26.55 ? 180  ALA B CB  1 
ATOM   3650 N N   . THR B 1 187 ? 17.432 54.927 -1.447  1.00   26.49 ? 181  THR B N   1 
ATOM   3651 C CA  . THR B 1 187 ? 16.372 54.290 -2.248  1.00   26.48 ? 181  THR B CA  1 
ATOM   3652 C C   . THR B 1 187 ? 15.328 53.577 -1.375  1.00   28.15 ? 181  THR B C   1 
ATOM   3653 O O   . THR B 1 187 ? 15.657 52.693 -0.597  1.00   27.63 ? 181  THR B O   1 
ATOM   3654 C CB  . THR B 1 187 ? 17.009 53.317 -3.237  1.00   26.53 ? 181  THR B CB  1 
ATOM   3655 O OG1 . THR B 1 187 ? 18.107 53.962 -3.907  1.00   25.97 ? 181  THR B OG1 1 
ATOM   3656 C CG2 . THR B 1 187 ? 15.970 52.850 -4.237  1.00   26.09 ? 181  THR B CG2 1 
ATOM   3657 N N   . ARG B 1 188 ? 14.074 53.988 -1.527  1.00   28.73 ? 182  ARG B N   1 
ATOM   3658 C CA  . ARG B 1 188 ? 12.987 53.505 -0.695  1.00   30.42 ? 182  ARG B CA  1 
ATOM   3659 C C   . ARG B 1 188 ? 13.341 53.735 0.759   1.00   31.24 ? 182  ARG B C   1 
ATOM   3660 O O   . ARG B 1 188 ? 13.138 52.875 1.600   1.00   31.75 ? 182  ARG B O   1 
ATOM   3661 C CB  . ARG B 1 188 ? 12.682 52.015 -0.989  1.00   30.09 ? 182  ARG B CB  1 
ATOM   3662 C CG  . ARG B 1 188 ? 12.026 51.783 -2.351  1.00   31.75 ? 182  ARG B CG  1 
ATOM   3663 C CD  . ARG B 1 188 ? 11.484 50.366 -2.492  1.00   35.33 ? 182  ARG B CD  1 
ATOM   3664 N NE  . ARG B 1 188 ? 10.485 50.030 -1.479  1.00   38.06 ? 182  ARG B NE  1 
ATOM   3665 C CZ  . ARG B 1 188 ? 10.543 48.948 -0.699  1.00   40.40 ? 182  ARG B CZ  1 
ATOM   3666 N NH1 . ARG B 1 188 ? 11.557 48.099 -0.829  1.00   40.27 ? 182  ARG B NH1 1 
ATOM   3667 N NH2 . ARG B 1 188 ? 9.590  48.720 0.199   1.00   42.62 ? 182  ARG B NH2 1 
ATOM   3668 N N   . GLY B 1 189 ? 13.879 54.913 1.046   1.00   31.75 ? 183  GLY B N   1 
ATOM   3669 C CA  . GLY B 1 189 ? 14.231 55.316 2.401   1.00   32.62 ? 183  GLY B CA  1 
ATOM   3670 C C   . GLY B 1 189 ? 15.348 54.499 3.044   1.00   33.33 ? 183  GLY B C   1 
ATOM   3671 O O   . GLY B 1 189 ? 15.561 54.607 4.240   1.00   34.26 ? 183  GLY B O   1 
ATOM   3672 N N   . GLY B 1 190 ? 16.050 53.687 2.263   1.00   33.83 ? 184  GLY B N   1 
ATOM   3673 C CA  . GLY B 1 190 ? 17.127 52.860 2.767   1.00   34.73 ? 184  GLY B CA  1 
ATOM   3674 C C   . GLY B 1 190 ? 16.870 51.369 2.623   1.00   35.66 ? 184  GLY B C   1 
ATOM   3675 O O   . GLY B 1 190 ? 17.739 50.550 2.967   1.00   36.35 ? 184  GLY B O   1 
ATOM   3676 N N   . LEU B 1 191 ? 15.694 50.982 2.125   1.00   36.69 ? 185  LEU B N   1 
ATOM   3677 C CA  . LEU B 1 191 ? 15.339 49.564 1.986   1.00   36.96 ? 185  LEU B CA  1 
ATOM   3678 C C   . LEU B 1 191 ? 15.990 48.871 0.792   1.00   36.89 ? 185  LEU B C   1 
ATOM   3679 O O   . LEU B 1 191 ? 16.213 47.653 0.816   1.00   37.09 ? 185  LEU B O   1 
ATOM   3680 C CB  . LEU B 1 191 ? 13.818 49.416 1.908   1.00   37.15 ? 185  LEU B CB  1 
ATOM   3681 C CG  . LEU B 1 191 ? 13.075 49.660 3.207   1.00   38.84 ? 185  LEU B CG  1 
ATOM   3682 C CD1 . LEU B 1 191 ? 11.581 49.608 2.960   1.00   38.20 ? 185  LEU B CD1 1 
ATOM   3683 C CD2 . LEU B 1 191 ? 13.480 48.643 4.250   1.00   40.11 ? 185  LEU B CD2 1 
ATOM   3684 N N   . GLU B 1 192 ? 16.277 49.613 -0.266  1.00   35.63 ? 186  GLU B N   1 
ATOM   3685 C CA  . GLU B 1 192 ? 16.922 49.028 -1.439  1.00   35.71 ? 186  GLU B CA  1 
ATOM   3686 C C   . GLU B 1 192 ? 18.413 49.348 -1.455  1.00   35.97 ? 186  GLU B C   1 
ATOM   3687 O O   . GLU B 1 192 ? 18.808 50.508 -1.549  1.00   35.47 ? 186  GLU B O   1 
ATOM   3688 C CB  . GLU B 1 192 ? 16.306 49.548 -2.734  1.00   35.55 ? 186  GLU B CB  1 
ATOM   3689 C CG  . GLU B 1 192 ? 14.822 49.254 -2.879  1.00   36.23 ? 186  GLU B CG  1 
ATOM   3690 C CD  . GLU B 1 192 ? 14.508 47.793 -3.172  1.00   37.39 ? 186  GLU B CD  1 
ATOM   3691 O OE1 . GLU B 1 192 ? 15.382 47.044 -3.651  1.00   36.72 ? 186  GLU B OE1 1 
ATOM   3692 O OE2 . GLU B 1 192 ? 13.359 47.397 -2.940  1.00   38.38 ? 186  GLU B OE2 1 
ATOM   3693 N N   . LYS B 1 193 ? 19.219 48.295 -1.380  1.00   35.78 ? 187  LYS B N   1 
ATOM   3694 C CA  . LYS B 1 193 ? 20.665 48.400 -1.272  1.00   35.65 ? 187  LYS B CA  1 
ATOM   3695 C C   . LYS B 1 193 ? 21.272 48.265 -2.652  1.00   34.71 ? 187  LYS B C   1 
ATOM   3696 O O   . LYS B 1 193 ? 20.703 47.637 -3.532  1.00   35.46 ? 187  LYS B O   1 
ATOM   3697 C CB  . LYS B 1 193 ? 21.216 47.312 -0.328  1.00   35.64 ? 187  LYS B CB  1 
ATOM   3698 C CG  . LYS B 1 193 ? 20.510 47.215 1.022   1.00   36.36 ? 187  LYS B CG  1 
ATOM   3699 C CD  . LYS B 1 193 ? 20.691 48.480 1.852   1.00   37.16 ? 187  LYS B CD  1 
ATOM   3700 C CE  . LYS B 1 193 ? 20.031 48.379 3.229   1.00   37.58 ? 187  LYS B CE  1 
ATOM   3701 N NZ  . LYS B 1 193 ? 20.064 49.692 3.959   1.00   37.19 ? 187  LYS B NZ  1 
ATOM   3702 N N   . THR B 1 194 ? 22.430 48.888 -2.840  1.00   34.32 ? 188  THR B N   1 
ATOM   3703 C CA  . THR B 1 194 ? 23.140 48.847 -4.096  1.00   33.94 ? 188  THR B CA  1 
ATOM   3704 C C   . THR B 1 194 ? 23.570 47.421 -4.431  1.00   35.42 ? 188  THR B C   1 
ATOM   3705 O O   . THR B 1 194 ? 24.080 46.688 -3.573  1.00   35.84 ? 188  THR B O   1 
ATOM   3706 C CB  . THR B 1 194 ? 24.383 49.738 -4.035  1.00   33.65 ? 188  THR B CB  1 
ATOM   3707 O OG1 . THR B 1 194 ? 24.020 51.090 -3.688  1.00   32.74 ? 188  THR B OG1 1 
ATOM   3708 C CG2 . THR B 1 194 ? 25.043 49.826 -5.406  1.00   32.86 ? 188  THR B CG2 1 
ATOM   3709 N N   . ASP B 1 195 ? 23.379 47.060 -5.683  1.00   35.98 ? 189  ASP B N   1 
ATOM   3710 C CA  . ASP B 1 195 ? 23.809 45.793 -6.227  1.00   37.07 ? 189  ASP B CA  1 
ATOM   3711 C C   . ASP B 1 195 ? 25.121 46.063 -6.938  1.00   36.52 ? 189  ASP B C   1 
ATOM   3712 O O   . ASP B 1 195 ? 25.172 46.548 -8.069  1.00   35.79 ? 189  ASP B O   1 
ATOM   3713 C CB  . ASP B 1 195 ? 22.730 45.254 -7.172  1.00   37.55 ? 189  ASP B CB  1 
ATOM   3714 C CG  . ASP B 1 195 ? 23.139 43.980 -7.870  1.00   39.68 ? 189  ASP B CG  1 
ATOM   3715 O OD1 . ASP B 1 195 ? 24.268 43.455 -7.740  1.00   42.91 ? 189  ASP B OD1 1 
ATOM   3716 O OD2 . ASP B 1 195 ? 22.306 43.458 -8.641  1.00   42.41 ? 189  ASP B OD2 1 
ATOM   3717 N N   . TRP B 1 196 ? 26.206 45.761 -6.244  1.00   36.86 ? 190  TRP B N   1 
ATOM   3718 C CA  . TRP B 1 196 ? 27.523 46.103 -6.737  1.00   37.51 ? 190  TRP B CA  1 
ATOM   3719 C C   . TRP B 1 196 ? 27.902 45.333 -7.990  1.00   38.57 ? 190  TRP B C   1 
ATOM   3720 O O   . TRP B 1 196 ? 28.804 45.738 -8.710  1.00   39.27 ? 190  TRP B O   1 
ATOM   3721 C CB  . TRP B 1 196 ? 28.540 45.966 -5.609  1.00   37.08 ? 190  TRP B CB  1 
ATOM   3722 C CG  . TRP B 1 196 ? 28.356 47.047 -4.615  1.00   35.00 ? 190  TRP B CG  1 
ATOM   3723 C CD1 . TRP B 1 196 ? 27.907 46.928 -3.342  1.00   33.83 ? 190  TRP B CD1 1 
ATOM   3724 C CD2 . TRP B 1 196 ? 28.565 48.447 -4.840  1.00   32.28 ? 190  TRP B CD2 1 
ATOM   3725 N NE1 . TRP B 1 196 ? 27.857 48.168 -2.742  1.00   34.90 ? 190  TRP B NE1 1 
ATOM   3726 C CE2 . TRP B 1 196 ? 28.255 49.115 -3.649  1.00   32.72 ? 190  TRP B CE2 1 
ATOM   3727 C CE3 . TRP B 1 196 ? 29.017 49.198 -5.931  1.00   31.99 ? 190  TRP B CE3 1 
ATOM   3728 C CZ2 . TRP B 1 196 ? 28.371 50.500 -3.511  1.00   32.12 ? 190  TRP B CZ2 1 
ATOM   3729 C CZ3 . TRP B 1 196 ? 29.116 50.574 -5.803  1.00   31.51 ? 190  TRP B CZ3 1 
ATOM   3730 C CH2 . TRP B 1 196 ? 28.809 51.206 -4.595  1.00   31.25 ? 190  TRP B CH2 1 
ATOM   3731 N N   . SER B 1 197 ? 27.178 44.259 -8.286  1.00   40.24 ? 191  SER B N   1 
ATOM   3732 C CA  . SER B 1 197 ? 27.354 43.532 -9.550  1.00   41.09 ? 191  SER B CA  1 
ATOM   3733 C C   . SER B 1 197 ? 26.897 44.332 -10.771 1.00   41.32 ? 191  SER B C   1 
ATOM   3734 O O   . SER B 1 197 ? 27.241 43.988 -11.896 1.00   41.47 ? 191  SER B O   1 
ATOM   3735 C CB  . SER B 1 197 ? 26.662 42.157 -9.492  1.00   41.50 ? 191  SER B CB  1 
ATOM   3736 O OG  . SER B 1 197 ? 25.258 42.258 -9.657  1.00   44.12 ? 191  SER B OG  1 
ATOM   3737 N N   . LYS B 1 198 ? 26.145 45.416 -10.551 1.00   41.46 ? 192  LYS B N   1 
ATOM   3738 C CA  . LYS B 1 198 ? 25.720 46.323 -11.622 1.00   41.20 ? 192  LYS B CA  1 
ATOM   3739 C C   . LYS B 1 198 ? 26.600 47.576 -11.808 1.00   40.12 ? 192  LYS B C   1 
ATOM   3740 O O   . LYS B 1 198 ? 26.252 48.445 -12.596 1.00   39.69 ? 192  LYS B O   1 
ATOM   3741 C CB  . LYS B 1 198 ? 24.259 46.736 -11.384 1.00   41.94 ? 192  LYS B CB  1 
ATOM   3742 C CG  . LYS B 1 198 ? 23.265 45.567 -11.373 1.00   42.93 ? 192  LYS B CG  1 
ATOM   3743 C CD  . LYS B 1 198 ? 23.068 45.004 -12.781 1.00   46.03 ? 192  LYS B CD  1 
ATOM   3744 C CE  . LYS B 1 198 ? 22.144 43.790 -12.824 1.00   46.61 ? 192  LYS B CE  1 
ATOM   3745 N NZ  . LYS B 1 198 ? 22.241 42.918 -11.625 1.00   48.58 ? 192  LYS B NZ  1 
ATOM   3746 N N   . ALA B 1 199 ? 27.733 47.639 -11.110 1.00   38.73 ? 193  ALA B N   1 
ATOM   3747 C CA  . ALA B 1 199 ? 28.751 48.665 -11.325 1.00   37.63 ? 193  ALA B CA  1 
ATOM   3748 C C   . ALA B 1 199 ? 29.455 48.435 -12.652 1.00   36.93 ? 193  ALA B C   1 
ATOM   3749 O O   . ALA B 1 199 ? 29.595 47.288 -13.083 1.00   37.31 ? 193  ALA B O   1 
ATOM   3750 C CB  . ALA B 1 199 ? 29.786 48.629 -10.195 1.00   38.10 ? 193  ALA B CB  1 
ATOM   3751 N N   . PRO B 1 200 ? 29.962 49.502 -13.286 1.00   35.07 ? 194  PRO B N   1 
ATOM   3752 C CA  . PRO B 1 200 ? 30.087 50.859 -12.719 1.00   33.32 ? 194  PRO B CA  1 
ATOM   3753 C C   . PRO B 1 200 ? 28.833 51.684 -12.962 1.00   31.21 ? 194  PRO B C   1 
ATOM   3754 O O   . PRO B 1 200 ? 28.245 51.610 -14.046 1.00   30.18 ? 194  PRO B O   1 
ATOM   3755 C CB  . PRO B 1 200 ? 31.174 51.491 -13.576 1.00   33.66 ? 194  PRO B CB  1 
ATOM   3756 C CG  . PRO B 1 200 ? 31.224 50.670 -14.829 1.00   34.21 ? 194  PRO B CG  1 
ATOM   3757 C CD  . PRO B 1 200 ? 30.383 49.477 -14.703 1.00   34.92 ? 194  PRO B CD  1 
ATOM   3758 N N   . PHE B 1 201 ? 28.463 52.464 -11.963 1.00   28.77 ? 195  PHE B N   1 
ATOM   3759 C CA  . PHE B 1 201 ? 27.363 53.414 -12.067 1.00   26.55 ? 195  PHE B CA  1 
ATOM   3760 C C   . PHE B 1 201 ? 27.929 54.707 -12.619 1.00   25.19 ? 195  PHE B C   1 
ATOM   3761 O O   . PHE B 1 201 ? 28.913 55.259 -12.093 1.00   24.74 ? 195  PHE B O   1 
ATOM   3762 C CB  . PHE B 1 201 ? 26.715 53.588 -10.685 1.00   26.37 ? 195  PHE B CB  1 
ATOM   3763 C CG  . PHE B 1 201 ? 26.256 52.300 -10.073 1.00   26.49 ? 195  PHE B CG  1 
ATOM   3764 C CD1 . PHE B 1 201 ? 25.020 51.764 -10.392 1.00   25.93 ? 195  PHE B CD1 1 
ATOM   3765 C CD2 . PHE B 1 201 ? 27.050 51.622 -9.157  1.00   26.15 ? 195  PHE B CD2 1 
ATOM   3766 C CE1 . PHE B 1 201 ? 24.594 50.576 -9.827  1.00   27.22 ? 195  PHE B CE1 1 
ATOM   3767 C CE2 . PHE B 1 201 ? 26.635 50.452 -8.583  1.00   28.38 ? 195  PHE B CE2 1 
ATOM   3768 C CZ  . PHE B 1 201 ? 25.405 49.903 -8.927  1.00   29.62 ? 195  PHE B CZ  1 
ATOM   3769 N N   . ILE B 1 202 ? 27.346 55.187 -13.722 1.00   23.76 ? 196  ILE B N   1 
ATOM   3770 C CA  . ILE B 1 202 ? 27.893 56.295 -14.439 1.00   22.69 ? 196  ILE B CA  1 
ATOM   3771 C C   . ILE B 1 202 ? 26.899 57.445 -14.548 1.00   23.05 ? 196  ILE B C   1 
ATOM   3772 O O   . ILE B 1 202 ? 25.803 57.261 -15.075 1.00   22.74 ? 196  ILE B O   1 
ATOM   3773 C CB  . ILE B 1 202 ? 28.278 55.873 -15.863 1.00   23.43 ? 196  ILE B CB  1 
ATOM   3774 C CG1 . ILE B 1 202 ? 29.298 54.722 -15.814 1.00   24.98 ? 196  ILE B CG1 1 
ATOM   3775 C CG2 . ILE B 1 202 ? 28.830 57.081 -16.594 1.00   22.80 ? 196  ILE B CG2 1 
ATOM   3776 C CD1 . ILE B 1 202 ? 29.491 53.974 -17.171 1.00   28.55 ? 196  ILE B CD1 1 
ATOM   3777 N N   . ALA B 1 203 ? 27.300 58.608 -14.050 1.00   22.80 ? 197  ALA B N   1 
ATOM   3778 C CA  . ALA B 1 203 ? 26.559 59.875 -14.214 1.00   22.67 ? 197  ALA B CA  1 
ATOM   3779 C C   . ALA B 1 203 ? 27.336 60.758 -15.150 1.00   23.18 ? 197  ALA B C   1 
ATOM   3780 O O   . ALA B 1 203 ? 28.563 60.820 -15.066 1.00   23.60 ? 197  ALA B O   1 
ATOM   3781 C CB  . ALA B 1 203 ? 26.430 60.556 -12.886 1.00   22.15 ? 197  ALA B CB  1 
ATOM   3782 N N   . SER B 1 204 ? 26.638 61.500 -16.009 1.00   23.41 ? 198  SER B N   1 
ATOM   3783 C CA  . SER B 1 204 ? 27.268 62.320 -17.029 1.00   23.88 ? 198  SER B CA  1 
ATOM   3784 C C   . SER B 1 204 ? 26.936 63.792 -16.865 1.00   24.22 ? 198  SER B C   1 
ATOM   3785 O O   . SER B 1 204 ? 25.809 64.156 -16.479 1.00   22.47 ? 198  SER B O   1 
ATOM   3786 C CB  . SER B 1 204 ? 26.849 61.853 -18.432 1.00   24.62 ? 198  SER B CB  1 
ATOM   3787 O OG  . SER B 1 204 ? 27.010 60.458 -18.545 1.00   26.00 ? 198  SER B OG  1 
ATOM   3788 N N   . TYR B 1 205 ? 27.913 64.625 -17.175 1.00   23.98 ? 199  TYR B N   1 
ATOM   3789 C CA  . TYR B 1 205 ? 27.862 66.069 -16.973 1.00   25.66 ? 199  TYR B CA  1 
ATOM   3790 C C   . TYR B 1 205 ? 28.347 66.842 -18.190 1.00   28.01 ? 199  TYR B C   1 
ATOM   3791 O O   . TYR B 1 205 ? 29.333 66.445 -18.873 1.00   28.11 ? 199  TYR B O   1 
ATOM   3792 C CB  . TYR B 1 205 ? 28.744 66.506 -15.801 1.00   25.57 ? 199  TYR B CB  1 
ATOM   3793 C CG  . TYR B 1 205 ? 28.367 65.993 -14.454 1.00   24.40 ? 199  TYR B CG  1 
ATOM   3794 C CD1 . TYR B 1 205 ? 28.595 64.669 -14.107 1.00   26.16 ? 199  TYR B CD1 1 
ATOM   3795 C CD2 . TYR B 1 205 ? 27.838 66.836 -13.495 1.00   24.46 ? 199  TYR B CD2 1 
ATOM   3796 C CE1 . TYR B 1 205 ? 28.256 64.201 -12.866 1.00   26.23 ? 199  TYR B CE1 1 
ATOM   3797 C CE2 . TYR B 1 205 ? 27.513 66.366 -12.245 1.00   24.24 ? 199  TYR B CE2 1 
ATOM   3798 C CZ  . TYR B 1 205 ? 27.746 65.055 -11.933 1.00   24.87 ? 199  TYR B CZ  1 
ATOM   3799 O OH  . TYR B 1 205 ? 27.420 64.589 -10.688 1.00   27.50 ? 199  TYR B OH  1 
ATOM   3800 N N   . ARG B 1 206 ? 27.659 67.958 -18.439 1.00   29.84 ? 200  ARG B N   1 
ATOM   3801 C CA  . ARG B 1 206 ? 28.020 68.970 -19.443 1.00   31.19 ? 200  ARG B CA  1 
ATOM   3802 C C   . ARG B 1 206 ? 27.743 70.386 -18.940 1.00   31.32 ? 200  ARG B C   1 
ATOM   3803 O O   . ARG B 1 206 ? 27.152 70.591 -17.858 1.00   29.44 ? 200  ARG B O   1 
ATOM   3804 C CB  . ARG B 1 206 ? 27.185 68.800 -20.708 1.00   31.70 ? 200  ARG B CB  1 
ATOM   3805 C CG  . ARG B 1 206 ? 27.358 67.556 -21.477 1.00   35.37 ? 200  ARG B CG  1 
ATOM   3806 C CD  . ARG B 1 206 ? 26.480 67.601 -22.722 1.00   40.39 ? 200  ARG B CD  1 
ATOM   3807 N NE  . ARG B 1 206 ? 26.675 66.469 -23.623 1.00   47.07 ? 200  ARG B NE  1 
ATOM   3808 C CZ  . ARG B 1 206 ? 25.819 66.129 -24.593 1.00   49.95 ? 200  ARG B CZ  1 
ATOM   3809 N NH1 . ARG B 1 206 ? 24.709 66.843 -24.797 1.00   50.77 ? 200  ARG B NH1 1 
ATOM   3810 N NH2 . ARG B 1 206 ? 26.071 65.071 -25.360 1.00   49.36 ? 200  ARG B NH2 1 
ATOM   3811 N N   . SER B 1 207 ? 28.185 71.356 -19.741 1.00   31.29 ? 201  SER B N   1 
ATOM   3812 C CA  . SER B 1 207 ? 27.952 72.794 -19.537 1.00   32.98 ? 201  SER B CA  1 
ATOM   3813 C C   . SER B 1 207 ? 28.865 73.482 -18.516 1.00   33.20 ? 201  SER B C   1 
ATOM   3814 O O   . SER B 1 207 ? 29.603 74.408 -18.875 1.00   35.59 ? 201  SER B O   1 
ATOM   3815 C CB  . SER B 1 207 ? 26.460 73.095 -19.284 1.00   33.18 ? 201  SER B CB  1 
ATOM   3816 O OG  . SER B 1 207 ? 26.261 74.489 -19.081 1.00   36.93 ? 201  SER B OG  1 
ATOM   3817 N N   . PHE B 1 208 ? 28.836 73.078 -17.250 1.00   33.32 ? 202  PHE B N   1 
ATOM   3818 C CA  . PHE B 1 208 ? 29.818 73.559 -16.278 1.00   33.00 ? 202  PHE B CA  1 
ATOM   3819 C C   . PHE B 1 208 ? 29.758 75.069 -16.177 1.00   32.88 ? 202  PHE B C   1 
ATOM   3820 O O   . PHE B 1 208 ? 30.802 75.773 -16.048 1.00   33.74 ? 202  PHE B O   1 
ATOM   3821 C CB  . PHE B 1 208 ? 31.237 73.074 -16.626 1.00   33.11 ? 202  PHE B CB  1 
ATOM   3822 C CG  . PHE B 1 208 ? 31.311 71.603 -16.894 1.00   31.05 ? 202  PHE B CG  1 
ATOM   3823 C CD1 . PHE B 1 208 ? 31.123 70.696 -15.878 1.00   30.59 ? 202  PHE B CD1 1 
ATOM   3824 C CD2 . PHE B 1 208 ? 31.545 71.124 -18.169 1.00   32.38 ? 202  PHE B CD2 1 
ATOM   3825 C CE1 . PHE B 1 208 ? 31.165 69.365 -16.112 1.00   29.83 ? 202  PHE B CE1 1 
ATOM   3826 C CE2 . PHE B 1 208 ? 31.591 69.781 -18.413 1.00   31.29 ? 202  PHE B CE2 1 
ATOM   3827 C CZ  . PHE B 1 208 ? 31.389 68.894 -17.385 1.00   30.18 ? 202  PHE B CZ  1 
ATOM   3828 N N   . HIS B 1 209 ? 28.522 75.570 -16.217 1.00   31.04 ? 203  HIS B N   1 
ATOM   3829 C CA  . HIS B 1 209 ? 28.291 76.998 -16.237 1.00   29.90 ? 203  HIS B CA  1 
ATOM   3830 C C   . HIS B 1 209 ? 28.401 77.627 -14.853 1.00   29.41 ? 203  HIS B C   1 
ATOM   3831 O O   . HIS B 1 209 ? 27.654 77.244 -13.920 1.00   28.54 ? 203  HIS B O   1 
ATOM   3832 C CB  . HIS B 1 209 ? 26.914 77.277 -16.853 1.00   30.56 ? 203  HIS B CB  1 
ATOM   3833 C CG  . HIS B 1 209 ? 26.539 78.727 -16.857 1.00   32.61 ? 203  HIS B CG  1 
ATOM   3834 N ND1 . HIS B 1 209 ? 26.875 79.581 -17.883 1.00   36.28 ? 203  HIS B ND1 1 
ATOM   3835 C CD2 . HIS B 1 209 ? 25.874 79.477 -15.944 1.00   35.58 ? 203  HIS B CD2 1 
ATOM   3836 C CE1 . HIS B 1 209 ? 26.423 80.791 -17.613 1.00   36.99 ? 203  HIS B CE1 1 
ATOM   3837 N NE2 . HIS B 1 209 ? 25.810 80.759 -16.441 1.00   37.42 ? 203  HIS B NE2 1 
ATOM   3838 N N   . ILE B 1 210 ? 29.293 78.619 -14.724 1.00   27.48 ? 204  ILE B N   1 
ATOM   3839 C CA  . ILE B 1 210 ? 29.363 79.469 -13.540 1.00   27.00 ? 204  ILE B CA  1 
ATOM   3840 C C   . ILE B 1 210 ? 29.324 80.951 -13.900 1.00   26.68 ? 204  ILE B C   1 
ATOM   3841 O O   . ILE B 1 210 ? 30.163 81.447 -14.659 1.00   26.92 ? 204  ILE B O   1 
ATOM   3842 C CB  . ILE B 1 210 ? 30.643 79.192 -12.722 1.00   26.93 ? 204  ILE B CB  1 
ATOM   3843 C CG1 . ILE B 1 210 ? 30.692 77.722 -12.299 1.00   27.95 ? 204  ILE B CG1 1 
ATOM   3844 C CG2 . ILE B 1 210 ? 30.724 80.122 -11.534 1.00   26.98 ? 204  ILE B CG2 1 
ATOM   3845 C CD1 . ILE B 1 210 ? 31.915 77.365 -11.476 1.00   29.01 ? 204  ILE B CD1 1 
ATOM   3846 N N   . ASP B 1 211 ? 28.369 81.668 -13.330 1.00   25.59 ? 205  ASP B N   1 
ATOM   3847 C CA  . ASP B 1 211 ? 28.263 83.110 -13.475 1.00   26.03 ? 205  ASP B CA  1 
ATOM   3848 C C   . ASP B 1 211 ? 27.965 83.645 -12.097 1.00   26.25 ? 205  ASP B C   1 
ATOM   3849 O O   . ASP B 1 211 ? 26.826 83.795 -11.700 1.00   25.26 ? 205  ASP B O   1 
ATOM   3850 C CB  . ASP B 1 211 ? 27.174 83.453 -14.491 1.00   26.86 ? 205  ASP B CB  1 
ATOM   3851 C CG  . ASP B 1 211 ? 26.973 84.940 -14.695 1.00   28.77 ? 205  ASP B CG  1 
ATOM   3852 O OD1 . ASP B 1 211 ? 27.800 85.784 -14.251 1.00   27.78 ? 205  ASP B OD1 1 
ATOM   3853 O OD2 . ASP B 1 211 ? 25.956 85.350 -15.295 1.00   31.07 ? 205  ASP B OD2 1 
ATOM   3854 N N   . GLY B 1 212 ? 29.013 83.889 -11.338 1.00   26.09 ? 206  GLY B N   1 
ATOM   3855 C CA  . GLY B 1 212 ? 28.842 84.257 -9.960  1.00   26.77 ? 206  GLY B CA  1 
ATOM   3856 C C   . GLY B 1 212 ? 29.792 85.324 -9.551  1.00   27.69 ? 206  GLY B C   1 
ATOM   3857 O O   . GLY B 1 212 ? 30.740 85.633 -10.275 1.00   27.90 ? 206  GLY B O   1 
ATOM   3858 N N   . CYS B 1 213 ? 29.543 85.890 -8.388  1.00   28.78 ? 207  CYS B N   1 
ATOM   3859 C CA  . CYS B 1 213 ? 30.462 86.855 -7.832  1.00   30.76 ? 207  CYS B CA  1 
ATOM   3860 C C   . CYS B 1 213 ? 31.570 86.138 -7.053  1.00   31.00 ? 207  CYS B C   1 
ATOM   3861 O O   . CYS B 1 213 ? 31.344 85.617 -5.954  1.00   29.38 ? 207  CYS B O   1 
ATOM   3862 C CB  . CYS B 1 213 ? 29.736 87.850 -6.960  1.00   31.09 ? 207  CYS B CB  1 
ATOM   3863 S SG  . CYS B 1 213 ? 30.882 89.102 -6.366  1.00   39.21 ? 207  CYS B SG  1 
ATOM   3864 N N   . GLU B 1 214 ? 32.767 86.106 -7.634  1.00   31.72 ? 208  GLU B N   1 
ATOM   3865 C CA  . GLU B 1 214 ? 33.905 85.458 -6.993  1.00   32.60 ? 208  GLU B CA  1 
ATOM   3866 C C   . GLU B 1 214 ? 34.236 86.185 -5.705  1.00   32.68 ? 208  GLU B C   1 
ATOM   3867 O O   . GLU B 1 214 ? 34.219 87.428 -5.640  1.00   31.66 ? 208  GLU B O   1 
ATOM   3868 C CB  . GLU B 1 214 ? 35.140 85.394 -7.907  1.00   33.87 ? 208  GLU B CB  1 
ATOM   3869 C CG  . GLU B 1 214 ? 34.808 85.098 -9.356  1.00   38.61 ? 208  GLU B CG  1 
ATOM   3870 C CD  . GLU B 1 214 ? 35.964 84.535 -10.155 1.00   44.76 ? 208  GLU B CD  1 
ATOM   3871 O OE1 . GLU B 1 214 ? 37.034 84.214 -9.569  1.00   48.01 ? 208  GLU B OE1 1 
ATOM   3872 O OE2 . GLU B 1 214 ? 35.781 84.399 -11.388 1.00   49.83 ? 208  GLU B OE2 1 
ATOM   3873 N N   . ALA B 1 215 ? 34.477 85.404 -4.661  1.00   32.11 ? 209  ALA B N   1 
ATOM   3874 C CA  . ALA B 1 215 ? 34.820 85.937 -3.368  1.00   33.39 ? 209  ALA B CA  1 
ATOM   3875 C C   . ALA B 1 215 ? 35.779 84.987 -2.668  1.00   34.50 ? 209  ALA B C   1 
ATOM   3876 O O   . ALA B 1 215 ? 35.599 83.768 -2.741  1.00   34.27 ? 209  ALA B O   1 
ATOM   3877 C CB  . ALA B 1 215 ? 33.577 86.166 -2.537  1.00   33.46 ? 209  ALA B CB  1 
ATOM   3878 N N   . SER B 1 216 ? 36.786 85.536 -2.003  1.00   35.30 ? 210  SER B N   1 
ATOM   3879 C CA  . SER B 1 216 ? 37.713 84.701 -1.248  1.00   36.52 ? 210  SER B CA  1 
ATOM   3880 C C   . SER B 1 216 ? 36.954 84.002 -0.119  1.00   37.22 ? 210  SER B C   1 
ATOM   3881 O O   . SER B 1 216 ? 35.924 84.491 0.352   1.00   36.14 ? 210  SER B O   1 
ATOM   3882 C CB  . SER B 1 216 ? 38.866 85.541 -0.696  1.00   36.69 ? 210  SER B CB  1 
ATOM   3883 O OG  . SER B 1 216 ? 38.407 86.444 0.289   1.00   38.94 ? 210  SER B OG  1 
ATOM   3884 N N   . VAL B 1 217 ? 37.449 82.819 0.279   1.00   38.71 ? 211  VAL B N   1 
ATOM   3885 C CA  . VAL B 1 217 ? 36.702 82.040 1.271   1.00   40.06 ? 211  VAL B CA  1 
ATOM   3886 C C   . VAL B 1 217 ? 36.421 82.791 2.575   1.00   40.05 ? 211  VAL B C   1 
ATOM   3887 O O   . VAL B 1 217 ? 35.398 82.534 3.221   1.00   40.81 ? 211  VAL B O   1 
ATOM   3888 C CB  . VAL B 1 217 ? 37.378 80.667 1.526   1.00   40.97 ? 211  VAL B CB  1 
ATOM   3889 C CG1 . VAL B 1 217 ? 38.518 80.817 2.519   1.00   42.46 ? 211  VAL B CG1 1 
ATOM   3890 C CG2 . VAL B 1 217 ? 36.351 79.667 2.022   1.00   41.63 ? 211  VAL B CG2 1 
ATOM   3891 N N   . GLU B 1 218 ? 37.278 83.738 2.920   1.00   40.08 ? 212  GLU B N   1 
ATOM   3892 C CA  . GLU B 1 218 ? 37.100 84.489 4.180   1.00   39.99 ? 212  GLU B CA  1 
ATOM   3893 C C   . GLU B 1 218 ? 36.268 85.767 4.040   1.00   39.52 ? 212  GLU B C   1 
ATOM   3894 O O   . GLU B 1 218 ? 35.985 86.406 5.046   1.00   40.17 ? 212  GLU B O   1 
ATOM   3895 C CB  . GLU B 1 218 ? 38.472 84.745 4.809   1.00   40.28 ? 212  GLU B CB  1 
ATOM   3896 C CG  . GLU B 1 218 ? 39.086 83.478 5.379   0.0000 45.65 ? 212  GLU B CG  1 
ATOM   3897 C CD  . GLU B 1 218 ? 40.393 83.801 6.079   0.0000 49.38 ? 212  GLU B CD  1 
ATOM   3898 O OE1 . GLU B 1 218 ? 41.124 84.692 5.587   0.0000 53.65 ? 212  GLU B OE1 1 
ATOM   3899 O OE2 . GLU B 1 218 ? 40.687 83.176 7.123   0.0000 52.28 ? 212  GLU B OE2 1 
ATOM   3900 N N   . ALA B 1 219 ? 35.870 86.134 2.821   1.00   38.21 ? 213  ALA B N   1 
ATOM   3901 C CA  . ALA B 1 219 ? 35.058 87.337 2.604   1.00   37.18 ? 213  ALA B CA  1 
ATOM   3902 C C   . ALA B 1 219 ? 33.636 87.165 3.139   1.00   36.53 ? 213  ALA B C   1 
ATOM   3903 O O   . ALA B 1 219 ? 33.095 86.062 3.164   1.00   35.49 ? 213  ALA B O   1 
ATOM   3904 C CB  . ALA B 1 219 ? 35.015 87.698 1.125   1.00   37.06 ? 213  ALA B CB  1 
ATOM   3905 N N   . LYS B 1 220 ? 33.029 88.265 3.567   1.00   35.88 ? 214  LYS B N   1 
ATOM   3906 C CA  . LYS B 1 220 ? 31.672 88.233 4.118   1.00   36.34 ? 214  LYS B CA  1 
ATOM   3907 C C   . LYS B 1 220 ? 30.680 88.983 3.238   1.00   34.97 ? 214  LYS B C   1 
ATOM   3908 O O   . LYS B 1 220 ? 29.506 89.109 3.569   1.00   34.00 ? 214  LYS B O   1 
ATOM   3909 C CB  . LYS B 1 220 ? 31.644 88.773 5.550   1.00   36.84 ? 214  LYS B CB  1 
ATOM   3910 C CG  . LYS B 1 220 ? 32.710 88.221 6.485   1.00   40.28 ? 214  LYS B CG  1 
ATOM   3911 C CD  . LYS B 1 220 ? 32.140 87.266 7.538   1.00   44.44 ? 214  LYS B CD  1 
ATOM   3912 C CE  . LYS B 1 220 ? 31.560 86.022 6.879   1.00   47.29 ? 214  LYS B CE  1 
ATOM   3913 N NZ  . LYS B 1 220 ? 31.799 84.798 7.688   1.00   47.89 ? 214  LYS B NZ  1 
ATOM   3914 N N   . PHE B 1 221 ? 31.157 89.490 2.099   1.00   34.29 ? 215  PHE B N   1 
ATOM   3915 C CA  . PHE B 1 221 ? 30.288 90.192 1.135   1.00   33.85 ? 215  PHE B CA  1 
ATOM   3916 C C   . PHE B 1 221 ? 30.839 90.134 -0.280  1.00   33.43 ? 215  PHE B C   1 
ATOM   3917 O O   . PHE B 1 221 ? 31.994 89.819 -0.492  1.00   33.39 ? 215  PHE B O   1 
ATOM   3918 C CB  . PHE B 1 221 ? 30.014 91.643 1.568   1.00   34.65 ? 215  PHE B CB  1 
ATOM   3919 C CG  . PHE B 1 221 ? 31.247 92.479 1.674   1.00   33.62 ? 215  PHE B CG  1 
ATOM   3920 C CD1 . PHE B 1 221 ? 31.859 92.980 0.532   1.00   35.26 ? 215  PHE B CD1 1 
ATOM   3921 C CD2 . PHE B 1 221 ? 31.827 92.730 2.913   1.00   35.24 ? 215  PHE B CD2 1 
ATOM   3922 C CE1 . PHE B 1 221 ? 33.036 93.753 0.631   1.00   36.00 ? 215  PHE B CE1 1 
ATOM   3923 C CE2 . PHE B 1 221 ? 33.003 93.488 3.018   1.00   36.48 ? 215  PHE B CE2 1 
ATOM   3924 C CZ  . PHE B 1 221 ? 33.604 93.994 1.871   1.00   36.16 ? 215  PHE B CZ  1 
ATOM   3925 N N   . CYS B 1 222 ? 29.958 90.402 -1.241  1.00   32.97 ? 216  CYS B N   1 
ATOM   3926 C CA  . CYS B 1 222 ? 30.262 90.426 -2.654  1.00   33.38 ? 216  CYS B CA  1 
ATOM   3927 C C   . CYS B 1 222 ? 30.564 91.893 -2.982  1.00   32.37 ? 216  CYS B C   1 
ATOM   3928 O O   . CYS B 1 222 ? 29.775 92.784 -2.671  1.00   31.74 ? 216  CYS B O   1 
ATOM   3929 C CB  . CYS B 1 222 ? 29.039 89.922 -3.437  1.00   33.56 ? 216  CYS B CB  1 
ATOM   3930 S SG  . CYS B 1 222 ? 28.928 90.448 -5.159  1.00   37.92 ? 216  CYS B SG  1 
ATOM   3931 N N   . ALA B 1 223 ? 31.727 92.145 -3.556  1.00   31.99 ? 217  ALA B N   1 
ATOM   3932 C CA  . ALA B 1 223 ? 32.175 93.522 -3.805  1.00   32.00 ? 217  ALA B CA  1 
ATOM   3933 C C   . ALA B 1 223 ? 31.325 94.280 -4.849  1.00   31.82 ? 217  ALA B C   1 
ATOM   3934 O O   . ALA B 1 223 ? 31.369 95.514 -4.916  1.00   32.22 ? 217  ALA B O   1 
ATOM   3935 C CB  . ALA B 1 223 ? 33.648 93.519 -4.223  1.00   32.33 ? 217  ALA B CB  1 
ATOM   3936 N N   . THR B 1 224 ? 30.587 93.544 -5.668  1.00   31.40 ? 218  THR B N   1 
ATOM   3937 C CA  . THR B 1 224 ? 29.715 94.108 -6.690  1.00   31.18 ? 218  THR B CA  1 
ATOM   3938 C C   . THR B 1 224 ? 28.233 93.925 -6.346  1.00   31.22 ? 218  THR B C   1 
ATOM   3939 O O   . THR B 1 224 ? 27.366 94.003 -7.223  1.00   30.29 ? 218  THR B O   1 
ATOM   3940 C CB  . THR B 1 224 ? 30.043 93.457 -8.045  1.00   31.51 ? 218  THR B CB  1 
ATOM   3941 O OG1 . THR B 1 224 ? 30.081 92.027 -7.919  1.00   32.38 ? 218  THR B OG1 1 
ATOM   3942 C CG2 . THR B 1 224 ? 31.459 93.822 -8.505  1.00   31.76 ? 218  THR B CG2 1 
ATOM   3943 N N   . GLN B 1 225 ? 27.942 93.737 -5.055  1.00   31.90 ? 219  GLN B N   1 
ATOM   3944 C CA  . GLN B 1 225 ? 26.584 93.580 -4.564  1.00   32.14 ? 219  GLN B CA  1 
ATOM   3945 C C   . GLN B 1 225 ? 25.697 94.715 -5.026  1.00   32.11 ? 219  GLN B C   1 
ATOM   3946 O O   . GLN B 1 225 ? 25.962 95.872 -4.727  1.00   32.28 ? 219  GLN B O   1 
ATOM   3947 C CB  . GLN B 1 225 ? 26.564 93.569 -3.024  1.00   32.77 ? 219  GLN B CB  1 
ATOM   3948 C CG  . GLN B 1 225 ? 25.153 93.521 -2.422  1.00   36.45 ? 219  GLN B CG  1 
ATOM   3949 C CD  . GLN B 1 225 ? 24.368 92.322 -2.905  1.00   39.46 ? 219  GLN B CD  1 
ATOM   3950 O OE1 . GLN B 1 225 ? 23.147 92.404 -3.145  1.00   42.14 ? 219  GLN B OE1 1 
ATOM   3951 N NE2 . GLN B 1 225 ? 25.055 91.187 -3.051  1.00   41.92 ? 219  GLN B NE2 1 
ATOM   3952 N N   . GLY B 1 226 ? 24.634 94.380 -5.742  1.00   31.57 ? 220  GLY B N   1 
ATOM   3953 C CA  . GLY B 1 226 ? 23.633 95.365 -6.124  1.00   31.40 ? 220  GLY B CA  1 
ATOM   3954 C C   . GLY B 1 226 ? 23.710 95.740 -7.577  1.00   30.65 ? 220  GLY B C   1 
ATOM   3955 O O   . GLY B 1 226 ? 22.762 96.284 -8.118  1.00   30.99 ? 220  GLY B O   1 
ATOM   3956 N N   . ALA B 1 227 ? 24.832 95.421 -8.213  1.00   29.86 ? 221  ALA B N   1 
ATOM   3957 C CA  . ALA B 1 227 ? 25.096 95.789 -9.595  1.00   28.83 ? 221  ALA B CA  1 
ATOM   3958 C C   . ALA B 1 227 ? 25.038 94.619 -10.560 1.00   28.39 ? 221  ALA B C   1 
ATOM   3959 O O   . ALA B 1 227 ? 25.075 94.821 -11.785 1.00   27.50 ? 221  ALA B O   1 
ATOM   3960 C CB  . ALA B 1 227 ? 26.480 96.460 -9.688  1.00   28.40 ? 221  ALA B CB  1 
ATOM   3961 N N   . ARG B 1 228 ? 24.978 93.387 -10.037 1.00   27.29 ? 222  ARG B N   1 
ATOM   3962 C CA  . ARG B 1 228 ? 24.903 92.210 -10.883 1.00   27.47 ? 222  ARG B CA  1 
ATOM   3963 C C   . ARG B 1 228 ? 23.512 92.102 -11.499 1.00   26.51 ? 222  ARG B C   1 
ATOM   3964 O O   . ARG B 1 228 ? 22.537 92.630 -10.957 1.00   27.62 ? 222  ARG B O   1 
ATOM   3965 C CB  . ARG B 1 228 ? 25.201 90.917 -10.083 1.00   27.59 ? 222  ARG B CB  1 
ATOM   3966 C CG  . ARG B 1 228 ? 26.444 90.985 -9.231  1.00   28.29 ? 222  ARG B CG  1 
ATOM   3967 C CD  . ARG B 1 228 ? 27.681 91.369 -9.952  1.00   30.22 ? 222  ARG B CD  1 
ATOM   3968 N NE  . ARG B 1 228 ? 28.094 90.401 -10.937 1.00   29.33 ? 222  ARG B NE  1 
ATOM   3969 C CZ  . ARG B 1 228 ? 29.263 89.753 -10.950 1.00   30.17 ? 222  ARG B CZ  1 
ATOM   3970 N NH1 . ARG B 1 228 ? 30.189 89.925 -10.036 1.00   31.65 ? 222  ARG B NH1 1 
ATOM   3971 N NH2 . ARG B 1 228 ? 29.497 88.884 -11.910 1.00   33.01 ? 222  ARG B NH2 1 
ATOM   3972 N N   . TRP B 1 229 ? 23.401 91.391 -12.602 1.00   26.58 ? 223  TRP B N   1 
ATOM   3973 C CA  . TRP B 1 229 ? 22.109 91.262 -13.254 1.00   27.00 ? 223  TRP B CA  1 
ATOM   3974 C C   . TRP B 1 229 ? 21.079 90.580 -12.357 1.00   27.24 ? 223  TRP B C   1 
ATOM   3975 O O   . TRP B 1 229 ? 19.894 90.918 -12.416 1.00   27.43 ? 223  TRP B O   1 
ATOM   3976 C CB  . TRP B 1 229 ? 22.202 90.554 -14.605 1.00   27.08 ? 223  TRP B CB  1 
ATOM   3977 C CG  . TRP B 1 229 ? 22.696 89.152 -14.627 1.00   27.56 ? 223  TRP B CG  1 
ATOM   3978 C CD1 . TRP B 1 229 ? 23.941 88.752 -14.965 1.00   27.87 ? 223  TRP B CD1 1 
ATOM   3979 C CD2 . TRP B 1 229 ? 21.938 87.946 -14.392 1.00   27.89 ? 223  TRP B CD2 1 
ATOM   3980 N NE1 . TRP B 1 229 ? 24.031 87.386 -14.935 1.00   28.92 ? 223  TRP B NE1 1 
ATOM   3981 C CE2 . TRP B 1 229 ? 22.819 86.864 -14.570 1.00   28.32 ? 223  TRP B CE2 1 
ATOM   3982 C CE3 . TRP B 1 229 ? 20.614 87.676 -14.038 1.00   28.45 ? 223  TRP B CE3 1 
ATOM   3983 C CZ2 . TRP B 1 229 ? 22.424 85.528 -14.406 1.00   28.38 ? 223  TRP B CZ2 1 
ATOM   3984 C CZ3 . TRP B 1 229 ? 20.223 86.335 -13.864 1.00   29.14 ? 223  TRP B CZ3 1 
ATOM   3985 C CH2 . TRP B 1 229 ? 21.125 85.289 -14.068 1.00   27.65 ? 223  TRP B CH2 1 
ATOM   3986 N N   . TRP B 1 230 ? 21.545 89.658 -11.511 1.00   26.77 ? 224  TRP B N   1 
ATOM   3987 C CA  . TRP B 1 230 ? 20.655 88.933 -10.590 1.00   25.85 ? 224  TRP B CA  1 
ATOM   3988 C C   . TRP B 1 230 ? 20.234 89.765 -9.386  1.00   27.47 ? 224  TRP B C   1 
ATOM   3989 O O   . TRP B 1 230 ? 19.368 89.352 -8.592  1.00   27.84 ? 224  TRP B O   1 
ATOM   3990 C CB  . TRP B 1 230 ? 21.298 87.608 -10.178 1.00   25.74 ? 224  TRP B CB  1 
ATOM   3991 C CG  . TRP B 1 230 ? 22.643 87.758 -9.529  1.00   22.62 ? 224  TRP B CG  1 
ATOM   3992 C CD1 . TRP B 1 230 ? 22.885 88.235 -8.308  1.00   23.37 ? 224  TRP B CD1 1 
ATOM   3993 C CD2 . TRP B 1 230 ? 23.905 87.451 -10.097 1.00   21.37 ? 224  TRP B CD2 1 
ATOM   3994 N NE1 . TRP B 1 230 ? 24.233 88.213 -8.043  1.00   23.27 ? 224  TRP B NE1 1 
ATOM   3995 C CE2 . TRP B 1 230 ? 24.878 87.728 -9.137  1.00   22.64 ? 224  TRP B CE2 1 
ATOM   3996 C CE3 . TRP B 1 230 ? 24.320 86.939 -11.329 1.00   22.88 ? 224  TRP B CE3 1 
ATOM   3997 C CZ2 . TRP B 1 230 ? 26.231 87.531 -9.371  1.00   22.92 ? 224  TRP B CZ2 1 
ATOM   3998 C CZ3 . TRP B 1 230 ? 25.671 86.751 -11.555 1.00   22.65 ? 224  TRP B CZ3 1 
ATOM   3999 C CH2 . TRP B 1 230 ? 26.592 87.048 -10.592 1.00   20.56 ? 224  TRP B CH2 1 
ATOM   4000 N N   . ASP B 1 231 ? 20.818 90.956 -9.239  1.00   27.20 ? 225  ASP B N   1 
ATOM   4001 C CA  . ASP B 1 231 ? 20.396 91.885 -8.213  1.00   28.38 ? 225  ASP B CA  1 
ATOM   4002 C C   . ASP B 1 231 ? 19.319 92.873 -8.674  1.00   28.99 ? 225  ASP B C   1 
ATOM   4003 O O   . ASP B 1 231 ? 18.852 93.665 -7.887  1.00   29.52 ? 225  ASP B O   1 
ATOM   4004 C CB  . ASP B 1 231 ? 21.604 92.660 -7.699  1.00   29.11 ? 225  ASP B CB  1 
ATOM   4005 C CG  . ASP B 1 231 ? 22.564 91.786 -6.935  1.00   30.59 ? 225  ASP B CG  1 
ATOM   4006 O OD1 . ASP B 1 231 ? 22.081 90.851 -6.255  1.00   31.00 ? 225  ASP B OD1 1 
ATOM   4007 O OD2 . ASP B 1 231 ? 23.812 91.959 -6.948  1.00   31.20 ? 225  ASP B OD2 1 
ATOM   4008 N N   . GLN B 1 232 ? 18.947 92.841 -9.941  1.00   29.79 ? 226  GLN B N   1 
ATOM   4009 C CA  . GLN B 1 232 ? 17.999 93.828 -10.473 1.00   30.96 ? 226  GLN B CA  1 
ATOM   4010 C C   . GLN B 1 232 ? 16.573 93.453 -10.087 1.00   32.38 ? 226  GLN B C   1 
ATOM   4011 O O   . GLN B 1 232 ? 16.318 92.331 -9.654  1.00   31.06 ? 226  GLN B O   1 
ATOM   4012 C CB  . GLN B 1 232 ? 18.188 93.983 -11.993 1.00   30.61 ? 226  GLN B CB  1 
ATOM   4013 C CG  . GLN B 1 232 ? 19.630 94.405 -12.392 1.00   31.66 ? 226  GLN B CG  1 
ATOM   4014 C CD  . GLN B 1 232 ? 20.224 95.487 -11.486 1.00   32.90 ? 226  GLN B CD  1 
ATOM   4015 O OE1 . GLN B 1 232 ? 21.267 95.286 -10.857 1.00   34.13 ? 226  GLN B OE1 1 
ATOM   4016 N NE2 . GLN B 1 232 ? 19.564 96.635 -11.426 1.00   30.04 ? 226  GLN B NE2 1 
ATOM   4017 N N   . LYS B 1 233 ? 15.641 94.394 -10.240 1.00   33.36 ? 227  LYS B N   1 
ATOM   4018 C CA  . LYS B 1 233 ? 14.307 94.236 -9.666  1.00   35.05 ? 227  LYS B CA  1 
ATOM   4019 C C   . LYS B 1 233 ? 13.597 92.983 -10.151 1.00   34.41 ? 227  LYS B C   1 
ATOM   4020 O O   . LYS B 1 233 ? 12.918 92.347 -9.375  1.00   34.67 ? 227  LYS B O   1 
ATOM   4021 C CB  . LYS B 1 233 ? 13.419 95.468 -9.933  1.00   36.37 ? 227  LYS B CB  1 
ATOM   4022 C CG  . LYS B 1 233 ? 12.424 95.773 -8.780  1.00   39.50 ? 227  LYS B CG  1 
ATOM   4023 C CD  . LYS B 1 233 ? 11.281 94.728 -8.674  1.00   44.13 ? 227  LYS B CD  1 
ATOM   4024 C CE  . LYS B 1 233 ? 10.202 95.083 -7.623  1.00   46.33 ? 227  LYS B CE  1 
ATOM   4025 N NZ  . LYS B 1 233 ? 9.958  96.559 -7.481  1.00   49.31 ? 227  LYS B NZ  1 
ATOM   4026 N N   . GLU B 1 234 ? 13.777 92.630 -11.419 1.00   34.36 ? 228  GLU B N   1 
ATOM   4027 C CA  . GLU B 1 234 ? 13.124 91.478 -12.030 1.00   35.07 ? 228  GLU B CA  1 
ATOM   4028 C C   . GLU B 1 234 ? 13.507 90.126 -11.357 1.00   34.42 ? 228  GLU B C   1 
ATOM   4029 O O   . GLU B 1 234 ? 12.818 89.128 -11.552 1.00   33.62 ? 228  GLU B O   1 
ATOM   4030 C CB  . GLU B 1 234 ? 13.473 91.371 -13.522 1.00   35.44 ? 228  GLU B CB  1 
ATOM   4031 C CG  . GLU B 1 234 ? 13.454 92.682 -14.299 1.00   39.71 ? 228  GLU B CG  1 
ATOM   4032 C CD  . GLU B 1 234 ? 14.791 93.414 -14.219 1.00   42.31 ? 228  GLU B CD  1 
ATOM   4033 O OE1 . GLU B 1 234 ? 15.766 93.002 -14.910 1.00   47.40 ? 228  GLU B OE1 1 
ATOM   4034 O OE2 . GLU B 1 234 ? 14.877 94.370 -13.425 1.00   40.56 ? 228  GLU B OE2 1 
ATOM   4035 N N   . PHE B 1 235 ? 14.616 90.105 -10.614 1.00   34.08 ? 229  PHE B N   1 
ATOM   4036 C CA  . PHE B 1 235 ? 15.107 88.883 -9.948  1.00   33.66 ? 229  PHE B CA  1 
ATOM   4037 C C   . PHE B 1 235 ? 14.952 88.905 -8.444  1.00   33.41 ? 229  PHE B C   1 
ATOM   4038 O O   . PHE B 1 235 ? 15.478 88.028 -7.746  1.00   33.76 ? 229  PHE B O   1 
ATOM   4039 C CB  . PHE B 1 235 ? 16.570 88.647 -10.324 1.00   33.38 ? 229  PHE B CB  1 
ATOM   4040 C CG  . PHE B 1 235 ? 16.732 88.284 -11.733 1.00   33.60 ? 229  PHE B CG  1 
ATOM   4041 C CD1 . PHE B 1 235 ? 16.514 86.985 -12.145 1.00   34.41 ? 229  PHE B CD1 1 
ATOM   4042 C CD2 . PHE B 1 235 ? 17.006 89.250 -12.685 1.00   33.07 ? 229  PHE B CD2 1 
ATOM   4043 C CE1 . PHE B 1 235 ? 16.608 86.649 -13.475 1.00   36.00 ? 229  PHE B CE1 1 
ATOM   4044 C CE2 . PHE B 1 235 ? 17.101 88.907 -14.010 1.00   33.25 ? 229  PHE B CE2 1 
ATOM   4045 C CZ  . PHE B 1 235 ? 16.899 87.615 -14.407 1.00   34.88 ? 229  PHE B CZ  1 
ATOM   4046 N N   . GLN B 1 236 ? 14.231 89.893 -7.938  1.00   33.01 ? 230  GLN B N   1 
ATOM   4047 C CA  . GLN B 1 236 ? 13.887 89.944 -6.536  1.00   33.37 ? 230  GLN B CA  1 
ATOM   4048 C C   . GLN B 1 236 ? 12.787 88.945 -6.178  1.00   32.09 ? 230  GLN B C   1 
ATOM   4049 O O   . GLN B 1 236 ? 12.588 88.670 -5.021  1.00   31.28 ? 230  GLN B O   1 
ATOM   4050 C CB  . GLN B 1 236 ? 13.411 91.336 -6.130  1.00   34.23 ? 230  GLN B CB  1 
ATOM   4051 C CG  . GLN B 1 236 ? 14.525 92.348 -5.992  1.00   38.32 ? 230  GLN B CG  1 
ATOM   4052 C CD  . GLN B 1 236 ? 13.997 93.725 -5.664  1.00   40.95 ? 230  GLN B CD  1 
ATOM   4053 O OE1 . GLN B 1 236 ? 14.621 94.709 -6.019  1.00   49.10 ? 230  GLN B OE1 1 
ATOM   4054 N NE2 . GLN B 1 236 ? 12.849 93.796 -5.000  1.00   43.23 ? 230  GLN B NE2 1 
ATOM   4055 N N   . ASP B 1 237 ? 12.058 88.439 -7.172  1.00   31.27 ? 231  ASP B N   1 
ATOM   4056 C CA  . ASP B 1 237 ? 11.006 87.464 -6.933  1.00   30.30 ? 231  ASP B CA  1 
ATOM   4057 C C   . ASP B 1 237 ? 10.691 86.716 -8.205  1.00   29.54 ? 231  ASP B C   1 
ATOM   4058 O O   . ASP B 1 237 ? 11.025 87.173 -9.305  1.00   28.35 ? 231  ASP B O   1 
ATOM   4059 C CB  . ASP B 1 237 ? 9.744  88.163 -6.422  1.00   31.16 ? 231  ASP B CB  1 
ATOM   4060 C CG  . ASP B 1 237 ? 8.792  87.221 -5.700  1.00   34.02 ? 231  ASP B CG  1 
ATOM   4061 O OD1 . ASP B 1 237 ? 9.064  86.011 -5.563  1.00   35.04 ? 231  ASP B OD1 1 
ATOM   4062 O OD2 . ASP B 1 237 ? 7.714  87.617 -5.235  1.00   37.74 ? 231  ASP B OD2 1 
ATOM   4063 N N   . LEU B 1 238 ? 10.058 85.557 -8.065  1.00   28.13 ? 232  LEU B N   1 
ATOM   4064 C CA  . LEU B 1 238 ? 9.553  84.864 -9.222  1.00   29.14 ? 232  LEU B CA  1 
ATOM   4065 C C   . LEU B 1 238 ? 8.380  85.672 -9.780  1.00   30.36 ? 232  LEU B C   1 
ATOM   4066 O O   . LEU B 1 238 ? 7.716  86.415 -9.046  1.00   30.18 ? 232  LEU B O   1 
ATOM   4067 C CB  . LEU B 1 238 ? 9.095  83.456 -8.867  1.00   28.40 ? 232  LEU B CB  1 
ATOM   4068 C CG  . LEU B 1 238 ? 10.175 82.455 -8.418  1.00   28.09 ? 232  LEU B CG  1 
ATOM   4069 C CD1 . LEU B 1 238 ? 9.547  81.056 -8.328  1.00   29.39 ? 232  LEU B CD1 1 
ATOM   4070 C CD2 . LEU B 1 238 ? 11.345 82.398 -9.367  1.00   29.88 ? 232  LEU B CD2 1 
ATOM   4071 N N   . ASP B 1 239 ? 8.134  85.517 -11.065 1.00   32.04 ? 233  ASP B N   1 
ATOM   4072 C CA  . ASP B 1 239 ? 6.973  86.158 -11.685 1.00   34.17 ? 233  ASP B CA  1 
ATOM   4073 C C   . ASP B 1 239 ? 5.777  85.208 -11.638 1.00   34.55 ? 233  ASP B C   1 
ATOM   4074 O O   . ASP B 1 239 ? 5.904  84.028 -11.231 1.00   32.90 ? 233  ASP B O   1 
ATOM   4075 C CB  . ASP B 1 239 ? 7.312  86.647 -13.090 1.00   35.06 ? 233  ASP B CB  1 
ATOM   4076 C CG  . ASP B 1 239 ? 7.574  85.536 -14.067 1.00   37.90 ? 233  ASP B CG  1 
ATOM   4077 O OD1 . ASP B 1 239 ? 6.947  84.462 -13.967 1.00   41.67 ? 233  ASP B OD1 1 
ATOM   4078 O OD2 . ASP B 1 239 ? 8.393  85.658 -15.004 1.00   44.67 ? 233  ASP B OD2 1 
ATOM   4079 N N   . ALA B 1 240 ? 4.607  85.711 -12.025 1.00   34.42 ? 234  ALA B N   1 
ATOM   4080 C CA  . ALA B 1 240 ? 3.378  84.950 -11.832 1.00   34.01 ? 234  ALA B CA  1 
ATOM   4081 C C   . ALA B 1 240 ? 3.424  83.619 -12.577 1.00   33.52 ? 234  ALA B C   1 
ATOM   4082 O O   . ALA B 1 240 ? 2.935  82.619 -12.067 1.00   33.32 ? 234  ALA B O   1 
ATOM   4083 C CB  . ALA B 1 240 ? 2.153  85.763 -12.284 1.00   34.90 ? 234  ALA B CB  1 
ATOM   4084 N N   . PHE B 1 241 ? 3.990  83.616 -13.777 1.00   33.07 ? 235  PHE B N   1 
ATOM   4085 C CA  . PHE B 1 241 ? 4.081  82.399 -14.568 1.00   33.43 ? 235  PHE B CA  1 
ATOM   4086 C C   . PHE B 1 241 ? 4.992  81.341 -13.915 1.00   32.00 ? 235  PHE B C   1 
ATOM   4087 O O   . PHE B 1 241 ? 4.654  80.162 -13.869 1.00   31.49 ? 235  PHE B O   1 
ATOM   4088 C CB  . PHE B 1 241 ? 4.613  82.677 -15.959 1.00   34.24 ? 235  PHE B CB  1 
ATOM   4089 C CG  . PHE B 1 241 ? 4.374  81.542 -16.919 1.00   37.90 ? 235  PHE B CG  1 
ATOM   4090 C CD1 . PHE B 1 241 ? 3.078  81.271 -17.366 1.00   42.83 ? 235  PHE B CD1 1 
ATOM   4091 C CD2 . PHE B 1 241 ? 5.414  80.744 -17.358 1.00   41.13 ? 235  PHE B CD2 1 
ATOM   4092 C CE1 . PHE B 1 241 ? 2.835  80.231 -18.240 1.00   43.97 ? 235  PHE B CE1 1 
ATOM   4093 C CE2 . PHE B 1 241 ? 5.179  79.687 -18.218 1.00   40.56 ? 235  PHE B CE2 1 
ATOM   4094 C CZ  . PHE B 1 241 ? 3.889  79.435 -18.660 1.00   43.32 ? 235  PHE B CZ  1 
ATOM   4095 N N   . GLN B 1 242 ? 6.153  81.779 -13.439 1.00   30.37 ? 236  GLN B N   1 
ATOM   4096 C CA  . GLN B 1 242 ? 7.069  80.889 -12.709 1.00   28.73 ? 236  GLN B CA  1 
ATOM   4097 C C   . GLN B 1 242 ? 6.391  80.290 -11.486 1.00   28.24 ? 236  GLN B C   1 
ATOM   4098 O O   . GLN B 1 242 ? 6.553  79.097 -11.203 1.00   26.22 ? 236  GLN B O   1 
ATOM   4099 C CB  . GLN B 1 242 ? 8.327  81.641 -12.319 1.00   28.38 ? 236  GLN B CB  1 
ATOM   4100 C CG  . GLN B 1 242 ? 9.200  81.996 -13.520 1.00   29.61 ? 236  GLN B CG  1 
ATOM   4101 C CD  . GLN B 1 242 ? 10.385 82.905 -13.173 1.00   32.48 ? 236  GLN B CD  1 
ATOM   4102 O OE1 . GLN B 1 242 ? 11.514 82.657 -13.631 1.00   38.10 ? 236  GLN B OE1 1 
ATOM   4103 N NE2 . GLN B 1 242 ? 10.148 83.924 -12.367 1.00   30.43 ? 236  GLN B NE2 1 
ATOM   4104 N N   . TYR B 1 243 ? 5.583  81.092 -10.788 1.00   27.15 ? 237  TYR B N   1 
ATOM   4105 C CA  . TYR B 1 243 ? 4.855  80.588 -9.636  1.00   27.68 ? 237  TYR B CA  1 
ATOM   4106 C C   . TYR B 1 243 ? 3.817  79.517 -10.034 1.00   27.81 ? 237  TYR B C   1 
ATOM   4107 O O   . TYR B 1 243 ? 3.597  78.585 -9.278  1.00   26.17 ? 237  TYR B O   1 
ATOM   4108 C CB  . TYR B 1 243 ? 4.209  81.714 -8.814  1.00   28.12 ? 237  TYR B CB  1 
ATOM   4109 C CG  . TYR B 1 243 ? 5.109  82.318 -7.769  1.00   28.46 ? 237  TYR B CG  1 
ATOM   4110 C CD1 . TYR B 1 243 ? 5.679  81.529 -6.761  1.00   29.97 ? 237  TYR B CD1 1 
ATOM   4111 C CD2 . TYR B 1 243 ? 5.416  83.677 -7.790  1.00   31.94 ? 237  TYR B CD2 1 
ATOM   4112 C CE1 . TYR B 1 243 ? 6.511  82.081 -5.805  1.00   30.36 ? 237  TYR B CE1 1 
ATOM   4113 C CE2 . TYR B 1 243 ? 6.247  84.254 -6.825  1.00   30.92 ? 237  TYR B CE2 1 
ATOM   4114 C CZ  . TYR B 1 243 ? 6.780  83.449 -5.838  1.00   32.82 ? 237  TYR B CZ  1 
ATOM   4115 O OH  . TYR B 1 243 ? 7.597  83.987 -4.890  1.00   31.91 ? 237  TYR B OH  1 
ATOM   4116 N N   . ARG B 1 244 ? 3.216  79.638 -11.221 1.00   28.57 ? 238  ARG B N   1 
ATOM   4117 C CA  . ARG B 1 244 ? 2.255  78.645 -11.677 1.00   29.51 ? 238  ARG B CA  1 
ATOM   4118 C C   . ARG B 1 244 ? 2.974  77.343 -11.977 1.00   27.72 ? 238  ARG B C   1 
ATOM   4119 O O   . ARG B 1 244 ? 2.481  76.295 -11.688 1.00   27.37 ? 238  ARG B O   1 
ATOM   4120 C CB  . ARG B 1 244 ? 1.532  79.072 -12.958 1.00   30.49 ? 238  ARG B CB  1 
ATOM   4121 C CG  . ARG B 1 244 ? 1.056  80.486 -12.982 1.00   36.30 ? 238  ARG B CG  1 
ATOM   4122 C CD  . ARG B 1 244 ? -0.032 80.741 -14.024 1.00   41.28 ? 238  ARG B CD  1 
ATOM   4123 N NE  . ARG B 1 244 ? 0.150  81.982 -14.781 1.00   43.57 ? 238  ARG B NE  1 
ATOM   4124 C CZ  . ARG B 1 244 ? -0.297 83.180 -14.420 1.00   47.25 ? 238  ARG B CZ  1 
ATOM   4125 N NH1 . ARG B 1 244 ? -0.943 83.366 -13.263 1.00   49.00 ? 238  ARG B NH1 1 
ATOM   4126 N NH2 . ARG B 1 244 ? -0.086 84.216 -15.228 1.00   48.89 ? 238  ARG B NH2 1 
ATOM   4127 N N   . ARG B 1 245 ? 4.148  77.421 -12.588 1.00   27.26 ? 239  ARG B N   1 
ATOM   4128 C CA  . ARG B 1 245 ? 4.894  76.209 -12.849 1.00   26.72 ? 239  ARG B CA  1 
ATOM   4129 C C   . ARG B 1 245 ? 5.348  75.529 -11.545 1.00   24.73 ? 239  ARG B C   1 
ATOM   4130 O O   . ARG B 1 245 ? 5.270  74.308 -11.418 1.00   23.77 ? 239  ARG B O   1 
ATOM   4131 C CB  . ARG B 1 245 ? 6.049  76.527 -13.758 1.00   27.67 ? 239  ARG B CB  1 
ATOM   4132 C CG  . ARG B 1 245 ? 5.553  76.975 -15.121 1.00   32.93 ? 239  ARG B CG  1 
ATOM   4133 C CD  . ARG B 1 245 ? 6.647  77.028 -16.131 1.00   38.69 ? 239  ARG B CD  1 
ATOM   4134 N NE  . ARG B 1 245 ? 6.647  75.847 -16.978 1.00   44.77 ? 239  ARG B NE  1 
ATOM   4135 C CZ  . ARG B 1 245 ? 7.526  75.671 -17.949 1.00   48.28 ? 239  ARG B CZ  1 
ATOM   4136 N NH1 . ARG B 1 245 ? 8.442  76.599 -18.180 1.00   49.79 ? 239  ARG B NH1 1 
ATOM   4137 N NH2 . ARG B 1 245 ? 7.488  74.584 -18.707 1.00   51.65 ? 239  ARG B NH2 1 
ATOM   4138 N N   . LEU B 1 246 ? 5.804  76.327 -10.591 1.00   23.58 ? 240  LEU B N   1 
ATOM   4139 C CA  . LEU B 1 246 ? 6.181  75.822 -9.274  1.00   22.86 ? 240  LEU B CA  1 
ATOM   4140 C C   . LEU B 1 246 ? 4.994  75.123 -8.590  1.00   23.58 ? 240  LEU B C   1 
ATOM   4141 O O   . LEU B 1 246 ? 5.147  74.109 -7.926  1.00   22.12 ? 240  LEU B O   1 
ATOM   4142 C CB  . LEU B 1 246 ? 6.663  76.958 -8.394  1.00   22.65 ? 240  LEU B CB  1 
ATOM   4143 C CG  . LEU B 1 246 ? 6.980  76.618 -6.924  1.00   23.25 ? 240  LEU B CG  1 
ATOM   4144 C CD1 . LEU B 1 246 ? 8.174  75.686 -6.769  1.00   23.26 ? 240  LEU B CD1 1 
ATOM   4145 C CD2 . LEU B 1 246 ? 7.236  77.850 -6.127  1.00   24.19 ? 240  LEU B CD2 1 
ATOM   4146 N N   . SER B 1 247 ? 3.792  75.677 -8.772  1.00   23.63 ? 241  SER B N   1 
ATOM   4147 C CA  . SER B 1 247 ? 2.593  75.063 -8.194  1.00   24.12 ? 241  SER B CA  1 
ATOM   4148 C C   . SER B 1 247 ? 2.312  73.676 -8.798  1.00   22.80 ? 241  SER B C   1 
ATOM   4149 O O   . SER B 1 247 ? 1.899  72.771 -8.083  1.00   23.18 ? 241  SER B O   1 
ATOM   4150 C CB  . SER B 1 247 ? 1.365  76.006 -8.382  1.00   24.94 ? 241  SER B CB  1 
ATOM   4151 O OG  . SER B 1 247 ? 0.246  75.440 -7.722  1.00   29.54 ? 241  SER B OG  1 
ATOM   4152 N N   . TRP B 1 248 ? 2.525  73.492 -10.100 1.00   22.82 ? 242  TRP B N   1 
ATOM   4153 C CA  . TRP B 1 248 ? 2.389  72.189 -10.714 1.00   22.61 ? 242  TRP B CA  1 
ATOM   4154 C C   . TRP B 1 248 ? 3.374  71.193 -10.088 1.00   21.69 ? 242  TRP B C   1 
ATOM   4155 O O   . TRP B 1 248 ? 3.042  70.044 -9.901  1.00   20.41 ? 242  TRP B O   1 
ATOM   4156 C CB  . TRP B 1 248 ? 2.658  72.204 -12.225 1.00   24.16 ? 242  TRP B CB  1 
ATOM   4157 C CG  . TRP B 1 248 ? 1.554  72.644 -13.085 1.00   29.08 ? 242  TRP B CG  1 
ATOM   4158 C CD1 . TRP B 1 248 ? 1.352  73.902 -13.572 1.00   34.26 ? 242  TRP B CD1 1 
ATOM   4159 C CD2 . TRP B 1 248 ? 0.519  71.830 -13.654 1.00   29.61 ? 242  TRP B CD2 1 
ATOM   4160 N NE1 . TRP B 1 248 ? 0.231  73.932 -14.376 1.00   35.34 ? 242  TRP B NE1 1 
ATOM   4161 C CE2 . TRP B 1 248 ? -0.291 72.675 -14.454 1.00   32.25 ? 242  TRP B CE2 1 
ATOM   4162 C CE3 . TRP B 1 248 ? 0.201  70.488 -13.580 1.00   31.78 ? 242  TRP B CE3 1 
ATOM   4163 C CZ2 . TRP B 1 248 ? -1.419 72.216 -15.135 1.00   32.30 ? 242  TRP B CZ2 1 
ATOM   4164 C CZ3 . TRP B 1 248 ? -0.905 70.026 -14.276 1.00   34.37 ? 242  TRP B CZ3 1 
ATOM   4165 C CH2 . TRP B 1 248 ? -1.698 70.892 -15.042 1.00   32.25 ? 242  TRP B CH2 1 
ATOM   4166 N N   . VAL B 1 249 ? 4.606  71.645 -9.826  1.00   21.34 ? 243  VAL B N   1 
ATOM   4167 C CA  . VAL B 1 249 ? 5.601  70.774 -9.199  1.00   20.40 ? 243  VAL B CA  1 
ATOM   4168 C C   . VAL B 1 249 ? 5.127  70.394 -7.792  1.00   20.35 ? 243  VAL B C   1 
ATOM   4169 O O   . VAL B 1 249 ? 5.148  69.231 -7.422  1.00   21.01 ? 243  VAL B O   1 
ATOM   4170 C CB  . VAL B 1 249 ? 6.954  71.463 -9.107  1.00   19.74 ? 243  VAL B CB  1 
ATOM   4171 C CG1 . VAL B 1 249 ? 7.890  70.643 -8.261  1.00   20.36 ? 243  VAL B CG1 1 
ATOM   4172 C CG2 . VAL B 1 249 ? 7.533  71.706 -10.516 1.00   20.27 ? 243  VAL B CG2 1 
ATOM   4173 N N   . ARG B 1 250 ? 4.613  71.376 -7.058  1.00   21.92 ? 244  ARG B N   1 
ATOM   4174 C CA  . ARG B 1 250 ? 4.183  71.181 -5.666  1.00   22.49 ? 244  ARG B CA  1 
ATOM   4175 C C   . ARG B 1 250 ? 2.976  70.236 -5.595  1.00   23.83 ? 244  ARG B C   1 
ATOM   4176 O O   . ARG B 1 250 ? 2.864  69.419 -4.682  1.00   23.46 ? 244  ARG B O   1 
ATOM   4177 C CB  . ARG B 1 250 ? 3.784  72.513 -5.003  1.00   22.92 ? 244  ARG B CB  1 
ATOM   4178 C CG  . ARG B 1 250 ? 4.915  73.433 -4.517  1.00   24.18 ? 244  ARG B CG  1 
ATOM   4179 C CD  . ARG B 1 250 ? 5.606  73.024 -3.224  1.00   24.46 ? 244  ARG B CD  1 
ATOM   4180 N NE  . ARG B 1 250 ? 6.415  71.865 -3.482  1.00   24.23 ? 244  ARG B NE  1 
ATOM   4181 C CZ  . ARG B 1 250 ? 7.669  71.899 -3.950  1.00   23.68 ? 244  ARG B CZ  1 
ATOM   4182 N NH1 . ARG B 1 250 ? 8.322  73.043 -4.095  1.00   24.03 ? 244  ARG B NH1 1 
ATOM   4183 N NH2 . ARG B 1 250 ? 8.254  70.757 -4.252  1.00   22.32 ? 244  ARG B NH2 1 
ATOM   4184 N N   . GLN B 1 251 ? 2.088  70.349 -6.569  1.00   24.62 ? 245  GLN B N   1 
ATOM   4185 C CA  . GLN B 1 251 ? 0.817  69.589 -6.515  1.00   25.90 ? 245  GLN B CA  1 
ATOM   4186 C C   . GLN B 1 251 ? 0.863  68.222 -7.174  1.00   25.22 ? 245  GLN B C   1 
ATOM   4187 O O   . GLN B 1 251 ? 0.133  67.318 -6.747  1.00   25.21 ? 245  GLN B O   1 
ATOM   4188 C CB  . GLN B 1 251 ? -0.307 70.417 -7.118  1.00   27.09 ? 245  GLN B CB  1 
ATOM   4189 C CG  . GLN B 1 251 ? -0.605 71.704 -6.350  1.00   31.24 ? 245  GLN B CG  1 
ATOM   4190 C CD  . GLN B 1 251 ? -0.981 71.448 -4.896  1.00   38.51 ? 245  GLN B CD  1 
ATOM   4191 O OE1 . GLN B 1 251 ? -1.629 70.445 -4.595  1.00   42.97 ? 245  GLN B OE1 1 
ATOM   4192 N NE2 . GLN B 1 251 ? -0.555 72.339 -3.998  1.00   42.46 ? 245  GLN B NE2 1 
ATOM   4193 N N   . LYS B 1 252 ? 1.688  68.045 -8.213  1.00   22.83 ? 246  LYS B N   1 
ATOM   4194 C CA  . LYS B 1 252 ? 1.695  66.814 -8.980  1.00   23.02 ? 246  LYS B CA  1 
ATOM   4195 C C   . LYS B 1 252 ? 2.978  65.959 -8.862  1.00   22.48 ? 246  LYS B C   1 
ATOM   4196 O O   . LYS B 1 252 ? 2.946  64.782 -9.180  1.00   23.01 ? 246  LYS B O   1 
ATOM   4197 C CB  . LYS B 1 252 ? 1.432  67.107 -10.467 1.00   23.74 ? 246  LYS B CB  1 
ATOM   4198 C CG  . LYS B 1 252 ? 0.099  67.818 -10.805 1.00   27.08 ? 246  LYS B CG  1 
ATOM   4199 C CD  . LYS B 1 252 ? -1.097 66.957 -10.433 1.00   31.65 ? 246  LYS B CD  1 
ATOM   4200 C CE  . LYS B 1 252 ? -2.381 67.321 -11.229 1.00   34.65 ? 246  LYS B CE  1 
ATOM   4201 N NZ  . LYS B 1 252 ? -3.497 66.394 -10.825 1.00   37.24 ? 246  LYS B NZ  1 
ATOM   4202 N N   . TYR B 1 253 ? 4.110  66.561 -8.490  1.00   20.22 ? 247  TYR B N   1 
ATOM   4203 C CA  . TYR B 1 253 ? 5.396  65.832 -8.525  1.00   20.03 ? 247  TYR B CA  1 
ATOM   4204 C C   . TYR B 1 253 ? 6.093  65.692 -7.175  1.00   20.30 ? 247  TYR B C   1 
ATOM   4205 O O   . TYR B 1 253 ? 7.143  65.051 -7.079  1.00   19.79 ? 247  TYR B O   1 
ATOM   4206 C CB  . TYR B 1 253 ? 6.337  66.537 -9.488  1.00   19.51 ? 247  TYR B CB  1 
ATOM   4207 C CG  . TYR B 1 253 ? 5.892  66.338 -10.914 1.00   19.43 ? 247  TYR B CG  1 
ATOM   4208 C CD1 . TYR B 1 253 ? 6.276  65.210 -11.600 1.00   21.27 ? 247  TYR B CD1 1 
ATOM   4209 C CD2 . TYR B 1 253 ? 5.002  67.213 -11.519 1.00   20.13 ? 247  TYR B CD2 1 
ATOM   4210 C CE1 . TYR B 1 253 ? 5.853  64.968 -12.899 1.00   22.17 ? 247  TYR B CE1 1 
ATOM   4211 C CE2 . TYR B 1 253 ? 4.559  66.984 -12.865 1.00   19.16 ? 247  TYR B CE2 1 
ATOM   4212 C CZ  . TYR B 1 253 ? 4.977  65.846 -13.512 1.00   23.07 ? 247  TYR B CZ  1 
ATOM   4213 O OH  . TYR B 1 253 ? 4.604  65.570 -14.812 1.00   23.67 ? 247  TYR B OH  1 
ATOM   4214 N N   . THR B 1 254 ? 5.517  66.261 -6.122  1.00   20.10 ? 248  THR B N   1 
ATOM   4215 C CA  . THR B 1 254 ? 6.198  66.259 -4.849  1.00   21.05 ? 248  THR B CA  1 
ATOM   4216 C C   . THR B 1 254 ? 5.771  65.086 -4.007  1.00   22.46 ? 248  THR B C   1 
ATOM   4217 O O   . THR B 1 254 ? 4.569  64.929 -3.732  1.00   22.96 ? 248  THR B O   1 
ATOM   4218 C CB  . THR B 1 254 ? 5.906  67.554 -4.116  1.00   21.08 ? 248  THR B CB  1 
ATOM   4219 O OG1 . THR B 1 254 ? 6.372  68.659 -4.897  1.00   21.19 ? 248  THR B OG1 1 
ATOM   4220 C CG2 . THR B 1 254 ? 6.714  67.632 -2.857  1.00   21.99 ? 248  THR B CG2 1 
ATOM   4221 N N   . ILE B 1 255 ? 6.732  64.270 -3.584  1.00   22.31 ? 249  ILE B N   1 
ATOM   4222 C CA  . ILE B 1 255 ? 6.445  63.125 -2.751  1.00   23.46 ? 249  ILE B CA  1 
ATOM   4223 C C   . ILE B 1 255 ? 6.878  63.260 -1.317  1.00   22.91 ? 249  ILE B C   1 
ATOM   4224 O O   . ILE B 1 255 ? 6.493  62.438 -0.506  1.00   23.28 ? 249  ILE B O   1 
ATOM   4225 C CB  . ILE B 1 255 ? 6.995  61.843 -3.332  1.00   24.88 ? 249  ILE B CB  1 
ATOM   4226 C CG1 . ILE B 1 255 ? 8.519  61.864 -3.374  1.00   25.77 ? 249  ILE B CG1 1 
ATOM   4227 C CG2 . ILE B 1 255 ? 6.424  61.615 -4.762  1.00   26.69 ? 249  ILE B CG2 1 
ATOM   4228 C CD1 . ILE B 1 255 ? 9.076  60.512 -3.415  1.00   32.83 ? 249  ILE B CD1 1 
ATOM   4229 N N   . TYR B 1 256 ? 7.720  64.242 -1.013  1.00   21.77 ? 250  TYR B N   1 
ATOM   4230 C CA  . TYR B 1 256 ? 8.056  64.597 0.361   1.00   20.63 ? 250  TYR B CA  1 
ATOM   4231 C C   . TYR B 1 256 ? 8.310  66.081 0.428   1.00   21.14 ? 250  TYR B C   1 
ATOM   4232 O O   . TYR B 1 256 ? 8.986  66.672 -0.445  1.00   18.93 ? 250  TYR B O   1 
ATOM   4233 C CB  . TYR B 1 256 ? 9.271  63.831 0.897   1.00   21.01 ? 250  TYR B CB  1 
ATOM   4234 C CG  . TYR B 1 256 ? 9.580  64.254 2.312   1.00   20.39 ? 250  TYR B CG  1 
ATOM   4235 C CD1 . TYR B 1 256 ? 8.844  63.740 3.371   1.00   22.87 ? 250  TYR B CD1 1 
ATOM   4236 C CD2 . TYR B 1 256 ? 10.514 65.268 2.582   1.00   18.28 ? 250  TYR B CD2 1 
ATOM   4237 C CE1 . TYR B 1 256 ? 9.075  64.165 4.678   1.00   20.57 ? 250  TYR B CE1 1 
ATOM   4238 C CE2 . TYR B 1 256 ? 10.763 65.694 3.871   1.00   19.11 ? 250  TYR B CE2 1 
ATOM   4239 C CZ  . TYR B 1 256 ? 10.018 65.133 4.927   1.00   22.66 ? 250  TYR B CZ  1 
ATOM   4240 O OH  . TYR B 1 256 ? 10.270 65.582 6.204   1.00   21.70 ? 250  TYR B OH  1 
ATOM   4241 N N   . ASN B 1 257 ? 7.780  66.726 1.461   1.00   20.02 ? 251  ASN B N   1 
ATOM   4242 C CA  . ASN B 1 257 ? 7.998  68.161 1.633   1.00   21.37 ? 251  ASN B CA  1 
ATOM   4243 C C   . ASN B 1 257 ? 8.181  68.418 3.123   1.00   22.41 ? 251  ASN B C   1 
ATOM   4244 O O   . ASN B 1 257 ? 7.218  68.247 3.902   1.00   22.77 ? 251  ASN B O   1 
ATOM   4245 C CB  . ASN B 1 257 ? 6.797  68.901 1.061   1.00   21.76 ? 251  ASN B CB  1 
ATOM   4246 C CG  . ASN B 1 257 ? 6.883  70.404 1.170   1.00   24.05 ? 251  ASN B CG  1 
ATOM   4247 O OD1 . ASN B 1 257 ? 7.893  70.989 1.588   1.00   25.50 ? 251  ASN B OD1 1 
ATOM   4248 N ND2 . ASN B 1 257 ? 5.765  71.060 0.800   1.00   30.05 ? 251  ASN B ND2 1 
ATOM   4249 N N   . TYR B 1 258 ? 9.367  68.867 3.520   1.00   21.88 ? 252  TYR B N   1 
ATOM   4250 C CA  . TYR B 1 258 ? 9.633  69.079 4.957   1.00   22.31 ? 252  TYR B CA  1 
ATOM   4251 C C   . TYR B 1 258 ? 8.591  70.010 5.580   1.00   23.61 ? 252  TYR B C   1 
ATOM   4252 O O   . TYR B 1 258 ? 8.243  69.833 6.724   1.00   23.46 ? 252  TYR B O   1 
ATOM   4253 C CB  . TYR B 1 258 ? 11.022 69.629 5.210   1.00   22.73 ? 252  TYR B CB  1 
ATOM   4254 C CG  . TYR B 1 258 ? 11.232 71.084 4.897   1.00   22.74 ? 252  TYR B CG  1 
ATOM   4255 C CD1 . TYR B 1 258 ? 11.242 71.562 3.564   1.00   22.50 ? 252  TYR B CD1 1 
ATOM   4256 C CD2 . TYR B 1 258 ? 11.441 72.007 5.910   1.00   23.08 ? 252  TYR B CD2 1 
ATOM   4257 C CE1 . TYR B 1 258 ? 11.461 72.898 3.282   1.00   21.78 ? 252  TYR B CE1 1 
ATOM   4258 C CE2 . TYR B 1 258 ? 11.658 73.366 5.634   1.00   23.54 ? 252  TYR B CE2 1 
ATOM   4259 C CZ  . TYR B 1 258 ? 11.681 73.819 4.333   1.00   23.61 ? 252  TYR B CZ  1 
ATOM   4260 O OH  . TYR B 1 258 ? 11.891 75.183 4.097   1.00   22.96 ? 252  TYR B OH  1 
ATOM   4261 N N   . CYS B 1 259 ? 8.127  70.989 4.810   1.00   23.44 ? 253  CYS B N   1 
ATOM   4262 C CA  . CYS B 1 259 ? 7.154  72.000 5.246   1.00   25.54 ? 253  CYS B CA  1 
ATOM   4263 C C   . CYS B 1 259 ? 5.859  71.434 5.786   1.00   25.60 ? 253  CYS B C   1 
ATOM   4264 O O   . CYS B 1 259 ? 5.223  72.053 6.665   1.00   25.53 ? 253  CYS B O   1 
ATOM   4265 C CB  . CYS B 1 259 ? 6.790  72.937 4.070   1.00   26.08 ? 253  CYS B CB  1 
ATOM   4266 S SG  . CYS B 1 259 ? 8.110  74.131 3.796   1.00   34.81 ? 253  CYS B SG  1 
ATOM   4267 N N   . THR B 1 260 ? 5.431  70.309 5.226   1.00   25.32 ? 254  THR B N   1 
ATOM   4268 C CA  . THR B 1 260 ? 4.169  69.682 5.624   1.00   26.68 ? 254  THR B CA  1 
ATOM   4269 C C   . THR B 1 260 ? 4.357  68.396 6.458   1.00   26.88 ? 254  THR B C   1 
ATOM   4270 O O   . THR B 1 260 ? 3.399  67.683 6.694   1.00   28.09 ? 254  THR B O   1 
ATOM   4271 C CB  . THR B 1 260 ? 3.312  69.374 4.395   1.00   27.00 ? 254  THR B CB  1 
ATOM   4272 O OG1 . THR B 1 260 ? 4.010  68.473 3.529   1.00   26.74 ? 254  THR B OG1 1 
ATOM   4273 C CG2 . THR B 1 260 ? 3.042  70.596 3.551   1.00   28.57 ? 254  THR B CG2 1 
ATOM   4274 N N   . ASP B 1 261 ? 5.579  68.095 6.897   1.00   26.58 ? 255  ASP B N   1 
ATOM   4275 C CA  . ASP B 1 261 ? 5.878  66.886 7.638   1.00   27.02 ? 255  ASP B CA  1 
ATOM   4276 C C   . ASP B 1 261 ? 5.685  67.207 9.129   1.00   27.77 ? 255  ASP B C   1 
ATOM   4277 O O   . ASP B 1 261 ? 6.568  67.739 9.789   1.00   26.50 ? 255  ASP B O   1 
ATOM   4278 C CB  . ASP B 1 261 ? 7.309  66.425 7.382   1.00   27.07 ? 255  ASP B CB  1 
ATOM   4279 C CG  . ASP B 1 261 ? 7.633  65.125 8.068   1.00   29.70 ? 255  ASP B CG  1 
ATOM   4280 O OD1 . ASP B 1 261 ? 6.804  64.649 8.891   1.00   32.37 ? 255  ASP B OD1 1 
ATOM   4281 O OD2 . ASP B 1 261 ? 8.696  64.502 7.873   1.00   27.92 ? 255  ASP B OD2 1 
ATOM   4282 N N   . ARG B 1 262 ? 4.479  66.963 9.622   1.00   29.07 ? 256  ARG B N   1 
ATOM   4283 C CA  . ARG B 1 262 ? 4.147  67.343 11.006  1.00   30.03 ? 256  ARG B CA  1 
ATOM   4284 C C   . ARG B 1 262 ? 4.656  66.386 12.073  1.00   31.80 ? 256  ARG B C   1 
ATOM   4285 O O   . ARG B 1 262 ? 4.594  66.712 13.271  1.00   33.02 ? 256  ARG B O   1 
ATOM   4286 C CB  . ARG B 1 262 ? 2.633  67.534 11.150  1.00   30.05 ? 256  ARG B CB  1 
ATOM   4287 C CG  . ARG B 1 262 ? 2.078  68.711 10.410  1.00   27.48 ? 256  ARG B CG  1 
ATOM   4288 C CD  . ARG B 1 262 ? 2.312  70.071 11.055  1.00   26.79 ? 256  ARG B CD  1 
ATOM   4289 N NE  . ARG B 1 262 ? 2.155  71.096 10.031  1.00   27.52 ? 256  ARG B NE  1 
ATOM   4290 C CZ  . ARG B 1 262 ? 3.139  71.503 9.216   1.00   28.22 ? 256  ARG B CZ  1 
ATOM   4291 N NH1 . ARG B 1 262 ? 4.370  71.041 9.357   1.00   27.11 ? 256  ARG B NH1 1 
ATOM   4292 N NH2 . ARG B 1 262 ? 2.865  72.369 8.253   1.00   27.41 ? 256  ARG B NH2 1 
ATOM   4293 N N   . SER B 1 263 ? 5.146  65.213 11.664  1.00   33.24 ? 257  SER B N   1 
ATOM   4294 C CA  . SER B 1 263 ? 5.924  64.317 12.548  1.00   34.74 ? 257  SER B CA  1 
ATOM   4295 C C   . SER B 1 263 ? 7.267  64.961 12.911  1.00   34.24 ? 257  SER B C   1 
ATOM   4296 O O   . SER B 1 263 ? 7.816  64.809 14.011  1.00   34.67 ? 257  SER B O   1 
ATOM   4297 C CB  . SER B 1 263 ? 6.163  62.991 11.837  1.00   35.85 ? 257  SER B CB  1 
ATOM   4298 O OG  . SER B 1 263 ? 6.509  61.949 12.737  1.00   40.44 ? 257  SER B OG  1 
ATOM   4299 N N   . ARG B 1 264 ? 7.808  65.707 11.963  1.00   32.51 ? 258  ARG B N   1 
ATOM   4300 C CA  . ARG B 1 264 ? 9.119  66.278 12.087  1.00   31.33 ? 258  ARG B CA  1 
ATOM   4301 C C   . ARG B 1 264 ? 9.071  67.742 12.490  1.00   30.01 ? 258  ARG B C   1 
ATOM   4302 O O   . ARG B 1 264 ? 9.878  68.193 13.297  1.00   30.15 ? 258  ARG B O   1 
ATOM   4303 C CB  . ARG B 1 264 ? 9.765  66.108 10.708  1.00   31.19 ? 258  ARG B CB  1 
ATOM   4304 C CG  . ARG B 1 264 ? 11.169 66.226 10.670  1.00   32.03 ? 258  ARG B CG  1 
ATOM   4305 C CD  . ARG B 1 264 ? 11.637 66.031 9.222   1.00   31.75 ? 258  ARG B CD  1 
ATOM   4306 N NE  . ARG B 1 264 ? 13.050 66.114 9.151   1.00   31.12 ? 258  ARG B NE  1 
ATOM   4307 C CZ  . ARG B 1 264 ? 13.713 66.195 8.011   1.00   29.89 ? 258  ARG B CZ  1 
ATOM   4308 N NH1 . ARG B 1 264 ? 13.065 66.193 6.854   1.00   24.43 ? 258  ARG B NH1 1 
ATOM   4309 N NH2 . ARG B 1 264 ? 15.020 66.247 8.052   1.00   28.17 ? 258  ARG B NH2 1 
ATOM   4310 N N   . TYR B 1 265 ? 8.116  68.477 11.929  1.00   29.05 ? 259  TYR B N   1 
ATOM   4311 C CA  . TYR B 1 265 ? 7.865  69.898 12.209  1.00   28.62 ? 259  TYR B CA  1 
ATOM   4312 C C   . TYR B 1 265 ? 6.395  70.097 12.642  1.00   29.07 ? 259  TYR B C   1 
ATOM   4313 O O   . TYR B 1 265 ? 5.509  70.367 11.829  1.00   27.19 ? 259  TYR B O   1 
ATOM   4314 C CB  . TYR B 1 265 ? 8.102  70.764 10.967  1.00   28.74 ? 259  TYR B CB  1 
ATOM   4315 C CG  . TYR B 1 265 ? 9.561  70.827 10.598  1.00   28.81 ? 259  TYR B CG  1 
ATOM   4316 C CD1 . TYR B 1 265 ? 10.421 71.695 11.258  1.00   32.89 ? 259  TYR B CD1 1 
ATOM   4317 C CD2 . TYR B 1 265 ? 10.090 69.962 9.630   1.00   28.49 ? 259  TYR B CD2 1 
ATOM   4318 C CE1 . TYR B 1 265 ? 11.784 71.765 10.928  1.00   34.25 ? 259  TYR B CE1 1 
ATOM   4319 C CE2 . TYR B 1 265 ? 11.460 70.004 9.294   1.00   31.05 ? 259  TYR B CE2 1 
ATOM   4320 C CZ  . TYR B 1 265 ? 12.297 70.913 9.946   1.00   33.37 ? 259  TYR B CZ  1 
ATOM   4321 O OH  . TYR B 1 265 ? 13.649 70.963 9.663   1.00   32.89 ? 259  TYR B OH  1 
ATOM   4322 N N   . PRO B 1 266 ? 6.137  69.983 13.929  1.00   30.39 ? 260  PRO B N   1 
ATOM   4323 C CA  . PRO B 1 266 ? 4.748  70.099 14.428  1.00   30.20 ? 260  PRO B CA  1 
ATOM   4324 C C   . PRO B 1 266 ? 4.096  71.426 14.057  1.00   29.68 ? 260  PRO B C   1 
ATOM   4325 O O   . PRO B 1 266 ? 2.881  71.545 13.871  1.00   29.70 ? 260  PRO B O   1 
ATOM   4326 C CB  . PRO B 1 266 ? 4.927  69.974 15.944  1.00   30.99 ? 260  PRO B CB  1 
ATOM   4327 C CG  . PRO B 1 266 ? 6.187  69.222 16.111  1.00   32.03 ? 260  PRO B CG  1 
ATOM   4328 C CD  . PRO B 1 266 ? 7.103  69.721 15.011  1.00   31.17 ? 260  PRO B CD  1 
ATOM   4329 N N   . SER B 1 267 ? 4.927  72.436 13.958  1.00   30.27 ? 261  SER B N   1 
ATOM   4330 C CA  . SER B 1 267 ? 4.578  73.724 13.400  1.00   31.73 ? 261  SER B CA  1 
ATOM   4331 C C   . SER B 1 267 ? 5.331  73.948 12.064  1.00   32.28 ? 261  SER B C   1 
ATOM   4332 O O   . SER B 1 267 ? 6.475  73.538 11.954  1.00   31.62 ? 261  SER B O   1 
ATOM   4333 C CB  . SER B 1 267 ? 5.071  74.770 14.371  1.00   32.60 ? 261  SER B CB  1 
ATOM   4334 O OG  . SER B 1 267 ? 4.808  76.050 13.875  1.00   36.52 ? 261  SER B OG  1 
ATOM   4335 N N   . MET B 1 268 ? 4.721  74.626 11.099  1.00   32.97 ? 262  MET B N   1 
ATOM   4336 C CA  . MET B 1 268 ? 5.371  74.805 9.800   1.00   34.12 ? 262  MET B CA  1 
ATOM   4337 C C   . MET B 1 268 ? 6.572  75.741 9.972   1.00   33.64 ? 262  MET B C   1 
ATOM   4338 O O   . MET B 1 268 ? 6.452  76.774 10.632  1.00   33.53 ? 262  MET B O   1 
ATOM   4339 C CB  . MET B 1 268 ? 4.374  75.325 8.766   1.00   34.73 ? 262  MET B CB  1 
ATOM   4340 C CG  . MET B 1 268 ? 3.993  76.768 8.861   1.00   37.53 ? 262  MET B CG  1 
ATOM   4341 S SD  . MET B 1 268 ? 2.939  77.286 7.472   0.50   42.98 ? 262  MET B SD  1 
ATOM   4342 C CE  . MET B 1 268 ? 2.205  78.774 8.107   1.00   45.17 ? 262  MET B CE  1 
ATOM   4343 N N   . PRO B 1 269 ? 7.738  75.398 9.415   1.00   33.61 ? 263  PRO B N   1 
ATOM   4344 C CA  . PRO B 1 269 ? 8.862  76.347 9.433   1.00   32.88 ? 263  PRO B CA  1 
ATOM   4345 C C   . PRO B 1 269 ? 8.426  77.698 8.898   1.00   32.78 ? 263  PRO B C   1 
ATOM   4346 O O   . PRO B 1 269 ? 7.578  77.737 8.002   1.00   33.26 ? 263  PRO B O   1 
ATOM   4347 C CB  . PRO B 1 269 ? 9.918  75.675 8.549   1.00   33.03 ? 263  PRO B CB  1 
ATOM   4348 C CG  . PRO B 1 269 ? 9.602  74.221 8.661   1.00   33.15 ? 263  PRO B CG  1 
ATOM   4349 C CD  . PRO B 1 269 ? 8.104  74.125 8.768   1.00   32.95 ? 263  PRO B CD  1 
ATOM   4350 N N   . PRO B 1 270 ? 8.975  78.788 9.429   1.00   32.61 ? 264  PRO B N   1 
ATOM   4351 C CA  . PRO B 1 270 ? 8.491  80.134 9.096   1.00   32.57 ? 264  PRO B CA  1 
ATOM   4352 C C   . PRO B 1 270 ? 8.567  80.533 7.617   1.00   31.97 ? 264  PRO B C   1 
ATOM   4353 O O   . PRO B 1 270 ? 7.739  81.322 7.174   1.00   32.03 ? 264  PRO B O   1 
ATOM   4354 C CB  . PRO B 1 270 ? 9.364  81.057 9.949   1.00   33.27 ? 264  PRO B CB  1 
ATOM   4355 C CG  . PRO B 1 270 ? 10.031 80.199 10.925  1.00   33.20 ? 264  PRO B CG  1 
ATOM   4356 C CD  . PRO B 1 270 ? 10.065 78.815 10.417  1.00   33.15 ? 264  PRO B CD  1 
ATOM   4357 N N   . GLU B 1 271 ? 9.537  79.994 6.874   1.00   31.45 ? 265  GLU B N   1 
ATOM   4358 C CA  . GLU B 1 271 ? 9.744  80.348 5.452   1.00   30.96 ? 265  GLU B CA  1 
ATOM   4359 C C   . GLU B 1 271 ? 8.716  79.745 4.488   1.00   31.01 ? 265  GLU B C   1 
ATOM   4360 O O   . GLU B 1 271 ? 8.582  80.189 3.345   1.00   30.67 ? 265  GLU B O   1 
ATOM   4361 C CB  . GLU B 1 271 ? 11.156 79.908 5.003   1.00   30.58 ? 265  GLU B CB  1 
ATOM   4362 C CG  . GLU B 1 271 ? 11.378 78.397 4.934   1.00   30.44 ? 265  GLU B CG  1 
ATOM   4363 C CD  . GLU B 1 271 ? 11.936 77.782 6.214   1.00   30.86 ? 265  GLU B CD  1 
ATOM   4364 O OE1 . GLU B 1 271 ? 11.796 78.379 7.312   1.00   32.99 ? 265  GLU B OE1 1 
ATOM   4365 O OE2 . GLU B 1 271 ? 12.532 76.690 6.132   1.00   30.74 ? 265  GLU B OE2 1 
ATOM   4366 N N   . CYS B 1 272 ? 8.005  78.728 4.944   1.00   30.76 ? 266  CYS B N   1 
ATOM   4367 C CA  . CYS B 1 272 ? 7.229  77.877 4.050   1.00   31.78 ? 266  CYS B CA  1 
ATOM   4368 C C   . CYS B 1 272 ? 6.104  78.587 3.306   1.00   32.11 ? 266  CYS B C   1 
ATOM   4369 O O   . CYS B 1 272 ? 5.850  78.278 2.144   1.00   30.78 ? 266  CYS B O   1 
ATOM   4370 C CB  . CYS B 1 272 ? 6.688  76.669 4.822   1.00   32.09 ? 266  CYS B CB  1 
ATOM   4371 S SG  . CYS B 1 272 ? 8.008  75.544 5.312   1.00   37.26 ? 266  CYS B SG  1 
ATOM   4372 N N   . LYS B 1 273 ? 5.421  79.548 3.941   1.00   32.55 ? 267  LYS B N   1 
ATOM   4373 C CA  . LYS B 1 273 ? 4.321  80.242 3.243   1.00   33.05 ? 267  LYS B CA  1 
ATOM   4374 C C   . LYS B 1 273 ? 4.820  81.189 2.161   1.00   32.51 ? 267  LYS B C   1 
ATOM   4375 O O   . LYS B 1 273 ? 4.304  81.218 1.034   1.00   31.29 ? 267  LYS B O   1 
ATOM   4376 C CB  . LYS B 1 273 ? 3.446  81.016 4.246   1.00   34.36 ? 267  LYS B CB  1 
ATOM   4377 C CG  . LYS B 1 273 ? 2.337  80.162 4.798   1.00   38.34 ? 267  LYS B CG  1 
ATOM   4378 C CD  . LYS B 1 273 ? 1.098  80.160 3.869   1.00   42.98 ? 267  LYS B CD  1 
ATOM   4379 C CE  . LYS B 1 273 ? -0.033 81.066 4.404   1.00   45.93 ? 267  LYS B CE  1 
ATOM   4380 N NZ  . LYS B 1 273 ? 0.485  82.301 5.094   1.00   46.28 ? 267  LYS B NZ  1 
ATOM   4381 N N   . ARG B 1 274 ? 5.840  81.956 2.503   1.00   32.43 ? 268  ARG B N   1 
ATOM   4382 C CA  . ARG B 1 274 ? 6.464  82.862 1.553   1.00   33.23 ? 268  ARG B CA  1 
ATOM   4383 C C   . ARG B 1 274 ? 7.072  82.107 0.367   1.00   32.01 ? 268  ARG B C   1 
ATOM   4384 O O   . ARG B 1 274 ? 7.069  82.601 -0.752  1.00   32.04 ? 268  ARG B O   1 
ATOM   4385 C CB  . ARG B 1 274 ? 7.538  83.685 2.244   1.00   34.24 ? 268  ARG B CB  1 
ATOM   4386 C CG  . ARG B 1 274 ? 7.612  85.097 1.712   1.00   38.50 ? 268  ARG B CG  1 
ATOM   4387 C CD  . ARG B 1 274 ? 8.492  86.008 2.527   1.00   42.72 ? 268  ARG B CD  1 
ATOM   4388 N NE  . ARG B 1 274 ? 7.797  86.624 3.656   1.00   45.81 ? 268  ARG B NE  1 
ATOM   4389 C CZ  . ARG B 1 274 ? 8.413  87.305 4.615   1.00   46.12 ? 268  ARG B CZ  1 
ATOM   4390 N NH1 . ARG B 1 274 ? 9.728  87.462 4.581   1.00   46.22 ? 268  ARG B NH1 1 
ATOM   4391 N NH2 . ARG B 1 274 ? 7.713  87.833 5.613   1.00   47.66 ? 268  ARG B NH2 1 
ATOM   4392 N N   . ASP B 1 275 ? 7.594  80.916 0.648   1.00   31.26 ? 269  ASP B N   1 
ATOM   4393 C CA  . ASP B 1 275 ? 8.200  80.042 -0.359  1.00   30.36 ? 269  ASP B CA  1 
ATOM   4394 C C   . ASP B 1 275 ? 7.148  79.333 -1.215  1.00   30.96 ? 269  ASP B C   1 
ATOM   4395 O O   . ASP B 1 275 ? 7.490  78.627 -2.166  1.00   28.72 ? 269  ASP B O   1 
ATOM   4396 C CB  . ASP B 1 275 ? 9.063  78.986 0.336   1.00   30.07 ? 269  ASP B CB  1 
ATOM   4397 C CG  . ASP B 1 275 ? 10.350 79.552 0.934   1.00   28.96 ? 269  ASP B CG  1 
ATOM   4398 O OD1 . ASP B 1 275 ? 10.674 80.731 0.699   1.00   29.61 ? 269  ASP B OD1 1 
ATOM   4399 O OD2 . ASP B 1 275 ? 11.119 78.854 1.636   1.00   29.95 ? 269  ASP B OD2 1 
ATOM   4400 N N   . ARG B 1 276 ? 5.864  79.486 -0.850  1.00   31.49 ? 270  ARG B N   1 
ATOM   4401 C CA  . ARG B 1 276 ? 4.764  78.796 -1.498  1.00   32.70 ? 270  ARG B CA  1 
ATOM   4402 C C   . ARG B 1 276 ? 4.910  77.271 -1.454  1.00   32.73 ? 270  ARG B C   1 
ATOM   4403 O O   . ARG B 1 276 ? 4.483  76.575 -2.366  1.00   32.65 ? 270  ARG B O   1 
ATOM   4404 C CB  . ARG B 1 276 ? 4.620  79.261 -2.943  1.00   33.41 ? 270  ARG B CB  1 
ATOM   4405 C CG  . ARG B 1 276 ? 4.569  80.788 -3.092  1.00   37.30 ? 270  ARG B CG  1 
ATOM   4406 C CD  . ARG B 1 276 ? 3.217  81.293 -3.517  1.00   41.55 ? 270  ARG B CD  1 
ATOM   4407 N NE  . ARG B 1 276 ? 3.249  82.436 -4.435  1.00   45.26 ? 270  ARG B NE  1 
ATOM   4408 C CZ  . ARG B 1 276 ? 3.607  83.665 -4.105  1.00   48.28 ? 270  ARG B CZ  1 
ATOM   4409 N NH1 . ARG B 1 276 ? 4.049  83.951 -2.877  1.00   50.70 ? 270  ARG B NH1 1 
ATOM   4410 N NH2 . ARG B 1 276 ? 3.546  84.625 -5.022  1.00   50.52 ? 270  ARG B NH2 1 
ATOM   4411 N N   . ASP B 1 277 ? 5.514  76.767 -0.385  1.00   34.08 ? 271  ASP B N   1 
ATOM   4412 C CA  . ASP B 1 277 ? 5.662  75.330 -0.156  1.00   35.09 ? 271  ASP B CA  1 
ATOM   4413 C C   . ASP B 1 277 ? 4.470  74.754 0.605   1.00   37.25 ? 271  ASP B C   1 
ATOM   4414 O O   . ASP B 1 277 ? 4.426  73.570 0.896   1.00   36.54 ? 271  ASP B O   1 
ATOM   4415 C CB  . ASP B 1 277 ? 6.965  75.040 0.594   1.00   34.89 ? 271  ASP B CB  1 
ATOM   4416 C CG  . ASP B 1 277 ? 8.182  75.072 -0.327  1.00   34.79 ? 271  ASP B CG  1 
ATOM   4417 O OD1 . ASP B 1 277 ? 8.026  74.691 -1.504  1.00   36.13 ? 271  ASP B OD1 1 
ATOM   4418 O OD2 . ASP B 1 277 ? 9.312  75.442 0.033   1.00   33.12 ? 271  ASP B OD2 1 
ATOM   4419 N N   . ILE B 1 278 ? 3.511  75.623 0.920   1.00   40.09 ? 272  ILE B N   1 
ATOM   4420 C CA  . ILE B 1 278 ? 2.189  75.231 1.395   1.00   42.53 ? 272  ILE B CA  1 
ATOM   4421 C C   . ILE B 1 278 ? 1.341  74.664 0.260   1.00   44.27 ? 272  ILE B C   1 
ATOM   4422 O O   . ILE B 1 278 ? 0.855  73.529 0.362   1.00   47.16 ? 272  ILE B O   1 
ATOM   4423 C CB  . ILE B 1 278 ? 1.495  76.475 2.063   1.00   43.38 ? 272  ILE B CB  1 
ATOM   4424 C CG1 . ILE B 1 278 ? 2.154  76.791 3.435   1.00   44.66 ? 272  ILE B CG1 1 
ATOM   4425 C CG2 . ILE B 1 278 ? 0.000  76.258 2.198   1.00   43.08 ? 272  ILE B CG2 1 
ATOM   4426 C CD1 . ILE B 1 278 ? 2.927  75.653 4.085   1.00   45.87 ? 272  ILE B CD1 1 
HETATM 4427 C C1  . NAG C 2 .   ? 37.278 41.019 5.640   1.00   26.80 ? 1    NAG C C1  1 
HETATM 4428 C C2  . NAG C 2 .   ? 37.582 42.430 6.142   1.00   26.26 ? 1    NAG C C2  1 
HETATM 4429 C C3  . NAG C 2 .   ? 36.732 42.762 7.395   1.00   27.54 ? 1    NAG C C3  1 
HETATM 4430 C C4  . NAG C 2 .   ? 35.249 42.521 7.118   1.00   28.74 ? 1    NAG C C4  1 
HETATM 4431 C C5  . NAG C 2 .   ? 35.058 41.180 6.424   1.00   30.14 ? 1    NAG C C5  1 
HETATM 4432 C C6  . NAG C 2 .   ? 33.596 41.001 5.985   1.00   32.36 ? 1    NAG C C6  1 
HETATM 4433 C C7  . NAG C 2 .   ? 39.684 41.860 7.282   1.00   24.73 ? 1    NAG C C7  1 
HETATM 4434 C C8  . NAG C 2 .   ? 41.190 41.852 7.141   1.00   23.46 ? 1    NAG C C8  1 
HETATM 4435 N N2  . NAG C 2 .   ? 39.013 42.613 6.417   1.00   23.40 ? 1    NAG C N2  1 
HETATM 4436 O O3  . NAG C 2 .   ? 36.919 44.105 7.792   1.00   25.74 ? 1    NAG C O3  1 
HETATM 4437 O O4  . NAG C 2 .   ? 34.558 42.528 8.355   1.00   31.25 ? 1    NAG C O4  1 
HETATM 4438 O O5  . NAG C 2 .   ? 35.888 41.063 5.284   1.00   28.14 ? 1    NAG C O5  1 
HETATM 4439 O O6  . NAG C 2 .   ? 33.437 39.615 5.877   1.00   32.25 ? 1    NAG C O6  1 
HETATM 4440 O O7  . NAG C 2 .   ? 39.158 41.171 8.171   1.00   26.92 ? 1    NAG C O7  1 
HETATM 4441 C C1  . NAG C 2 .   ? 33.698 43.682 8.518   1.00   35.11 ? 2    NAG C C1  1 
HETATM 4442 C C2  . NAG C 2 .   ? 32.599 43.333 9.530   1.00   37.80 ? 2    NAG C C2  1 
HETATM 4443 C C3  . NAG C 2 .   ? 31.597 44.479 9.667   1.00   39.37 ? 2    NAG C C3  1 
HETATM 4444 C C4  . NAG C 2 .   ? 32.323 45.797 9.904   1.00   40.22 ? 2    NAG C C4  1 
HETATM 4445 C C5  . NAG C 2 .   ? 33.503 45.976 8.941   1.00   38.75 ? 2    NAG C C5  1 
HETATM 4446 C C6  . NAG C 2 .   ? 34.334 47.184 9.315   1.00   36.95 ? 2    NAG C C6  1 
HETATM 4447 C C7  . NAG C 2 .   ? 32.172 40.922 9.587   1.00   39.68 ? 2    NAG C C7  1 
HETATM 4448 C C8  . NAG C 2 .   ? 31.313 39.781 9.095   1.00   40.15 ? 2    NAG C C8  1 
HETATM 4449 N N2  . NAG C 2 .   ? 31.896 42.133 9.116   1.00   38.66 ? 2    NAG C N2  1 
HETATM 4450 O O3  . NAG C 2 .   ? 30.775 44.193 10.777  1.00   37.91 ? 2    NAG C O3  1 
HETATM 4451 O O4  . NAG C 2 .   ? 31.424 46.844 9.657   1.00   45.11 ? 2    NAG C O4  1 
HETATM 4452 O O5  . NAG C 2 .   ? 34.339 44.831 8.997   1.00   36.92 ? 2    NAG C O5  1 
HETATM 4453 O O6  . NAG C 2 .   ? 34.939 46.857 10.544  1.00   39.91 ? 2    NAG C O6  1 
HETATM 4454 O O7  . NAG C 2 .   ? 33.078 40.713 10.387  1.00   41.12 ? 2    NAG C O7  1 
HETATM 4455 C C1  . BMA C 2 .   ? 31.372 47.796 10.735  1.00   51.09 ? 3    BMA C C1  1 
HETATM 4456 C C2  . BMA C 2 .   ? 30.691 49.036 10.162  1.00   52.74 ? 3    BMA C C2  1 
HETATM 4457 C C3  . BMA C 2 .   ? 30.550 50.111 11.235  1.00   54.96 ? 3    BMA C C3  1 
HETATM 4458 C C4  . BMA C 2 .   ? 29.984 49.561 12.541  1.00   55.32 ? 3    BMA C C4  1 
HETATM 4459 C C5  . BMA C 2 .   ? 30.626 48.228 12.928  1.00   55.98 ? 3    BMA C C5  1 
HETATM 4460 C C6  . BMA C 2 .   ? 29.870 47.571 14.080  1.00   57.12 ? 3    BMA C C6  1 
HETATM 4461 O O2  . BMA C 2 .   ? 29.441 48.668 9.625   1.00   53.86 ? 3    BMA C O2  1 
HETATM 4462 O O3  . BMA C 2 .   ? 29.809 51.214 10.751  1.00   54.83 ? 3    BMA C O3  1 
HETATM 4463 O O4  . BMA C 2 .   ? 30.291 50.478 13.562  1.00   56.63 ? 3    BMA C O4  1 
HETATM 4464 O O5  . BMA C 2 .   ? 30.659 47.314 11.848  1.00   52.95 ? 3    BMA C O5  1 
HETATM 4465 O O6  . BMA C 2 .   ? 30.698 46.588 14.642  1.00   59.60 ? 3    BMA C O6  1 
HETATM 4466 C C2  . BGC D 3 .   ? 41.618 40.805 18.762  1.00   50.44 ? 1    BGC D C2  1 
HETATM 4467 C C3  . BGC D 3 .   ? 43.066 40.796 18.250  1.00   49.71 ? 1    BGC D C3  1 
HETATM 4468 C C4  . BGC D 3 .   ? 44.064 40.426 19.363  1.00   50.01 ? 1    BGC D C4  1 
HETATM 4469 C C5  . BGC D 3 .   ? 43.554 39.190 20.133  1.00   51.71 ? 1    BGC D C5  1 
HETATM 4470 C C6  . BGC D 3 .   ? 44.468 38.783 21.301  1.00   52.63 ? 1    BGC D C6  1 
HETATM 4471 C C1  . BGC D 3 .   ? 41.269 39.539 19.548  1.00   51.40 ? 1    BGC D C1  1 
HETATM 4472 O O2  . BGC D 3 .   ? 40.709 40.935 17.690  1.00   49.63 ? 1    BGC D O2  1 
HETATM 4473 O O3  . BGC D 3 .   ? 43.360 42.061 17.685  1.00   48.89 ? 1    BGC D O3  1 
HETATM 4474 O O4  . BGC D 3 .   ? 45.326 40.057 18.823  1.00   48.27 ? 1    BGC D O4  1 
HETATM 4475 O O5  . BGC D 3 .   ? 42.215 39.371 20.585  1.00   52.50 ? 1    BGC D O5  1 
HETATM 4476 O O6  . BGC D 3 .   ? 44.830 39.928 22.056  1.00   54.39 ? 1    BGC D O6  1 
HETATM 4477 C C2  . BGC D 3 .   ? 47.690 40.452 18.510  1.00   43.29 ? 2    BGC D C2  1 
HETATM 4478 C C3  . BGC D 3 .   ? 48.779 41.500 18.261  1.00   40.30 ? 2    BGC D C3  1 
HETATM 4479 C C4  . BGC D 3 .   ? 48.321 42.511 17.212  1.00   39.30 ? 2    BGC D C4  1 
HETATM 4480 C C5  . BGC D 3 .   ? 46.945 43.038 17.579  1.00   41.64 ? 2    BGC D C5  1 
HETATM 4481 C C6  . BGC D 3 .   ? 46.407 43.926 16.474  1.00   41.55 ? 2    BGC D C6  1 
HETATM 4482 C C1  . BGC D 3 .   ? 46.322 41.091 18.789  1.00   44.50 ? 2    BGC D C1  1 
HETATM 4483 O O2  . BGC D 3 .   ? 48.085 39.597 19.572  1.00   43.72 ? 2    BGC D O2  1 
HETATM 4484 O O3  . BGC D 3 .   ? 49.983 40.873 17.861  1.00   38.98 ? 2    BGC D O3  1 
HETATM 4485 O O4  . BGC D 3 .   ? 49.187 43.636 17.139  1.00   38.32 ? 2    BGC D O4  1 
HETATM 4486 O O5  . BGC D 3 .   ? 45.993 42.012 17.775  1.00   42.80 ? 2    BGC D O5  1 
HETATM 4487 O O6  . BGC D 3 .   ? 45.202 44.462 16.976  1.00   41.04 ? 2    BGC D O6  1 
HETATM 4488 C C2  . BGC D 3 .   ? 50.524 44.991 15.564  1.00   34.33 ? 3    BGC D C2  1 
HETATM 4489 C C3  . BGC D 3 .   ? 51.526 44.948 14.389  1.00   33.85 ? 3    BGC D C3  1 
HETATM 4490 C C4  . BGC D 3 .   ? 52.683 44.002 14.726  1.00   36.33 ? 3    BGC D C4  1 
HETATM 4491 C C5  . BGC D 3 .   ? 52.091 42.648 15.148  1.00   37.87 ? 3    BGC D C5  1 
HETATM 4492 C C6  . BGC D 3 .   ? 53.128 41.589 15.503  1.00   39.07 ? 3    BGC D C6  1 
HETATM 4493 C C1  . BGC D 3 .   ? 50.068 43.590 15.985  1.00   36.64 ? 3    BGC D C1  1 
HETATM 4494 O O2  . BGC D 3 .   ? 49.411 45.753 15.185  1.00   32.35 ? 3    BGC D O2  1 
HETATM 4495 O O3  . BGC D 3 .   ? 51.954 46.265 14.046  1.00   29.24 ? 3    BGC D O3  1 
HETATM 4496 O O4  . BGC D 3 .   ? 53.517 43.825 13.586  1.00   35.40 ? 3    BGC D O4  1 
HETATM 4497 O O5  . BGC D 3 .   ? 51.208 42.791 16.256  1.00   37.85 ? 3    BGC D O5  1 
HETATM 4498 O O6  . BGC D 3 .   ? 52.394 40.393 15.631  1.00   42.70 ? 3    BGC D O6  1 
HETATM 4499 C C1  . XYS D 3 .   ? 53.263 39.281 15.930  1.00   47.19 ? 4    XYS D C1  1 
HETATM 4500 C C2  . XYS D 3 .   ? 52.465 38.003 15.919  1.00   48.16 ? 4    XYS D C2  1 
HETATM 4501 C C3  . XYS D 3 .   ? 51.503 37.983 17.118  1.00   48.93 ? 4    XYS D C3  1 
HETATM 4502 C C4  . XYS D 3 .   ? 52.240 38.277 18.420  1.00   48.53 ? 4    XYS D C4  1 
HETATM 4503 C C5  . XYS D 3 .   ? 53.139 39.510 18.266  1.00   48.82 ? 4    XYS D C5  1 
HETATM 4504 O O2  . XYS D 3 .   ? 51.749 37.885 14.699  1.00   47.78 ? 4    XYS D O2  1 
HETATM 4505 O O3  . XYS D 3 .   ? 50.835 36.743 17.247  1.00   49.02 ? 4    XYS D O3  1 
HETATM 4506 O O4  . XYS D 3 .   ? 51.277 38.515 19.427  1.00   47.93 ? 4    XYS D O4  1 
HETATM 4507 O O5  . XYS D 3 .   ? 53.949 39.404 17.101  1.00   48.78 ? 4    XYS D O5  1 
HETATM 4508 C C1  . XYS D 3 .   ? 45.084 45.903 17.987  1.00   45.58 ? 5    XYS D C1  1 
HETATM 4509 C C2  . XYS D 3 .   ? 44.088 45.715 19.107  1.00   48.41 ? 5    XYS D C2  1 
HETATM 4510 C C3  . XYS D 3 .   ? 42.694 45.499 18.530  1.00   48.85 ? 5    XYS D C3  1 
HETATM 4511 C C4  . XYS D 3 .   ? 42.360 46.604 17.538  1.00   47.23 ? 5    XYS D C4  1 
HETATM 4512 C C5  . XYS D 3 .   ? 43.463 46.751 16.487  1.00   46.01 ? 5    XYS D C5  1 
HETATM 4513 O O2  . XYS D 3 .   ? 44.431 44.578 19.890  1.00   50.56 ? 5    XYS D O2  1 
HETATM 4514 O O3  . XYS D 3 .   ? 41.755 45.497 19.591  1.00   49.54 ? 5    XYS D O3  1 
HETATM 4515 O O4  . XYS D 3 .   ? 41.152 46.279 16.905  1.00   48.25 ? 5    XYS D O4  1 
HETATM 4516 O O5  . XYS D 3 .   ? 44.746 46.856 17.083  1.00   44.03 ? 5    XYS D O5  1 
HETATM 4517 C C1  . GAL D 3 .   ? 45.433 44.865 20.898  1.00   54.36 ? 6    GAL D C1  1 
HETATM 4518 C C2  . GAL D 3 .   ? 45.283 43.886 22.069  1.00   55.46 ? 6    GAL D C2  1 
HETATM 4519 C C3  . GAL D 3 .   ? 46.440 43.955 23.071  1.00   55.84 ? 6    GAL D C3  1 
HETATM 4520 C C4  . GAL D 3 .   ? 47.810 44.050 22.391  1.00   56.07 ? 6    GAL D C4  1 
HETATM 4521 C C5  . GAL D 3 .   ? 47.747 45.126 21.317  1.00   55.81 ? 6    GAL D C5  1 
HETATM 4522 C C6  . GAL D 3 .   ? 49.061 45.337 20.567  1.00   55.97 ? 6    GAL D C6  1 
HETATM 4523 O O2  . GAL D 3 .   ? 44.096 44.192 22.760  1.00   56.82 ? 6    GAL D O2  1 
HETATM 4524 O O3  . GAL D 3 .   ? 46.390 42.815 23.899  1.00   55.68 ? 6    GAL D O3  1 
HETATM 4525 O O4  . GAL D 3 .   ? 48.189 42.825 21.805  1.00   55.99 ? 6    GAL D O4  1 
HETATM 4526 O O5  . GAL D 3 .   ? 46.748 44.769 20.390  1.00   54.59 ? 6    GAL D O5  1 
HETATM 4527 O O6  . GAL D 3 .   ? 48.883 46.500 19.787  1.00   54.60 ? 6    GAL D O6  1 
HETATM 4528 C C1  . NAG E 2 .   ? 11.921 54.034 -6.410  1.00   26.09 ? 1    NAG E C1  1 
HETATM 4529 C C2  . NAG E 2 .   ? 11.441 55.437 -6.000  1.00   26.38 ? 1    NAG E C2  1 
HETATM 4530 C C3  . NAG E 2 .   ? 10.437 55.334 -4.864  1.00   26.78 ? 1    NAG E C3  1 
HETATM 4531 C C4  . NAG E 2 .   ? 9.302  54.364 -5.223  1.00   28.79 ? 1    NAG E C4  1 
HETATM 4532 C C5  . NAG E 2 .   ? 9.845  53.066 -5.784  1.00   30.62 ? 1    NAG E C5  1 
HETATM 4533 C C6  . NAG E 2 .   ? 8.696  52.185 -6.315  1.00   31.61 ? 1    NAG E C6  1 
HETATM 4534 C C7  . NAG E 2 .   ? 13.434 56.172 -4.759  1.00   23.71 ? 1    NAG E C7  1 
HETATM 4535 C C8  . NAG E 2 .   ? 14.702 56.991 -4.774  1.00   22.56 ? 1    NAG E C8  1 
HETATM 4536 N N2  . NAG E 2 .   ? 12.516 56.402 -5.694  1.00   24.26 ? 1    NAG E N2  1 
HETATM 4537 O O3  . NAG E 2 .   ? 9.876  56.591 -4.552  1.00   25.25 ? 1    NAG E O3  1 
HETATM 4538 O O4  . NAG E 2 .   ? 8.615  54.048 -4.025  1.00   29.87 ? 1    NAG E O4  1 
HETATM 4539 O O5  . NAG E 2 .   ? 10.765 53.292 -6.845  1.00   28.41 ? 1    NAG E O5  1 
HETATM 4540 O O6  . NAG E 2 .   ? 9.280  50.919 -6.529  1.00   32.31 ? 1    NAG E O6  1 
HETATM 4541 O O7  . NAG E 2 .   ? 13.283 55.323 -3.898  1.00   23.80 ? 1    NAG E O7  1 
HETATM 4542 C C1  . NAG E 2 .   ? 7.251  54.507 -3.964  1.00   32.35 ? 2    NAG E C1  1 
HETATM 4543 C C2  . NAG E 2 .   ? 6.487  53.667 -2.933  1.00   34.27 ? 2    NAG E C2  1 
HETATM 4544 C C3  . NAG E 2 .   ? 5.035  54.125 -2.836  1.00   36.98 ? 2    NAG E C3  1 
HETATM 4545 C C4  . NAG E 2 .   ? 4.963  55.628 -2.589  1.00   36.11 ? 2    NAG E C4  1 
HETATM 4546 C C5  . NAG E 2 .   ? 5.857  56.375 -3.590  1.00   34.40 ? 2    NAG E C5  1 
HETATM 4547 C C6  . NAG E 2 .   ? 5.908  57.878 -3.341  1.00   32.40 ? 2    NAG E C6  1 
HETATM 4548 C C7  . NAG E 2 .   ? 7.350  51.408 -2.689  1.00   34.73 ? 2    NAG E C7  1 
HETATM 4549 C C8  . NAG E 2 .   ? 7.181  49.959 -3.046  1.00   37.01 ? 2    NAG E C8  1 
HETATM 4550 N N2  . NAG E 2 .   ? 6.550  52.263 -3.301  1.00   34.75 ? 2    NAG E N2  1 
HETATM 4551 O O3  . NAG E 2 .   ? 4.405  53.431 -1.777  1.00   38.85 ? 2    NAG E O3  1 
HETATM 4552 O O4  . NAG E 2 .   ? 3.632  55.999 -2.860  1.00   41.62 ? 2    NAG E O4  1 
HETATM 4553 O O5  . NAG E 2 .   ? 7.170  55.850 -3.568  1.00   30.78 ? 2    NAG E O5  1 
HETATM 4554 O O6  . NAG E 2 .   ? 6.598  58.112 -2.135  1.00   34.15 ? 2    NAG E O6  1 
HETATM 4555 O O7  . NAG E 2 .   ? 8.174  51.761 -1.854  1.00   35.90 ? 2    NAG E O7  1 
HETATM 4556 C C1  . BMA E 2 .   ? 3.019  56.814 -1.852  1.00   48.37 ? 3    BMA E C1  1 
HETATM 4557 C C2  . BMA E 2 .   ? 1.832  57.507 -2.519  1.00   49.90 ? 3    BMA E C2  1 
HETATM 4558 C C3  . BMA E 2 .   ? 1.088  58.434 -1.567  1.00   52.58 ? 3    BMA E C3  1 
HETATM 4559 C C4  . BMA E 2 .   ? 0.795  57.727 -0.248  1.00   53.49 ? 3    BMA E C4  1 
HETATM 4560 C C5  . BMA E 2 .   ? 1.987  56.891 0.249   1.00   53.94 ? 3    BMA E C5  1 
HETATM 4561 C C6  . BMA E 2 .   ? 1.577  56.011 1.427   1.00   54.53 ? 3    BMA E C6  1 
HETATM 4562 O O2  . BMA E 2 .   ? 0.954  56.521 -3.001  1.00   51.28 ? 3    BMA E O2  1 
HETATM 4563 O O3  . BMA E 2 .   ? -0.099 58.965 -2.167  1.00   52.93 ? 3    BMA E O3  1 
HETATM 4564 O O4  . BMA E 2 .   ? 0.499  58.723 0.710   1.00   54.61 ? 3    BMA E O4  1 
HETATM 4565 O O5  . BMA E 2 .   ? 2.553  56.060 -0.759  1.00   50.33 ? 3    BMA E O5  1 
HETATM 4566 O O6  . BMA E 2 .   ? 2.745  55.567 2.081   1.00   57.18 ? 3    BMA E O6  1 
HETATM 4567 C C2  . BGC F 3 .   ? 14.696 56.760 6.674   1.00   38.43 ? 1    BGC F C2  1 
HETATM 4568 C C3  . BGC F 3 .   ? 15.972 57.507 6.261   1.00   37.76 ? 1    BGC F C3  1 
HETATM 4569 C C4  . BGC F 3 .   ? 16.881 57.804 7.464   1.00   38.96 ? 1    BGC F C4  1 
HETATM 4570 C C5  . BGC F 3 .   ? 16.958 56.584 8.407   1.00   41.97 ? 1    BGC F C5  1 
HETATM 4571 C C6  . BGC F 3 .   ? 17.601 56.953 9.745   1.00   43.97 ? 1    BGC F C6  1 
HETATM 4572 C C1  . BGC F 3 .   ? 15.003 55.552 7.550   1.00   40.96 ? 1    BGC F C1  1 
HETATM 4573 O O2  . BGC F 3 .   ? 13.984 56.285 5.561   1.00   35.61 ? 1    BGC F O2  1 
HETATM 4574 O O3  . BGC F 3 .   ? 15.602 58.707 5.576   1.00   37.81 ? 1    BGC F O3  1 
HETATM 4575 O O4  . BGC F 3 .   ? 18.217 58.072 7.058   1.00   34.66 ? 1    BGC F O4  1 
HETATM 4576 O O5  . BGC F 3 .   ? 15.678 56.043 8.684   1.00   43.00 ? 1    BGC F O5  1 
HETATM 4577 O O6  . BGC F 3 .   ? 16.897 58.018 10.362  1.00   45.84 ? 1    BGC F O6  1 
HETATM 4578 C C2  . BGC F 3 .   ? 20.045 59.651 6.821   1.00   31.68 ? 2    BGC F C2  1 
HETATM 4579 C C3  . BGC F 3 .   ? 20.396 61.112 6.574   1.00   29.41 ? 2    BGC F C3  1 
HETATM 4580 C C4  . BGC F 3 .   ? 19.568 61.673 5.405   1.00   27.54 ? 2    BGC F C4  1 
HETATM 4581 C C5  . BGC F 3 .   ? 18.090 61.422 5.676   1.00   29.24 ? 2    BGC F C5  1 
HETATM 4582 C C6  . BGC F 3 .   ? 17.220 61.879 4.501   1.00   30.22 ? 2    BGC F C6  1 
HETATM 4583 C C1  . BGC F 3 .   ? 18.523 59.475 6.950   1.00   32.81 ? 2    BGC F C1  1 
HETATM 4584 O O2  . BGC F 3 .   ? 20.650 59.258 8.041   1.00   34.06 ? 2    BGC F O2  1 
HETATM 4585 O O3  . BGC F 3 .   ? 21.763 61.210 6.303   1.00   28.46 ? 2    BGC F O3  1 
HETATM 4586 O O4  . BGC F 3 .   ? 19.751 63.068 5.256   1.00   26.67 ? 2    BGC F O4  1 
HETATM 4587 O O5  . BGC F 3 .   ? 17.838 60.046 5.842   1.00   30.65 ? 2    BGC F O5  1 
HETATM 4588 O O6  . BGC F 3 .   ? 15.876 61.712 4.916   1.00   26.18 ? 2    BGC F O6  1 
HETATM 4589 C C2  . BGC F 3 .   ? 20.309 64.820 3.675   1.00   25.04 ? 3    BGC F C2  1 
HETATM 4590 C C3  . BGC F 3 .   ? 21.290 65.202 2.551   1.00   25.34 ? 3    BGC F C3  1 
HETATM 4591 C C4  . BGC F 3 .   ? 22.742 64.990 3.004   1.00   27.88 ? 3    BGC F C4  1 
HETATM 4592 C C5  . BGC F 3 .   ? 22.907 63.579 3.527   1.00   28.76 ? 3    BGC F C5  1 
HETATM 4593 C C6  . BGC F 3 .   ? 24.300 63.272 4.084   1.00   29.65 ? 3    BGC F C6  1 
HETATM 4594 C C1  . BGC F 3 .   ? 20.608 63.408 4.148   1.00   27.25 ? 3    BGC F C1  1 
HETATM 4595 O O2  . BGC F 3 .   ? 18.966 64.851 3.224   1.00   24.04 ? 3    BGC F O2  1 
HETATM 4596 O O3  . BGC F 3 .   ? 21.150 66.558 2.204   1.00   22.74 ? 3    BGC F O3  1 
HETATM 4597 O O4  . BGC F 3 .   ? 23.612 65.215 1.909   1.00   27.03 ? 3    BGC F O4  1 
HETATM 4598 O O5  . BGC F 3 .   ? 21.941 63.292 4.540   1.00   27.62 ? 3    BGC F O5  1 
HETATM 4599 O O6  . BGC F 3 .   ? 24.327 61.860 4.201   1.00   31.38 ? 3    BGC F O6  1 
HETATM 4600 C C1  . XYS F 3 .   ? 25.637 61.387 4.613   1.00   38.78 ? 4    XYS F C1  1 
HETATM 4601 C C2  . XYS F 3 .   ? 25.612 59.888 4.791   1.00   40.10 ? 4    XYS F C2  1 
HETATM 4602 C C3  . XYS F 3 .   ? 24.719 59.503 5.966   1.00   42.06 ? 4    XYS F C3  1 
HETATM 4603 C C4  . XYS F 3 .   ? 25.099 60.277 7.220   1.00   42.72 ? 4    XYS F C4  1 
HETATM 4604 C C5  . XYS F 3 .   ? 25.249 61.763 6.907   1.00   41.01 ? 4    XYS F C5  1 
HETATM 4605 O O2  . XYS F 3 .   ? 25.130 59.250 3.630   1.00   39.30 ? 4    XYS F O2  1 
HETATM 4606 O O3  . XYS F 3 .   ? 24.792 58.106 6.201   1.00   43.06 ? 4    XYS F O3  1 
HETATM 4607 O O4  . XYS F 3 .   ? 24.073 60.111 8.177   1.00   45.65 ? 4    XYS F O4  1 
HETATM 4608 O O5  . XYS F 3 .   ? 26.090 61.945 5.772   1.00   40.99 ? 4    XYS F O5  1 
HETATM 4609 C C1  . XYS F 3 .   ? 15.080 62.974 5.607   1.00   29.91 ? 5    XYS F C1  1 
HETATM 4610 C C2  . XYS F 3 .   ? 14.227 62.408 6.741   1.00   33.93 ? 5    XYS F C2  1 
HETATM 4611 C C3  . XYS F 3 .   ? 13.128 61.523 6.201   1.00   35.01 ? 5    XYS F C3  1 
HETATM 4612 C C4  . XYS F 3 .   ? 12.350 62.169 5.068   1.00   32.79 ? 5    XYS F C4  1 
HETATM 4613 C C5  . XYS F 3 .   ? 13.332 62.680 4.011   1.00   30.79 ? 5    XYS F C5  1 
HETATM 4614 O O2  . XYS F 3 .   ? 14.990 61.598 7.648   1.00   34.86 ? 5    XYS F O2  1 
HETATM 4615 O O3  . XYS F 3 .   ? 12.265 61.193 7.268   1.00   37.31 ? 5    XYS F O3  1 
HETATM 4616 O O4  . XYS F 3 .   ? 11.536 61.150 4.515   1.00   34.84 ? 5    XYS F O4  1 
HETATM 4617 O O5  . XYS F 3 .   ? 14.365 63.490 4.560   1.00   25.89 ? 5    XYS F O5  1 
HETATM 4618 C C1  . GAL F 3 .   ? 15.592 62.423 8.662   1.00   39.08 ? 6    GAL F C1  1 
HETATM 4619 C C2  . GAL F 3 .   ? 15.961 61.539 9.853   1.00   41.21 ? 6    GAL F C2  1 
HETATM 4620 C C3  . GAL F 3 .   ? 16.674 62.364 10.928  1.00   42.61 ? 6    GAL F C3  1 
HETATM 4621 C C4  . GAL F 3 .   ? 17.839 63.136 10.328  1.00   43.10 ? 6    GAL F C4  1 
HETATM 4622 C C5  . GAL F 3 .   ? 17.381 63.938 9.122   1.00   42.37 ? 6    GAL F C5  1 
HETATM 4623 C C6  . GAL F 3 .   ? 18.569 64.670 8.481   1.00   42.93 ? 6    GAL F C6  1 
HETATM 4624 O O2  . GAL F 3 .   ? 14.799 60.907 10.358  1.00   41.05 ? 6    GAL F O2  1 
HETATM 4625 O O3  . GAL F 3 .   ? 17.222 61.518 11.913  1.00   45.21 ? 6    GAL F O3  1 
HETATM 4626 O O4  . GAL F 3 .   ? 18.789 62.225 9.852   1.00   43.40 ? 6    GAL F O4  1 
HETATM 4627 O O5  . GAL F 3 .   ? 16.761 63.072 8.189   1.00   39.38 ? 6    GAL F O5  1 
HETATM 4628 O O6  . GAL F 3 .   ? 18.076 65.516 7.462   1.00   43.09 ? 6    GAL F O6  1 
HETATM 4629 O O   . HOH G 4 .   ? 68.784 48.608 -10.966 1.00   53.15 ? 2001 HOH A O   1 
HETATM 4630 O O   . HOH G 4 .   ? 67.863 42.140 -8.783  1.00   33.01 ? 2002 HOH A O   1 
HETATM 4631 O O   . HOH G 4 .   ? 72.542 42.078 -4.533  1.00   50.82 ? 2003 HOH A O   1 
HETATM 4632 O O   . HOH G 4 .   ? 65.127 28.159 3.365   1.00   50.98 ? 2004 HOH A O   1 
HETATM 4633 O O   . HOH G 4 .   ? 70.465 41.173 -3.392  1.00   33.02 ? 2005 HOH A O   1 
HETATM 4634 O O   . HOH G 4 .   ? 61.790 50.460 -1.354  1.00   26.17 ? 2006 HOH A O   1 
HETATM 4635 O O   . HOH G 4 .   ? 64.400 40.268 7.101   1.00   46.20 ? 2007 HOH A O   1 
HETATM 4636 O O   . HOH G 4 .   ? 65.405 29.720 5.391   1.00   35.16 ? 2008 HOH A O   1 
HETATM 4637 O O   . HOH G 4 .   ? 54.659 23.305 9.610   1.00   39.60 ? 2009 HOH A O   1 
HETATM 4638 O O   . HOH G 4 .   ? 55.751 25.345 10.194  1.00   45.71 ? 2010 HOH A O   1 
HETATM 4639 O O   . HOH G 4 .   ? 65.047 32.663 -5.219  1.00   34.87 ? 2011 HOH A O   1 
HETATM 4640 O O   . HOH G 4 .   ? 62.859 27.525 2.122   1.00   40.43 ? 2012 HOH A O   1 
HETATM 4641 O O   . HOH G 4 .   ? 66.125 34.786 -2.813  1.00   34.83 ? 2013 HOH A O   1 
HETATM 4642 O O   . HOH G 4 .   ? 58.818 37.867 -16.898 1.00   53.00 ? 2014 HOH A O   1 
HETATM 4643 O O   . HOH G 4 .   ? 57.449 41.652 -14.472 1.00   49.64 ? 2015 HOH A O   1 
HETATM 4644 O O   . HOH G 4 .   ? 44.391 33.167 -6.505  1.00   45.95 ? 2016 HOH A O   1 
HETATM 4645 O O   . HOH G 4 .   ? 61.296 47.691 -10.321 1.00   26.04 ? 2017 HOH A O   1 
HETATM 4646 O O   . HOH G 4 .   ? 52.922 40.869 -12.193 1.00   49.89 ? 2018 HOH A O   1 
HETATM 4647 O O   . HOH G 4 .   ? 53.565 39.143 -9.970  1.00   40.99 ? 2019 HOH A O   1 
HETATM 4648 O O   . HOH G 4 .   ? 53.812 29.054 7.121   1.00   36.43 ? 2020 HOH A O   1 
HETATM 4649 O O   . HOH G 4 .   ? 53.507 28.219 9.579   1.00   49.45 ? 2021 HOH A O   1 
HETATM 4650 O O   . HOH G 4 .   ? 53.136 25.414 9.479   1.00   28.42 ? 2022 HOH A O   1 
HETATM 4651 O O   . HOH G 4 .   ? 50.967 26.868 9.382   1.00   52.96 ? 2023 HOH A O   1 
HETATM 4652 O O   . HOH G 4 .   ? 50.422 25.176 2.000   1.00   32.41 ? 2024 HOH A O   1 
HETATM 4653 O O   . HOH G 4 .   ? 50.072 56.422 22.386  1.00   44.99 ? 2025 HOH A O   1 
HETATM 4654 O O   . HOH G 4 .   ? 61.999 40.728 6.502   1.00   25.39 ? 2026 HOH A O   1 
HETATM 4655 O O   . HOH G 4 .   ? 70.802 44.130 5.550   1.00   32.11 ? 2027 HOH A O   1 
HETATM 4656 O O   . HOH G 4 .   ? 38.407 46.566 -9.478  1.00   46.34 ? 2028 HOH A O   1 
HETATM 4657 O O   . HOH G 4 .   ? 70.931 53.977 -0.452  1.00   40.60 ? 2029 HOH A O   1 
HETATM 4658 O O   . HOH G 4 .   ? 69.856 49.574 1.003   1.00   24.81 ? 2030 HOH A O   1 
HETATM 4659 O O   . HOH G 4 .   ? 55.991 59.002 -2.434  1.00   45.24 ? 2031 HOH A O   1 
HETATM 4660 O O   . HOH G 4 .   ? 62.829 60.086 -3.790  1.00   34.92 ? 2032 HOH A O   1 
HETATM 4661 O O   . HOH G 4 .   ? 43.760 54.455 -7.576  1.00   50.09 ? 2033 HOH A O   1 
HETATM 4662 O O   . HOH G 4 .   ? 53.891 49.200 -12.415 1.00   54.13 ? 2034 HOH A O   1 
HETATM 4663 O O   . HOH G 4 .   ? 48.245 47.254 -4.344  1.00   17.95 ? 2035 HOH A O   1 
HETATM 4664 O O   . HOH G 4 .   ? 49.569 43.973 -12.827 1.00   45.50 ? 2036 HOH A O   1 
HETATM 4665 O O   . HOH G 4 .   ? 47.423 39.832 -7.160  1.00   29.36 ? 2037 HOH A O   1 
HETATM 4666 O O   . HOH G 4 .   ? 42.736 38.507 -1.585  1.00   22.60 ? 2038 HOH A O   1 
HETATM 4667 O O   . HOH G 4 .   ? 45.745 33.589 -4.188  1.00   32.00 ? 2039 HOH A O   1 
HETATM 4668 O O   . HOH G 4 .   ? 37.734 32.323 0.750   1.00   49.33 ? 2040 HOH A O   1 
HETATM 4669 O O   . HOH G 4 .   ? 42.254 31.596 -3.641  1.00   31.42 ? 2041 HOH A O   1 
HETATM 4670 O O   . HOH G 4 .   ? 44.805 31.908 -2.351  1.00   32.50 ? 2042 HOH A O   1 
HETATM 4671 O O   . HOH G 4 .   ? 43.293 31.731 3.514   1.00   27.37 ? 2043 HOH A O   1 
HETATM 4672 O O   . HOH G 4 .   ? 60.018 40.920 8.186   1.00   44.07 ? 2044 HOH A O   1 
HETATM 4673 O O   . HOH G 4 .   ? 48.490 33.854 -7.138  1.00   36.37 ? 2045 HOH A O   1 
HETATM 4674 O O   . HOH G 4 .   ? 66.372 50.246 18.245  1.00   46.23 ? 2046 HOH A O   1 
HETATM 4675 O O   . HOH G 4 .   ? 49.779 36.984 -8.125  1.00   49.46 ? 2047 HOH A O   1 
HETATM 4676 O O   . HOH G 4 .   ? 61.655 56.976 19.591  1.00   33.77 ? 2048 HOH A O   1 
HETATM 4677 O O   . HOH G 4 .   ? 64.694 57.591 18.004  1.00   25.91 ? 2049 HOH A O   1 
HETATM 4678 O O   . HOH G 4 .   ? 50.594 48.084 10.976  1.00   27.35 ? 2050 HOH A O   1 
HETATM 4679 O O   . HOH G 4 .   ? 39.447 38.199 -3.353  1.00   39.91 ? 2051 HOH A O   1 
HETATM 4680 O O   . HOH G 4 .   ? 40.740 40.429 -1.639  1.00   35.85 ? 2052 HOH A O   1 
HETATM 4681 O O   . HOH G 4 .   ? 48.224 39.647 3.012   1.00   16.39 ? 2053 HOH A O   1 
HETATM 4682 O O   . HOH G 4 .   ? 40.048 44.885 -1.026  1.00   29.43 ? 2054 HOH A O   1 
HETATM 4683 O O   . HOH G 4 .   ? 40.333 47.481 0.928   1.00   31.09 ? 2055 HOH A O   1 
HETATM 4684 O O   . HOH G 4 .   ? 46.164 52.794 8.041   1.00   21.89 ? 2056 HOH A O   1 
HETATM 4685 O O   . HOH G 4 .   ? 51.165 47.638 18.380  1.00   33.70 ? 2057 HOH A O   1 
HETATM 4686 O O   . HOH G 4 .   ? 56.396 55.812 23.239  1.00   39.71 ? 2058 HOH A O   1 
HETATM 4687 O O   . HOH G 4 .   ? 51.707 54.362 22.191  1.00   54.17 ? 2059 HOH A O   1 
HETATM 4688 O O   . HOH G 4 .   ? 53.504 48.259 22.039  1.00   44.50 ? 2060 HOH A O   1 
HETATM 4689 O O   . HOH G 4 .   ? 45.432 55.457 8.274   1.00   25.43 ? 2061 HOH A O   1 
HETATM 4690 O O   . HOH G 4 .   ? 39.317 45.882 12.144  1.00   45.61 ? 2062 HOH A O   1 
HETATM 4691 O O   . HOH G 4 .   ? 38.520 44.001 -8.364  1.00   44.05 ? 2063 HOH A O   1 
HETATM 4692 O O   . HOH G 4 .   ? 44.138 48.127 -8.313  1.00   35.42 ? 2064 HOH A O   1 
HETATM 4693 O O   . HOH G 4 .   ? 39.979 48.316 -8.370  1.00   26.88 ? 2065 HOH A O   1 
HETATM 4694 O O   . HOH G 4 .   ? 41.198 42.911 -2.353  1.00   36.93 ? 2066 HOH A O   1 
HETATM 4695 O O   . HOH G 4 .   ? 41.630 39.143 -5.770  1.00   44.97 ? 2067 HOH A O   1 
HETATM 4696 O O   . HOH G 4 .   ? 49.583 47.157 -12.373 1.00   33.90 ? 2068 HOH A O   1 
HETATM 4697 O O   . HOH G 4 .   ? 52.797 56.127 -2.261  1.00   25.59 ? 2069 HOH A O   1 
HETATM 4698 O O   . HOH G 4 .   ? 45.141 55.866 -5.872  1.00   35.39 ? 2070 HOH A O   1 
HETATM 4699 O O   . HOH G 4 .   ? 49.379 59.119 13.195  1.00   37.53 ? 2071 HOH A O   1 
HETATM 4700 O O   . HOH G 4 .   ? 55.978 62.380 18.279  1.00   29.52 ? 2072 HOH A O   1 
HETATM 4701 O O   . HOH G 4 .   ? 56.040 58.307 23.684  1.00   39.97 ? 2073 HOH A O   1 
HETATM 4702 O O   . HOH G 4 .   ? 62.283 60.898 20.686  1.00   44.94 ? 2074 HOH A O   1 
HETATM 4703 O O   . HOH G 4 .   ? 69.038 63.151 14.685  1.00   55.17 ? 2075 HOH A O   1 
HETATM 4704 O O   . HOH G 4 .   ? 64.693 56.405 14.724  1.00   24.97 ? 2076 HOH A O   1 
HETATM 4705 O O   . HOH G 4 .   ? 69.140 51.048 14.655  1.00   35.39 ? 2077 HOH A O   1 
HETATM 4706 O O   . HOH G 4 .   ? 67.903 42.795 10.426  1.00   40.35 ? 2078 HOH A O   1 
HETATM 4707 O O   . HOH G 4 .   ? 66.999 47.085 11.800  1.00   33.52 ? 2079 HOH A O   1 
HETATM 4708 O O   . HOH G 4 .   ? 54.515 39.577 7.245   1.00   24.09 ? 2080 HOH A O   1 
HETATM 4709 O O   . HOH G 4 .   ? 53.572 31.550 8.031   1.00   37.10 ? 2081 HOH A O   1 
HETATM 4710 O O   . HOH G 4 .   ? 42.979 42.140 14.694  1.00   37.00 ? 2082 HOH A O   1 
HETATM 4711 O O   . HOH G 4 .   ? 41.308 41.779 11.398  1.00   36.20 ? 2083 HOH A O   1 
HETATM 4712 O O   . HOH G 4 .   ? 43.162 35.696 10.868  1.00   32.30 ? 2084 HOH A O   1 
HETATM 4713 O O   . HOH G 4 .   ? 38.240 29.982 9.605   1.00   46.38 ? 2085 HOH A O   1 
HETATM 4714 O O   . HOH G 4 .   ? 43.857 24.896 6.271   1.00   40.91 ? 2086 HOH A O   1 
HETATM 4715 O O   . HOH G 4 .   ? 48.428 33.564 -4.519  1.00   24.00 ? 2087 HOH A O   1 
HETATM 4716 O O   . HOH G 4 .   ? 50.557 39.197 -6.140  1.00   25.33 ? 2088 HOH A O   1 
HETATM 4717 O O   . HOH G 4 .   ? 66.731 53.613 -4.883  1.00   40.93 ? 2089 HOH A O   1 
HETATM 4718 O O   . HOH G 4 .   ? 68.650 62.559 -2.066  1.00   36.94 ? 2090 HOH A O   1 
HETATM 4719 O O   . HOH G 4 .   ? 69.780 56.176 -0.583  1.00   42.62 ? 2091 HOH A O   1 
HETATM 4720 O O   . HOH G 4 .   ? 74.042 51.864 5.825   1.00   41.70 ? 2092 HOH A O   1 
HETATM 4721 O O   . HOH G 4 .   ? 70.233 61.606 9.110   1.00   32.71 ? 2093 HOH A O   1 
HETATM 4722 O O   . HOH G 4 .   ? 68.140 64.182 6.545   1.00   43.78 ? 2094 HOH A O   1 
HETATM 4723 O O   . HOH G 4 .   ? 68.659 65.060 -0.807  1.00   45.47 ? 2095 HOH A O   1 
HETATM 4724 O O   . HOH G 4 .   ? 63.424 70.202 -1.146  1.00   46.65 ? 2096 HOH A O   1 
HETATM 4725 O O   . HOH G 4 .   ? 65.190 65.186 8.506   1.00   27.13 ? 2097 HOH A O   1 
HETATM 4726 O O   . HOH G 4 .   ? 42.342 61.372 -5.070  1.00   43.86 ? 2098 HOH A O   1 
HETATM 4727 O O   . HOH G 4 .   ? 39.446 58.159 10.994  1.00   41.50 ? 2099 HOH A O   1 
HETATM 4728 O O   . HOH G 4 .   ? 36.045 56.276 8.034   1.00   52.26 ? 2100 HOH A O   1 
HETATM 4729 O O   . HOH G 4 .   ? 38.573 53.592 16.218  1.00   38.21 ? 2101 HOH A O   1 
HETATM 4730 O O   . HOH G 4 .   ? 35.758 53.538 21.581  1.00   51.61 ? 2102 HOH A O   1 
HETATM 4731 O O   . HOH G 4 .   ? 39.169 60.072 26.574  1.00   40.18 ? 2103 HOH A O   1 
HETATM 4732 O O   . HOH G 4 .   ? 51.719 58.590 22.073  1.00   37.05 ? 2104 HOH A O   1 
HETATM 4733 O O   . HOH G 4 .   ? 42.023 64.555 8.958   1.00   44.13 ? 2105 HOH A O   1 
HETATM 4734 O O   . HOH G 4 .   ? 48.012 60.442 15.575  1.00   44.54 ? 2106 HOH A O   1 
HETATM 4735 O O   . HOH G 4 .   ? 47.071 61.298 10.252  1.00   32.54 ? 2107 HOH A O   1 
HETATM 4736 O O   . HOH G 4 .   ? 36.797 44.430 10.281  1.00   34.91 ? 2108 HOH A O   1 
HETATM 4737 O O   . HOH G 4 .   ? 35.431 37.700 5.545   1.00   32.62 ? 2109 HOH A O   1 
HETATM 4738 O O   . HOH G 4 .   ? 34.910 49.189 12.027  1.00   44.45 ? 2110 HOH A O   1 
HETATM 4739 O O   . HOH G 4 .   ? 55.702 44.984 14.504  1.00   60.40 ? 2111 HOH A O   1 
HETATM 4740 O O   . HOH H 4 .   ? 38.642 69.896 -19.383 1.00   53.43 ? 2001 HOH B O   1 
HETATM 4741 O O   . HOH H 4 .   ? 28.400 74.597 -13.093 1.00   30.40 ? 2002 HOH B O   1 
HETATM 4742 O O   . HOH H 4 .   ? 24.422 51.785 -19.566 1.00   54.36 ? 2003 HOH B O   1 
HETATM 4743 O O   . HOH H 4 .   ? 33.314 66.901 -4.936  1.00   34.90 ? 2004 HOH B O   1 
HETATM 4744 O O   . HOH H 4 .   ? 42.013 59.366 -4.637  1.00   37.08 ? 2005 HOH B O   1 
HETATM 4745 O O   . HOH H 4 .   ? 43.180 59.906 -7.936  1.00   41.13 ? 2006 HOH B O   1 
HETATM 4746 O O   . HOH H 4 .   ? 40.680 60.374 -15.677 1.00   35.17 ? 2007 HOH B O   1 
HETATM 4747 O O   . HOH H 4 .   ? 40.884 67.800 -14.920 1.00   49.31 ? 2008 HOH B O   1 
HETATM 4748 O O   . HOH H 4 .   ? 40.432 63.595 -13.296 1.00   39.46 ? 2009 HOH B O   1 
HETATM 4749 O O   . HOH H 4 .   ? 23.358 50.341 -17.468 1.00   45.92 ? 2010 HOH B O   1 
HETATM 4750 O O   . HOH H 4 .   ? 27.919 60.233 -21.155 1.00   47.26 ? 2011 HOH B O   1 
HETATM 4751 O O   . HOH H 4 .   ? 26.564 61.272 -23.452 1.00   47.17 ? 2012 HOH B O   1 
HETATM 4752 O O   . HOH H 4 .   ? 17.686 82.823 -14.830 1.00   46.07 ? 2013 HOH B O   1 
HETATM 4753 O O   . HOH H 4 .   ? 31.865 53.055 -3.045  1.00   37.51 ? 2014 HOH B O   1 
HETATM 4754 O O   . HOH H 4 .   ? 33.432 50.265 -0.262  1.00   35.01 ? 2015 HOH B O   1 
HETATM 4755 O O   . HOH H 4 .   ? 30.707 49.513 -0.561  1.00   47.62 ? 2016 HOH B O   1 
HETATM 4756 O O   . HOH H 4 .   ? 31.617 47.349 -7.652  1.00   40.48 ? 2017 HOH B O   1 
HETATM 4757 O O   . HOH H 4 .   ? 31.853 52.132 -0.272  1.00   47.15 ? 2018 HOH B O   1 
HETATM 4758 O O   . HOH H 4 .   ? 38.940 74.140 -5.466  1.00   34.87 ? 2019 HOH B O   1 
HETATM 4759 O O   . HOH H 4 .   ? 35.535 78.216 -10.385 1.00   28.03 ? 2020 HOH B O   1 
HETATM 4760 O O   . HOH H 4 .   ? 34.152 82.306 -12.105 1.00   36.53 ? 2021 HOH B O   1 
HETATM 4761 O O   . HOH H 4 .   ? 18.630 78.804 -14.824 1.00   39.88 ? 2022 HOH B O   1 
HETATM 4762 O O   . HOH H 4 .   ? 11.528 67.761 -20.553 1.00   43.82 ? 2023 HOH B O   1 
HETATM 4763 O O   . HOH H 4 .   ? 18.752 64.551 -16.404 1.00   18.33 ? 2024 HOH B O   1 
HETATM 4764 O O   . HOH H 4 .   ? 18.449 54.440 -12.966 1.00   25.70 ? 2025 HOH B O   1 
HETATM 4765 O O   . HOH H 4 .   ? 23.925 51.658 -15.077 1.00   36.28 ? 2026 HOH B O   1 
HETATM 4766 O O   . HOH H 4 .   ? 16.172 52.264 -14.796 1.00   41.13 ? 2027 HOH B O   1 
HETATM 4767 O O   . HOH H 4 .   ? 21.759 48.231 -14.482 1.00   33.42 ? 2028 HOH B O   1 
HETATM 4768 O O   . HOH H 4 .   ? 17.178 46.654 -10.470 1.00   43.96 ? 2029 HOH B O   1 
HETATM 4769 O O   . HOH H 4 .   ? 19.928 44.565 -9.528  1.00   45.91 ? 2030 HOH B O   1 
HETATM 4770 O O   . HOH H 4 .   ? 22.082 49.217 -7.309  1.00   29.79 ? 2031 HOH B O   1 
HETATM 4771 O O   . HOH H 4 .   ? 26.142 53.614 -18.145 1.00   44.97 ? 2032 HOH B O   1 
HETATM 4772 O O   . HOH H 4 .   ? 34.168 78.317 -0.237  1.00   44.34 ? 2033 HOH B O   1 
HETATM 4773 O O   . HOH H 4 .   ? 28.103 72.834 9.673   1.00   44.17 ? 2034 HOH B O   1 
HETATM 4774 O O   . HOH H 4 .   ? 25.362 83.209 5.384   1.00   27.31 ? 2035 HOH B O   1 
HETATM 4775 O O   . HOH H 4 .   ? 23.150 81.190 7.006   1.00   34.65 ? 2036 HOH B O   1 
HETATM 4776 O O   . HOH H 4 .   ? 26.530 82.082 2.399   1.00   25.02 ? 2037 HOH B O   1 
HETATM 4777 O O   . HOH H 4 .   ? 14.482 84.221 -15.126 1.00   40.96 ? 2038 HOH B O   1 
HETATM 4778 O O   . HOH H 4 .   ? 19.150 67.356 -1.200  1.00   25.12 ? 2039 HOH B O   1 
HETATM 4779 O O   . HOH H 4 .   ? 15.968 82.733 -12.930 1.00   40.09 ? 2040 HOH B O   1 
HETATM 4780 O O   . HOH H 4 .   ? 12.186 50.432 -6.134  1.00   31.75 ? 2041 HOH B O   1 
HETATM 4781 O O   . HOH H 4 .   ? 5.624  63.704 5.253   1.00   44.75 ? 2042 HOH B O   1 
HETATM 4782 O O   . HOH H 4 .   ? 15.780 55.051 -13.398 1.00   31.75 ? 2043 HOH B O   1 
HETATM 4783 O O   . HOH H 4 .   ? 22.163 58.509 -8.369  1.00   18.95 ? 2044 HOH B O   1 
HETATM 4784 O O   . HOH H 4 .   ? 12.893 58.411 -13.215 1.00   42.01 ? 2045 HOH B O   1 
HETATM 4785 O O   . HOH H 4 .   ? 11.495 60.796 -11.417 1.00   29.56 ? 2046 HOH B O   1 
HETATM 4786 O O   . HOH H 4 .   ? 13.100 68.826 -4.567  1.00   19.63 ? 2047 HOH B O   1 
HETATM 4787 O O   . HOH H 4 .   ? 20.753 69.570 9.801   1.00   36.55 ? 2048 HOH B O   1 
HETATM 4788 O O   . HOH H 4 .   ? 11.094 70.689 -4.609  1.00   19.38 ? 2049 HOH B O   1 
HETATM 4789 O O   . HOH H 4 .   ? 11.608 57.454 -0.860  1.00   43.07 ? 2050 HOH B O   1 
HETATM 4790 O O   . HOH H 4 .   ? 10.796 59.434 -0.265  1.00   40.38 ? 2051 HOH B O   1 
HETATM 4791 O O   . HOH H 4 .   ? 6.122  55.653 -7.341  1.00   40.84 ? 2052 HOH B O   1 
HETATM 4792 O O   . HOH H 4 .   ? 11.203 60.164 -14.077 1.00   34.53 ? 2053 HOH B O   1 
HETATM 4793 O O   . HOH H 4 .   ? 14.743 57.242 -14.172 1.00   38.25 ? 2054 HOH B O   1 
HETATM 4794 O O   . HOH H 4 .   ? 12.288 56.084 -20.290 1.00   43.16 ? 2055 HOH B O   1 
HETATM 4795 O O   . HOH H 4 .   ? 11.662 61.166 -20.846 1.00   30.06 ? 2056 HOH B O   1 
HETATM 4796 O O   . HOH H 4 .   ? 14.900 62.924 -20.623 1.00   35.92 ? 2057 HOH B O   1 
HETATM 4797 O O   . HOH H 4 .   ? 17.713 53.976 -17.690 1.00   39.43 ? 2058 HOH B O   1 
HETATM 4798 O O   . HOH H 4 .   ? 22.077 57.626 -18.497 1.00   44.85 ? 2059 HOH B O   1 
HETATM 4799 O O   . HOH H 4 .   ? 19.455 69.703 -21.882 1.00   50.35 ? 2060 HOH B O   1 
HETATM 4800 O O   . HOH H 4 .   ? 12.958 87.777 -0.419  1.00   46.95 ? 2061 HOH B O   1 
HETATM 4801 O O   . HOH H 4 .   ? 11.881 70.195 -18.687 1.00   32.29 ? 2062 HOH B O   1 
HETATM 4802 O O   . HOH H 4 .   ? 17.814 74.706 -14.890 1.00   20.83 ? 2063 HOH B O   1 
HETATM 4803 O O   . HOH H 4 .   ? 11.008 72.327 -19.521 1.00   43.29 ? 2064 HOH B O   1 
HETATM 4804 O O   . HOH H 4 .   ? 12.020 80.103 -15.321 1.00   38.38 ? 2065 HOH B O   1 
HETATM 4805 O O   . HOH H 4 .   ? 15.432 82.683 5.104   1.00   28.38 ? 2066 HOH B O   1 
HETATM 4806 O O   . HOH H 4 .   ? 11.384 87.236 1.909   1.00   43.47 ? 2067 HOH B O   1 
HETATM 4807 O O   . HOH H 4 .   ? 16.359 91.341 1.936   1.00   49.17 ? 2068 HOH B O   1 
HETATM 4808 O O   . HOH H 4 .   ? 17.982 85.875 6.973   1.00   39.23 ? 2069 HOH B O   1 
HETATM 4809 O O   . HOH H 4 .   ? 17.180 79.745 10.595  1.00   33.67 ? 2070 HOH B O   1 
HETATM 4810 O O   . HOH H 4 .   ? 21.704 84.394 7.951   1.00   45.19 ? 2071 HOH B O   1 
HETATM 4811 O O   . HOH H 4 .   ? 26.680 89.626 2.002   1.00   38.59 ? 2072 HOH B O   1 
HETATM 4812 O O   . HOH H 4 .   ? 28.269 89.453 7.591   1.00   50.61 ? 2073 HOH B O   1 
HETATM 4813 O O   . HOH H 4 .   ? 33.009 80.163 3.025   1.00   33.77 ? 2074 HOH B O   1 
HETATM 4814 O O   . HOH H 4 .   ? 36.661 72.009 -0.709  1.00   38.59 ? 2075 HOH B O   1 
HETATM 4815 O O   . HOH H 4 .   ? 30.406 55.351 -2.457  1.00   31.68 ? 2076 HOH B O   1 
HETATM 4816 O O   . HOH H 4 .   ? 25.081 47.362 -0.970  1.00   53.37 ? 2077 HOH B O   1 
HETATM 4817 O O   . HOH H 4 .   ? 15.438 58.568 2.816   1.00   26.41 ? 2078 HOH B O   1 
HETATM 4818 O O   . HOH H 4 .   ? 14.397 57.140 -0.559  1.00   31.21 ? 2079 HOH B O   1 
HETATM 4819 O O   . HOH H 4 .   ? 19.176 52.985 -0.468  1.00   31.35 ? 2080 HOH B O   1 
HETATM 4820 O O   . HOH H 4 .   ? 17.924 45.643 -0.934  1.00   45.15 ? 2081 HOH B O   1 
HETATM 4821 O O   . HOH H 4 .   ? 25.804 44.070 -3.758  1.00   46.51 ? 2082 HOH B O   1 
HETATM 4822 O O   . HOH H 4 .   ? 23.842 49.656 -13.031 1.00   37.90 ? 2083 HOH B O   1 
HETATM 4823 O O   . HOH H 4 .   ? 26.197 53.098 -15.295 1.00   27.94 ? 2084 HOH B O   1 
HETATM 4824 O O   . HOH H 4 .   ? 25.047 58.841 -17.386 1.00   30.18 ? 2085 HOH B O   1 
HETATM 4825 O O   . HOH H 4 .   ? 24.345 83.053 -16.522 1.00   31.44 ? 2086 HOH B O   1 
HETATM 4826 O O   . HOH H 4 .   ? 30.224 86.229 -13.515 1.00   44.22 ? 2087 HOH B O   1 
HETATM 4827 O O   . HOH H 4 .   ? 27.541 88.486 -14.278 1.00   33.05 ? 2088 HOH B O   1 
HETATM 4828 O O   . HOH H 4 .   ? 31.755 83.604 -12.727 1.00   31.34 ? 2089 HOH B O   1 
HETATM 4829 O O   . HOH H 4 .   ? 34.256 89.098 -7.845  1.00   46.18 ? 2090 HOH B O   1 
HETATM 4830 O O   . HOH H 4 .   ? 33.860 90.020 -4.081  1.00   40.79 ? 2091 HOH B O   1 
HETATM 4831 O O   . HOH H 4 .   ? 36.653 88.582 -1.834  1.00   37.35 ? 2092 HOH B O   1 
HETATM 4832 O O   . HOH H 4 .   ? 34.773 90.417 4.265   1.00   39.26 ? 2093 HOH B O   1 
HETATM 4833 O O   . HOH H 4 .   ? 27.118 91.193 -0.492  1.00   28.84 ? 2094 HOH B O   1 
HETATM 4834 O O   . HOH H 4 .   ? 18.676 91.715 -14.845 1.00   36.01 ? 2095 HOH B O   1 
HETATM 4835 O O   . HOH H 4 .   ? 26.115 90.623 -13.554 1.00   32.03 ? 2096 HOH B O   1 
HETATM 4836 O O   . HOH H 4 .   ? 19.829 90.875 -4.464  1.00   46.25 ? 2097 HOH B O   1 
HETATM 4837 O O   . HOH H 4 .   ? 25.224 89.986 -5.820  1.00   27.49 ? 2098 HOH B O   1 
HETATM 4838 O O   . HOH H 4 .   ? 22.729 89.410 -4.204  1.00   30.20 ? 2099 HOH B O   1 
HETATM 4839 O O   . HOH H 4 .   ? 16.526 96.782 -11.308 1.00   48.20 ? 2100 HOH B O   1 
HETATM 4840 O O   . HOH H 4 .   ? 10.833 90.667 -8.735  1.00   41.27 ? 2101 HOH B O   1 
HETATM 4841 O O   . HOH H 4 .   ? 12.639 86.428 -13.728 1.00   54.34 ? 2102 HOH B O   1 
HETATM 4842 O O   . HOH H 4 .   ? 10.344 89.105 -10.730 1.00   37.53 ? 2103 HOH B O   1 
HETATM 4843 O O   . HOH H 4 .   ? 4.286  88.698 -12.459 1.00   54.32 ? 2104 HOH B O   1 
HETATM 4844 O O   . HOH H 4 .   ? 13.601 84.589 -12.626 1.00   46.88 ? 2105 HOH B O   1 
HETATM 4845 O O   . HOH H 4 .   ? 3.532  78.667 -6.501  1.00   27.33 ? 2106 HOH B O   1 
HETATM 4846 O O   . HOH H 4 .   ? -1.209 85.057 -18.602 1.00   50.47 ? 2107 HOH B O   1 
HETATM 4847 O O   . HOH H 4 .   ? 7.505  72.762 -20.933 1.00   37.18 ? 2108 HOH B O   1 
HETATM 4848 O O   . HOH H 4 .   ? 4.358  70.013 -2.303  1.00   28.08 ? 2109 HOH B O   1 
HETATM 4849 O O   . HOH H 4 .   ? 0.919  63.624 -10.509 1.00   39.96 ? 2110 HOH B O   1 
HETATM 4850 O O   . HOH H 4 .   ? 2.682  66.597 -4.965  1.00   33.47 ? 2111 HOH B O   1 
HETATM 4851 O O   . HOH H 4 .   ? 4.749  60.259 -0.915  1.00   45.52 ? 2112 HOH B O   1 
HETATM 4852 O O   . HOH H 4 .   ? 3.650  68.851 -0.060  1.00   44.97 ? 2113 HOH B O   1 
HETATM 4853 O O   . HOH H 4 .   ? 5.731  65.891 3.345   1.00   31.59 ? 2114 HOH B O   1 
HETATM 4854 O O   . HOH H 4 .   ? 9.437  62.200 8.201   1.00   47.59 ? 2115 HOH B O   1 
HETATM 4855 O O   . HOH H 4 .   ? -0.174 72.239 7.489   1.00   29.51 ? 2116 HOH B O   1 
HETATM 4856 O O   . HOH H 4 .   ? 2.413  65.157 8.396   1.00   36.66 ? 2117 HOH B O   1 
HETATM 4857 O O   . HOH H 4 .   ? 14.991 65.793 11.456  1.00   45.11 ? 2118 HOH B O   1 
HETATM 4858 O O   . HOH H 4 .   ? 13.447 74.516 9.258   1.00   46.63 ? 2119 HOH B O   1 
HETATM 4859 O O   . HOH H 4 .   ? 6.437  82.228 5.418   1.00   42.71 ? 2120 HOH B O   1 
HETATM 4860 O O   . HOH H 4 .   ? 13.587 77.099 8.768   1.00   41.71 ? 2121 HOH B O   1 
HETATM 4861 O O   . HOH H 4 .   ? 10.154 76.611 2.275   1.00   34.45 ? 2122 HOH B O   1 
HETATM 4862 O O   . HOH H 4 .   ? 3.226  76.606 -5.016  1.00   32.76 ? 2123 HOH B O   1 
HETATM 4863 O O   . HOH H 4 .   ? 1.594  80.451 -6.096  1.00   39.95 ? 2124 HOH B O   1 
HETATM 4864 O O   . HOH H 4 .   ? 11.988 76.139 -0.115  1.00   32.14 ? 2125 HOH B O   1 
HETATM 4865 O O   . HOH H 4 .   ? 9.243  76.642 -2.991  1.00   23.44 ? 2126 HOH B O   1 
HETATM 4866 O O   . HOH H 4 .   ? 9.492  56.963 -2.049  1.00   34.62 ? 2127 HOH B O   1 
HETATM 4867 O O   . HOH H 4 .   ? 9.646  54.123 -1.212  1.00   35.95 ? 2128 HOH B O   1 
HETATM 4868 O O   . HOH H 4 .   ? 4.554  51.372 -5.314  1.00   48.01 ? 2129 HOH B O   1 
HETATM 4869 O O   . HOH H 4 .   ? 24.416 67.573 2.496   1.00   50.22 ? 2130 HOH B O   1 
HETATM 4870 O O   . HOH H 4 .   ? 26.006 56.923 3.321   1.00   45.85 ? 2131 HOH B O   1 
HETATM 4871 O O   . HOH H 4 .   ? 12.506 58.502 3.878   1.00   38.06 ? 2132 HOH B O   1 
HETATM 4872 O O   . HOH H 4 .   ? 10.490 60.580 1.981   1.00   44.79 ? 2133 HOH B O   1 
HETATM 4873 O O   . HOH H 4 .   ? 19.324 67.630 6.242   1.00   23.40 ? 2134 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   UNK 1   -6  ?   ?   ?   A . n 
A 1 2   GLU 2   -5  ?   ?   ?   A . n 
A 1 3   THR 3   -4  ?   ?   ?   A . n 
A 1 4   ALA 4   -3  ?   ?   ?   A . n 
A 1 5   ALA 5   -2  ?   ?   ?   A . n 
A 1 6   PHE 6   -1  ?   ?   ?   A . n 
A 1 7   ALA 7   1   ?   ?   ?   A . n 
A 1 8   ALA 8   2   ?   ?   ?   A . n 
A 1 9   LEU 9   3   ?   ?   ?   A . n 
A 1 10  ARG 10  4   ?   ?   ?   A . n 
A 1 11  LYS 11  5   ?   ?   ?   A . n 
A 1 12  PRO 12  6   6   PRO PRO A . n 
A 1 13  VAL 13  7   7   VAL VAL A . n 
A 1 14  ASP 14  8   8   ASP ASP A . n 
A 1 15  VAL 15  9   9   VAL VAL A . n 
A 1 16  ALA 16  10  10  ALA ALA A . n 
A 1 17  PHE 17  11  11  PHE PHE A . n 
A 1 18  GLY 18  12  12  GLY GLY A . n 
A 1 19  ARG 19  13  13  ARG ARG A . n 
A 1 20  ASN 20  14  14  ASN ASN A . n 
A 1 21  TYR 21  15  15  TYR TYR A . n 
A 1 22  VAL 22  16  16  VAL VAL A . n 
A 1 23  PRO 23  17  17  PRO PRO A . n 
A 1 24  THR 24  18  18  THR THR A . n 
A 1 25  TRP 25  19  19  TRP TRP A . n 
A 1 26  ALA 26  20  20  ALA ALA A . n 
A 1 27  PHE 27  21  21  PHE PHE A . n 
A 1 28  ASP 28  22  22  ASP ASP A . n 
A 1 29  HIS 29  23  23  HIS HIS A . n 
A 1 30  ILE 30  24  24  ILE ILE A . n 
A 1 31  LYS 31  25  25  LYS LYS A . n 
A 1 32  TYR 32  26  26  TYR TYR A . n 
A 1 33  PHE 33  27  27  PHE PHE A . n 
A 1 34  ASN 34  28  28  ASN ASN A . n 
A 1 35  GLY 35  29  29  GLY GLY A . n 
A 1 36  GLY 36  30  30  GLY GLY A . n 
A 1 37  ASN 37  31  31  ASN ASN A . n 
A 1 38  GLU 38  32  32  GLU GLU A . n 
A 1 39  ILE 39  33  33  ILE ILE A . n 
A 1 40  GLN 40  34  34  GLN GLN A . n 
A 1 41  LEU 41  35  35  LEU LEU A . n 
A 1 42  HIS 42  36  36  HIS HIS A . n 
A 1 43  LEU 43  37  37  LEU LEU A . n 
A 1 44  ASP 44  38  38  ASP ASP A . n 
A 1 45  LYS 45  39  39  LYS LYS A . n 
A 1 46  TYR 46  40  40  TYR TYR A . n 
A 1 47  THR 47  41  41  THR THR A . n 
A 1 48  GLY 48  42  42  GLY GLY A . n 
A 1 49  THR 49  43  43  THR THR A . n 
A 1 50  GLY 50  44  44  GLY GLY A . n 
A 1 51  PHE 51  45  45  PHE PHE A . n 
A 1 52  GLN 52  46  46  GLN GLN A . n 
A 1 53  SER 53  47  47  SER SER A . n 
A 1 54  LYS 54  48  48  LYS LYS A . n 
A 1 55  GLY 55  49  49  GLY GLY A . n 
A 1 56  SER 56  50  50  SER SER A . n 
A 1 57  TYR 57  51  51  TYR TYR A . n 
A 1 58  LEU 58  52  52  LEU LEU A . n 
A 1 59  PHE 59  53  53  PHE PHE A . n 
A 1 60  GLY 60  54  54  GLY GLY A . n 
A 1 61  HIS 61  55  55  HIS HIS A . n 
A 1 62  PHE 62  56  56  PHE PHE A . n 
A 1 63  SER 63  57  57  SER SER A . n 
A 1 64  MET 64  58  58  MET MET A . n 
A 1 65  GLN 65  59  59  GLN GLN A . n 
A 1 66  MET 66  60  60  MET MET A . n 
A 1 67  LYS 67  61  61  LYS LYS A . n 
A 1 68  LEU 68  62  62  LEU LEU A . n 
A 1 69  VAL 69  63  63  VAL VAL A . n 
A 1 70  PRO 70  64  64  PRO PRO A . n 
A 1 71  GLY 71  65  65  GLY GLY A . n 
A 1 72  ASP 72  66  66  ASP ASP A . n 
A 1 73  SER 73  67  67  SER SER A . n 
A 1 74  ALA 74  68  68  ALA ALA A . n 
A 1 75  GLY 75  69  69  GLY GLY A . n 
A 1 76  THR 76  70  70  THR THR A . n 
A 1 77  VAL 77  71  71  VAL VAL A . n 
A 1 78  THR 78  72  72  THR THR A . n 
A 1 79  ALA 79  73  73  ALA ALA A . n 
A 1 80  PHE 80  74  74  PHE PHE A . n 
A 1 81  TYR 81  75  75  TYR TYR A . n 
A 1 82  LEU 82  76  76  LEU LEU A . n 
A 1 83  SER 83  77  77  SER SER A . n 
A 1 84  SER 84  78  78  SER SER A . n 
A 1 85  GLN 85  79  79  GLN GLN A . n 
A 1 86  ASN 86  80  80  ASN ASN A . n 
A 1 87  SER 87  81  81  SER SER A . n 
A 1 88  GLU 88  82  82  GLU GLU A . n 
A 1 89  HIS 89  83  83  HIS HIS A . n 
A 1 90  ASP 90  84  84  ASP ASP A . n 
A 1 91  GLU 91  85  85  GLU GLU A . n 
A 1 92  ILE 92  86  86  ILE ILE A . n 
A 1 93  ASP 93  87  87  ASP ASP A . n 
A 1 94  PHE 94  88  88  PHE PHE A . n 
A 1 95  GLU 95  89  89  GLU GLU A . n 
A 1 96  PHE 96  90  90  PHE PHE A . n 
A 1 97  LEU 97  91  91  LEU LEU A . n 
A 1 98  GLY 98  92  92  GLY GLY A . n 
A 1 99  ASN 99  93  93  ASN ASN A . n 
A 1 100 ARG 100 94  94  ARG ARG A . n 
A 1 101 THR 101 95  95  THR THR A . n 
A 1 102 GLY 102 96  96  GLY GLY A . n 
A 1 103 GLN 103 97  97  GLN GLN A . n 
A 1 104 PRO 104 98  98  PRO PRO A . n 
A 1 105 TYR 105 99  99  TYR TYR A . n 
A 1 106 ILE 106 100 100 ILE ILE A . n 
A 1 107 LEU 107 101 101 LEU LEU A . n 
A 1 108 GLN 108 102 102 GLN GLN A . n 
A 1 109 THR 109 103 103 THR THR A . n 
A 1 110 ASN 110 104 104 ASN ASN A . n 
A 1 111 VAL 111 105 105 VAL VAL A . n 
A 1 112 PHE 112 106 106 PHE PHE A . n 
A 1 113 THR 113 107 107 THR THR A . n 
A 1 114 GLY 114 108 108 GLY GLY A . n 
A 1 115 GLY 115 109 109 GLY GLY A . n 
A 1 116 LYS 116 110 110 LYS LYS A . n 
A 1 117 GLY 117 111 111 GLY GLY A . n 
A 1 118 ASP 118 112 112 ASP ASP A . n 
A 1 119 ARG 119 113 113 ARG ARG A . n 
A 1 120 GLU 120 114 114 GLU GLU A . n 
A 1 121 GLN 121 115 115 GLN GLN A . n 
A 1 122 ARG 122 116 116 ARG ARG A . n 
A 1 123 ILE 123 117 117 ILE ILE A . n 
A 1 124 TYR 124 118 118 TYR TYR A . n 
A 1 125 LEU 125 119 119 LEU LEU A . n 
A 1 126 TRP 126 120 120 TRP TRP A . n 
A 1 127 PHE 127 121 121 PHE PHE A . n 
A 1 128 ASP 128 122 122 ASP ASP A . n 
A 1 129 PRO 129 123 123 PRO PRO A . n 
A 1 130 THR 130 124 124 THR THR A . n 
A 1 131 LYS 131 125 125 LYS LYS A . n 
A 1 132 GLU 132 126 126 GLU GLU A . n 
A 1 133 PHE 133 127 127 PHE PHE A . n 
A 1 134 HIS 134 128 128 HIS HIS A . n 
A 1 135 TYR 135 129 129 TYR TYR A . n 
A 1 136 TYR 136 130 130 TYR TYR A . n 
A 1 137 SER 137 131 131 SER SER A . n 
A 1 138 VAL 138 132 132 VAL VAL A . n 
A 1 139 LEU 139 133 133 LEU LEU A . n 
A 1 140 TRP 140 134 134 TRP TRP A . n 
A 1 141 ASN 141 135 135 ASN ASN A . n 
A 1 142 MET 142 136 136 MET MET A . n 
A 1 143 TYR 143 137 137 TYR TYR A . n 
A 1 144 MET 144 138 138 MET MET A . n 
A 1 145 ILE 145 139 139 ILE ILE A . n 
A 1 146 VAL 146 140 140 VAL VAL A . n 
A 1 147 PHE 147 141 141 PHE PHE A . n 
A 1 148 LEU 148 142 142 LEU LEU A . n 
A 1 149 VAL 149 143 143 VAL VAL A . n 
A 1 150 ASP 150 144 144 ASP ASP A . n 
A 1 151 ASP 151 145 145 ASP ASP A . n 
A 1 152 VAL 152 146 146 VAL VAL A . n 
A 1 153 PRO 153 147 147 PRO PRO A . n 
A 1 154 ILE 154 148 148 ILE ILE A . n 
A 1 155 ARG 155 149 149 ARG ARG A . n 
A 1 156 VAL 156 150 150 VAL VAL A . n 
A 1 157 PHE 157 151 151 PHE PHE A . n 
A 1 158 LYS 158 152 152 LYS LYS A . n 
A 1 159 ASN 159 153 153 ASN ASN A . n 
A 1 160 CYS 160 154 154 CYS CYS A . n 
A 1 161 LYS 161 155 155 LYS LYS A . n 
A 1 162 ASP 162 156 156 ASP ASP A . n 
A 1 163 LEU 163 157 157 LEU LEU A . n 
A 1 164 GLY 164 158 158 GLY GLY A . n 
A 1 165 VAL 165 159 159 VAL VAL A . n 
A 1 166 LYS 166 160 160 LYS LYS A . n 
A 1 167 PHE 167 161 161 PHE PHE A . n 
A 1 168 PRO 168 162 162 PRO PRO A . n 
A 1 169 PHE 169 163 163 PHE PHE A . n 
A 1 170 ASN 170 164 164 ASN ASN A . n 
A 1 171 GLN 171 165 165 GLN GLN A . n 
A 1 172 PRO 172 166 166 PRO PRO A . n 
A 1 173 MET 173 167 167 MET MET A . n 
A 1 174 LYS 174 168 168 LYS LYS A . n 
A 1 175 ILE 175 169 169 ILE ILE A . n 
A 1 176 TYR 176 170 170 TYR TYR A . n 
A 1 177 SER 177 171 171 SER SER A . n 
A 1 178 SER 178 172 172 SER SER A . n 
A 1 179 LEU 179 173 173 LEU LEU A . n 
A 1 180 TRP 180 174 174 TRP TRP A . n 
A 1 181 ASN 181 175 175 ASN ASN A . n 
A 1 182 ALA 182 176 176 ALA ALA A . n 
A 1 183 ASP 183 177 177 ASP ASP A . n 
A 1 184 ASP 184 178 178 ASP ASP A . n 
A 1 185 TRP 185 179 179 TRP TRP A . n 
A 1 186 ALA 186 180 180 ALA ALA A . n 
A 1 187 THR 187 181 181 THR THR A . n 
A 1 188 ARG 188 182 182 ARG ARG A . n 
A 1 189 GLY 189 183 183 GLY GLY A . n 
A 1 190 GLY 190 184 184 GLY GLY A . n 
A 1 191 LEU 191 185 185 LEU LEU A . n 
A 1 192 GLU 192 186 186 GLU GLU A . n 
A 1 193 LYS 193 187 187 LYS LYS A . n 
A 1 194 THR 194 188 188 THR THR A . n 
A 1 195 ASP 195 189 189 ASP ASP A . n 
A 1 196 TRP 196 190 190 TRP TRP A . n 
A 1 197 SER 197 191 191 SER SER A . n 
A 1 198 LYS 198 192 192 LYS LYS A . n 
A 1 199 ALA 199 193 193 ALA ALA A . n 
A 1 200 PRO 200 194 194 PRO PRO A . n 
A 1 201 PHE 201 195 195 PHE PHE A . n 
A 1 202 ILE 202 196 196 ILE ILE A . n 
A 1 203 ALA 203 197 197 ALA ALA A . n 
A 1 204 SER 204 198 198 SER SER A . n 
A 1 205 TYR 205 199 199 TYR TYR A . n 
A 1 206 ARG 206 200 200 ARG ARG A . n 
A 1 207 SER 207 201 201 SER SER A . n 
A 1 208 PHE 208 202 202 PHE PHE A . n 
A 1 209 HIS 209 203 203 HIS HIS A . n 
A 1 210 ILE 210 204 204 ILE ILE A . n 
A 1 211 ASP 211 205 205 ASP ASP A . n 
A 1 212 GLY 212 206 206 GLY GLY A . n 
A 1 213 CYS 213 207 207 CYS CYS A . n 
A 1 214 GLU 214 208 208 GLU GLU A . n 
A 1 215 ALA 215 209 209 ALA ALA A . n 
A 1 216 SER 216 210 210 SER SER A . n 
A 1 217 VAL 217 211 211 VAL VAL A . n 
A 1 218 GLU 218 212 212 GLU GLU A . n 
A 1 219 ALA 219 213 213 ALA ALA A . n 
A 1 220 LYS 220 214 214 LYS LYS A . n 
A 1 221 PHE 221 215 215 PHE PHE A . n 
A 1 222 CYS 222 216 216 CYS CYS A . n 
A 1 223 ALA 223 217 217 ALA ALA A . n 
A 1 224 THR 224 218 218 THR THR A . n 
A 1 225 GLN 225 219 219 GLN GLN A . n 
A 1 226 GLY 226 220 220 GLY GLY A . n 
A 1 227 ALA 227 221 221 ALA ALA A . n 
A 1 228 ARG 228 222 222 ARG ARG A . n 
A 1 229 TRP 229 223 223 TRP TRP A . n 
A 1 230 TRP 230 224 224 TRP TRP A . n 
A 1 231 ASP 231 225 225 ASP ASP A . n 
A 1 232 GLN 232 226 226 GLN GLN A . n 
A 1 233 LYS 233 227 227 LYS LYS A . n 
A 1 234 GLU 234 228 228 GLU GLU A . n 
A 1 235 PHE 235 229 229 PHE PHE A . n 
A 1 236 GLN 236 230 230 GLN GLN A . n 
A 1 237 ASP 237 231 231 ASP ASP A . n 
A 1 238 LEU 238 232 232 LEU LEU A . n 
A 1 239 ASP 239 233 233 ASP ASP A . n 
A 1 240 ALA 240 234 234 ALA ALA A . n 
A 1 241 PHE 241 235 235 PHE PHE A . n 
A 1 242 GLN 242 236 236 GLN GLN A . n 
A 1 243 TYR 243 237 237 TYR TYR A . n 
A 1 244 ARG 244 238 238 ARG ARG A . n 
A 1 245 ARG 245 239 239 ARG ARG A . n 
A 1 246 LEU 246 240 240 LEU LEU A . n 
A 1 247 SER 247 241 241 SER SER A . n 
A 1 248 TRP 248 242 242 TRP TRP A . n 
A 1 249 VAL 249 243 243 VAL VAL A . n 
A 1 250 ARG 250 244 244 ARG ARG A . n 
A 1 251 GLN 251 245 245 GLN GLN A . n 
A 1 252 LYS 252 246 246 LYS LYS A . n 
A 1 253 TYR 253 247 247 TYR TYR A . n 
A 1 254 THR 254 248 248 THR THR A . n 
A 1 255 ILE 255 249 249 ILE ILE A . n 
A 1 256 TYR 256 250 250 TYR TYR A . n 
A 1 257 ASN 257 251 251 ASN ASN A . n 
A 1 258 TYR 258 252 252 TYR TYR A . n 
A 1 259 CYS 259 253 253 CYS CYS A . n 
A 1 260 THR 260 254 254 THR THR A . n 
A 1 261 ASP 261 255 255 ASP ASP A . n 
A 1 262 ARG 262 256 256 ARG ARG A . n 
A 1 263 SER 263 257 257 SER SER A . n 
A 1 264 ARG 264 258 258 ARG ARG A . n 
A 1 265 TYR 265 259 259 TYR TYR A . n 
A 1 266 PRO 266 260 260 PRO PRO A . n 
A 1 267 SER 267 261 261 SER SER A . n 
A 1 268 MET 268 262 262 MET MET A . n 
A 1 269 PRO 269 263 263 PRO PRO A . n 
A 1 270 PRO 270 264 264 PRO PRO A . n 
A 1 271 GLU 271 265 265 GLU GLU A . n 
A 1 272 CYS 272 266 266 CYS CYS A . n 
A 1 273 LYS 273 267 267 LYS LYS A . n 
A 1 274 ARG 274 268 268 ARG ARG A . n 
A 1 275 ASP 275 269 269 ASP ASP A . n 
A 1 276 ARG 276 270 270 ARG ARG A . n 
A 1 277 ASP 277 271 271 ASP ASP A . n 
A 1 278 ILE 278 272 272 ILE ILE A . n 
B 1 1   UNK 1   -6  ?   ?   ?   B . n 
B 1 2   GLU 2   -5  ?   ?   ?   B . n 
B 1 3   THR 3   -4  ?   ?   ?   B . n 
B 1 4   ALA 4   -3  ?   ?   ?   B . n 
B 1 5   ALA 5   -2  ?   ?   ?   B . n 
B 1 6   PHE 6   -1  ?   ?   ?   B . n 
B 1 7   ALA 7   1   ?   ?   ?   B . n 
B 1 8   ALA 8   2   ?   ?   ?   B . n 
B 1 9   LEU 9   3   ?   ?   ?   B . n 
B 1 10  ARG 10  4   ?   ?   ?   B . n 
B 1 11  LYS 11  5   ?   ?   ?   B . n 
B 1 12  PRO 12  6   ?   ?   ?   B . n 
B 1 13  VAL 13  7   ?   ?   ?   B . n 
B 1 14  ASP 14  8   ?   ?   ?   B . n 
B 1 15  VAL 15  9   9   VAL VAL B . n 
B 1 16  ALA 16  10  10  ALA ALA B . n 
B 1 17  PHE 17  11  11  PHE PHE B . n 
B 1 18  GLY 18  12  12  GLY GLY B . n 
B 1 19  ARG 19  13  13  ARG ARG B . n 
B 1 20  ASN 20  14  14  ASN ASN B . n 
B 1 21  TYR 21  15  15  TYR TYR B . n 
B 1 22  VAL 22  16  16  VAL VAL B . n 
B 1 23  PRO 23  17  17  PRO PRO B . n 
B 1 24  THR 24  18  18  THR THR B . n 
B 1 25  TRP 25  19  19  TRP TRP B . n 
B 1 26  ALA 26  20  20  ALA ALA B . n 
B 1 27  PHE 27  21  21  PHE PHE B . n 
B 1 28  ASP 28  22  22  ASP ASP B . n 
B 1 29  HIS 29  23  23  HIS HIS B . n 
B 1 30  ILE 30  24  24  ILE ILE B . n 
B 1 31  LYS 31  25  25  LYS LYS B . n 
B 1 32  TYR 32  26  26  TYR TYR B . n 
B 1 33  PHE 33  27  27  PHE PHE B . n 
B 1 34  ASN 34  28  28  ASN ASN B . n 
B 1 35  GLY 35  29  29  GLY GLY B . n 
B 1 36  GLY 36  30  30  GLY GLY B . n 
B 1 37  ASN 37  31  31  ASN ASN B . n 
B 1 38  GLU 38  32  32  GLU GLU B . n 
B 1 39  ILE 39  33  33  ILE ILE B . n 
B 1 40  GLN 40  34  34  GLN GLN B . n 
B 1 41  LEU 41  35  35  LEU LEU B . n 
B 1 42  HIS 42  36  36  HIS HIS B . n 
B 1 43  LEU 43  37  37  LEU LEU B . n 
B 1 44  ASP 44  38  38  ASP ASP B . n 
B 1 45  LYS 45  39  39  LYS LYS B . n 
B 1 46  TYR 46  40  40  TYR TYR B . n 
B 1 47  THR 47  41  41  THR THR B . n 
B 1 48  GLY 48  42  42  GLY GLY B . n 
B 1 49  THR 49  43  43  THR THR B . n 
B 1 50  GLY 50  44  44  GLY GLY B . n 
B 1 51  PHE 51  45  45  PHE PHE B . n 
B 1 52  GLN 52  46  46  GLN GLN B . n 
B 1 53  SER 53  47  47  SER SER B . n 
B 1 54  LYS 54  48  48  LYS LYS B . n 
B 1 55  GLY 55  49  49  GLY GLY B . n 
B 1 56  SER 56  50  50  SER SER B . n 
B 1 57  TYR 57  51  51  TYR TYR B . n 
B 1 58  LEU 58  52  52  LEU LEU B . n 
B 1 59  PHE 59  53  53  PHE PHE B . n 
B 1 60  GLY 60  54  54  GLY GLY B . n 
B 1 61  HIS 61  55  55  HIS HIS B . n 
B 1 62  PHE 62  56  56  PHE PHE B . n 
B 1 63  SER 63  57  57  SER SER B . n 
B 1 64  MET 64  58  58  MET MET B . n 
B 1 65  GLN 65  59  59  GLN GLN B . n 
B 1 66  MET 66  60  60  MET MET B . n 
B 1 67  LYS 67  61  61  LYS LYS B . n 
B 1 68  LEU 68  62  62  LEU LEU B . n 
B 1 69  VAL 69  63  63  VAL VAL B . n 
B 1 70  PRO 70  64  64  PRO PRO B . n 
B 1 71  GLY 71  65  65  GLY GLY B . n 
B 1 72  ASP 72  66  66  ASP ASP B . n 
B 1 73  SER 73  67  67  SER SER B . n 
B 1 74  ALA 74  68  68  ALA ALA B . n 
B 1 75  GLY 75  69  69  GLY GLY B . n 
B 1 76  THR 76  70  70  THR THR B . n 
B 1 77  VAL 77  71  71  VAL VAL B . n 
B 1 78  THR 78  72  72  THR THR B . n 
B 1 79  ALA 79  73  73  ALA ALA B . n 
B 1 80  PHE 80  74  74  PHE PHE B . n 
B 1 81  TYR 81  75  75  TYR TYR B . n 
B 1 82  LEU 82  76  76  LEU LEU B . n 
B 1 83  SER 83  77  77  SER SER B . n 
B 1 84  SER 84  78  78  SER SER B . n 
B 1 85  GLN 85  79  79  GLN GLN B . n 
B 1 86  ASN 86  80  80  ASN ASN B . n 
B 1 87  SER 87  81  81  SER SER B . n 
B 1 88  GLU 88  82  82  GLU GLU B . n 
B 1 89  HIS 89  83  83  HIS HIS B . n 
B 1 90  ASP 90  84  84  ASP ASP B . n 
B 1 91  GLU 91  85  85  GLU GLU B . n 
B 1 92  ILE 92  86  86  ILE ILE B . n 
B 1 93  ASP 93  87  87  ASP ASP B . n 
B 1 94  PHE 94  88  88  PHE PHE B . n 
B 1 95  GLU 95  89  89  GLU GLU B . n 
B 1 96  PHE 96  90  90  PHE PHE B . n 
B 1 97  LEU 97  91  91  LEU LEU B . n 
B 1 98  GLY 98  92  92  GLY GLY B . n 
B 1 99  ASN 99  93  93  ASN ASN B . n 
B 1 100 ARG 100 94  94  ARG ARG B . n 
B 1 101 THR 101 95  95  THR THR B . n 
B 1 102 GLY 102 96  96  GLY GLY B . n 
B 1 103 GLN 103 97  97  GLN GLN B . n 
B 1 104 PRO 104 98  98  PRO PRO B . n 
B 1 105 TYR 105 99  99  TYR TYR B . n 
B 1 106 ILE 106 100 100 ILE ILE B . n 
B 1 107 LEU 107 101 101 LEU LEU B . n 
B 1 108 GLN 108 102 102 GLN GLN B . n 
B 1 109 THR 109 103 103 THR THR B . n 
B 1 110 ASN 110 104 104 ASN ASN B . n 
B 1 111 VAL 111 105 105 VAL VAL B . n 
B 1 112 PHE 112 106 106 PHE PHE B . n 
B 1 113 THR 113 107 107 THR THR B . n 
B 1 114 GLY 114 108 108 GLY GLY B . n 
B 1 115 GLY 115 109 109 GLY GLY B . n 
B 1 116 LYS 116 110 110 LYS LYS B . n 
B 1 117 GLY 117 111 111 GLY GLY B . n 
B 1 118 ASP 118 112 112 ASP ASP B . n 
B 1 119 ARG 119 113 113 ARG ARG B . n 
B 1 120 GLU 120 114 114 GLU GLU B . n 
B 1 121 GLN 121 115 115 GLN GLN B . n 
B 1 122 ARG 122 116 116 ARG ARG B . n 
B 1 123 ILE 123 117 117 ILE ILE B . n 
B 1 124 TYR 124 118 118 TYR TYR B . n 
B 1 125 LEU 125 119 119 LEU LEU B . n 
B 1 126 TRP 126 120 120 TRP TRP B . n 
B 1 127 PHE 127 121 121 PHE PHE B . n 
B 1 128 ASP 128 122 122 ASP ASP B . n 
B 1 129 PRO 129 123 123 PRO PRO B . n 
B 1 130 THR 130 124 124 THR THR B . n 
B 1 131 LYS 131 125 125 LYS LYS B . n 
B 1 132 GLU 132 126 126 GLU GLU B . n 
B 1 133 PHE 133 127 127 PHE PHE B . n 
B 1 134 HIS 134 128 128 HIS HIS B . n 
B 1 135 TYR 135 129 129 TYR TYR B . n 
B 1 136 TYR 136 130 130 TYR TYR B . n 
B 1 137 SER 137 131 131 SER SER B . n 
B 1 138 VAL 138 132 132 VAL VAL B . n 
B 1 139 LEU 139 133 133 LEU LEU B . n 
B 1 140 TRP 140 134 134 TRP TRP B . n 
B 1 141 ASN 141 135 135 ASN ASN B . n 
B 1 142 MET 142 136 136 MET MET B . n 
B 1 143 TYR 143 137 137 TYR TYR B . n 
B 1 144 MET 144 138 138 MET MET B . n 
B 1 145 ILE 145 139 139 ILE ILE B . n 
B 1 146 VAL 146 140 140 VAL VAL B . n 
B 1 147 PHE 147 141 141 PHE PHE B . n 
B 1 148 LEU 148 142 142 LEU LEU B . n 
B 1 149 VAL 149 143 143 VAL VAL B . n 
B 1 150 ASP 150 144 144 ASP ASP B . n 
B 1 151 ASP 151 145 145 ASP ASP B . n 
B 1 152 VAL 152 146 146 VAL VAL B . n 
B 1 153 PRO 153 147 147 PRO PRO B . n 
B 1 154 ILE 154 148 148 ILE ILE B . n 
B 1 155 ARG 155 149 149 ARG ARG B . n 
B 1 156 VAL 156 150 150 VAL VAL B . n 
B 1 157 PHE 157 151 151 PHE PHE B . n 
B 1 158 LYS 158 152 152 LYS LYS B . n 
B 1 159 ASN 159 153 153 ASN ASN B . n 
B 1 160 CYS 160 154 154 CYS CYS B . n 
B 1 161 LYS 161 155 155 LYS LYS B . n 
B 1 162 ASP 162 156 156 ASP ASP B . n 
B 1 163 LEU 163 157 157 LEU LEU B . n 
B 1 164 GLY 164 158 158 GLY GLY B . n 
B 1 165 VAL 165 159 159 VAL VAL B . n 
B 1 166 LYS 166 160 160 LYS LYS B . n 
B 1 167 PHE 167 161 161 PHE PHE B . n 
B 1 168 PRO 168 162 162 PRO PRO B . n 
B 1 169 PHE 169 163 163 PHE PHE B . n 
B 1 170 ASN 170 164 164 ASN ASN B . n 
B 1 171 GLN 171 165 165 GLN GLN B . n 
B 1 172 PRO 172 166 166 PRO PRO B . n 
B 1 173 MET 173 167 167 MET MET B . n 
B 1 174 LYS 174 168 168 LYS LYS B . n 
B 1 175 ILE 175 169 169 ILE ILE B . n 
B 1 176 TYR 176 170 170 TYR TYR B . n 
B 1 177 SER 177 171 171 SER SER B . n 
B 1 178 SER 178 172 172 SER SER B . n 
B 1 179 LEU 179 173 173 LEU LEU B . n 
B 1 180 TRP 180 174 174 TRP TRP B . n 
B 1 181 ASN 181 175 175 ASN ASN B . n 
B 1 182 ALA 182 176 176 ALA ALA B . n 
B 1 183 ASP 183 177 177 ASP ASP B . n 
B 1 184 ASP 184 178 178 ASP ASP B . n 
B 1 185 TRP 185 179 179 TRP TRP B . n 
B 1 186 ALA 186 180 180 ALA ALA B . n 
B 1 187 THR 187 181 181 THR THR B . n 
B 1 188 ARG 188 182 182 ARG ARG B . n 
B 1 189 GLY 189 183 183 GLY GLY B . n 
B 1 190 GLY 190 184 184 GLY GLY B . n 
B 1 191 LEU 191 185 185 LEU LEU B . n 
B 1 192 GLU 192 186 186 GLU GLU B . n 
B 1 193 LYS 193 187 187 LYS LYS B . n 
B 1 194 THR 194 188 188 THR THR B . n 
B 1 195 ASP 195 189 189 ASP ASP B . n 
B 1 196 TRP 196 190 190 TRP TRP B . n 
B 1 197 SER 197 191 191 SER SER B . n 
B 1 198 LYS 198 192 192 LYS LYS B . n 
B 1 199 ALA 199 193 193 ALA ALA B . n 
B 1 200 PRO 200 194 194 PRO PRO B . n 
B 1 201 PHE 201 195 195 PHE PHE B . n 
B 1 202 ILE 202 196 196 ILE ILE B . n 
B 1 203 ALA 203 197 197 ALA ALA B . n 
B 1 204 SER 204 198 198 SER SER B . n 
B 1 205 TYR 205 199 199 TYR TYR B . n 
B 1 206 ARG 206 200 200 ARG ARG B . n 
B 1 207 SER 207 201 201 SER SER B . n 
B 1 208 PHE 208 202 202 PHE PHE B . n 
B 1 209 HIS 209 203 203 HIS HIS B . n 
B 1 210 ILE 210 204 204 ILE ILE B . n 
B 1 211 ASP 211 205 205 ASP ASP B . n 
B 1 212 GLY 212 206 206 GLY GLY B . n 
B 1 213 CYS 213 207 207 CYS CYS B . n 
B 1 214 GLU 214 208 208 GLU GLU B . n 
B 1 215 ALA 215 209 209 ALA ALA B . n 
B 1 216 SER 216 210 210 SER SER B . n 
B 1 217 VAL 217 211 211 VAL VAL B . n 
B 1 218 GLU 218 212 212 GLU GLU B . n 
B 1 219 ALA 219 213 213 ALA ALA B . n 
B 1 220 LYS 220 214 214 LYS LYS B . n 
B 1 221 PHE 221 215 215 PHE PHE B . n 
B 1 222 CYS 222 216 216 CYS CYS B . n 
B 1 223 ALA 223 217 217 ALA ALA B . n 
B 1 224 THR 224 218 218 THR THR B . n 
B 1 225 GLN 225 219 219 GLN GLN B . n 
B 1 226 GLY 226 220 220 GLY GLY B . n 
B 1 227 ALA 227 221 221 ALA ALA B . n 
B 1 228 ARG 228 222 222 ARG ARG B . n 
B 1 229 TRP 229 223 223 TRP TRP B . n 
B 1 230 TRP 230 224 224 TRP TRP B . n 
B 1 231 ASP 231 225 225 ASP ASP B . n 
B 1 232 GLN 232 226 226 GLN GLN B . n 
B 1 233 LYS 233 227 227 LYS LYS B . n 
B 1 234 GLU 234 228 228 GLU GLU B . n 
B 1 235 PHE 235 229 229 PHE PHE B . n 
B 1 236 GLN 236 230 230 GLN GLN B . n 
B 1 237 ASP 237 231 231 ASP ASP B . n 
B 1 238 LEU 238 232 232 LEU LEU B . n 
B 1 239 ASP 239 233 233 ASP ASP B . n 
B 1 240 ALA 240 234 234 ALA ALA B . n 
B 1 241 PHE 241 235 235 PHE PHE B . n 
B 1 242 GLN 242 236 236 GLN GLN B . n 
B 1 243 TYR 243 237 237 TYR TYR B . n 
B 1 244 ARG 244 238 238 ARG ARG B . n 
B 1 245 ARG 245 239 239 ARG ARG B . n 
B 1 246 LEU 246 240 240 LEU LEU B . n 
B 1 247 SER 247 241 241 SER SER B . n 
B 1 248 TRP 248 242 242 TRP TRP B . n 
B 1 249 VAL 249 243 243 VAL VAL B . n 
B 1 250 ARG 250 244 244 ARG ARG B . n 
B 1 251 GLN 251 245 245 GLN GLN B . n 
B 1 252 LYS 252 246 246 LYS LYS B . n 
B 1 253 TYR 253 247 247 TYR TYR B . n 
B 1 254 THR 254 248 248 THR THR B . n 
B 1 255 ILE 255 249 249 ILE ILE B . n 
B 1 256 TYR 256 250 250 TYR TYR B . n 
B 1 257 ASN 257 251 251 ASN ASN B . n 
B 1 258 TYR 258 252 252 TYR TYR B . n 
B 1 259 CYS 259 253 253 CYS CYS B . n 
B 1 260 THR 260 254 254 THR THR B . n 
B 1 261 ASP 261 255 255 ASP ASP B . n 
B 1 262 ARG 262 256 256 ARG ARG B . n 
B 1 263 SER 263 257 257 SER SER B . n 
B 1 264 ARG 264 258 258 ARG ARG B . n 
B 1 265 TYR 265 259 259 TYR TYR B . n 
B 1 266 PRO 266 260 260 PRO PRO B . n 
B 1 267 SER 267 261 261 SER SER B . n 
B 1 268 MET 268 262 262 MET MET B . n 
B 1 269 PRO 269 263 263 PRO PRO B . n 
B 1 270 PRO 270 264 264 PRO PRO B . n 
B 1 271 GLU 271 265 265 GLU GLU B . n 
B 1 272 CYS 272 266 266 CYS CYS B . n 
B 1 273 LYS 273 267 267 LYS LYS B . n 
B 1 274 ARG 274 268 268 ARG ARG B . n 
B 1 275 ASP 275 269 269 ASP ASP B . n 
B 1 276 ARG 276 270 270 ARG ARG B . n 
B 1 277 ASP 277 271 271 ASP ASP B . n 
B 1 278 ILE 278 272 272 ILE ILE B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 HOH 1   2001 2001 HOH HOH A . 
G 4 HOH 2   2002 2002 HOH HOH A . 
G 4 HOH 3   2003 2003 HOH HOH A . 
G 4 HOH 4   2004 2004 HOH HOH A . 
G 4 HOH 5   2005 2005 HOH HOH A . 
G 4 HOH 6   2006 2006 HOH HOH A . 
G 4 HOH 7   2007 2007 HOH HOH A . 
G 4 HOH 8   2008 2008 HOH HOH A . 
G 4 HOH 9   2009 2009 HOH HOH A . 
G 4 HOH 10  2010 2010 HOH HOH A . 
G 4 HOH 11  2011 2011 HOH HOH A . 
G 4 HOH 12  2012 2012 HOH HOH A . 
G 4 HOH 13  2013 2013 HOH HOH A . 
G 4 HOH 14  2014 2014 HOH HOH A . 
G 4 HOH 15  2015 2015 HOH HOH A . 
G 4 HOH 16  2016 2016 HOH HOH A . 
G 4 HOH 17  2017 2017 HOH HOH A . 
G 4 HOH 18  2018 2018 HOH HOH A . 
G 4 HOH 19  2019 2019 HOH HOH A . 
G 4 HOH 20  2020 2020 HOH HOH A . 
G 4 HOH 21  2021 2021 HOH HOH A . 
G 4 HOH 22  2022 2022 HOH HOH A . 
G 4 HOH 23  2023 2023 HOH HOH A . 
G 4 HOH 24  2024 2024 HOH HOH A . 
G 4 HOH 25  2025 2025 HOH HOH A . 
G 4 HOH 26  2026 2026 HOH HOH A . 
G 4 HOH 27  2027 2027 HOH HOH A . 
G 4 HOH 28  2028 2028 HOH HOH A . 
G 4 HOH 29  2029 2029 HOH HOH A . 
G 4 HOH 30  2030 2030 HOH HOH A . 
G 4 HOH 31  2031 2031 HOH HOH A . 
G 4 HOH 32  2032 2032 HOH HOH A . 
G 4 HOH 33  2033 2033 HOH HOH A . 
G 4 HOH 34  2034 2034 HOH HOH A . 
G 4 HOH 35  2035 2035 HOH HOH A . 
G 4 HOH 36  2036 2036 HOH HOH A . 
G 4 HOH 37  2037 2037 HOH HOH A . 
G 4 HOH 38  2038 2038 HOH HOH A . 
G 4 HOH 39  2039 2039 HOH HOH A . 
G 4 HOH 40  2040 2040 HOH HOH A . 
G 4 HOH 41  2041 2041 HOH HOH A . 
G 4 HOH 42  2042 2042 HOH HOH A . 
G 4 HOH 43  2043 2043 HOH HOH A . 
G 4 HOH 44  2044 2044 HOH HOH A . 
G 4 HOH 45  2045 2045 HOH HOH A . 
G 4 HOH 46  2046 2046 HOH HOH A . 
G 4 HOH 47  2047 2047 HOH HOH A . 
G 4 HOH 48  2048 2048 HOH HOH A . 
G 4 HOH 49  2049 2049 HOH HOH A . 
G 4 HOH 50  2050 2050 HOH HOH A . 
G 4 HOH 51  2051 2051 HOH HOH A . 
G 4 HOH 52  2052 2052 HOH HOH A . 
G 4 HOH 53  2053 2053 HOH HOH A . 
G 4 HOH 54  2054 2054 HOH HOH A . 
G 4 HOH 55  2055 2055 HOH HOH A . 
G 4 HOH 56  2056 2056 HOH HOH A . 
G 4 HOH 57  2057 2057 HOH HOH A . 
G 4 HOH 58  2058 2058 HOH HOH A . 
G 4 HOH 59  2059 2059 HOH HOH A . 
G 4 HOH 60  2060 2060 HOH HOH A . 
G 4 HOH 61  2061 2061 HOH HOH A . 
G 4 HOH 62  2062 2062 HOH HOH A . 
G 4 HOH 63  2063 2063 HOH HOH A . 
G 4 HOH 64  2064 2064 HOH HOH A . 
G 4 HOH 65  2065 2065 HOH HOH A . 
G 4 HOH 66  2066 2066 HOH HOH A . 
G 4 HOH 67  2067 2067 HOH HOH A . 
G 4 HOH 68  2068 2068 HOH HOH A . 
G 4 HOH 69  2069 2069 HOH HOH A . 
G 4 HOH 70  2070 2070 HOH HOH A . 
G 4 HOH 71  2071 2071 HOH HOH A . 
G 4 HOH 72  2072 2072 HOH HOH A . 
G 4 HOH 73  2073 2073 HOH HOH A . 
G 4 HOH 74  2074 2074 HOH HOH A . 
G 4 HOH 75  2075 2075 HOH HOH A . 
G 4 HOH 76  2076 2076 HOH HOH A . 
G 4 HOH 77  2077 2077 HOH HOH A . 
G 4 HOH 78  2078 2078 HOH HOH A . 
G 4 HOH 79  2079 2079 HOH HOH A . 
G 4 HOH 80  2080 2080 HOH HOH A . 
G 4 HOH 81  2081 2081 HOH HOH A . 
G 4 HOH 82  2082 2082 HOH HOH A . 
G 4 HOH 83  2083 2083 HOH HOH A . 
G 4 HOH 84  2084 2084 HOH HOH A . 
G 4 HOH 85  2085 2085 HOH HOH A . 
G 4 HOH 86  2086 2086 HOH HOH A . 
G 4 HOH 87  2087 2087 HOH HOH A . 
G 4 HOH 88  2088 2088 HOH HOH A . 
G 4 HOH 89  2089 2089 HOH HOH A . 
G 4 HOH 90  2090 2090 HOH HOH A . 
G 4 HOH 91  2091 2091 HOH HOH A . 
G 4 HOH 92  2092 2092 HOH HOH A . 
G 4 HOH 93  2093 2093 HOH HOH A . 
G 4 HOH 94  2094 2094 HOH HOH A . 
G 4 HOH 95  2095 2095 HOH HOH A . 
G 4 HOH 96  2096 2096 HOH HOH A . 
G 4 HOH 97  2097 2097 HOH HOH A . 
G 4 HOH 98  2098 2098 HOH HOH A . 
G 4 HOH 99  2099 2099 HOH HOH A . 
G 4 HOH 100 2100 2100 HOH HOH A . 
G 4 HOH 101 2101 2101 HOH HOH A . 
G 4 HOH 102 2102 2102 HOH HOH A . 
G 4 HOH 103 2103 2103 HOH HOH A . 
G 4 HOH 104 2104 2104 HOH HOH A . 
G 4 HOH 105 2105 2105 HOH HOH A . 
G 4 HOH 106 2106 2106 HOH HOH A . 
G 4 HOH 107 2107 2107 HOH HOH A . 
G 4 HOH 108 2108 2108 HOH HOH A . 
G 4 HOH 109 2109 2109 HOH HOH A . 
G 4 HOH 110 2110 2110 HOH HOH A . 
G 4 HOH 111 2111 2111 HOH HOH A . 
H 4 HOH 1   2001 2001 HOH HOH B . 
H 4 HOH 2   2002 2002 HOH HOH B . 
H 4 HOH 3   2003 2003 HOH HOH B . 
H 4 HOH 4   2004 2004 HOH HOH B . 
H 4 HOH 5   2005 2005 HOH HOH B . 
H 4 HOH 6   2006 2006 HOH HOH B . 
H 4 HOH 7   2007 2007 HOH HOH B . 
H 4 HOH 8   2008 2008 HOH HOH B . 
H 4 HOH 9   2009 2009 HOH HOH B . 
H 4 HOH 10  2010 2010 HOH HOH B . 
H 4 HOH 11  2011 2011 HOH HOH B . 
H 4 HOH 12  2012 2012 HOH HOH B . 
H 4 HOH 13  2013 2013 HOH HOH B . 
H 4 HOH 14  2014 2014 HOH HOH B . 
H 4 HOH 15  2015 2015 HOH HOH B . 
H 4 HOH 16  2016 2016 HOH HOH B . 
H 4 HOH 17  2017 2017 HOH HOH B . 
H 4 HOH 18  2018 2018 HOH HOH B . 
H 4 HOH 19  2019 2019 HOH HOH B . 
H 4 HOH 20  2020 2020 HOH HOH B . 
H 4 HOH 21  2021 2021 HOH HOH B . 
H 4 HOH 22  2022 2022 HOH HOH B . 
H 4 HOH 23  2023 2023 HOH HOH B . 
H 4 HOH 24  2024 2024 HOH HOH B . 
H 4 HOH 25  2025 2025 HOH HOH B . 
H 4 HOH 26  2026 2026 HOH HOH B . 
H 4 HOH 27  2027 2027 HOH HOH B . 
H 4 HOH 28  2028 2028 HOH HOH B . 
H 4 HOH 29  2029 2029 HOH HOH B . 
H 4 HOH 30  2030 2030 HOH HOH B . 
H 4 HOH 31  2031 2031 HOH HOH B . 
H 4 HOH 32  2032 2032 HOH HOH B . 
H 4 HOH 33  2033 2033 HOH HOH B . 
H 4 HOH 34  2034 2034 HOH HOH B . 
H 4 HOH 35  2035 2035 HOH HOH B . 
H 4 HOH 36  2036 2036 HOH HOH B . 
H 4 HOH 37  2037 2037 HOH HOH B . 
H 4 HOH 38  2038 2038 HOH HOH B . 
H 4 HOH 39  2039 2039 HOH HOH B . 
H 4 HOH 40  2040 2040 HOH HOH B . 
H 4 HOH 41  2041 2041 HOH HOH B . 
H 4 HOH 42  2042 2042 HOH HOH B . 
H 4 HOH 43  2043 2043 HOH HOH B . 
H 4 HOH 44  2044 2044 HOH HOH B . 
H 4 HOH 45  2045 2045 HOH HOH B . 
H 4 HOH 46  2046 2046 HOH HOH B . 
H 4 HOH 47  2047 2047 HOH HOH B . 
H 4 HOH 48  2048 2048 HOH HOH B . 
H 4 HOH 49  2049 2049 HOH HOH B . 
H 4 HOH 50  2050 2050 HOH HOH B . 
H 4 HOH 51  2051 2051 HOH HOH B . 
H 4 HOH 52  2052 2052 HOH HOH B . 
H 4 HOH 53  2053 2053 HOH HOH B . 
H 4 HOH 54  2054 2054 HOH HOH B . 
H 4 HOH 55  2055 2055 HOH HOH B . 
H 4 HOH 56  2056 2056 HOH HOH B . 
H 4 HOH 57  2057 2057 HOH HOH B . 
H 4 HOH 58  2058 2058 HOH HOH B . 
H 4 HOH 59  2059 2059 HOH HOH B . 
H 4 HOH 60  2060 2060 HOH HOH B . 
H 4 HOH 61  2061 2061 HOH HOH B . 
H 4 HOH 62  2062 2062 HOH HOH B . 
H 4 HOH 63  2063 2063 HOH HOH B . 
H 4 HOH 64  2064 2064 HOH HOH B . 
H 4 HOH 65  2065 2065 HOH HOH B . 
H 4 HOH 66  2066 2066 HOH HOH B . 
H 4 HOH 67  2067 2067 HOH HOH B . 
H 4 HOH 68  2068 2068 HOH HOH B . 
H 4 HOH 69  2069 2069 HOH HOH B . 
H 4 HOH 70  2070 2070 HOH HOH B . 
H 4 HOH 71  2071 2071 HOH HOH B . 
H 4 HOH 72  2072 2072 HOH HOH B . 
H 4 HOH 73  2073 2073 HOH HOH B . 
H 4 HOH 74  2074 2074 HOH HOH B . 
H 4 HOH 75  2075 2075 HOH HOH B . 
H 4 HOH 76  2076 2076 HOH HOH B . 
H 4 HOH 77  2077 2077 HOH HOH B . 
H 4 HOH 78  2078 2078 HOH HOH B . 
H 4 HOH 79  2079 2079 HOH HOH B . 
H 4 HOH 80  2080 2080 HOH HOH B . 
H 4 HOH 81  2081 2081 HOH HOH B . 
H 4 HOH 82  2082 2082 HOH HOH B . 
H 4 HOH 83  2083 2083 HOH HOH B . 
H 4 HOH 84  2084 2084 HOH HOH B . 
H 4 HOH 85  2085 2085 HOH HOH B . 
H 4 HOH 86  2086 2086 HOH HOH B . 
H 4 HOH 87  2087 2087 HOH HOH B . 
H 4 HOH 88  2088 2088 HOH HOH B . 
H 4 HOH 89  2089 2089 HOH HOH B . 
H 4 HOH 90  2090 2090 HOH HOH B . 
H 4 HOH 91  2091 2091 HOH HOH B . 
H 4 HOH 92  2092 2092 HOH HOH B . 
H 4 HOH 93  2093 2093 HOH HOH B . 
H 4 HOH 94  2094 2094 HOH HOH B . 
H 4 HOH 95  2095 2095 HOH HOH B . 
H 4 HOH 96  2096 2096 HOH HOH B . 
H 4 HOH 97  2097 2097 HOH HOH B . 
H 4 HOH 98  2098 2098 HOH HOH B . 
H 4 HOH 99  2099 2099 HOH HOH B . 
H 4 HOH 100 2100 2100 HOH HOH B . 
H 4 HOH 101 2101 2101 HOH HOH B . 
H 4 HOH 102 2102 2102 HOH HOH B . 
H 4 HOH 103 2103 2103 HOH HOH B . 
H 4 HOH 104 2104 2104 HOH HOH B . 
H 4 HOH 105 2105 2105 HOH HOH B . 
H 4 HOH 106 2106 2106 HOH HOH B . 
H 4 HOH 107 2107 2107 HOH HOH B . 
H 4 HOH 108 2108 2108 HOH HOH B . 
H 4 HOH 109 2109 2109 HOH HOH B . 
H 4 HOH 110 2110 2110 HOH HOH B . 
H 4 HOH 111 2111 2111 HOH HOH B . 
H 4 HOH 112 2112 2112 HOH HOH B . 
H 4 HOH 113 2113 2113 HOH HOH B . 
H 4 HOH 114 2114 2114 HOH HOH B . 
H 4 HOH 115 2115 2115 HOH HOH B . 
H 4 HOH 116 2116 2116 HOH HOH B . 
H 4 HOH 117 2117 2117 HOH HOH B . 
H 4 HOH 118 2118 2118 HOH HOH B . 
H 4 HOH 119 2119 2119 HOH HOH B . 
H 4 HOH 120 2120 2120 HOH HOH B . 
H 4 HOH 121 2121 2121 HOH HOH B . 
H 4 HOH 122 2122 2122 HOH HOH B . 
H 4 HOH 123 2123 2123 HOH HOH B . 
H 4 HOH 124 2124 2124 HOH HOH B . 
H 4 HOH 125 2125 2125 HOH HOH B . 
H 4 HOH 126 2126 2126 HOH HOH B . 
H 4 HOH 127 2127 2127 HOH HOH B . 
H 4 HOH 128 2128 2128 HOH HOH B . 
H 4 HOH 129 2129 2129 HOH HOH B . 
H 4 HOH 130 2130 2130 HOH HOH B . 
H 4 HOH 131 2131 2131 HOH HOH B . 
H 4 HOH 132 2132 2132 HOH HOH B . 
H 4 HOH 133 2133 2133 HOH HOH B . 
H 4 HOH 134 2134 2134 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 99 A ASN 93 ? ASN 'GLYCOSYLATION SITE' 
2 B ASN 99 B ASN 93 ? ASN 'GLYCOSYLATION SITE' 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS monomeric 1 
2 author_and_software_defined_assembly PQS monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G 
2 1 B,E,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-03-18 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Atomic model'              
5 4 'Structure model' 'Data collection'           
6 4 'Structure model' 'Derived calculations'      
7 4 'Structure model' Other                       
8 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' entity                        
4  4 'Structure model' pdbx_branch_scheme            
5  4 'Structure model' pdbx_chem_comp_identifier     
6  4 'Structure model' pdbx_database_status          
7  4 'Structure model' pdbx_entity_branch            
8  4 'Structure model' pdbx_entity_branch_descriptor 
9  4 'Structure model' pdbx_entity_branch_link       
10 4 'Structure model' pdbx_entity_branch_list       
11 4 'Structure model' pdbx_entity_nonpoly           
12 4 'Structure model' pdbx_nonpoly_scheme           
13 4 'Structure model' pdbx_struct_assembly_gen      
14 4 'Structure model' pdbx_unobs_or_zero_occ_atoms  
15 4 'Structure model' struct_asym                   
16 4 'Structure model' struct_conn                   
17 4 'Structure model' struct_site                   
18 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'              
2  4 'Structure model' '_atom_site.Cartn_x'                     
3  4 'Structure model' '_atom_site.Cartn_y'                     
4  4 'Structure model' '_atom_site.Cartn_z'                     
5  4 'Structure model' '_atom_site.auth_asym_id'                
6  4 'Structure model' '_atom_site.auth_seq_id'                 
7  4 'Structure model' '_atom_site.label_asym_id'               
8  4 'Structure model' '_atom_site.label_entity_id'             
9  4 'Structure model' '_chem_comp.name'                        
10 4 'Structure model' '_chem_comp.type'                        
11 4 'Structure model' '_pdbx_database_status.status_code_sf'   
12 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
13 4 'Structure model' '_struct_conn.pdbx_dist_value'           
14 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'    
15 4 'Structure model' '_struct_conn.pdbx_role'                 
16 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'        
18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'       
20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'       
21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'       
22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'        
23 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
24 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'        
25 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
26 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
27 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'       
28 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.1.19 ? 1 
DENZO     'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
AMoRE     phasing          .      ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD1 B ASN 80   ? ? N B GLU 82   ? ? 1.88 
2 1 O   A PRO 260  ? ? O A HOH 2103 ? ? 1.98 
3 1 O   A HOH 2098 ? ? O B HOH 2005 ? ? 2.08 
4 1 NE2 B GLN 79   ? ? O B HOH 2033 ? ? 2.09 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 94  ? ? CZ A ARG 94  ? ? NH2 A ARG 94  ? ? 116.92 120.30 -3.38 0.50 N 
2 1 CB A ASP 156 ? ? CG A ASP 156 ? ? OD2 A ASP 156 ? ? 124.28 118.30 5.98  0.90 N 
3 1 CB A ASP 233 ? ? CG A ASP 233 ? ? OD2 A ASP 233 ? ? 123.86 118.30 5.56  0.90 N 
4 1 CB B ASP 271 ? ? CG B ASP 271 ? ? OD2 B ASP 271 ? ? 123.82 118.30 5.52  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 53  ? ? 75.97   152.37  
2 1 ASP A 144 ? ? 52.39   -120.31 
3 1 TRP A 179 ? ? -153.73 -14.36  
4 1 SER A 201 ? ? 84.78   -61.96  
5 1 PHE B 53  ? ? 77.81   152.00  
6 1 ASP B 144 ? ? 47.50   -120.69 
7 1 TRP B 179 ? ? -147.98 -17.14  
8 1 SER B 201 ? ? 80.02   -61.66  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 N 1 D BGC 1 ? O1 ? D BGC 1 O1 
2 1 N 1 F BGC 1 ? O1 ? F BGC 1 O1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A UNK -6 ? A UNK 1  
2  1 Y 1 A GLU -5 ? A GLU 2  
3  1 Y 1 A THR -4 ? A THR 3  
4  1 Y 1 A ALA -3 ? A ALA 4  
5  1 Y 1 A ALA -2 ? A ALA 5  
6  1 Y 1 A PHE -1 ? A PHE 6  
7  1 Y 1 A ALA 1  ? A ALA 7  
8  1 Y 1 A ALA 2  ? A ALA 8  
9  1 Y 1 A LEU 3  ? A LEU 9  
10 1 Y 1 A ARG 4  ? A ARG 10 
11 1 Y 1 A LYS 5  ? A LYS 11 
12 1 Y 1 B UNK -6 ? B UNK 1  
13 1 Y 1 B GLU -5 ? B GLU 2  
14 1 Y 1 B THR -4 ? B THR 3  
15 1 Y 1 B ALA -3 ? B ALA 4  
16 1 Y 1 B ALA -2 ? B ALA 5  
17 1 Y 1 B PHE -1 ? B PHE 6  
18 1 Y 1 B ALA 1  ? B ALA 7  
19 1 Y 1 B ALA 2  ? B ALA 8  
20 1 Y 1 B LEU 3  ? B LEU 9  
21 1 Y 1 B ARG 4  ? B ARG 10 
22 1 Y 1 B LYS 5  ? B LYS 11 
23 1 Y 1 B PRO 6  ? B PRO 12 
24 1 Y 1 B VAL 7  ? B VAL 13 
25 1 Y 1 B ASP 8  ? B ASP 14 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 A NAG 1273 n 
C 2 NAG 2 C NAG 2 A NAG 1274 n 
C 2 BMA 3 C BMA 3 A BMA 1275 n 
D 3 BGC 1 D BGC 1 A BGC 1278 n 
D 3 BGC 2 D BGC 2 A BGC 1277 n 
D 3 BGC 3 D BGC 3 A BGC 1276 n 
D 3 XYS 4 D XYS 4 A XYS 1279 n 
D 3 XYS 5 D XYS 5 A XYS 1280 n 
D 3 GAL 6 D GAL 6 A GAL 1281 n 
E 2 NAG 1 E NAG 1 B NAG 1273 n 
E 2 NAG 2 E NAG 2 B NAG 1274 n 
E 2 BMA 3 E BMA 3 B BMA 1275 n 
F 3 BGC 1 F BGC 1 B BGC 1278 n 
F 3 BGC 2 F BGC 2 B BGC 1277 n 
F 3 BGC 3 F BGC 3 B BGC 1276 n 
F 3 XYS 4 F XYS 4 B XYS 1279 n 
F 3 XYS 5 F XYS 5 B XYS 1280 n 
F 3 GAL 6 F GAL 6 B GAL 1281 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BGC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpb                         
BGC 'COMMON NAME'                         GMML     1.0 b-D-glucopyranose              
BGC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Glcp                       
BGC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Glc                            
BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpb                         
BMA 'COMMON NAME'                         GMML     1.0 b-D-mannopyranose              
BMA 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Manp                       
BMA 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
GAL 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGalpb                         
GAL 'COMMON NAME'                         GMML     1.0 b-D-galactopyranose            
GAL 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Galp                       
GAL 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Gal                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
XYS 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DXylpa                         
XYS 'COMMON NAME'                         GMML     1.0 a-D-xylopyranose               
XYS 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Xylp                       
XYS 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Xyl                            
# 
loop_
_pdbx_entity_branch.entity_id 
_pdbx_entity_branch.type 
2 oligosaccharide 
3 oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DManpb1-4DGlcpNAcb1-4DGlcpNAcb1-                                                                                      
'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5]/1-1-2/a4-b1_b4-c1'                                          WURCS 
PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{}}}}'                                                 LINUCS 
PDB-CARE   ?     
4 3 'DXylpa1-6DGlcpb1-4[DGalpb1-2DXylpa1-6]DGlcpb1-4DGlcpb1-ROH'                                                          
'Glycam Condensed Sequence' GMML       1.0   
5 3 'WURCS=2.0/3,6,5/[a2122h-1b_1-5][a212h-1a_1-5][a2112h-1b_1-5]/1-1-1-2-2-3/a4-b1_b4-c1_b6-e1_c6-d1_e2-f1'              WURCS 
PDB2Glycan 1.1.0 
6 3 '[][D-1-deoxy-Glcp]{[(4+1)][b-D-Glcp]{[(4+1)][b-D-Glcp]{[(6+1)][a-D-Xylp]{}}[(6+1)][a-D-Xylp]{[(2+1)][b-D-Galp]{}}}}' LINUCS 
PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 BMA C1 O1 2 NAG O4 HO4 sing ? 
3 3 2 BGC C1 O1 1 BGC O4 HO4 sing ? 
4 3 3 BGC C1 O1 2 BGC O4 HO4 sing ? 
5 3 4 XYS C1 O1 3 BGC O6 HO6 sing ? 
6 3 5 XYS C1 O1 2 BGC O6 HO6 sing ? 
7 3 6 GAL C1 O1 5 XYS O2 HO2 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 BMA 3 n 
3 BGC 1 n 
3 BGC 2 n 
3 BGC 3 n 
3 XYS 4 n 
3 XYS 5 n 
3 GAL 6 n 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#