data_1UN0
# 
_entry.id   1UN0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1UN0         
PDBE  EBI-13420    
WWPDB D_1290013420 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1BK5 unspecified 'KARYOPHERIN ALPHA FROM SACCHAROMYCES CEREVISIAE'                                               
PDB 1BK6 unspecified 'KARYOPHERIN ALPHA (YEAST) + SV40 T ANTIGEN NLS'                                                
PDB 1EE4 unspecified 'CRYSTAL STRUCTURE OF YEAST KARYOPHERIN (IMPORTIN) ALPHA IN A COMPLEX WITH A C-MYC NLS PEPTIDE' 
PDB 1EE5 unspecified 'YEAST KARYOPHERIN (IMPORTIN) ALPHA IN A COMPLEX WITH A NUCLEOPLASMIN NLS PEPTIDE'              
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1UN0 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2003-09-03 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Matsuura, Y.'   1 
'Lange, A.'      2 
'Harreman, M.T.' 3 
'Corbett, A.H.'  4 
'Stewart, M.'    5 
# 
_citation.id                        primary 
_citation.title                     
'Structural Basis for Nup2P Function in Cargo Release and Karyopherin Recycling in Nuclear Import' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            22 
_citation.page_first                5358 
_citation.page_last                 ? 
_citation.year                      2003 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14532109 
_citation.pdbx_database_id_DOI      10.1093/EMBOJ/CDG538 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Matsuura, Y.'   1 
primary 'Lange, A.'      2 
primary 'Harreman, M.T.' 3 
primary 'Corbett, A.H.'  4 
primary 'Stewart, M.'    5 
# 
_cell.entry_id           1UN0 
_cell.length_a           129.813 
_cell.length_b           140.076 
_cell.length_c           63.990 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1UN0 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'IMPORTIN ALPHA SUBUNIT' 48906.562 2   ? YES 'ARMADILLO REPEAT DOMAIN, RESIDUES 88-530' ? 
2 polymer man 'NUCLEOPORIN NUP2'       5813.649  2   ? ?   'N-TERMINAL FRAGMENT, RESIDUES 1-51'       ? 
3 water   nat water                    18.015    158 ? ?   ?                                          ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'KAP60P, KARYOPHERIN ALPHA SUBUNIT, SERINE-RICH RNA POLYMERASE I SUPPRESSOR PROTEIN' 
2 'NUP2P, NUCLEAR PORE PROTEIN NUP2, P95'                                              
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;ELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTK
VVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKK
PQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIV
TGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEDKTKKEACWAI
SNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIF
NCQQNENDKIYEKAYKIIETYFGEEEDAVDETMAPQNAGNTFG
;
;ELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTK
VVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKK
PQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIV
TGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEDKTKKEACWAI
SNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIF
NCQQNENDKIYEKAYKIIETYFGEEEDAVDETMAPQNAGNTFG
;
A,B ? 
2 'polypeptide(L)' no no MAKRVADAQIQRETYDSNESDDDVTPSTKVASSAVMNRRKIAMPKRRMAFK MAKRVADAQIQRETYDSNESDDDVTPSTKVASSAVMNRRKIAMPKRRMAFK 
C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   LEU n 
1 3   PRO n 
1 4   GLN n 
1 5   MET n 
1 6   THR n 
1 7   GLN n 
1 8   GLN n 
1 9   LEU n 
1 10  ASN n 
1 11  SER n 
1 12  ASP n 
1 13  ASP n 
1 14  MET n 
1 15  GLN n 
1 16  GLU n 
1 17  GLN n 
1 18  LEU n 
1 19  SER n 
1 20  ALA n 
1 21  THR n 
1 22  VAL n 
1 23  LYS n 
1 24  PHE n 
1 25  ARG n 
1 26  GLN n 
1 27  ILE n 
1 28  LEU n 
1 29  SER n 
1 30  ARG n 
1 31  GLU n 
1 32  HIS n 
1 33  ARG n 
1 34  PRO n 
1 35  PRO n 
1 36  ILE n 
1 37  ASP n 
1 38  VAL n 
1 39  VAL n 
1 40  ILE n 
1 41  GLN n 
1 42  ALA n 
1 43  GLY n 
1 44  VAL n 
1 45  VAL n 
1 46  PRO n 
1 47  ARG n 
1 48  LEU n 
1 49  VAL n 
1 50  GLU n 
1 51  PHE n 
1 52  MET n 
1 53  ARG n 
1 54  GLU n 
1 55  ASN n 
1 56  GLN n 
1 57  PRO n 
1 58  GLU n 
1 59  MET n 
1 60  LEU n 
1 61  GLN n 
1 62  LEU n 
1 63  GLU n 
1 64  ALA n 
1 65  ALA n 
1 66  TRP n 
1 67  ALA n 
1 68  LEU n 
1 69  THR n 
1 70  ASN n 
1 71  ILE n 
1 72  ALA n 
1 73  SER n 
1 74  GLY n 
1 75  THR n 
1 76  SER n 
1 77  ALA n 
1 78  GLN n 
1 79  THR n 
1 80  LYS n 
1 81  VAL n 
1 82  VAL n 
1 83  VAL n 
1 84  ASP n 
1 85  ALA n 
1 86  ASP n 
1 87  ALA n 
1 88  VAL n 
1 89  PRO n 
1 90  LEU n 
1 91  PHE n 
1 92  ILE n 
1 93  GLN n 
1 94  LEU n 
1 95  LEU n 
1 96  TYR n 
1 97  THR n 
1 98  GLY n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 LYS n 
1 104 GLU n 
1 105 GLN n 
1 106 ALA n 
1 107 ILE n 
1 108 TRP n 
1 109 ALA n 
1 110 LEU n 
1 111 GLY n 
1 112 ASN n 
1 113 VAL n 
1 114 ALA n 
1 115 GLY n 
1 116 ASP n 
1 117 SER n 
1 118 THR n 
1 119 ASP n 
1 120 TYR n 
1 121 ARG n 
1 122 ASP n 
1 123 TYR n 
1 124 VAL n 
1 125 LEU n 
1 126 GLN n 
1 127 CYS n 
1 128 ASN n 
1 129 ALA n 
1 130 MET n 
1 131 GLU n 
1 132 PRO n 
1 133 ILE n 
1 134 LEU n 
1 135 GLY n 
1 136 LEU n 
1 137 PHE n 
1 138 ASN n 
1 139 SER n 
1 140 ASN n 
1 141 LYS n 
1 142 PRO n 
1 143 SER n 
1 144 LEU n 
1 145 ILE n 
1 146 ARG n 
1 147 THR n 
1 148 ALA n 
1 149 THR n 
1 150 TRP n 
1 151 THR n 
1 152 LEU n 
1 153 SER n 
1 154 ASN n 
1 155 LEU n 
1 156 CYS n 
1 157 ARG n 
1 158 GLY n 
1 159 LYS n 
1 160 LYS n 
1 161 PRO n 
1 162 GLN n 
1 163 PRO n 
1 164 ASP n 
1 165 TRP n 
1 166 SER n 
1 167 VAL n 
1 168 VAL n 
1 169 SER n 
1 170 GLN n 
1 171 ALA n 
1 172 LEU n 
1 173 PRO n 
1 174 THR n 
1 175 LEU n 
1 176 ALA n 
1 177 LYS n 
1 178 LEU n 
1 179 ILE n 
1 180 TYR n 
1 181 SER n 
1 182 MET n 
1 183 ASP n 
1 184 THR n 
1 185 GLU n 
1 186 THR n 
1 187 LEU n 
1 188 VAL n 
1 189 ASP n 
1 190 ALA n 
1 191 CYS n 
1 192 TRP n 
1 193 ALA n 
1 194 ILE n 
1 195 SER n 
1 196 TYR n 
1 197 LEU n 
1 198 SER n 
1 199 ASP n 
1 200 GLY n 
1 201 PRO n 
1 202 GLN n 
1 203 GLU n 
1 204 ALA n 
1 205 ILE n 
1 206 GLN n 
1 207 ALA n 
1 208 VAL n 
1 209 ILE n 
1 210 ASP n 
1 211 VAL n 
1 212 ARG n 
1 213 ILE n 
1 214 PRO n 
1 215 LYS n 
1 216 ARG n 
1 217 LEU n 
1 218 VAL n 
1 219 GLU n 
1 220 LEU n 
1 221 LEU n 
1 222 SER n 
1 223 HIS n 
1 224 GLU n 
1 225 SER n 
1 226 THR n 
1 227 LEU n 
1 228 VAL n 
1 229 GLN n 
1 230 THR n 
1 231 PRO n 
1 232 ALA n 
1 233 LEU n 
1 234 ARG n 
1 235 ALA n 
1 236 VAL n 
1 237 GLY n 
1 238 ASN n 
1 239 ILE n 
1 240 VAL n 
1 241 THR n 
1 242 GLY n 
1 243 ASN n 
1 244 ASP n 
1 245 LEU n 
1 246 GLN n 
1 247 THR n 
1 248 GLN n 
1 249 VAL n 
1 250 VAL n 
1 251 ILE n 
1 252 ASN n 
1 253 ALA n 
1 254 GLY n 
1 255 VAL n 
1 256 LEU n 
1 257 PRO n 
1 258 ALA n 
1 259 LEU n 
1 260 ARG n 
1 261 LEU n 
1 262 LEU n 
1 263 LEU n 
1 264 SER n 
1 265 SER n 
1 266 PRO n 
1 267 LYS n 
1 268 GLU n 
1 269 ASN n 
1 270 ILE n 
1 271 LYS n 
1 272 LYS n 
1 273 GLU n 
1 274 ALA n 
1 275 CYS n 
1 276 TRP n 
1 277 THR n 
1 278 ILE n 
1 279 SER n 
1 280 ASN n 
1 281 ILE n 
1 282 THR n 
1 283 ALA n 
1 284 GLY n 
1 285 ASN n 
1 286 THR n 
1 287 GLU n 
1 288 GLN n 
1 289 ILE n 
1 290 GLN n 
1 291 ALA n 
1 292 VAL n 
1 293 ILE n 
1 294 ASP n 
1 295 ALA n 
1 296 ASN n 
1 297 LEU n 
1 298 ILE n 
1 299 PRO n 
1 300 PRO n 
1 301 LEU n 
1 302 VAL n 
1 303 LYS n 
1 304 LEU n 
1 305 LEU n 
1 306 GLU n 
1 307 VAL n 
1 308 ALA n 
1 309 GLU n 
1 310 ASP n 
1 311 LYS n 
1 312 THR n 
1 313 LYS n 
1 314 LYS n 
1 315 GLU n 
1 316 ALA n 
1 317 CYS n 
1 318 TRP n 
1 319 ALA n 
1 320 ILE n 
1 321 SER n 
1 322 ASN n 
1 323 ALA n 
1 324 SER n 
1 325 SER n 
1 326 GLY n 
1 327 GLY n 
1 328 LEU n 
1 329 GLN n 
1 330 ARG n 
1 331 PRO n 
1 332 ASP n 
1 333 ILE n 
1 334 ILE n 
1 335 ARG n 
1 336 TYR n 
1 337 LEU n 
1 338 VAL n 
1 339 SER n 
1 340 GLN n 
1 341 GLY n 
1 342 CYS n 
1 343 ILE n 
1 344 LYS n 
1 345 PRO n 
1 346 LEU n 
1 347 CYS n 
1 348 ASP n 
1 349 LEU n 
1 350 LEU n 
1 351 GLU n 
1 352 ILE n 
1 353 ALA n 
1 354 ASP n 
1 355 ASN n 
1 356 ARG n 
1 357 ILE n 
1 358 ILE n 
1 359 GLU n 
1 360 VAL n 
1 361 THR n 
1 362 LEU n 
1 363 ASP n 
1 364 ALA n 
1 365 LEU n 
1 366 GLU n 
1 367 ASN n 
1 368 ILE n 
1 369 LEU n 
1 370 LYS n 
1 371 MET n 
1 372 GLY n 
1 373 GLU n 
1 374 ALA n 
1 375 ASP n 
1 376 LYS n 
1 377 GLU n 
1 378 ALA n 
1 379 ARG n 
1 380 GLY n 
1 381 LEU n 
1 382 ASN n 
1 383 ILE n 
1 384 ASN n 
1 385 GLU n 
1 386 ASN n 
1 387 ALA n 
1 388 ASP n 
1 389 PHE n 
1 390 ILE n 
1 391 GLU n 
1 392 LYS n 
1 393 ALA n 
1 394 GLY n 
1 395 GLY n 
1 396 MET n 
1 397 GLU n 
1 398 LYS n 
1 399 ILE n 
1 400 PHE n 
1 401 ASN n 
1 402 CYS n 
1 403 GLN n 
1 404 GLN n 
1 405 ASN n 
1 406 GLU n 
1 407 ASN n 
1 408 ASP n 
1 409 LYS n 
1 410 ILE n 
1 411 TYR n 
1 412 GLU n 
1 413 LYS n 
1 414 ALA n 
1 415 TYR n 
1 416 LYS n 
1 417 ILE n 
1 418 ILE n 
1 419 GLU n 
1 420 THR n 
1 421 TYR n 
1 422 PHE n 
1 423 GLY n 
1 424 GLU n 
1 425 GLU n 
1 426 GLU n 
1 427 ASP n 
1 428 ALA n 
1 429 VAL n 
1 430 ASP n 
1 431 GLU n 
1 432 THR n 
1 433 MET n 
1 434 ALA n 
1 435 PRO n 
1 436 GLN n 
1 437 ASN n 
1 438 ALA n 
1 439 GLY n 
1 440 ASN n 
1 441 THR n 
1 442 PHE n 
1 443 GLY n 
2 1   MET n 
2 2   ALA n 
2 3   LYS n 
2 4   ARG n 
2 5   VAL n 
2 6   ALA n 
2 7   ASP n 
2 8   ALA n 
2 9   GLN n 
2 10  ILE n 
2 11  GLN n 
2 12  ARG n 
2 13  GLU n 
2 14  THR n 
2 15  TYR n 
2 16  ASP n 
2 17  SER n 
2 18  ASN n 
2 19  GLU n 
2 20  SER n 
2 21  ASP n 
2 22  ASP n 
2 23  ASP n 
2 24  VAL n 
2 25  THR n 
2 26  PRO n 
2 27  SER n 
2 28  THR n 
2 29  LYS n 
2 30  VAL n 
2 31  ALA n 
2 32  SER n 
2 33  SER n 
2 34  ALA n 
2 35  VAL n 
2 36  MET n 
2 37  ASN n 
2 38  ARG n 
2 39  ARG n 
2 40  LYS n 
2 41  ILE n 
2 42  ALA n 
2 43  MET n 
2 44  PRO n 
2 45  LYS n 
2 46  ARG n 
2 47  ARG n 
2 48  MET n 
2 49  ALA n 
2 50  PHE n 
2 51  LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 
;BAKER'S YEAST
;
? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? 
? ? ? PET30A ? ? 
2 1 sample ? ? ? 
;BAKER'S YEAST
;
? ? ? ? ? ? ? ? 'SACCHAROMYCES CEREVISIAE' 4932 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? 
? ? ? PET30A ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP IMA1_YEAST 1 ? ? Q02821 ? 
2 UNP NUP2_YEAST 2 ? ? P32499 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1UN0 A 1 ? 443 ? Q02821 88 ? 530 ? 88 530 
2 1 1UN0 B 1 ? 443 ? Q02821 88 ? 530 ? 88 530 
3 2 1UN0 C 1 ? 51  ? P32499 1  ? 51  ? 1  51  
4 2 1UN0 D 1 ? 51  ? P32499 1  ? 51  ? 1  51  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1UN0 ASP A 310 ? UNP Q02821 TYR 397 'engineered mutation' 397 1 
2 1UN0 ASP B 310 ? UNP Q02821 TYR 397 'engineered mutation' 397 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1UN0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.4 
_exptl_crystal.density_percent_sol   49 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.80 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '50 MM HEPES PH 6.8, 0.15 M NACL, 24 % PEG3350, 2 % PEG400' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2002-04-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.978 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX14.2' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX14.2 
_diffrn_source.pdbx_wavelength             0.978 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1UN0 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.600 
_reflns.number_obs                   29670 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.5 
_reflns.pdbx_Rmerge_I_obs            0.08600 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.0000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.300 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.74 
_reflns_shell.percent_possible_all   98.3 
_reflns_shell.Rmerge_I_obs           0.53100 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.800 
_reflns_shell.pdbx_redundancy        2.30 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1UN0 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     33802 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    97.81 
_refine.ls_R_factor_obs                          0.21781 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21566 
_refine.ls_R_factor_R_free                       0.25735 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1806 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               49.220 
_refine.aniso_B[1][1]                            -0.07 
_refine.aniso_B[2][2]                            -1.57 
_refine.aniso_B[3][3]                            1.64 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1EE4' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.686 
_refine.pdbx_overall_ESU_R_Free                  0.316 
_refine.overall_SU_ML                            0.242 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             11.435 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7073 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             158 
_refine_hist.number_atoms_total               7231 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        20.0 
# 
_struct.entry_id                  1UN0 
_struct.title                     
'Crystal Structure of Yeast Karyopherin (Importin) alpha in complex with a Nup2p N-terminal fragment' 
_struct.pdbx_descriptor           'IMPORTIN ALPHA SUBUNIT, NUCLEOPORIN NUP2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UN0 
_struct_keywords.pdbx_keywords   'NUCLEAR IMPORT' 
_struct_keywords.text            'NUCLEAR IMPORT, ARMADILLO REPEAT, NUCLEOPORIN, NLS RELEASE, KARYOPHERIN RECYCLING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 1   ? LEU A 9   ? GLU A 88  LEU A 96  1 ? 9  
HELX_P HELX_P2  2  ASP A 13  ? LEU A 28  ? ASP A 100 LEU A 115 1 ? 16 
HELX_P HELX_P3  3  PRO A 35  ? ALA A 42  ? PRO A 122 ALA A 129 1 ? 8  
HELX_P HELX_P4  4  VAL A 44  ? PHE A 51  ? VAL A 131 PHE A 138 1 ? 8  
HELX_P HELX_P5  5  PRO A 57  ? SER A 73  ? PRO A 144 SER A 160 1 ? 17 
HELX_P HELX_P6  6  THR A 75  ? ALA A 85  ? THR A 162 ALA A 172 1 ? 11 
HELX_P HELX_P7  7  ALA A 87  ? GLY A 98  ? ALA A 174 GLY A 185 1 ? 12 
HELX_P HELX_P8  8  SER A 99  ? GLY A 115 ? SER A 186 GLY A 202 1 ? 17 
HELX_P HELX_P9  9  SER A 117 ? CYS A 127 ? SER A 204 CYS A 214 1 ? 11 
HELX_P HELX_P10 10 ALA A 129 ? LEU A 136 ? ALA A 216 LEU A 223 1 ? 8  
HELX_P HELX_P11 11 PHE A 137 ? SER A 139 ? PHE A 224 SER A 226 5 ? 3  
HELX_P HELX_P12 12 LYS A 141 ? ARG A 157 ? LYS A 228 ARG A 244 1 ? 17 
HELX_P HELX_P13 13 ASP A 164 ? SER A 169 ? ASP A 251 SER A 256 1 ? 6  
HELX_P HELX_P14 14 ALA A 171 ? ILE A 179 ? ALA A 258 ILE A 266 1 ? 9  
HELX_P HELX_P15 15 ASP A 183 ? SER A 198 ? ASP A 270 SER A 285 1 ? 16 
HELX_P HELX_P16 16 PRO A 201 ? VAL A 211 ? PRO A 288 VAL A 298 1 ? 11 
HELX_P HELX_P17 17 ARG A 212 ? LEU A 221 ? ARG A 299 LEU A 308 1 ? 10 
HELX_P HELX_P18 18 SER A 225 ? VAL A 240 ? SER A 312 VAL A 327 1 ? 16 
HELX_P HELX_P19 19 ASN A 243 ? ALA A 253 ? ASN A 330 ALA A 340 1 ? 11 
HELX_P HELX_P20 20 GLY A 254 ? LEU A 263 ? GLY A 341 LEU A 350 1 ? 10 
HELX_P HELX_P21 21 LYS A 267 ? ASN A 280 ? LYS A 354 ASN A 367 1 ? 14 
HELX_P HELX_P22 22 ASN A 285 ? ALA A 295 ? ASN A 372 ALA A 382 1 ? 11 
HELX_P HELX_P23 23 LEU A 297 ? ALA A 308 ? LEU A 384 ALA A 395 1 ? 12 
HELX_P HELX_P24 24 GLU A 309 ? SER A 324 ? GLU A 396 SER A 411 1 ? 16 
HELX_P HELX_P25 25 SER A 325 ? GLN A 329 ? SER A 412 GLN A 416 5 ? 5  
HELX_P HELX_P26 26 ARG A 330 ? GLN A 340 ? ARG A 417 GLN A 427 1 ? 11 
HELX_P HELX_P27 27 CYS A 342 ? LEU A 349 ? CYS A 429 LEU A 436 1 ? 8  
HELX_P HELX_P28 28 LEU A 350 ? ILE A 352 ? LEU A 437 ILE A 439 5 ? 3  
HELX_P HELX_P29 29 ASP A 354 ? ARG A 379 ? ASP A 441 ARG A 466 1 ? 26 
HELX_P HELX_P30 30 ASN A 384 ? ALA A 393 ? ASN A 471 ALA A 480 1 ? 10 
HELX_P HELX_P31 31 GLY A 394 ? CYS A 402 ? GLY A 481 CYS A 489 1 ? 9  
HELX_P HELX_P32 32 GLN A 403 ? ASN A 405 ? GLN A 490 ASN A 492 5 ? 3  
HELX_P HELX_P33 33 ASN A 407 ? PHE A 422 ? ASN A 494 PHE A 509 1 ? 16 
HELX_P HELX_P34 34 GLU B 1   ? LEU B 9   ? GLU B 88  LEU B 96  1 ? 9  
HELX_P HELX_P35 35 ASP B 13  ? SER B 29  ? ASP B 100 SER B 116 1 ? 17 
HELX_P HELX_P36 36 PRO B 35  ? ALA B 42  ? PRO B 122 ALA B 129 1 ? 8  
HELX_P HELX_P37 37 VAL B 44  ? PHE B 51  ? VAL B 131 PHE B 138 1 ? 8  
HELX_P HELX_P38 38 PRO B 57  ? SER B 73  ? PRO B 144 SER B 160 1 ? 17 
HELX_P HELX_P39 39 THR B 75  ? ALA B 85  ? THR B 162 ALA B 172 1 ? 11 
HELX_P HELX_P40 40 ALA B 87  ? GLY B 98  ? ALA B 174 GLY B 185 1 ? 12 
HELX_P HELX_P41 41 SER B 99  ? ASP B 116 ? SER B 186 ASP B 203 1 ? 18 
HELX_P HELX_P42 42 SER B 117 ? CYS B 127 ? SER B 204 CYS B 214 1 ? 11 
HELX_P HELX_P43 43 ALA B 129 ? LEU B 136 ? ALA B 216 LEU B 223 1 ? 8  
HELX_P HELX_P44 44 PHE B 137 ? SER B 139 ? PHE B 224 SER B 226 5 ? 3  
HELX_P HELX_P45 45 LYS B 141 ? ARG B 157 ? LYS B 228 ARG B 244 1 ? 17 
HELX_P HELX_P46 46 ASP B 164 ? SER B 169 ? ASP B 251 SER B 256 1 ? 6  
HELX_P HELX_P47 47 ALA B 171 ? ILE B 179 ? ALA B 258 ILE B 266 1 ? 9  
HELX_P HELX_P48 48 ASP B 183 ? SER B 198 ? ASP B 270 SER B 285 1 ? 16 
HELX_P HELX_P49 49 PRO B 201 ? VAL B 211 ? PRO B 288 VAL B 298 1 ? 11 
HELX_P HELX_P50 50 ARG B 212 ? LEU B 221 ? ARG B 299 LEU B 308 1 ? 10 
HELX_P HELX_P51 51 SER B 225 ? VAL B 240 ? SER B 312 VAL B 327 1 ? 16 
HELX_P HELX_P52 52 ASN B 243 ? ALA B 253 ? ASN B 330 ALA B 340 1 ? 11 
HELX_P HELX_P53 53 GLY B 254 ? LEU B 263 ? GLY B 341 LEU B 350 1 ? 10 
HELX_P HELX_P54 54 LYS B 267 ? ALA B 283 ? LYS B 354 ALA B 370 1 ? 17 
HELX_P HELX_P55 55 ASN B 285 ? ALA B 295 ? ASN B 372 ALA B 382 1 ? 11 
HELX_P HELX_P56 56 LEU B 297 ? ALA B 308 ? LEU B 384 ALA B 395 1 ? 12 
HELX_P HELX_P57 57 GLU B 309 ? SER B 324 ? GLU B 396 SER B 411 1 ? 16 
HELX_P HELX_P58 58 ARG B 330 ? GLN B 340 ? ARG B 417 GLN B 427 1 ? 11 
HELX_P HELX_P59 59 CYS B 342 ? LEU B 350 ? CYS B 429 LEU B 437 1 ? 9  
HELX_P HELX_P60 60 ASP B 354 ? ARG B 379 ? ASP B 441 ARG B 466 1 ? 26 
HELX_P HELX_P61 61 ASN B 384 ? ALA B 393 ? ASN B 471 ALA B 480 1 ? 10 
HELX_P HELX_P62 62 GLY B 394 ? CYS B 402 ? GLY B 481 CYS B 489 1 ? 9  
HELX_P HELX_P63 63 GLN B 403 ? ASN B 405 ? GLN B 490 ASN B 492 5 ? 3  
HELX_P HELX_P64 64 ASN B 407 ? TYR B 421 ? ASN B 494 TYR B 508 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 160 A . ? LYS 247 A PRO 161 A ? PRO 248 A 1 -0.84 
2 LYS 160 B . ? LYS 247 B PRO 161 B ? PRO 248 B 1 -0.98 
# 
_database_PDB_matrix.entry_id          1UN0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1UN0 
_atom_sites.fract_transf_matrix[1][1]   0.007703 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007139 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015627 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 39.945 1.055   20.185  1.00   79.13  ? 88   GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 41.375 1.447   20.042  1.00   82.99  ? 88   GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 42.005 1.401   18.634  1.00   82.66  ? 88   GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 43.209 1.195   18.508  1.00   82.58  ? 88   GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 42.207 0.576   20.993  1.00   84.86  ? 88   GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 43.565 1.172   21.363  1.00   86.68  ? 88   GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 44.718 0.207   21.171  1.00   87.67  ? 88   GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 45.842 0.671   20.848  1.00   87.16  ? 88   GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 44.483 -1.008  21.354  1.00   86.01  ? 88   GLU A OE2 1 
ATOM   10   N N   . LEU A 1 2   ? 41.225 1.676   17.590  1.00   83.59  ? 89   LEU A N   1 
ATOM   11   C CA  . LEU A 1 2   ? 41.673 1.551   16.205  1.00   82.89  ? 89   LEU A CA  1 
ATOM   12   C C   . LEU A 1 2   ? 42.133 2.830   15.498  1.00   84.41  ? 89   LEU A C   1 
ATOM   13   O O   . LEU A 1 2   ? 43.150 2.780   14.809  1.00   85.93  ? 89   LEU A O   1 
ATOM   14   C CB  . LEU A 1 2   ? 40.578 0.860   15.389  1.00   82.47  ? 89   LEU A CB  1 
ATOM   15   C CG  . LEU A 1 2   ? 40.971 0.267   14.040  1.00   82.45  ? 89   LEU A CG  1 
ATOM   16   C CD1 . LEU A 1 2   ? 42.202 -0.598  14.068  1.00   83.82  ? 89   LEU A CD1 1 
ATOM   17   C CD2 . LEU A 1 2   ? 39.834 -0.551  13.522  1.00   81.87  ? 89   LEU A CD2 1 
ATOM   18   N N   . PRO A 1 3   ? 41.406 3.948   15.583  1.00   85.06  ? 90   PRO A N   1 
ATOM   19   C CA  . PRO A 1 3   ? 41.893 5.204   14.989  1.00   83.28  ? 90   PRO A CA  1 
ATOM   20   C C   . PRO A 1 3   ? 43.292 5.587   15.469  1.00   81.87  ? 90   PRO A C   1 
ATOM   21   O O   . PRO A 1 3   ? 44.034 6.215   14.700  1.00   80.13  ? 90   PRO A O   1 
ATOM   22   C CB  . PRO A 1 3   ? 40.847 6.237   15.427  1.00   84.51  ? 90   PRO A CB  1 
ATOM   23   C CG  . PRO A 1 3   ? 39.601 5.450   15.650  1.00   84.97  ? 90   PRO A CG  1 
ATOM   24   C CD  . PRO A 1 3   ? 40.066 4.114   16.175  1.00   85.34  ? 90   PRO A CD  1 
ATOM   25   N N   . GLN A 1 4   ? 43.622 5.194   16.702  1.00   81.75  ? 91   GLN A N   1 
ATOM   26   C CA  . GLN A 1 4   ? 44.965 5.325   17.278  1.00   82.24  ? 91   GLN A CA  1 
ATOM   27   C C   . GLN A 1 4   ? 45.991 4.520   16.489  1.00   80.87  ? 91   GLN A C   1 
ATOM   28   O O   . GLN A 1 4   ? 47.003 5.076   16.068  1.00   79.82  ? 91   GLN A O   1 
ATOM   29   C CB  . GLN A 1 4   ? 44.966 4.899   18.754  1.00   83.19  ? 91   GLN A CB  1 
ATOM   30   C CG  . GLN A 1 4   ? 44.183 5.893   19.612  1.00   85.34  ? 91   GLN A CG  1 
ATOM   31   C CD  . GLN A 1 4   ? 44.079 5.542   21.088  1.00   86.89  ? 91   GLN A CD  1 
ATOM   32   O OE1 . GLN A 1 4   ? 43.491 4.522   21.464  1.00   87.09  ? 91   GLN A OE1 1 
ATOM   33   N NE2 . GLN A 1 4   ? 44.603 6.424   21.932  1.00   87.50  ? 91   GLN A NE2 1 
ATOM   34   N N   . MET A 1 5   ? 45.714 3.233   16.289  1.00   79.65  ? 92   MET A N   1 
ATOM   35   C CA  . MET A 1 5   ? 46.572 2.361   15.490  1.00   78.35  ? 92   MET A CA  1 
ATOM   36   C C   . MET A 1 5   ? 46.786 2.890   14.084  1.00   77.74  ? 92   MET A C   1 
ATOM   37   O O   . MET A 1 5   ? 47.900 2.815   13.581  1.00   79.76  ? 92   MET A O   1 
ATOM   38   C CB  . MET A 1 5   ? 45.980 0.966   15.390  1.00   77.59  ? 92   MET A CB  1 
ATOM   39   C CG  . MET A 1 5   ? 46.000 0.201   16.684  1.00   77.89  ? 92   MET A CG  1 
ATOM   40   S SD  . MET A 1 5   ? 44.980 -1.283  16.561  1.00   80.32  ? 92   MET A SD  1 
ATOM   41   C CE  . MET A 1 5   ? 45.616 -2.096  15.055  1.00   80.95  ? 92   MET A CE  1 
ATOM   42   N N   . THR A 1 6   ? 45.745 3.431   13.458  1.00   78.46  ? 93   THR A N   1 
ATOM   43   C CA  . THR A 1 6   ? 45.875 4.018   12.123  1.00   81.38  ? 93   THR A CA  1 
ATOM   44   C C   . THR A 1 6   ? 46.897 5.163   12.062  1.00   85.64  ? 93   THR A C   1 
ATOM   45   O O   . THR A 1 6   ? 47.554 5.350   11.033  1.00   87.55  ? 93   THR A O   1 
ATOM   46   C CB  . THR A 1 6   ? 44.527 4.550   11.602  1.00   80.85  ? 93   THR A CB  1 
ATOM   47   O OG1 . THR A 1 6   ? 43.507 3.550   11.696  1.00   80.10  ? 93   THR A OG1 1 
ATOM   48   C CG2 . THR A 1 6   ? 44.606 4.832   10.104  1.00   82.04  ? 93   THR A CG2 1 
ATOM   49   N N   . GLN A 1 7   ? 46.996 5.944   13.142  1.00   88.89  ? 94   GLN A N   1 
ATOM   50   C CA  . GLN A 1 7   ? 47.953 7.056   13.253  1.00   88.17  ? 94   GLN A CA  1 
ATOM   51   C C   . GLN A 1 7   ? 49.379 6.556   13.555  1.00   87.46  ? 94   GLN A C   1 
ATOM   52   O O   . GLN A 1 7   ? 50.357 7.076   13.017  1.00   89.42  ? 94   GLN A O   1 
ATOM   53   C CB  . GLN A 1 7   ? 47.518 8.067   14.329  1.00   88.69  ? 94   GLN A CB  1 
ATOM   54   C CG  . GLN A 1 7   ? 46.136 8.717   14.156  1.00   87.81  ? 94   GLN A CG  1 
ATOM   55   C CD  . GLN A 1 7   ? 45.720 9.609   15.342  1.00   86.90  ? 94   GLN A CD  1 
ATOM   56   O OE1 . GLN A 1 7   ? 45.943 9.264   16.508  1.00   84.16  ? 94   GLN A OE1 1 
ATOM   57   N NE2 . GLN A 1 7   ? 45.103 10.754  15.036  1.00   85.67  ? 94   GLN A NE2 1 
ATOM   58   N N   . GLN A 1 8   ? 49.497 5.547   14.412  1.00   85.29  ? 95   GLN A N   1 
ATOM   59   C CA  . GLN A 1 8   ? 50.775 4.926   14.743  1.00   85.41  ? 95   GLN A CA  1 
ATOM   60   C C   . GLN A 1 8   ? 51.416 4.232   13.530  1.00   86.55  ? 95   GLN A C   1 
ATOM   61   O O   . GLN A 1 8   ? 52.632 4.048   13.445  1.00   85.35  ? 95   GLN A O   1 
ATOM   62   C CB  . GLN A 1 8   ? 50.534 3.923   15.868  1.00   85.14  ? 95   GLN A CB  1 
ATOM   63   C CG  . GLN A 1 8   ? 51.798 3.303   16.412  1.00   87.50  ? 95   GLN A CG  1 
ATOM   64   C CD  . GLN A 1 8   ? 51.510 2.226   17.432  1.00   90.29  ? 95   GLN A CD  1 
ATOM   65   O OE1 . GLN A 1 8   ? 50.347 1.882   17.663  1.00   93.18  ? 95   GLN A OE1 1 
ATOM   66   N NE2 . GLN A 1 8   ? 52.567 1.676   18.034  1.00   91.24  ? 95   GLN A NE2 1 
ATOM   67   N N   . LEU A 1 9   ? 50.572 3.847   12.582  1.00   88.22  ? 96   LEU A N   1 
ATOM   68   C CA  . LEU A 1 9   ? 51.006 3.250   11.328  1.00   89.49  ? 96   LEU A CA  1 
ATOM   69   C C   . LEU A 1 9   ? 51.392 4.343   10.319  1.00   90.43  ? 96   LEU A C   1 
ATOM   70   O O   . LEU A 1 9   ? 51.885 4.063   9.226   1.00   91.08  ? 96   LEU A O   1 
ATOM   71   C CB  . LEU A 1 9   ? 49.866 2.387   10.761  1.00   88.54  ? 96   LEU A CB  1 
ATOM   72   C CG  . LEU A 1 9   ? 50.272 1.254   9.815   1.00   87.69  ? 96   LEU A CG  1 
ATOM   73   C CD1 . LEU A 1 9   ? 50.667 0.009   10.618  1.00   88.17  ? 96   LEU A CD1 1 
ATOM   74   C CD2 . LEU A 1 9   ? 49.200 0.955   8.770   1.00   87.12  ? 96   LEU A CD2 1 
ATOM   75   N N   . ASN A 1 10  ? 51.123 5.601   10.641  1.00   90.85  ? 97   ASN A N   1 
ATOM   76   C CA  . ASN A 1 10  ? 51.487 6.689   9.737   1.00   93.46  ? 97   ASN A CA  1 
ATOM   77   C C   . ASN A 1 10  ? 52.760 7.408   10.197  1.00   94.49  ? 97   ASN A C   1 
ATOM   78   O O   . ASN A 1 10  ? 53.364 8.177   9.439   1.00   92.07  ? 97   ASN A O   1 
ATOM   79   C CB  . ASN A 1 10  ? 50.320 7.672   9.604   1.00   92.71  ? 97   ASN A CB  1 
ATOM   80   C CG  . ASN A 1 10  ? 49.107 7.037   8.972   1.00   93.13  ? 97   ASN A CG  1 
ATOM   81   O OD1 . ASN A 1 10  ? 49.081 5.825   8.777   1.00   94.92  ? 97   ASN A OD1 1 
ATOM   82   N ND2 . ASN A 1 10  ? 48.099 7.840   8.648   1.00   93.72  ? 97   ASN A ND2 1 
ATOM   83   N N   . SER A 1 11  ? 53.167 7.113   11.431  1.00   96.32  ? 98   SER A N   1 
ATOM   84   C CA  . SER A 1 11  ? 54.354 7.693   12.055  1.00   97.89  ? 98   SER A CA  1 
ATOM   85   C C   . SER A 1 11  ? 55.586 7.409   11.190  1.00   100.34 ? 98   SER A C   1 
ATOM   86   O O   . SER A 1 11  ? 55.748 6.282   10.707  1.00   102.58 ? 98   SER A O   1 
ATOM   87   C CB  . SER A 1 11  ? 54.507 7.100   13.463  1.00   97.22  ? 98   SER A CB  1 
ATOM   88   O OG  . SER A 1 11  ? 55.803 7.254   14.009  1.00   99.05  ? 98   SER A OG  1 
ATOM   89   N N   . ASP A 1 12  ? 56.436 8.416   10.976  1.00   100.74 ? 99   ASP A N   1 
ATOM   90   C CA  . ASP A 1 12  ? 57.665 8.241   10.190  1.00   101.01 ? 99   ASP A CA  1 
ATOM   91   C C   . ASP A 1 12  ? 58.756 7.469   10.940  1.00   98.90  ? 99   ASP A C   1 
ATOM   92   O O   . ASP A 1 12  ? 59.744 7.064   10.331  1.00   98.29  ? 99   ASP A O   1 
ATOM   93   C CB  . ASP A 1 12  ? 58.241 9.590   9.741   1.00   102.52 ? 99   ASP A CB  1 
ATOM   94   C CG  . ASP A 1 12  ? 57.420 10.257  8.655   1.00   103.71 ? 99   ASP A CG  1 
ATOM   95   O OD1 . ASP A 1 12  ? 56.417 10.925  8.987   1.00   104.00 ? 99   ASP A OD1 1 
ATOM   96   O OD2 . ASP A 1 12  ? 57.732 10.190  7.447   1.00   103.78 ? 99   ASP A OD2 1 
ATOM   97   N N   . ASP A 1 13  ? 58.593 7.306   12.251  1.00   97.99  ? 100  ASP A N   1 
ATOM   98   C CA  . ASP A 1 13  ? 59.496 6.499   13.066  1.00   99.39  ? 100  ASP A CA  1 
ATOM   99   C C   . ASP A 1 13  ? 59.341 5.034   12.656  1.00   101.90 ? 100  ASP A C   1 
ATOM   100  O O   . ASP A 1 13  ? 58.240 4.493   12.765  1.00   102.44 ? 100  ASP A O   1 
ATOM   101  C CB  . ASP A 1 13  ? 59.160 6.685   14.553  1.00   98.79  ? 100  ASP A CB  1 
ATOM   102  C CG  . ASP A 1 13  ? 59.954 5.757   15.480  1.00   98.59  ? 100  ASP A CG  1 
ATOM   103  O OD1 . ASP A 1 13  ? 61.130 5.438   15.213  1.00   95.97  ? 100  ASP A OD1 1 
ATOM   104  O OD2 . ASP A 1 13  ? 59.481 5.300   16.543  1.00   98.87  ? 100  ASP A OD2 1 
ATOM   105  N N   . MET A 1 14  ? 60.418 4.408   12.172  1.00   104.28 ? 101  MET A N   1 
ATOM   106  C CA  . MET A 1 14  ? 60.399 2.985   11.787  1.00   106.82 ? 101  MET A CA  1 
ATOM   107  C C   . MET A 1 14  ? 60.026 2.072   12.969  1.00   106.80 ? 101  MET A C   1 
ATOM   108  O O   . MET A 1 14  ? 59.425 1.012   12.781  1.00   107.54 ? 101  MET A O   1 
ATOM   109  C CB  . MET A 1 14  ? 61.755 2.516   11.218  1.00   108.68 ? 101  MET A CB  1 
ATOM   110  C CG  . MET A 1 14  ? 62.247 3.200   9.932   1.00   111.00 ? 101  MET A CG  1 
ATOM   111  S SD  . MET A 1 14  ? 61.868 2.313   8.384   1.00   115.57 ? 101  MET A SD  1 
ATOM   112  C CE  . MET A 1 14  ? 63.477 1.866   7.710   1.00   111.44 ? 101  MET A CE  1 
ATOM   113  N N   . GLN A 1 15  ? 60.395 2.486   14.179  1.00   105.19 ? 102  GLN A N   1 
ATOM   114  C CA  . GLN A 1 15  ? 60.091 1.741   15.400  1.00   104.67 ? 102  GLN A CA  1 
ATOM   115  C C   . GLN A 1 15  ? 58.578 1.592   15.649  1.00   103.92 ? 102  GLN A C   1 
ATOM   116  O O   . GLN A 1 15  ? 58.109 0.515   16.029  1.00   103.44 ? 102  GLN A O   1 
ATOM   117  C CB  . GLN A 1 15  ? 60.807 2.416   16.586  1.00   104.72 ? 102  GLN A CB  1 
ATOM   118  C CG  . GLN A 1 15  ? 60.508 1.882   17.985  1.00   104.66 ? 102  GLN A CG  1 
ATOM   119  C CD  . GLN A 1 15  ? 60.705 0.383   18.096  1.00   106.06 ? 102  GLN A CD  1 
ATOM   120  O OE1 . GLN A 1 15  ? 61.710 -0.153  17.621  1.00   107.01 ? 102  GLN A OE1 1 
ATOM   121  N NE2 . GLN A 1 15  ? 59.739 -0.300  18.705  1.00   106.13 ? 102  GLN A NE2 1 
ATOM   122  N N   . GLU A 1 16  ? 57.822 2.665   15.421  1.00   103.21 ? 103  GLU A N   1 
ATOM   123  C CA  . GLU A 1 16  ? 56.373 2.666   15.645  1.00   102.74 ? 103  GLU A CA  1 
ATOM   124  C C   . GLU A 1 16  ? 55.626 2.009   14.475  1.00   102.41 ? 103  GLU A C   1 
ATOM   125  O O   . GLU A 1 16  ? 54.650 1.287   14.695  1.00   102.69 ? 103  GLU A O   1 
ATOM   126  C CB  . GLU A 1 16  ? 55.851 4.089   15.919  1.00   102.90 ? 103  GLU A CB  1 
ATOM   127  C CG  . GLU A 1 16  ? 56.212 4.666   17.287  1.00   103.44 ? 103  GLU A CG  1 
ATOM   128  C CD  . GLU A 1 16  ? 55.463 4.026   18.455  1.00   105.15 ? 103  GLU A CD  1 
ATOM   129  O OE1 . GLU A 1 16  ? 55.891 2.955   18.949  1.00   105.08 ? 103  GLU A OE1 1 
ATOM   130  O OE2 . GLU A 1 16  ? 54.442 4.596   18.904  1.00   104.78 ? 103  GLU A OE2 1 
ATOM   131  N N   . GLN A 1 17  ? 56.089 2.260   13.250  1.00   100.41 ? 104  GLN A N   1 
ATOM   132  C CA  . GLN A 1 17  ? 55.554 1.624   12.051  1.00   99.83  ? 104  GLN A CA  1 
ATOM   133  C C   . GLN A 1 17  ? 55.451 0.108   12.227  1.00   99.10  ? 104  GLN A C   1 
ATOM   134  O O   . GLN A 1 17  ? 54.466 -0.500  11.796  1.00   100.47 ? 104  GLN A O   1 
ATOM   135  C CB  . GLN A 1 17  ? 56.449 1.915   10.842  1.00   100.45 ? 104  GLN A CB  1 
ATOM   136  C CG  . GLN A 1 17  ? 56.272 3.293   10.210  1.00   100.06 ? 104  GLN A CG  1 
ATOM   137  C CD  . GLN A 1 17  ? 57.151 3.473   8.977   1.00   99.47  ? 104  GLN A CD  1 
ATOM   138  O OE1 . GLN A 1 17  ? 58.250 2.910   8.909   1.00   98.57  ? 104  GLN A OE1 1 
ATOM   139  N NE2 . GLN A 1 17  ? 56.673 4.247   8.006   1.00   93.80  ? 104  GLN A NE2 1 
ATOM   140  N N   . LEU A 1 18  ? 56.476 -0.495  12.829  1.00   96.99  ? 105  LEU A N   1 
ATOM   141  C CA  . LEU A 1 18  ? 56.467 -1.930  13.102  1.00   96.15  ? 105  LEU A CA  1 
ATOM   142  C C   . LEU A 1 18  ? 55.457 -2.228  14.198  1.00   94.46  ? 105  LEU A C   1 
ATOM   143  O O   . LEU A 1 18  ? 54.545 -3.028  14.014  1.00   97.61  ? 105  LEU A O   1 
ATOM   144  C CB  . LEU A 1 18  ? 57.837 -2.473  13.532  1.00   96.59  ? 105  LEU A CB  1 
ATOM   145  C CG  . LEU A 1 18  ? 57.872 -4.008  13.682  1.00   96.39  ? 105  LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 18  ? 58.094 -4.694  12.323  1.00   95.70  ? 105  LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 18  ? 58.905 -4.492  14.699  1.00   96.01  ? 105  LEU A CD2 1 
ATOM   148  N N   . SER A 1 19  ? 55.605 -1.575  15.338  1.00   91.30  ? 106  SER A N   1 
ATOM   149  C CA  . SER A 1 19  ? 54.708 -1.847  16.449  1.00   89.76  ? 106  SER A CA  1 
ATOM   150  C C   . SER A 1 19  ? 53.250 -1.875  15.985  1.00   87.00  ? 106  SER A C   1 
ATOM   151  O O   . SER A 1 19  ? 52.490 -2.752  16.379  1.00   86.16  ? 106  SER A O   1 
ATOM   152  C CB  . SER A 1 19  ? 54.902 -0.795  17.538  1.00   90.27  ? 106  SER A CB  1 
ATOM   153  O OG  . SER A 1 19  ? 54.166 -1.151  18.696  1.00   92.43  ? 106  SER A OG  1 
ATOM   154  N N   . ALA A 1 20  ? 52.888 -0.932  15.119  1.00   83.99  ? 107  ALA A N   1 
ATOM   155  C CA  . ALA A 1 20  ? 51.525 -0.785  14.609  1.00   81.92  ? 107  ALA A CA  1 
ATOM   156  C C   . ALA A 1 20  ? 51.145 -1.937  13.681  1.00   79.79  ? 107  ALA A C   1 
ATOM   157  O O   . ALA A 1 20  ? 50.086 -2.550  13.840  1.00   76.40  ? 107  ALA A O   1 
ATOM   158  C CB  . ALA A 1 20  ? 51.383 0.548   13.858  1.00   82.25  ? 107  ALA A CB  1 
ATOM   159  N N   . THR A 1 21  ? 52.008 -2.204  12.701  1.00   76.74  ? 108  THR A N   1 
ATOM   160  C CA  . THR A 1 21  ? 51.790 -3.292  11.760  1.00   74.01  ? 108  THR A CA  1 
ATOM   161  C C   . THR A 1 21  ? 51.584 -4.583  12.530  1.00   70.51  ? 108  THR A C   1 
ATOM   162  O O   . THR A 1 21  ? 50.788 -5.412  12.131  1.00   70.84  ? 108  THR A O   1 
ATOM   163  C CB  . THR A 1 21  ? 52.957 -3.400  10.763  1.00   73.65  ? 108  THR A CB  1 
ATOM   164  O OG1 . THR A 1 21  ? 53.023 -2.186  10.008  1.00   76.25  ? 108  THR A OG1 1 
ATOM   165  C CG2 . THR A 1 21  ? 52.707 -4.457  9.687   1.00   73.34  ? 108  THR A CG2 1 
ATOM   166  N N   . VAL A 1 22  ? 52.246 -4.722  13.666  1.00   68.86  ? 109  VAL A N   1 
ATOM   167  C CA  . VAL A 1 22  ? 52.190 -5.964  14.425  1.00   70.84  ? 109  VAL A CA  1 
ATOM   168  C C   . VAL A 1 22  ? 50.857 -6.116  15.124  1.00   70.20  ? 109  VAL A C   1 
ATOM   169  O O   . VAL A 1 22  ? 50.391 -7.224  15.402  1.00   70.70  ? 109  VAL A O   1 
ATOM   170  C CB  . VAL A 1 22  ? 53.285 -6.008  15.514  1.00   71.23  ? 109  VAL A CB  1 
ATOM   171  C CG1 . VAL A 1 22  ? 53.161 -7.256  16.377  1.00   71.46  ? 109  VAL A CG1 1 
ATOM   172  C CG2 . VAL A 1 22  ? 54.662 -5.962  14.880  1.00   73.86  ? 109  VAL A CG2 1 
ATOM   173  N N   . LYS A 1 23  ? 50.273 -4.979  15.466  1.00   70.95  ? 110  LYS A N   1 
ATOM   174  C CA  . LYS A 1 23  ? 49.015 -4.983  16.206  1.00   71.63  ? 110  LYS A CA  1 
ATOM   175  C C   . LYS A 1 23  ? 47.861 -5.297  15.245  1.00   68.22  ? 110  LYS A C   1 
ATOM   176  O O   . LYS A 1 23  ? 46.956 -6.054  15.585  1.00   66.30  ? 110  LYS A O   1 
ATOM   177  C CB  . LYS A 1 23  ? 48.833 -3.656  16.950  1.00   73.67  ? 110  LYS A CB  1 
ATOM   178  C CG  . LYS A 1 23  ? 47.992 -3.787  18.225  1.00   74.67  ? 110  LYS A CG  1 
ATOM   179  C CD  . LYS A 1 23  ? 48.817 -3.713  19.502  1.00   71.54  ? 110  LYS A CD  1 
ATOM   180  C CE  . LYS A 1 23  ? 49.132 -2.267  19.879  1.00   74.12  ? 110  LYS A CE  1 
ATOM   181  N NZ  . LYS A 1 23  ? 50.194 -1.624  19.032  1.00   77.26  ? 110  LYS A NZ  1 
ATOM   182  N N   . PHE A 1 24  ? 47.940 -4.728  14.044  1.00   65.43  ? 111  PHE A N   1 
ATOM   183  C CA  . PHE A 1 24  ? 47.029 -5.014  12.954  1.00   66.11  ? 111  PHE A CA  1 
ATOM   184  C C   . PHE A 1 24  ? 47.070 -6.512  12.659  1.00   69.09  ? 111  PHE A C   1 
ATOM   185  O O   . PHE A 1 24  ? 46.050 -7.204  12.735  1.00   71.73  ? 111  PHE A O   1 
ATOM   186  C CB  . PHE A 1 24  ? 47.418 -4.216  11.701  1.00   66.36  ? 111  PHE A CB  1 
ATOM   187  C CG  . PHE A 1 24  ? 46.787 -2.859  11.637  1.00   67.01  ? 111  PHE A CG  1 
ATOM   188  C CD1 . PHE A 1 24  ? 47.465 -1.743  12.090  1.00   67.82  ? 111  PHE A CD1 1 
ATOM   189  C CD2 . PHE A 1 24  ? 45.495 -2.697  11.158  1.00   67.72  ? 111  PHE A CD2 1 
ATOM   190  C CE1 . PHE A 1 24  ? 46.863 -0.486  12.042  1.00   68.69  ? 111  PHE A CE1 1 
ATOM   191  C CE2 . PHE A 1 24  ? 44.890 -1.442  11.115  1.00   67.01  ? 111  PHE A CE2 1 
ATOM   192  C CZ  . PHE A 1 24  ? 45.573 -0.341  11.556  1.00   68.03  ? 111  PHE A CZ  1 
ATOM   193  N N   . ARG A 1 25  ? 48.254 -7.023  12.340  1.00   67.75  ? 112  ARG A N   1 
ATOM   194  C CA  . ARG A 1 25  ? 48.420 -8.449  12.079  1.00   66.56  ? 112  ARG A CA  1 
ATOM   195  C C   . ARG A 1 25  ? 47.774 -9.331  13.129  1.00   64.32  ? 112  ARG A C   1 
ATOM   196  O O   . ARG A 1 25  ? 47.303 -10.416 12.833  1.00   65.51  ? 112  ARG A O   1 
ATOM   197  C CB  . ARG A 1 25  ? 49.897 -8.828  12.068  1.00   68.08  ? 112  ARG A CB  1 
ATOM   198  C CG  . ARG A 1 25  ? 50.169 -10.316 11.783  1.00   68.81  ? 112  ARG A CG  1 
ATOM   199  C CD  . ARG A 1 25  ? 50.422 -11.213 12.994  1.00   68.90  ? 112  ARG A CD  1 
ATOM   200  N NE  . ARG A 1 25  ? 51.629 -10.830 13.731  1.00   71.95  ? 112  ARG A NE  1 
ATOM   201  C CZ  . ARG A 1 25  ? 52.023 -11.346 14.900  1.00   70.07  ? 112  ARG A CZ  1 
ATOM   202  N NH1 . ARG A 1 25  ? 51.341 -12.300 15.513  1.00   67.47  ? 112  ARG A NH1 1 
ATOM   203  N NH2 . ARG A 1 25  ? 53.132 -10.906 15.469  1.00   69.70  ? 112  ARG A NH2 1 
ATOM   204  N N   . GLN A 1 26  ? 47.788 -8.902  14.376  1.00   65.67  ? 113  GLN A N   1 
ATOM   205  C CA  . GLN A 1 26  ? 47.247 -9.738  15.443  1.00   66.84  ? 113  GLN A CA  1 
ATOM   206  C C   . GLN A 1 26  ? 45.727 -9.766  15.521  1.00   61.89  ? 113  GLN A C   1 
ATOM   207  O O   . GLN A 1 26  ? 45.164 -10.819 15.813  1.00   60.04  ? 113  GLN A O   1 
ATOM   208  C CB  . GLN A 1 26  ? 47.752 -9.287  16.819  1.00   70.41  ? 113  GLN A CB  1 
ATOM   209  C CG  . GLN A 1 26  ? 49.200 -9.612  17.125  1.00   75.40  ? 113  GLN A CG  1 
ATOM   210  C CD  . GLN A 1 26  ? 49.680 -8.853  18.349  1.00   78.98  ? 113  GLN A CD  1 
ATOM   211  O OE1 . GLN A 1 26  ? 49.770 -7.623  18.324  1.00   84.01  ? 113  GLN A OE1 1 
ATOM   212  N NE2 . GLN A 1 26  ? 49.942 -9.571  19.432  1.00   77.93  ? 113  GLN A NE2 1 
ATOM   213  N N   . ILE A 1 27  ? 45.070 -8.619  15.354  1.00   59.16  ? 114  ILE A N   1 
ATOM   214  C CA  . ILE A 1 27  ? 43.601 -8.601  15.433  1.00   57.46  ? 114  ILE A CA  1 
ATOM   215  C C   . ILE A 1 27  ? 43.085 -9.313  14.197  1.00   57.54  ? 114  ILE A C   1 
ATOM   216  O O   . ILE A 1 27  ? 42.116 -10.068 14.284  1.00   61.49  ? 114  ILE A O   1 
ATOM   217  C CB  . ILE A 1 27  ? 42.977 -7.189  15.516  1.00   56.88  ? 114  ILE A CB  1 
ATOM   218  C CG1 . ILE A 1 27  ? 43.597 -6.233  14.479  1.00   55.31  ? 114  ILE A CG1 1 
ATOM   219  C CG2 . ILE A 1 27  ? 43.111 -6.673  16.932  1.00   61.41  ? 114  ILE A CG2 1 
ATOM   220  C CD1 . ILE A 1 27  ? 42.943 -4.889  14.352  1.00   53.41  ? 114  ILE A CD1 1 
ATOM   221  N N   . LEU A 1 28  ? 43.771 -9.102  13.073  1.00   52.74  ? 115  LEU A N   1 
ATOM   222  C CA  . LEU A 1 28  ? 43.436 -9.737  11.820  1.00   50.92  ? 115  LEU A CA  1 
ATOM   223  C C   . LEU A 1 28  ? 43.568 -11.253 11.899  1.00   52.75  ? 115  LEU A C   1 
ATOM   224  O O   . LEU A 1 28  ? 43.147 -11.967 10.997  1.00   56.00  ? 115  LEU A O   1 
ATOM   225  C CB  . LEU A 1 28  ? 44.346 -9.221  10.720  1.00   49.44  ? 115  LEU A CB  1 
ATOM   226  C CG  . LEU A 1 28  ? 44.127 -7.790  10.302  1.00   50.37  ? 115  LEU A CG  1 
ATOM   227  C CD1 . LEU A 1 28  ? 45.082 -7.457  9.187   1.00   54.19  ? 115  LEU A CD1 1 
ATOM   228  C CD2 . LEU A 1 28  ? 42.717 -7.612  9.820   1.00   54.52  ? 115  LEU A CD2 1 
ATOM   229  N N   . SER A 1 29  ? 44.171 -11.768 12.960  1.00   54.31  ? 116  SER A N   1 
ATOM   230  C CA  . SER A 1 29  ? 44.332 -13.212 13.079  1.00   56.95  ? 116  SER A CA  1 
ATOM   231  C C   . SER A 1 29  ? 43.307 -13.909 13.949  1.00   57.13  ? 116  SER A C   1 
ATOM   232  O O   . SER A 1 29  ? 43.251 -15.133 13.941  1.00   56.79  ? 116  SER A O   1 
ATOM   233  C CB  . SER A 1 29  ? 45.741 -13.529 13.552  1.00   57.54  ? 116  SER A CB  1 
ATOM   234  O OG  . SER A 1 29  ? 46.612 -13.194 12.480  1.00   62.29  ? 116  SER A OG  1 
ATOM   235  N N   . ARG A 1 30  ? 42.507 -13.149 14.694  1.00   58.57  ? 117  ARG A N   1 
ATOM   236  C CA  . ARG A 1 30  ? 41.443 -13.711 15.520  1.00   56.71  ? 117  ARG A CA  1 
ATOM   237  C C   . ARG A 1 30  ? 40.672 -14.779 14.736  1.00   57.17  ? 117  ARG A C   1 
ATOM   238  O O   . ARG A 1 30  ? 40.323 -14.594 13.561  1.00   48.66  ? 117  ARG A O   1 
ATOM   239  C CB  . ARG A 1 30  ? 40.487 -12.611 15.951  1.00   57.68  ? 117  ARG A CB  1 
ATOM   240  C CG  . ARG A 1 30  ? 39.487 -13.073 16.985  1.00   61.90  ? 117  ARG A CG  1 
ATOM   241  C CD  . ARG A 1 30  ? 38.676 -11.959 17.642  1.00   62.84  ? 117  ARG A CD  1 
ATOM   242  N NE  . ARG A 1 30  ? 37.976 -11.152 16.647  1.00   65.85  ? 117  ARG A NE  1 
ATOM   243  C CZ  . ARG A 1 30  ? 37.703 -9.853  16.739  1.00   63.63  ? 117  ARG A CZ  1 
ATOM   244  N NH1 . ARG A 1 30  ? 38.078 -9.117  17.771  1.00   63.26  ? 117  ARG A NH1 1 
ATOM   245  N NH2 . ARG A 1 30  ? 37.047 -9.272  15.753  1.00   63.38  ? 117  ARG A NH2 1 
ATOM   246  N N   . GLU A 1 31  ? 40.435 -15.908 15.397  1.00   58.84  ? 118  GLU A N   1 
ATOM   247  C CA  . GLU A 1 31  ? 39.826 -17.053 14.742  1.00   62.43  ? 118  GLU A CA  1 
ATOM   248  C C   . GLU A 1 31  ? 38.388 -16.731 14.380  1.00   61.25  ? 118  GLU A C   1 
ATOM   249  O O   . GLU A 1 31  ? 37.963 -16.980 13.258  1.00   62.07  ? 118  GLU A O   1 
ATOM   250  C CB  . GLU A 1 31  ? 39.891 -18.291 15.644  1.00   64.35  ? 118  GLU A CB  1 
ATOM   251  C CG  . GLU A 1 31  ? 39.405 -19.547 14.778  0.0000 79.50  ? 118  GLU A CG  1 
ATOM   252  C CD  . GLU A 1 31  ? 39.938 -19.815 13.361  0.0000 85.70  ? 118  GLU A CD  1 
ATOM   253  O OE1 . GLU A 1 31  ? 41.157 -20.105 13.206  0.0000 85.58  ? 118  GLU A OE1 1 
ATOM   254  O OE2 . GLU A 1 31  ? 39.123 -19.784 12.395  0.0000 85.81  ? 118  GLU A OE2 1 
ATOM   255  N N   . HIS A 1 32  ? 37.685 -16.130 15.333  1.00   61.12  ? 119  HIS A N   1 
ATOM   256  C CA  . HIS A 1 32  ? 36.258 -15.823 15.254  1.00   61.43  ? 119  HIS A CA  1 
ATOM   257  C C   . HIS A 1 32  ? 35.959 -14.389 14.847  1.00   60.20  ? 119  HIS A C   1 
ATOM   258  O O   . HIS A 1 32  ? 36.242 -13.447 15.598  1.00   58.00  ? 119  HIS A O   1 
ATOM   259  C CB  . HIS A 1 32  ? 35.615 -16.051 16.620  1.00   62.56  ? 119  HIS A CB  1 
ATOM   260  C CG  . HIS A 1 32  ? 35.729 -17.458 17.111  1.00   66.96  ? 119  HIS A CG  1 
ATOM   261  N ND1 . HIS A 1 32  ? 35.924 -18.530 16.261  1.00   64.76  ? 119  HIS A ND1 1 
ATOM   262  C CD2 . HIS A 1 32  ? 35.655 -17.968 18.364  1.00   68.08  ? 119  HIS A CD2 1 
ATOM   263  C CE1 . HIS A 1 32  ? 35.949 -19.642 16.975  1.00   66.29  ? 119  HIS A CE1 1 
ATOM   264  N NE2 . HIS A 1 32  ? 35.801 -19.329 18.253  1.00   66.49  ? 119  HIS A NE2 1 
ATOM   265  N N   . ARG A 1 33  ? 35.408 -14.253 13.643  1.00   60.36  ? 120  ARG A N   1 
ATOM   266  C CA  . ARG A 1 33  ? 34.900 -12.993 13.115  1.00   56.94  ? 120  ARG A CA  1 
ATOM   267  C C   . ARG A 1 33  ? 36.033 -12.007 12.981  1.00   53.77  ? 120  ARG A C   1 
ATOM   268  O O   . ARG A 1 33  ? 35.975 -10.964 13.605  1.00   53.12  ? 120  ARG A O   1 
ATOM   269  C CB  . ARG A 1 33  ? 33.834 -12.461 14.090  1.00   58.27  ? 120  ARG A CB  1 
ATOM   270  C CG  . ARG A 1 33  ? 33.260 -11.064 13.841  1.00   57.94  ? 120  ARG A CG  1 
ATOM   271  C CD  . ARG A 1 33  ? 32.589 -11.010 12.516  1.00   55.70  ? 120  ARG A CD  1 
ATOM   272  N NE  . ARG A 1 33  ? 31.922 -9.782  12.150  1.00   49.16  ? 120  ARG A NE  1 
ATOM   273  C CZ  . ARG A 1 33  ? 32.488 -8.707  11.645  1.00   49.80  ? 120  ARG A CZ  1 
ATOM   274  N NH1 . ARG A 1 33  ? 33.805 -8.563  11.568  1.00   43.52  ? 120  ARG A NH1 1 
ATOM   275  N NH2 . ARG A 1 33  ? 31.683 -7.730  11.243  1.00   52.31  ? 120  ARG A NH2 1 
ATOM   276  N N   . PRO A 1 34  ? 37.073 -12.319 12.217  1.00   52.85  ? 121  PRO A N   1 
ATOM   277  C CA  . PRO A 1 34  ? 38.206 -11.392 12.029  1.00   53.09  ? 121  PRO A CA  1 
ATOM   278  C C   . PRO A 1 34  ? 37.696 -9.997  11.690  1.00   50.02  ? 121  PRO A C   1 
ATOM   279  O O   . PRO A 1 34  ? 36.664 -9.965  11.033  1.00   53.86  ? 121  PRO A O   1 
ATOM   280  C CB  . PRO A 1 34  ? 38.967 -11.956 10.813  1.00   52.25  ? 121  PRO A CB  1 
ATOM   281  C CG  . PRO A 1 34  ? 38.504 -13.342 10.652  1.00   54.02  ? 121  PRO A CG  1 
ATOM   282  C CD  . PRO A 1 34  ? 37.243 -13.566 11.461  1.00   53.66  ? 121  PRO A CD  1 
ATOM   283  N N   . PRO A 1 35  ? 38.325 -8.924  12.153  1.00   48.39  ? 122  PRO A N   1 
ATOM   284  C CA  . PRO A 1 35  ? 37.970 -7.544  11.800  1.00   44.85  ? 122  PRO A CA  1 
ATOM   285  C C   . PRO A 1 35  ? 38.495 -7.073  10.458  1.00   43.02  ? 122  PRO A C   1 
ATOM   286  O O   . PRO A 1 35  ? 38.987 -5.934  10.324  1.00   37.87  ? 122  PRO A O   1 
ATOM   287  C CB  . PRO A 1 35  ? 38.673 -6.722  12.887  1.00   48.18  ? 122  PRO A CB  1 
ATOM   288  C CG  . PRO A 1 35  ? 39.053 -7.693  13.959  1.00   49.22  ? 122  PRO A CG  1 
ATOM   289  C CD  . PRO A 1 35  ? 39.359 -8.959  13.202  1.00   50.91  ? 122  PRO A CD  1 
ATOM   290  N N   . ILE A 1 36  ? 38.369 -7.933  9.454   1.00   41.55  ? 123  ILE A N   1 
ATOM   291  C CA  . ILE A 1 36  ? 38.945 -7.603  8.154   1.00   43.58  ? 123  ILE A CA  1 
ATOM   292  C C   . ILE A 1 36  ? 38.249 -6.379  7.578   1.00   42.51  ? 123  ILE A C   1 
ATOM   293  O O   . ILE A 1 36  ? 38.926 -5.486  7.110   1.00   48.34  ? 123  ILE A O   1 
ATOM   294  C CB  . ILE A 1 36  ? 38.915 -8.804  7.195   1.00   43.33  ? 123  ILE A CB  1 
ATOM   295  C CG1 . ILE A 1 36  ? 39.656 -9.986  7.819   1.00   49.38  ? 123  ILE A CG1 1 
ATOM   296  C CG2 . ILE A 1 36  ? 39.605 -8.451  5.931   1.00   44.27  ? 123  ILE A CG2 1 
ATOM   297  C CD1 . ILE A 1 36  ? 39.301 -11.335 7.266   1.00   51.86  ? 123  ILE A CD1 1 
ATOM   298  N N   . ASP A 1 37  ? 36.920 -6.327  7.627   1.00   44.25  ? 124  ASP A N   1 
ATOM   299  C CA  . ASP A 1 37  ? 36.145 -5.158  7.166   1.00   45.46  ? 124  ASP A CA  1 
ATOM   300  C C   . ASP A 1 37  ? 36.557 -3.820  7.821   1.00   44.15  ? 124  ASP A C   1 
ATOM   301  O O   . ASP A 1 37  ? 36.885 -2.868  7.123   1.00   45.42  ? 124  ASP A O   1 
ATOM   302  C CB  . ASP A 1 37  ? 34.625 -5.406  7.280   1.00   45.63  ? 124  ASP A CB  1 
ATOM   303  C CG  . ASP A 1 37  ? 34.129 -5.883  8.702   1.00   52.79  ? 124  ASP A CG  1 
ATOM   304  O OD1 . ASP A 1 37  ? 34.897 -6.320  9.627   1.00   46.00  ? 124  ASP A OD1 1 
ATOM   305  O OD2 . ASP A 1 37  ? 32.883 -5.861  8.954   1.00   51.69  ? 124  ASP A OD2 1 
ATOM   306  N N   . VAL A 1 38  ? 36.604 -3.779  9.150   1.00   42.46  ? 125  VAL A N   1 
ATOM   307  C CA  . VAL A 1 38  ? 36.935 -2.593  9.925   1.00   41.43  ? 125  VAL A CA  1 
ATOM   308  C C   . VAL A 1 38  ? 38.330 -2.082  9.603   1.00   45.31  ? 125  VAL A C   1 
ATOM   309  O O   . VAL A 1 38  ? 38.556 -0.876  9.452   1.00   48.03  ? 125  VAL A O   1 
ATOM   310  C CB  . VAL A 1 38  ? 36.878 -2.917  11.443  1.00   45.35  ? 125  VAL A CB  1 
ATOM   311  C CG1 . VAL A 1 38  ? 37.309 -1.737  12.276  1.00   48.62  ? 125  VAL A CG1 1 
ATOM   312  C CG2 . VAL A 1 38  ? 35.473 -3.323  11.912  1.00   45.96  ? 125  VAL A CG2 1 
ATOM   313  N N   . VAL A 1 39  ? 39.281 -3.005  9.484   1.00   48.96  ? 126  VAL A N   1 
ATOM   314  C CA  . VAL A 1 39  ? 40.666 -2.650  9.178   1.00   46.79  ? 126  VAL A CA  1 
ATOM   315  C C   . VAL A 1 39  ? 40.788 -2.129  7.762   1.00   43.33  ? 126  VAL A C   1 
ATOM   316  O O   . VAL A 1 39  ? 41.513 -1.158  7.541   1.00   45.95  ? 126  VAL A O   1 
ATOM   317  C CB  . VAL A 1 39  ? 41.642 -3.821  9.364   1.00   47.61  ? 126  VAL A CB  1 
ATOM   318  C CG1 . VAL A 1 39  ? 43.047 -3.467  8.883   1.00   45.09  ? 126  VAL A CG1 1 
ATOM   319  C CG2 . VAL A 1 39  ? 41.670 -4.266  10.805  1.00   48.50  ? 126  VAL A CG2 1 
ATOM   320  N N   . ILE A 1 40  ? 40.069 -2.733  6.824   1.00   42.97  ? 127  ILE A N   1 
ATOM   321  C CA  . ILE A 1 40  ? 40.061 -2.217  5.453   1.00   45.67  ? 127  ILE A CA  1 
ATOM   322  C C   . ILE A 1 40  ? 39.503 -0.810  5.432   1.00   49.23  ? 127  ILE A C   1 
ATOM   323  O O   . ILE A 1 40  ? 40.083 0.047   4.787   1.00   48.32  ? 127  ILE A O   1 
ATOM   324  C CB  . ILE A 1 40  ? 39.208 -3.057  4.507   1.00   44.83  ? 127  ILE A CB  1 
ATOM   325  C CG1 . ILE A 1 40  ? 39.848 -4.429  4.274   1.00   40.86  ? 127  ILE A CG1 1 
ATOM   326  C CG2 . ILE A 1 40  ? 39.020 -2.296  3.198   1.00   47.47  ? 127  ILE A CG2 1 
ATOM   327  C CD1 . ILE A 1 40  ? 39.213 -5.253  3.169   1.00   37.96  ? 127  ILE A CD1 1 
ATOM   328  N N   . GLN A 1 41  ? 38.411 -0.569  6.161   1.00   55.00  ? 128  GLN A N   1 
ATOM   329  C CA  . GLN A 1 41  ? 37.749 0.744   6.113   1.00   59.96  ? 128  GLN A CA  1 
ATOM   330  C C   . GLN A 1 41  ? 38.484 1.871   6.794   1.00   58.46  ? 128  GLN A C   1 
ATOM   331  O O   . GLN A 1 41  ? 38.121 3.020   6.573   1.00   53.57  ? 128  GLN A O   1 
ATOM   332  C CB  . GLN A 1 41  ? 36.302 0.755   6.611   1.00   59.92  ? 128  GLN A CB  1 
ATOM   333  C CG  . GLN A 1 41  ? 35.470 1.844   5.929   1.00   62.23  ? 128  GLN A CG  1 
ATOM   334  C CD  . GLN A 1 41  ? 35.552 1.881   4.375   1.00   66.68  ? 128  GLN A CD  1 
ATOM   335  O OE1 . GLN A 1 41  ? 35.330 2.950   3.771   1.00   71.78  ? 128  GLN A OE1 1 
ATOM   336  N NE2 . GLN A 1 41  ? 35.802 0.728   3.733   1.00   52.72  ? 128  GLN A NE2 1 
ATOM   337  N N   . ALA A 1 42  ? 39.476 1.530   7.608   1.00   60.26  ? 129  ALA A N   1 
ATOM   338  C CA  . ALA A 1 42  ? 40.390 2.519   8.174   1.00   63.44  ? 129  ALA A CA  1 
ATOM   339  C C   . ALA A 1 42  ? 41.431 3.006   7.158   1.00   65.25  ? 129  ALA A C   1 
ATOM   340  O O   . ALA A 1 42  ? 42.340 3.738   7.515   1.00   66.63  ? 129  ALA A O   1 
ATOM   341  C CB  . ALA A 1 42  ? 41.093 1.932   9.393   1.00   64.96  ? 129  ALA A CB  1 
ATOM   342  N N   . GLY A 1 43  ? 41.347 2.587   5.901   1.00   69.35  ? 130  GLY A N   1 
ATOM   343  C CA  . GLY A 1 43  ? 42.279 3.040   4.871   1.00   71.64  ? 130  GLY A CA  1 
ATOM   344  C C   . GLY A 1 43  ? 43.742 2.598   4.897   1.00   72.50  ? 130  GLY A C   1 
ATOM   345  O O   . GLY A 1 43  ? 44.546 3.123   4.123   1.00   74.65  ? 130  GLY A O   1 
ATOM   346  N N   . VAL A 1 44  ? 44.086 1.608   5.719   1.00   72.87  ? 131  VAL A N   1 
ATOM   347  C CA  . VAL A 1 44  ? 45.479 1.197   5.932   1.00   72.04  ? 131  VAL A CA  1 
ATOM   348  C C   . VAL A 1 44  ? 46.092 0.161   4.986   1.00   71.58  ? 131  VAL A C   1 
ATOM   349  O O   . VAL A 1 44  ? 47.285 -0.117  5.078   1.00   74.60  ? 131  VAL A O   1 
ATOM   350  C CB  . VAL A 1 44  ? 45.654 0.613   7.335   1.00   71.46  ? 131  VAL A CB  1 
ATOM   351  C CG1 . VAL A 1 44  ? 45.054 1.552   8.362   1.00   72.34  ? 131  VAL A CG1 1 
ATOM   352  C CG2 . VAL A 1 44  ? 45.015 -0.764  7.424   1.00   71.74  ? 131  VAL A CG2 1 
ATOM   353  N N   . VAL A 1 45  ? 45.303 -0.445  4.110   1.00   70.28  ? 132  VAL A N   1 
ATOM   354  C CA  . VAL A 1 45  ? 45.869 -1.387  3.142   1.00   68.78  ? 132  VAL A CA  1 
ATOM   355  C C   . VAL A 1 45  ? 47.013 -0.735  2.347   1.00   68.25  ? 132  VAL A C   1 
ATOM   356  O O   . VAL A 1 45  ? 48.136 -1.226  2.470   1.00   68.47  ? 132  VAL A O   1 
ATOM   357  C CB  . VAL A 1 45  ? 44.771 -2.066  2.259   1.00   66.27  ? 132  VAL A CB  1 
ATOM   358  C CG1 . VAL A 1 45  ? 45.335 -2.712  1.017   1.00   66.77  ? 132  VAL A CG1 1 
ATOM   359  C CG2 . VAL A 1 45  ? 44.057 -3.120  3.059   1.00   62.96  ? 132  VAL A CG2 1 
ATOM   360  N N   . PRO A 1 46  ? 46.790 0.365   1.618   1.00   67.81  ? 133  PRO A N   1 
ATOM   361  C CA  . PRO A 1 46  ? 47.863 0.983   0.813   1.00   68.99  ? 133  PRO A CA  1 
ATOM   362  C C   . PRO A 1 46  ? 49.109 1.315   1.618   1.00   69.22  ? 133  PRO A C   1 
ATOM   363  O O   . PRO A 1 46  ? 50.237 1.271   1.129   1.00   71.35  ? 133  PRO A O   1 
ATOM   364  C CB  . PRO A 1 46  ? 47.234 2.273   0.288   1.00   68.98  ? 133  PRO A CB  1 
ATOM   365  C CG  . PRO A 1 46  ? 45.753 1.988   0.287   1.00   68.98  ? 133  PRO A CG  1 
ATOM   366  C CD  . PRO A 1 46  ? 45.539 1.138   1.524   1.00   67.33  ? 133  PRO A CD  1 
ATOM   367  N N   . ARG A 1 47  ? 48.890 1.643   2.880   1.00   69.82  ? 134  ARG A N   1 
ATOM   368  C CA  . ARG A 1 47  ? 50.003 1.848   3.777   1.00   71.28  ? 134  ARG A CA  1 
ATOM   369  C C   . ARG A 1 47  ? 50.746 0.546   4.019   1.00   69.90  ? 134  ARG A C   1 
ATOM   370  O O   . ARG A 1 47  ? 51.968 0.533   4.014   1.00   69.60  ? 134  ARG A O   1 
ATOM   371  C CB  . ARG A 1 47  ? 49.506 2.421   5.101   1.00   74.04  ? 134  ARG A CB  1 
ATOM   372  C CG  . ARG A 1 47  ? 50.615 2.646   6.110   1.00   76.95  ? 134  ARG A CG  1 
ATOM   373  C CD  . ARG A 1 47  ? 51.682 3.607   5.596   1.00   81.06  ? 134  ARG A CD  1 
ATOM   374  N NE  . ARG A 1 47  ? 52.551 4.094   6.663   1.00   81.34  ? 134  ARG A NE  1 
ATOM   375  C CZ  . ARG A 1 47  ? 53.461 5.043   6.501   1.00   79.93  ? 134  ARG A CZ  1 
ATOM   376  N NH1 . ARG A 1 47  ? 53.627 5.621   5.315   1.00   79.51  ? 134  ARG A NH1 1 
ATOM   377  N NH2 . ARG A 1 47  ? 54.217 5.399   7.530   1.00   80.60  ? 134  ARG A NH2 1 
ATOM   378  N N   . LEU A 1 48  ? 50.023 -0.541  4.268   1.00   72.36  ? 135  LEU A N   1 
ATOM   379  C CA  . LEU A 1 48  ? 50.642 -1.862  4.455   1.00   70.66  ? 135  LEU A CA  1 
ATOM   380  C C   . LEU A 1 48  ? 51.344 -2.386  3.190   1.00   69.57  ? 135  LEU A C   1 
ATOM   381  O O   . LEU A 1 48  ? 52.321 -3.146  3.272   1.00   66.24  ? 135  LEU A O   1 
ATOM   382  C CB  . LEU A 1 48  ? 49.590 -2.878  4.892   1.00   70.43  ? 135  LEU A CB  1 
ATOM   383  C CG  . LEU A 1 48  ? 48.879 -2.627  6.217   1.00   71.27  ? 135  LEU A CG  1 
ATOM   384  C CD1 . LEU A 1 48  ? 47.736 -3.618  6.361   1.00   71.15  ? 135  LEU A CD1 1 
ATOM   385  C CD2 . LEU A 1 48  ? 49.846 -2.772  7.380   1.00   72.05  ? 135  LEU A CD2 1 
ATOM   386  N N   . VAL A 1 49  ? 50.846 -1.962  2.028   1.00   68.72  ? 136  VAL A N   1 
ATOM   387  C CA  . VAL A 1 49  ? 51.414 -2.378  0.758   1.00   70.20  ? 136  VAL A CA  1 
ATOM   388  C C   . VAL A 1 49  ? 52.809 -1.795  0.626   1.00   73.17  ? 136  VAL A C   1 
ATOM   389  O O   . VAL A 1 49  ? 53.719 -2.506  0.211   1.00   73.28  ? 136  VAL A O   1 
ATOM   390  C CB  . VAL A 1 49  ? 50.476 -2.038  -0.418  1.00   69.41  ? 136  VAL A CB  1 
ATOM   391  C CG1 . VAL A 1 49  ? 51.178 -2.016  -1.773  1.00   70.71  ? 136  VAL A CG1 1 
ATOM   392  C CG2 . VAL A 1 49  ? 49.390 -3.091  -0.470  1.00   71.84  ? 136  VAL A CG2 1 
ATOM   393  N N   . GLU A 1 50  ? 52.971 -0.529  1.009   1.00   79.17  ? 137  GLU A N   1 
ATOM   394  C CA  . GLU A 1 50  ? 54.276 0.145   1.022   1.00   82.43  ? 137  GLU A CA  1 
ATOM   395  C C   . GLU A 1 50  ? 55.292 -0.559  1.929   1.00   82.05  ? 137  GLU A C   1 
ATOM   396  O O   . GLU A 1 50  ? 56.486 -0.598  1.625   1.00   83.73  ? 137  GLU A O   1 
ATOM   397  C CB  . GLU A 1 50  ? 54.159 1.583   1.533   1.00   84.38  ? 137  GLU A CB  1 
ATOM   398  C CG  . GLU A 1 50  ? 53.341 2.536   0.681   1.00   87.50  ? 137  GLU A CG  1 
ATOM   399  C CD  . GLU A 1 50  ? 53.324 3.941   1.265   1.00   93.02  ? 137  GLU A CD  1 
ATOM   400  O OE1 . GLU A 1 50  ? 53.121 4.083   2.499   1.00   91.56  ? 137  GLU A OE1 1 
ATOM   401  O OE2 . GLU A 1 50  ? 53.524 4.907   0.486   1.00   98.56  ? 137  GLU A OE2 1 
ATOM   402  N N   . PHE A 1 51  ? 54.822 -1.106  3.042   1.00   80.25  ? 138  PHE A N   1 
ATOM   403  C CA  . PHE A 1 51  ? 55.697 -1.810  3.975   1.00   82.14  ? 138  PHE A CA  1 
ATOM   404  C C   . PHE A 1 51  ? 56.293 -3.125  3.457   1.00   82.96  ? 138  PHE A C   1 
ATOM   405  O O   . PHE A 1 51  ? 57.066 -3.783  4.168   1.00   81.29  ? 138  PHE A O   1 
ATOM   406  C CB  . PHE A 1 51  ? 54.925 -2.109  5.256   1.00   83.57  ? 138  PHE A CB  1 
ATOM   407  C CG  . PHE A 1 51  ? 54.688 -0.911  6.129   1.00   85.61  ? 138  PHE A CG  1 
ATOM   408  C CD1 . PHE A 1 51  ? 54.867 0.389   5.662   1.00   87.10  ? 138  PHE A CD1 1 
ATOM   409  C CD2 . PHE A 1 51  ? 54.271 -1.098  7.440   1.00   86.49  ? 138  PHE A CD2 1 
ATOM   410  C CE1 . PHE A 1 51  ? 54.649 1.482   6.502   1.00   86.85  ? 138  PHE A CE1 1 
ATOM   411  C CE2 . PHE A 1 51  ? 54.049 -0.016  8.278   1.00   86.67  ? 138  PHE A CE2 1 
ATOM   412  C CZ  . PHE A 1 51  ? 54.236 1.275   7.808   1.00   86.11  ? 138  PHE A CZ  1 
ATOM   413  N N   . MET A 1 52  ? 55.923 -3.507  2.234   1.00   85.91  ? 139  MET A N   1 
ATOM   414  C CA  . MET A 1 52  ? 56.391 -4.740  1.589   1.00   87.33  ? 139  MET A CA  1 
ATOM   415  C C   . MET A 1 52  ? 57.442 -4.496  0.491   1.00   89.90  ? 139  MET A C   1 
ATOM   416  O O   . MET A 1 52  ? 57.962 -5.450  -0.100  1.00   90.47  ? 139  MET A O   1 
ATOM   417  C CB  . MET A 1 52  ? 55.190 -5.499  0.999   1.00   85.02  ? 139  MET A CB  1 
ATOM   418  C CG  . MET A 1 52  ? 54.274 -6.125  2.037   1.00   80.27  ? 139  MET A CG  1 
ATOM   419  S SD  . MET A 1 52  ? 53.238 -7.405  1.343   1.00   72.36  ? 139  MET A SD  1 
ATOM   420  C CE  . MET A 1 52  ? 52.671 -6.676  -0.208  1.00   68.63  ? 139  MET A CE  1 
ATOM   421  N N   . ARG A 1 53  ? 57.753 -3.230  0.220   1.00   92.37  ? 140  ARG A N   1 
ATOM   422  C CA  . ARG A 1 53  ? 58.750 -2.878  -0.794  1.00   94.19  ? 140  ARG A CA  1 
ATOM   423  C C   . ARG A 1 53  ? 60.184 -3.308  -0.418  1.00   95.85  ? 140  ARG A C   1 
ATOM   424  O O   . ARG A 1 53  ? 60.465 -3.650  0.740   1.00   93.74  ? 140  ARG A O   1 
ATOM   425  C CB  . ARG A 1 53  ? 58.628 -1.389  -1.142  1.00   93.71  ? 140  ARG A CB  1 
ATOM   426  C CG  . ARG A 1 53  ? 57.434 -1.126  -2.069  1.00   93.54  ? 140  ARG A CG  1 
ATOM   427  C CD  . ARG A 1 53  ? 57.279 0.299   -2.549  1.00   94.44  ? 140  ARG A CD  1 
ATOM   428  N NE  . ARG A 1 53  ? 55.886 0.591   -2.875  1.00   97.40  ? 140  ARG A NE  1 
ATOM   429  C CZ  . ARG A 1 53  ? 55.285 1.761   -2.670  1.00   101.38 ? 140  ARG A CZ  1 
ATOM   430  N NH1 . ARG A 1 53  ? 55.940 2.801   -2.153  1.00   102.42 ? 140  ARG A NH1 1 
ATOM   431  N NH2 . ARG A 1 53  ? 54.004 1.905   -2.997  1.00   103.06 ? 140  ARG A NH2 1 
ATOM   432  N N   . GLU A 1 54  ? 61.072 -3.338  -1.417  1.00   97.39  ? 141  GLU A N   1 
ATOM   433  C CA  . GLU A 1 54  ? 62.466 -3.768  -1.239  1.00   96.48  ? 141  GLU A CA  1 
ATOM   434  C C   . GLU A 1 54  ? 63.163 -2.932  -0.182  1.00   96.31  ? 141  GLU A C   1 
ATOM   435  O O   . GLU A 1 54  ? 63.933 -3.455  0.636   1.00   95.12  ? 141  GLU A O   1 
ATOM   436  C CB  . GLU A 1 54  ? 63.259 -3.622  -2.538  1.00   96.19  ? 141  GLU A CB  1 
ATOM   437  C CG  . GLU A 1 54  ? 62.760 -4.482  -3.688  1.00   98.04  ? 141  GLU A CG  1 
ATOM   438  C CD  . GLU A 1 54  ? 63.316 -4.029  -5.021  1.00   96.91  ? 141  GLU A CD  1 
ATOM   439  O OE1 . GLU A 1 54  ? 64.514 -4.266  -5.241  1.00   98.04  ? 141  GLU A OE1 1 
ATOM   440  O OE2 . GLU A 1 54  ? 62.582 -3.422  -5.830  1.00   95.36  ? 141  GLU A OE2 1 
ATOM   441  N N   . ASN A 1 55  ? 62.865 -1.632  -0.227  1.00   96.36  ? 142  ASN A N   1 
ATOM   442  C CA  . ASN A 1 55  ? 63.425 -0.634  0.692   1.00   97.15  ? 142  ASN A CA  1 
ATOM   443  C C   . ASN A 1 55  ? 62.889 -0.595  2.127   1.00   95.85  ? 142  ASN A C   1 
ATOM   444  O O   . ASN A 1 55  ? 62.755 0.479   2.730   1.00   93.87  ? 142  ASN A O   1 
ATOM   445  C CB  . ASN A 1 55  ? 63.403 0.782   0.071   1.00   98.24  ? 142  ASN A CB  1 
ATOM   446  C CG  . ASN A 1 55  ? 62.040 1.199   -0.425  1.00   100.55 ? 142  ASN A CG  1 
ATOM   447  O OD1 . ASN A 1 55  ? 61.166 1.557   0.363   1.00   102.62 ? 142  ASN A OD1 1 
ATOM   448  N ND2 . ASN A 1 55  ? 61.859 1.171   -1.742  1.00   101.28 ? 142  ASN A ND2 1 
ATOM   449  N N   . GLN A 1 56  ? 62.647 -1.781  2.681   1.00   94.20  ? 143  GLN A N   1 
ATOM   450  C CA  . GLN A 1 56  ? 62.028 -1.906  3.992   1.00   91.89  ? 143  GLN A CA  1 
ATOM   451  C C   . GLN A 1 56  ? 62.669 -3.044  4.778   1.00   89.69  ? 143  GLN A C   1 
ATOM   452  O O   . GLN A 1 56  ? 63.173 -4.000  4.185   1.00   89.76  ? 143  GLN A O   1 
ATOM   453  C CB  . GLN A 1 56  ? 60.524 -2.162  3.826   1.00   92.47  ? 143  GLN A CB  1 
ATOM   454  C CG  . GLN A 1 56  ? 59.748 -1.088  3.031   1.00   93.40  ? 143  GLN A CG  1 
ATOM   455  C CD  . GLN A 1 56  ? 59.452 0.181   3.828   1.00   93.29  ? 143  GLN A CD  1 
ATOM   456  O OE1 . GLN A 1 56  ? 59.422 0.158   5.064   1.00   92.45  ? 143  GLN A OE1 1 
ATOM   457  N NE2 . GLN A 1 56  ? 59.213 1.282   3.118   1.00   90.69  ? 143  GLN A NE2 1 
ATOM   458  N N   . PRO A 1 57  ? 62.676 -2.927  6.106   1.00   88.74  ? 144  PRO A N   1 
ATOM   459  C CA  . PRO A 1 57  ? 63.198 -3.991  6.974   1.00   89.70  ? 144  PRO A CA  1 
ATOM   460  C C   . PRO A 1 57  ? 62.631 -5.368  6.657   1.00   91.80  ? 144  PRO A C   1 
ATOM   461  O O   . PRO A 1 57  ? 61.521 -5.480  6.141   1.00   92.19  ? 144  PRO A O   1 
ATOM   462  C CB  . PRO A 1 57  ? 62.788 -3.539  8.384   1.00   87.31  ? 144  PRO A CB  1 
ATOM   463  C CG  . PRO A 1 57  ? 62.739 -2.064  8.285   1.00   86.95  ? 144  PRO A CG  1 
ATOM   464  C CD  . PRO A 1 57  ? 62.266 -1.748  6.890   1.00   87.63  ? 144  PRO A CD  1 
ATOM   465  N N   . GLU A 1 58  ? 63.410 -6.407  6.937   1.00   94.08  ? 145  GLU A N   1 
ATOM   466  C CA  . GLU A 1 58  ? 62.936 -7.768  6.719   1.00   95.50  ? 145  GLU A CA  1 
ATOM   467  C C   . GLU A 1 58  ? 61.815 -8.062  7.722   1.00   94.38  ? 145  GLU A C   1 
ATOM   468  O O   . GLU A 1 58  ? 60.859 -8.762  7.391   1.00   94.21  ? 145  GLU A O   1 
ATOM   469  C CB  . GLU A 1 58  ? 64.082 -8.793  6.826   1.00   96.52  ? 145  GLU A CB  1 
ATOM   470  C CG  . GLU A 1 58  ? 63.662 -10.265 6.748   1.00   98.91  ? 145  GLU A CG  1 
ATOM   471  C CD  . GLU A 1 58  ? 63.203 -10.731 5.366   1.00   101.41 ? 145  GLU A CD  1 
ATOM   472  O OE1 . GLU A 1 58  ? 62.143 -10.260 4.890   1.00   102.73 ? 145  GLU A OE1 1 
ATOM   473  O OE2 . GLU A 1 58  ? 63.885 -11.590 4.747   1.00   101.92 ? 145  GLU A OE2 1 
ATOM   474  N N   . MET A 1 59  ? 61.909 -7.511  8.929   1.00   93.00  ? 146  MET A N   1 
ATOM   475  C CA  . MET A 1 59  ? 60.914 -7.802  9.964   1.00   92.68  ? 146  MET A CA  1 
ATOM   476  C C   . MET A 1 59  ? 59.585 -7.073  9.763   1.00   90.13  ? 146  MET A C   1 
ATOM   477  O O   . MET A 1 59  ? 58.552 -7.504  10.291  1.00   86.46  ? 146  MET A O   1 
ATOM   478  C CB  . MET A 1 59  ? 61.478 -7.492  11.354  1.00   94.72  ? 146  MET A CB  1 
ATOM   479  C CG  . MET A 1 59  ? 60.737 -8.179  12.505  1.00   97.26  ? 146  MET A CG  1 
ATOM   480  S SD  . MET A 1 59  ? 60.289 -9.939  12.198  1.00   102.39 ? 146  MET A SD  1 
ATOM   481  C CE  . MET A 1 59  ? 61.686 -10.848 12.911  1.00   98.62  ? 146  MET A CE  1 
ATOM   482  N N   . LEU A 1 60  ? 59.629 -5.976  9.006   1.00   88.51  ? 147  LEU A N   1 
ATOM   483  C CA  . LEU A 1 60  ? 58.449 -5.153  8.743   1.00   87.28  ? 147  LEU A CA  1 
ATOM   484  C C   . LEU A 1 60  ? 57.696 -5.745  7.564   1.00   86.46  ? 147  LEU A C   1 
ATOM   485  O O   . LEU A 1 60  ? 56.487 -5.936  7.641   1.00   87.23  ? 147  LEU A O   1 
ATOM   486  C CB  . LEU A 1 60  ? 58.827 -3.692  8.461   1.00   86.38  ? 147  LEU A CB  1 
ATOM   487  C CG  . LEU A 1 60  ? 57.670 -2.697  8.348   1.00   85.77  ? 147  LEU A CG  1 
ATOM   488  C CD1 . LEU A 1 60  ? 56.929 -2.621  9.655   1.00   85.52  ? 147  LEU A CD1 1 
ATOM   489  C CD2 . LEU A 1 60  ? 58.138 -1.304  7.965   1.00   86.46  ? 147  LEU A CD2 1 
ATOM   490  N N   . GLN A 1 61  ? 58.419 -5.990  6.475   1.00   85.47  ? 148  GLN A N   1 
ATOM   491  C CA  . GLN A 1 61  ? 57.909 -6.705  5.303   1.00   83.99  ? 148  GLN A CA  1 
ATOM   492  C C   . GLN A 1 61  ? 57.115 -7.944  5.709   1.00   81.03  ? 148  GLN A C   1 
ATOM   493  O O   . GLN A 1 61  ? 56.035 -8.178  5.180   1.00   80.67  ? 148  GLN A O   1 
ATOM   494  C CB  . GLN A 1 61  ? 59.073 -7.138  4.399   1.00   85.15  ? 148  GLN A CB  1 
ATOM   495  C CG  . GLN A 1 61  ? 59.748 -6.016  3.579   1.00   84.97  ? 148  GLN A CG  1 
ATOM   496  C CD  . GLN A 1 61  ? 60.829 -6.541  2.640   1.00   82.48  ? 148  GLN A CD  1 
ATOM   497  O OE1 . GLN A 1 61  ? 61.580 -7.446  3.019   1.00   80.84  ? 148  GLN A OE1 1 
ATOM   498  N NE2 . GLN A 1 61  ? 60.899 -5.996  1.422   1.00   78.82  ? 148  GLN A NE2 1 
ATOM   499  N N   . LEU A 1 62  ? 57.644 -8.722  6.648   1.00   78.91  ? 149  LEU A N   1 
ATOM   500  C CA  . LEU A 1 62  ? 56.983 -9.941  7.093   1.00   77.30  ? 149  LEU A CA  1 
ATOM   501  C C   . LEU A 1 62  ? 55.617 -9.601  7.692   1.00   78.89  ? 149  LEU A C   1 
ATOM   502  O O   . LEU A 1 62  ? 54.609 -10.201 7.314   1.00   81.94  ? 149  LEU A O   1 
ATOM   503  C CB  . LEU A 1 62  ? 57.823 -10.687 8.131   1.00   76.61  ? 149  LEU A CB  1 
ATOM   504  C CG  . LEU A 1 62  ? 57.130 -11.773 8.959   1.00   76.96  ? 149  LEU A CG  1 
ATOM   505  C CD1 . LEU A 1 62  ? 56.547 -12.829 8.037   1.00   78.40  ? 149  LEU A CD1 1 
ATOM   506  C CD2 . LEU A 1 62  ? 58.077 -12.432 9.950   1.00   76.60  ? 149  LEU A CD2 1 
ATOM   507  N N   . GLU A 1 63  ? 55.581 -8.664  8.634   1.00   76.02  ? 150  GLU A N   1 
ATOM   508  C CA  . GLU A 1 63  ? 54.340 -8.336  9.329   1.00   73.66  ? 150  GLU A CA  1 
ATOM   509  C C   . GLU A 1 63  ? 53.298 -7.695  8.409   1.00   71.64  ? 150  GLU A C   1 
ATOM   510  O O   . GLU A 1 63  ? 52.111 -7.949  8.536   1.00   71.06  ? 150  GLU A O   1 
ATOM   511  C CB  . GLU A 1 63  ? 54.620 -7.425  10.529  1.00   73.63  ? 150  GLU A CB  1 
ATOM   512  C CG  . GLU A 1 63  ? 55.400 -8.079  11.661  1.00   73.84  ? 150  GLU A CG  1 
ATOM   513  C CD  . GLU A 1 63  ? 54.569 -9.082  12.451  1.00   76.03  ? 150  GLU A CD  1 
ATOM   514  O OE1 . GLU A 1 63  ? 53.320 -9.003  12.416  1.00   70.66  ? 150  GLU A OE1 1 
ATOM   515  O OE2 . GLU A 1 63  ? 55.161 -9.963  13.119  1.00   78.52  ? 150  GLU A OE2 1 
ATOM   516  N N   . ALA A 1 64  ? 53.734 -6.865  7.477   1.00   69.85  ? 151  ALA A N   1 
ATOM   517  C CA  . ALA A 1 64  ? 52.815 -6.200  6.565   1.00   68.40  ? 151  ALA A CA  1 
ATOM   518  C C   . ALA A 1 64  ? 52.194 -7.234  5.634   1.00   69.40  ? 151  ALA A C   1 
ATOM   519  O O   . ALA A 1 64  ? 50.984 -7.236  5.401   1.00   71.97  ? 151  ALA A O   1 
ATOM   520  C CB  . ALA A 1 64  ? 53.553 -5.164  5.750   1.00   66.43  ? 151  ALA A CB  1 
ATOM   521  N N   . ALA A 1 65  ? 53.048 -8.082  5.072   1.00   67.57  ? 152  ALA A N   1 
ATOM   522  C CA  . ALA A 1 65  ? 52.620 -9.149  4.184   1.00   64.73  ? 152  ALA A CA  1 
ATOM   523  C C   . ALA A 1 65  ? 51.691 -10.155 4.863   1.00   61.33  ? 152  ALA A C   1 
ATOM   524  O O   . ALA A 1 65  ? 50.774 -10.635 4.220   1.00   57.52  ? 152  ALA A O   1 
ATOM   525  C CB  . ALA A 1 65  ? 53.831 -9.846  3.610   1.00   64.37  ? 152  ALA A CB  1 
ATOM   526  N N   . TRP A 1 66  ? 51.947 -10.462 6.132   1.00   60.57  ? 153  TRP A N   1 
ATOM   527  C CA  . TRP A 1 66  ? 51.164 -11.409 6.918   1.00   62.04  ? 153  TRP A CA  1 
ATOM   528  C C   . TRP A 1 66  ? 49.779 -10.796 7.201   1.00   64.86  ? 153  TRP A C   1 
ATOM   529  O O   . TRP A 1 66  ? 48.743 -11.464 7.113   1.00   66.09  ? 153  TRP A O   1 
ATOM   530  C CB  . TRP A 1 66  ? 51.923 -11.767 8.211   1.00   62.45  ? 153  TRP A CB  1 
ATOM   531  C CG  . TRP A 1 66  ? 51.290 -12.808 9.087   1.00   62.81  ? 153  TRP A CG  1 
ATOM   532  C CD1 . TRP A 1 66  ? 50.092 -13.424 8.888   1.00   65.68  ? 153  TRP A CD1 1 
ATOM   533  C CD2 . TRP A 1 66  ? 51.816 -13.360 10.308  1.00   63.87  ? 153  TRP A CD2 1 
ATOM   534  N NE1 . TRP A 1 66  ? 49.838 -14.324 9.896   1.00   69.28  ? 153  TRP A NE1 1 
ATOM   535  C CE2 . TRP A 1 66  ? 50.877 -14.301 10.788  1.00   65.75  ? 153  TRP A CE2 1 
ATOM   536  C CE3 . TRP A 1 66  ? 52.989 -13.162 11.043  1.00   64.05  ? 153  TRP A CE3 1 
ATOM   537  C CZ2 . TRP A 1 66  ? 51.063 -15.027 11.966  1.00   66.85  ? 153  TRP A CZ2 1 
ATOM   538  C CZ3 . TRP A 1 66  ? 53.176 -13.876 12.219  1.00   64.93  ? 153  TRP A CZ3 1 
ATOM   539  C CH2 . TRP A 1 66  ? 52.219 -14.802 12.668  1.00   67.96  ? 153  TRP A CH2 1 
ATOM   540  N N   . ALA A 1 67  ? 49.749 -9.501  7.501   1.00   65.32  ? 154  ALA A N   1 
ATOM   541  C CA  . ALA A 1 67  ? 48.499 -8.787  7.743   1.00   62.35  ? 154  ALA A CA  1 
ATOM   542  C C   . ALA A 1 67  ? 47.663 -8.772  6.471   1.00   60.23  ? 154  ALA A C   1 
ATOM   543  O O   . ALA A 1 67  ? 46.493 -9.136  6.479   1.00   60.36  ? 154  ALA A O   1 
ATOM   544  C CB  . ALA A 1 67  ? 48.783 -7.365  8.199   1.00   62.00  ? 154  ALA A CB  1 
ATOM   545  N N   . LEU A 1 68  ? 48.276 -8.352  5.375   1.00   57.83  ? 155  LEU A N   1 
ATOM   546  C CA  . LEU A 1 68  ? 47.589 -8.326  4.097   1.00   59.87  ? 155  LEU A CA  1 
ATOM   547  C C   . LEU A 1 68  ? 47.059 -9.703  3.691   1.00   61.13  ? 155  LEU A C   1 
ATOM   548  O O   . LEU A 1 68  ? 46.047 -9.806  3.009   1.00   63.17  ? 155  LEU A O   1 
ATOM   549  C CB  . LEU A 1 68  ? 48.539 -7.833  3.009   1.00   59.54  ? 155  LEU A CB  1 
ATOM   550  C CG  . LEU A 1 68  ? 48.713 -6.321  2.994   1.00   63.75  ? 155  LEU A CG  1 
ATOM   551  C CD1 . LEU A 1 68  ? 49.766 -5.941  1.975   1.00   66.49  ? 155  LEU A CD1 1 
ATOM   552  C CD2 . LEU A 1 68  ? 47.396 -5.628  2.639   1.00   64.12  ? 155  LEU A CD2 1 
ATOM   553  N N   . THR A 1 69  ? 47.768 -10.754 4.072   1.00   57.57  ? 156  THR A N   1 
ATOM   554  C CA  . THR A 1 69  ? 47.421 -12.099 3.647   1.00   56.33  ? 156  THR A CA  1 
ATOM   555  C C   . THR A 1 69  ? 46.128 -12.498 4.333   1.00   52.62  ? 156  THR A C   1 
ATOM   556  O O   . THR A 1 69  ? 45.232 -13.079 3.711   1.00   46.95  ? 156  THR A O   1 
ATOM   557  C CB  . THR A 1 69  ? 48.580 -13.082 3.973   1.00   54.81  ? 156  THR A CB  1 
ATOM   558  O OG1 . THR A 1 69  ? 49.493 -13.083 2.870   1.00   50.72  ? 156  THR A OG1 1 
ATOM   559  C CG2 . THR A 1 69  ? 48.103 -14.510 3.993   1.00   56.47  ? 156  THR A CG2 1 
ATOM   560  N N   . ASN A 1 70  ? 46.084 -12.180 5.623   1.00   50.64  ? 157  ASN A N   1 
ATOM   561  C CA  . ASN A 1 70  ? 44.895 -12.392 6.430   1.00   50.80  ? 157  ASN A CA  1 
ATOM   562  C C   . ASN A 1 70  ? 43.674 -11.691 5.822   1.00   47.68  ? 157  ASN A C   1 
ATOM   563  O O   . ASN A 1 70  ? 42.552 -12.172 5.975   1.00   50.68  ? 157  ASN A O   1 
ATOM   564  C CB  . ASN A 1 70  ? 45.131 -11.911 7.869   1.00   50.62  ? 157  ASN A CB  1 
ATOM   565  C CG  . ASN A 1 70  ? 45.769 -12.968 8.742   1.00   50.53  ? 157  ASN A CG  1 
ATOM   566  O OD1 . ASN A 1 70  ? 45.922 -14.125 8.344   1.00   49.71  ? 157  ASN A OD1 1 
ATOM   567  N ND2 . ASN A 1 70  ? 46.161 -12.570 9.946   1.00   49.68  ? 157  ASN A ND2 1 
ATOM   568  N N   . ILE A 1 71  ? 43.911 -10.587 5.115   1.00   44.19  ? 158  ILE A N   1 
ATOM   569  C CA  . ILE A 1 71  ? 42.868 -9.824  4.432   1.00   41.08  ? 158  ILE A CA  1 
ATOM   570  C C   . ILE A 1 71  ? 42.488 -10.519 3.150   1.00   40.88  ? 158  ILE A C   1 
ATOM   571  O O   . ILE A 1 71  ? 41.299 -10.739 2.877   1.00   43.65  ? 158  ILE A O   1 
ATOM   572  C CB  . ILE A 1 71  ? 43.339 -8.385  4.145   1.00   38.61  ? 158  ILE A CB  1 
ATOM   573  C CG1 . ILE A 1 71  ? 43.472 -7.625  5.472   1.00   38.11  ? 158  ILE A CG1 1 
ATOM   574  C CG2 . ILE A 1 71  ? 42.385 -7.669  3.190   1.00   39.34  ? 158  ILE A CG2 1 
ATOM   575  C CD1 . ILE A 1 71  ? 43.893 -6.175  5.348   1.00   36.55  ? 158  ILE A CD1 1 
ATOM   576  N N   . ALA A 1 72  ? 43.511 -10.905 2.394   1.00   42.73  ? 159  ALA A N   1 
ATOM   577  C CA  . ALA A 1 72  ? 43.348 -11.527 1.074   1.00   41.78  ? 159  ALA A CA  1 
ATOM   578  C C   . ALA A 1 72  ? 42.779 -12.942 1.150   1.00   42.07  ? 159  ALA A C   1 
ATOM   579  O O   . ALA A 1 72  ? 42.394 -13.516 0.130   1.00   37.63  ? 159  ALA A O   1 
ATOM   580  C CB  . ALA A 1 72  ? 44.655 -11.565 0.366   1.00   41.41  ? 159  ALA A CB  1 
ATOM   581  N N   . SER A 1 73  ? 42.748 -13.501 2.355   1.00   40.38  ? 160  SER A N   1 
ATOM   582  C CA  . SER A 1 73  ? 42.225 -14.837 2.516   1.00   44.44  ? 160  SER A CA  1 
ATOM   583  C C   . SER A 1 73  ? 40.836 -14.790 3.159   1.00   45.72  ? 160  SER A C   1 
ATOM   584  O O   . SER A 1 73  ? 40.341 -15.778 3.732   1.00   41.32  ? 160  SER A O   1 
ATOM   585  C CB  . SER A 1 73  ? 43.212 -15.666 3.339   1.00   45.71  ? 160  SER A CB  1 
ATOM   586  O OG  . SER A 1 73  ? 42.906 -15.531 4.717   1.00   49.72  ? 160  SER A OG  1 
ATOM   587  N N   . GLY A 1 74  ? 40.196 -13.631 3.034   1.00   47.54  ? 161  GLY A N   1 
ATOM   588  C CA  . GLY A 1 74  ? 38.835 -13.469 3.513   1.00   45.64  ? 161  GLY A CA  1 
ATOM   589  C C   . GLY A 1 74  ? 37.877 -13.650 2.353   1.00   43.44  ? 161  GLY A C   1 
ATOM   590  O O   . GLY A 1 74  ? 38.013 -14.626 1.607   1.00   44.40  ? 161  GLY A O   1 
ATOM   591  N N   . THR A 1 75  ? 36.964 -12.692 2.187   1.00   39.76  ? 162  THR A N   1 
ATOM   592  C CA  . THR A 1 75  ? 35.938 -12.753 1.156   1.00   40.05  ? 162  THR A CA  1 
ATOM   593  C C   . THR A 1 75  ? 36.486 -12.229 -0.143  1.00   37.98  ? 162  THR A C   1 
ATOM   594  O O   . THR A 1 75  ? 37.387 -11.403 -0.187  1.00   36.96  ? 162  THR A O   1 
ATOM   595  C CB  . THR A 1 75  ? 34.679 -11.886 1.478   1.00   41.21  ? 162  THR A CB  1 
ATOM   596  O OG1 . THR A 1 75  ? 35.028 -10.503 1.644   1.00   41.87  ? 162  THR A OG1 1 
ATOM   597  C CG2 . THR A 1 75  ? 34.017 -12.264 2.799   1.00   38.98  ? 162  THR A CG2 1 
ATOM   598  N N   . SER A 1 76  ? 35.838 -12.650 -1.211  1.00   39.92  ? 163  SER A N   1 
ATOM   599  C CA  . SER A 1 76  ? 36.168 -12.165 -2.543  1.00   41.92  ? 163  SER A CA  1 
ATOM   600  C C   . SER A 1 76  ? 36.362 -10.640 -2.617  1.00   38.19  ? 163  SER A C   1 
ATOM   601  O O   . SER A 1 76  ? 37.210 -10.162 -3.367  1.00   40.10  ? 163  SER A O   1 
ATOM   602  C CB  . SER A 1 76  ? 35.085 -12.694 -3.511  1.00   44.06  ? 163  SER A CB  1 
ATOM   603  O OG  . SER A 1 76  ? 35.277 -12.144 -4.795  1.00   53.47  ? 163  SER A OG  1 
ATOM   604  N N   . ALA A 1 77  ? 35.568 -9.878  -1.862  1.00   41.59  ? 164  ALA A N   1 
ATOM   605  C CA  . ALA A 1 77  ? 35.669 -8.405  -1.831  1.00   42.30  ? 164  ALA A CA  1 
ATOM   606  C C   . ALA A 1 77  ? 36.858 -7.861  -1.040  1.00   43.30  ? 164  ALA A C   1 
ATOM   607  O O   . ALA A 1 77  ? 37.370 -6.772  -1.331  1.00   44.28  ? 164  ALA A O   1 
ATOM   608  C CB  . ALA A 1 77  ? 34.381 -7.764  -1.296  1.00   38.35  ? 164  ALA A CB  1 
ATOM   609  N N   . GLN A 1 78  ? 37.242 -8.594  0.000   1.00   43.83  ? 165  GLN A N   1 
ATOM   610  C CA  . GLN A 1 78  ? 38.411 -8.255  0.809   1.00   45.63  ? 165  GLN A CA  1 
ATOM   611  C C   . GLN A 1 78  ? 39.738 -8.681  0.162   1.00   47.17  ? 165  GLN A C   1 
ATOM   612  O O   . GLN A 1 78  ? 40.805 -8.172  0.521   1.00   47.17  ? 165  GLN A O   1 
ATOM   613  C CB  . GLN A 1 78  ? 38.290 -8.875  2.198   1.00   44.21  ? 165  GLN A CB  1 
ATOM   614  C CG  . GLN A 1 78  ? 37.068 -8.432  2.912   1.00   43.77  ? 165  GLN A CG  1 
ATOM   615  C CD  . GLN A 1 78  ? 36.756 -9.276  4.115   1.00   46.92  ? 165  GLN A CD  1 
ATOM   616  O OE1 . GLN A 1 78  ? 37.069 -10.461 4.153   1.00   48.27  ? 165  GLN A OE1 1 
ATOM   617  N NE2 . GLN A 1 78  ? 36.117 -8.669  5.108   1.00   47.33  ? 165  GLN A NE2 1 
ATOM   618  N N   . THR A 1 79  ? 39.651 -9.635  -0.764  1.00   47.61  ? 166  THR A N   1 
ATOM   619  C CA  . THR A 1 79  ? 40.763 -10.039 -1.615  1.00   47.87  ? 166  THR A CA  1 
ATOM   620  C C   . THR A 1 79  ? 40.917 -8.968  -2.660  1.00   49.20  ? 166  THR A C   1 
ATOM   621  O O   . THR A 1 79  ? 42.030 -8.533  -2.934  1.00   53.49  ? 166  THR A O   1 
ATOM   622  C CB  . THR A 1 79  ? 40.466 -11.364 -2.326  1.00   46.49  ? 166  THR A CB  1 
ATOM   623  O OG1 . THR A 1 79  ? 40.478 -12.421 -1.361  1.00   43.35  ? 166  THR A OG1 1 
ATOM   624  C CG2 . THR A 1 79  ? 41.568 -11.745 -3.295  1.00   47.50  ? 166  THR A CG2 1 
ATOM   625  N N   . LYS A 1 80  ? 39.786 -8.529  -3.204  1.00   51.70  ? 167  LYS A N   1 
ATOM   626  C CA  . LYS A 1 80  ? 39.772 -7.507  -4.245  1.00   55.25  ? 167  LYS A CA  1 
ATOM   627  C C   . LYS A 1 80  ? 40.443 -6.257  -3.747  1.00   55.25  ? 167  LYS A C   1 
ATOM   628  O O   . LYS A 1 80  ? 41.098 -5.586  -4.519  1.00   58.38  ? 167  LYS A O   1 
ATOM   629  C CB  . LYS A 1 80  ? 38.339 -7.167  -4.666  1.00   55.75  ? 167  LYS A CB  1 
ATOM   630  C CG  . LYS A 1 80  ? 38.167 -5.844  -5.398  1.00   57.35  ? 167  LYS A CG  1 
ATOM   631  C CD  . LYS A 1 80  ? 36.810 -5.807  -6.125  1.00   58.92  ? 167  LYS A CD  1 
ATOM   632  C CE  . LYS A 1 80  ? 36.627 -4.521  -6.914  1.00   60.20  ? 167  LYS A CE  1 
ATOM   633  N NZ  . LYS A 1 80  ? 37.665 -4.352  -7.988  1.00   61.22  ? 167  LYS A NZ  1 
ATOM   634  N N   . VAL A 1 81  ? 40.287 -5.948  -2.466  1.00   56.26  ? 168  VAL A N   1 
ATOM   635  C CA  . VAL A 1 81  ? 40.874 -4.720  -1.968  1.00   57.54  ? 168  VAL A CA  1 
ATOM   636  C C   . VAL A 1 81  ? 42.380 -4.821  -2.104  1.00   57.69  ? 168  VAL A C   1 
ATOM   637  O O   . VAL A 1 81  ? 42.999 -3.889  -2.618  1.00   59.97  ? 168  VAL A O   1 
ATOM   638  C CB  . VAL A 1 81  ? 40.492 -4.422  -0.521  1.00   57.86  ? 168  VAL A CB  1 
ATOM   639  C CG1 . VAL A 1 81  ? 41.253 -3.200  -0.007  1.00   57.10  ? 168  VAL A CG1 1 
ATOM   640  C CG2 . VAL A 1 81  ? 39.006 -4.174  -0.411  1.00   54.99  ? 168  VAL A CG2 1 
ATOM   641  N N   . VAL A 1 82  ? 42.934 -5.959  -1.687  1.00   57.54  ? 169  VAL A N   1 
ATOM   642  C CA  . VAL A 1 82  ? 44.377 -6.208  -1.709  1.00   55.27  ? 169  VAL A CA  1 
ATOM   643  C C   . VAL A 1 82  ? 44.924 -6.171  -3.118  1.00   51.84  ? 169  VAL A C   1 
ATOM   644  O O   . VAL A 1 82  ? 46.010 -5.654  -3.330  1.00   49.66  ? 169  VAL A O   1 
ATOM   645  C CB  . VAL A 1 82  ? 44.699 -7.536  -1.019  1.00   59.33  ? 169  VAL A CB  1 
ATOM   646  C CG1 . VAL A 1 82  ? 46.165 -7.963  -1.192  1.00   61.69  ? 169  VAL A CG1 1 
ATOM   647  C CG2 . VAL A 1 82  ? 44.388 -7.414  0.466   1.00   60.17  ? 169  VAL A CG2 1 
ATOM   648  N N   . VAL A 1 83  ? 44.136 -6.631  -4.082  1.00   53.64  ? 170  VAL A N   1 
ATOM   649  C CA  . VAL A 1 83  ? 44.578 -6.664  -5.475  1.00   56.70  ? 170  VAL A CA  1 
ATOM   650  C C   . VAL A 1 83  ? 44.555 -5.265  -6.049  1.00   59.43  ? 170  VAL A C   1 
ATOM   651  O O   . VAL A 1 83  ? 45.451 -4.913  -6.792  1.00   64.87  ? 170  VAL A O   1 
ATOM   652  C CB  . VAL A 1 83  ? 43.710 -7.606  -6.348  1.00   55.70  ? 170  VAL A CB  1 
ATOM   653  C CG1 . VAL A 1 83  ? 43.937 -7.412  -7.849  1.00   52.10  ? 170  VAL A CG1 1 
ATOM   654  C CG2 . VAL A 1 83  ? 43.985 -9.053  -5.968  1.00   57.57  ? 170  VAL A CG2 1 
ATOM   655  N N   . ASP A 1 84  ? 43.547 -4.476  -5.695  1.00   63.39  ? 171  ASP A N   1 
ATOM   656  C CA  . ASP A 1 84  ? 43.382 -3.105  -6.184  1.00   63.12  ? 171  ASP A CA  1 
ATOM   657  C C   . ASP A 1 84  ? 44.479 -2.188  -5.613  1.00   62.86  ? 171  ASP A C   1 
ATOM   658  O O   . ASP A 1 84  ? 44.786 -1.157  -6.181  1.00   61.97  ? 171  ASP A O   1 
ATOM   659  C CB  . ASP A 1 84  ? 41.974 -2.568  -5.853  1.00   62.76  ? 171  ASP A CB  1 
ATOM   660  C CG  . ASP A 1 84  ? 40.845 -3.200  -6.703  1.00   65.66  ? 171  ASP A CG  1 
ATOM   661  O OD1 . ASP A 1 84  ? 41.112 -3.731  -7.798  1.00   69.65  ? 171  ASP A OD1 1 
ATOM   662  O OD2 . ASP A 1 84  ? 39.631 -3.212  -6.379  1.00   61.63  ? 171  ASP A OD2 1 
ATOM   663  N N   . ALA A 1 85  ? 45.097 -2.578  -4.506  1.00   64.48  ? 172  ALA A N   1 
ATOM   664  C CA  . ALA A 1 85  ? 46.188 -1.824  -3.907  1.00   65.68  ? 172  ALA A CA  1 
ATOM   665  C C   . ALA A 1 85  ? 47.536 -2.154  -4.537  1.00   69.04  ? 172  ALA A C   1 
ATOM   666  O O   . ALA A 1 85  ? 48.598 -1.798  -3.991  1.00   67.94  ? 172  ALA A O   1 
ATOM   667  C CB  . ALA A 1 85  ? 46.245 -2.155  -2.434  1.00   66.36  ? 172  ALA A CB  1 
ATOM   668  N N   . ASP A 1 86  ? 47.488 -2.878  -5.655  1.00   71.86  ? 173  ASP A N   1 
ATOM   669  C CA  . ASP A 1 86  ? 48.683 -3.362  -6.360  1.00   71.50  ? 173  ASP A CA  1 
ATOM   670  C C   . ASP A 1 86  ? 49.655 -4.111  -5.425  1.00   66.59  ? 173  ASP A C   1 
ATOM   671  O O   . ASP A 1 86  ? 50.835 -3.801  -5.341  1.00   64.75  ? 173  ASP A O   1 
ATOM   672  C CB  . ASP A 1 86  ? 49.347 -2.215  -7.143  1.00   72.49  ? 173  ASP A CB  1 
ATOM   673  C CG  . ASP A 1 86  ? 50.232 -2.720  -8.273  1.00   79.05  ? 173  ASP A CG  1 
ATOM   674  O OD1 . ASP A 1 86  ? 49.693 -3.331  -9.230  1.00   83.20  ? 173  ASP A OD1 1 
ATOM   675  O OD2 . ASP A 1 86  ? 51.480 -2.573  -8.274  1.00   80.61  ? 173  ASP A OD2 1 
ATOM   676  N N   . ALA A 1 87  ? 49.144 -5.104  -4.707  1.00   65.69  ? 174  ALA A N   1 
ATOM   677  C CA  . ALA A 1 87  ? 49.971 -5.894  -3.785  1.00   66.02  ? 174  ALA A CA  1 
ATOM   678  C C   . ALA A 1 87  ? 50.600 -7.139  -4.407  1.00   66.88  ? 174  ALA A C   1 
ATOM   679  O O   . ALA A 1 87  ? 51.556 -7.701  -3.843  1.00   66.40  ? 174  ALA A O   1 
ATOM   680  C CB  . ALA A 1 87  ? 49.153 -6.329  -2.595  1.00   63.67  ? 174  ALA A CB  1 
ATOM   681  N N   . VAL A 1 88  ? 50.059 -7.574  -5.543  1.00   64.33  ? 175  VAL A N   1 
ATOM   682  C CA  . VAL A 1 88  ? 50.491 -8.841  -6.117  1.00   64.49  ? 175  VAL A CA  1 
ATOM   683  C C   . VAL A 1 88  ? 51.941 -8.811  -6.570  1.00   65.38  ? 175  VAL A C   1 
ATOM   684  O O   . VAL A 1 88  ? 52.708 -9.688  -6.191  1.00   63.16  ? 175  VAL A O   1 
ATOM   685  C CB  . VAL A 1 88  ? 49.539 -9.325  -7.226  1.00   62.72  ? 175  VAL A CB  1 
ATOM   686  C CG1 . VAL A 1 88  ? 50.228 -10.312 -8.141  1.00   59.96  ? 175  VAL A CG1 1 
ATOM   687  C CG2 . VAL A 1 88  ? 48.301 -9.970  -6.603  1.00   60.58  ? 175  VAL A CG2 1 
ATOM   688  N N   . PRO A 1 89  ? 52.324 -7.818  -7.365  1.00   68.45  ? 176  PRO A N   1 
ATOM   689  C CA  . PRO A 1 89  ? 53.718 -7.726  -7.817  1.00   69.14  ? 176  PRO A CA  1 
ATOM   690  C C   . PRO A 1 89  ? 54.749 -7.637  -6.690  1.00   66.27  ? 176  PRO A C   1 
ATOM   691  O O   . PRO A 1 89  ? 55.881 -8.076  -6.893  1.00   65.58  ? 176  PRO A O   1 
ATOM   692  C CB  . PRO A 1 89  ? 53.732 -6.512  -8.762  1.00   69.14  ? 176  PRO A CB  1 
ATOM   693  C CG  . PRO A 1 89  ? 52.471 -5.825  -8.568  1.00   70.82  ? 176  PRO A CG  1 
ATOM   694  C CD  . PRO A 1 89  ? 51.479 -6.766  -7.947  1.00   69.49  ? 176  PRO A CD  1 
ATOM   695  N N   . LEU A 1 90  ? 54.356 -7.150  -5.520  1.00   65.36  ? 177  LEU A N   1 
ATOM   696  C CA  . LEU A 1 90  ? 55.274 -7.084  -4.379  1.00   66.44  ? 177  LEU A CA  1 
ATOM   697  C C   . LEU A 1 90  ? 55.295 -8.383  -3.597  1.00   66.26  ? 177  LEU A C   1 
ATOM   698  O O   . LEU A 1 90  ? 56.267 -8.710  -2.909  1.00   65.78  ? 177  LEU A O   1 
ATOM   699  C CB  . LEU A 1 90  ? 54.920 -5.930  -3.429  1.00   67.97  ? 177  LEU A CB  1 
ATOM   700  C CG  . LEU A 1 90  ? 54.745 -4.548  -4.086  1.00   71.44  ? 177  LEU A CG  1 
ATOM   701  C CD1 . LEU A 1 90  ? 54.591 -3.502  -3.006  1.00   74.64  ? 177  LEU A CD1 1 
ATOM   702  C CD2 . LEU A 1 90  ? 55.911 -4.141  -4.997  1.00   73.65  ? 177  LEU A CD2 1 
ATOM   703  N N   . PHE A 1 91  ? 54.168 -9.080  -3.644  1.00   66.14  ? 178  PHE A N   1 
ATOM   704  C CA  . PHE A 1 91  ? 54.088 -10.417 -3.083  1.00   64.61  ? 178  PHE A CA  1 
ATOM   705  C C   . PHE A 1 91  ? 54.997 -11.291 -3.922  1.00   63.69  ? 178  PHE A C   1 
ATOM   706  O O   . PHE A 1 91  ? 55.734 -12.121 -3.391  1.00   64.38  ? 178  PHE A O   1 
ATOM   707  C CB  . PHE A 1 91  ? 52.661 -10.977 -3.176  1.00   64.37  ? 178  PHE A CB  1 
ATOM   708  C CG  . PHE A 1 91  ? 51.802 -10.632 -1.998  1.00   62.98  ? 178  PHE A CG  1 
ATOM   709  C CD1 . PHE A 1 91  ? 50.535 -10.122 -2.184  1.00   61.58  ? 178  PHE A CD1 1 
ATOM   710  C CD2 . PHE A 1 91  ? 52.272 -10.798 -0.705  1.00   60.61  ? 178  PHE A CD2 1 
ATOM   711  C CE1 . PHE A 1 91  ? 49.762 -9.787  -1.108  1.00   58.07  ? 178  PHE A CE1 1 
ATOM   712  C CE2 . PHE A 1 91  ? 51.491 -10.463 0.375   1.00   57.71  ? 178  PHE A CE2 1 
ATOM   713  C CZ  . PHE A 1 91  ? 50.241 -9.966  0.170   1.00   57.92  ? 178  PHE A CZ  1 
ATOM   714  N N   . ILE A 1 92  ? 54.939 -11.078 -5.233  1.00   62.95  ? 179  ILE A N   1 
ATOM   715  C CA  . ILE A 1 92  ? 55.709 -11.869 -6.181  1.00   63.73  ? 179  ILE A CA  1 
ATOM   716  C C   . ILE A 1 92  ? 57.201 -11.667 -5.999  1.00   65.98  ? 179  ILE A C   1 
ATOM   717  O O   . ILE A 1 92  ? 57.936 -12.647 -5.904  1.00   68.43  ? 179  ILE A O   1 
ATOM   718  C CB  . ILE A 1 92  ? 55.311 -11.536 -7.617  1.00   61.53  ? 179  ILE A CB  1 
ATOM   719  C CG1 . ILE A 1 92  ? 53.992 -12.235 -7.931  1.00   58.79  ? 179  ILE A CG1 1 
ATOM   720  C CG2 . ILE A 1 92  ? 56.384 -12.014 -8.571  1.00   64.40  ? 179  ILE A CG2 1 
ATOM   721  C CD1 . ILE A 1 92  ? 53.340 -11.784 -9.209  1.00   59.75  ? 179  ILE A CD1 1 
ATOM   722  N N   . GLN A 1 93  ? 57.640 -10.414 -5.938  1.00   68.18  ? 180  GLN A N   1 
ATOM   723  C CA  . GLN A 1 93  ? 59.066 -10.145 -5.802  1.00   71.18  ? 180  GLN A CA  1 
ATOM   724  C C   . GLN A 1 93  ? 59.565 -10.563 -4.424  1.00   70.64  ? 180  GLN A C   1 
ATOM   725  O O   . GLN A 1 93  ? 60.736 -10.897 -4.273  1.00   74.83  ? 180  GLN A O   1 
ATOM   726  C CB  . GLN A 1 93  ? 59.432 -8.700  -6.158  1.00   73.65  ? 180  GLN A CB  1 
ATOM   727  C CG  . GLN A 1 93  ? 58.878 -7.678  -5.194  1.00   77.48  ? 180  GLN A CG  1 
ATOM   728  C CD  . GLN A 1 93  ? 59.200 -6.235  -5.568  1.00   81.36  ? 180  GLN A CD  1 
ATOM   729  O OE1 . GLN A 1 93  ? 59.005 -5.805  -6.718  1.00   80.49  ? 180  GLN A OE1 1 
ATOM   730  N NE2 . GLN A 1 93  ? 59.677 -5.477  -4.580  1.00   81.15  ? 180  GLN A NE2 1 
ATOM   731  N N   . LEU A 1 94  ? 58.695 -10.598 -3.423  1.00   69.60  ? 181  LEU A N   1 
ATOM   732  C CA  . LEU A 1 94  ? 59.090 -11.161 -2.124  1.00   71.18  ? 181  LEU A CA  1 
ATOM   733  C C   . LEU A 1 94  ? 59.391 -12.667 -2.160  1.00   69.60  ? 181  LEU A C   1 
ATOM   734  O O   . LEU A 1 94  ? 59.984 -13.196 -1.219  1.00   69.07  ? 181  LEU A O   1 
ATOM   735  C CB  . LEU A 1 94  ? 58.015 -10.930 -1.057  1.00   71.67  ? 181  LEU A CB  1 
ATOM   736  C CG  . LEU A 1 94  ? 57.932 -9.575  -0.356  1.00   72.49  ? 181  LEU A CG  1 
ATOM   737  C CD1 . LEU A 1 94  ? 56.674 -9.526  0.501   1.00   72.40  ? 181  LEU A CD1 1 
ATOM   738  C CD2 . LEU A 1 94  ? 59.172 -9.298  0.490   1.00   71.82  ? 181  LEU A CD2 1 
ATOM   739  N N   . LEU A 1 95  ? 58.973 -13.357 -3.218  1.00   68.52  ? 182  LEU A N   1 
ATOM   740  C CA  . LEU A 1 95  ? 59.213 -14.799 -3.336  1.00   70.81  ? 182  LEU A CA  1 
ATOM   741  C C   . LEU A 1 95  ? 60.679 -15.081 -3.659  1.00   71.10  ? 182  LEU A C   1 
ATOM   742  O O   . LEU A 1 95  ? 61.182 -16.158 -3.347  1.00   69.98  ? 182  LEU A O   1 
ATOM   743  C CB  . LEU A 1 95  ? 58.318 -15.452 -4.412  1.00   71.27  ? 182  LEU A CB  1 
ATOM   744  C CG  . LEU A 1 95  ? 56.788 -15.565 -4.246  1.00   66.83  ? 182  LEU A CG  1 
ATOM   745  C CD1 . LEU A 1 95  ? 56.154 -15.989 -5.563  1.00   66.78  ? 182  LEU A CD1 1 
ATOM   746  C CD2 . LEU A 1 95  ? 56.372 -16.528 -3.143  1.00   64.11  ? 182  LEU A CD2 1 
ATOM   747  N N   . TYR A 1 96  ? 61.318 -14.110 -4.315  1.00   73.07  ? 183  TYR A N   1 
ATOM   748  C CA  . TYR A 1 96  ? 62.752 -14.100 -4.613  1.00   71.43  ? 183  TYR A CA  1 
ATOM   749  C C   . TYR A 1 96  ? 63.517 -13.705 -3.345  1.00   73.58  ? 183  TYR A C   1 
ATOM   750  O O   . TYR A 1 96  ? 64.259 -14.500 -2.762  1.00   75.18  ? 183  TYR A O   1 
ATOM   751  C CB  . TYR A 1 96  ? 63.076 -13.047 -5.686  1.00   68.26  ? 183  TYR A CB  1 
ATOM   752  C CG  . TYR A 1 96  ? 62.625 -13.307 -7.116  1.00   65.63  ? 183  TYR A CG  1 
ATOM   753  C CD1 . TYR A 1 96  ? 61.530 -12.629 -7.664  1.00   62.76  ? 183  TYR A CD1 1 
ATOM   754  C CD2 . TYR A 1 96  ? 63.344 -14.168 -7.949  1.00   63.27  ? 183  TYR A CD2 1 
ATOM   755  C CE1 . TYR A 1 96  ? 61.141 -12.820 -8.989  1.00   59.89  ? 183  TYR A CE1 1 
ATOM   756  C CE2 . TYR A 1 96  ? 62.964 -14.375 -9.267  1.00   62.06  ? 183  TYR A CE2 1 
ATOM   757  C CZ  . TYR A 1 96  ? 61.871 -13.692 -9.778  1.00   61.19  ? 183  TYR A CZ  1 
ATOM   758  O OH  . TYR A 1 96  ? 61.500 -13.906 -11.082 1.00   60.70  ? 183  TYR A OH  1 
ATOM   759  N N   . THR A 1 97  ? 63.283 -12.473 -2.897  1.00   74.46  ? 184  THR A N   1 
ATOM   760  C CA  . THR A 1 97  ? 64.100 -11.855 -1.851  1.00   73.08  ? 184  THR A CA  1 
ATOM   761  C C   . THR A 1 97  ? 63.861 -12.439 -0.478  1.00   74.25  ? 184  THR A C   1 
ATOM   762  O O   . THR A 1 97  ? 64.774 -12.975 0.131   1.00   77.92  ? 184  THR A O   1 
ATOM   763  C CB  . THR A 1 97  ? 63.936 -10.295 -1.792  1.00   72.55  ? 184  THR A CB  1 
ATOM   764  O OG1 . THR A 1 97  ? 62.826 -9.904  -0.958  1.00   66.44  ? 184  THR A OG1 1 
ATOM   765  C CG2 . THR A 1 97  ? 63.722 -9.658  -3.210  1.00   68.06  ? 184  THR A CG2 1 
ATOM   766  N N   . GLY A 1 98  ? 62.619 -12.369 -0.018  1.00   75.58  ? 185  GLY A N   1 
ATOM   767  C CA  . GLY A 1 98  ? 62.274 -12.667 1.360   1.00   73.68  ? 185  GLY A CA  1 
ATOM   768  C C   . GLY A 1 98  ? 62.805 -13.950 1.953   1.00   73.17  ? 185  GLY A C   1 
ATOM   769  O O   . GLY A 1 98  ? 63.180 -14.865 1.235   1.00   69.51  ? 185  GLY A O   1 
ATOM   770  N N   . SER A 1 99  ? 62.804 -14.032 3.277   1.00   74.95  ? 186  SER A N   1 
ATOM   771  C CA  . SER A 1 99  ? 63.180 -15.270 3.946   1.00   77.36  ? 186  SER A CA  1 
ATOM   772  C C   . SER A 1 99  ? 62.102 -16.317 3.676   1.00   80.23  ? 186  SER A C   1 
ATOM   773  O O   . SER A 1 99  ? 61.170 -16.065 2.911   1.00   80.66  ? 186  SER A O   1 
ATOM   774  C CB  . SER A 1 99  ? 63.275 -15.049 5.450   1.00   78.61  ? 186  SER A CB  1 
ATOM   775  O OG  . SER A 1 99  ? 61.988 -14.780 5.985   1.00   79.07  ? 186  SER A OG  1 
ATOM   776  N N   . VAL A 1 100 ? 62.214 -17.475 4.327   1.00   81.56  ? 187  VAL A N   1 
ATOM   777  C CA  . VAL A 1 100 ? 61.259 -18.575 4.151   1.00   80.94  ? 187  VAL A CA  1 
ATOM   778  C C   . VAL A 1 100 ? 59.879 -18.287 4.769   1.00   80.45  ? 187  VAL A C   1 
ATOM   779  O O   . VAL A 1 100 ? 58.855 -18.627 4.177   1.00   78.95  ? 187  VAL A O   1 
ATOM   780  C CB  . VAL A 1 100 ? 61.847 -19.894 4.707   1.00   81.33  ? 187  VAL A CB  1 
ATOM   781  C CG1 . VAL A 1 100 ? 60.809 -21.004 4.733   1.00   83.20  ? 187  VAL A CG1 1 
ATOM   782  C CG2 . VAL A 1 100 ? 63.048 -20.341 3.876   1.00   81.73  ? 187  VAL A CG2 1 
ATOM   783  N N   . GLU A 1 101 ? 59.845 -17.656 5.941   1.00   79.87  ? 188  GLU A N   1 
ATOM   784  C CA  . GLU A 1 101 ? 58.579 -17.311 6.583   1.00   80.57  ? 188  GLU A CA  1 
ATOM   785  C C   . GLU A 1 101 ? 57.788 -16.383 5.658   1.00   78.42  ? 188  GLU A C   1 
ATOM   786  O O   . GLU A 1 101 ? 56.583 -16.556 5.456   1.00   80.71  ? 188  GLU A O   1 
ATOM   787  C CB  . GLU A 1 101 ? 58.785 -16.621 7.943   1.00   83.37  ? 188  GLU A CB  1 
ATOM   788  C CG  . GLU A 1 101 ? 59.733 -17.299 8.923   1.00   87.05  ? 188  GLU A CG  1 
ATOM   789  C CD  . GLU A 1 101 ? 61.204 -16.990 8.659   1.00   92.15  ? 188  GLU A CD  1 
ATOM   790  O OE1 . GLU A 1 101 ? 61.607 -15.797 8.691   1.00   92.17  ? 188  GLU A OE1 1 
ATOM   791  O OE2 . GLU A 1 101 ? 61.960 -17.959 8.402   1.00   95.43  ? 188  GLU A OE2 1 
ATOM   792  N N   . VAL A 1 102 ? 58.492 -15.407 5.096   1.00   74.92  ? 189  VAL A N   1 
ATOM   793  C CA  . VAL A 1 102 ? 57.916 -14.423 4.184   1.00   73.48  ? 189  VAL A CA  1 
ATOM   794  C C   . VAL A 1 102 ? 57.462 -15.064 2.884   1.00   72.26  ? 189  VAL A C   1 
ATOM   795  O O   . VAL A 1 102 ? 56.493 -14.634 2.257   1.00   73.41  ? 189  VAL A O   1 
ATOM   796  C CB  . VAL A 1 102 ? 58.964 -13.348 3.820   1.00   73.14  ? 189  VAL A CB  1 
ATOM   797  C CG1 . VAL A 1 102 ? 58.404 -12.280 2.870   1.00   67.47  ? 189  VAL A CG1 1 
ATOM   798  C CG2 . VAL A 1 102 ? 59.489 -12.699 5.098   1.00   76.22  ? 189  VAL A CG2 1 
ATOM   799  N N   . LYS A 1 103 ? 58.206 -16.071 2.451   1.00   70.44  ? 190  LYS A N   1 
ATOM   800  C CA  . LYS A 1 103 ? 57.895 -16.740 1.198   1.00   69.85  ? 190  LYS A CA  1 
ATOM   801  C C   . LYS A 1 103 ? 56.573 -17.491 1.359   1.00   67.41  ? 190  LYS A C   1 
ATOM   802  O O   . LYS A 1 103 ? 55.719 -17.473 0.466   1.00   62.30  ? 190  LYS A O   1 
ATOM   803  C CB  . LYS A 1 103 ? 59.040 -17.675 0.798   1.00   70.57  ? 190  LYS A CB  1 
ATOM   804  C CG  . LYS A 1 103 ? 60.191 -16.990 0.060   1.00   74.03  ? 190  LYS A CG  1 
ATOM   805  C CD  . LYS A 1 103 ? 61.362 -17.947 -0.216  1.00   77.35  ? 190  LYS A CD  1 
ATOM   806  C CE  . LYS A 1 103 ? 62.561 -17.288 -0.917  1.00   79.46  ? 190  LYS A CE  1 
ATOM   807  N NZ  . LYS A 1 103 ? 63.787 -18.155 -1.048  1.00   80.17  ? 190  LYS A NZ  1 
ATOM   808  N N   . GLU A 1 104 ? 56.393 -18.087 2.535   1.00   66.98  ? 191  GLU A N   1 
ATOM   809  C CA  . GLU A 1 104 ? 55.214 -18.891 2.791   1.00   68.17  ? 191  GLU A CA  1 
ATOM   810  C C   . GLU A 1 104 ? 53.960 -18.019 2.846   1.00   68.62  ? 191  GLU A C   1 
ATOM   811  O O   . GLU A 1 104 ? 52.876 -18.466 2.430   1.00   67.45  ? 191  GLU A O   1 
ATOM   812  C CB  . GLU A 1 104 ? 55.365 -19.725 4.060   1.00   69.45  ? 191  GLU A CB  1 
ATOM   813  C CG  . GLU A 1 104 ? 54.374 -20.885 4.117   1.00   72.90  ? 191  GLU A CG  1 
ATOM   814  C CD  . GLU A 1 104 ? 54.651 -21.877 5.237   1.00   77.06  ? 191  GLU A CD  1 
ATOM   815  O OE1 . GLU A 1 104 ? 55.852 -22.125 5.523   1.00   75.39  ? 191  GLU A OE1 1 
ATOM   816  O OE2 . GLU A 1 104 ? 53.662 -22.406 5.812   1.00   78.34  ? 191  GLU A OE2 1 
ATOM   817  N N   . GLN A 1 105 ? 54.120 -16.787 3.335   1.00   64.63  ? 192  GLN A N   1 
ATOM   818  C CA  . GLN A 1 105 ? 53.000 -15.855 3.416   1.00   62.28  ? 192  GLN A CA  1 
ATOM   819  C C   . GLN A 1 105 ? 52.631 -15.406 2.015   1.00   58.42  ? 192  GLN A C   1 
ATOM   820  O O   . GLN A 1 105 ? 51.488 -15.537 1.573   1.00   57.94  ? 192  GLN A O   1 
ATOM   821  C CB  . GLN A 1 105 ? 53.293 -14.642 4.308   1.00   63.22  ? 192  GLN A CB  1 
ATOM   822  C CG  . GLN A 1 105 ? 53.309 -14.953 5.811   1.00   61.27  ? 192  GLN A CG  1 
ATOM   823  C CD  . GLN A 1 105 ? 51.927 -15.227 6.367   1.00   58.70  ? 192  GLN A CD  1 
ATOM   824  O OE1 . GLN A 1 105 ? 51.782 -15.885 7.393   1.00   61.27  ? 192  GLN A OE1 1 
ATOM   825  N NE2 . GLN A 1 105 ? 50.908 -14.729 5.688   1.00   58.19  ? 192  GLN A NE2 1 
ATOM   826  N N   . ALA A 1 106 ? 53.609 -14.915 1.285   1.00   54.15  ? 193  ALA A N   1 
ATOM   827  C CA  . ALA A 1 106 ? 53.301 -14.438 -0.041  1.00   52.21  ? 193  ALA A CA  1 
ATOM   828  C C   . ALA A 1 106 ? 52.752 -15.538 -0.920  1.00   50.30  ? 193  ALA A C   1 
ATOM   829  O O   . ALA A 1 106 ? 51.901 -15.291 -1.772  1.00   52.58  ? 193  ALA A O   1 
ATOM   830  C CB  . ALA A 1 106 ? 54.540 -13.844 -0.674  1.00   56.85  ? 193  ALA A CB  1 
ATOM   831  N N   . ILE A 1 107 ? 53.257 -16.758 -0.783  1.00   52.58  ? 194  ILE A N   1 
ATOM   832  C CA  . ILE A 1 107 ? 52.776 -17.799 -1.710  1.00   51.41  ? 194  ILE A CA  1 
ATOM   833  C C   . ILE A 1 107 ? 51.280 -18.087 -1.426  1.00   47.72  ? 194  ILE A C   1 
ATOM   834  O O   . ILE A 1 107 ? 50.474 -18.133 -2.364  1.00   44.08  ? 194  ILE A O   1 
ATOM   835  C CB  . ILE A 1 107 ? 53.680 -19.076 -1.758  1.00   47.58  ? 194  ILE A CB  1 
ATOM   836  C CG1 . ILE A 1 107 ? 53.224 -20.002 -2.878  1.00   43.49  ? 194  ILE A CG1 1 
ATOM   837  C CG2 . ILE A 1 107 ? 53.604 -19.886 -0.488  1.00   50.02  ? 194  ILE A CG2 1 
ATOM   838  C CD1 . ILE A 1 107 ? 53.288 -19.403 -4.268  1.00   37.97  ? 194  ILE A CD1 1 
ATOM   839  N N   . TRP A 1 108 ? 50.934 -18.172 -0.137  1.00   45.90  ? 195  TRP A N   1 
ATOM   840  C CA  . TRP A 1 108 ? 49.551 -18.336 0.335   1.00   45.88  ? 195  TRP A CA  1 
ATOM   841  C C   . TRP A 1 108 ? 48.668 -17.182 -0.141  1.00   44.55  ? 195  TRP A C   1 
ATOM   842  O O   . TRP A 1 108 ? 47.565 -17.378 -0.619  1.00   42.00  ? 195  TRP A O   1 
ATOM   843  C CB  . TRP A 1 108 ? 49.523 -18.417 1.867   1.00   47.11  ? 195  TRP A CB  1 
ATOM   844  C CG  . TRP A 1 108 ? 48.169 -18.593 2.477   1.00   48.19  ? 195  TRP A CG  1 
ATOM   845  C CD1 . TRP A 1 108 ? 47.562 -17.754 3.347   1.00   47.24  ? 195  TRP A CD1 1 
ATOM   846  C CD2 . TRP A 1 108 ? 47.274 -19.703 2.298   1.00   48.54  ? 195  TRP A CD2 1 
ATOM   847  N NE1 . TRP A 1 108 ? 46.343 -18.260 3.723   1.00   47.90  ? 195  TRP A NE1 1 
ATOM   848  C CE2 . TRP A 1 108 ? 46.138 -19.452 3.082   1.00   46.00  ? 195  TRP A CE2 1 
ATOM   849  C CE3 . TRP A 1 108 ? 47.316 -20.884 1.539   1.00   47.19  ? 195  TRP A CE3 1 
ATOM   850  C CZ2 . TRP A 1 108 ? 45.054 -20.326 3.128   1.00   45.40  ? 195  TRP A CZ2 1 
ATOM   851  C CZ3 . TRP A 1 108 ? 46.239 -21.737 1.570   1.00   44.00  ? 195  TRP A CZ3 1 
ATOM   852  C CH2 . TRP A 1 108 ? 45.122 -21.450 2.356   1.00   46.49  ? 195  TRP A CH2 1 
ATOM   853  N N   . ALA A 1 109 ? 49.180 -15.967 -0.063  1.00   46.75  ? 196  ALA A N   1 
ATOM   854  C CA  . ALA A 1 109 ? 48.402 -14.826 -0.483  1.00   49.60  ? 196  ALA A CA  1 
ATOM   855  C C   . ALA A 1 109 ? 48.042 -14.972 -1.948  1.00   51.26  ? 196  ALA A C   1 
ATOM   856  O O   . ALA A 1 109 ? 46.872 -14.823 -2.324  1.00   51.05  ? 196  ALA A O   1 
ATOM   857  C CB  . ALA A 1 109 ? 49.193 -13.564 -0.273  1.00   51.14  ? 196  ALA A CB  1 
ATOM   858  N N   . LEU A 1 110 ? 49.059 -15.276 -2.750  1.00   52.15  ? 197  LEU A N   1 
ATOM   859  C CA  . LEU A 1 110 ? 48.918 -15.319 -4.208  1.00   50.38  ? 197  LEU A CA  1 
ATOM   860  C C   . LEU A 1 110 ? 47.998 -16.463 -4.607  1.00   49.44  ? 197  LEU A C   1 
ATOM   861  O O   . LEU A 1 110 ? 47.311 -16.426 -5.639  1.00   47.36  ? 197  LEU A O   1 
ATOM   862  C CB  . LEU A 1 110 ? 50.282 -15.480 -4.869  1.00   49.81  ? 197  LEU A CB  1 
ATOM   863  C CG  . LEU A 1 110 ? 51.181 -14.252 -4.783  1.00   48.08  ? 197  LEU A CG  1 
ATOM   864  C CD1 . LEU A 1 110 ? 52.593 -14.604 -5.186  1.00   50.72  ? 197  LEU A CD1 1 
ATOM   865  C CD2 . LEU A 1 110 ? 50.664 -13.166 -5.695  1.00   45.59  ? 197  LEU A CD2 1 
ATOM   866  N N   . GLY A 1 111 ? 47.977 -17.474 -3.746  1.00   47.92  ? 198  GLY A N   1 
ATOM   867  C CA  . GLY A 1 111 ? 47.093 -18.607 -3.953  1.00   47.43  ? 198  GLY A CA  1 
ATOM   868  C C   . GLY A 1 111 ? 45.643 -18.223 -3.780  1.00   44.09  ? 198  GLY A C   1 
ATOM   869  O O   . GLY A 1 111 ? 44.782 -18.626 -4.551  1.00   44.36  ? 198  GLY A O   1 
ATOM   870  N N   . ASN A 1 112 ? 45.383 -17.445 -2.739  1.00   46.44  ? 199  ASN A N   1 
ATOM   871  C CA  . ASN A 1 112 ? 44.043 -16.993 -2.407  1.00   43.54  ? 199  ASN A CA  1 
ATOM   872  C C   . ASN A 1 112 ? 43.598 -16.009 -3.481  1.00   45.03  ? 199  ASN A C   1 
ATOM   873  O O   . ASN A 1 112 ? 42.429 -16.005 -3.884  1.00   47.96  ? 199  ASN A O   1 
ATOM   874  C CB  . ASN A 1 112 ? 44.038 -16.387 -1.002  1.00   44.71  ? 199  ASN A CB  1 
ATOM   875  C CG  . ASN A 1 112 ? 43.871 -17.448 0.098   1.00   45.31  ? 199  ASN A CG  1 
ATOM   876  O OD1 . ASN A 1 112 ? 42.754 -17.860 0.421   1.00   44.69  ? 199  ASN A OD1 1 
ATOM   877  N ND2 . ASN A 1 112 ? 44.983 -17.888 0.680   1.00   46.02  ? 199  ASN A ND2 1 
ATOM   878  N N   . VAL A 1 113 ? 44.537 -15.221 -3.999  1.00   41.81  ? 200  VAL A N   1 
ATOM   879  C CA  . VAL A 1 113 ? 44.195 -14.257 -5.026  1.00   41.11  ? 200  VAL A CA  1 
ATOM   880  C C   . VAL A 1 113 ? 43.920 -14.971 -6.327  1.00   44.12  ? 200  VAL A C   1 
ATOM   881  O O   . VAL A 1 113 ? 42.933 -14.712 -7.020  1.00   45.12  ? 200  VAL A O   1 
ATOM   882  C CB  . VAL A 1 113 ? 45.325 -13.294 -5.278  1.00   42.48  ? 200  VAL A CB  1 
ATOM   883  C CG1 . VAL A 1 113 ? 45.088 -12.527 -6.568  1.00   44.69  ? 200  VAL A CG1 1 
ATOM   884  C CG2 . VAL A 1 113 ? 45.462 -12.338 -4.106  1.00   46.27  ? 200  VAL A CG2 1 
ATOM   885  N N   . ALA A 1 114 ? 44.801 -15.904 -6.656  1.00   46.21  ? 201  ALA A N   1 
ATOM   886  C CA  . ALA A 1 114 ? 44.657 -16.655 -7.894  1.00   45.35  ? 201  ALA A CA  1 
ATOM   887  C C   . ALA A 1 114 ? 43.408 -17.514 -7.924  1.00   43.17  ? 201  ALA A C   1 
ATOM   888  O O   . ALA A 1 114 ? 42.904 -17.832 -9.004  1.00   44.56  ? 201  ALA A O   1 
ATOM   889  C CB  . ALA A 1 114 ? 45.850 -17.537 -8.088  1.00   48.23  ? 201  ALA A CB  1 
ATOM   890  N N   . GLY A 1 115 ? 42.937 -17.903 -6.740  1.00   42.04  ? 202  GLY A N   1 
ATOM   891  C CA  . GLY A 1 115 ? 41.777 -18.763 -6.617  1.00   43.45  ? 202  GLY A CA  1 
ATOM   892  C C   . GLY A 1 115 ? 40.452 -18.038 -6.586  1.00   47.25  ? 202  GLY A C   1 
ATOM   893  O O   . GLY A 1 115 ? 39.423 -18.705 -6.573  1.00   48.31  ? 202  GLY A O   1 
ATOM   894  N N   . ASP A 1 116 ? 40.448 -16.705 -6.545  1.00   48.60  ? 203  ASP A N   1 
ATOM   895  C CA  . ASP A 1 116 ? 39.189 -15.958 -6.517  1.00   48.57  ? 203  ASP A CA  1 
ATOM   896  C C   . ASP A 1 116 ? 38.360 -16.019 -7.800  1.00   48.37  ? 203  ASP A C   1 
ATOM   897  O O   . ASP A 1 116 ? 37.140 -16.050 -7.748  1.00   46.16  ? 203  ASP A O   1 
ATOM   898  C CB  . ASP A 1 116 ? 39.422 -14.489 -6.201  1.00   51.39  ? 203  ASP A CB  1 
ATOM   899  C CG  . ASP A 1 116 ? 38.123 -13.745 -6.005  1.00   52.00  ? 203  ASP A CG  1 
ATOM   900  O OD1 . ASP A 1 116 ? 37.546 -13.931 -4.909  1.00   48.90  ? 203  ASP A OD1 1 
ATOM   901  O OD2 . ASP A 1 116 ? 37.616 -13.004 -6.888  1.00   51.48  ? 203  ASP A OD2 1 
ATOM   902  N N   . SER A 1 117 ? 39.015 -16.023 -8.954  1.00   52.28  ? 204  SER A N   1 
ATOM   903  C CA  . SER A 1 117 ? 38.318 -16.040 -10.241 1.00   53.68  ? 204  SER A CA  1 
ATOM   904  C C   . SER A 1 117 ? 39.292 -16.300 -11.375 1.00   52.29  ? 204  SER A C   1 
ATOM   905  O O   . SER A 1 117 ? 40.498 -16.251 -11.168 1.00   52.40  ? 204  SER A O   1 
ATOM   906  C CB  . SER A 1 117 ? 37.681 -14.675 -10.493 1.00   55.09  ? 204  SER A CB  1 
ATOM   907  O OG  . SER A 1 117 ? 38.688 -13.687 -10.660 1.00   57.32  ? 204  SER A OG  1 
ATOM   908  N N   . THR A 1 118 ? 38.792 -16.511 -12.587 1.00   53.74  ? 205  THR A N   1 
ATOM   909  C CA  . THR A 1 118 ? 39.712 -16.712 -13.717 1.00   54.63  ? 205  THR A CA  1 
ATOM   910  C C   . THR A 1 118 ? 40.463 -15.435 -14.103 1.00   56.37  ? 205  THR A C   1 
ATOM   911  O O   . THR A 1 118 ? 41.523 -15.499 -14.715 1.00   56.91  ? 205  THR A O   1 
ATOM   912  C CB  . THR A 1 118 ? 39.023 -17.271 -14.969 1.00   53.76  ? 205  THR A CB  1 
ATOM   913  O OG1 . THR A 1 118 ? 37.914 -16.434 -15.348 1.00   55.94  ? 205  THR A OG1 1 
ATOM   914  C CG2 . THR A 1 118 ? 38.442 -18.656 -14.707 1.00   55.18  ? 205  THR A CG2 1 
ATOM   915  N N   . ASP A 1 119 ? 39.933 -14.272 -13.745 1.00   57.96  ? 206  ASP A N   1 
ATOM   916  C CA  . ASP A 1 119 ? 40.614 -13.018 -14.051 1.00   60.02  ? 206  ASP A CA  1 
ATOM   917  C C   . ASP A 1 119 ? 41.828 -12.847 -13.163 1.00   56.60  ? 206  ASP A C   1 
ATOM   918  O O   . ASP A 1 119 ? 42.908 -12.514 -13.636 1.00   53.67  ? 206  ASP A O   1 
ATOM   919  C CB  . ASP A 1 119 ? 39.710 -11.798 -13.811 1.00   61.88  ? 206  ASP A CB  1 
ATOM   920  C CG  . ASP A 1 119 ? 38.579 -11.668 -14.819 1.00   62.67  ? 206  ASP A CG  1 
ATOM   921  O OD1 . ASP A 1 119 ? 37.781 -12.605 -15.026 1.00   65.85  ? 206  ASP A OD1 1 
ATOM   922  O OD2 . ASP A 1 119 ? 38.386 -10.606 -15.434 1.00   67.54  ? 206  ASP A OD2 1 
ATOM   923  N N   . TYR A 1 120 ? 41.629 -13.035 -11.866 1.00   56.49  ? 207  TYR A N   1 
ATOM   924  C CA  . TYR A 1 120 ? 42.724 -12.865 -10.925 1.00   57.00  ? 207  TYR A CA  1 
ATOM   925  C C   . TYR A 1 120 ? 43.809 -13.907 -11.180 1.00   57.18  ? 207  TYR A C   1 
ATOM   926  O O   . TYR A 1 120 ? 45.000 -13.638 -10.984 1.00   55.94  ? 207  TYR A O   1 
ATOM   927  C CB  . TYR A 1 120 ? 42.191 -12.967 -9.502  1.00   59.57  ? 207  TYR A CB  1 
ATOM   928  C CG  . TYR A 1 120 ? 41.526 -11.715 -8.987  1.00   62.56  ? 207  TYR A CG  1 
ATOM   929  C CD1 . TYR A 1 120 ? 41.085 -11.646 -7.672  1.00   62.48  ? 207  TYR A CD1 1 
ATOM   930  C CD2 . TYR A 1 120 ? 41.350 -10.595 -9.797  1.00   64.89  ? 207  TYR A CD2 1 
ATOM   931  C CE1 . TYR A 1 120 ? 40.495 -10.496 -7.181  1.00   66.53  ? 207  TYR A CE1 1 
ATOM   932  C CE2 . TYR A 1 120 ? 40.737 -9.444  -9.313  1.00   65.02  ? 207  TYR A CE2 1 
ATOM   933  C CZ  . TYR A 1 120 ? 40.320 -9.397  -7.998  1.00   64.40  ? 207  TYR A CZ  1 
ATOM   934  O OH  . TYR A 1 120 ? 39.731 -8.275  -7.465  1.00   58.40  ? 207  TYR A OH  1 
ATOM   935  N N   . ARG A 1 121 ? 43.385 -15.094 -11.614 1.00   55.45  ? 208  ARG A N   1 
ATOM   936  C CA  . ARG A 1 121 ? 44.315 -16.148 -11.984 1.00   53.20  ? 208  ARG A CA  1 
ATOM   937  C C   . ARG A 1 121 ? 45.174 -15.679 -13.154 1.00   50.75  ? 208  ARG A C   1 
ATOM   938  O O   . ARG A 1 121 ? 46.401 -15.663 -13.073 1.00   48.82  ? 208  ARG A O   1 
ATOM   939  C CB  . ARG A 1 121 ? 43.548 -17.406 -12.362 1.00   52.66  ? 208  ARG A CB  1 
ATOM   940  C CG  . ARG A 1 121 ? 44.392 -18.517 -12.954 1.00   48.38  ? 208  ARG A CG  1 
ATOM   941  C CD  . ARG A 1 121 ? 43.581 -19.451 -13.824 1.00   44.15  ? 208  ARG A CD  1 
ATOM   942  N NE  . ARG A 1 121 ? 43.145 -18.789 -15.040 1.00   39.27  ? 208  ARG A NE  1 
ATOM   943  C CZ  . ARG A 1 121 ? 42.332 -19.339 -15.942 1.00   44.56  ? 208  ARG A CZ  1 
ATOM   944  N NH1 . ARG A 1 121 ? 41.849 -20.564 -15.769 1.00   45.50  ? 208  ARG A NH1 1 
ATOM   945  N NH2 . ARG A 1 121 ? 41.991 -18.671 -17.036 1.00   47.67  ? 208  ARG A NH2 1 
ATOM   946  N N   . ASP A 1 122 ? 44.539 -15.260 -14.236 1.00   50.50  ? 209  ASP A N   1 
ATOM   947  C CA  . ASP A 1 122 ? 45.312 -14.731 -15.361 1.00   53.15  ? 209  ASP A CA  1 
ATOM   948  C C   . ASP A 1 122 ? 46.225 -13.575 -14.900 1.00   52.30  ? 209  ASP A C   1 
ATOM   949  O O   . ASP A 1 122 ? 47.391 -13.519 -15.271 1.00   54.48  ? 209  ASP A O   1 
ATOM   950  C CB  . ASP A 1 122 ? 44.419 -14.274 -16.522 1.00   50.90  ? 209  ASP A CB  1 
ATOM   951  C CG  . ASP A 1 122 ? 43.683 -15.416 -17.178 1.00   54.97  ? 209  ASP A CG  1 
ATOM   952  O OD1 . ASP A 1 122 ? 44.234 -16.535 -17.216 1.00   56.65  ? 209  ASP A OD1 1 
ATOM   953  O OD2 . ASP A 1 122 ? 42.551 -15.295 -17.695 1.00   56.23  ? 209  ASP A OD2 1 
ATOM   954  N N   . TYR A 1 123 ? 45.715 -12.693 -14.051 1.00   52.21  ? 210  TYR A N   1 
ATOM   955  C CA  . TYR A 1 123 ? 46.473 -11.535 -13.593 1.00   54.36  ? 210  TYR A CA  1 
ATOM   956  C C   . TYR A 1 123 ? 47.753 -11.939 -12.868 1.00   52.90  ? 210  TYR A C   1 
ATOM   957  O O   . TYR A 1 123 ? 48.812 -11.363 -13.110 1.00   52.77  ? 210  TYR A O   1 
ATOM   958  C CB  . TYR A 1 123 ? 45.609 -10.638 -12.685 1.00   55.26  ? 210  TYR A CB  1 
ATOM   959  C CG  . TYR A 1 123 ? 46.358 -9.500  -11.992 1.00   54.87  ? 210  TYR A CG  1 
ATOM   960  C CD1 . TYR A 1 123 ? 46.827 -8.393  -12.710 1.00   55.00  ? 210  TYR A CD1 1 
ATOM   961  C CD2 . TYR A 1 123 ? 46.604 -9.537  -10.623 1.00   52.77  ? 210  TYR A CD2 1 
ATOM   962  C CE1 . TYR A 1 123 ? 47.526 -7.357  -12.073 1.00   52.99  ? 210  TYR A CE1 1 
ATOM   963  C CE2 . TYR A 1 123 ? 47.293 -8.521  -9.989  1.00   53.91  ? 210  TYR A CE2 1 
ATOM   964  C CZ  . TYR A 1 123 ? 47.747 -7.438  -10.719 1.00   53.82  ? 210  TYR A CZ  1 
ATOM   965  O OH  . TYR A 1 123 ? 48.430 -6.441  -10.073 1.00   60.34  ? 210  TYR A OH  1 
ATOM   966  N N   . VAL A 1 124 ? 47.661 -12.919 -11.979 1.00   52.32  ? 211  VAL A N   1 
ATOM   967  C CA  . VAL A 1 124 ? 48.853 -13.360 -11.272 1.00   54.29  ? 211  VAL A CA  1 
ATOM   968  C C   . VAL A 1 124 ? 49.918 -13.866 -12.259 1.00   55.73  ? 211  VAL A C   1 
ATOM   969  O O   . VAL A 1 124 ? 51.122 -13.621 -12.090 1.00   53.55  ? 211  VAL A O   1 
ATOM   970  C CB  . VAL A 1 124 ? 48.502 -14.431 -10.230 1.00   52.16  ? 211  VAL A CB  1 
ATOM   971  C CG1 . VAL A 1 124 ? 49.759 -15.013 -9.608  1.00   50.04  ? 211  VAL A CG1 1 
ATOM   972  C CG2 . VAL A 1 124 ? 47.645 -13.807 -9.146  1.00   54.79  ? 211  VAL A CG2 1 
ATOM   973  N N   . LEU A 1 125 ? 49.443 -14.583 -13.271 1.00   55.61  ? 212  LEU A N   1 
ATOM   974  C CA  . LEU A 1 125 ? 50.301 -15.160 -14.278 1.00   58.73  ? 212  LEU A CA  1 
ATOM   975  C C   . LEU A 1 125 ? 50.931 -14.063 -15.126 1.00   62.33  ? 212  LEU A C   1 
ATOM   976  O O   . LEU A 1 125 ? 52.146 -14.083 -15.360 1.00   65.60  ? 212  LEU A O   1 
ATOM   977  C CB  . LEU A 1 125 ? 49.518 -16.153 -15.143 1.00   59.35  ? 212  LEU A CB  1 
ATOM   978  C CG  . LEU A 1 125 ? 49.169 -17.452 -14.404 1.00   58.27  ? 212  LEU A CG  1 
ATOM   979  C CD1 . LEU A 1 125 ? 48.341 -18.352 -15.286 1.00   55.43  ? 212  LEU A CD1 1 
ATOM   980  C CD2 . LEU A 1 125 ? 50.404 -18.183 -13.877 1.00   56.34  ? 212  LEU A CD2 1 
ATOM   981  N N   . GLN A 1 126 ? 50.131 -13.099 -15.567 1.00   62.51  ? 213  GLN A N   1 
ATOM   982  C CA  . GLN A 1 126 ? 50.667 -11.972 -16.332 1.00   63.87  ? 213  GLN A CA  1 
ATOM   983  C C   . GLN A 1 126 ? 51.792 -11.257 -15.557 1.00   63.99  ? 213  GLN A C   1 
ATOM   984  O O   . GLN A 1 126 ? 52.834 -10.929 -16.133 1.00   64.42  ? 213  GLN A O   1 
ATOM   985  C CB  . GLN A 1 126 ? 49.564 -10.987 -16.724 1.00   65.03  ? 213  GLN A CB  1 
ATOM   986  C CG  . GLN A 1 126 ? 48.868 -11.330 -18.038 1.00   66.63  ? 213  GLN A CG  1 
ATOM   987  C CD  . GLN A 1 126 ? 47.358 -11.252 -17.925 1.00   70.38  ? 213  GLN A CD  1 
ATOM   988  O OE1 . GLN A 1 126 ? 46.828 -10.287 -17.367 1.00   73.50  ? 213  GLN A OE1 1 
ATOM   989  N NE2 . GLN A 1 126 ? 46.662 -12.275 -18.427 1.00   71.54  ? 213  GLN A NE2 1 
ATOM   990  N N   . CYS A 1 127 ? 51.629 -11.095 -14.248 1.00   60.68  ? 214  CYS A N   1 
ATOM   991  C CA  . CYS A 1 127 ? 52.673 -10.499 -13.416 1.00   63.42  ? 214  CYS A CA  1 
ATOM   992  C C   . CYS A 1 127 ? 53.902 -11.386 -13.233 1.00   64.98  ? 214  CYS A C   1 
ATOM   993  O O   . CYS A 1 127 ? 54.690 -11.176 -12.299 1.00   63.59  ? 214  CYS A O   1 
ATOM   994  C CB  . CYS A 1 127 ? 52.113 -10.167 -12.026 1.00   65.02  ? 214  CYS A CB  1 
ATOM   995  S SG  . CYS A 1 127 ? 50.804 -8.900  -11.994 1.00   71.96  ? 214  CYS A SG  1 
ATOM   996  N N   . ASN A 1 128 ? 54.048 -12.397 -14.091 1.00   69.46  ? 215  ASN A N   1 
ATOM   997  C CA  . ASN A 1 128 ? 55.185 -13.332 -14.053 1.00   71.29  ? 215  ASN A CA  1 
ATOM   998  C C   . ASN A 1 128 ? 55.466 -13.909 -12.665 1.00   68.01  ? 215  ASN A C   1 
ATOM   999  O O   . ASN A 1 128 ? 56.540 -13.701 -12.110 1.00   67.98  ? 215  ASN A O   1 
ATOM   1000 C CB  . ASN A 1 128 ? 56.457 -12.682 -14.635 1.00   72.45  ? 215  ASN A CB  1 
ATOM   1001 C CG  . ASN A 1 128 ? 56.247 -12.122 -16.049 1.00   76.27  ? 215  ASN A CG  1 
ATOM   1002 O OD1 . ASN A 1 128 ? 55.721 -12.790 -16.944 1.00   80.50  ? 215  ASN A OD1 1 
ATOM   1003 N ND2 . ASN A 1 128 ? 56.640 -10.872 -16.244 1.00   79.95  ? 215  ASN A ND2 1 
ATOM   1004 N N   . ALA A 1 129 ? 54.486 -14.596 -12.090 1.00   65.93  ? 216  ALA A N   1 
ATOM   1005 C CA  . ALA A 1 129 ? 54.719 -15.285 -10.826 1.00   66.97  ? 216  ALA A CA  1 
ATOM   1006 C C   . ALA A 1 129 ? 55.251 -16.701 -11.032 1.00   65.42  ? 216  ALA A C   1 
ATOM   1007 O O   . ALA A 1 129 ? 55.913 -17.236 -10.140 1.00   64.11  ? 216  ALA A O   1 
ATOM   1008 C CB  . ALA A 1 129 ? 53.445 -15.341 -9.995  1.00   68.37  ? 216  ALA A CB  1 
ATOM   1009 N N   . MET A 1 130 ? 54.969 -17.309 -12.185 1.00   63.72  ? 217  MET A N   1 
ATOM   1010 C CA  . MET A 1 130 ? 55.337 -18.703 -12.400 1.00   63.80  ? 217  MET A CA  1 
ATOM   1011 C C   . MET A 1 130 ? 56.796 -18.977 -12.084 1.00   64.92  ? 217  MET A C   1 
ATOM   1012 O O   . MET A 1 130 ? 57.097 -19.921 -11.363 1.00   66.68  ? 217  MET A O   1 
ATOM   1013 C CB  . MET A 1 130 ? 55.051 -19.150 -13.830 1.00   64.78  ? 217  MET A CB  1 
ATOM   1014 C CG  . MET A 1 130 ? 55.127 -20.676 -14.010 1.00   67.11  ? 217  MET A CG  1 
ATOM   1015 S SD  . MET A 1 130 ? 54.289 -21.677 -12.705 1.00   62.88  ? 217  MET A SD  1 
ATOM   1016 C CE  . MET A 1 130 ? 52.645 -21.890 -13.366 1.00   60.32  ? 217  MET A CE  1 
ATOM   1017 N N   . GLU A 1 131 ? 57.685 -18.130 -12.590 1.00   67.57  ? 218  GLU A N   1 
ATOM   1018 C CA  . GLU A 1 131 ? 59.125 -18.309 -12.427 1.00   68.75  ? 218  GLU A CA  1 
ATOM   1019 C C   . GLU A 1 131 ? 59.530 -18.425 -10.953 1.00   64.95  ? 218  GLU A C   1 
ATOM   1020 O O   . GLU A 1 131 ? 60.133 -19.430 -10.562 1.00   61.95  ? 218  GLU A O   1 
ATOM   1021 C CB  . GLU A 1 131 ? 59.912 -17.212 -13.180 1.00   72.03  ? 218  GLU A CB  1 
ATOM   1022 C CG  . GLU A 1 131 ? 61.400 -17.505 -13.394 1.00   77.69  ? 218  GLU A CG  1 
ATOM   1023 C CD  . GLU A 1 131 ? 62.215 -16.282 -13.804 1.00   79.23  ? 218  GLU A CD  1 
ATOM   1024 O OE1 . GLU A 1 131 ? 61.963 -15.717 -14.890 1.00   81.50  ? 218  GLU A OE1 1 
ATOM   1025 O OE2 . GLU A 1 131 ? 63.119 -15.869 -13.045 1.00   80.91  ? 218  GLU A OE2 1 
ATOM   1026 N N   . PRO A 1 132 ? 59.239 -17.419 -10.132 1.00   65.07  ? 219  PRO A N   1 
ATOM   1027 C CA  . PRO A 1 132 ? 59.627 -17.501 -8.716  1.00   66.11  ? 219  PRO A CA  1 
ATOM   1028 C C   . PRO A 1 132 ? 58.939 -18.633 -7.960  1.00   67.62  ? 219  PRO A C   1 
ATOM   1029 O O   . PRO A 1 132 ? 59.575 -19.207 -7.071  1.00   69.73  ? 219  PRO A O   1 
ATOM   1030 C CB  . PRO A 1 132 ? 59.243 -16.130 -8.138  1.00   65.01  ? 219  PRO A CB  1 
ATOM   1031 C CG  . PRO A 1 132 ? 58.264 -15.538 -9.111  1.00   65.72  ? 219  PRO A CG  1 
ATOM   1032 C CD  . PRO A 1 132 ? 58.638 -16.112 -10.458 1.00   64.80  ? 219  PRO A CD  1 
ATOM   1033 N N   . ILE A 1 133 ? 57.689 -18.943 -8.307  1.00   67.62  ? 220  ILE A N   1 
ATOM   1034 C CA  . ILE A 1 133 ? 56.925 -19.967 -7.594  1.00   66.14  ? 220  ILE A CA  1 
ATOM   1035 C C   . ILE A 1 133 ? 57.672 -21.294 -7.748  1.00   66.15  ? 220  ILE A C   1 
ATOM   1036 O O   . ILE A 1 133 ? 57.924 -21.977 -6.751  1.00   64.44  ? 220  ILE A O   1 
ATOM   1037 C CB  . ILE A 1 133 ? 55.453 -20.071 -8.108  1.00   65.52  ? 220  ILE A CB  1 
ATOM   1038 C CG1 . ILE A 1 133 ? 54.639 -18.849 -7.665  1.00   63.98  ? 220  ILE A CG1 1 
ATOM   1039 C CG2 . ILE A 1 133 ? 54.761 -21.342 -7.586  1.00   61.42  ? 220  ILE A CG2 1 
ATOM   1040 C CD1 . ILE A 1 133 ? 53.316 -18.685 -8.396  1.00   59.25  ? 220  ILE A CD1 1 
ATOM   1041 N N   . LEU A 1 134 ? 58.063 -21.619 -8.983  1.00   66.00  ? 221  LEU A N   1 
ATOM   1042 C CA  . LEU A 1 134 ? 58.793 -22.861 -9.282  1.00   65.58  ? 221  LEU A CA  1 
ATOM   1043 C C   . LEU A 1 134 ? 60.095 -22.931 -8.460  1.00   65.49  ? 221  LEU A C   1 
ATOM   1044 O O   . LEU A 1 134 ? 60.451 -23.978 -7.907  1.00   61.81  ? 221  LEU A O   1 
ATOM   1045 C CB  . LEU A 1 134 ? 59.057 -23.004 -10.791 1.00   63.55  ? 221  LEU A CB  1 
ATOM   1046 C CG  . LEU A 1 134 ? 57.813 -23.186 -11.679 1.00   63.72  ? 221  LEU A CG  1 
ATOM   1047 C CD1 . LEU A 1 134 ? 58.175 -23.300 -13.151 1.00   63.00  ? 221  LEU A CD1 1 
ATOM   1048 C CD2 . LEU A 1 134 ? 56.968 -24.404 -11.282 1.00   62.67  ? 221  LEU A CD2 1 
ATOM   1049 N N   . GLY A 1 135 ? 60.761 -21.784 -8.339  1.00   64.69  ? 222  GLY A N   1 
ATOM   1050 C CA  . GLY A 1 135 ? 61.954 -21.655 -7.530  1.00   64.60  ? 222  GLY A CA  1 
ATOM   1051 C C   . GLY A 1 135 ? 61.792 -22.027 -6.069  1.00   64.98  ? 222  GLY A C   1 
ATOM   1052 O O   . GLY A 1 135 ? 62.758 -22.273 -5.343  1.00   66.49  ? 222  GLY A O   1 
ATOM   1053 N N   . LEU A 1 136 ? 60.555 -22.041 -5.604  1.00   65.91  ? 223  LEU A N   1 
ATOM   1054 C CA  . LEU A 1 136 ? 60.287 -22.415 -4.222  1.00   67.46  ? 223  LEU A CA  1 
ATOM   1055 C C   . LEU A 1 136 ? 60.403 -23.911 -3.920  1.00   66.35  ? 223  LEU A C   1 
ATOM   1056 O O   . LEU A 1 136 ? 60.657 -24.307 -2.768  1.00   62.22  ? 223  LEU A O   1 
ATOM   1057 C CB  . LEU A 1 136 ? 58.879 -21.950 -3.845  1.00   69.83  ? 223  LEU A CB  1 
ATOM   1058 C CG  . LEU A 1 136 ? 58.649 -20.446 -3.960  1.00   71.92  ? 223  LEU A CG  1 
ATOM   1059 C CD1 . LEU A 1 136 ? 57.139 -20.192 -3.902  1.00   72.29  ? 223  LEU A CD1 1 
ATOM   1060 C CD2 . LEU A 1 136 ? 59.432 -19.721 -2.845  1.00   71.14  ? 223  LEU A CD2 1 
ATOM   1061 N N   . PHE A 1 137 ? 60.195 -24.732 -4.949  1.00   67.55  ? 224  PHE A N   1 
ATOM   1062 C CA  . PHE A 1 137 ? 60.209 -26.190 -4.797  1.00   68.83  ? 224  PHE A CA  1 
ATOM   1063 C C   . PHE A 1 137 ? 61.618 -26.765 -4.652  1.00   73.03  ? 224  PHE A C   1 
ATOM   1064 O O   . PHE A 1 137 ? 61.841 -27.940 -4.928  1.00   71.29  ? 224  PHE A O   1 
ATOM   1065 C CB  . PHE A 1 137 ? 59.495 -26.872 -5.963  1.00   67.30  ? 224  PHE A CB  1 
ATOM   1066 C CG  . PHE A 1 137 ? 58.044 -26.550 -6.022  1.00   66.08  ? 224  PHE A CG  1 
ATOM   1067 C CD1 . PHE A 1 137 ? 57.597 -25.462 -6.743  1.00   63.25  ? 224  PHE A CD1 1 
ATOM   1068 C CD2 . PHE A 1 137 ? 57.134 -27.286 -5.283  1.00   68.67  ? 224  PHE A CD2 1 
ATOM   1069 C CE1 . PHE A 1 137 ? 56.262 -25.127 -6.761  1.00   62.28  ? 224  PHE A CE1 1 
ATOM   1070 C CE2 . PHE A 1 137 ? 55.793 -26.951 -5.299  1.00   68.88  ? 224  PHE A CE2 1 
ATOM   1071 C CZ  . PHE A 1 137 ? 55.359 -25.866 -6.051  1.00   64.67  ? 224  PHE A CZ  1 
ATOM   1072 N N   . ASN A 1 138 ? 62.563 -25.917 -4.252  1.00   76.74  ? 225  ASN A N   1 
ATOM   1073 C CA  . ASN A 1 138 ? 63.894 -26.344 -3.861  1.00   78.01  ? 225  ASN A CA  1 
ATOM   1074 C C   . ASN A 1 138 ? 64.026 -26.324 -2.343  1.00   78.30  ? 225  ASN A C   1 
ATOM   1075 O O   . ASN A 1 138 ? 64.845 -27.058 -1.791  1.00   78.23  ? 225  ASN A O   1 
ATOM   1076 C CB  . ASN A 1 138 ? 64.932 -25.448 -4.544  1.00   78.10  ? 225  ASN A CB  1 
ATOM   1077 C CG  . ASN A 1 138 ? 65.000 -25.709 -6.031  1.00   77.58  ? 225  ASN A CG  1 
ATOM   1078 O OD1 . ASN A 1 138 ? 64.760 -24.818 -6.840  1.00   77.07  ? 225  ASN A OD1 1 
ATOM   1079 N ND2 . ASN A 1 138 ? 65.283 -26.950 -6.400  1.00   75.81  ? 225  ASN A ND2 1 
ATOM   1080 N N   . SER A 1 139 ? 63.148 -25.577 -1.674  1.00   79.03  ? 226  SER A N   1 
ATOM   1081 C CA  . SER A 1 139 ? 63.340 -25.240 -0.264  1.00   80.82  ? 226  SER A CA  1 
ATOM   1082 C C   . SER A 1 139 ? 63.563 -26.420 0.678   1.00   79.35  ? 226  SER A C   1 
ATOM   1083 O O   . SER A 1 139 ? 64.209 -26.241 1.717   1.00   79.51  ? 226  SER A O   1 
ATOM   1084 C CB  . SER A 1 139 ? 62.193 -24.363 0.257   1.00   82.64  ? 226  SER A CB  1 
ATOM   1085 O OG  . SER A 1 139 ? 61.071 -25.152 0.628   1.00   87.44  ? 226  SER A OG  1 
ATOM   1086 N N   . ASN A 1 140 ? 63.040 -27.599 0.329   1.00   77.73  ? 227  ASN A N   1 
ATOM   1087 C CA  . ASN A 1 140 ? 63.127 -28.769 1.204   1.00   77.25  ? 227  ASN A CA  1 
ATOM   1088 C C   . ASN A 1 140 ? 62.484 -28.467 2.574   1.00   72.65  ? 227  ASN A C   1 
ATOM   1089 O O   . ASN A 1 140 ? 62.846 -29.058 3.593   1.00   67.86  ? 227  ASN A O   1 
ATOM   1090 C CB  . ASN A 1 140 ? 64.606 -29.197 1.324   1.00   81.61  ? 227  ASN A CB  1 
ATOM   1091 C CG  . ASN A 1 140 ? 64.805 -30.644 1.810   1.00   83.57  ? 227  ASN A CG  1 
ATOM   1092 O OD1 . ASN A 1 140 ? 65.827 -30.943 2.428   1.00   84.18  ? 227  ASN A OD1 1 
ATOM   1093 N ND2 . ASN A 1 140 ? 63.853 -31.534 1.528   1.00   84.08  ? 227  ASN A ND2 1 
ATOM   1094 N N   . LYS A 1 141 ? 61.526 -27.538 2.569   1.00   71.23  ? 228  LYS A N   1 
ATOM   1095 C CA  . LYS A 1 141 ? 60.736 -27.160 3.738   1.00   70.06  ? 228  LYS A CA  1 
ATOM   1096 C C   . LYS A 1 141 ? 59.293 -27.619 3.509   1.00   66.24  ? 228  LYS A C   1 
ATOM   1097 O O   . LYS A 1 141 ? 58.582 -26.993 2.748   1.00   65.02  ? 228  LYS A O   1 
ATOM   1098 C CB  . LYS A 1 141 ? 60.814 -25.645 3.941   1.00   72.52  ? 228  LYS A CB  1 
ATOM   1099 C CG  . LYS A 1 141 ? 60.003 -25.090 5.114   1.00   74.04  ? 228  LYS A CG  1 
ATOM   1100 C CD  . LYS A 1 141 ? 60.162 -25.917 6.380   1.00   77.60  ? 228  LYS A CD  1 
ATOM   1101 C CE  . LYS A 1 141 ? 59.082 -25.592 7.396   1.00   80.03  ? 228  LYS A CE  1 
ATOM   1102 N NZ  . LYS A 1 141 ? 59.083 -24.145 7.731   1.00   80.48  ? 228  LYS A NZ  1 
ATOM   1103 N N   . PRO A 1 142 ? 58.852 -28.706 4.139   1.00   66.44  ? 229  PRO A N   1 
ATOM   1104 C CA  . PRO A 1 142 ? 57.569 -29.345 3.790   1.00   66.69  ? 229  PRO A CA  1 
ATOM   1105 C C   . PRO A 1 142 ? 56.347 -28.439 3.714   1.00   65.31  ? 229  PRO A C   1 
ATOM   1106 O O   . PRO A 1 142 ? 55.628 -28.524 2.716   1.00   65.08  ? 229  PRO A O   1 
ATOM   1107 C CB  . PRO A 1 142 ? 57.389 -30.401 4.891   1.00   66.88  ? 229  PRO A CB  1 
ATOM   1108 C CG  . PRO A 1 142 ? 58.798 -30.761 5.277   1.00   65.02  ? 229  PRO A CG  1 
ATOM   1109 C CD  . PRO A 1 142 ? 59.528 -29.436 5.228   1.00   65.56  ? 229  PRO A CD  1 
ATOM   1110 N N   . SER A 1 143 ? 56.150 -27.592 4.723   1.00   64.28  ? 230  SER A N   1 
ATOM   1111 C CA  . SER A 1 143 ? 55.024 -26.658 4.780   1.00   60.18  ? 230  SER A CA  1 
ATOM   1112 C C   . SER A 1 143 ? 55.000 -25.645 3.643   1.00   56.53  ? 230  SER A C   1 
ATOM   1113 O O   . SER A 1 143 ? 53.917 -25.242 3.203   1.00   57.28  ? 230  SER A O   1 
ATOM   1114 C CB  . SER A 1 143 ? 55.029 -25.893 6.095   1.00   61.96  ? 230  SER A CB  1 
ATOM   1115 O OG  . SER A 1 143 ? 55.939 -24.800 6.021   1.00   64.73  ? 230  SER A OG  1 
ATOM   1116 N N   . LEU A 1 144 ? 56.177 -25.245 3.174   1.00   53.28  ? 231  LEU A N   1 
ATOM   1117 C CA  . LEU A 1 144 ? 56.288 -24.290 2.068   1.00   54.96  ? 231  LEU A CA  1 
ATOM   1118 C C   . LEU A 1 144 ? 56.015 -24.930 0.710   1.00   56.76  ? 231  LEU A C   1 
ATOM   1119 O O   . LEU A 1 144 ? 55.418 -24.327 -0.193  1.00   57.71  ? 231  LEU A O   1 
ATOM   1120 C CB  . LEU A 1 144 ? 57.691 -23.691 2.012   1.00   55.61  ? 231  LEU A CB  1 
ATOM   1121 C CG  . LEU A 1 144 ? 57.968 -22.727 0.861   1.00   54.33  ? 231  LEU A CG  1 
ATOM   1122 C CD1 . LEU A 1 144 ? 57.008 -21.551 0.896   1.00   53.98  ? 231  LEU A CD1 1 
ATOM   1123 C CD2 . LEU A 1 144 ? 59.373 -22.181 0.965   1.00   56.98  ? 231  LEU A CD2 1 
ATOM   1124 N N   . ILE A 1 145 ? 56.494 -26.157 0.557   1.00   55.76  ? 232  ILE A N   1 
ATOM   1125 C CA  . ILE A 1 145 ? 56.208 -26.910 -0.654  1.00   55.66  ? 232  ILE A CA  1 
ATOM   1126 C C   . ILE A 1 145 ? 54.702 -27.176 -0.710  1.00   52.30  ? 232  ILE A C   1 
ATOM   1127 O O   . ILE A 1 145 ? 54.108 -27.093 -1.799  1.00   46.30  ? 232  ILE A O   1 
ATOM   1128 C CB  . ILE A 1 145 ? 56.994 -28.243 -0.679  1.00   56.22  ? 232  ILE A CB  1 
ATOM   1129 C CG1 . ILE A 1 145 ? 58.488 -27.990 -0.807  1.00   59.94  ? 232  ILE A CG1 1 
ATOM   1130 C CG2 . ILE A 1 145 ? 56.600 -29.114 -1.858  1.00   55.51  ? 232  ILE A CG2 1 
ATOM   1131 C CD1 . ILE A 1 145 ? 59.305 -29.182 -0.307  1.00   64.39  ? 232  ILE A CD1 1 
ATOM   1132 N N   . ARG A 1 146 ? 54.123 -27.473 0.461   1.00   50.92  ? 233  ARG A N   1 
ATOM   1133 C CA  . ARG A 1 146 ? 52.711 -27.807 0.580   1.00   50.77  ? 233  ARG A CA  1 
ATOM   1134 C C   . ARG A 1 146 ? 51.913 -26.634 0.071   1.00   48.93  ? 233  ARG A C   1 
ATOM   1135 O O   . ARG A 1 146 ? 51.015 -26.769 -0.747  1.00   48.30  ? 233  ARG A O   1 
ATOM   1136 C CB  . ARG A 1 146 ? 52.305 -28.112 2.023   1.00   51.22  ? 233  ARG A CB  1 
ATOM   1137 C CG  . ARG A 1 146 ? 50.904 -28.690 2.073   1.00   54.09  ? 233  ARG A CG  1 
ATOM   1138 C CD  . ARG A 1 146 ? 50.331 -28.830 3.446   1.00   55.49  ? 233  ARG A CD  1 
ATOM   1139 N NE  . ARG A 1 146 ? 51.088 -29.853 4.152   1.00   59.23  ? 233  ARG A NE  1 
ATOM   1140 C CZ  . ARG A 1 146 ? 52.013 -29.631 5.072   1.00   55.11  ? 233  ARG A CZ  1 
ATOM   1141 N NH1 . ARG A 1 146 ? 52.290 -28.404 5.476   1.00   53.54  ? 233  ARG A NH1 1 
ATOM   1142 N NH2 . ARG A 1 146 ? 52.640 -30.666 5.618   1.00   55.47  ? 233  ARG A NH2 1 
ATOM   1143 N N   . THR A 1 147 ? 52.301 -25.466 0.546   1.00   50.44  ? 234  THR A N   1 
ATOM   1144 C CA  . THR A 1 147 ? 51.586 -24.254 0.215   1.00   53.23  ? 234  THR A CA  1 
ATOM   1145 C C   . THR A 1 147 ? 51.779 -23.898 -1.260  1.00   53.65  ? 234  THR A C   1 
ATOM   1146 O O   . THR A 1 147 ? 50.834 -23.574 -1.975  1.00   55.03  ? 234  THR A O   1 
ATOM   1147 C CB  . THR A 1 147 ? 52.074 -23.134 1.137   1.00   53.77  ? 234  THR A CB  1 
ATOM   1148 O OG1 . THR A 1 147 ? 51.819 -23.500 2.502   1.00   52.79  ? 234  THR A OG1 1 
ATOM   1149 C CG2 . THR A 1 147 ? 51.256 -21.876 0.921   1.00   54.71  ? 234  THR A CG2 1 
ATOM   1150 N N   . ALA A 1 148 ? 53.020 -23.959 -1.715  1.00   52.32  ? 235  ALA A N   1 
ATOM   1151 C CA  . ALA A 1 148 ? 53.340 -23.632 -3.095  1.00   48.72  ? 235  ALA A CA  1 
ATOM   1152 C C   . ALA A 1 148 ? 52.578 -24.527 -4.067  1.00   45.43  ? 235  ALA A C   1 
ATOM   1153 O O   . ALA A 1 148 ? 52.191 -24.082 -5.146  1.00   43.84  ? 235  ALA A O   1 
ATOM   1154 C CB  . ALA A 1 148 ? 54.828 -23.764 -3.298  1.00   51.20  ? 235  ALA A CB  1 
ATOM   1155 N N   . THR A 1 149 ? 52.324 -25.768 -3.665  1.00   40.95  ? 236  THR A N   1 
ATOM   1156 C CA  . THR A 1 149 ? 51.583 -26.694 -4.499  1.00   40.96  ? 236  THR A CA  1 
ATOM   1157 C C   . THR A 1 149 ? 50.096 -26.325 -4.559  1.00   40.82  ? 236  THR A C   1 
ATOM   1158 O O   . THR A 1 149 ? 49.455 -26.332 -5.623  1.00   36.77  ? 236  THR A O   1 
ATOM   1159 C CB  . THR A 1 149 ? 51.778 -28.109 -3.969  1.00   42.75  ? 236  THR A CB  1 
ATOM   1160 O OG1 . THR A 1 149 ? 53.160 -28.458 -4.095  1.00   45.38  ? 236  THR A OG1 1 
ATOM   1161 C CG2 . THR A 1 149 ? 51.068 -29.136 -4.846  1.00   43.20  ? 236  THR A CG2 1 
ATOM   1162 N N   . TRP A 1 150 ? 49.532 -25.999 -3.401  1.00   41.64  ? 237  TRP A N   1 
ATOM   1163 C CA  . TRP A 1 150 ? 48.161 -25.494 -3.367  1.00   41.06  ? 237  TRP A CA  1 
ATOM   1164 C C   . TRP A 1 150 ? 47.980 -24.321 -4.342  1.00   36.63  ? 237  TRP A C   1 
ATOM   1165 O O   . TRP A 1 150 ? 47.168 -24.373 -5.248  1.00   31.90  ? 237  TRP A O   1 
ATOM   1166 C CB  . TRP A 1 150 ? 47.820 -25.064 -1.944  1.00   43.22  ? 237  TRP A CB  1 
ATOM   1167 C CG  . TRP A 1 150 ? 46.382 -24.657 -1.746  1.00   44.07  ? 237  TRP A CG  1 
ATOM   1168 C CD1 . TRP A 1 150 ? 45.300 -25.478 -1.614  1.00   40.18  ? 237  TRP A CD1 1 
ATOM   1169 C CD2 . TRP A 1 150 ? 45.885 -23.323 -1.669  1.00   42.96  ? 237  TRP A CD2 1 
ATOM   1170 N NE1 . TRP A 1 150 ? 44.165 -24.729 -1.448  1.00   39.36  ? 237  TRP A NE1 1 
ATOM   1171 C CE2 . TRP A 1 150 ? 44.499 -23.404 -1.480  1.00   41.25  ? 237  TRP A CE2 1 
ATOM   1172 C CE3 . TRP A 1 150 ? 46.475 -22.062 -1.714  1.00   44.53  ? 237  TRP A CE3 1 
ATOM   1173 C CZ2 . TRP A 1 150 ? 43.701 -22.284 -1.368  1.00   42.22  ? 237  TRP A CZ2 1 
ATOM   1174 C CZ3 . TRP A 1 150 ? 45.674 -20.946 -1.578  1.00   45.62  ? 237  TRP A CZ3 1 
ATOM   1175 C CH2 . TRP A 1 150 ? 44.306 -21.069 -1.391  1.00   41.13  ? 237  TRP A CH2 1 
ATOM   1176 N N   . THR A 1 151 ? 48.783 -23.284 -4.185  1.00   36.36  ? 238  THR A N   1 
ATOM   1177 C CA  . THR A 1 151 ? 48.754 -22.147 -5.105  1.00   41.58  ? 238  THR A CA  1 
ATOM   1178 C C   . THR A 1 151 ? 48.927 -22.530 -6.579  1.00   44.43  ? 238  THR A C   1 
ATOM   1179 O O   . THR A 1 151 ? 48.261 -21.987 -7.480  1.00   42.30  ? 238  THR A O   1 
ATOM   1180 C CB  . THR A 1 151 ? 49.880 -21.184 -4.713  1.00   40.74  ? 238  THR A CB  1 
ATOM   1181 O OG1 . THR A 1 151 ? 49.620 -20.646 -3.411  1.00   41.10  ? 238  THR A OG1 1 
ATOM   1182 C CG2 . THR A 1 151 ? 49.937 -19.971 -5.637  1.00   41.44  ? 238  THR A CG2 1 
ATOM   1183 N N   . LEU A 1 152 ? 49.865 -23.446 -6.813  1.00   45.25  ? 239  LEU A N   1 
ATOM   1184 C CA  . LEU A 1 152 ? 50.192 -23.863 -8.170  1.00   44.91  ? 239  LEU A CA  1 
ATOM   1185 C C   . LEU A 1 152 ? 48.944 -24.430 -8.838  1.00   39.10  ? 239  LEU A C   1 
ATOM   1186 O O   . LEU A 1 152 ? 48.628 -24.099 -9.978  1.00   38.57  ? 239  LEU A O   1 
ATOM   1187 C CB  . LEU A 1 152 ? 51.385 -24.832 -8.140  1.00   45.64  ? 239  LEU A CB  1 
ATOM   1188 C CG  . LEU A 1 152 ? 51.958 -25.317 -9.478  1.00   49.75  ? 239  LEU A CG  1 
ATOM   1189 C CD1 . LEU A 1 152 ? 52.592 -24.185 -10.257 1.00   48.99  ? 239  LEU A CD1 1 
ATOM   1190 C CD2 . LEU A 1 152 ? 52.998 -26.403 -9.190  1.00   55.76  ? 239  LEU A CD2 1 
ATOM   1191 N N   . SER A 1 153 ? 48.224 -25.267 -8.108  1.00   37.99  ? 240  SER A N   1 
ATOM   1192 C CA  . SER A 1 153 ? 47.013 -25.891 -8.633  1.00   38.07  ? 240  SER A CA  1 
ATOM   1193 C C   . SER A 1 153 ? 45.955 -24.844 -8.960  1.00   38.59  ? 240  SER A C   1 
ATOM   1194 O O   . SER A 1 153 ? 45.212 -25.027 -9.922  1.00   37.40  ? 240  SER A O   1 
ATOM   1195 C CB  . SER A 1 153 ? 46.439 -26.928 -7.649  1.00   37.34  ? 240  SER A CB  1 
ATOM   1196 O OG  . SER A 1 153 ? 46.018 -26.322 -6.443  1.00   37.53  ? 240  SER A OG  1 
ATOM   1197 N N   . ASN A 1 154 ? 45.869 -23.785 -8.152  1.00   38.43  ? 241  ASN A N   1 
ATOM   1198 C CA  . ASN A 1 154 ? 44.934 -22.692 -8.404  1.00   42.55  ? 241  ASN A CA  1 
ATOM   1199 C C   . ASN A 1 154 ? 45.317 -21.911 -9.660  1.00   43.62  ? 241  ASN A C   1 
ATOM   1200 O O   . ASN A 1 154 ? 44.444 -21.321 -10.310 1.00   46.96  ? 241  ASN A O   1 
ATOM   1201 C CB  . ASN A 1 154 ? 44.817 -21.737 -7.197  1.00   43.77  ? 241  ASN A CB  1 
ATOM   1202 C CG  . ASN A 1 154 ? 43.948 -22.296 -6.066  1.00   45.58  ? 241  ASN A CG  1 
ATOM   1203 O OD1 . ASN A 1 154 ? 43.213 -23.276 -6.223  1.00   45.30  ? 241  ASN A OD1 1 
ATOM   1204 N ND2 . ASN A 1 154 ? 44.015 -21.637 -4.917  1.00   47.66  ? 241  ASN A ND2 1 
ATOM   1205 N N   . LEU A 1 155 ? 46.605 -21.876 -9.997  1.00   42.36  ? 242  LEU A N   1 
ATOM   1206 C CA  . LEU A 1 155 ? 47.005 -21.229 -11.249 1.00   42.48  ? 242  LEU A CA  1 
ATOM   1207 C C   . LEU A 1 155 ? 46.611 -22.061 -12.457 1.00   41.67  ? 242  LEU A C   1 
ATOM   1208 O O   . LEU A 1 155 ? 46.477 -21.519 -13.551 1.00   40.10  ? 242  LEU A O   1 
ATOM   1209 C CB  . LEU A 1 155 ? 48.489 -20.934 -11.296 1.00   42.95  ? 242  LEU A CB  1 
ATOM   1210 C CG  . LEU A 1 155 ? 48.978 -20.017 -10.178 1.00   47.31  ? 242  LEU A CG  1 
ATOM   1211 C CD1 . LEU A 1 155 ? 50.469 -20.084 -10.008 1.00   48.51  ? 242  LEU A CD1 1 
ATOM   1212 C CD2 . LEU A 1 155 ? 48.574 -18.575 -10.447 1.00   51.39  ? 242  LEU A CD2 1 
ATOM   1213 N N   . CYS A 1 156 ? 46.374 -23.352 -12.264 1.00   39.02  ? 243  CYS A N   1 
ATOM   1214 C CA  . CYS A 1 156 ? 45.998 -24.204 -13.393 1.00   43.16  ? 243  CYS A CA  1 
ATOM   1215 C C   . CYS A 1 156 ? 44.509 -24.399 -13.581 1.00   43.29  ? 243  CYS A C   1 
ATOM   1216 O O   . CYS A 1 156 ? 44.071 -24.851 -14.655 1.00   39.03  ? 243  CYS A O   1 
ATOM   1217 C CB  . CYS A 1 156 ? 46.567 -25.601 -13.194 1.00   47.38  ? 243  CYS A CB  1 
ATOM   1218 S SG  . CYS A 1 156 ? 48.365 -25.598 -13.207 1.00   49.26  ? 243  CYS A SG  1 
ATOM   1219 N N   . ARG A 1 157 ? 43.771 -24.090 -12.512 1.00   44.42  ? 244  ARG A N   1 
ATOM   1220 C CA  . ARG A 1 157 ? 42.347 -24.379 -12.413 1.00   43.43  ? 244  ARG A CA  1 
ATOM   1221 C C   . ARG A 1 157 ? 41.601 -23.468 -13.353 1.00   43.42  ? 244  ARG A C   1 
ATOM   1222 O O   . ARG A 1 157 ? 42.018 -22.330 -13.593 1.00   43.59  ? 244  ARG A O   1 
ATOM   1223 C CB  . ARG A 1 157 ? 41.877 -24.106 -10.984 1.00   45.21  ? 244  ARG A CB  1 
ATOM   1224 C CG  . ARG A 1 157 ? 40.391 -24.321 -10.730 1.00   50.09  ? 244  ARG A CG  1 
ATOM   1225 C CD  . ARG A 1 157 ? 40.023 -24.180 -9.259  1.00   53.33  ? 244  ARG A CD  1 
ATOM   1226 N NE  . ARG A 1 157 ? 39.533 -22.841 -8.953  1.00   51.10  ? 244  ARG A NE  1 
ATOM   1227 C CZ  . ARG A 1 157 ? 39.812 -22.142 -7.860  1.00   49.39  ? 244  ARG A CZ  1 
ATOM   1228 N NH1 . ARG A 1 157 ? 40.576 -22.608 -6.887  1.00   52.81  ? 244  ARG A NH1 1 
ATOM   1229 N NH2 . ARG A 1 157 ? 39.320 -20.930 -7.747  1.00   51.40  ? 244  ARG A NH2 1 
ATOM   1230 N N   . GLY A 1 158 ? 40.505 -23.999 -13.872 1.00   43.54  ? 245  GLY A N   1 
ATOM   1231 C CA  . GLY A 1 158 ? 39.618 -23.251 -14.730 1.00   45.97  ? 245  GLY A CA  1 
ATOM   1232 C C   . GLY A 1 158 ? 39.730 -23.517 -16.220 1.00   48.51  ? 245  GLY A C   1 
ATOM   1233 O O   . GLY A 1 158 ? 40.787 -23.306 -16.821 1.00   49.55  ? 245  GLY A O   1 
ATOM   1234 N N   . LYS A 1 159 ? 38.611 -23.914 -16.817 1.00   49.91  ? 246  LYS A N   1 
ATOM   1235 C CA  . LYS A 1 159 ? 38.538 -24.337 -18.221 1.00   54.01  ? 246  LYS A CA  1 
ATOM   1236 C C   . LYS A 1 159 ? 37.959 -23.263 -19.148 1.00   60.13  ? 246  LYS A C   1 
ATOM   1237 O O   . LYS A 1 159 ? 38.279 -23.230 -20.334 1.00   61.23  ? 246  LYS A O   1 
ATOM   1238 C CB  . LYS A 1 159 ? 37.607 -25.548 -18.282 1.00   53.91  ? 246  LYS A CB  1 
ATOM   1239 C CG  . LYS A 1 159 ? 37.827 -26.501 -19.403 1.00   53.15  ? 246  LYS A CG  1 
ATOM   1240 C CD  . LYS A 1 159 ? 36.915 -27.700 -19.249 1.00   50.86  ? 246  LYS A CD  1 
ATOM   1241 C CE  . LYS A 1 159 ? 37.161 -28.611 -20.441 1.00   52.79  ? 246  LYS A CE  1 
ATOM   1242 N NZ  . LYS A 1 159 ? 36.341 -29.852 -20.330 1.00   54.70  ? 246  LYS A NZ  1 
ATOM   1243 N N   . LYS A 1 160 ? 37.098 -22.402 -18.603 1.00   61.60  ? 247  LYS A N   1 
ATOM   1244 C CA  . LYS A 1 160 ? 36.475 -21.322 -19.358 1.00   58.79  ? 247  LYS A CA  1 
ATOM   1245 C C   . LYS A 1 160 ? 36.710 -19.948 -18.747 1.00   55.47  ? 247  LYS A C   1 
ATOM   1246 O O   . LYS A 1 160 ? 35.921 -19.499 -17.932 1.00   55.31  ? 247  LYS A O   1 
ATOM   1247 C CB  . LYS A 1 160 ? 34.972 -21.533 -19.546 1.00   58.92  ? 247  LYS A CB  1 
ATOM   1248 C CG  . LYS A 1 160 ? 34.191 -22.118 -18.399 1.00   58.35  ? 247  LYS A CG  1 
ATOM   1249 C CD  . LYS A 1 160 ? 33.353 -23.255 -18.993 1.00   55.89  ? 247  LYS A CD  1 
ATOM   1250 C CE  . LYS A 1 160 ? 32.503 -23.948 -17.967 1.00   56.30  ? 247  LYS A CE  1 
ATOM   1251 N NZ  . LYS A 1 160 ? 31.553 -22.972 -17.388 1.00   64.22  ? 247  LYS A NZ  1 
ATOM   1252 N N   . PRO A 1 161 ? 37.761 -19.268 -19.182 1.00   53.85  ? 248  PRO A N   1 
ATOM   1253 C CA  . PRO A 1 161 ? 38.684 -19.800 -20.193 1.00   53.25  ? 248  PRO A CA  1 
ATOM   1254 C C   . PRO A 1 161 ? 39.800 -20.619 -19.564 1.00   51.78  ? 248  PRO A C   1 
ATOM   1255 O O   . PRO A 1 161 ? 39.942 -20.489 -18.352 1.00   45.97  ? 248  PRO A O   1 
ATOM   1256 C CB  . PRO A 1 161 ? 39.276 -18.522 -20.817 1.00   52.75  ? 248  PRO A CB  1 
ATOM   1257 C CG  . PRO A 1 161 ? 39.182 -17.443 -19.752 1.00   49.32  ? 248  PRO A CG  1 
ATOM   1258 C CD  . PRO A 1 161 ? 38.131 -17.901 -18.764 1.00   52.80  ? 248  PRO A CD  1 
ATOM   1259 N N   . GLN A 1 162 ? 40.585 -21.355 -20.360 1.00   54.46  ? 249  GLN A N   1 
ATOM   1260 C CA  . GLN A 1 162 ? 41.792 -22.049 -19.879 1.00   57.33  ? 249  GLN A CA  1 
ATOM   1261 C C   . GLN A 1 162 ? 42.813 -21.000 -19.521 1.00   55.83  ? 249  GLN A C   1 
ATOM   1262 O O   . GLN A 1 162 ? 42.698 -19.892 -20.016 1.00   62.12  ? 249  GLN A O   1 
ATOM   1263 C CB  . GLN A 1 162 ? 42.419 -22.974 -20.935 1.00   58.08  ? 249  GLN A CB  1 
ATOM   1264 C CG  . GLN A 1 162 ? 41.498 -24.110 -21.385 1.00   59.35  ? 249  GLN A CG  1 
ATOM   1265 C CD  . GLN A 1 162 ? 41.775 -25.471 -20.753 1.00   57.12  ? 249  GLN A CD  1 
ATOM   1266 O OE1 . GLN A 1 162 ? 42.520 -25.586 -19.769 1.00   57.31  ? 249  GLN A OE1 1 
ATOM   1267 N NE2 . GLN A 1 162 ? 41.130 -26.511 -21.310 1.00   56.46  ? 249  GLN A NE2 1 
ATOM   1268 N N   . PRO A 1 163 ? 43.764 -21.286 -18.644 1.00   55.34  ? 250  PRO A N   1 
ATOM   1269 C CA  . PRO A 1 163 ? 44.888 -20.360 -18.473 1.00   56.35  ? 250  PRO A CA  1 
ATOM   1270 C C   . PRO A 1 163 ? 45.805 -20.491 -19.684 1.00   58.10  ? 250  PRO A C   1 
ATOM   1271 O O   . PRO A 1 163 ? 45.651 -21.390 -20.514 1.00   60.35  ? 250  PRO A O   1 
ATOM   1272 C CB  . PRO A 1 163 ? 45.591 -20.861 -17.206 1.00   55.63  ? 250  PRO A CB  1 
ATOM   1273 C CG  . PRO A 1 163 ? 45.236 -22.319 -17.104 1.00   53.55  ? 250  PRO A CG  1 
ATOM   1274 C CD  . PRO A 1 163 ? 43.873 -22.456 -17.751 1.00   55.00  ? 250  PRO A CD  1 
ATOM   1275 N N   . ASP A 1 164 ? 46.736 -19.556 -19.777 1.00   61.65  ? 251  ASP A N   1 
ATOM   1276 C CA  . ASP A 1 164 ? 47.722 -19.494 -20.847 1.00   62.53  ? 251  ASP A CA  1 
ATOM   1277 C C   . ASP A 1 164 ? 48.603 -20.753 -20.768 1.00   58.37  ? 251  ASP A C   1 
ATOM   1278 O O   . ASP A 1 164 ? 49.489 -20.886 -19.914 1.00   55.64  ? 251  ASP A O   1 
ATOM   1279 C CB  . ASP A 1 164 ? 48.522 -18.194 -20.659 1.00   64.32  ? 251  ASP A CB  1 
ATOM   1280 C CG  . ASP A 1 164 ? 49.620 -17.988 -21.692 1.00   67.21  ? 251  ASP A CG  1 
ATOM   1281 O OD1 . ASP A 1 164 ? 49.879 -18.857 -22.557 1.00   66.48  ? 251  ASP A OD1 1 
ATOM   1282 O OD2 . ASP A 1 164 ? 50.283 -16.930 -21.695 1.00   71.20  ? 251  ASP A OD2 1 
ATOM   1283 N N   . TRP A 1 165 ? 48.364 -21.662 -21.700 1.00   53.52  ? 252  TRP A N   1 
ATOM   1284 C CA  . TRP A 1 165 ? 49.058 -22.939 -21.706 1.00   56.36  ? 252  TRP A CA  1 
ATOM   1285 C C   . TRP A 1 165 ? 50.590 -22.899 -21.729 1.00   56.94  ? 252  TRP A C   1 
ATOM   1286 O O   . TRP A 1 165 ? 51.271 -23.738 -21.123 1.00   55.65  ? 252  TRP A O   1 
ATOM   1287 C CB  . TRP A 1 165 ? 48.567 -23.776 -22.882 1.00   57.51  ? 252  TRP A CB  1 
ATOM   1288 C CG  . TRP A 1 165 ? 49.329 -25.020 -22.994 1.00   59.34  ? 252  TRP A CG  1 
ATOM   1289 C CD1 . TRP A 1 165 ? 50.304 -25.296 -23.884 1.00   59.64  ? 252  TRP A CD1 1 
ATOM   1290 C CD2 . TRP A 1 165 ? 49.208 -26.162 -22.147 1.00   62.67  ? 252  TRP A CD2 1 
ATOM   1291 N NE1 . TRP A 1 165 ? 50.793 -26.559 -23.667 1.00   61.95  ? 252  TRP A NE1 1 
ATOM   1292 C CE2 . TRP A 1 165 ? 50.144 -27.111 -22.597 1.00   64.50  ? 252  TRP A CE2 1 
ATOM   1293 C CE3 . TRP A 1 165 ? 48.409 -26.478 -21.043 1.00   60.83  ? 252  TRP A CE3 1 
ATOM   1294 C CZ2 . TRP A 1 165 ? 50.296 -28.359 -21.994 1.00   62.98  ? 252  TRP A CZ2 1 
ATOM   1295 C CZ3 . TRP A 1 165 ? 48.561 -27.709 -20.447 1.00   62.07  ? 252  TRP A CZ3 1 
ATOM   1296 C CH2 . TRP A 1 165 ? 49.488 -28.640 -20.929 1.00   62.19  ? 252  TRP A CH2 1 
ATOM   1297 N N   . SER A 1 166 ? 51.125 -21.924 -22.451 1.00   60.67  ? 253  SER A N   1 
ATOM   1298 C CA  . SER A 1 166 ? 52.569 -21.787 -22.610 1.00   62.36  ? 253  SER A CA  1 
ATOM   1299 C C   . SER A 1 166 ? 53.254 -21.441 -21.278 1.00   62.08  ? 253  SER A C   1 
ATOM   1300 O O   . SER A 1 166 ? 54.447 -21.706 -21.112 1.00   62.07  ? 253  SER A O   1 
ATOM   1301 C CB  . SER A 1 166 ? 52.868 -20.759 -23.705 1.00   62.48  ? 253  SER A CB  1 
ATOM   1302 O OG  . SER A 1 166 ? 52.270 -19.519 -23.387 1.00   65.65  ? 253  SER A OG  1 
ATOM   1303 N N   . VAL A 1 167 ? 52.496 -20.872 -20.336 1.00   61.94  ? 254  VAL A N   1 
ATOM   1304 C CA  . VAL A 1 167 ? 52.986 -20.593 -18.979 1.00   60.19  ? 254  VAL A CA  1 
ATOM   1305 C C   . VAL A 1 167 ? 52.740 -21.738 -17.976 1.00   58.78  ? 254  VAL A C   1 
ATOM   1306 O O   . VAL A 1 167 ? 53.674 -22.166 -17.297 1.00   61.57  ? 254  VAL A O   1 
ATOM   1307 C CB  . VAL A 1 167 ? 52.355 -19.291 -18.416 1.00   60.92  ? 254  VAL A CB  1 
ATOM   1308 C CG1 . VAL A 1 167 ? 52.872 -18.964 -17.019 1.00   61.93  ? 254  VAL A CG1 1 
ATOM   1309 C CG2 . VAL A 1 167 ? 52.613 -18.104 -19.332 1.00   60.84  ? 254  VAL A CG2 1 
ATOM   1310 N N   . VAL A 1 168 ? 51.508 -22.239 -17.868 1.00   55.36  ? 255  VAL A N   1 
ATOM   1311 C CA  . VAL A 1 168 ? 51.180 -23.215 -16.819 1.00   53.30  ? 255  VAL A CA  1 
ATOM   1312 C C   . VAL A 1 168 ? 51.815 -24.579 -17.066 1.00   54.19  ? 255  VAL A C   1 
ATOM   1313 O O   . VAL A 1 168 ? 52.200 -25.241 -16.101 1.00   51.27  ? 255  VAL A O   1 
ATOM   1314 C CB  . VAL A 1 168 ? 49.660 -23.379 -16.561 1.00   51.67  ? 255  VAL A CB  1 
ATOM   1315 C CG1 . VAL A 1 168 ? 49.093 -22.151 -15.858 1.00   51.22  ? 255  VAL A CG1 1 
ATOM   1316 C CG2 . VAL A 1 168 ? 48.889 -23.674 -17.843 1.00   47.22  ? 255  VAL A CG2 1 
ATOM   1317 N N   . SER A 1 169 ? 51.957 -24.953 -18.342 1.00   55.54  ? 256  SER A N   1 
ATOM   1318 C CA  . SER A 1 169 ? 52.676 -26.168 -18.766 1.00   54.08  ? 256  SER A CA  1 
ATOM   1319 C C   . SER A 1 169 ? 54.143 -26.218 -18.311 1.00   53.00  ? 256  SER A C   1 
ATOM   1320 O O   . SER A 1 169 ? 54.723 -27.295 -18.221 1.00   56.52  ? 256  SER A O   1 
ATOM   1321 C CB  . SER A 1 169 ? 52.588 -26.369 -20.281 1.00   54.25  ? 256  SER A CB  1 
ATOM   1322 O OG  . SER A 1 169 ? 53.238 -25.334 -20.987 1.00   52.99  ? 256  SER A OG  1 
ATOM   1323 N N   . GLN A 1 170 ? 54.732 -25.083 -17.950 1.00   51.58  ? 257  GLN A N   1 
ATOM   1324 C CA  . GLN A 1 170 ? 56.091 -25.083 -17.413 1.00   52.86  ? 257  GLN A CA  1 
ATOM   1325 C C   . GLN A 1 170 ? 56.172 -25.733 -16.034 1.00   51.91  ? 257  GLN A C   1 
ATOM   1326 O O   . GLN A 1 170 ? 57.250 -25.815 -15.438 1.00   47.88  ? 257  GLN A O   1 
ATOM   1327 C CB  . GLN A 1 170 ? 56.611 -23.651 -17.270 1.00   54.66  ? 257  GLN A CB  1 
ATOM   1328 C CG  . GLN A 1 170 ? 56.740 -22.865 -18.577 1.00   57.99  ? 257  GLN A CG  1 
ATOM   1329 C CD  . GLN A 1 170 ? 57.309 -21.466 -18.326 1.00   58.55  ? 257  GLN A CD  1 
ATOM   1330 O OE1 . GLN A 1 170 ? 58.132 -21.277 -17.422 1.00   54.94  ? 257  GLN A OE1 1 
ATOM   1331 N NE2 . GLN A 1 170 ? 56.848 -20.488 -19.097 1.00   58.42  ? 257  GLN A NE2 1 
ATOM   1332 N N   . ALA A 1 171 ? 55.020 -26.107 -15.482 1.00   53.49  ? 258  ALA A N   1 
ATOM   1333 C CA  . ALA A 1 171 ? 54.968 -26.655 -14.127 1.00   52.75  ? 258  ALA A CA  1 
ATOM   1334 C C   . ALA A 1 171 ? 54.930 -28.165 -14.175 1.00   49.80  ? 258  ALA A C   1 
ATOM   1335 O O   . ALA A 1 171 ? 55.210 -28.802 -13.169 1.00   50.62  ? 258  ALA A O   1 
ATOM   1336 C CB  . ALA A 1 171 ? 53.792 -26.120 -13.358 1.00   53.05  ? 258  ALA A CB  1 
ATOM   1337 N N   . LEU A 1 172 ? 54.643 -28.734 -15.343 1.00   47.33  ? 259  LEU A N   1 
ATOM   1338 C CA  . LEU A 1 172 ? 54.674 -30.191 -15.491 1.00   46.97  ? 259  LEU A CA  1 
ATOM   1339 C C   . LEU A 1 172 ? 55.899 -30.917 -14.903 1.00   47.31  ? 259  LEU A C   1 
ATOM   1340 O O   . LEU A 1 172 ? 55.746 -31.835 -14.109 1.00   47.92  ? 259  LEU A O   1 
ATOM   1341 C CB  . LEU A 1 172 ? 54.449 -30.556 -16.956 1.00   45.10  ? 259  LEU A CB  1 
ATOM   1342 C CG  . LEU A 1 172 ? 53.003 -30.384 -17.432 1.00   44.70  ? 259  LEU A CG  1 
ATOM   1343 C CD1 . LEU A 1 172 ? 52.889 -30.693 -18.904 1.00   43.36  ? 259  LEU A CD1 1 
ATOM   1344 C CD2 . LEU A 1 172 ? 52.003 -31.250 -16.684 1.00   42.92  ? 259  LEU A CD2 1 
ATOM   1345 N N   . PRO A 1 173 ? 57.125 -30.528 -15.238 1.00   50.83  ? 260  PRO A N   1 
ATOM   1346 C CA  . PRO A 1 173 ? 58.284 -31.204 -14.644 1.00   47.23  ? 260  PRO A CA  1 
ATOM   1347 C C   . PRO A 1 173 ? 58.261 -31.220 -13.141 1.00   44.72  ? 260  PRO A C   1 
ATOM   1348 O O   . PRO A 1 173 ? 58.641 -32.243 -12.582 1.00   44.48  ? 260  PRO A O   1 
ATOM   1349 C CB  . PRO A 1 173 ? 59.477 -30.379 -15.142 1.00   49.01  ? 260  PRO A CB  1 
ATOM   1350 C CG  . PRO A 1 173 ? 58.980 -29.777 -16.461 1.00   50.72  ? 260  PRO A CG  1 
ATOM   1351 C CD  . PRO A 1 173 ? 57.526 -29.486 -16.207 1.00   52.11  ? 260  PRO A CD  1 
ATOM   1352 N N   . THR A 1 174 ? 57.854 -30.125 -12.502 1.00   47.13  ? 261  THR A N   1 
ATOM   1353 C CA  . THR A 1 174 ? 57.814 -30.076 -11.024 1.00   46.86  ? 261  THR A CA  1 
ATOM   1354 C C   . THR A 1 174 ? 56.726 -30.963 -10.435 1.00   46.51  ? 261  THR A C   1 
ATOM   1355 O O   . THR A 1 174 ? 56.964 -31.707 -9.485  1.00   47.61  ? 261  THR A O   1 
ATOM   1356 C CB  . THR A 1 174 ? 57.575 -28.675 -10.498 1.00   44.07  ? 261  THR A CB  1 
ATOM   1357 O OG1 . THR A 1 174 ? 58.586 -27.798 -10.989 1.00   46.67  ? 261  THR A OG1 1 
ATOM   1358 C CG2 . THR A 1 174 ? 57.760 -28.663 -8.997  1.00   42.58  ? 261  THR A CG2 1 
ATOM   1359 N N   . LEU A 1 175 ? 55.524 -30.826 -10.975 1.00   44.91  ? 262  LEU A N   1 
ATOM   1360 C CA  . LEU A 1 175 ? 54.412 -31.658 -10.553 1.00   48.34  ? 262  LEU A CA  1 
ATOM   1361 C C   . LEU A 1 175 ? 54.825 -33.137 -10.704 1.00   51.86  ? 262  LEU A C   1 
ATOM   1362 O O   . LEU A 1 175 ? 54.580 -33.931 -9.784  1.00   51.65  ? 262  LEU A O   1 
ATOM   1363 C CB  . LEU A 1 175 ? 53.148 -31.353 -11.364 1.00   46.10  ? 262  LEU A CB  1 
ATOM   1364 C CG  . LEU A 1 175 ? 52.573 -29.955 -11.141 1.00   48.26  ? 262  LEU A CG  1 
ATOM   1365 C CD1 . LEU A 1 175 ? 51.665 -29.518 -12.298 1.00   49.10  ? 262  LEU A CD1 1 
ATOM   1366 C CD2 . LEU A 1 175 ? 51.823 -29.928 -9.826  1.00   47.72  ? 262  LEU A CD2 1 
ATOM   1367 N N   . ALA A 1 176 ? 55.493 -33.493 -11.812 1.00   48.10  ? 263  ALA A N   1 
ATOM   1368 C CA  . ALA A 1 176 ? 55.814 -34.901 -12.083 1.00   45.18  ? 263  ALA A CA  1 
ATOM   1369 C C   . ALA A 1 176 ? 56.566 -35.511 -10.919 1.00   42.51  ? 263  ALA A C   1 
ATOM   1370 O O   . ALA A 1 176 ? 56.450 -36.707 -10.630 1.00   39.61  ? 263  ALA A O   1 
ATOM   1371 C CB  . ALA A 1 176 ? 56.618 -35.072 -13.350 1.00   42.01  ? 263  ALA A CB  1 
ATOM   1372 N N   . LYS A 1 177 ? 57.353 -34.661 -10.274 1.00   42.89  ? 264  LYS A N   1 
ATOM   1373 C CA  . LYS A 1 177 ? 58.069 -35.065 -9.071  1.00   43.80  ? 264  LYS A CA  1 
ATOM   1374 C C   . LYS A 1 177 ? 57.162 -35.015 -7.848  1.00   40.52  ? 264  LYS A C   1 
ATOM   1375 O O   . LYS A 1 177 ? 57.238 -35.865 -6.983  1.00   35.17  ? 264  LYS A O   1 
ATOM   1376 C CB  . LYS A 1 177 ? 59.300 -34.174 -8.863  1.00   45.06  ? 264  LYS A CB  1 
ATOM   1377 C CG  . LYS A 1 177 ? 60.373 -34.344 -9.940  1.00   49.92  ? 264  LYS A CG  1 
ATOM   1378 C CD  . LYS A 1 177 ? 61.328 -33.146 -9.991  1.00   55.90  ? 264  LYS A CD  1 
ATOM   1379 C CE  . LYS A 1 177 ? 62.791 -33.565 -9.983  1.00   58.34  ? 264  LYS A CE  1 
ATOM   1380 N NZ  . LYS A 1 177 ? 63.696 -32.364 -9.999  1.00   58.09  ? 264  LYS A NZ  1 
ATOM   1381 N N   . LEU A 1 178 ? 56.300 -34.006 -7.776  1.00   45.19  ? 265  LEU A N   1 
ATOM   1382 C CA  . LEU A 1 178 ? 55.442 -33.806 -6.614  1.00   43.87  ? 265  LEU A CA  1 
ATOM   1383 C C   . LEU A 1 178 ? 54.476 -34.936 -6.354  1.00   40.40  ? 265  LEU A C   1 
ATOM   1384 O O   . LEU A 1 178 ? 54.146 -35.162 -5.199  1.00   41.15  ? 265  LEU A O   1 
ATOM   1385 C CB  . LEU A 1 178 ? 54.670 -32.495 -6.741  1.00   45.34  ? 265  LEU A CB  1 
ATOM   1386 C CG  . LEU A 1 178 ? 55.551 -31.251 -6.609  1.00   43.83  ? 265  LEU A CG  1 
ATOM   1387 C CD1 . LEU A 1 178 ? 54.759 -30.039 -7.028  1.00   44.44  ? 265  LEU A CD1 1 
ATOM   1388 C CD2 . LEU A 1 178 ? 56.040 -31.093 -5.163  1.00   46.78  ? 265  LEU A CD2 1 
ATOM   1389 N N   . ILE A 1 179 ? 54.043 -35.641 -7.399  1.00   40.34  ? 266  ILE A N   1 
ATOM   1390 C CA  . ILE A 1 179 ? 53.179 -36.809 -7.233  1.00   40.61  ? 266  ILE A CA  1 
ATOM   1391 C C   . ILE A 1 179 ? 53.901 -38.041 -6.692  1.00   41.70  ? 266  ILE A C   1 
ATOM   1392 O O   . ILE A 1 179 ? 53.282 -39.106 -6.592  1.00   44.08  ? 266  ILE A O   1 
ATOM   1393 C CB  . ILE A 1 179 ? 52.406 -37.138 -8.508  1.00   42.11  ? 266  ILE A CB  1 
ATOM   1394 C CG1 . ILE A 1 179 ? 53.325 -37.320 -9.715  1.00   39.59  ? 266  ILE A CG1 1 
ATOM   1395 C CG2 . ILE A 1 179 ? 51.364 -36.026 -8.795  1.00   43.23  ? 266  ILE A CG2 1 
ATOM   1396 C CD1 . ILE A 1 179 ? 52.527 -37.831 -10.931 1.00   37.57  ? 266  ILE A CD1 1 
ATOM   1397 N N   . TYR A 1 180 ? 55.171 -37.850 -6.316  1.00   41.15  ? 267  TYR A N   1 
ATOM   1398 C CA  . TYR A 1 180 ? 55.968 -38.781 -5.520  1.00   40.84  ? 267  TYR A CA  1 
ATOM   1399 C C   . TYR A 1 180 ? 56.164 -38.339 -4.066  1.00   43.96  ? 267  TYR A C   1 
ATOM   1400 O O   . TYR A 1 180 ? 56.754 -39.089 -3.275  1.00   46.11  ? 267  TYR A O   1 
ATOM   1401 C CB  . TYR A 1 180 ? 57.335 -39.016 -6.161  1.00   38.59  ? 267  TYR A CB  1 
ATOM   1402 C CG  . TYR A 1 180 ? 57.259 -39.936 -7.369  1.00   37.42  ? 267  TYR A CG  1 
ATOM   1403 C CD1 . TYR A 1 180 ? 57.139 -39.413 -8.654  1.00   33.47  ? 267  TYR A CD1 1 
ATOM   1404 C CD2 . TYR A 1 180 ? 57.274 -41.326 -7.221  1.00   33.08  ? 267  TYR A CD2 1 
ATOM   1405 C CE1 . TYR A 1 180 ? 57.051 -40.242 -9.756  1.00   36.21  ? 267  TYR A CE1 1 
ATOM   1406 C CE2 . TYR A 1 180 ? 57.190 -42.157 -8.324  1.00   31.64  ? 267  TYR A CE2 1 
ATOM   1407 C CZ  . TYR A 1 180 ? 57.099 -41.607 -9.580  1.00   35.29  ? 267  TYR A CZ  1 
ATOM   1408 O OH  . TYR A 1 180 ? 56.990 -42.421 -10.676 1.00   41.76  ? 267  TYR A OH  1 
ATOM   1409 N N   . SER A 1 181 ? 55.634 -37.182 -3.683  1.00   45.00  ? 268  SER A N   1 
ATOM   1410 C CA  . SER A 1 181 ? 55.733 -36.703 -2.298  1.00   49.61  ? 268  SER A CA  1 
ATOM   1411 C C   . SER A 1 181 ? 55.003 -37.600 -1.291  1.00   50.85  ? 268  SER A C   1 
ATOM   1412 O O   . SER A 1 181 ? 53.984 -38.229 -1.608  1.00   52.37  ? 268  SER A O   1 
ATOM   1413 C CB  . SER A 1 181 ? 55.195 -35.270 -2.168  1.00   51.22  ? 268  SER A CB  1 
ATOM   1414 O OG  . SER A 1 181 ? 55.137 -34.859 -0.815  1.00   54.05  ? 268  SER A OG  1 
ATOM   1415 N N   . MET A 1 182 ? 55.536 -37.648 -0.075  1.00   52.56  ? 269  MET A N   1 
ATOM   1416 C CA  . MET A 1 182 ? 54.956 -38.459 0.999   1.00   57.06  ? 269  MET A CA  1 
ATOM   1417 C C   . MET A 1 182 ? 54.028 -37.619 1.893   1.00   55.63  ? 269  MET A C   1 
ATOM   1418 O O   . MET A 1 182 ? 53.456 -38.114 2.873   1.00   49.15  ? 269  MET A O   1 
ATOM   1419 C CB  . MET A 1 182 ? 56.071 -39.097 1.843   1.00   61.63  ? 269  MET A CB  1 
ATOM   1420 C CG  . MET A 1 182 ? 56.965 -40.083 1.087   1.00   66.38  ? 269  MET A CG  1 
ATOM   1421 S SD  . MET A 1 182 ? 55.960 -41.497 0.421   1.00   73.27  ? 269  MET A SD  1 
ATOM   1422 C CE  . MET A 1 182 ? 55.712 -42.420 1.913   1.00   72.61  ? 269  MET A CE  1 
ATOM   1423 N N   . ASP A 1 183 ? 53.954 -36.322 1.598   1.00   54.32  ? 270  ASP A N   1 
ATOM   1424 C CA  . ASP A 1 183 ? 53.020 -35.427 2.273   1.00   52.98  ? 270  ASP A CA  1 
ATOM   1425 C C   . ASP A 1 183 ? 51.683 -35.470 1.566   1.00   49.21  ? 270  ASP A C   1 
ATOM   1426 O O   . ASP A 1 183 ? 51.578 -35.010 0.433   1.00   48.46  ? 270  ASP A O   1 
ATOM   1427 C CB  . ASP A 1 183 ? 53.555 -33.995 2.255   1.00   54.07  ? 270  ASP A CB  1 
ATOM   1428 C CG  . ASP A 1 183 ? 52.638 -33.034 2.973   1.00   57.86  ? 270  ASP A CG  1 
ATOM   1429 O OD1 . ASP A 1 183 ? 52.325 -33.335 4.144   1.00   63.19  ? 270  ASP A OD1 1 
ATOM   1430 O OD2 . ASP A 1 183 ? 52.149 -32.005 2.451   1.00   53.92  ? 270  ASP A OD2 1 
ATOM   1431 N N   . THR A 1 184 ? 50.662 -35.987 2.238   1.00   47.07  ? 271  THR A N   1 
ATOM   1432 C CA  . THR A 1 184 ? 49.359 -36.154 1.596   1.00   48.91  ? 271  THR A CA  1 
ATOM   1433 C C   . THR A 1 184 ? 48.813 -34.882 0.959   1.00   48.33  ? 271  THR A C   1 
ATOM   1434 O O   . THR A 1 184 ? 48.435 -34.899 -0.210  1.00   45.76  ? 271  THR A O   1 
ATOM   1435 C CB  . THR A 1 184 ? 48.355 -36.688 2.598   1.00   48.08  ? 271  THR A CB  1 
ATOM   1436 O OG1 . THR A 1 184 ? 48.829 -37.945 3.069   1.00   45.67  ? 271  THR A OG1 1 
ATOM   1437 C CG2 . THR A 1 184 ? 47.047 -37.047 1.936   1.00   47.68  ? 271  THR A CG2 1 
ATOM   1438 N N   . GLU A 1 185 ? 48.809 -33.780 1.704   1.00   47.26  ? 272  GLU A N   1 
ATOM   1439 C CA  . GLU A 1 185 ? 48.259 -32.562 1.134   1.00   48.94  ? 272  GLU A CA  1 
ATOM   1440 C C   . GLU A 1 185 ? 48.968 -32.141 -0.130  1.00   45.27  ? 272  GLU A C   1 
ATOM   1441 O O   . GLU A 1 185 ? 48.308 -31.694 -1.059  1.00   44.50  ? 272  GLU A O   1 
ATOM   1442 C CB  . GLU A 1 185 ? 48.239 -31.411 2.131   1.00   54.38  ? 272  GLU A CB  1 
ATOM   1443 C CG  . GLU A 1 185 ? 47.342 -31.678 3.333   1.00   57.65  ? 272  GLU A CG  1 
ATOM   1444 C CD  . GLU A 1 185 ? 48.140 -31.873 4.607   1.00   62.19  ? 272  GLU A CD  1 
ATOM   1445 O OE1 . GLU A 1 185 ? 48.244 -30.898 5.379   1.00   65.64  ? 272  GLU A OE1 1 
ATOM   1446 O OE2 . GLU A 1 185 ? 48.684 -32.985 4.816   1.00   65.92  ? 272  GLU A OE2 1 
ATOM   1447 N N   . THR A 1 186 ? 50.286 -32.316 -0.178  1.00   44.76  ? 273  THR A N   1 
ATOM   1448 C CA  . THR A 1 186 ? 51.059 -31.983 -1.373  1.00   41.91  ? 273  THR A CA  1 
ATOM   1449 C C   . THR A 1 186 ? 50.619 -32.812 -2.577  1.00   42.25  ? 273  THR A C   1 
ATOM   1450 O O   . THR A 1 186 ? 50.281 -32.321 -3.663  1.00   41.25  ? 273  THR A O   1 
ATOM   1451 C CB  . THR A 1 186 ? 52.543 -32.196 -1.113  1.00   40.01  ? 273  THR A CB  1 
ATOM   1452 O OG1 . THR A 1 186 ? 52.960 -31.244 -0.134  1.00   43.90  ? 273  THR A OG1 1 
ATOM   1453 C CG2 . THR A 1 186 ? 53.360 -31.789 -2.325  1.00   38.57  ? 273  THR A CG2 1 
ATOM   1454 N N   . LEU A 1 187 ? 50.589 -34.103 -2.314  1.00   42.01  ? 274  LEU A N   1 
ATOM   1455 C CA  . LEU A 1 187 ? 50.215 -35.113 -3.280  1.00   41.91  ? 274  LEU A CA  1 
ATOM   1456 C C   . LEU A 1 187 ? 48.847 -34.794 -3.858  1.00   38.16  ? 274  LEU A C   1 
ATOM   1457 O O   . LEU A 1 187 ? 48.675 -34.743 -5.079  1.00   37.26  ? 274  LEU A O   1 
ATOM   1458 C CB  . LEU A 1 187 ? 50.194 -36.463 -2.541  1.00   42.87  ? 274  LEU A CB  1 
ATOM   1459 C CG  . LEU A 1 187 ? 49.917 -37.706 -3.357  1.00   41.30  ? 274  LEU A CG  1 
ATOM   1460 C CD1 . LEU A 1 187 ? 50.765 -37.740 -4.603  1.00   43.28  ? 274  LEU A CD1 1 
ATOM   1461 C CD2 . LEU A 1 187 ? 50.163 -38.905 -2.460  1.00   40.35  ? 274  LEU A CD2 1 
ATOM   1462 N N   . VAL A 1 188 ? 47.895 -34.558 -2.963  1.00   34.79  ? 275  VAL A N   1 
ATOM   1463 C CA  . VAL A 1 188 ? 46.536 -34.230 -3.383  1.00   37.35  ? 275  VAL A CA  1 
ATOM   1464 C C   . VAL A 1 188 ? 46.453 -33.020 -4.334  1.00   32.80  ? 275  VAL A C   1 
ATOM   1465 O O   . VAL A 1 188 ? 45.813 -33.070 -5.379  1.00   30.89  ? 275  VAL A O   1 
ATOM   1466 C CB  . VAL A 1 188 ? 45.659 -33.945 -2.168  1.00   36.46  ? 275  VAL A CB  1 
ATOM   1467 C CG1 . VAL A 1 188 ? 44.306 -33.412 -2.646  1.00   37.88  ? 275  VAL A CG1 1 
ATOM   1468 C CG2 . VAL A 1 188 ? 45.501 -35.222 -1.313  1.00   36.86  ? 275  VAL A CG2 1 
ATOM   1469 N N   . ASP A 1 189 ? 47.106 -31.944 -3.935  1.00   31.80  ? 276  ASP A N   1 
ATOM   1470 C CA  . ASP A 1 189 ? 47.076 -30.688 -4.649  1.00   35.73  ? 276  ASP A CA  1 
ATOM   1471 C C   . ASP A 1 189 ? 47.842 -30.796 -5.949  1.00   38.32  ? 276  ASP A C   1 
ATOM   1472 O O   . ASP A 1 189 ? 47.457 -30.186 -6.939  1.00   38.16  ? 276  ASP A O   1 
ATOM   1473 C CB  . ASP A 1 189 ? 47.690 -29.602 -3.761  1.00   38.58  ? 276  ASP A CB  1 
ATOM   1474 C CG  . ASP A 1 189 ? 46.758 -29.170 -2.642  1.00   42.15  ? 276  ASP A CG  1 
ATOM   1475 O OD1 . ASP A 1 189 ? 45.605 -29.671 -2.559  1.00   40.42  ? 276  ASP A OD1 1 
ATOM   1476 O OD2 . ASP A 1 189 ? 47.109 -28.313 -1.802  1.00   44.38  ? 276  ASP A OD2 1 
ATOM   1477 N N   . ALA A 1 190 ? 48.938 -31.558 -5.938  1.00   39.48  ? 277  ALA A N   1 
ATOM   1478 C CA  . ALA A 1 190 ? 49.667 -31.881 -7.172  1.00   36.32  ? 277  ALA A CA  1 
ATOM   1479 C C   . ALA A 1 190 ? 48.808 -32.646 -8.159  1.00   31.06  ? 277  ALA A C   1 
ATOM   1480 O O   . ALA A 1 190 ? 48.739 -32.234 -9.302  1.00   34.19  ? 277  ALA A O   1 
ATOM   1481 C CB  . ALA A 1 190 ? 50.912 -32.649 -6.872  1.00   39.61  ? 277  ALA A CB  1 
ATOM   1482 N N   . CYS A 1 191 ? 48.087 -33.673 -7.712  1.00   32.52  ? 278  CYS A N   1 
ATOM   1483 C CA  . CYS A 1 191 ? 47.078 -34.355 -8.546  1.00   35.91  ? 278  CYS A CA  1 
ATOM   1484 C C   . CYS A 1 191 ? 45.948 -33.444 -9.058  1.00   36.55  ? 278  CYS A C   1 
ATOM   1485 O O   . CYS A 1 191 ? 45.534 -33.579 -10.212 1.00   36.52  ? 278  CYS A O   1 
ATOM   1486 C CB  . CYS A 1 191 ? 46.434 -35.547 -7.821  1.00   38.67  ? 278  CYS A CB  1 
ATOM   1487 S SG  . CYS A 1 191 ? 47.582 -36.932 -7.605  1.00   38.43  ? 278  CYS A SG  1 
ATOM   1488 N N   . TRP A 1 192 ? 45.441 -32.517 -8.239  1.00   34.35  ? 279  TRP A N   1 
ATOM   1489 C CA  . TRP A 1 192 ? 44.444 -31.577 -8.766  1.00   33.65  ? 279  TRP A CA  1 
ATOM   1490 C C   . TRP A 1 192 ? 45.070 -30.795 -9.939  1.00   33.65  ? 279  TRP A C   1 
ATOM   1491 O O   . TRP A 1 192 ? 44.480 -30.647 -11.010 1.00   27.57  ? 279  TRP A O   1 
ATOM   1492 C CB  . TRP A 1 192 ? 43.924 -30.614 -7.687  1.00   30.47  ? 279  TRP A CB  1 
ATOM   1493 C CG  . TRP A 1 192 ? 42.866 -31.253 -6.861  1.00   27.86  ? 279  TRP A CG  1 
ATOM   1494 C CD1 . TRP A 1 192 ? 42.991 -31.673 -5.579  1.00   22.19  ? 279  TRP A CD1 1 
ATOM   1495 C CD2 . TRP A 1 192 ? 41.553 -31.651 -7.292  1.00   21.28  ? 279  TRP A CD2 1 
ATOM   1496 N NE1 . TRP A 1 192 ? 41.842 -32.317 -5.195  1.00   30.68  ? 279  TRP A NE1 1 
ATOM   1497 C CE2 . TRP A 1 192 ? 40.926 -32.264 -6.213  1.00   20.24  ? 279  TRP A CE2 1 
ATOM   1498 C CE3 . TRP A 1 192 ? 40.823 -31.475 -8.453  1.00   23.25  ? 279  TRP A CE3 1 
ATOM   1499 C CZ2 . TRP A 1 192 ? 39.639 -32.756 -6.274  1.00   26.07  ? 279  TRP A CZ2 1 
ATOM   1500 C CZ3 . TRP A 1 192 ? 39.528 -31.960 -8.510  1.00   17.67  ? 279  TRP A CZ3 1 
ATOM   1501 C CH2 . TRP A 1 192 ? 38.954 -32.601 -7.437  1.00   22.74  ? 279  TRP A CH2 1 
ATOM   1502 N N   . ALA A 1 193 ? 46.292 -30.319 -9.727  1.00   31.42  ? 280  ALA A N   1 
ATOM   1503 C CA  . ALA A 1 193 ? 46.910 -29.450 -10.694 1.00   32.64  ? 280  ALA A CA  1 
ATOM   1504 C C   . ALA A 1 193 ? 47.088 -30.230 -11.995 1.00   37.18  ? 280  ALA A C   1 
ATOM   1505 O O   . ALA A 1 193 ? 46.804 -29.730 -13.108 1.00   35.73  ? 280  ALA A O   1 
ATOM   1506 C CB  . ALA A 1 193 ? 48.191 -28.910 -10.138 1.00   32.70  ? 280  ALA A CB  1 
ATOM   1507 N N   . ILE A 1 194 ? 47.440 -31.509 -11.866 1.00   38.18  ? 281  ILE A N   1 
ATOM   1508 C CA  . ILE A 1 194 ? 47.518 -32.328 -13.084 1.00   36.80  ? 281  ILE A CA  1 
ATOM   1509 C C   . ILE A 1 194 ? 46.140 -32.562 -13.734 1.00   37.42  ? 281  ILE A C   1 
ATOM   1510 O O   . ILE A 1 194 ? 46.051 -32.525 -14.979 1.00   39.35  ? 281  ILE A O   1 
ATOM   1511 C CB  . ILE A 1 194 ? 48.257 -33.628 -12.809 1.00   35.03  ? 281  ILE A CB  1 
ATOM   1512 C CG1 . ILE A 1 194 ? 49.714 -33.353 -12.444 1.00   32.30  ? 281  ILE A CG1 1 
ATOM   1513 C CG2 . ILE A 1 194 ? 48.217 -34.533 -13.995 1.00   35.75  ? 281  ILE A CG2 1 
ATOM   1514 C CD1 . ILE A 1 194 ? 50.314 -34.473 -11.596 1.00   34.52  ? 281  ILE A CD1 1 
ATOM   1515 N N   . SER A 1 195 ? 45.091 -32.774 -12.923 1.00   34.27  ? 282  SER A N   1 
ATOM   1516 C CA  . SER A 1 195 ? 43.727 -32.972 -13.443 1.00   36.89  ? 282  SER A CA  1 
ATOM   1517 C C   . SER A 1 195 ? 43.239 -31.769 -14.268 1.00   38.76  ? 282  SER A C   1 
ATOM   1518 O O   . SER A 1 195 ? 42.486 -31.913 -15.238 1.00   34.74  ? 282  SER A O   1 
ATOM   1519 C CB  . SER A 1 195 ? 42.697 -33.289 -12.341 1.00   37.24  ? 282  SER A CB  1 
ATOM   1520 O OG  . SER A 1 195 ? 42.291 -32.151 -11.588 1.00   31.65  ? 282  SER A OG  1 
ATOM   1521 N N   . TYR A 1 196 ? 43.715 -30.585 -13.896 1.00   40.85  ? 283  TYR A N   1 
ATOM   1522 C CA  . TYR A 1 196 ? 43.326 -29.347 -14.574 1.00   41.67  ? 283  TYR A CA  1 
ATOM   1523 C C   . TYR A 1 196 ? 44.125 -29.219 -15.880 1.00   42.73  ? 283  TYR A C   1 
ATOM   1524 O O   . TYR A 1 196 ? 43.560 -28.931 -16.930 1.00   40.55  ? 283  TYR A O   1 
ATOM   1525 C CB  . TYR A 1 196 ? 43.587 -28.115 -13.680 1.00   38.10  ? 283  TYR A CB  1 
ATOM   1526 C CG  . TYR A 1 196 ? 42.888 -28.088 -12.322 1.00   33.58  ? 283  TYR A CG  1 
ATOM   1527 C CD1 . TYR A 1 196 ? 43.474 -27.450 -11.221 1.00   32.33  ? 283  TYR A CD1 1 
ATOM   1528 C CD2 . TYR A 1 196 ? 41.649 -28.693 -12.137 1.00   31.10  ? 283  TYR A CD2 1 
ATOM   1529 C CE1 . TYR A 1 196 ? 42.842 -27.432 -9.970  1.00   35.52  ? 283  TYR A CE1 1 
ATOM   1530 C CE2 . TYR A 1 196 ? 40.994 -28.664 -10.886 1.00   35.48  ? 283  TYR A CE2 1 
ATOM   1531 C CZ  . TYR A 1 196 ? 41.602 -28.034 -9.810  1.00   34.31  ? 283  TYR A CZ  1 
ATOM   1532 O OH  . TYR A 1 196 ? 41.020 -28.000 -8.583  1.00   27.27  ? 283  TYR A OH  1 
ATOM   1533 N N   . LEU A 1 197 ? 45.443 -29.396 -15.784 1.00   42.82  ? 284  LEU A N   1 
ATOM   1534 C CA  . LEU A 1 197 ? 46.326 -29.352 -16.946 1.00   42.02  ? 284  LEU A CA  1 
ATOM   1535 C C   . LEU A 1 197 ? 45.919 -30.396 -17.976 1.00   43.76  ? 284  LEU A C   1 
ATOM   1536 O O   . LEU A 1 197 ? 45.823 -30.105 -19.168 1.00   45.69  ? 284  LEU A O   1 
ATOM   1537 C CB  . LEU A 1 197 ? 47.782 -29.550 -16.531 1.00   40.84  ? 284  LEU A CB  1 
ATOM   1538 C CG  . LEU A 1 197 ? 48.378 -28.457 -15.635 1.00   41.89  ? 284  LEU A CG  1 
ATOM   1539 C CD1 . LEU A 1 197 ? 49.718 -28.877 -15.084 1.00   45.28  ? 284  LEU A CD1 1 
ATOM   1540 C CD2 . LEU A 1 197 ? 48.570 -27.137 -16.359 1.00   41.53  ? 284  LEU A CD2 1 
ATOM   1541 N N   . SER A 1 198 ? 45.631 -31.615 -17.542 1.00   44.31  ? 285  SER A N   1 
ATOM   1542 C CA  . SER A 1 198 ? 45.273 -32.641 -18.525 1.00   45.33  ? 285  SER A CA  1 
ATOM   1543 C C   . SER A 1 198 ? 43.909 -32.405 -19.161 1.00   43.87  ? 285  SER A C   1 
ATOM   1544 O O   . SER A 1 198 ? 43.546 -33.051 -20.141 1.00   41.91  ? 285  SER A O   1 
ATOM   1545 C CB  . SER A 1 198 ? 45.301 -34.025 -17.879 1.00   46.27  ? 285  SER A CB  1 
ATOM   1546 O OG  . SER A 1 198 ? 44.299 -34.160 -16.894 1.00   49.80  ? 285  SER A OG  1 
ATOM   1547 N N   . ASP A 1 199 ? 43.140 -31.506 -18.554 1.00   46.21  ? 286  ASP A N   1 
ATOM   1548 C CA  . ASP A 1 199 ? 41.783 -31.167 -18.978 1.00   44.99  ? 286  ASP A CA  1 
ATOM   1549 C C   . ASP A 1 199 ? 41.865 -30.066 -20.013 1.00   47.32  ? 286  ASP A C   1 
ATOM   1550 O O   . ASP A 1 199 ? 41.864 -28.862 -19.712 1.00   49.40  ? 286  ASP A O   1 
ATOM   1551 C CB  . ASP A 1 199 ? 40.999 -30.650 -17.784 1.00   45.62  ? 286  ASP A CB  1 
ATOM   1552 C CG  . ASP A 1 199 ? 39.553 -30.558 -18.066 1.00   45.45  ? 286  ASP A CG  1 
ATOM   1553 O OD1 . ASP A 1 199 ? 39.130 -30.878 -19.194 1.00   49.80  ? 286  ASP A OD1 1 
ATOM   1554 O OD2 . ASP A 1 199 ? 38.777 -30.181 -17.188 1.00   48.06  ? 286  ASP A OD2 1 
ATOM   1555 N N   . GLY A 1 200 ? 42.076 -30.516 -21.238 1.00   50.05  ? 287  GLY A N   1 
ATOM   1556 C CA  . GLY A 1 200 ? 42.220 -29.638 -22.372 1.00   50.14  ? 287  GLY A CA  1 
ATOM   1557 C C   . GLY A 1 200 ? 42.434 -30.384 -23.676 1.00   49.75  ? 287  GLY A C   1 
ATOM   1558 O O   . GLY A 1 200 ? 41.968 -31.510 -23.864 1.00   47.89  ? 287  GLY A O   1 
ATOM   1559 N N   . PRO A 1 201 ? 43.083 -29.718 -24.624 1.00   51.21  ? 288  PRO A N   1 
ATOM   1560 C CA  . PRO A 1 201 ? 43.298 -30.299 -25.952 1.00   52.01  ? 288  PRO A CA  1 
ATOM   1561 C C   . PRO A 1 201 ? 44.340 -31.413 -25.987 1.00   53.15  ? 288  PRO A C   1 
ATOM   1562 O O   . PRO A 1 201 ? 45.128 -31.567 -25.059 1.00   53.71  ? 288  PRO A O   1 
ATOM   1563 C CB  . PRO A 1 201 ? 43.778 -29.098 -26.779 1.00   50.75  ? 288  PRO A CB  1 
ATOM   1564 C CG  . PRO A 1 201 ? 44.254 -28.054 -25.809 1.00   49.99  ? 288  PRO A CG  1 
ATOM   1565 C CD  . PRO A 1 201 ? 43.588 -28.337 -24.514 1.00   50.32  ? 288  PRO A CD  1 
ATOM   1566 N N   . GLN A 1 202 ? 44.380 -32.148 -27.091 1.00   57.17  ? 289  GLN A N   1 
ATOM   1567 C CA  . GLN A 1 202 ? 45.399 -33.190 -27.294 1.00   59.38  ? 289  GLN A CA  1 
ATOM   1568 C C   . GLN A 1 202 ? 46.860 -32.770 -27.099 1.00   57.01  ? 289  GLN A C   1 
ATOM   1569 O O   . GLN A 1 202 ? 47.705 -33.574 -26.734 1.00   57.02  ? 289  GLN A O   1 
ATOM   1570 C CB  . GLN A 1 202 ? 45.214 -33.858 -28.660 1.00   60.95  ? 289  GLN A CB  1 
ATOM   1571 C CG  . GLN A 1 202 ? 43.903 -34.647 -28.729 1.00   63.45  ? 289  GLN A CG  1 
ATOM   1572 C CD  . GLN A 1 202 ? 43.820 -35.538 -29.936 1.00   66.99  ? 289  GLN A CD  1 
ATOM   1573 O OE1 . GLN A 1 202 ? 44.852 -35.916 -30.492 1.00   72.06  ? 289  GLN A OE1 1 
ATOM   1574 N NE2 . GLN A 1 202 ? 42.600 -35.877 -30.351 1.00   67.14  ? 289  GLN A NE2 1 
ATOM   1575 N N   . GLU A 1 203 ? 47.164 -31.505 -27.327 1.00   58.49  ? 290  GLU A N   1 
ATOM   1576 C CA  . GLU A 1 203 ? 48.504 -31.006 -27.073 1.00   58.41  ? 290  GLU A CA  1 
ATOM   1577 C C   . GLU A 1 203 ? 48.805 -31.026 -25.579 1.00   55.92  ? 290  GLU A C   1 
ATOM   1578 O O   . GLU A 1 203 ? 49.933 -31.247 -25.162 1.00   57.32  ? 290  GLU A O   1 
ATOM   1579 C CB  . GLU A 1 203 ? 48.628 -29.575 -27.602 1.00   61.64  ? 290  GLU A CB  1 
ATOM   1580 C CG  . GLU A 1 203 ? 50.078 -29.087 -27.604 1.00   68.48  ? 290  GLU A CG  1 
ATOM   1581 C CD  . GLU A 1 203 ? 50.252 -27.573 -27.696 1.00   74.14  ? 290  GLU A CD  1 
ATOM   1582 O OE1 . GLU A 1 203 ? 49.309 -26.864 -28.108 1.00   78.65  ? 290  GLU A OE1 1 
ATOM   1583 O OE2 . GLU A 1 203 ? 51.352 -27.069 -27.370 1.00   78.57  ? 290  GLU A OE2 1 
ATOM   1584 N N   . ALA A 1 204 ? 47.791 -30.749 -24.772 1.00   52.12  ? 291  ALA A N   1 
ATOM   1585 C CA  . ALA A 1 204 ? 47.964 -30.713 -23.331 1.00   52.31  ? 291  ALA A CA  1 
ATOM   1586 C C   . ALA A 1 204 ? 48.067 -32.114 -22.745 1.00   50.49  ? 291  ALA A C   1 
ATOM   1587 O O   . ALA A 1 204 ? 48.904 -32.382 -21.870 1.00   49.57  ? 291  ALA A O   1 
ATOM   1588 C CB  . ALA A 1 204 ? 46.826 -29.953 -22.674 1.00   50.12  ? 291  ALA A CB  1 
ATOM   1589 N N   . ILE A 1 205 ? 47.214 -32.999 -23.238 1.00   44.69  ? 292  ILE A N   1 
ATOM   1590 C CA  . ILE A 1 205 ? 47.292 -34.383 -22.825 1.00   46.57  ? 292  ILE A CA  1 
ATOM   1591 C C   . ILE A 1 205 ? 48.679 -34.929 -23.133 1.00   47.80  ? 292  ILE A C   1 
ATOM   1592 O O   . ILE A 1 205 ? 49.273 -35.648 -22.331 1.00   49.04  ? 292  ILE A O   1 
ATOM   1593 C CB  . ILE A 1 205 ? 46.226 -35.210 -23.541 1.00   46.58  ? 292  ILE A CB  1 
ATOM   1594 C CG1 . ILE A 1 205 ? 44.845 -34.800 -23.042 1.00   48.17  ? 292  ILE A CG1 1 
ATOM   1595 C CG2 . ILE A 1 205 ? 46.446 -36.697 -23.298 1.00   48.48  ? 292  ILE A CG2 1 
ATOM   1596 C CD1 . ILE A 1 205 ? 43.710 -35.279 -23.934 1.00   46.87  ? 292  ILE A CD1 1 
ATOM   1597 N N   . GLN A 1 206 ? 49.212 -34.569 -24.292 1.00   48.18  ? 293  GLN A N   1 
ATOM   1598 C CA  . GLN A 1 206 ? 50.507 -35.100 -24.693 1.00   48.60  ? 293  GLN A CA  1 
ATOM   1599 C C   . GLN A 1 206 ? 51.607 -34.575 -23.767 1.00   44.58  ? 293  GLN A C   1 
ATOM   1600 O O   . GLN A 1 206 ? 52.545 -35.290 -23.426 1.00   47.85  ? 293  GLN A O   1 
ATOM   1601 C CB  . GLN A 1 206 ? 50.802 -34.766 -26.160 1.00   48.38  ? 293  GLN A CB  1 
ATOM   1602 C CG  . GLN A 1 206 ? 51.929 -35.566 -26.787 1.00   48.09  ? 293  GLN A CG  1 
ATOM   1603 C CD  . GLN A 1 206 ? 51.676 -37.072 -26.785 1.00   50.06  ? 293  GLN A CD  1 
ATOM   1604 O OE1 . GLN A 1 206 ? 50.607 -37.531 -27.195 1.00   46.61  ? 293  GLN A OE1 1 
ATOM   1605 N NE2 . GLN A 1 206 ? 52.663 -37.839 -26.308 1.00   46.69  ? 293  GLN A NE2 1 
ATOM   1606 N N   . ALA A 1 207 ? 51.494 -33.332 -23.341 1.00   39.10  ? 294  ALA A N   1 
ATOM   1607 C CA  . ALA A 1 207 ? 52.502 -32.796 -22.445 1.00   41.54  ? 294  ALA A CA  1 
ATOM   1608 C C   . ALA A 1 207 ? 52.588 -33.614 -21.162 1.00   42.01  ? 294  ALA A C   1 
ATOM   1609 O O   . ALA A 1 207 ? 53.682 -33.847 -20.626 1.00   39.47  ? 294  ALA A O   1 
ATOM   1610 C CB  . ALA A 1 207 ? 52.215 -31.333 -22.144 1.00   40.41  ? 294  ALA A CB  1 
ATOM   1611 N N   . VAL A 1 208 ? 51.418 -34.057 -20.704 1.00   44.73  ? 295  VAL A N   1 
ATOM   1612 C CA  . VAL A 1 208 ? 51.281 -34.773 -19.444 1.00   46.60  ? 295  VAL A CA  1 
ATOM   1613 C C   . VAL A 1 208 ? 51.939 -36.134 -19.624 1.00   46.87  ? 295  VAL A C   1 
ATOM   1614 O O   . VAL A 1 208 ? 52.739 -36.562 -18.780 1.00   46.22  ? 295  VAL A O   1 
ATOM   1615 C CB  . VAL A 1 208 ? 49.795 -34.905 -19.011 1.00   48.06  ? 295  VAL A CB  1 
ATOM   1616 C CG1 . VAL A 1 208 ? 49.629 -35.888 -17.849 1.00   49.54  ? 295  VAL A CG1 1 
ATOM   1617 C CG2 . VAL A 1 208 ? 49.226 -33.543 -18.617 1.00   44.31  ? 295  VAL A CG2 1 
ATOM   1618 N N   . ILE A 1 209 ? 51.626 -36.765 -20.749 1.00   43.92  ? 296  ILE A N   1 
ATOM   1619 C CA  . ILE A 1 209 ? 52.209 -38.050 -21.103 1.00   46.76  ? 296  ILE A CA  1 
ATOM   1620 C C   . ILE A 1 209 ? 53.738 -37.990 -21.256 1.00   47.48  ? 296  ILE A C   1 
ATOM   1621 O O   . ILE A 1 209 ? 54.427 -38.882 -20.746 1.00   46.25  ? 296  ILE A O   1 
ATOM   1622 C CB  . ILE A 1 209 ? 51.579 -38.565 -22.410 1.00   49.11  ? 296  ILE A CB  1 
ATOM   1623 C CG1 . ILE A 1 209 ? 50.158 -39.056 -22.154 1.00   50.17  ? 296  ILE A CG1 1 
ATOM   1624 C CG2 . ILE A 1 209 ? 52.430 -39.674 -23.037 1.00   48.62  ? 296  ILE A CG2 1 
ATOM   1625 C CD1 . ILE A 1 209 ? 49.380 -39.297 -23.441 1.00   53.24  ? 296  ILE A CD1 1 
ATOM   1626 N N   . ASP A 1 210 ? 54.252 -36.940 -21.906 1.00   44.27  ? 297  ASP A N   1 
ATOM   1627 C CA  . ASP A 1 210 ? 55.689 -36.817 -22.162 1.00   46.59  ? 297  ASP A CA  1 
ATOM   1628 C C   . ASP A 1 210 ? 56.581 -36.592 -20.941 1.00   49.02  ? 297  ASP A C   1 
ATOM   1629 O O   . ASP A 1 210 ? 57.754 -36.891 -21.014 1.00   49.70  ? 297  ASP A O   1 
ATOM   1630 C CB  . ASP A 1 210 ? 56.005 -35.699 -23.160 1.00   47.10  ? 297  ASP A CB  1 
ATOM   1631 C CG  . ASP A 1 210 ? 55.426 -35.949 -24.531 1.00   49.99  ? 297  ASP A CG  1 
ATOM   1632 O OD1 . ASP A 1 210 ? 55.279 -37.131 -24.933 1.00   45.39  ? 297  ASP A OD1 1 
ATOM   1633 O OD2 . ASP A 1 210 ? 55.059 -34.990 -25.265 1.00   56.96  ? 297  ASP A OD2 1 
ATOM   1634 N N   . VAL A 1 211 ? 56.077 -36.021 -19.855 1.00   52.47  ? 298  VAL A N   1 
ATOM   1635 C CA  . VAL A 1 211 ? 56.845 -35.951 -18.611 1.00   52.44  ? 298  VAL A CA  1 
ATOM   1636 C C   . VAL A 1 211 ? 56.767 -37.255 -17.819 1.00   50.90  ? 298  VAL A C   1 
ATOM   1637 O O   . VAL A 1 211 ? 57.325 -37.302 -16.725 1.00   51.86  ? 298  VAL A O   1 
ATOM   1638 C CB  . VAL A 1 211 ? 56.392 -34.809 -17.643 1.00   55.57  ? 298  VAL A CB  1 
ATOM   1639 C CG1 . VAL A 1 211 ? 56.970 -33.469 -18.060 1.00   54.25  ? 298  VAL A CG1 1 
ATOM   1640 C CG2 . VAL A 1 211 ? 54.847 -34.729 -17.501 1.00   58.14  ? 298  VAL A CG2 1 
ATOM   1641 N N   . ARG A 1 212 ? 56.067 -38.277 -18.321 1.00   51.94  ? 299  ARG A N   1 
ATOM   1642 C CA  . ARG A 1 212 ? 55.945 -39.589 -17.628 1.00   56.26  ? 299  ARG A CA  1 
ATOM   1643 C C   . ARG A 1 212 ? 54.996 -39.604 -16.435 1.00   51.98  ? 299  ARG A C   1 
ATOM   1644 O O   . ARG A 1 212 ? 55.137 -40.427 -15.530 1.00   54.35  ? 299  ARG A O   1 
ATOM   1645 C CB  . ARG A 1 212 ? 57.292 -40.148 -17.121 1.00   57.81  ? 299  ARG A CB  1 
ATOM   1646 C CG  . ARG A 1 212 ? 58.396 -40.175 -18.153 1.00   63.34  ? 299  ARG A CG  1 
ATOM   1647 C CD  . ARG A 1 212 ? 58.828 -41.579 -18.547 1.00   70.91  ? 299  ARG A CD  1 
ATOM   1648 N NE  . ARG A 1 212 ? 59.899 -41.607 -19.541 1.00   78.96  ? 299  ARG A NE  1 
ATOM   1649 C CZ  . ARG A 1 212 ? 59.957 -40.849 -20.648 1.00   83.04  ? 299  ARG A CZ  1 
ATOM   1650 N NH1 . ARG A 1 212 ? 59.007 -39.964 -20.959 1.00   82.22  ? 299  ARG A NH1 1 
ATOM   1651 N NH2 . ARG A 1 212 ? 60.991 -40.981 -21.477 1.00   83.71  ? 299  ARG A NH2 1 
ATOM   1652 N N   . ILE A 1 213 ? 54.058 -38.669 -16.425 1.00   47.98  ? 300  ILE A N   1 
ATOM   1653 C CA  . ILE A 1 213 ? 53.115 -38.584 -15.335 1.00   47.08  ? 300  ILE A CA  1 
ATOM   1654 C C   . ILE A 1 213 ? 52.204 -39.800 -15.240 1.00   45.60  ? 300  ILE A C   1 
ATOM   1655 O O   . ILE A 1 213 ? 52.045 -40.343 -14.148 1.00   44.30  ? 300  ILE A O   1 
ATOM   1656 C CB  . ILE A 1 213 ? 52.308 -37.281 -15.449 1.00   48.44  ? 300  ILE A CB  1 
ATOM   1657 C CG1 . ILE A 1 213 ? 53.056 -36.166 -14.712 1.00   50.74  ? 300  ILE A CG1 1 
ATOM   1658 C CG2 . ILE A 1 213 ? 50.913 -37.407 -14.850 1.00   47.80  ? 300  ILE A CG2 1 
ATOM   1659 C CD1 . ILE A 1 213 ? 52.394 -34.792 -14.828 1.00   50.25  ? 300  ILE A CD1 1 
ATOM   1660 N N   . PRO A 1 214 ? 51.628 -40.235 -16.357 1.00   44.49  ? 301  PRO A N   1 
ATOM   1661 C CA  . PRO A 1 214 ? 50.578 -41.259 -16.302 1.00   45.95  ? 301  PRO A CA  1 
ATOM   1662 C C   . PRO A 1 214 ? 50.936 -42.549 -15.583 1.00   48.18  ? 301  PRO A C   1 
ATOM   1663 O O   . PRO A 1 214 ? 50.050 -43.232 -15.055 1.00   50.68  ? 301  PRO A O   1 
ATOM   1664 C CB  . PRO A 1 214 ? 50.220 -41.502 -17.778 1.00   45.40  ? 301  PRO A CB  1 
ATOM   1665 C CG  . PRO A 1 214 ? 51.213 -40.795 -18.577 1.00   42.54  ? 301  PRO A CG  1 
ATOM   1666 C CD  . PRO A 1 214 ? 51.839 -39.745 -17.732 1.00   42.36  ? 301  PRO A CD  1 
ATOM   1667 N N   . LYS A 1 215 ? 52.208 -42.918 -15.592 1.00   46.96  ? 302  LYS A N   1 
ATOM   1668 C CA  . LYS A 1 215 ? 52.618 -44.107 -14.851 1.00   45.04  ? 302  LYS A CA  1 
ATOM   1669 C C   . LYS A 1 215 ? 52.256 -43.932 -13.385 1.00   39.40  ? 302  LYS A C   1 
ATOM   1670 O O   . LYS A 1 215 ? 51.631 -44.792 -12.763 1.00   36.39  ? 302  LYS A O   1 
ATOM   1671 C CB  . LYS A 1 215 ? 54.127 -44.325 -14.957 1.00   45.67  ? 302  LYS A CB  1 
ATOM   1672 C CG  . LYS A 1 215 ? 54.640 -45.551 -14.238 1.00   47.39  ? 302  LYS A CG  1 
ATOM   1673 C CD  . LYS A 1 215 ? 56.158 -45.588 -14.293 1.00   57.74  ? 302  LYS A CD  1 
ATOM   1674 C CE  . LYS A 1 215 ? 56.783 -46.736 -13.480 1.00   61.32  ? 302  LYS A CE  1 
ATOM   1675 N NZ  . LYS A 1 215 ? 56.608 -46.624 -11.996 1.00   63.98  ? 302  LYS A NZ  1 
ATOM   1676 N N   . ARG A 1 216 ? 52.713 -42.819 -12.834 1.00   38.14  ? 303  ARG A N   1 
ATOM   1677 C CA  . ARG A 1 216 ? 52.517 -42.538 -11.421 1.00   37.69  ? 303  ARG A CA  1 
ATOM   1678 C C   . ARG A 1 216 ? 51.054 -42.364 -11.041 1.00   35.23  ? 303  ARG A C   1 
ATOM   1679 O O   . ARG A 1 216 ? 50.614 -42.850 -10.013 1.00   33.28  ? 303  ARG A O   1 
ATOM   1680 C CB  . ARG A 1 216 ? 53.321 -41.311 -11.037 1.00   36.93  ? 303  ARG A CB  1 
ATOM   1681 C CG  . ARG A 1 216 ? 53.303 -41.009 -9.560  1.00   39.92  ? 303  ARG A CG  1 
ATOM   1682 C CD  . ARG A 1 216 ? 53.656 -42.196 -8.686  1.00   43.50  ? 303  ARG A CD  1 
ATOM   1683 N NE  . ARG A 1 216 ? 53.535 -41.912 -7.259  1.00   48.20  ? 303  ARG A NE  1 
ATOM   1684 C CZ  . ARG A 1 216 ? 53.866 -42.770 -6.308  1.00   51.83  ? 303  ARG A CZ  1 
ATOM   1685 N NH1 . ARG A 1 216 ? 54.342 -43.947 -6.659  1.00   59.34  ? 303  ARG A NH1 1 
ATOM   1686 N NH2 . ARG A 1 216 ? 53.707 -42.483 -5.025  1.00   51.70  ? 303  ARG A NH2 1 
ATOM   1687 N N   . LEU A 1 217 ? 50.295 -41.714 -11.907 1.00   34.70  ? 304  LEU A N   1 
ATOM   1688 C CA  . LEU A 1 217 ? 48.889 -41.503 -11.649 1.00   36.02  ? 304  LEU A CA  1 
ATOM   1689 C C   . LEU A 1 217 ? 48.211 -42.829 -11.497 1.00   34.45  ? 304  LEU A C   1 
ATOM   1690 O O   . LEU A 1 217 ? 47.389 -42.940 -10.624 1.00   37.18  ? 304  LEU A O   1 
ATOM   1691 C CB  . LEU A 1 217 ? 48.181 -40.750 -12.776 1.00   36.15  ? 304  LEU A CB  1 
ATOM   1692 C CG  . LEU A 1 217 ? 48.490 -39.271 -12.941 1.00   32.81  ? 304  LEU A CG  1 
ATOM   1693 C CD1 . LEU A 1 217 ? 47.859 -38.809 -14.256 1.00   37.79  ? 304  LEU A CD1 1 
ATOM   1694 C CD2 . LEU A 1 217 ? 47.972 -38.463 -11.774 1.00   35.21  ? 304  LEU A CD2 1 
ATOM   1695 N N   . VAL A 1 218 ? 48.485 -43.790 -12.372 1.00   36.80  ? 305  VAL A N   1 
ATOM   1696 C CA  . VAL A 1 218 ? 47.840 -45.106 -12.310 1.00   35.66  ? 305  VAL A CA  1 
ATOM   1697 C C   . VAL A 1 218 ? 48.103 -45.769 -10.959 1.00   35.89  ? 305  VAL A C   1 
ATOM   1698 O O   . VAL A 1 218 ? 47.233 -46.430 -10.395 1.00   37.05  ? 305  VAL A O   1 
ATOM   1699 C CB  . VAL A 1 218 ? 48.342 -46.035 -13.429 1.00   34.70  ? 305  VAL A CB  1 
ATOM   1700 C CG1 . VAL A 1 218 ? 47.897 -47.483 -13.194 1.00   35.77  ? 305  VAL A CG1 1 
ATOM   1701 C CG2 . VAL A 1 218 ? 47.798 -45.593 -14.768 1.00   41.19  ? 305  VAL A CG2 1 
ATOM   1702 N N   . GLU A 1 219 ? 49.322 -45.604 -10.456 1.00   38.87  ? 306  GLU A N   1 
ATOM   1703 C CA  . GLU A 1 219 ? 49.714 -46.137 -9.144  1.00   40.49  ? 306  GLU A CA  1 
ATOM   1704 C C   . GLU A 1 219 ? 48.914 -45.517 -8.011  1.00   31.95  ? 306  GLU A C   1 
ATOM   1705 O O   . GLU A 1 219 ? 48.452 -46.208 -7.115  1.00   33.20  ? 306  GLU A O   1 
ATOM   1706 C CB  . GLU A 1 219 ? 51.202 -45.921 -8.871  1.00   43.25  ? 306  GLU A CB  1 
ATOM   1707 C CG  . GLU A 1 219 ? 52.141 -46.671 -9.799  1.00   45.55  ? 306  GLU A CG  1 
ATOM   1708 C CD  . GLU A 1 219 ? 53.605 -46.461 -9.429  1.00   52.38  ? 306  GLU A CD  1 
ATOM   1709 O OE1 . GLU A 1 219 ? 54.009 -45.321 -9.130  1.00   53.03  ? 306  GLU A OE1 1 
ATOM   1710 O OE2 . GLU A 1 219 ? 54.375 -47.445 -9.406  1.00   60.56  ? 306  GLU A OE2 1 
ATOM   1711 N N   . LEU A 1 220 ? 48.712 -44.215 -8.124  1.00   33.14  ? 307  LEU A N   1 
ATOM   1712 C CA  . LEU A 1 220 ? 47.896 -43.432 -7.205  1.00   30.72  ? 307  LEU A CA  1 
ATOM   1713 C C   . LEU A 1 220 ? 46.388 -43.732 -7.223  1.00   30.67  ? 307  LEU A C   1 
ATOM   1714 O O   . LEU A 1 220 ? 45.710 -43.409 -6.263  1.00   37.87  ? 307  LEU A O   1 
ATOM   1715 C CB  . LEU A 1 220 ? 48.135 -41.971 -7.507  1.00   29.58  ? 307  LEU A CB  1 
ATOM   1716 C CG  . LEU A 1 220 ? 49.578 -41.560 -7.233  1.00   34.91  ? 307  LEU A CG  1 
ATOM   1717 C CD1 . LEU A 1 220 ? 49.800 -40.112 -7.644  1.00   40.47  ? 307  LEU A CD1 1 
ATOM   1718 C CD2 . LEU A 1 220 ? 49.922 -41.742 -5.747  1.00   35.98  ? 307  LEU A CD2 1 
ATOM   1719 N N   . LEU A 1 221 ? 45.853 -44.382 -8.246  1.00   24.51  ? 308  LEU A N   1 
ATOM   1720 C CA  . LEU A 1 221 ? 44.457 -44.795 -8.216  1.00   27.89  ? 308  LEU A CA  1 
ATOM   1721 C C   . LEU A 1 221 ? 44.169 -45.778 -7.076  1.00   31.08  ? 308  LEU A C   1 
ATOM   1722 O O   . LEU A 1 221 ? 43.001 -45.958 -6.748  1.00   33.90  ? 308  LEU A O   1 
ATOM   1723 C CB  . LEU A 1 221 ? 44.042 -45.459 -9.553  1.00   26.99  ? 308  LEU A CB  1 
ATOM   1724 C CG  . LEU A 1 221 ? 44.222 -44.544 -10.776 1.00   30.88  ? 308  LEU A CG  1 
ATOM   1725 C CD1 . LEU A 1 221 ? 43.773 -45.218 -12.075 1.00   34.61  ? 308  LEU A CD1 1 
ATOM   1726 C CD2 . LEU A 1 221 ? 43.494 -43.204 -10.605 1.00   29.69  ? 308  LEU A CD2 1 
ATOM   1727 N N   . SER A 1 222 ? 45.189 -46.438 -6.506  1.00   32.11  ? 309  SER A N   1 
ATOM   1728 C CA  . SER A 1 222 ? 44.975 -47.382 -5.400  1.00   33.69  ? 309  SER A CA  1 
ATOM   1729 C C   . SER A 1 222 ? 45.473 -46.854 -4.060  1.00   32.94  ? 309  SER A C   1 
ATOM   1730 O O   . SER A 1 222 ? 45.693 -47.626 -3.126  1.00   26.85  ? 309  SER A O   1 
ATOM   1731 C CB  . SER A 1 222 ? 45.584 -48.767 -5.658  1.00   34.36  ? 309  SER A CB  1 
ATOM   1732 O OG  . SER A 1 222 ? 46.921 -48.637 -6.036  1.00   33.41  ? 309  SER A OG  1 
ATOM   1733 N N   . HIS A 1 223 ? 45.663 -45.538 -3.984  1.00   34.46  ? 310  HIS A N   1 
ATOM   1734 C CA  . HIS A 1 223 ? 46.041 -44.905 -2.726  1.00   34.72  ? 310  HIS A CA  1 
ATOM   1735 C C   . HIS A 1 223 ? 44.896 -45.083 -1.725  1.00   34.97  ? 310  HIS A C   1 
ATOM   1736 O O   . HIS A 1 223 ? 43.740 -45.237 -2.099  1.00   36.94  ? 310  HIS A O   1 
ATOM   1737 C CB  . HIS A 1 223 ? 46.374 -43.441 -2.972  1.00   35.25  ? 310  HIS A CB  1 
ATOM   1738 C CG  . HIS A 1 223 ? 47.069 -42.761 -1.840  1.00   34.52  ? 310  HIS A CG  1 
ATOM   1739 N ND1 . HIS A 1 223 ? 46.416 -42.421 -0.674  1.00   40.66  ? 310  HIS A ND1 1 
ATOM   1740 C CD2 . HIS A 1 223 ? 48.334 -42.292 -1.717  1.00   34.64  ? 310  HIS A CD2 1 
ATOM   1741 C CE1 . HIS A 1 223 ? 47.272 -41.823 0.140   1.00   41.58  ? 310  HIS A CE1 1 
ATOM   1742 N NE2 . HIS A 1 223 ? 48.439 -41.721 -0.470  1.00   31.29  ? 310  HIS A NE2 1 
ATOM   1743 N N   . GLU A 1 224 ? 45.222 -45.098 -0.440  1.00   36.10  ? 311  GLU A N   1 
ATOM   1744 C CA  . GLU A 1 224 ? 44.212 -45.310 0.595   1.00   39.53  ? 311  GLU A CA  1 
ATOM   1745 C C   . GLU A 1 224 ? 43.210 -44.140 0.695   1.00   39.82  ? 311  GLU A C   1 
ATOM   1746 O O   . GLU A 1 224 ? 42.065 -44.349 1.072   1.00   41.88  ? 311  GLU A O   1 
ATOM   1747 C CB  . GLU A 1 224 ? 44.872 -45.585 1.952   1.00   40.93  ? 311  GLU A CB  1 
ATOM   1748 C CG  . GLU A 1 224 ? 45.713 -44.430 2.499   1.00   49.11  ? 311  GLU A CG  1 
ATOM   1749 C CD  . GLU A 1 224 ? 47.196 -44.510 2.167   1.00   59.72  ? 311  GLU A CD  1 
ATOM   1750 O OE1 . GLU A 1 224 ? 47.568 -45.128 1.101   1.00   61.92  ? 311  GLU A OE1 1 
ATOM   1751 O OE2 . GLU A 1 224 ? 47.971 -43.954 3.013   1.00   57.05  ? 311  GLU A OE2 1 
ATOM   1752 N N   . SER A 1 225 ? 43.653 -42.929 0.369   1.00   38.02  ? 312  SER A N   1 
ATOM   1753 C CA  . SER A 1 225 ? 42.847 -41.729 0.451   1.00   37.58  ? 312  SER A CA  1 
ATOM   1754 C C   . SER A 1 225 ? 42.088 -41.414 -0.853  1.00   39.39  ? 312  SER A C   1 
ATOM   1755 O O   . SER A 1 225 ? 42.670 -41.226 -1.923  1.00   32.48  ? 312  SER A O   1 
ATOM   1756 C CB  . SER A 1 225 ? 43.748 -40.538 0.798   1.00   41.34  ? 312  SER A CB  1 
ATOM   1757 O OG  . SER A 1 225 ? 43.034 -39.320 0.996   1.00   39.47  ? 312  SER A OG  1 
ATOM   1758 N N   . THR A 1 226 ? 40.771 -41.285 -0.727  1.00   38.13  ? 313  THR A N   1 
ATOM   1759 C CA  . THR A 1 226 ? 39.938 -40.886 -1.842  1.00   33.97  ? 313  THR A CA  1 
ATOM   1760 C C   . THR A 1 226 ? 40.284 -39.474 -2.229  1.00   29.45  ? 313  THR A C   1 
ATOM   1761 O O   . THR A 1 226 ? 39.984 -39.060 -3.317  1.00   37.23  ? 313  THR A O   1 
ATOM   1762 C CB  . THR A 1 226 ? 38.421 -40.982 -1.523  1.00   36.29  ? 313  THR A CB  1 
ATOM   1763 O OG1 . THR A 1 226 ? 38.080 -40.347 -0.284  1.00   35.26  ? 313  THR A OG1 1 
ATOM   1764 C CG2 . THR A 1 226 ? 38.027 -42.404 -1.242  1.00   37.43  ? 313  THR A CG2 1 
ATOM   1765 N N   . LEU A 1 227 ? 40.910 -38.705 -1.357  1.00   33.18  ? 314  LEU A N   1 
ATOM   1766 C CA  . LEU A 1 227 ? 41.356 -37.353 -1.702  1.00   34.36  ? 314  LEU A CA  1 
ATOM   1767 C C   . LEU A 1 227 ? 42.438 -37.383 -2.796  1.00   34.24  ? 314  LEU A C   1 
ATOM   1768 O O   . LEU A 1 227 ? 42.770 -36.370 -3.408  1.00   27.77  ? 314  LEU A O   1 
ATOM   1769 C CB  . LEU A 1 227 ? 41.913 -36.664 -0.441  1.00   33.65  ? 314  LEU A CB  1 
ATOM   1770 C CG  . LEU A 1 227 ? 40.873 -36.384 0.650   1.00   34.39  ? 314  LEU A CG  1 
ATOM   1771 C CD1 . LEU A 1 227 ? 41.576 -35.642 1.762   1.00   35.89  ? 314  LEU A CD1 1 
ATOM   1772 C CD2 . LEU A 1 227 ? 39.666 -35.570 0.199   1.00   35.88  ? 314  LEU A CD2 1 
ATOM   1773 N N   . VAL A 1 228 ? 43.075 -38.542 -2.940  1.00   33.84  ? 315  VAL A N   1 
ATOM   1774 C CA  . VAL A 1 228 ? 44.101 -38.736 -3.940  1.00   31.68  ? 315  VAL A CA  1 
ATOM   1775 C C   . VAL A 1 228 ? 43.446 -39.409 -5.138  1.00   31.12  ? 315  VAL A C   1 
ATOM   1776 O O   . VAL A 1 228 ? 43.676 -39.034 -6.277  1.00   31.77  ? 315  VAL A O   1 
ATOM   1777 C CB  . VAL A 1 228 ? 45.241 -39.569 -3.359  1.00   30.98  ? 315  VAL A CB  1 
ATOM   1778 C CG1 . VAL A 1 228 ? 46.266 -39.838 -4.398  1.00   33.60  ? 315  VAL A CG1 1 
ATOM   1779 C CG2 . VAL A 1 228 ? 45.905 -38.821 -2.246  1.00   40.27  ? 315  VAL A CG2 1 
ATOM   1780 N N   . GLN A 1 229 ? 42.632 -40.416 -4.868  1.00   31.45  ? 316  GLN A N   1 
ATOM   1781 C CA  . GLN A 1 229 ? 41.969 -41.154 -5.907  1.00   32.56  ? 316  GLN A CA  1 
ATOM   1782 C C   . GLN A 1 229 ? 41.258 -40.204 -6.831  1.00   33.54  ? 316  GLN A C   1 
ATOM   1783 O O   . GLN A 1 229 ? 41.538 -40.190 -8.020  1.00   34.88  ? 316  GLN A O   1 
ATOM   1784 C CB  . GLN A 1 229 ? 40.989 -42.159 -5.327  1.00   32.08  ? 316  GLN A CB  1 
ATOM   1785 C CG  . GLN A 1 229 ? 41.715 -43.292 -4.663  1.00   37.08  ? 316  GLN A CG  1 
ATOM   1786 C CD  . GLN A 1 229 ? 40.777 -44.189 -3.891  1.00   39.40  ? 316  GLN A CD  1 
ATOM   1787 O OE1 . GLN A 1 229 ? 39.629 -44.369 -4.276  1.00   39.66  ? 316  GLN A OE1 1 
ATOM   1788 N NE2 . GLN A 1 229 ? 41.248 -44.686 -2.756  1.00   44.00  ? 316  GLN A NE2 1 
ATOM   1789 N N   . THR A 1 230 ? 40.367 -39.401 -6.274  1.00   35.44  ? 317  THR A N   1 
ATOM   1790 C CA  . THR A 1 230 ? 39.518 -38.544 -7.094  1.00   35.06  ? 317  THR A CA  1 
ATOM   1791 C C   . THR A 1 230 ? 40.215 -37.744 -8.192  1.00   31.30  ? 317  THR A C   1 
ATOM   1792 O O   . THR A 1 230 ? 39.841 -37.826 -9.374  1.00   30.30  ? 317  THR A O   1 
ATOM   1793 C CB  . THR A 1 230 ? 38.617 -37.690 -6.189  1.00   34.23  ? 317  THR A CB  1 
ATOM   1794 O OG1 . THR A 1 230 ? 37.406 -38.431 -5.970  1.00   31.01  ? 317  THR A OG1 1 
ATOM   1795 C CG2 . THR A 1 230 ? 38.083 -36.426 -6.880  1.00   35.71  ? 317  THR A CG2 1 
ATOM   1796 N N   . PRO A 1 231 ? 41.159 -36.896 -7.826  1.00   28.65  ? 318  PRO A N   1 
ATOM   1797 C CA  . PRO A 1 231 ? 41.785 -36.054 -8.854  1.00   31.13  ? 318  PRO A CA  1 
ATOM   1798 C C   . PRO A 1 231 ? 42.639 -36.910 -9.776  1.00   34.96  ? 318  PRO A C   1 
ATOM   1799 O O   . PRO A 1 231 ? 42.695 -36.660 -10.979 1.00   33.76  ? 318  PRO A O   1 
ATOM   1800 C CB  . PRO A 1 231 ? 42.604 -35.051 -8.052  1.00   30.04  ? 318  PRO A CB  1 
ATOM   1801 C CG  . PRO A 1 231 ? 42.796 -35.716 -6.752  1.00   29.62  ? 318  PRO A CG  1 
ATOM   1802 C CD  . PRO A 1 231 ? 41.575 -36.524 -6.473  1.00   28.29  ? 318  PRO A CD  1 
ATOM   1803 N N   . ALA A 1 232 ? 43.271 -37.938 -9.215  1.00   39.33  ? 319  ALA A N   1 
ATOM   1804 C CA  . ALA A 1 232 ? 44.093 -38.864 -10.007 1.00   37.11  ? 319  ALA A CA  1 
ATOM   1805 C C   . ALA A 1 232 ? 43.227 -39.550 -11.054 1.00   33.48  ? 319  ALA A C   1 
ATOM   1806 O O   . ALA A 1 232 ? 43.564 -39.605 -12.225 1.00   29.46  ? 319  ALA A O   1 
ATOM   1807 C CB  . ALA A 1 232 ? 44.740 -39.899 -9.101  1.00   37.31  ? 319  ALA A CB  1 
ATOM   1808 N N   . LEU A 1 233 ? 42.087 -40.064 -10.617 1.00   33.60  ? 320  LEU A N   1 
ATOM   1809 C CA  . LEU A 1 233 ? 41.171 -40.728 -11.527 1.00   33.50  ? 320  LEU A CA  1 
ATOM   1810 C C   . LEU A 1 233 ? 40.789 -39.740 -12.612 1.00   37.78  ? 320  LEU A C   1 
ATOM   1811 O O   . LEU A 1 233 ? 40.675 -40.068 -13.807 1.00   35.60  ? 320  LEU A O   1 
ATOM   1812 C CB  . LEU A 1 233 ? 39.912 -41.164 -10.788 1.00   31.68  ? 320  LEU A CB  1 
ATOM   1813 C CG  . LEU A 1 233 ? 38.858 -41.844 -11.660 1.00   29.40  ? 320  LEU A CG  1 
ATOM   1814 C CD1 . LEU A 1 233 ? 39.400 -42.992 -12.494 1.00   28.86  ? 320  LEU A CD1 1 
ATOM   1815 C CD2 . LEU A 1 233 ? 37.763 -42.369 -10.730 1.00   30.28  ? 320  LEU A CD2 1 
ATOM   1816 N N   . ARG A 1 234 ? 40.551 -38.510 -12.173 1.00   37.44  ? 321  ARG A N   1 
ATOM   1817 C CA  . ARG A 1 234 ? 40.073 -37.549 -13.127 1.00   36.86  ? 321  ARG A CA  1 
ATOM   1818 C C   . ARG A 1 234 ? 41.117 -37.282 -14.200 1.00   40.22  ? 321  ARG A C   1 
ATOM   1819 O O   . ARG A 1 234 ? 40.770 -37.229 -15.389 1.00   41.97  ? 321  ARG A O   1 
ATOM   1820 C CB  . ARG A 1 234 ? 39.726 -36.225 -12.465 1.00   39.93  ? 321  ARG A CB  1 
ATOM   1821 C CG  . ARG A 1 234 ? 39.126 -35.255 -13.489 1.00   37.37  ? 321  ARG A CG  1 
ATOM   1822 C CD  . ARG A 1 234 ? 37.929 -35.842 -14.237 1.00   38.42  ? 321  ARG A CD  1 
ATOM   1823 N NE  . ARG A 1 234 ? 37.100 -34.718 -14.611 1.00   41.97  ? 321  ARG A NE  1 
ATOM   1824 C CZ  . ARG A 1 234 ? 35.824 -34.558 -14.338 1.00   41.27  ? 321  ARG A CZ  1 
ATOM   1825 N NH1 . ARG A 1 234 ? 35.083 -35.452 -13.722 1.00   43.92  ? 321  ARG A NH1 1 
ATOM   1826 N NH2 . ARG A 1 234 ? 35.272 -33.441 -14.726 1.00   48.62  ? 321  ARG A NH2 1 
ATOM   1827 N N   . ALA A 1 235 ? 42.368 -37.062 -13.784 1.00   34.22  ? 322  ALA A N   1 
ATOM   1828 C CA  . ALA A 1 235 ? 43.450 -36.822 -14.733 1.00   32.20  ? 322  ALA A CA  1 
ATOM   1829 C C   . ALA A 1 235 ? 43.590 -37.969 -15.753 1.00   34.67  ? 322  ALA A C   1 
ATOM   1830 O O   . ALA A 1 235 ? 43.738 -37.753 -16.955 1.00   31.55  ? 322  ALA A O   1 
ATOM   1831 C CB  . ALA A 1 235 ? 44.727 -36.661 -13.995 1.00   34.21  ? 322  ALA A CB  1 
ATOM   1832 N N   . VAL A 1 236 ? 43.526 -39.202 -15.266 1.00   33.62  ? 323  VAL A N   1 
ATOM   1833 C CA  . VAL A 1 236 ? 43.557 -40.366 -16.125 1.00   34.39  ? 323  VAL A CA  1 
ATOM   1834 C C   . VAL A 1 236 ? 42.364 -40.358 -17.069 1.00   37.59  ? 323  VAL A C   1 
ATOM   1835 O O   . VAL A 1 236 ? 42.480 -40.720 -18.252 1.00   41.51  ? 323  VAL A O   1 
ATOM   1836 C CB  . VAL A 1 236 ? 43.536 -41.637 -15.257 1.00   37.57  ? 323  VAL A CB  1 
ATOM   1837 C CG1 . VAL A 1 236 ? 43.228 -42.897 -16.034 1.00   35.00  ? 323  VAL A CG1 1 
ATOM   1838 C CG2 . VAL A 1 236 ? 44.856 -41.771 -14.520 1.00   40.07  ? 323  VAL A CG2 1 
ATOM   1839 N N   . GLY A 1 237 ? 41.184 -40.032 -16.563 1.00   36.48  ? 324  GLY A N   1 
ATOM   1840 C CA  . GLY A 1 237 ? 40.022 -39.986 -17.444 1.00   37.04  ? 324  GLY A CA  1 
ATOM   1841 C C   . GLY A 1 237 ? 40.171 -38.960 -18.567 1.00   34.31  ? 324  GLY A C   1 
ATOM   1842 O O   . GLY A 1 237 ? 39.712 -39.151 -19.688 1.00   33.02  ? 324  GLY A O   1 
ATOM   1843 N N   . ASN A 1 238 ? 40.831 -37.855 -18.271 1.00   35.56  ? 325  ASN A N   1 
ATOM   1844 C CA  . ASN A 1 238 ? 40.984 -36.775 -19.234 1.00   35.34  ? 325  ASN A CA  1 
ATOM   1845 C C   . ASN A 1 238 ? 41.967 -37.233 -20.287 1.00   38.39  ? 325  ASN A C   1 
ATOM   1846 O O   . ASN A 1 238 ? 41.775 -37.016 -21.482 1.00   45.01  ? 325  ASN A O   1 
ATOM   1847 C CB  . ASN A 1 238 ? 41.498 -35.502 -18.565 1.00   33.83  ? 325  ASN A CB  1 
ATOM   1848 C CG  . ASN A 1 238 ? 40.447 -34.784 -17.761 1.00   36.35  ? 325  ASN A CG  1 
ATOM   1849 O OD1 . ASN A 1 238 ? 39.233 -35.025 -17.908 1.00   34.50  ? 325  ASN A OD1 1 
ATOM   1850 N ND2 . ASN A 1 238 ? 40.925 -33.891 -16.875 1.00   37.38  ? 325  ASN A ND2 1 
ATOM   1851 N N   . ILE A 1 239 ? 43.035 -37.878 -19.855 1.00   39.48  ? 326  ILE A N   1 
ATOM   1852 C CA  . ILE A 1 239 ? 43.994 -38.417 -20.811 1.00   38.18  ? 326  ILE A CA  1 
ATOM   1853 C C   . ILE A 1 239 ? 43.316 -39.358 -21.804 1.00   39.60  ? 326  ILE A C   1 
ATOM   1854 O O   . ILE A 1 239 ? 43.651 -39.335 -22.975 1.00   41.34  ? 326  ILE A O   1 
ATOM   1855 C CB  . ILE A 1 239 ? 45.118 -39.179 -20.120 1.00   34.74  ? 326  ILE A CB  1 
ATOM   1856 C CG1 . ILE A 1 239 ? 46.055 -38.200 -19.418 1.00   34.14  ? 326  ILE A CG1 1 
ATOM   1857 C CG2 . ILE A 1 239 ? 45.877 -39.982 -21.151 1.00   36.82  ? 326  ILE A CG2 1 
ATOM   1858 C CD1 . ILE A 1 239 ? 46.860 -38.833 -18.293 1.00   34.90  ? 326  ILE A CD1 1 
ATOM   1859 N N   . VAL A 1 240 ? 42.372 -40.178 -21.360 1.00   40.68  ? 327  VAL A N   1 
ATOM   1860 C CA  . VAL A 1 240 ? 41.716 -41.084 -22.296 1.00   41.74  ? 327  VAL A CA  1 
ATOM   1861 C C   . VAL A 1 240 ? 40.637 -40.426 -23.137 1.00   42.02  ? 327  VAL A C   1 
ATOM   1862 O O   . VAL A 1 240 ? 40.005 -41.152 -23.894 1.00   42.43  ? 327  VAL A O   1 
ATOM   1863 C CB  . VAL A 1 240 ? 41.151 -42.395 -21.640 1.00   42.94  ? 327  VAL A CB  1 
ATOM   1864 C CG1 . VAL A 1 240 ? 42.276 -43.299 -21.149 1.00   40.20  ? 327  VAL A CG1 1 
ATOM   1865 C CG2 . VAL A 1 240 ? 40.161 -42.113 -20.525 1.00   43.60  ? 327  VAL A CG2 1 
ATOM   1866 N N   . THR A 1 241 ? 40.364 -39.122 -22.998 1.00   43.84  ? 328  THR A N   1 
ATOM   1867 C CA  . THR A 1 241 ? 39.509 -38.446 -24.001 1.00   44.32  ? 328  THR A CA  1 
ATOM   1868 C C   . THR A 1 241 ? 40.336 -38.233 -25.268 1.00   47.55  ? 328  THR A C   1 
ATOM   1869 O O   . THR A 1 241 ? 39.825 -38.035 -26.366 1.00   48.30  ? 328  THR A O   1 
ATOM   1870 C CB  . THR A 1 241 ? 38.957 -37.116 -23.563 1.00   41.24  ? 328  THR A CB  1 
ATOM   1871 O OG1 . THR A 1 241 ? 40.022 -36.284 -23.065 1.00   33.46  ? 328  THR A OG1 1 
ATOM   1872 C CG2 . THR A 1 241 ? 38.010 -37.357 -22.411 1.00   46.77  ? 328  THR A CG2 1 
ATOM   1873 N N   . GLY A 1 242 ? 41.646 -38.318 -25.104 1.00   49.27  ? 329  GLY A N   1 
ATOM   1874 C CA  . GLY A 1 242 ? 42.543 -38.288 -26.231 1.00   50.82  ? 329  GLY A CA  1 
ATOM   1875 C C   . GLY A 1 242 ? 42.388 -39.426 -27.225 1.00   50.46  ? 329  GLY A C   1 
ATOM   1876 O O   . GLY A 1 242 ? 41.462 -40.250 -27.200 1.00   47.71  ? 329  GLY A O   1 
ATOM   1877 N N   . ASN A 1 243 ? 43.343 -39.440 -28.145 1.00   52.35  ? 330  ASN A N   1 
ATOM   1878 C CA  . ASN A 1 243 ? 43.353 -40.426 -29.225 1.00   54.73  ? 330  ASN A CA  1 
ATOM   1879 C C   . ASN A 1 243 ? 43.782 -41.820 -28.768 1.00   53.74  ? 330  ASN A C   1 
ATOM   1880 O O   . ASN A 1 243 ? 44.317 -42.024 -27.692 1.00   55.17  ? 330  ASN A O   1 
ATOM   1881 C CB  . ASN A 1 243 ? 44.247 -39.939 -30.379 1.00   54.77  ? 330  ASN A CB  1 
ATOM   1882 C CG  . ASN A 1 243 ? 45.717 -39.840 -29.987 1.00   54.33  ? 330  ASN A CG  1 
ATOM   1883 O OD1 . ASN A 1 243 ? 46.288 -40.811 -29.508 1.00   54.86  ? 330  ASN A OD1 1 
ATOM   1884 N ND2 . ASN A 1 243 ? 46.330 -38.672 -30.185 1.00   53.37  ? 330  ASN A ND2 1 
ATOM   1885 N N   . ASP A 1 244 ? 43.581 -42.792 -29.635 1.00   55.53  ? 331  ASP A N   1 
ATOM   1886 C CA  . ASP A 1 244 ? 43.942 -44.171 -29.334 1.00   54.32  ? 331  ASP A CA  1 
ATOM   1887 C C   . ASP A 1 244 ? 45.350 -44.379 -28.782 1.00   52.55  ? 331  ASP A C   1 
ATOM   1888 O O   . ASP A 1 244 ? 45.511 -45.105 -27.823 1.00   53.11  ? 331  ASP A O   1 
ATOM   1889 C CB  . ASP A 1 244 ? 43.721 -45.004 -30.586 1.00   53.72  ? 331  ASP A CB  1 
ATOM   1890 C CG  . ASP A 1 244 ? 42.259 -45.105 -30.927 1.00   58.28  ? 331  ASP A CG  1 
ATOM   1891 O OD1 . ASP A 1 244 ? 41.463 -44.524 -30.151 1.00   57.86  ? 331  ASP A OD1 1 
ATOM   1892 O OD2 . ASP A 1 244 ? 41.831 -45.732 -31.921 1.00   62.92  ? 331  ASP A OD2 1 
ATOM   1893 N N   . LEU A 1 245 ? 46.360 -43.754 -29.367 1.00   51.85  ? 332  LEU A N   1 
ATOM   1894 C CA  . LEU A 1 245 ? 47.724 -43.875 -28.867 1.00   51.39  ? 332  LEU A CA  1 
ATOM   1895 C C   . LEU A 1 245 ? 47.842 -43.406 -27.423 1.00   52.35  ? 332  LEU A C   1 
ATOM   1896 O O   . LEU A 1 245 ? 48.589 -44.028 -26.669 1.00   59.63  ? 332  LEU A O   1 
ATOM   1897 C CB  . LEU A 1 245 ? 48.745 -43.090 -29.735 1.00   53.91  ? 332  LEU A CB  1 
ATOM   1898 C CG  . LEU A 1 245 ? 49.376 -43.678 -31.015 1.00   51.88  ? 332  LEU A CG  1 
ATOM   1899 C CD1 . LEU A 1 245 ? 50.035 -42.624 -31.777 0.0000 54.63  ? 332  LEU A CD1 1 
ATOM   1900 C CD2 . LEU A 1 245 ? 50.096 -44.850 -30.641 0.0000 54.63  ? 332  LEU A CD2 1 
ATOM   1901 N N   . GLN A 1 246 ? 47.167 -42.309 -27.059 1.00   51.16  ? 333  GLN A N   1 
ATOM   1902 C CA  . GLN A 1 246 ? 47.192 -41.687 -25.723 1.00   45.32  ? 333  GLN A CA  1 
ATOM   1903 C C   . GLN A 1 246 ? 46.514 -42.570 -24.698 1.00   41.95  ? 333  GLN A C   1 
ATOM   1904 O O   . GLN A 1 246 ? 47.028 -42.811 -23.572 1.00   41.05  ? 333  GLN A O   1 
ATOM   1905 C CB  . GLN A 1 246 ? 46.497 -40.322 -25.762 1.00   46.39  ? 333  GLN A CB  1 
ATOM   1906 C CG  . GLN A 1 246 ? 47.353 -39.308 -26.515 1.00   48.13  ? 333  GLN A CG  1 
ATOM   1907 C CD  . GLN A 1 246 ? 46.692 -37.971 -26.772 1.00   46.81  ? 333  GLN A CD  1 
ATOM   1908 O OE1 . GLN A 1 246 ? 45.470 -37.880 -26.904 1.00   45.64  ? 333  GLN A OE1 1 
ATOM   1909 N NE2 . GLN A 1 246 ? 47.515 -36.924 -26.855 1.00   46.80  ? 333  GLN A NE2 1 
ATOM   1910 N N   . THR A 1 247 ? 45.366 -43.071 -25.136 1.00   35.33  ? 334  THR A N   1 
ATOM   1911 C CA  . THR A 1 247 ? 44.602 -43.997 -24.330 1.00   36.70  ? 334  THR A CA  1 
ATOM   1912 C C   . THR A 1 247 ? 45.431 -45.248 -24.023 1.00   40.60  ? 334  THR A C   1 
ATOM   1913 O O   . THR A 1 247 ? 45.404 -45.764 -22.907 1.00   41.38  ? 334  THR A O   1 
ATOM   1914 C CB  . THR A 1 247 ? 43.334 -44.337 -25.074 1.00   37.19  ? 334  THR A CB  1 
ATOM   1915 O OG1 . THR A 1 247 ? 42.532 -43.154 -25.152 1.00   34.64  ? 334  THR A OG1 1 
ATOM   1916 C CG2 . THR A 1 247 ? 42.505 -45.370 -24.324 1.00   40.52  ? 334  THR A CG2 1 
ATOM   1917 N N   . GLN A 1 248 ? 46.151 -45.731 -25.035 1.00   44.35  ? 335  GLN A N   1 
ATOM   1918 C CA  . GLN A 1 248 ? 46.975 -46.928 -24.950 1.00   43.04  ? 335  GLN A CA  1 
ATOM   1919 C C   . GLN A 1 248 ? 48.093 -46.755 -23.937 1.00   39.02  ? 335  GLN A C   1 
ATOM   1920 O O   . GLN A 1 248 ? 48.478 -47.725 -23.315 1.00   42.08  ? 335  GLN A O   1 
ATOM   1921 C CB  . GLN A 1 248 ? 47.590 -47.331 -26.307 1.00   41.93  ? 335  GLN A CB  1 
ATOM   1922 C CG  . GLN A 1 248 ? 48.155 -48.752 -26.274 1.00   36.89  ? 335  GLN A CG  1 
ATOM   1923 C CD  . GLN A 1 248 ? 47.081 -49.746 -25.946 1.00   34.84  ? 335  GLN A CD  1 
ATOM   1924 O OE1 . GLN A 1 248 ? 45.966 -49.654 -26.474 1.00   34.71  ? 335  GLN A OE1 1 
ATOM   1925 N NE2 . GLN A 1 248 ? 47.390 -50.674 -25.053 1.00   33.06  ? 335  GLN A NE2 1 
ATOM   1926 N N   . VAL A 1 249 ? 48.632 -45.566 -23.767 1.00   34.39  ? 336  VAL A N   1 
ATOM   1927 C CA  . VAL A 1 249 ? 49.652 -45.378 -22.734 1.00   38.75  ? 336  VAL A CA  1 
ATOM   1928 C C   . VAL A 1 249 ? 49.182 -45.659 -21.300 1.00   41.94  ? 336  VAL A C   1 
ATOM   1929 O O   . VAL A 1 249 ? 49.957 -46.111 -20.457 1.00   45.69  ? 336  VAL A O   1 
ATOM   1930 C CB  . VAL A 1 249 ? 50.178 -43.924 -22.768 1.00   39.80  ? 336  VAL A CB  1 
ATOM   1931 C CG1 . VAL A 1 249 ? 51.044 -43.625 -21.561 1.00   41.39  ? 336  VAL A CG1 1 
ATOM   1932 C CG2 . VAL A 1 249 ? 50.994 -43.693 -24.021 1.00   40.04  ? 336  VAL A CG2 1 
ATOM   1933 N N   . VAL A 1 250 ? 47.923 -45.328 -21.024 1.00   44.61  ? 337  VAL A N   1 
ATOM   1934 C CA  . VAL A 1 250 ? 47.287 -45.454 -19.708 1.00   41.16  ? 337  VAL A CA  1 
ATOM   1935 C C   . VAL A 1 250 ? 46.947 -46.921 -19.511 1.00   39.30  ? 337  VAL A C   1 
ATOM   1936 O O   . VAL A 1 250 ? 47.132 -47.436 -18.416 1.00   39.57  ? 337  VAL A O   1 
ATOM   1937 C CB  . VAL A 1 250 ? 46.027 -44.537 -19.637 1.00   42.92  ? 337  VAL A CB  1 
ATOM   1938 C CG1 . VAL A 1 250 ? 45.122 -44.841 -18.509 1.00   45.07  ? 337  VAL A CG1 1 
ATOM   1939 C CG2 . VAL A 1 250 ? 46.446 -43.096 -19.513 1.00   44.14  ? 337  VAL A CG2 1 
ATOM   1940 N N   . ILE A 1 251 ? 46.454 -47.599 -20.542 1.00   37.79  ? 338  ILE A N   1 
ATOM   1941 C CA  . ILE A 1 251 ? 46.174 -49.033 -20.431 1.00   39.49  ? 338  ILE A CA  1 
ATOM   1942 C C   . ILE A 1 251 ? 47.460 -49.835 -20.166 1.00   43.20  ? 338  ILE A C   1 
ATOM   1943 O O   . ILE A 1 251 ? 47.474 -50.776 -19.354 1.00   46.56  ? 338  ILE A O   1 
ATOM   1944 C CB  . ILE A 1 251 ? 45.555 -49.550 -21.711 1.00   38.32  ? 338  ILE A CB  1 
ATOM   1945 C CG1 . ILE A 1 251 ? 44.163 -48.961 -21.886 1.00   40.57  ? 338  ILE A CG1 1 
ATOM   1946 C CG2 . ILE A 1 251 ? 45.566 -51.076 -21.719 1.00   41.04  ? 338  ILE A CG2 1 
ATOM   1947 C CD1 . ILE A 1 251 ? 43.485 -49.401 -23.173 1.00   44.39  ? 338  ILE A CD1 1 
ATOM   1948 N N   . ASN A 1 252 ? 48.524 -49.425 -20.860 1.00   40.20  ? 339  ASN A N   1 
ATOM   1949 C CA  . ASN A 1 252 ? 49.855 -49.992 -20.742 1.00   39.13  ? 339  ASN A CA  1 
ATOM   1950 C C   . ASN A 1 252 ? 50.460 -49.723 -19.383 1.00   40.76  ? 339  ASN A C   1 
ATOM   1951 O O   . ASN A 1 252 ? 51.301 -50.468 -18.949 1.00   46.55  ? 339  ASN A O   1 
ATOM   1952 C CB  . ASN A 1 252 ? 50.824 -49.385 -21.756 1.00   40.37  ? 339  ASN A CB  1 
ATOM   1953 C CG  . ASN A 1 252 ? 50.704 -49.965 -23.163 1.00   35.72  ? 339  ASN A CG  1 
ATOM   1954 O OD1 . ASN A 1 252 ? 49.959 -50.894 -23.426 1.00   34.79  ? 339  ASN A OD1 1 
ATOM   1955 N ND2 . ASN A 1 252 ? 51.485 -49.407 -24.076 1.00   37.00  ? 339  ASN A ND2 1 
ATOM   1956 N N   . ALA A 1 253 ? 50.060 -48.657 -18.713 1.00   44.69  ? 340  ALA A N   1 
ATOM   1957 C CA  . ALA A 1 253 ? 50.501 -48.379 -17.345 1.00   42.75  ? 340  ALA A CA  1 
ATOM   1958 C C   . ALA A 1 253 ? 49.721 -49.111 -16.255 1.00   38.88  ? 340  ALA A C   1 
ATOM   1959 O O   . ALA A 1 253 ? 50.077 -48.950 -15.070 1.00   32.01  ? 340  ALA A O   1 
ATOM   1960 C CB  . ALA A 1 253 ? 50.441 -46.900 -17.088 1.00   44.75  ? 340  ALA A CB  1 
ATOM   1961 N N   . GLY A 1 254 ? 48.674 -49.866 -16.629 1.00   33.56  ? 341  GLY A N   1 
ATOM   1962 C CA  . GLY A 1 254 ? 47.961 -50.663 -15.636 1.00   33.29  ? 341  GLY A CA  1 
ATOM   1963 C C   . GLY A 1 254 ? 46.614 -50.180 -15.133 1.00   36.04  ? 341  GLY A C   1 
ATOM   1964 O O   . GLY A 1 254 ? 46.061 -50.711 -14.145 1.00   39.05  ? 341  GLY A O   1 
ATOM   1965 N N   . VAL A 1 255 ? 46.078 -49.180 -15.821 1.00   32.34  ? 342  VAL A N   1 
ATOM   1966 C CA  . VAL A 1 255 ? 44.819 -48.549 -15.428 1.00   32.56  ? 342  VAL A CA  1 
ATOM   1967 C C   . VAL A 1 255 ? 43.592 -49.466 -15.385 1.00   29.86  ? 342  VAL A C   1 
ATOM   1968 O O   . VAL A 1 255 ? 42.690 -49.222 -14.612 1.00   32.38  ? 342  VAL A O   1 
ATOM   1969 C CB  . VAL A 1 255 ? 44.455 -47.406 -16.390 1.00   31.40  ? 342  VAL A CB  1 
ATOM   1970 C CG1 . VAL A 1 255 ? 43.775 -47.975 -17.638 1.00   30.03  ? 342  VAL A CG1 1 
ATOM   1971 C CG2 . VAL A 1 255 ? 43.569 -46.406 -15.719 1.00   28.42  ? 342  VAL A CG2 1 
ATOM   1972 N N   . LEU A 1 256 ? 43.508 -50.515 -16.190 1.00   30.52  ? 343  LEU A N   1 
ATOM   1973 C CA  . LEU A 1 256 ? 42.292 -51.328 -16.118 1.00   31.13  ? 343  LEU A CA  1 
ATOM   1974 C C   . LEU A 1 256 ? 42.087 -52.016 -14.754 1.00   32.98  ? 343  LEU A C   1 
ATOM   1975 O O   . LEU A 1 256 ? 40.975 -51.930 -14.241 1.00   33.14  ? 343  LEU A O   1 
ATOM   1976 C CB  . LEU A 1 256 ? 42.186 -52.311 -17.283 1.00   30.39  ? 343  LEU A CB  1 
ATOM   1977 C CG  . LEU A 1 256 ? 42.091 -51.565 -18.619 1.00   33.61  ? 343  LEU A CG  1 
ATOM   1978 C CD1 . LEU A 1 256 ? 42.339 -52.556 -19.756 1.00   33.65  ? 343  LEU A CD1 1 
ATOM   1979 C CD2 . LEU A 1 256 ? 40.734 -50.879 -18.736 1.00   32.76  ? 343  LEU A CD2 1 
ATOM   1980 N N   . PRO A 1 257 ? 43.085 -52.711 -14.191 1.00   32.27  ? 344  PRO A N   1 
ATOM   1981 C CA  . PRO A 1 257 ? 42.960 -53.292 -12.851 1.00   32.91  ? 344  PRO A CA  1 
ATOM   1982 C C   . PRO A 1 257 ? 42.726 -52.226 -11.783 1.00   34.21  ? 344  PRO A C   1 
ATOM   1983 O O   . PRO A 1 257 ? 42.002 -52.478 -10.832 1.00   33.99  ? 344  PRO A O   1 
ATOM   1984 C CB  . PRO A 1 257 ? 44.303 -54.007 -12.634 1.00   30.35  ? 344  PRO A CB  1 
ATOM   1985 C CG  . PRO A 1 257 ? 44.817 -54.259 -14.043 1.00   30.79  ? 344  PRO A CG  1 
ATOM   1986 C CD  . PRO A 1 257 ? 44.387 -53.054 -14.786 1.00   32.99  ? 344  PRO A CD  1 
ATOM   1987 N N   . ALA A 1 258 ? 43.315 -51.046 -11.919 1.00   35.81  ? 345  ALA A N   1 
ATOM   1988 C CA  . ALA A 1 258 ? 43.049 -49.985 -10.948 1.00   36.48  ? 345  ALA A CA  1 
ATOM   1989 C C   . ALA A 1 258 ? 41.581 -49.564 -11.062 1.00   38.59  ? 345  ALA A C   1 
ATOM   1990 O O   . ALA A 1 258 ? 40.939 -49.310 -10.035 1.00   37.70  ? 345  ALA A O   1 
ATOM   1991 C CB  . ALA A 1 258 ? 43.938 -48.801 -11.187 1.00   36.45  ? 345  ALA A CB  1 
ATOM   1992 N N   . LEU A 1 259 ? 41.062 -49.483 -12.289 1.00   32.83  ? 346  LEU A N   1 
ATOM   1993 C CA  . LEU A 1 259 ? 39.646 -49.176 -12.475 1.00   35.47  ? 346  LEU A CA  1 
ATOM   1994 C C   . LEU A 1 259 ? 38.723 -50.217 -11.869 1.00   34.13  ? 346  LEU A C   1 
ATOM   1995 O O   . LEU A 1 259 ? 37.647 -49.888 -11.393 1.00   31.79  ? 346  LEU A O   1 
ATOM   1996 C CB  . LEU A 1 259 ? 39.300 -48.966 -13.953 1.00   36.84  ? 346  LEU A CB  1 
ATOM   1997 C CG  . LEU A 1 259 ? 39.928 -47.677 -14.479 1.00   36.12  ? 346  LEU A CG  1 
ATOM   1998 C CD1 . LEU A 1 259 ? 39.882 -47.695 -16.003 1.00   40.05  ? 346  LEU A CD1 1 
ATOM   1999 C CD2 . LEU A 1 259 ? 39.291 -46.417 -13.899 1.00   31.29  ? 346  LEU A CD2 1 
ATOM   2000 N N   . ARG A 1 260 ? 39.176 -51.462 -11.846 1.00   36.80  ? 347  ARG A N   1 
ATOM   2001 C CA  . ARG A 1 260 ? 38.405 -52.554 -11.274 1.00   36.24  ? 347  ARG A CA  1 
ATOM   2002 C C   . ARG A 1 260 ? 38.213 -52.240 -9.812  1.00   37.07  ? 347  ARG A C   1 
ATOM   2003 O O   . ARG A 1 260 ? 37.140 -52.397 -9.227  1.00   43.74  ? 347  ARG A O   1 
ATOM   2004 C CB  . ARG A 1 260 ? 39.174 -53.870 -11.362 1.00   37.13  ? 347  ARG A CB  1 
ATOM   2005 C CG  . ARG A 1 260 ? 38.278 -55.069 -11.582 1.00   41.69  ? 347  ARG A CG  1 
ATOM   2006 C CD  . ARG A 1 260 ? 37.053 -54.973 -10.719 1.00   44.12  ? 347  ARG A CD  1 
ATOM   2007 N NE  . ARG A 1 260 ? 36.213 -56.148 -10.612 1.00   43.87  ? 347  ARG A NE  1 
ATOM   2008 C CZ  . ARG A 1 260 ? 35.244 -56.219 -9.705  1.00   49.00  ? 347  ARG A CZ  1 
ATOM   2009 N NH1 . ARG A 1 260 ? 34.986 -55.178 -8.921  1.00   45.03  ? 347  ARG A NH1 1 
ATOM   2010 N NH2 . ARG A 1 260 ? 34.507 -57.321 -9.609  1.00   57.57  ? 347  ARG A NH2 1 
ATOM   2011 N N   . LEU A 1 261 ? 39.293 -51.792 -9.208  1.00   32.76  ? 348  LEU A N   1 
ATOM   2012 C CA  . LEU A 1 261 ? 39.277 -51.532 -7.794  1.00   34.29  ? 348  LEU A CA  1 
ATOM   2013 C C   . LEU A 1 261 ? 38.275 -50.418 -7.552  1.00   33.02  ? 348  LEU A C   1 
ATOM   2014 O O   . LEU A 1 261 ? 37.457 -50.528 -6.672  1.00   39.65  ? 348  LEU A O   1 
ATOM   2015 C CB  . LEU A 1 261 ? 40.681 -51.144 -7.332  1.00   33.41  ? 348  LEU A CB  1 
ATOM   2016 C CG  . LEU A 1 261 ? 41.102 -51.142 -5.866  1.00   36.99  ? 348  LEU A CG  1 
ATOM   2017 C CD1 . LEU A 1 261 ? 41.608 -49.727 -5.518  1.00   35.10  ? 348  LEU A CD1 1 
ATOM   2018 C CD2 . LEU A 1 261 ? 40.054 -51.635 -4.841  1.00   33.87  ? 348  LEU A CD2 1 
ATOM   2019 N N   . LEU A 1 262 ? 38.295 -49.385 -8.377  1.00   33.84  ? 349  LEU A N   1 
ATOM   2020 C CA  . LEU A 1 262 ? 37.482 -48.209 -8.163  1.00   31.93  ? 349  LEU A CA  1 
ATOM   2021 C C   . LEU A 1 262 ? 36.034 -48.460 -8.464  1.00   34.97  ? 349  LEU A C   1 
ATOM   2022 O O   . LEU A 1 262 ? 35.186 -47.759 -7.928  1.00   39.97  ? 349  LEU A O   1 
ATOM   2023 C CB  . LEU A 1 262 ? 37.952 -47.048 -9.023  1.00   33.25  ? 349  LEU A CB  1 
ATOM   2024 C CG  . LEU A 1 262 ? 39.362 -46.534 -8.750  1.00   33.04  ? 349  LEU A CG  1 
ATOM   2025 C CD1 . LEU A 1 262 ? 39.836 -45.766 -9.946  1.00   34.97  ? 349  LEU A CD1 1 
ATOM   2026 C CD2 . LEU A 1 262 ? 39.418 -45.666 -7.508  1.00   31.60  ? 349  LEU A CD2 1 
ATOM   2027 N N   . LEU A 1 263 ? 35.734 -49.457 -9.286  1.00   34.45  ? 350  LEU A N   1 
ATOM   2028 C CA  . LEU A 1 263 ? 34.349 -49.749 -9.563  1.00   31.36  ? 350  LEU A CA  1 
ATOM   2029 C C   . LEU A 1 263 ? 33.722 -50.315 -8.295  1.00   35.80  ? 350  LEU A C   1 
ATOM   2030 O O   . LEU A 1 263 ? 32.509 -50.442 -8.237  1.00   39.39  ? 350  LEU A O   1 
ATOM   2031 C CB  . LEU A 1 263 ? 34.236 -50.717 -10.737 1.00   32.97  ? 350  LEU A CB  1 
ATOM   2032 C CG  . LEU A 1 263 ? 34.278 -50.172 -12.184 1.00   33.96  ? 350  LEU A CG  1 
ATOM   2033 C CD1 . LEU A 1 263 ? 33.916 -51.288 -13.130 1.00   35.37  ? 350  LEU A CD1 1 
ATOM   2034 C CD2 . LEU A 1 263 ? 33.341 -49.019 -12.488 1.00   28.48  ? 350  LEU A CD2 1 
ATOM   2035 N N   . SER A 1 264 ? 34.503 -50.680 -7.273  1.00   37.90  ? 351  SER A N   1 
ATOM   2036 C CA  . SER A 1 264 ? 33.890 -51.068 -5.989  1.00   42.36  ? 351  SER A CA  1 
ATOM   2037 C C   . SER A 1 264 ? 34.237 -50.150 -4.807  1.00   43.87  ? 351  SER A C   1 
ATOM   2038 O O   . SER A 1 264 ? 34.321 -50.535 -3.652  1.00   44.82  ? 351  SER A O   1 
ATOM   2039 C CB  . SER A 1 264 ? 34.060 -52.558 -5.671  1.00   43.84  ? 351  SER A CB  1 
ATOM   2040 O OG  . SER A 1 264 ? 35.411 -52.915 -5.797  1.00   52.26  ? 351  SER A OG  1 
ATOM   2041 N N   . SER A 1 265 ? 34.351 -48.869 -5.106  1.00   45.03  ? 352  SER A N   1 
ATOM   2042 C CA  . SER A 1 265 ? 34.636 -47.867 -4.101  1.00   44.05  ? 352  SER A CA  1 
ATOM   2043 C C   . SER A 1 265 ? 33.373 -47.583 -3.292  1.00   47.16  ? 352  SER A C   1 
ATOM   2044 O O   . SER A 1 265 ? 32.273 -47.758 -3.814  1.00   48.88  ? 352  SER A O   1 
ATOM   2045 C CB  . SER A 1 265 ? 35.092 -46.594 -4.817  1.00   42.60  ? 352  SER A CB  1 
ATOM   2046 O OG  . SER A 1 265 ? 35.158 -45.495 -3.935  1.00   36.62  ? 352  SER A OG  1 
ATOM   2047 N N   . PRO A 1 266 ? 33.524 -47.203 -2.021  1.00   48.99  ? 353  PRO A N   1 
ATOM   2048 C CA  . PRO A 1 266 ? 32.400 -46.768 -1.183  1.00   48.88  ? 353  PRO A CA  1 
ATOM   2049 C C   . PRO A 1 266 ? 31.756 -45.484 -1.693  1.00   49.77  ? 353  PRO A C   1 
ATOM   2050 O O   . PRO A 1 266 ? 30.551 -45.313 -1.563  1.00   53.26  ? 353  PRO A O   1 
ATOM   2051 C CB  . PRO A 1 266 ? 33.069 -46.473 0.163   1.00   51.14  ? 353  PRO A CB  1 
ATOM   2052 C CG  . PRO A 1 266 ? 34.326 -47.210 0.179   1.00   47.97  ? 353  PRO A CG  1 
ATOM   2053 C CD  . PRO A 1 266 ? 34.781 -47.224 -1.247  1.00   49.42  ? 353  PRO A CD  1 
ATOM   2054 N N   . LYS A 1 267 ? 32.548 -44.558 -2.216  1.00   47.72  ? 354  LYS A N   1 
ATOM   2055 C CA  . LYS A 1 267 ? 31.993 -43.336 -2.762  1.00   47.54  ? 354  LYS A CA  1 
ATOM   2056 C C   . LYS A 1 267 ? 31.280 -43.627 -4.086  1.00   47.54  ? 354  LYS A C   1 
ATOM   2057 O O   . LYS A 1 267 ? 31.869 -44.180 -5.011  1.00   49.12  ? 354  LYS A O   1 
ATOM   2058 C CB  . LYS A 1 267 ? 33.092 -42.282 -2.948  1.00   48.20  ? 354  LYS A CB  1 
ATOM   2059 C CG  . LYS A 1 267 ? 33.877 -41.948 -1.688  1.00   51.16  ? 354  LYS A CG  1 
ATOM   2060 C CD  . LYS A 1 267 ? 33.058 -41.125 -0.704  1.00   55.62  ? 354  LYS A CD  1 
ATOM   2061 C CE  . LYS A 1 267 ? 33.935 -40.547 0.397   1.00   53.88  ? 354  LYS A CE  1 
ATOM   2062 N NZ  . LYS A 1 267 ? 33.078 -39.878 1.376   1.00   55.91  ? 354  LYS A NZ  1 
ATOM   2063 N N   . GLU A 1 268 ? 30.022 -43.201 -4.197  1.00   47.73  ? 355  GLU A N   1 
ATOM   2064 C CA  . GLU A 1 268 ? 29.268 -43.351 -5.437  1.00   44.82  ? 355  GLU A CA  1 
ATOM   2065 C C   . GLU A 1 268 ? 29.899 -42.626 -6.631  1.00   42.21  ? 355  GLU A C   1 
ATOM   2066 O O   . GLU A 1 268 ? 29.908 -43.162 -7.728  1.00   36.97  ? 355  GLU A O   1 
ATOM   2067 C CB  . GLU A 1 268 ? 27.833 -42.854 -5.263  1.00   44.63  ? 355  GLU A CB  1 
ATOM   2068 C CG  . GLU A 1 268 ? 26.894 -43.119 -6.439  1.00   49.44  ? 355  GLU A CG  1 
ATOM   2069 C CD  . GLU A 1 268 ? 26.635 -44.601 -6.728  1.00   53.78  ? 355  GLU A CD  1 
ATOM   2070 O OE1 . GLU A 1 268 ? 27.532 -45.440 -6.572  1.00   61.03  ? 355  GLU A OE1 1 
ATOM   2071 O OE2 . GLU A 1 268 ? 25.536 -45.000 -7.147  1.00   55.23  ? 355  GLU A OE2 1 
ATOM   2072 N N   . ASN A 1 269 ? 30.399 -41.416 -6.410  1.00   42.48  ? 356  ASN A N   1 
ATOM   2073 C CA  . ASN A 1 269 ? 30.975 -40.584 -7.464  1.00   44.89  ? 356  ASN A CA  1 
ATOM   2074 C C   . ASN A 1 269 ? 32.301 -41.086 -8.028  1.00   43.49  ? 356  ASN A C   1 
ATOM   2075 O O   . ASN A 1 269 ? 32.601 -40.800 -9.182  1.00   39.44  ? 356  ASN A O   1 
ATOM   2076 C CB  . ASN A 1 269 ? 31.138 -39.125 -6.985  1.00   52.16  ? 356  ASN A CB  1 
ATOM   2077 C CG  . ASN A 1 269 ? 29.799 -38.315 -7.008  1.00   59.76  ? 356  ASN A CG  1 
ATOM   2078 O OD1 . ASN A 1 269 ? 28.823 -38.664 -7.716  1.00   60.07  ? 356  ASN A OD1 1 
ATOM   2079 N ND2 . ASN A 1 269 ? 29.769 -37.213 -6.234  1.00   59.94  ? 356  ASN A ND2 1 
ATOM   2080 N N   . ILE A 1 270 ? 33.096 -41.798 -7.222  1.00   42.08  ? 357  ILE A N   1 
ATOM   2081 C CA  . ILE A 1 270 ? 34.297 -42.456 -7.709  1.00   38.49  ? 357  ILE A CA  1 
ATOM   2082 C C   . ILE A 1 270 ? 33.843 -43.536 -8.699  1.00   35.54  ? 357  ILE A C   1 
ATOM   2083 O O   . ILE A 1 270 ? 34.447 -43.715 -9.759  1.00   32.23  ? 357  ILE A O   1 
ATOM   2084 C CB  . ILE A 1 270 ? 35.080 -43.134 -6.567  1.00   42.49  ? 357  ILE A CB  1 
ATOM   2085 C CG1 . ILE A 1 270 ? 35.538 -42.162 -5.469  1.00   48.02  ? 357  ILE A CG1 1 
ATOM   2086 C CG2 . ILE A 1 270 ? 36.276 -43.862 -7.116  1.00   40.96  ? 357  ILE A CG2 1 
ATOM   2087 C CD1 . ILE A 1 270 ? 36.764 -41.373 -5.760  1.00   50.26  ? 357  ILE A CD1 1 
ATOM   2088 N N   . LYS A 1 271 ? 32.783 -44.266 -8.355  1.00   34.29  ? 358  LYS A N   1 
ATOM   2089 C CA  . LYS A 1 271 ? 32.277 -45.313 -9.231  1.00   34.55  ? 358  LYS A CA  1 
ATOM   2090 C C   . LYS A 1 271 ? 31.770 -44.713 -10.534 1.00   39.15  ? 358  LYS A C   1 
ATOM   2091 O O   . LYS A 1 271 ? 32.029 -45.298 -11.605 1.00   43.40  ? 358  LYS A O   1 
ATOM   2092 C CB  . LYS A 1 271 ? 31.191 -46.129 -8.551  1.00   37.28  ? 358  LYS A CB  1 
ATOM   2093 C CG  . LYS A 1 271 ? 31.739 -47.062 -7.480  1.00   42.56  ? 358  LYS A CG  1 
ATOM   2094 C CD  . LYS A 1 271 ? 30.718 -48.134 -7.079  1.00   47.15  ? 358  LYS A CD  1 
ATOM   2095 C CE  . LYS A 1 271 ? 29.788 -47.712 -5.956  1.00   48.37  ? 358  LYS A CE  1 
ATOM   2096 N NZ  . LYS A 1 271 ? 28.841 -48.855 -5.750  1.00   54.23  ? 358  LYS A NZ  1 
ATOM   2097 N N   . LYS A 1 272 ? 31.097 -43.559 -10.440 1.00   32.59  ? 359  LYS A N   1 
ATOM   2098 C CA  . LYS A 1 272 ? 30.602 -42.857 -11.605 1.00   33.69  ? 359  LYS A CA  1 
ATOM   2099 C C   . LYS A 1 272 ? 31.777 -42.431 -12.484 1.00   34.97  ? 359  LYS A C   1 
ATOM   2100 O O   . LYS A 1 272 ? 31.702 -42.528 -13.690 1.00   37.01  ? 359  LYS A O   1 
ATOM   2101 C CB  . LYS A 1 272 ? 29.761 -41.626 -11.221 1.00   36.42  ? 359  LYS A CB  1 
ATOM   2102 C CG  . LYS A 1 272 ? 29.142 -40.878 -12.398 1.00   40.73  ? 359  LYS A CG  1 
ATOM   2103 C CD  . LYS A 1 272 ? 28.423 -39.599 -12.016 1.00   48.19  ? 359  LYS A CD  1 
ATOM   2104 C CE  . LYS A 1 272 ? 29.327 -38.403 -11.821 1.00   55.99  ? 359  LYS A CE  1 
ATOM   2105 N NZ  . LYS A 1 272 ? 28.626 -37.368 -10.961 1.00   54.07  ? 359  LYS A NZ  1 
ATOM   2106 N N   . GLU A 1 273 ? 32.857 -41.919 -11.915 1.00   37.43  ? 360  GLU A N   1 
ATOM   2107 C CA  . GLU A 1 273 ? 33.979 -41.437 -12.721 1.00   38.66  ? 360  GLU A CA  1 
ATOM   2108 C C   . GLU A 1 273 ? 34.739 -42.573 -13.336 1.00   37.57  ? 360  GLU A C   1 
ATOM   2109 O O   . GLU A 1 273 ? 35.329 -42.464 -14.388 1.00   35.44  ? 360  GLU A O   1 
ATOM   2110 C CB  . GLU A 1 273 ? 34.929 -40.643 -11.853 1.00   40.72  ? 360  GLU A CB  1 
ATOM   2111 C CG  . GLU A 1 273 ? 34.329 -39.309 -11.460 1.00   45.67  ? 360  GLU A CG  1 
ATOM   2112 C CD  . GLU A 1 273 ? 34.687 -38.265 -12.489 1.00   48.53  ? 360  GLU A CD  1 
ATOM   2113 O OE1 . GLU A 1 273 ? 35.888 -38.132 -12.886 1.00   46.83  ? 360  GLU A OE1 1 
ATOM   2114 O OE2 . GLU A 1 273 ? 33.695 -37.626 -12.890 1.00   49.70  ? 360  GLU A OE2 1 
ATOM   2115 N N   . ALA A 1 274 ? 34.708 -43.694 -12.644 1.00   38.70  ? 361  ALA A N   1 
ATOM   2116 C CA  . ALA A 1 274 ? 35.386 -44.868 -13.123 1.00   38.47  ? 361  ALA A CA  1 
ATOM   2117 C C   . ALA A 1 274 ? 34.659 -45.394 -14.373 1.00   35.87  ? 361  ALA A C   1 
ATOM   2118 O O   . ALA A 1 274 ? 35.265 -45.805 -15.363 1.00   32.30  ? 361  ALA A O   1 
ATOM   2119 C CB  . ALA A 1 274 ? 35.400 -45.898 -11.974 1.00   41.15  ? 361  ALA A CB  1 
ATOM   2120 N N   . CYS A 1 275 ? 33.332 -45.376 -14.311 1.00   37.30  ? 362  CYS A N   1 
ATOM   2121 C CA  . CYS A 1 275 ? 32.492 -45.833 -15.416 1.00   38.46  ? 362  CYS A CA  1 
ATOM   2122 C C   . CYS A 1 275 ? 32.719 -44.924 -16.615 1.00   36.26  ? 362  CYS A C   1 
ATOM   2123 O O   . CYS A 1 275 ? 33.033 -45.370 -17.711 1.00   37.71  ? 362  CYS A O   1 
ATOM   2124 C CB  . CYS A 1 275 ? 31.017 -45.775 -15.020 1.00   39.79  ? 362  CYS A CB  1 
ATOM   2125 S SG  . CYS A 1 275 ? 30.484 -47.025 -13.855 1.00   39.45  ? 362  CYS A SG  1 
ATOM   2126 N N   . TRP A 1 276 ? 32.616 -43.628 -16.380 1.00   34.32  ? 363  TRP A N   1 
ATOM   2127 C CA  . TRP A 1 276 ? 32.920 -42.649 -17.415 1.00   36.29  ? 363  TRP A CA  1 
ATOM   2128 C C   . TRP A 1 276 ? 34.259 -43.006 -18.043 1.00   35.32  ? 363  TRP A C   1 
ATOM   2129 O O   . TRP A 1 276 ? 34.339 -43.094 -19.263 1.00   41.37  ? 363  TRP A O   1 
ATOM   2130 C CB  . TRP A 1 276 ? 32.954 -41.214 -16.847 1.00   35.06  ? 363  TRP A CB  1 
ATOM   2131 C CG  . TRP A 1 276 ? 33.476 -40.149 -17.763 1.00   35.57  ? 363  TRP A CG  1 
ATOM   2132 C CD1 . TRP A 1 276 ? 32.923 -39.721 -18.957 1.00   34.96  ? 363  TRP A CD1 1 
ATOM   2133 C CD2 . TRP A 1 276 ? 34.647 -39.355 -17.560 1.00   33.50  ? 363  TRP A CD2 1 
ATOM   2134 N NE1 . TRP A 1 276 ? 33.694 -38.717 -19.496 1.00   33.20  ? 363  TRP A NE1 1 
ATOM   2135 C CE2 . TRP A 1 276 ? 34.754 -38.468 -18.661 1.00   32.05  ? 363  TRP A CE2 1 
ATOM   2136 C CE3 . TRP A 1 276 ? 35.599 -39.277 -16.551 1.00   34.06  ? 363  TRP A CE3 1 
ATOM   2137 C CZ2 . TRP A 1 276 ? 35.785 -37.544 -18.779 1.00   29.42  ? 363  TRP A CZ2 1 
ATOM   2138 C CZ3 . TRP A 1 276 ? 36.636 -38.355 -16.675 1.00   37.60  ? 363  TRP A CZ3 1 
ATOM   2139 C CH2 . TRP A 1 276 ? 36.736 -37.517 -17.792 1.00   33.47  ? 363  TRP A CH2 1 
ATOM   2140 N N   . THR A 1 277 ? 35.283 -43.227 -17.224 1.00   34.25  ? 364  THR A N   1 
ATOM   2141 C CA  . THR A 1 277 ? 36.632 -43.448 -17.718 1.00   33.59  ? 364  THR A CA  1 
ATOM   2142 C C   . THR A 1 277 ? 36.705 -44.698 -18.559 1.00   34.76  ? 364  THR A C   1 
ATOM   2143 O O   . THR A 1 277 ? 37.249 -44.698 -19.646 1.00   35.60  ? 364  THR A O   1 
ATOM   2144 C CB  . THR A 1 277 ? 37.597 -43.533 -16.547 1.00   32.80  ? 364  THR A CB  1 
ATOM   2145 O OG1 . THR A 1 277 ? 37.642 -42.248 -15.910 1.00   34.22  ? 364  THR A OG1 1 
ATOM   2146 C CG2 . THR A 1 277 ? 39.022 -43.726 -17.042 1.00   32.84  ? 364  THR A CG2 1 
ATOM   2147 N N   . ILE A 1 278 ? 36.103 -45.766 -18.076 1.00   37.87  ? 365  ILE A N   1 
ATOM   2148 C CA  . ILE A 1 278 ? 36.069 -46.994 -18.865 1.00   41.27  ? 365  ILE A CA  1 
ATOM   2149 C C   . ILE A 1 278 ? 35.296 -46.817 -20.177 1.00   41.44  ? 365  ILE A C   1 
ATOM   2150 O O   . ILE A 1 278 ? 35.618 -47.456 -21.177 1.00   41.26  ? 365  ILE A O   1 
ATOM   2151 C CB  . ILE A 1 278 ? 35.408 -48.117 -18.057 1.00   39.52  ? 365  ILE A CB  1 
ATOM   2152 C CG1 . ILE A 1 278 ? 36.302 -48.499 -16.889 1.00   38.63  ? 365  ILE A CG1 1 
ATOM   2153 C CG2 . ILE A 1 278 ? 35.114 -49.317 -18.928 1.00   37.51  ? 365  ILE A CG2 1 
ATOM   2154 C CD1 . ILE A 1 278 ? 35.490 -49.039 -15.742 1.00   42.26  ? 365  ILE A CD1 1 
ATOM   2155 N N   . SER A 1 279 ? 34.258 -45.988 -20.166 1.00   42.39  ? 366  SER A N   1 
ATOM   2156 C CA  . SER A 1 279 ? 33.428 -45.804 -21.355 1.00   41.37  ? 366  SER A CA  1 
ATOM   2157 C C   . SER A 1 279 ? 34.249 -45.145 -22.454 1.00   38.19  ? 366  SER A C   1 
ATOM   2158 O O   . SER A 1 279 ? 34.041 -45.474 -23.624 1.00   34.39  ? 366  SER A O   1 
ATOM   2159 C CB  . SER A 1 279 ? 32.186 -44.981 -21.043 1.00   41.85  ? 366  SER A CB  1 
ATOM   2160 O OG  . SER A 1 279 ? 32.547 -43.609 -20.980 1.00   42.95  ? 366  SER A OG  1 
ATOM   2161 N N   . ASN A 1 280 ? 35.173 -44.256 -22.077 1.00   35.24  ? 367  ASN A N   1 
ATOM   2162 C CA  . ASN A 1 280 ? 36.066 -43.644 -23.052 1.00   33.54  ? 367  ASN A CA  1 
ATOM   2163 C C   . ASN A 1 280 ? 37.159 -44.576 -23.519 1.00   34.92  ? 367  ASN A C   1 
ATOM   2164 O O   . ASN A 1 280 ? 37.904 -44.220 -24.427 1.00   39.01  ? 367  ASN A O   1 
ATOM   2165 C CB  . ASN A 1 280 ? 36.702 -42.353 -22.564 1.00   35.08  ? 367  ASN A CB  1 
ATOM   2166 C CG  . ASN A 1 280 ? 35.780 -41.149 -22.695 1.00   39.33  ? 367  ASN A CG  1 
ATOM   2167 O OD1 . ASN A 1 280 ? 34.936 -41.068 -23.598 1.00   43.71  ? 367  ASN A OD1 1 
ATOM   2168 N ND2 . ASN A 1 280 ? 35.925 -40.209 -21.767 1.00   37.53  ? 367  ASN A ND2 1 
ATOM   2169 N N   . ILE A 1 281 ? 37.285 -45.745 -22.912 1.00   34.70  ? 368  ILE A N   1 
ATOM   2170 C CA  . ILE A 1 281 ? 38.264 -46.723 -23.386 1.00   37.82  ? 368  ILE A CA  1 
ATOM   2171 C C   . ILE A 1 281 ? 37.541 -47.698 -24.314 1.00   41.92  ? 368  ILE A C   1 
ATOM   2172 O O   . ILE A 1 281 ? 38.106 -48.126 -25.324 1.00   40.79  ? 368  ILE A O   1 
ATOM   2173 C CB  . ILE A 1 281 ? 39.025 -47.411 -22.193 1.00   37.34  ? 368  ILE A CB  1 
ATOM   2174 C CG1 . ILE A 1 281 ? 39.871 -46.377 -21.438 1.00   34.36  ? 368  ILE A CG1 1 
ATOM   2175 C CG2 . ILE A 1 281 ? 39.942 -48.533 -22.667 1.00   34.50  ? 368  ILE A CG2 1 
ATOM   2176 C CD1 . ILE A 1 281 ? 40.440 -46.879 -20.146 1.00   35.60  ? 368  ILE A CD1 1 
ATOM   2177 N N   . THR A 1 282 ? 36.284 -48.017 -24.009 1.00   43.27  ? 369  THR A N   1 
ATOM   2178 C CA  . THR A 1 282 ? 35.470 -48.846 -24.903 1.00   44.18  ? 369  THR A CA  1 
ATOM   2179 C C   . THR A 1 282 ? 34.995 -48.073 -26.138 1.00   43.14  ? 369  THR A C   1 
ATOM   2180 O O   . THR A 1 282 ? 34.388 -48.622 -27.075 1.00   42.59  ? 369  THR A O   1 
ATOM   2181 C CB  . THR A 1 282 ? 34.237 -49.430 -24.178 1.00   43.24  ? 369  THR A CB  1 
ATOM   2182 O OG1 . THR A 1 282 ? 33.375 -48.373 -23.722 1.00   42.90  ? 369  THR A OG1 1 
ATOM   2183 C CG2 . THR A 1 282 ? 34.674 -50.201 -22.935 1.00   41.56  ? 369  THR A CG2 1 
ATOM   2184 N N   . ALA A 1 283 ? 35.239 -46.773 -26.097 1.00   42.02  ? 370  ALA A N   1 
ATOM   2185 C CA  . ALA A 1 283 ? 35.023 -45.927 -27.257 1.00   44.33  ? 370  ALA A CA  1 
ATOM   2186 C C   . ALA A 1 283 ? 36.218 -46.008 -28.195 1.00   44.55  ? 370  ALA A C   1 
ATOM   2187 O O   . ALA A 1 283 ? 36.152 -45.497 -29.307 1.00   45.18  ? 370  ALA A O   1 
ATOM   2188 C CB  . ALA A 1 283 ? 34.808 -44.494 -26.826 1.00   44.79  ? 370  ALA A CB  1 
ATOM   2189 N N   . GLY A 1 284 ? 37.278 -46.661 -27.715 1.00   47.10  ? 371  GLY A N   1 
ATOM   2190 C CA  . GLY A 1 284 ? 38.566 -46.813 -28.369 1.00   46.17  ? 371  GLY A CA  1 
ATOM   2191 C C   . GLY A 1 284 ? 38.529 -47.932 -29.389 1.00   45.42  ? 371  GLY A C   1 
ATOM   2192 O O   . GLY A 1 284 ? 37.451 -48.368 -29.784 1.00   48.19  ? 371  GLY A O   1 
ATOM   2193 N N   . ASN A 1 285 ? 39.686 -48.410 -29.825 1.00   46.68  ? 372  ASN A N   1 
ATOM   2194 C CA  . ASN A 1 285 ? 39.699 -49.452 -30.866 1.00   49.67  ? 372  ASN A CA  1 
ATOM   2195 C C   . ASN A 1 285 ? 39.347 -50.814 -30.306 1.00   51.53  ? 372  ASN A C   1 
ATOM   2196 O O   . ASN A 1 285 ? 39.058 -50.943 -29.129 1.00   56.22  ? 372  ASN A O   1 
ATOM   2197 C CB  . ASN A 1 285 ? 41.027 -49.517 -31.623 1.00   46.26  ? 372  ASN A CB  1 
ATOM   2198 C CG  . ASN A 1 285 ? 42.196 -49.825 -30.710 1.00   44.61  ? 372  ASN A CG  1 
ATOM   2199 O OD1 . ASN A 1 285 ? 42.097 -50.689 -29.842 1.00   37.83  ? 372  ASN A OD1 1 
ATOM   2200 N ND2 . ASN A 1 285 ? 43.297 -49.098 -30.883 1.00   37.76  ? 372  ASN A ND2 1 
ATOM   2201 N N   . THR A 1 286 ? 39.333 -51.807 -31.181 1.00   56.16  ? 373  THR A N   1 
ATOM   2202 C CA  . THR A 1 286 ? 38.954 -53.181 -30.866 1.00   58.21  ? 373  THR A CA  1 
ATOM   2203 C C   . THR A 1 286 ? 39.890 -53.902 -29.884 1.00   56.43  ? 373  THR A C   1 
ATOM   2204 O O   . THR A 1 286 ? 39.422 -54.706 -29.081 1.00   54.68  ? 373  THR A O   1 
ATOM   2205 C CB  . THR A 1 286 ? 38.838 -53.971 -32.192 1.00   59.38  ? 373  THR A CB  1 
ATOM   2206 O OG1 . THR A 1 286 ? 37.761 -53.425 -32.965 1.00   59.96  ? 373  THR A OG1 1 
ATOM   2207 C CG2 . THR A 1 286 ? 38.399 -55.410 -31.938 1.00   62.90  ? 373  THR A CG2 1 
ATOM   2208 N N   . GLU A 1 287 ? 41.190 -53.638 -29.943 1.00   53.92  ? 374  GLU A N   1 
ATOM   2209 C CA  . GLU A 1 287 ? 42.108 -54.205 -28.958 1.00   54.65  ? 374  GLU A CA  1 
ATOM   2210 C C   . GLU A 1 287 ? 41.733 -53.722 -27.553 1.00   52.23  ? 374  GLU A C   1 
ATOM   2211 O O   . GLU A 1 287 ? 41.705 -54.497 -26.595 1.00   55.31  ? 374  GLU A O   1 
ATOM   2212 C CB  . GLU A 1 287 ? 43.565 -53.824 -29.267 1.00   58.73  ? 374  GLU A CB  1 
ATOM   2213 C CG  . GLU A 1 287 ? 44.077 -54.279 -30.629 1.00   64.49  ? 374  GLU A CG  1 
ATOM   2214 C CD  . GLU A 1 287 ? 44.329 -53.090 -31.563 1.00   73.88  ? 374  GLU A CD  1 
ATOM   2215 O OE1 . GLU A 1 287 ? 43.575 -52.875 -32.547 1.00   76.60  ? 374  GLU A OE1 1 
ATOM   2216 O OE2 . GLU A 1 287 ? 45.291 -52.326 -31.306 1.00   78.54  ? 374  GLU A OE2 1 
ATOM   2217 N N   . GLN A 1 288 ? 41.412 -52.439 -27.444 1.00   46.84  ? 375  GLN A N   1 
ATOM   2218 C CA  . GLN A 1 288 ? 41.131 -51.793 -26.178 1.00   42.45  ? 375  GLN A CA  1 
ATOM   2219 C C   . GLN A 1 288 ? 39.753 -52.266 -25.666 1.00   42.17  ? 375  GLN A C   1 
ATOM   2220 O O   . GLN A 1 288 ? 39.511 -52.488 -24.475 1.00   41.86  ? 375  GLN A O   1 
ATOM   2221 C CB  . GLN A 1 288 ? 41.243 -50.269 -26.363 1.00   40.96  ? 375  GLN A CB  1 
ATOM   2222 C CG  . GLN A 1 288 ? 42.661 -49.764 -26.699 1.00   36.44  ? 375  GLN A CG  1 
ATOM   2223 C CD  . GLN A 1 288 ? 42.673 -48.348 -27.287 1.00   40.93  ? 375  GLN A CD  1 
ATOM   2224 O OE1 . GLN A 1 288 ? 41.632 -47.907 -27.797 1.00   46.11  ? 375  GLN A OE1 1 
ATOM   2225 N NE2 . GLN A 1 288 ? 43.839 -47.659 -27.287 1.00   33.64  ? 375  GLN A NE2 1 
ATOM   2226 N N   . ILE A 1 289 ? 38.804 -52.483 -26.555 1.00   39.40  ? 376  ILE A N   1 
ATOM   2227 C CA  . ILE A 1 289 ? 37.547 -53.021 -26.033 1.00   40.52  ? 376  ILE A CA  1 
ATOM   2228 C C   . ILE A 1 289 ? 37.810 -54.406 -25.436 1.00   37.58  ? 376  ILE A C   1 
ATOM   2229 O O   . ILE A 1 289 ? 37.209 -54.799 -24.449 1.00   39.95  ? 376  ILE A O   1 
ATOM   2230 C CB  . ILE A 1 289 ? 36.468 -53.075 -27.110 1.00   37.63  ? 376  ILE A CB  1 
ATOM   2231 C CG1 . ILE A 1 289 ? 36.126 -51.662 -27.580 1.00   38.49  ? 376  ILE A CG1 1 
ATOM   2232 C CG2 . ILE A 1 289 ? 35.232 -53.750 -26.561 1.00   40.77  ? 376  ILE A CG2 1 
ATOM   2233 C CD1 . ILE A 1 289 ? 35.143 -51.629 -28.729 1.00   39.91  ? 376  ILE A CD1 1 
ATOM   2234 N N   . GLN A 1 290 ? 38.723 -55.146 -26.043 1.00   39.91  ? 377  GLN A N   1 
ATOM   2235 C CA  . GLN A 1 290 ? 39.052 -56.482 -25.576 1.00   41.01  ? 377  GLN A CA  1 
ATOM   2236 C C   . GLN A 1 290 ? 39.821 -56.402 -24.262 1.00   39.81  ? 377  GLN A C   1 
ATOM   2237 O O   . GLN A 1 290 ? 39.597 -57.220 -23.381 1.00   33.79  ? 377  GLN A O   1 
ATOM   2238 C CB  . GLN A 1 290 ? 39.847 -57.275 -26.627 1.00   43.49  ? 377  GLN A CB  1 
ATOM   2239 C CG  . GLN A 1 290 ? 40.126 -58.749 -26.247 1.00   40.61  ? 377  GLN A CG  1 
ATOM   2240 C CD  . GLN A 1 290 ? 38.873 -59.633 -26.263 1.00   40.96  ? 377  GLN A CD  1 
ATOM   2241 O OE1 . GLN A 1 290 ? 38.099 -59.595 -27.199 1.00   48.32  ? 377  GLN A OE1 1 
ATOM   2242 N NE2 . GLN A 1 290 ? 38.655 -60.396 -25.215 1.00   41.78  ? 377  GLN A NE2 1 
ATOM   2243 N N   . ALA A 1 291 ? 40.687 -55.398 -24.118 1.00   42.60  ? 378  ALA A N   1 
ATOM   2244 C CA  . ALA A 1 291 ? 41.447 -55.214 -22.868 1.00   41.59  ? 378  ALA A CA  1 
ATOM   2245 C C   . ALA A 1 291 ? 40.513 -55.007 -21.707 1.00   42.55  ? 378  ALA A C   1 
ATOM   2246 O O   . ALA A 1 291 ? 40.795 -55.562 -20.636 1.00   45.79  ? 378  ALA A O   1 
ATOM   2247 C CB  . ALA A 1 291 ? 42.422 -54.045 -22.940 1.00   39.51  ? 378  ALA A CB  1 
ATOM   2248 N N   . VAL A 1 292 ? 39.452 -54.211 -21.936 1.00   40.37  ? 379  VAL A N   1 
ATOM   2249 C CA  . VAL A 1 292 ? 38.390 -53.966 -20.948 1.00   38.92  ? 379  VAL A CA  1 
ATOM   2250 C C   . VAL A 1 292 ? 37.704 -55.252 -20.527 1.00   36.65  ? 379  VAL A C   1 
ATOM   2251 O O   . VAL A 1 292 ? 37.553 -55.527 -19.347 1.00   36.22  ? 379  VAL A O   1 
ATOM   2252 C CB  . VAL A 1 292 ? 37.327 -52.967 -21.452 1.00   35.79  ? 379  VAL A CB  1 
ATOM   2253 C CG1 . VAL A 1 292 ? 36.041 -53.083 -20.683 1.00   33.45  ? 379  VAL A CG1 1 
ATOM   2254 C CG2 . VAL A 1 292 ? 37.852 -51.543 -21.297 1.00   35.78  ? 379  VAL A CG2 1 
ATOM   2255 N N   . ILE A 1 293 ? 37.294 -56.041 -21.505 1.00   36.50  ? 380  ILE A N   1 
ATOM   2256 C CA  . ILE A 1 293 ? 36.732 -57.354 -21.231 1.00   39.53  ? 380  ILE A CA  1 
ATOM   2257 C C   . ILE A 1 293 ? 37.731 -58.268 -20.495 1.00   43.49  ? 380  ILE A C   1 
ATOM   2258 O O   . ILE A 1 293 ? 37.366 -58.881 -19.504 1.00   46.77  ? 380  ILE A O   1 
ATOM   2259 C CB  . ILE A 1 293 ? 36.299 -57.985 -22.549 1.00   42.81  ? 380  ILE A CB  1 
ATOM   2260 C CG1 . ILE A 1 293 ? 35.103 -57.207 -23.102 1.00   49.07  ? 380  ILE A CG1 1 
ATOM   2261 C CG2 . ILE A 1 293 ? 35.977 -59.458 -22.374 1.00   42.94  ? 380  ILE A CG2 1 
ATOM   2262 C CD1 . ILE A 1 293 ? 34.649 -57.669 -24.479 1.00   53.98  ? 380  ILE A CD1 1 
ATOM   2263 N N   . ASP A 1 294 ? 38.973 -58.390 -20.962 1.00   45.77  ? 381  ASP A N   1 
ATOM   2264 C CA  . ASP A 1 294 ? 39.997 -59.207 -20.283 1.00   48.70  ? 381  ASP A CA  1 
ATOM   2265 C C   . ASP A 1 294 ? 40.300 -58.794 -18.822 1.00   47.28  ? 381  ASP A C   1 
ATOM   2266 O O   . ASP A 1 294 ? 40.720 -59.634 -18.002 1.00   44.87  ? 381  ASP A O   1 
ATOM   2267 C CB  . ASP A 1 294 ? 41.324 -59.223 -21.066 1.00   50.77  ? 381  ASP A CB  1 
ATOM   2268 C CG  . ASP A 1 294 ? 41.183 -59.774 -22.478 1.00   54.43  ? 381  ASP A CG  1 
ATOM   2269 O OD1 . ASP A 1 294 ? 40.154 -60.419 -22.798 1.00   51.83  ? 381  ASP A OD1 1 
ATOM   2270 O OD2 . ASP A 1 294 ? 42.070 -59.558 -23.338 1.00   58.74  ? 381  ASP A OD2 1 
ATOM   2271 N N   . ALA A 1 295 ? 40.076 -57.518 -18.494 1.00   40.00  ? 382  ALA A N   1 
ATOM   2272 C CA  . ALA A 1 295 ? 40.250 -57.058 -17.120 1.00   34.38  ? 382  ALA A CA  1 
ATOM   2273 C C   . ALA A 1 295 ? 39.023 -57.321 -16.240 1.00   34.96  ? 382  ALA A C   1 
ATOM   2274 O O   . ALA A 1 295 ? 38.933 -56.814 -15.119 1.00   36.97  ? 382  ALA A O   1 
ATOM   2275 C CB  . ALA A 1 295 ? 40.591 -55.598 -17.091 1.00   32.88  ? 382  ALA A CB  1 
ATOM   2276 N N   . ASN A 1 296 ? 38.085 -58.131 -16.725 1.00   36.19  ? 383  ASN A N   1 
ATOM   2277 C CA  . ASN A 1 296 ? 36.866 -58.465 -15.968 1.00   38.92  ? 383  ASN A CA  1 
ATOM   2278 C C   . ASN A 1 296 ? 36.048 -57.225 -15.507 1.00   39.26  ? 383  ASN A C   1 
ATOM   2279 O O   . ASN A 1 296 ? 35.411 -57.215 -14.457 1.00   38.50  ? 383  ASN A O   1 
ATOM   2280 C CB  . ASN A 1 296 ? 37.195 -59.370 -14.772 1.00   37.50  ? 383  ASN A CB  1 
ATOM   2281 C CG  . ASN A 1 296 ? 37.984 -60.603 -15.156 1.00   40.09  ? 383  ASN A CG  1 
ATOM   2282 O OD1 . ASN A 1 296 ? 37.595 -61.338 -16.056 1.00   41.26  ? 383  ASN A OD1 1 
ATOM   2283 N ND2 . ASN A 1 296 ? 39.100 -60.841 -14.468 1.00   41.90  ? 383  ASN A ND2 1 
ATOM   2284 N N   . LEU A 1 297 ? 36.069 -56.163 -16.302 1.00   38.93  ? 384  LEU A N   1 
ATOM   2285 C CA  . LEU A 1 297 ? 35.302 -54.974 -15.983 1.00   36.93  ? 384  LEU A CA  1 
ATOM   2286 C C   . LEU A 1 297 ? 33.835 -55.089 -16.379 1.00   35.77  ? 384  LEU A C   1 
ATOM   2287 O O   . LEU A 1 297 ? 32.980 -54.448 -15.788 1.00   38.06  ? 384  LEU A O   1 
ATOM   2288 C CB  . LEU A 1 297 ? 35.925 -53.778 -16.676 1.00   35.90  ? 384  LEU A CB  1 
ATOM   2289 C CG  . LEU A 1 297 ? 37.253 -53.407 -16.009 1.00   37.51  ? 384  LEU A CG  1 
ATOM   2290 C CD1 . LEU A 1 297 ? 38.006 -52.314 -16.759 1.00   34.29  ? 384  LEU A CD1 1 
ATOM   2291 C CD2 . LEU A 1 297 ? 37.039 -52.953 -14.597 1.00   36.48  ? 384  LEU A CD2 1 
ATOM   2292 N N   . ILE A 1 298 ? 33.506 -55.911 -17.357 1.00   34.14  ? 385  ILE A N   1 
ATOM   2293 C CA  . ILE A 1 298 ? 32.108 -55.977 -17.731 1.00   37.01  ? 385  ILE A CA  1 
ATOM   2294 C C   . ILE A 1 298 ? 31.212 -56.368 -16.544 1.00   39.72  ? 385  ILE A C   1 
ATOM   2295 O O   . ILE A 1 298 ? 30.243 -55.670 -16.297 1.00   41.18  ? 385  ILE A O   1 
ATOM   2296 C CB  . ILE A 1 298 ? 31.878 -56.881 -18.952 1.00   34.97  ? 385  ILE A CB  1 
ATOM   2297 C CG1 . ILE A 1 298 ? 32.597 -56.325 -20.176 1.00   40.53  ? 385  ILE A CG1 1 
ATOM   2298 C CG2 . ILE A 1 298 ? 30.420 -56.964 -19.307 1.00   35.03  ? 385  ILE A CG2 1 
ATOM   2299 C CD1 . ILE A 1 298 ? 32.262 -54.877 -20.533 1.00   40.22  ? 385  ILE A CD1 1 
ATOM   2300 N N   . PRO A 1 299 ? 31.450 -57.469 -15.842 1.00   41.54  ? 386  PRO A N   1 
ATOM   2301 C CA  . PRO A 1 299 ? 30.537 -57.866 -14.757 1.00   44.54  ? 386  PRO A CA  1 
ATOM   2302 C C   . PRO A 1 299 ? 30.166 -56.797 -13.712 1.00   43.57  ? 386  PRO A C   1 
ATOM   2303 O O   . PRO A 1 299 ? 28.982 -56.616 -13.417 1.00   41.18  ? 386  PRO A O   1 
ATOM   2304 C CB  . PRO A 1 299 ? 31.228 -59.086 -14.136 1.00   44.99  ? 386  PRO A CB  1 
ATOM   2305 C CG  . PRO A 1 299 ? 31.961 -59.672 -15.307 1.00   47.35  ? 386  PRO A CG  1 
ATOM   2306 C CD  . PRO A 1 299 ? 32.497 -58.482 -16.060 1.00   44.90  ? 386  PRO A CD  1 
ATOM   2307 N N   . PRO A 1 300 ? 31.113 -56.096 -13.108 1.00   40.92  ? 387  PRO A N   1 
ATOM   2308 C CA  . PRO A 1 300 ? 30.697 -55.008 -12.220 1.00   41.40  ? 387  PRO A CA  1 
ATOM   2309 C C   . PRO A 1 300 ? 29.912 -53.899 -12.964 1.00   41.06  ? 387  PRO A C   1 
ATOM   2310 O O   . PRO A 1 300 ? 28.971 -53.319 -12.416 1.00   35.99  ? 387  PRO A O   1 
ATOM   2311 C CB  . PRO A 1 300 ? 32.020 -54.510 -11.619 1.00   38.09  ? 387  PRO A CB  1 
ATOM   2312 C CG  . PRO A 1 300 ? 33.035 -54.949 -12.566 1.00   43.06  ? 387  PRO A CG  1 
ATOM   2313 C CD  . PRO A 1 300 ? 32.570 -56.278 -13.105 1.00   41.68  ? 387  PRO A CD  1 
ATOM   2314 N N   . LEU A 1 301 ? 30.313 -53.597 -14.194 1.00   39.91  ? 388  LEU A N   1 
ATOM   2315 C CA  . LEU A 1 301 ? 29.653 -52.569 -14.985 1.00   39.00  ? 388  LEU A CA  1 
ATOM   2316 C C   . LEU A 1 301 ? 28.192 -52.907 -15.179 1.00   39.36  ? 388  LEU A C   1 
ATOM   2317 O O   . LEU A 1 301 ? 27.353 -52.029 -15.059 1.00   42.53  ? 388  LEU A O   1 
ATOM   2318 C CB  . LEU A 1 301 ? 30.311 -52.443 -16.358 1.00   42.22  ? 388  LEU A CB  1 
ATOM   2319 C CG  . LEU A 1 301 ? 31.177 -51.231 -16.677 1.00   38.38  ? 388  LEU A CG  1 
ATOM   2320 C CD1 . LEU A 1 301 ? 31.578 -50.542 -15.403 1.00   42.12  ? 388  LEU A CD1 1 
ATOM   2321 C CD2 . LEU A 1 301 ? 32.394 -51.620 -17.504 1.00   32.00  ? 388  LEU A CD2 1 
ATOM   2322 N N   . VAL A 1 302 ? 27.895 -54.169 -15.471 1.00   42.13  ? 389  VAL A N   1 
ATOM   2323 C CA  . VAL A 1 302 ? 26.529 -54.661 -15.660 1.00   42.99  ? 389  VAL A CA  1 
ATOM   2324 C C   . VAL A 1 302 ? 25.748 -54.587 -14.358 1.00   46.45  ? 389  VAL A C   1 
ATOM   2325 O O   . VAL A 1 302 ? 24.596 -54.185 -14.341 1.00   46.04  ? 389  VAL A O   1 
ATOM   2326 C CB  . VAL A 1 302 ? 26.523 -56.109 -16.183 1.00   42.10  ? 389  VAL A CB  1 
ATOM   2327 C CG1 . VAL A 1 302 ? 25.137 -56.760 -16.087 1.00   46.53  ? 389  VAL A CG1 1 
ATOM   2328 C CG2 . VAL A 1 302 ? 26.977 -56.142 -17.646 1.00   42.39  ? 389  VAL A CG2 1 
ATOM   2329 N N   . LYS A 1 303 ? 26.391 -54.985 -13.270 1.00   51.80  ? 390  LYS A N   1 
ATOM   2330 C CA  . LYS A 1 303 ? 25.807 -54.932 -11.937 1.00   52.62  ? 390  LYS A CA  1 
ATOM   2331 C C   . LYS A 1 303 ? 25.427 -53.502 -11.566 1.00   51.00  ? 390  LYS A C   1 
ATOM   2332 O O   . LYS A 1 303 ? 24.371 -53.277 -10.999 1.00   51.87  ? 390  LYS A O   1 
ATOM   2333 C CB  . LYS A 1 303 ? 26.786 -55.516 -10.912 1.00   55.06  ? 390  LYS A CB  1 
ATOM   2334 C CG  . LYS A 1 303 ? 26.267 -55.538 -9.481  1.00   59.39  ? 390  LYS A CG  1 
ATOM   2335 C CD  . LYS A 1 303 ? 25.783 -56.940 -9.085  1.00   65.02  ? 390  LYS A CD  1 
ATOM   2336 C CE  . LYS A 1 303 ? 26.939 -57.831 -8.569  1.00   68.20  ? 390  LYS A CE  1 
ATOM   2337 N NZ  . LYS A 1 303 ? 26.445 -58.916 -7.645  1.00   67.30  ? 390  LYS A NZ  1 
ATOM   2338 N N   . LEU A 1 304 ? 26.284 -52.537 -11.876 1.00   51.36  ? 391  LEU A N   1 
ATOM   2339 C CA  . LEU A 1 304 ? 25.997 -51.111 -11.649 1.00   48.94  ? 391  LEU A CA  1 
ATOM   2340 C C   . LEU A 1 304 ? 24.853 -50.620 -12.553 1.00   51.18  ? 391  LEU A C   1 
ATOM   2341 O O   . LEU A 1 304 ? 24.007 -49.824 -12.160 1.00   51.50  ? 391  LEU A O   1 
ATOM   2342 C CB  . LEU A 1 304 ? 27.231 -50.255 -11.930 1.00   45.24  ? 391  LEU A CB  1 
ATOM   2343 C CG  . LEU A 1 304 ? 28.398 -50.367 -10.948 1.00   46.19  ? 391  LEU A CG  1 
ATOM   2344 C CD1 . LEU A 1 304 ? 29.650 -49.669 -11.450 1.00   44.52  ? 391  LEU A CD1 1 
ATOM   2345 C CD2 . LEU A 1 304 ? 28.023 -49.777 -9.597  1.00   45.88  ? 391  LEU A CD2 1 
ATOM   2346 N N   . LEU A 1 305 ? 24.810 -51.108 -13.783 1.00   51.49  ? 392  LEU A N   1 
ATOM   2347 C CA  . LEU A 1 305 ? 23.726 -50.763 -14.683 1.00   50.98  ? 392  LEU A CA  1 
ATOM   2348 C C   . LEU A 1 305 ? 22.366 -51.151 -14.100 1.00   53.34  ? 392  LEU A C   1 
ATOM   2349 O O   . LEU A 1 305 ? 21.351 -50.525 -14.401 1.00   54.29  ? 392  LEU A O   1 
ATOM   2350 C CB  . LEU A 1 305 ? 23.938 -51.477 -16.022 1.00   51.88  ? 392  LEU A CB  1 
ATOM   2351 C CG  . LEU A 1 305 ? 23.082 -51.095 -17.232 1.00   49.35  ? 392  LEU A CG  1 
ATOM   2352 C CD1 . LEU A 1 305 ? 23.329 -49.613 -17.501 1.00   45.86  ? 392  LEU A CD1 1 
ATOM   2353 C CD2 . LEU A 1 305 ? 23.406 -51.927 -18.488 1.00   48.51  ? 392  LEU A CD2 1 
ATOM   2354 N N   . GLU A 1 306 ? 22.322 -52.178 -13.258 1.00   56.50  ? 393  GLU A N   1 
ATOM   2355 C CA  . GLU A 1 306 ? 21.039 -52.616 -12.702 1.00   57.02  ? 393  GLU A CA  1 
ATOM   2356 C C   . GLU A 1 306 ? 20.682 -52.006 -11.336 1.00   56.27  ? 393  GLU A C   1 
ATOM   2357 O O   . GLU A 1 306 ? 19.511 -51.746 -11.125 1.00   57.97  ? 393  GLU A O   1 
ATOM   2358 C CB  . GLU A 1 306 ? 20.865 -54.144 -12.715 1.00   57.48  ? 393  GLU A CB  1 
ATOM   2359 C CG  . GLU A 1 306 ? 22.070 -54.967 -12.324 1.00   65.73  ? 393  GLU A CG  1 
ATOM   2360 C CD  . GLU A 1 306 ? 21.847 -56.462 -12.470 1.00   71.70  ? 393  GLU A CD  1 
ATOM   2361 O OE1 . GLU A 1 306 ? 21.571 -56.939 -13.595 1.00   74.71  ? 393  GLU A OE1 1 
ATOM   2362 O OE2 . GLU A 1 306 ? 21.973 -57.172 -11.446 1.00   77.59  ? 393  GLU A OE2 1 
ATOM   2363 N N   . VAL A 1 307 ? 21.644 -51.690 -10.470 1.00   54.36  ? 394  VAL A N   1 
ATOM   2364 C CA  . VAL A 1 307 ? 21.362 -51.278 -9.098  1.00   53.66  ? 394  VAL A CA  1 
ATOM   2365 C C   . VAL A 1 307 ? 21.962 -49.967 -8.648  1.00   53.61  ? 394  VAL A C   1 
ATOM   2366 O O   . VAL A 1 307 ? 21.760 -49.556 -7.509  1.00   53.03  ? 394  VAL A O   1 
ATOM   2367 C CB  . VAL A 1 307 ? 21.910 -52.314 -8.079  1.00   54.59  ? 394  VAL A CB  1 
ATOM   2368 C CG1 . VAL A 1 307 ? 21.412 -53.722 -8.423  1.00   51.23  ? 394  VAL A CG1 1 
ATOM   2369 C CG2 . VAL A 1 307 ? 23.459 -52.251 -7.967  1.00   52.79  ? 394  VAL A CG2 1 
ATOM   2370 N N   . ALA A 1 308 ? 22.740 -49.325 -9.502  1.00   55.92  ? 395  ALA A N   1 
ATOM   2371 C CA  . ALA A 1 308 ? 23.466 -48.126 -9.082  1.00   56.75  ? 395  ALA A CA  1 
ATOM   2372 C C   . ALA A 1 308 ? 22.551 -46.923 -9.130  1.00   54.67  ? 395  ALA A C   1 
ATOM   2373 O O   . ALA A 1 308 ? 21.471 -47.002 -9.671  1.00   52.99  ? 395  ALA A O   1 
ATOM   2374 C CB  . ALA A 1 308 ? 24.688 -47.882 -9.969  1.00   57.92  ? 395  ALA A CB  1 
ATOM   2375 N N   . GLU A 1 309 ? 22.980 -45.810 -8.555  1.00   56.16  ? 396  GLU A N   1 
ATOM   2376 C CA  . GLU A 1 309 ? 22.237 -44.563 -8.696  1.00   58.84  ? 396  GLU A CA  1 
ATOM   2377 C C   . GLU A 1 309 ? 22.190 -44.153 -10.173 1.00   58.14  ? 396  GLU A C   1 
ATOM   2378 O O   . GLU A 1 309 ? 23.107 -44.437 -10.939 1.00   59.60  ? 396  GLU A O   1 
ATOM   2379 C CB  . GLU A 1 309 ? 22.891 -43.434 -7.890  1.00   61.98  ? 396  GLU A CB  1 
ATOM   2380 C CG  . GLU A 1 309 ? 22.573 -43.427 -6.398  1.00   64.87  ? 396  GLU A CG  1 
ATOM   2381 C CD  . GLU A 1 309 ? 23.351 -42.354 -5.619  1.00   69.87  ? 396  GLU A CD  1 
ATOM   2382 O OE1 . GLU A 1 309 ? 23.738 -41.294 -6.164  1.00   71.15  ? 396  GLU A OE1 1 
ATOM   2383 O OE2 . GLU A 1 309 ? 23.633 -42.564 -4.423  1.00   75.32  ? 396  GLU A OE2 1 
ATOM   2384 N N   . ASP A 1 310 ? 21.132 -43.451 -10.558 1.00   56.22  ? 397  ASP A N   1 
ATOM   2385 C CA  . ASP A 1 310 ? 20.916 -43.028 -11.945 1.00   55.34  ? 397  ASP A CA  1 
ATOM   2386 C C   . ASP A 1 310 ? 22.082 -42.414 -12.713 1.00   52.80  ? 397  ASP A C   1 
ATOM   2387 O O   . ASP A 1 310 ? 22.362 -42.806 -13.841 1.00   48.92  ? 397  ASP A O   1 
ATOM   2388 C CB  . ASP A 1 310 ? 19.708 -42.100 -12.023 1.00   55.28  ? 397  ASP A CB  1 
ATOM   2389 C CG  . ASP A 1 310 ? 18.405 -42.864 -12.037 1.00   59.24  ? 397  ASP A CG  1 
ATOM   2390 O OD1 . ASP A 1 310 ? 18.398 -44.063 -11.673 1.00   63.12  ? 397  ASP A OD1 1 
ATOM   2391 O OD2 . ASP A 1 310 ? 17.332 -42.357 -12.412 1.00   63.02  ? 397  ASP A OD2 1 
ATOM   2392 N N   . LYS A 1 311 ? 22.771 -41.461 -12.102 1.00   55.79  ? 398  LYS A N   1 
ATOM   2393 C CA  . LYS A 1 311 ? 23.957 -40.852 -12.722 1.00   57.10  ? 398  LYS A CA  1 
ATOM   2394 C C   . LYS A 1 311 ? 25.034 -41.914 -13.069 1.00   49.98  ? 398  LYS A C   1 
ATOM   2395 O O   . LYS A 1 311 ? 25.668 -41.819 -14.117 1.00   42.42  ? 398  LYS A O   1 
ATOM   2396 C CB  . LYS A 1 311 ? 24.522 -39.730 -11.820 1.00   61.45  ? 398  LYS A CB  1 
ATOM   2397 C CG  . LYS A 1 311 ? 25.046 -40.227 -10.426 1.00   72.43  ? 398  LYS A CG  1 
ATOM   2398 C CD  . LYS A 1 311 ? 25.521 -39.105 -9.480  1.00   77.76  ? 398  LYS A CD  1 
ATOM   2399 C CE  . LYS A 1 311 ? 25.762 -39.574 -8.029  1.00   81.22  ? 398  LYS A CE  1 
ATOM   2400 N NZ  . LYS A 1 311 ? 26.098 -38.451 -7.077  1.00   83.92  ? 398  LYS A NZ  1 
ATOM   2401 N N   . THR A 1 312 ? 25.211 -42.911 -12.194 1.00   45.95  ? 399  THR A N   1 
ATOM   2402 C CA  . THR A 1 312 ? 26.199 -43.977 -12.357 1.00   44.32  ? 399  THR A CA  1 
ATOM   2403 C C   . THR A 1 312 ? 25.778 -44.961 -13.441 1.00   44.54  ? 399  THR A C   1 
ATOM   2404 O O   . THR A 1 312 ? 26.630 -45.373 -14.251 1.00   41.97  ? 399  THR A O   1 
ATOM   2405 C CB  . THR A 1 312 ? 26.403 -44.737 -11.039 1.00   43.86  ? 399  THR A CB  1 
ATOM   2406 O OG1 . THR A 1 312 ? 26.835 -43.838 -10.010 1.00   44.87  ? 399  THR A OG1 1 
ATOM   2407 C CG2 . THR A 1 312 ? 27.524 -45.766 -11.179 1.00   45.53  ? 399  THR A CG2 1 
ATOM   2408 N N   . LYS A 1 313 ? 24.495 -45.346 -13.420 1.00   41.37  ? 400  LYS A N   1 
ATOM   2409 C CA  . LYS A 1 313 ? 23.896 -46.176 -14.458 1.00   41.60  ? 400  LYS A CA  1 
ATOM   2410 C C   . LYS A 1 313 ? 24.110 -45.580 -15.851 1.00   41.84  ? 400  LYS A C   1 
ATOM   2411 O O   . LYS A 1 313 ? 24.397 -46.303 -16.777 1.00   39.70  ? 400  LYS A O   1 
ATOM   2412 C CB  . LYS A 1 313 ? 22.380 -46.277 -14.282 1.00   44.91  ? 400  LYS A CB  1 
ATOM   2413 C CG  . LYS A 1 313 ? 21.894 -47.120 -13.123 1.00   46.34  ? 400  LYS A CG  1 
ATOM   2414 C CD  . LYS A 1 313 ? 20.429 -47.442 -13.285 1.00   46.50  ? 400  LYS A CD  1 
ATOM   2415 C CE  . LYS A 1 313 ? 19.881 -48.268 -12.141 1.00   47.34  ? 400  LYS A CE  1 
ATOM   2416 N NZ  . LYS A 1 313 ? 18.472 -48.610 -12.403 1.00   50.42  ? 400  LYS A NZ  1 
ATOM   2417 N N   . LYS A 1 314 ? 23.961 -44.272 -16.028 1.00   43.77  ? 401  LYS A N   1 
ATOM   2418 C CA  . LYS A 1 314 ? 24.059 -43.678 -17.356 1.00   44.32  ? 401  LYS A CA  1 
ATOM   2419 C C   . LYS A 1 314 ? 25.463 -43.885 -17.844 1.00   45.55  ? 401  LYS A C   1 
ATOM   2420 O O   . LYS A 1 314 ? 25.695 -44.378 -18.940 1.00   49.06  ? 401  LYS A O   1 
ATOM   2421 C CB  . LYS A 1 314 ? 23.767 -42.180 -17.348 1.00   44.53  ? 401  LYS A CB  1 
ATOM   2422 C CG  . LYS A 1 314 ? 22.335 -41.805 -17.022 1.00   44.53  ? 401  LYS A CG  1 
ATOM   2423 C CD  . LYS A 1 314 ? 22.181 -40.286 -16.926 1.00   45.91  ? 401  LYS A CD  1 
ATOM   2424 C CE  . LYS A 1 314 ? 20.738 -39.842 -16.663 1.00   48.56  ? 401  LYS A CE  1 
ATOM   2425 N NZ  . LYS A 1 314 ? 20.702 -38.334 -16.509 1.00   47.56  ? 401  LYS A NZ  1 
ATOM   2426 N N   . GLU A 1 315 ? 26.414 -43.526 -17.003 1.00   46.80  ? 402  GLU A N   1 
ATOM   2427 C CA  . GLU A 1 315 ? 27.819 -43.745 -17.324 1.00   46.08  ? 402  GLU A CA  1 
ATOM   2428 C C   . GLU A 1 315 ? 28.181 -45.211 -17.620 1.00   44.62  ? 402  GLU A C   1 
ATOM   2429 O O   . GLU A 1 315 ? 28.980 -45.497 -18.493 1.00   44.98  ? 402  GLU A O   1 
ATOM   2430 C CB  . GLU A 1 315 ? 28.637 -43.214 -16.169 1.00   46.07  ? 402  GLU A CB  1 
ATOM   2431 C CG  . GLU A 1 315 ? 29.699 -42.219 -16.586 1.00   50.91  ? 402  GLU A CG  1 
ATOM   2432 C CD  . GLU A 1 315 ? 29.234 -41.087 -17.485 1.00   52.39  ? 402  GLU A CD  1 
ATOM   2433 O OE1 . GLU A 1 315 ? 28.461 -40.228 -17.054 1.00   59.20  ? 402  GLU A OE1 1 
ATOM   2434 O OE2 . GLU A 1 315 ? 29.676 -40.997 -18.636 1.00   56.10  ? 402  GLU A OE2 1 
ATOM   2435 N N   . ALA A 1 316 ? 27.580 -46.148 -16.908 1.00   44.94  ? 403  ALA A N   1 
ATOM   2436 C CA  . ALA A 1 316 ? 27.836 -47.561 -17.133 1.00   46.18  ? 403  ALA A CA  1 
ATOM   2437 C C   . ALA A 1 316 ? 27.257 -48.023 -18.461 1.00   47.04  ? 403  ALA A C   1 
ATOM   2438 O O   . ALA A 1 316 ? 27.846 -48.849 -19.154 1.00   50.95  ? 403  ALA A O   1 
ATOM   2439 C CB  . ALA A 1 316 ? 27.264 -48.386 -15.981 1.00   45.07  ? 403  ALA A CB  1 
ATOM   2440 N N   . CYS A 1 317 ? 26.098 -47.481 -18.802 1.00   46.07  ? 404  CYS A N   1 
ATOM   2441 C CA  . CYS A 1 317 ? 25.389 -47.758 -20.047 1.00   42.99  ? 404  CYS A CA  1 
ATOM   2442 C C   . CYS A 1 317 ? 26.265 -47.288 -21.223 1.00   41.03  ? 404  CYS A C   1 
ATOM   2443 O O   . CYS A 1 317 ? 26.386 -47.953 -22.247 1.00   34.99  ? 404  CYS A O   1 
ATOM   2444 C CB  . CYS A 1 317 ? 24.060 -46.999 -19.989 1.00   42.96  ? 404  CYS A CB  1 
ATOM   2445 S SG  . CYS A 1 317 ? 23.030 -47.000 -21.451 1.00   52.30  ? 404  CYS A SG  1 
ATOM   2446 N N   . TRP A 1 318 ? 26.922 -46.149 -21.070 1.00   41.11  ? 405  TRP A N   1 
ATOM   2447 C CA  . TRP A 1 318 ? 27.842 -45.696 -22.110 1.00   43.20  ? 405  TRP A CA  1 
ATOM   2448 C C   . TRP A 1 318 ? 28.979 -46.672 -22.311 1.00   43.79  ? 405  TRP A C   1 
ATOM   2449 O O   . TRP A 1 318 ? 29.456 -46.871 -23.429 1.00   40.27  ? 405  TRP A O   1 
ATOM   2450 C CB  . TRP A 1 318 ? 28.444 -44.324 -21.780 1.00   44.81  ? 405  TRP A CB  1 
ATOM   2451 C CG  . TRP A 1 318 ? 27.598 -43.149 -22.207 1.00   48.11  ? 405  TRP A CG  1 
ATOM   2452 C CD1 . TRP A 1 318 ? 26.768 -42.407 -21.415 1.00   48.84  ? 405  TRP A CD1 1 
ATOM   2453 C CD2 . TRP A 1 318 ? 27.494 -42.596 -23.524 1.00   50.69  ? 405  TRP A CD2 1 
ATOM   2454 N NE1 . TRP A 1 318 ? 26.163 -41.419 -22.153 1.00   51.82  ? 405  TRP A NE1 1 
ATOM   2455 C CE2 . TRP A 1 318 ? 26.599 -41.505 -23.448 1.00   51.56  ? 405  TRP A CE2 1 
ATOM   2456 C CE3 . TRP A 1 318 ? 28.101 -42.885 -24.758 1.00   49.45  ? 405  TRP A CE3 1 
ATOM   2457 C CZ2 . TRP A 1 318 ? 26.279 -40.723 -24.554 1.00   51.61  ? 405  TRP A CZ2 1 
ATOM   2458 C CZ3 . TRP A 1 318 ? 27.794 -42.101 -25.857 1.00   51.01  ? 405  TRP A CZ3 1 
ATOM   2459 C CH2 . TRP A 1 318 ? 26.880 -41.036 -25.749 1.00   52.03  ? 405  TRP A CH2 1 
ATOM   2460 N N   . ALA A 1 319 ? 29.457 -47.214 -21.195 1.00   45.76  ? 406  ALA A N   1 
ATOM   2461 C CA  . ALA A 1 319 ? 30.605 -48.100 -21.219 1.00   46.30  ? 406  ALA A CA  1 
ATOM   2462 C C   . ALA A 1 319 ? 30.236 -49.379 -21.940 1.00   44.01  ? 406  ALA A C   1 
ATOM   2463 O O   . ALA A 1 319 ? 31.012 -49.864 -22.754 1.00   45.91  ? 406  ALA A O   1 
ATOM   2464 C CB  . ALA A 1 319 ? 31.091 -48.396 -19.806 1.00   47.08  ? 406  ALA A CB  1 
ATOM   2465 N N   . ILE A 1 320 ? 29.041 -49.886 -21.672 1.00   40.44  ? 407  ILE A N   1 
ATOM   2466 C CA  . ILE A 1 320 ? 28.592 -51.129 -22.276 1.00   42.60  ? 407  ILE A CA  1 
ATOM   2467 C C   . ILE A 1 320 ? 28.150 -50.954 -23.724 1.00   46.97  ? 407  ILE A C   1 
ATOM   2468 O O   . ILE A 1 320 ? 28.454 -51.788 -24.591 1.00   50.57  ? 407  ILE A O   1 
ATOM   2469 C CB  . ILE A 1 320 ? 27.478 -51.758 -21.434 1.00   41.05  ? 407  ILE A CB  1 
ATOM   2470 C CG1 . ILE A 1 320 ? 28.127 -52.416 -20.213 1.00   42.93  ? 407  ILE A CG1 1 
ATOM   2471 C CG2 . ILE A 1 320 ? 26.684 -52.761 -22.267 1.00   37.50  ? 407  ILE A CG2 1 
ATOM   2472 C CD1 . ILE A 1 320 ? 27.214 -52.532 -19.050 1.00   46.37  ? 407  ILE A CD1 1 
ATOM   2473 N N   . SER A 1 321 ? 27.452 -49.856 -23.981 1.00   46.28  ? 408  SER A N   1 
ATOM   2474 C CA  . SER A 1 321 ? 27.024 -49.526 -25.327 1.00   45.48  ? 408  SER A CA  1 
ATOM   2475 C C   . SER A 1 321 ? 28.219 -49.260 -26.228 1.00   44.27  ? 408  SER A C   1 
ATOM   2476 O O   . SER A 1 321 ? 28.329 -49.858 -27.303 1.00   46.45  ? 408  SER A O   1 
ATOM   2477 C CB  . SER A 1 321 ? 26.073 -48.334 -25.305 1.00   49.02  ? 408  SER A CB  1 
ATOM   2478 O OG  . SER A 1 321 ? 25.544 -48.088 -26.593 1.00   53.17  ? 408  SER A OG  1 
ATOM   2479 N N   . ASN A 1 322 ? 29.128 -48.377 -25.833 1.00   46.12  ? 409  ASN A N   1 
ATOM   2480 C CA  . ASN A 1 322 ? 30.332 -48.130 -26.650 1.00   46.50  ? 409  ASN A CA  1 
ATOM   2481 C C   . ASN A 1 322 ? 31.055 -49.419 -27.001 1.00   49.91  ? 409  ASN A C   1 
ATOM   2482 O O   . ASN A 1 322 ? 31.767 -49.481 -28.004 1.00   54.07  ? 409  ASN A O   1 
ATOM   2483 C CB  . ASN A 1 322 ? 31.368 -47.272 -25.914 1.00   46.61  ? 409  ASN A CB  1 
ATOM   2484 C CG  . ASN A 1 322 ? 30.927 -45.841 -25.698 1.00   42.92  ? 409  ASN A CG  1 
ATOM   2485 O OD1 . ASN A 1 322 ? 29.880 -45.421 -26.189 1.00   43.75  ? 409  ASN A OD1 1 
ATOM   2486 N ND2 . ASN A 1 322 ? 31.736 -45.080 -24.970 1.00   38.52  ? 409  ASN A ND2 1 
ATOM   2487 N N   . ALA A 1 323 ? 30.946 -50.411 -26.118 1.00   51.64  ? 410  ALA A N   1 
ATOM   2488 C CA  . ALA A 1 323 ? 31.651 -51.673 -26.289 1.00   54.03  ? 410  ALA A CA  1 
ATOM   2489 C C   . ALA A 1 323 ? 31.030 -52.565 -27.367 1.00   54.71  ? 410  ALA A C   1 
ATOM   2490 O O   . ALA A 1 323 ? 31.703 -53.370 -28.017 1.00   58.69  ? 410  ALA A O   1 
ATOM   2491 C CB  . ALA A 1 323 ? 31.715 -52.404 -24.969 1.00   51.70  ? 410  ALA A CB  1 
ATOM   2492 N N   . SER A 1 324 ? 29.729 -52.414 -27.547 1.00   54.61  ? 411  SER A N   1 
ATOM   2493 C CA  . SER A 1 324 ? 28.989 -53.131 -28.581 1.00   52.84  ? 411  SER A CA  1 
ATOM   2494 C C   . SER A 1 324 ? 29.238 -52.592 -29.996 1.00   54.02  ? 411  SER A C   1 
ATOM   2495 O O   . SER A 1 324 ? 28.748 -53.200 -30.936 1.00   50.66  ? 411  SER A O   1 
ATOM   2496 C CB  . SER A 1 324 ? 27.500 -53.069 -28.240 1.00   53.49  ? 411  SER A CB  1 
ATOM   2497 O OG  . SER A 1 324 ? 27.004 -51.744 -28.400 1.00   52.22  ? 411  SER A OG  1 
ATOM   2498 N N   . SER A 1 325 ? 29.962 -51.473 -30.137 1.00   58.56  ? 412  SER A N   1 
ATOM   2499 C CA  . SER A 1 325 ? 30.355 -50.885 -31.424 1.00   62.59  ? 412  SER A CA  1 
ATOM   2500 C C   . SER A 1 325 ? 31.222 -51.851 -32.171 1.00   66.56  ? 412  SER A C   1 
ATOM   2501 O O   . SER A 1 325 ? 31.025 -52.085 -33.363 1.00   62.75  ? 412  SER A O   1 
ATOM   2502 C CB  . SER A 1 325 ? 31.241 -49.654 -31.249 1.00   62.03  ? 412  SER A CB  1 
ATOM   2503 O OG  . SER A 1 325 ? 30.510 -48.598 -30.685 1.00   71.69  ? 412  SER A OG  1 
ATOM   2504 N N   . GLY A 1 326 ? 32.198 -52.360 -31.418 1.00   74.62  ? 413  GLY A N   1 
ATOM   2505 C CA  . GLY A 1 326 ? 33.207 -53.288 -31.893 1.00   79.94  ? 413  GLY A CA  1 
ATOM   2506 C C   . GLY A 1 326 ? 32.659 -54.680 -32.152 1.00   83.39  ? 413  GLY A C   1 
ATOM   2507 O O   . GLY A 1 326 ? 33.381 -55.513 -32.697 1.00   86.90  ? 413  GLY A O   1 
ATOM   2508 N N   . GLY A 1 327 ? 31.412 -54.931 -31.749 1.00   84.95  ? 414  GLY A N   1 
ATOM   2509 C CA  . GLY A 1 327 ? 30.699 -56.171 -32.034 1.00   85.10  ? 414  GLY A CA  1 
ATOM   2510 C C   . GLY A 1 327 ? 30.362 -56.476 -33.491 1.00   86.22  ? 414  GLY A C   1 
ATOM   2511 O O   . GLY A 1 327 ? 30.012 -57.599 -33.856 1.00   84.76  ? 414  GLY A O   1 
ATOM   2512 N N   . LEU A 1 328 ? 30.466 -55.478 -34.356 1.00   87.91  ? 415  LEU A N   1 
ATOM   2513 C CA  . LEU A 1 328 ? 30.164 -55.691 -35.769 1.00   89.77  ? 415  LEU A CA  1 
ATOM   2514 C C   . LEU A 1 328 ? 31.398 -56.293 -36.470 1.00   88.02  ? 415  LEU A C   1 
ATOM   2515 O O   . LEU A 1 328 ? 31.257 -57.056 -37.424 1.00   85.27  ? 415  LEU A O   1 
ATOM   2516 C CB  . LEU A 1 328 ? 29.597 -54.389 -36.384 1.00   91.58  ? 415  LEU A CB  1 
ATOM   2517 C CG  . LEU A 1 328 ? 28.499 -53.742 -35.491 1.00   91.52  ? 415  LEU A CG  1 
ATOM   2518 C CD1 . LEU A 1 328 ? 27.943 -52.372 -35.964 1.00   89.02  ? 415  LEU A CD1 1 
ATOM   2519 C CD2 . LEU A 1 328 ? 27.341 -54.717 -35.215 1.00   89.71  ? 415  LEU A CD2 1 
ATOM   2520 N N   . GLN A 1 329 ? 32.592 -55.991 -35.951 1.00   87.26  ? 416  GLN A N   1 
ATOM   2521 C CA  . GLN A 1 329 ? 33.866 -56.540 -36.448 1.00   86.17  ? 416  GLN A CA  1 
ATOM   2522 C C   . GLN A 1 329 ? 34.440 -57.651 -35.549 1.00   82.42  ? 416  GLN A C   1 
ATOM   2523 O O   . GLN A 1 329 ? 35.331 -58.371 -35.966 1.00   80.27  ? 416  GLN A O   1 
ATOM   2524 C CB  . GLN A 1 329 ? 34.957 -55.460 -36.630 1.00   87.28  ? 416  GLN A CB  1 
ATOM   2525 C CG  . GLN A 1 329 ? 34.513 -54.036 -36.983 1.00   88.56  ? 416  GLN A CG  1 
ATOM   2526 C CD  . GLN A 1 329 ? 35.191 -53.011 -36.098 1.00   90.08  ? 416  GLN A CD  1 
ATOM   2527 O OE1 . GLN A 1 329 ? 36.413 -53.042 -35.939 1.00   90.86  ? 416  GLN A OE1 1 
ATOM   2528 N NE2 . GLN A 1 329 ? 34.405 -52.121 -35.502 1.00   91.65  ? 416  GLN A NE2 1 
ATOM   2529 N N   . ARG A 1 330 ? 34.015 -57.742 -34.294 1.00   80.94  ? 417  ARG A N   1 
ATOM   2530 C CA  . ARG A 1 330 ? 34.367 -58.868 -33.427 1.00   79.98  ? 417  ARG A CA  1 
ATOM   2531 C C   . ARG A 1 330 ? 33.092 -59.242 -32.681 1.00   77.68  ? 417  ARG A C   1 
ATOM   2532 O O   . ARG A 1 330 ? 32.775 -58.650 -31.645 1.00   76.43  ? 417  ARG A O   1 
ATOM   2533 C CB  . ARG A 1 330 ? 35.517 -58.608 -32.439 1.00   80.91  ? 417  ARG A CB  1 
ATOM   2534 C CG  . ARG A 1 330 ? 35.968 -59.898 -31.703 1.00   81.78  ? 417  ARG A CG  1 
ATOM   2535 C CD  . ARG A 1 330 ? 37.118 -59.733 -30.709 1.00   81.91  ? 417  ARG A CD  1 
ATOM   2536 N NE  . ARG A 1 330 ? 38.361 -59.310 -31.354 1.00   81.49  ? 417  ARG A NE  1 
ATOM   2537 C CZ  . ARG A 1 330 ? 39.478 -58.986 -30.706 1.00   83.48  ? 417  ARG A CZ  1 
ATOM   2538 N NH1 . ARG A 1 330 ? 39.522 -59.043 -29.386 1.00   83.87  ? 417  ARG A NH1 1 
ATOM   2539 N NH2 . ARG A 1 330 ? 40.565 -58.594 -31.362 1.00   84.08  ? 417  ARG A NH2 1 
ATOM   2540 N N   . PRO A 1 331 ? 32.353 -60.192 -33.250 1.00   75.77  ? 418  PRO A N   1 
ATOM   2541 C CA  . PRO A 1 331 ? 31.117 -60.701 -32.653 1.00   74.69  ? 418  PRO A CA  1 
ATOM   2542 C C   . PRO A 1 331 ? 31.290 -61.414 -31.312 1.00   74.18  ? 418  PRO A C   1 
ATOM   2543 O O   . PRO A 1 331 ? 30.304 -61.613 -30.607 1.00   76.91  ? 418  PRO A O   1 
ATOM   2544 C CB  . PRO A 1 331 ? 30.596 -61.672 -33.716 1.00   74.71  ? 418  PRO A CB  1 
ATOM   2545 C CG  . PRO A 1 331 ? 31.781 -62.065 -34.477 1.00   75.68  ? 418  PRO A CG  1 
ATOM   2546 C CD  . PRO A 1 331 ? 32.609 -60.829 -34.554 1.00   76.42  ? 418  PRO A CD  1 
ATOM   2547 N N   . ASP A 1 332 ? 32.501 -61.812 -30.948 1.00   74.57  ? 419  ASP A N   1 
ATOM   2548 C CA  . ASP A 1 332 ? 32.734 -62.413 -29.626 1.00   74.24  ? 419  ASP A CA  1 
ATOM   2549 C C   . ASP A 1 332 ? 32.369 -61.443 -28.504 1.00   67.49  ? 419  ASP A C   1 
ATOM   2550 O O   . ASP A 1 332 ? 31.916 -61.847 -27.437 1.00   61.50  ? 419  ASP A O   1 
ATOM   2551 C CB  . ASP A 1 332 ? 34.214 -62.795 -29.447 1.00   79.88  ? 419  ASP A CB  1 
ATOM   2552 C CG  . ASP A 1 332 ? 34.686 -63.862 -30.427 1.00   86.24  ? 419  ASP A CG  1 
ATOM   2553 O OD1 . ASP A 1 332 ? 35.133 -63.493 -31.545 1.00   91.53  ? 419  ASP A OD1 1 
ATOM   2554 O OD2 . ASP A 1 332 ? 34.653 -65.084 -30.147 1.00   89.09  ? 419  ASP A OD2 1 
ATOM   2555 N N   . ILE A 1 333 ? 32.602 -60.157 -28.758 1.00   64.65  ? 420  ILE A N   1 
ATOM   2556 C CA  . ILE A 1 333 ? 32.364 -59.113 -27.774 1.00   61.32  ? 420  ILE A CA  1 
ATOM   2557 C C   . ILE A 1 333 ? 30.877 -59.064 -27.429 1.00   58.42  ? 420  ILE A C   1 
ATOM   2558 O O   . ILE A 1 333 ? 30.523 -59.225 -26.263 1.00   52.63  ? 420  ILE A O   1 
ATOM   2559 C CB  . ILE A 1 333 ? 32.898 -57.766 -28.283 1.00   61.47  ? 420  ILE A CB  1 
ATOM   2560 C CG1 . ILE A 1 333 ? 34.424 -57.811 -28.367 1.00   62.73  ? 420  ILE A CG1 1 
ATOM   2561 C CG2 . ILE A 1 333 ? 32.506 -56.626 -27.352 1.00   62.60  ? 420  ILE A CG2 1 
ATOM   2562 C CD1 . ILE A 1 333 ? 35.005 -56.713 -29.248 1.00   64.99  ? 420  ILE A CD1 1 
ATOM   2563 N N   . ILE A 1 334 ? 30.022 -58.904 -28.438 1.00   56.86  ? 421  ILE A N   1 
ATOM   2564 C CA  . ILE A 1 334 ? 28.580 -58.872 -28.217 1.00   54.68  ? 421  ILE A CA  1 
ATOM   2565 C C   . ILE A 1 334 ? 28.123 -60.113 -27.511 1.00   53.87  ? 421  ILE A C   1 
ATOM   2566 O O   . ILE A 1 334 ? 27.303 -60.005 -26.623 1.00   54.68  ? 421  ILE A O   1 
ATOM   2567 C CB  . ILE A 1 334 ? 27.749 -58.792 -29.511 1.00   54.08  ? 421  ILE A CB  1 
ATOM   2568 C CG1 . ILE A 1 334 ? 27.951 -57.450 -30.200 1.00   56.93  ? 421  ILE A CG1 1 
ATOM   2569 C CG2 . ILE A 1 334 ? 26.274 -58.983 -29.195 1.00   53.18  ? 421  ILE A CG2 1 
ATOM   2570 C CD1 . ILE A 1 334 ? 27.371 -56.274 -29.438 1.00   59.41  ? 421  ILE A CD1 1 
ATOM   2571 N N   . ARG A 1 335 ? 28.589 -61.280 -27.951 1.00   56.44  ? 422  ARG A N   1 
ATOM   2572 C CA  . ARG A 1 335 ? 28.190 -62.562 -27.353 1.00   55.98  ? 422  ARG A CA  1 
ATOM   2573 C C   . ARG A 1 335 ? 28.474 -62.612 -25.860 1.00   54.27  ? 422  ARG A C   1 
ATOM   2574 O O   . ARG A 1 335 ? 27.685 -63.129 -25.077 1.00   52.91  ? 422  ARG A O   1 
ATOM   2575 C CB  . ARG A 1 335 ? 28.970 -63.707 -27.983 1.00   59.53  ? 422  ARG A CB  1 
ATOM   2576 C CG  . ARG A 1 335 ? 28.588 -64.051 -29.417 1.00   65.35  ? 422  ARG A CG  1 
ATOM   2577 C CD  . ARG A 1 335 ? 28.992 -65.475 -29.847 1.00   64.40  ? 422  ARG A CD  1 
ATOM   2578 N NE  . ARG A 1 335 ? 28.742 -65.614 -31.280 1.00   65.05  ? 422  ARG A NE  1 
ATOM   2579 C CZ  . ARG A 1 335 ? 29.655 -65.453 -32.226 1.00   69.63  ? 422  ARG A CZ  1 
ATOM   2580 N NH1 . ARG A 1 335 ? 30.926 -65.167 -31.925 1.00   73.18  ? 422  ARG A NH1 1 
ATOM   2581 N NH2 . ARG A 1 335 ? 29.293 -65.574 -33.496 1.00   71.91  ? 422  ARG A NH2 1 
ATOM   2582 N N   . TYR A 1 336 ? 29.646 -62.102 -25.495 1.00   55.01  ? 423  TYR A N   1 
ATOM   2583 C CA  . TYR A 1 336 ? 30.077 -62.066 -24.110 1.00   53.09  ? 423  TYR A CA  1 
ATOM   2584 C C   . TYR A 1 336 ? 29.224 -61.069 -23.314 1.00   53.31  ? 423  TYR A C   1 
ATOM   2585 O O   . TYR A 1 336 ? 28.815 -61.375 -22.191 1.00   53.07  ? 423  TYR A O   1 
ATOM   2586 C CB  . TYR A 1 336 ? 31.571 -61.751 -24.022 1.00   52.22  ? 423  TYR A CB  1 
ATOM   2587 C CG  . TYR A 1 336 ? 32.038 -61.493 -22.606 1.00   52.17  ? 423  TYR A CG  1 
ATOM   2588 C CD1 . TYR A 1 336 ? 32.513 -62.510 -21.806 1.00   51.26  ? 423  TYR A CD1 1 
ATOM   2589 C CD2 . TYR A 1 336 ? 32.001 -60.215 -22.070 1.00   52.87  ? 423  TYR A CD2 1 
ATOM   2590 C CE1 . TYR A 1 336 ? 32.950 -62.255 -20.505 1.00   51.82  ? 423  TYR A CE1 1 
ATOM   2591 C CE2 . TYR A 1 336 ? 32.405 -59.963 -20.784 1.00   53.13  ? 423  TYR A CE2 1 
ATOM   2592 C CZ  . TYR A 1 336 ? 32.893 -60.974 -19.993 1.00   53.28  ? 423  TYR A CZ  1 
ATOM   2593 O OH  . TYR A 1 336 ? 33.303 -60.649 -18.706 1.00   54.03  ? 423  TYR A OH  1 
ATOM   2594 N N   . LEU A 1 337 ? 28.951 -59.889 -23.877 1.00   51.78  ? 424  LEU A N   1 
ATOM   2595 C CA  . LEU A 1 337 ? 28.074 -58.908 -23.221 1.00   49.21  ? 424  LEU A CA  1 
ATOM   2596 C C   . LEU A 1 337 ? 26.700 -59.515 -22.892 1.00   46.94  ? 424  LEU A C   1 
ATOM   2597 O O   . LEU A 1 337 ? 26.170 -59.396 -21.791 1.00   42.60  ? 424  LEU A O   1 
ATOM   2598 C CB  . LEU A 1 337 ? 27.903 -57.669 -24.098 1.00   48.82  ? 424  LEU A CB  1 
ATOM   2599 C CG  . LEU A 1 337 ? 29.183 -56.849 -24.362 1.00   54.30  ? 424  LEU A CG  1 
ATOM   2600 C CD1 . LEU A 1 337 ? 28.923 -55.691 -25.325 1.00   54.60  ? 424  LEU A CD1 1 
ATOM   2601 C CD2 . LEU A 1 337 ? 29.844 -56.302 -23.104 1.00   55.33  ? 424  LEU A CD2 1 
ATOM   2602 N N   . VAL A 1 338 ? 26.135 -60.204 -23.870 1.00   47.39  ? 425  VAL A N   1 
ATOM   2603 C CA  . VAL A 1 338 ? 24.808 -60.780 -23.767 1.00   48.00  ? 425  VAL A CA  1 
ATOM   2604 C C   . VAL A 1 338 ? 24.800 -61.806 -22.673 1.00   51.01  ? 425  VAL A C   1 
ATOM   2605 O O   . VAL A 1 338 ? 23.930 -61.805 -21.812 1.00   49.19  ? 425  VAL A O   1 
ATOM   2606 C CB  . VAL A 1 338 ? 24.406 -61.466 -25.083 1.00   47.04  ? 425  VAL A CB  1 
ATOM   2607 C CG1 . VAL A 1 338 ? 23.120 -62.267 -24.927 1.00   44.15  ? 425  VAL A CG1 1 
ATOM   2608 C CG2 . VAL A 1 338 ? 24.239 -60.395 -26.177 1.00   51.21  ? 425  VAL A CG2 1 
ATOM   2609 N N   . SER A 1 339 ? 25.797 -62.680 -22.736 1.00   55.46  ? 426  SER A N   1 
ATOM   2610 C CA  . SER A 1 339 ? 25.935 -63.783 -21.796 1.00   54.78  ? 426  SER A CA  1 
ATOM   2611 C C   . SER A 1 339 ? 26.182 -63.291 -20.373 1.00   54.32  ? 426  SER A C   1 
ATOM   2612 O O   . SER A 1 339 ? 25.817 -63.955 -19.411 1.00   59.24  ? 426  SER A O   1 
ATOM   2613 C CB  . SER A 1 339 ? 27.077 -64.677 -22.243 1.00   55.40  ? 426  SER A CB  1 
ATOM   2614 O OG  . SER A 1 339 ? 28.280 -64.064 -21.846 1.00   60.25  ? 426  SER A OG  1 
ATOM   2615 N N   . GLN A 1 340 ? 26.791 -62.125 -20.224 1.00   53.90  ? 427  GLN A N   1 
ATOM   2616 C CA  . GLN A 1 340 ? 26.916 -61.513 -18.908 1.00   54.81  ? 427  GLN A CA  1 
ATOM   2617 C C   . GLN A 1 340 ? 25.639 -60.872 -18.376 1.00   57.23  ? 427  GLN A C   1 
ATOM   2618 O O   . GLN A 1 340 ? 25.685 -60.267 -17.310 1.00   59.63  ? 427  GLN A O   1 
ATOM   2619 C CB  . GLN A 1 340 ? 28.002 -60.436 -18.922 1.00   56.55  ? 427  GLN A CB  1 
ATOM   2620 C CG  . GLN A 1 340 ? 29.408 -60.974 -19.057 1.00   56.72  ? 427  GLN A CG  1 
ATOM   2621 C CD  . GLN A 1 340 ? 29.770 -61.948 -17.942 1.00   54.34  ? 427  GLN A CD  1 
ATOM   2622 O OE1 . GLN A 1 340 ? 29.727 -61.585 -16.774 1.00   53.66  ? 427  GLN A OE1 1 
ATOM   2623 N NE2 . GLN A 1 340 ? 30.123 -63.180 -18.309 1.00   51.18  ? 427  GLN A NE2 1 
ATOM   2624 N N   . GLY A 1 341 ? 24.527 -60.959 -19.105 1.00   59.35  ? 428  GLY A N   1 
ATOM   2625 C CA  . GLY A 1 341 ? 23.240 -60.424 -18.667 1.00   60.40  ? 428  GLY A CA  1 
ATOM   2626 C C   . GLY A 1 341 ? 22.969 -58.926 -18.780 1.00   60.55  ? 428  GLY A C   1 
ATOM   2627 O O   . GLY A 1 341 ? 22.321 -58.356 -17.894 1.00   61.52  ? 428  GLY A O   1 
ATOM   2628 N N   . CYS A 1 342 ? 23.425 -58.301 -19.865 1.00   58.95  ? 429  CYS A N   1 
ATOM   2629 C CA  . CYS A 1 342 ? 23.340 -56.854 -20.004 1.00   58.87  ? 429  CYS A CA  1 
ATOM   2630 C C   . CYS A 1 342 ? 22.088 -56.423 -20.738 1.00   58.96  ? 429  CYS A C   1 
ATOM   2631 O O   . CYS A 1 342 ? 21.818 -55.238 -20.823 1.00   59.47  ? 429  CYS A O   1 
ATOM   2632 C CB  . CYS A 1 342 ? 24.564 -56.313 -20.742 1.00   58.54  ? 429  CYS A CB  1 
ATOM   2633 S SG  . CYS A 1 342 ? 24.517 -56.780 -22.455 1.00   66.84  ? 429  CYS A SG  1 
ATOM   2634 N N   . ILE A 1 343 ? 21.369 -57.378 -21.315 1.00   59.58  ? 430  ILE A N   1 
ATOM   2635 C CA  . ILE A 1 343 ? 20.157 -57.100 -22.079 1.00   58.19  ? 430  ILE A CA  1 
ATOM   2636 C C   . ILE A 1 343 ? 19.047 -56.522 -21.208 1.00   57.85  ? 430  ILE A C   1 
ATOM   2637 O O   . ILE A 1 343 ? 18.542 -55.444 -21.485 1.00   57.21  ? 430  ILE A O   1 
ATOM   2638 C CB  . ILE A 1 343 ? 19.701 -58.357 -22.867 1.00   57.82  ? 430  ILE A CB  1 
ATOM   2639 C CG1 . ILE A 1 343 ? 20.594 -58.539 -24.096 1.00   57.33  ? 430  ILE A CG1 1 
ATOM   2640 C CG2 . ILE A 1 343 ? 18.265 -58.218 -23.338 1.00   57.81  ? 430  ILE A CG2 1 
ATOM   2641 C CD1 . ILE A 1 343 ? 20.275 -59.753 -24.924 1.00   58.87  ? 430  ILE A CD1 1 
ATOM   2642 N N   . LYS A 1 344 ? 18.681 -57.218 -20.142 1.00   62.94  ? 431  LYS A N   1 
ATOM   2643 C CA  . LYS A 1 344 ? 17.647 -56.717 -19.229 1.00   64.46  ? 431  LYS A CA  1 
ATOM   2644 C C   . LYS A 1 344 ? 17.908 -55.357 -18.581 1.00   62.71  ? 431  LYS A C   1 
ATOM   2645 O O   . LYS A 1 344 ? 16.984 -54.566 -18.498 1.00   63.39  ? 431  LYS A O   1 
ATOM   2646 C CB  . LYS A 1 344 ? 17.276 -57.711 -18.124 1.00   65.51  ? 431  LYS A CB  1 
ATOM   2647 C CG  . LYS A 1 344 ? 15.903 -57.349 -17.509 1.00   69.67  ? 431  LYS A CG  1 
ATOM   2648 C CD  . LYS A 1 344 ? 15.247 -58.466 -16.671 1.00   75.81  ? 431  LYS A CD  1 
ATOM   2649 C CE  . LYS A 1 344 ? 14.918 -59.763 -17.475 1.00   79.99  ? 431  LYS A CE  1 
ATOM   2650 N NZ  . LYS A 1 344 ? 14.139 -60.830 -16.741 1.00   80.50  ? 431  LYS A NZ  1 
ATOM   2651 N N   . PRO A 1 345 ? 19.103 -55.066 -18.081 1.00   60.89  ? 432  PRO A N   1 
ATOM   2652 C CA  . PRO A 1 345 ? 19.392 -53.717 -17.567 1.00   58.66  ? 432  PRO A CA  1 
ATOM   2653 C C   . PRO A 1 345 ? 19.334 -52.628 -18.641 1.00   56.59  ? 432  PRO A C   1 
ATOM   2654 O O   . PRO A 1 345 ? 18.864 -51.540 -18.334 1.00   56.18  ? 432  PRO A O   1 
ATOM   2655 C CB  . PRO A 1 345 ? 20.818 -53.828 -17.026 1.00   58.05  ? 432  PRO A CB  1 
ATOM   2656 C CG  . PRO A 1 345 ? 21.029 -55.271 -16.840 1.00   61.36  ? 432  PRO A CG  1 
ATOM   2657 C CD  . PRO A 1 345 ? 20.245 -55.976 -17.918 1.00   61.80  ? 432  PRO A CD  1 
ATOM   2658 N N   . LEU A 1 346 ? 19.828 -52.899 -19.848 1.00   55.71  ? 433  LEU A N   1 
ATOM   2659 C CA  . LEU A 1 346 ? 19.770 -51.950 -20.950 1.00   54.13  ? 433  LEU A CA  1 
ATOM   2660 C C   . LEU A 1 346 ? 18.317 -51.680 -21.282 1.00   55.85  ? 433  LEU A C   1 
ATOM   2661 O O   . LEU A 1 346 ? 17.936 -50.520 -21.412 1.00   56.51  ? 433  LEU A O   1 
ATOM   2662 C CB  . LEU A 1 346 ? 20.451 -52.481 -22.206 1.00   51.29  ? 433  LEU A CB  1 
ATOM   2663 C CG  . LEU A 1 346 ? 21.974 -52.513 -22.164 1.00   52.39  ? 433  LEU A CG  1 
ATOM   2664 C CD1 . LEU A 1 346 ? 22.447 -53.224 -23.422 1.00   55.90  ? 433  LEU A CD1 1 
ATOM   2665 C CD2 . LEU A 1 346 ? 22.586 -51.144 -22.086 1.00   48.94  ? 433  LEU A CD2 1 
ATOM   2666 N N   . CYS A 1 347 ? 17.526 -52.738 -21.442 1.00   56.55  ? 434  CYS A N   1 
ATOM   2667 C CA  . CYS A 1 347 ? 16.093 -52.587 -21.676 1.00   59.92  ? 434  CYS A CA  1 
ATOM   2668 C C   . CYS A 1 347 ? 15.420 -51.719 -20.600 1.00   62.53  ? 434  CYS A C   1 
ATOM   2669 O O   . CYS A 1 347 ? 14.767 -50.711 -20.900 1.00   63.89  ? 434  CYS A O   1 
ATOM   2670 C CB  . CYS A 1 347 ? 15.410 -53.952 -21.699 1.00   59.21  ? 434  CYS A CB  1 
ATOM   2671 S SG  . CYS A 1 347 ? 15.674 -54.846 -23.226 1.00   66.63  ? 434  CYS A SG  1 
ATOM   2672 N N   . ASP A 1 348 ? 15.615 -52.095 -19.339 1.00   62.11  ? 435  ASP A N   1 
ATOM   2673 C CA  . ASP A 1 348 ? 14.978 -51.405 -18.223 1.00   62.37  ? 435  ASP A CA  1 
ATOM   2674 C C   . ASP A 1 348 ? 15.369 -49.939 -18.199 1.00   60.71  ? 435  ASP A C   1 
ATOM   2675 O O   . ASP A 1 348 ? 14.701 -49.137 -17.574 1.00   65.58  ? 435  ASP A O   1 
ATOM   2676 C CB  . ASP A 1 348 ? 15.337 -52.036 -16.870 1.00   62.87  ? 435  ASP A CB  1 
ATOM   2677 C CG  . ASP A 1 348 ? 14.723 -53.411 -16.679 1.00   67.96  ? 435  ASP A CG  1 
ATOM   2678 O OD1 . ASP A 1 348 ? 15.137 -54.114 -15.721 1.00   68.95  ? 435  ASP A OD1 1 
ATOM   2679 O OD2 . ASP A 1 348 ? 13.866 -53.888 -17.464 1.00   72.73  ? 435  ASP A OD2 1 
ATOM   2680 N N   . LEU A 1 349 ? 16.459 -49.584 -18.857 1.00   58.27  ? 436  LEU A N   1 
ATOM   2681 C CA  . LEU A 1 349 ? 16.955 -48.215 -18.825 1.00   58.00  ? 436  LEU A CA  1 
ATOM   2682 C C   . LEU A 1 349 ? 16.285 -47.312 -19.857 1.00   57.32  ? 436  LEU A C   1 
ATOM   2683 O O   . LEU A 1 349 ? 16.429 -46.092 -19.785 1.00   51.89  ? 436  LEU A O   1 
ATOM   2684 C CB  . LEU A 1 349 ? 18.467 -48.220 -19.070 1.00   57.74  ? 436  LEU A CB  1 
ATOM   2685 C CG  . LEU A 1 349 ? 19.237 -46.945 -18.723 1.00   58.88  ? 436  LEU A CG  1 
ATOM   2686 C CD1 . LEU A 1 349 ? 19.329 -46.742 -17.218 1.00   58.79  ? 436  LEU A CD1 1 
ATOM   2687 C CD2 . LEU A 1 349 ? 20.614 -46.987 -19.323 1.00   60.14  ? 436  LEU A CD2 1 
ATOM   2688 N N   . LEU A 1 350 ? 15.577 -47.916 -20.813 1.00   59.48  ? 437  LEU A N   1 
ATOM   2689 C CA  . LEU A 1 350 ? 14.906 -47.195 -21.899 1.00   61.87  ? 437  LEU A CA  1 
ATOM   2690 C C   . LEU A 1 350 ? 13.882 -46.198 -21.357 1.00   65.33  ? 437  LEU A C   1 
ATOM   2691 O O   . LEU A 1 350 ? 13.555 -45.218 -22.020 1.00   69.98  ? 437  LEU A O   1 
ATOM   2692 C CB  . LEU A 1 350 ? 14.219 -48.176 -22.862 1.00   61.08  ? 437  LEU A CB  1 
ATOM   2693 C CG  . LEU A 1 350 ? 15.117 -48.850 -23.912 1.00   62.48  ? 437  LEU A CG  1 
ATOM   2694 C CD1 . LEU A 1 350 ? 14.420 -49.957 -24.716 1.00   59.05  ? 437  LEU A CD1 1 
ATOM   2695 C CD2 . LEU A 1 350 ? 15.731 -47.810 -24.870 1.00   62.05  ? 437  LEU A CD2 1 
ATOM   2696 N N   . GLU A 1 351 ? 13.403 -46.436 -20.140 1.00   63.86  ? 438  GLU A N   1 
ATOM   2697 C CA  . GLU A 1 351 ? 12.392 -45.598 -19.534 1.00   63.00  ? 438  GLU A CA  1 
ATOM   2698 C C   . GLU A 1 351 ? 12.982 -44.522 -18.659 1.00   62.54  ? 438  GLU A C   1 
ATOM   2699 O O   . GLU A 1 351 ? 12.247 -43.797 -18.013 1.00   62.98  ? 438  GLU A O   1 
ATOM   2700 C CB  . GLU A 1 351 ? 11.452 -46.470 -18.709 1.00   65.24  ? 438  GLU A CB  1 
ATOM   2701 C CG  . GLU A 1 351 ? 10.714 -47.438 -19.612 1.00   66.57  ? 438  GLU A CG  1 
ATOM   2702 C CD  . GLU A 1 351 ? 9.433  -47.933 -18.992 1.00   65.82  ? 438  GLU A CD  1 
ATOM   2703 O OE1 . GLU A 1 351 ? 9.535  -48.247 -17.790 1.00   73.39  ? 438  GLU A OE1 1 
ATOM   2704 O OE2 . GLU A 1 351 ? 8.383  -48.021 -19.675 1.00   56.89  ? 438  GLU A OE2 1 
ATOM   2705 N N   . ILE A 1 352 ? 14.300 -44.434 -18.594 1.00   64.73  ? 439  ILE A N   1 
ATOM   2706 C CA  . ILE A 1 352 ? 14.935 -43.332 -17.882 1.00   67.57  ? 439  ILE A CA  1 
ATOM   2707 C C   . ILE A 1 352 ? 14.456 -42.067 -18.580 1.00   69.23  ? 439  ILE A C   1 
ATOM   2708 O O   . ILE A 1 352 ? 14.125 -42.096 -19.773 1.00   70.53  ? 439  ILE A O   1 
ATOM   2709 C CB  . ILE A 1 352 ? 16.504 -43.480 -17.885 1.00   70.15  ? 439  ILE A CB  1 
ATOM   2710 C CG1 . ILE A 1 352 ? 17.200 -42.691 -16.764 1.00   71.64  ? 439  ILE A CG1 1 
ATOM   2711 C CG2 . ILE A 1 352 ? 17.131 -43.047 -19.210 1.00   69.11  ? 439  ILE A CG2 1 
ATOM   2712 C CD1 . ILE A 1 352 ? 16.638 -42.911 -15.355 1.00   73.63  ? 439  ILE A CD1 1 
ATOM   2713 N N   . ALA A 1 353 ? 14.384 -40.970 -17.831 1.00   70.52  ? 440  ALA A N   1 
ATOM   2714 C CA  . ALA A 1 353 ? 13.953 -39.688 -18.394 1.00   69.89  ? 440  ALA A CA  1 
ATOM   2715 C C   . ALA A 1 353 ? 15.114 -38.852 -18.973 1.00   67.89  ? 440  ALA A C   1 
ATOM   2716 O O   . ALA A 1 353 ? 15.332 -37.709 -18.573 1.00   69.85  ? 440  ALA A O   1 
ATOM   2717 C CB  . ALA A 1 353 ? 13.170 -38.900 -17.332 1.00   69.97  ? 440  ALA A CB  1 
ATOM   2718 N N   . ASP A 1 354 ? 15.850 -39.401 -19.933 1.00   65.22  ? 441  ASP A N   1 
ATOM   2719 C CA  . ASP A 1 354 ? 16.992 -38.700 -20.532 1.00   64.90  ? 441  ASP A CA  1 
ATOM   2720 C C   . ASP A 1 354 ? 17.126 -39.236 -21.951 1.00   65.34  ? 441  ASP A C   1 
ATOM   2721 O O   . ASP A 1 354 ? 17.394 -40.412 -22.167 1.00   67.22  ? 441  ASP A O   1 
ATOM   2722 C CB  . ASP A 1 354 ? 18.285 -38.943 -19.728 1.00   65.57  ? 441  ASP A CB  1 
ATOM   2723 C CG  . ASP A 1 354 ? 19.526 -38.286 -20.353 1.00   65.09  ? 441  ASP A CG  1 
ATOM   2724 O OD1 . ASP A 1 354 ? 19.562 -38.053 -21.571 1.00   67.99  ? 441  ASP A OD1 1 
ATOM   2725 O OD2 . ASP A 1 354 ? 20.560 -37.964 -19.737 1.00   66.48  ? 441  ASP A OD2 1 
ATOM   2726 N N   . ASN A 1 355 ? 16.913 -38.377 -22.934 1.00   65.28  ? 442  ASN A N   1 
ATOM   2727 C CA  . ASN A 1 355 ? 16.928 -38.817 -24.328 1.00   63.64  ? 442  ASN A CA  1 
ATOM   2728 C C   . ASN A 1 355 ? 18.324 -39.160 -24.848 1.00   63.40  ? 442  ASN A C   1 
ATOM   2729 O O   . ASN A 1 355 ? 18.496 -39.933 -25.792 1.00   61.90  ? 442  ASN A O   1 
ATOM   2730 C CB  . ASN A 1 355 ? 16.286 -37.744 -25.217 1.00   62.77  ? 442  ASN A CB  1 
ATOM   2731 C CG  . ASN A 1 355 ? 14.808 -37.533 -24.921 1.00   62.05  ? 442  ASN A CG  1 
ATOM   2732 O OD1 . ASN A 1 355 ? 14.069 -38.465 -24.611 1.00   58.56  ? 442  ASN A OD1 1 
ATOM   2733 N ND2 . ASN A 1 355 ? 14.372 -36.289 -25.027 1.00   63.90  ? 442  ASN A ND2 1 
ATOM   2734 N N   . ARG A 1 356 ? 19.331 -38.537 -24.261 1.00   63.54  ? 443  ARG A N   1 
ATOM   2735 C CA  . ARG A 1 356 ? 20.708 -38.824 -24.632 1.00   64.91  ? 443  ARG A CA  1 
ATOM   2736 C C   . ARG A 1 356 ? 21.043 -40.312 -24.409 1.00   61.90  ? 443  ARG A C   1 
ATOM   2737 O O   . ARG A 1 356 ? 21.594 -40.970 -25.292 1.00   58.29  ? 443  ARG A O   1 
ATOM   2738 C CB  . ARG A 1 356 ? 21.625 -37.925 -23.801 1.00   70.30  ? 443  ARG A CB  1 
ATOM   2739 C CG  . ARG A 1 356 ? 23.040 -37.781 -24.338 1.00   76.78  ? 443  ARG A CG  1 
ATOM   2740 C CD  . ARG A 1 356 ? 23.135 -36.874 -25.547 1.00   80.04  ? 443  ARG A CD  1 
ATOM   2741 N NE  . ARG A 1 356 ? 24.400 -37.053 -26.249 1.00   83.38  ? 443  ARG A NE  1 
ATOM   2742 C CZ  . ARG A 1 356 ? 24.736 -38.130 -26.961 1.00   84.48  ? 443  ARG A CZ  1 
ATOM   2743 N NH1 . ARG A 1 356 ? 23.910 -39.178 -27.066 1.00   83.45  ? 443  ARG A NH1 1 
ATOM   2744 N NH2 . ARG A 1 356 ? 25.917 -38.151 -27.582 1.00   83.54  ? 443  ARG A NH2 1 
ATOM   2745 N N   . ILE A 1 357 ? 20.666 -40.827 -23.240 1.00   57.49  ? 444  ILE A N   1 
ATOM   2746 C CA  . ILE A 1 357 ? 20.883 -42.217 -22.854 1.00   55.17  ? 444  ILE A CA  1 
ATOM   2747 C C   . ILE A 1 357 ? 19.966 -43.214 -23.557 1.00   53.69  ? 444  ILE A C   1 
ATOM   2748 O O   . ILE A 1 357 ? 20.405 -44.313 -23.876 1.00   50.67  ? 444  ILE A O   1 
ATOM   2749 C CB  . ILE A 1 357 ? 20.692 -42.369 -21.329 1.00   54.90  ? 444  ILE A CB  1 
ATOM   2750 C CG1 . ILE A 1 357 ? 21.749 -41.559 -20.592 1.00   55.62  ? 444  ILE A CG1 1 
ATOM   2751 C CG2 . ILE A 1 357 ? 20.736 -43.835 -20.914 1.00   55.57  ? 444  ILE A CG2 1 
ATOM   2752 C CD1 . ILE A 1 357 ? 23.173 -41.948 -20.976 1.00   59.51  ? 444  ILE A CD1 1 
ATOM   2753 N N   . ILE A 1 358 ? 18.690 -42.870 -23.739 1.00   55.67  ? 445  ILE A N   1 
ATOM   2754 C CA  . ILE A 1 358 ? 17.728 -43.744 -24.432 1.00   53.64  ? 445  ILE A CA  1 
ATOM   2755 C C   . ILE A 1 358 ? 18.314 -44.110 -25.786 1.00   54.18  ? 445  ILE A C   1 
ATOM   2756 O O   . ILE A 1 358 ? 18.292 -45.275 -26.207 1.00   48.46  ? 445  ILE A O   1 
ATOM   2757 C CB  . ILE A 1 358 ? 16.360 -43.062 -24.636 1.00   52.63  ? 445  ILE A CB  1 
ATOM   2758 C CG1 . ILE A 1 358 ? 15.561 -43.056 -23.331 1.00   56.61  ? 445  ILE A CG1 1 
ATOM   2759 C CG2 . ILE A 1 358 ? 15.562 -43.792 -25.703 1.00   51.69  ? 445  ILE A CG2 1 
ATOM   2760 C CD1 . ILE A 1 358 ? 14.359 -42.109 -23.308 1.00   59.33  ? 445  ILE A CD1 1 
ATOM   2761 N N   . GLU A 1 359 ? 18.871 -43.084 -26.429 1.00   55.97  ? 446  GLU A N   1 
ATOM   2762 C CA  . GLU A 1 359 ? 19.494 -43.213 -27.733 1.00   56.01  ? 446  GLU A CA  1 
ATOM   2763 C C   . GLU A 1 359 ? 20.658 -44.175 -27.665 1.00   55.84  ? 446  GLU A C   1 
ATOM   2764 O O   . GLU A 1 359 ? 20.675 -45.163 -28.382 1.00   56.60  ? 446  GLU A O   1 
ATOM   2765 C CB  . GLU A 1 359 ? 19.958 -41.846 -28.225 1.00   59.17  ? 446  GLU A CB  1 
ATOM   2766 C CG  . GLU A 1 359 ? 20.228 -41.809 -29.716 1.00   63.56  ? 446  GLU A CG  1 
ATOM   2767 C CD  . GLU A 1 359 ? 20.434 -40.396 -30.210 1.00   70.25  ? 446  GLU A CD  1 
ATOM   2768 O OE1 . GLU A 1 359 ? 21.150 -40.227 -31.231 1.00   72.14  ? 446  GLU A OE1 1 
ATOM   2769 O OE2 . GLU A 1 359 ? 19.880 -39.479 -29.553 1.00   72.37  ? 446  GLU A OE2 1 
ATOM   2770 N N   . VAL A 1 360 ? 21.608 -43.910 -26.779 1.00   56.84  ? 447  VAL A N   1 
ATOM   2771 C CA  . VAL A 1 360 ? 22.735 -44.823 -26.563 1.00   57.56  ? 447  VAL A CA  1 
ATOM   2772 C C   . VAL A 1 360 ? 22.288 -46.271 -26.283 1.00   56.23  ? 447  VAL A C   1 
ATOM   2773 O O   . VAL A 1 360 ? 22.880 -47.223 -26.805 1.00   50.61  ? 447  VAL A O   1 
ATOM   2774 C CB  . VAL A 1 360 ? 23.592 -44.386 -25.363 1.00   58.21  ? 447  VAL A CB  1 
ATOM   2775 C CG1 . VAL A 1 360 ? 24.664 -45.408 -25.068 1.00   60.37  ? 447  VAL A CG1 1 
ATOM   2776 C CG2 . VAL A 1 360 ? 24.258 -43.037 -25.607 1.00   58.93  ? 447  VAL A CG2 1 
ATOM   2777 N N   . THR A 1 361 ? 21.236 -46.418 -25.474 1.00   54.12  ? 448  THR A N   1 
ATOM   2778 C CA  . THR A 1 361 ? 20.712 -47.723 -25.091 1.00   52.27  ? 448  THR A CA  1 
ATOM   2779 C C   . THR A 1 361 ? 20.124 -48.451 -26.274 1.00   54.18  ? 448  THR A C   1 
ATOM   2780 O O   . THR A 1 361 ? 20.314 -49.652 -26.393 1.00   56.39  ? 448  THR A O   1 
ATOM   2781 C CB  . THR A 1 361 ? 19.632 -47.567 -24.040 1.00   53.45  ? 448  THR A CB  1 
ATOM   2782 O OG1 . THR A 1 361 ? 20.214 -47.047 -22.836 1.00   55.18  ? 448  THR A OG1 1 
ATOM   2783 C CG2 . THR A 1 361 ? 19.063 -48.900 -23.621 1.00   53.28  ? 448  THR A CG2 1 
ATOM   2784 N N   . LEU A 1 362 ? 19.400 -47.743 -27.135 1.00   58.43  ? 449  LEU A N   1 
ATOM   2785 C CA  . LEU A 1 362 ? 18.834 -48.331 -28.359 1.00   56.77  ? 449  LEU A CA  1 
ATOM   2786 C C   . LEU A 1 362 ? 19.932 -48.710 -29.360 1.00   59.73  ? 449  LEU A C   1 
ATOM   2787 O O   . LEU A 1 362 ? 19.789 -49.698 -30.076 1.00   58.43  ? 449  LEU A O   1 
ATOM   2788 C CB  . LEU A 1 362 ? 17.850 -47.360 -29.013 1.00   53.81  ? 449  LEU A CB  1 
ATOM   2789 C CG  . LEU A 1 362 ? 16.501 -47.112 -28.348 1.00   49.47  ? 449  LEU A CG  1 
ATOM   2790 C CD1 . LEU A 1 362 ? 15.781 -46.056 -29.172 1.00   52.20  ? 449  LEU A CD1 1 
ATOM   2791 C CD2 . LEU A 1 362 ? 15.644 -48.348 -28.258 1.00   46.29  ? 449  LEU A CD2 1 
ATOM   2792 N N   . ASP A 1 363 ? 21.002 -47.914 -29.428 1.00   62.76  ? 450  ASP A N   1 
ATOM   2793 C CA  . ASP A 1 363 ? 22.170 -48.212 -30.274 1.00   62.88  ? 450  ASP A CA  1 
ATOM   2794 C C   . ASP A 1 363 ? 22.833 -49.510 -29.797 1.00   61.91  ? 450  ASP A C   1 
ATOM   2795 O O   . ASP A 1 363 ? 23.253 -50.347 -30.590 1.00   62.96  ? 450  ASP A O   1 
ATOM   2796 C CB  . ASP A 1 363 ? 23.196 -47.065 -30.270 1.00   62.89  ? 450  ASP A CB  1 
ATOM   2797 C CG  . ASP A 1 363 ? 22.810 -45.926 -31.206 1.00   66.44  ? 450  ASP A CG  1 
ATOM   2798 O OD1 . ASP A 1 363 ? 23.201 -44.752 -30.963 1.00   66.95  ? 450  ASP A OD1 1 
ATOM   2799 O OD2 . ASP A 1 363 ? 22.106 -46.135 -32.221 1.00   67.81  ? 450  ASP A OD2 1 
ATOM   2800 N N   . ALA A 1 364 ? 22.930 -49.679 -28.487 1.00   59.67  ? 451  ALA A N   1 
ATOM   2801 C CA  . ALA A 1 364 ? 23.457 -50.911 -27.928 1.00   58.58  ? 451  ALA A CA  1 
ATOM   2802 C C   . ALA A 1 364 ? 22.546 -52.087 -28.257 1.00   58.68  ? 451  ALA A C   1 
ATOM   2803 O O   . ALA A 1 364 ? 23.025 -53.139 -28.686 1.00   57.63  ? 451  ALA A O   1 
ATOM   2804 C CB  . ALA A 1 364 ? 23.636 -50.792 -26.423 1.00   58.34  ? 451  ALA A CB  1 
ATOM   2805 N N   . LEU A 1 365 ? 21.240 -51.911 -28.084 1.00   57.55  ? 452  LEU A N   1 
ATOM   2806 C CA  . LEU A 1 365 ? 20.297 -52.978 -28.413 1.00   59.19  ? 452  LEU A CA  1 
ATOM   2807 C C   . LEU A 1 365 ? 20.248 -53.331 -29.903 1.00   61.52  ? 452  LEU A C   1 
ATOM   2808 O O   . LEU A 1 365 ? 20.036 -54.491 -30.256 1.00   61.49  ? 452  LEU A O   1 
ATOM   2809 C CB  . LEU A 1 365 ? 18.893 -52.611 -27.947 1.00   59.71  ? 452  LEU A CB  1 
ATOM   2810 C CG  . LEU A 1 365 ? 18.761 -52.481 -26.434 1.00   59.02  ? 452  LEU A CG  1 
ATOM   2811 C CD1 . LEU A 1 365 ? 17.435 -51.834 -26.103 1.00   59.62  ? 452  LEU A CD1 1 
ATOM   2812 C CD2 . LEU A 1 365 ? 18.881 -53.837 -25.763 1.00   60.26  ? 452  LEU A CD2 1 
ATOM   2813 N N   . GLU A 1 366 ? 20.435 -52.335 -30.765 1.00   63.50  ? 453  GLU A N   1 
ATOM   2814 C CA  . GLU A 1 366 ? 20.434 -52.551 -32.208 1.00   65.78  ? 453  GLU A CA  1 
ATOM   2815 C C   . GLU A 1 366 ? 21.649 -53.421 -32.521 1.00   65.22  ? 453  GLU A C   1 
ATOM   2816 O O   . GLU A 1 366 ? 21.495 -54.464 -33.167 1.00   65.49  ? 453  GLU A O   1 
ATOM   2817 C CB  . GLU A 1 366 ? 20.413 -51.220 -32.992 1.00   68.21  ? 453  GLU A CB  1 
ATOM   2818 C CG  . GLU A 1 366 ? 20.912 -51.247 -34.438 1.00   70.93  ? 453  GLU A CG  1 
ATOM   2819 C CD  . GLU A 1 366 ? 19.995 -50.493 -35.393 1.00   76.96  ? 453  GLU A CD  1 
ATOM   2820 O OE1 . GLU A 1 366 ? 19.921 -49.243 -35.289 1.00   79.37  ? 453  GLU A OE1 1 
ATOM   2821 O OE2 . GLU A 1 366 ? 19.338 -51.150 -36.242 1.00   81.22  ? 453  GLU A OE2 1 
ATOM   2822 N N   . ASN A 1 367 ? 22.830 -53.011 -32.053 1.00   63.02  ? 454  ASN A N   1 
ATOM   2823 C CA  . ASN A 1 367 ? 24.071 -53.772 -32.271 1.00   61.48  ? 454  ASN A CA  1 
ATOM   2824 C C   . ASN A 1 367 ? 23.958 -55.229 -31.788 1.00   61.08  ? 454  ASN A C   1 
ATOM   2825 O O   . ASN A 1 367 ? 24.459 -56.150 -32.416 1.00   60.12  ? 454  ASN A O   1 
ATOM   2826 C CB  . ASN A 1 367 ? 25.248 -53.097 -31.574 1.00   60.65  ? 454  ASN A CB  1 
ATOM   2827 C CG  . ASN A 1 367 ? 25.660 -51.801 -32.234 1.00   61.06  ? 454  ASN A CG  1 
ATOM   2828 O OD1 . ASN A 1 367 ? 25.367 -51.564 -33.413 1.00   66.60  ? 454  ASN A OD1 1 
ATOM   2829 N ND2 . ASN A 1 367 ? 26.355 -50.952 -31.474 1.00   52.31  ? 454  ASN A ND2 1 
ATOM   2830 N N   . ILE A 1 368 ? 23.275 -55.445 -30.673 1.00   60.15  ? 455  ILE A N   1 
ATOM   2831 C CA  . ILE A 1 368 ? 23.022 -56.794 -30.183 1.00   59.13  ? 455  ILE A CA  1 
ATOM   2832 C C   . ILE A 1 368 ? 22.084 -57.559 -31.119 1.00   63.21  ? 455  ILE A C   1 
ATOM   2833 O O   . ILE A 1 368 ? 22.208 -58.767 -31.289 1.00   64.41  ? 455  ILE A O   1 
ATOM   2834 C CB  . ILE A 1 368 ? 22.406 -56.711 -28.784 1.00   56.55  ? 455  ILE A CB  1 
ATOM   2835 C CG1 . ILE A 1 368 ? 23.481 -56.282 -27.777 1.00   57.25  ? 455  ILE A CG1 1 
ATOM   2836 C CG2 . ILE A 1 368 ? 21.796 -58.027 -28.374 1.00   54.19  ? 455  ILE A CG2 1 
ATOM   2837 C CD1 . ILE A 1 368 ? 22.979 -56.103 -26.355 1.00   54.37  ? 455  ILE A CD1 1 
ATOM   2838 N N   . LEU A 1 369 ? 21.109 -56.859 -31.689 1.00   66.54  ? 456  LEU A N   1 
ATOM   2839 C CA  . LEU A 1 369 ? 20.168 -57.482 -32.609 1.00   66.59  ? 456  LEU A CA  1 
ATOM   2840 C C   . LEU A 1 369 ? 20.867 -57.785 -33.929 1.00   68.27  ? 456  LEU A C   1 
ATOM   2841 O O   . LEU A 1 369 ? 20.684 -58.881 -34.429 1.00   66.09  ? 456  LEU A O   1 
ATOM   2842 C CB  . LEU A 1 369 ? 18.925 -56.608 -32.814 1.00   64.59  ? 456  LEU A CB  1 
ATOM   2843 C CG  . LEU A 1 369 ? 17.985 -56.556 -31.608 1.00   64.16  ? 456  LEU A CG  1 
ATOM   2844 C CD1 . LEU A 1 369 ? 17.071 -55.352 -31.677 1.00   63.97  ? 456  LEU A CD1 1 
ATOM   2845 C CD2 . LEU A 1 369 ? 17.157 -57.802 -31.494 1.00   62.53  ? 456  LEU A CD2 1 
ATOM   2846 N N   . LYS A 1 370 ? 21.648 -56.841 -34.466 1.00   73.16  ? 457  LYS A N   1 
ATOM   2847 C CA  . LYS A 1 370 ? 22.388 -56.991 -35.732 1.00   78.73  ? 457  LYS A CA  1 
ATOM   2848 C C   . LYS A 1 370 ? 23.367 -58.164 -35.712 1.00   84.92  ? 457  LYS A C   1 
ATOM   2849 O O   . LYS A 1 370 ? 23.619 -58.819 -36.731 1.00   89.26  ? 457  LYS A O   1 
ATOM   2850 C CB  . LYS A 1 370 ? 23.228 -55.753 -36.061 1.00   78.01  ? 457  LYS A CB  1 
ATOM   2851 C CG  . LYS A 1 370 ? 22.472 -54.646 -36.767 1.00   80.98  ? 457  LYS A CG  1 
ATOM   2852 C CD  . LYS A 1 370 ? 23.365 -53.416 -36.951 1.00   84.13  ? 457  LYS A CD  1 
ATOM   2853 C CE  . LYS A 1 370 ? 22.587 -52.178 -37.418 1.00   84.61  ? 457  LYS A CE  1 
ATOM   2854 N NZ  . LYS A 1 370 ? 23.374 -50.913 -37.247 1.00   84.60  ? 457  LYS A NZ  1 
ATOM   2855 N N   . MET A 1 371 ? 23.963 -58.380 -34.547 1.00   87.45  ? 458  MET A N   1 
ATOM   2856 C CA  . MET A 1 371 ? 24.880 -59.486 -34.337 1.00   86.42  ? 458  MET A CA  1 
ATOM   2857 C C   . MET A 1 371 ? 24.067 -60.764 -34.134 1.00   87.64  ? 458  MET A C   1 
ATOM   2858 O O   . MET A 1 371 ? 24.473 -61.830 -34.591 1.00   91.20  ? 458  MET A O   1 
ATOM   2859 C CB  . MET A 1 371 ? 25.759 -59.177 -33.129 1.00   85.69  ? 458  MET A CB  1 
ATOM   2860 C CG  . MET A 1 371 ? 26.961 -60.077 -32.976 1.00   84.19  ? 458  MET A CG  1 
ATOM   2861 S SD  . MET A 1 371 ? 26.480 -61.523 -32.071 1.00   81.65  ? 458  MET A SD  1 
ATOM   2862 C CE  . MET A 1 371 ? 27.129 -62.715 -33.210 1.00   83.54  ? 458  MET A CE  1 
ATOM   2863 N N   . GLY A 1 372 ? 22.917 -60.670 -33.476 1.00   85.52  ? 459  GLY A N   1 
ATOM   2864 C CA  . GLY A 1 372 ? 22.050 -61.824 -33.318 1.00   85.90  ? 459  GLY A CA  1 
ATOM   2865 C C   . GLY A 1 372 ? 21.426 -62.282 -34.629 1.00   88.36  ? 459  GLY A C   1 
ATOM   2866 O O   . GLY A 1 372 ? 21.167 -63.479 -34.806 1.00   86.93  ? 459  GLY A O   1 
ATOM   2867 N N   . GLU A 1 373 ? 21.204 -61.326 -35.537 1.00   91.08  ? 460  GLU A N   1 
ATOM   2868 C CA  . GLU A 1 373 ? 20.575 -61.557 -36.843 1.00   93.22  ? 460  GLU A CA  1 
ATOM   2869 C C   . GLU A 1 373 ? 21.613 -62.140 -37.804 1.00   95.33  ? 460  GLU A C   1 
ATOM   2870 O O   . GLU A 1 373 ? 21.316 -63.113 -38.501 1.00   97.78  ? 460  GLU A O   1 
ATOM   2871 C CB  . GLU A 1 373 ? 19.933 -60.276 -37.425 1.00   92.83  ? 460  GLU A CB  1 
ATOM   2872 C CG  . GLU A 1 373 ? 19.166 -60.413 -38.753 1.00   92.99  ? 460  GLU A CG  1 
ATOM   2873 C CD  . GLU A 1 373 ? 17.733 -60.957 -38.661 1.00   92.08  ? 460  GLU A CD  1 
ATOM   2874 O OE1 . GLU A 1 373 ? 16.960 -60.555 -37.759 1.00   93.18  ? 460  GLU A OE1 1 
ATOM   2875 O OE2 . GLU A 1 373 ? 17.332 -61.783 -39.519 1.00   88.64  ? 460  GLU A OE2 1 
ATOM   2876 N N   . ALA A 1 374 ? 22.812 -61.556 -37.847 1.00   94.22  ? 461  ALA A N   1 
ATOM   2877 C CA  . ALA A 1 374 ? 23.909 -62.076 -38.671 1.00   93.89  ? 461  ALA A CA  1 
ATOM   2878 C C   . ALA A 1 374 ? 24.390 -63.446 -38.162 1.00   93.97  ? 461  ALA A C   1 
ATOM   2879 O O   . ALA A 1 374 ? 25.021 -64.206 -38.904 1.00   93.01  ? 461  ALA A O   1 
ATOM   2880 C CB  . ALA A 1 374 ? 25.078 -61.091 -38.703 1.00   93.20  ? 461  ALA A CB  1 
ATOM   2881 N N   . ASP A 1 375 ? 24.096 -63.741 -36.896 1.00   94.01  ? 462  ASP A N   1 
ATOM   2882 C CA  . ASP A 1 375 ? 24.424 -65.027 -36.280 1.00   95.33  ? 462  ASP A CA  1 
ATOM   2883 C C   . ASP A 1 375 ? 23.515 -66.139 -36.789 1.00   96.38  ? 462  ASP A C   1 
ATOM   2884 O O   . ASP A 1 375 ? 23.983 -67.239 -37.068 1.00   97.18  ? 462  ASP A O   1 
ATOM   2885 C CB  . ASP A 1 375 ? 24.287 -64.947 -34.756 1.00   95.42  ? 462  ASP A CB  1 
ATOM   2886 C CG  . ASP A 1 375 ? 25.090 -66.017 -34.027 1.00   92.94  ? 462  ASP A CG  1 
ATOM   2887 O OD1 . ASP A 1 375 ? 24.645 -67.177 -33.984 1.00   93.82  ? 462  ASP A OD1 1 
ATOM   2888 O OD2 . ASP A 1 375 ? 26.171 -65.803 -33.452 1.00   87.57  ? 462  ASP A OD2 1 
ATOM   2889 N N   . LYS A 1 376 ? 22.220 -65.853 -36.895 1.00   97.68  ? 463  LYS A N   1 
ATOM   2890 C CA  . LYS A 1 376 ? 21.246 -66.831 -37.392 1.00   98.98  ? 463  LYS A CA  1 
ATOM   2891 C C   . LYS A 1 376 ? 21.233 -66.977 -38.919 1.00   100.33 ? 463  LYS A C   1 
ATOM   2892 O O   . LYS A 1 376 ? 20.894 -68.043 -39.423 1.00   98.97  ? 463  LYS A O   1 
ATOM   2893 C CB  . LYS A 1 376 ? 19.840 -66.469 -36.922 1.00   99.12  ? 463  LYS A CB  1 
ATOM   2894 C CG  . LYS A 1 376 ? 19.358 -65.124 -37.470 1.00   99.72  ? 463  LYS A CG  1 
ATOM   2895 C CD  . LYS A 1 376 ? 17.857 -64.925 -37.335 1.00   99.83  ? 463  LYS A CD  1 
ATOM   2896 C CE  . LYS A 1 376 ? 17.081 -65.360 -38.566 1.00   98.78  ? 463  LYS A CE  1 
ATOM   2897 N NZ  . LYS A 1 376 ? 15.931 -64.428 -38.752 1.00   98.35  ? 463  LYS A NZ  1 
ATOM   2898 N N   . GLU A 1 377 ? 21.573 -65.913 -39.650 1.00   102.52 ? 464  GLU A N   1 
ATOM   2899 C CA  . GLU A 1 377 ? 21.651 -65.951 -41.116 1.00   103.49 ? 464  GLU A CA  1 
ATOM   2900 C C   . GLU A 1 377 ? 22.946 -66.618 -41.570 1.00   104.58 ? 464  GLU A C   1 
ATOM   2901 O O   . GLU A 1 377 ? 22.992 -67.168 -42.671 1.00   105.83 ? 464  GLU A O   1 
ATOM   2902 C CB  . GLU A 1 377 ? 21.565 -64.553 -41.750 1.00   103.36 ? 464  GLU A CB  1 
ATOM   2903 C CG  . GLU A 1 377 ? 20.294 -63.770 -41.436 1.00   104.76 ? 464  GLU A CG  1 
ATOM   2904 C CD  . GLU A 1 377 ? 19.041 -64.278 -42.137 1.00   107.22 ? 464  GLU A CD  1 
ATOM   2905 O OE1 . GLU A 1 377 ? 18.915 -65.501 -42.395 1.00   108.25 ? 464  GLU A OE1 1 
ATOM   2906 O OE2 . GLU A 1 377 ? 18.156 -63.434 -42.415 1.00   108.50 ? 464  GLU A OE2 1 
ATOM   2907 N N   . ALA A 1 378 ? 23.979 -66.561 -40.727 1.00   105.73 ? 465  ALA A N   1 
ATOM   2908 C CA  . ALA A 1 378 ? 25.280 -67.191 -40.998 1.00   105.70 ? 465  ALA A CA  1 
ATOM   2909 C C   . ALA A 1 378 ? 25.205 -68.720 -40.903 1.00   106.05 ? 465  ALA A C   1 
ATOM   2910 O O   . ALA A 1 378 ? 25.961 -69.413 -41.594 1.00   104.89 ? 465  ALA A O   1 
ATOM   2911 C CB  . ALA A 1 378 ? 26.370 -66.658 -40.053 1.00   104.28 ? 465  ALA A CB  1 
ATOM   2912 N N   . ARG A 1 379 ? 24.307 -69.225 -40.052 1.00   106.60 ? 466  ARG A N   1 
ATOM   2913 C CA  . ARG A 1 379 ? 24.086 -70.668 -39.885 1.00   108.98 ? 466  ARG A CA  1 
ATOM   2914 C C   . ARG A 1 379 ? 22.621 -71.109 -40.042 1.00   109.92 ? 466  ARG A C   1 
ATOM   2915 O O   . ARG A 1 379 ? 22.100 -71.908 -39.247 1.00   106.94 ? 466  ARG A O   1 
ATOM   2916 C CB  . ARG A 1 379 ? 24.664 -71.156 -38.549 1.00   110.67 ? 466  ARG A CB  1 
ATOM   2917 C CG  . ARG A 1 379 ? 24.044 -70.551 -37.284 1.00   112.24 ? 466  ARG A CG  1 
ATOM   2918 C CD  . ARG A 1 379 ? 24.820 -70.887 -36.013 1.00   111.96 ? 466  ARG A CD  1 
ATOM   2919 N NE  . ARG A 1 379 ? 24.124 -70.477 -34.796 1.00   112.39 ? 466  ARG A NE  1 
ATOM   2920 C CZ  . ARG A 1 379 ? 24.623 -70.595 -33.570 1.00   111.39 ? 466  ARG A CZ  1 
ATOM   2921 N NH1 . ARG A 1 379 ? 25.833 -71.114 -33.381 1.00   111.89 ? 466  ARG A NH1 1 
ATOM   2922 N NH2 . ARG A 1 379 ? 23.908 -70.193 -32.524 1.00   109.92 ? 466  ARG A NH2 1 
ATOM   2923 N N   . GLY A 1 380 ? 21.980 -70.560 -41.077 1.00   112.02 ? 467  GLY A N   1 
ATOM   2924 C CA  . GLY A 1 380 ? 20.631 -70.906 -41.506 1.00   113.14 ? 467  GLY A CA  1 
ATOM   2925 C C   . GLY A 1 380 ? 19.541 -71.189 -40.478 1.00   114.67 ? 467  GLY A C   1 
ATOM   2926 O O   . GLY A 1 380 ? 18.660 -72.014 -40.732 1.00   115.92 ? 467  GLY A O   1 
ATOM   2927 N N   . LEU A 1 381 ? 19.582 -70.508 -39.334 1.00   115.18 ? 468  LEU A N   1 
ATOM   2928 C CA  . LEU A 1 381 ? 18.557 -70.638 -38.293 1.00   114.32 ? 468  LEU A CA  1 
ATOM   2929 C C   . LEU A 1 381 ? 17.326 -69.774 -38.641 1.00   114.04 ? 468  LEU A C   1 
ATOM   2930 O O   . LEU A 1 381 ? 17.410 -68.899 -39.517 1.00   113.87 ? 468  LEU A O   1 
ATOM   2931 C CB  . LEU A 1 381 ? 19.149 -70.258 -36.924 1.00   113.90 ? 468  LEU A CB  1 
ATOM   2932 C CG  . LEU A 1 381 ? 19.334 -71.376 -35.885 1.00   113.57 ? 468  LEU A CG  1 
ATOM   2933 C CD1 . LEU A 1 381 ? 17.996 -72.013 -35.485 1.00   112.23 ? 468  LEU A CD1 1 
ATOM   2934 C CD2 . LEU A 1 381 ? 20.346 -72.429 -36.359 1.00   112.91 ? 468  LEU A CD2 1 
ATOM   2935 N N   . ASN A 1 382 ? 16.193 -70.019 -37.975 1.00   112.29 ? 469  ASN A N   1 
ATOM   2936 C CA  . ASN A 1 382 ? 14.966 -69.247 -38.222 1.00   111.35 ? 469  ASN A CA  1 
ATOM   2937 C C   . ASN A 1 382 ? 14.524 -68.339 -37.055 1.00   110.44 ? 469  ASN A C   1 
ATOM   2938 O O   . ASN A 1 382 ? 13.358 -67.928 -36.964 1.00   110.23 ? 469  ASN A O   1 
ATOM   2939 C CB  . ASN A 1 382 ? 13.823 -70.188 -38.636 1.00   111.70 ? 469  ASN A CB  1 
ATOM   2940 C CG  . ASN A 1 382 ? 12.871 -69.563 -39.667 1.00   112.39 ? 469  ASN A CG  1 
ATOM   2941 O OD1 . ASN A 1 382 ? 12.034 -70.252 -40.252 1.00   112.85 ? 469  ASN A OD1 1 
ATOM   2942 N ND2 . ASN A 1 382 ? 12.993 -68.259 -39.892 1.00   112.79 ? 469  ASN A ND2 1 
ATOM   2943 N N   . ILE A 1 383 ? 15.470 -68.013 -36.176 1.00   108.45 ? 470  ILE A N   1 
ATOM   2944 C CA  . ILE A 1 383 ? 15.211 -67.188 -34.997 1.00   106.31 ? 470  ILE A CA  1 
ATOM   2945 C C   . ILE A 1 383 ? 16.430 -66.338 -34.643 1.00   103.88 ? 470  ILE A C   1 
ATOM   2946 O O   . ILE A 1 383 ? 17.578 -66.779 -34.798 1.00   102.31 ? 470  ILE A O   1 
ATOM   2947 C CB  . ILE A 1 383 ? 14.839 -68.074 -33.775 1.00   105.97 ? 470  ILE A CB  1 
ATOM   2948 C CG1 . ILE A 1 383 ? 15.880 -69.192 -33.603 1.00   106.98 ? 470  ILE A CG1 1 
ATOM   2949 C CG2 . ILE A 1 383 ? 13.423 -68.631 -33.918 1.00   103.61 ? 470  ILE A CG2 1 
ATOM   2950 C CD1 . ILE A 1 383 ? 15.640 -70.151 -32.442 1.00   106.99 ? 470  ILE A CD1 1 
ATOM   2951 N N   . ASN A 1 384 ? 16.150 -65.113 -34.197 1.00   101.73 ? 471  ASN A N   1 
ATOM   2952 C CA  . ASN A 1 384 ? 17.152 -64.210 -33.631 1.00   99.59  ? 471  ASN A CA  1 
ATOM   2953 C C   . ASN A 1 384 ? 17.144 -64.381 -32.106 1.00   96.57  ? 471  ASN A C   1 
ATOM   2954 O O   . ASN A 1 384 ? 16.245 -63.894 -31.415 1.00   93.99  ? 471  ASN A O   1 
ATOM   2955 C CB  . ASN A 1 384 ? 16.868 -62.758 -34.036 1.00   98.93  ? 471  ASN A CB  1 
ATOM   2956 C CG  . ASN A 1 384 ? 18.058 -61.856 -33.817 1.00   97.80  ? 471  ASN A CG  1 
ATOM   2957 O OD1 . ASN A 1 384 ? 18.801 -62.016 -32.852 1.00   97.74  ? 471  ASN A OD1 1 
ATOM   2958 N ND2 . ASN A 1 384 ? 18.260 -60.919 -34.728 1.00   97.09  ? 471  ASN A ND2 1 
ATOM   2959 N N   . GLU A 1 385 ? 18.137 -65.106 -31.596 1.00   94.13  ? 472  GLU A N   1 
ATOM   2960 C CA  . GLU A 1 385 ? 18.207 -65.417 -30.172 1.00   92.58  ? 472  GLU A CA  1 
ATOM   2961 C C   . GLU A 1 385 ? 18.132 -64.139 -29.346 1.00   89.81  ? 472  GLU A C   1 
ATOM   2962 O O   . GLU A 1 385 ? 17.397 -64.077 -28.362 1.00   87.11  ? 472  GLU A O   1 
ATOM   2963 C CB  . GLU A 1 385 ? 19.503 -66.163 -29.817 1.00   93.70  ? 472  GLU A CB  1 
ATOM   2964 C CG  . GLU A 1 385 ? 19.501 -67.665 -30.076 1.00   96.71  ? 472  GLU A CG  1 
ATOM   2965 C CD  . GLU A 1 385 ? 20.830 -68.310 -29.715 1.00   98.93  ? 472  GLU A CD  1 
ATOM   2966 O OE1 . GLU A 1 385 ? 21.256 -68.157 -28.551 1.00   103.40 ? 472  GLU A OE1 1 
ATOM   2967 O OE2 . GLU A 1 385 ? 21.461 -68.948 -30.586 1.00   96.10  ? 472  GLU A OE2 1 
ATOM   2968 N N   . ASN A 1 386 ? 18.899 -63.130 -29.754 1.00   87.82  ? 473  ASN A N   1 
ATOM   2969 C CA  . ASN A 1 386 ? 18.977 -61.873 -29.011 1.00   85.32  ? 473  ASN A CA  1 
ATOM   2970 C C   . ASN A 1 386 ? 17.627 -61.161 -29.018 1.00   84.50  ? 473  ASN A C   1 
ATOM   2971 O O   . ASN A 1 386 ? 17.202 -60.635 -27.987 1.00   82.69  ? 473  ASN A O   1 
ATOM   2972 C CB  . ASN A 1 386 ? 20.089 -60.972 -29.566 1.00   84.60  ? 473  ASN A CB  1 
ATOM   2973 C CG  . ASN A 1 386 ? 21.474 -61.436 -29.158 1.00   81.17  ? 473  ASN A CG  1 
ATOM   2974 O OD1 . ASN A 1 386 ? 21.630 -62.152 -28.165 1.00   80.79  ? 473  ASN A OD1 1 
ATOM   2975 N ND2 . ASN A 1 386 ? 22.486 -61.020 -29.914 1.00   74.77  ? 473  ASN A ND2 1 
ATOM   2976 N N   . ALA A 1 387 ? 16.955 -61.161 -30.171 1.00   83.57  ? 474  ALA A N   1 
ATOM   2977 C CA  . ALA A 1 387 ? 15.603 -60.612 -30.282 1.00   82.66  ? 474  ALA A CA  1 
ATOM   2978 C C   . ALA A 1 387 ? 14.641 -61.265 -29.296 1.00   81.45  ? 474  ALA A C   1 
ATOM   2979 O O   . ALA A 1 387 ? 13.798 -60.589 -28.734 1.00   78.86  ? 474  ALA A O   1 
ATOM   2980 C CB  . ALA A 1 387 ? 15.074 -60.756 -31.699 1.00   82.07  ? 474  ALA A CB  1 
ATOM   2981 N N   . ASP A 1 388 ? 14.767 -62.569 -29.078 1.00   83.78  ? 475  ASP A N   1 
ATOM   2982 C CA  . ASP A 1 388 ? 13.888 -63.277 -28.149 1.00   86.21  ? 475  ASP A CA  1 
ATOM   2983 C C   . ASP A 1 388 ? 14.213 -62.940 -26.699 1.00   86.43  ? 475  ASP A C   1 
ATOM   2984 O O   . ASP A 1 388 ? 13.307 -62.928 -25.856 1.00   84.87  ? 475  ASP A O   1 
ATOM   2985 C CB  . ASP A 1 388 ? 13.962 -64.799 -28.348 1.00   90.06  ? 475  ASP A CB  1 
ATOM   2986 C CG  . ASP A 1 388 ? 13.022 -65.317 -29.458 1.00   95.73  ? 475  ASP A CG  1 
ATOM   2987 O OD1 . ASP A 1 388 ? 11.877 -64.806 -29.594 1.00   97.88  ? 475  ASP A OD1 1 
ATOM   2988 O OD2 . ASP A 1 388 ? 13.325 -66.254 -30.243 1.00   99.54  ? 475  ASP A OD2 1 
ATOM   2989 N N   . PHE A 1 389 ? 15.495 -62.698 -26.410 1.00   86.76  ? 476  PHE A N   1 
ATOM   2990 C CA  . PHE A 1 389 ? 15.943 -62.293 -25.065 1.00   86.21  ? 476  PHE A CA  1 
ATOM   2991 C C   . PHE A 1 389 ? 15.363 -60.923 -24.698 1.00   85.98  ? 476  PHE A C   1 
ATOM   2992 O O   . PHE A 1 389 ? 14.862 -60.719 -23.581 1.00   83.43  ? 476  PHE A O   1 
ATOM   2993 C CB  . PHE A 1 389 ? 17.472 -62.215 -24.965 1.00   85.24  ? 476  PHE A CB  1 
ATOM   2994 C CG  . PHE A 1 389 ? 18.166 -63.548 -24.916 1.00   86.59  ? 476  PHE A CG  1 
ATOM   2995 C CD1 . PHE A 1 389 ? 19.476 -63.660 -25.375 1.00   88.72  ? 476  PHE A CD1 1 
ATOM   2996 C CD2 . PHE A 1 389 ? 17.533 -64.685 -24.412 1.00   86.69  ? 476  PHE A CD2 1 
ATOM   2997 C CE1 . PHE A 1 389 ? 20.139 -64.887 -25.336 1.00   90.43  ? 476  PHE A CE1 1 
ATOM   2998 C CE2 . PHE A 1 389 ? 18.183 -65.914 -24.370 1.00   85.32  ? 476  PHE A CE2 1 
ATOM   2999 C CZ  . PHE A 1 389 ? 19.487 -66.020 -24.830 1.00   88.46  ? 476  PHE A CZ  1 
ATOM   3000 N N   . ILE A 1 390 ? 15.432 -60.004 -25.662 1.00   83.88  ? 477  ILE A N   1 
ATOM   3001 C CA  . ILE A 1 390 ? 14.909 -58.653 -25.488 1.00   81.99  ? 477  ILE A CA  1 
ATOM   3002 C C   . ILE A 1 390 ? 13.392 -58.695 -25.296 1.00   82.29  ? 477  ILE A C   1 
ATOM   3003 O O   . ILE A 1 390 ? 12.849 -57.952 -24.485 1.00   80.72  ? 477  ILE A O   1 
ATOM   3004 C CB  . ILE A 1 390 ? 15.274 -57.767 -26.694 1.00   80.80  ? 477  ILE A CB  1 
ATOM   3005 C CG1 . ILE A 1 390 ? 16.779 -57.461 -26.681 1.00   79.23  ? 477  ILE A CG1 1 
ATOM   3006 C CG2 . ILE A 1 390 ? 14.440 -56.492 -26.658 1.00   80.77  ? 477  ILE A CG2 1 
ATOM   3007 C CD1 . ILE A 1 390 ? 17.306 -56.691 -27.887 1.00   79.53  ? 477  ILE A CD1 1 
ATOM   3008 N N   . GLU A 1 391 ? 12.724 -59.580 -26.034 1.00   83.27  ? 478  GLU A N   1 
ATOM   3009 C CA  . GLU A 1 391 ? 11.271 -59.722 -25.981 1.00   83.83  ? 478  GLU A CA  1 
ATOM   3010 C C   . GLU A 1 391 ? 10.836 -60.258 -24.623 1.00   84.63  ? 478  GLU A C   1 
ATOM   3011 O O   . GLU A 1 391 ? 9.900  -59.741 -24.033 1.00   85.31  ? 478  GLU A O   1 
ATOM   3012 C CB  . GLU A 1 391 ? 10.767 -60.664 -27.087 1.00   84.55  ? 478  GLU A CB  1 
ATOM   3013 C CG  . GLU A 1 391 ? 9.254  -60.649 -27.323 1.00   83.21  ? 478  GLU A CG  1 
ATOM   3014 C CD  . GLU A 1 391 ? 8.775  -61.749 -28.262 1.00   81.96  ? 478  GLU A CD  1 
ATOM   3015 O OE1 . GLU A 1 391 ? 9.480  -62.059 -29.243 1.00   80.77  ? 478  GLU A OE1 1 
ATOM   3016 O OE2 . GLU A 1 391 ? 7.689  -62.317 -28.026 1.00   81.29  ? 478  GLU A OE2 1 
ATOM   3017 N N   . LYS A 1 392 ? 11.517 -61.294 -24.143 1.00   86.29  ? 479  LYS A N   1 
ATOM   3018 C CA  . LYS A 1 392 ? 11.188 -61.946 -22.871 1.00   86.52  ? 479  LYS A CA  1 
ATOM   3019 C C   . LYS A 1 392 ? 11.495 -61.101 -21.629 1.00   84.21  ? 479  LYS A C   1 
ATOM   3020 O O   . LYS A 1 392 ? 11.073 -61.444 -20.526 1.00   81.55  ? 479  LYS A O   1 
ATOM   3021 C CB  . LYS A 1 392 ? 11.921 -63.296 -22.776 1.00   88.08  ? 479  LYS A CB  1 
ATOM   3022 C CG  . LYS A 1 392 ? 11.276 -64.433 -23.581 1.00   90.18  ? 479  LYS A CG  1 
ATOM   3023 C CD  . LYS A 1 392 ? 11.806 -65.825 -23.189 1.00   91.24  ? 479  LYS A CD  1 
ATOM   3024 C CE  . LYS A 1 392 ? 11.169 -66.931 -24.041 1.00   91.60  ? 479  LYS A CE  1 
ATOM   3025 N NZ  . LYS A 1 392 ? 11.535 -66.862 -25.492 1.00   91.29  ? 479  LYS A NZ  1 
ATOM   3026 N N   . ALA A 1 393 ? 12.250 -60.019 -21.819 1.00   84.40  ? 480  ALA A N   1 
ATOM   3027 C CA  . ALA A 1 393 ? 12.647 -59.095 -20.751 1.00   82.79  ? 480  ALA A CA  1 
ATOM   3028 C C   . ALA A 1 393 ? 11.780 -57.826 -20.740 1.00   82.21  ? 480  ALA A C   1 
ATOM   3029 O O   . ALA A 1 393 ? 12.053 -56.862 -20.021 1.00   79.13  ? 480  ALA A O   1 
ATOM   3030 C CB  . ALA A 1 393 ? 14.133 -58.727 -20.915 1.00   81.98  ? 480  ALA A CB  1 
ATOM   3031 N N   . GLY A 1 394 ? 10.722 -57.832 -21.546 1.00   83.17  ? 481  GLY A N   1 
ATOM   3032 C CA  . GLY A 1 394 ? 9.848  -56.680 -21.670 1.00   84.20  ? 481  GLY A CA  1 
ATOM   3033 C C   . GLY A 1 394 ? 10.516 -55.502 -22.366 1.00   84.11  ? 481  GLY A C   1 
ATOM   3034 O O   . GLY A 1 394 ? 10.141 -54.354 -22.136 1.00   83.81  ? 481  GLY A O   1 
ATOM   3035 N N   . GLY A 1 395 ? 11.508 -55.790 -23.207 1.00   82.03  ? 482  GLY A N   1 
ATOM   3036 C CA  . GLY A 1 395 ? 12.245 -54.776 -23.940 1.00   79.86  ? 482  GLY A CA  1 
ATOM   3037 C C   . GLY A 1 395 ? 11.582 -54.352 -25.233 1.00   79.69  ? 482  GLY A C   1 
ATOM   3038 O O   . GLY A 1 395 ? 11.793 -53.230 -25.692 1.00   74.35  ? 482  GLY A O   1 
ATOM   3039 N N   . MET A 1 396 ? 10.803 -55.260 -25.824 1.00   82.10  ? 483  MET A N   1 
ATOM   3040 C CA  . MET A 1 396 ? 10.064 -54.989 -27.058 1.00   83.07  ? 483  MET A CA  1 
ATOM   3041 C C   . MET A 1 396 ? 9.019  -53.901 -26.807 1.00   80.31  ? 483  MET A C   1 
ATOM   3042 O O   . MET A 1 396 ? 8.975  -52.885 -27.505 1.00   74.94  ? 483  MET A O   1 
ATOM   3043 C CB  . MET A 1 396 ? 9.389  -56.263 -27.584 1.00   86.42  ? 483  MET A CB  1 
ATOM   3044 C CG  . MET A 1 396 ? 8.812  -56.154 -29.015 1.00   89.78  ? 483  MET A CG  1 
ATOM   3045 S SD  . MET A 1 396 ? 7.917  -57.621 -29.611 1.00   93.33  ? 483  MET A SD  1 
ATOM   3046 C CE  . MET A 1 396 ? 6.477  -57.601 -28.421 1.00   93.62  ? 483  MET A CE  1 
ATOM   3047 N N   . GLU A 1 397 ? 8.189  -54.134 -25.795 1.00   79.88  ? 484  GLU A N   1 
ATOM   3048 C CA  . GLU A 1 397 ? 7.221  -53.141 -25.325 1.00   81.44  ? 484  GLU A CA  1 
ATOM   3049 C C   . GLU A 1 397 ? 7.900  -51.777 -25.107 1.00   79.42  ? 484  GLU A C   1 
ATOM   3050 O O   . GLU A 1 397 ? 7.426  -50.759 -25.602 1.00   78.52  ? 484  GLU A O   1 
ATOM   3051 C CB  . GLU A 1 397 ? 6.517  -53.617 -24.037 1.00   84.11  ? 484  GLU A CB  1 
ATOM   3052 C CG  . GLU A 1 397 ? 7.476  -54.217 -23.002 1.00   87.69  ? 484  GLU A CG  1 
ATOM   3053 C CD  . GLU A 1 397 ? 6.995  -54.235 -21.555 1.00   89.78  ? 484  GLU A CD  1 
ATOM   3054 O OE1 . GLU A 1 397 ? 6.276  -55.194 -21.184 1.00   90.60  ? 484  GLU A OE1 1 
ATOM   3055 O OE2 . GLU A 1 397 ? 7.388  -53.328 -20.776 1.00   88.03  ? 484  GLU A OE2 1 
ATOM   3056 N N   . LYS A 1 398 ? 9.039  -51.764 -24.416 1.00   76.71  ? 485  LYS A N   1 
ATOM   3057 C CA  . LYS A 1 398 ? 9.765  -50.527 -24.108 1.00   72.76  ? 485  LYS A CA  1 
ATOM   3058 C C   . LYS A 1 398 ? 10.300 -49.798 -25.349 1.00   68.67  ? 485  LYS A C   1 
ATOM   3059 O O   . LYS A 1 398 ? 10.270 -48.564 -25.413 1.00   64.31  ? 485  LYS A O   1 
ATOM   3060 C CB  . LYS A 1 398 ? 10.939 -50.811 -23.159 1.00   74.05  ? 485  LYS A CB  1 
ATOM   3061 C CG  . LYS A 1 398 ? 10.607 -51.607 -21.896 1.00   74.01  ? 485  LYS A CG  1 
ATOM   3062 C CD  . LYS A 1 398 ? 10.471 -50.715 -20.667 1.00   73.11  ? 485  LYS A CD  1 
ATOM   3063 C CE  . LYS A 1 398 ? 10.282 -51.523 -19.394 1.00   72.29  ? 485  LYS A CE  1 
ATOM   3064 N NZ  . LYS A 1 398 ? 11.436 -52.405 -19.105 1.00   75.22  ? 485  LYS A NZ  1 
ATOM   3065 N N   . ILE A 1 399 ? 10.828 -50.558 -26.307 1.00   66.26  ? 486  ILE A N   1 
ATOM   3066 C CA  . ILE A 1 399 ? 11.357 -49.987 -27.547 1.00   66.32  ? 486  ILE A CA  1 
ATOM   3067 C C   . ILE A 1 399 ? 10.167 -49.475 -28.352 1.00   67.89  ? 486  ILE A C   1 
ATOM   3068 O O   . ILE A 1 399 ? 10.241 -48.420 -28.989 1.00   64.08  ? 486  ILE A O   1 
ATOM   3069 C CB  . ILE A 1 399 ? 12.148 -51.044 -28.366 1.00   64.80  ? 486  ILE A CB  1 
ATOM   3070 C CG1 . ILE A 1 399 ? 13.443 -51.429 -27.654 1.00   64.09  ? 486  ILE A CG1 1 
ATOM   3071 C CG2 . ILE A 1 399 ? 12.449 -50.541 -29.781 1.00   64.09  ? 486  ILE A CG2 1 
ATOM   3072 C CD1 . ILE A 1 399 ? 14.007 -52.739 -28.134 1.00   64.10  ? 486  ILE A CD1 1 
ATOM   3073 N N   . PHE A 1 400 ? 9.071  -50.229 -28.296 1.00   69.29  ? 487  PHE A N   1 
ATOM   3074 C CA  . PHE A 1 400 ? 7.853  -49.847 -28.999 1.00   71.77  ? 487  PHE A CA  1 
ATOM   3075 C C   . PHE A 1 400 ? 7.412  -48.438 -28.595 1.00   71.63  ? 487  PHE A C   1 
ATOM   3076 O O   . PHE A 1 400 ? 7.179  -47.583 -29.443 1.00   71.18  ? 487  PHE A O   1 
ATOM   3077 C CB  . PHE A 1 400 ? 6.723  -50.861 -28.754 1.00   73.24  ? 487  PHE A CB  1 
ATOM   3078 C CG  . PHE A 1 400 ? 5.387  -50.406 -29.271 1.00   75.21  ? 487  PHE A CG  1 
ATOM   3079 C CD1 . PHE A 1 400 ? 5.183  -50.244 -30.636 1.00   75.08  ? 487  PHE A CD1 1 
ATOM   3080 C CD2 . PHE A 1 400 ? 4.350  -50.109 -28.403 1.00   75.83  ? 487  PHE A CD2 1 
ATOM   3081 C CE1 . PHE A 1 400 ? 3.965  -49.806 -31.130 1.00   77.09  ? 487  PHE A CE1 1 
ATOM   3082 C CE2 . PHE A 1 400 ? 3.131  -49.663 -28.895 1.00   76.23  ? 487  PHE A CE2 1 
ATOM   3083 C CZ  . PHE A 1 400 ? 2.936  -49.508 -30.256 1.00   76.67  ? 487  PHE A CZ  1 
ATOM   3084 N N   . ASN A 1 401 ? 7.330  -48.209 -27.288 1.00   72.88  ? 488  ASN A N   1 
ATOM   3085 C CA  . ASN A 1 401 ? 6.940  -46.919 -26.713 1.00   70.95  ? 488  ASN A CA  1 
ATOM   3086 C C   . ASN A 1 401 ? 7.865  -45.771 -27.073 1.00   68.05  ? 488  ASN A C   1 
ATOM   3087 O O   . ASN A 1 401 ? 7.435  -44.630 -27.137 1.00   69.20  ? 488  ASN A O   1 
ATOM   3088 C CB  . ASN A 1 401 ? 6.795  -47.038 -25.198 1.00   70.73  ? 488  ASN A CB  1 
ATOM   3089 C CG  . ASN A 1 401 ? 5.476  -47.671 -24.819 1.00   75.75  ? 488  ASN A CG  1 
ATOM   3090 O OD1 . ASN A 1 401 ? 5.220  -48.841 -25.116 1.00   78.99  ? 488  ASN A OD1 1 
ATOM   3091 N ND2 . ASN A 1 401 ? 4.598  -46.875 -24.217 1.00   80.57  ? 488  ASN A ND2 1 
ATOM   3092 N N   . CYS A 1 402 ? 9.126  -46.064 -27.355 1.00   66.31  ? 489  CYS A N   1 
ATOM   3093 C CA  . CYS A 1 402 ? 10.051 -45.015 -27.776 1.00   64.93  ? 489  CYS A CA  1 
ATOM   3094 C C   . CYS A 1 402 ? 9.628  -44.348 -29.047 1.00   64.91  ? 489  CYS A C   1 
ATOM   3095 O O   . CYS A 1 402 ? 10.207 -43.334 -29.436 1.00   65.97  ? 489  CYS A O   1 
ATOM   3096 C CB  . CYS A 1 402 ? 11.458 -45.544 -28.035 1.00   63.84  ? 489  CYS A CB  1 
ATOM   3097 S SG  . CYS A 1 402 ? 12.216 -46.053 -26.507 1.00   57.18  ? 489  CYS A SG  1 
ATOM   3098 N N   . GLN A 1 403 ? 8.661  -44.929 -29.738 1.00   68.46  ? 490  GLN A N   1 
ATOM   3099 C CA  . GLN A 1 403 ? 8.271  -44.278 -30.983 1.00   72.05  ? 490  GLN A CA  1 
ATOM   3100 C C   . GLN A 1 403 ? 7.337  -43.098 -30.697 1.00   73.59  ? 490  GLN A C   1 
ATOM   3101 O O   . GLN A 1 403 ? 7.180  -42.216 -31.540 1.00   71.71  ? 490  GLN A O   1 
ATOM   3102 C CB  . GLN A 1 403 ? 7.851  -45.250 -32.105 1.00   71.58  ? 490  GLN A CB  1 
ATOM   3103 C CG  . GLN A 1 403 ? 6.891  -46.388 -31.814 1.00   69.14  ? 490  GLN A CG  1 
ATOM   3104 C CD  . GLN A 1 403 ? 7.023  -47.537 -32.823 1.00   66.38  ? 490  GLN A CD  1 
ATOM   3105 O OE1 . GLN A 1 403 ? 7.397  -47.336 -33.977 1.00   63.56  ? 490  GLN A OE1 1 
ATOM   3106 N NE2 . GLN A 1 403 ? 6.728  -48.741 -32.380 1.00   62.46  ? 490  GLN A NE2 1 
ATOM   3107 N N   . GLN A 1 404 ? 6.855  -43.042 -29.452 1.00   76.01  ? 491  GLN A N   1 
ATOM   3108 C CA  . GLN A 1 404 ? 5.973  -41.987 -28.955 1.00   75.35  ? 491  GLN A CA  1 
ATOM   3109 C C   . GLN A 1 404 ? 6.775  -40.864 -28.282 1.00   75.79  ? 491  GLN A C   1 
ATOM   3110 O O   . GLN A 1 404 ? 6.180  -40.009 -27.631 1.00   75.67  ? 491  GLN A O   1 
ATOM   3111 C CB  . GLN A 1 404 ? 4.860  -42.596 -28.069 1.00   76.02  ? 491  GLN A CB  1 
ATOM   3112 C CG  . GLN A 1 404 ? 3.658  -43.126 -28.919 1.00   77.54  ? 491  GLN A CG  1 
ATOM   3113 C CD  . GLN A 1 404 ? 3.220  -44.571 -28.672 1.00   79.59  ? 491  GLN A CD  1 
ATOM   3114 O OE1 . GLN A 1 404 ? 3.802  -45.521 -29.213 1.00   79.41  ? 491  GLN A OE1 1 
ATOM   3115 N NE2 . GLN A 1 404 ? 2.154  -44.728 -27.891 1.00   78.03  ? 491  GLN A NE2 1 
ATOM   3116 N N   . ASN A 1 405 ? 8.098  -40.862 -28.496 1.00   76.69  ? 492  ASN A N   1 
ATOM   3117 C CA  . ASN A 1 405 ? 9.080  -39.906 -27.947 1.00   76.64  ? 492  ASN A CA  1 
ATOM   3118 C C   . ASN A 1 405 ? 9.240  -38.756 -28.922 1.00   76.21  ? 492  ASN A C   1 
ATOM   3119 O O   . ASN A 1 405 ? 9.223  -38.971 -30.125 1.00   75.51  ? 492  ASN A O   1 
ATOM   3120 C CB  . ASN A 1 405 ? 10.455 -40.593 -27.732 1.00   76.94  ? 492  ASN A CB  1 
ATOM   3121 C CG  . ASN A 1 405 ? 11.578 -39.656 -27.204 1.00   76.37  ? 492  ASN A CG  1 
ATOM   3122 O OD1 . ASN A 1 405 ? 12.661 -40.127 -26.858 1.00   73.44  ? 492  ASN A OD1 1 
ATOM   3123 N ND2 . ASN A 1 405 ? 11.332 -38.356 -27.140 1.00   78.63  ? 492  ASN A ND2 1 
ATOM   3124 N N   . GLU A 1 406 ? 9.455  -37.553 -28.403 1.00   79.02  ? 493  GLU A N   1 
ATOM   3125 C CA  . GLU A 1 406 ? 9.480  -36.342 -29.232 1.00   82.73  ? 493  GLU A CA  1 
ATOM   3126 C C   . GLU A 1 406 ? 10.670 -36.256 -30.154 1.00   83.44  ? 493  GLU A C   1 
ATOM   3127 O O   . GLU A 1 406 ? 10.584 -35.656 -31.224 1.00   83.46  ? 493  GLU A O   1 
ATOM   3128 C CB  . GLU A 1 406 ? 9.492  -35.055 -28.399 1.00   84.34  ? 493  GLU A CB  1 
ATOM   3129 C CG  . GLU A 1 406 ? 10.847 -34.686 -27.793 1.00   85.30  ? 493  GLU A CG  1 
ATOM   3130 C CD  . GLU A 1 406 ? 10.816 -33.317 -27.152 1.00   86.55  ? 493  GLU A CD  1 
ATOM   3131 O OE1 . GLU A 1 406 ? 10.271 -32.373 -27.778 1.00   80.58  ? 493  GLU A OE1 1 
ATOM   3132 O OE2 . GLU A 1 406 ? 11.322 -33.222 -26.012 1.00   91.14  ? 493  GLU A OE2 1 
ATOM   3133 N N   . ASN A 1 407 ? 11.799 -36.777 -29.695 1.00   85.71  ? 494  ASN A N   1 
ATOM   3134 C CA  . ASN A 1 407 ? 13.015 -36.694 -30.489 1.00   87.14  ? 494  ASN A CA  1 
ATOM   3135 C C   . ASN A 1 407 ? 12.794 -37.588 -31.699 1.00   85.38  ? 494  ASN A C   1 
ATOM   3136 O O   . ASN A 1 407 ? 12.398 -38.742 -31.538 1.00   87.04  ? 494  ASN A O   1 
ATOM   3137 C CB  . ASN A 1 407 ? 14.236 -37.114 -29.660 1.00   88.64  ? 494  ASN A CB  1 
ATOM   3138 C CG  . ASN A 1 407 ? 15.553 -36.667 -30.294 1.00   89.22  ? 494  ASN A CG  1 
ATOM   3139 O OD1 . ASN A 1 407 ? 16.025 -37.245 -31.280 1.00   89.41  ? 494  ASN A OD1 1 
ATOM   3140 N ND2 . ASN A 1 407 ? 16.146 -35.621 -29.729 1.00   88.13  ? 494  ASN A ND2 1 
ATOM   3141 N N   . ASP A 1 408 ? 12.964 -37.033 -32.895 1.00   83.39  ? 495  ASP A N   1 
ATOM   3142 C CA  . ASP A 1 408 ? 12.674 -37.767 -34.132 1.00   82.71  ? 495  ASP A CA  1 
ATOM   3143 C C   . ASP A 1 408 ? 13.624 -38.921 -34.353 1.00   80.98  ? 495  ASP A C   1 
ATOM   3144 O O   . ASP A 1 408 ? 13.214 -39.973 -34.832 1.00   78.22  ? 495  ASP A O   1 
ATOM   3145 C CB  . ASP A 1 408 ? 12.760 -36.863 -35.364 1.00   83.61  ? 495  ASP A CB  1 
ATOM   3146 C CG  . ASP A 1 408 ? 11.422 -36.266 -35.758 1.00   85.88  ? 495  ASP A CG  1 
ATOM   3147 O OD1 . ASP A 1 408 ? 10.443 -36.342 -34.975 1.00   89.85  ? 495  ASP A OD1 1 
ATOM   3148 O OD2 . ASP A 1 408 ? 11.278 -35.680 -36.850 1.00   86.24  ? 495  ASP A OD2 1 
ATOM   3149 N N   . LYS A 1 409 ? 14.890 -38.703 -34.013 1.00   81.25  ? 496  LYS A N   1 
ATOM   3150 C CA  . LYS A 1 409 ? 15.904 -39.740 -34.173 1.00   80.39  ? 496  LYS A CA  1 
ATOM   3151 C C   . LYS A 1 409 ? 15.623 -40.985 -33.322 1.00   76.64  ? 496  LYS A C   1 
ATOM   3152 O O   . LYS A 1 409 ? 15.797 -42.096 -33.817 1.00   71.08  ? 496  LYS A O   1 
ATOM   3153 C CB  . LYS A 1 409 ? 17.290 -39.168 -33.881 1.00   82.72  ? 496  LYS A CB  1 
ATOM   3154 C CG  . LYS A 1 409 ? 18.395 -39.735 -34.771 1.00   86.00  ? 496  LYS A CG  1 
ATOM   3155 C CD  . LYS A 1 409 ? 19.533 -40.376 -33.955 1.00   88.37  ? 496  LYS A CD  1 
ATOM   3156 C CE  . LYS A 1 409 ? 20.495 -41.214 -34.824 1.00   87.39  ? 496  LYS A CE  1 
ATOM   3157 N NZ  . LYS A 1 409 ? 21.269 -42.248 -34.083 1.00   87.14  ? 496  LYS A NZ  1 
ATOM   3158 N N   . ILE A 1 410 ? 15.159 -40.794 -32.083 1.00   76.91  ? 497  ILE A N   1 
ATOM   3159 C CA  . ILE A 1 410 ? 14.782 -41.903 -31.186 1.00   76.55  ? 497  ILE A CA  1 
ATOM   3160 C C   . ILE A 1 410 ? 13.632 -42.697 -31.820 1.00   77.59  ? 497  ILE A C   1 
ATOM   3161 O O   . ILE A 1 410 ? 13.631 -43.925 -31.848 1.00   77.58  ? 497  ILE A O   1 
ATOM   3162 C CB  . ILE A 1 410 ? 14.288 -41.419 -29.779 1.00   74.35  ? 497  ILE A CB  1 
ATOM   3163 C CG1 . ILE A 1 410 ? 15.292 -40.508 -29.062 1.00   75.90  ? 497  ILE A CG1 1 
ATOM   3164 C CG2 . ILE A 1 410 ? 13.888 -42.603 -28.896 1.00   71.45  ? 497  ILE A CG2 1 
ATOM   3165 C CD1 . ILE A 1 410 ? 16.564 -41.158 -28.674 1.00   76.03  ? 497  ILE A CD1 1 
ATOM   3166 N N   . TYR A 1 411 ? 12.607 -41.982 -32.271 1.00   77.87  ? 498  TYR A N   1 
ATOM   3167 C CA  . TYR A 1 411 ? 11.431 -42.623 -32.835 1.00   78.15  ? 498  TYR A CA  1 
ATOM   3168 C C   . TYR A 1 411 ? 11.827 -43.443 -34.052 1.00   76.83  ? 498  TYR A C   1 
ATOM   3169 O O   . TYR A 1 411 ? 11.379 -44.568 -34.223 1.00   73.57  ? 498  TYR A O   1 
ATOM   3170 C CB  . TYR A 1 411 ? 10.386 -41.577 -33.237 1.00   79.22  ? 498  TYR A CB  1 
ATOM   3171 C CG  . TYR A 1 411 ? 9.595  -41.985 -34.463 1.00   80.81  ? 498  TYR A CG  1 
ATOM   3172 C CD1 . TYR A 1 411 ? 8.528  -42.865 -34.352 1.00   82.38  ? 498  TYR A CD1 1 
ATOM   3173 C CD2 . TYR A 1 411 ? 9.928  -41.519 -35.737 1.00   79.65  ? 498  TYR A CD2 1 
ATOM   3174 C CE1 . TYR A 1 411 ? 7.800  -43.262 -35.469 1.00   81.72  ? 498  TYR A CE1 1 
ATOM   3175 C CE2 . TYR A 1 411 ? 9.203  -41.908 -36.857 1.00   78.15  ? 498  TYR A CE2 1 
ATOM   3176 C CZ  . TYR A 1 411 ? 8.137  -42.772 -36.717 1.00   78.39  ? 498  TYR A CZ  1 
ATOM   3177 O OH  . TYR A 1 411 ? 7.403  -43.161 -37.813 1.00   76.74  ? 498  TYR A OH  1 
ATOM   3178 N N   . GLU A 1 412 ? 12.665 -42.845 -34.890 1.00   79.54  ? 499  GLU A N   1 
ATOM   3179 C CA  . GLU A 1 412 ? 13.090 -43.426 -36.160 1.00   81.37  ? 499  GLU A CA  1 
ATOM   3180 C C   . GLU A 1 412 ? 13.912 -44.705 -35.961 1.00   81.25  ? 499  GLU A C   1 
ATOM   3181 O O   . GLU A 1 412 ? 13.707 -45.711 -36.631 1.00   82.09  ? 499  GLU A O   1 
ATOM   3182 C CB  . GLU A 1 412 ? 13.860 -42.367 -36.956 1.00   83.08  ? 499  GLU A CB  1 
ATOM   3183 C CG  . GLU A 1 412 ? 14.376 -42.848 -38.299 1.00   89.50  ? 499  GLU A CG  1 
ATOM   3184 C CD  . GLU A 1 412 ? 14.808 -41.717 -39.233 1.00   93.04  ? 499  GLU A CD  1 
ATOM   3185 O OE1 . GLU A 1 412 ? 15.569 -40.820 -38.799 1.00   92.84  ? 499  GLU A OE1 1 
ATOM   3186 O OE2 . GLU A 1 412 ? 14.405 -41.742 -40.421 1.00   95.71  ? 499  GLU A OE2 1 
ATOM   3187 N N   . LYS A 1 413 ? 14.841 -44.682 -35.014 1.00   81.71  ? 500  LYS A N   1 
ATOM   3188 C CA  . LYS A 1 413 ? 15.605 -45.871 -34.653 1.00   79.96  ? 500  LYS A CA  1 
ATOM   3189 C C   . LYS A 1 413 ? 14.747 -46.953 -33.998 1.00   76.71  ? 500  LYS A C   1 
ATOM   3190 O O   . LYS A 1 413 ? 14.991 -48.131 -34.239 1.00   76.96  ? 500  LYS A O   1 
ATOM   3191 C CB  . LYS A 1 413 ? 16.726 -45.486 -33.692 1.00   83.23  ? 500  LYS A CB  1 
ATOM   3192 C CG  . LYS A 1 413 ? 17.921 -46.422 -33.700 1.00   83.99  ? 500  LYS A CG  1 
ATOM   3193 C CD  . LYS A 1 413 ? 18.825 -46.152 -32.501 1.00   83.92  ? 500  LYS A CD  1 
ATOM   3194 C CE  . LYS A 1 413 ? 19.259 -44.692 -32.384 1.00   81.88  ? 500  LYS A CE  1 
ATOM   3195 N NZ  . LYS A 1 413 ? 19.831 -44.236 -33.672 1.00   80.26  ? 500  LYS A NZ  1 
ATOM   3196 N N   . ALA A 1 414 ? 13.785 -46.562 -33.158 1.00   73.02  ? 501  ALA A N   1 
ATOM   3197 C CA  . ALA A 1 414 ? 12.870 -47.491 -32.507 1.00   73.58  ? 501  ALA A CA  1 
ATOM   3198 C C   . ALA A 1 414 ? 11.944 -48.124 -33.539 1.00   76.84  ? 501  ALA A C   1 
ATOM   3199 O O   . ALA A 1 414 ? 11.650 -49.322 -33.501 1.00   75.32  ? 501  ALA A O   1 
ATOM   3200 C CB  . ALA A 1 414 ? 12.044 -46.790 -31.445 1.00   71.94  ? 501  ALA A CB  1 
ATOM   3201 N N   . TYR A 1 415 ? 11.455 -47.288 -34.446 1.00   80.69  ? 502  TYR A N   1 
ATOM   3202 C CA  . TYR A 1 415 ? 10.572 -47.748 -35.504 1.00   83.90  ? 502  TYR A CA  1 
ATOM   3203 C C   . TYR A 1 415 ? 11.349 -48.836 -36.227 1.00   83.97  ? 502  TYR A C   1 
ATOM   3204 O O   . TYR A 1 415 ? 10.885 -49.974 -36.309 1.00   84.59  ? 502  TYR A O   1 
ATOM   3205 C CB  . TYR A 1 415 ? 10.210 -46.596 -36.452 1.00   87.01  ? 502  TYR A CB  1 
ATOM   3206 C CG  . TYR A 1 415 ? 9.508  -47.010 -37.731 1.00   89.92  ? 502  TYR A CG  1 
ATOM   3207 C CD1 . TYR A 1 415 ? 8.115  -47.099 -37.784 1.00   92.54  ? 502  TYR A CD1 1 
ATOM   3208 C CD2 . TYR A 1 415 ? 10.230 -47.295 -38.882 1.00   89.42  ? 502  TYR A CD2 1 
ATOM   3209 C CE1 . TYR A 1 415 ? 7.455  -47.474 -38.943 1.00   92.24  ? 502  TYR A CE1 1 
ATOM   3210 C CE2 . TYR A 1 415 ? 9.586  -47.685 -40.039 1.00   92.05  ? 502  TYR A CE2 1 
ATOM   3211 C CZ  . TYR A 1 415 ? 8.202  -47.774 -40.066 1.00   93.66  ? 502  TYR A CZ  1 
ATOM   3212 O OH  . TYR A 1 415 ? 7.576  -48.167 -41.228 1.00   95.59  ? 502  TYR A OH  1 
ATOM   3213 N N   . LYS A 1 416 ? 12.556 -48.495 -36.671 1.00   82.90  ? 503  LYS A N   1 
ATOM   3214 C CA  . LYS A 1 416 ? 13.410 -49.410 -37.426 1.00   83.16  ? 503  LYS A CA  1 
ATOM   3215 C C   . LYS A 1 416 ? 13.639 -50.747 -36.700 1.00   81.50  ? 503  LYS A C   1 
ATOM   3216 O O   . LYS A 1 416 ? 13.570 -51.806 -37.314 1.00   80.96  ? 503  LYS A O   1 
ATOM   3217 C CB  . LYS A 1 416 ? 14.742 -48.720 -37.758 1.00   84.68  ? 503  LYS A CB  1 
ATOM   3218 C CG  . LYS A 1 416 ? 15.729 -49.528 -38.608 1.00   86.29  ? 503  LYS A CG  1 
ATOM   3219 C CD  . LYS A 1 416 ? 17.053 -48.782 -38.749 1.00   89.39  ? 503  LYS A CD  1 
ATOM   3220 C CE  . LYS A 1 416 ? 18.141 -49.603 -39.440 1.00   90.24  ? 503  LYS A CE  1 
ATOM   3221 N NZ  . LYS A 1 416 ? 19.451 -49.509 -38.743 1.00   90.34  ? 503  LYS A NZ  1 
ATOM   3222 N N   . ILE A 1 417 ? 13.879 -50.706 -35.393 1.00   80.13  ? 504  ILE A N   1 
ATOM   3223 C CA  . ILE A 1 417 ? 14.117 -51.914 -34.601 1.00   79.55  ? 504  ILE A CA  1 
ATOM   3224 C C   . ILE A 1 417 ? 12.887 -52.825 -34.548 1.00   81.74  ? 504  ILE A C   1 
ATOM   3225 O O   . ILE A 1 417 ? 13.016 -54.050 -34.524 1.00   82.21  ? 504  ILE A O   1 
ATOM   3226 C CB  . ILE A 1 417 ? 14.604 -51.518 -33.169 1.00   77.32  ? 504  ILE A CB  1 
ATOM   3227 C CG1 . ILE A 1 417 ? 16.074 -51.075 -33.215 1.00   75.17  ? 504  ILE A CG1 1 
ATOM   3228 C CG2 . ILE A 1 417 ? 14.433 -52.640 -32.152 1.00   75.04  ? 504  ILE A CG2 1 
ATOM   3229 C CD1 . ILE A 1 417 ? 16.586 -50.426 -31.938 1.00   73.07  ? 504  ILE A CD1 1 
ATOM   3230 N N   . ILE A 1 418 ? 11.699 -52.230 -34.516 1.00   83.69  ? 505  ILE A N   1 
ATOM   3231 C CA  . ILE A 1 418 ? 10.462 -52.994 -34.397 1.00   84.38  ? 505  ILE A CA  1 
ATOM   3232 C C   . ILE A 1 418 ? 10.098 -53.651 -35.728 1.00   86.07  ? 505  ILE A C   1 
ATOM   3233 O O   . ILE A 1 418 ? 9.490  -54.719 -35.761 1.00   85.95  ? 505  ILE A O   1 
ATOM   3234 C CB  . ILE A 1 418 ? 9.331  -52.084 -33.886 1.00   83.83  ? 505  ILE A CB  1 
ATOM   3235 C CG1 . ILE A 1 418 ? 9.644  -51.568 -32.479 1.00   83.08  ? 505  ILE A CG1 1 
ATOM   3236 C CG2 . ILE A 1 418 ? 7.998  -52.820 -33.881 1.00   85.39  ? 505  ILE A CG2 1 
ATOM   3237 C CD1 . ILE A 1 418 ? 9.496  -52.595 -31.379 1.00   83.86  ? 505  ILE A CD1 1 
ATOM   3238 N N   . GLU A 1 419 ? 10.499 -53.017 -36.823 1.00   88.35  ? 506  GLU A N   1 
ATOM   3239 C CA  . GLU A 1 419 ? 10.185 -53.491 -38.169 1.00   90.09  ? 506  GLU A CA  1 
ATOM   3240 C C   . GLU A 1 419 ? 11.146 -54.616 -38.541 1.00   91.04  ? 506  GLU A C   1 
ATOM   3241 O O   . GLU A 1 419 ? 10.722 -55.711 -38.922 1.00   92.63  ? 506  GLU A O   1 
ATOM   3242 C CB  . GLU A 1 419 ? 10.302 -52.324 -39.164 1.00   91.02  ? 506  GLU A CB  1 
ATOM   3243 C CG  . GLU A 1 419 ? 10.069 -52.635 -40.639 1.00   91.87  ? 506  GLU A CG  1 
ATOM   3244 C CD  . GLU A 1 419 ? 9.661  -51.393 -41.421 1.00   92.73  ? 506  GLU A CD  1 
ATOM   3245 O OE1 . GLU A 1 419 ? 10.559 -50.711 -41.952 1.00   93.63  ? 506  GLU A OE1 1 
ATOM   3246 O OE2 . GLU A 1 419 ? 8.451  -51.069 -41.481 1.00   91.65  ? 506  GLU A OE2 1 
ATOM   3247 N N   . THR A 1 420 ? 12.438 -54.332 -38.382 1.00   89.27  ? 507  THR A N   1 
ATOM   3248 C CA  . THR A 1 420 ? 13.527 -55.232 -38.758 1.00   86.39  ? 507  THR A CA  1 
ATOM   3249 C C   . THR A 1 420 ? 13.609 -56.523 -37.943 1.00   84.43  ? 507  THR A C   1 
ATOM   3250 O O   . THR A 1 420 ? 13.788 -57.600 -38.510 1.00   85.96  ? 507  THR A O   1 
ATOM   3251 C CB  . THR A 1 420 ? 14.871 -54.478 -38.670 1.00   85.34  ? 507  THR A CB  1 
ATOM   3252 O OG1 . THR A 1 420 ? 14.833 -53.296 -39.476 1.00   85.00  ? 507  THR A OG1 1 
ATOM   3253 C CG2 . THR A 1 420 ? 15.997 -55.255 -39.311 1.00   85.12  ? 507  THR A CG2 1 
ATOM   3254 N N   . TYR A 1 421 ? 13.485 -56.431 -36.625 1.00   82.50  ? 508  TYR A N   1 
ATOM   3255 C CA  . TYR A 1 421 ? 13.698 -57.595 -35.764 1.00   80.09  ? 508  TYR A CA  1 
ATOM   3256 C C   . TYR A 1 421 ? 12.436 -58.111 -35.086 1.00   82.09  ? 508  TYR A C   1 
ATOM   3257 O O   . TYR A 1 421 ? 12.492 -59.124 -34.392 1.00   81.31  ? 508  TYR A O   1 
ATOM   3258 C CB  . TYR A 1 421 ? 14.813 -57.305 -34.744 1.00   77.17  ? 508  TYR A CB  1 
ATOM   3259 C CG  . TYR A 1 421 ? 16.084 -56.790 -35.390 1.00   73.66  ? 508  TYR A CG  1 
ATOM   3260 C CD1 . TYR A 1 421 ? 16.361 -55.427 -35.433 1.00   73.24  ? 508  TYR A CD1 1 
ATOM   3261 C CD2 . TYR A 1 421 ? 16.981 -57.656 -36.003 1.00   70.41  ? 508  TYR A CD2 1 
ATOM   3262 C CE1 . TYR A 1 421 ? 17.505 -54.943 -36.068 1.00   74.73  ? 508  TYR A CE1 1 
ATOM   3263 C CE2 . TYR A 1 421 ? 18.130 -57.183 -36.636 1.00   72.09  ? 508  TYR A CE2 1 
ATOM   3264 C CZ  . TYR A 1 421 ? 18.394 -55.824 -36.665 1.00   73.74  ? 508  TYR A CZ  1 
ATOM   3265 O OH  . TYR A 1 421 ? 19.533 -55.342 -37.285 1.00   73.05  ? 508  TYR A OH  1 
ATOM   3266 N N   . PHE A 1 422 ? 11.303 -57.447 -35.291 1.00   86.46  ? 509  PHE A N   1 
ATOM   3267 C CA  . PHE A 1 422 ? 10.037 -57.921 -34.721 1.00   92.67  ? 509  PHE A CA  1 
ATOM   3268 C C   . PHE A 1 422 ? 8.913  -57.842 -35.759 1.00   96.44  ? 509  PHE A C   1 
ATOM   3269 O O   . PHE A 1 422 ? 7.848  -57.282 -35.485 1.00   96.81  ? 509  PHE A O   1 
ATOM   3270 C CB  . PHE A 1 422 ? 9.661  -57.136 -33.454 1.00   93.84  ? 509  PHE A CB  1 
ATOM   3271 C CG  . PHE A 1 422 ? 10.726 -57.142 -32.383 1.00   93.51  ? 509  PHE A CG  1 
ATOM   3272 C CD1 . PHE A 1 422 ? 11.679 -56.132 -32.320 1.00   92.24  ? 509  PHE A CD1 1 
ATOM   3273 C CD2 . PHE A 1 422 ? 10.770 -58.153 -31.436 1.00   92.54  ? 509  PHE A CD2 1 
ATOM   3274 C CE1 . PHE A 1 422 ? 12.656 -56.128 -31.341 1.00   91.00  ? 509  PHE A CE1 1 
ATOM   3275 C CE2 . PHE A 1 422 ? 11.740 -58.149 -30.449 1.00   91.77  ? 509  PHE A CE2 1 
ATOM   3276 C CZ  . PHE A 1 422 ? 12.683 -57.136 -30.402 1.00   91.43  ? 509  PHE A CZ  1 
ATOM   3277 N N   . GLY A 1 423 ? 9.165  -58.441 -36.926 1.00   100.47 ? 510  GLY A N   1 
ATOM   3278 C CA  . GLY A 1 423 ? 8.283  -58.400 -38.086 1.00   102.96 ? 510  GLY A CA  1 
ATOM   3279 C C   . GLY A 1 423 ? 6.972  -59.182 -38.021 1.00   103.94 ? 510  GLY A C   1 
ATOM   3280 O O   . GLY A 1 423 ? 5.986  -58.799 -38.673 1.00   104.25 ? 510  GLY A O   1 
ATOM   3281 N N   . GLU A 1 424 ? 6.594  -59.765 -38.014 0.0000 112.51 ? 511  GLU A N   1 
ATOM   3282 C CA  . GLU A 1 424 ? 5.186  -60.119 -38.173 0.0000 114.29 ? 511  GLU A CA  1 
ATOM   3283 C C   . GLU A 1 424 ? 4.038  -59.373 -36.575 0.0000 115.04 ? 511  GLU A C   1 
ATOM   3284 O O   . GLU A 1 424 ? 2.874  -58.967 -36.684 0.0000 115.73 ? 511  GLU A O   1 
ATOM   3285 C CB  . GLU A 1 424 ? 5.046  -61.449 -38.926 0.0000 114.80 ? 511  GLU A CB  1 
ATOM   3286 C CG  . GLU A 1 424 ? 3.658  -61.642 -39.509 0.0000 114.86 ? 511  GLU A CG  1 
ATOM   3287 C CD  . GLU A 1 424 ? 2.600  -61.666 -38.423 0.0000 113.98 ? 511  GLU A CD  1 
ATOM   3288 O OE1 . GLU A 1 424 ? 2.601  -62.611 -37.609 0.0000 111.94 ? 511  GLU A OE1 1 
ATOM   3289 O OE2 . GLU A 1 424 ? 1.787  -60.722 -38.364 0.0000 113.89 ? 511  GLU A OE2 1 
ATOM   3290 N N   . GLU A 1 425 ? 4.067  -59.157 -35.726 1.00   107.90 ? 512  GLU A N   1 
ATOM   3291 C CA  . GLU A 1 425 ? 3.648  -59.228 -34.333 1.00   107.92 ? 512  GLU A CA  1 
ATOM   3292 C C   . GLU A 1 425 ? 3.490  -57.844 -33.703 1.00   108.01 ? 512  GLU A C   1 
ATOM   3293 O O   . GLU A 1 425 ? 2.544  -57.615 -32.949 1.00   108.53 ? 512  GLU A O   1 
ATOM   3294 C CB  . GLU A 1 425 ? 4.645  -60.057 -33.517 1.00   107.98 ? 512  GLU A CB  1 
ATOM   3295 C CG  . GLU A 1 425 ? 4.022  -60.942 -32.446 1.00   107.54 ? 512  GLU A CG  1 
ATOM   3296 C CD  . GLU A 1 425 ? 3.650  -60.205 -31.169 1.00   106.91 ? 512  GLU A CD  1 
ATOM   3297 O OE1 . GLU A 1 425 ? 4.396  -59.291 -30.754 1.00   105.55 ? 512  GLU A OE1 1 
ATOM   3298 O OE2 . GLU A 1 425 ? 2.611  -60.557 -30.568 1.00   105.29 ? 512  GLU A OE2 1 
ATOM   3299 N N   . GLU A 1 426 ? 4.375  -56.906 -34.035 1.00   107.81 ? 513  GLU A N   1 
ATOM   3300 C CA  . GLU A 1 426 ? 4.362  -55.596 -33.381 1.00   106.52 ? 513  GLU A CA  1 
ATOM   3301 C C   . GLU A 1 426 ? 4.501  -54.572 -34.487 1.00   102.59 ? 513  GLU A C   1 
ATOM   3302 O O   . GLU A 1 426 ? 5.460  -54.588 -35.256 1.00   102.30 ? 513  GLU A O   1 
ATOM   3303 C CB  . GLU A 1 426 ? 5.430  -55.404 -32.293 1.00   108.15 ? 513  GLU A CB  1 
ATOM   3304 C CG  . GLU A 1 426 ? 5.231  -54.132 -31.469 1.00   110.85 ? 513  GLU A CG  1 
ATOM   3305 C CD  . GLU A 1 426 ? 4.194  -54.240 -30.354 1.00   112.14 ? 513  GLU A CD  1 
ATOM   3306 O OE1 . GLU A 1 426 ? 2.986  -54.283 -30.659 1.00   114.46 ? 513  GLU A OE1 1 
ATOM   3307 O OE2 . GLU A 1 426 ? 4.564  -54.237 -29.159 1.00   112.57 ? 513  GLU A OE2 1 
ATOM   3308 N N   . ASP A 1 427 ? 3.483  -53.729 -34.594 1.00   98.44  ? 514  ASP A N   1 
ATOM   3309 C CA  . ASP A 1 427 ? 3.430  -52.733 -35.649 1.00   95.22  ? 514  ASP A CA  1 
ATOM   3310 C C   . ASP A 1 427 ? 4.419  -51.620 -35.340 1.00   93.64  ? 514  ASP A C   1 
ATOM   3311 O O   . ASP A 1 427 ? 4.760  -51.376 -34.185 1.00   93.31  ? 514  ASP A O   1 
ATOM   3312 C CB  . ASP A 1 427 ? 2.000  -52.198 -35.834 1.00   93.64  ? 514  ASP A CB  1 
ATOM   3313 C CG  . ASP A 1 427 ? 1.368  -51.684 -34.536 1.00   91.44  ? 514  ASP A CG  1 
ATOM   3314 O OD1 . ASP A 1 427 ? 1.140  -50.460 -34.412 1.00   89.16  ? 514  ASP A OD1 1 
ATOM   3315 O OD2 . ASP A 1 427 ? 1.033  -52.426 -33.588 1.00   86.96  ? 514  ASP A OD2 1 
ATOM   3316 N N   . ALA A 1 428 ? 4.949  -51.013 -36.389 1.00   92.77  ? 515  ALA A N   1 
ATOM   3317 C CA  . ALA A 1 428 ? 5.679  -49.773 -36.241 1.00   93.92  ? 515  ALA A CA  1 
ATOM   3318 C C   . ALA A 1 428 ? 4.658  -48.677 -36.580 1.00   96.44  ? 515  ALA A C   1 
ATOM   3319 O O   . ALA A 1 428 ? 3.645  -48.940 -37.227 1.00   97.48  ? 515  ALA A O   1 
ATOM   3320 C CB  . ALA A 1 428 ? 6.873  -49.762 -37.148 1.00   92.47  ? 515  ALA A CB  1 
ATOM   3321 N N   . VAL A 1 429 ? 4.882  -47.463 -36.095 1.00   97.71  ? 516  VAL A N   1 
ATOM   3322 C CA  . VAL A 1 429 ? 3.952  -46.362 -36.295 1.00   99.35  ? 516  VAL A CA  1 
ATOM   3323 C C   . VAL A 1 429 ? 4.590  -45.336 -37.233 1.00   102.95 ? 516  VAL A C   1 
ATOM   3324 O O   . VAL A 1 429 ? 5.798  -45.114 -37.175 1.00   103.86 ? 516  VAL A O   1 
ATOM   3325 C CB  . VAL A 1 429 ? 3.597  -45.709 -34.930 1.00   98.92  ? 516  VAL A CB  1 
ATOM   3326 C CG1 . VAL A 1 429 ? 2.394  -44.794 -35.042 1.00   98.56  ? 516  VAL A CG1 1 
ATOM   3327 C CG2 . VAL A 1 429 ? 3.336  -46.774 -33.861 1.00   98.62  ? 516  VAL A CG2 1 
ATOM   3328 N N   . ASP A 1 430 ? 3.799  -44.734 -38.119 1.00   106.51 ? 517  ASP A N   1 
ATOM   3329 C CA  . ASP A 1 430 ? 4.272  -43.630 -38.969 1.00   108.77 ? 517  ASP A CA  1 
ATOM   3330 C C   . ASP A 1 430 ? 3.739  -42.260 -38.471 1.00   110.40 ? 517  ASP A C   1 
ATOM   3331 O O   . ASP A 1 430 ? 3.137  -42.215 -37.401 1.00   110.58 ? 517  ASP A O   1 
ATOM   3332 C CB  . ASP A 1 430 ? 3.905  -43.909 -40.428 1.00   108.96 ? 517  ASP A CB  1 
ATOM   3333 C CG  . ASP A 1 430 ? 5.082  -44.430 -41.237 1.00   108.58 ? 517  ASP A CG  1 
ATOM   3334 O OD1 . ASP A 1 430 ? 6.247  -44.273 -40.810 1.00   108.11 ? 517  ASP A OD1 1 
ATOM   3335 O OD2 . ASP A 1 430 ? 4.941  -45.006 -42.333 1.00   109.96 ? 517  ASP A OD2 1 
ATOM   3336 N N   . GLU A 1 431 ? 3.858  -41.169 -39.238 1.00   112.34 ? 518  GLU A N   1 
ATOM   3337 C CA  . GLU A 1 431 ? 3.588  -39.805 -38.731 1.00   114.32 ? 518  GLU A CA  1 
ATOM   3338 C C   . GLU A 1 431 ? 2.201  -39.098 -38.756 1.00   116.81 ? 518  GLU A C   1 
ATOM   3339 O O   . GLU A 1 431 ? 2.032  -38.040 -39.363 1.00   116.56 ? 518  GLU A O   1 
ATOM   3340 C CB  . GLU A 1 431 ? 4.670  -38.844 -39.263 1.00   113.93 ? 518  GLU A CB  1 
ATOM   3341 C CG  . GLU A 1 431 ? 4.351  -38.032 -40.513 1.00   112.62 ? 518  GLU A CG  1 
ATOM   3342 C CD  . GLU A 1 431 ? 4.298  -36.533 -40.252 1.00   111.22 ? 518  GLU A CD  1 
ATOM   3343 O OE1 . GLU A 1 431 ? 5.333  -35.861 -40.437 1.00   109.82 ? 518  GLU A OE1 1 
ATOM   3344 O OE2 . GLU A 1 431 ? 3.235  -36.012 -39.854 1.00   107.90 ? 518  GLU A OE2 1 
ATOM   3345 N N   . THR A 1 432 ? 1.215  -39.649 -38.048 1.00   119.96 ? 519  THR A N   1 
ATOM   3346 C CA  . THR A 1 432 ? 0.005  -38.903 -37.664 1.00   120.80 ? 519  THR A CA  1 
ATOM   3347 C C   . THR A 1 432 ? 0.256  -38.281 -36.280 1.00   121.55 ? 519  THR A C   1 
ATOM   3348 O O   . THR A 1 432 ? -0.600 -37.532 -35.791 1.00   122.22 ? 519  THR A O   1 
ATOM   3349 C CB  . THR A 1 432 ? -1.270 -39.798 -37.635 1.00   120.58 ? 519  THR A CB  1 
ATOM   3350 O OG1 . THR A 1 432 ? -1.877 -39.817 -38.933 1.00   122.63 ? 519  THR A OG1 1 
ATOM   3351 C CG2 . THR A 1 432 ? -2.393 -39.233 -36.743 1.00   119.44 ? 519  THR A CG2 1 
ATOM   3352 N N   . MET A 1 433 ? 1.407  -38.606 -35.666 1.00   120.42 ? 520  MET A N   1 
ATOM   3353 C CA  . MET A 1 433 ? 1.852  -38.057 -34.375 1.00   118.30 ? 520  MET A CA  1 
ATOM   3354 C C   . MET A 1 433 ? 2.376  -36.644 -34.574 1.00   117.28 ? 520  MET A C   1 
ATOM   3355 O O   . MET A 1 433 ? 3.563  -36.316 -34.543 1.00   114.76 ? 520  MET A O   1 
ATOM   3356 C CB  . MET A 1 433 ? 2.884  -38.929 -33.669 1.00   117.86 ? 520  MET A CB  1 
ATOM   3357 C CG  . MET A 1 433 ? 2.267  -39.777 -32.574 1.00   116.69 ? 520  MET A CG  1 
ATOM   3358 S SD  . MET A 1 433 ? 3.546  -40.285 -31.440 1.00   114.07 ? 520  MET A SD  1 
ATOM   3359 C CE  . MET A 1 433 ? 4.378  -41.500 -32.445 1.00   114.76 ? 520  MET A CE  1 
ATOM   3360 N N   . ALA A 1 434 ? 1.352  -35.838 -34.784 1.00   117.72 ? 521  ALA A N   1 
ATOM   3361 C CA  . ALA A 1 434 ? 1.379  -34.426 -35.061 1.00   117.01 ? 521  ALA A CA  1 
ATOM   3362 C C   . ALA A 1 434 ? 1.074  -33.678 -33.757 1.00   116.92 ? 521  ALA A C   1 
ATOM   3363 O O   . ALA A 1 434 ? 1.532  -32.542 -33.622 1.00   116.89 ? 521  ALA A O   1 
ATOM   3364 C CB  . ALA A 1 434 ? 0.364  -34.150 -36.157 1.00   116.90 ? 521  ALA A CB  1 
ATOM   3365 N N   . PRO A 1 435 ? 0.301  -34.261 -32.824 1.00   116.73 ? 522  PRO A N   1 
ATOM   3366 C CA  . PRO A 1 435 ? 0.326  -33.789 -31.431 1.00   115.65 ? 522  PRO A CA  1 
ATOM   3367 C C   . PRO A 1 435 ? 1.545  -34.458 -30.790 1.00   114.70 ? 522  PRO A C   1 
ATOM   3368 O O   . PRO A 1 435 ? 1.462  -35.561 -30.244 1.00   114.10 ? 522  PRO A O   1 
ATOM   3369 C CB  . PRO A 1 435 ? -0.996 -34.302 -30.831 1.00   115.13 ? 522  PRO A CB  1 
ATOM   3370 C CG  . PRO A 1 435 ? -1.718 -34.991 -31.933 1.00   114.52 ? 522  PRO A CG  1 
ATOM   3371 C CD  . PRO A 1 435 ? -0.693 -35.345 -32.966 1.00   115.68 ? 522  PRO A CD  1 
ATOM   3372 N N   . GLN A 1 436 ? 2.676  -33.766 -30.890 1.00   113.66 ? 523  GLN A N   1 
ATOM   3373 C CA  . GLN A 1 436 ? 4.006  -34.285 -30.549 1.00   112.70 ? 523  GLN A CA  1 
ATOM   3374 C C   . GLN A 1 436 ? 4.105  -34.896 -29.145 1.00   109.04 ? 523  GLN A C   1 
ATOM   3375 O O   . GLN A 1 436 ? 3.067  -35.206 -28.560 1.00   107.50 ? 523  GLN A O   1 
ATOM   3376 C CB  . GLN A 1 436 ? 5.019  -33.154 -30.768 1.00   114.42 ? 523  GLN A CB  1 
ATOM   3377 C CG  . GLN A 1 436 ? 5.002  -32.639 -32.216 1.00   116.21 ? 523  GLN A CG  1 
ATOM   3378 C CD  . GLN A 1 436 ? 5.573  -31.245 -32.381 1.00   117.73 ? 523  GLN A CD  1 
ATOM   3379 O OE1 . GLN A 1 436 ? 6.437  -30.821 -31.617 1.00   120.82 ? 523  GLN A OE1 1 
ATOM   3380 N NE2 . GLN A 1 436 ? 5.101  -30.532 -33.391 1.00   118.85 ? 523  GLN A NE2 1 
ATOM   3381 N N   . ASN A 1 437 ? 5.310  -35.132 -28.616 1.00   105.64 ? 524  ASN A N   1 
ATOM   3382 C CA  . ASN A 1 437 ? 5.426  -35.610 -27.229 1.00   101.42 ? 524  ASN A CA  1 
ATOM   3383 C C   . ASN A 1 437 ? 6.773  -35.740 -26.551 1.00   102.22 ? 524  ASN A C   1 
ATOM   3384 O O   . ASN A 1 437 ? 7.616  -36.419 -27.108 1.00   103.05 ? 524  ASN A O   1 
ATOM   3385 C CB  . ASN A 1 437 ? 4.912  -37.040 -27.077 1.00   96.94  ? 524  ASN A CB  1 
ATOM   3386 C CG  . ASN A 1 437 ? 4.899  -37.468 -25.622 1.00   90.53  ? 524  ASN A CG  1 
ATOM   3387 O OD1 . ASN A 1 437 ? 5.722  -38.246 -25.158 1.00   85.04  ? 524  ASN A OD1 1 
ATOM   3388 N ND2 . ASN A 1 437 ? 3.980  -36.901 -24.878 1.00   85.33  ? 524  ASN A ND2 1 
ATOM   3389 N N   . ALA A 1 438 ? 6.936  -35.210 -25.336 1.00   103.45 ? 525  ALA A N   1 
ATOM   3390 C CA  . ALA A 1 438 ? 8.077  -35.535 -24.461 1.00   103.53 ? 525  ALA A CA  1 
ATOM   3391 C C   . ALA A 1 438 ? 8.624  -34.432 -23.562 1.00   104.03 ? 525  ALA A C   1 
ATOM   3392 O O   . ALA A 1 438 ? 8.311  -33.246 -23.706 1.00   101.99 ? 525  ALA A O   1 
ATOM   3393 C CB  . ALA A 1 438 ? 9.251  -36.149 -25.216 1.00   103.18 ? 525  ALA A CB  1 
ATOM   3394 N N   . GLY A 1 439 ? 9.466  -34.889 -22.634 1.00   106.18 ? 526  GLY A N   1 
ATOM   3395 C CA  . GLY A 1 439 ? 10.126 -34.049 -21.654 1.00   107.38 ? 526  GLY A CA  1 
ATOM   3396 C C   . GLY A 1 439 ? 10.482 -34.837 -20.409 1.00   107.56 ? 526  GLY A C   1 
ATOM   3397 O O   . GLY A 1 439 ? 11.611 -35.319 -20.334 1.00   108.08 ? 526  GLY A O   1 
ATOM   3398 N N   . ASN A 1 440 ? 9.643  -34.977 -19.514 1.00   107.35 ? 527  ASN A N   1 
ATOM   3399 N N   . GLU B 1 1   ? 51.837 -38.566 9.780   1.00   74.50  ? 88   GLU B N   1 
ATOM   3400 C CA  . GLU B 1 1   ? 51.524 -39.107 11.149  1.00   72.45  ? 88   GLU B CA  1 
ATOM   3401 C C   . GLU B 1 1   ? 50.053 -39.019 11.546  1.00   65.69  ? 88   GLU B C   1 
ATOM   3402 O O   . GLU B 1 1   ? 49.775 -38.736 12.686  1.00   66.48  ? 88   GLU B O   1 
ATOM   3403 C CB  . GLU B 1 1   ? 52.374 -38.401 12.217  1.00   75.50  ? 88   GLU B CB  1 
ATOM   3404 C CG  . GLU B 1 1   ? 52.456 -39.118 13.565  1.00   76.12  ? 88   GLU B CG  1 
ATOM   3405 C CD  . GLU B 1 1   ? 52.021 -38.249 14.732  1.00   77.27  ? 88   GLU B CD  1 
ATOM   3406 O OE1 . GLU B 1 1   ? 52.066 -38.740 15.892  1.00   74.81  ? 88   GLU B OE1 1 
ATOM   3407 O OE2 . GLU B 1 1   ? 51.629 -37.085 14.462  1.00   74.90  ? 88   GLU B OE2 1 
ATOM   3408 N N   . LEU B 1 2   ? 49.132 -39.312 10.632  1.00   61.15  ? 89   LEU B N   1 
ATOM   3409 C CA  . LEU B 1 2   ? 47.684 -39.264 10.854  1.00   53.30  ? 89   LEU B CA  1 
ATOM   3410 C C   . LEU B 1 2   ? 46.913 -40.551 11.165  1.00   49.86  ? 89   LEU B C   1 
ATOM   3411 O O   . LEU B 1 2   ? 45.922 -40.547 11.900  1.00   43.76  ? 89   LEU B O   1 
ATOM   3412 C CB  . LEU B 1 2   ? 47.054 -38.728 9.584   1.00   55.41  ? 89   LEU B CB  1 
ATOM   3413 C CG  . LEU B 1 2   ? 45.735 -37.990 9.786   1.00   59.50  ? 89   LEU B CG  1 
ATOM   3414 C CD1 . LEU B 1 2   ? 45.996 -36.532 10.080  1.00   61.06  ? 89   LEU B CD1 1 
ATOM   3415 C CD2 . LEU B 1 2   ? 44.887 -38.105 8.546   1.00   61.56  ? 89   LEU B CD2 1 
ATOM   3416 N N   . PRO B 1 3   ? 47.266 -41.670 10.546  1.00   49.31  ? 90   PRO B N   1 
ATOM   3417 C CA  . PRO B 1 3   ? 46.593 -42.921 10.920  1.00   48.15  ? 90   PRO B CA  1 
ATOM   3418 C C   . PRO B 1 3   ? 46.799 -43.244 12.400  1.00   46.90  ? 90   PRO B C   1 
ATOM   3419 O O   . PRO B 1 3   ? 45.914 -43.837 13.023  1.00   41.19  ? 90   PRO B O   1 
ATOM   3420 C CB  . PRO B 1 3   ? 47.284 -43.966 10.064  1.00   46.19  ? 90   PRO B CB  1 
ATOM   3421 C CG  . PRO B 1 3   ? 47.824 -43.171 8.913   1.00   47.83  ? 90   PRO B CG  1 
ATOM   3422 C CD  . PRO B 1 3   ? 48.256 -41.872 9.471   1.00   46.70  ? 90   PRO B CD  1 
ATOM   3423 N N   . GLN B 1 4   ? 47.963 -42.853 12.921  1.00   47.62  ? 91   GLN B N   1 
ATOM   3424 C CA  . GLN B 1 4   ? 48.303 -42.991 14.341  1.00   48.33  ? 91   GLN B CA  1 
ATOM   3425 C C   . GLN B 1 4   ? 47.337 -42.184 15.223  1.00   47.85  ? 91   GLN B C   1 
ATOM   3426 O O   . GLN B 1 4   ? 46.786 -42.703 16.198  1.00   46.76  ? 91   GLN B O   1 
ATOM   3427 C CB  . GLN B 1 4   ? 49.742 -42.522 14.611  1.00   48.85  ? 91   GLN B CB  1 
ATOM   3428 C CG  . GLN B 1 4   ? 50.803 -43.405 13.991  1.00   48.65  ? 91   GLN B CG  1 
ATOM   3429 C CD  . GLN B 1 4   ? 52.222 -43.078 14.428  1.00   48.29  ? 91   GLN B CD  1 
ATOM   3430 O OE1 . GLN B 1 4   ? 52.815 -42.142 13.904  1.00   49.82  ? 91   GLN B OE1 1 
ATOM   3431 N NE2 . GLN B 1 4   ? 52.790 -43.878 15.339  1.00   42.32  ? 91   GLN B NE2 1 
ATOM   3432 N N   . MET B 1 5   ? 47.121 -40.918 14.872  1.00   46.50  ? 92   MET B N   1 
ATOM   3433 C CA  . MET B 1 5   ? 46.177 -40.044 15.589  1.00   41.92  ? 92   MET B CA  1 
ATOM   3434 C C   . MET B 1 5   ? 44.753 -40.614 15.596  1.00   39.93  ? 92   MET B C   1 
ATOM   3435 O O   . MET B 1 5   ? 44.025 -40.607 16.599  1.00   31.34  ? 92   MET B O   1 
ATOM   3436 C CB  . MET B 1 5   ? 46.161 -38.655 14.944  1.00   41.36  ? 92   MET B CB  1 
ATOM   3437 C CG  . MET B 1 5   ? 47.479 -37.857 15.076  1.00   44.23  ? 92   MET B CG  1 
ATOM   3438 S SD  . MET B 1 5   ? 47.459 -36.344 14.041  1.00   46.94  ? 92   MET B SD  1 
ATOM   3439 C CE  . MET B 1 5   ? 45.965 -35.548 14.714  1.00   43.99  ? 92   MET B CE  1 
ATOM   3440 N N   . THR B 1 6   ? 44.342 -41.127 14.446  1.00   39.63  ? 93   THR B N   1 
ATOM   3441 C CA  . THR B 1 6   ? 43.024 -41.709 14.340  1.00   37.61  ? 93   THR B CA  1 
ATOM   3442 C C   . THR B 1 6   ? 42.855 -42.813 15.377  1.00   45.42  ? 93   THR B C   1 
ATOM   3443 O O   . THR B 1 6   ? 41.805 -42.923 16.024  1.00   48.32  ? 93   THR B O   1 
ATOM   3444 C CB  . THR B 1 6   ? 42.855 -42.259 12.933  1.00   38.56  ? 93   THR B CB  1 
ATOM   3445 O OG1 . THR B 1 6   ? 43.083 -41.215 11.975  1.00   42.14  ? 93   THR B OG1 1 
ATOM   3446 C CG2 . THR B 1 6   ? 41.434 -42.724 12.677  1.00   42.73  ? 93   THR B CG2 1 
ATOM   3447 N N   . GLN B 1 7   ? 43.878 -43.658 15.514  1.00   49.59  ? 94   GLN B N   1 
ATOM   3448 C CA  . GLN B 1 7   ? 43.829 -44.799 16.425  1.00   48.27  ? 94   GLN B CA  1 
ATOM   3449 C C   . GLN B 1 7   ? 43.857 -44.348 17.890  1.00   45.88  ? 94   GLN B C   1 
ATOM   3450 O O   . GLN B 1 7   ? 43.186 -44.936 18.728  1.00   43.88  ? 94   GLN B O   1 
ATOM   3451 C CB  . GLN B 1 7   ? 45.033 -45.711 16.184  1.00   47.63  ? 94   GLN B CB  1 
ATOM   3452 C CG  . GLN B 1 7   ? 44.976 -46.425 14.872  1.00   45.82  ? 94   GLN B CG  1 
ATOM   3453 C CD  . GLN B 1 7   ? 46.175 -47.329 14.668  1.00   41.50  ? 94   GLN B CD  1 
ATOM   3454 O OE1 . GLN B 1 7   ? 47.283 -47.002 15.101  1.00   34.11  ? 94   GLN B OE1 1 
ATOM   3455 N NE2 . GLN B 1 7   ? 45.959 -48.449 13.979  1.00   42.07  ? 94   GLN B NE2 1 
ATOM   3456 N N   . GLN B 1 8   ? 44.667 -43.342 18.182  1.00   40.31  ? 95   GLN B N   1 
ATOM   3457 C CA  . GLN B 1 8   ? 44.744 -42.761 19.506  1.00   47.18  ? 95   GLN B CA  1 
ATOM   3458 C C   . GLN B 1 8   ? 43.400 -42.150 19.930  1.00   53.20  ? 95   GLN B C   1 
ATOM   3459 O O   . GLN B 1 8   ? 43.021 -42.175 21.110  1.00   52.42  ? 95   GLN B O   1 
ATOM   3460 C CB  . GLN B 1 8   ? 45.866 -41.718 19.487  1.00   48.51  ? 95   GLN B CB  1 
ATOM   3461 C CG  . GLN B 1 8   ? 46.158 -40.944 20.759  1.00   53.10  ? 95   GLN B CG  1 
ATOM   3462 C CD  . GLN B 1 8   ? 47.280 -39.905 20.574  1.00   58.04  ? 95   GLN B CD  1 
ATOM   3463 O OE1 . GLN B 1 8   ? 47.839 -39.742 19.485  1.00   54.52  ? 95   GLN B OE1 1 
ATOM   3464 N NE2 . GLN B 1 8   ? 47.614 -39.210 21.655  1.00   66.37  ? 95   GLN B NE2 1 
ATOM   3465 N N   . LEU B 1 9   ? 42.651 -41.646 18.950  1.00   56.65  ? 96   LEU B N   1 
ATOM   3466 C CA  . LEU B 1 9   ? 41.341 -41.028 19.191  1.00   55.23  ? 96   LEU B CA  1 
ATOM   3467 C C   . LEU B 1 9   ? 40.301 -42.097 19.431  1.00   54.03  ? 96   LEU B C   1 
ATOM   3468 O O   . LEU B 1 9   ? 39.198 -41.786 19.847  1.00   55.21  ? 96   LEU B O   1 
ATOM   3469 C CB  . LEU B 1 9   ? 40.887 -40.204 17.975  1.00   55.43  ? 96   LEU B CB  1 
ATOM   3470 C CG  . LEU B 1 9   ? 39.814 -39.126 18.163  1.00   53.83  ? 96   LEU B CG  1 
ATOM   3471 C CD1 . LEU B 1 9   ? 40.470 -37.819 18.581  1.00   54.33  ? 96   LEU B CD1 1 
ATOM   3472 C CD2 . LEU B 1 9   ? 38.986 -38.899 16.912  1.00   54.51  ? 96   LEU B CD2 1 
ATOM   3473 N N   . ASN B 1 10  ? 40.613 -43.348 19.128  1.00   53.80  ? 97   ASN B N   1 
ATOM   3474 C CA  . ASN B 1 10  ? 39.623 -44.400 19.277  1.00   55.38  ? 97   ASN B CA  1 
ATOM   3475 C C   . ASN B 1 10  ? 39.934 -45.225 20.526  1.00   57.08  ? 97   ASN B C   1 
ATOM   3476 O O   . ASN B 1 10  ? 39.166 -46.105 20.884  1.00   55.77  ? 97   ASN B O   1 
ATOM   3477 C CB  . ASN B 1 10  ? 39.510 -45.241 17.992  1.00   55.99  ? 97   ASN B CB  1 
ATOM   3478 C CG  . ASN B 1 10  ? 38.857 -44.495 16.815  1.00   55.31  ? 97   ASN B CG  1 
ATOM   3479 O OD1 . ASN B 1 10  ? 37.754 -43.965 16.927  1.00   55.82  ? 97   ASN B OD1 1 
ATOM   3480 N ND2 . ASN B 1 10  ? 39.531 -44.485 15.669  1.00   57.33  ? 97   ASN B ND2 1 
ATOM   3481 N N   . SER B 1 11  ? 41.046 -44.918 21.193  1.00   62.77  ? 98   SER B N   1 
ATOM   3482 C CA  . SER B 1 11  ? 41.431 -45.545 22.459  1.00   67.42  ? 98   SER B CA  1 
ATOM   3483 C C   . SER B 1 11  ? 40.329 -45.333 23.498  1.00   71.67  ? 98   SER B C   1 
ATOM   3484 O O   . SER B 1 11  ? 39.683 -44.281 23.488  1.00   73.40  ? 98   SER B O   1 
ATOM   3485 C CB  . SER B 1 11  ? 42.743 -44.906 22.942  1.00   68.11  ? 98   SER B CB  1 
ATOM   3486 O OG  . SER B 1 11  ? 42.936 -45.013 24.343  1.00   66.92  ? 98   SER B OG  1 
ATOM   3487 N N   . ASP B 1 12  ? 40.091 -46.311 24.372  1.00   74.97  ? 99   ASP B N   1 
ATOM   3488 C CA  . ASP B 1 12  ? 39.110 -46.145 25.467  1.00   77.24  ? 99   ASP B CA  1 
ATOM   3489 C C   . ASP B 1 12  ? 39.663 -45.446 26.704  1.00   74.22  ? 99   ASP B C   1 
ATOM   3490 O O   . ASP B 1 12  ? 38.897 -45.173 27.619  1.00   69.76  ? 99   ASP B O   1 
ATOM   3491 C CB  . ASP B 1 12  ? 38.493 -47.469 25.930  1.00   78.50  ? 99   ASP B CB  1 
ATOM   3492 C CG  . ASP B 1 12  ? 37.639 -48.092 24.879  1.00   80.70  ? 99   ASP B CG  1 
ATOM   3493 O OD1 . ASP B 1 12  ? 38.226 -48.554 23.875  1.00   84.94  ? 99   ASP B OD1 1 
ATOM   3494 O OD2 . ASP B 1 12  ? 36.395 -48.131 24.973  1.00   81.64  ? 99   ASP B OD2 1 
ATOM   3495 N N   . ASP B 1 13  ? 40.974 -45.220 26.734  1.00   75.19  ? 100  ASP B N   1 
ATOM   3496 C CA  . ASP B 1 13  ? 41.643 -44.446 27.778  1.00   78.82  ? 100  ASP B CA  1 
ATOM   3497 C C   . ASP B 1 13  ? 41.309 -42.963 27.579  1.00   79.71  ? 100  ASP B C   1 
ATOM   3498 O O   . ASP B 1 13  ? 41.689 -42.374 26.573  1.00   80.82  ? 100  ASP B O   1 
ATOM   3499 C CB  . ASP B 1 13  ? 43.158 -44.707 27.697  1.00   80.85  ? 100  ASP B CB  1 
ATOM   3500 C CG  . ASP B 1 13  ? 43.990 -43.836 28.633  1.00   85.84  ? 100  ASP B CG  1 
ATOM   3501 O OD1 . ASP B 1 13  ? 43.623 -43.611 29.808  1.00   91.47  ? 100  ASP B OD1 1 
ATOM   3502 O OD2 . ASP B 1 13  ? 45.083 -43.354 28.278  1.00   89.84  ? 100  ASP B OD2 1 
ATOM   3503 N N   . MET B 1 14  ? 40.589 -42.359 28.521  1.00   81.89  ? 101  MET B N   1 
ATOM   3504 C CA  . MET B 1 14  ? 40.196 -40.955 28.406  1.00   83.34  ? 101  MET B CA  1 
ATOM   3505 C C   . MET B 1 14  ? 41.404 -40.040 28.258  1.00   82.72  ? 101  MET B C   1 
ATOM   3506 O O   . MET B 1 14  ? 41.340 -39.011 27.588  1.00   80.30  ? 101  MET B O   1 
ATOM   3507 C CB  . MET B 1 14  ? 39.349 -40.522 29.600  1.00   86.27  ? 101  MET B CB  1 
ATOM   3508 C CG  . MET B 1 14  ? 37.947 -41.164 29.630  1.00   89.14  ? 101  MET B CG  1 
ATOM   3509 S SD  . MET B 1 14  ? 36.630 -40.092 28.976  1.00   91.90  ? 101  MET B SD  1 
ATOM   3510 C CE  . MET B 1 14  ? 35.460 -39.991 30.404  1.00   92.55  ? 101  MET B CE  1 
ATOM   3511 N N   . GLN B 1 15  ? 42.515 -40.431 28.867  1.00   83.13  ? 102  GLN B N   1 
ATOM   3512 C CA  . GLN B 1 15  ? 43.744 -39.652 28.784  1.00   84.08  ? 102  GLN B CA  1 
ATOM   3513 C C   . GLN B 1 15  ? 44.238 -39.490 27.339  1.00   81.72  ? 102  GLN B C   1 
ATOM   3514 O O   . GLN B 1 15  ? 44.738 -38.421 26.975  1.00   79.20  ? 102  GLN B O   1 
ATOM   3515 C CB  . GLN B 1 15  ? 44.833 -40.314 29.649  1.00   87.24  ? 102  GLN B CB  1 
ATOM   3516 C CG  . GLN B 1 15  ? 46.191 -39.611 29.671  1.00   90.15  ? 102  GLN B CG  1 
ATOM   3517 C CD  . GLN B 1 15  ? 46.044 -38.110 29.860  1.00   93.19  ? 102  GLN B CD  1 
ATOM   3518 O OE1 . GLN B 1 15  ? 45.196 -37.658 30.638  1.00   93.52  ? 102  GLN B OE1 1 
ATOM   3519 N NE2 . GLN B 1 15  ? 46.842 -37.335 29.126  1.00   96.34  ? 102  GLN B NE2 1 
ATOM   3520 N N   . GLU B 1 16  ? 44.126 -40.556 26.542  1.00   79.59  ? 103  GLU B N   1 
ATOM   3521 C CA  . GLU B 1 16  ? 44.619 -40.575 25.156  1.00   77.59  ? 103  GLU B CA  1 
ATOM   3522 C C   . GLU B 1 16  ? 43.620 -39.914 24.194  1.00   74.34  ? 103  GLU B C   1 
ATOM   3523 O O   . GLU B 1 16  ? 44.030 -39.214 23.260  1.00   71.14  ? 103  GLU B O   1 
ATOM   3524 C CB  . GLU B 1 16  ? 44.982 -42.003 24.696  1.00   78.38  ? 103  GLU B CB  1 
ATOM   3525 C CG  . GLU B 1 16  ? 46.212 -42.622 25.370  1.00   79.46  ? 103  GLU B CG  1 
ATOM   3526 C CD  . GLU B 1 16  ? 47.554 -42.050 24.919  1.00   78.40  ? 103  GLU B CD  1 
ATOM   3527 O OE1 . GLU B 1 16  ? 48.216 -41.377 25.732  1.00   76.29  ? 103  GLU B OE1 1 
ATOM   3528 O OE2 . GLU B 1 16  ? 47.975 -42.290 23.765  1.00   80.43  ? 103  GLU B OE2 1 
ATOM   3529 N N   . GLN B 1 17  ? 42.326 -40.138 24.440  1.00   70.21  ? 104  GLN B N   1 
ATOM   3530 C CA  . GLN B 1 17  ? 41.245 -39.466 23.717  1.00   66.61  ? 104  GLN B CA  1 
ATOM   3531 C C   . GLN B 1 17  ? 41.450 -37.954 23.686  1.00   65.12  ? 104  GLN B C   1 
ATOM   3532 O O   . GLN B 1 17  ? 41.285 -37.314 22.648  1.00   65.79  ? 104  GLN B O   1 
ATOM   3533 C CB  . GLN B 1 17  ? 39.898 -39.764 24.366  1.00   64.83  ? 104  GLN B CB  1 
ATOM   3534 C CG  . GLN B 1 17  ? 39.348 -41.135 24.033  1.00   65.85  ? 104  GLN B CG  1 
ATOM   3535 C CD  . GLN B 1 17  ? 38.130 -41.459 24.868  1.00   65.37  ? 104  GLN B CD  1 
ATOM   3536 O OE1 . GLN B 1 17  ? 37.856 -40.746 25.825  1.00   65.85  ? 104  GLN B OE1 1 
ATOM   3537 N NE2 . GLN B 1 17  ? 37.413 -42.528 24.532  1.00   62.44  ? 104  GLN B NE2 1 
ATOM   3538 N N   . LEU B 1 18  ? 41.819 -37.393 24.832  1.00   63.15  ? 105  LEU B N   1 
ATOM   3539 C CA  . LEU B 1 18  ? 42.089 -35.975 24.935  1.00   62.82  ? 105  LEU B CA  1 
ATOM   3540 C C   . LEU B 1 18  ? 43.333 -35.605 24.142  1.00   60.56  ? 105  LEU B C   1 
ATOM   3541 O O   . LEU B 1 18  ? 43.301 -34.692 23.328  1.00   57.35  ? 105  LEU B O   1 
ATOM   3542 C CB  . LEU B 1 18  ? 42.235 -35.547 26.401  1.00   64.92  ? 105  LEU B CB  1 
ATOM   3543 C CG  . LEU B 1 18  ? 42.284 -34.020 26.534  1.00   69.11  ? 105  LEU B CG  1 
ATOM   3544 C CD1 . LEU B 1 18  ? 40.866 -33.453 26.360  1.00   70.31  ? 105  LEU B CD1 1 
ATOM   3545 C CD2 . LEU B 1 18  ? 42.941 -33.524 27.815  1.00   68.96  ? 105  LEU B CD2 1 
ATOM   3546 N N   . SER B 1 19  ? 44.434 -36.297 24.402  1.00   60.79  ? 106  SER B N   1 
ATOM   3547 C CA  . SER B 1 19  ? 45.692 -35.994 23.730  1.00   60.29  ? 106  SER B CA  1 
ATOM   3548 C C   . SER B 1 19  ? 45.503 -35.979 22.201  1.00   60.30  ? 106  SER B C   1 
ATOM   3549 O O   . SER B 1 19  ? 46.068 -35.120 21.508  1.00   57.19  ? 106  SER B O   1 
ATOM   3550 C CB  . SER B 1 19  ? 46.801 -36.956 24.183  1.00   57.98  ? 106  SER B CB  1 
ATOM   3551 O OG  . SER B 1 19  ? 48.054 -36.556 23.633  1.00   57.55  ? 106  SER B OG  1 
ATOM   3552 N N   . ALA B 1 20  ? 44.687 -36.911 21.701  1.00   59.20  ? 107  ALA B N   1 
ATOM   3553 C CA  . ALA B 1 20  ? 44.403 -37.044 20.267  1.00   58.89  ? 107  ALA B CA  1 
ATOM   3554 C C   . ALA B 1 20  ? 43.558 -35.899 19.746  1.00   57.76  ? 107  ALA B C   1 
ATOM   3555 O O   . ALA B 1 20  ? 43.894 -35.286 18.736  1.00   58.19  ? 107  ALA B O   1 
ATOM   3556 C CB  . ALA B 1 20  ? 43.659 -38.326 19.976  1.00   59.32  ? 107  ALA B CB  1 
ATOM   3557 N N   . THR B 1 21  ? 42.454 -35.633 20.435  1.00   52.77  ? 108  THR B N   1 
ATOM   3558 C CA  . THR B 1 21  ? 41.574 -34.557 20.032  1.00   48.54  ? 108  THR B CA  1 
ATOM   3559 C C   . THR B 1 21  ? 42.330 -33.261 19.977  1.00   47.89  ? 108  THR B C   1 
ATOM   3560 O O   . THR B 1 21  ? 41.973 -32.413 19.177  1.00   52.39  ? 108  THR B O   1 
ATOM   3561 C CB  . THR B 1 21  ? 40.392 -34.417 20.978  1.00   49.91  ? 108  THR B CB  1 
ATOM   3562 O OG1 . THR B 1 21  ? 39.498 -35.525 20.841  1.00   44.12  ? 108  THR B OG1 1 
ATOM   3563 C CG2 . THR B 1 21  ? 39.520 -33.284 20.564  1.00   52.85  ? 108  THR B CG2 1 
ATOM   3564 N N   . VAL B 1 22  ? 43.371 -33.102 20.787  1.00   48.21  ? 109  VAL B N   1 
ATOM   3565 C CA  . VAL B 1 22  ? 44.091 -31.832 20.902  1.00   47.61  ? 109  VAL B CA  1 
ATOM   3566 C C   . VAL B 1 22  ? 45.017 -31.682 19.732  1.00   49.86  ? 109  VAL B C   1 
ATOM   3567 O O   . VAL B 1 22  ? 45.312 -30.586 19.258  1.00   50.98  ? 109  VAL B O   1 
ATOM   3568 C CB  . VAL B 1 22  ? 44.946 -31.765 22.185  1.00   47.69  ? 109  VAL B CB  1 
ATOM   3569 C CG1 . VAL B 1 22  ? 45.881 -30.537 22.203  1.00   48.69  ? 109  VAL B CG1 1 
ATOM   3570 C CG2 . VAL B 1 22  ? 44.061 -31.765 23.430  1.00   48.26  ? 109  VAL B CG2 1 
ATOM   3571 N N   . LYS B 1 23  ? 45.501 -32.825 19.282  1.00   52.85  ? 110  LYS B N   1 
ATOM   3572 C CA  . LYS B 1 23  ? 46.463 -32.858 18.193  1.00   54.80  ? 110  LYS B CA  1 
ATOM   3573 C C   . LYS B 1 23  ? 45.715 -32.469 16.905  1.00   52.99  ? 110  LYS B C   1 
ATOM   3574 O O   . LYS B 1 23  ? 46.206 -31.624 16.146  1.00   50.53  ? 110  LYS B O   1 
ATOM   3575 C CB  . LYS B 1 23  ? 47.108 -34.260 18.179  1.00   58.56  ? 110  LYS B CB  1 
ATOM   3576 C CG  . LYS B 1 23  ? 48.412 -34.427 17.379  1.00   64.17  ? 110  LYS B CG  1 
ATOM   3577 C CD  . LYS B 1 23  ? 49.667 -34.639 18.234  1.00   66.62  ? 110  LYS B CD  1 
ATOM   3578 C CE  . LYS B 1 23  ? 49.987 -36.115 18.562  1.00   65.44  ? 110  LYS B CE  1 
ATOM   3579 N NZ  . LYS B 1 23  ? 49.166 -36.723 19.663  1.00   62.06  ? 110  LYS B NZ  1 
ATOM   3580 N N   . PHE B 1 24  ? 44.519 -33.046 16.717  1.00   50.20  ? 111  PHE B N   1 
ATOM   3581 C CA  . PHE B 1 24  ? 43.622 -32.774 15.591  1.00   49.04  ? 111  PHE B CA  1 
ATOM   3582 C C   . PHE B 1 24  ? 43.223 -31.308 15.578  1.00   52.61  ? 111  PHE B C   1 
ATOM   3583 O O   . PHE B 1 24  ? 43.354 -30.635 14.562  1.00   54.00  ? 111  PHE B O   1 
ATOM   3584 C CB  . PHE B 1 24  ? 42.336 -33.603 15.696  1.00   49.52  ? 111  PHE B CB  1 
ATOM   3585 C CG  . PHE B 1 24  ? 42.396 -34.944 15.008  1.00   47.29  ? 111  PHE B CG  1 
ATOM   3586 C CD1 . PHE B 1 24  ? 42.425 -36.112 15.745  1.00   51.54  ? 111  PHE B CD1 1 
ATOM   3587 C CD2 . PHE B 1 24  ? 42.396 -35.044 13.636  1.00   45.76  ? 111  PHE B CD2 1 
ATOM   3588 C CE1 . PHE B 1 24  ? 42.484 -37.360 15.116  1.00   50.17  ? 111  PHE B CE1 1 
ATOM   3589 C CE2 . PHE B 1 24  ? 42.441 -36.280 13.001  1.00   46.20  ? 111  PHE B CE2 1 
ATOM   3590 C CZ  . PHE B 1 24  ? 42.500 -37.433 13.731  1.00   45.87  ? 111  PHE B CZ  1 
ATOM   3591 N N   . ARG B 1 25  ? 42.734 -30.811 16.713  1.00   55.07  ? 112  ARG B N   1 
ATOM   3592 C CA  . ARG B 1 25  ? 42.403 -29.393 16.860  1.00   54.51  ? 112  ARG B CA  1 
ATOM   3593 C C   . ARG B 1 25  ? 43.544 -28.467 16.461  1.00   52.14  ? 112  ARG B C   1 
ATOM   3594 O O   . ARG B 1 25  ? 43.289 -27.386 15.958  1.00   54.51  ? 112  ARG B O   1 
ATOM   3595 C CB  . ARG B 1 25  ? 41.980 -29.082 18.299  1.00   56.81  ? 112  ARG B CB  1 
ATOM   3596 C CG  . ARG B 1 25  ? 41.602 -27.612 18.539  1.00   57.26  ? 112  ARG B CG  1 
ATOM   3597 C CD  . ARG B 1 25  ? 42.757 -26.713 18.951  1.00   52.71  ? 112  ARG B CD  1 
ATOM   3598 N NE  . ARG B 1 25  ? 43.190 -27.084 20.290  1.00   54.26  ? 112  ARG B NE  1 
ATOM   3599 C CZ  . ARG B 1 25  ? 44.127 -26.462 20.998  1.00   52.94  ? 112  ARG B CZ  1 
ATOM   3600 N NH1 . ARG B 1 25  ? 44.768 -25.391 20.536  1.00   53.65  ? 112  ARG B NH1 1 
ATOM   3601 N NH2 . ARG B 1 25  ? 44.423 -26.937 22.193  1.00   45.32  ? 112  ARG B NH2 1 
ATOM   3602 N N   . GLN B 1 26  ? 44.792 -28.871 16.663  1.00   52.14  ? 113  GLN B N   1 
ATOM   3603 C CA  . GLN B 1 26  ? 45.924 -28.005 16.330  1.00   52.44  ? 113  GLN B CA  1 
ATOM   3604 C C   . GLN B 1 26  ? 46.316 -28.007 14.861  1.00   49.11  ? 113  GLN B C   1 
ATOM   3605 O O   . GLN B 1 26  ? 46.716 -26.996 14.294  1.00   48.14  ? 113  GLN B O   1 
ATOM   3606 C CB  . GLN B 1 26  ? 47.159 -28.402 17.137  1.00   56.96  ? 113  GLN B CB  1 
ATOM   3607 C CG  . GLN B 1 26  ? 47.084 -28.069 18.621  1.00   60.92  ? 113  GLN B CG  1 
ATOM   3608 C CD  . GLN B 1 26  ? 48.242 -28.684 19.374  1.00   62.91  ? 113  GLN B CD  1 
ATOM   3609 O OE1 . GLN B 1 26  ? 48.361 -29.912 19.433  1.00   64.68  ? 113  GLN B OE1 1 
ATOM   3610 N NE2 . GLN B 1 26  ? 49.124 -27.838 19.898  1.00   59.95  ? 113  GLN B NE2 1 
ATOM   3611 N N   . ILE B 1 27  ? 46.271 -29.158 14.220  1.00   48.93  ? 114  ILE B N   1 
ATOM   3612 C CA  . ILE B 1 27  ? 46.643 -29.158 12.806  1.00   49.98  ? 114  ILE B CA  1 
ATOM   3613 C C   . ILE B 1 27  ? 45.542 -28.467 12.042  1.00   44.96  ? 114  ILE B C   1 
ATOM   3614 O O   . ILE B 1 27  ? 45.800 -27.851 11.015  1.00   43.13  ? 114  ILE B O   1 
ATOM   3615 C CB  . ILE B 1 27  ? 46.892 -30.583 12.279  1.00   50.54  ? 114  ILE B CB  1 
ATOM   3616 C CG1 . ILE B 1 27  ? 45.681 -31.486 12.507  1.00   50.04  ? 114  ILE B CG1 1 
ATOM   3617 C CG2 . ILE B 1 27  ? 48.091 -31.142 13.007  1.00   50.70  ? 114  ILE B CG2 1 
ATOM   3618 C CD1 . ILE B 1 27  ? 45.769 -32.792 11.771  1.00   53.31  ? 114  ILE B CD1 1 
ATOM   3619 N N   . LEU B 1 28  ? 44.331 -28.580 12.584  1.00   42.98  ? 115  LEU B N   1 
ATOM   3620 C CA  . LEU B 1 28  ? 43.148 -27.982 11.987  1.00   42.51  ? 115  LEU B CA  1 
ATOM   3621 C C   . LEU B 1 28  ? 43.221 -26.477 11.991  1.00   44.24  ? 115  LEU B C   1 
ATOM   3622 O O   . LEU B 1 28  ? 42.687 -25.843 11.083  1.00   48.92  ? 115  LEU B O   1 
ATOM   3623 C CB  . LEU B 1 28  ? 41.890 -28.436 12.704  1.00   38.06  ? 115  LEU B CB  1 
ATOM   3624 C CG  . LEU B 1 28  ? 41.467 -29.830 12.272  1.00   33.77  ? 115  LEU B CG  1 
ATOM   3625 C CD1 . LEU B 1 28  ? 40.300 -30.272 13.093  1.00   35.31  ? 115  LEU B CD1 1 
ATOM   3626 C CD2 . LEU B 1 28  ? 41.069 -29.928 10.835  1.00   35.83  ? 115  LEU B CD2 1 
ATOM   3627 N N   . SER B 1 29  ? 43.962 -25.939 12.951  1.00   45.27  ? 116  SER B N   1 
ATOM   3628 C CA  . SER B 1 29  ? 44.049 -24.507 13.184  1.00   45.43  ? 116  SER B CA  1 
ATOM   3629 C C   . SER B 1 29  ? 45.111 -23.891 12.328  1.00   45.72  ? 116  SER B C   1 
ATOM   3630 O O   . SER B 1 29  ? 45.254 -22.683 12.344  1.00   46.54  ? 116  SER B O   1 
ATOM   3631 C CB  . SER B 1 29  ? 44.360 -24.219 14.655  1.00   44.25  ? 116  SER B CB  1 
ATOM   3632 O OG  . SER B 1 29  ? 43.226 -24.535 15.442  1.00   44.98  ? 116  SER B OG  1 
ATOM   3633 N N   . ARG B 1 30  ? 45.862 -24.708 11.602  1.00   51.59  ? 117  ARG B N   1 
ATOM   3634 C CA  . ARG B 1 30  ? 46.891 -24.174 10.713  1.00   55.95  ? 117  ARG B CA  1 
ATOM   3635 C C   . ARG B 1 30  ? 46.342 -23.069 9.787   1.00   58.88  ? 117  ARG B C   1 
ATOM   3636 O O   . ARG B 1 30  ? 45.328 -23.259 9.117   1.00   53.71  ? 117  ARG B O   1 
ATOM   3637 C CB  . ARG B 1 30  ? 47.532 -25.297 9.901   1.00   54.94  ? 117  ARG B CB  1 
ATOM   3638 C CG  . ARG B 1 30  ? 48.861 -24.869 9.308   1.00   58.57  ? 117  ARG B CG  1 
ATOM   3639 C CD  . ARG B 1 30  ? 49.320 -25.674 8.102   1.00   60.84  ? 117  ARG B CD  1 
ATOM   3640 N NE  . ARG B 1 30  ? 49.388 -27.098 8.384   1.00   62.10  ? 117  ARG B NE  1 
ATOM   3641 C CZ  . ARG B 1 30  ? 49.001 -28.073 7.565   1.00   64.34  ? 117  ARG B CZ  1 
ATOM   3642 N NH1 . ARG B 1 30  ? 49.155 -29.322 7.981   1.00   66.31  ? 117  ARG B NH1 1 
ATOM   3643 N NH2 . ARG B 1 30  ? 48.468 -27.844 6.367   1.00   61.76  ? 117  ARG B NH2 1 
ATOM   3644 N N   . GLU B 1 31  ? 47.009 -21.915 9.768   1.00   64.17  ? 118  GLU B N   1 
ATOM   3645 C CA  . GLU B 1 31  ? 46.598 -20.780 8.945   1.00   66.36  ? 118  GLU B CA  1 
ATOM   3646 C C   . GLU B 1 31  ? 46.845 -21.066 7.468   1.00   67.17  ? 118  GLU B C   1 
ATOM   3647 O O   . GLU B 1 31  ? 46.075 -20.626 6.622   1.00   72.13  ? 118  GLU B O   1 
ATOM   3648 C CB  . GLU B 1 31  ? 47.278 -19.477 9.391   1.00   66.84  ? 118  GLU B CB  1 
ATOM   3649 C CG  . GLU B 1 31  ? 47.036 -18.182 8.921   0.0000 80.04  ? 118  GLU B CG  1 
ATOM   3650 C CD  . GLU B 1 31  ? 45.732 -17.627 9.480   0.0000 85.04  ? 118  GLU B CD  1 
ATOM   3651 O OE1 . GLU B 1 31  ? 45.742 -17.083 10.608  0.0000 85.86  ? 118  GLU B OE1 1 
ATOM   3652 O OE2 . GLU B 1 31  ? 44.695 -17.718 8.779   0.0000 88.96  ? 118  GLU B OE2 1 
ATOM   3653 N N   . HIS B 1 32  ? 47.871 -21.843 7.139   1.00   68.68  ? 119  HIS B N   1 
ATOM   3654 C CA  . HIS B 1 32  ? 48.163 -22.135 5.726   1.00   70.16  ? 119  HIS B CA  1 
ATOM   3655 C C   . HIS B 1 32  ? 47.715 -23.528 5.264   1.00   66.83  ? 119  HIS B C   1 
ATOM   3656 O O   . HIS B 1 32  ? 48.337 -24.539 5.594   1.00   63.99  ? 119  HIS B O   1 
ATOM   3657 C CB  . HIS B 1 32  ? 49.653 -21.939 5.403   1.00   71.75  ? 119  HIS B CB  1 
ATOM   3658 C CG  . HIS B 1 32  ? 50.151 -20.549 5.666   1.00   77.04  ? 119  HIS B CG  1 
ATOM   3659 N ND1 . HIS B 1 32  ? 49.436 -19.423 5.311   1.00   78.13  ? 119  HIS B ND1 1 
ATOM   3660 C CD2 . HIS B 1 32  ? 51.277 -20.107 6.279   1.00   76.67  ? 119  HIS B CD2 1 
ATOM   3661 C CE1 . HIS B 1 32  ? 50.109 -18.348 5.678   1.00   79.29  ? 119  HIS B CE1 1 
ATOM   3662 N NE2 . HIS B 1 32  ? 51.228 -18.735 6.268   1.00   79.07  ? 119  HIS B NE2 1 
ATOM   3663 N N   . ARG B 1 33  ? 46.632 -23.562 4.492   1.00   62.86  ? 120  ARG B N   1 
ATOM   3664 C CA  . ARG B 1 33  ? 46.154 -24.784 3.857   1.00   58.68  ? 120  ARG B CA  1 
ATOM   3665 C C   . ARG B 1 33  ? 45.740 -25.794 4.933   1.00   54.85  ? 120  ARG B C   1 
ATOM   3666 O O   . ARG B 1 33  ? 46.230 -26.912 5.003   1.00   53.66  ? 120  ARG B O   1 
ATOM   3667 C CB  . ARG B 1 33  ? 47.241 -25.247 2.860   1.00   58.05  ? 120  ARG B CB  1 
ATOM   3668 C CG  . ARG B 1 33  ? 47.372 -26.733 2.484   1.00   56.41  ? 120  ARG B CG  1 
ATOM   3669 C CD  . ARG B 1 33  ? 46.459 -27.231 1.361   1.00   51.08  ? 120  ARG B CD  1 
ATOM   3670 N NE  . ARG B 1 33  ? 45.649 -28.354 1.796   1.00   45.26  ? 120  ARG B NE  1 
ATOM   3671 C CZ  . ARG B 1 33  ? 45.216 -29.337 1.036   1.00   42.94  ? 120  ARG B CZ  1 
ATOM   3672 N NH1 . ARG B 1 33  ? 44.430 -30.243 1.554   1.00   36.89  ? 120  ARG B NH1 1 
ATOM   3673 N NH2 . ARG B 1 33  ? 45.547 -29.439 -0.231  1.00   46.53  ? 120  ARG B NH2 1 
ATOM   3674 N N   . PRO B 1 34  ? 44.823 -25.407 5.808   1.00   54.58  ? 121  PRO B N   1 
ATOM   3675 C CA  . PRO B 1 34  ? 44.314 -26.330 6.837   1.00   53.99  ? 121  PRO B CA  1 
ATOM   3676 C C   . PRO B 1 34  ? 44.062 -27.748 6.325   1.00   51.84  ? 121  PRO B C   1 
ATOM   3677 O O   . PRO B 1 34  ? 43.561 -27.902 5.227   1.00   55.29  ? 121  PRO B O   1 
ATOM   3678 C CB  . PRO B 1 34  ? 42.990 -25.696 7.250   1.00   52.92  ? 121  PRO B CB  1 
ATOM   3679 C CG  . PRO B 1 34  ? 43.157 -24.248 6.990   1.00   53.95  ? 121  PRO B CG  1 
ATOM   3680 C CD  . PRO B 1 34  ? 44.191 -24.083 5.909   1.00   53.86  ? 121  PRO B CD  1 
ATOM   3681 N N   . PRO B 1 35  ? 44.436 -28.780 7.066   1.00   51.48  ? 122  PRO B N   1 
ATOM   3682 C CA  . PRO B 1 35  ? 44.263 -30.163 6.603   1.00   47.69  ? 122  PRO B CA  1 
ATOM   3683 C C   . PRO B 1 35  ? 42.848 -30.643 6.772   1.00   45.36  ? 122  PRO B C   1 
ATOM   3684 O O   . PRO B 1 35  ? 42.648 -31.733 7.272   1.00   48.67  ? 122  PRO B O   1 
ATOM   3685 C CB  . PRO B 1 35  ? 45.136 -30.945 7.573   1.00   44.56  ? 122  PRO B CB  1 
ATOM   3686 C CG  . PRO B 1 35  ? 45.989 -29.939 8.109   1.00   47.13  ? 122  PRO B CG  1 
ATOM   3687 C CD  . PRO B 1 35  ? 45.120 -28.742 8.368   1.00   49.01  ? 122  PRO B CD  1 
ATOM   3688 N N   . ILE B 1 36  ? 41.869 -29.854 6.373   1.00   45.05  ? 123  ILE B N   1 
ATOM   3689 C CA  . ILE B 1 36  ? 40.503 -30.166 6.754   1.00   43.41  ? 123  ILE B CA  1 
ATOM   3690 C C   . ILE B 1 36  ? 40.059 -31.383 5.975   1.00   40.69  ? 123  ILE B C   1 
ATOM   3691 O O   . ILE B 1 36  ? 39.452 -32.313 6.517   1.00   42.25  ? 123  ILE B O   1 
ATOM   3692 C CB  . ILE B 1 36  ? 39.590 -28.952 6.534   1.00   40.96  ? 123  ILE B CB  1 
ATOM   3693 C CG1 . ILE B 1 36  ? 40.068 -27.774 7.392   1.00   38.78  ? 123  ILE B CG1 1 
ATOM   3694 C CG2 . ILE B 1 36  ? 38.148 -29.300 6.900   1.00   42.10  ? 123  ILE B CG2 1 
ATOM   3695 C CD1 . ILE B 1 36  ? 39.381 -26.411 7.084   1.00   36.37  ? 123  ILE B CD1 1 
ATOM   3696 N N   . ASP B 1 37  ? 40.363 -31.358 4.691   1.00   39.52  ? 124  ASP B N   1 
ATOM   3697 C CA  . ASP B 1 37  ? 40.014 -32.488 3.841   1.00   38.08  ? 124  ASP B CA  1 
ATOM   3698 C C   . ASP B 1 37  ? 40.588 -33.815 4.376   1.00   36.82  ? 124  ASP B C   1 
ATOM   3699 O O   . ASP B 1 37  ? 39.830 -34.756 4.620   1.00   36.05  ? 124  ASP B O   1 
ATOM   3700 C CB  . ASP B 1 37  ? 40.359 -32.217 2.368   1.00   36.88  ? 124  ASP B CB  1 
ATOM   3701 C CG  . ASP B 1 37  ? 41.794 -31.700 2.117   1.00   42.98  ? 124  ASP B CG  1 
ATOM   3702 O OD1 . ASP B 1 37  ? 42.627 -31.567 3.067   1.00   43.45  ? 124  ASP B OD1 1 
ATOM   3703 O OD2 . ASP B 1 37  ? 42.148 -31.426 0.920   1.00   40.91  ? 124  ASP B OD2 1 
ATOM   3704 N N   . VAL B 1 38  ? 41.900 -33.851 4.602   1.00   36.92  ? 125  VAL B N   1 
ATOM   3705 C CA  . VAL B 1 38  ? 42.627 -35.016 5.094   1.00   39.50  ? 125  VAL B CA  1 
ATOM   3706 C C   . VAL B 1 38  ? 42.050 -35.563 6.395   1.00   37.45  ? 125  VAL B C   1 
ATOM   3707 O O   . VAL B 1 38  ? 41.939 -36.767 6.563   1.00   40.33  ? 125  VAL B O   1 
ATOM   3708 C CB  . VAL B 1 38  ? 44.119 -34.672 5.369   1.00   43.95  ? 125  VAL B CB  1 
ATOM   3709 C CG1 . VAL B 1 38  ? 44.845 -35.865 5.920   1.00   46.78  ? 125  VAL B CG1 1 
ATOM   3710 C CG2 . VAL B 1 38  ? 44.846 -34.233 4.098   1.00   49.27  ? 125  VAL B CG2 1 
ATOM   3711 N N   . VAL B 1 39  ? 41.699 -34.675 7.316   1.00   35.96  ? 126  VAL B N   1 
ATOM   3712 C CA  . VAL B 1 39  ? 41.161 -35.046 8.625   1.00   35.18  ? 126  VAL B CA  1 
ATOM   3713 C C   . VAL B 1 39  ? 39.755 -35.566 8.450   1.00   34.80  ? 126  VAL B C   1 
ATOM   3714 O O   . VAL B 1 39  ? 39.385 -36.526 9.106   1.00   34.42  ? 126  VAL B O   1 
ATOM   3715 C CB  . VAL B 1 39  ? 41.139 -33.850 9.645   1.00   35.19  ? 126  VAL B CB  1 
ATOM   3716 C CG1 . VAL B 1 39  ? 40.410 -34.231 10.931  1.00   28.94  ? 126  VAL B CG1 1 
ATOM   3717 C CG2 . VAL B 1 39  ? 42.529 -33.346 9.960   1.00   33.74  ? 126  VAL B CG2 1 
ATOM   3718 N N   . ILE B 1 40  ? 38.965 -34.961 7.563   1.00   35.33  ? 127  ILE B N   1 
ATOM   3719 C CA  . ILE B 1 40  ? 37.637 -35.520 7.282   1.00   35.47  ? 127  ILE B CA  1 
ATOM   3720 C C   . ILE B 1 40  ? 37.723 -36.935 6.707   1.00   38.71  ? 127  ILE B C   1 
ATOM   3721 O O   . ILE B 1 40  ? 36.926 -37.820 7.068   1.00   35.64  ? 127  ILE B O   1 
ATOM   3722 C CB  . ILE B 1 40  ? 36.828 -34.648 6.289   1.00   34.74  ? 127  ILE B CB  1 
ATOM   3723 C CG1 . ILE B 1 40  ? 36.507 -33.301 6.944   1.00   38.72  ? 127  ILE B CG1 1 
ATOM   3724 C CG2 . ILE B 1 40  ? 35.553 -35.385 5.849   1.00   27.98  ? 127  ILE B CG2 1 
ATOM   3725 C CD1 . ILE B 1 40  ? 35.587 -32.420 6.183   1.00   39.51  ? 127  ILE B CD1 1 
ATOM   3726 N N   . GLN B 1 41  ? 38.674 -37.145 5.792   1.00   42.81  ? 128  GLN B N   1 
ATOM   3727 C CA  . GLN B 1 41  ? 38.766 -38.450 5.105   1.00   43.82  ? 128  GLN B CA  1 
ATOM   3728 C C   . GLN B 1 41  ? 39.218 -39.578 6.021   1.00   36.68  ? 128  GLN B C   1 
ATOM   3729 O O   . GLN B 1 41  ? 38.830 -40.727 5.816   1.00   29.95  ? 128  GLN B O   1 
ATOM   3730 C CB  . GLN B 1 41  ? 39.588 -38.395 3.807   1.00   45.72  ? 128  GLN B CB  1 
ATOM   3731 C CG  . GLN B 1 41  ? 39.148 -39.457 2.793   1.00   54.86  ? 128  GLN B CG  1 
ATOM   3732 C CD  . GLN B 1 41  ? 37.620 -39.630 2.583   1.00   65.08  ? 128  GLN B CD  1 
ATOM   3733 O OE1 . GLN B 1 41  ? 37.182 -40.753 2.222   1.00   65.61  ? 128  GLN B OE1 1 
ATOM   3734 N NE2 . GLN B 1 41  ? 36.824 -38.549 2.767   1.00   63.33  ? 128  GLN B NE2 1 
ATOM   3735 N N   . ALA B 1 42  ? 39.932 -39.214 7.079   1.00   35.21  ? 129  ALA B N   1 
ATOM   3736 C CA  . ALA B 1 42  ? 40.323 -40.168 8.112   1.00   39.32  ? 129  ALA B CA  1 
ATOM   3737 C C   . ALA B 1 42  ? 39.154 -40.714 8.919   1.00   39.65  ? 129  ALA B C   1 
ATOM   3738 O O   . ALA B 1 42  ? 39.362 -41.525 9.828   1.00   44.42  ? 129  ALA B O   1 
ATOM   3739 C CB  . ALA B 1 42  ? 41.365 -39.567 9.055   1.00   39.70  ? 129  ALA B CB  1 
ATOM   3740 N N   . GLY B 1 43  ? 37.937 -40.282 8.605   1.00   38.37  ? 130  GLY B N   1 
ATOM   3741 C CA  . GLY B 1 43  ? 36.753 -40.793 9.285   1.00   36.90  ? 130  GLY B CA  1 
ATOM   3742 C C   . GLY B 1 43  ? 36.465 -40.403 10.732  1.00   30.55  ? 130  GLY B C   1 
ATOM   3743 O O   . GLY B 1 43  ? 35.540 -40.964 11.298  1.00   23.74  ? 130  GLY B O   1 
ATOM   3744 N N   . VAL B 1 44  ? 37.180 -39.417 11.271  1.00   32.83  ? 131  VAL B N   1 
ATOM   3745 C CA  . VAL B 1 44  ? 37.110 -39.021 12.683  1.00   38.19  ? 131  VAL B CA  1 
ATOM   3746 C C   . VAL B 1 44  ? 35.997 -38.060 13.125  1.00   41.06  ? 131  VAL B C   1 
ATOM   3747 O O   . VAL B 1 44  ? 35.761 -37.919 14.339  1.00   42.06  ? 131  VAL B O   1 
ATOM   3748 C CB  . VAL B 1 44  ? 38.430 -38.392 13.122  1.00   38.86  ? 131  VAL B CB  1 
ATOM   3749 C CG1 . VAL B 1 44  ? 39.567 -39.309 12.719  1.00   43.69  ? 131  VAL B CG1 1 
ATOM   3750 C CG2 . VAL B 1 44  ? 38.630 -37.007 12.516  1.00   40.43  ? 131  VAL B CG2 1 
ATOM   3751 N N   . VAL B 1 45  ? 35.326 -37.400 12.180  1.00   37.58  ? 132  VAL B N   1 
ATOM   3752 C CA  . VAL B 1 45  ? 34.244 -36.492 12.539  1.00   37.38  ? 132  VAL B CA  1 
ATOM   3753 C C   . VAL B 1 45  ? 33.207 -37.108 13.504  1.00   38.13  ? 132  VAL B C   1 
ATOM   3754 O O   . VAL B 1 45  ? 32.966 -36.529 14.565  1.00   37.77  ? 132  VAL B O   1 
ATOM   3755 C CB  . VAL B 1 45  ? 33.612 -35.820 11.312  1.00   36.17  ? 132  VAL B CB  1 
ATOM   3756 C CG1 . VAL B 1 45  ? 32.283 -35.180 11.650  1.00   37.87  ? 132  VAL B CG1 1 
ATOM   3757 C CG2 . VAL B 1 45  ? 34.546 -34.742 10.823  1.00   38.16  ? 132  VAL B CG2 1 
ATOM   3758 N N   . PRO B 1 46  ? 32.628 -38.262 13.195  1.00   35.55  ? 133  PRO B N   1 
ATOM   3759 C CA  . PRO B 1 46  ? 31.657 -38.895 14.099  1.00   34.64  ? 133  PRO B CA  1 
ATOM   3760 C C   . PRO B 1 46  ? 32.214 -39.183 15.489  1.00   37.89  ? 133  PRO B C   1 
ATOM   3761 O O   . PRO B 1 46  ? 31.592 -39.055 16.550  1.00   38.54  ? 133  PRO B O   1 
ATOM   3762 C CB  . PRO B 1 46  ? 31.273 -40.189 13.373  1.00   34.44  ? 133  PRO B CB  1 
ATOM   3763 C CG  . PRO B 1 46  ? 31.554 -39.916 11.886  1.00   34.76  ? 133  PRO B CG  1 
ATOM   3764 C CD  . PRO B 1 46  ? 32.802 -39.030 11.947  1.00   39.75  ? 133  PRO B CD  1 
ATOM   3765 N N   . ARG B 1 47  ? 33.485 -39.521 15.494  1.00   43.23  ? 134  ARG B N   1 
ATOM   3766 C CA  . ARG B 1 47  ? 34.135 -39.739 16.767  1.00   44.34  ? 134  ARG B CA  1 
ATOM   3767 C C   . ARG B 1 47  ? 34.181 -38.397 17.509  1.00   40.60  ? 134  ARG B C   1 
ATOM   3768 O O   . ARG B 1 47  ? 33.819 -38.321 18.669  1.00   31.14  ? 134  ARG B O   1 
ATOM   3769 C CB  . ARG B 1 47  ? 35.521 -40.327 16.539  1.00   44.43  ? 134  ARG B CB  1 
ATOM   3770 C CG  . ARG B 1 47  ? 36.283 -40.530 17.798  1.00   47.21  ? 134  ARG B CG  1 
ATOM   3771 C CD  . ARG B 1 47  ? 35.601 -41.475 18.737  1.00   49.93  ? 134  ARG B CD  1 
ATOM   3772 N NE  . ARG B 1 47  ? 36.520 -41.957 19.764  1.00   53.98  ? 134  ARG B NE  1 
ATOM   3773 C CZ  . ARG B 1 47  ? 36.236 -42.950 20.589  1.00   55.83  ? 134  ARG B CZ  1 
ATOM   3774 N NH1 . ARG B 1 47  ? 35.050 -43.545 20.529  1.00   52.29  ? 134  ARG B NH1 1 
ATOM   3775 N NH2 . ARG B 1 47  ? 37.140 -43.352 21.469  1.00   57.84  ? 134  ARG B NH2 1 
ATOM   3776 N N   . LEU B 1 48  ? 34.629 -37.334 16.852  1.00   41.73  ? 135  LEU B N   1 
ATOM   3777 C CA  . LEU B 1 48  ? 34.682 -36.038 17.529  1.00   43.60  ? 135  LEU B CA  1 
ATOM   3778 C C   . LEU B 1 48  ? 33.293 -35.573 18.027  1.00   43.27  ? 135  LEU B C   1 
ATOM   3779 O O   . LEU B 1 48  ? 33.167 -34.889 19.039  1.00   40.37  ? 135  LEU B O   1 
ATOM   3780 C CB  . LEU B 1 48  ? 35.302 -34.991 16.603  1.00   41.87  ? 135  LEU B CB  1 
ATOM   3781 C CG  . LEU B 1 48  ? 36.732 -35.222 16.121  1.00   40.89  ? 135  LEU B CG  1 
ATOM   3782 C CD1 . LEU B 1 48  ? 37.085 -34.207 15.039  1.00   40.90  ? 135  LEU B CD1 1 
ATOM   3783 C CD2 . LEU B 1 48  ? 37.690 -35.102 17.267  1.00   39.07  ? 135  LEU B CD2 1 
ATOM   3784 N N   . VAL B 1 49  ? 32.243 -35.984 17.332  1.00   44.30  ? 136  VAL B N   1 
ATOM   3785 C CA  . VAL B 1 49  ? 30.898 -35.557 17.656  1.00   47.23  ? 136  VAL B CA  1 
ATOM   3786 C C   . VAL B 1 49  ? 30.484 -36.234 18.954  1.00   51.99  ? 136  VAL B C   1 
ATOM   3787 O O   . VAL B 1 49  ? 29.825 -35.616 19.785  1.00   52.94  ? 136  VAL B O   1 
ATOM   3788 C CB  . VAL B 1 49  ? 29.905 -35.827 16.477  1.00   46.15  ? 136  VAL B CB  1 
ATOM   3789 C CG1 . VAL B 1 49  ? 28.437 -35.930 16.897  1.00   43.01  ? 136  VAL B CG1 1 
ATOM   3790 C CG2 . VAL B 1 49  ? 30.045 -34.752 15.409  1.00   41.63  ? 136  VAL B CG2 1 
ATOM   3791 N N   . GLU B 1 50  ? 30.858 -37.495 19.133  1.00   57.50  ? 137  GLU B N   1 
ATOM   3792 C CA  . GLU B 1 50  ? 30.620 -38.190 20.400  1.00   60.02  ? 137  GLU B CA  1 
ATOM   3793 C C   . GLU B 1 50  ? 31.304 -37.484 21.549  1.00   58.85  ? 137  GLU B C   1 
ATOM   3794 O O   . GLU B 1 50  ? 30.782 -37.497 22.653  1.00   63.21  ? 137  GLU B O   1 
ATOM   3795 C CB  . GLU B 1 50  ? 31.175 -39.611 20.410  1.00   64.52  ? 137  GLU B CB  1 
ATOM   3796 C CG  . GLU B 1 50  ? 30.502 -40.608 19.477  1.00   71.87  ? 137  GLU B CG  1 
ATOM   3797 C CD  . GLU B 1 50  ? 31.095 -42.012 19.637  1.00   77.15  ? 137  GLU B CD  1 
ATOM   3798 O OE1 . GLU B 1 50  ? 32.328 -42.148 19.818  1.00   80.03  ? 137  GLU B OE1 1 
ATOM   3799 O OE2 . GLU B 1 50  ? 30.344 -43.011 19.590  1.00   82.84  ? 137  GLU B OE2 1 
ATOM   3800 N N   . PHE B 1 51  ? 32.472 -36.901 21.307  1.00   57.59  ? 138  PHE B N   1 
ATOM   3801 C CA  . PHE B 1 51  ? 33.219 -36.200 22.348  1.00   59.87  ? 138  PHE B CA  1 
ATOM   3802 C C   . PHE B 1 51  ? 32.531 -34.922 22.878  1.00   61.15  ? 138  PHE B C   1 
ATOM   3803 O O   . PHE B 1 51  ? 33.014 -34.304 23.833  1.00   59.06  ? 138  PHE B O   1 
ATOM   3804 C CB  . PHE B 1 51  ? 34.630 -35.867 21.838  1.00   59.47  ? 138  PHE B CB  1 
ATOM   3805 C CG  . PHE B 1 51  ? 35.561 -37.047 21.760  1.00   61.16  ? 138  PHE B CG  1 
ATOM   3806 C CD1 . PHE B 1 51  ? 35.107 -38.359 21.916  1.00   64.32  ? 138  PHE B CD1 1 
ATOM   3807 C CD2 . PHE B 1 51  ? 36.913 -36.835 21.557  1.00   61.37  ? 138  PHE B CD2 1 
ATOM   3808 C CE1 . PHE B 1 51  ? 35.984 -39.434 21.839  1.00   62.56  ? 138  PHE B CE1 1 
ATOM   3809 C CE2 . PHE B 1 51  ? 37.799 -37.899 21.494  1.00   60.90  ? 138  PHE B CE2 1 
ATOM   3810 C CZ  . PHE B 1 51  ? 37.331 -39.197 21.616  1.00   64.03  ? 138  PHE B CZ  1 
ATOM   3811 N N   . MET B 1 52  ? 31.416 -34.525 22.266  1.00   63.31  ? 139  MET B N   1 
ATOM   3812 C CA  . MET B 1 52  ? 30.705 -33.300 22.628  1.00   63.36  ? 139  MET B CA  1 
ATOM   3813 C C   . MET B 1 52  ? 29.423 -33.595 23.391  1.00   65.80  ? 139  MET B C   1 
ATOM   3814 O O   . MET B 1 52  ? 28.697 -32.668 23.721  1.00   65.83  ? 139  MET B O   1 
ATOM   3815 C CB  . MET B 1 52  ? 30.348 -32.501 21.381  1.00   60.31  ? 139  MET B CB  1 
ATOM   3816 C CG  . MET B 1 52  ? 31.501 -31.782 20.716  1.00   60.28  ? 139  MET B CG  1 
ATOM   3817 S SD  . MET B 1 52  ? 30.951 -30.409 19.604  1.00   58.06  ? 139  MET B SD  1 
ATOM   3818 C CE  . MET B 1 52  ? 29.652 -31.299 18.649  1.00   59.32  ? 139  MET B CE  1 
ATOM   3819 N N   . ARG B 1 53  ? 29.137 -34.866 23.668  1.00   68.95  ? 140  ARG B N   1 
ATOM   3820 C CA  . ARG B 1 53  ? 27.964 -35.250 24.466  1.00   72.10  ? 140  ARG B CA  1 
ATOM   3821 C C   . ARG B 1 53  ? 28.042 -34.851 25.965  1.00   72.21  ? 140  ARG B C   1 
ATOM   3822 O O   . ARG B 1 53  ? 29.104 -34.479 26.477  1.00   69.02  ? 140  ARG B O   1 
ATOM   3823 C CB  . ARG B 1 53  ? 27.682 -36.749 24.263  1.00   72.85  ? 140  ARG B CB  1 
ATOM   3824 C CG  . ARG B 1 53  ? 27.018 -37.032 22.926  1.00   76.08  ? 140  ARG B CG  1 
ATOM   3825 C CD  . ARG B 1 53  ? 26.561 -38.456 22.675  1.00   79.28  ? 140  ARG B CD  1 
ATOM   3826 N NE  . ARG B 1 53  ? 26.495 -38.739 21.234  1.00   84.57  ? 140  ARG B NE  1 
ATOM   3827 C CZ  . ARG B 1 53  ? 26.823 -39.899 20.649  1.00   87.03  ? 140  ARG B CZ  1 
ATOM   3828 N NH1 . ARG B 1 53  ? 27.232 -40.955 21.351  1.00   85.73  ? 140  ARG B NH1 1 
ATOM   3829 N NH2 . ARG B 1 53  ? 26.755 -40.007 19.328  1.00   88.01  ? 140  ARG B NH2 1 
ATOM   3830 N N   . GLU B 1 54  ? 26.906 -34.879 26.658  1.00   75.07  ? 141  GLU B N   1 
ATOM   3831 C CA  . GLU B 1 54  ? 26.847 -34.458 28.066  1.00   81.03  ? 141  GLU B CA  1 
ATOM   3832 C C   . GLU B 1 54  ? 27.724 -35.304 28.991  1.00   81.49  ? 141  GLU B C   1 
ATOM   3833 O O   . GLU B 1 54  ? 28.326 -34.802 29.947  1.00   81.50  ? 141  GLU B O   1 
ATOM   3834 C CB  . GLU B 1 54  ? 25.428 -34.570 28.618  1.00   83.27  ? 141  GLU B CB  1 
ATOM   3835 C CG  . GLU B 1 54  ? 24.387 -33.720 27.929  1.00   87.58  ? 141  GLU B CG  1 
ATOM   3836 C CD  . GLU B 1 54  ? 22.996 -34.216 28.263  1.00   91.84  ? 141  GLU B CD  1 
ATOM   3837 O OE1 . GLU B 1 54  ? 22.574 -34.039 29.434  1.00   90.78  ? 141  GLU B OE1 1 
ATOM   3838 O OE2 . GLU B 1 54  ? 22.357 -34.804 27.355  1.00   93.61  ? 141  GLU B OE2 1 
ATOM   3839 N N   . ASN B 1 55  ? 27.745 -36.601 28.712  1.00   80.66  ? 142  ASN B N   1 
ATOM   3840 C CA  . ASN B 1 55  ? 28.525 -37.554 29.495  1.00   82.71  ? 142  ASN B CA  1 
ATOM   3841 C C   . ASN B 1 55  ? 30.025 -37.514 29.195  1.00   79.91  ? 142  ASN B C   1 
ATOM   3842 O O   . ASN B 1 55  ? 30.659 -38.566 29.163  1.00   82.23  ? 142  ASN B O   1 
ATOM   3843 C CB  . ASN B 1 55  ? 27.978 -38.993 29.321  1.00   86.68  ? 142  ASN B CB  1 
ATOM   3844 C CG  . ASN B 1 55  ? 27.794 -39.424 27.854  1.00   90.53  ? 142  ASN B CG  1 
ATOM   3845 O OD1 . ASN B 1 55  ? 28.762 -39.749 27.159  1.00   94.92  ? 142  ASN B OD1 1 
ATOM   3846 N ND2 . ASN B 1 55  ? 26.544 -39.467 27.396  1.00   90.40  ? 142  ASN B ND2 1 
ATOM   3847 N N   . GLN B 1 56  ? 30.597 -36.329 28.990  1.00   75.21  ? 143  GLN B N   1 
ATOM   3848 C CA  . GLN B 1 56  ? 31.999 -36.211 28.614  1.00   72.51  ? 143  GLN B CA  1 
ATOM   3849 C C   . GLN B 1 56  ? 32.670 -35.085 29.388  1.00   71.78  ? 143  GLN B C   1 
ATOM   3850 O O   . GLN B 1 56  ? 32.013 -34.102 29.726  1.00   74.20  ? 143  GLN B O   1 
ATOM   3851 C CB  . GLN B 1 56  ? 32.117 -35.954 27.107  1.00   71.28  ? 143  GLN B CB  1 
ATOM   3852 C CG  . GLN B 1 56  ? 31.521 -37.046 26.201  1.00   68.72  ? 143  GLN B CG  1 
ATOM   3853 C CD  . GLN B 1 56  ? 32.356 -38.329 26.155  1.00   64.74  ? 143  GLN B CD  1 
ATOM   3854 O OE1 . GLN B 1 56  ? 33.547 -38.282 26.414  1.00   68.72  ? 143  GLN B OE1 1 
ATOM   3855 N NE2 . GLN B 1 56  ? 31.740 -39.461 25.835  1.00   53.13  ? 143  GLN B NE2 1 
ATOM   3856 N N   . PRO B 1 57  ? 33.965 -35.213 29.670  1.00   71.15  ? 144  PRO B N   1 
ATOM   3857 C CA  . PRO B 1 57  ? 34.709 -34.146 30.347  1.00   72.52  ? 144  PRO B CA  1 
ATOM   3858 C C   . PRO B 1 57  ? 34.503 -32.762 29.748  1.00   71.86  ? 144  PRO B C   1 
ATOM   3859 O O   . PRO B 1 57  ? 34.205 -32.648 28.576  1.00   70.38  ? 144  PRO B O   1 
ATOM   3860 C CB  . PRO B 1 57  ? 36.172 -34.585 30.193  1.00   72.62  ? 144  PRO B CB  1 
ATOM   3861 C CG  . PRO B 1 57  ? 36.103 -36.053 30.146  1.00   70.65  ? 144  PRO B CG  1 
ATOM   3862 C CD  . PRO B 1 57  ? 34.829 -36.378 29.421  1.00   70.40  ? 144  PRO B CD  1 
ATOM   3863 N N   . GLU B 1 58  ? 34.639 -31.728 30.565  1.00   75.33  ? 145  GLU B N   1 
ATOM   3864 C CA  . GLU B 1 58  ? 34.511 -30.361 30.085  1.00   77.83  ? 145  GLU B CA  1 
ATOM   3865 C C   . GLU B 1 58  ? 35.683 -30.051 29.164  1.00   74.33  ? 145  GLU B C   1 
ATOM   3866 O O   . GLU B 1 58  ? 35.510 -29.359 28.163  1.00   73.30  ? 145  GLU B O   1 
ATOM   3867 C CB  . GLU B 1 58  ? 34.414 -29.349 31.245  1.00   82.04  ? 145  GLU B CB  1 
ATOM   3868 C CG  . GLU B 1 58  ? 34.378 -27.873 30.827  1.00   89.41  ? 145  GLU B CG  1 
ATOM   3869 C CD  . GLU B 1 58  ? 33.075 -27.430 30.136  1.00   95.47  ? 145  GLU B CD  1 
ATOM   3870 O OE1 . GLU B 1 58  ? 32.804 -27.814 28.960  1.00   98.12  ? 145  GLU B OE1 1 
ATOM   3871 O OE2 . GLU B 1 58  ? 32.305 -26.664 30.771  1.00   95.63  ? 145  GLU B OE2 1 
ATOM   3872 N N   . MET B 1 59  ? 36.859 -30.579 29.487  1.00   72.45  ? 146  MET B N   1 
ATOM   3873 C CA  . MET B 1 59  ? 38.059 -30.264 28.721  1.00   72.44  ? 146  MET B CA  1 
ATOM   3874 C C   . MET B 1 59  ? 38.087 -30.987 27.373  1.00   68.57  ? 146  MET B C   1 
ATOM   3875 O O   . MET B 1 59  ? 38.724 -30.525 26.424  1.00   65.26  ? 146  MET B O   1 
ATOM   3876 C CB  . MET B 1 59  ? 39.306 -30.580 29.549  1.00   77.03  ? 146  MET B CB  1 
ATOM   3877 C CG  . MET B 1 59  ? 40.589 -29.908 29.069  1.00   83.79  ? 146  MET B CG  1 
ATOM   3878 S SD  . MET B 1 59  ? 40.359 -28.203 28.535  1.00   92.38  ? 146  MET B SD  1 
ATOM   3879 C CE  . MET B 1 59  ? 40.763 -27.219 30.076  1.00   90.57  ? 146  MET B CE  1 
ATOM   3880 N N   . LEU B 1 60  ? 37.360 -32.099 27.274  1.00   64.53  ? 147  LEU B N   1 
ATOM   3881 C CA  . LEU B 1 60  ? 37.322 -32.870 26.036  1.00   62.36  ? 147  LEU B CA  1 
ATOM   3882 C C   . LEU B 1 60  ? 36.310 -32.249 25.077  1.00   60.87  ? 147  LEU B C   1 
ATOM   3883 O O   . LEU B 1 60  ? 36.656 -31.864 23.959  1.00   61.58  ? 147  LEU B O   1 
ATOM   3884 C CB  . LEU B 1 60  ? 37.005 -34.337 26.312  1.00   62.35  ? 147  LEU B CB  1 
ATOM   3885 C CG  . LEU B 1 60  ? 37.118 -35.296 25.122  1.00   62.34  ? 147  LEU B CG  1 
ATOM   3886 C CD1 . LEU B 1 60  ? 38.545 -35.350 24.629  1.00   65.55  ? 147  LEU B CD1 1 
ATOM   3887 C CD2 . LEU B 1 60  ? 36.667 -36.696 25.490  1.00   62.13  ? 147  LEU B CD2 1 
ATOM   3888 N N   . GLN B 1 61  ? 35.071 -32.119 25.541  1.00   56.66  ? 148  GLN B N   1 
ATOM   3889 C CA  . GLN B 1 61  ? 34.044 -31.329 24.866  1.00   53.10  ? 148  GLN B CA  1 
ATOM   3890 C C   . GLN B 1 61  ? 34.552 -30.025 24.231  1.00   49.91  ? 148  GLN B C   1 
ATOM   3891 O O   . GLN B 1 61  ? 34.095 -29.618 23.175  1.00   45.40  ? 148  GLN B O   1 
ATOM   3892 C CB  . GLN B 1 61  ? 32.970 -30.934 25.876  1.00   54.02  ? 148  GLN B CB  1 
ATOM   3893 C CG  . GLN B 1 61  ? 32.062 -32.064 26.357  1.00   53.94  ? 148  GLN B CG  1 
ATOM   3894 C CD  . GLN B 1 61  ? 30.897 -31.544 27.178  1.00   52.21  ? 148  GLN B CD  1 
ATOM   3895 O OE1 . GLN B 1 61  ? 31.034 -30.529 27.862  1.00   50.66  ? 148  GLN B OE1 1 
ATOM   3896 N NE2 . GLN B 1 61  ? 29.757 -32.225 27.106  1.00   46.00  ? 148  GLN B NE2 1 
ATOM   3897 N N   . LEU B 1 62  ? 35.452 -29.331 24.913  1.00   47.57  ? 149  LEU B N   1 
ATOM   3898 C CA  . LEU B 1 62  ? 35.974 -28.095 24.383  1.00   47.32  ? 149  LEU B CA  1 
ATOM   3899 C C   . LEU B 1 62  ? 36.758 -28.407 23.134  1.00   48.92  ? 149  LEU B C   1 
ATOM   3900 O O   . LEU B 1 62  ? 36.444 -27.880 22.078  1.00   54.18  ? 149  LEU B O   1 
ATOM   3901 C CB  . LEU B 1 62  ? 36.815 -27.330 25.407  1.00   46.95  ? 149  LEU B CB  1 
ATOM   3902 C CG  . LEU B 1 62  ? 37.719 -26.219 24.865  1.00   51.55  ? 149  LEU B CG  1 
ATOM   3903 C CD1 . LEU B 1 62  ? 36.934 -25.157 24.117  1.00   54.74  ? 149  LEU B CD1 1 
ATOM   3904 C CD2 . LEU B 1 62  ? 38.489 -25.573 26.017  1.00   55.51  ? 149  LEU B CD2 1 
ATOM   3905 N N   . GLU B 1 63  ? 37.762 -29.265 23.247  1.00   50.44  ? 150  GLU B N   1 
ATOM   3906 C CA  . GLU B 1 63  ? 38.676 -29.544 22.139  1.00   47.29  ? 150  GLU B CA  1 
ATOM   3907 C C   . GLU B 1 63  ? 37.961 -30.180 20.933  1.00   45.39  ? 150  GLU B C   1 
ATOM   3908 O O   . GLU B 1 63  ? 38.263 -29.892 19.791  1.00   46.62  ? 150  GLU B O   1 
ATOM   3909 C CB  . GLU B 1 63  ? 39.815 -30.448 22.638  1.00   49.20  ? 150  GLU B CB  1 
ATOM   3910 C CG  . GLU B 1 63  ? 40.759 -29.813 23.648  1.00   44.03  ? 150  GLU B CG  1 
ATOM   3911 C CD  . GLU B 1 63  ? 41.667 -28.778 23.020  1.00   44.79  ? 150  GLU B CD  1 
ATOM   3912 O OE1 . GLU B 1 63  ? 41.747 -28.689 21.772  1.00   47.28  ? 150  GLU B OE1 1 
ATOM   3913 O OE2 . GLU B 1 63  ? 42.300 -28.027 23.777  1.00   43.65  ? 150  GLU B OE2 1 
ATOM   3914 N N   . ALA B 1 64  ? 36.986 -31.039 21.188  1.00   45.01  ? 151  ALA B N   1 
ATOM   3915 C CA  . ALA B 1 64  ? 36.251 -31.692 20.135  1.00   43.03  ? 151  ALA B CA  1 
ATOM   3916 C C   . ALA B 1 64  ? 35.493 -30.625 19.378  1.00   47.21  ? 151  ALA B C   1 
ATOM   3917 O O   . ALA B 1 64  ? 35.615 -30.450 18.167  1.00   53.21  ? 151  ALA B O   1 
ATOM   3918 C CB  . ALA B 1 64  ? 35.314 -32.724 20.726  1.00   39.49  ? 151  ALA B CB  1 
ATOM   3919 N N   . ALA B 1 65  ? 34.716 -29.862 20.121  1.00   49.72  ? 152  ALA B N   1 
ATOM   3920 C CA  . ALA B 1 65  ? 33.953 -28.771 19.544  1.00   47.54  ? 152  ALA B CA  1 
ATOM   3921 C C   . ALA B 1 65  ? 34.843 -27.775 18.801  1.00   44.16  ? 152  ALA B C   1 
ATOM   3922 O O   . ALA B 1 65  ? 34.496 -27.268 17.736  1.00   45.19  ? 152  ALA B O   1 
ATOM   3923 C CB  . ALA B 1 65  ? 33.171 -28.089 20.636  1.00   47.90  ? 152  ALA B CB  1 
ATOM   3924 N N   . TRP B 1 66  ? 36.017 -27.506 19.335  1.00   41.83  ? 153  TRP B N   1 
ATOM   3925 C CA  . TRP B 1 66  ? 36.884 -26.523 18.691  1.00   44.61  ? 153  TRP B CA  1 
ATOM   3926 C C   . TRP B 1 66  ? 37.406 -27.101 17.352  1.00   46.37  ? 153  TRP B C   1 
ATOM   3927 O O   . TRP B 1 66  ? 37.483 -26.419 16.335  1.00   46.31  ? 153  TRP B O   1 
ATOM   3928 C CB  . TRP B 1 66  ? 37.989 -26.103 19.669  1.00   40.63  ? 153  TRP B CB  1 
ATOM   3929 C CG  . TRP B 1 66  ? 38.955 -25.076 19.186  1.00   39.10  ? 153  TRP B CG  1 
ATOM   3930 C CD1 . TRP B 1 66  ? 39.023 -24.514 17.956  1.00   38.31  ? 153  TRP B CD1 1 
ATOM   3931 C CD2 . TRP B 1 66  ? 40.019 -24.506 19.945  1.00   41.30  ? 153  TRP B CD2 1 
ATOM   3932 N NE1 . TRP B 1 66  ? 40.052 -23.607 17.901  1.00   40.35  ? 153  TRP B NE1 1 
ATOM   3933 C CE2 . TRP B 1 66  ? 40.684 -23.589 19.114  1.00   42.63  ? 153  TRP B CE2 1 
ATOM   3934 C CE3 . TRP B 1 66  ? 40.490 -24.689 21.251  1.00   44.72  ? 153  TRP B CE3 1 
ATOM   3935 C CZ2 . TRP B 1 66  ? 41.791 -22.848 19.540  1.00   47.24  ? 153  TRP B CZ2 1 
ATOM   3936 C CZ3 . TRP B 1 66  ? 41.582 -23.965 21.676  1.00   47.19  ? 153  TRP B CZ3 1 
ATOM   3937 C CH2 . TRP B 1 66  ? 42.223 -23.054 20.819  1.00   48.07  ? 153  TRP B CH2 1 
ATOM   3938 N N   . ALA B 1 67  ? 37.733 -28.382 17.351  1.00   44.45  ? 154  ALA B N   1 
ATOM   3939 C CA  . ALA B 1 67  ? 38.204 -29.032 16.147  1.00   44.49  ? 154  ALA B CA  1 
ATOM   3940 C C   . ALA B 1 67  ? 37.109 -29.024 15.073  1.00   43.13  ? 154  ALA B C   1 
ATOM   3941 O O   . ALA B 1 67  ? 37.359 -28.683 13.919  1.00   39.76  ? 154  ALA B O   1 
ATOM   3942 C CB  . ALA B 1 67  ? 38.619 -30.469 16.477  1.00   43.55  ? 154  ALA B CB  1 
ATOM   3943 N N   . LEU B 1 68  ? 35.903 -29.432 15.461  1.00   42.73  ? 155  LEU B N   1 
ATOM   3944 C CA  . LEU B 1 68  ? 34.757 -29.467 14.556  1.00   40.25  ? 155  LEU B CA  1 
ATOM   3945 C C   . LEU B 1 68  ? 34.439 -28.086 13.998  1.00   39.66  ? 155  LEU B C   1 
ATOM   3946 O O   . LEU B 1 68  ? 34.048 -27.907 12.860  1.00   40.21  ? 155  LEU B O   1 
ATOM   3947 C CB  . LEU B 1 68  ? 33.544 -30.011 15.287  1.00   37.67  ? 155  LEU B CB  1 
ATOM   3948 C CG  . LEU B 1 68  ? 33.540 -31.524 15.421  1.00   35.30  ? 155  LEU B CG  1 
ATOM   3949 C CD1 . LEU B 1 68  ? 32.352 -31.971 16.240  1.00   36.73  ? 155  LEU B CD1 1 
ATOM   3950 C CD2 . LEU B 1 68  ? 33.468 -32.171 14.055  1.00   35.61  ? 155  LEU B CD2 1 
ATOM   3951 N N   . THR B 1 69  ? 34.684 -27.077 14.797  1.00   40.52  ? 156  THR B N   1 
ATOM   3952 C CA  . THR B 1 69  ? 34.388 -25.730 14.367  1.00   41.12  ? 156  THR B CA  1 
ATOM   3953 C C   . THR B 1 69  ? 35.305 -25.363 13.228  1.00   39.66  ? 156  THR B C   1 
ATOM   3954 O O   . THR B 1 69  ? 34.892 -24.767 12.240  1.00   40.08  ? 156  THR B O   1 
ATOM   3955 C CB  . THR B 1 69  ? 34.586 -24.789 15.562  1.00   38.29  ? 156  THR B CB  1 
ATOM   3956 O OG1 . THR B 1 69  ? 33.452 -24.917 16.405  1.00   33.88  ? 156  THR B OG1 1 
ATOM   3957 C CG2 . THR B 1 69  ? 34.559 -23.371 15.143  1.00   42.44  ? 156  THR B CG2 1 
ATOM   3958 N N   . ASN B 1 70  ? 36.576 -25.688 13.406  1.00   40.93  ? 157  ASN B N   1 
ATOM   3959 C CA  . ASN B 1 70  ? 37.565 -25.427 12.379  1.00   43.02  ? 157  ASN B CA  1 
ATOM   3960 C C   . ASN B 1 70  ? 37.192 -26.094 11.045  1.00   43.62  ? 157  ASN B C   1 
ATOM   3961 O O   . ASN B 1 70  ? 37.569 -25.634 9.966   1.00   41.69  ? 157  ASN B O   1 
ATOM   3962 C CB  . ASN B 1 70  ? 38.923 -25.891 12.884  1.00   45.19  ? 157  ASN B CB  1 
ATOM   3963 C CG  . ASN B 1 70  ? 39.629 -24.811 13.687  1.00   51.64  ? 157  ASN B CG  1 
ATOM   3964 O OD1 . ASN B 1 70  ? 39.513 -23.650 13.347  1.00   58.12  ? 157  ASN B OD1 1 
ATOM   3965 N ND2 . ASN B 1 70  ? 40.368 -25.177 14.731  1.00   53.10  ? 157  ASN B ND2 1 
ATOM   3966 N N   . ILE B 1 71  ? 36.437 -27.187 11.140  1.00   41.44  ? 158  ILE B N   1 
ATOM   3967 C CA  . ILE B 1 71  ? 36.008 -27.951 9.987   1.00   37.79  ? 158  ILE B CA  1 
ATOM   3968 C C   . ILE B 1 71  ? 34.791 -27.270 9.415   1.00   38.79  ? 158  ILE B C   1 
ATOM   3969 O O   . ILE B 1 71  ? 34.729 -27.027 8.204   1.00   38.23  ? 158  ILE B O   1 
ATOM   3970 C CB  . ILE B 1 71  ? 35.683 -29.403 10.380  1.00   35.28  ? 158  ILE B CB  1 
ATOM   3971 C CG1 . ILE B 1 71  ? 36.970 -30.137 10.750  1.00   35.33  ? 158  ILE B CG1 1 
ATOM   3972 C CG2 . ILE B 1 71  ? 34.955 -30.141 9.274   1.00   32.84  ? 158  ILE B CG2 1 
ATOM   3973 C CD1 . ILE B 1 71  ? 36.740 -31.619 11.068  1.00   38.26  ? 158  ILE B CD1 1 
ATOM   3974 N N   . ALA B 1 72  ? 33.855 -26.942 10.302  1.00   37.55  ? 159  ALA B N   1 
ATOM   3975 C CA  . ALA B 1 72  ? 32.586 -26.335 9.907   1.00   33.77  ? 159  ALA B CA  1 
ATOM   3976 C C   . ALA B 1 72  ? 32.759 -24.972 9.267   1.00   34.08  ? 159  ALA B C   1 
ATOM   3977 O O   . ALA B 1 72  ? 31.900 -24.511 8.516   1.00   31.44  ? 159  ALA B O   1 
ATOM   3978 C CB  . ALA B 1 72  ? 31.652 -26.221 11.070  1.00   31.52  ? 159  ALA B CB  1 
ATOM   3979 N N   . SER B 1 73  ? 33.907 -24.358 9.522   1.00   36.44  ? 160  SER B N   1 
ATOM   3980 C CA  . SER B 1 73  ? 34.124 -23.008 9.060   1.00   34.59  ? 160  SER B CA  1 
ATOM   3981 C C   . SER B 1 73  ? 34.995 -23.042 7.834   1.00   32.21  ? 160  SER B C   1 
ATOM   3982 O O   . SER B 1 73  ? 35.642 -22.049 7.530   1.00   35.21  ? 160  SER B O   1 
ATOM   3983 C CB  . SER B 1 73  ? 34.700 -22.165 10.190  1.00   34.90  ? 160  SER B CB  1 
ATOM   3984 O OG  . SER B 1 73  ? 36.097 -22.112 10.130  1.00   43.67  ? 160  SER B OG  1 
ATOM   3985 N N   . GLY B 1 74  ? 35.000 -24.172 7.136   1.00   31.77  ? 161  GLY B N   1 
ATOM   3986 C CA  . GLY B 1 74  ? 35.749 -24.310 5.903   1.00   35.87  ? 161  GLY B CA  1 
ATOM   3987 C C   . GLY B 1 74  ? 34.862 -24.121 4.689   1.00   37.45  ? 161  GLY B C   1 
ATOM   3988 O O   . GLY B 1 74  ? 34.116 -23.157 4.650   1.00   41.80  ? 161  GLY B O   1 
ATOM   3989 N N   . THR B 1 75  ? 34.934 -25.028 3.719   1.00   36.92  ? 162  THR B N   1 
ATOM   3990 C CA  . THR B 1 75  ? 34.123 -24.967 2.498   1.00   33.56  ? 162  THR B CA  1 
ATOM   3991 C C   . THR B 1 75  ? 32.749 -25.509 2.790   1.00   32.11  ? 162  THR B C   1 
ATOM   3992 O O   . THR B 1 75  ? 32.518 -26.253 3.723   1.00   35.01  ? 162  THR B O   1 
ATOM   3993 C CB  . THR B 1 75  ? 34.658 -25.864 1.305   1.00   33.15  ? 162  THR B CB  1 
ATOM   3994 O OG1 . THR B 1 75  ? 34.644 -27.271 1.627   1.00   33.45  ? 162  THR B OG1 1 
ATOM   3995 C CG2 . THR B 1 75  ? 36.087 -25.546 0.921   1.00   26.65  ? 162  THR B CG2 1 
ATOM   3996 N N   . SER B 1 76  ? 31.828 -25.172 1.916   1.00   36.26  ? 163  SER B N   1 
ATOM   3997 C CA  . SER B 1 76  ? 30.487 -25.684 2.031   1.00   36.89  ? 163  SER B CA  1 
ATOM   3998 C C   . SER B 1 76  ? 30.452 -27.198 2.187   1.00   39.06  ? 163  SER B C   1 
ATOM   3999 O O   . SER B 1 76  ? 29.646 -27.707 2.971   1.00   45.33  ? 163  SER B O   1 
ATOM   4000 C CB  . SER B 1 76  ? 29.667 -25.221 0.844   1.00   37.91  ? 163  SER B CB  1 
ATOM   4001 O OG  . SER B 1 76  ? 28.411 -25.869 0.937   1.00   44.02  ? 163  SER B OG  1 
ATOM   4002 N N   . ALA B 1 77  ? 31.328 -27.940 1.513   1.00   41.27  ? 164  ALA B N   1 
ATOM   4003 C CA  . ALA B 1 77  ? 31.303 -29.421 1.633   1.00   41.47  ? 164  ALA B CA  1 
ATOM   4004 C C   . ALA B 1 77  ? 31.816 -29.972 2.959   1.00   38.73  ? 164  ALA B C   1 
ATOM   4005 O O   . ALA B 1 77  ? 31.374 -31.042 3.415   1.00   34.42  ? 164  ALA B O   1 
ATOM   4006 C CB  . ALA B 1 77  ? 32.081 -30.078 0.517   1.00   41.50  ? 164  ALA B CB  1 
ATOM   4007 N N   . GLN B 1 78  ? 32.762 -29.231 3.537   1.00   35.71  ? 165  GLN B N   1 
ATOM   4008 C CA  . GLN B 1 78  ? 33.340 -29.570 4.838   1.00   34.83  ? 165  GLN B CA  1 
ATOM   4009 C C   . GLN B 1 78  ? 32.352 -29.243 5.958   1.00   36.07  ? 165  GLN B C   1 
ATOM   4010 O O   . GLN B 1 78  ? 32.283 -29.980 6.952   1.00   34.34  ? 165  GLN B O   1 
ATOM   4011 C CB  . GLN B 1 78  ? 34.720 -28.938 5.017   1.00   30.98  ? 165  GLN B CB  1 
ATOM   4012 C CG  . GLN B 1 78  ? 35.663 -29.375 3.873   1.00   33.63  ? 165  GLN B CG  1 
ATOM   4013 C CD  . GLN B 1 78  ? 36.875 -28.480 3.667   1.00   33.04  ? 165  GLN B CD  1 
ATOM   4014 O OE1 . GLN B 1 78  ? 36.796 -27.258 3.790   1.00   35.76  ? 165  GLN B OE1 1 
ATOM   4015 N NE2 . GLN B 1 78  ? 38.003 -29.097 3.342   1.00   24.86  ? 165  GLN B NE2 1 
ATOM   4016 N N   . THR B 1 79  ? 31.528 -28.213 5.741   1.00   33.38  ? 166  THR B N   1 
ATOM   4017 C CA  . THR B 1 79  ? 30.491 -27.834 6.686   1.00   31.12  ? 166  THR B CA  1 
ATOM   4018 C C   . THR B 1 79  ? 29.388 -28.881 6.687   1.00   33.35  ? 166  THR B C   1 
ATOM   4019 O O   . THR B 1 79  ? 28.832 -29.229 7.736   1.00   33.91  ? 166  THR B O   1 
ATOM   4020 C CB  . THR B 1 79  ? 29.873 -26.528 6.270   1.00   32.99  ? 166  THR B CB  1 
ATOM   4021 O OG1 . THR B 1 79  ? 30.806 -25.456 6.424   1.00   34.94  ? 166  THR B OG1 1 
ATOM   4022 C CG2 . THR B 1 79  ? 28.740 -26.177 7.210   1.00   35.17  ? 166  THR B CG2 1 
ATOM   4023 N N   . LYS B 1 80  ? 29.097 -29.393 5.492   1.00   31.91  ? 167  LYS B N   1 
ATOM   4024 C CA  . LYS B 1 80  ? 28.097 -30.433 5.301   1.00   27.07  ? 167  LYS B CA  1 
ATOM   4025 C C   . LYS B 1 80  ? 28.473 -31.711 6.033   1.00   28.26  ? 167  LYS B C   1 
ATOM   4026 O O   . LYS B 1 80  ? 27.620 -32.474 6.482   1.00   28.12  ? 167  LYS B O   1 
ATOM   4027 C CB  . LYS B 1 80  ? 27.957 -30.729 3.805   1.00   31.05  ? 167  LYS B CB  1 
ATOM   4028 C CG  . LYS B 1 80  ? 27.246 -32.055 3.493   1.00   30.22  ? 167  LYS B CG  1 
ATOM   4029 C CD  . LYS B 1 80  ? 26.784 -32.105 2.059   1.00   33.75  ? 167  LYS B CD  1 
ATOM   4030 C CE  . LYS B 1 80  ? 26.124 -33.413 1.686   1.00   36.74  ? 167  LYS B CE  1 
ATOM   4031 N NZ  . LYS B 1 80  ? 24.919 -33.732 2.480   1.00   39.10  ? 167  LYS B NZ  1 
ATOM   4032 N N   . VAL B 1 81  ? 29.763 -31.998 6.108   1.00   29.89  ? 168  VAL B N   1 
ATOM   4033 C CA  . VAL B 1 81  ? 30.177 -33.225 6.768   1.00   33.60  ? 168  VAL B CA  1 
ATOM   4034 C C   . VAL B 1 81  ? 29.807 -33.107 8.231   1.00   34.85  ? 168  VAL B C   1 
ATOM   4035 O O   . VAL B 1 81  ? 29.268 -34.038 8.812   1.00   36.41  ? 168  VAL B O   1 
ATOM   4036 C CB  . VAL B 1 81  ? 31.709 -33.511 6.652   1.00   36.81  ? 168  VAL B CB  1 
ATOM   4037 C CG1 . VAL B 1 81  ? 32.100 -34.705 7.480   1.00   34.85  ? 168  VAL B CG1 1 
ATOM   4038 C CG2 . VAL B 1 81  ? 32.132 -33.741 5.206   1.00   34.01  ? 168  VAL B CG2 1 
ATOM   4039 N N   . VAL B 1 82  ? 30.095 -31.951 8.824   1.00   40.04  ? 169  VAL B N   1 
ATOM   4040 C CA  . VAL B 1 82  ? 29.790 -31.706 10.237  1.00   38.06  ? 169  VAL B CA  1 
ATOM   4041 C C   . VAL B 1 82  ? 28.294 -31.795 10.530  1.00   37.31  ? 169  VAL B C   1 
ATOM   4042 O O   . VAL B 1 82  ? 27.885 -32.273 11.573  1.00   36.92  ? 169  VAL B O   1 
ATOM   4043 C CB  . VAL B 1 82  ? 30.373 -30.374 10.655  1.00   36.73  ? 169  VAL B CB  1 
ATOM   4044 C CG1 . VAL B 1 82  ? 29.945 -29.972 12.057  1.00   36.85  ? 169  VAL B CG1 1 
ATOM   4045 C CG2 . VAL B 1 82  ? 31.892 -30.508 10.609  1.00   39.01  ? 169  VAL B CG2 1 
ATOM   4046 N N   . VAL B 1 83  ? 27.479 -31.375 9.581   1.00   35.56  ? 170  VAL B N   1 
ATOM   4047 C CA  . VAL B 1 83  ? 26.058 -31.341 9.788   1.00   35.43  ? 170  VAL B CA  1 
ATOM   4048 C C   . VAL B 1 83  ? 25.538 -32.755 9.633   1.00   37.11  ? 170  VAL B C   1 
ATOM   4049 O O   . VAL B 1 83  ? 24.618 -33.131 10.340  1.00   38.93  ? 170  VAL B O   1 
ATOM   4050 C CB  . VAL B 1 83  ? 25.372 -30.387 8.768   1.00   36.29  ? 170  VAL B CB  1 
ATOM   4051 C CG1 . VAL B 1 83  ? 23.851 -30.588 8.712   1.00   36.73  ? 170  VAL B CG1 1 
ATOM   4052 C CG2 . VAL B 1 83  ? 25.679 -28.958 9.089   1.00   33.60  ? 170  VAL B CG2 1 
ATOM   4053 N N   . ASP B 1 84  ? 26.075 -33.517 8.681   1.00   43.04  ? 171  ASP B N   1 
ATOM   4054 C CA  . ASP B 1 84  ? 25.583 -34.877 8.383   1.00   43.53  ? 171  ASP B CA  1 
ATOM   4055 C C   . ASP B 1 84  ? 25.932 -35.810 9.538   1.00   43.43  ? 171  ASP B C   1 
ATOM   4056 O O   . ASP B 1 84  ? 25.198 -36.761 9.806   1.00   44.62  ? 171  ASP B O   1 
ATOM   4057 C CB  . ASP B 1 84  ? 26.090 -35.415 7.044   1.00   45.48  ? 171  ASP B CB  1 
ATOM   4058 C CG  . ASP B 1 84  ? 25.418 -34.739 5.828   1.00   49.40  ? 171  ASP B CG  1 
ATOM   4059 O OD1 . ASP B 1 84  ? 24.315 -34.183 5.957   1.00   45.50  ? 171  ASP B OD1 1 
ATOM   4060 O OD2 . ASP B 1 84  ? 25.916 -34.686 4.674   1.00   52.32  ? 171  ASP B OD2 1 
ATOM   4061 N N   . ALA B 1 85  ? 26.964 -35.458 10.300  1.00   41.09  ? 172  ALA B N   1 
ATOM   4062 C CA  . ALA B 1 85  ? 27.299 -36.150 11.534  1.00   40.11  ? 172  ALA B CA  1 
ATOM   4063 C C   . ALA B 1 85  ? 26.361 -35.838 12.720  1.00   42.97  ? 172  ALA B C   1 
ATOM   4064 O O   . ALA B 1 85  ? 26.571 -36.269 13.854  1.00   43.08  ? 172  ALA B O   1 
ATOM   4065 C CB  . ALA B 1 85  ? 28.724 -35.785 11.891  1.00   43.62  ? 172  ALA B CB  1 
ATOM   4066 N N   . ASP B 1 86  ? 25.315 -35.061 12.482  1.00   44.20  ? 173  ASP B N   1 
ATOM   4067 C CA  . ASP B 1 86  ? 24.408 -34.640 13.545  1.00   42.90  ? 173  ASP B CA  1 
ATOM   4068 C C   . ASP B 1 86  ? 25.059 -33.927 14.718  1.00   38.38  ? 173  ASP B C   1 
ATOM   4069 O O   . ASP B 1 86  ? 24.646 -34.112 15.852  1.00   38.95  ? 173  ASP B O   1 
ATOM   4070 C CB  . ASP B 1 86  ? 23.542 -35.816 14.018  1.00   46.20  ? 173  ASP B CB  1 
ATOM   4071 C CG  . ASP B 1 86  ? 22.237 -35.367 14.666  1.00   50.86  ? 173  ASP B CG  1 
ATOM   4072 O OD1 . ASP B 1 86  ? 21.370 -34.730 14.022  1.00   47.40  ? 173  ASP B OD1 1 
ATOM   4073 O OD2 . ASP B 1 86  ? 21.993 -35.621 15.865  1.00   63.81  ? 173  ASP B OD2 1 
ATOM   4074 N N   . ALA B 1 87  ? 25.991 -33.032 14.421  1.00   35.60  ? 174  ALA B N   1 
ATOM   4075 C CA  . ALA B 1 87  ? 26.691 -32.217 15.414  1.00   34.08  ? 174  ALA B CA  1 
ATOM   4076 C C   . ALA B 1 87  ? 25.926 -30.989 15.932  1.00   36.24  ? 174  ALA B C   1 
ATOM   4077 O O   . ALA B 1 87  ? 26.246 -30.447 16.992  1.00   37.10  ? 174  ALA B O   1 
ATOM   4078 C CB  . ALA B 1 87  ? 27.991 -31.706 14.800  1.00   34.84  ? 174  ALA B CB  1 
ATOM   4079 N N   . VAL B 1 88  ? 24.971 -30.491 15.162  1.00   35.94  ? 175  VAL B N   1 
ATOM   4080 C CA  . VAL B 1 88  ? 24.329 -29.223 15.498  1.00   36.77  ? 175  VAL B CA  1 
ATOM   4081 C C   . VAL B 1 88  ? 23.550 -29.308 16.826  1.00   38.43  ? 175  VAL B C   1 
ATOM   4082 O O   . VAL B 1 88  ? 23.645 -28.438 17.691  1.00   32.20  ? 175  VAL B O   1 
ATOM   4083 C CB  . VAL B 1 88  ? 23.420 -28.730 14.337  1.00   34.47  ? 175  VAL B CB  1 
ATOM   4084 C CG1 . VAL B 1 88  ? 22.335 -27.824 14.831  1.00   33.33  ? 175  VAL B CG1 1 
ATOM   4085 C CG2 . VAL B 1 88  ? 24.274 -28.034 13.270  1.00   32.32  ? 175  VAL B CG2 1 
ATOM   4086 N N   . PRO B 1 89  ? 22.728 -30.329 17.000  1.00   38.16  ? 176  PRO B N   1 
ATOM   4087 C CA  . PRO B 1 89  ? 22.015 -30.430 18.263  1.00   40.39  ? 176  PRO B CA  1 
ATOM   4088 C C   . PRO B 1 89  ? 22.973 -30.511 19.461  1.00   42.68  ? 176  PRO B C   1 
ATOM   4089 O O   . PRO B 1 89  ? 22.617 -30.101 20.560  1.00   45.30  ? 176  PRO B O   1 
ATOM   4090 C CB  . PRO B 1 89  ? 21.066 -31.625 18.057  1.00   37.98  ? 176  PRO B CB  1 
ATOM   4091 C CG  . PRO B 1 89  ? 21.469 -32.258 16.866  1.00   40.39  ? 176  PRO B CG  1 
ATOM   4092 C CD  . PRO B 1 89  ? 22.296 -31.345 16.038  1.00   41.18  ? 176  PRO B CD  1 
ATOM   4093 N N   . LEU B 1 90  ? 24.207 -30.939 19.263  1.00   42.64  ? 177  LEU B N   1 
ATOM   4094 C CA  . LEU B 1 90  ? 25.093 -31.011 20.410  1.00   46.98  ? 177  LEU B CA  1 
ATOM   4095 C C   . LEU B 1 90  ? 25.756 -29.687 20.612  1.00   44.79  ? 177  LEU B C   1 
ATOM   4096 O O   . LEU B 1 90  ? 26.085 -29.348 21.732  1.00   49.98  ? 177  LEU B O   1 
ATOM   4097 C CB  . LEU B 1 90  ? 26.132 -32.155 20.299  1.00   49.65  ? 177  LEU B CB  1 
ATOM   4098 C CG  . LEU B 1 90  ? 25.552 -33.553 20.008  1.00   48.38  ? 177  LEU B CG  1 
ATOM   4099 C CD1 . LEU B 1 90  ? 26.610 -34.585 19.997  1.00   49.98  ? 177  LEU B CD1 1 
ATOM   4100 C CD2 . LEU B 1 90  ? 24.473 -33.971 20.980  1.00   50.41  ? 177  LEU B CD2 1 
ATOM   4101 N N   . PHE B 1 91  ? 26.005 -28.975 19.525  1.00   44.51  ? 178  PHE B N   1 
ATOM   4102 C CA  . PHE B 1 91  ? 26.557 -27.621 19.586  1.00   42.95  ? 178  PHE B CA  1 
ATOM   4103 C C   . PHE B 1 91  ? 25.540 -26.762 20.314  1.00   43.49  ? 178  PHE B C   1 
ATOM   4104 O O   . PHE B 1 91  ? 25.851 -25.851 21.065  1.00   39.22  ? 178  PHE B O   1 
ATOM   4105 C CB  . PHE B 1 91  ? 26.736 -27.043 18.170  1.00   40.64  ? 178  PHE B CB  1 
ATOM   4106 C CG  . PHE B 1 91  ? 28.062 -27.368 17.544  1.00   39.02  ? 178  PHE B CG  1 
ATOM   4107 C CD1 . PHE B 1 91  ? 28.138 -27.842 16.243  1.00   41.82  ? 178  PHE B CD1 1 
ATOM   4108 C CD2 . PHE B 1 91  ? 29.234 -27.201 18.249  1.00   38.48  ? 178  PHE B CD2 1 
ATOM   4109 C CE1 . PHE B 1 91  ? 29.339 -28.158 15.649  1.00   36.30  ? 178  PHE B CE1 1 
ATOM   4110 C CE2 . PHE B 1 91  ? 30.449 -27.528 17.665  1.00   45.00  ? 178  PHE B CE2 1 
ATOM   4111 C CZ  . PHE B 1 91  ? 30.491 -28.011 16.352  1.00   42.08  ? 178  PHE B CZ  1 
ATOM   4112 N N   . ILE B 1 92  ? 24.278 -27.069 20.072  1.00   46.12  ? 179  ILE B N   1 
ATOM   4113 C CA  . ILE B 1 92  ? 23.221 -26.258 20.635  1.00   46.29  ? 179  ILE B CA  1 
ATOM   4114 C C   . ILE B 1 92  ? 23.153 -26.483 22.120  1.00   50.12  ? 179  ILE B C   1 
ATOM   4115 O O   . ILE B 1 92  ? 23.165 -25.526 22.890  1.00   50.11  ? 179  ILE B O   1 
ATOM   4116 C CB  . ILE B 1 92  ? 21.893 -26.560 19.954  1.00   44.58  ? 179  ILE B CB  1 
ATOM   4117 C CG1 . ILE B 1 92  ? 21.850 -25.849 18.595  1.00   43.75  ? 179  ILE B CG1 1 
ATOM   4118 C CG2 . ILE B 1 92  ? 20.741 -26.071 20.807  1.00   45.47  ? 179  ILE B CG2 1 
ATOM   4119 C CD1 . ILE B 1 92  ? 20.732 -26.332 17.715  1.00   44.89  ? 179  ILE B CD1 1 
ATOM   4120 N N   . GLN B 1 93  ? 23.088 -27.746 22.534  1.00   54.59  ? 180  GLN B N   1 
ATOM   4121 C CA  . GLN B 1 93  ? 22.972 -28.044 23.967  1.00   54.40  ? 180  GLN B CA  1 
ATOM   4122 C C   . GLN B 1 93  ? 24.228 -27.658 24.757  1.00   51.33  ? 180  GLN B C   1 
ATOM   4123 O O   . GLN B 1 93  ? 24.148 -27.399 25.953  1.00   49.07  ? 180  GLN B O   1 
ATOM   4124 C CB  . GLN B 1 93  ? 22.530 -29.482 24.240  1.00   56.12  ? 180  GLN B CB  1 
ATOM   4125 C CG  . GLN B 1 93  ? 23.569 -30.493 23.876  1.00   62.65  ? 180  GLN B CG  1 
ATOM   4126 C CD  . GLN B 1 93  ? 23.125 -31.930 24.115  1.00   62.52  ? 180  GLN B CD  1 
ATOM   4127 O OE1 . GLN B 1 93  ? 22.029 -32.320 23.719  1.00   56.04  ? 180  GLN B OE1 1 
ATOM   4128 N NE2 . GLN B 1 93  ? 23.997 -32.722 24.735  1.00   64.85  ? 180  GLN B NE2 1 
ATOM   4129 N N   . LEU B 1 94  ? 25.368 -27.554 24.084  1.00   49.15  ? 181  LEU B N   1 
ATOM   4130 C CA  . LEU B 1 94  ? 26.559 -26.979 24.702  1.00   48.62  ? 181  LEU B CA  1 
ATOM   4131 C C   . LEU B 1 94  ? 26.439 -25.477 24.990  1.00   49.16  ? 181  LEU B C   1 
ATOM   4132 O O   . LEU B 1 94  ? 27.283 -24.929 25.688  1.00   53.05  ? 181  LEU B O   1 
ATOM   4133 C CB  . LEU B 1 94  ? 27.794 -27.221 23.823  1.00   48.52  ? 181  LEU B CB  1 
ATOM   4134 C CG  . LEU B 1 94  ? 28.489 -28.591 23.801  1.00   50.35  ? 181  LEU B CG  1 
ATOM   4135 C CD1 . LEU B 1 94  ? 29.575 -28.607 22.730  1.00   46.17  ? 181  LEU B CD1 1 
ATOM   4136 C CD2 . LEU B 1 94  ? 29.085 -28.932 25.181  1.00   53.11  ? 181  LEU B CD2 1 
ATOM   4137 N N   . LEU B 1 95  ? 25.463 -24.784 24.410  1.00   47.98  ? 182  LEU B N   1 
ATOM   4138 C CA  . LEU B 1 95  ? 25.333 -23.335 24.598  1.00   49.30  ? 182  LEU B CA  1 
ATOM   4139 C C   . LEU B 1 95  ? 24.706 -23.061 25.966  1.00   51.16  ? 182  LEU B C   1 
ATOM   4140 O O   . LEU B 1 95  ? 24.795 -21.959 26.503  1.00   51.14  ? 182  LEU B O   1 
ATOM   4141 C CB  . LEU B 1 95  ? 24.451 -22.682 23.522  1.00   47.87  ? 182  LEU B CB  1 
ATOM   4142 C CG  . LEU B 1 95  ? 24.896 -22.563 22.059  1.00   47.25  ? 182  LEU B CG  1 
ATOM   4143 C CD1 . LEU B 1 95  ? 23.718 -22.130 21.229  1.00   47.96  ? 182  LEU B CD1 1 
ATOM   4144 C CD2 . LEU B 1 95  ? 26.045 -21.579 21.825  1.00   48.48  ? 182  LEU B CD2 1 
ATOM   4145 N N   . TYR B 1 96  ? 24.004 -24.066 26.478  1.00   53.08  ? 183  TYR B N   1 
ATOM   4146 C CA  . TYR B 1 96  ? 23.400 -24.061 27.801  1.00   53.57  ? 183  TYR B CA  1 
ATOM   4147 C C   . TYR B 1 96  ? 24.456 -24.472 28.824  1.00   57.44  ? 183  TYR B C   1 
ATOM   4148 O O   . TYR B 1 96  ? 24.817 -23.690 29.705  1.00   60.62  ? 183  TYR B O   1 
ATOM   4149 C CB  . TYR B 1 96  ? 22.302 -25.124 27.864  1.00   54.19  ? 183  TYR B CB  1 
ATOM   4150 C CG  . TYR B 1 96  ? 20.985 -24.857 27.164  1.00   55.49  ? 183  TYR B CG  1 
ATOM   4151 C CD1 . TYR B 1 96  ? 20.635 -25.522 25.989  1.00   57.04  ? 183  TYR B CD1 1 
ATOM   4152 C CD2 . TYR B 1 96  ? 20.019 -24.048 27.755  1.00   59.08  ? 183  TYR B CD2 1 
ATOM   4153 C CE1 . TYR B 1 96  ? 19.377 -25.323 25.380  1.00   54.27  ? 183  TYR B CE1 1 
ATOM   4154 C CE2 . TYR B 1 96  ? 18.772 -23.843 27.157  1.00   57.69  ? 183  TYR B CE2 1 
ATOM   4155 C CZ  . TYR B 1 96  ? 18.453 -24.473 25.977  1.00   54.99  ? 183  TYR B CZ  1 
ATOM   4156 O OH  . TYR B 1 96  ? 17.185 -24.218 25.488  1.00   56.62  ? 183  TYR B OH  1 
ATOM   4157 N N   . THR B 1 97  ? 24.971 -25.697 28.661  1.00   60.18  ? 184  THR B N   1 
ATOM   4158 C CA  . THR B 1 97  ? 25.826 -26.347 29.651  1.00   58.76  ? 184  THR B CA  1 
ATOM   4159 C C   . THR B 1 97  ? 27.207 -25.762 29.662  1.00   58.62  ? 184  THR B C   1 
ATOM   4160 O O   . THR B 1 97  ? 27.689 -25.344 30.692  1.00   62.09  ? 184  THR B O   1 
ATOM   4161 C CB  . THR B 1 97  ? 25.943 -27.891 29.469  1.00   57.38  ? 184  THR B CB  1 
ATOM   4162 O OG1 . THR B 1 97  ? 26.879 -28.222 28.435  1.00   59.84  ? 184  THR B OG1 1 
ATOM   4163 C CG2 . THR B 1 97  ? 24.649 -28.543 29.016  1.00   57.03  ? 184  THR B CG2 1 
ATOM   4164 N N   . GLY B 1 98  ? 27.850 -25.737 28.512  1.00   59.00  ? 185  GLY B N   1 
ATOM   4165 C CA  . GLY B 1 98  ? 29.267 -25.420 28.467  1.00   59.45  ? 185  GLY B CA  1 
ATOM   4166 C C   . GLY B 1 98  ? 29.770 -24.173 29.156  1.00   55.15  ? 185  GLY B C   1 
ATOM   4167 O O   . GLY B 1 98  ? 29.009 -23.329 29.551  1.00   49.47  ? 185  GLY B O   1 
ATOM   4168 N N   . SER B 1 99  ? 31.084 -24.074 29.303  1.00   58.92  ? 186  SER B N   1 
ATOM   4169 C CA  . SER B 1 99  ? 31.688 -22.862 29.823  1.00   59.89  ? 186  SER B CA  1 
ATOM   4170 C C   . SER B 1 99  ? 31.597 -21.801 28.726  1.00   59.43  ? 186  SER B C   1 
ATOM   4171 O O   . SER B 1 99  ? 30.982 -22.023 27.698  1.00   55.51  ? 186  SER B O   1 
ATOM   4172 C CB  . SER B 1 99  ? 33.148 -23.112 30.218  1.00   60.35  ? 186  SER B CB  1 
ATOM   4173 O OG  . SER B 1 99  ? 33.954 -23.392 29.084  1.00   60.63  ? 186  SER B OG  1 
ATOM   4174 N N   . VAL B 1 100 ? 32.239 -20.662 28.954  1.00   60.29  ? 187  VAL B N   1 
ATOM   4175 C CA  . VAL B 1 100 ? 32.260 -19.559 28.015  1.00   59.15  ? 187  VAL B CA  1 
ATOM   4176 C C   . VAL B 1 100 ? 33.136 -19.841 26.801  1.00   61.31  ? 187  VAL B C   1 
ATOM   4177 O O   . VAL B 1 100 ? 32.759 -19.497 25.679  1.00   65.13  ? 187  VAL B O   1 
ATOM   4178 C CB  . VAL B 1 100 ? 32.692 -18.267 28.734  1.00   60.38  ? 187  VAL B CB  1 
ATOM   4179 C CG1 . VAL B 1 100 ? 32.908 -17.141 27.742  1.00   62.55  ? 187  VAL B CG1 1 
ATOM   4180 C CG2 . VAL B 1 100 ? 31.625 -17.849 29.773  1.00   59.80  ? 187  VAL B CG2 1 
ATOM   4181 N N   . GLU B 1 101 ? 34.292 -20.463 26.992  1.00   61.97  ? 188  GLU B N   1 
ATOM   4182 C CA  . GLU B 1 101 ? 35.174 -20.762 25.860  1.00   61.65  ? 188  GLU B CA  1 
ATOM   4183 C C   . GLU B 1 101 ? 34.477 -21.711 24.899  1.00   60.54  ? 188  GLU B C   1 
ATOM   4184 O O   . GLU B 1 101 ? 34.648 -21.600 23.688  1.00   60.61  ? 188  GLU B O   1 
ATOM   4185 C CB  . GLU B 1 101 ? 36.467 -21.453 26.298  1.00   64.64  ? 188  GLU B CB  1 
ATOM   4186 C CG  . GLU B 1 101 ? 37.250 -20.807 27.431  1.00   68.81  ? 188  GLU B CG  1 
ATOM   4187 C CD  . GLU B 1 101 ? 36.679 -21.114 28.805  1.00   72.24  ? 188  GLU B CD  1 
ATOM   4188 O OE1 . GLU B 1 101 ? 36.450 -22.302 29.180  1.00   75.03  ? 188  GLU B OE1 1 
ATOM   4189 O OE2 . GLU B 1 101 ? 36.447 -20.103 29.492  1.00   70.03  ? 188  GLU B OE2 1 
ATOM   4190 N N   . VAL B 1 102 ? 33.744 -22.666 25.474  1.00   59.88  ? 189  VAL B N   1 
ATOM   4191 C CA  . VAL B 1 102 ? 32.975 -23.677 24.744  1.00   59.01  ? 189  VAL B CA  1 
ATOM   4192 C C   . VAL B 1 102 ? 31.782 -23.056 24.047  1.00   57.10  ? 189  VAL B C   1 
ATOM   4193 O O   . VAL B 1 102 ? 31.401 -23.517 22.979  1.00   59.19  ? 189  VAL B O   1 
ATOM   4194 C CB  . VAL B 1 102 ? 32.425 -24.776 25.692  1.00   60.54  ? 189  VAL B CB  1 
ATOM   4195 C CG1 . VAL B 1 102 ? 31.594 -25.828 24.948  1.00   62.47  ? 189  VAL B CG1 1 
ATOM   4196 C CG2 . VAL B 1 102 ? 33.563 -25.475 26.415  1.00   65.02  ? 189  VAL B CG2 1 
ATOM   4197 N N   . LYS B 1 103 ? 31.180 -22.053 24.681  1.00   54.52  ? 190  LYS B N   1 
ATOM   4198 C CA  . LYS B 1 103 ? 30.008 -21.375 24.157  1.00   51.65  ? 190  LYS B CA  1 
ATOM   4199 C C   . LYS B 1 103 ? 30.467 -20.600 22.939  1.00   48.80  ? 190  LYS B C   1 
ATOM   4200 O O   . LYS B 1 103 ? 29.797 -20.605 21.926  1.00   50.62  ? 190  LYS B O   1 
ATOM   4201 C CB  . LYS B 1 103 ? 29.368 -20.461 25.209  1.00   53.19  ? 190  LYS B CB  1 
ATOM   4202 C CG  . LYS B 1 103 ? 28.413 -21.156 26.182  1.00   54.65  ? 190  LYS B CG  1 
ATOM   4203 C CD  . LYS B 1 103 ? 27.908 -20.201 27.264  1.00   56.38  ? 190  LYS B CD  1 
ATOM   4204 C CE  . LYS B 1 103 ? 27.041 -20.911 28.313  1.00   58.71  ? 190  LYS B CE  1 
ATOM   4205 N NZ  . LYS B 1 103 ? 26.818 -20.115 29.572  1.00   64.05  ? 190  LYS B NZ  1 
ATOM   4206 N N   . GLU B 1 104 ? 31.643 -20.004 22.993  1.00   47.96  ? 191  GLU B N   1 
ATOM   4207 C CA  . GLU B 1 104 ? 32.112 -19.199 21.877  1.00   51.02  ? 191  GLU B CA  1 
ATOM   4208 C C   . GLU B 1 104 ? 32.448 -20.015 20.630  1.00   52.91  ? 191  GLU B C   1 
ATOM   4209 O O   . GLU B 1 104 ? 32.356 -19.496 19.488  1.00   51.71  ? 191  GLU B O   1 
ATOM   4210 C CB  . GLU B 1 104 ? 33.327 -18.358 22.264  1.00   52.37  ? 191  GLU B CB  1 
ATOM   4211 C CG  . GLU B 1 104 ? 33.530 -17.189 21.299  1.00   60.88  ? 191  GLU B CG  1 
ATOM   4212 C CD  . GLU B 1 104 ? 34.503 -16.123 21.795  1.00   65.14  ? 191  GLU B CD  1 
ATOM   4213 O OE1 . GLU B 1 104 ? 34.540 -15.835 23.027  1.00   59.49  ? 191  GLU B OE1 1 
ATOM   4214 O OE2 . GLU B 1 104 ? 35.217 -15.564 20.925  1.00   68.65  ? 191  GLU B OE2 1 
ATOM   4215 N N   . GLN B 1 105 ? 32.858 -21.269 20.849  1.00   48.29  ? 192  GLN B N   1 
ATOM   4216 C CA  . GLN B 1 105 ? 33.151 -22.181 19.731  1.00   45.46  ? 192  GLN B CA  1 
ATOM   4217 C C   . GLN B 1 105 ? 31.848 -22.659 19.142  1.00   40.76  ? 192  GLN B C   1 
ATOM   4218 O O   . GLN B 1 105 ? 31.620 -22.526 17.965  1.00   43.44  ? 192  GLN B O   1 
ATOM   4219 C CB  . GLN B 1 105 ? 33.969 -23.405 20.155  1.00   46.63  ? 192  GLN B CB  1 
ATOM   4220 C CG  . GLN B 1 105 ? 35.431 -23.060 20.480  1.00   44.51  ? 192  GLN B CG  1 
ATOM   4221 C CD  . GLN B 1 105 ? 36.216 -22.672 19.261  1.00   40.06  ? 192  GLN B CD  1 
ATOM   4222 O OE1 . GLN B 1 105 ? 37.160 -21.891 19.332  1.00   41.64  ? 192  GLN B OE1 1 
ATOM   4223 N NE2 . GLN B 1 105 ? 35.811 -23.195 18.124  1.00   41.32  ? 192  GLN B NE2 1 
ATOM   4224 N N   . ALA B 1 106 ? 30.941 -23.154 19.957  1.00   37.19  ? 193  ALA B N   1 
ATOM   4225 C CA  . ALA B 1 106 ? 29.682 -23.596 19.407  1.00   39.55  ? 193  ALA B CA  1 
ATOM   4226 C C   . ALA B 1 106 ? 28.908 -22.483 18.702  1.00   39.64  ? 193  ALA B C   1 
ATOM   4227 O O   . ALA B 1 106 ? 28.181 -22.743 17.732  1.00   37.57  ? 193  ALA B O   1 
ATOM   4228 C CB  . ALA B 1 106 ? 28.828 -24.203 20.497  1.00   42.50  ? 193  ALA B CB  1 
ATOM   4229 N N   . ILE B 1 107 ? 29.006 -21.250 19.191  1.00   36.63  ? 194  ILE B N   1 
ATOM   4230 C CA  . ILE B 1 107 ? 28.179 -20.224 18.562  1.00   36.34  ? 194  ILE B CA  1 
ATOM   4231 C C   . ILE B 1 107 ? 28.762 -19.950 17.181  1.00   36.32  ? 194  ILE B C   1 
ATOM   4232 O O   . ILE B 1 107 ? 28.044 -19.807 16.198  1.00   34.95  ? 194  ILE B O   1 
ATOM   4233 C CB  . ILE B 1 107 ? 27.934 -18.970 19.449  1.00   32.53  ? 194  ILE B CB  1 
ATOM   4234 C CG1 . ILE B 1 107 ? 26.889 -18.059 18.833  1.00   32.73  ? 194  ILE B CG1 1 
ATOM   4235 C CG2 . ILE B 1 107 ? 29.143 -18.164 19.631  1.00   35.14  ? 194  ILE B CG2 1 
ATOM   4236 C CD1 . ILE B 1 107 ? 25.538 -18.683 18.656  1.00   35.14  ? 194  ILE B CD1 1 
ATOM   4237 N N   . TRP B 1 108 ? 30.078 -19.943 17.101  1.00   35.14  ? 195  TRP B N   1 
ATOM   4238 C CA  . TRP B 1 108 ? 30.719 -19.701 15.820  1.00   39.31  ? 195  TRP B CA  1 
ATOM   4239 C C   . TRP B 1 108 ? 30.463 -20.806 14.822  1.00   40.28  ? 195  TRP B C   1 
ATOM   4240 O O   . TRP B 1 108 ? 30.305 -20.559 13.633  1.00   43.06  ? 195  TRP B O   1 
ATOM   4241 C CB  . TRP B 1 108 ? 32.210 -19.582 16.030  1.00   40.83  ? 195  TRP B CB  1 
ATOM   4242 C CG  . TRP B 1 108 ? 33.015 -19.386 14.809  1.00   41.97  ? 195  TRP B CG  1 
ATOM   4243 C CD1 . TRP B 1 108 ? 33.999 -20.219 14.351  1.00   44.27  ? 195  TRP B CD1 1 
ATOM   4244 C CD2 . TRP B 1 108 ? 33.010 -18.258 13.940  1.00   35.67  ? 195  TRP B CD2 1 
ATOM   4245 N NE1 . TRP B 1 108 ? 34.579 -19.686 13.226  1.00   39.65  ? 195  TRP B NE1 1 
ATOM   4246 C CE2 . TRP B 1 108 ? 33.992 -18.480 12.958  1.00   36.07  ? 195  TRP B CE2 1 
ATOM   4247 C CE3 . TRP B 1 108 ? 32.252 -17.092 13.865  1.00   38.66  ? 195  TRP B CE3 1 
ATOM   4248 C CZ2 . TRP B 1 108 ? 34.250 -17.581 11.938  1.00   38.78  ? 195  TRP B CZ2 1 
ATOM   4249 C CZ3 . TRP B 1 108 ? 32.497 -16.198 12.830  1.00   35.68  ? 195  TRP B CZ3 1 
ATOM   4250 C CH2 . TRP B 1 108 ? 33.490 -16.455 11.878  1.00   35.58  ? 195  TRP B CH2 1 
ATOM   4251 N N   . ALA B 1 109 ? 30.433 -22.031 15.313  1.00   39.35  ? 196  ALA B N   1 
ATOM   4252 C CA  . ALA B 1 109 ? 30.163 -23.157 14.462  1.00   36.10  ? 196  ALA B CA  1 
ATOM   4253 C C   . ALA B 1 109 ? 28.740 -23.024 13.933  1.00   34.40  ? 196  ALA B C   1 
ATOM   4254 O O   . ALA B 1 109 ? 28.463 -23.258 12.775  1.00   36.98  ? 196  ALA B O   1 
ATOM   4255 C CB  . ALA B 1 109 ? 30.286 -24.435 15.276  1.00   37.56  ? 196  ALA B CB  1 
ATOM   4256 N N   . LEU B 1 110 ? 27.795 -22.698 14.793  1.00   35.40  ? 197  LEU B N   1 
ATOM   4257 C CA  . LEU B 1 110 ? 26.395 -22.741 14.378  1.00   34.78  ? 197  LEU B CA  1 
ATOM   4258 C C   . LEU B 1 110 ? 26.135 -21.601 13.423  1.00   33.74  ? 197  LEU B C   1 
ATOM   4259 O O   . LEU B 1 110 ? 25.224 -21.672 12.615  1.00   30.69  ? 197  LEU B O   1 
ATOM   4260 C CB  . LEU B 1 110 ? 25.463 -22.596 15.572  1.00   33.82  ? 197  LEU B CB  1 
ATOM   4261 C CG  . LEU B 1 110 ? 25.357 -23.816 16.456  1.00   29.22  ? 197  LEU B CG  1 
ATOM   4262 C CD1 . LEU B 1 110 ? 24.683 -23.458 17.755  1.00   31.26  ? 197  LEU B CD1 1 
ATOM   4263 C CD2 . LEU B 1 110 ? 24.564 -24.920 15.796  1.00   30.68  ? 197  LEU B CD2 1 
ATOM   4264 N N   . GLY B 1 111 ? 26.974 -20.574 13.510  1.00   33.91  ? 198  GLY B N   1 
ATOM   4265 C CA  . GLY B 1 111 ? 26.903 -19.437 12.611  1.00   31.94  ? 198  GLY B CA  1 
ATOM   4266 C C   . GLY B 1 111 ? 27.405 -19.827 11.234  1.00   31.61  ? 198  GLY B C   1 
ATOM   4267 O O   . GLY B 1 111 ? 26.853 -19.423 10.198  1.00   26.00  ? 198  GLY B O   1 
ATOM   4268 N N   . ASN B 1 112 ? 28.506 -20.575 11.207  1.00   32.42  ? 199  ASN B N   1 
ATOM   4269 C CA  . ASN B 1 112 ? 29.095 -20.971 9.931   1.00   29.41  ? 199  ASN B CA  1 
ATOM   4270 C C   . ASN B 1 112 ? 28.146 -21.953 9.222   1.00   28.83  ? 199  ASN B C   1 
ATOM   4271 O O   . ASN B 1 112 ? 27.870 -21.869 8.015   1.00   23.26  ? 199  ASN B O   1 
ATOM   4272 C CB  . ASN B 1 112 ? 30.494 -21.509 10.175  1.00   30.51  ? 199  ASN B CB  1 
ATOM   4273 C CG  . ASN B 1 112 ? 31.540 -20.420 10.104  1.00   32.98  ? 199  ASN B CG  1 
ATOM   4274 O OD1 . ASN B 1 112 ? 31.964 -20.059 9.010   1.00   43.07  ? 199  ASN B OD1 1 
ATOM   4275 N ND2 . ASN B 1 112 ? 31.946 -19.867 11.241  1.00   35.26  ? 199  ASN B ND2 1 
ATOM   4276 N N   . VAL B 1 113 ? 27.525 -22.807 10.020  1.00   24.96  ? 200  VAL B N   1 
ATOM   4277 C CA  . VAL B 1 113 ? 26.570 -23.735 9.471   1.00   26.07  ? 200  VAL B CA  1 
ATOM   4278 C C   . VAL B 1 113 ? 25.391 -22.948 8.953   1.00   28.04  ? 200  VAL B C   1 
ATOM   4279 O O   . VAL B 1 113 ? 24.952 -23.181 7.841   1.00   29.37  ? 200  VAL B O   1 
ATOM   4280 C CB  . VAL B 1 113 ? 26.103 -24.719 10.560  1.00   29.93  ? 200  VAL B CB  1 
ATOM   4281 C CG1 . VAL B 1 113 ? 24.827 -25.486 10.173  1.00   29.39  ? 200  VAL B CG1 1 
ATOM   4282 C CG2 . VAL B 1 113 ? 27.231 -25.692 10.867  1.00   32.65  ? 200  VAL B CG2 1 
ATOM   4283 N N   . ALA B 1 114 ? 24.859 -22.031 9.761   1.00   29.99  ? 201  ALA B N   1 
ATOM   4284 C CA  . ALA B 1 114 ? 23.633 -21.316 9.392   1.00   28.49  ? 201  ALA B CA  1 
ATOM   4285 C C   . ALA B 1 114 ? 23.814 -20.472 8.128   1.00   28.64  ? 201  ALA B C   1 
ATOM   4286 O O   . ALA B 1 114 ? 22.876 -20.295 7.353   1.00   30.27  ? 201  ALA B O   1 
ATOM   4287 C CB  . ALA B 1 114 ? 23.200 -20.442 10.512  1.00   27.56  ? 201  ALA B CB  1 
ATOM   4288 N N   . GLY B 1 115 ? 25.040 -20.009 7.919   1.00   25.75  ? 202  GLY B N   1 
ATOM   4289 C CA  . GLY B 1 115 ? 25.396 -19.134 6.831   1.00   23.46  ? 202  GLY B CA  1 
ATOM   4290 C C   . GLY B 1 115 ? 25.668 -19.870 5.539   1.00   29.18  ? 202  GLY B C   1 
ATOM   4291 O O   . GLY B 1 115 ? 25.806 -19.256 4.485   1.00   30.40  ? 202  GLY B O   1 
ATOM   4292 N N   . ASP B 1 116 ? 25.745 -21.198 5.573   1.00   33.76  ? 203  ASP B N   1 
ATOM   4293 C CA  . ASP B 1 116 ? 26.095 -21.923 4.364   1.00   32.60  ? 203  ASP B CA  1 
ATOM   4294 C C   . ASP B 1 116 ? 25.011 -21.835 3.305   1.00   32.76  ? 203  ASP B C   1 
ATOM   4295 O O   . ASP B 1 116 ? 25.298 -21.804 2.118   1.00   34.02  ? 203  ASP B O   1 
ATOM   4296 C CB  . ASP B 1 116 ? 26.351 -23.400 4.621   1.00   34.19  ? 203  ASP B CB  1 
ATOM   4297 C CG  . ASP B 1 116 ? 26.775 -24.119 3.352   1.00   37.32  ? 203  ASP B CG  1 
ATOM   4298 O OD1 . ASP B 1 116 ? 27.868 -23.788 2.834   1.00   41.08  ? 203  ASP B OD1 1 
ATOM   4299 O OD2 . ASP B 1 116 ? 26.067 -24.962 2.758   1.00   42.97  ? 203  ASP B OD2 1 
ATOM   4300 N N   . SER B 1 117 ? 23.762 -21.873 3.729   1.00   32.58  ? 204  SER B N   1 
ATOM   4301 C CA  . SER B 1 117 ? 22.670 -21.852 2.769   1.00   31.94  ? 204  SER B CA  1 
ATOM   4302 C C   . SER B 1 117 ? 21.371 -21.562 3.480   1.00   30.58  ? 204  SER B C   1 
ATOM   4303 O O   . SER B 1 117 ? 21.310 -21.524 4.715   1.00   33.98  ? 204  SER B O   1 
ATOM   4304 C CB  . SER B 1 117 ? 22.574 -23.211 2.075   1.00   30.95  ? 204  SER B CB  1 
ATOM   4305 O OG  . SER B 1 117 ? 21.963 -24.157 2.927   1.00   28.76  ? 204  SER B OG  1 
ATOM   4306 N N   . THR B 1 118 ? 20.298 -21.397 2.731   1.00   31.15  ? 205  THR B N   1 
ATOM   4307 C CA  . THR B 1 118 ? 19.032 -21.224 3.440   1.00   34.88  ? 205  THR B CA  1 
ATOM   4308 C C   . THR B 1 118 ? 18.558 -22.485 4.132   1.00   30.25  ? 205  THR B C   1 
ATOM   4309 O O   . THR B 1 118 ? 17.884 -22.356 5.123   1.00   30.99  ? 205  THR B O   1 
ATOM   4310 C CB  . THR B 1 118 ? 17.916 -20.650 2.561   1.00   34.89  ? 205  THR B CB  1 
ATOM   4311 O OG1 . THR B 1 118 ? 17.706 -21.504 1.434   1.00   41.28  ? 205  THR B OG1 1 
ATOM   4312 C CG2 . THR B 1 118 ? 18.307 -19.296 2.002   1.00   34.13  ? 205  THR B CG2 1 
ATOM   4313 N N   . ASP B 1 119 ? 18.892 -23.678 3.651   1.00   34.88  ? 206  ASP B N   1 
ATOM   4314 C CA  . ASP B 1 119 ? 18.436 -24.922 4.300   1.00   37.85  ? 206  ASP B CA  1 
ATOM   4315 C C   . ASP B 1 119 ? 19.161 -25.171 5.623   1.00   37.14  ? 206  ASP B C   1 
ATOM   4316 O O   . ASP B 1 119 ? 18.577 -25.663 6.591   1.00   33.65  ? 206  ASP B O   1 
ATOM   4317 C CB  . ASP B 1 119 ? 18.780 -26.128 3.451   1.00   43.23  ? 206  ASP B CB  1 
ATOM   4318 C CG  . ASP B 1 119 ? 17.989 -26.198 2.192   1.00   48.83  ? 206  ASP B CG  1 
ATOM   4319 O OD1 . ASP B 1 119 ? 18.102 -25.298 1.317   1.00   54.89  ? 206  ASP B OD1 1 
ATOM   4320 O OD2 . ASP B 1 119 ? 17.278 -27.194 2.013   1.00   52.13  ? 206  ASP B OD2 1 
ATOM   4321 N N   . TYR B 1 120 ? 20.460 -24.891 5.653   1.00   32.93  ? 207  TYR B N   1 
ATOM   4322 C CA  . TYR B 1 120 ? 21.160 -25.069 6.903   1.00   38.13  ? 207  TYR B CA  1 
ATOM   4323 C C   . TYR B 1 120 ? 20.667 -24.039 7.914   1.00   40.36  ? 207  TYR B C   1 
ATOM   4324 O O   . TYR B 1 120 ? 20.576 -24.316 9.117   1.00   40.39  ? 207  TYR B O   1 
ATOM   4325 C CB  . TYR B 1 120 ? 22.671 -25.026 6.733   1.00   39.49  ? 207  TYR B CB  1 
ATOM   4326 C CG  . TYR B 1 120 ? 23.290 -26.289 6.165   1.00   41.29  ? 207  TYR B CG  1 
ATOM   4327 C CD1 . TYR B 1 120 ? 24.655 -26.360 5.968   1.00   47.76  ? 207  TYR B CD1 1 
ATOM   4328 C CD2 . TYR B 1 120 ? 22.527 -27.388 5.790   1.00   43.69  ? 207  TYR B CD2 1 
ATOM   4329 C CE1 . TYR B 1 120 ? 25.250 -27.494 5.442   1.00   48.82  ? 207  TYR B CE1 1 
ATOM   4330 C CE2 . TYR B 1 120 ? 23.096 -28.513 5.258   1.00   42.79  ? 207  TYR B CE2 1 
ATOM   4331 C CZ  . TYR B 1 120 ? 24.456 -28.564 5.093   1.00   48.59  ? 207  TYR B CZ  1 
ATOM   4332 O OH  . TYR B 1 120 ? 25.026 -29.684 4.550   1.00   51.45  ? 207  TYR B OH  1 
ATOM   4333 N N   . ARG B 1 121 ? 20.309 -22.863 7.417   1.00   38.19  ? 208  ARG B N   1 
ATOM   4334 C CA  . ARG B 1 121 ? 19.764 -21.846 8.284   1.00   34.95  ? 208  ARG B CA  1 
ATOM   4335 C C   . ARG B 1 121 ? 18.445 -22.345 8.877   1.00   35.18  ? 208  ARG B C   1 
ATOM   4336 O O   . ARG B 1 121 ? 18.214 -22.298 10.095  1.00   35.02  ? 208  ARG B O   1 
ATOM   4337 C CB  . ARG B 1 121 ? 19.589 -20.578 7.479   1.00   36.97  ? 208  ARG B CB  1 
ATOM   4338 C CG  . ARG B 1 121 ? 18.856 -19.472 8.186   1.00   36.91  ? 208  ARG B CG  1 
ATOM   4339 C CD  . ARG B 1 121 ? 18.139 -18.564 7.223   1.00   31.35  ? 208  ARG B CD  1 
ATOM   4340 N NE  . ARG B 1 121 ? 17.059 -19.261 6.567   1.00   27.34  ? 208  ARG B NE  1 
ATOM   4341 C CZ  . ARG B 1 121 ? 16.320 -18.731 5.614   1.00   33.26  ? 208  ARG B CZ  1 
ATOM   4342 N NH1 . ARG B 1 121 ? 16.581 -17.485 5.202   1.00   26.45  ? 208  ARG B NH1 1 
ATOM   4343 N NH2 . ARG B 1 121 ? 15.321 -19.442 5.070   1.00   33.76  ? 208  ARG B NH2 1 
ATOM   4344 N N   . ASP B 1 122 ? 17.563 -22.871 8.044   1.00   34.46  ? 209  ASP B N   1 
ATOM   4345 C CA  . ASP B 1 122 ? 16.294 -23.351 8.587   1.00   35.06  ? 209  ASP B CA  1 
ATOM   4346 C C   . ASP B 1 122 ? 16.499 -24.518 9.534   1.00   37.62  ? 209  ASP B C   1 
ATOM   4347 O O   . ASP B 1 122 ? 15.795 -24.643 10.521  1.00   38.90  ? 209  ASP B O   1 
ATOM   4348 C CB  . ASP B 1 122 ? 15.374 -23.799 7.468   1.00   34.13  ? 209  ASP B CB  1 
ATOM   4349 C CG  . ASP B 1 122 ? 14.927 -22.665 6.598   1.00   35.62  ? 209  ASP B CG  1 
ATOM   4350 O OD1 . ASP B 1 122 ? 14.850 -21.510 7.100   1.00   36.92  ? 209  ASP B OD1 1 
ATOM   4351 O OD2 . ASP B 1 122 ? 14.623 -22.883 5.408   1.00   36.39  ? 209  ASP B OD2 1 
ATOM   4352 N N   . TYR B 1 123 ? 17.470 -25.376 9.225   1.00   38.39  ? 210  TYR B N   1 
ATOM   4353 C CA  . TYR B 1 123 ? 17.778 -26.522 10.070  1.00   35.67  ? 210  TYR B CA  1 
ATOM   4354 C C   . TYR B 1 123 ? 18.219 -26.113 11.503  1.00   35.97  ? 210  TYR B C   1 
ATOM   4355 O O   . TYR B 1 123 ? 17.732 -26.647 12.502  1.00   36.13  ? 210  TYR B O   1 
ATOM   4356 C CB  . TYR B 1 123 ? 18.827 -27.398 9.389   1.00   32.81  ? 210  TYR B CB  1 
ATOM   4357 C CG  . TYR B 1 123 ? 19.369 -28.507 10.261  1.00   34.40  ? 210  TYR B CG  1 
ATOM   4358 C CD1 . TYR B 1 123 ? 18.580 -29.567 10.659  1.00   40.62  ? 210  TYR B CD1 1 
ATOM   4359 C CD2 . TYR B 1 123 ? 20.698 -28.509 10.666  1.00   36.33  ? 210  TYR B CD2 1 
ATOM   4360 C CE1 . TYR B 1 123 ? 19.106 -30.602 11.475  1.00   41.05  ? 210  TYR B CE1 1 
ATOM   4361 C CE2 . TYR B 1 123 ? 21.221 -29.519 11.441  1.00   35.81  ? 210  TYR B CE2 1 
ATOM   4362 C CZ  . TYR B 1 123 ? 20.436 -30.563 11.860  1.00   36.04  ? 210  TYR B CZ  1 
ATOM   4363 O OH  . TYR B 1 123 ? 21.046 -31.502 12.680  1.00   35.86  ? 210  TYR B OH  1 
ATOM   4364 N N   . VAL B 1 124 ? 19.127 -25.149 11.610  1.00   31.99  ? 211  VAL B N   1 
ATOM   4365 C CA  . VAL B 1 124 ? 19.596 -24.728 12.911  1.00   29.16  ? 211  VAL B CA  1 
ATOM   4366 C C   . VAL B 1 124 ? 18.416 -24.195 13.719  1.00   33.99  ? 211  VAL B C   1 
ATOM   4367 O O   . VAL B 1 124 ? 18.303 -24.448 14.912  1.00   33.05  ? 211  VAL B O   1 
ATOM   4368 C CB  . VAL B 1 124 ? 20.622 -23.654 12.766  1.00   28.10  ? 211  VAL B CB  1 
ATOM   4369 C CG1 . VAL B 1 124 ? 20.897 -23.060 14.095  1.00   24.86  ? 211  VAL B CG1 1 
ATOM   4370 C CG2 . VAL B 1 124 ? 21.885 -24.241 12.154  1.00   31.30  ? 211  VAL B CG2 1 
ATOM   4371 N N   . LEU B 1 125 ? 17.518 -23.476 13.053  1.00   37.44  ? 212  LEU B N   1 
ATOM   4372 C CA  . LEU B 1 125 ? 16.325 -22.944 13.691  1.00   37.46  ? 212  LEU B CA  1 
ATOM   4373 C C   . LEU B 1 125 ? 15.314 -24.027 14.060  1.00   40.91  ? 212  LEU B C   1 
ATOM   4374 O O   . LEU B 1 125 ? 14.723 -23.967 15.129  1.00   45.83  ? 212  LEU B O   1 
ATOM   4375 C CB  . LEU B 1 125 ? 15.660 -21.912 12.787  1.00   38.30  ? 212  LEU B CB  1 
ATOM   4376 C CG  . LEU B 1 125 ? 16.457 -20.620 12.580  1.00   34.76  ? 212  LEU B CG  1 
ATOM   4377 C CD1 . LEU B 1 125 ? 15.769 -19.718 11.587  1.00   28.24  ? 212  LEU B CD1 1 
ATOM   4378 C CD2 . LEU B 1 125 ? 16.671 -19.912 13.892  1.00   33.20  ? 212  LEU B CD2 1 
ATOM   4379 N N   . GLN B 1 126 ? 15.102 -25.012 13.202  1.00   42.69  ? 213  GLN B N   1 
ATOM   4380 C CA  . GLN B 1 126 ? 14.221 -26.123 13.539  1.00   46.51  ? 213  GLN B CA  1 
ATOM   4381 C C   . GLN B 1 126 ? 14.728 -26.875 14.764  1.00   45.27  ? 213  GLN B C   1 
ATOM   4382 O O   . GLN B 1 126 ? 13.901 -27.367 15.518  1.00   44.25  ? 213  GLN B O   1 
ATOM   4383 C CB  . GLN B 1 126 ? 14.086 -27.117 12.375  1.00   50.43  ? 213  GLN B CB  1 
ATOM   4384 C CG  . GLN B 1 126 ? 12.889 -26.814 11.441  1.00   58.42  ? 213  GLN B CG  1 
ATOM   4385 C CD  . GLN B 1 126 ? 13.174 -26.942 9.917   1.00   62.90  ? 213  GLN B CD  1 
ATOM   4386 O OE1 . GLN B 1 126 ? 13.830 -27.873 9.467   1.00   65.04  ? 213  GLN B OE1 1 
ATOM   4387 N NE2 . GLN B 1 126 ? 12.671 -26.000 9.134   1.00   66.36  ? 213  GLN B NE2 1 
ATOM   4388 N N   . CYS B 1 127 ? 16.049 -27.010 14.922  1.00   45.08  ? 214  CYS B N   1 
ATOM   4389 C CA  . CYS B 1 127 ? 16.685 -27.591 16.113  1.00   43.76  ? 214  CYS B CA  1 
ATOM   4390 C C   . CYS B 1 127 ? 16.689 -26.639 17.305  1.00   44.88  ? 214  CYS B C   1 
ATOM   4391 O O   . CYS B 1 127 ? 17.563 -26.746 18.161  1.00   42.91  ? 214  CYS B O   1 
ATOM   4392 C CB  . CYS B 1 127 ? 18.168 -27.873 15.861  1.00   44.35  ? 214  CYS B CB  1 
ATOM   4393 S SG  . CYS B 1 127 ? 18.432 -29.184 14.711  1.00   39.65  ? 214  CYS B SG  1 
ATOM   4394 N N   . ASN B 1 128 ? 15.791 -25.655 17.312  1.00   45.22  ? 215  ASN B N   1 
ATOM   4395 C CA  . ASN B 1 128 ? 15.585 -24.785 18.456  1.00   41.53  ? 215  ASN B CA  1 
ATOM   4396 C C   . ASN B 1 128 ? 16.827 -24.181 19.079  1.00   38.68  ? 215  ASN B C   1 
ATOM   4397 O O   . ASN B 1 128 ? 16.985 -24.209 20.287  1.00   34.41  ? 215  ASN B O   1 
ATOM   4398 C CB  . ASN B 1 128 ? 14.815 -25.550 19.525  1.00   43.56  ? 215  ASN B CB  1 
ATOM   4399 C CG  . ASN B 1 128 ? 13.522 -26.154 18.986  1.00   48.98  ? 215  ASN B CG  1 
ATOM   4400 O OD1 . ASN B 1 128 ? 12.786 -25.508 18.234  1.00   52.20  ? 215  ASN B OD1 1 
ATOM   4401 N ND2 . ASN B 1 128 ? 13.237 -27.400 19.363  1.00   52.41  ? 215  ASN B ND2 1 
ATOM   4402 N N   . ALA B 1 129 ? 17.690 -23.603 18.255  1.00   40.41  ? 216  ALA B N   1 
ATOM   4403 C CA  . ALA B 1 129 ? 18.862 -22.885 18.749  1.00   37.43  ? 216  ALA B CA  1 
ATOM   4404 C C   . ALA B 1 129 ? 18.524 -21.487 19.231  1.00   37.47  ? 216  ALA B C   1 
ATOM   4405 O O   . ALA B 1 129 ? 19.323 -20.889 19.941  1.00   40.18  ? 216  ALA B O   1 
ATOM   4406 C CB  . ALA B 1 129 ? 19.929 -22.780 17.651  1.00   34.65  ? 216  ALA B CB  1 
ATOM   4407 N N   . MET B 1 130 ? 17.407 -20.904 18.804  1.00   37.16  ? 217  MET B N   1 
ATOM   4408 C CA  . MET B 1 130 ? 17.183 -19.489 19.127  1.00   37.22  ? 217  MET B CA  1 
ATOM   4409 C C   . MET B 1 130 ? 17.167 -19.228 20.632  1.00   38.89  ? 217  MET B C   1 
ATOM   4410 O O   . MET B 1 130 ? 17.775 -18.288 21.144  1.00   36.77  ? 217  MET B O   1 
ATOM   4411 C CB  . MET B 1 130 ? 15.868 -19.014 18.526  1.00   38.39  ? 217  MET B CB  1 
ATOM   4412 C CG  . MET B 1 130 ? 15.633 -17.524 18.590  1.00   34.24  ? 217  MET B CG  1 
ATOM   4413 S SD  . MET B 1 130 ? 17.016 -16.566 18.024  1.00   40.44  ? 217  MET B SD  1 
ATOM   4414 C CE  . MET B 1 130 ? 16.693 -16.348 16.262  1.00   42.63  ? 217  MET B CE  1 
ATOM   4415 N N   . GLU B 1 131 ? 16.505 -20.118 21.358  1.00   41.34  ? 218  GLU B N   1 
ATOM   4416 C CA  . GLU B 1 131 ? 16.385 -19.938 22.791  1.00   47.05  ? 218  GLU B CA  1 
ATOM   4417 C C   . GLU B 1 131 ? 17.775 -19.826 23.414  1.00   46.82  ? 218  GLU B C   1 
ATOM   4418 O O   . GLU B 1 131 ? 18.090 -18.794 24.015  1.00   47.49  ? 218  GLU B O   1 
ATOM   4419 C CB  . GLU B 1 131 ? 15.509 -21.027 23.417  1.00   51.53  ? 218  GLU B CB  1 
ATOM   4420 C CG  . GLU B 1 131 ? 15.020 -20.732 24.829  1.00   56.48  ? 218  GLU B CG  1 
ATOM   4421 C CD  . GLU B 1 131 ? 14.496 -21.983 25.540  1.00   63.10  ? 218  GLU B CD  1 
ATOM   4422 O OE1 . GLU B 1 131 ? 13.510 -22.585 25.058  1.00   65.72  ? 218  GLU B OE1 1 
ATOM   4423 O OE2 . GLU B 1 131 ? 15.069 -22.407 26.574  1.00   65.18  ? 218  GLU B OE2 1 
ATOM   4424 N N   . PRO B 1 132 ? 18.617 -20.849 23.289  1.00   43.85  ? 219  PRO B N   1 
ATOM   4425 C CA  . PRO B 1 132 ? 19.925 -20.781 23.938  1.00   40.83  ? 219  PRO B CA  1 
ATOM   4426 C C   . PRO B 1 132 ? 20.804 -19.682 23.440  1.00   40.59  ? 219  PRO B C   1 
ATOM   4427 O O   . PRO B 1 132 ? 21.602 -19.205 24.241  1.00   44.29  ? 219  PRO B O   1 
ATOM   4428 C CB  . PRO B 1 132 ? 20.556 -22.145 23.641  1.00   40.95  ? 219  PRO B CB  1 
ATOM   4429 C CG  . PRO B 1 132 ? 19.792 -22.724 22.551  1.00   42.19  ? 219  PRO B CG  1 
ATOM   4430 C CD  . PRO B 1 132 ? 18.404 -22.165 22.664  1.00   43.24  ? 219  PRO B CD  1 
ATOM   4431 N N   . ILE B 1 133 ? 20.660 -19.294 22.177  1.00   42.49  ? 220  ILE B N   1 
ATOM   4432 C CA  . ILE B 1 133 ? 21.499 -18.244 21.583  1.00   39.80  ? 220  ILE B CA  1 
ATOM   4433 C C   . ILE B 1 133 ? 21.192 -16.933 22.276  1.00   38.63  ? 220  ILE B C   1 
ATOM   4434 O O   . ILE B 1 133 ? 22.124 -16.197 22.619  1.00   36.73  ? 220  ILE B O   1 
ATOM   4435 C CB  . ILE B 1 133 ? 21.298 -18.111 20.054  1.00   38.19  ? 220  ILE B CB  1 
ATOM   4436 C CG1 . ILE B 1 133 ? 21.896 -19.307 19.312  1.00   42.27  ? 220  ILE B CG1 1 
ATOM   4437 C CG2 . ILE B 1 133 ? 21.965 -16.882 19.539  1.00   37.93  ? 220  ILE B CG2 1 
ATOM   4438 C CD1 . ILE B 1 133 ? 21.423 -19.457 17.874  1.00   43.78  ? 220  ILE B CD1 1 
ATOM   4439 N N   . LEU B 1 134 ? 19.900 -16.655 22.488  1.00   38.28  ? 221  LEU B N   1 
ATOM   4440 C CA  . LEU B 1 134 ? 19.461 -15.377 23.103  1.00   38.99  ? 221  LEU B CA  1 
ATOM   4441 C C   . LEU B 1 134 ? 19.980 -15.286 24.538  1.00   39.35  ? 221  LEU B C   1 
ATOM   4442 O O   . LEU B 1 134 ? 20.424 -14.215 24.973  1.00   34.37  ? 221  LEU B O   1 
ATOM   4443 C CB  . LEU B 1 134 ? 17.929 -15.192 23.061  1.00   38.40  ? 221  LEU B CB  1 
ATOM   4444 C CG  . LEU B 1 134 ? 17.328 -15.024 21.657  1.00   34.95  ? 221  LEU B CG  1 
ATOM   4445 C CD1 . LEU B 1 134 ? 15.843 -14.938 21.697  1.00   33.60  ? 221  LEU B CD1 1 
ATOM   4446 C CD2 . LEU B 1 134 ? 17.890 -13.815 20.946  1.00   34.15  ? 221  LEU B CD2 1 
ATOM   4447 N N   . GLY B 1 135 ? 19.996 -16.443 25.208  1.00   39.08  ? 222  GLY B N   1 
ATOM   4448 C CA  . GLY B 1 135 ? 20.562 -16.608 26.533  1.00   35.87  ? 222  GLY B CA  1 
ATOM   4449 C C   . GLY B 1 135 ? 21.984 -16.117 26.624  1.00   36.45  ? 222  GLY B C   1 
ATOM   4450 O O   . GLY B 1 135 ? 22.362 -15.495 27.617  1.00   41.67  ? 222  GLY B O   1 
ATOM   4451 N N   . LEU B 1 136 ? 22.775 -16.325 25.581  1.00   35.76  ? 223  LEU B N   1 
ATOM   4452 C CA  . LEU B 1 136 ? 24.163 -15.867 25.595  1.00   35.17  ? 223  LEU B CA  1 
ATOM   4453 C C   . LEU B 1 136 ? 24.379 -14.376 25.709  1.00   37.32  ? 223  LEU B C   1 
ATOM   4454 O O   . LEU B 1 136 ? 25.497 -13.964 25.980  1.00   38.85  ? 223  LEU B O   1 
ATOM   4455 C CB  . LEU B 1 136 ? 24.854 -16.267 24.293  1.00   39.20  ? 223  LEU B CB  1 
ATOM   4456 C CG  . LEU B 1 136 ? 24.774 -17.757 23.979  1.00   41.26  ? 223  LEU B CG  1 
ATOM   4457 C CD1 . LEU B 1 136 ? 25.126 -18.014 22.524  1.00   40.53  ? 223  LEU B CD1 1 
ATOM   4458 C CD2 . LEU B 1 136 ? 25.704 -18.475 24.949  1.00   43.59  ? 223  LEU B CD2 1 
ATOM   4459 N N   . PHE B 1 137 ? 23.377 -13.548 25.397  1.00   45.15  ? 224  PHE B N   1 
ATOM   4460 C CA  . PHE B 1 137 ? 23.534 -12.083 25.454  1.00   47.55  ? 224  PHE B CA  1 
ATOM   4461 C C   . PHE B 1 137 ? 23.477 -11.535 26.877  1.00   56.63  ? 224  PHE B C   1 
ATOM   4462 O O   . PHE B 1 137 ? 23.382 -10.341 27.097  1.00   60.66  ? 224  PHE B O   1 
ATOM   4463 C CB  . PHE B 1 137 ? 22.540 -11.372 24.538  1.00   42.45  ? 224  PHE B CB  1 
ATOM   4464 C CG  . PHE B 1 137 ? 22.790 -11.662 23.102  1.00   37.41  ? 224  PHE B CG  1 
ATOM   4465 C CD1 . PHE B 1 137 ? 22.274 -12.790 22.539  1.00   32.53  ? 224  PHE B CD1 1 
ATOM   4466 C CD2 . PHE B 1 137 ? 23.641 -10.877 22.353  1.00   34.78  ? 224  PHE B CD2 1 
ATOM   4467 C CE1 . PHE B 1 137 ? 22.568 -13.094 21.263  1.00   31.81  ? 224  PHE B CE1 1 
ATOM   4468 C CE2 . PHE B 1 137 ? 23.895 -11.183 21.056  1.00   32.17  ? 224  PHE B CE2 1 
ATOM   4469 C CZ  . PHE B 1 137 ? 23.353 -12.281 20.523  1.00   31.47  ? 224  PHE B CZ  1 
ATOM   4470 N N   . ASN B 1 138 ? 23.601 -12.416 27.859  1.00   64.88  ? 225  ASN B N   1 
ATOM   4471 C CA  . ASN B 1 138 ? 23.737 -11.996 29.239  1.00   67.66  ? 225  ASN B CA  1 
ATOM   4472 C C   . ASN B 1 138 ? 25.188 -12.050 29.673  1.00   69.24  ? 225  ASN B C   1 
ATOM   4473 O O   . ASN B 1 138 ? 25.536 -11.476 30.693  1.00   72.34  ? 225  ASN B O   1 
ATOM   4474 C CB  . ASN B 1 138 ? 22.848 -12.879 30.103  1.00   66.31  ? 225  ASN B CB  1 
ATOM   4475 C CG  . ASN B 1 138 ? 21.375 -12.557 29.882  1.00   68.90  ? 225  ASN B CG  1 
ATOM   4476 O OD1 . ASN B 1 138 ? 20.546 -13.437 29.611  1.00   67.72  ? 225  ASN B OD1 1 
ATOM   4477 N ND2 . ASN B 1 138 ? 21.049 -11.263 29.963  1.00   64.24  ? 225  ASN B ND2 1 
ATOM   4478 N N   . SER B 1 139 ? 26.040 -12.660 28.858  1.00   70.73  ? 226  SER B N   1 
ATOM   4479 C CA  . SER B 1 139 ? 27.389 -12.987 29.291  1.00   73.35  ? 226  SER B CA  1 
ATOM   4480 C C   . SER B 1 139 ? 28.251 -11.791 29.693  1.00   74.67  ? 226  SER B C   1 
ATOM   4481 O O   . SER B 1 139 ? 29.180 -11.955 30.492  1.00   78.50  ? 226  SER B O   1 
ATOM   4482 C CB  . SER B 1 139 ? 28.106 -13.850 28.244  1.00   73.37  ? 226  SER B CB  1 
ATOM   4483 O OG  . SER B 1 139 ? 28.583 -13.063 27.169  1.00   71.72  ? 226  SER B OG  1 
ATOM   4484 N N   . ASN B 1 140 ? 27.970 -10.602 29.170  1.00   71.65  ? 227  ASN B N   1 
ATOM   4485 C CA  . ASN B 1 140 ? 28.830 -9.473  29.502  1.00   73.68  ? 227  ASN B CA  1 
ATOM   4486 C C   . ASN B 1 140 ? 30.291 -9.811  29.156  1.00   70.68  ? 227  ASN B C   1 
ATOM   4487 O O   . ASN B 1 140 ? 31.240 -9.308  29.765  1.00   71.26  ? 227  ASN B O   1 
ATOM   4488 C CB  . ASN B 1 140 ? 28.674 -9.078  30.989  1.00   76.58  ? 227  ASN B CB  1 
ATOM   4489 C CG  . ASN B 1 140 ? 29.148 -7.645  31.294  1.00   80.08  ? 227  ASN B CG  1 
ATOM   4490 O OD1 . ASN B 1 140 ? 29.577 -7.343  32.413  1.00   85.64  ? 227  ASN B OD1 1 
ATOM   4491 N ND2 . ASN B 1 140 ? 29.083 -6.763  30.301  1.00   80.06  ? 227  ASN B ND2 1 
ATOM   4492 N N   . LYS B 1 141 ? 30.455 -10.683 28.167  1.00   68.10  ? 228  LYS B N   1 
ATOM   4493 C CA  . LYS B 1 141 ? 31.756 -11.002 27.587  1.00   64.50  ? 228  LYS B CA  1 
ATOM   4494 C C   . LYS B 1 141 ? 31.764 -10.495 26.130  1.00   56.68  ? 228  LYS B C   1 
ATOM   4495 O O   . LYS B 1 141 ? 31.076 -11.027 25.277  1.00   47.21  ? 228  LYS B O   1 
ATOM   4496 C CB  . LYS B 1 141 ? 31.995 -12.510 27.695  1.00   65.94  ? 228  LYS B CB  1 
ATOM   4497 C CG  . LYS B 1 141 ? 33.321 -13.023 27.118  1.00   69.21  ? 228  LYS B CG  1 
ATOM   4498 C CD  . LYS B 1 141 ? 34.529 -12.194 27.522  1.00   71.04  ? 228  LYS B CD  1 
ATOM   4499 C CE  . LYS B 1 141 ? 35.744 -12.488 26.656  1.00   70.57  ? 228  LYS B CE  1 
ATOM   4500 N NZ  . LYS B 1 141 ? 36.008 -13.944 26.727  1.00   64.40  ? 228  LYS B NZ  1 
ATOM   4501 N N   . PRO B 1 142 ? 32.500 -9.434  25.841  1.00   54.25  ? 229  PRO B N   1 
ATOM   4502 C CA  . PRO B 1 142 ? 32.433 -8.786  24.530  1.00   53.83  ? 229  PRO B CA  1 
ATOM   4503 C C   . PRO B 1 142 ? 32.674 -9.657  23.301  1.00   51.78  ? 229  PRO B C   1 
ATOM   4504 O O   . PRO B 1 142 ? 31.961 -9.477  22.321  1.00   52.59  ? 229  PRO B O   1 
ATOM   4505 C CB  . PRO B 1 142 ? 33.525 -7.716  24.612  1.00   53.57  ? 229  PRO B CB  1 
ATOM   4506 C CG  . PRO B 1 142 ? 33.612 -7.392  26.032  1.00   54.49  ? 229  PRO B CG  1 
ATOM   4507 C CD  . PRO B 1 142 ? 33.445 -8.733  26.720  1.00   57.03  ? 229  PRO B CD  1 
ATOM   4508 N N   . SER B 1 143 ? 33.674 -10.525 23.333  1.00   49.15  ? 230  SER B N   1 
ATOM   4509 C CA  . SER B 1 143 ? 33.958 -11.403 22.212  1.00   46.65  ? 230  SER B CA  1 
ATOM   4510 C C   . SER B 1 143 ? 32.830 -12.398 21.971  1.00   43.84  ? 230  SER B C   1 
ATOM   4511 O O   . SER B 1 143 ? 32.615 -12.819 20.845  1.00   44.34  ? 230  SER B O   1 
ATOM   4512 C CB  . SER B 1 143 ? 35.262 -12.163 22.455  1.00   48.31  ? 230  SER B CB  1 
ATOM   4513 O OG  . SER B 1 143 ? 35.070 -13.255 23.336  1.00   42.70  ? 230  SER B OG  1 
ATOM   4514 N N   . LEU B 1 144 ? 32.148 -12.812 23.027  1.00   38.31  ? 231  LEU B N   1 
ATOM   4515 C CA  . LEU B 1 144 ? 31.109 -13.805 22.897  1.00   38.80  ? 231  LEU B CA  1 
ATOM   4516 C C   . LEU B 1 144 ? 29.864 -13.172 22.317  1.00   41.12  ? 231  LEU B C   1 
ATOM   4517 O O   . LEU B 1 144 ? 29.153 -13.800 21.525  1.00   41.88  ? 231  LEU B O   1 
ATOM   4518 C CB  . LEU B 1 144 ? 30.775 -14.420 24.251  1.00   38.76  ? 231  LEU B CB  1 
ATOM   4519 C CG  . LEU B 1 144 ? 29.611 -15.416 24.278  1.00   37.81  ? 231  LEU B CG  1 
ATOM   4520 C CD1 . LEU B 1 144 ? 29.889 -16.570 23.352  1.00   38.63  ? 231  LEU B CD1 1 
ATOM   4521 C CD2 . LEU B 1 144 ? 29.381 -15.972 25.650  1.00   37.96  ? 231  LEU B CD2 1 
ATOM   4522 N N   . ILE B 1 145 ? 29.592 -11.949 22.758  1.00   39.95  ? 232  ILE B N   1 
ATOM   4523 C CA  . ILE B 1 145 ? 28.458 -11.180 22.262  1.00   39.94  ? 232  ILE B CA  1 
ATOM   4524 C C   . ILE B 1 145 ? 28.724 -10.890 20.792  1.00   34.72  ? 232  ILE B C   1 
ATOM   4525 O O   . ILE B 1 145 ? 27.838 -10.938 19.982  1.00   37.96  ? 232  ILE B O   1 
ATOM   4526 C CB  . ILE B 1 145 ? 28.261 -9.867  23.078  1.00   39.96  ? 232  ILE B CB  1 
ATOM   4527 C CG1 . ILE B 1 145 ? 27.749 -10.170 24.490  1.00   44.46  ? 232  ILE B CG1 1 
ATOM   4528 C CG2 . ILE B 1 145 ? 27.233 -8.968  22.479  1.00   40.84  ? 232  ILE B CG2 1 
ATOM   4529 C CD1 . ILE B 1 145 ? 28.058 -9.019  25.482  1.00   48.12  ? 232  ILE B CD1 1 
ATOM   4530 N N   . ARG B 1 146 ? 29.956 -10.579 20.451  1.00   34.60  ? 233  ARG B N   1 
ATOM   4531 C CA  . ARG B 1 146 ? 30.294 -10.189 19.103  1.00   36.90  ? 233  ARG B CA  1 
ATOM   4532 C C   . ARG B 1 146 ? 29.974 -11.362 18.204  1.00   42.20  ? 233  ARG B C   1 
ATOM   4533 O O   . ARG B 1 146 ? 29.401 -11.196 17.123  1.00   45.22  ? 233  ARG B O   1 
ATOM   4534 C CB  . ARG B 1 146 ? 31.787 -9.869  18.986  1.00   34.20  ? 233  ARG B CB  1 
ATOM   4535 C CG  . ARG B 1 146 ? 32.130 -9.327  17.661  1.00   37.12  ? 233  ARG B CG  1 
ATOM   4536 C CD  . ARG B 1 146 ? 33.600 -9.213  17.373  1.00   43.87  ? 233  ARG B CD  1 
ATOM   4537 N NE  . ARG B 1 146 ? 34.205 -8.173  18.194  1.00   48.80  ? 233  ARG B NE  1 
ATOM   4538 C CZ  . ARG B 1 146 ? 34.913 -8.365  19.305  1.00   51.46  ? 233  ARG B CZ  1 
ATOM   4539 N NH1 . ARG B 1 146 ? 35.145 -9.584  19.795  1.00   55.23  ? 233  ARG B NH1 1 
ATOM   4540 N NH2 . ARG B 1 146 ? 35.397 -7.306  19.944  1.00   49.01  ? 233  ARG B NH2 1 
ATOM   4541 N N   . THR B 1 147 ? 30.337 -12.550 18.679  1.00   42.31  ? 234  THR B N   1 
ATOM   4542 C CA  . THR B 1 147 ? 30.203 -13.763 17.890  1.00   40.86  ? 234  THR B CA  1 
ATOM   4543 C C   . THR B 1 147 ? 28.746 -14.192 17.742  1.00   37.36  ? 234  THR B C   1 
ATOM   4544 O O   . THR B 1 147 ? 28.335 -14.696 16.686  1.00   33.33  ? 234  THR B O   1 
ATOM   4545 C CB  . THR B 1 147 ? 31.048 -14.892 18.519  1.00   40.46  ? 234  THR B CB  1 
ATOM   4546 O OG1 . THR B 1 147 ? 32.418 -14.488 18.538  1.00   38.58  ? 234  THR B OG1 1 
ATOM   4547 C CG2 . THR B 1 147 ? 31.023 -16.185 17.661  1.00   37.71  ? 234  THR B CG2 1 
ATOM   4548 N N   . ALA B 1 148 ? 28.027 -14.071 18.845  1.00   34.30  ? 235  ALA B N   1 
ATOM   4549 C CA  . ALA B 1 148 ? 26.628 -14.461 18.915  1.00   37.17  ? 235  ALA B CA  1 
ATOM   4550 C C   . ALA B 1 148 ? 25.799 -13.555 18.021  1.00   34.27  ? 235  ALA B C   1 
ATOM   4551 O O   . ALA B 1 148 ? 24.783 -13.967 17.477  1.00   33.36  ? 235  ALA B O   1 
ATOM   4552 C CB  . ALA B 1 148 ? 26.122 -14.389 20.363  1.00   38.98  ? 235  ALA B CB  1 
ATOM   4553 N N   . THR B 1 149 ? 26.256 -12.324 17.861  1.00   33.64  ? 236  THR B N   1 
ATOM   4554 C CA  . THR B 1 149 ? 25.562 -11.350 17.042  1.00   35.82  ? 236  THR B CA  1 
ATOM   4555 C C   . THR B 1 149 ? 25.747 -11.704 15.565  1.00   34.47  ? 236  THR B C   1 
ATOM   4556 O O   . THR B 1 149 ? 24.804 -11.589 14.774  1.00   32.65  ? 236  THR B O   1 
ATOM   4557 C CB  . THR B 1 149 ? 26.074 -9.937  17.385  1.00   34.00  ? 236  THR B CB  1 
ATOM   4558 O OG1 . THR B 1 149 ? 25.645 -9.595  18.716  1.00   36.73  ? 236  THR B OG1 1 
ATOM   4559 C CG2 . THR B 1 149 ? 25.386 -8.931  16.519  1.00   35.19  ? 236  THR B CG2 1 
ATOM   4560 N N   . TRP B 1 150 ? 26.967 -12.100 15.207  1.00   29.94  ? 237  TRP B N   1 
ATOM   4561 C CA  . TRP B 1 150 ? 27.277 -12.589 13.866  1.00   30.40  ? 237  TRP B CA  1 
ATOM   4562 C C   . TRP B 1 150 ? 26.357 -13.766 13.451  1.00   30.66  ? 237  TRP B C   1 
ATOM   4563 O O   . TRP B 1 150 ? 25.651 -13.786 12.430  1.00   28.35  ? 237  TRP B O   1 
ATOM   4564 C CB  . TRP B 1 150 ? 28.755 -12.992 13.817  1.00   30.48  ? 237  TRP B CB  1 
ATOM   4565 C CG  . TRP B 1 150 ? 29.245 -13.349 12.435  1.00   29.19  ? 237  TRP B CG  1 
ATOM   4566 C CD1 . TRP B 1 150 ? 29.579 -12.498 11.422  1.00   28.92  ? 237  TRP B CD1 1 
ATOM   4567 C CD2 . TRP B 1 150 ? 29.452 -14.662 11.932  1.00   28.22  ? 237  TRP B CD2 1 
ATOM   4568 N NE1 . TRP B 1 150 ? 29.977 -13.210 10.320  1.00   25.93  ? 237  TRP B NE1 1 
ATOM   4569 C CE2 . TRP B 1 150 ? 29.916 -14.541 10.612  1.00   22.22  ? 237  TRP B CE2 1 
ATOM   4570 C CE3 . TRP B 1 150 ? 29.272 -15.943 12.467  1.00   35.21  ? 237  TRP B CE3 1 
ATOM   4571 C CZ2 . TRP B 1 150 ? 30.182 -15.633 9.817   1.00   25.54  ? 237  TRP B CZ2 1 
ATOM   4572 C CZ3 . TRP B 1 150 ? 29.563 -17.051 11.678  1.00   34.38  ? 237  TRP B CZ3 1 
ATOM   4573 C CH2 . TRP B 1 150 ? 30.011 -16.885 10.367  1.00   30.96  ? 237  TRP B CH2 1 
ATOM   4574 N N   . THR B 1 151 ? 26.337 -14.767 14.295  1.00   27.16  ? 238  THR B N   1 
ATOM   4575 C CA  . THR B 1 151 ? 25.495 -15.912 14.073  1.00   31.90  ? 238  THR B CA  1 
ATOM   4576 C C   . THR B 1 151 ? 24.027 -15.519 13.967  1.00   32.35  ? 238  THR B C   1 
ATOM   4577 O O   . THR B 1 151 ? 23.309 -15.933 13.054  1.00   34.09  ? 238  THR B O   1 
ATOM   4578 C CB  . THR B 1 151 ? 25.706 -16.869 15.247  1.00   34.21  ? 238  THR B CB  1 
ATOM   4579 O OG1 . THR B 1 151 ? 27.056 -17.355 15.189  1.00   33.45  ? 238  THR B OG1 1 
ATOM   4580 C CG2 . THR B 1 151 ? 24.751 -18.072 15.175  1.00   32.89  ? 238  THR B CG2 1 
ATOM   4581 N N   . LEU B 1 152 ? 23.582 -14.696 14.896  1.00   32.42  ? 239  LEU B N   1 
ATOM   4582 C CA  . LEU B 1 152 ? 22.197 -14.240 14.877  1.00   33.85  ? 239  LEU B CA  1 
ATOM   4583 C C   . LEU B 1 152 ? 21.896 -13.575 13.514  1.00   30.54  ? 239  LEU B C   1 
ATOM   4584 O O   . LEU B 1 152 ? 20.909 -13.884 12.859  1.00   29.49  ? 239  LEU B O   1 
ATOM   4585 C CB  . LEU B 1 152 ? 22.016 -13.267 16.050  1.00   38.63  ? 239  LEU B CB  1 
ATOM   4586 C CG  . LEU B 1 152 ? 20.632 -12.787 16.451  1.00   41.04  ? 239  LEU B CG  1 
ATOM   4587 C CD1 . LEU B 1 152 ? 19.758 -13.961 16.913  1.00   44.45  ? 239  LEU B CD1 1 
ATOM   4588 C CD2 . LEU B 1 152 ? 20.764 -11.740 17.533  1.00   39.31  ? 239  LEU B CD2 1 
ATOM   4589 N N   . SER B 1 153 ? 22.786 -12.725 13.016  1.00   24.77  ? 240  SER B N   1 
ATOM   4590 C CA  . SER B 1 153 ? 22.533 -12.150 11.721  1.00   27.41  ? 240  SER B CA  1 
ATOM   4591 C C   . SER B 1 153 ? 22.372 -13.184 10.616  1.00   30.16  ? 240  SER B C   1 
ATOM   4592 O O   . SER B 1 153 ? 21.538 -12.983 9.729   1.00   32.41  ? 240  SER B O   1 
ATOM   4593 C CB  . SER B 1 153 ? 23.610 -11.141 11.316  1.00   30.05  ? 240  SER B CB  1 
ATOM   4594 O OG  . SER B 1 153 ? 24.790 -11.737 10.797  1.00   28.94  ? 240  SER B OG  1 
ATOM   4595 N N   . ASN B 1 154 ? 23.200 -14.229 10.612  1.00   27.84  ? 241  ASN B N   1 
ATOM   4596 C CA  . ASN B 1 154 ? 23.077 -15.261 9.595   1.00   24.17  ? 241  ASN B CA  1 
ATOM   4597 C C   . ASN B 1 154 ? 21.775 -16.035 9.752   1.00   27.33  ? 241  ASN B C   1 
ATOM   4598 O O   . ASN B 1 154 ? 21.294 -16.605 8.790   1.00   31.09  ? 241  ASN B O   1 
ATOM   4599 C CB  . ASN B 1 154 ? 24.242 -16.248 9.689   1.00   28.85  ? 241  ASN B CB  1 
ATOM   4600 C CG  . ASN B 1 154 ? 25.532 -15.702 9.130   1.00   26.86  ? 241  ASN B CG  1 
ATOM   4601 O OD1 . ASN B 1 154 ? 25.578 -14.643 8.478   1.00   27.96  ? 241  ASN B OD1 1 
ATOM   4602 N ND2 . ASN B 1 154 ? 26.609 -16.414 9.427   1.00   22.67  ? 241  ASN B ND2 1 
ATOM   4603 N N   . LEU B 1 155 ? 21.203 -16.122 10.951  1.00   26.32  ? 242  LEU B N   1 
ATOM   4604 C CA  . LEU B 1 155 ? 19.917 -16.791 11.088  1.00   27.78  ? 242  LEU B CA  1 
ATOM   4605 C C   . LEU B 1 155 ? 18.789 -15.991 10.457  1.00   30.96  ? 242  LEU B C   1 
ATOM   4606 O O   . LEU B 1 155 ? 17.714 -16.551 10.171  1.00   33.96  ? 242  LEU B O   1 
ATOM   4607 C CB  . LEU B 1 155 ? 19.580 -17.116 12.557  1.00   28.84  ? 242  LEU B CB  1 
ATOM   4608 C CG  . LEU B 1 155 ? 20.590 -18.044 13.233  1.00   30.58  ? 242  LEU B CG  1 
ATOM   4609 C CD1 . LEU B 1 155 ? 20.432 -18.028 14.739  1.00   32.59  ? 242  LEU B CD1 1 
ATOM   4610 C CD2 . LEU B 1 155 ? 20.529 -19.487 12.671  1.00   31.78  ? 242  LEU B CD2 1 
ATOM   4611 N N   . CYS B 1 156 ? 19.015 -14.693 10.250  1.00   31.83  ? 243  CYS B N   1 
ATOM   4612 C CA  . CYS B 1 156 ? 17.986 -13.816 9.703   1.00   31.62  ? 243  CYS B CA  1 
ATOM   4613 C C   . CYS B 1 156 ? 18.081 -13.599 8.240   1.00   29.93  ? 243  CYS B C   1 
ATOM   4614 O O   . CYS B 1 156 ? 17.132 -13.139 7.601   1.00   34.80  ? 243  CYS B O   1 
ATOM   4615 C CB  . CYS B 1 156 ? 18.120 -12.424 10.296  1.00   32.57  ? 243  CYS B CB  1 
ATOM   4616 S SG  . CYS B 1 156 ? 17.819 -12.504 12.038  1.00   41.81  ? 243  CYS B SG  1 
ATOM   4617 N N   . ARG B 1 157 ? 19.268 -13.876 7.735   1.00   30.37  ? 244  ARG B N   1 
ATOM   4618 C CA  . ARG B 1 157 ? 19.631 -13.542 6.370   1.00   30.25  ? 244  ARG B CA  1 
ATOM   4619 C C   . ARG B 1 157 ? 18.863 -14.409 5.407   1.00   28.48  ? 244  ARG B C   1 
ATOM   4620 O O   . ARG B 1 157 ? 18.568 -15.558 5.724   1.00   23.83  ? 244  ARG B O   1 
ATOM   4621 C CB  . ARG B 1 157 ? 21.115 -13.829 6.187   1.00   33.67  ? 244  ARG B CB  1 
ATOM   4622 C CG  . ARG B 1 157 ? 21.681 -13.612 4.807   1.00   35.85  ? 244  ARG B CG  1 
ATOM   4623 C CD  . ARG B 1 157 ? 23.180 -13.755 4.800   1.00   39.98  ? 244  ARG B CD  1 
ATOM   4624 N NE  . ARG B 1 157 ? 23.609 -15.065 4.339   1.00   43.08  ? 244  ARG B NE  1 
ATOM   4625 C CZ  . ARG B 1 157 ? 24.649 -15.750 4.797   1.00   40.64  ? 244  ARG B CZ  1 
ATOM   4626 N NH1 . ARG B 1 157 ? 25.438 -15.323 5.770   1.00   34.25  ? 244  ARG B NH1 1 
ATOM   4627 N NH2 . ARG B 1 157 ? 24.898 -16.915 4.238   1.00   45.93  ? 244  ARG B NH2 1 
ATOM   4628 N N   . GLY B 1 158 ? 18.538 -13.846 4.251   1.00   25.97  ? 245  GLY B N   1 
ATOM   4629 C CA  . GLY B 1 158 ? 17.932 -14.652 3.214   1.00   29.67  ? 245  GLY B CA  1 
ATOM   4630 C C   . GLY B 1 158 ? 16.439 -14.463 3.074   1.00   30.66  ? 245  GLY B C   1 
ATOM   4631 O O   . GLY B 1 158 ? 15.701 -14.681 4.023   1.00   32.22  ? 245  GLY B O   1 
ATOM   4632 N N   . LYS B 1 159 ? 16.023 -14.069 1.877   1.00   30.70  ? 246  LYS B N   1 
ATOM   4633 C CA  . LYS B 1 159 ? 14.652 -13.683 1.521   1.00   32.96  ? 246  LYS B CA  1 
ATOM   4634 C C   . LYS B 1 159 ? 13.973 -14.798 0.698   1.00   39.00  ? 246  LYS B C   1 
ATOM   4635 O O   . LYS B 1 159 ? 12.762 -14.872 0.648   1.00   43.97  ? 246  LYS B O   1 
ATOM   4636 C CB  . LYS B 1 159 ? 14.774 -12.433 0.648   1.00   33.59  ? 246  LYS B CB  1 
ATOM   4637 C CG  . LYS B 1 159 ? 13.624 -11.514 0.605   1.00   34.03  ? 246  LYS B CG  1 
ATOM   4638 C CD  . LYS B 1 159 ? 13.953 -10.299 -0.253  1.00   30.46  ? 246  LYS B CD  1 
ATOM   4639 C CE  . LYS B 1 159 ? 12.723 -9.432  -0.217  1.00   27.45  ? 246  LYS B CE  1 
ATOM   4640 N NZ  . LYS B 1 159 ? 12.896 -8.282  -1.074  1.00   31.98  ? 246  LYS B NZ  1 
ATOM   4641 N N   . LYS B 1 160 ? 14.731 -15.647 0.011   1.00   38.26  ? 247  LYS B N   1 
ATOM   4642 C CA  . LYS B 1 160 ? 14.166 -16.728 -0.780  1.00   38.35  ? 247  LYS B CA  1 
ATOM   4643 C C   . LYS B 1 160 ? 14.698 -18.121 -0.477  1.00   35.78  ? 247  LYS B C   1 
ATOM   4644 O O   . LYS B 1 160 ? 15.656 -18.574 -1.089  1.00   33.57  ? 247  LYS B O   1 
ATOM   4645 C CB  . LYS B 1 160 ? 14.285 -16.485 -2.289  1.00   41.21  ? 247  LYS B CB  1 
ATOM   4646 C CG  . LYS B 1 160 ? 15.523 -15.869 -2.834  1.00   41.45  ? 247  LYS B CG  1 
ATOM   4647 C CD  . LYS B 1 160 ? 15.082 -14.727 -3.753  1.00   49.92  ? 247  LYS B CD  1 
ATOM   4648 C CE  . LYS B 1 160 ? 16.233 -13.946 -4.369  1.00   52.18  ? 247  LYS B CE  1 
ATOM   4649 N NZ  . LYS B 1 160 ? 17.070 -14.882 -5.186  1.00   61.50  ? 247  LYS B NZ  1 
ATOM   4650 N N   . PRO B 1 161 ? 14.058 -18.816 0.456   1.00   33.13  ? 248  PRO B N   1 
ATOM   4651 C CA  . PRO B 1 161 ? 12.898 -18.305 1.208   1.00   30.16  ? 248  PRO B CA  1 
ATOM   4652 C C   . PRO B 1 161 ? 13.295 -17.544 2.478   1.00   28.82  ? 248  PRO B C   1 
ATOM   4653 O O   . PRO B 1 161 ? 14.441 -17.631 2.866   1.00   28.70  ? 248  PRO B O   1 
ATOM   4654 C CB  . PRO B 1 161 ? 12.168 -19.578 1.595   1.00   26.07  ? 248  PRO B CB  1 
ATOM   4655 C CG  . PRO B 1 161 ? 13.265 -20.640 1.655   1.00   23.60  ? 248  PRO B CG  1 
ATOM   4656 C CD  . PRO B 1 161 ? 14.434 -20.185 0.838   1.00   27.40  ? 248  PRO B CD  1 
ATOM   4657 N N   . GLN B 1 162 ? 12.367 -16.806 3.082   1.00   28.16  ? 249  GLN B N   1 
ATOM   4658 C CA  . GLN B 1 162 ? 12.571 -16.098 4.341   1.00   28.78  ? 249  GLN B CA  1 
ATOM   4659 C C   . GLN B 1 162 ? 12.647 -17.140 5.430   1.00   29.88  ? 249  GLN B C   1 
ATOM   4660 O O   . GLN B 1 162 ? 12.056 -18.191 5.305   1.00   32.25  ? 249  GLN B O   1 
ATOM   4661 C CB  . GLN B 1 162 ? 11.401 -15.159 4.684   1.00   29.22  ? 249  GLN B CB  1 
ATOM   4662 C CG  . GLN B 1 162 ? 11.114 -14.031 3.678   1.00   26.68  ? 249  GLN B CG  1 
ATOM   4663 C CD  . GLN B 1 162 ? 11.753 -12.673 3.986   1.00   27.86  ? 249  GLN B CD  1 
ATOM   4664 O OE1 . GLN B 1 162 ? 12.735 -12.635 4.721   1.00   25.20  ? 249  GLN B OE1 1 
ATOM   4665 N NE2 . GLN B 1 162 ? 11.259 -11.570 3.365   1.00   21.62  ? 249  GLN B NE2 1 
ATOM   4666 N N   . PRO B 1 163 ? 13.359 -16.876 6.513   1.00   31.19  ? 250  PRO B N   1 
ATOM   4667 C CA  . PRO B 1 163 ? 13.328 -17.807 7.634   1.00   30.94  ? 250  PRO B CA  1 
ATOM   4668 C C   . PRO B 1 163 ? 11.981 -17.677 8.323   1.00   31.85  ? 250  PRO B C   1 
ATOM   4669 O O   . PRO B 1 163 ? 11.260 -16.730 8.083   1.00   36.51  ? 250  PRO B O   1 
ATOM   4670 C CB  . PRO B 1 163 ? 14.455 -17.322 8.534   1.00   30.52  ? 250  PRO B CB  1 
ATOM   4671 C CG  . PRO B 1 163 ? 14.639 -15.866 8.214   1.00   29.62  ? 250  PRO B CG  1 
ATOM   4672 C CD  . PRO B 1 163 ? 14.221 -15.710 6.788   1.00   32.08  ? 250  PRO B CD  1 
ATOM   4673 N N   . ASP B 1 164 ? 11.658 -18.658 9.145   1.00   33.72  ? 251  ASP B N   1 
ATOM   4674 C CA  . ASP B 1 164 ? 10.432 -18.756 9.924   1.00   32.96  ? 251  ASP B CA  1 
ATOM   4675 C C   . ASP B 1 164 ? 10.363 -17.501 10.819  1.00   32.22  ? 251  ASP B C   1 
ATOM   4676 O O   . ASP B 1 164 ? 11.143 -17.297 11.749  1.00   31.00  ? 251  ASP B O   1 
ATOM   4677 C CB  . ASP B 1 164 ? 10.553 -20.060 10.731  1.00   37.06  ? 251  ASP B CB  1 
ATOM   4678 C CG  . ASP B 1 164 ? 9.465  -20.296 11.731  1.00   39.06  ? 251  ASP B CG  1 
ATOM   4679 O OD1 . ASP B 1 164 ? 8.571  -19.452 11.954  1.00   40.48  ? 251  ASP B OD1 1 
ATOM   4680 O OD2 . ASP B 1 164 ? 9.495  -21.362 12.383  1.00   44.54  ? 251  ASP B OD2 1 
ATOM   4681 N N   . TRP B 1 165 ? 9.423  -16.633 10.493  1.00   29.45  ? 252  TRP B N   1 
ATOM   4682 C CA  . TRP B 1 165 ? 9.353  -15.359 11.162  1.00   31.10  ? 252  TRP B CA  1 
ATOM   4683 C C   . TRP B 1 165 ? 9.052  -15.474 12.664  1.00   32.03  ? 252  TRP B C   1 
ATOM   4684 O O   . TRP B 1 165 ? 9.510  -14.663 13.472  1.00   22.05  ? 252  TRP B O   1 
ATOM   4685 C CB  . TRP B 1 165 ? 8.301  -14.510 10.473  1.00   27.72  ? 252  TRP B CB  1 
ATOM   4686 C CG  . TRP B 1 165 ? 8.010  -13.302 11.234  1.00   29.31  ? 252  TRP B CG  1 
ATOM   4687 C CD1 . TRP B 1 165 ? 6.893  -13.043 12.000  1.00   28.18  ? 252  TRP B CD1 1 
ATOM   4688 C CD2 . TRP B 1 165 ? 8.868  -12.174 11.376  1.00   24.28  ? 252  TRP B CD2 1 
ATOM   4689 N NE1 . TRP B 1 165 ? 6.998  -11.789 12.550  1.00   28.35  ? 252  TRP B NE1 1 
ATOM   4690 C CE2 . TRP B 1 165 ? 8.200  -11.238 12.182  1.00   25.40  ? 252  TRP B CE2 1 
ATOM   4691 C CE3 . TRP B 1 165 ? 10.115 -11.835 10.860  1.00   23.77  ? 252  TRP B CE3 1 
ATOM   4692 C CZ2 . TRP B 1 165 ? 8.774  -10.022 12.526  1.00   28.97  ? 252  TRP B CZ2 1 
ATOM   4693 C CZ3 . TRP B 1 165 ? 10.670 -10.605 11.165  1.00   17.09  ? 252  TRP B CZ3 1 
ATOM   4694 C CH2 . TRP B 1 165 ? 10.018 -9.734  12.001  1.00   27.85  ? 252  TRP B CH2 1 
ATOM   4695 N N   . SER B 1 166 ? 8.258  -16.479 13.010  1.00   33.24  ? 253  SER B N   1 
ATOM   4696 C CA  . SER B 1 166 ? 7.798  -16.643 14.374  1.00   35.73  ? 253  SER B CA  1 
ATOM   4697 C C   . SER B 1 166 ? 8.969  -16.960 15.270  1.00   35.39  ? 253  SER B C   1 
ATOM   4698 O O   . SER B 1 166 ? 8.900  -16.650 16.448  1.00   39.89  ? 253  SER B O   1 
ATOM   4699 C CB  . SER B 1 166 ? 6.713  -17.715 14.482  1.00   36.83  ? 253  SER B CB  1 
ATOM   4700 O OG  . SER B 1 166 ? 7.235  -18.974 14.100  1.00   48.00  ? 253  SER B OG  1 
ATOM   4701 N N   . VAL B 1 167 ? 10.043 -17.518 14.720  1.00   29.53  ? 254  VAL B N   1 
ATOM   4702 C CA  . VAL B 1 167 ? 11.276 -17.736 15.468  1.00   25.68  ? 254  VAL B CA  1 
ATOM   4703 C C   . VAL B 1 167 ? 12.264 -16.545 15.411  1.00   27.03  ? 254  VAL B C   1 
ATOM   4704 O O   . VAL B 1 167 ? 12.824 -16.141 16.427  1.00   28.81  ? 254  VAL B O   1 
ATOM   4705 C CB  . VAL B 1 167 ? 11.994 -19.023 14.921  1.00   29.53  ? 254  VAL B CB  1 
ATOM   4706 C CG1 . VAL B 1 167 ? 13.311 -19.315 15.592  1.00   29.54  ? 254  VAL B CG1 1 
ATOM   4707 C CG2 . VAL B 1 167 ? 11.121 -20.261 15.059  1.00   23.56  ? 254  VAL B CG2 1 
ATOM   4708 N N   . VAL B 1 168 ? 12.579 -16.013 14.233  1.00   28.32  ? 255  VAL B N   1 
ATOM   4709 C CA  . VAL B 1 168 ? 13.657 -15.023 14.143  1.00   27.36  ? 255  VAL B CA  1 
ATOM   4710 C C   . VAL B 1 168 ? 13.243 -13.680 14.727  1.00   30.79  ? 255  VAL B C   1 
ATOM   4711 O O   . VAL B 1 168 ? 14.069 -12.892 15.220  1.00   31.36  ? 255  VAL B O   1 
ATOM   4712 C CB  . VAL B 1 168 ? 14.230 -14.854 12.716  1.00   27.34  ? 255  VAL B CB  1 
ATOM   4713 C CG1 . VAL B 1 168 ? 14.971 -16.091 12.269  1.00   31.03  ? 255  VAL B CG1 1 
ATOM   4714 C CG2 . VAL B 1 168 ? 13.183 -14.477 11.686  1.00   30.41  ? 255  VAL B CG2 1 
ATOM   4715 N N   . SER B 1 169 ? 11.946 -13.410 14.676  1.00   33.21  ? 256  SER B N   1 
ATOM   4716 C CA  . SER B 1 169 ? 11.414 -12.193 15.285  1.00   34.77  ? 256  SER B CA  1 
ATOM   4717 C C   . SER B 1 169 ? 11.627 -12.145 16.788  1.00   36.29  ? 256  SER B C   1 
ATOM   4718 O O   . SER B 1 169 ? 11.551 -11.083 17.383  1.00   41.44  ? 256  SER B O   1 
ATOM   4719 C CB  . SER B 1 169 ? 9.933  -12.032 14.984  1.00   33.13  ? 256  SER B CB  1 
ATOM   4720 O OG  . SER B 1 169 ? 9.212  -13.069 15.599  1.00   39.59  ? 256  SER B OG  1 
ATOM   4721 N N   . GLN B 1 170 ? 11.905 -13.285 17.409  1.00   37.76  ? 257  GLN B N   1 
ATOM   4722 C CA  . GLN B 1 170 ? 12.172 -13.351 18.848  1.00   32.31  ? 257  GLN B CA  1 
ATOM   4723 C C   . GLN B 1 170 ? 13.471 -12.674 19.173  1.00   30.68  ? 257  GLN B C   1 
ATOM   4724 O O   . GLN B 1 170 ? 13.791 -12.493 20.338  1.00   33.18  ? 257  GLN B O   1 
ATOM   4725 C CB  . GLN B 1 170 ? 12.258 -14.796 19.334  1.00   32.56  ? 257  GLN B CB  1 
ATOM   4726 C CG  . GLN B 1 170 ? 10.981 -15.605 19.135  1.00   39.64  ? 257  GLN B CG  1 
ATOM   4727 C CD  . GLN B 1 170 ? 11.075 -17.071 19.584  1.00   48.13  ? 257  GLN B CD  1 
ATOM   4728 O OE1 . GLN B 1 170 ? 11.870 -17.428 20.466  1.00   53.36  ? 257  GLN B OE1 1 
ATOM   4729 N NE2 . GLN B 1 170 ? 10.237 -17.920 18.992  1.00   49.61  ? 257  GLN B NE2 1 
ATOM   4730 N N   . ALA B 1 171 ? 14.238 -12.283 18.167  1.00   30.07  ? 258  ALA B N   1 
ATOM   4731 C CA  . ALA B 1 171 ? 15.524 -11.655 18.437  1.00   29.76  ? 258  ALA B CA  1 
ATOM   4732 C C   . ALA B 1 171 ? 15.498 -10.136 18.459  1.00   28.76  ? 258  ALA B C   1 
ATOM   4733 O O   . ALA B 1 171 ? 16.484 -9.492  18.850  1.00   31.66  ? 258  ALA B O   1 
ATOM   4734 C CB  . ALA B 1 171 ? 16.535 -12.126 17.403  1.00   35.32  ? 258  ALA B CB  1 
ATOM   4735 N N   . LEU B 1 172 ? 14.390 -9.555  18.008  1.00   28.84  ? 259  LEU B N   1 
ATOM   4736 C CA  . LEU B 1 172 ? 14.231 -8.108  17.986  1.00   27.29  ? 259  LEU B CA  1 
ATOM   4737 C C   . LEU B 1 172 ? 14.532 -7.389  19.335  1.00   27.78  ? 259  LEU B C   1 
ATOM   4738 O O   . LEU B 1 172 ? 15.251 -6.387  19.370  1.00   22.90  ? 259  LEU B O   1 
ATOM   4739 C CB  . LEU B 1 172 ? 12.843 -7.781  17.416  1.00   26.26  ? 259  LEU B CB  1 
ATOM   4740 C CG  . LEU B 1 172 ? 12.700 -7.930  15.891  1.00   22.25  ? 259  LEU B CG  1 
ATOM   4741 C CD1 . LEU B 1 172 ? 11.270 -7.670  15.469  1.00   24.23  ? 259  LEU B CD1 1 
ATOM   4742 C CD2 . LEU B 1 172 ? 13.604 -6.991  15.130  1.00   22.04  ? 259  LEU B CD2 1 
ATOM   4743 N N   . PRO B 1 173 ? 13.996 -7.845  20.460  1.00   27.13  ? 260  PRO B N   1 
ATOM   4744 C CA  . PRO B 1 173 ? 14.295 -7.139  21.718  1.00   29.07  ? 260  PRO B CA  1 
ATOM   4745 C C   . PRO B 1 173 ? 15.786 -7.071  21.960  1.00   33.37  ? 260  PRO B C   1 
ATOM   4746 O O   . PRO B 1 173 ? 16.274 -5.996  22.324  1.00   31.05  ? 260  PRO B O   1 
ATOM   4747 C CB  . PRO B 1 173 ? 13.584 -7.958  22.790  1.00   24.74  ? 260  PRO B CB  1 
ATOM   4748 C CG  . PRO B 1 173 ? 12.433 -8.649  21.984  1.00   29.22  ? 260  PRO B CG  1 
ATOM   4749 C CD  . PRO B 1 173 ? 13.014 -8.935  20.625  1.00   27.63  ? 260  PRO B CD  1 
ATOM   4750 N N   . THR B 1 174 ? 16.491 -8.177  21.706  1.00   35.06  ? 261  THR B N   1 
ATOM   4751 C CA  . THR B 1 174 ? 17.943 -8.216  21.894  1.00   32.22  ? 261  THR B CA  1 
ATOM   4752 C C   . THR B 1 174 ? 18.620 -7.301  20.919  1.00   30.79  ? 261  THR B C   1 
ATOM   4753 O O   . THR B 1 174 ? 19.454 -6.492  21.289  1.00   31.40  ? 261  THR B O   1 
ATOM   4754 C CB  . THR B 1 174 ? 18.517 -9.590  21.641  1.00   33.87  ? 261  THR B CB  1 
ATOM   4755 O OG1 . THR B 1 174 ? 17.909 -10.521 22.538  1.00   33.55  ? 261  THR B OG1 1 
ATOM   4756 C CG2 . THR B 1 174 ? 19.982 -9.588  22.020  1.00   37.92  ? 261  THR B CG2 1 
ATOM   4757 N N   . LEU B 1 175 ? 18.290 -7.454  19.643  1.00   30.89  ? 262  LEU B N   1 
ATOM   4758 C CA  . LEU B 1 175 ? 18.934 -6.602  18.635  1.00   28.47  ? 262  LEU B CA  1 
ATOM   4759 C C   . LEU B 1 175 ? 18.687 -5.137  18.915  1.00   26.46  ? 262  LEU B C   1 
ATOM   4760 O O   . LEU B 1 175 ? 19.546 -4.323  18.637  1.00   28.24  ? 262  LEU B O   1 
ATOM   4761 C CB  . LEU B 1 175 ? 18.429 -6.906  17.227  1.00   24.68  ? 262  LEU B CB  1 
ATOM   4762 C CG  . LEU B 1 175 ? 18.812 -8.269  16.697  1.00   23.67  ? 262  LEU B CG  1 
ATOM   4763 C CD1 . LEU B 1 175 ? 17.852 -8.726  15.608  1.00   27.53  ? 262  LEU B CD1 1 
ATOM   4764 C CD2 . LEU B 1 175 ? 20.230 -8.238  16.184  1.00   25.31  ? 262  LEU B CD2 1 
ATOM   4765 N N   . ALA B 1 176 ? 17.520 -4.806  19.462  1.00   29.03  ? 263  ALA B N   1 
ATOM   4766 C CA  . ALA B 1 176 ? 17.216 -3.409  19.754  1.00   31.75  ? 263  ALA B CA  1 
ATOM   4767 C C   . ALA B 1 176 ? 18.231 -2.805  20.713  1.00   33.05  ? 263  ALA B C   1 
ATOM   4768 O O   . ALA B 1 176 ? 18.570 -1.635  20.587  1.00   34.35  ? 263  ALA B O   1 
ATOM   4769 C CB  . ALA B 1 176 ? 15.844 -3.269  20.315  1.00   32.10  ? 263  ALA B CB  1 
ATOM   4770 N N   . LYS B 1 177 ? 18.727 -3.626  21.642  1.00   35.66  ? 264  LYS B N   1 
ATOM   4771 C CA  . LYS B 1 177 ? 19.768 -3.224  22.582  1.00   33.99  ? 264  LYS B CA  1 
ATOM   4772 C C   . LYS B 1 177 ? 21.119 -3.197  21.910  1.00   34.31  ? 264  LYS B C   1 
ATOM   4773 O O   . LYS B 1 177 ? 21.889 -2.286  22.124  1.00   32.69  ? 264  LYS B O   1 
ATOM   4774 C CB  . LYS B 1 177 ? 19.786 -4.158  23.781  1.00   32.17  ? 264  LYS B CB  1 
ATOM   4775 C CG  . LYS B 1 177 ? 18.528 -4.028  24.632  1.00   40.18  ? 264  LYS B CG  1 
ATOM   4776 C CD  . LYS B 1 177 ? 18.302 -5.223  25.546  1.00   42.59  ? 264  LYS B CD  1 
ATOM   4777 C CE  . LYS B 1 177 ? 17.929 -4.831  26.956  1.00   43.90  ? 264  LYS B CE  1 
ATOM   4778 N NZ  . LYS B 1 177 ? 17.570 -6.102  27.660  1.00   43.22  ? 264  LYS B NZ  1 
ATOM   4779 N N   . LEU B 1 178 ? 21.401 -4.198  21.088  1.00   35.59  ? 265  LEU B N   1 
ATOM   4780 C CA  . LEU B 1 178 ? 22.703 -4.321  20.439  1.00   36.68  ? 265  LEU B CA  1 
ATOM   4781 C C   . LEU B 1 178 ? 23.115 -3.175  19.524  1.00   35.98  ? 265  LEU B C   1 
ATOM   4782 O O   . LEU B 1 178 ? 24.304 -2.969  19.297  1.00   37.27  ? 265  LEU B O   1 
ATOM   4783 C CB  . LEU B 1 178 ? 22.766 -5.615  19.623  1.00   37.74  ? 265  LEU B CB  1 
ATOM   4784 C CG  . LEU B 1 178 ? 22.723 -6.880  20.477  1.00   37.85  ? 265  LEU B CG  1 
ATOM   4785 C CD1 . LEU B 1 178 ? 22.457 -8.059  19.574  1.00   39.24  ? 265  LEU B CD1 1 
ATOM   4786 C CD2 . LEU B 1 178 ? 24.031 -7.038  21.258  1.00   35.14  ? 265  LEU B CD2 1 
ATOM   4787 N N   . ILE B 1 179 ? 22.154 -2.464  18.948  1.00   34.65  ? 266  ILE B N   1 
ATOM   4788 C CA  . ILE B 1 179 ? 22.480 -1.286  18.163  1.00   34.14  ? 266  ILE B CA  1 
ATOM   4789 C C   . ILE B 1 179 ? 22.860 -0.061  18.999  1.00   33.23  ? 266  ILE B C   1 
ATOM   4790 O O   . ILE B 1 179 ? 23.134 1.036   18.468  1.00   28.56  ? 266  ILE B O   1 
ATOM   4791 C CB  . ILE B 1 179 ? 21.372 -0.989  17.165  1.00   38.98  ? 266  ILE B CB  1 
ATOM   4792 C CG1 . ILE B 1 179 ? 20.000 -0.849  17.831  1.00   38.99  ? 266  ILE B CG1 1 
ATOM   4793 C CG2 . ILE B 1 179 ? 21.360 -2.081  16.101  1.00   40.26  ? 266  ILE B CG2 1 
ATOM   4794 C CD1 . ILE B 1 179 ? 18.953 -0.303  16.867  1.00   38.00  ? 266  ILE B CD1 1 
ATOM   4795 N N   . TYR B 1 180 ? 22.943 -0.295  20.310  1.00   37.98  ? 267  TYR B N   1 
ATOM   4796 C CA  . TYR B 1 180 ? 23.522 0.636   21.289  1.00   36.97  ? 267  TYR B CA  1 
ATOM   4797 C C   . TYR B 1 180 ? 24.918 0.212   21.748  1.00   41.33  ? 267  TYR B C   1 
ATOM   4798 O O   . TYR B 1 180 ? 25.549 0.942   22.488  1.00   47.03  ? 267  TYR B O   1 
ATOM   4799 C CB  . TYR B 1 180 ? 22.620 0.821   22.490  1.00   33.03  ? 267  TYR B CB  1 
ATOM   4800 C CG  . TYR B 1 180 ? 21.420 1.694   22.175  1.00   32.32  ? 267  TYR B CG  1 
ATOM   4801 C CD1 . TYR B 1 180 ? 20.207 1.141   21.801  1.00   30.40  ? 267  TYR B CD1 1 
ATOM   4802 C CD2 . TYR B 1 180 ? 21.518 3.070   22.223  1.00   30.63  ? 267  TYR B CD2 1 
ATOM   4803 C CE1 . TYR B 1 180 ? 19.124 1.934   21.512  1.00   31.46  ? 267  TYR B CE1 1 
ATOM   4804 C CE2 . TYR B 1 180 ? 20.442 3.874   21.931  1.00   31.53  ? 267  TYR B CE2 1 
ATOM   4805 C CZ  . TYR B 1 180 ? 19.252 3.300   21.574  1.00   33.32  ? 267  TYR B CZ  1 
ATOM   4806 O OH  . TYR B 1 180 ? 18.186 4.100   21.249  1.00   37.26  ? 267  TYR B OH  1 
ATOM   4807 N N   . SER B 1 181 ? 25.430 -0.918  21.278  1.00   40.31  ? 268  SER B N   1 
ATOM   4808 C CA  . SER B 1 181 ? 26.768 -1.375  21.638  1.00   43.24  ? 268  SER B CA  1 
ATOM   4809 C C   . SER B 1 181 ? 27.868 -0.440  21.154  1.00   44.62  ? 268  SER B C   1 
ATOM   4810 O O   . SER B 1 181 ? 27.726 0.257   20.151  1.00   42.98  ? 268  SER B O   1 
ATOM   4811 C CB  . SER B 1 181 ? 27.037 -2.787  21.076  1.00   45.97  ? 268  SER B CB  1 
ATOM   4812 O OG  . SER B 1 181 ? 28.387 -3.190  21.254  1.00   45.52  ? 268  SER B OG  1 
ATOM   4813 N N   . MET B 1 182 ? 28.973 -0.448  21.885  1.00   47.44  ? 269  MET B N   1 
ATOM   4814 C CA  . MET B 1 182 ? 30.109 0.411   21.554  1.00   53.77  ? 269  MET B CA  1 
ATOM   4815 C C   . MET B 1 182 ? 31.161 -0.335  20.742  1.00   51.16  ? 269  MET B C   1 
ATOM   4816 O O   . MET B 1 182 ? 32.048 0.286   20.164  1.00   48.42  ? 269  MET B O   1 
ATOM   4817 C CB  . MET B 1 182 ? 30.738 1.018   22.824  1.00   59.79  ? 269  MET B CB  1 
ATOM   4818 C CG  . MET B 1 182 ? 29.820 1.950   23.646  1.00   63.79  ? 269  MET B CG  1 
ATOM   4819 S SD  . MET B 1 182 ? 29.271 3.408   22.731  1.00   74.83  ? 269  MET B SD  1 
ATOM   4820 C CE  . MET B 1 182 ? 30.792 4.369   22.567  1.00   70.45  ? 269  MET B CE  1 
ATOM   4821 N N   . ASP B 1 183 ? 31.022 -1.657  20.690  1.00   48.19  ? 270  ASP B N   1 
ATOM   4822 C CA  . ASP B 1 183 ? 31.824 -2.511  19.840  1.00   44.72  ? 270  ASP B CA  1 
ATOM   4823 C C   . ASP B 1 183 ? 31.363 -2.447  18.369  1.00   46.62  ? 270  ASP B C   1 
ATOM   4824 O O   . ASP B 1 183 ? 30.263 -2.860  17.997  1.00   49.16  ? 270  ASP B O   1 
ATOM   4825 C CB  . ASP B 1 183 ? 31.708 -3.930  20.360  1.00   46.54  ? 270  ASP B CB  1 
ATOM   4826 C CG  . ASP B 1 183 ? 32.607 -4.875  19.631  1.00   49.81  ? 270  ASP B CG  1 
ATOM   4827 O OD1 . ASP B 1 183 ? 33.823 -4.574  19.523  1.00   53.19  ? 270  ASP B OD1 1 
ATOM   4828 O OD2 . ASP B 1 183 ? 32.139 -5.910  19.121  1.00   48.08  ? 270  ASP B OD2 1 
ATOM   4829 N N   . THR B 1 184 ? 32.216 -1.933  17.499  1.00   44.81  ? 271  THR B N   1 
ATOM   4830 C CA  . THR B 1 184 ? 31.853 -1.780  16.107  1.00   41.55  ? 271  THR B CA  1 
ATOM   4831 C C   . THR B 1 184 ? 31.319 -3.039  15.457  1.00   38.65  ? 271  THR B C   1 
ATOM   4832 O O   . THR B 1 184 ? 30.258 -2.998  14.877  1.00   39.26  ? 271  THR B O   1 
ATOM   4833 C CB  . THR B 1 184 ? 33.068 -1.305  15.335  1.00   40.03  ? 271  THR B CB  1 
ATOM   4834 O OG1 . THR B 1 184 ? 33.533 -0.123  15.969  1.00   41.23  ? 271  THR B OG1 1 
ATOM   4835 C CG2 . THR B 1 184 ? 32.686 -0.818  13.935  1.00   43.11  ? 271  THR B CG2 1 
ATOM   4836 N N   . GLU B 1 185 ? 32.051 -4.143  15.525  1.00   40.51  ? 272  GLU B N   1 
ATOM   4837 C CA  . GLU B 1 185 ? 31.624 -5.368  14.842  1.00   40.28  ? 272  GLU B CA  1 
ATOM   4838 C C   . GLU B 1 185 ? 30.271 -5.841  15.354  1.00   38.50  ? 272  GLU B C   1 
ATOM   4839 O O   . GLU B 1 185 ? 29.523 -6.444  14.600  1.00   40.64  ? 272  GLU B O   1 
ATOM   4840 C CB  . GLU B 1 185 ? 32.636 -6.498  14.983  1.00   42.27  ? 272  GLU B CB  1 
ATOM   4841 C CG  . GLU B 1 185 ? 33.986 -6.202  14.358  1.00   52.07  ? 272  GLU B CG  1 
ATOM   4842 C CD  . GLU B 1 185 ? 35.077 -6.118  15.410  1.00   57.10  ? 272  GLU B CD  1 
ATOM   4843 O OE1 . GLU B 1 185 ? 35.763 -7.141  15.569  1.00   58.59  ? 272  GLU B OE1 1 
ATOM   4844 O OE2 . GLU B 1 185 ? 35.203 -5.077  16.099  1.00   54.96  ? 272  GLU B OE2 1 
ATOM   4845 N N   . THR B 1 186 ? 29.969 -5.609  16.627  1.00   35.81  ? 273  THR B N   1 
ATOM   4846 C CA  . THR B 1 186 ? 28.682 -6.006  17.177  1.00   36.51  ? 273  THR B CA  1 
ATOM   4847 C C   . THR B 1 186 ? 27.591 -5.128  16.586  1.00   35.27  ? 273  THR B C   1 
ATOM   4848 O O   . THR B 1 186 ? 26.504 -5.574  16.262  1.00   37.32  ? 273  THR B O   1 
ATOM   4849 C CB  . THR B 1 186 ? 28.656 -5.840  18.695  1.00   35.21  ? 273  THR B CB  1 
ATOM   4850 O OG1 . THR B 1 186 ? 29.624 -6.695  19.296  1.00   34.68  ? 273  THR B OG1 1 
ATOM   4851 C CG2 . THR B 1 186 ? 27.338 -6.366  19.245  1.00   37.70  ? 273  THR B CG2 1 
ATOM   4852 N N   . LEU B 1 187 ? 27.900 -3.853  16.467  1.00   31.66  ? 274  LEU B N   1 
ATOM   4853 C CA  . LEU B 1 187 ? 26.957 -2.895  15.955  1.00   31.13  ? 274  LEU B CA  1 
ATOM   4854 C C   . LEU B 1 187 ? 26.640 -3.194  14.518  1.00   34.06  ? 274  LEU B C   1 
ATOM   4855 O O   . LEU B 1 187 ? 25.486 -3.242  14.130  1.00   37.35  ? 274  LEU B O   1 
ATOM   4856 C CB  . LEU B 1 187 ? 27.592 -1.539  16.052  1.00   30.66  ? 274  LEU B CB  1 
ATOM   4857 C CG  . LEU B 1 187 ? 26.825 -0.310  15.633  1.00   32.86  ? 274  LEU B CG  1 
ATOM   4858 C CD1 . LEU B 1 187 ? 25.462 -0.305  16.331  1.00   35.22  ? 274  LEU B CD1 1 
ATOM   4859 C CD2 . LEU B 1 187 ? 27.700 0.917   15.985  1.00   30.37  ? 274  LEU B CD2 1 
ATOM   4860 N N   . VAL B 1 188 ? 27.685 -3.412  13.742  1.00   33.18  ? 275  VAL B N   1 
ATOM   4861 C CA  . VAL B 1 188 ? 27.558 -3.720  12.331  1.00   32.63  ? 275  VAL B CA  1 
ATOM   4862 C C   . VAL B 1 188 ? 26.724 -4.977  12.076  1.00   34.20  ? 275  VAL B C   1 
ATOM   4863 O O   . VAL B 1 188 ? 25.780 -4.991  11.302  1.00   31.58  ? 275  VAL B O   1 
ATOM   4864 C CB  . VAL B 1 188 ? 28.941 -4.012  11.757  1.00   28.06  ? 275  VAL B CB  1 
ATOM   4865 C CG1 . VAL B 1 188 ? 28.768 -4.489  10.362  1.00   24.73  ? 275  VAL B CG1 1 
ATOM   4866 C CG2 . VAL B 1 188 ? 29.787 -2.769  11.816  1.00   28.64  ? 275  VAL B CG2 1 
ATOM   4867 N N   . ASP B 1 189 ? 27.086 -6.062  12.741  1.00   35.81  ? 276  ASP B N   1 
ATOM   4868 C CA  . ASP B 1 189 ? 26.366 -7.309  12.565  1.00   37.54  ? 276  ASP B CA  1 
ATOM   4869 C C   . ASP B 1 189 ? 24.904 -7.193  13.012  1.00   35.97  ? 276  ASP B C   1 
ATOM   4870 O O   . ASP B 1 189 ? 24.026 -7.737  12.383  1.00   37.73  ? 276  ASP B O   1 
ATOM   4871 C CB  . ASP B 1 189 ? 27.093 -8.396  13.337  1.00   39.70  ? 276  ASP B CB  1 
ATOM   4872 C CG  . ASP B 1 189 ? 28.431 -8.764  12.712  1.00   43.81  ? 276  ASP B CG  1 
ATOM   4873 O OD1 . ASP B 1 189 ? 28.758 -8.321  11.579  1.00   37.07  ? 276  ASP B OD1 1 
ATOM   4874 O OD2 . ASP B 1 189 ? 29.210 -9.532  13.329  1.00   43.65  ? 276  ASP B OD2 1 
ATOM   4875 N N   . ALA B 1 190 ? 24.651 -6.491  14.107  1.00   34.87  ? 277  ALA B N   1 
ATOM   4876 C CA  . ALA B 1 190 ? 23.313 -6.218  14.590  1.00   29.58  ? 277  ALA B CA  1 
ATOM   4877 C C   . ALA B 1 190 ? 22.515 -5.425  13.541  1.00   29.71  ? 277  ALA B C   1 
ATOM   4878 O O   . ALA B 1 190 ? 21.336 -5.715  13.290  1.00   27.67  ? 277  ALA B O   1 
ATOM   4879 C CB  . ALA B 1 190 ? 23.411 -5.483  15.871  1.00   28.88  ? 277  ALA B CB  1 
ATOM   4880 N N   . CYS B 1 191 ? 23.146 -4.446  12.906  1.00   27.39  ? 278  CYS B N   1 
ATOM   4881 C CA  . CYS B 1 191 ? 22.504 -3.701  11.825  1.00   28.74  ? 278  CYS B CA  1 
ATOM   4882 C C   . CYS B 1 191 ? 22.182 -4.577  10.612  1.00   31.27  ? 278  CYS B C   1 
ATOM   4883 O O   . CYS B 1 191 ? 21.100 -4.483  10.025  1.00   38.39  ? 278  CYS B O   1 
ATOM   4884 C CB  . CYS B 1 191 ? 23.313 -2.482  11.383  1.00   28.93  ? 278  CYS B CB  1 
ATOM   4885 S SG  . CYS B 1 191 ? 23.302 -1.018  12.495  1.00   30.08  ? 278  CYS B SG  1 
ATOM   4886 N N   . TRP B 1 192 ? 23.086 -5.465  10.242  1.00   31.40  ? 279  TRP B N   1 
ATOM   4887 C CA  . TRP B 1 192 ? 22.803 -6.393  9.158   1.00   27.05  ? 279  TRP B CA  1 
ATOM   4888 C C   . TRP B 1 192 ? 21.627 -7.245  9.557   1.00   26.11  ? 279  TRP B C   1 
ATOM   4889 O O   . TRP B 1 192 ? 20.667 -7.402  8.804   1.00   32.29  ? 279  TRP B O   1 
ATOM   4890 C CB  . TRP B 1 192 ? 23.993 -7.298  8.854   1.00   25.78  ? 279  TRP B CB  1 
ATOM   4891 C CG  . TRP B 1 192 ? 24.984 -6.621  7.983   1.00   21.44  ? 279  TRP B CG  1 
ATOM   4892 C CD1 . TRP B 1 192 ? 26.246 -6.237  8.335   1.00   24.09  ? 279  TRP B CD1 1 
ATOM   4893 C CD2 . TRP B 1 192 ? 24.826 -6.258  6.614   1.00   15.93  ? 279  TRP B CD2 1 
ATOM   4894 N NE1 . TRP B 1 192 ? 26.884 -5.664  7.260   1.00   22.59  ? 279  TRP B NE1 1 
ATOM   4895 C CE2 . TRP B 1 192 ? 26.038 -5.679  6.181   1.00   20.42  ? 279  TRP B CE2 1 
ATOM   4896 C CE3 . TRP B 1 192 ? 23.818 -6.431  5.678   1.00   19.70  ? 279  TRP B CE3 1 
ATOM   4897 C CZ2 . TRP B 1 192 ? 26.206 -5.131  4.897   1.00   20.23  ? 279  TRP B CZ2 1 
ATOM   4898 C CZ3 . TRP B 1 192 ? 24.016 -5.933  4.380   1.00   21.19  ? 279  TRP B CZ3 1 
ATOM   4899 C CH2 . TRP B 1 192 ? 25.197 -5.288  4.005   1.00   16.54  ? 279  TRP B CH2 1 
ATOM   4900 N N   . ALA B 1 193 ? 21.658 -7.791  10.757  1.00   25.14  ? 280  ALA B N   1 
ATOM   4901 C CA  . ALA B 1 193 ? 20.532 -8.597  11.182  1.00   26.18  ? 280  ALA B CA  1 
ATOM   4902 C C   . ALA B 1 193 ? 19.203 -7.819  11.059  1.00   21.87  ? 280  ALA B C   1 
ATOM   4903 O O   . ALA B 1 193 ? 18.207 -8.318  10.595  1.00   24.94  ? 280  ALA B O   1 
ATOM   4904 C CB  . ALA B 1 193 ? 20.773 -9.111  12.572  1.00   26.78  ? 280  ALA B CB  1 
ATOM   4905 N N   . ILE B 1 194 ? 19.178 -6.560  11.429  1.00   27.29  ? 281  ILE B N   1 
ATOM   4906 C CA  . ILE B 1 194 ? 17.934 -5.803  11.371  1.00   25.81  ? 281  ILE B CA  1 
ATOM   4907 C C   . ILE B 1 194 ? 17.610 -5.473  9.929   1.00   22.64  ? 281  ILE B C   1 
ATOM   4908 O O   . ILE B 1 194 ? 16.440 -5.384  9.590   1.00   20.78  ? 281  ILE B O   1 
ATOM   4909 C CB  . ILE B 1 194 ? 18.063 -4.527  12.203  1.00   25.97  ? 281  ILE B CB  1 
ATOM   4910 C CG1 . ILE B 1 194 ? 18.176 -4.888  13.685  1.00   25.80  ? 281  ILE B CG1 1 
ATOM   4911 C CG2 . ILE B 1 194 ? 16.866 -3.630  11.980  1.00   30.28  ? 281  ILE B CG2 1 
ATOM   4912 C CD1 . ILE B 1 194 ? 18.816 -3.767  14.504  1.00   23.26  ? 281  ILE B CD1 1 
ATOM   4913 N N   . SER B 1 195 ? 18.619 -5.301  9.074   1.00   22.08  ? 282  SER B N   1 
ATOM   4914 C CA  . SER B 1 195 ? 18.356 -5.052  7.647   1.00   18.83  ? 282  SER B CA  1 
ATOM   4915 C C   . SER B 1 195 ? 17.673 -6.247  6.998   1.00   23.79  ? 282  SER B C   1 
ATOM   4916 O O   . SER B 1 195 ? 16.975 -6.080  5.990   1.00   28.96  ? 282  SER B O   1 
ATOM   4917 C CB  . SER B 1 195 ? 19.616 -4.742  6.857   1.00   17.34  ? 282  SER B CB  1 
ATOM   4918 O OG  . SER B 1 195 ? 20.479 -5.860  6.611   1.00   10.28  ? 282  SER B OG  1 
ATOM   4919 N N   . TYR B 1 196 ? 17.875 -7.437  7.562   1.00   21.75  ? 283  TYR B N   1 
ATOM   4920 C CA  . TYR B 1 196 ? 17.324 -8.674  6.998   1.00   23.83  ? 283  TYR B CA  1 
ATOM   4921 C C   . TYR B 1 196 ? 15.919 -8.922  7.541   1.00   24.99  ? 283  TYR B C   1 
ATOM   4922 O O   . TYR B 1 196 ? 15.013 -9.226  6.790   1.00   24.31  ? 283  TYR B O   1 
ATOM   4923 C CB  . TYR B 1 196 ? 18.207 -9.881  7.339   1.00   24.46  ? 283  TYR B CB  1 
ATOM   4924 C CG  . TYR B 1 196 ? 19.654 -9.865  6.869   1.00   19.04  ? 283  TYR B CG  1 
ATOM   4925 C CD1 . TYR B 1 196 ? 20.658 -10.518 7.595   1.00   23.87  ? 283  TYR B CD1 1 
ATOM   4926 C CD2 . TYR B 1 196 ? 20.025 -9.237  5.709   1.00   16.73  ? 283  TYR B CD2 1 
ATOM   4927 C CE1 . TYR B 1 196 ? 21.992 -10.523 7.199   1.00   17.98  ? 283  TYR B CE1 1 
ATOM   4928 C CE2 . TYR B 1 196 ? 21.363 -9.242  5.288   1.00   19.15  ? 283  TYR B CE2 1 
ATOM   4929 C CZ  . TYR B 1 196 ? 22.321 -9.892  6.018   1.00   20.24  ? 283  TYR B CZ  1 
ATOM   4930 O OH  . TYR B 1 196 ? 23.600 -9.889  5.519   1.00   25.48  ? 283  TYR B OH  1 
ATOM   4931 N N   . LEU B 1 197 ? 15.751 -8.820  8.854   1.00   28.50  ? 284  LEU B N   1 
ATOM   4932 C CA  . LEU B 1 197 ? 14.437 -8.881  9.491   1.00   25.74  ? 284  LEU B CA  1 
ATOM   4933 C C   . LEU B 1 197 ? 13.458 -7.834  8.961   1.00   24.46  ? 284  LEU B C   1 
ATOM   4934 O O   . LEU B 1 197 ? 12.291 -8.129  8.743   1.00   29.93  ? 284  LEU B O   1 
ATOM   4935 C CB  . LEU B 1 197 ? 14.615 -8.666  10.980  1.00   25.89  ? 284  LEU B CB  1 
ATOM   4936 C CG  . LEU B 1 197 ? 15.352 -9.777  11.729  1.00   27.86  ? 284  LEU B CG  1 
ATOM   4937 C CD1 . LEU B 1 197 ? 15.574 -9.397  13.144  1.00   29.35  ? 284  LEU B CD1 1 
ATOM   4938 C CD2 . LEU B 1 197 ? 14.584 -11.097 11.758  1.00   27.59  ? 284  LEU B CD2 1 
ATOM   4939 N N   . SER B 1 198 ? 13.907 -6.617  8.695   1.00   25.02  ? 285  SER B N   1 
ATOM   4940 C CA  . SER B 1 198 ? 12.992 -5.610  8.157   1.00   25.06  ? 285  SER B CA  1 
ATOM   4941 C C   . SER B 1 198 ? 12.750 -5.816  6.659   1.00   26.26  ? 285  SER B C   1 
ATOM   4942 O O   . SER B 1 198 ? 11.958 -5.111  6.063   1.00   20.74  ? 285  SER B O   1 
ATOM   4943 C CB  . SER B 1 198 ? 13.568 -4.222  8.350   1.00   24.50  ? 285  SER B CB  1 
ATOM   4944 O OG  . SER B 1 198 ? 14.690 -4.083  7.498   1.00   29.76  ? 285  SER B OG  1 
ATOM   4945 N N   . ASP B 1 199 ? 13.491 -6.729  6.030   1.00   26.49  ? 286  ASP B N   1 
ATOM   4946 C CA  . ASP B 1 199 ? 13.323 -7.010  4.611   1.00   25.90  ? 286  ASP B CA  1 
ATOM   4947 C C   . ASP B 1 199 ? 12.261 -8.076  4.438   1.00   25.63  ? 286  ASP B C   1 
ATOM   4948 O O   . ASP B 1 199 ? 12.535 -9.265  4.271   1.00   32.45  ? 286  ASP B O   1 
ATOM   4949 C CB  . ASP B 1 199 ? 14.625 -7.528  4.054   1.00   27.45  ? 286  ASP B CB  1 
ATOM   4950 C CG  . ASP B 1 199 ? 14.614 -7.619  2.550   1.00   33.71  ? 286  ASP B CG  1 
ATOM   4951 O OD1 . ASP B 1 199 ? 13.539 -7.523  1.894   1.00   35.46  ? 286  ASP B OD1 1 
ATOM   4952 O OD2 . ASP B 1 199 ? 15.694 -7.786  1.961   1.00   31.00  ? 286  ASP B OD2 1 
ATOM   4953 N N   . GLY B 1 200 ? 11.015 -7.652  4.503   1.00   24.74  ? 287  GLY B N   1 
ATOM   4954 C CA  . GLY B 1 200 ? 9.919  -8.588  4.397   1.00   25.58  ? 287  GLY B CA  1 
ATOM   4955 C C   . GLY B 1 200 ? 8.587  -7.896  4.499   1.00   23.35  ? 287  GLY B C   1 
ATOM   4956 O O   . GLY B 1 200 ? 8.446  -6.718  4.214   1.00   24.84  ? 287  GLY B O   1 
ATOM   4957 N N   . PRO B 1 201 ? 7.593  -8.650  4.913   1.00   25.28  ? 288  PRO B N   1 
ATOM   4958 C CA  . PRO B 1 201 ? 6.243  -8.109  4.940   1.00   23.17  ? 288  PRO B CA  1 
ATOM   4959 C C   . PRO B 1 201 ? 6.032  -7.016  5.970   1.00   23.81  ? 288  PRO B C   1 
ATOM   4960 O O   . PRO B 1 201 ? 6.829  -6.845  6.893   1.00   24.83  ? 288  PRO B O   1 
ATOM   4961 C CB  . PRO B 1 201 ? 5.370  -9.338  5.219   1.00   18.15  ? 288  PRO B CB  1 
ATOM   4962 C CG  . PRO B 1 201 ? 6.253  -10.417 5.715   1.00   24.55  ? 288  PRO B CG  1 
ATOM   4963 C CD  . PRO B 1 201 ? 7.644  -10.077 5.288   1.00   28.86  ? 288  PRO B CD  1 
ATOM   4964 N N   . GLN B 1 202 ? 4.915  -6.309  5.806   1.00   24.44  ? 289  GLN B N   1 
ATOM   4965 C CA  . GLN B 1 202 ? 4.476  -5.282  6.725   1.00   17.26  ? 289  GLN B CA  1 
ATOM   4966 C C   . GLN B 1 202 ? 4.445  -5.745  8.181   1.00   22.55  ? 289  GLN B C   1 
ATOM   4967 O O   . GLN B 1 202 ? 4.790  -4.981  9.092   1.00   20.75  ? 289  GLN B O   1 
ATOM   4968 C CB  . GLN B 1 202 ? 3.159  -4.710  6.283   1.00   16.05  ? 289  GLN B CB  1 
ATOM   4969 C CG  . GLN B 1 202 ? 3.202  -3.947  4.983   1.00   13.14  ? 289  GLN B CG  1 
ATOM   4970 C CD  . GLN B 1 202 ? 1.913  -3.218  4.659   1.00   16.65  ? 289  GLN B CD  1 
ATOM   4971 O OE1 . GLN B 1 202 ? 1.187  -2.770  5.529   1.00   27.94  ? 289  GLN B OE1 1 
ATOM   4972 N NE2 . GLN B 1 202 ? 1.640  -3.077  3.397   1.00   24.49  ? 289  GLN B NE2 1 
ATOM   4973 N N   . GLU B 1 203 ? 4.098  -7.008  8.406   1.00   23.94  ? 290  GLU B N   1 
ATOM   4974 C CA  . GLU B 1 203 ? 4.091  -7.504  9.767   1.00   25.68  ? 290  GLU B CA  1 
ATOM   4975 C C   . GLU B 1 203 ? 5.499  -7.410  10.377  1.00   27.71  ? 290  GLU B C   1 
ATOM   4976 O O   . GLU B 1 203 ? 5.658  -7.095  11.568  1.00   31.20  ? 290  GLU B O   1 
ATOM   4977 C CB  . GLU B 1 203 ? 3.578  -8.948  9.792   1.00   30.48  ? 290  GLU B CB  1 
ATOM   4978 C CG  . GLU B 1 203 ? 3.252  -9.489  11.184  1.00   39.88  ? 290  GLU B CG  1 
ATOM   4979 C CD  . GLU B 1 203 ? 3.178  -11.007 11.286  1.00   45.41  ? 290  GLU B CD  1 
ATOM   4980 O OE1 . GLU B 1 203 ? 3.036  -11.702 10.256  1.00   43.24  ? 290  GLU B OE1 1 
ATOM   4981 O OE2 . GLU B 1 203 ? 3.277  -11.503 12.433  1.00   54.45  ? 290  GLU B OE2 1 
ATOM   4982 N N   . ALA B 1 204 ? 6.520  -7.713  9.580   1.00   22.36  ? 291  ALA B N   1 
ATOM   4983 C CA  . ALA B 1 204 ? 7.880  -7.782  10.084  1.00   21.22  ? 291  ALA B CA  1 
ATOM   4984 C C   . ALA B 1 204 ? 8.410  -6.369  10.314  1.00   26.61  ? 291  ALA B C   1 
ATOM   4985 O O   . ALA B 1 204 ? 9.100  -6.085  11.288  1.00   27.19  ? 291  ALA B O   1 
ATOM   4986 C CB  . ALA B 1 204 ? 8.748  -8.495  9.112   1.00   20.43  ? 291  ALA B CB  1 
ATOM   4987 N N   . ILE B 1 205 ? 8.079  -5.467  9.400   1.00   25.85  ? 292  ILE B N   1 
ATOM   4988 C CA  . ILE B 1 205 ? 8.475  -4.083  9.576   1.00   25.15  ? 292  ILE B CA  1 
ATOM   4989 C C   . ILE B 1 205 ? 7.860  -3.539  10.861  1.00   23.94  ? 292  ILE B C   1 
ATOM   4990 O O   . ILE B 1 205 ? 8.479  -2.799  11.608  1.00   19.17  ? 292  ILE B O   1 
ATOM   4991 C CB  . ILE B 1 205 ? 7.984  -3.276  8.366   1.00   26.67  ? 292  ILE B CB  1 
ATOM   4992 C CG1 . ILE B 1 205 ? 8.754  -3.679  7.089   1.00   25.04  ? 292  ILE B CG1 1 
ATOM   4993 C CG2 . ILE B 1 205 ? 8.105  -1.799  8.628   1.00   26.25  ? 292  ILE B CG2 1 
ATOM   4994 C CD1 . ILE B 1 205 ? 8.091  -3.196  5.821   1.00   24.12  ? 292  ILE B CD1 1 
ATOM   4995 N N   . GLN B 1 206 ? 6.625  -3.936  11.135  1.00   25.30  ? 293  GLN B N   1 
ATOM   4996 C CA  . GLN B 1 206 ? 5.956  -3.425  12.303  1.00   26.46  ? 293  GLN B CA  1 
ATOM   4997 C C   . GLN B 1 206 ? 6.709  -3.890  13.539  1.00   28.31  ? 293  GLN B C   1 
ATOM   4998 O O   . GLN B 1 206 ? 6.934  -3.099  14.454  1.00   29.47  ? 293  GLN B O   1 
ATOM   4999 C CB  . GLN B 1 206 ? 4.498  -3.870  12.318  1.00   29.41  ? 293  GLN B CB  1 
ATOM   5000 C CG  . GLN B 1 206 ? 3.596  -3.124  13.305  1.00   30.86  ? 293  GLN B CG  1 
ATOM   5001 C CD  . GLN B 1 206 ? 3.560  -1.622  13.094  1.00   29.61  ? 293  GLN B CD  1 
ATOM   5002 O OE1 . GLN B 1 206 ? 3.415  -1.120  11.960  1.00   32.71  ? 293  GLN B OE1 1 
ATOM   5003 N NE2 . GLN B 1 206 ? 3.784  -0.915  14.176  1.00   17.92  ? 293  GLN B NE2 1 
ATOM   5004 N N   . ALA B 1 207 ? 7.130  -5.147  13.551  1.00   24.14  ? 294  ALA B N   1 
ATOM   5005 C CA  . ALA B 1 207 ? 7.810  -5.700  14.715  1.00   22.49  ? 294  ALA B CA  1 
ATOM   5006 C C   . ALA B 1 207 ? 9.077  -4.922  15.018  1.00   23.17  ? 294  ALA B C   1 
ATOM   5007 O O   . ALA B 1 207 ? 9.438  -4.696  16.175  1.00   22.99  ? 294  ALA B O   1 
ATOM   5008 C CB  . ALA B 1 207 ? 8.150  -7.161  14.471  1.00   26.63  ? 294  ALA B CB  1 
ATOM   5009 N N   . VAL B 1 208 ? 9.749  -4.488  13.964  1.00   22.52  ? 295  VAL B N   1 
ATOM   5010 C CA  . VAL B 1 208 ? 10.965 -3.692  14.106  1.00   25.02  ? 295  VAL B CA  1 
ATOM   5011 C C   . VAL B 1 208 ? 10.632 -2.314  14.709  1.00   25.96  ? 295  VAL B C   1 
ATOM   5012 O O   . VAL B 1 208 ? 11.433 -1.732  15.437  1.00   24.55  ? 295  VAL B O   1 
ATOM   5013 C CB  . VAL B 1 208 ? 11.650 -3.492  12.708  1.00   25.38  ? 295  VAL B CB  1 
ATOM   5014 C CG1 . VAL B 1 208 ? 12.790 -2.483  12.735  1.00   24.68  ? 295  VAL B CG1 1 
ATOM   5015 C CG2 . VAL B 1 208 ? 12.162 -4.808  12.152  1.00   25.28  ? 295  VAL B CG2 1 
ATOM   5016 N N   . ILE B 1 209 ? 9.531  -1.734  14.242  1.00   25.28  ? 296  ILE B N   1 
ATOM   5017 C CA  . ILE B 1 209 ? 9.056  -0.449  14.705  1.00   25.69  ? 296  ILE B CA  1 
ATOM   5018 C C   . ILE B 1 209 ? 8.641  -0.511  16.193  1.00   26.97  ? 296  ILE B C   1 
ATOM   5019 O O   . ILE B 1 209 ? 9.000  0.357   17.000  1.00   23.32  ? 296  ILE B O   1 
ATOM   5020 C CB  . ILE B 1 209 ? 7.875  0.034   13.812  1.00   27.39  ? 296  ILE B CB  1 
ATOM   5021 C CG1 . ILE B 1 209 ? 8.373  0.520   12.428  1.00   27.01  ? 296  ILE B CG1 1 
ATOM   5022 C CG2 . ILE B 1 209 ? 7.052  1.156   14.520  1.00   23.32  ? 296  ILE B CG2 1 
ATOM   5023 C CD1 . ILE B 1 209 ? 7.289  0.699   11.374  1.00   25.03  ? 296  ILE B CD1 1 
ATOM   5024 N N   . ASP B 1 210 ? 7.912  -1.552  16.557  1.00   22.89  ? 297  ASP B N   1 
ATOM   5025 C CA  . ASP B 1 210 ? 7.384  -1.698  17.907  1.00   26.08  ? 297  ASP B CA  1 
ATOM   5026 C C   . ASP B 1 210 ? 8.453  -1.922  18.991  1.00   32.02  ? 297  ASP B C   1 
ATOM   5027 O O   . ASP B 1 210 ? 8.174  -1.665  20.191  1.00   31.46  ? 297  ASP B O   1 
ATOM   5028 C CB  . ASP B 1 210 ? 6.383  -2.858  18.000  1.00   27.22  ? 297  ASP B CB  1 
ATOM   5029 C CG  . ASP B 1 210 ? 5.102  -2.630  17.218  1.00   31.82  ? 297  ASP B CG  1 
ATOM   5030 O OD1 . ASP B 1 210 ? 4.673  -1.492  16.862  1.00   28.72  ? 297  ASP B OD1 1 
ATOM   5031 O OD2 . ASP B 1 210 ? 4.459  -3.652  16.916  1.00   40.73  ? 297  ASP B OD2 1 
ATOM   5032 N N   . VAL B 1 211 ? 9.627  -2.439  18.608  1.00   32.77  ? 298  VAL B N   1 
ATOM   5033 C CA  . VAL B 1 211 ? 10.762 -2.503  19.533  1.00   32.38  ? 298  VAL B CA  1 
ATOM   5034 C C   . VAL B 1 211 ? 11.563 -1.211  19.506  1.00   29.01  ? 298  VAL B C   1 
ATOM   5035 O O   . VAL B 1 211 ? 12.638 -1.193  20.104  1.00   30.11  ? 298  VAL B O   1 
ATOM   5036 C CB  . VAL B 1 211 ? 11.810 -3.623  19.334  1.00   33.73  ? 298  VAL B CB  1 
ATOM   5037 C CG1 . VAL B 1 211 ? 11.294 -4.943  19.816  1.00   40.68  ? 298  VAL B CG1 1 
ATOM   5038 C CG2 . VAL B 1 211 ? 12.236 -3.716  17.889  1.00   31.45  ? 298  VAL B CG2 1 
ATOM   5039 N N   . ARG B 1 212 ? 11.046 -0.150  18.886  1.00   25.43  ? 299  ARG B N   1 
ATOM   5040 C CA  . ARG B 1 212 ? 11.668 1.191   18.946  1.00   30.00  ? 299  ARG B CA  1 
ATOM   5041 C C   . ARG B 1 212 ? 13.047 1.221   18.303  1.00   28.96  ? 299  ARG B C   1 
ATOM   5042 O O   . ARG B 1 212 ? 13.897 2.070   18.611  1.00   26.62  ? 299  ARG B O   1 
ATOM   5043 C CB  . ARG B 1 212 ? 11.840 1.763   20.370  1.00   31.88  ? 299  ARG B CB  1 
ATOM   5044 C CG  . ARG B 1 212 ? 10.640 1.748   21.274  1.00   43.02  ? 299  ARG B CG  1 
ATOM   5045 C CD  . ARG B 1 212 ? 10.145 3.112   21.698  1.00   55.88  ? 299  ARG B CD  1 
ATOM   5046 N NE  . ARG B 1 212 ? 8.947  3.094   22.549  1.00   63.59  ? 299  ARG B NE  1 
ATOM   5047 C CZ  . ARG B 1 212 ? 7.855  2.331   22.375  1.00   69.68  ? 299  ARG B CZ  1 
ATOM   5048 N NH1 . ARG B 1 212 ? 7.745  1.448   21.379  1.00   74.00  ? 299  ARG B NH1 1 
ATOM   5049 N NH2 . ARG B 1 212 ? 6.838  2.427   23.225  1.00   68.59  ? 299  ARG B NH2 1 
ATOM   5050 N N   . ILE B 1 213 ? 13.282 0.285   17.401  1.00   29.33  ? 300  ILE B N   1 
ATOM   5051 C CA  . ILE B 1 213 ? 14.540 0.281   16.664  1.00   28.31  ? 300  ILE B CA  1 
ATOM   5052 C C   . ILE B 1 213 ? 14.703 1.515   15.788  1.00   30.85  ? 300  ILE B C   1 
ATOM   5053 O O   . ILE B 1 213 ? 15.801 2.057   15.732  1.00   36.53  ? 300  ILE B O   1 
ATOM   5054 C CB  . ILE B 1 213 ? 14.649 -1.007  15.810  1.00   28.59  ? 300  ILE B CB  1 
ATOM   5055 C CG1 . ILE B 1 213 ? 15.242 -2.123  16.666  1.00   30.88  ? 300  ILE B CG1 1 
ATOM   5056 C CG2 . ILE B 1 213 ? 15.511 -0.840  14.583  1.00   26.04  ? 300  ILE B CG2 1 
ATOM   5057 C CD1 . ILE B 1 213 ? 15.332 -3.472  15.970  1.00   31.72  ? 300  ILE B CD1 1 
ATOM   5058 N N   . PRO B 1 214 ? 13.688 1.941   15.041  1.00   31.06  ? 301  PRO B N   1 
ATOM   5059 C CA  . PRO B 1 214 ? 13.922 2.970   14.021  1.00   34.96  ? 301  PRO B CA  1 
ATOM   5060 C C   . PRO B 1 214 ? 14.535 4.281   14.497  1.00   33.02  ? 301  PRO B C   1 
ATOM   5061 O O   . PRO B 1 214 ? 15.328 4.880   13.790  1.00   29.87  ? 301  PRO B O   1 
ATOM   5062 C CB  . PRO B 1 214 ? 12.551 3.161   13.365  1.00   35.07  ? 301  PRO B CB  1 
ATOM   5063 C CG  . PRO B 1 214 ? 11.642 2.406   14.139  1.00   36.25  ? 301  PRO B CG  1 
ATOM   5064 C CD  . PRO B 1 214 ? 12.337 1.383   14.938  1.00   32.96  ? 301  PRO B CD  1 
ATOM   5065 N N   . LYS B 1 215 ? 14.210 4.698   15.705  1.00   32.38  ? 302  LYS B N   1 
ATOM   5066 C CA  . LYS B 1 215 ? 14.803 5.891   16.261  1.00   33.94  ? 302  LYS B CA  1 
ATOM   5067 C C   . LYS B 1 215 ? 16.307 5.768   16.209  1.00   32.85  ? 302  LYS B C   1 
ATOM   5068 O O   . LYS B 1 215 ? 16.994 6.636   15.694  1.00   34.48  ? 302  LYS B O   1 
ATOM   5069 C CB  . LYS B 1 215 ? 14.382 6.007   17.724  1.00   39.51  ? 302  LYS B CB  1 
ATOM   5070 C CG  . LYS B 1 215 ? 15.004 7.193   18.418  1.00   44.86  ? 302  LYS B CG  1 
ATOM   5071 C CD  . LYS B 1 215 ? 14.654 7.232   19.893  1.00   50.05  ? 302  LYS B CD  1 
ATOM   5072 C CE  . LYS B 1 215 ? 15.293 8.466   20.571  1.00   51.37  ? 302  LYS B CE  1 
ATOM   5073 N NZ  . LYS B 1 215 ? 16.758 8.569   20.330  1.00   49.30  ? 302  LYS B NZ  1 
ATOM   5074 N N   . ARG B 1 216 ? 16.807 4.666   16.751  1.00   31.66  ? 303  ARG B N   1 
ATOM   5075 C CA  . ARG B 1 216 ? 18.234 4.395   16.788  1.00   32.21  ? 303  ARG B CA  1 
ATOM   5076 C C   . ARG B 1 216 ? 18.889 4.164   15.434  1.00   28.38  ? 303  ARG B C   1 
ATOM   5077 O O   . ARG B 1 216 ? 20.064 4.453   15.259  1.00   31.25  ? 303  ARG B O   1 
ATOM   5078 C CB  . ARG B 1 216 ? 18.511 3.170   17.673  1.00   35.84  ? 303  ARG B CB  1 
ATOM   5079 C CG  . ARG B 1 216 ? 20.000 2.880   17.922  1.00   35.86  ? 303  ARG B CG  1 
ATOM   5080 C CD  . ARG B 1 216 ? 20.718 4.064   18.466  1.00   32.95  ? 303  ARG B CD  1 
ATOM   5081 N NE  . ARG B 1 216 ? 22.150 3.859   18.514  1.00   40.07  ? 303  ARG B NE  1 
ATOM   5082 C CZ  . ARG B 1 216 ? 22.994 4.732   19.030  1.00   39.75  ? 303  ARG B CZ  1 
ATOM   5083 N NH1 . ARG B 1 216 ? 22.525 5.844   19.553  1.00   43.70  ? 303  ARG B NH1 1 
ATOM   5084 N NH2 . ARG B 1 216 ? 24.298 4.510   19.026  1.00   43.20  ? 303  ARG B NH2 1 
ATOM   5085 N N   . LEU B 1 217 ? 18.185 3.561   14.490  1.00   29.17  ? 304  LEU B N   1 
ATOM   5086 C CA  . LEU B 1 217 ? 18.750 3.401   13.151  1.00   25.68  ? 304  LEU B CA  1 
ATOM   5087 C C   . LEU B 1 217 ? 18.981 4.757   12.567  1.00   24.13  ? 304  LEU B C   1 
ATOM   5088 O O   . LEU B 1 217 ? 19.958 4.953   11.906  1.00   24.89  ? 304  LEU B O   1 
ATOM   5089 C CB  . LEU B 1 217 ? 17.819 2.653   12.200  1.00   24.84  ? 304  LEU B CB  1 
ATOM   5090 C CG  . LEU B 1 217 ? 17.646 1.158   12.474  1.00   30.71  ? 304  LEU B CG  1 
ATOM   5091 C CD1 . LEU B 1 217 ? 16.507 0.606   11.686  1.00   32.81  ? 304  LEU B CD1 1 
ATOM   5092 C CD2 . LEU B 1 217 ? 18.933 0.380   12.156  1.00   31.95  ? 304  LEU B CD2 1 
ATOM   5093 N N   . VAL B 1 218 ? 18.049 5.687   12.722  1.00   30.42  ? 305  VAL B N   1 
ATOM   5094 C CA  . VAL B 1 218 ? 18.198 7.002   12.098  1.00   28.75  ? 305  VAL B CA  1 
ATOM   5095 C C   . VAL B 1 218 ? 19.454 7.679   12.631  1.00   30.69  ? 305  VAL B C   1 
ATOM   5096 O O   . VAL B 1 218 ? 20.180 8.317   11.886  1.00   37.30  ? 305  VAL B O   1 
ATOM   5097 C CB  . VAL B 1 218 ? 16.978 7.878   12.349  1.00   28.00  ? 305  VAL B CB  1 
ATOM   5098 C CG1 . VAL B 1 218 ? 17.278 9.320   12.047  1.00   29.28  ? 305  VAL B CG1 1 
ATOM   5099 C CG2 . VAL B 1 218 ? 15.790 7.392   11.489  1.00   30.97  ? 305  VAL B CG2 1 
ATOM   5100 N N   . GLU B 1 219 ? 19.712 7.553   13.922  1.00   30.86  ? 306  GLU B N   1 
ATOM   5101 C CA  . GLU B 1 219 ? 20.920 8.111   14.514  1.00   31.87  ? 306  GLU B CA  1 
ATOM   5102 C C   . GLU B 1 219 ? 22.117 7.476   13.855  1.00   29.29  ? 306  GLU B C   1 
ATOM   5103 O O   . GLU B 1 219 ? 23.041 8.183   13.509  1.00   31.01  ? 306  GLU B O   1 
ATOM   5104 C CB  . GLU B 1 219 ? 21.004 7.869   16.032  1.00   33.70  ? 306  GLU B CB  1 
ATOM   5105 C CG  . GLU B 1 219 ? 19.945 8.654   16.784  1.00   42.50  ? 306  GLU B CG  1 
ATOM   5106 C CD  . GLU B 1 219 ? 19.978 8.463   18.293  1.00   48.11  ? 306  GLU B CD  1 
ATOM   5107 O OE1 . GLU B 1 219 ? 20.376 7.388   18.783  1.00   45.68  ? 306  GLU B OE1 1 
ATOM   5108 O OE2 . GLU B 1 219 ? 19.511 9.375   19.002  1.00   54.17  ? 306  GLU B OE2 1 
ATOM   5109 N N   . LEU B 1 220 ? 22.107 6.153   13.703  1.00   28.73  ? 307  LEU B N   1 
ATOM   5110 C CA  . LEU B 1 220 ? 23.226 5.448   13.079  1.00   28.47  ? 307  LEU B CA  1 
ATOM   5111 C C   . LEU B 1 220 ? 23.456 5.811   11.613  1.00   26.01  ? 307  LEU B C   1 
ATOM   5112 O O   . LEU B 1 220 ? 24.489 5.491   11.081  1.00   28.07  ? 307  LEU B O   1 
ATOM   5113 C CB  . LEU B 1 220 ? 23.082 3.940   13.229  1.00   28.62  ? 307  LEU B CB  1 
ATOM   5114 C CG  . LEU B 1 220 ? 23.051 3.511   14.684  1.00   29.96  ? 307  LEU B CG  1 
ATOM   5115 C CD1 . LEU B 1 220 ? 22.686 2.064   14.814  1.00   31.80  ? 307  LEU B CD1 1 
ATOM   5116 C CD2 . LEU B 1 220 ? 24.395 3.778   15.321  1.00   36.00  ? 307  LEU B CD2 1 
ATOM   5117 N N   . LEU B 1 221 ? 22.570 6.530   10.949  1.00   25.35  ? 308  LEU B N   1 
ATOM   5118 C CA  . LEU B 1 221 ? 22.867 6.903   9.573   1.00   30.22  ? 308  LEU B CA  1 
ATOM   5119 C C   . LEU B 1 221 ? 24.060 7.847   9.499   1.00   32.97  ? 308  LEU B C   1 
ATOM   5120 O O   . LEU B 1 221 ? 24.653 7.989   8.419   1.00   30.39  ? 308  LEU B O   1 
ATOM   5121 C CB  . LEU B 1 221 ? 21.637 7.532   8.878   1.00   29.90  ? 308  LEU B CB  1 
ATOM   5122 C CG  . LEU B 1 221 ? 20.440 6.588   8.756   1.00   29.38  ? 308  LEU B CG  1 
ATOM   5123 C CD1 . LEU B 1 221 ? 19.245 7.222   8.117   1.00   25.35  ? 308  LEU B CD1 1 
ATOM   5124 C CD2 . LEU B 1 221 ? 20.859 5.328   7.985   1.00   31.81  ? 308  LEU B CD2 1 
ATOM   5125 N N   . SER B 1 222 ? 24.360 8.519   10.620  1.00   34.87  ? 309  SER B N   1 
ATOM   5126 C CA  . SER B 1 222 ? 25.444 9.519   10.704  1.00   36.72  ? 309  SER B CA  1 
ATOM   5127 C C   . SER B 1 222 ? 26.701 9.013   11.419  1.00   37.47  ? 309  SER B C   1 
ATOM   5128 O O   . SER B 1 222 ? 27.589 9.803   11.764  1.00   37.09  ? 309  SER B O   1 
ATOM   5129 C CB  . SER B 1 222 ? 24.975 10.831  11.377  1.00   35.86  ? 309  SER B CB  1 
ATOM   5130 O OG  . SER B 1 222 ? 24.387 10.621  12.664  1.00   34.08  ? 309  SER B OG  1 
ATOM   5131 N N   . HIS B 1 223 ? 26.787 7.698   11.611  1.00   36.02  ? 310  HIS B N   1 
ATOM   5132 C CA  . HIS B 1 223 ? 27.975 7.100   12.182  1.00   34.58  ? 310  HIS B CA  1 
ATOM   5133 C C   . HIS B 1 223 ? 29.162 7.344   11.254  1.00   38.37  ? 310  HIS B C   1 
ATOM   5134 O O   . HIS B 1 223 ? 29.026 7.513   10.051  1.00   33.34  ? 310  HIS B O   1 
ATOM   5135 C CB  . HIS B 1 223 ? 27.729 5.617   12.392  1.00   33.62  ? 310  HIS B CB  1 
ATOM   5136 C CG  . HIS B 1 223 ? 28.733 4.912   13.253  1.00   30.34  ? 310  HIS B CG  1 
ATOM   5137 N ND1 . HIS B 1 223 ? 30.018 4.636   12.829  1.00   33.59  ? 310  HIS B ND1 1 
ATOM   5138 C CD2 . HIS B 1 223 ? 28.608 4.336   14.474  1.00   25.58  ? 310  HIS B CD2 1 
ATOM   5139 C CE1 . HIS B 1 223 ? 30.645 3.924   13.755  1.00   30.24  ? 310  HIS B CE1 1 
ATOM   5140 N NE2 . HIS B 1 223 ? 29.818 3.747   14.772  1.00   27.67  ? 310  HIS B NE2 1 
ATOM   5141 N N   . GLU B 1 224 ? 30.354 7.396   11.835  1.00   41.95  ? 311  GLU B N   1 
ATOM   5142 C CA  . GLU B 1 224 ? 31.556 7.670   11.048  1.00   43.71  ? 311  GLU B CA  1 
ATOM   5143 C C   . GLU B 1 224 ? 31.917 6.547   10.063  1.00   41.16  ? 311  GLU B C   1 
ATOM   5144 O O   . GLU B 1 224 ? 32.430 6.825   8.980   1.00   40.21  ? 311  GLU B O   1 
ATOM   5145 C CB  . GLU B 1 224 ? 32.748 7.991   11.955  1.00   46.59  ? 311  GLU B CB  1 
ATOM   5146 C CG  . GLU B 1 224 ? 33.172 6.866   12.911  1.00   51.36  ? 311  GLU B CG  1 
ATOM   5147 C CD  . GLU B 1 224 ? 32.487 6.951   14.282  1.00   57.74  ? 311  GLU B CD  1 
ATOM   5148 O OE1 . GLU B 1 224 ? 31.273 7.316   14.340  1.00   59.49  ? 311  GLU B OE1 1 
ATOM   5149 O OE2 . GLU B 1 224 ? 33.136 6.629   15.316  1.00   57.39  ? 311  GLU B OE2 1 
ATOM   5150 N N   . SER B 1 225 ? 31.625 5.304   10.438  1.00   36.92  ? 312  SER B N   1 
ATOM   5151 C CA  . SER B 1 225 ? 31.910 4.143   9.604   1.00   36.55  ? 312  SER B CA  1 
ATOM   5152 C C   . SER B 1 225 ? 30.797 3.787   8.597   1.00   38.45  ? 312  SER B C   1 
ATOM   5153 O O   . SER B 1 225 ? 29.620 3.646   8.959   1.00   41.40  ? 312  SER B O   1 
ATOM   5154 C CB  . SER B 1 225 ? 32.161 2.924   10.481  1.00   36.52  ? 312  SER B CB  1 
ATOM   5155 O OG  . SER B 1 225 ? 32.566 1.809   9.689   1.00   34.85  ? 312  SER B OG  1 
ATOM   5156 N N   . THR B 1 226 ? 31.181 3.601   7.338   1.00   34.62  ? 313  THR B N   1 
ATOM   5157 C CA  . THR B 1 226 ? 30.240 3.143   6.322   1.00   34.50  ? 313  THR B CA  1 
ATOM   5158 C C   . THR B 1 226 ? 29.794 1.696   6.544   1.00   33.17  ? 313  THR B C   1 
ATOM   5159 O O   . THR B 1 226 ? 28.779 1.248   6.014   1.00   35.75  ? 313  THR B O   1 
ATOM   5160 C CB  . THR B 1 226 ? 30.787 3.300   4.908   1.00   30.28  ? 313  THR B CB  1 
ATOM   5161 O OG1 . THR B 1 226 ? 32.037 2.629   4.796   1.00   34.36  ? 313  THR B OG1 1 
ATOM   5162 C CG2 . THR B 1 226 ? 31.126 4.722   4.616   1.00   32.13  ? 313  THR B CG2 1 
ATOM   5163 N N   . LEU B 1 227 ? 30.542 0.964   7.348   1.00   31.40  ? 314  LEU B N   1 
ATOM   5164 C CA  . LEU B 1 227 ? 30.166 -0.389  7.701   1.00   27.48  ? 314  LEU B CA  1 
ATOM   5165 C C   . LEU B 1 227 ? 28.921 -0.418  8.560   1.00   29.06  ? 314  LEU B C   1 
ATOM   5166 O O   . LEU B 1 227 ? 28.301 -1.484  8.702   1.00   29.48  ? 314  LEU B O   1 
ATOM   5167 C CB  . LEU B 1 227 ? 31.312 -1.053  8.454   1.00   29.34  ? 314  LEU B CB  1 
ATOM   5168 C CG  . LEU B 1 227 ? 32.601 -1.262  7.628   1.00   32.60  ? 314  LEU B CG  1 
ATOM   5169 C CD1 . LEU B 1 227 ? 33.612 -1.927  8.558   1.00   33.09  ? 314  LEU B CD1 1 
ATOM   5170 C CD2 . LEU B 1 227 ? 32.419 -2.086  6.303   1.00   25.67  ? 314  LEU B CD2 1 
ATOM   5171 N N   . VAL B 1 228 ? 28.613 0.727   9.170   1.00   26.73  ? 315  VAL B N   1 
ATOM   5172 C CA  . VAL B 1 228 ? 27.395 0.912   9.919   1.00   29.67  ? 315  VAL B CA  1 
ATOM   5173 C C   . VAL B 1 228 ? 26.350 1.587   9.028   1.00   29.38  ? 315  VAL B C   1 
ATOM   5174 O O   . VAL B 1 228 ? 25.232 1.132   8.872   1.00   33.51  ? 315  VAL B O   1 
ATOM   5175 C CB  . VAL B 1 228 ? 27.683 1.756   11.149  1.00   32.92  ? 315  VAL B CB  1 
ATOM   5176 C CG1 . VAL B 1 228 ? 26.407 1.975   11.962  1.00   30.98  ? 315  VAL B CG1 1 
ATOM   5177 C CG2 . VAL B 1 228 ? 28.698 1.026   12.033  1.00   35.21  ? 315  VAL B CG2 1 
ATOM   5178 N N   . GLN B 1 229 ? 26.745 2.644   8.359   1.00   29.09  ? 316  GLN B N   1 
ATOM   5179 C CA  . GLN B 1 229 ? 25.837 3.330   7.465   1.00   32.46  ? 316  GLN B CA  1 
ATOM   5180 C C   . GLN B 1 229 ? 25.111 2.394   6.516   1.00   32.01  ? 316  GLN B C   1 
ATOM   5181 O O   . GLN B 1 229 ? 23.892 2.400   6.434   1.00   37.51  ? 316  GLN B O   1 
ATOM   5182 C CB  . GLN B 1 229 ? 26.569 4.418   6.672   1.00   31.74  ? 316  GLN B CB  1 
ATOM   5183 C CG  . GLN B 1 229 ? 27.058 5.560   7.594   1.00   33.14  ? 316  GLN B CG  1 
ATOM   5184 C CD  . GLN B 1 229 ? 27.893 6.632   6.900   1.00   30.88  ? 316  GLN B CD  1 
ATOM   5185 O OE1 . GLN B 1 229 ? 27.631 6.991   5.780   1.00   40.26  ? 316  GLN B OE1 1 
ATOM   5186 N NE2 . GLN B 1 229 ? 28.916 7.115   7.564   1.00   40.48  ? 316  GLN B NE2 1 
ATOM   5187 N N   . THR B 1 230 ? 25.847 1.563   5.808   1.00   33.01  ? 317  THR B N   1 
ATOM   5188 C CA  . THR B 1 230 ? 25.235 0.706   4.804   1.00   28.04  ? 317  THR B CA  1 
ATOM   5189 C C   . THR B 1 230 ? 24.072 -0.180  5.230   1.00   26.05  ? 317  THR B C   1 
ATOM   5190 O O   . THR B 1 230 ? 23.041 -0.170  4.583   1.00   29.16  ? 317  THR B O   1 
ATOM   5191 C CB  . THR B 1 230 ? 26.317 -0.066  4.136   1.00   28.34  ? 317  THR B CB  1 
ATOM   5192 O OG1 . THR B 1 230 ? 26.890 0.794   3.143   1.00   32.23  ? 317  THR B OG1 1 
ATOM   5193 C CG2 . THR B 1 230 ? 25.759 -1.265  3.329   1.00   33.28  ? 317  THR B CG2 1 
ATOM   5194 N N   . PRO B 1 231 ? 24.247 -1.041  6.215   1.00   25.43  ? 318  PRO B N   1 
ATOM   5195 C CA  . PRO B 1 231 ? 23.125 -1.853  6.654   1.00   24.15  ? 318  PRO B CA  1 
ATOM   5196 C C   . PRO B 1 231 ? 22.054 -1.019  7.315   1.00   25.05  ? 318  PRO B C   1 
ATOM   5197 O O   . PRO B 1 231 ? 20.882 -1.383  7.264   1.00   27.59  ? 318  PRO B O   1 
ATOM   5198 C CB  . PRO B 1 231 ? 23.788 -2.854  7.611   1.00   26.28  ? 318  PRO B CB  1 
ATOM   5199 C CG  . PRO B 1 231 ? 25.010 -2.218  8.046   1.00   23.73  ? 318  PRO B CG  1 
ATOM   5200 C CD  . PRO B 1 231 ? 25.499 -1.464  6.864   1.00   24.66  ? 318  PRO B CD  1 
ATOM   5201 N N   . ALA B 1 232 ? 22.455 0.033   8.008   1.00   26.51  ? 319  ALA B N   1 
ATOM   5202 C CA  . ALA B 1 232 ? 21.501 0.859   8.745   1.00   26.31  ? 319  ALA B CA  1 
ATOM   5203 C C   . ALA B 1 232 ? 20.583 1.542   7.746   1.00   24.64  ? 319  ALA B C   1 
ATOM   5204 O O   . ALA B 1 232 ? 19.369 1.544   7.909   1.00   23.07  ? 319  ALA B O   1 
ATOM   5205 C CB  . ALA B 1 232 ? 22.235 1.899   9.569   1.00   28.08  ? 319  ALA B CB  1 
ATOM   5206 N N   . LEU B 1 233 ? 21.184 2.095   6.700   1.00   23.28  ? 320  LEU B N   1 
ATOM   5207 C CA  . LEU B 1 233 ? 20.451 2.768   5.646   1.00   20.95  ? 320  LEU B CA  1 
ATOM   5208 C C   . LEU B 1 233 ? 19.529 1.763   5.013   1.00   22.60  ? 320  LEU B C   1 
ATOM   5209 O O   . LEU B 1 233 ? 18.385 2.042   4.675   1.00   24.15  ? 320  LEU B O   1 
ATOM   5210 C CB  . LEU B 1 233 ? 21.404 3.276   4.583   1.00   17.83  ? 320  LEU B CB  1 
ATOM   5211 C CG  . LEU B 1 233 ? 20.697 3.902   3.401   1.00   19.24  ? 320  LEU B CG  1 
ATOM   5212 C CD1 . LEU B 1 233 ? 19.752 5.020   3.756   1.00   20.18  ? 320  LEU B CD1 1 
ATOM   5213 C CD2 . LEU B 1 233 ? 21.774 4.398   2.484   1.00   25.44  ? 320  LEU B CD2 1 
ATOM   5214 N N   . ARG B 1 234 ? 20.041 0.561   4.850   1.00   22.98  ? 321  ARG B N   1 
ATOM   5215 C CA  . ARG B 1 234 ? 19.255 -0.436  4.175   1.00   24.10  ? 321  ARG B CA  1 
ATOM   5216 C C   . ARG B 1 234 ? 18.001 -0.744  4.948   1.00   24.28  ? 321  ARG B C   1 
ATOM   5217 O O   . ARG B 1 234 ? 16.971 -0.933  4.312   1.00   21.67  ? 321  ARG B O   1 
ATOM   5218 C CB  . ARG B 1 234 ? 20.018 -1.752  4.000   1.00   26.56  ? 321  ARG B CB  1 
ATOM   5219 C CG  . ARG B 1 234 ? 19.170 -2.762  3.185   1.00   30.31  ? 321  ARG B CG  1 
ATOM   5220 C CD  . ARG B 1 234 ? 18.638 -2.169  1.874   1.00   30.61  ? 321  ARG B CD  1 
ATOM   5221 N NE  . ARG B 1 234 ? 18.447 -3.319  1.018   1.00   39.04  ? 321  ARG B NE  1 
ATOM   5222 C CZ  . ARG B 1 234 ? 18.963 -3.505  -0.192  1.00   33.21  ? 321  ARG B CZ  1 
ATOM   5223 N NH1 . ARG B 1 234 ? 19.578 -2.573  -0.885  1.00   25.13  ? 321  ARG B NH1 1 
ATOM   5224 N NH2 . ARG B 1 234 ? 18.765 -4.670  -0.739  1.00   33.54  ? 321  ARG B NH2 1 
ATOM   5225 N N   . ALA B 1 235 ? 18.142 -0.920  6.267   1.00   24.27  ? 322  ALA B N   1 
ATOM   5226 C CA  . ALA B 1 235 ? 17.034 -1.225  7.148   1.00   26.90  ? 322  ALA B CA  1 
ATOM   5227 C C   . ALA B 1 235 ? 16.006 -0.095  6.999   1.00   25.68  ? 322  ALA B C   1 
ATOM   5228 O O   . ALA B 1 235 ? 14.834 -0.297  6.773   1.00   23.87  ? 322  ALA B O   1 
ATOM   5229 C CB  . ALA B 1 235 ? 17.535 -1.339  8.602   1.00   30.30  ? 322  ALA B CB  1 
ATOM   5230 N N   . VAL B 1 236 ? 16.462 1.131   7.070   1.00   25.40  ? 323  VAL B N   1 
ATOM   5231 C CA  . VAL B 1 236 ? 15.537 2.250   6.972   1.00   30.23  ? 323  VAL B CA  1 
ATOM   5232 C C   . VAL B 1 236 ? 14.787 2.207   5.626   1.00   30.89  ? 323  VAL B C   1 
ATOM   5233 O O   . VAL B 1 236 ? 13.561 2.442   5.551   1.00   31.70  ? 323  VAL B O   1 
ATOM   5234 C CB  . VAL B 1 236 ? 16.336 3.581   7.135   1.00   30.28  ? 323  VAL B CB  1 
ATOM   5235 C CG1 . VAL B 1 236 ? 15.535 4.783   6.693   1.00   30.56  ? 323  VAL B CG1 1 
ATOM   5236 C CG2 . VAL B 1 236 ? 16.819 3.708   8.554   1.00   25.67  ? 323  VAL B CG2 1 
ATOM   5237 N N   . GLY B 1 237 ? 15.529 1.969   4.548   1.00   26.46  ? 324  GLY B N   1 
ATOM   5238 C CA  . GLY B 1 237 ? 14.911 1.830   3.243   1.00   23.38  ? 324  GLY B CA  1 
ATOM   5239 C C   . GLY B 1 237 ? 13.895 0.688   3.208   1.00   25.04  ? 324  GLY B C   1 
ATOM   5240 O O   . GLY B 1 237 ? 12.834 0.822   2.619   1.00   24.92  ? 324  GLY B O   1 
ATOM   5241 N N   . ASN B 1 238 ? 14.149 -0.418  3.906   1.00   23.20  ? 325  ASN B N   1 
ATOM   5242 C CA  . ASN B 1 238 ? 13.177 -1.497  3.952   1.00   24.15  ? 325  ASN B CA  1 
ATOM   5243 C C   . ASN B 1 238 ? 11.882 -1.144  4.707   1.00   22.74  ? 325  ASN B C   1 
ATOM   5244 O O   . ASN B 1 238 ? 10.775 -1.532  4.315   1.00   25.04  ? 325  ASN B O   1 
ATOM   5245 C CB  . ASN B 1 238 ? 13.829 -2.719  4.573   1.00   22.59  ? 325  ASN B CB  1 
ATOM   5246 C CG  . ASN B 1 238 ? 14.812 -3.393  3.645   1.00   21.02  ? 325  ASN B CG  1 
ATOM   5247 O OD1 . ASN B 1 238 ? 14.857 -3.144  2.418   1.00   19.21  ? 325  ASN B OD1 1 
ATOM   5248 N ND2 . ASN B 1 238 ? 15.590 -4.293  4.220   1.00   20.16  ? 325  ASN B ND2 1 
ATOM   5249 N N   . ILE B 1 239 ? 12.023 -0.382  5.780   1.00   20.94  ? 326  ILE B N   1 
ATOM   5250 C CA  . ILE B 1 239 ? 10.884 0.104   6.555   1.00   21.32  ? 326  ILE B CA  1 
ATOM   5251 C C   . ILE B 1 239 ? 9.971  0.978   5.701   1.00   23.17  ? 326  ILE B C   1 
ATOM   5252 O O   . ILE B 1 239 ? 8.756  0.811   5.718   1.00   24.21  ? 326  ILE B O   1 
ATOM   5253 C CB  . ILE B 1 239 ? 11.347 0.844   7.794   1.00   19.61  ? 326  ILE B CB  1 
ATOM   5254 C CG1 . ILE B 1 239 ? 11.951 -0.151  8.782   1.00   18.44  ? 326  ILE B CG1 1 
ATOM   5255 C CG2 . ILE B 1 239 ? 10.159 1.547   8.423   1.00   22.87  ? 326  ILE B CG2 1 
ATOM   5256 C CD1 . ILE B 1 239 ? 12.826 0.489   9.820   1.00   22.29  ? 326  ILE B CD1 1 
ATOM   5257 N N   . VAL B 1 240 ? 10.545 1.859   4.899   1.00   24.48  ? 327  VAL B N   1 
ATOM   5258 C CA  . VAL B 1 240 ? 9.705  2.709   4.068   1.00   24.75  ? 327  VAL B CA  1 
ATOM   5259 C C   . VAL B 1 240 ? 9.219  1.987   2.827   1.00   24.62  ? 327  VAL B C   1 
ATOM   5260 O O   . VAL B 1 240 ? 8.557  2.606   2.018   1.00   26.06  ? 327  VAL B O   1 
ATOM   5261 C CB  . VAL B 1 240 ? 10.367 4.065   3.668   1.00   26.75  ? 327  VAL B CB  1 
ATOM   5262 C CG1 . VAL B 1 240 ? 10.641 4.913   4.910   1.00   27.63  ? 327  VAL B CG1 1 
ATOM   5263 C CG2 . VAL B 1 240 ? 11.646 3.876   2.864   1.00   29.20  ? 327  VAL B CG2 1 
ATOM   5264 N N   . THR B 1 241 ? 9.565  0.724   2.597   1.00   25.29  ? 328  THR B N   1 
ATOM   5265 C CA  . THR B 1 241 ? 8.803  -0.020  1.577   1.00   25.33  ? 328  THR B CA  1 
ATOM   5266 C C   . THR B 1 241 ? 7.463  -0.456  2.136   1.00   20.91  ? 328  THR B C   1 
ATOM   5267 O O   . THR B 1 241 ? 6.721  -1.094  1.455   1.00   23.45  ? 328  THR B O   1 
ATOM   5268 C CB  . THR B 1 241 ? 9.472  -1.336  1.107   1.00   24.25  ? 328  THR B CB  1 
ATOM   5269 O OG1 . THR B 1 241 ? 9.636  -2.216  2.220   1.00   25.63  ? 328  THR B OG1 1 
ATOM   5270 C CG2 . THR B 1 241 ? 10.855 -1.102  0.566   1.00   25.43  ? 328  THR B CG2 1 
ATOM   5271 N N   . GLY B 1 242 ? 7.210  -0.206  3.405   1.00   23.36  ? 329  GLY B N   1 
ATOM   5272 C CA  . GLY B 1 242 ? 5.984  -0.572  4.063   1.00   23.18  ? 329  GLY B CA  1 
ATOM   5273 C C   . GLY B 1 242 ? 4.912  0.457   3.848   1.00   25.27  ? 329  GLY B C   1 
ATOM   5274 O O   . GLY B 1 242 ? 5.045  1.299   2.966   1.00   17.63  ? 329  GLY B O   1 
ATOM   5275 N N   . ASN B 1 243 ? 3.881  0.387   4.699   1.00   25.32  ? 330  ASN B N   1 
ATOM   5276 C CA  . ASN B 1 243 ? 2.759  1.317   4.616   1.00   21.69  ? 330  ASN B CA  1 
ATOM   5277 C C   . ASN B 1 243 ? 3.068  2.779   4.957   1.00   23.74  ? 330  ASN B C   1 
ATOM   5278 O O   . ASN B 1 243 ? 4.198  3.126   5.320   1.00   20.63  ? 330  ASN B O   1 
ATOM   5279 C CB  . ASN B 1 243 ? 1.530  0.726   5.329   1.00   18.54  ? 330  ASN B CB  1 
ATOM   5280 C CG  . ASN B 1 243 ? 1.685  0.546   6.838   1.00   23.39  ? 330  ASN B CG  1 
ATOM   5281 O OD1 . ASN B 1 243 ? 1.911  1.507   7.568   1.00   29.33  ? 330  ASN B OD1 1 
ATOM   5282 N ND2 . ASN B 1 243 ? 1.496  -0.676  7.319   1.00   17.52  ? 330  ASN B ND2 1 
ATOM   5283 N N   . ASP B 1 244 ? 2.056  3.632   4.801   1.00   26.15  ? 331  ASP B N   1 
ATOM   5284 C CA  . ASP B 1 244 ? 2.172  5.038   5.157   1.00   27.81  ? 331  ASP B CA  1 
ATOM   5285 C C   . ASP B 1 244 ? 2.422  5.245   6.638   1.00   27.15  ? 331  ASP B C   1 
ATOM   5286 O O   . ASP B 1 244 ? 3.217  6.103   6.965   1.00   32.43  ? 331  ASP B O   1 
ATOM   5287 C CB  . ASP B 1 244 ? 0.909  5.813   4.792   1.00   32.59  ? 331  ASP B CB  1 
ATOM   5288 C CG  . ASP B 1 244 ? 0.631  5.845   3.298   1.00   44.33  ? 331  ASP B CG  1 
ATOM   5289 O OD1 . ASP B 1 244 ? 1.473  5.374   2.477   1.00   49.18  ? 331  ASP B OD1 1 
ATOM   5290 O OD2 . ASP B 1 244 ? -0.450 6.338   2.890   1.00   47.72  ? 331  ASP B OD2 1 
ATOM   5291 N N   . LEU B 1 245 ? 1.735  4.537   7.531   1.00   22.55  ? 332  LEU B N   1 
ATOM   5292 C CA  . LEU B 1 245 ? 1.963  4.714   8.963   1.00   21.81  ? 332  LEU B CA  1 
ATOM   5293 C C   . LEU B 1 245 ? 3.398  4.359   9.316   1.00   23.31  ? 332  LEU B C   1 
ATOM   5294 O O   . LEU B 1 245 ? 4.078  5.095   10.055  1.00   21.46  ? 332  LEU B O   1 
ATOM   5295 C CB  . LEU B 1 245 ? 1.003  3.882   9.823   1.00   20.41  ? 332  LEU B CB  1 
ATOM   5296 C CG  . LEU B 1 245 ? -0.446 4.322   9.613   1.00   29.65  ? 332  LEU B CG  1 
ATOM   5297 C CD1 . LEU B 1 245 ? -1.320 3.387   10.426  1.00   35.55  ? 332  LEU B CD1 1 
ATOM   5298 C CD2 . LEU B 1 245 ? -0.664 5.720   10.051  1.00   36.46  ? 332  LEU B CD2 1 
ATOM   5299 N N   . GLN B 1 246 ? 3.874  3.288   8.688   1.00   23.53  ? 333  GLN B N   1 
ATOM   5300 C CA  . GLN B 1 246 ? 5.243  2.806   8.909   1.00   25.09  ? 333  GLN B CA  1 
ATOM   5301 C C   . GLN B 1 246 ? 6.270  3.805   8.401   1.00   24.74  ? 333  GLN B C   1 
ATOM   5302 O O   . GLN B 1 246 ? 7.277  4.077   9.056   1.00   22.12  ? 333  GLN B O   1 
ATOM   5303 C CB  . GLN B 1 246 ? 5.460  1.438   8.269   1.00   25.29  ? 333  GLN B CB  1 
ATOM   5304 C CG  . GLN B 1 246 ? 4.638  0.332   8.937   1.00   23.13  ? 333  GLN B CG  1 
ATOM   5305 C CD  . GLN B 1 246 ? 4.708  -0.968  8.222   1.00   21.08  ? 333  GLN B CD  1 
ATOM   5306 O OE1 . GLN B 1 246 ? 4.932  -1.000  7.006   1.00   21.80  ? 333  GLN B OE1 1 
ATOM   5307 N NE2 . GLN B 1 246 ? 4.518  -2.058  8.962   1.00   21.82  ? 333  GLN B NE2 1 
ATOM   5308 N N   . THR B 1 247 ? 5.991  4.384   7.241   1.00   25.45  ? 334  THR B N   1 
ATOM   5309 C CA  . THR B 1 247 ? 6.902  5.366   6.671   1.00   24.53  ? 334  THR B CA  1 
ATOM   5310 C C   . THR B 1 247 ? 6.933  6.625   7.542   1.00   26.38  ? 334  THR B C   1 
ATOM   5311 O O   . THR B 1 247 ? 7.972  7.192   7.800   1.00   22.68  ? 334  THR B O   1 
ATOM   5312 C CB  . THR B 1 247 ? 6.408  5.723   5.296   1.00   26.33  ? 334  THR B CB  1 
ATOM   5313 O OG1 . THR B 1 247 ? 6.610  4.607   4.430   1.00   26.30  ? 334  THR B OG1 1 
ATOM   5314 C CG2 . THR B 1 247 ? 7.263  6.816   4.709   1.00   26.21  ? 334  THR B CG2 1 
ATOM   5315 N N   . GLN B 1 248 ? 5.779  7.044   8.050   1.00   28.37  ? 335  GLN B N   1 
ATOM   5316 C CA  . GLN B 1 248 ? 5.695  8.196   8.942   1.00   25.36  ? 335  GLN B CA  1 
ATOM   5317 C C   . GLN B 1 248 ? 6.489  8.023   10.248  1.00   26.26  ? 335  GLN B C   1 
ATOM   5318 O O   . GLN B 1 248 ? 6.973  8.996   10.785  1.00   29.09  ? 335  GLN B O   1 
ATOM   5319 C CB  . GLN B 1 248 ? 4.236  8.509   9.273   1.00   23.75  ? 335  GLN B CB  1 
ATOM   5320 C CG  . GLN B 1 248 ? 4.044  9.895   9.837   1.00   18.68  ? 335  GLN B CG  1 
ATOM   5321 C CD  . GLN B 1 248 ? 4.451  10.960  8.853   1.00   28.07  ? 335  GLN B CD  1 
ATOM   5322 O OE1 . GLN B 1 248 ? 4.088  10.874  7.660   1.00   25.14  ? 335  GLN B OE1 1 
ATOM   5323 N NE2 . GLN B 1 248 ? 5.204  11.976  9.330   1.00   22.26  ? 335  GLN B NE2 1 
ATOM   5324 N N   . VAL B 1 249 ? 6.621  6.814   10.777  1.00   23.40  ? 336  VAL B N   1 
ATOM   5325 C CA  . VAL B 1 249 ? 7.436  6.608   11.964  1.00   22.31  ? 336  VAL B CA  1 
ATOM   5326 C C   . VAL B 1 249 ? 8.874  7.006   11.708  1.00   22.85  ? 336  VAL B C   1 
ATOM   5327 O O   . VAL B 1 249 ? 9.511  7.661   12.526  1.00   22.87  ? 336  VAL B O   1 
ATOM   5328 C CB  . VAL B 1 249 ? 7.392  5.131   12.450  1.00   26.38  ? 336  VAL B CB  1 
ATOM   5329 C CG1 . VAL B 1 249 ? 8.391  4.858   13.539  1.00   30.66  ? 336  VAL B CG1 1 
ATOM   5330 C CG2 . VAL B 1 249 ? 6.034  4.769   13.061  1.00   26.87  ? 336  VAL B CG2 1 
ATOM   5331 N N   . VAL B 1 250 ? 9.388  6.641   10.545  1.00   25.07  ? 337  VAL B N   1 
ATOM   5332 C CA  . VAL B 1 250 ? 10.775 6.934   10.181  1.00   26.05  ? 337  VAL B CA  1 
ATOM   5333 C C   . VAL B 1 250 ? 10.976 8.435   9.908   1.00   29.38  ? 337  VAL B C   1 
ATOM   5334 O O   . VAL B 1 250 ? 11.957 9.064   10.304  1.00   26.27  ? 337  VAL B O   1 
ATOM   5335 C CB  . VAL B 1 250 ? 11.150 6.065   8.965   1.00   30.73  ? 337  VAL B CB  1 
ATOM   5336 C CG1 . VAL B 1 250 ? 12.466 6.410   8.459   1.00   35.94  ? 337  VAL B CG1 1 
ATOM   5337 C CG2 . VAL B 1 250 ? 11.218 4.598   9.334   1.00   37.31  ? 337  VAL B CG2 1 
ATOM   5338 N N   . ILE B 1 251 ? 10.014 9.066   9.243   1.00   31.77  ? 338  ILE B N   1 
ATOM   5339 C CA  . ILE B 1 251 ? 10.089 10.513  9.093   1.00   28.98  ? 338  ILE B CA  1 
ATOM   5340 C C   . ILE B 1 251 ? 10.118 11.250  10.463  1.00   29.95  ? 338  ILE B C   1 
ATOM   5341 O O   . ILE B 1 251 ? 10.855 12.223  10.645  1.00   25.53  ? 338  ILE B O   1 
ATOM   5342 C CB  . ILE B 1 251 ? 8.885  10.971  8.307   1.00   25.97  ? 338  ILE B CB  1 
ATOM   5343 C CG1 . ILE B 1 251 ? 9.019  10.467  6.882   1.00   28.23  ? 338  ILE B CG1 1 
ATOM   5344 C CG2 . ILE B 1 251 ? 8.802  12.515  8.357   1.00   23.84  ? 338  ILE B CG2 1 
ATOM   5345 C CD1 . ILE B 1 251 ? 7.842  10.871  5.975   1.00   27.12  ? 338  ILE B CD1 1 
ATOM   5346 N N   . ASN B 1 252 ? 9.273  10.796  11.386  1.00   28.34  ? 339  ASN B N   1 
ATOM   5347 C CA  . ASN B 1 252 ? 9.078  11.376  12.720  1.00   30.36  ? 339  ASN B CA  1 
ATOM   5348 C C   . ASN B 1 252 ? 10.318 11.168  13.594  1.00   34.66  ? 339  ASN B C   1 
ATOM   5349 O O   . ASN B 1 252 ? 10.572 11.964  14.498  1.00   39.74  ? 339  ASN B O   1 
ATOM   5350 C CB  . ASN B 1 252 ? 7.843  10.760  13.410  1.00   27.50  ? 339  ASN B CB  1 
ATOM   5351 C CG  . ASN B 1 252 ? 6.543  11.379  12.945  1.00   25.38  ? 339  ASN B CG  1 
ATOM   5352 O OD1 . ASN B 1 252 ? 6.529  12.259  12.057  1.00   25.40  ? 339  ASN B OD1 1 
ATOM   5353 N ND2 . ASN B 1 252 ? 5.438  10.921  13.522  1.00   19.82  ? 339  ASN B ND2 1 
ATOM   5354 N N   . ALA B 1 253 ? 11.069 10.099  13.341  1.00   33.38  ? 340  ALA B N   1 
ATOM   5355 C CA  . ALA B 1 253 ? 12.335 9.831   14.029  1.00   30.94  ? 340  ALA B CA  1 
ATOM   5356 C C   . ALA B 1 253 ? 13.538 10.565  13.451  1.00   27.28  ? 340  ALA B C   1 
ATOM   5357 O O   . ALA B 1 253 ? 14.651 10.334  13.897  1.00   26.76  ? 340  ALA B O   1 
ATOM   5358 C CB  . ALA B 1 253 ? 12.663 8.360   13.990  1.00   32.08  ? 340  ALA B CB  1 
ATOM   5359 N N   . GLY B 1 254 ? 13.362 11.362  12.414  1.00   27.54  ? 341  GLY B N   1 
ATOM   5360 C CA  . GLY B 1 254 ? 14.441 12.213  11.944  1.00   25.42  ? 341  GLY B CA  1 
ATOM   5361 C C   . GLY B 1 254 ? 15.160 11.790  10.694  1.00   26.63  ? 341  GLY B C   1 
ATOM   5362 O O   . GLY B 1 254 ? 16.200 12.328  10.342  1.00   34.18  ? 341  GLY B O   1 
ATOM   5363 N N   . VAL B 1 255 ? 14.594 10.842  9.981   1.00   26.39  ? 342  VAL B N   1 
ATOM   5364 C CA  . VAL B 1 255 ? 15.266 10.274  8.826   1.00   26.08  ? 342  VAL B CA  1 
ATOM   5365 C C   . VAL B 1 255 ? 15.551 11.249  7.722   1.00   23.67  ? 342  VAL B C   1 
ATOM   5366 O O   . VAL B 1 255 ? 16.531 11.062  7.041   1.00   25.00  ? 342  VAL B O   1 
ATOM   5367 C CB  . VAL B 1 255 ? 14.439 9.114   8.209   1.00   25.48  ? 342  VAL B CB  1 
ATOM   5368 C CG1 . VAL B 1 255 ? 13.354 9.636   7.356   1.00   22.66  ? 342  VAL B CG1 1 
ATOM   5369 C CG2 . VAL B 1 255 ? 15.309 8.184   7.404   1.00   28.67  ? 342  VAL B CG2 1 
ATOM   5370 N N   . LEU B 1 256 ? 14.740 12.275  7.518   1.00   25.85  ? 343  LEU B N   1 
ATOM   5371 C CA  . LEU B 1 256 ? 14.955 13.119  6.338   1.00   28.43  ? 343  LEU B CA  1 
ATOM   5372 C C   . LEU B 1 256 ? 16.265 13.936  6.394   1.00   32.33  ? 343  LEU B C   1 
ATOM   5373 O O   . LEU B 1 256 ? 17.044 13.898  5.446   1.00   34.49  ? 343  LEU B O   1 
ATOM   5374 C CB  . LEU B 1 256 ? 13.733 13.981  6.063   1.00   27.72  ? 343  LEU B CB  1 
ATOM   5375 C CG  . LEU B 1 256 ? 12.486 13.221  5.631   1.00   29.85  ? 343  LEU B CG  1 
ATOM   5376 C CD1 . LEU B 1 256 ? 11.284 14.163  5.602   1.00   29.27  ? 343  LEU B CD1 1 
ATOM   5377 C CD2 . LEU B 1 256 ? 12.695 12.572  4.244   1.00   31.25  ? 343  LEU B CD2 1 
ATOM   5378 N N   . PRO B 1 257 ? 16.538 14.650  7.482   1.00   34.05  ? 344  PRO B N   1 
ATOM   5379 C CA  . PRO B 1 257 ? 17.842 15.302  7.683   1.00   33.49  ? 344  PRO B CA  1 
ATOM   5380 C C   . PRO B 1 257 ? 19.044 14.358  7.679   1.00   32.37  ? 344  PRO B C   1 
ATOM   5381 O O   . PRO B 1 257 ? 20.132 14.781  7.303   1.00   35.79  ? 344  PRO B O   1 
ATOM   5382 C CB  . PRO B 1 257 ? 17.719 15.937  9.071   1.00   32.24  ? 344  PRO B CB  1 
ATOM   5383 C CG  . PRO B 1 257 ? 16.252 16.055  9.280   1.00   35.25  ? 344  PRO B CG  1 
ATOM   5384 C CD  . PRO B 1 257 ? 15.643 14.878  8.627   1.00   36.24  ? 344  PRO B CD  1 
ATOM   5385 N N   . ALA B 1 258 ? 18.876 13.111  8.100   1.00   30.48  ? 345  ALA B N   1 
ATOM   5386 C CA  . ALA B 1 258 ? 19.957 12.132  7.983   1.00   28.13  ? 345  ALA B CA  1 
ATOM   5387 C C   . ALA B 1 258 ? 20.169 11.788  6.490   1.00   31.57  ? 345  ALA B C   1 
ATOM   5388 O O   . ALA B 1 258 ? 21.308 11.738  5.991   1.00   32.25  ? 345  ALA B O   1 
ATOM   5389 C CB  . ALA B 1 258 ? 19.629 10.906  8.787   1.00   25.36  ? 345  ALA B CB  1 
ATOM   5390 N N   . LEU B 1 259 ? 19.065 11.592  5.769   1.00   27.40  ? 346  LEU B N   1 
ATOM   5391 C CA  . LEU B 1 259 ? 19.159 11.308  4.352   1.00   29.77  ? 346  LEU B CA  1 
ATOM   5392 C C   . LEU B 1 259 ? 19.838 12.455  3.602   1.00   31.46  ? 346  LEU B C   1 
ATOM   5393 O O   . LEU B 1 259 ? 20.452 12.255  2.554   1.00   28.95  ? 346  LEU B O   1 
ATOM   5394 C CB  . LEU B 1 259 ? 17.791 10.981  3.757   1.00   29.65  ? 346  LEU B CB  1 
ATOM   5395 C CG  . LEU B 1 259 ? 17.241 9.640   4.258   1.00   33.30  ? 346  LEU B CG  1 
ATOM   5396 C CD1 . LEU B 1 259 ? 15.769 9.532   3.921   1.00   36.38  ? 346  LEU B CD1 1 
ATOM   5397 C CD2 . LEU B 1 259 ? 18.004 8.479   3.658   1.00   36.70  ? 346  LEU B CD2 1 
ATOM   5398 N N   . ARG B 1 260 ? 19.738 13.658  4.149   1.00   32.10  ? 347  ARG B N   1 
ATOM   5399 C CA  . ARG B 1 260 ? 20.338 14.815  3.516   1.00   33.06  ? 347  ARG B CA  1 
ATOM   5400 C C   . ARG B 1 260 ? 21.844 14.653  3.547   1.00   33.60  ? 347  ARG B C   1 
ATOM   5401 O O   . ARG B 1 260 ? 22.563 14.998  2.630   1.00   30.27  ? 347  ARG B O   1 
ATOM   5402 C CB  . ARG B 1 260 ? 19.945 16.081  4.282   1.00   34.47  ? 347  ARG B CB  1 
ATOM   5403 C CG  . ARG B 1 260 ? 19.858 17.336  3.431   1.00   41.85  ? 347  ARG B CG  1 
ATOM   5404 C CD  . ARG B 1 260 ? 20.986 17.422  2.446   1.00   51.09  ? 347  ARG B CD  1 
ATOM   5405 N NE  . ARG B 1 260 ? 21.136 18.662  1.691   1.00   54.78  ? 347  ARG B NE  1 
ATOM   5406 C CZ  . ARG B 1 260 ? 22.132 18.812  0.818   1.00   59.25  ? 347  ARG B CZ  1 
ATOM   5407 N NH1 . ARG B 1 260 ? 23.002 17.814  0.597   1.00   55.52  ? 347  ARG B NH1 1 
ATOM   5408 N NH2 . ARG B 1 260 ? 22.257 19.949  0.146   1.00   64.24  ? 347  ARG B NH2 1 
ATOM   5409 N N   . LEU B 1 261 ? 22.317 14.182  4.690   1.00   39.67  ? 348  LEU B N   1 
ATOM   5410 C CA  . LEU B 1 261 ? 23.736 13.991  4.920   1.00   36.01  ? 348  LEU B CA  1 
ATOM   5411 C C   . LEU B 1 261 ? 24.175 12.950  3.917   1.00   38.65  ? 348  LEU B C   1 
ATOM   5412 O O   . LEU B 1 261 ? 25.132 13.190  3.184   1.00   40.86  ? 348  LEU B O   1 
ATOM   5413 C CB  . LEU B 1 261 ? 23.918 13.483  6.348   1.00   37.29  ? 348  LEU B CB  1 
ATOM   5414 C CG  . LEU B 1 261 ? 25.246 13.574  7.119   1.00   43.13  ? 348  LEU B CG  1 
ATOM   5415 C CD1 . LEU B 1 261 ? 25.590 12.181  7.665   1.00   43.35  ? 348  LEU B CD1 1 
ATOM   5416 C CD2 . LEU B 1 261 ? 26.410 14.194  6.330   1.00   41.46  ? 348  LEU B CD2 1 
ATOM   5417 N N   . LEU B 1 262 ? 23.439 11.832  3.839   1.00   38.09  ? 349  LEU B N   1 
ATOM   5418 C CA  . LEU B 1 262 ? 23.866 10.688  3.017   1.00   35.44  ? 349  LEU B CA  1 
ATOM   5419 C C   . LEU B 1 262 ? 23.841 10.992  1.518   1.00   31.44  ? 349  LEU B C   1 
ATOM   5420 O O   . LEU B 1 262 ? 24.528 10.322  0.754   1.00   26.41  ? 349  LEU B O   1 
ATOM   5421 C CB  . LEU B 1 262 ? 22.994 9.455   3.260   1.00   35.34  ? 349  LEU B CB  1 
ATOM   5422 C CG  . LEU B 1 262 ? 23.008 8.873   4.664   1.00   40.04  ? 349  LEU B CG  1 
ATOM   5423 C CD1 . LEU B 1 262 ? 21.780 7.990   4.864   1.00   42.77  ? 349  LEU B CD1 1 
ATOM   5424 C CD2 . LEU B 1 262 ? 24.276 8.088   4.974   1.00   40.21  ? 349  LEU B CD2 1 
ATOM   5425 N N   . LEU B 1 263 ? 23.033 11.962  1.095   1.00   28.51  ? 350  LEU B N   1 
ATOM   5426 C CA  . LEU B 1 263 ? 23.010 12.330  -0.308  1.00   34.77  ? 350  LEU B CA  1 
ATOM   5427 C C   . LEU B 1 263 ? 24.350 12.920  -0.719  1.00   37.53  ? 350  LEU B C   1 
ATOM   5428 O O   . LEU B 1 263 ? 24.638 12.920  -1.910  1.00   35.33  ? 350  LEU B O   1 
ATOM   5429 C CB  . LEU B 1 263 ? 21.865 13.288  -0.655  1.00   34.45  ? 350  LEU B CB  1 
ATOM   5430 C CG  . LEU B 1 263 ? 20.492 12.639  -0.892  1.00   30.31  ? 350  LEU B CG  1 
ATOM   5431 C CD1 . LEU B 1 263 ? 19.563 13.687  -1.388  1.00   26.81  ? 350  LEU B CD1 1 
ATOM   5432 C CD2 . LEU B 1 263 ? 20.482 11.499  -1.879  1.00   30.86  ? 350  LEU B CD2 1 
ATOM   5433 N N   . SER B 1 264 ? 25.134 13.410  0.248   1.00   38.40  ? 351  SER B N   1 
ATOM   5434 C CA  . SER B 1 264 ? 26.485 13.901  -0.045  1.00   45.54  ? 351  SER B CA  1 
ATOM   5435 C C   . SER B 1 264 ? 27.637 13.023  0.508   1.00   45.75  ? 351  SER B C   1 
ATOM   5436 O O   . SER B 1 264 ? 28.701 13.499  0.913   1.00   44.19  ? 351  SER B O   1 
ATOM   5437 C CB  . SER B 1 264 ? 26.639 15.402  0.288   1.00   49.48  ? 351  SER B CB  1 
ATOM   5438 O OG  . SER B 1 264 ? 26.112 15.810  1.547   1.00   52.68  ? 351  SER B OG  1 
ATOM   5439 N N   . SER B 1 265 ? 27.430 11.714  0.454   1.00   41.37  ? 352  SER B N   1 
ATOM   5440 C CA  . SER B 1 265 ? 28.425 10.762  0.908   1.00   43.77  ? 352  SER B CA  1 
ATOM   5441 C C   . SER B 1 265 ? 29.527 10.576  -0.128  1.00   46.21  ? 352  SER B C   1 
ATOM   5442 O O   . SER B 1 265 ? 29.261 10.708  -1.325  1.00   50.85  ? 352  SER B O   1 
ATOM   5443 C CB  . SER B 1 265 ? 27.754 9.411   1.177   1.00   43.05  ? 352  SER B CB  1 
ATOM   5444 O OG  . SER B 1 265 ? 28.668 8.332   1.212   1.00   38.80  ? 352  SER B OG  1 
ATOM   5445 N N   . PRO B 1 266 ? 30.744 10.237  0.308   1.00   45.66  ? 353  PRO B N   1 
ATOM   5446 C CA  . PRO B 1 266 ? 31.813 9.835   -0.630  1.00   46.37  ? 353  PRO B CA  1 
ATOM   5447 C C   . PRO B 1 266 ? 31.466 8.567   -1.453  1.00   48.06  ? 353  PRO B C   1 
ATOM   5448 O O   . PRO B 1 266 ? 31.661 8.549   -2.667  1.00   48.04  ? 353  PRO B O   1 
ATOM   5449 C CB  . PRO B 1 266 ? 33.011 9.550   0.285   1.00   42.58  ? 353  PRO B CB  1 
ATOM   5450 C CG  . PRO B 1 266 ? 32.682 10.250  1.560   1.00   45.89  ? 353  PRO B CG  1 
ATOM   5451 C CD  . PRO B 1 266 ? 31.200 10.228  1.711   1.00   43.71  ? 353  PRO B CD  1 
ATOM   5452 N N   . LYS B 1 267 ? 30.955 7.528   -0.791  1.00   47.92  ? 354  LYS B N   1 
ATOM   5453 C CA  . LYS B 1 267 ? 30.593 6.273   -1.441  1.00   48.78  ? 354  LYS B CA  1 
ATOM   5454 C C   . LYS B 1 267 ? 29.378 6.446   -2.334  1.00   46.42  ? 354  LYS B C   1 
ATOM   5455 O O   . LYS B 1 267 ? 28.324 6.823   -1.843  1.00   48.80  ? 354  LYS B O   1 
ATOM   5456 C CB  . LYS B 1 267 ? 30.200 5.226   -0.407  1.00   51.46  ? 354  LYS B CB  1 
ATOM   5457 C CG  . LYS B 1 267 ? 31.273 4.882   0.584   1.00   57.61  ? 354  LYS B CG  1 
ATOM   5458 C CD  . LYS B 1 267 ? 32.419 4.136   -0.084  1.00   61.00  ? 354  LYS B CD  1 
ATOM   5459 C CE  . LYS B 1 267 ? 33.409 3.614   0.953   1.00   64.45  ? 354  LYS B CE  1 
ATOM   5460 N NZ  . LYS B 1 267 ? 34.598 2.944   0.352   1.00   61.54  ? 354  LYS B NZ  1 
ATOM   5461 N N   . GLU B 1 268 ? 29.516 6.151   -3.622  1.00   44.69  ? 355  GLU B N   1 
ATOM   5462 C CA  . GLU B 1 268 ? 28.430 6.282   -4.594  1.00   44.46  ? 355  GLU B CA  1 
ATOM   5463 C C   . GLU B 1 268 ? 27.180 5.491   -4.198  1.00   40.81  ? 355  GLU B C   1 
ATOM   5464 O O   . GLU B 1 268 ? 26.058 5.968   -4.354  1.00   36.88  ? 355  GLU B O   1 
ATOM   5465 C CB  . GLU B 1 268 ? 28.914 5.816   -5.977  1.00   46.99  ? 355  GLU B CB  1 
ATOM   5466 C CG  . GLU B 1 268 ? 27.989 6.086   -7.151  1.00   51.41  ? 355  GLU B CG  1 
ATOM   5467 C CD  . GLU B 1 268 ? 27.749 7.569   -7.380  1.00   52.96  ? 355  GLU B CD  1 
ATOM   5468 O OE1 . GLU B 1 268 ? 27.689 8.292   -6.380  1.00   59.57  ? 355  GLU B OE1 1 
ATOM   5469 O OE2 . GLU B 1 268 ? 27.601 8.034   -8.524  1.00   56.04  ? 355  GLU B OE2 1 
ATOM   5470 N N   . ASN B 1 269 ? 27.394 4.291   -3.681  1.00   39.39  ? 356  ASN B N   1 
ATOM   5471 C CA  . ASN B 1 269 ? 26.305 3.378   -3.358  1.00   43.50  ? 356  ASN B CA  1 
ATOM   5472 C C   . ASN B 1 269 ? 25.477 3.810   -2.169  1.00   40.92  ? 356  ASN B C   1 
ATOM   5473 O O   . ASN B 1 269 ? 24.305 3.471   -2.118  1.00   38.50  ? 356  ASN B O   1 
ATOM   5474 C CB  . ASN B 1 269 ? 26.797 1.950   -3.132  1.00   46.37  ? 356  ASN B CB  1 
ATOM   5475 C CG  . ASN B 1 269 ? 26.960 1.163   -4.432  1.00   53.28  ? 356  ASN B CG  1 
ATOM   5476 O OD1 . ASN B 1 269 ? 26.387 1.499   -5.496  1.00   52.85  ? 356  ASN B OD1 1 
ATOM   5477 N ND2 . ASN B 1 269 ? 27.743 0.078   -4.338  1.00   56.06  ? 356  ASN B ND2 1 
ATOM   5478 N N   . ILE B 1 270 ? 26.072 4.553   -1.243  1.00   37.04  ? 357  ILE B N   1 
ATOM   5479 C CA  . ILE B 1 270 ? 25.302 5.149   -0.166  1.00   36.13  ? 357  ILE B CA  1 
ATOM   5480 C C   . ILE B 1 270 ? 24.362 6.188   -0.764  1.00   35.57  ? 357  ILE B C   1 
ATOM   5481 O O   . ILE B 1 270 ? 23.222 6.315   -0.348  1.00   40.52  ? 357  ILE B O   1 
ATOM   5482 C CB  . ILE B 1 270 ? 26.225 5.824   0.844   1.00   37.77  ? 357  ILE B CB  1 
ATOM   5483 C CG1 . ILE B 1 270 ? 27.236 4.827   1.421   1.00   35.12  ? 357  ILE B CG1 1 
ATOM   5484 C CG2 . ILE B 1 270 ? 25.424 6.513   1.931   1.00   36.53  ? 357  ILE B CG2 1 
ATOM   5485 C CD1 . ILE B 1 270 ? 26.695 3.959   2.486   1.00   36.29  ? 357  ILE B CD1 1 
ATOM   5486 N N   . LYS B 1 271 ? 24.831 6.927   -1.762  1.00   34.22  ? 358  LYS B N   1 
ATOM   5487 C CA  . LYS B 1 271 ? 24.004 7.922   -2.432  1.00   31.42  ? 358  LYS B CA  1 
ATOM   5488 C C   . LYS B 1 271 ? 22.879 7.245   -3.235  1.00   31.23  ? 358  LYS B C   1 
ATOM   5489 O O   . LYS B 1 271 ? 21.768 7.789   -3.372  1.00   27.77  ? 358  LYS B O   1 
ATOM   5490 C CB  . LYS B 1 271 ? 24.868 8.831   -3.334  1.00   31.13  ? 358  LYS B CB  1 
ATOM   5491 C CG  . LYS B 1 271 ? 25.760 9.816   -2.578  1.00   37.64  ? 358  LYS B CG  1 
ATOM   5492 C CD  . LYS B 1 271 ? 26.312 10.995  -3.389  1.00   40.82  ? 358  LYS B CD  1 
ATOM   5493 C CE  . LYS B 1 271 ? 27.621 10.646  -4.045  1.00   45.73  ? 358  LYS B CE  1 
ATOM   5494 N NZ  . LYS B 1 271 ? 27.982 11.639  -5.088  1.00   54.39  ? 358  LYS B NZ  1 
ATOM   5495 N N   . LYS B 1 272 ? 23.175 6.081   -3.815  1.00   25.68  ? 359  LYS B N   1 
ATOM   5496 C CA  . LYS B 1 272 ? 22.142 5.366   -4.542  1.00   28.65  ? 359  LYS B CA  1 
ATOM   5497 C C   . LYS B 1 272 ? 21.026 4.861   -3.602  1.00   27.77  ? 359  LYS B C   1 
ATOM   5498 O O   . LYS B 1 272 ? 19.846 5.060   -3.864  1.00   27.91  ? 359  LYS B O   1 
ATOM   5499 C CB  . LYS B 1 272 ? 22.772 4.242   -5.325  1.00   33.12  ? 359  LYS B CB  1 
ATOM   5500 C CG  . LYS B 1 272 ? 21.848 3.518   -6.238  1.00   37.75  ? 359  LYS B CG  1 
ATOM   5501 C CD  . LYS B 1 272 ? 22.512 2.273   -6.833  1.00   43.57  ? 359  LYS B CD  1 
ATOM   5502 C CE  . LYS B 1 272 ? 22.564 1.091   -5.832  1.00   49.88  ? 359  LYS B CE  1 
ATOM   5503 N NZ  . LYS B 1 272 ? 23.633 0.062   -6.077  1.00   50.08  ? 359  LYS B NZ  1 
ATOM   5504 N N   . GLU B 1 273 ? 21.385 4.315   -2.452  1.00   26.44  ? 360  GLU B N   1 
ATOM   5505 C CA  . GLU B 1 273 ? 20.424 3.742   -1.534  1.00   25.77  ? 360  GLU B CA  1 
ATOM   5506 C C   . GLU B 1 273 ? 19.641 4.823   -0.807  1.00   29.22  ? 360  GLU B C   1 
ATOM   5507 O O   . GLU B 1 273 ? 18.486 4.608   -0.430  1.00   27.54  ? 360  GLU B O   1 
ATOM   5508 C CB  . GLU B 1 273 ? 21.133 2.899   -0.507  1.00   26.01  ? 360  GLU B CB  1 
ATOM   5509 C CG  . GLU B 1 273 ? 21.746 1.642   -1.107  1.00   23.00  ? 360  GLU B CG  1 
ATOM   5510 C CD  . GLU B 1 273 ? 20.917 0.384   -0.896  1.00   24.37  ? 360  GLU B CD  1 
ATOM   5511 O OE1 . GLU B 1 273 ? 20.471 0.113   0.242   1.00   38.54  ? 360  GLU B OE1 1 
ATOM   5512 O OE2 . GLU B 1 273 ? 20.697 -0.366  -1.862  1.00   28.78  ? 360  GLU B OE2 1 
ATOM   5513 N N   . ALA B 1 274 ? 20.281 5.973   -0.631  1.00   28.74  ? 361  ALA B N   1 
ATOM   5514 C CA  . ALA B 1 274 ? 19.631 7.150   -0.086  1.00   31.30  ? 361  ALA B CA  1 
ATOM   5515 C C   . ALA B 1 274 ? 18.532 7.661   -1.018  1.00   31.40  ? 361  ALA B C   1 
ATOM   5516 O O   . ALA B 1 274 ? 17.453 8.015   -0.579  1.00   34.03  ? 361  ALA B O   1 
ATOM   5517 C CB  . ALA B 1 274 ? 20.676 8.246   0.122   1.00   34.66  ? 361  ALA B CB  1 
ATOM   5518 N N   . CYS B 1 275 ? 18.805 7.678   -2.313  1.00   32.89  ? 362  CYS B N   1 
ATOM   5519 C CA  . CYS B 1 275 ? 17.832 8.104   -3.307  1.00   32.73  ? 362  CYS B CA  1 
ATOM   5520 C C   . CYS B 1 275 ? 16.676 7.123   -3.402  1.00   32.17  ? 362  CYS B C   1 
ATOM   5521 O O   . CYS B 1 275 ? 15.495 7.502   -3.524  1.00   33.85  ? 362  CYS B O   1 
ATOM   5522 C CB  . CYS B 1 275 ? 18.509 8.254   -4.672  1.00   33.80  ? 362  CYS B CB  1 
ATOM   5523 S SG  . CYS B 1 275 ? 19.642 9.682   -4.719  1.00   32.45  ? 362  CYS B SG  1 
ATOM   5524 N N   . TRP B 1 276 ? 17.031 5.848   -3.384  1.00   27.19  ? 363  TRP B N   1 
ATOM   5525 C CA  . TRP B 1 276 ? 16.021 4.802   -3.404  1.00   25.93  ? 363  TRP B CA  1 
ATOM   5526 C C   . TRP B 1 276 ? 15.061 5.019   -2.226  1.00   24.73  ? 363  TRP B C   1 
ATOM   5527 O O   . TRP B 1 276 ? 13.839 4.983   -2.390  1.00   25.42  ? 363  TRP B O   1 
ATOM   5528 C CB  . TRP B 1 276 ? 16.690 3.409   -3.322  1.00   22.10  ? 363  TRP B CB  1 
ATOM   5529 C CG  . TRP B 1 276 ? 15.755 2.268   -3.056  1.00   22.26  ? 363  TRP B CG  1 
ATOM   5530 C CD1 . TRP B 1 276 ? 14.748 1.813   -3.855  1.00   22.91  ? 363  TRP B CD1 1 
ATOM   5531 C CD2 . TRP B 1 276 ? 15.734 1.454   -1.886  1.00   23.63  ? 363  TRP B CD2 1 
ATOM   5532 N NE1 . TRP B 1 276 ? 14.128 0.737   -3.265  1.00   27.35  ? 363  TRP B NE1 1 
ATOM   5533 C CE2 . TRP B 1 276 ? 14.732 0.482   -2.063  1.00   26.10  ? 363  TRP B CE2 1 
ATOM   5534 C CE3 . TRP B 1 276 ? 16.513 1.406   -0.729  1.00   24.57  ? 363  TRP B CE3 1 
ATOM   5535 C CZ2 . TRP B 1 276 ? 14.469 -0.499  -1.120  1.00   22.24  ? 363  TRP B CZ2 1 
ATOM   5536 C CZ3 . TRP B 1 276 ? 16.268 0.435   0.188   1.00   26.31  ? 363  TRP B CZ3 1 
ATOM   5537 C CH2 . TRP B 1 276 ? 15.241 -0.499  0.003   1.00   26.82  ? 363  TRP B CH2 1 
ATOM   5538 N N   . THR B 1 277 ? 15.636 5.267   -1.052  1.00   23.18  ? 364  THR B N   1 
ATOM   5539 C CA  . THR B 1 277 ? 14.874 5.426   0.163   1.00   24.42  ? 364  THR B CA  1 
ATOM   5540 C C   . THR B 1 277 ? 13.962 6.611   0.038   1.00   24.22  ? 364  THR B C   1 
ATOM   5541 O O   . THR B 1 277 ? 12.773 6.530   0.246   1.00   28.77  ? 364  THR B O   1 
ATOM   5542 C CB  . THR B 1 277 ? 15.832 5.620   1.356   1.00   27.85  ? 364  THR B CB  1 
ATOM   5543 O OG1 . THR B 1 277 ? 16.638 4.446   1.501   1.00   30.73  ? 364  THR B OG1 1 
ATOM   5544 C CG2 . THR B 1 277 ? 15.093 5.676   2.670   1.00   25.97  ? 364  THR B CG2 1 
ATOM   5545 N N   . ILE B 1 278 ? 14.527 7.739   -0.343  1.00   29.12  ? 365  ILE B N   1 
ATOM   5546 C CA  . ILE B 1 278 ? 13.717 8.932   -0.487  1.00   28.60  ? 365  ILE B CA  1 
ATOM   5547 C C   . ILE B 1 278 ? 12.573 8.692   -1.464  1.00   28.93  ? 365  ILE B C   1 
ATOM   5548 O O   . ILE B 1 278 ? 11.493 9.238   -1.275  1.00   29.34  ? 365  ILE B O   1 
ATOM   5549 C CB  . ILE B 1 278 ? 14.591 10.112  -0.952  1.00   25.32  ? 365  ILE B CB  1 
ATOM   5550 C CG1 . ILE B 1 278 ? 15.507 10.550  0.198   1.00   27.80  ? 365  ILE B CG1 1 
ATOM   5551 C CG2 . ILE B 1 278 ? 13.714 11.271  -1.376  1.00   21.26  ? 365  ILE B CG2 1 
ATOM   5552 C CD1 . ILE B 1 278 ? 16.782 11.245  -0.317  1.00   30.09  ? 365  ILE B CD1 1 
ATOM   5553 N N   . SER B 1 279 ? 12.827 7.926   -2.525  1.00   26.15  ? 366  SER B N   1 
ATOM   5554 C CA  . SER B 1 279 ? 11.838 7.746   -3.569  1.00   22.19  ? 366  SER B CA  1 
ATOM   5555 C C   . SER B 1 279 ? 10.705 6.897   -3.013  1.00   24.61  ? 366  SER B C   1 
ATOM   5556 O O   . SER B 1 279 ? 9.547  7.022   -3.426  1.00   23.51  ? 366  SER B O   1 
ATOM   5557 C CB  . SER B 1 279 ? 12.458 7.041   -4.760  1.00   21.04  ? 366  SER B CB  1 
ATOM   5558 O OG  . SER B 1 279 ? 12.416 5.674   -4.499  1.00   18.50  ? 366  SER B OG  1 
ATOM   5559 N N   . ASN B 1 280 ? 11.024 6.007   -2.082  1.00   21.90  ? 367  ASN B N   1 
ATOM   5560 C CA  . ASN B 1 280 ? 9.934  5.362   -1.367  1.00   25.26  ? 367  ASN B CA  1 
ATOM   5561 C C   . ASN B 1 280 ? 9.170  6.257   -0.357  1.00   26.69  ? 367  ASN B C   1 
ATOM   5562 O O   . ASN B 1 280 ? 8.070  5.943   0.070   1.00   29.82  ? 367  ASN B O   1 
ATOM   5563 C CB  . ASN B 1 280 ? 10.383 4.034   -0.761  1.00   24.58  ? 367  ASN B CB  1 
ATOM   5564 C CG  . ASN B 1 280 ? 10.364 2.906   -1.792  1.00   19.92  ? 367  ASN B CG  1 
ATOM   5565 O OD1 . ASN B 1 280 ? 9.473  2.878   -2.624  1.00   27.38  ? 367  ASN B OD1 1 
ATOM   5566 N ND2 . ASN B 1 280 ? 11.333 2.008   -1.772  1.00   14.98  ? 367  ASN B ND2 1 
ATOM   5567 N N   . ILE B 1 281 ? 9.700  7.416   -0.010  1.00   27.06  ? 368  ILE B N   1 
ATOM   5568 C CA  . ILE B 1 281 ? 8.941  8.344   0.811   1.00   26.15  ? 368  ILE B CA  1 
ATOM   5569 C C   . ILE B 1 281 ? 8.119  9.276   -0.081  1.00   27.58  ? 368  ILE B C   1 
ATOM   5570 O O   . ILE B 1 281 ? 7.016  9.704   0.323   1.00   29.35  ? 368  ILE B O   1 
ATOM   5571 C CB  . ILE B 1 281 ? 9.891  9.084   1.783   1.00   25.20  ? 368  ILE B CB  1 
ATOM   5572 C CG1 . ILE B 1 281 ? 10.516 8.049   2.707   1.00   22.52  ? 368  ILE B CG1 1 
ATOM   5573 C CG2 . ILE B 1 281 ? 9.128  10.086  2.635   1.00   23.01  ? 368  ILE B CG2 1 
ATOM   5574 C CD1 . ILE B 1 281 ? 11.630 8.565   3.591   1.00   22.43  ? 368  ILE B CD1 1 
ATOM   5575 N N   . THR B 1 282 ? 8.620  9.586   -1.282  1.00   26.58  ? 369  THR B N   1 
ATOM   5576 C CA  . THR B 1 282 ? 7.851  10.403  -2.243  1.00   27.96  ? 369  THR B CA  1 
ATOM   5577 C C   . THR B 1 282 ? 6.807  9.598   -2.995  1.00   28.42  ? 369  THR B C   1 
ATOM   5578 O O   . THR B 1 282 ? 5.967  10.139  -3.740  1.00   30.44  ? 369  THR B O   1 
ATOM   5579 C CB  . THR B 1 282 ? 8.726  11.153  -3.254  1.00   24.79  ? 369  THR B CB  1 
ATOM   5580 O OG1 . THR B 1 282 ? 9.397  10.224  -4.103  1.00   30.96  ? 369  THR B OG1 1 
ATOM   5581 C CG2 . THR B 1 282 ? 9.816  11.937  -2.543  1.00   23.38  ? 369  THR B CG2 1 
ATOM   5582 N N   . ALA B 1 283 ? 6.856  8.294   -2.760  1.00   27.28  ? 370  ALA B N   1 
ATOM   5583 C CA  . ALA B 1 283 ? 5.795  7.412   -3.224  1.00   24.91  ? 370  ALA B CA  1 
ATOM   5584 C C   . ALA B 1 283 ? 4.645  7.380   -2.225  1.00   24.51  ? 370  ALA B C   1 
ATOM   5585 O O   . ALA B 1 283 ? 3.595  6.766   -2.493  1.00   25.07  ? 370  ALA B O   1 
ATOM   5586 C CB  . ALA B 1 283 ? 6.338  6.043   -3.440  1.00   22.51  ? 370  ALA B CB  1 
ATOM   5587 N N   . GLY B 1 284 ? 4.871  8.071   -1.109  1.00   20.41  ? 371  GLY B N   1 
ATOM   5588 C CA  . GLY B 1 284 ? 3.947  8.139   0.001   1.00   23.75  ? 371  GLY B CA  1 
ATOM   5589 C C   . GLY B 1 284 ? 2.819  9.122   -0.215  1.00   21.83  ? 371  GLY B C   1 
ATOM   5590 O O   . GLY B 1 284 ? 2.481  9.420   -1.355  1.00   22.06  ? 371  GLY B O   1 
ATOM   5591 N N   . ASN B 1 285 ? 2.189  9.581   0.863   1.00   22.09  ? 372  ASN B N   1 
ATOM   5592 C CA  . ASN B 1 285 ? 1.106  10.559  0.715   1.00   22.68  ? 372  ASN B CA  1 
ATOM   5593 C C   . ASN B 1 285 ? 1.677  11.940  0.546   1.00   24.40  ? 372  ASN B C   1 
ATOM   5594 O O   . ASN B 1 285 ? 2.890  12.122  0.561   1.00   25.36  ? 372  ASN B O   1 
ATOM   5595 C CB  . ASN B 1 285 ? 0.093  10.516  1.859   1.00   18.40  ? 372  ASN B CB  1 
ATOM   5596 C CG  . ASN B 1 285 ? 0.720  10.752  3.180   1.00   23.85  ? 372  ASN B CG  1 
ATOM   5597 O OD1 . ASN B 1 285 ? 1.586  11.646  3.299   1.00   27.20  ? 372  ASN B OD1 1 
ATOM   5598 N ND2 . ASN B 1 285 ? 0.318  9.945   4.188   1.00   13.70  ? 372  ASN B ND2 1 
ATOM   5599 N N   . THR B 1 286 ? 0.765  12.883  0.369   1.00   30.01  ? 373  THR B N   1 
ATOM   5600 C CA  . THR B 1 286 ? 1.057  14.296  0.169   1.00   34.60  ? 373  THR B CA  1 
ATOM   5601 C C   . THR B 1 286 ? 1.805  14.963  1.331   1.00   32.06  ? 373  THR B C   1 
ATOM   5602 O O   . THR B 1 286 ? 2.700  15.772  1.107   1.00   32.84  ? 373  THR B O   1 
ATOM   5603 C CB  . THR B 1 286 ? -0.272 15.019  -0.174  1.00   34.87  ? 373  THR B CB  1 
ATOM   5604 O OG1 . THR B 1 286 ? -0.725 14.507  -1.424  1.00   32.71  ? 373  THR B OG1 1 
ATOM   5605 C CG2 . THR B 1 286 ? -0.063 16.493  -0.495  1.00   39.40  ? 373  THR B CG2 1 
ATOM   5606 N N   . GLU B 1 287 ? 1.484  14.619  2.570   1.00   33.23  ? 374  GLU B N   1 
ATOM   5607 C CA  . GLU B 1 287 ? 2.229  15.206  3.702   1.00   36.55  ? 374  GLU B CA  1 
ATOM   5608 C C   . GLU B 1 287 ? 3.675  14.769  3.659   1.00   32.78  ? 374  GLU B C   1 
ATOM   5609 O O   . GLU B 1 287 ? 4.553  15.482  4.121   1.00   34.18  ? 374  GLU B O   1 
ATOM   5610 C CB  . GLU B 1 287 ? 1.652  14.809  5.062   1.00   37.87  ? 374  GLU B CB  1 
ATOM   5611 C CG  . GLU B 1 287 ? 0.207  15.253  5.268   1.00   48.45  ? 374  GLU B CG  1 
ATOM   5612 C CD  . GLU B 1 287 ? -0.841 14.291  4.823   0.0000 75.93  ? 374  GLU B CD  1 
ATOM   5613 O OE1 . GLU B 1 287 ? -1.657 13.866  5.667   0.0000 73.83  ? 374  GLU B OE1 1 
ATOM   5614 O OE2 . GLU B 1 287 ? -0.850 13.939  3.625   0.0000 77.23  ? 374  GLU B OE2 1 
ATOM   5615 N N   . GLN B 1 288 ? 3.894  13.570  3.127   1.00   30.85  ? 375  GLN B N   1 
ATOM   5616 C CA  . GLN B 1 288 ? 5.207  12.982  3.072   1.00   26.12  ? 375  GLN B CA  1 
ATOM   5617 C C   . GLN B 1 288 ? 6.026  13.513  1.907   1.00   28.87  ? 375  GLN B C   1 
ATOM   5618 O O   . GLN B 1 288 ? 7.237  13.750  2.051   1.00   29.77  ? 375  GLN B O   1 
ATOM   5619 C CB  . GLN B 1 288 ? 5.079  11.473  3.079   1.00   23.45  ? 375  GLN B CB  1 
ATOM   5620 C CG  . GLN B 1 288 ? 4.525  10.955  4.375   1.00   19.49  ? 375  GLN B CG  1 
ATOM   5621 C CD  . GLN B 1 288 ? 4.088  9.512   4.321   1.00   23.19  ? 375  GLN B CD  1 
ATOM   5622 O OE1 . GLN B 1 288 ? 3.794  8.999   3.242   1.00   22.07  ? 375  GLN B OE1 1 
ATOM   5623 N NE2 . GLN B 1 288 ? 4.036  8.847   5.485   1.00   16.34  ? 375  GLN B NE2 1 
ATOM   5624 N N   . ILE B 1 289 ? 5.365  13.776  0.784   1.00   28.84  ? 376  ILE B N   1 
ATOM   5625 C CA  . ILE B 1 289 ? 6.046  14.423  -0.329  1.00   25.88  ? 376  ILE B CA  1 
ATOM   5626 C C   . ILE B 1 289 ? 6.412  15.824  0.121   1.00   27.80  ? 376  ILE B C   1 
ATOM   5627 O O   . ILE B 1 289 ? 7.515  16.322  -0.177  1.00   30.08  ? 376  ILE B O   1 
ATOM   5628 C CB  . ILE B 1 289 ? 5.184  14.493  -1.577  1.00   26.95  ? 376  ILE B CB  1 
ATOM   5629 C CG1 . ILE B 1 289 ? 4.815  13.071  -2.022  1.00   27.65  ? 376  ILE B CG1 1 
ATOM   5630 C CG2 . ILE B 1 289 ? 5.947  15.197  -2.705  1.00   20.98  ? 376  ILE B CG2 1 
ATOM   5631 C CD1 . ILE B 1 289 ? 3.870  13.009  -3.141  1.00   22.94  ? 376  ILE B CD1 1 
ATOM   5632 N N   . GLN B 1 290 ? 5.553  16.427  0.933   1.00   24.95  ? 377  GLN B N   1 
ATOM   5633 C CA  . GLN B 1 290 ? 5.883  17.771  1.395   1.00   29.31  ? 377  GLN B CA  1 
ATOM   5634 C C   . GLN B 1 290 ? 7.016  17.753  2.401   1.00   25.37  ? 377  GLN B C   1 
ATOM   5635 O O   . GLN B 1 290 ? 7.796  18.691  2.432   1.00   22.01  ? 377  GLN B O   1 
ATOM   5636 C CB  . GLN B 1 290 ? 4.680  18.499  1.996   1.00   33.58  ? 377  GLN B CB  1 
ATOM   5637 C CG  . GLN B 1 290 ? 4.978  19.952  2.369   1.00   33.52  ? 377  GLN B CG  1 
ATOM   5638 C CD  . GLN B 1 290 ? 5.029  20.834  1.148   1.00   28.05  ? 377  GLN B CD  1 
ATOM   5639 O OE1 . GLN B 1 290 ? 4.209  20.696  0.268   1.00   27.92  ? 377  GLN B OE1 1 
ATOM   5640 N NE2 . GLN B 1 290 ? 5.942  21.763  1.115   1.00   23.65  ? 377  GLN B NE2 1 
ATOM   5641 N N   . ALA B 1 291 ? 7.095  16.712  3.220   1.00   21.03  ? 378  ALA B N   1 
ATOM   5642 C CA  . ALA B 1 291 ? 8.161  16.635  4.211   1.00   23.09  ? 378  ALA B CA  1 
ATOM   5643 C C   . ALA B 1 291 ? 9.531  16.531  3.551   1.00   22.83  ? 378  ALA B C   1 
ATOM   5644 O O   . ALA B 1 291 ? 10.502 17.074  4.047   1.00   24.43  ? 378  ALA B O   1 
ATOM   5645 C CB  . ALA B 1 291 ? 7.956  15.452  5.167   1.00   21.19  ? 378  ALA B CB  1 
ATOM   5646 N N   . VAL B 1 292 ? 9.611  15.760  2.476   1.00   25.26  ? 379  VAL B N   1 
ATOM   5647 C CA  . VAL B 1 292 ? 10.830 15.628  1.694   1.00   22.13  ? 379  VAL B CA  1 
ATOM   5648 C C   . VAL B 1 292 ? 11.195 17.012  1.205   1.00   21.40  ? 379  VAL B C   1 
ATOM   5649 O O   . VAL B 1 292 ? 12.324 17.421  1.373   1.00   19.30  ? 379  VAL B O   1 
ATOM   5650 C CB  . VAL B 1 292 ? 10.596 14.661  0.494   1.00   21.41  ? 379  VAL B CB  1 
ATOM   5651 C CG1 . VAL B 1 292 ? 11.648 14.805  -0.592  1.00   25.30  ? 379  VAL B CG1 1 
ATOM   5652 C CG2 . VAL B 1 292 ? 10.655 13.240  0.955   1.00   24.60  ? 379  VAL B CG2 1 
ATOM   5653 N N   . ILE B 1 293 ? 10.249 17.716  0.566   1.00   25.18  ? 380  ILE B N   1 
ATOM   5654 C CA  . ILE B 1 293 ? 10.483 19.079  0.084   1.00   23.81  ? 380  ILE B CA  1 
ATOM   5655 C C   . ILE B 1 293 ? 10.921 20.017  1.213   1.00   26.28  ? 380  ILE B C   1 
ATOM   5656 O O   . ILE B 1 293 ? 11.917 20.696  1.069   1.00   29.87  ? 380  ILE B O   1 
ATOM   5657 C CB  . ILE B 1 293 ? 9.257  19.654  -0.596  1.00   24.93  ? 380  ILE B CB  1 
ATOM   5658 C CG1 . ILE B 1 293 ? 9.003  18.912  -1.918  1.00   29.79  ? 380  ILE B CG1 1 
ATOM   5659 C CG2 . ILE B 1 293 ? 9.382  21.196  -0.787  1.00   22.21  ? 380  ILE B CG2 1 
ATOM   5660 C CD1 . ILE B 1 293 ? 7.712  19.353  -2.633  1.00   24.40  ? 380  ILE B CD1 1 
ATOM   5661 N N   . ASP B 1 294 ? 10.210 20.054  2.328   1.00   26.56  ? 381  ASP B N   1 
ATOM   5662 C CA  . ASP B 1 294 ? 10.642 20.832  3.492   1.00   32.12  ? 381  ASP B CA  1 
ATOM   5663 C C   . ASP B 1 294 ? 12.004 20.474  4.092   1.00   29.66  ? 381  ASP B C   1 
ATOM   5664 O O   . ASP B 1 294 ? 12.579 21.302  4.804   1.00   32.55  ? 381  ASP B O   1 
ATOM   5665 C CB  . ASP B 1 294 ? 9.630  20.770  4.647   1.00   33.32  ? 381  ASP B CB  1 
ATOM   5666 C CG  . ASP B 1 294 ? 8.236  21.250  4.255   1.00   33.97  ? 381  ASP B CG  1 
ATOM   5667 O OD1 . ASP B 1 294 ? 8.058  21.918  3.225   1.00   36.48  ? 381  ASP B OD1 1 
ATOM   5668 O OD2 . ASP B 1 294 ? 7.222  20.977  4.917   1.00   36.81  ? 381  ASP B OD2 1 
ATOM   5669 N N   . ALA B 1 295 ? 12.529 19.283  3.819   1.00   28.85  ? 382  ALA B N   1 
ATOM   5670 C CA  . ALA B 1 295 ? 13.861 18.908  4.317   1.00   26.14  ? 382  ALA B CA  1 
ATOM   5671 C C   . ALA B 1 295 ? 14.984 19.317  3.373   1.00   24.89  ? 382  ALA B C   1 
ATOM   5672 O O   . ALA B 1 295 ? 16.124 18.950  3.612   1.00   24.71  ? 382  ALA B O   1 
ATOM   5673 C CB  . ALA B 1 295 ? 13.917 17.418  4.609   1.00   24.05  ? 382  ALA B CB  1 
ATOM   5674 N N   . ASN B 1 296 ? 14.654 20.096  2.344   1.00   29.46  ? 383  ASN B N   1 
ATOM   5675 C CA  . ASN B 1 296 ? 15.577 20.569  1.306   1.00   30.71  ? 383  ASN B CA  1 
ATOM   5676 C C   . ASN B 1 296 ? 16.273 19.435  0.557   1.00   29.60  ? 383  ASN B C   1 
ATOM   5677 O O   . ASN B 1 296 ? 17.434 19.570  0.203   1.00   30.67  ? 383  ASN B O   1 
ATOM   5678 C CB  . ASN B 1 296 ? 16.613 21.517  1.885   1.00   29.62  ? 383  ASN B CB  1 
ATOM   5679 C CG  . ASN B 1 296 ? 15.979 22.625  2.646   1.00   33.07  ? 383  ASN B CG  1 
ATOM   5680 O OD1 . ASN B 1 296 ? 15.219 23.404  2.077   1.00   35.23  ? 383  ASN B OD1 1 
ATOM   5681 N ND2 . ASN B 1 296 ? 16.234 22.682  3.954   1.00   31.14  ? 383  ASN B ND2 1 
ATOM   5682 N N   . LEU B 1 297 ? 15.554 18.341  0.314   1.00   29.47  ? 384  LEU B N   1 
ATOM   5683 C CA  . LEU B 1 297 ? 16.093 17.202  -0.406  1.00   28.02  ? 384  LEU B CA  1 
ATOM   5684 C C   . LEU B 1 297 ? 15.980 17.375  -1.937  1.00   26.93  ? 384  LEU B C   1 
ATOM   5685 O O   . LEU B 1 297 ? 16.711 16.750  -2.706  1.00   30.26  ? 384  LEU B O   1 
ATOM   5686 C CB  . LEU B 1 297 ? 15.419 15.927  0.095   1.00   24.58  ? 384  LEU B CB  1 
ATOM   5687 C CG  . LEU B 1 297 ? 15.837 15.520  1.517   1.00   27.80  ? 384  LEU B CG  1 
ATOM   5688 C CD1 . LEU B 1 297 ? 15.035 14.370  2.110   1.00   26.37  ? 384  LEU B CD1 1 
ATOM   5689 C CD2 . LEU B 1 297 ? 17.285 15.055  1.525   1.00   31.38  ? 384  LEU B CD2 1 
ATOM   5690 N N   . ILE B 1 298 ? 15.082 18.214  -2.416  1.00   21.64  ? 385  ILE B N   1 
ATOM   5691 C CA  . ILE B 1 298 ? 14.948 18.301  -3.855  1.00   23.74  ? 385  ILE B CA  1 
ATOM   5692 C C   . ILE B 1 298 ? 16.223 18.747  -4.530  1.00   29.19  ? 385  ILE B C   1 
ATOM   5693 O O   . ILE B 1 298 ? 16.724 18.035  -5.415  1.00   30.97  ? 385  ILE B O   1 
ATOM   5694 C CB  . ILE B 1 298 ? 13.745 19.157  -4.295  1.00   24.08  ? 385  ILE B CB  1 
ATOM   5695 C CG1 . ILE B 1 298 ? 12.434 18.525  -3.824  1.00   21.57  ? 385  ILE B CG1 1 
ATOM   5696 C CG2 . ILE B 1 298 ? 13.681 19.199  -5.833  1.00   26.36  ? 385  ILE B CG2 1 
ATOM   5697 C CD1 . ILE B 1 298 ? 12.272 17.001  -4.240  1.00   23.77  ? 385  ILE B CD1 1 
ATOM   5698 N N   . PRO B 1 299 ? 16.796 19.871  -4.122  1.00   30.88  ? 386  PRO B N   1 
ATOM   5699 C CA  . PRO B 1 299 ? 18.031 20.350  -4.769  1.00   33.42  ? 386  PRO B CA  1 
ATOM   5700 C C   . PRO B 1 299 ? 19.176 19.355  -4.924  1.00   31.55  ? 386  PRO B C   1 
ATOM   5701 O O   . PRO B 1 299 ? 19.611 19.195  -6.040  1.00   36.96  ? 386  PRO B O   1 
ATOM   5702 C CB  . PRO B 1 299 ? 18.443 21.533  -3.918  1.00   34.34  ? 386  PRO B CB  1 
ATOM   5703 C CG  . PRO B 1 299 ? 17.110 22.034  -3.395  1.00   37.25  ? 386  PRO B CG  1 
ATOM   5704 C CD  . PRO B 1 299 ? 16.343 20.777  -3.058  1.00   34.23  ? 386  PRO B CD  1 
ATOM   5705 N N   . PRO B 1 300 ? 19.682 18.691  -3.910  1.00   30.36  ? 387  PRO B N   1 
ATOM   5706 C CA  . PRO B 1 300 ? 20.731 17.709  -4.174  1.00   29.80  ? 387  PRO B CA  1 
ATOM   5707 C C   . PRO B 1 300 ? 20.222 16.558  -5.029  1.00   33.97  ? 387  PRO B C   1 
ATOM   5708 O O   . PRO B 1 300 ? 21.053 15.908  -5.664  1.00   36.42  ? 387  PRO B O   1 
ATOM   5709 C CB  . PRO B 1 300 ? 21.128 17.211  -2.780  1.00   26.87  ? 387  PRO B CB  1 
ATOM   5710 C CG  . PRO B 1 300 ? 19.955 17.513  -1.959  1.00   33.77  ? 387  PRO B CG  1 
ATOM   5711 C CD  . PRO B 1 300 ? 19.350 18.792  -2.480  1.00   30.98  ? 387  PRO B CD  1 
ATOM   5712 N N   . LEU B 1 301 ? 18.925 16.253  -4.993  1.00   35.00  ? 388  LEU B N   1 
ATOM   5713 C CA  . LEU B 1 301 ? 18.373 15.178  -5.839  1.00   34.67  ? 388  LEU B CA  1 
ATOM   5714 C C   . LEU B 1 301 ? 18.440 15.557  -7.339  1.00   30.58  ? 388  LEU B C   1 
ATOM   5715 O O   . LEU B 1 301 ? 18.768 14.767  -8.205  1.00   29.70  ? 388  LEU B O   1 
ATOM   5716 C CB  . LEU B 1 301 ? 16.931 14.875  -5.428  1.00   34.60  ? 388  LEU B CB  1 
ATOM   5717 C CG  . LEU B 1 301 ? 16.525 13.572  -4.748  1.00   36.61  ? 388  LEU B CG  1 
ATOM   5718 C CD1 . LEU B 1 301 ? 17.719 12.905  -4.125  1.00   38.20  ? 388  LEU B CD1 1 
ATOM   5719 C CD2 . LEU B 1 301 ? 15.375 13.771  -3.739  1.00   31.01  ? 388  LEU B CD2 1 
ATOM   5720 N N   . VAL B 1 302 ? 18.074 16.783  -7.646  1.00   29.93  ? 389  VAL B N   1 
ATOM   5721 C CA  . VAL B 1 302 ? 18.138 17.313  -8.999  1.00   31.26  ? 389  VAL B CA  1 
ATOM   5722 C C   . VAL B 1 302 ? 19.585 17.400  -9.441  1.00   34.96  ? 389  VAL B C   1 
ATOM   5723 O O   . VAL B 1 302 ? 19.886 17.015  -10.573 1.00   38.97  ? 389  VAL B O   1 
ATOM   5724 C CB  . VAL B 1 302 ? 17.507 18.714  -9.062  1.00   28.90  ? 389  VAL B CB  1 
ATOM   5725 C CG1 . VAL B 1 302 ? 17.769 19.392  -10.352 1.00   26.68  ? 389  VAL B CG1 1 
ATOM   5726 C CG2 . VAL B 1 302 ? 16.047 18.577  -8.866  1.00   29.19  ? 389  VAL B CG2 1 
ATOM   5727 N N   . LYS B 1 303 ? 20.480 17.826  -8.553  1.00   33.36  ? 390  LYS B N   1 
ATOM   5728 C CA  . LYS B 1 303 ? 21.906 17.822  -8.864  1.00   36.87  ? 390  LYS B CA  1 
ATOM   5729 C C   . LYS B 1 303 ? 22.359 16.419  -9.236  1.00   35.53  ? 390  LYS B C   1 
ATOM   5730 O O   . LYS B 1 303 ? 23.025 16.271  -10.260 1.00   43.00  ? 390  LYS B O   1 
ATOM   5731 C CB  . LYS B 1 303 ? 22.726 18.381  -7.701  1.00   41.73  ? 390  LYS B CB  1 
ATOM   5732 C CG  . LYS B 1 303 ? 24.223 18.483  -7.955  1.00   52.96  ? 390  LYS B CG  1 
ATOM   5733 C CD  . LYS B 1 303 ? 24.662 19.910  -8.276  1.00   59.14  ? 390  LYS B CD  1 
ATOM   5734 C CE  . LYS B 1 303 ? 24.827 20.741  -6.997  1.00   61.37  ? 390  LYS B CE  1 
ATOM   5735 N NZ  . LYS B 1 303 ? 25.674 21.959  -7.173  1.00   65.94  ? 390  LYS B NZ  1 
ATOM   5736 N N   . LEU B 1 304 ? 22.007 15.411  -8.441  1.00   30.90  ? 391  LEU B N   1 
ATOM   5737 C CA  . LEU B 1 304 ? 22.407 14.037  -8.712  1.00   31.11  ? 391  LEU B CA  1 
ATOM   5738 C C   . LEU B 1 304 ? 21.823 13.520  -10.025 1.00   32.51  ? 391  LEU B C   1 
ATOM   5739 O O   . LEU B 1 304 ? 22.464 12.733  -10.719 1.00   33.10  ? 391  LEU B O   1 
ATOM   5740 C CB  . LEU B 1 304 ? 21.976 13.087  -7.596  1.00   30.04  ? 391  LEU B CB  1 
ATOM   5741 C CG  . LEU B 1 304 ? 22.742 13.228  -6.295  1.00   32.46  ? 391  LEU B CG  1 
ATOM   5742 C CD1 . LEU B 1 304 ? 22.051 12.414  -5.212  1.00   35.28  ? 391  LEU B CD1 1 
ATOM   5743 C CD2 . LEU B 1 304 ? 24.149 12.706  -6.440  1.00   36.25  ? 391  LEU B CD2 1 
ATOM   5744 N N   . LEU B 1 305 ? 20.608 13.932  -10.356 1.00   32.28  ? 392  LEU B N   1 
ATOM   5745 C CA  . LEU B 1 305 ? 19.972 13.521  -11.598 1.00   35.89  ? 392  LEU B CA  1 
ATOM   5746 C C   . LEU B 1 305 ? 20.733 14.077  -12.797 1.00   42.69  ? 392  LEU B C   1 
ATOM   5747 O O   . LEU B 1 305 ? 20.500 13.665  -13.932 1.00   44.40  ? 392  LEU B O   1 
ATOM   5748 C CB  . LEU B 1 305 ? 18.555 14.102  -11.644 1.00   38.75  ? 392  LEU B CB  1 
ATOM   5749 C CG  . LEU B 1 305 ? 17.558 13.728  -12.747 1.00   33.34  ? 392  LEU B CG  1 
ATOM   5750 C CD1 . LEU B 1 305 ? 17.332 12.249  -12.698 1.00   34.47  ? 392  LEU B CD1 1 
ATOM   5751 C CD2 . LEU B 1 305 ? 16.213 14.444  -12.520 1.00   35.09  ? 392  LEU B CD2 1 
ATOM   5752 N N   . GLU B 1 306 ? 21.599 15.071  -12.593 1.00   48.41  ? 393  GLU B N   1 
ATOM   5753 C CA  . GLU B 1 306 ? 22.340 15.613  -13.740 1.00   48.96  ? 393  GLU B CA  1 
ATOM   5754 C C   . GLU B 1 306 ? 23.776 15.134  -13.846 1.00   44.13  ? 393  GLU B C   1 
ATOM   5755 O O   . GLU B 1 306 ? 24.238 14.974  -14.963 1.00   41.82  ? 393  GLU B O   1 
ATOM   5756 C CB  . GLU B 1 306 ? 22.216 17.133  -13.897 1.00   50.37  ? 393  GLU B CB  1 
ATOM   5757 C CG  . GLU B 1 306 ? 22.249 17.923  -12.602 1.00   55.87  ? 393  GLU B CG  1 
ATOM   5758 C CD  . GLU B 1 306 ? 22.034 19.425  -12.767 1.00   59.16  ? 393  GLU B CD  1 
ATOM   5759 O OE1 . GLU B 1 306 ? 21.037 19.872  -13.390 1.00   63.76  ? 393  GLU B OE1 1 
ATOM   5760 O OE2 . GLU B 1 306 ? 22.889 20.174  -12.252 1.00   58.13  ? 393  GLU B OE2 1 
ATOM   5761 N N   . VAL B 1 307 ? 24.428 14.827  -12.726 1.00   41.34  ? 394  VAL B N   1 
ATOM   5762 C CA  . VAL B 1 307 ? 25.860 14.485  -12.735 1.00   40.27  ? 394  VAL B CA  1 
ATOM   5763 C C   . VAL B 1 307 ? 26.277 13.174  -12.069 1.00   42.06  ? 394  VAL B C   1 
ATOM   5764 O O   . VAL B 1 307 ? 27.453 12.810  -12.111 1.00   43.76  ? 394  VAL B O   1 
ATOM   5765 C CB  . VAL B 1 307 ? 26.697 15.549  -12.018 1.00   38.41  ? 394  VAL B CB  1 
ATOM   5766 C CG1 . VAL B 1 307 ? 26.387 16.934  -12.545 1.00   41.06  ? 394  VAL B CG1 1 
ATOM   5767 C CG2 . VAL B 1 307 ? 26.468 15.481  -10.503 1.00   39.58  ? 394  VAL B CG2 1 
ATOM   5768 N N   . ALA B 1 308 ? 25.347 12.445  -11.470 1.00   42.58  ? 395  ALA B N   1 
ATOM   5769 C CA  . ALA B 1 308 ? 25.713 11.237  -10.738 1.00   44.04  ? 395  ALA B CA  1 
ATOM   5770 C C   . ALA B 1 308 ? 25.937 10.073  -11.708 1.00   44.47  ? 395  ALA B C   1 
ATOM   5771 O O   . ALA B 1 308 ? 25.628 10.204  -12.893 1.00   40.13  ? 395  ALA B O   1 
ATOM   5772 C CB  . ALA B 1 308 ? 24.633 10.904  -9.733  1.00   43.88  ? 395  ALA B CB  1 
ATOM   5773 N N   . GLU B 1 309 ? 26.498 8.967   -11.219 1.00   42.90  ? 396  GLU B N   1 
ATOM   5774 C CA  . GLU B 1 309 ? 26.562 7.748   -12.018 1.00   44.60  ? 396  GLU B CA  1 
ATOM   5775 C C   . GLU B 1 309 ? 25.155 7.325   -12.385 1.00   40.77  ? 396  GLU B C   1 
ATOM   5776 O O   . GLU B 1 309 ? 24.233 7.632   -11.652 1.00   41.10  ? 396  GLU B O   1 
ATOM   5777 C CB  . GLU B 1 309 ? 27.265 6.625   -11.264 1.00   47.96  ? 396  GLU B CB  1 
ATOM   5778 C CG  . GLU B 1 309 ? 28.775 6.787   -11.329 1.00   56.43  ? 396  GLU B CG  1 
ATOM   5779 C CD  . GLU B 1 309 ? 29.531 5.756   -10.512 1.00   64.25  ? 396  GLU B CD  1 
ATOM   5780 O OE1 . GLU B 1 309 ? 29.030 4.618   -10.342 1.00   71.27  ? 396  GLU B OE1 1 
ATOM   5781 O OE2 . GLU B 1 309 ? 30.643 6.091   -10.048 1.00   67.26  ? 396  GLU B OE2 1 
ATOM   5782 N N   . ASP B 1 310 ? 25.001 6.657   -13.523 1.00   42.07  ? 397  ASP B N   1 
ATOM   5783 C CA  . ASP B 1 310 ? 23.719 6.202   -14.042 1.00   44.69  ? 397  ASP B CA  1 
ATOM   5784 C C   . ASP B 1 310 ? 22.843 5.501   -12.999 1.00   44.63  ? 397  ASP B C   1 
ATOM   5785 O O   . ASP B 1 310 ? 21.664 5.775   -12.894 1.00   44.50  ? 397  ASP B O   1 
ATOM   5786 C CB  . ASP B 1 310 ? 23.952 5.302   -15.266 1.00   48.90  ? 397  ASP B CB  1 
ATOM   5787 C CG  . ASP B 1 310 ? 24.210 6.106   -16.562 1.00   56.36  ? 397  ASP B CG  1 
ATOM   5788 O OD1 . ASP B 1 310 ? 24.385 7.348   -16.475 1.00   58.69  ? 397  ASP B OD1 1 
ATOM   5789 O OD2 . ASP B 1 310 ? 24.234 5.594   -17.718 1.00   55.04  ? 397  ASP B OD2 1 
ATOM   5790 N N   . LYS B 1 311 ? 23.402 4.596   -12.210 1.00   44.20  ? 398  LYS B N   1 
ATOM   5791 C CA  . LYS B 1 311 ? 22.589 3.860   -11.250 1.00   44.16  ? 398  LYS B CA  1 
ATOM   5792 C C   . LYS B 1 311 ? 21.976 4.813   -10.230 1.00   42.43  ? 398  LYS B C   1 
ATOM   5793 O O   . LYS B 1 311 ? 20.857 4.617   -9.741  1.00   39.96  ? 398  LYS B O   1 
ATOM   5794 C CB  . LYS B 1 311 ? 23.418 2.757   -10.580 1.00   47.41  ? 398  LYS B CB  1 
ATOM   5795 C CG  . LYS B 1 311 ? 24.629 3.276   -9.791  1.00   53.40  ? 398  LYS B CG  1 
ATOM   5796 C CD  . LYS B 1 311 ? 25.502 2.152   -9.203  1.00   59.20  ? 398  LYS B CD  1 
ATOM   5797 C CE  . LYS B 1 311 ? 26.840 2.643   -8.621  1.00   62.34  ? 398  LYS B CE  1 
ATOM   5798 N NZ  . LYS B 1 311 ? 27.709 1.533   -8.065  1.00   62.05  ? 398  LYS B NZ  1 
ATOM   5799 N N   . THR B 1 312 ? 22.724 5.857   -9.904  1.00   38.52  ? 399  THR B N   1 
ATOM   5800 C CA  . THR B 1 312 ? 22.236 6.837   -8.959  1.00   37.92  ? 399  THR B CA  1 
ATOM   5801 C C   . THR B 1 312 ? 21.214 7.762   -9.578  1.00   39.23  ? 399  THR B C   1 
ATOM   5802 O O   . THR B 1 312 ? 20.251 8.122   -8.937  1.00   41.91  ? 399  THR B O   1 
ATOM   5803 C CB  . THR B 1 312 ? 23.398 7.611   -8.407  1.00   39.17  ? 399  THR B CB  1 
ATOM   5804 O OG1 . THR B 1 312 ? 24.209 6.711   -7.643  1.00   41.92  ? 399  THR B OG1 1 
ATOM   5805 C CG2 . THR B 1 312 ? 22.960 8.634   -7.373  1.00   38.20  ? 399  THR B CG2 1 
ATOM   5806 N N   . LYS B 1 313 ? 21.416 8.153   -10.828 1.00   43.69  ? 400  LYS B N   1 
ATOM   5807 C CA  . LYS B 1 313 ? 20.444 8.969   -11.555 1.00   40.18  ? 400  LYS B CA  1 
ATOM   5808 C C   . LYS B 1 313 ? 19.072 8.307   -11.647 1.00   40.10  ? 400  LYS B C   1 
ATOM   5809 O O   . LYS B 1 313 ? 18.058 8.983   -11.554 1.00   39.56  ? 400  LYS B O   1 
ATOM   5810 C CB  . LYS B 1 313 ? 20.920 9.177   -12.977 1.00   38.56  ? 400  LYS B CB  1 
ATOM   5811 C CG  . LYS B 1 313 ? 22.051 10.134  -13.163 1.00   40.11  ? 400  LYS B CG  1 
ATOM   5812 C CD  . LYS B 1 313 ? 22.156 10.490  -14.652 1.00   44.68  ? 400  LYS B CD  1 
ATOM   5813 C CE  . LYS B 1 313 ? 23.326 11.449  -14.972 1.00   46.15  ? 400  LYS B CE  1 
ATOM   5814 N NZ  . LYS B 1 313 ? 23.269 11.923  -16.388 1.00   44.48  ? 400  LYS B NZ  1 
ATOM   5815 N N   . LYS B 1 314 ? 19.033 6.995   -11.885 1.00   41.42  ? 401  LYS B N   1 
ATOM   5816 C CA  . LYS B 1 314 ? 17.769 6.281   -12.065 1.00   39.18  ? 401  LYS B CA  1 
ATOM   5817 C C   . LYS B 1 314 ? 16.992 6.400   -10.770 1.00   38.73  ? 401  LYS B C   1 
ATOM   5818 O O   . LYS B 1 314 ? 15.845 6.807   -10.740 1.00   36.03  ? 401  LYS B O   1 
ATOM   5819 C CB  . LYS B 1 314 ? 17.989 4.810   -12.368 1.00   38.29  ? 401  LYS B CB  1 
ATOM   5820 C CG  . LYS B 1 314 ? 18.635 4.531   -13.702 1.00   42.67  ? 401  LYS B CG  1 
ATOM   5821 C CD  . LYS B 1 314 ? 18.866 3.043   -13.924 1.00   44.62  ? 401  LYS B CD  1 
ATOM   5822 C CE  . LYS B 1 314 ? 19.450 2.778   -15.332 1.00   47.49  ? 401  LYS B CE  1 
ATOM   5823 N NZ  . LYS B 1 314 ? 19.788 1.332   -15.595 1.00   50.09  ? 401  LYS B NZ  1 
ATOM   5824 N N   . GLU B 1 315 ? 17.659 6.062   -9.678  1.00   40.38  ? 402  GLU B N   1 
ATOM   5825 C CA  . GLU B 1 315 ? 17.081 6.194   -8.357  1.00   37.41  ? 402  GLU B CA  1 
ATOM   5826 C C   . GLU B 1 315 ? 16.603 7.626   -8.057  1.00   33.84  ? 402  GLU B C   1 
ATOM   5827 O O   . GLU B 1 315 ? 15.487 7.880   -7.610  1.00   32.33  ? 402  GLU B O   1 
ATOM   5828 C CB  . GLU B 1 315 ? 18.113 5.673   -7.368  1.00   38.89  ? 402  GLU B CB  1 
ATOM   5829 C CG  . GLU B 1 315 ? 17.576 4.599   -6.453  1.00   43.47  ? 402  GLU B CG  1 
ATOM   5830 C CD  . GLU B 1 315 ? 16.941 3.429   -7.173  1.00   45.68  ? 402  GLU B CD  1 
ATOM   5831 O OE1 . GLU B 1 315 ? 17.630 2.734   -7.910  1.00   51.15  ? 402  GLU B OE1 1 
ATOM   5832 O OE2 . GLU B 1 315 ? 15.755 3.157   -6.975  1.00   46.70  ? 402  GLU B OE2 1 
ATOM   5833 N N   . ALA B 1 316 ? 17.407 8.610   -8.399  1.00   32.04  ? 403  ALA B N   1 
ATOM   5834 C CA  . ALA B 1 316 ? 16.986 9.986   -8.183  1.00   29.67  ? 403  ALA B CA  1 
ATOM   5835 C C   . ALA B 1 316 ? 15.770 10.373  -9.036  1.00   32.07  ? 403  ALA B C   1 
ATOM   5836 O O   . ALA B 1 316 ? 14.924 11.190  -8.648  1.00   29.16  ? 403  ALA B O   1 
ATOM   5837 C CB  . ALA B 1 316 ? 18.134 10.881  -8.472  1.00   28.15  ? 403  ALA B CB  1 
ATOM   5838 N N   . CYS B 1 317 ? 15.712 9.804   -10.237 1.00   34.69  ? 404  CYS B N   1 
ATOM   5839 C CA  . CYS B 1 317 ? 14.620 10.034  -11.179 1.00   31.46  ? 404  CYS B CA  1 
ATOM   5840 C C   . CYS B 1 317 ? 13.338 9.465   -10.605 1.00   23.37  ? 404  CYS B C   1 
ATOM   5841 O O   . CYS B 1 317 ? 12.308 10.112  -10.594 1.00   28.03  ? 404  CYS B O   1 
ATOM   5842 C CB  . CYS B 1 317 ? 14.927 9.379   -12.518 1.00   34.23  ? 404  CYS B CB  1 
ATOM   5843 S SG  . CYS B 1 317 ? 13.524 9.414   -13.660 1.00   39.71  ? 404  CYS B SG  1 
ATOM   5844 N N   . TRP B 1 318 ? 13.400 8.275   -10.049 1.00   23.53  ? 405  TRP B N   1 
ATOM   5845 C CA  . TRP B 1 318 ? 12.243 7.751   -9.325  1.00   25.60  ? 405  TRP B CA  1 
ATOM   5846 C C   . TRP B 1 318 ? 11.795 8.696   -8.216  1.00   24.85  ? 405  TRP B C   1 
ATOM   5847 O O   . TRP B 1 318 ? 10.617 8.971   -8.108  1.00   27.63  ? 405  TRP B O   1 
ATOM   5848 C CB  . TRP B 1 318 ? 12.546 6.410   -8.679  1.00   25.69  ? 405  TRP B CB  1 
ATOM   5849 C CG  . TRP B 1 318 ? 12.401 5.249   -9.605  1.00   26.51  ? 405  TRP B CG  1 
ATOM   5850 C CD1 . TRP B 1 318 ? 13.408 4.573   -10.271 1.00   23.30  ? 405  TRP B CD1 1 
ATOM   5851 C CD2 . TRP B 1 318 ? 11.188 4.567   -9.913  1.00   28.70  ? 405  TRP B CD2 1 
ATOM   5852 N NE1 . TRP B 1 318 ? 12.874 3.536   -10.999 1.00   29.13  ? 405  TRP B NE1 1 
ATOM   5853 C CE2 . TRP B 1 318 ? 11.517 3.497   -10.788 1.00   31.60  ? 405  TRP B CE2 1 
ATOM   5854 C CE3 . TRP B 1 318 ? 9.846  4.775   -9.573  1.00   33.96  ? 405  TRP B CE3 1 
ATOM   5855 C CZ2 . TRP B 1 318 ? 10.549 2.668   -11.348 1.00   30.99  ? 405  TRP B CZ2 1 
ATOM   5856 C CZ3 . TRP B 1 318 ? 8.889  3.927   -10.105 1.00   36.11  ? 405  TRP B CZ3 1 
ATOM   5857 C CH2 . TRP B 1 318 ? 9.251  2.879   -10.975 1.00   33.35  ? 405  TRP B CH2 1 
ATOM   5858 N N   . ALA B 1 319 ? 12.727 9.233   -7.441  1.00   23.85  ? 406  ALA B N   1 
ATOM   5859 C CA  . ALA B 1 319 ? 12.389 10.145  -6.350  1.00   28.30  ? 406  ALA B CA  1 
ATOM   5860 C C   . ALA B 1 319 ? 11.630 11.382  -6.817  1.00   29.57  ? 406  ALA B C   1 
ATOM   5861 O O   . ALA B 1 319 ? 10.578 11.733  -6.296  1.00   31.01  ? 406  ALA B O   1 
ATOM   5862 C CB  . ALA B 1 319 ? 13.648 10.544  -5.545  1.00   28.03  ? 406  ALA B CB  1 
ATOM   5863 N N   . ILE B 1 320 ? 12.135 12.013  -7.858  1.00   33.42  ? 407  ILE B N   1 
ATOM   5864 C CA  . ILE B 1 320 ? 11.516 13.241  -8.345  1.00   33.12  ? 407  ILE B CA  1 
ATOM   5865 C C   . ILE B 1 320 ? 10.213 12.910  -9.065  1.00   29.81  ? 407  ILE B C   1 
ATOM   5866 O O   . ILE B 1 320 ? 9.200  13.593  -8.940  1.00   30.16  ? 407  ILE B O   1 
ATOM   5867 C CB  . ILE B 1 320 ? 12.518 13.974  -9.247  1.00   32.81  ? 407  ILE B CB  1 
ATOM   5868 C CG1 . ILE B 1 320 ? 13.539 14.660  -8.335  1.00   36.97  ? 407  ILE B CG1 1 
ATOM   5869 C CG2 . ILE B 1 320 ? 11.803 14.914  -10.204 1.00   31.95  ? 407  ILE B CG2 1 
ATOM   5870 C CD1 . ILE B 1 320 ? 14.900 14.861  -8.965  1.00   41.44  ? 407  ILE B CD1 1 
ATOM   5871 N N   . SER B 1 321 ? 10.230 11.833  -9.820  1.00   26.13  ? 408  SER B N   1 
ATOM   5872 C CA  . SER B 1 321 ? 9.025  11.442  -10.531 1.00   28.54  ? 408  SER B CA  1 
ATOM   5873 C C   . SER B 1 321 ? 7.899  11.035  -9.568  1.00   23.43  ? 408  SER B C   1 
ATOM   5874 O O   . SER B 1 321 ? 6.786  11.507  -9.675  1.00   20.55  ? 408  SER B O   1 
ATOM   5875 C CB  . SER B 1 321 ? 9.351  10.301  -11.510 1.00   30.67  ? 408  SER B CB  1 
ATOM   5876 O OG  . SER B 1 321 ? 8.173  9.930   -12.217 1.00   38.07  ? 408  SER B OG  1 
ATOM   5877 N N   . ASN B 1 322 ? 8.155  10.173  -8.593  1.00   26.09  ? 409  ASN B N   1 
ATOM   5878 C CA  . ASN B 1 322 ? 7.106  9.851   -7.614  1.00   26.71  ? 409  ASN B CA  1 
ATOM   5879 C C   . ASN B 1 322 ? 6.478  11.108  -7.029  1.00   28.19  ? 409  ASN B C   1 
ATOM   5880 O O   . ASN B 1 322 ? 5.281  11.139  -6.782  1.00   26.22  ? 409  ASN B O   1 
ATOM   5881 C CB  . ASN B 1 322 ? 7.619  9.012   -6.445  1.00   24.46  ? 409  ASN B CB  1 
ATOM   5882 C CG  . ASN B 1 322 ? 7.985  7.589   -6.864  1.00   28.08  ? 409  ASN B CG  1 
ATOM   5883 O OD1 . ASN B 1 322 ? 7.716  7.204   -7.991  1.00   25.13  ? 409  ASN B OD1 1 
ATOM   5884 N ND2 . ASN B 1 322 ? 8.712  6.865   -6.007  1.00   23.89  ? 409  ASN B ND2 1 
ATOM   5885 N N   . ALA B 1 323 ? 7.311  12.118  -6.784  1.00   28.38  ? 410  ALA B N   1 
ATOM   5886 C CA  . ALA B 1 323 ? 6.900  13.309  -6.084  1.00   28.23  ? 410  ALA B CA  1 
ATOM   5887 C C   . ALA B 1 323 ? 5.899  14.072  -6.922  1.00   30.79  ? 410  ALA B C   1 
ATOM   5888 O O   . ALA B 1 323 ? 4.982  14.691  -6.370  1.00   26.75  ? 410  ALA B O   1 
ATOM   5889 C CB  . ALA B 1 323 ? 8.114  14.162  -5.756  1.00   31.19  ? 410  ALA B CB  1 
ATOM   5890 N N   . SER B 1 324 ? 6.066  14.013  -8.246  1.00   32.64  ? 411  SER B N   1 
ATOM   5891 C CA  . SER B 1 324 ? 5.200  14.719  -9.185  1.00   30.80  ? 411  SER B CA  1 
ATOM   5892 C C   . SER B 1 324 ? 3.817  14.072  -9.293  1.00   36.66  ? 411  SER B C   1 
ATOM   5893 O O   . SER B 1 324 ? 2.947  14.513  -10.049 1.00   42.69  ? 411  SER B O   1 
ATOM   5894 C CB  . SER B 1 324 ? 5.927  14.807  -10.540 1.00   31.13  ? 411  SER B CB  1 
ATOM   5895 O OG  . SER B 1 324 ? 6.092  13.559  -11.221 1.00   33.53  ? 411  SER B OG  1 
ATOM   5896 N N   . SER B 1 325 ? 3.604  12.971  -8.583  1.00   42.92  ? 412  SER B N   1 
ATOM   5897 C CA  . SER B 1 325 ? 2.280  12.335  -8.458  1.00   46.05  ? 412  SER B CA  1 
ATOM   5898 C C   . SER B 1 325 ? 1.341  13.175  -7.619  1.00   49.52  ? 412  SER B C   1 
ATOM   5899 O O   . SER B 1 325 ? 0.138  13.212  -7.881  1.00   52.54  ? 412  SER B O   1 
ATOM   5900 C CB  . SER B 1 325 ? 2.387  11.039  -7.677  1.00   43.50  ? 412  SER B CB  1 
ATOM   5901 O OG  . SER B 1 325 ? 3.199  10.199  -8.437  1.00   51.24  ? 412  SER B OG  1 
ATOM   5902 N N   . GLY B 1 326 ? 1.904  13.757  -6.560  1.00   52.37  ? 413  GLY B N   1 
ATOM   5903 C CA  . GLY B 1 326 ? 1.180  14.602  -5.633  1.00   59.01  ? 413  GLY B CA  1 
ATOM   5904 C C   . GLY B 1 326 ? 0.915  15.982  -6.198  1.00   62.95  ? 413  GLY B C   1 
ATOM   5905 O O   . GLY B 1 326 ? 0.195  16.788  -5.597  1.00   64.26  ? 413  GLY B O   1 
ATOM   5906 N N   . GLY B 1 327 ? 1.499  16.254  -7.360  1.00   66.30  ? 414  GLY B N   1 
ATOM   5907 C CA  . GLY B 1 327 ? 1.242  17.485  -8.084  1.00   69.27  ? 414  GLY B CA  1 
ATOM   5908 C C   . GLY B 1 327 ? -0.170 17.623  -8.631  1.00   72.09  ? 414  GLY B C   1 
ATOM   5909 O O   . GLY B 1 327 ? -0.607 18.707  -9.037  1.00   75.27  ? 414  GLY B O   1 
ATOM   5910 N N   . LEU B 1 328 ? -0.905 16.520  -8.639  1.00   72.48  ? 415  LEU B N   1 
ATOM   5911 C CA  . LEU B 1 328 ? -2.249 16.539  -9.190  1.00   74.08  ? 415  LEU B CA  1 
ATOM   5912 C C   . LEU B 1 328 ? -3.232 17.052  -8.132  1.00   70.91  ? 415  LEU B C   1 
ATOM   5913 O O   . LEU B 1 328 ? -4.184 17.753  -8.476  1.00   67.82  ? 415  LEU B O   1 
ATOM   5914 C CB  . LEU B 1 328 ? -2.545 15.156  -9.779  1.00   76.71  ? 415  LEU B CB  1 
ATOM   5915 C CG  . LEU B 1 328 ? -1.312 14.662  -10.585 1.00   80.46  ? 415  LEU B CG  1 
ATOM   5916 C CD1 . LEU B 1 328 ? -1.598 13.350  -11.365 1.00   79.63  ? 415  LEU B CD1 1 
ATOM   5917 C CD2 . LEU B 1 328 ? -0.723 15.753  -11.555 1.00   82.21  ? 415  LEU B CD2 1 
ATOM   5918 N N   . GLN B 1 329 ? -2.926 16.765  -6.863  1.00   68.97  ? 416  GLN B N   1 
ATOM   5919 C CA  . GLN B 1 329 ? -3.669 17.235  -5.680  1.00   69.01  ? 416  GLN B CA  1 
ATOM   5920 C C   . GLN B 1 329 ? -3.019 18.413  -4.953  1.00   66.15  ? 416  GLN B C   1 
ATOM   5921 O O   . GLN B 1 329 ? -3.620 19.023  -4.060  1.00   64.51  ? 416  GLN B O   1 
ATOM   5922 C CB  . GLN B 1 329 ? -3.788 16.159  -4.605  1.00   71.95  ? 416  GLN B CB  1 
ATOM   5923 C CG  . GLN B 1 329 ? -4.056 14.759  -5.102  1.00   81.49  ? 416  GLN B CG  1 
ATOM   5924 C CD  . GLN B 1 329 ? -3.282 13.747  -4.277  1.00   88.24  ? 416  GLN B CD  1 
ATOM   5925 O OE1 . GLN B 1 329 ? -3.527 13.616  -3.072  1.00   93.13  ? 416  GLN B OE1 1 
ATOM   5926 N NE2 . GLN B 1 329 ? -2.317 13.068  -4.903  1.00   91.53  ? 416  GLN B NE2 1 
ATOM   5927 N N   . ARG B 1 330 ? -1.765 18.685  -5.292  1.00   62.08  ? 417  ARG B N   1 
ATOM   5928 C CA  . ARG B 1 330 ? -1.093 19.875  -4.800  1.00   57.64  ? 417  ARG B CA  1 
ATOM   5929 C C   . ARG B 1 330 ? -0.157 20.368  -5.893  1.00   51.95  ? 417  ARG B C   1 
ATOM   5930 O O   . ARG B 1 330 ? 0.967  19.903  -6.040  1.00   48.06  ? 417  ARG B O   1 
ATOM   5931 C CB  . ARG B 1 330 ? -0.357 19.616  -3.490  1.00   58.04  ? 417  ARG B CB  1 
ATOM   5932 C CG  . ARG B 1 330 ? 0.142  20.910  -2.858  1.00   57.60  ? 417  ARG B CG  1 
ATOM   5933 C CD  . ARG B 1 330 ? 0.869  20.745  -1.532  1.00   54.03  ? 417  ARG B CD  1 
ATOM   5934 N NE  . ARG B 1 330 ? 0.022  20.229  -0.473  1.00   49.10  ? 417  ARG B NE  1 
ATOM   5935 C CZ  . ARG B 1 330 ? 0.462  19.916  0.742   1.00   50.88  ? 417  ARG B CZ  1 
ATOM   5936 N NH1 . ARG B 1 330 ? 1.733  20.073  1.069   1.00   50.16  ? 417  ARG B NH1 1 
ATOM   5937 N NH2 . ARG B 1 330 ? -0.372 19.422  1.647   1.00   50.00  ? 417  ARG B NH2 1 
ATOM   5938 N N   . PRO B 1 331 ? -0.665 21.278  -6.704  1.00   49.72  ? 418  PRO B N   1 
ATOM   5939 C CA  . PRO B 1 331 ? 0.131  21.879  -7.765  1.00   48.68  ? 418  PRO B CA  1 
ATOM   5940 C C   . PRO B 1 331 ? 1.351  22.619  -7.267  1.00   46.21  ? 418  PRO B C   1 
ATOM   5941 O O   . PRO B 1 331 ? 2.300  22.696  -8.038  1.00   48.30  ? 418  PRO B O   1 
ATOM   5942 C CB  . PRO B 1 331 ? -0.865 22.828  -8.439  1.00   50.85  ? 418  PRO B CB  1 
ATOM   5943 C CG  . PRO B 1 331 ? -1.884 23.071  -7.474  1.00   51.74  ? 418  PRO B CG  1 
ATOM   5944 C CD  . PRO B 1 331 ? -2.049 21.782  -6.728  1.00   51.12  ? 418  PRO B CD  1 
ATOM   5945 N N   . ASP B 1 332 ? 1.349  23.125  -6.041  1.00   44.33  ? 419  ASP B N   1 
ATOM   5946 C CA  . ASP B 1 332 ? 2.549  23.737  -5.473  1.00   47.01  ? 419  ASP B CA  1 
ATOM   5947 C C   . ASP B 1 332 ? 3.770  22.837  -5.546  1.00   41.15  ? 419  ASP B C   1 
ATOM   5948 O O   . ASP B 1 332 ? 4.887  23.342  -5.572  1.00   41.00  ? 419  ASP B O   1 
ATOM   5949 C CB  . ASP B 1 332 ? 2.377  24.030  -3.984  1.00   54.85  ? 419  ASP B CB  1 
ATOM   5950 C CG  . ASP B 1 332 ? 1.229  24.976  -3.691  1.00   64.33  ? 419  ASP B CG  1 
ATOM   5951 O OD1 . ASP B 1 332 ? 0.046  24.516  -3.633  1.00   67.09  ? 419  ASP B OD1 1 
ATOM   5952 O OD2 . ASP B 1 332 ? 1.463  26.195  -3.500  1.00   66.30  ? 419  ASP B OD2 1 
ATOM   5953 N N   . ILE B 1 333 ? 3.571  21.521  -5.506  1.00   37.76  ? 420  ILE B N   1 
ATOM   5954 C CA  . ILE B 1 333 ? 4.676  20.572  -5.553  1.00   37.43  ? 420  ILE B CA  1 
ATOM   5955 C C   . ILE B 1 333 ? 5.326  20.577  -6.925  1.00   36.29  ? 420  ILE B C   1 
ATOM   5956 O O   . ILE B 1 333 ? 6.538  20.684  -7.003  1.00   44.63  ? 420  ILE B O   1 
ATOM   5957 C CB  . ILE B 1 333 ? 4.219  19.165  -5.167  1.00   38.44  ? 420  ILE B CB  1 
ATOM   5958 C CG1 . ILE B 1 333 ? 3.856  19.105  -3.676  1.00   37.45  ? 420  ILE B CG1 1 
ATOM   5959 C CG2 . ILE B 1 333 ? 5.321  18.152  -5.408  1.00   39.64  ? 420  ILE B CG2 1 
ATOM   5960 C CD1 . ILE B 1 333 ? 2.954  17.951  -3.320  1.00   33.60  ? 420  ILE B CD1 1 
ATOM   5961 N N   . ILE B 1 334 ? 4.566  20.458  -7.997  1.00   31.36  ? 421  ILE B N   1 
ATOM   5962 C CA  . ILE B 1 334 ? 5.146  20.517  -9.329  1.00   36.99  ? 421  ILE B CA  1 
ATOM   5963 C C   . ILE B 1 334 ? 5.830  21.845  -9.573  1.00   37.86  ? 421  ILE B C   1 
ATOM   5964 O O   . ILE B 1 334 ? 6.890  21.870  -10.187 1.00   42.11  ? 421  ILE B O   1 
ATOM   5965 C CB  . ILE B 1 334 ? 4.083  20.378  -10.456 1.00   39.77  ? 421  ILE B CB  1 
ATOM   5966 C CG1 . ILE B 1 334 ? 3.452  18.987  -10.441 1.00   40.54  ? 421  ILE B CG1 1 
ATOM   5967 C CG2 . ILE B 1 334 ? 4.689  20.726  -11.823 1.00   33.86  ? 421  ILE B CG2 1 
ATOM   5968 C CD1 . ILE B 1 334 ? 4.388  17.921  -10.903 1.00   44.82  ? 421  ILE B CD1 1 
ATOM   5969 N N   . ARG B 1 335 ? 5.200  22.940  -9.162  1.00   35.90  ? 422  ARG B N   1 
ATOM   5970 C CA  . ARG B 1 335 ? 5.783  24.251  -9.356  1.00   38.38  ? 422  ARG B CA  1 
ATOM   5971 C C   . ARG B 1 335 ? 7.171  24.334  -8.733  1.00   39.83  ? 422  ARG B C   1 
ATOM   5972 O O   . ARG B 1 335 ? 8.097  24.938  -9.298  1.00   39.84  ? 422  ARG B O   1 
ATOM   5973 C CB  . ARG B 1 335 ? 4.924  25.314  -8.693  1.00   41.54  ? 422  ARG B CB  1 
ATOM   5974 C CG  . ARG B 1 335 ? 3.607  25.571  -9.391  1.00   46.74  ? 422  ARG B CG  1 
ATOM   5975 C CD  . ARG B 1 335 ? 2.976  26.902  -9.027  1.00   49.41  ? 422  ARG B CD  1 
ATOM   5976 N NE  . ARG B 1 335 ? 1.616  26.919  -9.555  1.00   52.66  ? 422  ARG B NE  1 
ATOM   5977 C CZ  . ARG B 1 335 ? 0.516  26.654  -8.853  1.00   51.60  ? 422  ARG B CZ  1 
ATOM   5978 N NH1 . ARG B 1 335 ? 0.587  26.371  -7.553  1.00   50.75  ? 422  ARG B NH1 1 
ATOM   5979 N NH2 . ARG B 1 335 ? -0.671 26.689  -9.457  1.00   50.41  ? 422  ARG B NH2 1 
ATOM   5980 N N   . TYR B 1 336 ? 7.284  23.757  -7.537  1.00   35.87  ? 423  TYR B N   1 
ATOM   5981 C CA  . TYR B 1 336 ? 8.523  23.848  -6.825  1.00   34.16  ? 423  TYR B CA  1 
ATOM   5982 C C   . TYR B 1 336 ? 9.524  22.988  -7.565  1.00   36.27  ? 423  TYR B C   1 
ATOM   5983 O O   . TYR B 1 336 ? 10.659 23.422  -7.751  1.00   43.96  ? 423  TYR B O   1 
ATOM   5984 C CB  . TYR B 1 336 ? 8.349  23.481  -5.368  1.00   33.36  ? 423  TYR B CB  1 
ATOM   5985 C CG  . TYR B 1 336 ? 9.650  23.311  -4.627  1.00   30.62  ? 423  TYR B CG  1 
ATOM   5986 C CD1 . TYR B 1 336 ? 10.274 24.377  -4.013  1.00   34.69  ? 423  TYR B CD1 1 
ATOM   5987 C CD2 . TYR B 1 336 ? 10.242 22.072  -4.518  1.00   25.13  ? 423  TYR B CD2 1 
ATOM   5988 C CE1 . TYR B 1 336 ? 11.471 24.215  -3.294  1.00   32.02  ? 423  TYR B CE1 1 
ATOM   5989 C CE2 . TYR B 1 336 ? 11.457 21.922  -3.892  1.00   33.18  ? 423  TYR B CE2 1 
ATOM   5990 C CZ  . TYR B 1 336 ? 12.053 22.985  -3.246  1.00   32.46  ? 423  TYR B CZ  1 
ATOM   5991 O OH  . TYR B 1 336 ? 13.236 22.812  -2.573  1.00   36.31  ? 423  TYR B OH  1 
ATOM   5992 N N   . LEU B 1 337 ? 9.134  21.795  -7.997  1.00   33.42  ? 424  LEU B N   1 
ATOM   5993 C CA  . LEU B 1 337 ? 10.057 20.914  -8.720  1.00   33.08  ? 424  LEU B CA  1 
ATOM   5994 C C   . LEU B 1 337 ? 10.627 21.551  -9.987  1.00   32.03  ? 424  LEU B C   1 
ATOM   5995 O O   . LEU B 1 337 ? 11.820 21.460  -10.232 1.00   31.85  ? 424  LEU B O   1 
ATOM   5996 C CB  . LEU B 1 337 ? 9.351  19.625  -9.120  1.00   30.86  ? 424  LEU B CB  1 
ATOM   5997 C CG  . LEU B 1 337 ? 8.939  18.728  -7.971  1.00   29.87  ? 424  LEU B CG  1 
ATOM   5998 C CD1 . LEU B 1 337 ? 8.136  17.553  -8.518  1.00   30.28  ? 424  LEU B CD1 1 
ATOM   5999 C CD2 . LEU B 1 337 ? 10.108 18.226  -7.128  1.00   29.80  ? 424  LEU B CD2 1 
ATOM   6000 N N   . VAL B 1 338 ? 9.764  22.199  -10.765 1.00   30.59  ? 425  VAL B N   1 
ATOM   6001 C CA  . VAL B 1 338 ? 10.141 22.910  -11.980 1.00   32.69  ? 425  VAL B CA  1 
ATOM   6002 C C   . VAL B 1 338 ? 11.118 24.071  -11.693 1.00   35.87  ? 425  VAL B C   1 
ATOM   6003 O O   . VAL B 1 338 ? 12.160 24.227  -12.340 1.00   35.17  ? 425  VAL B O   1 
ATOM   6004 C CB  . VAL B 1 338 ? 8.889  23.500  -12.646 1.00   30.34  ? 425  VAL B CB  1 
ATOM   6005 C CG1 . VAL B 1 338 ? 9.259  24.357  -13.840 1.00   31.56  ? 425  VAL B CG1 1 
ATOM   6006 C CG2 . VAL B 1 338 ? 7.967  22.384  -13.114 1.00   33.95  ? 425  VAL B CG2 1 
ATOM   6007 N N   . SER B 1 339 ? 10.761 24.861  -10.687 1.00   36.01  ? 426  SER B N   1 
ATOM   6008 C CA  . SER B 1 339 ? 11.553 25.992  -10.261 1.00   41.51  ? 426  SER B CA  1 
ATOM   6009 C C   . SER B 1 339 ? 12.925 25.564  -9.741  1.00   41.87  ? 426  SER B C   1 
ATOM   6010 O O   . SER B 1 339 ? 13.884 26.324  -9.867  1.00   47.12  ? 426  SER B O   1 
ATOM   6011 C CB  . SER B 1 339 ? 10.806 26.845  -9.229  1.00   41.32  ? 426  SER B CB  1 
ATOM   6012 O OG  . SER B 1 339 ? 11.099 26.355  -7.949  1.00   47.85  ? 426  SER B OG  1 
ATOM   6013 N N   . GLN B 1 340 ? 13.039 24.359  -9.194  1.00   39.09  ? 427  GLN B N   1 
ATOM   6014 C CA  . GLN B 1 340 ? 14.358 23.800  -8.870  1.00   37.04  ? 427  GLN B CA  1 
ATOM   6015 C C   . GLN B 1 340 ? 15.120 23.230  -10.085 1.00   34.17  ? 427  GLN B C   1 
ATOM   6016 O O   . GLN B 1 340 ? 16.178 22.645  -9.944  1.00   33.69  ? 427  GLN B O   1 
ATOM   6017 C CB  . GLN B 1 340 ? 14.220 22.715  -7.817  1.00   33.99  ? 427  GLN B CB  1 
ATOM   6018 C CG  . GLN B 1 340 ? 13.745 23.192  -6.480  1.00   37.88  ? 427  GLN B CG  1 
ATOM   6019 C CD  . GLN B 1 340 ? 14.671 24.219  -5.833  1.00   42.21  ? 427  GLN B CD  1 
ATOM   6020 O OE1 . GLN B 1 340 ? 15.896 24.060  -5.785  1.00   49.56  ? 427  GLN B OE1 1 
ATOM   6021 N NE2 . GLN B 1 340 ? 14.071 25.270  -5.311  1.00   37.14  ? 427  GLN B NE2 1 
ATOM   6022 N N   . GLY B 1 341 ? 14.580 23.344  -11.288 1.00   36.92  ? 428  GLY B N   1 
ATOM   6023 C CA  . GLY B 1 341 ? 15.312 22.907  -12.469 1.00   40.16  ? 428  GLY B CA  1 
ATOM   6024 C C   . GLY B 1 341 ? 15.356 21.423  -12.780 1.00   40.09  ? 428  GLY B C   1 
ATOM   6025 O O   . GLY B 1 341 ? 16.356 20.892  -13.293 1.00   39.61  ? 428  GLY B O   1 
ATOM   6026 N N   . CYS B 1 342 ? 14.242 20.751  -12.537 1.00   39.33  ? 429  CYS B N   1 
ATOM   6027 C CA  . CYS B 1 342 ? 14.238 19.306  -12.695 1.00   40.79  ? 429  CYS B CA  1 
ATOM   6028 C C   . CYS B 1 342 ? 13.862 18.886  -14.094 1.00   38.69  ? 429  CYS B C   1 
ATOM   6029 O O   . CYS B 1 342 ? 14.128 17.772  -14.475 1.00   38.53  ? 429  CYS B O   1 
ATOM   6030 C CB  . CYS B 1 342 ? 13.291 18.662  -11.701 1.00   42.21  ? 429  CYS B CB  1 
ATOM   6031 S SG  . CYS B 1 342 ? 11.604 19.018  -12.199 1.00   53.64  ? 429  CYS B SG  1 
ATOM   6032 N N   . ILE B 1 343 ? 13.328 19.802  -14.883 1.00   40.60  ? 430  ILE B N   1 
ATOM   6033 C CA  . ILE B 1 343 ? 12.944 19.534  -16.270 1.00   39.92  ? 430  ILE B CA  1 
ATOM   6034 C C   . ILE B 1 343 ? 14.116 19.064  -17.158 1.00   42.25  ? 430  ILE B C   1 
ATOM   6035 O O   . ILE B 1 343 ? 14.071 17.952  -17.692 1.00   43.27  ? 430  ILE B O   1 
ATOM   6036 C CB  . ILE B 1 343 ? 12.215 20.779  -16.841 1.00   37.90  ? 430  ILE B CB  1 
ATOM   6037 C CG1 . ILE B 1 343 ? 10.807 20.806  -16.268 1.00   41.50  ? 430  ILE B CG1 1 
ATOM   6038 C CG2 . ILE B 1 343 ? 12.086 20.731  -18.330 1.00   40.83  ? 430  ILE B CG2 1 
ATOM   6039 C CD1 . ILE B 1 343 ? 9.983  21.989  -16.709 1.00   46.50  ? 430  ILE B CD1 1 
ATOM   6040 N N   . LYS B 1 344 ? 15.166 19.877  -17.275 1.00   42.76  ? 431  LYS B N   1 
ATOM   6041 C CA  . LYS B 1 344 ? 16.312 19.539  -18.109 1.00   45.19  ? 431  LYS B CA  1 
ATOM   6042 C C   . LYS B 1 344 ? 16.916 18.181  -17.758 1.00   40.00  ? 431  LYS B C   1 
ATOM   6043 O O   . LYS B 1 344 ? 17.060 17.367  -18.639 1.00   43.70  ? 431  LYS B O   1 
ATOM   6044 C CB  . LYS B 1 344 ? 17.385 20.664  -18.205 1.00   46.07  ? 431  LYS B CB  1 
ATOM   6045 C CG  . LYS B 1 344 ? 18.324 20.468  -19.435 1.00   52.14  ? 431  LYS B CG  1 
ATOM   6046 C CD  . LYS B 1 344 ? 19.254 21.652  -19.825 1.00   57.60  ? 431  LYS B CD  1 
ATOM   6047 C CE  . LYS B 1 344 ? 18.492 22.907  -20.312 1.00   61.06  ? 431  LYS B CE  1 
ATOM   6048 N NZ  . LYS B 1 344 ? 19.266 23.975  -21.036 1.00   54.69  ? 431  LYS B NZ  1 
ATOM   6049 N N   . PRO B 1 345 ? 17.277 17.894  -16.520 1.00   40.05  ? 432  PRO B N   1 
ATOM   6050 C CA  . PRO B 1 345 ? 17.858 16.590  -16.209 1.00   39.13  ? 432  PRO B CA  1 
ATOM   6051 C C   . PRO B 1 345 ? 16.909 15.426  -16.553 1.00   41.87  ? 432  PRO B C   1 
ATOM   6052 O O   . PRO B 1 345 ? 17.386 14.383  -16.999 1.00   40.21  ? 432  PRO B O   1 
ATOM   6053 C CB  . PRO B 1 345 ? 18.088 16.674  -14.704 1.00   41.83  ? 432  PRO B CB  1 
ATOM   6054 C CG  . PRO B 1 345 ? 18.115 18.113  -14.358 1.00   41.29  ? 432  PRO B CG  1 
ATOM   6055 C CD  . PRO B 1 345 ? 17.175 18.751  -15.325 1.00   43.26  ? 432  PRO B CD  1 
ATOM   6056 N N   . LEU B 1 346 ? 15.600 15.586  -16.344 1.00   40.50  ? 433  LEU B N   1 
ATOM   6057 C CA  . LEU B 1 346 ? 14.643 14.538  -16.693 1.00   38.91  ? 433  LEU B CA  1 
ATOM   6058 C C   . LEU B 1 346 ? 14.659 14.348  -18.197 1.00   41.16  ? 433  LEU B C   1 
ATOM   6059 O O   . LEU B 1 346 ? 14.745 13.232  -18.703 1.00   39.80  ? 433  LEU B O   1 
ATOM   6060 C CB  . LEU B 1 346 ? 13.214 14.886  -16.284 1.00   36.93  ? 433  LEU B CB  1 
ATOM   6061 C CG  . LEU B 1 346 ? 12.887 14.862  -14.795 1.00   32.96  ? 433  LEU B CG  1 
ATOM   6062 C CD1 . LEU B 1 346 ? 11.536 15.470  -14.570 1.00   26.64  ? 433  LEU B CD1 1 
ATOM   6063 C CD2 . LEU B 1 346 ? 12.967 13.490  -14.255 1.00   35.91  ? 433  LEU B CD2 1 
ATOM   6064 N N   . CYS B 1 347 ? 14.530 15.448  -18.924 1.00   42.30  ? 434  CYS B N   1 
ATOM   6065 C CA  . CYS B 1 347 ? 14.582 15.378  -20.375 1.00   39.88  ? 434  CYS B CA  1 
ATOM   6066 C C   . CYS B 1 347 ? 15.844 14.664  -20.829 1.00   39.09  ? 434  CYS B C   1 
ATOM   6067 O O   . CYS B 1 347 ? 15.768 13.744  -21.649 1.00   38.34  ? 434  CYS B O   1 
ATOM   6068 C CB  . CYS B 1 347 ? 14.535 16.779  -20.963 1.00   40.79  ? 434  CYS B CB  1 
ATOM   6069 S SG  . CYS B 1 347 ? 12.869 17.517  -20.916 1.00   39.85  ? 434  CYS B SG  1 
ATOM   6070 N N   . ASP B 1 348 ? 16.987 15.045  -20.260 1.00   38.31  ? 435  ASP B N   1 
ATOM   6071 C CA  . ASP B 1 348 ? 18.276 14.490  -20.682 1.00   40.54  ? 435  ASP B CA  1 
ATOM   6072 C C   . ASP B 1 348 ? 18.386 12.996  -20.454 1.00   40.56  ? 435  ASP B C   1 
ATOM   6073 O O   . ASP B 1 348 ? 19.191 12.321  -21.095 1.00   42.00  ? 435  ASP B O   1 
ATOM   6074 C CB  . ASP B 1 348 ? 19.452 15.223  -20.024 1.00   39.30  ? 435  ASP B CB  1 
ATOM   6075 C CG  . ASP B 1 348 ? 19.619 16.651  -20.552 1.00   44.36  ? 435  ASP B CG  1 
ATOM   6076 O OD1 . ASP B 1 348 ? 20.347 17.431  -19.887 1.00   40.92  ? 435  ASP B OD1 1 
ATOM   6077 O OD2 . ASP B 1 348 ? 19.040 17.090  -21.593 1.00   45.62  ? 435  ASP B OD2 1 
ATOM   6078 N N   . LEU B 1 349 ? 17.576 12.511  -19.525 1.00   42.57  ? 436  LEU B N   1 
ATOM   6079 C CA  . LEU B 1 349 ? 17.597 11.121  -19.075 1.00   42.32  ? 436  LEU B CA  1 
ATOM   6080 C C   . LEU B 1 349 ? 16.777 10.223  -19.970 1.00   38.88  ? 436  LEU B C   1 
ATOM   6081 O O   . LEU B 1 349 ? 16.849 9.015   -19.860 1.00   40.13  ? 436  LEU B O   1 
ATOM   6082 C CB  . LEU B 1 349 ? 17.036 11.029  -17.663 1.00   42.19  ? 436  LEU B CB  1 
ATOM   6083 C CG  . LEU B 1 349 ? 17.318 9.763   -16.873 1.00   46.66  ? 436  LEU B CG  1 
ATOM   6084 C CD1 . LEU B 1 349 ? 18.768 9.666   -16.446 1.00   47.52  ? 436  LEU B CD1 1 
ATOM   6085 C CD2 . LEU B 1 349 ? 16.394 9.744   -15.669 1.00   50.90  ? 436  LEU B CD2 1 
ATOM   6086 N N   . LEU B 1 350 ? 16.011 10.816  -20.872 1.00   39.65  ? 437  LEU B N   1 
ATOM   6087 C CA  . LEU B 1 350 ? 15.165 10.056  -21.779 1.00   39.06  ? 437  LEU B CA  1 
ATOM   6088 C C   . LEU B 1 350 ? 16.006 9.212   -22.730 1.00   40.58  ? 437  LEU B C   1 
ATOM   6089 O O   . LEU B 1 350 ? 15.514 8.312   -23.397 1.00   39.31  ? 437  LEU B O   1 
ATOM   6090 C CB  . LEU B 1 350 ? 14.283 11.013  -22.576 1.00   39.28  ? 437  LEU B CB  1 
ATOM   6091 C CG  . LEU B 1 350 ? 13.016 11.538  -21.885 1.00   41.79  ? 437  LEU B CG  1 
ATOM   6092 C CD1 . LEU B 1 350 ? 12.301 12.625  -22.762 1.00   40.34  ? 437  LEU B CD1 1 
ATOM   6093 C CD2 . LEU B 1 350 ? 12.027 10.403  -21.521 1.00   38.61  ? 437  LEU B CD2 1 
ATOM   6094 N N   . GLU B 1 351 ? 17.292 9.517   -22.809 1.00   45.02  ? 438  GLU B N   1 
ATOM   6095 C CA  . GLU B 1 351 ? 18.179 8.786   -23.696 1.00   49.48  ? 438  GLU B CA  1 
ATOM   6096 C C   . GLU B 1 351 ? 18.943 7.689   -22.997 1.00   47.33  ? 438  GLU B C   1 
ATOM   6097 O O   . GLU B 1 351 ? 19.616 6.908   -23.634 1.00   47.23  ? 438  GLU B O   1 
ATOM   6098 C CB  . GLU B 1 351 ? 19.107 9.765   -24.423 1.00   52.88  ? 438  GLU B CB  1 
ATOM   6099 C CG  . GLU B 1 351 ? 18.284 10.718  -25.295 1.00   59.69  ? 438  GLU B CG  1 
ATOM   6100 C CD  . GLU B 1 351 ? 19.051 11.414  -26.416 1.00   60.96  ? 438  GLU B CD  1 
ATOM   6101 O OE1 . GLU B 1 351 ? 20.154 11.920  -26.113 1.00   55.39  ? 438  GLU B OE1 1 
ATOM   6102 O OE2 . GLU B 1 351 ? 18.514 11.481  -27.561 1.00   61.51  ? 438  GLU B OE2 1 
ATOM   6103 N N   . ILE B 1 352 ? 18.803 7.589   -21.690 1.00   49.64  ? 439  ILE B N   1 
ATOM   6104 C CA  . ILE B 1 352 ? 19.385 6.467   -20.972 1.00   51.91  ? 439  ILE B CA  1 
ATOM   6105 C C   . ILE B 1 352 ? 18.874 5.154   -21.611 1.00   52.07  ? 439  ILE B C   1 
ATOM   6106 O O   . ILE B 1 352 ? 17.754 5.055   -22.114 1.00   55.51  ? 439  ILE B O   1 
ATOM   6107 C CB  . ILE B 1 352 ? 19.029 6.586   -19.447 1.00   53.51  ? 439  ILE B CB  1 
ATOM   6108 C CG1 . ILE B 1 352 ? 20.006 5.811   -18.569 1.00   57.02  ? 439  ILE B CG1 1 
ATOM   6109 C CG2 . ILE B 1 352 ? 17.632 6.042   -19.134 1.00   53.80  ? 439  ILE B CG2 1 
ATOM   6110 C CD1 . ILE B 1 352 ? 21.461 6.098   -18.830 1.00   61.11  ? 439  ILE B CD1 1 
ATOM   6111 N N   . ALA B 1 353 ? 19.699 4.127   -21.614 1.00   50.60  ? 440  ALA B N   1 
ATOM   6112 C CA  . ALA B 1 353 ? 19.313 2.864   -22.219 1.00   50.73  ? 440  ALA B CA  1 
ATOM   6113 C C   . ALA B 1 353 ? 18.633 1.964   -21.192 1.00   51.28  ? 440  ALA B C   1 
ATOM   6114 O O   . ALA B 1 353 ? 19.182 0.909   -20.848 1.00   54.11  ? 440  ALA B O   1 
ATOM   6115 C CB  . ALA B 1 353 ? 20.562 2.177   -22.779 1.00   52.14  ? 440  ALA B CB  1 
ATOM   6116 N N   . ASP B 1 354 ? 17.462 2.379   -20.705 1.00   47.54  ? 441  ASP B N   1 
ATOM   6117 C CA  . ASP B 1 354 ? 16.687 1.606   -19.731 1.00   44.05  ? 441  ASP B CA  1 
ATOM   6118 C C   . ASP B 1 354 ? 15.230 2.013   -19.872 1.00   40.72  ? 441  ASP B C   1 
ATOM   6119 O O   . ASP B 1 354 ? 14.845 3.098   -19.479 1.00   42.95  ? 441  ASP B O   1 
ATOM   6120 C CB  . ASP B 1 354 ? 17.231 1.870   -18.317 1.00   45.54  ? 441  ASP B CB  1 
ATOM   6121 C CG  . ASP B 1 354 ? 16.501 1.103   -17.198 1.00   51.86  ? 441  ASP B CG  1 
ATOM   6122 O OD1 . ASP B 1 354 ? 15.313 0.687   -17.327 1.00   52.56  ? 441  ASP B OD1 1 
ATOM   6123 O OD2 . ASP B 1 354 ? 17.090 0.895   -16.104 1.00   48.39  ? 441  ASP B OD2 1 
ATOM   6124 N N   . ASN B 1 355 ? 14.405 1.140   -20.419 1.00   39.68  ? 442  ASN B N   1 
ATOM   6125 C CA  . ASN B 1 355 ? 13.010 1.457   -20.645 1.00   40.62  ? 442  ASN B CA  1 
ATOM   6126 C C   . ASN B 1 355 ? 12.199 1.681   -19.385 1.00   42.79  ? 442  ASN B C   1 
ATOM   6127 O O   . ASN B 1 355 ? 11.216 2.405   -19.405 1.00   46.68  ? 442  ASN B O   1 
ATOM   6128 C CB  . ASN B 1 355 ? 12.385 0.362   -21.500 1.00   42.15  ? 442  ASN B CB  1 
ATOM   6129 C CG  . ASN B 1 355 ? 13.129 0.182   -22.811 1.00   40.52  ? 442  ASN B CG  1 
ATOM   6130 O OD1 . ASN B 1 355 ? 13.468 1.155   -23.489 1.00   40.73  ? 442  ASN B OD1 1 
ATOM   6131 N ND2 . ASN B 1 355 ? 13.458 -1.052  -23.129 1.00   43.56  ? 442  ASN B ND2 1 
ATOM   6132 N N   . ARG B 1 356 ? 12.596 1.049   -18.291 1.00   44.06  ? 443  ARG B N   1 
ATOM   6133 C CA  . ARG B 1 356 ? 11.922 1.221   -17.015 1.00   47.79  ? 443  ARG B CA  1 
ATOM   6134 C C   . ARG B 1 356 ? 11.982 2.683   -16.577 1.00   43.62  ? 443  ARG B C   1 
ATOM   6135 O O   . ARG B 1 356 ? 10.994 3.236   -16.084 1.00   45.03  ? 443  ARG B O   1 
ATOM   6136 C CB  . ARG B 1 356 ? 12.580 0.335   -15.951 1.00   54.84  ? 443  ARG B CB  1 
ATOM   6137 C CG  . ARG B 1 356 ? 11.729 0.052   -14.716 1.00   61.04  ? 443  ARG B CG  1 
ATOM   6138 C CD  . ARG B 1 356 ? 10.561 -0.913  -14.948 1.00   69.01  ? 443  ARG B CD  1 
ATOM   6139 N NE  . ARG B 1 356 ? 9.569  -0.866  -13.863 1.00   74.53  ? 443  ARG B NE  1 
ATOM   6140 C CZ  . ARG B 1 356 ? 8.714  0.138   -13.644 1.00   74.25  ? 443  ARG B CZ  1 
ATOM   6141 N NH1 . ARG B 1 356 ? 8.700  1.214   -14.433 1.00   75.42  ? 443  ARG B NH1 1 
ATOM   6142 N NH2 . ARG B 1 356 ? 7.853  0.059   -12.638 1.00   70.56  ? 443  ARG B NH2 1 
ATOM   6143 N N   . ILE B 1 357 ? 13.151 3.288   -16.739 1.00   37.62  ? 444  ILE B N   1 
ATOM   6144 C CA  . ILE B 1 357 ? 13.346 4.677   -16.361 1.00   36.54  ? 444  ILE B CA  1 
ATOM   6145 C C   . ILE B 1 357 ? 12.776 5.650   -17.383 1.00   37.14  ? 444  ILE B C   1 
ATOM   6146 O O   . ILE B 1 357 ? 12.217 6.681   -17.008 1.00   35.67  ? 444  ILE B O   1 
ATOM   6147 C CB  . ILE B 1 357 ? 14.826 4.974   -16.162 1.00   37.15  ? 444  ILE B CB  1 
ATOM   6148 C CG1 . ILE B 1 357 ? 15.392 4.168   -14.992 1.00   41.66  ? 444  ILE B CG1 1 
ATOM   6149 C CG2 . ILE B 1 357 ? 15.046 6.450   -15.955 1.00   35.74  ? 444  ILE B CG2 1 
ATOM   6150 C CD1 . ILE B 1 357 ? 14.641 4.400   -13.675 1.00   46.40  ? 444  ILE B CD1 1 
ATOM   6151 N N   . ILE B 1 358 ? 12.926 5.345   -18.666 1.00   35.44  ? 445  ILE B N   1 
ATOM   6152 C CA  . ILE B 1 358 ? 12.355 6.213   -19.682 1.00   37.21  ? 445  ILE B CA  1 
ATOM   6153 C C   . ILE B 1 358 ? 10.891 6.435   -19.324 1.00   37.44  ? 445  ILE B C   1 
ATOM   6154 O O   . ILE B 1 358 ? 10.421 7.563   -19.347 1.00   36.63  ? 445  ILE B O   1 
ATOM   6155 C CB  . ILE B 1 358 ? 12.489 5.618   -21.106 1.00   36.80  ? 445  ILE B CB  1 
ATOM   6156 C CG1 . ILE B 1 358 ? 13.928 5.779   -21.584 1.00   35.89  ? 445  ILE B CG1 1 
ATOM   6157 C CG2 . ILE B 1 358 ? 11.544 6.315   -22.083 1.00   34.89  ? 445  ILE B CG2 1 
ATOM   6158 C CD1 . ILE B 1 358 ? 14.260 4.882   -22.721 1.00   39.28  ? 445  ILE B CD1 1 
ATOM   6159 N N   . GLU B 1 359 ? 10.203 5.351   -18.984 1.00   38.13  ? 446  GLU B N   1 
ATOM   6160 C CA  . GLU B 1 359 ? 8.786  5.373   -18.687 1.00   38.55  ? 446  GLU B CA  1 
ATOM   6161 C C   . GLU B 1 359 ? 8.466  6.207   -17.458 1.00   34.66  ? 446  GLU B C   1 
ATOM   6162 O O   . GLU B 1 359 ? 7.528  6.969   -17.457 1.00   37.33  ? 446  GLU B O   1 
ATOM   6163 C CB  . GLU B 1 359 ? 8.301  3.951   -18.508 1.00   40.78  ? 446  GLU B CB  1 
ATOM   6164 C CG  . GLU B 1 359 ? 6.785  3.824   -18.577 1.00   48.64  ? 446  GLU B CG  1 
ATOM   6165 C CD  . GLU B 1 359 ? 6.328  2.384   -18.396 1.00   52.33  ? 446  GLU B CD  1 
ATOM   6166 O OE1 . GLU B 1 359 ? 5.167  2.157   -17.984 1.00   49.93  ? 446  GLU B OE1 1 
ATOM   6167 O OE2 . GLU B 1 359 ? 7.158  1.477   -18.642 1.00   58.79  ? 446  GLU B OE2 1 
ATOM   6168 N N   . VAL B 1 360 ? 9.234  6.065   -16.396 1.00   36.59  ? 447  VAL B N   1 
ATOM   6169 C CA  . VAL B 1 360 ? 9.101  6.914   -15.201 1.00   34.13  ? 447  VAL B CA  1 
ATOM   6170 C C   . VAL B 1 360 ? 9.363  8.399   -15.493 1.00   32.28  ? 447  VAL B C   1 
ATOM   6171 O O   . VAL B 1 360 ? 8.756  9.281   -14.892 1.00   28.94  ? 447  VAL B O   1 
ATOM   6172 C CB  . VAL B 1 360 ? 10.140 6.524   -14.162 1.00   33.70  ? 447  VAL B CB  1 
ATOM   6173 C CG1 . VAL B 1 360 ? 10.072 7.452   -13.014 1.00   36.43  ? 447  VAL B CG1 1 
ATOM   6174 C CG2 . VAL B 1 360 ? 9.898  5.124   -13.642 1.00   41.60  ? 447  VAL B CG2 1 
ATOM   6175 N N   . THR B 1 361 ? 10.293 8.664   -16.407 1.00   29.64  ? 448  THR B N   1 
ATOM   6176 C CA  . THR B 1 361 ? 10.647 10.007  -16.787 1.00   27.03  ? 448  THR B CA  1 
ATOM   6177 C C   . THR B 1 361 ? 9.520  10.652  -17.574 1.00   26.47  ? 448  THR B C   1 
ATOM   6178 O O   . THR B 1 361 ? 9.119  11.759  -17.262 1.00   26.03  ? 448  THR B O   1 
ATOM   6179 C CB  . THR B 1 361 ? 11.943 9.940   -17.558 1.00   28.89  ? 448  THR B CB  1 
ATOM   6180 O OG1 . THR B 1 361 ? 12.927 9.365   -16.687 1.00   32.93  ? 448  THR B OG1 1 
ATOM   6181 C CG2 . THR B 1 361 ? 12.453 11.331  -17.912 1.00   31.47  ? 448  THR B CG2 1 
ATOM   6182 N N   . LEU B 1 362 ? 8.986  9.971   -18.577 1.00   27.97  ? 449  LEU B N   1 
ATOM   6183 C CA  . LEU B 1 362 ? 7.868  10.502  -19.346 1.00   31.29  ? 449  LEU B CA  1 
ATOM   6184 C C   . LEU B 1 362 ? 6.620  10.712  -18.456 1.00   37.19  ? 449  LEU B C   1 
ATOM   6185 O O   . LEU B 1 362 ? 5.847  11.663  -18.690 1.00   35.92  ? 449  LEU B O   1 
ATOM   6186 C CB  . LEU B 1 362 ? 7.523  9.554   -20.491 1.00   29.44  ? 449  LEU B CB  1 
ATOM   6187 C CG  . LEU B 1 362 ? 8.498  9.431   -21.667 1.00   34.41  ? 449  LEU B CG  1 
ATOM   6188 C CD1 . LEU B 1 362 ? 7.970  8.395   -22.642 1.00   35.64  ? 449  LEU B CD1 1 
ATOM   6189 C CD2 . LEU B 1 362 ? 8.698  10.720  -22.404 1.00   36.04  ? 449  LEU B CD2 1 
ATOM   6190 N N   . ASP B 1 363 ? 6.414  9.830   -17.465 1.00   33.60  ? 450  ASP B N   1 
ATOM   6191 C CA  . ASP B 1 363 ? 5.340  10.005  -16.484 1.00   37.78  ? 450  ASP B CA  1 
ATOM   6192 C C   . ASP B 1 363 ? 5.521  11.296  -15.695 1.00   35.41  ? 450  ASP B C   1 
ATOM   6193 O O   . ASP B 1 363 ? 4.562  12.052  -15.560 1.00   34.60  ? 450  ASP B O   1 
ATOM   6194 C CB  . ASP B 1 363 ? 5.214  8.822   -15.504 1.00   41.32  ? 450  ASP B CB  1 
ATOM   6195 C CG  . ASP B 1 363 ? 4.531  7.588   -16.123 1.00   44.31  ? 450  ASP B CG  1 
ATOM   6196 O OD1 . ASP B 1 363 ? 4.828  6.437   -15.727 1.00   49.57  ? 450  ASP B OD1 1 
ATOM   6197 O OD2 . ASP B 1 363 ? 3.676  7.634   -17.031 1.00   49.59  ? 450  ASP B OD2 1 
ATOM   6198 N N   . ALA B 1 364 ? 6.750  11.559  -15.250 1.00   32.22  ? 451  ALA B N   1 
ATOM   6199 C CA  . ALA B 1 364 ? 7.082  12.801  -14.594 1.00   31.96  ? 451  ALA B CA  1 
ATOM   6200 C C   . ALA B 1 364 ? 6.841  13.965  -15.555 1.00   32.74  ? 451  ALA B C   1 
ATOM   6201 O O   . ALA B 1 364 ? 6.269  14.965  -15.135 1.00   36.03  ? 451  ALA B O   1 
ATOM   6202 C CB  . ALA B 1 364 ? 8.523  12.792  -14.108 1.00   33.28  ? 451  ALA B CB  1 
ATOM   6203 N N   . LEU B 1 365 ? 7.267  13.864  -16.812 1.00   30.28  ? 452  LEU B N   1 
ATOM   6204 C CA  . LEU B 1 365 ? 7.119  14.980  -17.735 1.00   34.16  ? 452  LEU B CA  1 
ATOM   6205 C C   . LEU B 1 365 ? 5.664  15.265  -18.086 1.00   33.79  ? 452  LEU B C   1 
ATOM   6206 O O   . LEU B 1 365 ? 5.288  16.405  -18.333 1.00   33.28  ? 452  LEU B O   1 
ATOM   6207 C CB  . LEU B 1 365 ? 7.930  14.760  -19.011 1.00   33.45  ? 452  LEU B CB  1 
ATOM   6208 C CG  . LEU B 1 365 ? 9.432  14.760  -18.764 1.00   35.21  ? 452  LEU B CG  1 
ATOM   6209 C CD1 . LEU B 1 365 ? 10.086 14.216  -20.018 1.00   41.14  ? 452  LEU B CD1 1 
ATOM   6210 C CD2 . LEU B 1 365 ? 9.955  16.151  -18.460 1.00   35.58  ? 452  LEU B CD2 1 
ATOM   6211 N N   . GLU B 1 366 ? 4.852  14.222  -18.096 1.00   34.24  ? 453  GLU B N   1 
ATOM   6212 C CA  . GLU B 1 366 ? 3.437  14.368  -18.416 1.00   36.45  ? 453  GLU B CA  1 
ATOM   6213 C C   . GLU B 1 366 ? 2.744  15.030  -17.235 1.00   33.94  ? 453  GLU B C   1 
ATOM   6214 O O   . GLU B 1 366 ? 1.960  15.939  -17.409 1.00   36.30  ? 453  GLU B O   1 
ATOM   6215 C CB  . GLU B 1 366 ? 2.787  13.024  -18.703 1.00   38.80  ? 453  GLU B CB  1 
ATOM   6216 C CG  . GLU B 1 366 ? 1.289  12.975  -18.462 1.00   44.34  ? 453  GLU B CG  1 
ATOM   6217 C CD  . GLU B 1 366 ? 0.526  12.238  -19.547 1.00   51.93  ? 453  GLU B CD  1 
ATOM   6218 O OE1 . GLU B 1 366 ? 0.744  11.021  -19.697 1.00   60.69  ? 453  GLU B OE1 1 
ATOM   6219 O OE2 . GLU B 1 366 ? -0.285 12.866  -20.270 1.00   63.22  ? 453  GLU B OE2 1 
ATOM   6220 N N   . ASN B 1 367 ? 3.043  14.606  -16.021 1.00   33.53  ? 454  ASN B N   1 
ATOM   6221 C CA  . ASN B 1 367 ? 2.551  15.310  -14.839 1.00   33.20  ? 454  ASN B CA  1 
ATOM   6222 C C   . ASN B 1 367 ? 2.890  16.819  -14.838 1.00   34.76  ? 454  ASN B C   1 
ATOM   6223 O O   . ASN B 1 367 ? 1.998  17.646  -14.607 1.00   34.18  ? 454  ASN B O   1 
ATOM   6224 C CB  . ASN B 1 367 ? 3.100  14.626  -13.588 1.00   28.17  ? 454  ASN B CB  1 
ATOM   6225 C CG  . ASN B 1 367 ? 2.462  13.258  -13.344 1.00   29.77  ? 454  ASN B CG  1 
ATOM   6226 O OD1 . ASN B 1 367 ? 1.328  12.991  -13.782 1.00   30.42  ? 454  ASN B OD1 1 
ATOM   6227 N ND2 . ASN B 1 367 ? 3.161  12.401  -12.588 1.00   23.44  ? 454  ASN B ND2 1 
ATOM   6228 N N   . ILE B 1 368 ? 4.136  17.161  -15.178 1.00   32.01  ? 455  ILE B N   1 
ATOM   6229 C CA  . ILE B 1 368 ? 4.573  18.547  -15.271 1.00   34.18  ? 455  ILE B CA  1 
ATOM   6230 C C   . ILE B 1 368 ? 3.784  19.330  -16.328 1.00   37.35  ? 455  ILE B C   1 
ATOM   6231 O O   . ILE B 1 368 ? 3.387  20.472  -16.125 1.00   38.09  ? 455  ILE B O   1 
ATOM   6232 C CB  . ILE B 1 368 ? 6.085  18.564  -15.568 1.00   31.25  ? 455  ILE B CB  1 
ATOM   6233 C CG1 . ILE B 1 368 ? 6.832  18.122  -14.310 1.00   29.10  ? 455  ILE B CG1 1 
ATOM   6234 C CG2 . ILE B 1 368 ? 6.544  19.960  -15.917 1.00   29.01  ? 455  ILE B CG2 1 
ATOM   6235 C CD1 . ILE B 1 368 ? 8.302  18.089  -14.458 1.00   35.44  ? 455  ILE B CD1 1 
ATOM   6236 N N   . LEU B 1 369 ? 3.538  18.691  -17.460 1.00   38.02  ? 456  LEU B N   1 
ATOM   6237 C CA  . LEU B 1 369 ? 2.787  19.283  -18.552 1.00   36.84  ? 456  LEU B CA  1 
ATOM   6238 C C   . LEU B 1 369 ? 1.320  19.446  -18.224 1.00   38.35  ? 456  LEU B C   1 
ATOM   6239 O O   . LEU B 1 369 ? 0.763  20.472  -18.562 1.00   40.49  ? 456  LEU B O   1 
ATOM   6240 C CB  . LEU B 1 369 ? 2.936  18.433  -19.817 1.00   36.45  ? 456  LEU B CB  1 
ATOM   6241 C CG  . LEU B 1 369 ? 4.314  18.518  -20.456 1.00   36.08  ? 456  LEU B CG  1 
ATOM   6242 C CD1 . LEU B 1 369 ? 4.493  17.360  -21.375 1.00   41.51  ? 456  LEU B CD1 1 
ATOM   6243 C CD2 . LEU B 1 369 ? 4.487  19.836  -21.206 1.00   39.77  ? 456  LEU B CD2 1 
ATOM   6244 N N   . LYS B 1 370 ? 0.690  18.450  -17.615 1.00   41.52  ? 457  LYS B N   1 
ATOM   6245 C CA  . LYS B 1 370 ? -0.706 18.539  -17.154 1.00   46.20  ? 457  LYS B CA  1 
ATOM   6246 C C   . LYS B 1 370 ? -0.928 19.698  -16.173 1.00   45.76  ? 457  LYS B C   1 
ATOM   6247 O O   . LYS B 1 370 ? -1.925 20.389  -16.191 1.00   42.26  ? 457  LYS B O   1 
ATOM   6248 C CB  . LYS B 1 370 ? -1.129 17.249  -16.419 1.00   49.48  ? 457  LYS B CB  1 
ATOM   6249 C CG  . LYS B 1 370 ? -1.577 16.122  -17.336 1.00   55.30  ? 457  LYS B CG  1 
ATOM   6250 C CD  . LYS B 1 370 ? -1.850 14.843  -16.540 1.00   58.71  ? 457  LYS B CD  1 
ATOM   6251 C CE  . LYS B 1 370 ? -2.044 13.614  -17.458 1.00   58.37  ? 457  LYS B CE  1 
ATOM   6252 N NZ  . LYS B 1 370 ? -1.935 12.302  -16.715 1.00   58.51  ? 457  LYS B NZ  1 
ATOM   6253 N N   . MET B 1 371 ? 0.009  19.884  -15.266 1.00   48.90  ? 458  MET B N   1 
ATOM   6254 C CA  . MET B 1 371 ? -0.105 20.930  -14.278 1.00   52.39  ? 458  MET B CA  1 
ATOM   6255 C C   . MET B 1 371 ? 0.153  22.247  -14.973 1.00   50.23  ? 458  MET B C   1 
ATOM   6256 O O   . MET B 1 371 ? -0.487 23.232  -14.692 1.00   50.63  ? 458  MET B O   1 
ATOM   6257 C CB  . MET B 1 371 ? 0.910  20.662  -13.175 1.00   56.46  ? 458  MET B CB  1 
ATOM   6258 C CG  . MET B 1 371 ? 0.755  21.519  -11.977 1.00   62.34  ? 458  MET B CG  1 
ATOM   6259 S SD  . MET B 1 371 ? 1.706  22.992  -12.270 1.00   71.35  ? 458  MET B SD  1 
ATOM   6260 C CE  . MET B 1 371 ? 0.371  24.120  -11.722 1.00   77.44  ? 458  MET B CE  1 
ATOM   6261 N N   . GLY B 1 372 ? 1.079  22.270  -15.918 1.00   53.84  ? 459  GLY B N   1 
ATOM   6262 C CA  . GLY B 1 372 ? 1.344  23.477  -16.683 1.00   52.60  ? 459  GLY B CA  1 
ATOM   6263 C C   . GLY B 1 372 ? 0.132  23.852  -17.522 1.00   51.60  ? 459  GLY B C   1 
ATOM   6264 O O   . GLY B 1 372 ? -0.091 25.040  -17.716 1.00   52.44  ? 459  GLY B O   1 
ATOM   6265 N N   . GLU B 1 373 ? -0.619 22.856  -18.002 1.00   48.84  ? 460  GLU B N   1 
ATOM   6266 C CA  . GLU B 1 373 ? -1.755 23.037  -18.893 1.00   51.91  ? 460  GLU B CA  1 
ATOM   6267 C C   . GLU B 1 373 ? -2.991 23.507  -18.109 1.00   56.66  ? 460  GLU B C   1 
ATOM   6268 O O   . GLU B 1 373 ? -3.739 24.378  -18.547 1.00   55.25  ? 460  GLU B O   1 
ATOM   6269 C CB  . GLU B 1 373 ? -2.039 21.760  -19.707 1.00   51.08  ? 460  GLU B CB  1 
ATOM   6270 C CG  . GLU B 1 373 ? -3.156 21.845  -20.762 1.00   54.41  ? 460  GLU B CG  1 
ATOM   6271 C CD  . GLU B 1 373 ? -2.793 22.473  -22.115 1.00   52.32  ? 460  GLU B CD  1 
ATOM   6272 O OE1 . GLU B 1 373 ? -1.629 22.453  -22.553 1.00   51.72  ? 460  GLU B OE1 1 
ATOM   6273 O OE2 . GLU B 1 373 ? -3.689 23.027  -22.781 1.00   52.88  ? 460  GLU B OE2 1 
ATOM   6274 N N   . ALA B 1 374 ? -3.213 22.910  -16.949 1.00   59.53  ? 461  ALA B N   1 
ATOM   6275 C CA  . ALA B 1 374 ? -4.289 23.318  -16.062 1.00   61.37  ? 461  ALA B CA  1 
ATOM   6276 C C   . ALA B 1 374 ? -4.016 24.710  -15.498 1.00   64.36  ? 461  ALA B C   1 
ATOM   6277 O O   . ALA B 1 374 ? -4.935 25.461  -15.201 1.00   65.97  ? 461  ALA B O   1 
ATOM   6278 C CB  . ALA B 1 374 ? -4.442 22.292  -14.937 1.00   59.97  ? 461  ALA B CB  1 
ATOM   6279 N N   . ASP B 1 375 ? -2.743 25.053  -15.369 1.00   66.12  ? 462  ASP B N   1 
ATOM   6280 C CA  . ASP B 1 375 ? -2.334 26.341  -14.855 1.00   68.80  ? 462  ASP B CA  1 
ATOM   6281 C C   . ASP B 1 375 ? -2.749 27.430  -15.831 1.00   71.58  ? 462  ASP B C   1 
ATOM   6282 O O   . ASP B 1 375 ? -3.255 28.464  -15.412 1.00   75.65  ? 462  ASP B O   1 
ATOM   6283 C CB  . ASP B 1 375 ? -0.818 26.361  -14.704 1.00   71.84  ? 462  ASP B CB  1 
ATOM   6284 C CG  . ASP B 1 375 ? -0.347 27.374  -13.709 1.00   74.83  ? 462  ASP B CG  1 
ATOM   6285 O OD1 . ASP B 1 375 ? -0.214 28.555  -14.080 1.00   75.33  ? 462  ASP B OD1 1 
ATOM   6286 O OD2 . ASP B 1 375 ? -0.067 27.064  -12.536 1.00   78.75  ? 462  ASP B OD2 1 
ATOM   6287 N N   . LYS B 1 376 ? -2.537 27.213  -17.127 1.00   71.52  ? 463  LYS B N   1 
ATOM   6288 C CA  . LYS B 1 376 ? -2.838 28.217  -18.142 1.00   70.20  ? 463  LYS B CA  1 
ATOM   6289 C C   . LYS B 1 376 ? -4.321 28.285  -18.481 1.00   70.84  ? 463  LYS B C   1 
ATOM   6290 O O   . LYS B 1 376 ? -4.815 29.328  -18.901 1.00   69.38  ? 463  LYS B O   1 
ATOM   6291 C CB  . LYS B 1 376 ? -2.035 27.958  -19.423 1.00   71.76  ? 463  LYS B CB  1 
ATOM   6292 C CG  . LYS B 1 376 ? -2.361 26.648  -20.109 1.00   72.07  ? 463  LYS B CG  1 
ATOM   6293 C CD  . LYS B 1 376 ? -1.902 26.594  -21.563 1.00   69.49  ? 463  LYS B CD  1 
ATOM   6294 C CE  . LYS B 1 376 ? -2.990 26.962  -22.543 1.00   63.21  ? 463  LYS B CE  1 
ATOM   6295 N NZ  . LYS B 1 376 ? -2.975 26.050  -23.704 1.00   54.69  ? 463  LYS B NZ  1 
ATOM   6296 N N   . GLU B 1 377 ? -5.027 27.171  -18.343 1.00   73.04  ? 464  GLU B N   1 
ATOM   6297 C CA  . GLU B 1 377 ? -6.460 27.147  -18.629 1.00   76.43  ? 464  GLU B CA  1 
ATOM   6298 C C   . GLU B 1 377 ? -7.186 27.802  -17.455 1.00   79.12  ? 464  GLU B C   1 
ATOM   6299 O O   . GLU B 1 377 ? -8.226 28.448  -17.630 1.00   79.98  ? 464  GLU B O   1 
ATOM   6300 C CB  . GLU B 1 377 ? -6.985 25.724  -18.906 1.00   77.22  ? 464  GLU B CB  1 
ATOM   6301 C CG  . GLU B 1 377 ? -6.404 25.026  -20.139 1.00   81.23  ? 464  GLU B CG  1 
ATOM   6302 C CD  . GLU B 1 377 ? -6.875 25.572  -21.494 1.00   84.27  ? 464  GLU B CD  1 
ATOM   6303 O OE1 . GLU B 1 377 ? -7.256 26.763  -21.645 1.00   81.22  ? 464  GLU B OE1 1 
ATOM   6304 O OE2 . GLU B 1 377 ? -6.812 24.790  -22.469 1.00   87.96  ? 464  GLU B OE2 1 
ATOM   6305 N N   . ALA B 1 378 ? -6.596 27.674  -16.268 1.00   80.61  ? 465  ALA B N   1 
ATOM   6306 C CA  . ALA B 1 378 ? -7.201 28.174  -15.035 1.00   79.49  ? 465  ALA B CA  1 
ATOM   6307 C C   . ALA B 1 378 ? -7.197 29.689  -15.062 1.00   79.62  ? 465  ALA B C   1 
ATOM   6308 O O   . ALA B 1 378 ? -8.116 30.319  -14.537 1.00   81.18  ? 465  ALA B O   1 
ATOM   6309 C CB  . ALA B 1 378 ? -6.462 27.658  -13.807 1.00   79.41  ? 465  ALA B CB  1 
ATOM   6310 N N   . ARG B 1 379 ? -6.178 30.266  -15.693 1.00   78.53  ? 466  ARG B N   1 
ATOM   6311 C CA  . ARG B 1 379 ? -6.081 31.714  -15.811 1.00   77.50  ? 466  ARG B CA  1 
ATOM   6312 C C   . ARG B 1 379 ? -5.939 32.195  -17.261 1.00   75.17  ? 466  ARG B C   1 
ATOM   6313 O O   . ARG B 1 379 ? -5.112 33.054  -17.563 1.00   78.19  ? 466  ARG B O   1 
ATOM   6314 C CB  . ARG B 1 379 ? -4.973 32.247  -14.904 1.00   78.31  ? 466  ARG B CB  1 
ATOM   6315 C CG  . ARG B 1 379 ? -3.586 31.761  -15.242 1.00   80.82  ? 466  ARG B CG  1 
ATOM   6316 C CD  . ARG B 1 379 ? -2.544 32.156  -14.211 1.00   82.72  ? 466  ARG B CD  1 
ATOM   6317 N NE  . ARG B 1 379 ? -1.179 31.868  -14.639 1.00   84.63  ? 466  ARG B NE  1 
ATOM   6318 C CZ  . ARG B 1 379 ? -0.100 32.042  -13.886 1.00   88.14  ? 466  ARG B CZ  1 
ATOM   6319 N NH1 . ARG B 1 379 ? -0.211 32.531  -12.658 1.00   90.02  ? 466  ARG B NH1 1 
ATOM   6320 N NH2 . ARG B 1 379 ? 1.099  31.728  -14.366 1.00   90.15  ? 466  ARG B NH2 1 
ATOM   6321 N N   . GLY B 1 380 ? -6.773 31.637  -18.136 1.00   72.94  ? 467  GLY B N   1 
ATOM   6322 C CA  . GLY B 1 380 ? -6.939 32.050  -19.521 1.00   73.79  ? 467  GLY B CA  1 
ATOM   6323 C C   . GLY B 1 380 ? -5.742 32.472  -20.349 1.00   74.68  ? 467  GLY B C   1 
ATOM   6324 O O   . GLY B 1 380 ? -5.859 33.342  -21.208 1.00   76.57  ? 467  GLY B O   1 
ATOM   6325 N N   . LEU B 1 381 ? -4.595 31.851  -20.106 1.00   75.14  ? 468  LEU B N   1 
ATOM   6326 C CA  . LEU B 1 381 ? -3.370 32.129  -20.854 1.00   75.12  ? 468  LEU B CA  1 
ATOM   6327 C C   . LEU B 1 381 ? -3.375 31.306  -22.149 1.00   72.77  ? 468  LEU B C   1 
ATOM   6328 O O   . LEU B 1 381 ? -4.167 30.378  -22.301 1.00   66.47  ? 468  LEU B O   1 
ATOM   6329 C CB  . LEU B 1 381 ? -2.143 31.813  -19.980 1.00   77.19  ? 468  LEU B CB  1 
ATOM   6330 C CG  . LEU B 1 381 ? -1.235 32.952  -19.504 1.00   81.71  ? 468  LEU B CG  1 
ATOM   6331 C CD1 . LEU B 1 381 ? -0.635 33.703  -20.704 1.00   84.97  ? 468  LEU B CD1 1 
ATOM   6332 C CD2 . LEU B 1 381 ? -1.982 33.906  -18.590 1.00   83.95  ? 468  LEU B CD2 1 
ATOM   6333 N N   . ASN B 1 382 ? -2.502 31.647  -23.092 1.00   73.33  ? 469  ASN B N   1 
ATOM   6334 C CA  . ASN B 1 382 ? -2.442 30.912  -24.363 1.00   74.86  ? 469  ASN B CA  1 
ATOM   6335 C C   . ASN B 1 382 ? -1.183 30.024  -24.572 1.00   71.90  ? 469  ASN B C   1 
ATOM   6336 O O   . ASN B 1 382 ? -0.919 29.500  -25.654 1.00   67.96  ? 469  ASN B O   1 
ATOM   6337 C CB  . ASN B 1 382 ? -2.649 31.904  -25.516 1.00   76.50  ? 469  ASN B CB  1 
ATOM   6338 C CG  . ASN B 1 382 ? -3.437 31.313  -26.679 1.00   80.35  ? 469  ASN B CG  1 
ATOM   6339 O OD1 . ASN B 1 382 ? -3.873 32.056  -27.559 1.00   84.92  ? 469  ASN B OD1 1 
ATOM   6340 N ND2 . ASN B 1 382 ? -3.616 29.989  -26.698 1.00   80.21  ? 469  ASN B ND2 1 
ATOM   6341 N N   . ILE B 1 383 ? -0.441 29.810  -23.494 1.00   69.79  ? 470  ILE B N   1 
ATOM   6342 C CA  . ILE B 1 383 ? 0.802  29.065  -23.521 1.00   69.30  ? 470  ILE B CA  1 
ATOM   6343 C C   . ILE B 1 383 ? 0.910  28.146  -22.297 1.00   67.48  ? 470  ILE B C   1 
ATOM   6344 O O   . ILE B 1 383 ? 0.492  28.501  -21.183 1.00   68.04  ? 470  ILE B O   1 
ATOM   6345 C CB  . ILE B 1 383 ? 1.993  30.055  -23.562 1.00   71.56  ? 470  ILE B CB  1 
ATOM   6346 C CG1 . ILE B 1 383 ? 1.834  31.119  -22.462 1.00   76.28  ? 470  ILE B CG1 1 
ATOM   6347 C CG2 . ILE B 1 383 ? 2.114  30.692  -24.957 1.00   71.32  ? 470  ILE B CG2 1 
ATOM   6348 C CD1 . ILE B 1 383 ? 2.938  32.181  -22.398 1.00   80.58  ? 470  ILE B CD1 1 
ATOM   6349 N N   . ASN B 1 384 ? 1.473  26.959  -22.509 1.00   61.17  ? 471  ASN B N   1 
ATOM   6350 C CA  . ASN B 1 384 ? 1.867  26.089  -21.407 1.00   55.66  ? 471  ASN B CA  1 
ATOM   6351 C C   . ASN B 1 384 ? 3.332  26.386  -21.064 1.00   53.50  ? 471  ASN B C   1 
ATOM   6352 O O   . ASN B 1 384 ? 4.220  25.965  -21.793 1.00   52.76  ? 471  ASN B O   1 
ATOM   6353 C CB  . ASN B 1 384 ? 1.679  24.638  -21.839 1.00   55.09  ? 471  ASN B CB  1 
ATOM   6354 C CG  . ASN B 1 384 ? 1.753  23.642  -20.684 1.00   51.04  ? 471  ASN B CG  1 
ATOM   6355 O OD1 . ASN B 1 384 ? 2.475  23.836  -19.700 1.00   44.89  ? 471  ASN B OD1 1 
ATOM   6356 N ND2 . ASN B 1 384 ? 1.028  22.538  -20.833 1.00   44.00  ? 471  ASN B ND2 1 
ATOM   6357 N N   . GLU B 1 385 ? 3.596  27.114  -19.984 1.00   51.08  ? 472  GLU B N   1 
ATOM   6358 C CA  . GLU B 1 385 ? 4.958  27.480  -19.622 1.00   53.62  ? 472  GLU B CA  1 
ATOM   6359 C C   . GLU B 1 385 ? 5.865  26.261  -19.511 1.00   52.88  ? 472  GLU B C   1 
ATOM   6360 O O   . GLU B 1 385 ? 7.060  26.326  -19.822 1.00   52.76  ? 472  GLU B O   1 
ATOM   6361 C CB  . GLU B 1 385 ? 4.995  28.176  -18.259 1.00   58.09  ? 472  GLU B CB  1 
ATOM   6362 C CG  . GLU B 1 385 ? 4.628  29.652  -18.223 1.00   66.79  ? 472  GLU B CG  1 
ATOM   6363 C CD  . GLU B 1 385 ? 4.748  30.233  -16.815 1.00   73.91  ? 472  GLU B CD  1 
ATOM   6364 O OE1 . GLU B 1 385 ? 5.867  30.099  -16.250 1.00   75.07  ? 472  GLU B OE1 1 
ATOM   6365 O OE2 . GLU B 1 385 ? 3.753  30.809  -16.285 1.00   73.00  ? 472  GLU B OE2 1 
ATOM   6366 N N   . ASN B 1 386 ? 5.311  25.169  -18.988 1.00   49.90  ? 473  ASN B N   1 
ATOM   6367 C CA  . ASN B 1 386 ? 6.103  23.975  -18.745 1.00   48.64  ? 473  ASN B CA  1 
ATOM   6368 C C   . ASN B 1 386 ? 6.482  23.290  -20.046 1.00   45.93  ? 473  ASN B C   1 
ATOM   6369 O O   . ASN B 1 386 ? 7.634  22.886  -20.202 1.00   43.06  ? 473  ASN B O   1 
ATOM   6370 C CB  . ASN B 1 386 ? 5.400  23.013  -17.786 1.00   47.59  ? 473  ASN B CB  1 
ATOM   6371 C CG  . ASN B 1 386 ? 5.441  23.478  -16.329 1.00   43.08  ? 473  ASN B CG  1 
ATOM   6372 O OD1 . ASN B 1 386 ? 6.268  24.292  -15.929 1.00   40.09  ? 473  ASN B OD1 1 
ATOM   6373 N ND2 . ASN B 1 386 ? 4.548  22.928  -15.523 1.00   38.58  ? 473  ASN B ND2 1 
ATOM   6374 N N   . ALA B 1 387 ? 5.529  23.209  -20.969 1.00   43.16  ? 474  ALA B N   1 
ATOM   6375 C CA  . ALA B 1 387 ? 5.817  22.777  -22.332 1.00   44.04  ? 474  ALA B CA  1 
ATOM   6376 C C   . ALA B 1 387 ? 6.952  23.565  -22.986 1.00   44.43  ? 474  ALA B C   1 
ATOM   6377 O O   . ALA B 1 387 ? 7.802  22.986  -23.656 1.00   49.35  ? 474  ALA B O   1 
ATOM   6378 C CB  . ALA B 1 387 ? 4.569  22.885  -23.180 1.00   45.82  ? 474  ALA B CB  1 
ATOM   6379 N N   . ASP B 1 388 ? 7.003  24.876  -22.786 1.00   47.31  ? 475  ASP B N   1 
ATOM   6380 C CA  . ASP B 1 388 ? 8.034  25.711  -23.402 1.00   48.67  ? 475  ASP B CA  1 
ATOM   6381 C C   . ASP B 1 388 ? 9.399  25.489  -22.784 1.00   46.15  ? 475  ASP B C   1 
ATOM   6382 O O   . ASP B 1 388 ? 10.420 25.586  -23.479 1.00   48.66  ? 475  ASP B O   1 
ATOM   6383 C CB  . ASP B 1 388 ? 7.654  27.197  -23.325 1.00   52.41  ? 475  ASP B CB  1 
ATOM   6384 C CG  . ASP B 1 388 ? 6.665  27.615  -24.413 1.00   58.09  ? 475  ASP B CG  1 
ATOM   6385 O OD1 . ASP B 1 388 ? 6.541  26.947  -25.467 1.00   60.04  ? 475  ASP B OD1 1 
ATOM   6386 O OD2 . ASP B 1 388 ? 5.921  28.606  -24.285 1.00   66.66  ? 475  ASP B OD2 1 
ATOM   6387 N N   . PHE B 1 389 ? 9.411  25.215  -21.484 1.00   42.59  ? 476  PHE B N   1 
ATOM   6388 C CA  . PHE B 1 389 ? 10.637 24.844  -20.799 1.00   45.57  ? 476  PHE B CA  1 
ATOM   6389 C C   . PHE B 1 389 ? 11.184 23.539  -21.360 1.00   46.58  ? 476  PHE B C   1 
ATOM   6390 O O   . PHE B 1 389 ? 12.390 23.408  -21.565 1.00   46.31  ? 476  PHE B O   1 
ATOM   6391 C CB  . PHE B 1 389 ? 10.393 24.668  -19.302 1.00   48.46  ? 476  PHE B CB  1 
ATOM   6392 C CG  . PHE B 1 389 ? 10.161 25.955  -18.571 1.00   52.01  ? 476  PHE B CG  1 
ATOM   6393 C CD1 . PHE B 1 389 ? 9.454  25.969  -17.382 1.00   52.79  ? 476  PHE B CD1 1 
ATOM   6394 C CD2 . PHE B 1 389 ? 10.672 27.153  -19.052 1.00   51.71  ? 476  PHE B CD2 1 
ATOM   6395 C CE1 . PHE B 1 389 ? 9.241  27.165  -16.687 1.00   52.43  ? 476  PHE B CE1 1 
ATOM   6396 C CE2 . PHE B 1 389 ? 10.481 28.330  -18.349 1.00   51.43  ? 476  PHE B CE2 1 
ATOM   6397 C CZ  . PHE B 1 389 ? 9.757  28.339  -17.176 1.00   50.08  ? 476  PHE B CZ  1 
ATOM   6398 N N   . ILE B 1 390 ? 10.281 22.588  -21.603 1.00   48.44  ? 477  ILE B N   1 
ATOM   6399 C CA  . ILE B 1 390 ? 10.658 21.276  -22.101 1.00   48.46  ? 477  ILE B CA  1 
ATOM   6400 C C   . ILE B 1 390 ? 11.195 21.387  -23.509 1.00   47.32  ? 477  ILE B C   1 
ATOM   6401 O O   . ILE B 1 390 ? 12.153 20.700  -23.836 1.00   46.73  ? 477  ILE B O   1 
ATOM   6402 C CB  . ILE B 1 390 ? 9.494  20.284  -22.040 1.00   45.89  ? 477  ILE B CB  1 
ATOM   6403 C CG1 . ILE B 1 390 ? 9.236  19.925  -20.577 1.00   45.80  ? 477  ILE B CG1 1 
ATOM   6404 C CG2 . ILE B 1 390 ? 9.837  19.048  -22.880 1.00   46.13  ? 477  ILE B CG2 1 
ATOM   6405 C CD1 . ILE B 1 390 ? 8.026  19.072  -20.358 1.00   45.53  ? 477  ILE B CD1 1 
ATOM   6406 N N   . GLU B 1 391 ? 10.592 22.263  -24.303 1.00   47.70  ? 478  GLU B N   1 
ATOM   6407 C CA  . GLU B 1 391 ? 10.994 22.498  -25.692 1.00   51.38  ? 478  GLU B CA  1 
ATOM   6408 C C   . GLU B 1 391 ? 12.356 23.164  -25.812 1.00   50.86  ? 478  GLU B C   1 
ATOM   6409 O O   . GLU B 1 391 ? 13.195 22.740  -26.603 1.00   46.04  ? 478  GLU B O   1 
ATOM   6410 C CB  . GLU B 1 391 ? 9.968  23.402  -26.373 1.00   54.88  ? 478  GLU B CB  1 
ATOM   6411 C CG  . GLU B 1 391 ? 10.012 23.434  -27.894 1.00   58.01  ? 478  GLU B CG  1 
ATOM   6412 C CD  . GLU B 1 391 ? 9.104  24.497  -28.511 1.00   62.69  ? 478  GLU B CD  1 
ATOM   6413 O OE1 . GLU B 1 391 ? 7.953  24.715  -28.061 1.00   63.50  ? 478  GLU B OE1 1 
ATOM   6414 O OE2 . GLU B 1 391 ? 9.544  25.134  -29.490 1.00   65.63  ? 478  GLU B OE2 1 
ATOM   6415 N N   . LYS B 1 392 ? 12.571 24.194  -25.003 1.00   53.13  ? 479  LYS B N   1 
ATOM   6416 C CA  . LYS B 1 392 ? 13.843 24.906  -24.995 1.00   59.65  ? 479  LYS B CA  1 
ATOM   6417 C C   . LYS B 1 392 ? 15.018 24.107  -24.438 1.00   58.91  ? 479  LYS B C   1 
ATOM   6418 O O   . LYS B 1 392 ? 16.161 24.515  -24.583 1.00   61.25  ? 479  LYS B O   1 
ATOM   6419 C CB  . LYS B 1 392 ? 13.701 26.208  -24.204 1.00   63.64  ? 479  LYS B CB  1 
ATOM   6420 C CG  . LYS B 1 392 ? 12.986 27.316  -24.986 1.00   71.93  ? 479  LYS B CG  1 
ATOM   6421 C CD  . LYS B 1 392 ? 13.139 28.711  -24.350 1.00   78.67  ? 479  LYS B CD  1 
ATOM   6422 C CE  . LYS B 1 392 ? 12.377 29.817  -25.113 1.00   79.50  ? 479  LYS B CE  1 
ATOM   6423 N NZ  . LYS B 1 392 ? 10.884 29.677  -25.013 1.00   79.93  ? 479  LYS B NZ  1 
ATOM   6424 N N   . ALA B 1 393 ? 14.745 22.990  -23.782 1.00   56.68  ? 480  ALA B N   1 
ATOM   6425 C CA  . ALA B 1 393 ? 15.786 22.160  -23.211 1.00   58.92  ? 480  ALA B CA  1 
ATOM   6426 C C   . ALA B 1 393 ? 16.066 20.954  -24.104 1.00   57.88  ? 480  ALA B C   1 
ATOM   6427 O O   . ALA B 1 393 ? 16.776 20.042  -23.703 1.00   55.20  ? 480  ALA B O   1 
ATOM   6428 C CB  . ALA B 1 393 ? 15.350 21.698  -21.818 1.00   60.85  ? 480  ALA B CB  1 
ATOM   6429 N N   . GLY B 1 394 ? 15.497 20.952  -25.306 1.00   58.84  ? 481  GLY B N   1 
ATOM   6430 C CA  . GLY B 1 394 ? 15.669 19.853  -26.236 1.00   61.33  ? 481  GLY B CA  1 
ATOM   6431 C C   . GLY B 1 394 ? 14.934 18.603  -25.809 1.00   63.05  ? 481  GLY B C   1 
ATOM   6432 O O   . GLY B 1 394 ? 15.322 17.504  -26.194 1.00   64.68  ? 481  GLY B O   1 
ATOM   6433 N N   . GLY B 1 395 ? 13.890 18.778  -25.002 1.00   62.61  ? 482  GLY B N   1 
ATOM   6434 C CA  . GLY B 1 395 ? 13.095 17.683  -24.468 1.00   59.76  ? 482  GLY B CA  1 
ATOM   6435 C C   . GLY B 1 395 ? 11.958 17.273  -25.379 1.00   57.81  ? 482  GLY B C   1 
ATOM   6436 O O   . GLY B 1 395 ? 11.416 16.178  -25.272 1.00   55.35  ? 482  GLY B O   1 
ATOM   6437 N N   . MET B 1 396 ? 11.575 18.159  -26.287 1.00   57.94  ? 483  MET B N   1 
ATOM   6438 C CA  . MET B 1 396 ? 10.574 17.807  -27.299 1.00   58.62  ? 483  MET B CA  1 
ATOM   6439 C C   . MET B 1 396 ? 11.137 16.795  -28.295 1.00   54.82  ? 483  MET B C   1 
ATOM   6440 O O   . MET B 1 396 ? 10.548 15.758  -28.535 1.00   55.16  ? 483  MET B O   1 
ATOM   6441 C CB  . MET B 1 396 ? 10.111 19.066  -28.024 1.00   60.03  ? 483  MET B CB  1 
ATOM   6442 C CG  . MET B 1 396 ? 8.863  18.918  -28.875 1.00   64.54  ? 483  MET B CG  1 
ATOM   6443 S SD  . MET B 1 396 ? 8.456  20.519  -29.686 1.00   70.05  ? 483  MET B SD  1 
ATOM   6444 C CE  . MET B 1 396 ? 9.843  20.571  -30.966 1.00   69.04  ? 483  MET B CE  1 
ATOM   6445 N N   . GLU B 1 397 ? 12.293 17.106  -28.864 1.00   56.28  ? 484  GLU B N   1 
ATOM   6446 C CA  . GLU B 1 397 ? 13.010 16.211  -29.772 1.00   57.25  ? 484  GLU B CA  1 
ATOM   6447 C C   . GLU B 1 397 ? 13.161 14.849  -29.086 1.00   49.72  ? 484  GLU B C   1 
ATOM   6448 O O   . GLU B 1 397 ? 12.793 13.845  -29.676 1.00   46.77  ? 484  GLU B O   1 
ATOM   6449 C CB  . GLU B 1 397 ? 14.365 16.815  -30.216 1.00   60.10  ? 484  GLU B CB  1 
ATOM   6450 C CG  . GLU B 1 397 ? 15.137 17.439  -29.049 1.00   71.58  ? 484  GLU B CG  1 
ATOM   6451 C CD  . GLU B 1 397 ? 16.663 17.551  -29.182 1.00   76.85  ? 484  GLU B CD  1 
ATOM   6452 O OE1 . GLU B 1 397 ? 17.187 18.609  -29.648 1.00   75.57  ? 484  GLU B OE1 1 
ATOM   6453 O OE2 . GLU B 1 397 ? 17.336 16.588  -28.723 1.00   75.70  ? 484  GLU B OE2 1 
ATOM   6454 N N   . LYS B 1 398 ? 13.605 14.827  -27.828 1.00   45.71  ? 485  LYS B N   1 
ATOM   6455 C CA  . LYS B 1 398 ? 13.805 13.573  -27.080 1.00   44.75  ? 485  LYS B CA  1 
ATOM   6456 C C   . LYS B 1 398 ? 12.537 12.748  -26.846 1.00   38.69  ? 485  LYS B C   1 
ATOM   6457 O O   . LYS B 1 398 ? 12.525 11.548  -27.001 1.00   40.69  ? 485  LYS B O   1 
ATOM   6458 C CB  . LYS B 1 398 ? 14.471 13.807  -25.731 1.00   45.12  ? 485  LYS B CB  1 
ATOM   6459 C CG  . LYS B 1 398 ? 15.682 14.702  -25.734 1.00   43.59  ? 485  LYS B CG  1 
ATOM   6460 C CD  . LYS B 1 398 ? 16.956 13.942  -25.594 1.00   46.37  ? 485  LYS B CD  1 
ATOM   6461 C CE  . LYS B 1 398 ? 18.145 14.891  -25.504 1.00   48.16  ? 485  LYS B CE  1 
ATOM   6462 N NZ  . LYS B 1 398 ? 17.943 15.821  -24.394 1.00   50.60  ? 485  LYS B NZ  1 
ATOM   6463 N N   . ILE B 1 399 ? 11.437 13.392  -26.519 1.00   39.92  ? 486  ILE B N   1 
ATOM   6464 C CA  . ILE B 1 399 ? 10.166 12.688  -26.353 1.00   39.86  ? 486  ILE B CA  1 
ATOM   6465 C C   . ILE B 1 399 ? 9.693  12.211  -27.722 1.00   42.19  ? 486  ILE B C   1 
ATOM   6466 O O   . ILE B 1 399 ? 9.088  11.146  -27.862 1.00   41.08  ? 486  ILE B O   1 
ATOM   6467 C CB  . ILE B 1 399 ? 9.122  13.637  -25.699 1.00   35.92  ? 486  ILE B CB  1 
ATOM   6468 C CG1 . ILE B 1 399 ? 9.510  13.961  -24.258 1.00   33.93  ? 486  ILE B CG1 1 
ATOM   6469 C CG2 . ILE B 1 399 ? 7.728  13.050  -25.749 1.00   34.54  ? 486  ILE B CG2 1 
ATOM   6470 C CD1 . ILE B 1 399 ? 8.825  15.194  -23.703 1.00   32.23  ? 486  ILE B CD1 1 
ATOM   6471 N N   . PHE B 1 400 ? 9.950  13.020  -28.743 1.00   47.21  ? 487  PHE B N   1 
ATOM   6472 C CA  . PHE B 1 400 ? 9.520  12.666  -30.093 1.00   51.66  ? 487  PHE B CA  1 
ATOM   6473 C C   . PHE B 1 400 ? 10.174 11.367  -30.531 1.00   50.88  ? 487  PHE B C   1 
ATOM   6474 O O   . PHE B 1 400 ? 9.484  10.533  -31.108 1.00   53.76  ? 487  PHE B O   1 
ATOM   6475 C CB  . PHE B 1 400 ? 9.867  13.750  -31.109 1.00   54.31  ? 487  PHE B CB  1 
ATOM   6476 C CG  . PHE B 1 400 ? 9.689  13.306  -32.534 1.00   53.98  ? 487  PHE B CG  1 
ATOM   6477 C CD1 . PHE B 1 400 ? 8.427  13.083  -33.045 1.00   56.33  ? 487  PHE B CD1 1 
ATOM   6478 C CD2 . PHE B 1 400 ? 10.781 13.089  -33.350 1.00   53.00  ? 487  PHE B CD2 1 
ATOM   6479 C CE1 . PHE B 1 400 ? 8.248  12.658  -34.346 1.00   53.93  ? 487  PHE B CE1 1 
ATOM   6480 C CE2 . PHE B 1 400 ? 10.607 12.665  -34.636 1.00   52.76  ? 487  PHE B CE2 1 
ATOM   6481 C CZ  . PHE B 1 400 ? 9.339  12.435  -35.129 1.00   52.99  ? 487  PHE B CZ  1 
ATOM   6482 N N   . ASN B 1 401 ? 11.472 11.216  -30.248 1.00   47.61  ? 488  ASN B N   1 
ATOM   6483 C CA  . ASN B 1 401 ? 12.233 9.998   -30.537 1.00   51.31  ? 488  ASN B CA  1 
ATOM   6484 C C   . ASN B 1 401 ? 11.830 8.749   -29.755 1.00   50.82  ? 488  ASN B C   1 
ATOM   6485 O O   . ASN B 1 401 ? 12.000 7.615   -30.236 1.00   51.73  ? 488  ASN B O   1 
ATOM   6486 C CB  . ASN B 1 401 ? 13.727 10.233  -30.340 1.00   53.35  ? 488  ASN B CB  1 
ATOM   6487 C CG  . ASN B 1 401 ? 14.363 10.998  -31.509 1.00   59.57  ? 488  ASN B CG  1 
ATOM   6488 O OD1 . ASN B 1 401 ? 13.894 12.066  -31.943 1.00   58.97  ? 488  ASN B OD1 1 
ATOM   6489 N ND2 . ASN B 1 401 ? 15.422 10.417  -32.058 1.00   61.87  ? 488  ASN B ND2 1 
ATOM   6490 N N   . CYS B 1 402 ? 11.285 8.941   -28.558 1.00   46.34  ? 489  CYS B N   1 
ATOM   6491 C CA  . CYS B 1 402 ? 10.747 7.807   -27.805 1.00   42.65  ? 489  CYS B CA  1 
ATOM   6492 C C   . CYS B 1 402 ? 9.693  7.080   -28.585 1.00   38.12  ? 489  CYS B C   1 
ATOM   6493 O O   . CYS B 1 402 ? 9.380  5.965   -28.189 1.00   37.91  ? 489  CYS B O   1 
ATOM   6494 C CB  . CYS B 1 402 ? 10.123 8.216   -26.475 1.00   41.85  ? 489  CYS B CB  1 
ATOM   6495 S SG  . CYS B 1 402 ? 11.437 8.652   -25.365 1.00   40.17  ? 489  CYS B SG  1 
ATOM   6496 N N   . GLN B 1 403 ? 9.154  7.673   -29.656 1.00   40.81  ? 490  GLN B N   1 
ATOM   6497 C CA  . GLN B 1 403 ? 8.074  6.981   -30.366 1.00   44.99  ? 490  GLN B CA  1 
ATOM   6498 C C   . GLN B 1 403 ? 8.641  5.929   -31.318 1.00   41.78  ? 490  GLN B C   1 
ATOM   6499 O O   . GLN B 1 403 ? 7.939  5.095   -31.853 1.00   42.46  ? 490  GLN B O   1 
ATOM   6500 C CB  . GLN B 1 403 ? 6.929  7.872   -30.896 1.00   43.77  ? 490  GLN B CB  1 
ATOM   6501 C CG  . GLN B 1 403 ? 7.265  9.040   -31.739 1.00   43.17  ? 490  GLN B CG  1 
ATOM   6502 C CD  . GLN B 1 403 ? 6.132  10.060  -31.839 1.00   38.13  ? 490  GLN B CD  1 
ATOM   6503 O OE1 . GLN B 1 403 ? 4.944  9.744   -31.946 1.00   37.46  ? 490  GLN B OE1 1 
ATOM   6504 N NE2 . GLN B 1 403 ? 6.532  11.301  -31.865 1.00   34.08  ? 490  GLN B NE2 1 
ATOM   6505 N N   . GLN B 1 404 ? 9.956  5.909   -31.390 1.00   48.52  ? 491  GLN B N   1 
ATOM   6506 C CA  . GLN B 1 404 ? 10.699 4.942   -32.195 1.00   56.87  ? 491  GLN B CA  1 
ATOM   6507 C C   . GLN B 1 404 ? 11.259 3.813   -31.321 1.00   57.75  ? 491  GLN B C   1 
ATOM   6508 O O   . GLN B 1 404 ? 12.042 3.001   -31.810 1.00   55.39  ? 491  GLN B O   1 
ATOM   6509 C CB  . GLN B 1 404 ? 11.763 5.657   -33.070 1.00   59.59  ? 491  GLN B CB  1 
ATOM   6510 C CG  . GLN B 1 404 ? 11.111 6.243   -34.394 1.00   67.29  ? 491  GLN B CG  1 
ATOM   6511 C CD  . GLN B 1 404 ? 11.242 7.780   -34.681 1.00   68.66  ? 491  GLN B CD  1 
ATOM   6512 O OE1 . GLN B 1 404 ? 10.419 8.614   -34.255 1.00   63.90  ? 491  GLN B OE1 1 
ATOM   6513 N NE2 . GLN B 1 404 ? 12.238 8.124   -35.489 1.00   71.22  ? 491  GLN B NE2 1 
ATOM   6514 N N   . ASN B 1 405 ? 10.781 3.736   -30.072 1.00   56.40  ? 492  ASN B N   1 
ATOM   6515 C CA  . ASN B 1 405 ? 11.148 2.729   -29.069 1.00   51.65  ? 492  ASN B CA  1 
ATOM   6516 C C   . ASN B 1 405 ? 10.253 1.498   -29.266 1.00   47.28  ? 492  ASN B C   1 
ATOM   6517 O O   . ASN B 1 405 ? 9.099  1.606   -29.683 1.00   49.02  ? 492  ASN B O   1 
ATOM   6518 C CB  . ASN B 1 405 ? 10.965 3.351   -27.661 1.00   52.79  ? 492  ASN B CB  1 
ATOM   6519 C CG  . ASN B 1 405 ? 11.361 2.432   -26.483 1.00   49.46  ? 492  ASN B CG  1 
ATOM   6520 O OD1 . ASN B 1 405 ? 11.489 2.905   -25.386 1.00   50.99  ? 492  ASN B OD1 1 
ATOM   6521 N ND2 . ASN B 1 405 ? 11.554 1.156   -26.702 1.00   58.49  ? 492  ASN B ND2 1 
ATOM   6522 N N   . GLU B 1 406 ? 10.769 0.332   -28.913 1.00   46.34  ? 493  GLU B N   1 
ATOM   6523 C CA  . GLU B 1 406 ? 10.062 -0.925  -29.095 1.00   50.71  ? 493  GLU B CA  1 
ATOM   6524 C C   . GLU B 1 406 ? 8.956  -1.192  -28.119 1.00   48.18  ? 493  GLU B C   1 
ATOM   6525 O O   . GLU B 1 406 ? 8.041  -1.947  -28.421 1.00   49.08  ? 493  GLU B O   1 
ATOM   6526 C CB  . GLU B 1 406 ? 11.021 -2.108  -28.987 1.00   57.09  ? 493  GLU B CB  1 
ATOM   6527 C CG  . GLU B 1 406 ? 11.383 -2.487  -27.559 1.00   65.77  ? 493  GLU B CG  1 
ATOM   6528 C CD  . GLU B 1 406 ? 12.202 -3.751  -27.517 1.00   71.34  ? 493  GLU B CD  1 
ATOM   6529 O OE1 . GLU B 1 406 ? 11.829 -4.723  -28.220 1.00   75.25  ? 493  GLU B OE1 1 
ATOM   6530 O OE2 . GLU B 1 406 ? 13.204 -3.740  -26.774 1.00   74.10  ? 493  GLU B OE2 1 
ATOM   6531 N N   . ASN B 1 407 ? 9.090  -0.671  -26.912 1.00   51.60  ? 494  ASN B N   1 
ATOM   6532 C CA  . ASN B 1 407 ? 8.032  -0.818  -25.930 1.00   51.94  ? 494  ASN B CA  1 
ATOM   6533 C C   . ASN B 1 407 ? 6.831  0.019   -26.427 1.00   48.56  ? 494  ASN B C   1 
ATOM   6534 O O   . ASN B 1 407 ? 6.949  1.214   -26.666 1.00   45.53  ? 494  ASN B O   1 
ATOM   6535 C CB  . ASN B 1 407 ? 8.586  -0.403  -24.573 1.00   53.95  ? 494  ASN B CB  1 
ATOM   6536 C CG  . ASN B 1 407 ? 7.760  -0.900  -23.428 1.00   58.69  ? 494  ASN B CG  1 
ATOM   6537 O OD1 . ASN B 1 407 ? 6.660  -0.400  -23.193 1.00   67.57  ? 494  ASN B OD1 1 
ATOM   6538 N ND2 . ASN B 1 407 ? 8.290  -1.864  -22.689 1.00   56.15  ? 494  ASN B ND2 1 
ATOM   6539 N N   . ASP B 1 408 ? 5.695  -0.630  -26.643 1.00   46.97  ? 495  ASP B N   1 
ATOM   6540 C CA  . ASP B 1 408 ? 4.479  0.033   -27.105 1.00   47.20  ? 495  ASP B CA  1 
ATOM   6541 C C   . ASP B 1 408 ? 4.001  1.108   -26.127 1.00   46.52  ? 495  ASP B C   1 
ATOM   6542 O O   . ASP B 1 408 ? 3.499  2.122   -26.577 1.00   49.11  ? 495  ASP B O   1 
ATOM   6543 C CB  . ASP B 1 408 ? 3.344  -0.991  -27.315 1.00   47.01  ? 495  ASP B CB  1 
ATOM   6544 C CG  . ASP B 1 408 ? 3.411  -1.732  -28.665 1.00   45.53  ? 495  ASP B CG  1 
ATOM   6545 O OD1 . ASP B 1 408 ? 4.345  -1.536  -29.474 1.00   43.90  ? 495  ASP B OD1 1 
ATOM   6546 O OD2 . ASP B 1 408 ? 2.551  -2.579  -29.010 1.00   44.81  ? 495  ASP B OD2 1 
ATOM   6547 N N   . LYS B 1 409 ? 4.098  0.870   -24.819 1.00   47.48  ? 496  LYS B N   1 
ATOM   6548 C CA  . LYS B 1 409 ? 3.633  1.801   -23.794 1.00   48.57  ? 496  LYS B CA  1 
ATOM   6549 C C   . LYS B 1 409 ? 4.475  3.075   -23.836 1.00   43.52  ? 496  LYS B C   1 
ATOM   6550 O O   . LYS B 1 409 ? 3.938  4.159   -23.722 1.00   38.89  ? 496  LYS B O   1 
ATOM   6551 C CB  . LYS B 1 409 ? 3.654  1.152   -22.396 1.00   55.62  ? 496  LYS B CB  1 
ATOM   6552 C CG  . LYS B 1 409 ? 2.505  1.562   -21.462 1.00   66.35  ? 496  LYS B CG  1 
ATOM   6553 C CD  . LYS B 1 409 ? 2.986  2.153   -20.123 1.00   71.56  ? 496  LYS B CD  1 
ATOM   6554 C CE  . LYS B 1 409 ? 1.877  2.915   -19.365 1.00   75.50  ? 496  LYS B CE  1 
ATOM   6555 N NZ  . LYS B 1 409 ? 2.425  3.988   -18.448 1.00   77.35  ? 496  LYS B NZ  1 
ATOM   6556 N N   . ILE B 1 410 ? 5.780  2.962   -24.059 1.00   40.31  ? 497  ILE B N   1 
ATOM   6557 C CA  . ILE B 1 410 ? 6.629  4.138   -24.148 1.00   41.03  ? 497  ILE B CA  1 
ATOM   6558 C C   . ILE B 1 410 ? 6.250  4.968   -25.367 1.00   42.40  ? 497  ILE B C   1 
ATOM   6559 O O   . ILE B 1 410 ? 6.177  6.188   -25.278 1.00   43.13  ? 497  ILE B O   1 
ATOM   6560 C CB  . ILE B 1 410 ? 8.118  3.800   -24.325 1.00   45.11  ? 497  ILE B CB  1 
ATOM   6561 C CG1 . ILE B 1 410 ? 8.680  2.909   -23.224 1.00   47.83  ? 497  ILE B CG1 1 
ATOM   6562 C CG2 . ILE B 1 410 ? 8.951  5.079   -24.477 1.00   43.45  ? 497  ILE B CG2 1 
ATOM   6563 C CD1 . ILE B 1 410 ? 8.707  3.528   -21.889 1.00   55.01  ? 497  ILE B CD1 1 
ATOM   6564 N N   . TYR B 1 411 ? 6.064  4.308   -26.505 1.00   41.64  ? 498  TYR B N   1 
ATOM   6565 C CA  . TYR B 1 411 ? 5.644  4.957   -27.743 1.00   43.37  ? 498  TYR B CA  1 
ATOM   6566 C C   . TYR B 1 411 ? 4.296  5.663   -27.561 1.00   43.13  ? 498  TYR B C   1 
ATOM   6567 O O   . TYR B 1 411 ? 4.127  6.817   -27.938 1.00   39.91  ? 498  TYR B O   1 
ATOM   6568 C CB  . TYR B 1 411 ? 5.534  3.929   -28.889 1.00   43.22  ? 498  TYR B CB  1 
ATOM   6569 C CG  . TYR B 1 411 ? 4.501  4.286   -29.931 1.00   42.40  ? 498  TYR B CG  1 
ATOM   6570 C CD1 . TYR B 1 411 ? 4.768  5.246   -30.884 1.00   41.80  ? 498  TYR B CD1 1 
ATOM   6571 C CD2 . TYR B 1 411 ? 3.230  3.729   -29.909 1.00   48.61  ? 498  TYR B CD2 1 
ATOM   6572 C CE1 . TYR B 1 411 ? 3.810  5.635   -31.807 1.00   46.58  ? 498  TYR B CE1 1 
ATOM   6573 C CE2 . TYR B 1 411 ? 2.260  4.112   -30.824 1.00   48.84  ? 498  TYR B CE2 1 
ATOM   6574 C CZ  . TYR B 1 411 ? 2.559  5.068   -31.776 1.00   45.67  ? 498  TYR B CZ  1 
ATOM   6575 O OH  . TYR B 1 411 ? 1.631  5.470   -32.705 1.00   38.90  ? 498  TYR B OH  1 
ATOM   6576 N N   . GLU B 1 412 ? 3.337  4.953   -26.987 1.00   46.03  ? 499  GLU B N   1 
ATOM   6577 C CA  . GLU B 1 412 ? 1.976  5.454   -26.839 1.00   51.38  ? 499  GLU B CA  1 
ATOM   6578 C C   . GLU B 1 412 ? 1.977  6.746   -26.016 1.00   48.97  ? 499  GLU B C   1 
ATOM   6579 O O   . GLU B 1 412 ? 1.381  7.742   -26.440 1.00   44.85  ? 499  GLU B O   1 
ATOM   6580 C CB  . GLU B 1 412 ? 1.053  4.351   -26.273 1.00   57.40  ? 499  GLU B CB  1 
ATOM   6581 C CG  . GLU B 1 412 ? -0.397 4.780   -26.016 1.00   66.86  ? 499  GLU B CG  1 
ATOM   6582 C CD  . GLU B 1 412 ? -1.381 3.634   -25.809 1.00   73.95  ? 499  GLU B CD  1 
ATOM   6583 O OE1 . GLU B 1 412 ? -1.035 2.665   -25.087 1.00   81.91  ? 499  GLU B OE1 1 
ATOM   6584 O OE2 . GLU B 1 412 ? -2.517 3.720   -26.346 1.00   72.72  ? 499  GLU B OE2 1 
ATOM   6585 N N   . LYS B 1 413 ? 2.678  6.723   -24.879 1.00   48.04  ? 500  LYS B N   1 
ATOM   6586 C CA  . LYS B 1 413 ? 2.770  7.854   -23.960 1.00   46.52  ? 500  LYS B CA  1 
ATOM   6587 C C   . LYS B 1 413 ? 3.492  9.034   -24.588 1.00   43.52  ? 500  LYS B C   1 
ATOM   6588 O O   . LYS B 1 413 ? 3.107  10.169  -24.387 1.00   40.39  ? 500  LYS B O   1 
ATOM   6589 C CB  . LYS B 1 413 ? 3.483  7.447   -22.667 1.00   50.96  ? 500  LYS B CB  1 
ATOM   6590 C CG  . LYS B 1 413 ? 3.109  8.311   -21.467 1.00   62.21  ? 500  LYS B CG  1 
ATOM   6591 C CD  . LYS B 1 413 ? 4.069  8.085   -20.310 1.00   70.49  ? 500  LYS B CD  1 
ATOM   6592 C CE  . LYS B 1 413 ? 4.232  6.611   -19.935 1.00   73.79  ? 500  LYS B CE  1 
ATOM   6593 N NZ  . LYS B 1 413 ? 2.911  5.963   -19.679 1.00   77.38  ? 500  LYS B NZ  1 
ATOM   6594 N N   . ALA B 1 414 ? 4.538  8.764   -25.358 1.00   42.20  ? 501  ALA B N   1 
ATOM   6595 C CA  . ALA B 1 414 ? 5.275  9.801   -26.063 1.00   40.39  ? 501  ALA B CA  1 
ATOM   6596 C C   . ALA B 1 414 ? 4.403  10.391  -27.146 1.00   40.21  ? 501  ALA B C   1 
ATOM   6597 O O   . ALA B 1 414 ? 4.375  11.587  -27.338 1.00   35.75  ? 501  ALA B O   1 
ATOM   6598 C CB  . ALA B 1 414 ? 6.538  9.238   -26.696 1.00   40.49  ? 501  ALA B CB  1 
ATOM   6599 N N   . TYR B 1 415 ? 3.699  9.532   -27.864 1.00   46.00  ? 502  TYR B N   1 
ATOM   6600 C CA  . TYR B 1 415 ? 2.815  9.970   -28.927 1.00   47.70  ? 502  TYR B CA  1 
ATOM   6601 C C   . TYR B 1 415 ? 1.856  10.945  -28.295 1.00   44.83  ? 502  TYR B C   1 
ATOM   6602 O O   . TYR B 1 415 ? 1.695  12.036  -28.807 1.00   41.63  ? 502  TYR B O   1 
ATOM   6603 C CB  . TYR B 1 415 ? 2.059  8.792   -29.554 1.00   51.80  ? 502  TYR B CB  1 
ATOM   6604 C CG  . TYR B 1 415 ? 0.950  9.180   -30.509 1.00   58.62  ? 502  TYR B CG  1 
ATOM   6605 C CD1 . TYR B 1 415 ? 1.201  9.361   -31.867 1.00   63.44  ? 502  TYR B CD1 1 
ATOM   6606 C CD2 . TYR B 1 415 ? -0.350 9.362   -30.057 1.00   61.29  ? 502  TYR B CD2 1 
ATOM   6607 C CE1 . TYR B 1 415 ? 0.181  9.706   -32.749 1.00   66.99  ? 502  TYR B CE1 1 
ATOM   6608 C CE2 . TYR B 1 415 ? -1.376 9.706   -30.925 1.00   65.58  ? 502  TYR B CE2 1 
ATOM   6609 C CZ  . TYR B 1 415 ? -1.115 9.873   -32.276 1.00   69.49  ? 502  TYR B CZ  1 
ATOM   6610 O OH  . TYR B 1 415 ? -2.149 10.215  -33.142 1.00   70.99  ? 502  TYR B OH  1 
ATOM   6611 N N   . LYS B 1 416 ? 1.246  10.546  -27.181 1.00   46.01  ? 503  LYS B N   1 
ATOM   6612 C CA  . LYS B 1 416 ? 0.224  11.346  -26.510 1.00   48.15  ? 503  LYS B CA  1 
ATOM   6613 C C   . LYS B 1 416 ? 0.768  12.721  -26.136 1.00   44.78  ? 503  LYS B C   1 
ATOM   6614 O O   . LYS B 1 416 ? 0.142  13.736  -26.417 1.00   46.53  ? 503  LYS B O   1 
ATOM   6615 C CB  . LYS B 1 416 ? -0.339 10.561  -25.321 1.00   54.08  ? 503  LYS B CB  1 
ATOM   6616 C CG  . LYS B 1 416 ? -1.451 11.232  -24.514 1.00   62.43  ? 503  LYS B CG  1 
ATOM   6617 C CD  . LYS B 1 416 ? -1.843 10.376  -23.281 1.00   66.73  ? 503  LYS B CD  1 
ATOM   6618 C CE  . LYS B 1 416 ? -2.797 11.088  -22.315 1.00   67.60  ? 503  LYS B CE  1 
ATOM   6619 N NZ  . LYS B 1 416 ? -2.338 11.000  -20.898 1.00   68.65  ? 503  LYS B NZ  1 
ATOM   6620 N N   . ILE B 1 417 ? 1.979  12.761  -25.599 1.00   39.91  ? 504  ILE B N   1 
ATOM   6621 C CA  . ILE B 1 417 ? 2.604  13.994  -25.145 1.00   37.64  ? 504  ILE B CA  1 
ATOM   6622 C C   . ILE B 1 417 ? 2.850  14.964  -26.298 1.00   44.66  ? 504  ILE B C   1 
ATOM   6623 O O   . ILE B 1 417 ? 2.755  16.187  -26.159 1.00   46.55  ? 504  ILE B O   1 
ATOM   6624 C CB  . ILE B 1 417 ? 3.917  13.636  -24.387 1.00   32.00  ? 504  ILE B CB  1 
ATOM   6625 C CG1 . ILE B 1 417 ? 3.585  13.085  -23.007 1.00   31.10  ? 504  ILE B CG1 1 
ATOM   6626 C CG2 . ILE B 1 417 ? 4.836  14.813  -24.225 1.00   29.96  ? 504  ILE B CG2 1 
ATOM   6627 C CD1 . ILE B 1 417 ? 4.739  12.472  -22.248 1.00   30.85  ? 504  ILE B CD1 1 
ATOM   6628 N N   . ILE B 1 418 ? 3.201  14.419  -27.455 1.00   50.17  ? 505  ILE B N   1 
ATOM   6629 C CA  . ILE B 1 418 ? 3.490  15.244  -28.616 1.00   52.73  ? 505  ILE B CA  1 
ATOM   6630 C C   . ILE B 1 418 ? 2.206  15.775  -29.238 1.00   54.82  ? 505  ILE B C   1 
ATOM   6631 O O   . ILE B 1 418 ? 2.188  16.822  -29.861 1.00   61.73  ? 505  ILE B O   1 
ATOM   6632 C CB  . ILE B 1 418 ? 4.297  14.446  -29.633 1.00   53.53  ? 505  ILE B CB  1 
ATOM   6633 C CG1 . ILE B 1 418 ? 5.645  14.044  -29.043 1.00   53.49  ? 505  ILE B CG1 1 
ATOM   6634 C CG2 . ILE B 1 418 ? 4.549  15.242  -30.903 1.00   55.36  ? 505  ILE B CG2 1 
ATOM   6635 C CD1 . ILE B 1 418 ? 6.635  15.169  -28.892 1.00   53.57  ? 505  ILE B CD1 1 
ATOM   6636 N N   . GLU B 1 419 ? 1.105  15.069  -29.060 1.00   57.73  ? 506  GLU B N   1 
ATOM   6637 C CA  . GLU B 1 419 ? -0.160 15.472  -29.668 1.00   57.57  ? 506  GLU B CA  1 
ATOM   6638 C C   . GLU B 1 419 ? -0.827 16.511  -28.772 1.00   54.22  ? 506  GLU B C   1 
ATOM   6639 O O   . GLU B 1 419 ? -1.208 17.579  -29.220 1.00   54.58  ? 506  GLU B O   1 
ATOM   6640 C CB  . GLU B 1 419 ? -1.052 14.238  -29.859 1.00   58.53  ? 506  GLU B CB  1 
ATOM   6641 C CG  . GLU B 1 419 ? -2.474 14.484  -30.359 1.00   61.67  ? 506  GLU B CG  1 
ATOM   6642 C CD  . GLU B 1 419 ? -3.098 13.228  -30.958 1.00   64.99  ? 506  GLU B CD  1 
ATOM   6643 O OE1 . GLU B 1 419 ? -3.609 12.348  -30.203 1.00   58.05  ? 506  GLU B OE1 1 
ATOM   6644 O OE2 . GLU B 1 419 ? -3.034 13.124  -32.210 1.00   66.37  ? 506  GLU B OE2 1 
ATOM   6645 N N   . THR B 1 420 ? -0.950 16.174  -27.497 1.00   51.58  ? 507  THR B N   1 
ATOM   6646 C CA  . THR B 1 420 ? -1.588 17.010  -26.507 1.00   49.60  ? 507  THR B CA  1 
ATOM   6647 C C   . THR B 1 420 ? -0.866 18.338  -26.233 1.00   47.89  ? 507  THR B C   1 
ATOM   6648 O O   . THR B 1 420 ? -1.499 19.383  -26.299 1.00   50.98  ? 507  THR B O   1 
ATOM   6649 C CB  . THR B 1 420 ? -1.708 16.187  -25.216 1.00   53.15  ? 507  THR B CB  1 
ATOM   6650 O OG1 . THR B 1 420 ? -2.303 14.920  -25.519 1.00   47.66  ? 507  THR B OG1 1 
ATOM   6651 C CG2 . THR B 1 420 ? -2.643 16.863  -24.175 1.00   54.58  ? 507  THR B CG2 1 
ATOM   6652 N N   . TYR B 1 421 ? 0.439  18.328  -25.979 1.00   44.66  ? 508  TYR B N   1 
ATOM   6653 C CA  . TYR B 1 421 ? 1.149  19.535  -25.563 1.00   44.39  ? 508  TYR B CA  1 
ATOM   6654 C C   . TYR B 1 421 ? 2.070  20.153  -26.611 1.00   45.50  ? 508  TYR B C   1 
ATOM   6655 O O   . TYR B 1 421 ? 2.590  21.238  -26.401 1.00   44.58  ? 508  TYR B O   1 
ATOM   6656 C CB  . TYR B 1 421 ? 1.888  19.256  -24.251 1.00   45.77  ? 508  TYR B CB  1 
ATOM   6657 C CG  . TYR B 1 421 ? 1.017  18.609  -23.195 1.00   46.61  ? 508  TYR B CG  1 
ATOM   6658 C CD1 . TYR B 1 421 ? 1.041  17.250  -22.970 1.00   46.35  ? 508  TYR B CD1 1 
ATOM   6659 C CD2 . TYR B 1 421 ? 0.143  19.367  -22.430 1.00   50.27  ? 508  TYR B CD2 1 
ATOM   6660 C CE1 . TYR B 1 421 ? 0.219  16.665  -22.000 1.00   48.58  ? 508  TYR B CE1 1 
ATOM   6661 C CE2 . TYR B 1 421 ? -0.685 18.782  -21.474 1.00   48.10  ? 508  TYR B CE2 1 
ATOM   6662 C CZ  . TYR B 1 421 ? -0.647 17.439  -21.274 1.00   45.99  ? 508  TYR B CZ  1 
ATOM   6663 O OH  . TYR B 1 421 ? -1.439 16.878  -20.304 1.00   53.57  ? 508  TYR B OH  1 
ATOM   6664 N N   . PHE B 1 422 ? 2.272  19.504  -27.755 1.00   50.60  ? 509  PHE B N   1 
ATOM   6665 C CA  . PHE B 1 422 ? 3.118  20.059  -28.821 1.00   51.75  ? 509  PHE B CA  1 
ATOM   6666 C C   . PHE B 1 422 ? 2.399  19.971  -30.183 1.00   58.62  ? 509  PHE B C   1 
ATOM   6667 O O   . PHE B 1 422 ? 2.998  19.679  -31.225 1.00   55.26  ? 509  PHE B O   1 
ATOM   6668 C CB  . PHE B 1 422 ? 4.505  19.381  -28.804 1.00   51.67  ? 509  PHE B CB  1 
ATOM   6669 C CG  . PHE B 1 422 ? 5.248  19.515  -27.476 1.00   43.77  ? 509  PHE B CG  1 
ATOM   6670 C CD1 . PHE B 1 422 ? 5.262  18.476  -26.560 1.00   40.88  ? 509  PHE B CD1 1 
ATOM   6671 C CD2 . PHE B 1 422 ? 5.831  20.701  -27.105 1.00   41.70  ? 509  PHE B CD2 1 
ATOM   6672 C CE1 . PHE B 1 422 ? 5.877  18.600  -25.351 1.00   35.60  ? 509  PHE B CE1 1 
ATOM   6673 C CE2 . PHE B 1 422 ? 6.492  20.834  -25.879 1.00   39.11  ? 509  PHE B CE2 1 
ATOM   6674 C CZ  . PHE B 1 422 ? 6.530  19.772  -25.017 1.00   38.90  ? 509  PHE B CZ  1 
ATOM   6675 N N   . GLY B 1 423 ? 1.096  20.266  -30.139 1.00   67.95  ? 510  GLY B N   1 
ATOM   6676 C CA  . GLY B 1 423 ? 0.182  20.274  -31.273 1.00   72.80  ? 510  GLY B CA  1 
ATOM   6677 C C   . GLY B 1 423 ? 0.406  21.339  -32.346 1.00   76.66  ? 510  GLY B C   1 
ATOM   6678 O O   . GLY B 1 423 ? 0.361  21.019  -33.545 1.00   82.00  ? 510  GLY B O   1 
ATOM   6679 N N   . GLU B 1 424 ? 0.315  22.132  -32.873 0.0000 92.66  ? 511  GLU B N   1 
ATOM   6680 C CA  . GLU B 1 424 ? 0.524  22.594  -34.249 0.0000 97.15  ? 511  GLU B CA  1 
ATOM   6681 C C   . GLU B 1 424 ? 1.743  22.695  -34.764 0.0000 101.73 ? 511  GLU B C   1 
ATOM   6682 O O   . GLU B 1 424 ? 2.069  23.211  -35.848 0.0000 102.88 ? 511  GLU B O   1 
ATOM   6683 C CB  . GLU B 1 424 ? -0.517 23.646  -34.646 0.0000 100.08 ? 511  GLU B CB  1 
ATOM   6684 C CG  . GLU B 1 424 ? -1.455 23.197  -35.770 0.0000 103.62 ? 511  GLU B CG  1 
ATOM   6685 C CD  . GLU B 1 424 ? -2.836 23.837  -35.712 0.0000 105.93 ? 511  GLU B CD  1 
ATOM   6686 O OE1 . GLU B 1 424 ? -3.038 24.821  -34.960 0.0000 107.63 ? 511  GLU B OE1 1 
ATOM   6687 O OE2 . GLU B 1 424 ? -3.739 23.345  -36.425 0.0000 105.56 ? 511  GLU B OE2 1 
ATOM   6688 N N   . GLU B 1 425 ? 3.806  21.875  -33.318 1.00   95.77  ? 512  GLU B N   1 
ATOM   6689 C CA  . GLU B 1 425 ? 4.905  21.885  -34.279 1.00   96.17  ? 512  GLU B CA  1 
ATOM   6690 C C   . GLU B 1 425 ? 5.968  20.857  -33.952 1.00   93.38  ? 512  GLU B C   1 
ATOM   6691 O O   . GLU B 1 425 ? 7.053  21.177  -33.483 1.00   94.59  ? 512  GLU B O   1 
ATOM   6692 C CB  . GLU B 1 425 ? 5.586  23.253  -34.406 1.00   98.52  ? 512  GLU B CB  1 
ATOM   6693 C CG  . GLU B 1 425 ? 6.937  23.213  -35.125 1.00   100.48 ? 512  GLU B CG  1 
ATOM   6694 C CD  . GLU B 1 425 ? 6.914  23.844  -36.506 1.00   102.35 ? 512  GLU B CD  1 
ATOM   6695 O OE1 . GLU B 1 425 ? 7.424  24.977  -36.657 1.00   101.38 ? 512  GLU B OE1 1 
ATOM   6696 O OE2 . GLU B 1 425 ? 6.409  23.187  -37.445 1.00   103.38 ? 512  GLU B OE2 1 
ATOM   6697 N N   . GLU B 1 426 ? 5.583  19.622  -34.219 1.00   90.77  ? 513  GLU B N   1 
ATOM   6698 C CA  . GLU B 1 426 ? 6.407  18.412  -34.268 1.00   89.11  ? 513  GLU B CA  1 
ATOM   6699 C C   . GLU B 1 426 ? 5.357  17.323  -34.441 1.00   83.90  ? 513  GLU B C   1 
ATOM   6700 O O   . GLU B 1 426 ? 4.448  17.183  -33.637 1.00   81.61  ? 513  GLU B O   1 
ATOM   6701 C CB  . GLU B 1 426 ? 7.320  18.154  -33.066 1.00   89.99  ? 513  GLU B CB  1 
ATOM   6702 C CG  . GLU B 1 426 ? 8.201  16.905  -33.216 1.00   95.03  ? 513  GLU B CG  1 
ATOM   6703 C CD  . GLU B 1 426 ? 9.527  17.058  -33.996 1.00   98.95  ? 513  GLU B CD  1 
ATOM   6704 O OE1 . GLU B 1 426 ? 9.500  17.138  -35.248 1.00   100.20 ? 513  GLU B OE1 1 
ATOM   6705 O OE2 . GLU B 1 426 ? 10.640 17.036  -33.397 1.00   99.52  ? 513  GLU B OE2 1 
ATOM   6706 N N   . ASP B 1 427 ? 5.440  16.614  -35.554 1.00   80.03  ? 514  ASP B N   1 
ATOM   6707 C CA  . ASP B 1 427 ? 4.444  15.624  -35.880 1.00   78.26  ? 514  ASP B CA  1 
ATOM   6708 C C   . ASP B 1 427 ? 4.597  14.445  -34.919 1.00   80.45  ? 514  ASP B C   1 
ATOM   6709 O O   . ASP B 1 427 ? 5.696  14.137  -34.432 1.00   78.13  ? 514  ASP B O   1 
ATOM   6710 C CB  . ASP B 1 427 ? 4.553  15.197  -37.358 1.00   78.42  ? 514  ASP B CB  1 
ATOM   6711 C CG  . ASP B 1 427 ? 5.945  14.643  -37.761 1.00   77.07  ? 514  ASP B CG  1 
ATOM   6712 O OD1 . ASP B 1 427 ? 6.003  13.443  -38.108 1.00   64.53  ? 514  ASP B OD1 1 
ATOM   6713 O OD2 . ASP B 1 427 ? 7.018  15.302  -37.811 1.00   74.55  ? 514  ASP B OD2 1 
ATOM   6714 N N   . ALA B 1 428 ? 3.468  13.825  -34.599 1.00   80.42  ? 515  ALA B N   1 
ATOM   6715 C CA  . ALA B 1 428 ? 3.481  12.538  -33.924 1.00   80.83  ? 515  ALA B CA  1 
ATOM   6716 C C   . ALA B 1 428 ? 3.316  11.520  -35.053 1.00   83.47  ? 515  ALA B C   1 
ATOM   6717 O O   . ALA B 1 428 ? 2.774  11.836  -36.113 1.00   83.41  ? 515  ALA B O   1 
ATOM   6718 C CB  . ALA B 1 428 ? 2.353  12.438  -32.937 1.00   80.76  ? 515  ALA B CB  1 
ATOM   6719 N N   . VAL B 1 429 ? 3.797  10.303  -34.839 1.00   86.39  ? 516  VAL B N   1 
ATOM   6720 C CA  . VAL B 1 429 ? 3.790  9.255   -35.857 1.00   87.15  ? 516  VAL B CA  1 
ATOM   6721 C C   . VAL B 1 429 ? 2.786  8.157   -35.490 1.00   88.19  ? 516  VAL B C   1 
ATOM   6722 O O   . VAL B 1 429 ? 2.690  7.739   -34.339 1.00   89.71  ? 516  VAL B O   1 
ATOM   6723 C CB  . VAL B 1 429 ? 5.200  8.644   -35.985 1.00   88.42  ? 516  VAL B CB  1 
ATOM   6724 C CG1 . VAL B 1 429 ? 5.331  7.809   -37.242 1.00   91.36  ? 516  VAL B CG1 1 
ATOM   6725 C CG2 . VAL B 1 429 ? 6.279  9.727   -35.963 1.00   87.43  ? 516  VAL B CG2 1 
ATOM   6726 N N   . ASP B 1 430 ? 2.009  7.692   -36.452 1.00   89.53  ? 517  ASP B N   1 
ATOM   6727 C CA  . ASP B 1 430 ? 1.099  6.599   -36.163 1.00   92.88  ? 517  ASP B CA  1 
ATOM   6728 C C   . ASP B 1 430 ? 1.909  5.333   -36.424 1.00   93.29  ? 517  ASP B C   1 
ATOM   6729 O O   . ASP B 1 430 ? 2.674  5.262   -37.385 1.00   93.52  ? 517  ASP B O   1 
ATOM   6730 C CB  . ASP B 1 430 ? -0.208 6.779   -36.935 1.00   96.32  ? 517  ASP B CB  1 
ATOM   6731 C CG  . ASP B 1 430 ? -1.326 7.285   -36.044 1.00   100.20 ? 517  ASP B CG  1 
ATOM   6732 O OD1 . ASP B 1 430 ? -1.191 7.133   -34.810 1.00   107.85 ? 517  ASP B OD1 1 
ATOM   6733 O OD2 . ASP B 1 430 ? -2.368 7.841   -36.458 1.00   101.56 ? 517  ASP B OD2 1 
ATOM   6734 N N   . GLU B 1 431 ? 1.880  4.390   -35.486 1.00   93.89  ? 518  GLU B N   1 
ATOM   6735 C CA  . GLU B 1 431 ? 2.905  3.339   -35.534 1.00   95.05  ? 518  GLU B CA  1 
ATOM   6736 C C   . GLU B 1 431 ? 2.533  2.294   -36.567 1.00   96.64  ? 518  GLU B C   1 
ATOM   6737 O O   . GLU B 1 431 ? 1.460  1.681   -36.522 1.00   98.97  ? 518  GLU B O   1 
ATOM   6738 C CB  . GLU B 1 431 ? 3.263  2.682   -34.170 1.00   92.76  ? 518  GLU B CB  1 
ATOM   6739 C CG  . GLU B 1 431 ? 4.766  2.665   -33.829 1.00   87.23  ? 518  GLU B CG  1 
ATOM   6740 C CD  . GLU B 1 431 ? 5.174  1.869   -32.575 1.00   82.37  ? 518  GLU B CD  1 
ATOM   6741 O OE1 . GLU B 1 431 ? 4.386  1.028   -32.099 1.00   79.88  ? 518  GLU B OE1 1 
ATOM   6742 O OE2 . GLU B 1 431 ? 6.297  2.047   -32.032 1.00   73.08  ? 518  GLU B OE2 1 
ATOM   6743 N N   . THR B 1 432 ? 3.417  2.183   -37.549 1.00   96.01  ? 519  THR B N   1 
ATOM   6744 C CA  . THR B 1 432 ? 3.435  1.020   -38.417 1.00   94.57  ? 519  THR B CA  1 
ATOM   6745 C C   . THR B 1 432 ? 4.906  0.767   -38.709 1.00   92.26  ? 519  THR B C   1 
ATOM   6746 O O   . THR B 1 432 ? 5.292  0.469   -39.839 1.00   90.46  ? 519  THR B O   1 
ATOM   6747 C CB  . THR B 1 432 ? 2.464  1.168   -39.616 1.00   95.14  ? 519  THR B CB  1 
ATOM   6748 O OG1 . THR B 1 432 ? 1.717  -0.044  -39.739 1.00   95.27  ? 519  THR B OG1 1 
ATOM   6749 C CG2 . THR B 1 432 ? 3.129  1.306   -40.975 1.00   96.47  ? 519  THR B CG2 1 
ATOM   6750 N N   . MET B 1 433 ? 5.697  0.914   -37.639 1.00   89.93  ? 520  MET B N   1 
ATOM   6751 C CA  . MET B 1 433 ? 7.119  0.600   -37.629 1.00   89.22  ? 520  MET B CA  1 
ATOM   6752 C C   . MET B 1 433 ? 7.271  -0.917  -37.691 1.00   91.64  ? 520  MET B C   1 
ATOM   6753 O O   . MET B 1 433 ? 7.308  -1.624  -36.670 1.00   88.83  ? 520  MET B O   1 
ATOM   6754 C CB  . MET B 1 433 ? 7.828  1.181   -36.415 1.00   88.16  ? 520  MET B CB  1 
ATOM   6755 C CG  . MET B 1 433 ? 8.683  2.396   -36.752 1.00   88.52  ? 520  MET B CG  1 
ATOM   6756 S SD  . MET B 1 433 ? 9.247  3.371   -35.313 1.00   87.81  ? 520  MET B SD  1 
ATOM   6757 C CE  . MET B 1 433 ? 8.230  2.734   -34.004 1.00   88.03  ? 520  MET B CE  1 
ATOM   6758 N N   . ALA B 1 434 ? 7.335  -1.364  -38.947 1.00   93.50  ? 521  ALA B N   1 
ATOM   6759 C CA  . ALA B 1 434 ? 7.403  -2.760  -39.307 1.00   94.63  ? 521  ALA B CA  1 
ATOM   6760 C C   . ALA B 1 434 ? 8.852  -3.169  -39.332 1.00   95.83  ? 521  ALA B C   1 
ATOM   6761 O O   . ALA B 1 434 ? 9.103  -4.333  -39.071 1.00   99.69  ? 521  ALA B O   1 
ATOM   6762 C CB  . ALA B 1 434 ? 6.715  -3.021  -40.636 1.00   96.57  ? 521  ALA B CB  1 
ATOM   6763 N N   . PRO B 1 435 ? 9.792  -2.293  -39.696 1.00   97.07  ? 522  PRO B N   1 
ATOM   6764 C CA  . PRO B 1 435 ? 11.204 -2.514  -39.350 1.00   98.54  ? 522  PRO B CA  1 
ATOM   6765 C C   . PRO B 1 435 ? 11.336 -1.954  -37.945 1.00   98.09  ? 522  PRO B C   1 
ATOM   6766 O O   . PRO B 1 435 ? 11.641 -0.774  -37.787 1.00   99.21  ? 522  PRO B O   1 
ATOM   6767 C CB  . PRO B 1 435 ? 11.990 -1.677  -40.369 1.00   98.03  ? 522  PRO B CB  1 
ATOM   6768 C CG  . PRO B 1 435 ? 10.987 -1.135  -41.245 1.00   98.06  ? 522  PRO B CG  1 
ATOM   6769 C CD  . PRO B 1 435 ? 9.663  -1.100  -40.541 1.00   97.21  ? 522  PRO B CD  1 
ATOM   6770 N N   . GLN B 1 436 ? 11.098 -2.815  -36.960 1.00   96.24  ? 523  GLN B N   1 
ATOM   6771 C CA  . GLN B 1 436 ? 10.940 -2.452  -35.549 1.00   95.50  ? 523  GLN B CA  1 
ATOM   6772 C C   . GLN B 1 436 ? 12.060 -1.583  -34.982 1.00   92.51  ? 523  GLN B C   1 
ATOM   6773 O O   . GLN B 1 436 ? 12.748 -0.940  -35.757 1.00   93.45  ? 523  GLN B O   1 
ATOM   6774 C CB  . GLN B 1 436 ? 10.762 -3.751  -34.765 1.00   96.49  ? 523  GLN B CB  1 
ATOM   6775 C CG  . GLN B 1 436 ? 9.541  -4.537  -35.261 1.00   97.26  ? 523  GLN B CG  1 
ATOM   6776 C CD  . GLN B 1 436 ? 9.553  -6.020  -34.914 1.00   98.24  ? 523  GLN B CD  1 
ATOM   6777 O OE1 . GLN B 1 436 ? 10.180 -6.452  -33.939 1.00   99.17  ? 523  GLN B OE1 1 
ATOM   6778 N NE2 . GLN B 1 436 ? 8.833  -6.802  -35.707 1.00   94.66  ? 523  GLN B NE2 1 
ATOM   6779 N N   . ASN B 1 437 ? 12.232 -1.486  -33.665 1.00   91.41  ? 524  ASN B N   1 
ATOM   6780 C CA  . ASN B 1 437 ? 13.413 -0.795  -33.125 1.00   89.65  ? 524  ASN B CA  1 
ATOM   6781 C C   . ASN B 1 437 ? 13.661 -0.772  -31.638 1.00   86.38  ? 524  ASN B C   1 
ATOM   6782 O O   . ASN B 1 437 ? 12.721 -0.510  -30.916 1.00   88.57  ? 524  ASN B O   1 
ATOM   6783 C CB  . ASN B 1 437 ? 13.394 0.696   -33.409 1.00   91.24  ? 524  ASN B CB  1 
ATOM   6784 C CG  . ASN B 1 437 ? 14.642 1.347   -32.867 1.00   91.28  ? 524  ASN B CG  1 
ATOM   6785 O OD1 . ASN B 1 437 ? 14.610 2.061   -31.884 1.00   93.01  ? 524  ASN B OD1 1 
ATOM   6786 N ND2 . ASN B 1 437 ? 15.770 1.005   -33.447 1.00   91.41  ? 524  ASN B ND2 1 
ATOM   6787 N N   . ALA B 1 438 ? 14.907 -0.955  -31.198 1.00   85.55  ? 525  ALA B N   1 
ATOM   6788 C CA  . ALA B 1 438 ? 15.362 -0.660  -29.821 1.00   84.88  ? 525  ALA B CA  1 
ATOM   6789 C C   . ALA B 1 438 ? 16.377 -1.581  -29.141 1.00   83.97  ? 525  ALA B C   1 
ATOM   6790 O O   . ALA B 1 438 ? 16.686 -2.680  -29.608 1.00   82.07  ? 525  ALA B O   1 
ATOM   6791 C CB  . ALA B 1 438 ? 14.186 -0.466  -28.849 1.00   86.53  ? 525  ALA B CB  1 
ATOM   6792 N N   . GLY B 1 439 ? 16.867 -1.099  -27.999 1.00   84.01  ? 526  GLY B N   1 
ATOM   6793 C CA  . GLY B 1 439 ? 17.804 -1.826  -27.163 1.00   85.55  ? 526  GLY B CA  1 
ATOM   6794 C C   . GLY B 1 439 ? 18.691 -0.890  -26.352 1.00   87.57  ? 526  GLY B C   1 
ATOM   6795 O O   . GLY B 1 439 ? 18.496 -0.669  -25.146 1.00   89.76  ? 526  GLY B O   1 
ATOM   6796 N N   . MET C 2 36  ? 38.609 -40.096 -26.138 1.00   79.38  ? 36   MET C N   1 
ATOM   6797 C CA  . MET C 2 36  ? 38.143 -40.861 -27.325 1.00   79.42  ? 36   MET C CA  1 
ATOM   6798 C C   . MET C 2 36  ? 36.770 -40.364 -27.806 1.00   78.71  ? 36   MET C C   1 
ATOM   6799 O O   . MET C 2 36  ? 36.493 -40.290 -29.013 1.00   84.52  ? 36   MET C O   1 
ATOM   6800 C CB  . MET C 2 36  ? 38.121 -42.364 -27.001 1.00   76.55  ? 36   MET C CB  1 
ATOM   6801 C CG  . MET C 2 36  ? 39.426 -42.890 -26.429 1.00   72.70  ? 36   MET C CG  1 
ATOM   6802 S SD  . MET C 2 36  ? 40.195 -42.870 -26.350 0.0000 93.09  ? 36   MET C SD  1 
ATOM   6803 C CE  . MET C 2 36  ? 40.663 -44.603 -27.079 0.0000 89.00  ? 36   MET C CE  1 
ATOM   6804 N N   . ASN C 2 37  ? 35.930 -39.953 -26.867 1.00   73.63  ? 37   ASN C N   1 
ATOM   6805 C CA  . ASN C 2 37  ? 34.524 -39.768 -27.180 1.00   68.19  ? 37   ASN C CA  1 
ATOM   6806 C C   . ASN C 2 37  ? 33.887 -38.616 -26.437 1.00   63.64  ? 37   ASN C C   1 
ATOM   6807 O O   . ASN C 2 37  ? 33.204 -37.810 -27.053 1.00   67.36  ? 37   ASN C O   1 
ATOM   6808 C CB  . ASN C 2 37  ? 33.763 -41.043 -26.799 1.00   66.70  ? 37   ASN C CB  1 
ATOM   6809 C CG  . ASN C 2 37  ? 32.785 -41.474 -27.852 1.00   68.81  ? 37   ASN C CG  1 
ATOM   6810 O OD1 . ASN C 2 37  ? 32.893 -41.047 -29.012 1.00   73.70  ? 37   ASN C OD1 1 
ATOM   6811 N ND2 . ASN C 2 37  ? 31.827 -42.330 -27.469 1.00   60.89  ? 37   ASN C ND2 1 
ATOM   6812 N N   . ARG C 2 38  ? 34.079 -38.564 -25.124 1.00   54.81  ? 38   ARG C N   1 
ATOM   6813 C CA  . ARG C 2 38  ? 33.336 -37.626 -24.287 1.00   50.67  ? 38   ARG C CA  1 
ATOM   6814 C C   . ARG C 2 38  ? 34.104 -36.921 -23.188 1.00   47.96  ? 38   ARG C C   1 
ATOM   6815 O O   . ARG C 2 38  ? 34.604 -37.564 -22.289 1.00   46.32  ? 38   ARG C O   1 
ATOM   6816 C CB  . ARG C 2 38  ? 32.158 -38.347 -23.624 1.00   46.23  ? 38   ARG C CB  1 
ATOM   6817 C CG  . ARG C 2 38  ? 31.049 -38.672 -24.577 1.00   48.68  ? 38   ARG C CG  1 
ATOM   6818 C CD  . ARG C 2 38  ? 29.800 -39.230 -23.944 1.00   51.69  ? 38   ARG C CD  1 
ATOM   6819 N NE  . ARG C 2 38  ? 30.119 -40.383 -23.127 1.00   53.11  ? 38   ARG C NE  1 
ATOM   6820 C CZ  . ARG C 2 38  ? 29.723 -40.581 -21.878 1.00   51.30  ? 38   ARG C CZ  1 
ATOM   6821 N NH1 . ARG C 2 38  ? 28.947 -39.716 -21.264 1.00   51.15  ? 38   ARG C NH1 1 
ATOM   6822 N NH2 . ARG C 2 38  ? 30.103 -41.686 -21.250 1.00   55.36  ? 38   ARG C NH2 1 
ATOM   6823 N N   . ARG C 2 39  ? 34.156 -35.596 -23.237 1.00   51.64  ? 39   ARG C N   1 
ATOM   6824 C CA  . ARG C 2 39  ? 34.601 -34.791 -22.094 1.00   52.96  ? 39   ARG C CA  1 
ATOM   6825 C C   . ARG C 2 39  ? 33.643 -34.954 -20.955 1.00   48.74  ? 39   ARG C C   1 
ATOM   6826 O O   . ARG C 2 39  ? 32.505 -35.349 -21.166 1.00   49.00  ? 39   ARG C O   1 
ATOM   6827 C CB  . ARG C 2 39  ? 34.629 -33.297 -22.431 1.00   55.74  ? 39   ARG C CB  1 
ATOM   6828 C CG  . ARG C 2 39  ? 35.726 -32.954 -23.380 1.00   60.90  ? 39   ARG C CG  1 
ATOM   6829 C CD  . ARG C 2 39  ? 36.903 -33.902 -23.269 1.00   68.42  ? 39   ARG C CD  1 
ATOM   6830 N NE  . ARG C 2 39  ? 38.182 -33.193 -23.187 1.00   79.54  ? 39   ARG C NE  1 
ATOM   6831 C CZ  . ARG C 2 39  ? 38.757 -32.726 -22.072 1.00   81.87  ? 39   ARG C CZ  1 
ATOM   6832 N NH1 . ARG C 2 39  ? 38.213 -32.847 -20.859 1.00   76.25  ? 39   ARG C NH1 1 
ATOM   6833 N NH2 . ARG C 2 39  ? 39.923 -32.114 -22.198 1.00   85.55  ? 39   ARG C NH2 1 
ATOM   6834 N N   . LYS C 2 40  ? 34.096 -34.634 -19.752 1.00   49.87  ? 40   LYS C N   1 
ATOM   6835 C CA  . LYS C 2 40  ? 33.191 -34.666 -18.620 1.00   51.05  ? 40   LYS C CA  1 
ATOM   6836 C C   . LYS C 2 40  ? 32.193 -33.509 -18.759 1.00   53.48  ? 40   LYS C C   1 
ATOM   6837 O O   . LYS C 2 40  ? 32.445 -32.545 -19.483 1.00   50.89  ? 40   LYS C O   1 
ATOM   6838 C CB  . LYS C 2 40  ? 33.966 -34.549 -17.321 1.00   49.92  ? 40   LYS C CB  1 
ATOM   6839 C CG  . LYS C 2 40  ? 33.011 -35.410 -16.097 0.0000 67.81  ? 40   LYS C CG  1 
ATOM   6840 C CD  . LYS C 2 40  ? 31.726 -36.309 -16.340 0.0000 68.10  ? 40   LYS C CD  1 
ATOM   6841 C CE  . LYS C 2 40  ? 31.903 -37.719 -15.702 0.0000 67.57  ? 40   LYS C CE  1 
ATOM   6842 N NZ  . LYS C 2 40  ? 30.717 -38.322 -14.968 0.0000 68.97  ? 40   LYS C NZ  1 
ATOM   6843 N N   . ILE C 2 41  ? 31.077 -33.617 -18.041 1.00   56.55  ? 41   ILE C N   1 
ATOM   6844 C CA  . ILE C 2 41  ? 30.037 -32.596 -18.020 1.00   54.96  ? 41   ILE C CA  1 
ATOM   6845 C C   . ILE C 2 41  ? 30.596 -31.236 -17.615 1.00   49.29  ? 41   ILE C C   1 
ATOM   6846 O O   . ILE C 2 41  ? 30.175 -30.221 -18.152 1.00   52.07  ? 41   ILE C O   1 
ATOM   6847 C CB  . ILE C 2 41  ? 28.848 -32.982 -17.094 1.00   59.75  ? 41   ILE C CB  1 
ATOM   6848 C CG1 . ILE C 2 41  ? 28.233 -34.353 -17.433 1.00   61.78  ? 41   ILE C CG1 1 
ATOM   6849 C CG2 . ILE C 2 41  ? 27.736 -31.920 -17.203 1.00   66.30  ? 41   ILE C CG2 1 
ATOM   6850 C CD1 . ILE C 2 41  ? 27.619 -35.077 -16.209 1.00   63.61  ? 41   ILE C CD1 1 
ATOM   6851 N N   . ALA C 2 42  ? 31.560 -31.209 -16.709 1.00   47.31  ? 42   ALA C N   1 
ATOM   6852 C CA  . ALA C 2 42  ? 32.170 -29.964 -16.199 1.00   44.78  ? 42   ALA C CA  1 
ATOM   6853 C C   . ALA C 2 42  ? 33.576 -30.273 -15.721 1.00   43.55  ? 42   ALA C C   1 
ATOM   6854 O O   . ALA C 2 42  ? 33.786 -31.363 -15.213 1.00   35.17  ? 42   ALA C O   1 
ATOM   6855 C CB  . ALA C 2 42  ? 31.361 -29.435 -14.996 1.00   43.60  ? 42   ALA C CB  1 
ATOM   6856 N N   . MET C 2 43  ? 34.538 -29.366 -15.878 1.00   48.87  ? 43   MET C N   1 
ATOM   6857 C CA  . MET C 2 43  ? 35.902 -29.680 -15.428 1.00   50.38  ? 43   MET C CA  1 
ATOM   6858 C C   . MET C 2 43  ? 35.653 -29.845 -13.988 1.00   54.62  ? 43   MET C C   1 
ATOM   6859 O O   . MET C 2 43  ? 35.921 -30.892 -13.396 1.00   61.86  ? 43   MET C O   1 
ATOM   6860 C CB  . MET C 2 43  ? 36.956 -28.567 -15.468 1.00   47.31  ? 43   MET C CB  1 
ATOM   6861 C CG  . MET C 2 43  ? 37.951 -28.643 -14.300 1.00   45.00  ? 43   MET C CG  1 
ATOM   6862 S SD  . MET C 2 43  ? 39.149 -27.286 -14.196 1.00   51.37  ? 43   MET C SD  1 
ATOM   6863 C CE  . MET C 2 43  ? 40.000 -27.659 -15.687 1.00   47.43  ? 43   MET C CE  1 
ATOM   6864 N N   . PRO C 2 44  ? 35.131 -28.768 -13.432 1.00   58.25  ? 44   PRO C N   1 
ATOM   6865 C CA  . PRO C 2 44  ? 34.900 -28.794 -12.001 1.00   62.28  ? 44   PRO C CA  1 
ATOM   6866 C C   . PRO C 2 44  ? 35.546 -30.114 -11.581 1.00   62.21  ? 44   PRO C C   1 
ATOM   6867 O O   . PRO C 2 44  ? 36.699 -30.262 -11.974 1.00   63.52  ? 44   PRO C O   1 
ATOM   6868 C CB  . PRO C 2 44  ? 33.379 -28.628 -11.853 1.00   64.33  ? 44   PRO C CB  1 
ATOM   6869 C CG  . PRO C 2 44  ? 33.333 -29.881 -13.544 0.0000 80.00  ? 44   PRO C CG  1 
ATOM   6870 C CD  . PRO C 2 44  ? 34.398 -29.287 -14.422 0.0000 80.00  ? 44   PRO C CD  1 
ATOM   6871 N N   . LYS C 2 45  ? 34.949 -31.097 -10.931 1.00   59.73  ? 45   LYS C N   1 
ATOM   6872 C CA  . LYS C 2 45  ? 35.941 -31.853 -10.245 1.00   59.00  ? 45   LYS C CA  1 
ATOM   6873 C C   . LYS C 2 45  ? 36.983 -30.702 -10.095 1.00   55.09  ? 45   LYS C C   1 
ATOM   6874 O O   . LYS C 2 45  ? 37.992 -30.601 -10.813 1.00   58.32  ? 45   LYS C O   1 
ATOM   6875 C CB  . LYS C 2 45  ? 36.440 -33.036 -11.052 1.00   60.68  ? 45   LYS C CB  1 
ATOM   6876 C CG  . LYS C 2 45  ? 35.875 -34.311 -10.509 1.00   65.94  ? 45   LYS C CG  1 
ATOM   6877 C CD  . LYS C 2 45  ? 36.908 -35.118 -9.753  1.00   68.19  ? 45   LYS C CD  1 
ATOM   6878 C CE  . LYS C 2 45  ? 36.808 -37.021 -10.331 0.0000 86.24  ? 45   LYS C CE  1 
ATOM   6879 N NZ  . LYS C 2 45  ? 37.659 -38.038 -9.712  0.0000 100.09 ? 45   LYS C NZ  1 
ATOM   6880 N N   . ARG C 2 46  ? 36.681 -29.752 -9.222  1.00   47.08  ? 46   ARG C N   1 
ATOM   6881 C CA  . ARG C 2 46  ? 37.695 -28.825 -8.750  1.00   43.92  ? 46   ARG C CA  1 
ATOM   6882 C C   . ARG C 2 46  ? 37.771 -29.138 -7.270  1.00   38.54  ? 46   ARG C C   1 
ATOM   6883 O O   . ARG C 2 46  ? 36.772 -29.469 -6.655  1.00   36.56  ? 46   ARG C O   1 
ATOM   6884 C CB  . ARG C 2 46  ? 37.275 -27.373 -8.979  1.00   45.92  ? 46   ARG C CB  1 
ATOM   6885 C CG  . ARG C 2 46  ? 37.466 -26.812 -10.366 1.00   50.02  ? 46   ARG C CG  1 
ATOM   6886 C CD  . ARG C 2 46  ? 36.909 -25.412 -10.497 1.00   56.59  ? 46   ARG C CD  1 
ATOM   6887 N NE  . ARG C 2 46  ? 37.012 -24.931 -11.870 1.00   68.80  ? 46   ARG C NE  1 
ATOM   6888 C CZ  . ARG C 2 46  ? 36.327 -23.890 -12.387 1.00   82.42  ? 46   ARG C CZ  1 
ATOM   6889 N NH1 . ARG C 2 46  ? 35.450 -23.194 -11.653 1.00   86.33  ? 46   ARG C NH1 1 
ATOM   6890 N NH2 . ARG C 2 46  ? 36.500 -23.525 -13.661 1.00   82.75  ? 46   ARG C NH2 1 
ATOM   6891 N N   . ARG C 2 47  ? 38.933 -28.984 -6.661  1.00   41.93  ? 47   ARG C N   1 
ATOM   6892 C CA  . ARG C 2 47  ? 39.126 -29.325 -5.239  1.00   44.02  ? 47   ARG C CA  1 
ATOM   6893 C C   . ARG C 2 47  ? 38.153 -28.684 -4.255  1.00   44.94  ? 47   ARG C C   1 
ATOM   6894 O O   . ARG C 2 47  ? 37.687 -29.332 -3.325  1.00   40.05  ? 47   ARG C O   1 
ATOM   6895 C CB  . ARG C 2 47  ? 40.547 -28.944 -4.784  1.00   43.71  ? 47   ARG C CB  1 
ATOM   6896 C CG  . ARG C 2 47  ? 40.861 -29.300 -3.334  1.00   40.41  ? 47   ARG C CG  1 
ATOM   6897 C CD  . ARG C 2 47  ? 42.170 -28.778 -2.805  1.00   40.05  ? 47   ARG C CD  1 
ATOM   6898 N NE  . ARG C 2 47  ? 42.451 -27.466 -3.372  1.00   40.40  ? 47   ARG C NE  1 
ATOM   6899 C CZ  . ARG C 2 47  ? 43.416 -27.172 -4.226  1.00   35.28  ? 47   ARG C CZ  1 
ATOM   6900 N NH1 . ARG C 2 47  ? 44.339 -28.052 -4.610  1.00   40.43  ? 47   ARG C NH1 1 
ATOM   6901 N NH2 . ARG C 2 47  ? 43.491 -25.932 -4.644  1.00   36.46  ? 47   ARG C NH2 1 
ATOM   6902 N N   . MET C 2 48  ? 37.881 -27.404 -4.472  1.00   48.45  ? 48   MET C N   1 
ATOM   6903 C CA  . MET C 2 48  ? 37.068 -26.609 -3.561  1.00   50.65  ? 48   MET C CA  1 
ATOM   6904 C C   . MET C 2 48  ? 35.563 -26.883 -3.675  1.00   49.21  ? 48   MET C C   1 
ATOM   6905 O O   . MET C 2 48  ? 34.852 -26.828 -2.683  1.00   51.30  ? 48   MET C O   1 
ATOM   6906 C CB  . MET C 2 48  ? 37.406 -25.109 -3.682  1.00   51.76  ? 48   MET C CB  1 
ATOM   6907 C CG  . MET C 2 48  ? 38.084 -24.697 -4.986  1.00   55.23  ? 48   MET C CG  1 
ATOM   6908 S SD  . MET C 2 48  ? 39.822 -25.206 -5.244  1.00   55.46  ? 48   MET C SD  1 
ATOM   6909 C CE  . MET C 2 48  ? 40.622 -24.396 -3.721  1.00   47.34  ? 48   MET C CE  1 
ATOM   6910 N N   . ALA C 2 49  ? 35.079 -27.232 -4.857  1.00   50.05  ? 49   ALA C N   1 
ATOM   6911 C CA  . ALA C 2 49  ? 33.645 -27.455 -5.107  1.00   47.03  ? 49   ALA C CA  1 
ATOM   6912 C C   . ALA C 2 49  ? 33.217 -28.939 -5.027  1.00   48.14  ? 49   ALA C C   1 
ATOM   6913 O O   . ALA C 2 49  ? 32.126 -29.207 -4.539  1.00   48.90  ? 49   ALA C O   1 
ATOM   6914 C CB  . ALA C 2 49  ? 33.250 -26.838 -6.476  1.00   42.77  ? 49   ALA C CB  1 
ATOM   6915 N N   . PHE C 2 50  ? 34.047 -29.902 -5.454  1.00   49.91  ? 50   PHE C N   1 
ATOM   6916 C CA  . PHE C 2 50  ? 33.644 -31.321 -5.569  1.00   52.99  ? 50   PHE C CA  1 
ATOM   6917 C C   . PHE C 2 50  ? 33.123 -31.930 -4.279  1.00   55.28  ? 50   PHE C C   1 
ATOM   6918 O O   . PHE C 2 50  ? 33.765 -31.817 -3.244  1.00   56.11  ? 50   PHE C O   1 
ATOM   6919 C CB  . PHE C 2 50  ? 34.783 -32.232 -6.071  1.00   52.41  ? 50   PHE C CB  1 
ATOM   6920 C CG  . PHE C 2 50  ? 34.370 -33.640 -6.550  1.00   48.28  ? 50   PHE C CG  1 
ATOM   6921 C CD1 . PHE C 2 50  ? 33.409 -33.839 -7.535  1.00   48.77  ? 50   PHE C CD1 1 
ATOM   6922 C CD2 . PHE C 2 50  ? 35.048 -34.770 -6.095  1.00   44.22  ? 50   PHE C CD2 1 
ATOM   6923 C CE1 . PHE C 2 50  ? 33.111 -35.145 -8.015  1.00   49.35  ? 50   PHE C CE1 1 
ATOM   6924 C CE2 . PHE C 2 50  ? 34.757 -36.062 -6.569  1.00   42.58  ? 50   PHE C CE2 1 
ATOM   6925 C CZ  . PHE C 2 50  ? 33.769 -36.261 -7.510  1.00   44.49  ? 50   PHE C CZ  1 
ATOM   6926 N N   . LYS C 2 51  ? 31.945 -32.539 -4.396  1.00   59.44  ? 51   LYS C N   1 
ATOM   6927 C CA  . LYS C 2 51  ? 31.334 -33.400 -3.395  1.00   61.87  ? 51   LYS C CA  1 
ATOM   6928 C C   . LYS C 2 51  ? 31.560 -32.891 -1.986  1.00   62.92  ? 51   LYS C C   1 
ATOM   6929 O O   . LYS C 2 51  ? 32.525 -33.312 -1.339  1.00   65.09  ? 51   LYS C O   1 
ATOM   6930 C CB  . LYS C 2 51  ? 31.894 -34.821 -3.552  1.00   62.60  ? 51   LYS C CB  1 
ATOM   6931 C CG  . LYS C 2 51  ? 31.419 -35.750 -2.474  1.00   67.04  ? 51   LYS C CG  1 
ATOM   6932 C CD  . LYS C 2 51  ? 31.507 -37.188 -2.898  1.00   71.44  ? 51   LYS C CD  1 
ATOM   6933 C CE  . LYS C 2 51  ? 30.212 -37.951 -2.510  1.00   73.10  ? 51   LYS C CE  1 
ATOM   6934 N NZ  . LYS C 2 51  ? 30.069 -39.292 -3.216  1.00   76.40  ? 51   LYS C NZ  1 
ATOM   6935 N N   . MET D 2 36  ? 5.217  3.857   -1.184  1.00   56.13  ? 36   MET D N   1 
ATOM   6936 C CA  . MET D 2 36  ? 6.165  3.052   -0.404  1.00   47.10  ? 36   MET D CA  1 
ATOM   6937 C C   . MET D 2 36  ? 6.078  1.706   -1.099  1.00   50.04  ? 36   MET D C   1 
ATOM   6938 O O   . MET D 2 36  ? 5.702  0.705   -0.532  1.00   54.60  ? 36   MET D O   1 
ATOM   6939 C CB  . MET D 2 36  ? 5.641  3.094   1.003   1.00   44.25  ? 36   MET D CB  1 
ATOM   6940 C CG  . MET D 2 36  ? 5.484  4.476   1.519   1.00   38.20  ? 36   MET D CG  1 
ATOM   6941 S SD  . MET D 2 36  ? 6.824  4.777   2.188   0.0000 82.92  ? 36   MET D SD  1 
ATOM   6942 C CE  . MET D 2 36  ? 6.505  6.644   2.069   0.0000 84.51  ? 36   MET D CE  1 
ATOM   6943 N N   . ASN D 2 37  ? 6.518  1.728   -2.352  1.00   52.91  ? 37   ASN D N   1 
ATOM   6944 C CA  . ASN D 2 37  ? 6.096  0.852   -3.434  1.00   47.69  ? 37   ASN D CA  1 
ATOM   6945 C C   . ASN D 2 37  ? 7.230  0.031   -4.074  1.00   42.29  ? 37   ASN D C   1 
ATOM   6946 O O   . ASN D 2 37  ? 6.899  -0.953  -4.717  1.00   45.17  ? 37   ASN D O   1 
ATOM   6947 C CB  . ASN D 2 37  ? 5.453  1.779   -4.503  1.00   50.54  ? 37   ASN D CB  1 
ATOM   6948 C CG  . ASN D 2 37  ? 3.942  1.570   -4.699  1.00   59.15  ? 37   ASN D CG  1 
ATOM   6949 O OD1 . ASN D 2 37  ? 3.479  0.479   -4.995  1.00   62.15  ? 37   ASN D OD1 1 
ATOM   6950 N ND2 . ASN D 2 37  ? 3.178  2.649   -4.622  1.00   66.14  ? 37   ASN D ND2 1 
ATOM   6951 N N   . ARG D 2 38  ? 8.521  0.372   -3.988  1.00   35.80  ? 38   ARG D N   1 
ATOM   6952 C CA  . ARG D 2 38  ? 9.576  -0.486  -4.590  1.00   35.67  ? 38   ARG D CA  1 
ATOM   6953 C C   . ARG D 2 38  ? 10.603 -1.175  -3.697  1.00   34.22  ? 38   ARG D C   1 
ATOM   6954 O O   . ARG D 2 38  ? 11.472 -0.483  -3.188  1.00   37.12  ? 38   ARG D O   1 
ATOM   6955 C CB  . ARG D 2 38  ? 10.452 0.311   -5.552  1.00   35.05  ? 38   ARG D CB  1 
ATOM   6956 C CG  . ARG D 2 38  ? 9.786  0.612   -6.865  1.00   37.69  ? 38   ARG D CG  1 
ATOM   6957 C CD  . ARG D 2 38  ? 10.700 1.195   -7.931  1.00   37.56  ? 38   ARG D CD  1 
ATOM   6958 N NE  . ARG D 2 38  ? 11.380 2.359   -7.381  1.00   38.51  ? 38   ARG D NE  1 
ATOM   6959 C CZ  . ARG D 2 38  ? 12.677 2.564   -7.424  1.00   34.53  ? 38   ARG D CZ  1 
ATOM   6960 N NH1 . ARG D 2 38  ? 13.481 1.715   -8.054  1.00   35.08  ? 38   ARG D NH1 1 
ATOM   6961 N NH2 . ARG D 2 38  ? 13.156 3.665   -6.871  1.00   34.12  ? 38   ARG D NH2 1 
ATOM   6962 N N   . ARG D 2 39  ? 10.543 -2.493  -3.545  1.00   36.42  ? 39   ARG D N   1 
ATOM   6963 C CA  . ARG D 2 39  ? 11.619 -3.319  -2.948  1.00   40.78  ? 39   ARG D CA  1 
ATOM   6964 C C   . ARG D 2 39  ? 12.926 -3.202  -3.715  1.00   38.66  ? 39   ARG D C   1 
ATOM   6965 O O   . ARG D 2 39  ? 12.920 -2.930  -4.906  1.00   42.34  ? 39   ARG D O   1 
ATOM   6966 C CB  . ARG D 2 39  ? 11.314 -4.827  -3.021  1.00   42.68  ? 39   ARG D CB  1 
ATOM   6967 C CG  . ARG D 2 39  ? 10.204 -5.200  -2.116  1.00   50.24  ? 39   ARG D CG  1 
ATOM   6968 C CD  . ARG D 2 39  ? 10.064 -4.265  -0.921  1.00   59.78  ? 39   ARG D CD  1 
ATOM   6969 N NE  . ARG D 2 39  ? 9.885  -4.972  0.357   1.00   72.46  ? 39   ARG D NE  1 
ATOM   6970 C CZ  . ARG D 2 39  ? 10.861 -5.451  1.141   1.00   75.50  ? 39   ARG D CZ  1 
ATOM   6971 N NH1 . ARG D 2 39  ? 12.151 -5.358  0.825   1.00   73.28  ? 39   ARG D NH1 1 
ATOM   6972 N NH2 . ARG D 2 39  ? 10.525 -6.063  2.260   1.00   79.25  ? 39   ARG D NH2 1 
ATOM   6973 N N   . LYS D 2 40  ? 14.037 -3.456  -3.046  1.00   35.38  ? 40   LYS D N   1 
ATOM   6974 C CA  . LYS D 2 40  ? 15.319 -3.356  -3.691  1.00   35.90  ? 40   LYS D CA  1 
ATOM   6975 C C   . LYS D 2 40  ? 15.421 -4.446  -4.739  1.00   37.32  ? 40   LYS D C   1 
ATOM   6976 O O   . LYS D 2 40  ? 14.659 -5.409  -4.707  1.00   35.96  ? 40   LYS D O   1 
ATOM   6977 C CB  . LYS D 2 40  ? 16.429 -3.526  -2.659  1.00   34.22  ? 40   LYS D CB  1 
ATOM   6978 C CG  . LYS D 2 40  ? 17.768 -2.619  -3.277  0.0000 58.73  ? 40   LYS D CG  1 
ATOM   6979 C CD  . LYS D 2 40  ? 17.745 -1.641  -4.557  0.0000 65.06  ? 40   LYS D CD  1 
ATOM   6980 C CE  . LYS D 2 40  ? 18.277 -0.200  -4.246  0.0000 66.42  ? 40   LYS D CE  1 
ATOM   6981 N NZ  . LYS D 2 40  ? 19.076 0.477   -5.335  0.0000 68.87  ? 40   LYS D NZ  1 
ATOM   6982 N N   . ILE D 2 41  ? 16.393 -4.317  -5.632  1.00   40.06  ? 41   ILE D N   1 
ATOM   6983 C CA  . ILE D 2 41  ? 16.600 -5.330  -6.664  1.00   44.14  ? 41   ILE D CA  1 
ATOM   6984 C C   . ILE D 2 41  ? 16.948 -6.682  -6.044  1.00   37.61  ? 41   ILE D C   1 
ATOM   6985 O O   . ILE D 2 41  ? 16.548 -7.725  -6.561  1.00   34.92  ? 41   ILE D O   1 
ATOM   6986 C CB  . ILE D 2 41  ? 17.700 -4.925  -7.657  1.00   51.62  ? 41   ILE D CB  1 
ATOM   6987 C CG1 . ILE D 2 41  ? 17.453 -3.543  -8.295  1.00   58.15  ? 41   ILE D CG1 1 
ATOM   6988 C CG2 . ILE D 2 41  ? 17.796 -5.988  -8.771  1.00   57.14  ? 41   ILE D CG2 1 
ATOM   6989 C CD1 . ILE D 2 41  ? 18.759 -2.778  -8.643  1.00   61.11  ? 41   ILE D CD1 1 
ATOM   6990 N N   . ALA D 2 42  ? 17.663 -6.666  -4.931  1.00   29.31  ? 42   ALA D N   1 
ATOM   6991 C CA  . ALA D 2 42  ? 18.070 -7.909  -4.294  1.00   33.95  ? 42   ALA D CA  1 
ATOM   6992 C C   . ALA D 2 42  ? 18.266 -7.637  -2.804  1.00   33.12  ? 42   ALA D C   1 
ATOM   6993 O O   . ALA D 2 42  ? 18.601 -6.519  -2.508  1.00   25.35  ? 42   ALA D O   1 
ATOM   6994 C CB  . ALA D 2 42  ? 19.359 -8.432  -4.924  1.00   28.89  ? 42   ALA D CB  1 
ATOM   6995 N N   . MET D 2 43  ? 17.998 -8.594  -1.908  1.00   36.25  ? 43   MET D N   1 
ATOM   6996 C CA  . MET D 2 43  ? 18.090 -8.339  -0.482  1.00   38.37  ? 43   MET D CA  1 
ATOM   6997 C C   . MET D 2 43  ? 19.512 -8.160  -0.491  1.00   40.88  ? 43   MET D C   1 
ATOM   6998 O O   . MET D 2 43  ? 20.040 -7.072  -0.294  1.00   51.31  ? 43   MET D O   1 
ATOM   6999 C CB  . MET D 2 43  ? 17.874 -9.488  0.505   1.00   39.24  ? 43   MET D CB  1 
ATOM   7000 C CG  . MET D 2 43  ? 18.791 -9.391  1.747   1.00   37.44  ? 43   MET D CG  1 
ATOM   7001 S SD  . MET D 2 43  ? 18.718 -10.775 2.957   1.00   41.47  ? 43   MET D SD  1 
ATOM   7002 C CE  . MET D 2 43  ? 17.101 -10.362 3.507   1.00   36.68  ? 43   MET D CE  1 
ATOM   7003 N N   . PRO D 2 44  ? 20.140 -9.282  -0.714  1.00   43.68  ? 44   PRO D N   1 
ATOM   7004 C CA  . PRO D 2 44  ? 21.577 -9.154  -0.688  1.00   49.19  ? 44   PRO D CA  1 
ATOM   7005 C C   . PRO D 2 44  ? 21.737 -7.750  -0.051  1.00   47.44  ? 44   PRO D C   1 
ATOM   7006 O O   . PRO D 2 44  ? 21.025 -7.442  0.888   1.00   52.34  ? 44   PRO D O   1 
ATOM   7007 C CB  . PRO D 2 44  ? 21.996 -9.391  -2.153  1.00   53.28  ? 44   PRO D CB  1 
ATOM   7008 C CG  . PRO D 2 44  ? 20.169 -8.357  -2.539  0.0000 60.00  ? 44   PRO D CG  1 
ATOM   7009 C CD  . PRO D 2 44  ? 19.254 -8.954  -1.507  0.0000 60.00  ? 44   PRO D CD  1 
ATOM   7010 N N   . LYS D 2 45  ? 22.533 -6.808  -0.491  1.00   43.42  ? 45   LYS D N   1 
ATOM   7011 C CA  . LYS D 2 45  ? 22.991 -6.081  0.644   1.00   43.29  ? 45   LYS D CA  1 
ATOM   7012 C C   . LYS D 2 45  ? 22.998 -7.317  1.601   1.00   37.58  ? 45   LYS D C   1 
ATOM   7013 O O   . LYS D 2 45  ? 22.127 -7.528  2.441   1.00   34.92  ? 45   LYS D O   1 
ATOM   7014 C CB  . LYS D 2 45  ? 22.095 -4.914  1.038   1.00   42.40  ? 45   LYS D CB  1 
ATOM   7015 C CG  . LYS D 2 45  ? 22.719 -3.602  0.603   1.00   46.96  ? 45   LYS D CG  1 
ATOM   7016 C CD  . LYS D 2 45  ? 23.261 -2.766  1.730   1.00   48.52  ? 45   LYS D CD  1 
ATOM   7017 C CE  . LYS D 2 45  ? 23.204 -1.329  2.247   0.0000 72.09  ? 45   LYS D CE  1 
ATOM   7018 N NZ  . LYS D 2 45  ? 23.009 -0.615  3.521   0.0000 83.44  ? 45   LYS D NZ  1 
ATOM   7019 N N   . ARG D 2 46  ? 23.934 -8.229  1.386   1.00   34.46  ? 46   ARG D N   1 
ATOM   7020 C CA  . ARG D 2 46  ? 24.275 -9.164  2.460   1.00   35.52  ? 46   ARG D CA  1 
ATOM   7021 C C   . ARG D 2 46  ? 25.708 -8.846  2.856   1.00   35.49  ? 46   ARG D C   1 
ATOM   7022 O O   . ARG D 2 46  ? 26.493 -8.504  1.979   1.00   35.23  ? 46   ARG D O   1 
ATOM   7023 C CB  . ARG D 2 46  ? 24.174 -10.599 2.016   1.00   30.83  ? 46   ARG D CB  1 
ATOM   7024 C CG  . ARG D 2 46  ? 22.804 -11.184 1.923   1.00   33.41  ? 46   ARG D CG  1 
ATOM   7025 C CD  . ARG D 2 46  ? 22.815 -12.592 1.396   1.00   31.71  ? 46   ARG D CD  1 
ATOM   7026 N NE  . ARG D 2 46  ? 21.443 -13.065 1.268   1.00   45.42  ? 46   ARG D NE  1 
ATOM   7027 C CZ  . ARG D 2 46  ? 21.066 -14.068 0.443   1.00   67.71  ? 46   ARG D CZ  1 
ATOM   7028 N NH1 . ARG D 2 46  ? 21.957 -14.716 -0.316  1.00   76.07  ? 46   ARG D NH1 1 
ATOM   7029 N NH2 . ARG D 2 46  ? 19.790 -14.463 0.344   1.00   72.38  ? 46   ARG D NH2 1 
ATOM   7030 N N   . ARG D 2 47  ? 26.054 -8.922  4.142   1.00   39.44  ? 47   ARG D N   1 
ATOM   7031 C CA  . ARG D 2 47  ? 27.405 -8.569  4.613   1.00   41.54  ? 47   ARG D CA  1 
ATOM   7032 C C   . ARG D 2 47  ? 28.538 -9.241  3.832   1.00   42.86  ? 47   ARG D C   1 
ATOM   7033 O O   . ARG D 2 47  ? 29.483 -8.599  3.392   1.00   44.29  ? 47   ARG D O   1 
ATOM   7034 C CB  . ARG D 2 47  ? 27.596 -8.922  6.084   1.00   42.62  ? 47   ARG D CB  1 
ATOM   7035 C CG  . ARG D 2 47  ? 28.972 -8.556  6.688   1.00   37.87  ? 47   ARG D CG  1 
ATOM   7036 C CD  . ARG D 2 47  ? 29.154 -9.109  8.080   1.00   35.01  ? 47   ARG D CD  1 
ATOM   7037 N NE  . ARG D 2 47  ? 28.560 -10.451 8.179   1.00   32.62  ? 47   ARG D NE  1 
ATOM   7038 C CZ  . ARG D 2 47  ? 27.598 -10.826 9.017   1.00   33.53  ? 47   ARG D CZ  1 
ATOM   7039 N NH1 . ARG D 2 47  ? 27.086 -10.001 9.926   1.00   38.76  ? 47   ARG D NH1 1 
ATOM   7040 N NH2 . ARG D 2 47  ? 27.182 -12.080 9.001   1.00   32.15  ? 47   ARG D NH2 1 
ATOM   7041 N N   . MET D 2 48  ? 28.403 -10.529 3.588   1.00   45.00  ? 48   MET D N   1 
ATOM   7042 C CA  . MET D 2 48  ? 29.478 -11.283 2.953   1.00   49.12  ? 48   MET D CA  1 
ATOM   7043 C C   . MET D 2 48  ? 29.606 -11.020 1.452   1.00   47.25  ? 48   MET D C   1 
ATOM   7044 O O   . MET D 2 48  ? 30.693 -11.115 0.927   1.00   50.37  ? 48   MET D O   1 
ATOM   7045 C CB  . MET D 2 48  ? 29.340 -12.775 3.263   1.00   50.95  ? 48   MET D CB  1 
ATOM   7046 C CG  . MET D 2 48  ? 27.923 -13.202 3.685   1.00   59.24  ? 48   MET D CG  1 
ATOM   7047 S SD  . MET D 2 48  ? 27.408 -12.704 5.389   1.00   63.94  ? 48   MET D SD  1 
ATOM   7048 C CE  . MET D 2 48  ? 28.798 -13.488 6.344   1.00   62.66  ? 48   MET D CE  1 
ATOM   7049 N N   . ALA D 2 49  ? 28.536 -10.642 0.767   1.00   48.89  ? 49   ALA D N   1 
ATOM   7050 C CA  . ALA D 2 49  ? 28.562 -10.394 -0.682  1.00   47.71  ? 49   ALA D CA  1 
ATOM   7051 C C   . ALA D 2 49  ? 28.718 -8.925  -1.094  1.00   46.80  ? 49   ALA D C   1 
ATOM   7052 O O   . ALA D 2 49  ? 29.290 -8.691  -2.126  1.00   49.41  ? 49   ALA D O   1 
ATOM   7053 C CB  . ALA D 2 49  ? 27.319 -11.009 -1.353  1.00   42.78  ? 49   ALA D CB  1 
ATOM   7054 N N   . PHE D 2 50  ? 28.265 -7.941  -0.325  1.00   50.26  ? 50   PHE D N   1 
ATOM   7055 C CA  . PHE D 2 50  ? 28.252 -6.526  -0.732  1.00   54.19  ? 50   PHE D CA  1 
ATOM   7056 C C   . PHE D 2 50  ? 29.617 -5.914  -0.986  1.00   57.45  ? 50   PHE D C   1 
ATOM   7057 O O   . PHE D 2 50  ? 30.584 -6.277  -0.334  1.00   58.95  ? 50   PHE D O   1 
ATOM   7058 C CB  . PHE D 2 50  ? 27.578 -5.655  0.347   1.00   54.86  ? 50   PHE D CB  1 
ATOM   7059 C CG  . PHE D 2 50  ? 27.282 -4.217  -0.069  1.00   55.29  ? 50   PHE D CG  1 
ATOM   7060 C CD1 . PHE D 2 50  ? 26.359 -3.928  -1.083  1.00   55.24  ? 50   PHE D CD1 1 
ATOM   7061 C CD2 . PHE D 2 50  ? 27.874 -3.145  0.594   1.00   51.88  ? 50   PHE D CD2 1 
ATOM   7062 C CE1 . PHE D 2 50  ? 26.062 -2.600  -1.451  1.00   55.61  ? 50   PHE D CE1 1 
ATOM   7063 C CE2 . PHE D 2 50  ? 27.570 -1.808  0.233   1.00   53.89  ? 50   PHE D CE2 1 
ATOM   7064 C CZ  . PHE D 2 50  ? 26.671 -1.530  -0.798  1.00   52.73  ? 50   PHE D CZ  1 
ATOM   7065 N N   . LYS D 2 51  ? 29.666 -4.954  -1.904  1.00   62.19  ? 51   LYS D N   1 
ATOM   7066 C CA  . LYS D 2 51  ? 30.858 -4.143  -2.130  1.00   66.25  ? 51   LYS D CA  1 
ATOM   7067 C C   . LYS D 2 51  ? 31.935 -5.039  -2.777  1.00   66.74  ? 51   LYS D C   1 
ATOM   7068 O O   . LYS D 2 51  ? 32.845 -4.594  -3.497  1.00   64.64  ? 51   LYS D O   1 
ATOM   7069 C CB  . LYS D 2 51  ? 31.304 -3.491  -0.791  1.00   69.26  ? 51   LYS D CB  1 
ATOM   7070 C CG  . LYS D 2 51  ? 31.982 -2.088  -0.788  1.00   72.69  ? 51   LYS D CG  1 
ATOM   7071 C CD  . LYS D 2 51  ? 31.231 -0.980  -1.518  1.00   74.12  ? 51   LYS D CD  1 
ATOM   7072 C CE  . LYS D 2 51  ? 31.322 -1.175  -3.035  1.00   76.35  ? 51   LYS D CE  1 
ATOM   7073 N NZ  . LYS D 2 51  ? 31.948 -0.042  -3.751  1.00   77.08  ? 51   LYS D NZ  1 
HETATM 7074 O O   . HOH E 3 .   ? 38.354 -15.915 17.948  1.00   47.95  ? 2001 HOH A O   1 
HETATM 7075 O O   . HOH E 3 .   ? 60.057 -2.073  -3.527  1.00   51.04  ? 2002 HOH A O   1 
HETATM 7076 O O   . HOH E 3 .   ? 38.935 -16.994 1.748   1.00   41.67  ? 2003 HOH A O   1 
HETATM 7077 O O   . HOH E 3 .   ? 38.536 -34.887 -3.524  1.00   29.54  ? 2004 HOH A O   1 
HETATM 7078 O O   . HOH E 3 .   ? 41.879 -20.085 -9.961  1.00   48.78  ? 2005 HOH A O   1 
HETATM 7079 O O   . HOH E 3 .   ? 47.817 -6.446  -7.356  1.00   53.33  ? 2006 HOH A O   1 
HETATM 7080 O O   . HOH E 3 .   ? 49.507 -4.661  -11.419 1.00   40.18  ? 2007 HOH A O   1 
HETATM 7081 O O   . HOH E 3 .   ? 54.867 -8.761  -10.810 1.00   51.11  ? 2008 HOH A O   1 
HETATM 7082 O O   . HOH E 3 .   ? 53.439 -16.368 -14.305 1.00   80.50  ? 2009 HOH A O   1 
HETATM 7083 O O   . HOH E 3 .   ? 57.348 -27.663 7.609   1.00   53.30  ? 2010 HOH A O   1 
HETATM 7084 O O   . HOH E 3 .   ? 50.040 -29.248 -0.900  1.00   54.07  ? 2011 HOH A O   1 
HETATM 7085 O O   . HOH E 3 .   ? 41.302 -25.640 -1.043  1.00   49.75  ? 2012 HOH A O   1 
HETATM 7086 O O   . HOH E 3 .   ? 44.980 -25.785 -17.432 1.00   47.92  ? 2013 HOH A O   1 
HETATM 7087 O O   . HOH E 3 .   ? 42.181 -25.711 -16.356 1.00   35.46  ? 2014 HOH A O   1 
HETATM 7088 O O   . HOH E 3 .   ? 40.316 -20.500 -11.833 1.00   43.94  ? 2015 HOH A O   1 
HETATM 7089 O O   . HOH E 3 .   ? 37.208 -24.491 -7.571  1.00   34.58  ? 2016 HOH A O   1 
HETATM 7090 O O   . HOH E 3 .   ? 30.597 -26.354 -17.058 1.00   50.31  ? 2017 HOH A O   1 
HETATM 7091 O O   . HOH E 3 .   ? 39.772 -20.725 -22.968 1.00   45.17  ? 2018 HOH A O   1 
HETATM 7092 O O   . HOH E 3 .   ? 58.236 -27.409 -13.654 1.00   54.61  ? 2019 HOH A O   1 
HETATM 7093 O O   . HOH E 3 .   ? 6.478  -39.804 -35.156 1.00   61.28  ? 2020 HOH A O   1 
HETATM 7094 O O   . HOH E 3 .   ? 61.843 -30.221 -11.115 1.00   50.40  ? 2021 HOH A O   1 
HETATM 7095 O O   . HOH E 3 .   ? 57.431 -36.563 2.126   1.00   47.49  ? 2022 HOH A O   1 
HETATM 7096 O O   . HOH E 3 .   ? 40.041 -31.444 -12.790 1.00   32.79  ? 2023 HOH A O   1 
HETATM 7097 O O   . HOH E 3 .   ? 44.325 -27.837 -19.823 1.00   45.11  ? 2024 HOH A O   1 
HETATM 7098 O O   . HOH E 3 .   ? 52.448 -31.192 -26.196 1.00   53.46  ? 2025 HOH A O   1 
HETATM 7099 O O   . HOH E 3 .   ? 54.678 -32.123 -25.020 1.00   47.29  ? 2026 HOH A O   1 
HETATM 7100 O O   . HOH E 3 .   ? 55.518 -41.460 -13.710 1.00   59.72  ? 2027 HOH A O   1 
HETATM 7101 O O   . HOH E 3 .   ? 53.001 -45.719 -4.580  1.00   40.04  ? 2028 HOH A O   1 
HETATM 7102 O O   . HOH E 3 .   ? 43.629 -38.754 3.762   1.00   44.00  ? 2029 HOH A O   1 
HETATM 7103 O O   . HOH E 3 .   ? 36.732 -38.206 -0.664  1.00   46.04  ? 2030 HOH A O   1 
HETATM 7104 O O   . HOH E 3 .   ? 40.862 -34.203 -3.200  1.00   28.61  ? 2031 HOH A O   1 
HETATM 7105 O O   . HOH E 3 .   ? 35.467 -39.029 -7.775  1.00   44.50  ? 2032 HOH A O   1 
HETATM 7106 O O   . HOH E 3 .   ? 37.332 -40.423 -19.450 1.00   36.03  ? 2033 HOH A O   1 
HETATM 7107 O O   . HOH E 3 .   ? 42.180 -54.313 -9.035  1.00   40.90  ? 2034 HOH A O   1 
HETATM 7108 O O   . HOH E 3 .   ? 37.610 -45.737 -3.050  1.00   21.08  ? 2035 HOH A O   1 
HETATM 7109 O O   . HOH E 3 .   ? 34.873 -48.259 -29.627 1.00   45.94  ? 2036 HOH A O   1 
HETATM 7110 O O   . HOH E 3 .   ? 42.973 -56.551 -19.429 1.00   37.43  ? 2037 HOH A O   1 
HETATM 7111 O O   . HOH E 3 .   ? 41.004 -56.311 -13.438 1.00   41.18  ? 2038 HOH A O   1 
HETATM 7112 O O   . HOH E 3 .   ? 35.081 -58.681 -12.460 1.00   38.67  ? 2039 HOH A O   1 
HETATM 7113 O O   . HOH E 3 .   ? 39.407 -63.029 -17.158 1.00   38.22  ? 2040 HOH A O   1 
HETATM 7114 O O   . HOH E 3 .   ? 27.122 -58.668 -12.694 1.00   48.89  ? 2041 HOH A O   1 
HETATM 7115 O O   . HOH E 3 .   ? 19.377 -42.740 -8.299  1.00   40.74  ? 2042 HOH A O   1 
HETATM 7116 O O   . HOH E 3 .   ? 33.904 -49.575 -31.847 1.00   66.55  ? 2043 HOH A O   1 
HETATM 7117 O O   . HOH E 3 .   ? 21.281 -60.590 -21.145 1.00   44.35  ? 2044 HOH A O   1 
HETATM 7118 O O   . HOH E 3 .   ? 8.413  -38.888 -33.390 1.00   41.88  ? 2045 HOH A O   1 
HETATM 7119 O O   . HOH E 3 .   ? 6.327  -51.719 -39.892 1.00   61.35  ? 2046 HOH A O   1 
HETATM 7120 O O   . HOH F 3 .   ? 50.200 -39.772 17.687  1.00   50.49  ? 2001 HOH B O   1 
HETATM 7121 O O   . HOH F 3 .   ? 49.929 -47.628 15.625  1.00   39.02  ? 2002 HOH B O   1 
HETATM 7122 O O   . HOH F 3 .   ? 44.504 -24.489 17.958  1.00   67.58  ? 2003 HOH B O   1 
HETATM 7123 O O   . HOH F 3 .   ? 50.214 -22.370 8.505   1.00   54.88  ? 2004 HOH B O   1 
HETATM 7124 O O   . HOH F 3 .   ? 40.925 -32.389 -1.050  1.00   46.49  ? 2005 HOH B O   1 
HETATM 7125 O O   . HOH F 3 .   ? 34.857 -38.257 9.087   1.00   27.40  ? 2006 HOH B O   1 
HETATM 7126 O O   . HOH F 3 .   ? 41.394 -40.708 3.742   1.00   35.09  ? 2007 HOH B O   1 
HETATM 7127 O O   . HOH F 3 .   ? 32.553 -38.594 8.386   1.00   43.07  ? 2008 HOH B O   1 
HETATM 7128 O O   . HOH F 3 .   ? 34.846 -41.333 13.710  1.00   44.69  ? 2009 HOH B O   1 
HETATM 7129 O O   . HOH F 3 .   ? 6.870  -11.638 8.873   1.00   52.06  ? 2010 HOH B O   1 
HETATM 7130 O O   . HOH F 3 .   ? 31.856 -23.384 5.250   1.00   42.99  ? 2011 HOH B O   1 
HETATM 7131 O O   . HOH F 3 .   ? 33.906 -21.108 5.692   1.00   47.79  ? 2012 HOH B O   1 
HETATM 7132 O O   . HOH F 3 .   ? 37.055 -31.347 1.523   1.00   37.33  ? 2013 HOH B O   1 
HETATM 7133 O O   . HOH F 3 .   ? 19.364 -33.342 13.636  1.00   36.98  ? 2014 HOH B O   1 
HETATM 7134 O O   . HOH F 3 .   ? 7.613  -13.461 2.815   1.00   30.78  ? 2015 HOH B O   1 
HETATM 7135 O O   . HOH F 3 .   ? 9.222  -12.596 7.264   1.00   35.17  ? 2016 HOH B O   1 
HETATM 7136 O O   . HOH F 3 .   ? 26.308 -31.982 24.828  1.00   31.21  ? 2017 HOH B O   1 
HETATM 7137 O O   . HOH F 3 .   ? 28.851 -20.386 6.616   1.00   35.93  ? 2018 HOH B O   1 
HETATM 7138 O O   . HOH F 3 .   ? 22.257 -17.873 6.548   1.00   30.29  ? 2019 HOH B O   1 
HETATM 7139 O O   . HOH F 3 .   ? 0.857  8.420   10.963  1.00   44.80  ? 2020 HOH B O   1 
HETATM 7140 O O   . HOH F 3 .   ? 20.519 -21.192 0.314   1.00   42.47  ? 2021 HOH B O   1 
HETATM 7141 O O   . HOH F 3 .   ? 15.166 -21.853 17.043  1.00   26.97  ? 2022 HOH B O   1 
HETATM 7142 O O   . HOH F 3 .   ? 0.317  8.397   7.960   1.00   35.75  ? 2023 HOH B O   1 
HETATM 7143 O O   . HOH F 3 .   ? 25.308 -8.368  28.077  1.00   45.35  ? 2024 HOH B O   1 
HETATM 7144 O O   . HOH F 3 .   ? 30.722 -7.179  21.698  1.00   32.27  ? 2025 HOH B O   1 
HETATM 7145 O O   . HOH F 3 .   ? 36.609 -10.020 24.825  1.00   52.99  ? 2026 HOH B O   1 
HETATM 7146 O O   . HOH F 3 .   ? 29.490 -9.103  15.802  1.00   32.06  ? 2027 HOH B O   1 
HETATM 7147 O O   . HOH F 3 .   ? 31.962 -11.319 8.910   1.00   69.05  ? 2028 HOH B O   1 
HETATM 7148 O O   . HOH F 3 .   ? 14.168 -12.225 7.944   1.00   22.41  ? 2029 HOH B O   1 
HETATM 7149 O O   . HOH F 3 .   ? 20.293 -17.635 4.375   1.00   37.62  ? 2030 HOH B O   1 
HETATM 7150 O O   . HOH F 3 .   ? 15.602 -11.999 5.236   1.00   14.10  ? 2031 HOH B O   1 
HETATM 7151 O O   . HOH F 3 .   ? 8.740  -11.516 1.602   1.00   32.99  ? 2032 HOH B O   1 
HETATM 7152 O O   . HOH F 3 .   ? 11.928 -13.882 8.462   1.00   29.29  ? 2033 HOH B O   1 
HETATM 7153 O O   . HOH F 3 .   ? 11.314 -23.266 12.336  1.00   36.15  ? 2034 HOH B O   1 
HETATM 7154 O O   . HOH F 3 .   ? 15.212 -10.889 21.963  1.00   32.01  ? 2035 HOH B O   1 
HETATM 7155 O O   . HOH F 3 .   ? 14.423 -6.701  28.003  1.00   55.01  ? 2036 HOH B O   1 
HETATM 7156 O O   . HOH F 3 .   ? 18.722 -8.386  26.123  1.00   48.50  ? 2037 HOH B O   1 
HETATM 7157 O O   . HOH F 3 .   ? 13.509 -10.832 6.210   1.00   24.23  ? 2038 HOH B O   1 
HETATM 7158 O O   . HOH F 3 .   ? 25.023 -11.909 6.461   1.00   43.38  ? 2039 HOH B O   1 
HETATM 7159 O O   . HOH F 3 .   ? 15.521 -6.371  -0.490  1.00   42.49  ? 2040 HOH B O   1 
HETATM 7160 O O   . HOH F 3 .   ? 2.270  -8.300  6.592   1.00   38.89  ? 2041 HOH B O   1 
HETATM 7161 O O   . HOH F 3 .   ? 1.368  0.455   10.991  1.00   33.08  ? 2042 HOH B O   1 
HETATM 7162 O O   . HOH F 3 .   ? 8.364  -5.826  18.096  1.00   35.94  ? 2043 HOH B O   1 
HETATM 7163 O O   . HOH F 3 .   ? 9.312  2.975   16.436  1.00   27.16  ? 2044 HOH B O   1 
HETATM 7164 O O   . HOH F 3 .   ? 4.835  1.042   18.008  1.00   38.94  ? 2045 HOH B O   1 
HETATM 7165 O O   . HOH F 3 .   ? 5.864  -0.696  21.449  1.00   41.13  ? 2046 HOH B O   1 
HETATM 7166 O O   . HOH F 3 .   ? 15.873 3.159   19.467  1.00   47.70  ? 2047 HOH B O   1 
HETATM 7167 O O   . HOH F 3 .   ? 11.385 4.634   16.779  1.00   40.74  ? 2048 HOH B O   1 
HETATM 7168 O O   . HOH F 3 .   ? 21.806 10.382  11.937  1.00   45.16  ? 2049 HOH B O   1 
HETATM 7169 O O   . HOH F 3 .   ? 18.201 11.266  18.179  1.00   38.74  ? 2050 HOH B O   1 
HETATM 7170 O O   . HOH F 3 .   ? 35.002 3.239   8.093   1.00   43.78  ? 2051 HOH B O   1 
HETATM 7171 O O   . HOH F 3 .   ? 17.704 -5.742  2.431   1.00   25.69  ? 2052 HOH B O   1 
HETATM 7172 O O   . HOH F 3 .   ? 13.388 2.323   0.399   1.00   28.60  ? 2053 HOH B O   1 
HETATM 7173 O O   . HOH F 3 .   ? 14.227 -3.940  0.033   1.00   34.61  ? 2054 HOH B O   1 
HETATM 7174 O O   . HOH F 3 .   ? 2.481  6.312   12.240  1.00   34.50  ? 2055 HOH B O   1 
HETATM 7175 O O   . HOH F 3 .   ? 6.249  14.883  8.336   1.00   36.53  ? 2056 HOH B O   1 
HETATM 7176 O O   . HOH F 3 .   ? 9.127  7.599   15.543  1.00   29.58  ? 2057 HOH B O   1 
HETATM 7177 O O   . HOH F 3 .   ? 16.304 9.159   15.505  1.00   34.84  ? 2058 HOH B O   1 
HETATM 7178 O O   . HOH F 3 .   ? 12.571 13.252  8.815   1.00   37.46  ? 2059 HOH B O   1 
HETATM 7179 O O   . HOH F 3 .   ? 19.918 20.990  0.892   1.00   57.53  ? 2060 HOH B O   1 
HETATM 7180 O O   . HOH F 3 .   ? 3.220  9.334   -3.955  1.00   28.75  ? 2061 HOH B O   1 
HETATM 7181 O O   . HOH F 3 .   ? 1.354  10.448  6.794   1.00   34.21  ? 2062 HOH B O   1 
HETATM 7182 O O   . HOH F 3 .   ? -0.275 13.265  -3.359  1.00   46.35  ? 2063 HOH B O   1 
HETATM 7183 O O   . HOH F 3 .   ? -1.333 13.282  2.759   1.00   56.04  ? 2064 HOH B O   1 
HETATM 7184 O O   . HOH F 3 .   ? 3.805  17.414  5.551   1.00   33.22  ? 2065 HOH B O   1 
HETATM 7185 O O   . HOH F 3 .   ? 4.095  6.380   2.784   1.00   40.21  ? 2066 HOH B O   1 
HETATM 7186 O O   . HOH F 3 .   ? 6.969  24.456  -0.732  1.00   35.11  ? 2067 HOH B O   1 
HETATM 7187 O O   . HOH F 3 .   ? 4.753  22.673  -1.545  1.00   32.13  ? 2068 HOH B O   1 
HETATM 7188 O O   . HOH F 3 .   ? 10.659 17.760  6.572   1.00   23.77  ? 2069 HOH B O   1 
HETATM 7189 O O   . HOH F 3 .   ? 5.820  18.738  5.746   1.00   32.46  ? 2070 HOH B O   1 
HETATM 7190 O O   . HOH F 3 .   ? 13.782 20.220  -1.063  1.00   36.03  ? 2071 HOH B O   1 
HETATM 7191 O O   . HOH F 3 .   ? 20.146 13.553  -16.162 1.00   39.40  ? 2072 HOH B O   1 
HETATM 7192 O O   . HOH F 3 .   ? 26.227 9.476   -15.393 1.00   64.72  ? 2073 HOH B O   1 
HETATM 7193 O O   . HOH F 3 .   ? 25.169 9.628   -15.850 1.00   60.21  ? 2074 HOH B O   1 
HETATM 7194 O O   . HOH F 3 .   ? 1.063  10.818  -5.102  1.00   66.11  ? 2075 HOH B O   1 
HETATM 7195 O O   . HOH F 3 .   ? 1.402  18.880  4.217   1.00   38.32  ? 2076 HOH B O   1 
HETATM 7196 O O   . HOH F 3 .   ? 14.132 25.446  -1.368  1.00   47.71  ? 2077 HOH B O   1 
HETATM 7197 O O   . HOH F 3 .   ? 12.748 22.643  -14.235 1.00   41.99  ? 2078 HOH B O   1 
HETATM 7198 O O   . HOH F 3 .   ? 13.489 28.196  -11.354 1.00   76.89  ? 2079 HOH B O   1 
HETATM 7199 O O   . HOH F 3 .   ? 17.824 23.353  -7.250  1.00   39.57  ? 2080 HOH B O   1 
HETATM 7200 O O   . HOH F 3 .   ? 14.600 6.637   -25.521 1.00   45.38  ? 2081 HOH B O   1 
HETATM 7201 O O   . HOH F 3 .   ? 7.087  -0.037  -16.136 1.00   57.72  ? 2082 HOH B O   1 
HETATM 7202 O O   . HOH F 3 .   ? -4.402 19.410  -17.428 1.00   38.59  ? 2083 HOH B O   1 
HETATM 7203 O O   . HOH F 3 .   ? 6.255  24.435  -29.805 1.00   43.65  ? 2084 HOH B O   1 
HETATM 7204 O O   . HOH F 3 .   ? 6.029  24.268  -26.126 1.00   52.00  ? 2085 HOH B O   1 
HETATM 7205 O O   . HOH F 3 .   ? 12.937 20.442  -27.803 1.00   44.82  ? 2086 HOH B O   1 
HETATM 7206 O O   . HOH F 3 .   ? 0.681  1.110   -27.755 1.00   45.69  ? 2087 HOH B O   1 
HETATM 7207 O O   . HOH F 3 .   ? -2.984 7.364   -31.754 1.00   44.42  ? 2088 HOH B O   1 
HETATM 7208 O O   . HOH F 3 .   ? 1.486  23.307  -24.496 1.00   43.84  ? 2089 HOH B O   1 
HETATM 7209 O O   . HOH F 3 .   ? 2.130  -1.690  -38.040 1.00   53.68  ? 2090 HOH B O   1 
HETATM 7210 O O   . HOH F 3 .   ? 4.851  -0.856  -35.753 1.00   47.01  ? 2091 HOH B O   1 
HETATM 7211 O O   . HOH F 3 .   ? 4.547  -3.682  -38.470 1.00   41.31  ? 2092 HOH B O   1 
HETATM 7212 O O   . HOH F 3 .   ? 10.678 0.088   -32.707 1.00   44.48  ? 2093 HOH B O   1 
HETATM 7213 O O   . HOH F 3 .   ? 21.422 0.202   -25.829 1.00   60.77  ? 2094 HOH B O   1 
HETATM 7214 O O   . HOH G 3 .   ? 34.091 -30.758 -19.073 1.00   45.67  ? 2001 HOH C O   1 
HETATM 7215 O O   . HOH G 3 .   ? 37.463 -38.512 -10.510 1.00   37.28  ? 2002 HOH C O   1 
HETATM 7216 O O   . HOH G 3 .   ? 33.383 -29.877 -8.691  1.00   38.99  ? 2003 HOH C O   1 
HETATM 7217 O O   . HOH G 3 .   ? 35.618 -24.669 -15.593 1.00   46.36  ? 2004 HOH C O   1 
HETATM 7218 O O   . HOH G 3 .   ? 38.371 -31.899 -1.378  1.00   37.34  ? 2005 HOH C O   1 
HETATM 7219 O O   . HOH G 3 .   ? 31.455 -39.167 -2.749  1.00   82.32  ? 2006 HOH C O   1 
HETATM 7220 O O   . HOH G 3 .   ? 33.927 -37.896 -2.357  1.00   45.56  ? 2007 HOH C O   1 
HETATM 7221 O O   . HOH H 3 .   ? 3.780  -0.926  -1.847  1.00   49.50  ? 2001 HOH D O   1 
HETATM 7222 O O   . HOH H 3 .   ? 8.475  -3.821  -5.504  1.00   36.62  ? 2002 HOH D O   1 
HETATM 7223 O O   . HOH H 3 .   ? 20.210 0.386   -6.629  1.00   50.95  ? 2003 HOH D O   1 
HETATM 7224 O O   . HOH H 3 .   ? 17.569 -11.179 -3.026  1.00   34.23  ? 2004 HOH D O   1 
HETATM 7225 O O   . HOH H 3 .   ? 23.827 -7.726  -3.628  1.00   41.49  ? 2005 HOH D O   1 
HETATM 7226 O O   . HOH H 3 .   ? 22.777 -4.849  -1.333  1.00   36.17  ? 2006 HOH D O   1 
HETATM 7227 O O   . HOH H 3 .   ? 25.122 -8.208  -1.582  1.00   28.95  ? 2007 HOH D O   1 
HETATM 7228 O O   . HOH H 3 .   ? 20.341 -6.187  3.854   1.00   25.99  ? 2008 HOH D O   1 
HETATM 7229 O O   . HOH H 3 .   ? 20.650 -16.295 1.503   1.00   32.01  ? 2009 HOH D O   1 
HETATM 7230 O O   . HOH H 3 .   ? 18.003 -13.226 -0.838  1.00   19.28  ? 2010 HOH D O   1 
HETATM 7231 O O   . HOH H 3 .   ? 15.292 -10.847 -3.978  1.00   50.29  ? 2011 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   88  88  GLU GLU A . n 
A 1 2   LEU 2   89  89  LEU LEU A . n 
A 1 3   PRO 3   90  90  PRO PRO A . n 
A 1 4   GLN 4   91  91  GLN GLN A . n 
A 1 5   MET 5   92  92  MET MET A . n 
A 1 6   THR 6   93  93  THR THR A . n 
A 1 7   GLN 7   94  94  GLN GLN A . n 
A 1 8   GLN 8   95  95  GLN GLN A . n 
A 1 9   LEU 9   96  96  LEU LEU A . n 
A 1 10  ASN 10  97  97  ASN ASN A . n 
A 1 11  SER 11  98  98  SER SER A . n 
A 1 12  ASP 12  99  99  ASP ASP A . n 
A 1 13  ASP 13  100 100 ASP ASP A . n 
A 1 14  MET 14  101 101 MET MET A . n 
A 1 15  GLN 15  102 102 GLN GLN A . n 
A 1 16  GLU 16  103 103 GLU GLU A . n 
A 1 17  GLN 17  104 104 GLN GLN A . n 
A 1 18  LEU 18  105 105 LEU LEU A . n 
A 1 19  SER 19  106 106 SER SER A . n 
A 1 20  ALA 20  107 107 ALA ALA A . n 
A 1 21  THR 21  108 108 THR THR A . n 
A 1 22  VAL 22  109 109 VAL VAL A . n 
A 1 23  LYS 23  110 110 LYS LYS A . n 
A 1 24  PHE 24  111 111 PHE PHE A . n 
A 1 25  ARG 25  112 112 ARG ARG A . n 
A 1 26  GLN 26  113 113 GLN GLN A . n 
A 1 27  ILE 27  114 114 ILE ILE A . n 
A 1 28  LEU 28  115 115 LEU LEU A . n 
A 1 29  SER 29  116 116 SER SER A . n 
A 1 30  ARG 30  117 117 ARG ARG A . n 
A 1 31  GLU 31  118 118 GLU GLU A . n 
A 1 32  HIS 32  119 119 HIS HIS A . n 
A 1 33  ARG 33  120 120 ARG ARG A . n 
A 1 34  PRO 34  121 121 PRO PRO A . n 
A 1 35  PRO 35  122 122 PRO PRO A . n 
A 1 36  ILE 36  123 123 ILE ILE A . n 
A 1 37  ASP 37  124 124 ASP ASP A . n 
A 1 38  VAL 38  125 125 VAL VAL A . n 
A 1 39  VAL 39  126 126 VAL VAL A . n 
A 1 40  ILE 40  127 127 ILE ILE A . n 
A 1 41  GLN 41  128 128 GLN GLN A . n 
A 1 42  ALA 42  129 129 ALA ALA A . n 
A 1 43  GLY 43  130 130 GLY GLY A . n 
A 1 44  VAL 44  131 131 VAL VAL A . n 
A 1 45  VAL 45  132 132 VAL VAL A . n 
A 1 46  PRO 46  133 133 PRO PRO A . n 
A 1 47  ARG 47  134 134 ARG ARG A . n 
A 1 48  LEU 48  135 135 LEU LEU A . n 
A 1 49  VAL 49  136 136 VAL VAL A . n 
A 1 50  GLU 50  137 137 GLU GLU A . n 
A 1 51  PHE 51  138 138 PHE PHE A . n 
A 1 52  MET 52  139 139 MET MET A . n 
A 1 53  ARG 53  140 140 ARG ARG A . n 
A 1 54  GLU 54  141 141 GLU GLU A . n 
A 1 55  ASN 55  142 142 ASN ASN A . n 
A 1 56  GLN 56  143 143 GLN GLN A . n 
A 1 57  PRO 57  144 144 PRO PRO A . n 
A 1 58  GLU 58  145 145 GLU GLU A . n 
A 1 59  MET 59  146 146 MET MET A . n 
A 1 60  LEU 60  147 147 LEU LEU A . n 
A 1 61  GLN 61  148 148 GLN GLN A . n 
A 1 62  LEU 62  149 149 LEU LEU A . n 
A 1 63  GLU 63  150 150 GLU GLU A . n 
A 1 64  ALA 64  151 151 ALA ALA A . n 
A 1 65  ALA 65  152 152 ALA ALA A . n 
A 1 66  TRP 66  153 153 TRP TRP A . n 
A 1 67  ALA 67  154 154 ALA ALA A . n 
A 1 68  LEU 68  155 155 LEU LEU A . n 
A 1 69  THR 69  156 156 THR THR A . n 
A 1 70  ASN 70  157 157 ASN ASN A . n 
A 1 71  ILE 71  158 158 ILE ILE A . n 
A 1 72  ALA 72  159 159 ALA ALA A . n 
A 1 73  SER 73  160 160 SER SER A . n 
A 1 74  GLY 74  161 161 GLY GLY A . n 
A 1 75  THR 75  162 162 THR THR A . n 
A 1 76  SER 76  163 163 SER SER A . n 
A 1 77  ALA 77  164 164 ALA ALA A . n 
A 1 78  GLN 78  165 165 GLN GLN A . n 
A 1 79  THR 79  166 166 THR THR A . n 
A 1 80  LYS 80  167 167 LYS LYS A . n 
A 1 81  VAL 81  168 168 VAL VAL A . n 
A 1 82  VAL 82  169 169 VAL VAL A . n 
A 1 83  VAL 83  170 170 VAL VAL A . n 
A 1 84  ASP 84  171 171 ASP ASP A . n 
A 1 85  ALA 85  172 172 ALA ALA A . n 
A 1 86  ASP 86  173 173 ASP ASP A . n 
A 1 87  ALA 87  174 174 ALA ALA A . n 
A 1 88  VAL 88  175 175 VAL VAL A . n 
A 1 89  PRO 89  176 176 PRO PRO A . n 
A 1 90  LEU 90  177 177 LEU LEU A . n 
A 1 91  PHE 91  178 178 PHE PHE A . n 
A 1 92  ILE 92  179 179 ILE ILE A . n 
A 1 93  GLN 93  180 180 GLN GLN A . n 
A 1 94  LEU 94  181 181 LEU LEU A . n 
A 1 95  LEU 95  182 182 LEU LEU A . n 
A 1 96  TYR 96  183 183 TYR TYR A . n 
A 1 97  THR 97  184 184 THR THR A . n 
A 1 98  GLY 98  185 185 GLY GLY A . n 
A 1 99  SER 99  186 186 SER SER A . n 
A 1 100 VAL 100 187 187 VAL VAL A . n 
A 1 101 GLU 101 188 188 GLU GLU A . n 
A 1 102 VAL 102 189 189 VAL VAL A . n 
A 1 103 LYS 103 190 190 LYS LYS A . n 
A 1 104 GLU 104 191 191 GLU GLU A . n 
A 1 105 GLN 105 192 192 GLN GLN A . n 
A 1 106 ALA 106 193 193 ALA ALA A . n 
A 1 107 ILE 107 194 194 ILE ILE A . n 
A 1 108 TRP 108 195 195 TRP TRP A . n 
A 1 109 ALA 109 196 196 ALA ALA A . n 
A 1 110 LEU 110 197 197 LEU LEU A . n 
A 1 111 GLY 111 198 198 GLY GLY A . n 
A 1 112 ASN 112 199 199 ASN ASN A . n 
A 1 113 VAL 113 200 200 VAL VAL A . n 
A 1 114 ALA 114 201 201 ALA ALA A . n 
A 1 115 GLY 115 202 202 GLY GLY A . n 
A 1 116 ASP 116 203 203 ASP ASP A . n 
A 1 117 SER 117 204 204 SER SER A . n 
A 1 118 THR 118 205 205 THR THR A . n 
A 1 119 ASP 119 206 206 ASP ASP A . n 
A 1 120 TYR 120 207 207 TYR TYR A . n 
A 1 121 ARG 121 208 208 ARG ARG A . n 
A 1 122 ASP 122 209 209 ASP ASP A . n 
A 1 123 TYR 123 210 210 TYR TYR A . n 
A 1 124 VAL 124 211 211 VAL VAL A . n 
A 1 125 LEU 125 212 212 LEU LEU A . n 
A 1 126 GLN 126 213 213 GLN GLN A . n 
A 1 127 CYS 127 214 214 CYS CYS A . n 
A 1 128 ASN 128 215 215 ASN ASN A . n 
A 1 129 ALA 129 216 216 ALA ALA A . n 
A 1 130 MET 130 217 217 MET MET A . n 
A 1 131 GLU 131 218 218 GLU GLU A . n 
A 1 132 PRO 132 219 219 PRO PRO A . n 
A 1 133 ILE 133 220 220 ILE ILE A . n 
A 1 134 LEU 134 221 221 LEU LEU A . n 
A 1 135 GLY 135 222 222 GLY GLY A . n 
A 1 136 LEU 136 223 223 LEU LEU A . n 
A 1 137 PHE 137 224 224 PHE PHE A . n 
A 1 138 ASN 138 225 225 ASN ASN A . n 
A 1 139 SER 139 226 226 SER SER A . n 
A 1 140 ASN 140 227 227 ASN ASN A . n 
A 1 141 LYS 141 228 228 LYS LYS A . n 
A 1 142 PRO 142 229 229 PRO PRO A . n 
A 1 143 SER 143 230 230 SER SER A . n 
A 1 144 LEU 144 231 231 LEU LEU A . n 
A 1 145 ILE 145 232 232 ILE ILE A . n 
A 1 146 ARG 146 233 233 ARG ARG A . n 
A 1 147 THR 147 234 234 THR THR A . n 
A 1 148 ALA 148 235 235 ALA ALA A . n 
A 1 149 THR 149 236 236 THR THR A . n 
A 1 150 TRP 150 237 237 TRP TRP A . n 
A 1 151 THR 151 238 238 THR THR A . n 
A 1 152 LEU 152 239 239 LEU LEU A . n 
A 1 153 SER 153 240 240 SER SER A . n 
A 1 154 ASN 154 241 241 ASN ASN A . n 
A 1 155 LEU 155 242 242 LEU LEU A . n 
A 1 156 CYS 156 243 243 CYS CYS A . n 
A 1 157 ARG 157 244 244 ARG ARG A . n 
A 1 158 GLY 158 245 245 GLY GLY A . n 
A 1 159 LYS 159 246 246 LYS LYS A . n 
A 1 160 LYS 160 247 247 LYS LYS A . n 
A 1 161 PRO 161 248 248 PRO PRO A . n 
A 1 162 GLN 162 249 249 GLN GLN A . n 
A 1 163 PRO 163 250 250 PRO PRO A . n 
A 1 164 ASP 164 251 251 ASP ASP A . n 
A 1 165 TRP 165 252 252 TRP TRP A . n 
A 1 166 SER 166 253 253 SER SER A . n 
A 1 167 VAL 167 254 254 VAL VAL A . n 
A 1 168 VAL 168 255 255 VAL VAL A . n 
A 1 169 SER 169 256 256 SER SER A . n 
A 1 170 GLN 170 257 257 GLN GLN A . n 
A 1 171 ALA 171 258 258 ALA ALA A . n 
A 1 172 LEU 172 259 259 LEU LEU A . n 
A 1 173 PRO 173 260 260 PRO PRO A . n 
A 1 174 THR 174 261 261 THR THR A . n 
A 1 175 LEU 175 262 262 LEU LEU A . n 
A 1 176 ALA 176 263 263 ALA ALA A . n 
A 1 177 LYS 177 264 264 LYS LYS A . n 
A 1 178 LEU 178 265 265 LEU LEU A . n 
A 1 179 ILE 179 266 266 ILE ILE A . n 
A 1 180 TYR 180 267 267 TYR TYR A . n 
A 1 181 SER 181 268 268 SER SER A . n 
A 1 182 MET 182 269 269 MET MET A . n 
A 1 183 ASP 183 270 270 ASP ASP A . n 
A 1 184 THR 184 271 271 THR THR A . n 
A 1 185 GLU 185 272 272 GLU GLU A . n 
A 1 186 THR 186 273 273 THR THR A . n 
A 1 187 LEU 187 274 274 LEU LEU A . n 
A 1 188 VAL 188 275 275 VAL VAL A . n 
A 1 189 ASP 189 276 276 ASP ASP A . n 
A 1 190 ALA 190 277 277 ALA ALA A . n 
A 1 191 CYS 191 278 278 CYS CYS A . n 
A 1 192 TRP 192 279 279 TRP TRP A . n 
A 1 193 ALA 193 280 280 ALA ALA A . n 
A 1 194 ILE 194 281 281 ILE ILE A . n 
A 1 195 SER 195 282 282 SER SER A . n 
A 1 196 TYR 196 283 283 TYR TYR A . n 
A 1 197 LEU 197 284 284 LEU LEU A . n 
A 1 198 SER 198 285 285 SER SER A . n 
A 1 199 ASP 199 286 286 ASP ASP A . n 
A 1 200 GLY 200 287 287 GLY GLY A . n 
A 1 201 PRO 201 288 288 PRO PRO A . n 
A 1 202 GLN 202 289 289 GLN GLN A . n 
A 1 203 GLU 203 290 290 GLU GLU A . n 
A 1 204 ALA 204 291 291 ALA ALA A . n 
A 1 205 ILE 205 292 292 ILE ILE A . n 
A 1 206 GLN 206 293 293 GLN GLN A . n 
A 1 207 ALA 207 294 294 ALA ALA A . n 
A 1 208 VAL 208 295 295 VAL VAL A . n 
A 1 209 ILE 209 296 296 ILE ILE A . n 
A 1 210 ASP 210 297 297 ASP ASP A . n 
A 1 211 VAL 211 298 298 VAL VAL A . n 
A 1 212 ARG 212 299 299 ARG ARG A . n 
A 1 213 ILE 213 300 300 ILE ILE A . n 
A 1 214 PRO 214 301 301 PRO PRO A . n 
A 1 215 LYS 215 302 302 LYS LYS A . n 
A 1 216 ARG 216 303 303 ARG ARG A . n 
A 1 217 LEU 217 304 304 LEU LEU A . n 
A 1 218 VAL 218 305 305 VAL VAL A . n 
A 1 219 GLU 219 306 306 GLU GLU A . n 
A 1 220 LEU 220 307 307 LEU LEU A . n 
A 1 221 LEU 221 308 308 LEU LEU A . n 
A 1 222 SER 222 309 309 SER SER A . n 
A 1 223 HIS 223 310 310 HIS HIS A . n 
A 1 224 GLU 224 311 311 GLU GLU A . n 
A 1 225 SER 225 312 312 SER SER A . n 
A 1 226 THR 226 313 313 THR THR A . n 
A 1 227 LEU 227 314 314 LEU LEU A . n 
A 1 228 VAL 228 315 315 VAL VAL A . n 
A 1 229 GLN 229 316 316 GLN GLN A . n 
A 1 230 THR 230 317 317 THR THR A . n 
A 1 231 PRO 231 318 318 PRO PRO A . n 
A 1 232 ALA 232 319 319 ALA ALA A . n 
A 1 233 LEU 233 320 320 LEU LEU A . n 
A 1 234 ARG 234 321 321 ARG ARG A . n 
A 1 235 ALA 235 322 322 ALA ALA A . n 
A 1 236 VAL 236 323 323 VAL VAL A . n 
A 1 237 GLY 237 324 324 GLY GLY A . n 
A 1 238 ASN 238 325 325 ASN ASN A . n 
A 1 239 ILE 239 326 326 ILE ILE A . n 
A 1 240 VAL 240 327 327 VAL VAL A . n 
A 1 241 THR 241 328 328 THR THR A . n 
A 1 242 GLY 242 329 329 GLY GLY A . n 
A 1 243 ASN 243 330 330 ASN ASN A . n 
A 1 244 ASP 244 331 331 ASP ASP A . n 
A 1 245 LEU 245 332 332 LEU LEU A . n 
A 1 246 GLN 246 333 333 GLN GLN A . n 
A 1 247 THR 247 334 334 THR THR A . n 
A 1 248 GLN 248 335 335 GLN GLN A . n 
A 1 249 VAL 249 336 336 VAL VAL A . n 
A 1 250 VAL 250 337 337 VAL VAL A . n 
A 1 251 ILE 251 338 338 ILE ILE A . n 
A 1 252 ASN 252 339 339 ASN ASN A . n 
A 1 253 ALA 253 340 340 ALA ALA A . n 
A 1 254 GLY 254 341 341 GLY GLY A . n 
A 1 255 VAL 255 342 342 VAL VAL A . n 
A 1 256 LEU 256 343 343 LEU LEU A . n 
A 1 257 PRO 257 344 344 PRO PRO A . n 
A 1 258 ALA 258 345 345 ALA ALA A . n 
A 1 259 LEU 259 346 346 LEU LEU A . n 
A 1 260 ARG 260 347 347 ARG ARG A . n 
A 1 261 LEU 261 348 348 LEU LEU A . n 
A 1 262 LEU 262 349 349 LEU LEU A . n 
A 1 263 LEU 263 350 350 LEU LEU A . n 
A 1 264 SER 264 351 351 SER SER A . n 
A 1 265 SER 265 352 352 SER SER A . n 
A 1 266 PRO 266 353 353 PRO PRO A . n 
A 1 267 LYS 267 354 354 LYS LYS A . n 
A 1 268 GLU 268 355 355 GLU GLU A . n 
A 1 269 ASN 269 356 356 ASN ASN A . n 
A 1 270 ILE 270 357 357 ILE ILE A . n 
A 1 271 LYS 271 358 358 LYS LYS A . n 
A 1 272 LYS 272 359 359 LYS LYS A . n 
A 1 273 GLU 273 360 360 GLU GLU A . n 
A 1 274 ALA 274 361 361 ALA ALA A . n 
A 1 275 CYS 275 362 362 CYS CYS A . n 
A 1 276 TRP 276 363 363 TRP TRP A . n 
A 1 277 THR 277 364 364 THR THR A . n 
A 1 278 ILE 278 365 365 ILE ILE A . n 
A 1 279 SER 279 366 366 SER SER A . n 
A 1 280 ASN 280 367 367 ASN ASN A . n 
A 1 281 ILE 281 368 368 ILE ILE A . n 
A 1 282 THR 282 369 369 THR THR A . n 
A 1 283 ALA 283 370 370 ALA ALA A . n 
A 1 284 GLY 284 371 371 GLY GLY A . n 
A 1 285 ASN 285 372 372 ASN ASN A . n 
A 1 286 THR 286 373 373 THR THR A . n 
A 1 287 GLU 287 374 374 GLU GLU A . n 
A 1 288 GLN 288 375 375 GLN GLN A . n 
A 1 289 ILE 289 376 376 ILE ILE A . n 
A 1 290 GLN 290 377 377 GLN GLN A . n 
A 1 291 ALA 291 378 378 ALA ALA A . n 
A 1 292 VAL 292 379 379 VAL VAL A . n 
A 1 293 ILE 293 380 380 ILE ILE A . n 
A 1 294 ASP 294 381 381 ASP ASP A . n 
A 1 295 ALA 295 382 382 ALA ALA A . n 
A 1 296 ASN 296 383 383 ASN ASN A . n 
A 1 297 LEU 297 384 384 LEU LEU A . n 
A 1 298 ILE 298 385 385 ILE ILE A . n 
A 1 299 PRO 299 386 386 PRO PRO A . n 
A 1 300 PRO 300 387 387 PRO PRO A . n 
A 1 301 LEU 301 388 388 LEU LEU A . n 
A 1 302 VAL 302 389 389 VAL VAL A . n 
A 1 303 LYS 303 390 390 LYS LYS A . n 
A 1 304 LEU 304 391 391 LEU LEU A . n 
A 1 305 LEU 305 392 392 LEU LEU A . n 
A 1 306 GLU 306 393 393 GLU GLU A . n 
A 1 307 VAL 307 394 394 VAL VAL A . n 
A 1 308 ALA 308 395 395 ALA ALA A . n 
A 1 309 GLU 309 396 396 GLU GLU A . n 
A 1 310 ASP 310 397 397 ASP ASP A . n 
A 1 311 LYS 311 398 398 LYS LYS A . n 
A 1 312 THR 312 399 399 THR THR A . n 
A 1 313 LYS 313 400 400 LYS LYS A . n 
A 1 314 LYS 314 401 401 LYS LYS A . n 
A 1 315 GLU 315 402 402 GLU GLU A . n 
A 1 316 ALA 316 403 403 ALA ALA A . n 
A 1 317 CYS 317 404 404 CYS CYS A . n 
A 1 318 TRP 318 405 405 TRP TRP A . n 
A 1 319 ALA 319 406 406 ALA ALA A . n 
A 1 320 ILE 320 407 407 ILE ILE A . n 
A 1 321 SER 321 408 408 SER SER A . n 
A 1 322 ASN 322 409 409 ASN ASN A . n 
A 1 323 ALA 323 410 410 ALA ALA A . n 
A 1 324 SER 324 411 411 SER SER A . n 
A 1 325 SER 325 412 412 SER SER A . n 
A 1 326 GLY 326 413 413 GLY GLY A . n 
A 1 327 GLY 327 414 414 GLY GLY A . n 
A 1 328 LEU 328 415 415 LEU LEU A . n 
A 1 329 GLN 329 416 416 GLN GLN A . n 
A 1 330 ARG 330 417 417 ARG ARG A . n 
A 1 331 PRO 331 418 418 PRO PRO A . n 
A 1 332 ASP 332 419 419 ASP ASP A . n 
A 1 333 ILE 333 420 420 ILE ILE A . n 
A 1 334 ILE 334 421 421 ILE ILE A . n 
A 1 335 ARG 335 422 422 ARG ARG A . n 
A 1 336 TYR 336 423 423 TYR TYR A . n 
A 1 337 LEU 337 424 424 LEU LEU A . n 
A 1 338 VAL 338 425 425 VAL VAL A . n 
A 1 339 SER 339 426 426 SER SER A . n 
A 1 340 GLN 340 427 427 GLN GLN A . n 
A 1 341 GLY 341 428 428 GLY GLY A . n 
A 1 342 CYS 342 429 429 CYS CYS A . n 
A 1 343 ILE 343 430 430 ILE ILE A . n 
A 1 344 LYS 344 431 431 LYS LYS A . n 
A 1 345 PRO 345 432 432 PRO PRO A . n 
A 1 346 LEU 346 433 433 LEU LEU A . n 
A 1 347 CYS 347 434 434 CYS CYS A . n 
A 1 348 ASP 348 435 435 ASP ASP A . n 
A 1 349 LEU 349 436 436 LEU LEU A . n 
A 1 350 LEU 350 437 437 LEU LEU A . n 
A 1 351 GLU 351 438 438 GLU GLU A . n 
A 1 352 ILE 352 439 439 ILE ILE A . n 
A 1 353 ALA 353 440 440 ALA ALA A . n 
A 1 354 ASP 354 441 441 ASP ASP A . n 
A 1 355 ASN 355 442 442 ASN ASN A . n 
A 1 356 ARG 356 443 443 ARG ARG A . n 
A 1 357 ILE 357 444 444 ILE ILE A . n 
A 1 358 ILE 358 445 445 ILE ILE A . n 
A 1 359 GLU 359 446 446 GLU GLU A . n 
A 1 360 VAL 360 447 447 VAL VAL A . n 
A 1 361 THR 361 448 448 THR THR A . n 
A 1 362 LEU 362 449 449 LEU LEU A . n 
A 1 363 ASP 363 450 450 ASP ASP A . n 
A 1 364 ALA 364 451 451 ALA ALA A . n 
A 1 365 LEU 365 452 452 LEU LEU A . n 
A 1 366 GLU 366 453 453 GLU GLU A . n 
A 1 367 ASN 367 454 454 ASN ASN A . n 
A 1 368 ILE 368 455 455 ILE ILE A . n 
A 1 369 LEU 369 456 456 LEU LEU A . n 
A 1 370 LYS 370 457 457 LYS LYS A . n 
A 1 371 MET 371 458 458 MET MET A . n 
A 1 372 GLY 372 459 459 GLY GLY A . n 
A 1 373 GLU 373 460 460 GLU GLU A . n 
A 1 374 ALA 374 461 461 ALA ALA A . n 
A 1 375 ASP 375 462 462 ASP ASP A . n 
A 1 376 LYS 376 463 463 LYS LYS A . n 
A 1 377 GLU 377 464 464 GLU GLU A . n 
A 1 378 ALA 378 465 465 ALA ALA A . n 
A 1 379 ARG 379 466 466 ARG ARG A . n 
A 1 380 GLY 380 467 467 GLY GLY A . n 
A 1 381 LEU 381 468 468 LEU LEU A . n 
A 1 382 ASN 382 469 469 ASN ASN A . n 
A 1 383 ILE 383 470 470 ILE ILE A . n 
A 1 384 ASN 384 471 471 ASN ASN A . n 
A 1 385 GLU 385 472 472 GLU GLU A . n 
A 1 386 ASN 386 473 473 ASN ASN A . n 
A 1 387 ALA 387 474 474 ALA ALA A . n 
A 1 388 ASP 388 475 475 ASP ASP A . n 
A 1 389 PHE 389 476 476 PHE PHE A . n 
A 1 390 ILE 390 477 477 ILE ILE A . n 
A 1 391 GLU 391 478 478 GLU GLU A . n 
A 1 392 LYS 392 479 479 LYS LYS A . n 
A 1 393 ALA 393 480 480 ALA ALA A . n 
A 1 394 GLY 394 481 481 GLY GLY A . n 
A 1 395 GLY 395 482 482 GLY GLY A . n 
A 1 396 MET 396 483 483 MET MET A . n 
A 1 397 GLU 397 484 484 GLU GLU A . n 
A 1 398 LYS 398 485 485 LYS LYS A . n 
A 1 399 ILE 399 486 486 ILE ILE A . n 
A 1 400 PHE 400 487 487 PHE PHE A . n 
A 1 401 ASN 401 488 488 ASN ASN A . n 
A 1 402 CYS 402 489 489 CYS CYS A . n 
A 1 403 GLN 403 490 490 GLN GLN A . n 
A 1 404 GLN 404 491 491 GLN GLN A . n 
A 1 405 ASN 405 492 492 ASN ASN A . n 
A 1 406 GLU 406 493 493 GLU GLU A . n 
A 1 407 ASN 407 494 494 ASN ASN A . n 
A 1 408 ASP 408 495 495 ASP ASP A . n 
A 1 409 LYS 409 496 496 LYS LYS A . n 
A 1 410 ILE 410 497 497 ILE ILE A . n 
A 1 411 TYR 411 498 498 TYR TYR A . n 
A 1 412 GLU 412 499 499 GLU GLU A . n 
A 1 413 LYS 413 500 500 LYS LYS A . n 
A 1 414 ALA 414 501 501 ALA ALA A . n 
A 1 415 TYR 415 502 502 TYR TYR A . n 
A 1 416 LYS 416 503 503 LYS LYS A . n 
A 1 417 ILE 417 504 504 ILE ILE A . n 
A 1 418 ILE 418 505 505 ILE ILE A . n 
A 1 419 GLU 419 506 506 GLU GLU A . n 
A 1 420 THR 420 507 507 THR THR A . n 
A 1 421 TYR 421 508 508 TYR TYR A . n 
A 1 422 PHE 422 509 509 PHE PHE A . n 
A 1 423 GLY 423 510 510 GLY GLY A . n 
A 1 424 GLU 424 511 511 GLU GLU A . n 
A 1 425 GLU 425 512 512 GLU GLU A . n 
A 1 426 GLU 426 513 513 GLU GLU A . n 
A 1 427 ASP 427 514 514 ASP ASP A . n 
A 1 428 ALA 428 515 515 ALA ALA A . n 
A 1 429 VAL 429 516 516 VAL VAL A . n 
A 1 430 ASP 430 517 517 ASP ASP A . n 
A 1 431 GLU 431 518 518 GLU GLU A . n 
A 1 432 THR 432 519 519 THR THR A . n 
A 1 433 MET 433 520 520 MET MET A . n 
A 1 434 ALA 434 521 521 ALA ALA A . n 
A 1 435 PRO 435 522 522 PRO PRO A . n 
A 1 436 GLN 436 523 523 GLN GLN A . n 
A 1 437 ASN 437 524 524 ASN ASN A . n 
A 1 438 ALA 438 525 525 ALA ALA A . n 
A 1 439 GLY 439 526 526 GLY GLY A . n 
A 1 440 ASN 440 527 527 ASN ASN A . n 
A 1 441 THR 441 528 ?   ?   ?   A . n 
A 1 442 PHE 442 529 ?   ?   ?   A . n 
A 1 443 GLY 443 530 ?   ?   ?   A . n 
B 1 1   GLU 1   88  88  GLU GLU B . n 
B 1 2   LEU 2   89  89  LEU LEU B . n 
B 1 3   PRO 3   90  90  PRO PRO B . n 
B 1 4   GLN 4   91  91  GLN GLN B . n 
B 1 5   MET 5   92  92  MET MET B . n 
B 1 6   THR 6   93  93  THR THR B . n 
B 1 7   GLN 7   94  94  GLN GLN B . n 
B 1 8   GLN 8   95  95  GLN GLN B . n 
B 1 9   LEU 9   96  96  LEU LEU B . n 
B 1 10  ASN 10  97  97  ASN ASN B . n 
B 1 11  SER 11  98  98  SER SER B . n 
B 1 12  ASP 12  99  99  ASP ASP B . n 
B 1 13  ASP 13  100 100 ASP ASP B . n 
B 1 14  MET 14  101 101 MET MET B . n 
B 1 15  GLN 15  102 102 GLN GLN B . n 
B 1 16  GLU 16  103 103 GLU GLU B . n 
B 1 17  GLN 17  104 104 GLN GLN B . n 
B 1 18  LEU 18  105 105 LEU LEU B . n 
B 1 19  SER 19  106 106 SER SER B . n 
B 1 20  ALA 20  107 107 ALA ALA B . n 
B 1 21  THR 21  108 108 THR THR B . n 
B 1 22  VAL 22  109 109 VAL VAL B . n 
B 1 23  LYS 23  110 110 LYS LYS B . n 
B 1 24  PHE 24  111 111 PHE PHE B . n 
B 1 25  ARG 25  112 112 ARG ARG B . n 
B 1 26  GLN 26  113 113 GLN GLN B . n 
B 1 27  ILE 27  114 114 ILE ILE B . n 
B 1 28  LEU 28  115 115 LEU LEU B . n 
B 1 29  SER 29  116 116 SER SER B . n 
B 1 30  ARG 30  117 117 ARG ARG B . n 
B 1 31  GLU 31  118 118 GLU GLU B . n 
B 1 32  HIS 32  119 119 HIS HIS B . n 
B 1 33  ARG 33  120 120 ARG ARG B . n 
B 1 34  PRO 34  121 121 PRO PRO B . n 
B 1 35  PRO 35  122 122 PRO PRO B . n 
B 1 36  ILE 36  123 123 ILE ILE B . n 
B 1 37  ASP 37  124 124 ASP ASP B . n 
B 1 38  VAL 38  125 125 VAL VAL B . n 
B 1 39  VAL 39  126 126 VAL VAL B . n 
B 1 40  ILE 40  127 127 ILE ILE B . n 
B 1 41  GLN 41  128 128 GLN GLN B . n 
B 1 42  ALA 42  129 129 ALA ALA B . n 
B 1 43  GLY 43  130 130 GLY GLY B . n 
B 1 44  VAL 44  131 131 VAL VAL B . n 
B 1 45  VAL 45  132 132 VAL VAL B . n 
B 1 46  PRO 46  133 133 PRO PRO B . n 
B 1 47  ARG 47  134 134 ARG ARG B . n 
B 1 48  LEU 48  135 135 LEU LEU B . n 
B 1 49  VAL 49  136 136 VAL VAL B . n 
B 1 50  GLU 50  137 137 GLU GLU B . n 
B 1 51  PHE 51  138 138 PHE PHE B . n 
B 1 52  MET 52  139 139 MET MET B . n 
B 1 53  ARG 53  140 140 ARG ARG B . n 
B 1 54  GLU 54  141 141 GLU GLU B . n 
B 1 55  ASN 55  142 142 ASN ASN B . n 
B 1 56  GLN 56  143 143 GLN GLN B . n 
B 1 57  PRO 57  144 144 PRO PRO B . n 
B 1 58  GLU 58  145 145 GLU GLU B . n 
B 1 59  MET 59  146 146 MET MET B . n 
B 1 60  LEU 60  147 147 LEU LEU B . n 
B 1 61  GLN 61  148 148 GLN GLN B . n 
B 1 62  LEU 62  149 149 LEU LEU B . n 
B 1 63  GLU 63  150 150 GLU GLU B . n 
B 1 64  ALA 64  151 151 ALA ALA B . n 
B 1 65  ALA 65  152 152 ALA ALA B . n 
B 1 66  TRP 66  153 153 TRP TRP B . n 
B 1 67  ALA 67  154 154 ALA ALA B . n 
B 1 68  LEU 68  155 155 LEU LEU B . n 
B 1 69  THR 69  156 156 THR THR B . n 
B 1 70  ASN 70  157 157 ASN ASN B . n 
B 1 71  ILE 71  158 158 ILE ILE B . n 
B 1 72  ALA 72  159 159 ALA ALA B . n 
B 1 73  SER 73  160 160 SER SER B . n 
B 1 74  GLY 74  161 161 GLY GLY B . n 
B 1 75  THR 75  162 162 THR THR B . n 
B 1 76  SER 76  163 163 SER SER B . n 
B 1 77  ALA 77  164 164 ALA ALA B . n 
B 1 78  GLN 78  165 165 GLN GLN B . n 
B 1 79  THR 79  166 166 THR THR B . n 
B 1 80  LYS 80  167 167 LYS LYS B . n 
B 1 81  VAL 81  168 168 VAL VAL B . n 
B 1 82  VAL 82  169 169 VAL VAL B . n 
B 1 83  VAL 83  170 170 VAL VAL B . n 
B 1 84  ASP 84  171 171 ASP ASP B . n 
B 1 85  ALA 85  172 172 ALA ALA B . n 
B 1 86  ASP 86  173 173 ASP ASP B . n 
B 1 87  ALA 87  174 174 ALA ALA B . n 
B 1 88  VAL 88  175 175 VAL VAL B . n 
B 1 89  PRO 89  176 176 PRO PRO B . n 
B 1 90  LEU 90  177 177 LEU LEU B . n 
B 1 91  PHE 91  178 178 PHE PHE B . n 
B 1 92  ILE 92  179 179 ILE ILE B . n 
B 1 93  GLN 93  180 180 GLN GLN B . n 
B 1 94  LEU 94  181 181 LEU LEU B . n 
B 1 95  LEU 95  182 182 LEU LEU B . n 
B 1 96  TYR 96  183 183 TYR TYR B . n 
B 1 97  THR 97  184 184 THR THR B . n 
B 1 98  GLY 98  185 185 GLY GLY B . n 
B 1 99  SER 99  186 186 SER SER B . n 
B 1 100 VAL 100 187 187 VAL VAL B . n 
B 1 101 GLU 101 188 188 GLU GLU B . n 
B 1 102 VAL 102 189 189 VAL VAL B . n 
B 1 103 LYS 103 190 190 LYS LYS B . n 
B 1 104 GLU 104 191 191 GLU GLU B . n 
B 1 105 GLN 105 192 192 GLN GLN B . n 
B 1 106 ALA 106 193 193 ALA ALA B . n 
B 1 107 ILE 107 194 194 ILE ILE B . n 
B 1 108 TRP 108 195 195 TRP TRP B . n 
B 1 109 ALA 109 196 196 ALA ALA B . n 
B 1 110 LEU 110 197 197 LEU LEU B . n 
B 1 111 GLY 111 198 198 GLY GLY B . n 
B 1 112 ASN 112 199 199 ASN ASN B . n 
B 1 113 VAL 113 200 200 VAL VAL B . n 
B 1 114 ALA 114 201 201 ALA ALA B . n 
B 1 115 GLY 115 202 202 GLY GLY B . n 
B 1 116 ASP 116 203 203 ASP ASP B . n 
B 1 117 SER 117 204 204 SER SER B . n 
B 1 118 THR 118 205 205 THR THR B . n 
B 1 119 ASP 119 206 206 ASP ASP B . n 
B 1 120 TYR 120 207 207 TYR TYR B . n 
B 1 121 ARG 121 208 208 ARG ARG B . n 
B 1 122 ASP 122 209 209 ASP ASP B . n 
B 1 123 TYR 123 210 210 TYR TYR B . n 
B 1 124 VAL 124 211 211 VAL VAL B . n 
B 1 125 LEU 125 212 212 LEU LEU B . n 
B 1 126 GLN 126 213 213 GLN GLN B . n 
B 1 127 CYS 127 214 214 CYS CYS B . n 
B 1 128 ASN 128 215 215 ASN ASN B . n 
B 1 129 ALA 129 216 216 ALA ALA B . n 
B 1 130 MET 130 217 217 MET MET B . n 
B 1 131 GLU 131 218 218 GLU GLU B . n 
B 1 132 PRO 132 219 219 PRO PRO B . n 
B 1 133 ILE 133 220 220 ILE ILE B . n 
B 1 134 LEU 134 221 221 LEU LEU B . n 
B 1 135 GLY 135 222 222 GLY GLY B . n 
B 1 136 LEU 136 223 223 LEU LEU B . n 
B 1 137 PHE 137 224 224 PHE PHE B . n 
B 1 138 ASN 138 225 225 ASN ASN B . n 
B 1 139 SER 139 226 226 SER SER B . n 
B 1 140 ASN 140 227 227 ASN ASN B . n 
B 1 141 LYS 141 228 228 LYS LYS B . n 
B 1 142 PRO 142 229 229 PRO PRO B . n 
B 1 143 SER 143 230 230 SER SER B . n 
B 1 144 LEU 144 231 231 LEU LEU B . n 
B 1 145 ILE 145 232 232 ILE ILE B . n 
B 1 146 ARG 146 233 233 ARG ARG B . n 
B 1 147 THR 147 234 234 THR THR B . n 
B 1 148 ALA 148 235 235 ALA ALA B . n 
B 1 149 THR 149 236 236 THR THR B . n 
B 1 150 TRP 150 237 237 TRP TRP B . n 
B 1 151 THR 151 238 238 THR THR B . n 
B 1 152 LEU 152 239 239 LEU LEU B . n 
B 1 153 SER 153 240 240 SER SER B . n 
B 1 154 ASN 154 241 241 ASN ASN B . n 
B 1 155 LEU 155 242 242 LEU LEU B . n 
B 1 156 CYS 156 243 243 CYS CYS B . n 
B 1 157 ARG 157 244 244 ARG ARG B . n 
B 1 158 GLY 158 245 245 GLY GLY B . n 
B 1 159 LYS 159 246 246 LYS LYS B . n 
B 1 160 LYS 160 247 247 LYS LYS B . n 
B 1 161 PRO 161 248 248 PRO PRO B . n 
B 1 162 GLN 162 249 249 GLN GLN B . n 
B 1 163 PRO 163 250 250 PRO PRO B . n 
B 1 164 ASP 164 251 251 ASP ASP B . n 
B 1 165 TRP 165 252 252 TRP TRP B . n 
B 1 166 SER 166 253 253 SER SER B . n 
B 1 167 VAL 167 254 254 VAL VAL B . n 
B 1 168 VAL 168 255 255 VAL VAL B . n 
B 1 169 SER 169 256 256 SER SER B . n 
B 1 170 GLN 170 257 257 GLN GLN B . n 
B 1 171 ALA 171 258 258 ALA ALA B . n 
B 1 172 LEU 172 259 259 LEU LEU B . n 
B 1 173 PRO 173 260 260 PRO PRO B . n 
B 1 174 THR 174 261 261 THR THR B . n 
B 1 175 LEU 175 262 262 LEU LEU B . n 
B 1 176 ALA 176 263 263 ALA ALA B . n 
B 1 177 LYS 177 264 264 LYS LYS B . n 
B 1 178 LEU 178 265 265 LEU LEU B . n 
B 1 179 ILE 179 266 266 ILE ILE B . n 
B 1 180 TYR 180 267 267 TYR TYR B . n 
B 1 181 SER 181 268 268 SER SER B . n 
B 1 182 MET 182 269 269 MET MET B . n 
B 1 183 ASP 183 270 270 ASP ASP B . n 
B 1 184 THR 184 271 271 THR THR B . n 
B 1 185 GLU 185 272 272 GLU GLU B . n 
B 1 186 THR 186 273 273 THR THR B . n 
B 1 187 LEU 187 274 274 LEU LEU B . n 
B 1 188 VAL 188 275 275 VAL VAL B . n 
B 1 189 ASP 189 276 276 ASP ASP B . n 
B 1 190 ALA 190 277 277 ALA ALA B . n 
B 1 191 CYS 191 278 278 CYS CYS B . n 
B 1 192 TRP 192 279 279 TRP TRP B . n 
B 1 193 ALA 193 280 280 ALA ALA B . n 
B 1 194 ILE 194 281 281 ILE ILE B . n 
B 1 195 SER 195 282 282 SER SER B . n 
B 1 196 TYR 196 283 283 TYR TYR B . n 
B 1 197 LEU 197 284 284 LEU LEU B . n 
B 1 198 SER 198 285 285 SER SER B . n 
B 1 199 ASP 199 286 286 ASP ASP B . n 
B 1 200 GLY 200 287 287 GLY GLY B . n 
B 1 201 PRO 201 288 288 PRO PRO B . n 
B 1 202 GLN 202 289 289 GLN GLN B . n 
B 1 203 GLU 203 290 290 GLU GLU B . n 
B 1 204 ALA 204 291 291 ALA ALA B . n 
B 1 205 ILE 205 292 292 ILE ILE B . n 
B 1 206 GLN 206 293 293 GLN GLN B . n 
B 1 207 ALA 207 294 294 ALA ALA B . n 
B 1 208 VAL 208 295 295 VAL VAL B . n 
B 1 209 ILE 209 296 296 ILE ILE B . n 
B 1 210 ASP 210 297 297 ASP ASP B . n 
B 1 211 VAL 211 298 298 VAL VAL B . n 
B 1 212 ARG 212 299 299 ARG ARG B . n 
B 1 213 ILE 213 300 300 ILE ILE B . n 
B 1 214 PRO 214 301 301 PRO PRO B . n 
B 1 215 LYS 215 302 302 LYS LYS B . n 
B 1 216 ARG 216 303 303 ARG ARG B . n 
B 1 217 LEU 217 304 304 LEU LEU B . n 
B 1 218 VAL 218 305 305 VAL VAL B . n 
B 1 219 GLU 219 306 306 GLU GLU B . n 
B 1 220 LEU 220 307 307 LEU LEU B . n 
B 1 221 LEU 221 308 308 LEU LEU B . n 
B 1 222 SER 222 309 309 SER SER B . n 
B 1 223 HIS 223 310 310 HIS HIS B . n 
B 1 224 GLU 224 311 311 GLU GLU B . n 
B 1 225 SER 225 312 312 SER SER B . n 
B 1 226 THR 226 313 313 THR THR B . n 
B 1 227 LEU 227 314 314 LEU LEU B . n 
B 1 228 VAL 228 315 315 VAL VAL B . n 
B 1 229 GLN 229 316 316 GLN GLN B . n 
B 1 230 THR 230 317 317 THR THR B . n 
B 1 231 PRO 231 318 318 PRO PRO B . n 
B 1 232 ALA 232 319 319 ALA ALA B . n 
B 1 233 LEU 233 320 320 LEU LEU B . n 
B 1 234 ARG 234 321 321 ARG ARG B . n 
B 1 235 ALA 235 322 322 ALA ALA B . n 
B 1 236 VAL 236 323 323 VAL VAL B . n 
B 1 237 GLY 237 324 324 GLY GLY B . n 
B 1 238 ASN 238 325 325 ASN ASN B . n 
B 1 239 ILE 239 326 326 ILE ILE B . n 
B 1 240 VAL 240 327 327 VAL VAL B . n 
B 1 241 THR 241 328 328 THR THR B . n 
B 1 242 GLY 242 329 329 GLY GLY B . n 
B 1 243 ASN 243 330 330 ASN ASN B . n 
B 1 244 ASP 244 331 331 ASP ASP B . n 
B 1 245 LEU 245 332 332 LEU LEU B . n 
B 1 246 GLN 246 333 333 GLN GLN B . n 
B 1 247 THR 247 334 334 THR THR B . n 
B 1 248 GLN 248 335 335 GLN GLN B . n 
B 1 249 VAL 249 336 336 VAL VAL B . n 
B 1 250 VAL 250 337 337 VAL VAL B . n 
B 1 251 ILE 251 338 338 ILE ILE B . n 
B 1 252 ASN 252 339 339 ASN ASN B . n 
B 1 253 ALA 253 340 340 ALA ALA B . n 
B 1 254 GLY 254 341 341 GLY GLY B . n 
B 1 255 VAL 255 342 342 VAL VAL B . n 
B 1 256 LEU 256 343 343 LEU LEU B . n 
B 1 257 PRO 257 344 344 PRO PRO B . n 
B 1 258 ALA 258 345 345 ALA ALA B . n 
B 1 259 LEU 259 346 346 LEU LEU B . n 
B 1 260 ARG 260 347 347 ARG ARG B . n 
B 1 261 LEU 261 348 348 LEU LEU B . n 
B 1 262 LEU 262 349 349 LEU LEU B . n 
B 1 263 LEU 263 350 350 LEU LEU B . n 
B 1 264 SER 264 351 351 SER SER B . n 
B 1 265 SER 265 352 352 SER SER B . n 
B 1 266 PRO 266 353 353 PRO PRO B . n 
B 1 267 LYS 267 354 354 LYS LYS B . n 
B 1 268 GLU 268 355 355 GLU GLU B . n 
B 1 269 ASN 269 356 356 ASN ASN B . n 
B 1 270 ILE 270 357 357 ILE ILE B . n 
B 1 271 LYS 271 358 358 LYS LYS B . n 
B 1 272 LYS 272 359 359 LYS LYS B . n 
B 1 273 GLU 273 360 360 GLU GLU B . n 
B 1 274 ALA 274 361 361 ALA ALA B . n 
B 1 275 CYS 275 362 362 CYS CYS B . n 
B 1 276 TRP 276 363 363 TRP TRP B . n 
B 1 277 THR 277 364 364 THR THR B . n 
B 1 278 ILE 278 365 365 ILE ILE B . n 
B 1 279 SER 279 366 366 SER SER B . n 
B 1 280 ASN 280 367 367 ASN ASN B . n 
B 1 281 ILE 281 368 368 ILE ILE B . n 
B 1 282 THR 282 369 369 THR THR B . n 
B 1 283 ALA 283 370 370 ALA ALA B . n 
B 1 284 GLY 284 371 371 GLY GLY B . n 
B 1 285 ASN 285 372 372 ASN ASN B . n 
B 1 286 THR 286 373 373 THR THR B . n 
B 1 287 GLU 287 374 374 GLU GLU B . n 
B 1 288 GLN 288 375 375 GLN GLN B . n 
B 1 289 ILE 289 376 376 ILE ILE B . n 
B 1 290 GLN 290 377 377 GLN GLN B . n 
B 1 291 ALA 291 378 378 ALA ALA B . n 
B 1 292 VAL 292 379 379 VAL VAL B . n 
B 1 293 ILE 293 380 380 ILE ILE B . n 
B 1 294 ASP 294 381 381 ASP ASP B . n 
B 1 295 ALA 295 382 382 ALA ALA B . n 
B 1 296 ASN 296 383 383 ASN ASN B . n 
B 1 297 LEU 297 384 384 LEU LEU B . n 
B 1 298 ILE 298 385 385 ILE ILE B . n 
B 1 299 PRO 299 386 386 PRO PRO B . n 
B 1 300 PRO 300 387 387 PRO PRO B . n 
B 1 301 LEU 301 388 388 LEU LEU B . n 
B 1 302 VAL 302 389 389 VAL VAL B . n 
B 1 303 LYS 303 390 390 LYS LYS B . n 
B 1 304 LEU 304 391 391 LEU LEU B . n 
B 1 305 LEU 305 392 392 LEU LEU B . n 
B 1 306 GLU 306 393 393 GLU GLU B . n 
B 1 307 VAL 307 394 394 VAL VAL B . n 
B 1 308 ALA 308 395 395 ALA ALA B . n 
B 1 309 GLU 309 396 396 GLU GLU B . n 
B 1 310 ASP 310 397 397 ASP ASP B . n 
B 1 311 LYS 311 398 398 LYS LYS B . n 
B 1 312 THR 312 399 399 THR THR B . n 
B 1 313 LYS 313 400 400 LYS LYS B . n 
B 1 314 LYS 314 401 401 LYS LYS B . n 
B 1 315 GLU 315 402 402 GLU GLU B . n 
B 1 316 ALA 316 403 403 ALA ALA B . n 
B 1 317 CYS 317 404 404 CYS CYS B . n 
B 1 318 TRP 318 405 405 TRP TRP B . n 
B 1 319 ALA 319 406 406 ALA ALA B . n 
B 1 320 ILE 320 407 407 ILE ILE B . n 
B 1 321 SER 321 408 408 SER SER B . n 
B 1 322 ASN 322 409 409 ASN ASN B . n 
B 1 323 ALA 323 410 410 ALA ALA B . n 
B 1 324 SER 324 411 411 SER SER B . n 
B 1 325 SER 325 412 412 SER SER B . n 
B 1 326 GLY 326 413 413 GLY GLY B . n 
B 1 327 GLY 327 414 414 GLY GLY B . n 
B 1 328 LEU 328 415 415 LEU LEU B . n 
B 1 329 GLN 329 416 416 GLN GLN B . n 
B 1 330 ARG 330 417 417 ARG ARG B . n 
B 1 331 PRO 331 418 418 PRO PRO B . n 
B 1 332 ASP 332 419 419 ASP ASP B . n 
B 1 333 ILE 333 420 420 ILE ILE B . n 
B 1 334 ILE 334 421 421 ILE ILE B . n 
B 1 335 ARG 335 422 422 ARG ARG B . n 
B 1 336 TYR 336 423 423 TYR TYR B . n 
B 1 337 LEU 337 424 424 LEU LEU B . n 
B 1 338 VAL 338 425 425 VAL VAL B . n 
B 1 339 SER 339 426 426 SER SER B . n 
B 1 340 GLN 340 427 427 GLN GLN B . n 
B 1 341 GLY 341 428 428 GLY GLY B . n 
B 1 342 CYS 342 429 429 CYS CYS B . n 
B 1 343 ILE 343 430 430 ILE ILE B . n 
B 1 344 LYS 344 431 431 LYS LYS B . n 
B 1 345 PRO 345 432 432 PRO PRO B . n 
B 1 346 LEU 346 433 433 LEU LEU B . n 
B 1 347 CYS 347 434 434 CYS CYS B . n 
B 1 348 ASP 348 435 435 ASP ASP B . n 
B 1 349 LEU 349 436 436 LEU LEU B . n 
B 1 350 LEU 350 437 437 LEU LEU B . n 
B 1 351 GLU 351 438 438 GLU GLU B . n 
B 1 352 ILE 352 439 439 ILE ILE B . n 
B 1 353 ALA 353 440 440 ALA ALA B . n 
B 1 354 ASP 354 441 441 ASP ASP B . n 
B 1 355 ASN 355 442 442 ASN ASN B . n 
B 1 356 ARG 356 443 443 ARG ARG B . n 
B 1 357 ILE 357 444 444 ILE ILE B . n 
B 1 358 ILE 358 445 445 ILE ILE B . n 
B 1 359 GLU 359 446 446 GLU GLU B . n 
B 1 360 VAL 360 447 447 VAL VAL B . n 
B 1 361 THR 361 448 448 THR THR B . n 
B 1 362 LEU 362 449 449 LEU LEU B . n 
B 1 363 ASP 363 450 450 ASP ASP B . n 
B 1 364 ALA 364 451 451 ALA ALA B . n 
B 1 365 LEU 365 452 452 LEU LEU B . n 
B 1 366 GLU 366 453 453 GLU GLU B . n 
B 1 367 ASN 367 454 454 ASN ASN B . n 
B 1 368 ILE 368 455 455 ILE ILE B . n 
B 1 369 LEU 369 456 456 LEU LEU B . n 
B 1 370 LYS 370 457 457 LYS LYS B . n 
B 1 371 MET 371 458 458 MET MET B . n 
B 1 372 GLY 372 459 459 GLY GLY B . n 
B 1 373 GLU 373 460 460 GLU GLU B . n 
B 1 374 ALA 374 461 461 ALA ALA B . n 
B 1 375 ASP 375 462 462 ASP ASP B . n 
B 1 376 LYS 376 463 463 LYS LYS B . n 
B 1 377 GLU 377 464 464 GLU GLU B . n 
B 1 378 ALA 378 465 465 ALA ALA B . n 
B 1 379 ARG 379 466 466 ARG ARG B . n 
B 1 380 GLY 380 467 467 GLY GLY B . n 
B 1 381 LEU 381 468 468 LEU LEU B . n 
B 1 382 ASN 382 469 469 ASN ASN B . n 
B 1 383 ILE 383 470 470 ILE ILE B . n 
B 1 384 ASN 384 471 471 ASN ASN B . n 
B 1 385 GLU 385 472 472 GLU GLU B . n 
B 1 386 ASN 386 473 473 ASN ASN B . n 
B 1 387 ALA 387 474 474 ALA ALA B . n 
B 1 388 ASP 388 475 475 ASP ASP B . n 
B 1 389 PHE 389 476 476 PHE PHE B . n 
B 1 390 ILE 390 477 477 ILE ILE B . n 
B 1 391 GLU 391 478 478 GLU GLU B . n 
B 1 392 LYS 392 479 479 LYS LYS B . n 
B 1 393 ALA 393 480 480 ALA ALA B . n 
B 1 394 GLY 394 481 481 GLY GLY B . n 
B 1 395 GLY 395 482 482 GLY GLY B . n 
B 1 396 MET 396 483 483 MET MET B . n 
B 1 397 GLU 397 484 484 GLU GLU B . n 
B 1 398 LYS 398 485 485 LYS LYS B . n 
B 1 399 ILE 399 486 486 ILE ILE B . n 
B 1 400 PHE 400 487 487 PHE PHE B . n 
B 1 401 ASN 401 488 488 ASN ASN B . n 
B 1 402 CYS 402 489 489 CYS CYS B . n 
B 1 403 GLN 403 490 490 GLN GLN B . n 
B 1 404 GLN 404 491 491 GLN GLN B . n 
B 1 405 ASN 405 492 492 ASN ASN B . n 
B 1 406 GLU 406 493 493 GLU GLU B . n 
B 1 407 ASN 407 494 494 ASN ASN B . n 
B 1 408 ASP 408 495 495 ASP ASP B . n 
B 1 409 LYS 409 496 496 LYS LYS B . n 
B 1 410 ILE 410 497 497 ILE ILE B . n 
B 1 411 TYR 411 498 498 TYR TYR B . n 
B 1 412 GLU 412 499 499 GLU GLU B . n 
B 1 413 LYS 413 500 500 LYS LYS B . n 
B 1 414 ALA 414 501 501 ALA ALA B . n 
B 1 415 TYR 415 502 502 TYR TYR B . n 
B 1 416 LYS 416 503 503 LYS LYS B . n 
B 1 417 ILE 417 504 504 ILE ILE B . n 
B 1 418 ILE 418 505 505 ILE ILE B . n 
B 1 419 GLU 419 506 506 GLU GLU B . n 
B 1 420 THR 420 507 507 THR THR B . n 
B 1 421 TYR 421 508 508 TYR TYR B . n 
B 1 422 PHE 422 509 509 PHE PHE B . n 
B 1 423 GLY 423 510 510 GLY GLY B . n 
B 1 424 GLU 424 511 511 GLU GLU B . n 
B 1 425 GLU 425 512 512 GLU GLU B . n 
B 1 426 GLU 426 513 513 GLU GLU B . n 
B 1 427 ASP 427 514 514 ASP ASP B . n 
B 1 428 ALA 428 515 515 ALA ALA B . n 
B 1 429 VAL 429 516 516 VAL VAL B . n 
B 1 430 ASP 430 517 517 ASP ASP B . n 
B 1 431 GLU 431 518 518 GLU GLU B . n 
B 1 432 THR 432 519 519 THR THR B . n 
B 1 433 MET 433 520 520 MET MET B . n 
B 1 434 ALA 434 521 521 ALA ALA B . n 
B 1 435 PRO 435 522 522 PRO PRO B . n 
B 1 436 GLN 436 523 523 GLN GLN B . n 
B 1 437 ASN 437 524 524 ASN ASN B . n 
B 1 438 ALA 438 525 525 ALA ALA B . n 
B 1 439 GLY 439 526 526 GLY GLY B . n 
B 1 440 ASN 440 527 ?   ?   ?   B . n 
B 1 441 THR 441 528 ?   ?   ?   B . n 
B 1 442 PHE 442 529 ?   ?   ?   B . n 
B 1 443 GLY 443 530 ?   ?   ?   B . n 
C 2 1   MET 1   1   ?   ?   ?   C . n 
C 2 2   ALA 2   2   ?   ?   ?   C . n 
C 2 3   LYS 3   3   ?   ?   ?   C . n 
C 2 4   ARG 4   4   ?   ?   ?   C . n 
C 2 5   VAL 5   5   ?   ?   ?   C . n 
C 2 6   ALA 6   6   ?   ?   ?   C . n 
C 2 7   ASP 7   7   ?   ?   ?   C . n 
C 2 8   ALA 8   8   ?   ?   ?   C . n 
C 2 9   GLN 9   9   ?   ?   ?   C . n 
C 2 10  ILE 10  10  ?   ?   ?   C . n 
C 2 11  GLN 11  11  ?   ?   ?   C . n 
C 2 12  ARG 12  12  ?   ?   ?   C . n 
C 2 13  GLU 13  13  ?   ?   ?   C . n 
C 2 14  THR 14  14  ?   ?   ?   C . n 
C 2 15  TYR 15  15  ?   ?   ?   C . n 
C 2 16  ASP 16  16  ?   ?   ?   C . n 
C 2 17  SER 17  17  ?   ?   ?   C . n 
C 2 18  ASN 18  18  ?   ?   ?   C . n 
C 2 19  GLU 19  19  ?   ?   ?   C . n 
C 2 20  SER 20  20  ?   ?   ?   C . n 
C 2 21  ASP 21  21  ?   ?   ?   C . n 
C 2 22  ASP 22  22  ?   ?   ?   C . n 
C 2 23  ASP 23  23  ?   ?   ?   C . n 
C 2 24  VAL 24  24  ?   ?   ?   C . n 
C 2 25  THR 25  25  ?   ?   ?   C . n 
C 2 26  PRO 26  26  ?   ?   ?   C . n 
C 2 27  SER 27  27  ?   ?   ?   C . n 
C 2 28  THR 28  28  ?   ?   ?   C . n 
C 2 29  LYS 29  29  ?   ?   ?   C . n 
C 2 30  VAL 30  30  ?   ?   ?   C . n 
C 2 31  ALA 31  31  ?   ?   ?   C . n 
C 2 32  SER 32  32  ?   ?   ?   C . n 
C 2 33  SER 33  33  ?   ?   ?   C . n 
C 2 34  ALA 34  34  ?   ?   ?   C . n 
C 2 35  VAL 35  35  ?   ?   ?   C . n 
C 2 36  MET 36  36  36  MET MET C . n 
C 2 37  ASN 37  37  37  ASN ASN C . n 
C 2 38  ARG 38  38  38  ARG ARG C . n 
C 2 39  ARG 39  39  39  ARG ARG C . n 
C 2 40  LYS 40  40  40  LYS LYS C . n 
C 2 41  ILE 41  41  41  ILE ILE C . n 
C 2 42  ALA 42  42  42  ALA ALA C . n 
C 2 43  MET 43  43  43  MET MET C . n 
C 2 44  PRO 44  44  44  PRO PRO C . n 
C 2 45  LYS 45  45  45  LYS LYS C . n 
C 2 46  ARG 46  46  46  ARG ARG C . n 
C 2 47  ARG 47  47  47  ARG ARG C . n 
C 2 48  MET 48  48  48  MET MET C . n 
C 2 49  ALA 49  49  49  ALA ALA C . n 
C 2 50  PHE 50  50  50  PHE PHE C . n 
C 2 51  LYS 51  51  51  LYS LYS C . n 
D 2 1   MET 1   1   ?   ?   ?   D . n 
D 2 2   ALA 2   2   ?   ?   ?   D . n 
D 2 3   LYS 3   3   ?   ?   ?   D . n 
D 2 4   ARG 4   4   ?   ?   ?   D . n 
D 2 5   VAL 5   5   ?   ?   ?   D . n 
D 2 6   ALA 6   6   ?   ?   ?   D . n 
D 2 7   ASP 7   7   ?   ?   ?   D . n 
D 2 8   ALA 8   8   ?   ?   ?   D . n 
D 2 9   GLN 9   9   ?   ?   ?   D . n 
D 2 10  ILE 10  10  ?   ?   ?   D . n 
D 2 11  GLN 11  11  ?   ?   ?   D . n 
D 2 12  ARG 12  12  ?   ?   ?   D . n 
D 2 13  GLU 13  13  ?   ?   ?   D . n 
D 2 14  THR 14  14  ?   ?   ?   D . n 
D 2 15  TYR 15  15  ?   ?   ?   D . n 
D 2 16  ASP 16  16  ?   ?   ?   D . n 
D 2 17  SER 17  17  ?   ?   ?   D . n 
D 2 18  ASN 18  18  ?   ?   ?   D . n 
D 2 19  GLU 19  19  ?   ?   ?   D . n 
D 2 20  SER 20  20  ?   ?   ?   D . n 
D 2 21  ASP 21  21  ?   ?   ?   D . n 
D 2 22  ASP 22  22  ?   ?   ?   D . n 
D 2 23  ASP 23  23  ?   ?   ?   D . n 
D 2 24  VAL 24  24  ?   ?   ?   D . n 
D 2 25  THR 25  25  ?   ?   ?   D . n 
D 2 26  PRO 26  26  ?   ?   ?   D . n 
D 2 27  SER 27  27  ?   ?   ?   D . n 
D 2 28  THR 28  28  ?   ?   ?   D . n 
D 2 29  LYS 29  29  ?   ?   ?   D . n 
D 2 30  VAL 30  30  ?   ?   ?   D . n 
D 2 31  ALA 31  31  ?   ?   ?   D . n 
D 2 32  SER 32  32  ?   ?   ?   D . n 
D 2 33  SER 33  33  ?   ?   ?   D . n 
D 2 34  ALA 34  34  ?   ?   ?   D . n 
D 2 35  VAL 35  35  ?   ?   ?   D . n 
D 2 36  MET 36  36  36  MET MET D . n 
D 2 37  ASN 37  37  37  ASN ASN D . n 
D 2 38  ARG 38  38  38  ARG ARG D . n 
D 2 39  ARG 39  39  39  ARG ARG D . n 
D 2 40  LYS 40  40  40  LYS LYS D . n 
D 2 41  ILE 41  41  41  ILE ILE D . n 
D 2 42  ALA 42  42  42  ALA ALA D . n 
D 2 43  MET 43  43  43  MET MET D . n 
D 2 44  PRO 44  44  44  PRO PRO D . n 
D 2 45  LYS 45  45  45  LYS LYS D . n 
D 2 46  ARG 46  46  46  ARG ARG D . n 
D 2 47  ARG 47  47  47  ARG ARG D . n 
D 2 48  MET 48  48  48  MET MET D . n 
D 2 49  ALA 49  49  49  ALA ALA D . n 
D 2 50  PHE 50  50  50  PHE PHE D . n 
D 2 51  LYS 51  51  51  LYS LYS D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  2001 2001 HOH HOH A . 
E 3 HOH 2  2002 2002 HOH HOH A . 
E 3 HOH 3  2003 2003 HOH HOH A . 
E 3 HOH 4  2004 2004 HOH HOH A . 
E 3 HOH 5  2005 2005 HOH HOH A . 
E 3 HOH 6  2006 2006 HOH HOH A . 
E 3 HOH 7  2007 2007 HOH HOH A . 
E 3 HOH 8  2008 2008 HOH HOH A . 
E 3 HOH 9  2009 2009 HOH HOH A . 
E 3 HOH 10 2010 2010 HOH HOH A . 
E 3 HOH 11 2011 2011 HOH HOH A . 
E 3 HOH 12 2012 2012 HOH HOH A . 
E 3 HOH 13 2013 2013 HOH HOH A . 
E 3 HOH 14 2014 2014 HOH HOH A . 
E 3 HOH 15 2015 2015 HOH HOH A . 
E 3 HOH 16 2016 2016 HOH HOH A . 
E 3 HOH 17 2017 2017 HOH HOH A . 
E 3 HOH 18 2018 2018 HOH HOH A . 
E 3 HOH 19 2019 2019 HOH HOH A . 
E 3 HOH 20 2020 2020 HOH HOH A . 
E 3 HOH 21 2021 2021 HOH HOH A . 
E 3 HOH 22 2022 2022 HOH HOH A . 
E 3 HOH 23 2023 2023 HOH HOH A . 
E 3 HOH 24 2024 2024 HOH HOH A . 
E 3 HOH 25 2025 2025 HOH HOH A . 
E 3 HOH 26 2026 2026 HOH HOH A . 
E 3 HOH 27 2027 2027 HOH HOH A . 
E 3 HOH 28 2028 2028 HOH HOH A . 
E 3 HOH 29 2029 2029 HOH HOH A . 
E 3 HOH 30 2030 2030 HOH HOH A . 
E 3 HOH 31 2031 2031 HOH HOH A . 
E 3 HOH 32 2032 2032 HOH HOH A . 
E 3 HOH 33 2033 2033 HOH HOH A . 
E 3 HOH 34 2034 2034 HOH HOH A . 
E 3 HOH 35 2035 2035 HOH HOH A . 
E 3 HOH 36 2036 2036 HOH HOH A . 
E 3 HOH 37 2037 2037 HOH HOH A . 
E 3 HOH 38 2038 2038 HOH HOH A . 
E 3 HOH 39 2039 2039 HOH HOH A . 
E 3 HOH 40 2040 2040 HOH HOH A . 
E 3 HOH 41 2041 2041 HOH HOH A . 
E 3 HOH 42 2042 2042 HOH HOH A . 
E 3 HOH 43 2043 2043 HOH HOH A . 
E 3 HOH 44 2044 2044 HOH HOH A . 
E 3 HOH 45 2045 2045 HOH HOH A . 
E 3 HOH 46 2046 2046 HOH HOH A . 
F 3 HOH 1  2001 2001 HOH HOH B . 
F 3 HOH 2  2002 2002 HOH HOH B . 
F 3 HOH 3  2003 2003 HOH HOH B . 
F 3 HOH 4  2004 2004 HOH HOH B . 
F 3 HOH 5  2005 2005 HOH HOH B . 
F 3 HOH 6  2006 2006 HOH HOH B . 
F 3 HOH 7  2007 2007 HOH HOH B . 
F 3 HOH 8  2008 2008 HOH HOH B . 
F 3 HOH 9  2009 2009 HOH HOH B . 
F 3 HOH 10 2010 2010 HOH HOH B . 
F 3 HOH 11 2011 2011 HOH HOH B . 
F 3 HOH 12 2012 2012 HOH HOH B . 
F 3 HOH 13 2013 2013 HOH HOH B . 
F 3 HOH 14 2014 2014 HOH HOH B . 
F 3 HOH 15 2015 2015 HOH HOH B . 
F 3 HOH 16 2016 2016 HOH HOH B . 
F 3 HOH 17 2017 2017 HOH HOH B . 
F 3 HOH 18 2018 2018 HOH HOH B . 
F 3 HOH 19 2019 2019 HOH HOH B . 
F 3 HOH 20 2020 2020 HOH HOH B . 
F 3 HOH 21 2021 2021 HOH HOH B . 
F 3 HOH 22 2022 2022 HOH HOH B . 
F 3 HOH 23 2023 2023 HOH HOH B . 
F 3 HOH 24 2024 2024 HOH HOH B . 
F 3 HOH 25 2025 2025 HOH HOH B . 
F 3 HOH 26 2026 2026 HOH HOH B . 
F 3 HOH 27 2027 2027 HOH HOH B . 
F 3 HOH 28 2028 2028 HOH HOH B . 
F 3 HOH 29 2029 2029 HOH HOH B . 
F 3 HOH 30 2030 2030 HOH HOH B . 
F 3 HOH 31 2031 2031 HOH HOH B . 
F 3 HOH 32 2032 2032 HOH HOH B . 
F 3 HOH 33 2033 2033 HOH HOH B . 
F 3 HOH 34 2034 2034 HOH HOH B . 
F 3 HOH 35 2035 2035 HOH HOH B . 
F 3 HOH 36 2036 2036 HOH HOH B . 
F 3 HOH 37 2037 2037 HOH HOH B . 
F 3 HOH 38 2038 2038 HOH HOH B . 
F 3 HOH 39 2039 2039 HOH HOH B . 
F 3 HOH 40 2040 2040 HOH HOH B . 
F 3 HOH 41 2041 2041 HOH HOH B . 
F 3 HOH 42 2042 2042 HOH HOH B . 
F 3 HOH 43 2043 2043 HOH HOH B . 
F 3 HOH 44 2044 2044 HOH HOH B . 
F 3 HOH 45 2045 2045 HOH HOH B . 
F 3 HOH 46 2046 2046 HOH HOH B . 
F 3 HOH 47 2047 2047 HOH HOH B . 
F 3 HOH 48 2048 2048 HOH HOH B . 
F 3 HOH 49 2049 2049 HOH HOH B . 
F 3 HOH 50 2050 2050 HOH HOH B . 
F 3 HOH 51 2051 2051 HOH HOH B . 
F 3 HOH 52 2052 2052 HOH HOH B . 
F 3 HOH 53 2053 2053 HOH HOH B . 
F 3 HOH 54 2054 2054 HOH HOH B . 
F 3 HOH 55 2055 2055 HOH HOH B . 
F 3 HOH 56 2056 2056 HOH HOH B . 
F 3 HOH 57 2057 2057 HOH HOH B . 
F 3 HOH 58 2058 2058 HOH HOH B . 
F 3 HOH 59 2059 2059 HOH HOH B . 
F 3 HOH 60 2060 2060 HOH HOH B . 
F 3 HOH 61 2061 2061 HOH HOH B . 
F 3 HOH 62 2062 2062 HOH HOH B . 
F 3 HOH 63 2063 2063 HOH HOH B . 
F 3 HOH 64 2064 2064 HOH HOH B . 
F 3 HOH 65 2065 2065 HOH HOH B . 
F 3 HOH 66 2066 2066 HOH HOH B . 
F 3 HOH 67 2067 2067 HOH HOH B . 
F 3 HOH 68 2068 2068 HOH HOH B . 
F 3 HOH 69 2069 2069 HOH HOH B . 
F 3 HOH 70 2070 2070 HOH HOH B . 
F 3 HOH 71 2071 2071 HOH HOH B . 
F 3 HOH 72 2072 2072 HOH HOH B . 
F 3 HOH 73 2073 2073 HOH HOH B . 
F 3 HOH 74 2074 2074 HOH HOH B . 
F 3 HOH 75 2075 2075 HOH HOH B . 
F 3 HOH 76 2076 2076 HOH HOH B . 
F 3 HOH 77 2077 2077 HOH HOH B . 
F 3 HOH 78 2078 2078 HOH HOH B . 
F 3 HOH 79 2079 2079 HOH HOH B . 
F 3 HOH 80 2080 2080 HOH HOH B . 
F 3 HOH 81 2081 2081 HOH HOH B . 
F 3 HOH 82 2082 2082 HOH HOH B . 
F 3 HOH 83 2083 2083 HOH HOH B . 
F 3 HOH 84 2084 2084 HOH HOH B . 
F 3 HOH 85 2085 2085 HOH HOH B . 
F 3 HOH 86 2086 2086 HOH HOH B . 
F 3 HOH 87 2087 2087 HOH HOH B . 
F 3 HOH 88 2088 2088 HOH HOH B . 
F 3 HOH 89 2089 2089 HOH HOH B . 
F 3 HOH 90 2090 2090 HOH HOH B . 
F 3 HOH 91 2091 2091 HOH HOH B . 
F 3 HOH 92 2092 2092 HOH HOH B . 
F 3 HOH 93 2093 2093 HOH HOH B . 
F 3 HOH 94 2094 2094 HOH HOH B . 
G 3 HOH 1  2001 2001 HOH HOH C . 
G 3 HOH 2  2002 2002 HOH HOH C . 
G 3 HOH 3  2003 2003 HOH HOH C . 
G 3 HOH 4  2004 2004 HOH HOH C . 
G 3 HOH 5  2005 2005 HOH HOH C . 
G 3 HOH 6  2006 2006 HOH HOH C . 
G 3 HOH 7  2007 2007 HOH HOH C . 
H 3 HOH 1  2001 2001 HOH HOH D . 
H 3 HOH 2  2002 2002 HOH HOH D . 
H 3 HOH 3  2003 2003 HOH HOH D . 
H 3 HOH 4  2004 2004 HOH HOH D . 
H 3 HOH 5  2005 2005 HOH HOH D . 
H 3 HOH 6  2006 2006 HOH HOH D . 
H 3 HOH 7  2007 2007 HOH HOH D . 
H 3 HOH 8  2008 2008 HOH HOH D . 
H 3 HOH 9  2009 2009 HOH HOH D . 
H 3 HOH 10 2010 2010 HOH HOH D . 
H 3 HOH 11 2011 2011 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS dimeric 2 
2 author_and_software_defined_assembly PQS dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,G 
2 1 B,D,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-10-16 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       . ? 1 
MOSFLM 'data reduction' . ? 2 
SCALA  'data scaling'   . ? 3 
CNS    phasing          . ? 4 
# 
_pdbx_entry_details.entry_id             1UN0 
_pdbx_entry_details.compound_details     'CHAIN A, B ENGINEERED MUTATION TYR 397 ASP' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 NZ  C LYS 45   ? ? O  C HOH 2002 ? ? 0.95 
2  1 O   B THR 317  ? ? NZ D LYS 45   ? ? 1.15 
3  1 O   B HOH 2073 ? ? O  B HOH 2074 ? ? 1.16 
4  1 OE2 B GLU 374  ? ? O  B HOH 2064 ? ? 1.19 
5  1 O   B GLY 510  ? ? N  B GLU 511  ? ? 1.30 
6  1 C   D MET 43   ? ? CD D PRO 44   ? ? 1.32 
7  1 O   A GLY 510  ? ? N  A GLU 511  ? ? 1.32 
8  1 N   D MET 43   ? ? CD D PRO 44   ? ? 1.37 
9  1 C   C MET 43   ? ? CD C PRO 44   ? ? 1.44 
10 1 N   C MET 43   ? ? CD C PRO 44   ? ? 1.46 
11 1 NZ  C LYS 51   ? ? O  C HOH 2006 ? ? 1.47 
12 1 O   A GLU 511  ? ? N  A GLU 512  ? ? 1.54 
13 1 O   D MET 43   ? ? O  D PRO 44   ? ? 1.58 
14 1 O   A GLY 510  ? ? CA A GLU 511  ? ? 1.62 
15 1 CE  C LYS 45   ? ? O  C HOH 2002 ? ? 1.64 
16 1 CA  D MET 43   ? ? CD D PRO 44   ? ? 1.67 
17 1 NZ  D LYS 40   ? ? O  D HOH 2003 ? ? 1.72 
18 1 O   B GLY 510  ? ? CA B GLU 511  ? ? 1.73 
19 1 O   C MET 43   ? ? O  C PRO 44   ? ? 1.74 
20 1 CE  C LYS 51   ? ? O  C HOH 2006 ? ? 1.76 
21 1 O   C PRO 44   ? ? O  C LYS 45   ? ? 1.77 
22 1 C   C ALA 42   ? ? CD C PRO 44   ? ? 1.83 
23 1 CD  C LYS 51   ? ? O  C HOH 2006 ? ? 1.99 
24 1 C   D ALA 42   ? ? CG D PRO 44   ? ? 2.05 
25 1 C   B THR 317  ? ? NZ D LYS 45   ? ? 2.06 
26 1 C   D ALA 42   ? ? CD D PRO 44   ? ? 2.10 
27 1 O   A ARG 299  ? ? O  A HOH 2027 ? ? 2.13 
28 1 N   D LYS 45   ? ? O  D HOH 2006 ? ? 2.15 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 C  A GLY 510 ? ? N  A GLU 511 ? ? 0.695 1.336 -0.641 0.023 Y 
2  1 CA A GLU 511 ? ? C  A GLU 511 ? ? 2.104 1.525 0.579  0.026 N 
3  1 C  A GLU 511 ? ? N  A GLU 512 ? ? 0.877 1.336 -0.459 0.023 Y 
4  1 CB B GLU 118 ? ? CG B GLU 118 ? ? 1.399 1.517 -0.118 0.019 N 
5  1 C  B GLY 510 ? ? N  B GLU 511 ? ? 0.956 1.336 -0.380 0.023 Y 
6  1 CA B GLU 511 ? ? C  B GLU 511 ? ? 1.327 1.525 -0.198 0.026 N 
7  1 CG C MET 36  ? ? SD C MET 36  ? ? 0.773 1.807 -1.034 0.026 N 
8  1 CB C LYS 40  ? ? CG C LYS 40  ? ? 1.775 1.521 0.254  0.027 N 
9  1 CB C PRO 44  ? ? CG C PRO 44  ? ? 2.105 1.495 0.610  0.050 N 
10 1 CD C PRO 44  ? ? N  C PRO 44  ? ? 1.337 1.474 -0.137 0.014 N 
11 1 CD C LYS 45  ? ? CE C LYS 45  ? ? 1.991 1.508 0.483  0.025 N 
12 1 CG D MET 36  ? ? SD D MET 36  ? ? 1.528 1.807 -0.279 0.026 N 
13 1 CB D LYS 40  ? ? CG D LYS 40  ? ? 1.731 1.521 0.210  0.027 N 
14 1 CB D PRO 44  ? ? CG D PRO 44  ? ? 2.134 1.495 0.639  0.050 N 
15 1 CD D PRO 44  ? ? N  D PRO 44  ? ? 1.233 1.474 -0.241 0.014 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE A ARG 120 ? ? CZ A ARG 120 ? ? NH2 A ARG 120 ? ? 117.16 120.30 -3.14  0.50 N 
2  1 CB A ASP 124 ? ? CG A ASP 124 ? ? OD1 A ASP 124 ? ? 124.44 118.30 6.14   0.90 N 
3  1 CB A ASP 171 ? ? CG A ASP 171 ? ? OD2 A ASP 171 ? ? 124.54 118.30 6.24   0.90 N 
4  1 CB A ASP 270 ? ? CG A ASP 270 ? ? OD2 A ASP 270 ? ? 124.16 118.30 5.86   0.90 N 
5  1 NE A ARG 321 ? ? CZ A ARG 321 ? ? NH1 A ARG 321 ? ? 124.17 120.30 3.87   0.50 N 
6  1 NE A ARG 321 ? ? CZ A ARG 321 ? ? NH2 A ARG 321 ? ? 116.94 120.30 -3.36  0.50 N 
7  1 CB A ASP 441 ? ? CG A ASP 441 ? ? OD2 A ASP 441 ? ? 125.42 118.30 7.12   0.90 N 
8  1 CB A ASP 462 ? ? CG A ASP 462 ? ? OD2 A ASP 462 ? ? 123.97 118.30 5.67   0.90 N 
9  1 CA A GLY 510 ? ? C  A GLY 510 ? ? N   A GLU 511 ? ? 153.72 117.20 36.52  2.20 Y 
10 1 O  A GLY 510 ? ? C  A GLY 510 ? ? N   A GLU 511 ? ? 80.34  122.70 -42.36 1.60 Y 
11 1 CB A GLU 511 ? ? CA A GLU 511 ? ? C   A GLU 511 ? ? 129.05 110.40 18.65  2.00 N 
12 1 CA A GLU 511 ? ? C  A GLU 511 ? ? N   A GLU 512 ? ? 143.60 117.20 26.40  2.20 Y 
13 1 O  A GLU 511 ? ? C  A GLU 511 ? ? N   A GLU 512 ? ? 92.04  122.70 -30.66 1.60 Y 
14 1 C  A GLU 511 ? ? N  A GLU 512 ? ? CA  A GLU 512 ? ? 154.81 121.70 33.11  2.50 Y 
15 1 CA B GLU 118 ? ? CB B GLU 118 ? ? CG  B GLU 118 ? ? 127.68 113.40 14.28  2.20 N 
16 1 CB B ASP 171 ? ? CG B ASP 171 ? ? OD2 B ASP 171 ? ? 124.63 118.30 6.33   0.90 N 
17 1 CB B ASP 203 ? ? CG B ASP 203 ? ? OD2 B ASP 203 ? ? 123.90 118.30 5.60   0.90 N 
18 1 NE B ARG 244 ? ? CZ B ARG 244 ? ? NH1 B ARG 244 ? ? 123.67 120.30 3.37   0.50 N 
19 1 CB B ASP 297 ? ? CG B ASP 297 ? ? OD1 B ASP 297 ? ? 124.42 118.30 6.12   0.90 N 
20 1 NE B ARG 321 ? ? CZ B ARG 321 ? ? NH1 B ARG 321 ? ? 124.25 120.30 3.95   0.50 N 
21 1 NE B ARG 321 ? ? CZ B ARG 321 ? ? NH2 B ARG 321 ? ? 116.67 120.30 -3.63  0.50 N 
22 1 CB B ASP 397 ? ? CG B ASP 397 ? ? OD2 B ASP 397 ? ? 123.96 118.30 5.66   0.90 N 
23 1 CB B ASP 435 ? ? CG B ASP 435 ? ? OD2 B ASP 435 ? ? 123.74 118.30 5.44   0.90 N 
24 1 CB B ASP 450 ? ? CG B ASP 450 ? ? OD2 B ASP 450 ? ? 124.52 118.30 6.22   0.90 N 
25 1 CA B GLY 510 ? ? C  B GLY 510 ? ? N   B GLU 511 ? ? 161.92 117.20 44.72  2.20 Y 
26 1 O  B GLY 510 ? ? C  B GLY 510 ? ? N   B GLU 511 ? ? 71.23  122.70 -51.47 1.60 Y 
27 1 C  B GLY 510 ? ? N  B GLU 511 ? ? CA  B GLU 511 ? ? 139.87 121.70 18.17  2.50 Y 
28 1 CB B ASP 514 ? ? CG B ASP 514 ? ? OD2 B ASP 514 ? ? 125.98 118.30 7.68   0.90 N 
29 1 CB B ASP 517 ? ? CG B ASP 517 ? ? OD2 B ASP 517 ? ? 124.59 118.30 6.29   0.90 N 
30 1 CB C MET 36  ? ? CG C MET 36  ? ? SD  C MET 36  ? ? 152.12 112.40 39.72  3.00 N 
31 1 NE C ARG 39  ? ? CZ C ARG 39  ? ? NH1 C ARG 39  ? ? 123.38 120.30 3.08   0.50 N 
32 1 CB C LYS 40  ? ? CG C LYS 40  ? ? CD  C LYS 40  ? ? 127.21 111.60 15.61  2.60 N 
33 1 C  C MET 43  ? ? N  C PRO 44  ? ? CD  C PRO 44  ? ? 65.67  128.40 -62.73 2.10 Y 
34 1 CA C PRO 44  ? ? N  C PRO 44  ? ? CD  C PRO 44  ? ? 129.55 111.70 17.85  1.40 N 
35 1 CA C PRO 44  ? ? CB C PRO 44  ? ? CG  C PRO 44  ? ? 83.11  104.80 -21.69 1.90 N 
36 1 NE C ARG 47  ? ? CZ C ARG 47  ? ? NH2 C ARG 47  ? ? 117.28 120.30 -3.02  0.50 N 
37 1 N  D MET 43  ? ? CA D MET 43  ? ? C   D MET 43  ? ? 94.51  111.00 -16.49 2.70 N 
38 1 C  D MET 43  ? ? N  D PRO 44  ? ? CD  D PRO 44  ? ? 62.33  128.40 -66.07 2.10 Y 
39 1 CA D PRO 44  ? ? N  D PRO 44  ? ? CD  D PRO 44  ? ? 134.70 111.70 23.00  1.40 N 
40 1 CA D PRO 44  ? ? CB D PRO 44  ? ? CG  D PRO 44  ? ? 82.23  104.80 -22.57 1.90 N 
41 1 CG D LYS 45  ? ? CD D LYS 45  ? ? CE  D LYS 45  ? ? 139.69 111.90 27.79  3.00 N 
42 1 CD D LYS 45  ? ? CE D LYS 45  ? ? NZ  D LYS 45  ? ? 138.86 111.70 27.16  2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 122 ? ? -80.02  44.01   
2  1 ASN A 142 ? ? -74.97  39.22   
3  1 SER A 186 ? ? -68.64  -173.33 
4  1 PHE A 224 ? ? -75.59  21.00   
5  1 GLU A 512 ? ? -134.34 -38.43  
6  1 ASP A 517 ? ? -104.29 -168.08 
7  1 GLN A 523 ? ? -52.55  -165.54 
8  1 ASN A 524 ? ? -173.14 130.64  
9  1 ALA A 525 ? ? 145.73  167.59  
10 1 PRO B 122 ? ? -78.95  46.82   
11 1 ALA B 129 ? ? -67.05  0.23    
12 1 ASN B 142 ? ? -76.31  39.20   
13 1 PRO B 144 ? ? -48.37  152.13  
14 1 GLN B 148 ? ? -38.25  -39.69  
15 1 CYS B 214 ? ? -75.84  21.72   
16 1 GLU B 513 ? ? 172.94  118.22  
17 1 THR B 519 ? ? -143.77 41.52   
18 1 GLN B 523 ? ? -51.38  -161.80 
19 1 ASN B 524 ? ? -175.52 138.26  
20 1 ALA B 525 ? ? 142.48  169.79  
21 1 ASN C 37  ? ? -145.22 -49.56  
22 1 PRO C 44  ? ? 6.79    -124.05 
23 1 LYS C 45  ? ? 26.61   72.04   
24 1 PRO D 44  ? ? 13.33   -133.61 
25 1 LYS D 45  ? ? 33.14   70.85   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 GLU A 511 ? ? GLU A 512 ? ? -123.04 
2 1 GLY B 510 ? ? GLU B 511 ? ? -149.50 
3 1 PRO D 44  ? ? LYS D 45  ? ? -146.80 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 GLY A 510 ? ? 33.94 
2 1 GLY B 510 ? ? 47.11 
# 
loop_
_pdbx_validate_polymer_linkage.id 
_pdbx_validate_polymer_linkage.PDB_model_num 
_pdbx_validate_polymer_linkage.auth_atom_id_1 
_pdbx_validate_polymer_linkage.auth_asym_id_1 
_pdbx_validate_polymer_linkage.auth_comp_id_1 
_pdbx_validate_polymer_linkage.auth_seq_id_1 
_pdbx_validate_polymer_linkage.PDB_ins_code_1 
_pdbx_validate_polymer_linkage.label_alt_id_1 
_pdbx_validate_polymer_linkage.auth_atom_id_2 
_pdbx_validate_polymer_linkage.auth_asym_id_2 
_pdbx_validate_polymer_linkage.auth_comp_id_2 
_pdbx_validate_polymer_linkage.auth_seq_id_2 
_pdbx_validate_polymer_linkage.PDB_ins_code_2 
_pdbx_validate_polymer_linkage.label_alt_id_2 
_pdbx_validate_polymer_linkage.dist 
1 1 C A GLY 510 ? ? N A GLU 511 ? ? 0.69 
2 1 C A GLU 511 ? ? N A GLU 512 ? ? 0.88 
3 1 C B GLY 510 ? ? N B GLU 511 ? ? 0.96 
4 1 C B GLU 511 ? ? N B GLU 512 ? ? 2.65 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A GLU 118 ? CG  ? A GLU 31  CG  
2  1 Y 0 A GLU 118 ? CD  ? A GLU 31  CD  
3  1 Y 0 A GLU 118 ? OE1 ? A GLU 31  OE1 
4  1 Y 0 A GLU 118 ? OE2 ? A GLU 31  OE2 
5  1 Y 0 A LEU 332 ? CD1 ? A LEU 245 CD1 
6  1 Y 0 A LEU 332 ? CD2 ? A LEU 245 CD2 
7  1 Y 1 A ASN 527 ? CA  ? A ASN 440 CA  
8  1 Y 1 A ASN 527 ? C   ? A ASN 440 C   
9  1 Y 1 A ASN 527 ? O   ? A ASN 440 O   
10 1 Y 1 A ASN 527 ? CB  ? A ASN 440 CB  
11 1 Y 1 A ASN 527 ? CG  ? A ASN 440 CG  
12 1 Y 1 A ASN 527 ? OD1 ? A ASN 440 OD1 
13 1 Y 1 A ASN 527 ? ND2 ? A ASN 440 ND2 
14 1 Y 0 B GLU 118 ? CG  ? B GLU 31  CG  
15 1 Y 0 B GLU 118 ? CD  ? B GLU 31  CD  
16 1 Y 0 B GLU 118 ? OE1 ? B GLU 31  OE1 
17 1 Y 0 B GLU 118 ? OE2 ? B GLU 31  OE2 
18 1 Y 0 B GLU 374 ? CD  ? B GLU 287 CD  
19 1 Y 0 B GLU 374 ? OE1 ? B GLU 287 OE1 
20 1 Y 0 B GLU 374 ? OE2 ? B GLU 287 OE2 
21 1 Y 0 C MET 36  ? SD  ? C MET 36  SD  
22 1 Y 0 C MET 36  ? CE  ? C MET 36  CE  
23 1 Y 0 C LYS 40  ? CG  ? C LYS 40  CG  
24 1 Y 0 C LYS 40  ? CD  ? C LYS 40  CD  
25 1 Y 0 C LYS 40  ? CE  ? C LYS 40  CE  
26 1 Y 0 C LYS 40  ? NZ  ? C LYS 40  NZ  
27 1 Y 0 C PRO 44  ? CG  ? C PRO 44  CG  
28 1 Y 0 C PRO 44  ? CD  ? C PRO 44  CD  
29 1 Y 0 C LYS 45  ? CE  ? C LYS 45  CE  
30 1 Y 0 C LYS 45  ? NZ  ? C LYS 45  NZ  
31 1 Y 0 D MET 36  ? SD  ? D MET 36  SD  
32 1 Y 0 D MET 36  ? CE  ? D MET 36  CE  
33 1 Y 0 D LYS 40  ? CG  ? D LYS 40  CG  
34 1 Y 0 D LYS 40  ? CD  ? D LYS 40  CD  
35 1 Y 0 D LYS 40  ? CE  ? D LYS 40  CE  
36 1 Y 0 D LYS 40  ? NZ  ? D LYS 40  NZ  
37 1 Y 0 D PRO 44  ? CG  ? D PRO 44  CG  
38 1 Y 0 D PRO 44  ? CD  ? D PRO 44  CD  
39 1 Y 0 D LYS 45  ? CE  ? D LYS 45  CE  
40 1 Y 0 D LYS 45  ? NZ  ? D LYS 45  NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 0 A GLU 511 ? A GLU 424 
2  1 Y 1 A THR 528 ? A THR 441 
3  1 Y 1 A PHE 529 ? A PHE 442 
4  1 Y 1 A GLY 530 ? A GLY 443 
5  1 Y 0 B GLU 511 ? B GLU 424 
6  1 Y 1 B ASN 527 ? B ASN 440 
7  1 Y 1 B THR 528 ? B THR 441 
8  1 Y 1 B PHE 529 ? B PHE 442 
9  1 Y 1 B GLY 530 ? B GLY 443 
10 1 Y 1 C MET 1   ? C MET 1   
11 1 Y 1 C ALA 2   ? C ALA 2   
12 1 Y 1 C LYS 3   ? C LYS 3   
13 1 Y 1 C ARG 4   ? C ARG 4   
14 1 Y 1 C VAL 5   ? C VAL 5   
15 1 Y 1 C ALA 6   ? C ALA 6   
16 1 Y 1 C ASP 7   ? C ASP 7   
17 1 Y 1 C ALA 8   ? C ALA 8   
18 1 Y 1 C GLN 9   ? C GLN 9   
19 1 Y 1 C ILE 10  ? C ILE 10  
20 1 Y 1 C GLN 11  ? C GLN 11  
21 1 Y 1 C ARG 12  ? C ARG 12  
22 1 Y 1 C GLU 13  ? C GLU 13  
23 1 Y 1 C THR 14  ? C THR 14  
24 1 Y 1 C TYR 15  ? C TYR 15  
25 1 Y 1 C ASP 16  ? C ASP 16  
26 1 Y 1 C SER 17  ? C SER 17  
27 1 Y 1 C ASN 18  ? C ASN 18  
28 1 Y 1 C GLU 19  ? C GLU 19  
29 1 Y 1 C SER 20  ? C SER 20  
30 1 Y 1 C ASP 21  ? C ASP 21  
31 1 Y 1 C ASP 22  ? C ASP 22  
32 1 Y 1 C ASP 23  ? C ASP 23  
33 1 Y 1 C VAL 24  ? C VAL 24  
34 1 Y 1 C THR 25  ? C THR 25  
35 1 Y 1 C PRO 26  ? C PRO 26  
36 1 Y 1 C SER 27  ? C SER 27  
37 1 Y 1 C THR 28  ? C THR 28  
38 1 Y 1 C LYS 29  ? C LYS 29  
39 1 Y 1 C VAL 30  ? C VAL 30  
40 1 Y 1 C ALA 31  ? C ALA 31  
41 1 Y 1 C SER 32  ? C SER 32  
42 1 Y 1 C SER 33  ? C SER 33  
43 1 Y 1 C ALA 34  ? C ALA 34  
44 1 Y 1 C VAL 35  ? C VAL 35  
45 1 Y 1 D MET 1   ? D MET 1   
46 1 Y 1 D ALA 2   ? D ALA 2   
47 1 Y 1 D LYS 3   ? D LYS 3   
48 1 Y 1 D ARG 4   ? D ARG 4   
49 1 Y 1 D VAL 5   ? D VAL 5   
50 1 Y 1 D ALA 6   ? D ALA 6   
51 1 Y 1 D ASP 7   ? D ASP 7   
52 1 Y 1 D ALA 8   ? D ALA 8   
53 1 Y 1 D GLN 9   ? D GLN 9   
54 1 Y 1 D ILE 10  ? D ILE 10  
55 1 Y 1 D GLN 11  ? D GLN 11  
56 1 Y 1 D ARG 12  ? D ARG 12  
57 1 Y 1 D GLU 13  ? D GLU 13  
58 1 Y 1 D THR 14  ? D THR 14  
59 1 Y 1 D TYR 15  ? D TYR 15  
60 1 Y 1 D ASP 16  ? D ASP 16  
61 1 Y 1 D SER 17  ? D SER 17  
62 1 Y 1 D ASN 18  ? D ASN 18  
63 1 Y 1 D GLU 19  ? D GLU 19  
64 1 Y 1 D SER 20  ? D SER 20  
65 1 Y 1 D ASP 21  ? D ASP 21  
66 1 Y 1 D ASP 22  ? D ASP 22  
67 1 Y 1 D ASP 23  ? D ASP 23  
68 1 Y 1 D VAL 24  ? D VAL 24  
69 1 Y 1 D THR 25  ? D THR 25  
70 1 Y 1 D PRO 26  ? D PRO 26  
71 1 Y 1 D SER 27  ? D SER 27  
72 1 Y 1 D THR 28  ? D THR 28  
73 1 Y 1 D LYS 29  ? D LYS 29  
74 1 Y 1 D VAL 30  ? D VAL 30  
75 1 Y 1 D ALA 31  ? D ALA 31  
76 1 Y 1 D SER 32  ? D SER 32  
77 1 Y 1 D SER 33  ? D SER 33  
78 1 Y 1 D ALA 34  ? D ALA 34  
79 1 Y 1 D VAL 35  ? D VAL 35  
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#