data_1UN1
# 
_entry.id   1UN1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1UN1         
PDBE  EBI-13428    
WWPDB D_1290013428 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1UMZ 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'XYLOGLUCAN ENDOTRANSGLYCOSYLASE IN COMPLEX WITH THE XYLOGLUCAN NONASACCHARIDE XLLG.' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1UN1 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2003-09-03 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Johansson, P.'  1 
'Brumer, H.'     2 
'Kallas, A.'     3 
'Henriksson, H.' 4 
'Denman, S.'     5 
'Teeri, T.T.'    6 
'Jones, T.A.'    7 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structures of a Poplar Xyloglucan Endotransglycosylase Reveal Details of Transglycosylation Acceptor Binding' 
_citation.journal_abbrev            'Plant Cell' 
_citation.journal_volume            16 
_citation.page_first                874 
_citation.page_last                 ? 
_citation.year                      2004 
_citation.journal_id_ASTM           PLCEEW 
_citation.country                   US 
_citation.journal_id_ISSN           1040-4651 
_citation.journal_id_CSD            2109 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15020748 
_citation.pdbx_database_id_DOI      10.1105/TPC.020065 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Johansson, P.'  1 ? 
primary 'Brumer, H.'     2 ? 
primary 'Baumann, M.'    3 ? 
primary 'Kallas, A.'     4 ? 
primary 'Henriksson, H.' 5 ? 
primary 'Denman, S.'     6 ? 
primary 'Teeri, T.T.'    7 ? 
primary 'Jones, T.A.'    8 ? 
# 
_cell.entry_id           1UN1 
_cell.length_a           188.762 
_cell.length_b           188.762 
_cell.length_c           45.973 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1UN1 
_symmetry.space_group_name_H-M             'P 63' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                173 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'XYLOGLUCAN ENDOTRANSGLYCOSYLASE' 32531.570 2   2.4.1.207 ? ? ? 
2 branched    man 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   2   
?         ? ? ? 
3 non-polymer syn 'GOLD ION' 196.967   1   ?         ? ? ? 
4 water       nat water 18.015    190 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        XET16A 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;(UNK)ETAAFAALRKPVDVAFGRNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDSAGT
VTAFYLSSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKEFHYYSVLWNMYMIVFLVDDVPIRV
FKNCKDLGVKFPFNQPMKIYSSLWNADDWATRGGLEKTDWSKAPFIASYRSFHIDGCEASVEAKFCATQGARWWDQKEFQ
DLDAFQYRRLSWVRQKYTIYNYCTDRSRYPSMPPECKRDRDI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;XETAAFAALRKPVDVAFGRNYVPTWAFDHIKYFNGGNEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDSAGTVTAF
YLSSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKEFHYYSVLWNMYMIVFLVDDVPIRVFKNC
KDLGVKFPFNQPMKIYSSLWNADDWATRGGLEKTDWSKAPFIASYRSFHIDGCEASVEAKFCATQGARWWDQKEFQDLDA
FQYRRLSWVRQKYTIYNYCTDRSRYPSMPPECKRDRDI
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   UNK n 
1 2   GLU n 
1 3   THR n 
1 4   ALA n 
1 5   ALA n 
1 6   PHE n 
1 7   ALA n 
1 8   ALA n 
1 9   LEU n 
1 10  ARG n 
1 11  LYS n 
1 12  PRO n 
1 13  VAL n 
1 14  ASP n 
1 15  VAL n 
1 16  ALA n 
1 17  PHE n 
1 18  GLY n 
1 19  ARG n 
1 20  ASN n 
1 21  TYR n 
1 22  VAL n 
1 23  PRO n 
1 24  THR n 
1 25  TRP n 
1 26  ALA n 
1 27  PHE n 
1 28  ASP n 
1 29  HIS n 
1 30  ILE n 
1 31  LYS n 
1 32  TYR n 
1 33  PHE n 
1 34  ASN n 
1 35  GLY n 
1 36  GLY n 
1 37  ASN n 
1 38  GLU n 
1 39  ILE n 
1 40  GLN n 
1 41  LEU n 
1 42  HIS n 
1 43  LEU n 
1 44  ASP n 
1 45  LYS n 
1 46  TYR n 
1 47  THR n 
1 48  GLY n 
1 49  THR n 
1 50  GLY n 
1 51  PHE n 
1 52  GLN n 
1 53  SER n 
1 54  LYS n 
1 55  GLY n 
1 56  SER n 
1 57  TYR n 
1 58  LEU n 
1 59  PHE n 
1 60  GLY n 
1 61  HIS n 
1 62  PHE n 
1 63  SER n 
1 64  MET n 
1 65  GLN n 
1 66  MET n 
1 67  LYS n 
1 68  LEU n 
1 69  VAL n 
1 70  PRO n 
1 71  GLY n 
1 72  ASP n 
1 73  SER n 
1 74  ALA n 
1 75  GLY n 
1 76  THR n 
1 77  VAL n 
1 78  THR n 
1 79  ALA n 
1 80  PHE n 
1 81  TYR n 
1 82  LEU n 
1 83  SER n 
1 84  SER n 
1 85  GLN n 
1 86  ASN n 
1 87  SER n 
1 88  GLU n 
1 89  HIS n 
1 90  ASP n 
1 91  GLU n 
1 92  ILE n 
1 93  ASP n 
1 94  PHE n 
1 95  GLU n 
1 96  PHE n 
1 97  LEU n 
1 98  GLY n 
1 99  ASN n 
1 100 ARG n 
1 101 THR n 
1 102 GLY n 
1 103 GLN n 
1 104 PRO n 
1 105 TYR n 
1 106 ILE n 
1 107 LEU n 
1 108 GLN n 
1 109 THR n 
1 110 ASN n 
1 111 VAL n 
1 112 PHE n 
1 113 THR n 
1 114 GLY n 
1 115 GLY n 
1 116 LYS n 
1 117 GLY n 
1 118 ASP n 
1 119 ARG n 
1 120 GLU n 
1 121 GLN n 
1 122 ARG n 
1 123 ILE n 
1 124 TYR n 
1 125 LEU n 
1 126 TRP n 
1 127 PHE n 
1 128 ASP n 
1 129 PRO n 
1 130 THR n 
1 131 LYS n 
1 132 GLU n 
1 133 PHE n 
1 134 HIS n 
1 135 TYR n 
1 136 TYR n 
1 137 SER n 
1 138 VAL n 
1 139 LEU n 
1 140 TRP n 
1 141 ASN n 
1 142 MET n 
1 143 TYR n 
1 144 MET n 
1 145 ILE n 
1 146 VAL n 
1 147 PHE n 
1 148 LEU n 
1 149 VAL n 
1 150 ASP n 
1 151 ASP n 
1 152 VAL n 
1 153 PRO n 
1 154 ILE n 
1 155 ARG n 
1 156 VAL n 
1 157 PHE n 
1 158 LYS n 
1 159 ASN n 
1 160 CYS n 
1 161 LYS n 
1 162 ASP n 
1 163 LEU n 
1 164 GLY n 
1 165 VAL n 
1 166 LYS n 
1 167 PHE n 
1 168 PRO n 
1 169 PHE n 
1 170 ASN n 
1 171 GLN n 
1 172 PRO n 
1 173 MET n 
1 174 LYS n 
1 175 ILE n 
1 176 TYR n 
1 177 SER n 
1 178 SER n 
1 179 LEU n 
1 180 TRP n 
1 181 ASN n 
1 182 ALA n 
1 183 ASP n 
1 184 ASP n 
1 185 TRP n 
1 186 ALA n 
1 187 THR n 
1 188 ARG n 
1 189 GLY n 
1 190 GLY n 
1 191 LEU n 
1 192 GLU n 
1 193 LYS n 
1 194 THR n 
1 195 ASP n 
1 196 TRP n 
1 197 SER n 
1 198 LYS n 
1 199 ALA n 
1 200 PRO n 
1 201 PHE n 
1 202 ILE n 
1 203 ALA n 
1 204 SER n 
1 205 TYR n 
1 206 ARG n 
1 207 SER n 
1 208 PHE n 
1 209 HIS n 
1 210 ILE n 
1 211 ASP n 
1 212 GLY n 
1 213 CYS n 
1 214 GLU n 
1 215 ALA n 
1 216 SER n 
1 217 VAL n 
1 218 GLU n 
1 219 ALA n 
1 220 LYS n 
1 221 PHE n 
1 222 CYS n 
1 223 ALA n 
1 224 THR n 
1 225 GLN n 
1 226 GLY n 
1 227 ALA n 
1 228 ARG n 
1 229 TRP n 
1 230 TRP n 
1 231 ASP n 
1 232 GLN n 
1 233 LYS n 
1 234 GLU n 
1 235 PHE n 
1 236 GLN n 
1 237 ASP n 
1 238 LEU n 
1 239 ASP n 
1 240 ALA n 
1 241 PHE n 
1 242 GLN n 
1 243 TYR n 
1 244 ARG n 
1 245 ARG n 
1 246 LEU n 
1 247 SER n 
1 248 TRP n 
1 249 VAL n 
1 250 ARG n 
1 251 GLN n 
1 252 LYS n 
1 253 TYR n 
1 254 THR n 
1 255 ILE n 
1 256 TYR n 
1 257 ASN n 
1 258 TYR n 
1 259 CYS n 
1 260 THR n 
1 261 ASP n 
1 262 ARG n 
1 263 SER n 
1 264 ARG n 
1 265 TYR n 
1 266 PRO n 
1 267 SER n 
1 268 MET n 
1 269 PRO n 
1 270 PRO n 
1 271 GLU n 
1 272 CYS n 
1 273 LYS n 
1 274 ARG n 
1 275 ASP n 
1 276 ARG n 
1 277 ASP n 
1 278 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'EUROPEAN ASPEN' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'POPULUS TREMULA' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     113636 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'PICHIA PASTORIS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PPIC9 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 1UN1   1 ? ? 1UN1   ? 
2 UNP Q8GZD5 1 ? ? Q8GZD5 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1UN1 A 1 ? 6   ? 1UN1   -6 ? -1  ? -6 -1  
2 2 1UN1 A 7 ? 278 ? Q8GZD5 23 ? 294 ? 1  272 
3 1 1UN1 B 1 ? 6   ? 1UN1   -6 ? -1  ? -6 -1  
4 2 1UN1 B 7 ? 278 ? Q8GZD5 23 ? 294 ? 1  272 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
AU  non-polymer                  . 'GOLD ION'                               ? 'Au 1'           196.967 
BMA 'D-saccharide, beta linking' . beta-D-mannopyranose                     ? 'C6 H12 O6'      180.156 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
UNK 'L-peptide linking'          . UNKNOWN                                  ? 'C4 H9 N O2'     103.120 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1UN1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.0 
_exptl_crystal.density_percent_sol   68 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '10 MG ML-1 PROTEIN SOLUTION 1:1 WITH 1.0 M NAOAC AND 0.2 M IMIDAZOLE PH 6.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2002-05-15 
_diffrn_detector.details                'TOROIDAL MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI (111) / SI (311)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-4' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-4 
_diffrn_source.pdbx_wavelength             0.933 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1UN1 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25.000 
_reflns.d_resolution_high            2.100 
_reflns.number_obs                   106310 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.08100 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.4000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.120 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.14 
_reflns_shell.percent_possible_all   95.5 
_reflns_shell.Rmerge_I_obs           0.26000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.700 
_reflns_shell.pdbx_redundancy        2.20 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1UN1 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     52388 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             24.77 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_obs                          0.208 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.206 
_refine.ls_R_factor_R_free                       0.232 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2798 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.944 
_refine.correlation_coeff_Fo_to_Fc_free          0.931 
_refine.B_iso_mean                               36.56 
_refine.aniso_B[1][1]                            0.02000 
_refine.aniso_B[2][2]                            0.02000 
_refine.aniso_B[3][3]                            -0.02000 
_refine.aniso_B[1][2]                            0.01000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SIRAS 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.164 
_refine.pdbx_overall_ESU_R_Free                  0.148 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4417 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         79 
_refine_hist.number_atoms_solvent             190 
_refine_hist.number_atoms_total               4686 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        24.77 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014 0.021 ? 4618 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.000 0.020 ? 3858 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.483 1.929 ? 6266 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            3.930 3.000 ? 8937 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.954 5.000 ? 529  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.089 0.200 ? 624  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006 0.020 ? 5150 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.008 0.020 ? 1088 'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.207 0.200 ? 735  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.283 0.200 ? 4171 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.119 0.200 ? 2204 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.222 0.200 ? 200  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.139 0.200 ? 7    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.263 0.200 ? 42   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.030 0.200 ? 3    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.000 1.500 ? 2632 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.919 2.000 ? 4226 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.513 3.000 ? 1986 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 4.094 4.500 ? 2040 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.10 
_refine_ls_shell.d_res_low                        2.15 
_refine_ls_shell.number_reflns_R_work             3783 
_refine_ls_shell.R_factor_R_work                  0.2340 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2550 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             205 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.867600 
_struct_ncs_oper.matrix[1][2]   -0.493400 
_struct_ncs_oper.matrix[1][3]   -0.061800 
_struct_ncs_oper.matrix[2][1]   0.496700 
_struct_ncs_oper.matrix[2][2]   0.854100 
_struct_ncs_oper.matrix[2][3]   0.154000 
_struct_ncs_oper.matrix[3][1]   -0.023200 
_struct_ncs_oper.matrix[3][2]   -0.164300 
_struct_ncs_oper.matrix[3][3]   0.986100 
_struct_ncs_oper.vector[1]      94.18890 
_struct_ncs_oper.vector[2]      -25.14600 
_struct_ncs_oper.vector[3]      18.02840 
# 
_struct.entry_id                  1UN1 
_struct.title                     'Xyloglucan endotransglycosylase native structure.' 
_struct.pdbx_descriptor           'XYLOGLUCAN ENDOTRANSGLYCOSYLASE (E.C.2.4.1.207)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UN1 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
'GLYCOSIDE HYDROLASE, XET, XTH, XEH, TRANSGLYCOSYLATION, XYLOGLUCAN, TRANSFERASE, GLYCOSYLTRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 16  ? ASN A 20  ? ALA A 10  ASN A 14  1 ? 5  
HELX_P HELX_P2  2  ALA A 26  ? ASP A 28  ? ALA A 20  ASP A 22  5 ? 3  
HELX_P HELX_P3  3  ASN A 34  ? GLY A 36  ? ASN A 28  GLY A 30  5 ? 3  
HELX_P HELX_P4  4  CYS A 160 ? GLY A 164 ? CYS A 154 GLY A 158 5 ? 5  
HELX_P HELX_P5  5  THR A 187 ? LEU A 191 ? THR A 181 LEU A 185 5 ? 5  
HELX_P HELX_P6  6  ASP A 195 ? ALA A 199 ? ASP A 189 ALA A 193 5 ? 5  
HELX_P HELX_P7  7  ARG A 228 ? GLN A 232 ? ARG A 222 GLN A 226 5 ? 5  
HELX_P HELX_P8  8  GLN A 232 ? GLN A 236 ? GLN A 226 GLN A 230 5 ? 5  
HELX_P HELX_P9  9  ASP A 239 ? TYR A 253 ? ASP A 233 TYR A 247 1 ? 15 
HELX_P HELX_P10 10 CYS A 259 ? ASP A 261 ? CYS A 253 ASP A 255 5 ? 3  
HELX_P HELX_P11 11 GLU A 271 ? ARG A 276 ? GLU A 265 ARG A 270 1 ? 6  
HELX_P HELX_P12 12 ALA B 16  ? ASN B 20  ? ALA B 10  ASN B 14  1 ? 5  
HELX_P HELX_P13 13 ALA B 26  ? ASP B 28  ? ALA B 20  ASP B 22  5 ? 3  
HELX_P HELX_P14 14 CYS B 160 ? GLY B 164 ? CYS B 154 GLY B 158 5 ? 5  
HELX_P HELX_P15 15 THR B 187 ? LEU B 191 ? THR B 181 LEU B 185 5 ? 5  
HELX_P HELX_P16 16 ASP B 195 ? ALA B 199 ? ASP B 189 ALA B 193 5 ? 5  
HELX_P HELX_P17 17 ARG B 228 ? GLN B 232 ? ARG B 222 GLN B 226 5 ? 5  
HELX_P HELX_P18 18 GLN B 232 ? GLN B 236 ? GLN B 226 GLN B 230 5 ? 5  
HELX_P HELX_P19 19 ASP B 239 ? TYR B 253 ? ASP B 233 TYR B 247 1 ? 15 
HELX_P HELX_P20 20 CYS B 259 ? ASP B 261 ? CYS B 253 ASP B 255 5 ? 3  
HELX_P HELX_P21 21 PRO B 269 ? LYS B 273 ? PRO B 263 LYS B 267 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 259 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 253 A CYS 266 1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf2 disulf ?    ? B CYS 213 SG  ? ? ? 1_555 B CYS 222 SG ? ? B CYS 207 B CYS 216 1_555 ? ? ? ? ? ? ? 2.833 ? ?               
disulf3 disulf ?    ? B CYS 259 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 253 B CYS 266 1_555 ? ? ? ? ? ? ? 2.072 ? ?               
covale1 covale one  ? A ASN 99  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 93  C NAG 1   1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
covale2 covale one  ? B ASN 99  ND2 ? ? ? 1_555 D NAG .   C1 ? ? B ASN 93  D NAG 1   1_555 ? ? ? ? ? ? ? 1.436 ? N-Glycosylation 
covale3 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.441 ? ?               
covale4 covale both ? C NAG .   O4  ? ? ? 1_555 C BMA .   C1 ? ? C NAG 2   C BMA 3   1_555 ? ? ? ? ? ? ? 1.437 ? ?               
covale5 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.445 ? ?               
covale6 covale both ? D NAG .   O4  ? ? ? 1_555 D BMA .   C1 ? ? D NAG 2   D BMA 3   1_555 ? ? ? ? ? ? ? 1.438 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 199 A . ? ALA 193 A PRO 200 A ? PRO 194 A 1 3.22 
2 ALA 199 B . ? ALA 193 B PRO 200 B ? PRO 194 B 1 3.09 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 8 ? 
AB ? 7 ? 
BA ? 8 ? 
BB ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AA 6 7 ? anti-parallel 
AA 7 8 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AB 6 7 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BA 5 6 ? anti-parallel 
BA 6 7 ? anti-parallel 
BA 7 8 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? anti-parallel 
BB 4 5 ? anti-parallel 
BB 5 6 ? anti-parallel 
BB 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 TYR A 21  ? TRP A 25  ? TYR A 15  TRP A 19  
AA 2 THR A 49  ? SER A 53  ? THR A 43  SER A 47  
AA 3 LYS A 174 ? ASN A 181 ? LYS A 168 ASN A 175 
AA 4 THR A 76  ? SER A 83  ? THR A 70  SER A 77  
AA 5 GLU A 91  ? LEU A 97  ? GLU A 85  LEU A 91  
AA 6 ILE A 106 ? PHE A 112 ? ILE A 100 PHE A 106 
AA 7 GLN A 121 ? ILE A 123 ? GLN A 115 ILE A 117 
AA 8 THR A 254 ? ASN A 257 ? THR A 248 ASN A 251 
AB 1 ILE A 30  ? PHE A 33  ? ILE A 24  PHE A 27  
AB 2 GLU A 38  ? LEU A 43  ? GLU A 32  LEU A 37  
AB 3 PHE A 201 ? GLU A 214 ? PHE A 195 GLU A 208 
AB 4 TYR A 57  ? LYS A 67  ? TYR A 51  LYS A 61  
AB 5 HIS A 134 ? TRP A 140 ? HIS A 128 TRP A 134 
AB 6 MET A 144 ? VAL A 149 ? MET A 138 VAL A 143 
AB 7 VAL A 152 ? LYS A 158 ? VAL A 146 LYS A 152 
BA 1 TYR B 21  ? TRP B 25  ? TYR B 15  TRP B 19  
BA 2 THR B 49  ? SER B 53  ? THR B 43  SER B 47  
BA 3 LYS B 174 ? ASN B 181 ? LYS B 168 ASN B 175 
BA 4 THR B 76  ? SER B 83  ? THR B 70  SER B 77  
BA 5 GLU B 91  ? LEU B 97  ? GLU B 85  LEU B 91  
BA 6 ILE B 106 ? PHE B 112 ? ILE B 100 PHE B 106 
BA 7 GLN B 121 ? ILE B 123 ? GLN B 115 ILE B 117 
BA 8 THR B 254 ? ASN B 257 ? THR B 248 ASN B 251 
BB 1 ILE B 30  ? PHE B 33  ? ILE B 24  PHE B 27  
BB 2 GLU B 38  ? LEU B 43  ? GLU B 32  LEU B 37  
BB 3 PHE B 201 ? GLU B 214 ? PHE B 195 GLU B 208 
BB 4 TYR B 57  ? LYS B 67  ? TYR B 51  LYS B 61  
BB 5 HIS B 134 ? TRP B 140 ? HIS B 128 TRP B 134 
BB 6 MET B 144 ? VAL B 149 ? MET B 138 VAL B 143 
BB 7 VAL B 152 ? LYS B 158 ? VAL B 146 LYS B 152 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N THR A 24  ? N THR A 18  O GLY A 50  ? O GLY A 44  
AA 2 3 N SER A 53  ? N SER A 47  O ILE A 175 ? O ILE A 169 
AA 3 4 N TRP A 180 ? N TRP A 174 O VAL A 77  ? O VAL A 71  
AA 4 5 N LEU A 82  ? N LEU A 76  O ILE A 92  ? O ILE A 86  
AA 5 6 N LEU A 97  ? N LEU A 91  O ILE A 106 ? O ILE A 100 
AA 6 7 N THR A 109 ? N THR A 103 O GLN A 121 ? O GLN A 115 
AA 7 8 O ARG A 122 ? O ARG A 116 N ILE A 255 ? N ILE A 249 
AB 1 2 N PHE A 33  ? N PHE A 27  O GLU A 38  ? O GLU A 32  
AB 2 3 N LEU A 43  ? N LEU A 37  O PHE A 201 ? O PHE A 195 
AB 3 4 O CYS A 213 ? O CYS A 207 N LEU A 58  ? N LEU A 52  
AB 4 5 N MET A 66  ? N MET A 60  O HIS A 134 ? O HIS A 128 
AB 5 6 N LEU A 139 ? N LEU A 133 O VAL A 146 ? O VAL A 140 
AB 6 7 N VAL A 149 ? N VAL A 143 O VAL A 152 ? O VAL A 146 
BA 1 2 N THR B 24  ? N THR B 18  O GLY B 50  ? O GLY B 44  
BA 2 3 N SER B 53  ? N SER B 47  O ILE B 175 ? O ILE B 169 
BA 3 4 N TRP B 180 ? N TRP B 174 O VAL B 77  ? O VAL B 71  
BA 4 5 N LEU B 82  ? N LEU B 76  O ILE B 92  ? O ILE B 86  
BA 5 6 N LEU B 97  ? N LEU B 91  O ILE B 106 ? O ILE B 100 
BA 6 7 N THR B 109 ? N THR B 103 O GLN B 121 ? O GLN B 115 
BA 7 8 O ARG B 122 ? O ARG B 116 N ILE B 255 ? N ILE B 249 
BB 1 2 N PHE B 33  ? N PHE B 27  O GLU B 38  ? O GLU B 32  
BB 2 3 N LEU B 43  ? N LEU B 37  O PHE B 201 ? O PHE B 195 
BB 3 4 O CYS B 213 ? O CYS B 207 N LEU B 58  ? N LEU B 52  
BB 4 5 N MET B 66  ? N MET B 60  O HIS B 134 ? O HIS B 128 
BB 5 6 N LEU B 139 ? N LEU B 133 O VAL B 146 ? O VAL B 140 
BB 6 7 N VAL B 149 ? N VAL B 143 O VAL B 152 ? O VAL B 146 
# 
_database_PDB_matrix.entry_id          1UN1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1UN1 
_atom_sites.fract_transf_matrix[1][1]   0.005298 
_atom_sites.fract_transf_matrix[1][2]   0.003059 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006117 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021752 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
AU 
C  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 12  ? 13.516 142.100 12.229  1.00   62.72 ? 6    PRO A N   1 
ATOM   2    C  CA  . PRO A 1 12  ? 14.214 140.781 12.050  1.00   62.67 ? 6    PRO A CA  1 
ATOM   3    C  C   . PRO A 1 12  ? 14.524 140.076 13.380  1.00   62.35 ? 6    PRO A C   1 
ATOM   4    O  O   . PRO A 1 12  ? 15.091 140.711 14.276  1.00   62.59 ? 6    PRO A O   1 
ATOM   5    C  CB  . PRO A 1 12  ? 15.515 141.167 11.317  1.00   62.70 ? 6    PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 12  ? 15.307 142.615 10.837  1.00   62.51 ? 6    PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 12  ? 14.393 143.228 11.866  1.00   63.05 ? 6    PRO A CD  1 
ATOM   8    N  N   . VAL A 1 13  ? 14.140 138.801 13.504  1.00   61.87 ? 7    VAL A N   1 
ATOM   9    C  CA  . VAL A 1 13  ? 14.398 138.009 14.720  1.00   61.48 ? 7    VAL A CA  1 
ATOM   10   C  C   . VAL A 1 13  ? 15.564 137.013 14.527  1.00   60.77 ? 7    VAL A C   1 
ATOM   11   O  O   . VAL A 1 13  ? 15.660 136.313 13.501  1.00   60.71 ? 7    VAL A O   1 
ATOM   12   C  CB  . VAL A 1 13  ? 13.132 137.229 15.219  1.00   61.63 ? 7    VAL A CB  1 
ATOM   13   C  CG1 . VAL A 1 13  ? 13.334 136.752 16.661  1.00   61.52 ? 7    VAL A CG1 1 
ATOM   14   C  CG2 . VAL A 1 13  ? 11.846 138.089 15.104  1.00   61.47 ? 7    VAL A CG2 1 
ATOM   15   N  N   . ASP A 1 14  ? 16.457 136.858 15.512  1.00   59.47 ? 8    ASP A N   1 
ATOM   16   C  CA  . ASP A 1 14  ? 17.685 136.069 15.471  1.00   58.35 ? 8    ASP A CA  1 
ATOM   17   C  C   . ASP A 1 14  ? 17.417 134.578 15.738  1.00   56.79 ? 8    ASP A C   1 
ATOM   18   O  O   . ASP A 1 14  ? 16.850 134.216 16.774  1.00   57.21 ? 8    ASP A O   1 
ATOM   19   C  CB  . ASP A 1 14  ? 18.697 136.614 16.489  1.00   58.51 ? 8    ASP A CB  1 
ATOM   20   C  CG  . ASP A 1 14  ? 19.020 138.101 16.279  1.00   60.43 ? 8    ASP A CG  1 
ATOM   21   O  OD1 . ASP A 1 14  ? 18.808 138.645 15.160  1.00   61.81 ? 8    ASP A OD1 1 
ATOM   22   O  OD2 . ASP A 1 14  ? 19.503 138.810 17.193  1.00   63.23 ? 8    ASP A OD2 1 
ATOM   23   N  N   . VAL A 1 15  ? 17.684 133.774 14.735  1.00   54.30 ? 9    VAL A N   1 
ATOM   24   C  CA  . VAL A 1 15  ? 17.657 132.315 14.925  1.00   52.18 ? 9    VAL A CA  1 
ATOM   25   C  C   . VAL A 1 15  ? 19.083 131.762 14.781  1.00   49.86 ? 9    VAL A C   1 
ATOM   26   O  O   . VAL A 1 15  ? 20.011 132.517 14.462  1.00   49.70 ? 9    VAL A O   1 
ATOM   27   C  CB  . VAL A 1 15  ? 16.698 131.623 13.913  1.00   52.34 ? 9    VAL A CB  1 
ATOM   28   C  CG1 . VAL A 1 15  ? 15.298 132.206 14.022  1.00   53.13 ? 9    VAL A CG1 1 
ATOM   29   C  CG2 . VAL A 1 15  ? 17.209 131.754 12.475  1.00   52.03 ? 9    VAL A CG2 1 
ATOM   30   N  N   . ALA A 1 16  ? 19.224 130.446 14.995  1.00   46.91 ? 10   ALA A N   1 
ATOM   31   C  CA  . ALA A 1 16  ? 20.493 129.747 14.789  1.00   45.47 ? 10   ALA A CA  1 
ATOM   32   C  C   . ALA A 1 16  ? 20.731 129.449 13.303  1.00   43.20 ? 10   ALA A C   1 
ATOM   33   O  O   . ALA A 1 16  ? 19.795 129.202 12.553  1.00   43.19 ? 10   ALA A O   1 
ATOM   34   C  CB  . ALA A 1 16  ? 20.531 128.441 15.588  1.00   45.09 ? 10   ALA A CB  1 
ATOM   35   N  N   . PHE A 1 17  ? 22.002 129.446 12.915  1.00   41.01 ? 11   PHE A N   1 
ATOM   36   C  CA  . PHE A 1 17  ? 22.443 129.189 11.544  1.00   39.41 ? 11   PHE A CA  1 
ATOM   37   C  C   . PHE A 1 17  ? 21.769 127.964 10.923  1.00   39.23 ? 11   PHE A C   1 
ATOM   38   O  O   . PHE A 1 17  ? 21.212 128.047 9.827   1.00   36.92 ? 11   PHE A O   1 
ATOM   39   C  CB  . PHE A 1 17  ? 23.969 129.017 11.538  1.00   39.36 ? 11   PHE A CB  1 
ATOM   40   C  CG  . PHE A 1 17  ? 24.551 128.648 10.210  1.00   37.13 ? 11   PHE A CG  1 
ATOM   41   C  CD1 . PHE A 1 17  ? 24.808 129.628 9.252   1.00   36.52 ? 11   PHE A CD1 1 
ATOM   42   C  CD2 . PHE A 1 17  ? 24.842 127.321 9.908   1.00   37.23 ? 11   PHE A CD2 1 
ATOM   43   C  CE1 . PHE A 1 17  ? 25.379 129.292 8.004   1.00   35.92 ? 11   PHE A CE1 1 
ATOM   44   C  CE2 . PHE A 1 17  ? 25.391 126.971 8.653   1.00   37.58 ? 11   PHE A CE2 1 
ATOM   45   C  CZ  . PHE A 1 17  ? 25.665 127.971 7.706   1.00   34.55 ? 11   PHE A CZ  1 
ATOM   46   N  N   . GLY A 1 18  ? 21.811 126.843 11.648  1.00   39.10 ? 12   GLY A N   1 
ATOM   47   C  CA  . GLY A 1 18  ? 21.372 125.546 11.140  1.00   39.34 ? 12   GLY A CA  1 
ATOM   48   C  C   . GLY A 1 18  ? 19.869 125.393 10.976  1.00   39.46 ? 12   GLY A C   1 
ATOM   49   O  O   . GLY A 1 18  ? 19.405 124.467 10.332  1.00   40.44 ? 12   GLY A O   1 
ATOM   50   N  N   . ARG A 1 19  ? 19.096 126.306 11.527  1.00   40.05 ? 13   ARG A N   1 
ATOM   51   C  CA  . ARG A 1 19  ? 17.668 126.362 11.200  1.00   40.70 ? 13   ARG A CA  1 
ATOM   52   C  C   . ARG A 1 19  ? 17.441 126.597 9.681   1.00   39.31 ? 13   ARG A C   1 
ATOM   53   O  O   . ARG A 1 19  ? 16.654 125.912 9.039   1.00   39.97 ? 13   ARG A O   1 
ATOM   54   C  CB  . ARG A 1 19  ? 16.975 127.460 12.032  1.00   41.62 ? 13   ARG A CB  1 
ATOM   55   C  CG  . ARG A 1 19  ? 15.572 127.830 11.540  1.00   46.56 ? 13   ARG A CG  1 
ATOM   56   C  CD  . ARG A 1 19  ? 14.581 128.288 12.600  1.00   52.38 ? 13   ARG A CD  1 
ATOM   57   N  NE  . ARG A 1 19  ? 13.357 127.477 12.542  1.00   57.22 ? 13   ARG A NE  1 
ATOM   58   C  CZ  . ARG A 1 19  ? 12.721 126.959 13.598  1.00   60.10 ? 13   ARG A CZ  1 
ATOM   59   N  NH1 . ARG A 1 19  ? 13.161 127.178 14.839  1.00   61.27 ? 13   ARG A NH1 1 
ATOM   60   N  NH2 . ARG A 1 19  ? 11.621 126.225 13.409  1.00   60.45 ? 13   ARG A NH2 1 
ATOM   61   N  N   . ASN A 1 20  ? 18.160 127.552 9.106   1.00   37.62 ? 14   ASN A N   1 
ATOM   62   C  CA  . ASN A 1 20  ? 17.872 128.042 7.739   1.00   35.03 ? 14   ASN A CA  1 
ATOM   63   C  C   . ASN A 1 20  ? 18.934 127.760 6.664   1.00   33.17 ? 14   ASN A C   1 
ATOM   64   O  O   . ASN A 1 20  ? 18.639 127.843 5.474   1.00   31.91 ? 14   ASN A O   1 
ATOM   65   C  CB  . ASN A 1 20  ? 17.712 129.551 7.830   1.00   35.41 ? 14   ASN A CB  1 
ATOM   66   C  CG  . ASN A 1 20  ? 16.350 129.992 8.419   1.00   36.02 ? 14   ASN A CG  1 
ATOM   67   O  OD1 . ASN A 1 20  ? 15.421 129.192 8.500   1.00   36.95 ? 14   ASN A OD1 1 
ATOM   68   N  ND2 . ASN A 1 20  ? 16.261 131.222 8.858   1.00   37.01 ? 14   ASN A ND2 1 
ATOM   69   N  N   . TYR A 1 21  ? 20.161 127.463 7.098   1.00   31.21 ? 15   TYR A N   1 
ATOM   70   C  CA  . TYR A 1 21  ? 21.352 127.436 6.242   1.00   30.32 ? 15   TYR A CA  1 
ATOM   71   C  C   . TYR A 1 21  ? 22.158 126.136 6.377   1.00   30.84 ? 15   TYR A C   1 
ATOM   72   O  O   . TYR A 1 21  ? 22.093 125.492 7.406   1.00   30.39 ? 15   TYR A O   1 
ATOM   73   C  CB  . TYR A 1 21  ? 22.252 128.606 6.598   1.00   28.95 ? 15   TYR A CB  1 
ATOM   74   C  CG  . TYR A 1 21  ? 21.663 129.943 6.183   1.00   27.77 ? 15   TYR A CG  1 
ATOM   75   C  CD1 . TYR A 1 21  ? 21.734 130.378 4.865   1.00   27.29 ? 15   TYR A CD1 1 
ATOM   76   C  CD2 . TYR A 1 21  ? 21.024 130.756 7.100   1.00   29.29 ? 15   TYR A CD2 1 
ATOM   77   C  CE1 . TYR A 1 21  ? 21.194 131.606 4.468   1.00   27.00 ? 15   TYR A CE1 1 
ATOM   78   C  CE2 . TYR A 1 21  ? 20.455 132.006 6.712   1.00   29.21 ? 15   TYR A CE2 1 
ATOM   79   C  CZ  . TYR A 1 21  ? 20.557 132.412 5.395   1.00   29.52 ? 15   TYR A CZ  1 
ATOM   80   O  OH  . TYR A 1 21  ? 20.037 133.626 5.004   1.00   31.40 ? 15   TYR A OH  1 
ATOM   81   N  N   . VAL A 1 22  ? 22.854 125.757 5.304   1.00   31.26 ? 16   VAL A N   1 
ATOM   82   C  CA  . VAL A 1 22  ? 23.843 124.689 5.299   1.00   31.53 ? 16   VAL A CA  1 
ATOM   83   C  C   . VAL A 1 22  ? 25.153 125.143 4.632   1.00   31.05 ? 16   VAL A C   1 
ATOM   84   O  O   . VAL A 1 22  ? 25.141 125.881 3.641   1.00   29.11 ? 16   VAL A O   1 
ATOM   85   C  CB  . VAL A 1 22  ? 23.345 123.425 4.576   1.00   31.94 ? 16   VAL A CB  1 
ATOM   86   C  CG1 . VAL A 1 22  ? 22.182 122.828 5.333   1.00   34.92 ? 16   VAL A CG1 1 
ATOM   87   C  CG2 . VAL A 1 22  ? 22.910 123.711 3.150   1.00   33.31 ? 16   VAL A CG2 1 
ATOM   88   N  N   . PRO A 1 23  ? 26.283 124.687 5.169   1.00   30.89 ? 17   PRO A N   1 
ATOM   89   C  CA  . PRO A 1 23  ? 27.585 124.913 4.522   1.00   30.52 ? 17   PRO A CA  1 
ATOM   90   C  C   . PRO A 1 23  ? 27.675 124.132 3.223   1.00   29.86 ? 17   PRO A C   1 
ATOM   91   O  O   . PRO A 1 23  ? 27.073 123.060 3.108   1.00   30.05 ? 17   PRO A O   1 
ATOM   92   C  CB  . PRO A 1 23  ? 28.598 124.410 5.558   1.00   31.02 ? 17   PRO A CB  1 
ATOM   93   C  CG  . PRO A 1 23  ? 27.842 123.660 6.572   1.00   31.20 ? 17   PRO A CG  1 
ATOM   94   C  CD  . PRO A 1 23  ? 26.393 123.922 6.432   1.00   31.48 ? 17   PRO A CD  1 
ATOM   95   N  N   . THR A 1 24  ? 28.354 124.671 2.223   1.00   28.60 ? 18   THR A N   1 
ATOM   96   C  CA  . THR A 1 24  ? 28.538 123.913 0.989   1.00   28.86 ? 18   THR A CA  1 
ATOM   97   C  C   . THR A 1 24  ? 29.979 123.702 0.539   1.00   28.84 ? 18   THR A C   1 
ATOM   98   O  O   . THR A 1 24  ? 30.190 122.961 -0.409  1.00   29.98 ? 18   THR A O   1 
ATOM   99   C  CB  . THR A 1 24  ? 27.778 124.530 -0.169  1.00   28.33 ? 18   THR A CB  1 
ATOM   100  O  OG1 . THR A 1 24  ? 28.270 125.850 -0.396  1.00   27.71 ? 18   THR A OG1 1 
ATOM   101  C  CG2 . THR A 1 24  ? 26.296 124.688 0.166   1.00   30.80 ? 18   THR A CG2 1 
ATOM   102  N  N   . TRP A 1 25  ? 30.937 124.398 1.140   1.00   28.73 ? 19   TRP A N   1 
ATOM   103  C  CA  . TRP A 1 25  ? 32.339 124.226 0.813   1.00   29.19 ? 19   TRP A CA  1 
ATOM   104  C  C   . TRP A 1 25  ? 33.205 124.546 2.016   1.00   30.23 ? 19   TRP A C   1 
ATOM   105  O  O   . TRP A 1 25  ? 32.995 125.579 2.687   1.00   31.42 ? 19   TRP A O   1 
ATOM   106  C  CB  . TRP A 1 25  ? 32.765 125.109 -0.354  1.00   29.10 ? 19   TRP A CB  1 
ATOM   107  C  CG  . TRP A 1 25  ? 34.163 124.858 -0.815  1.00   27.19 ? 19   TRP A CG  1 
ATOM   108  C  CD1 . TRP A 1 25  ? 35.271 125.591 -0.518  1.00   26.51 ? 19   TRP A CD1 1 
ATOM   109  C  CD2 . TRP A 1 25  ? 34.610 123.772 -1.640  1.00   25.77 ? 19   TRP A CD2 1 
ATOM   110  N  NE1 . TRP A 1 25  ? 36.376 125.042 -1.124  1.00   25.31 ? 19   TRP A NE1 1 
ATOM   111  C  CE2 . TRP A 1 25  ? 35.998 123.919 -1.814  1.00   25.20 ? 19   TRP A CE2 1 
ATOM   112  C  CE3 . TRP A 1 25  ? 33.972 122.688 -2.259  1.00   27.83 ? 19   TRP A CE3 1 
ATOM   113  C  CZ2 . TRP A 1 25  ? 36.766 123.023 -2.589  1.00   24.31 ? 19   TRP A CZ2 1 
ATOM   114  C  CZ3 . TRP A 1 25  ? 34.749 121.791 -3.038  1.00   27.89 ? 19   TRP A CZ3 1 
ATOM   115  C  CH2 . TRP A 1 25  ? 36.119 121.977 -3.184  1.00   25.15 ? 19   TRP A CH2 1 
ATOM   116  N  N   . ALA A 1 26  ? 34.192 123.674 2.254   1.00   30.36 ? 20   ALA A N   1 
ATOM   117  C  CA  . ALA A 1 26  ? 35.204 123.833 3.305   1.00   30.51 ? 20   ALA A CA  1 
ATOM   118  C  C   . ALA A 1 26  ? 34.539 123.981 4.683   1.00   32.32 ? 20   ALA A C   1 
ATOM   119  O  O   . ALA A 1 26  ? 34.540 125.062 5.308   1.00   30.88 ? 20   ALA A O   1 
ATOM   120  C  CB  . ALA A 1 26  ? 36.094 124.978 3.022   1.00   30.03 ? 20   ALA A CB  1 
ATOM   121  N  N   . PHE A 1 27  ? 33.958 122.867 5.114   1.00   33.94 ? 21   PHE A N   1 
ATOM   122  C  CA  . PHE A 1 27  ? 33.172 122.776 6.337   1.00   36.05 ? 21   PHE A CA  1 
ATOM   123  C  C   . PHE A 1 27  ? 34.004 123.169 7.539   1.00   35.81 ? 21   PHE A C   1 
ATOM   124  O  O   . PHE A 1 27  ? 33.498 123.753 8.487   1.00   36.75 ? 21   PHE A O   1 
ATOM   125  C  CB  . PHE A 1 27  ? 32.668 121.338 6.511   1.00   37.17 ? 21   PHE A CB  1 
ATOM   126  C  CG  . PHE A 1 27  ? 31.486 120.990 5.650   1.00   43.14 ? 21   PHE A CG  1 
ATOM   127  C  CD1 . PHE A 1 27  ? 31.273 121.590 4.397   1.00   47.62 ? 21   PHE A CD1 1 
ATOM   128  C  CD2 . PHE A 1 27  ? 30.563 120.052 6.104   1.00   49.86 ? 21   PHE A CD2 1 
ATOM   129  C  CE1 . PHE A 1 27  ? 30.166 121.244 3.613   1.00   49.11 ? 21   PHE A CE1 1 
ATOM   130  C  CE2 . PHE A 1 27  ? 29.445 119.710 5.332   1.00   51.88 ? 21   PHE A CE2 1 
ATOM   131  C  CZ  . PHE A 1 27  ? 29.251 120.309 4.087   1.00   51.17 ? 21   PHE A CZ  1 
ATOM   132  N  N   . ASP A 1 28  ? 35.291 122.878 7.504   1.00   35.28 ? 22   ASP A N   1 
ATOM   133  C  CA  . ASP A 1 28  ? 36.145 123.235 8.632   1.00   36.36 ? 22   ASP A CA  1 
ATOM   134  C  C   . ASP A 1 28  ? 36.540 124.713 8.707   1.00   35.11 ? 22   ASP A C   1 
ATOM   135  O  O   . ASP A 1 28  ? 37.174 125.135 9.669   1.00   35.12 ? 22   ASP A O   1 
ATOM   136  C  CB  . ASP A 1 28  ? 37.391 122.355 8.650   1.00   37.42 ? 22   ASP A CB  1 
ATOM   137  C  CG  . ASP A 1 28  ? 38.243 122.539 7.439   1.00   40.63 ? 22   ASP A CG  1 
ATOM   138  O  OD1 . ASP A 1 28  ? 37.728 122.900 6.342   1.00   46.48 ? 22   ASP A OD1 1 
ATOM   139  O  OD2 . ASP A 1 28  ? 39.461 122.315 7.480   1.00   49.36 ? 22   ASP A OD2 1 
ATOM   140  N  N   . HIS A 1 29  ? 36.145 125.496 7.709   1.00   33.20 ? 23   HIS A N   1 
ATOM   141  C  CA  . HIS A 1 29  ? 36.415 126.926 7.675   1.00   32.59 ? 23   HIS A CA  1 
ATOM   142  C  C   . HIS A 1 29  ? 35.238 127.768 8.135   1.00   32.10 ? 23   HIS A C   1 
ATOM   143  O  O   . HIS A 1 29  ? 35.279 128.983 8.049   1.00   32.26 ? 23   HIS A O   1 
ATOM   144  C  CB  . HIS A 1 29  ? 36.824 127.319 6.265   1.00   31.96 ? 23   HIS A CB  1 
ATOM   145  C  CG  . HIS A 1 29  ? 38.250 127.042 5.980   1.00   32.50 ? 23   HIS A CG  1 
ATOM   146  N  ND1 . HIS A 1 29  ? 38.773 125.776 6.041   1.00   34.41 ? 23   HIS A ND1 1 
ATOM   147  C  CD2 . HIS A 1 29  ? 39.264 127.858 5.593   1.00   34.83 ? 23   HIS A CD2 1 
ATOM   148  C  CE1 . HIS A 1 29  ? 40.050 125.815 5.707   1.00   35.83 ? 23   HIS A CE1 1 
ATOM   149  N  NE2 . HIS A 1 29  ? 40.373 127.066 5.428   1.00   37.01 ? 23   HIS A NE2 1 
ATOM   150  N  N   . ILE A 1 30  ? 34.183 127.112 8.585   1.00   31.91 ? 24   ILE A N   1 
ATOM   151  C  CA  . ILE A 1 30  ? 33.091 127.770 9.224   1.00   32.95 ? 24   ILE A CA  1 
ATOM   152  C  C   . ILE A 1 30  ? 33.142 127.364 10.692  1.00   33.34 ? 24   ILE A C   1 
ATOM   153  O  O   . ILE A 1 30  ? 33.039 126.179 11.016  1.00   33.96 ? 24   ILE A O   1 
ATOM   154  C  CB  . ILE A 1 30  ? 31.767 127.340 8.613   1.00   33.05 ? 24   ILE A CB  1 
ATOM   155  C  CG1 . ILE A 1 30  ? 31.715 127.752 7.139   1.00   36.19 ? 24   ILE A CG1 1 
ATOM   156  C  CG2 . ILE A 1 30  ? 30.618 127.936 9.420   1.00   33.24 ? 24   ILE A CG2 1 
ATOM   157  C  CD1 . ILE A 1 30  ? 30.383 127.477 6.475   1.00   38.76 ? 24   ILE A CD1 1 
ATOM   158  N  N   . LYS A 1 31  ? 33.297 128.350 11.566  1.00   33.79 ? 25   LYS A N   1 
ATOM   159  C  CA  . LYS A 1 31  ? 33.342 128.138 13.006  1.00   34.35 ? 25   LYS A CA  1 
ATOM   160  C  C   . LYS A 1 31  ? 32.017 128.558 13.613  1.00   34.46 ? 25   LYS A C   1 
ATOM   161  O  O   . LYS A 1 31  ? 31.550 129.664 13.332  1.00   33.34 ? 25   LYS A O   1 
ATOM   162  C  CB  . LYS A 1 31  ? 34.460 128.986 13.592  1.00   34.83 ? 25   LYS A CB  1 
ATOM   163  C  CG  . LYS A 1 31  ? 35.805 128.860 12.923  1.00   36.93 ? 25   LYS A CG  1 
ATOM   164  C  CD  . LYS A 1 31  ? 36.205 127.436 12.707  1.00   40.70 ? 25   LYS A CD  1 
ATOM   165  C  CE  . LYS A 1 31  ? 37.603 127.291 12.050  1.00   43.82 ? 25   LYS A CE  1 
ATOM   166  N  NZ  . LYS A 1 31  ? 38.440 128.538 12.152  1.00   46.77 ? 25   LYS A NZ  1 
ATOM   167  N  N   . TYR A 1 32  ? 31.417 127.685 14.428  1.00   34.52 ? 26   TYR A N   1 
ATOM   168  C  CA  . TYR A 1 32  ? 30.120 127.907 15.063  1.00   35.59 ? 26   TYR A CA  1 
ATOM   169  C  C   . TYR A 1 32  ? 30.302 128.307 16.533  1.00   37.10 ? 26   TYR A C   1 
ATOM   170  O  O   . TYR A 1 32  ? 31.026 127.636 17.278  1.00   37.13 ? 26   TYR A O   1 
ATOM   171  C  CB  . TYR A 1 32  ? 29.245 126.653 15.000  1.00   35.83 ? 26   TYR A CB  1 
ATOM   172  C  CG  . TYR A 1 32  ? 29.000 126.170 13.606  1.00   38.27 ? 26   TYR A CG  1 
ATOM   173  C  CD1 . TYR A 1 32  ? 29.970 125.463 12.918  1.00   40.88 ? 26   TYR A CD1 1 
ATOM   174  C  CD2 . TYR A 1 32  ? 27.814 126.448 12.957  1.00   41.26 ? 26   TYR A CD2 1 
ATOM   175  C  CE1 . TYR A 1 32  ? 29.761 125.039 11.618  1.00   43.41 ? 26   TYR A CE1 1 
ATOM   176  C  CE2 . TYR A 1 32  ? 27.591 126.025 11.665  1.00   43.52 ? 26   TYR A CE2 1 
ATOM   177  C  CZ  . TYR A 1 32  ? 28.570 125.325 10.993  1.00   45.24 ? 26   TYR A CZ  1 
ATOM   178  O  OH  . TYR A 1 32  ? 28.364 124.900 9.702   1.00   46.30 ? 26   TYR A OH  1 
ATOM   179  N  N   . PHE A 1 33  ? 29.653 129.401 16.941  1.00   37.31 ? 27   PHE A N   1 
ATOM   180  C  CA  . PHE A 1 33  ? 29.695 129.888 18.315  1.00   37.70 ? 27   PHE A CA  1 
ATOM   181  C  C   . PHE A 1 33  ? 28.289 129.981 18.858  1.00   39.22 ? 27   PHE A C   1 
ATOM   182  O  O   . PHE A 1 33  ? 27.328 130.228 18.122  1.00   37.24 ? 27   PHE A O   1 
ATOM   183  C  CB  . PHE A 1 33  ? 30.371 131.248 18.390  1.00   37.56 ? 27   PHE A CB  1 
ATOM   184  C  CG  . PHE A 1 33  ? 31.792 131.202 17.927  1.00   37.32 ? 27   PHE A CG  1 
ATOM   185  C  CD1 . PHE A 1 33  ? 32.096 131.405 16.583  1.00   35.46 ? 27   PHE A CD1 1 
ATOM   186  C  CD2 . PHE A 1 33  ? 32.826 130.989 18.827  1.00   35.71 ? 27   PHE A CD2 1 
ATOM   187  C  CE1 . PHE A 1 33  ? 33.428 131.377 16.147  1.00   36.13 ? 27   PHE A CE1 1 
ATOM   188  C  CE2 . PHE A 1 33  ? 34.129 130.955 18.409  1.00   35.55 ? 27   PHE A CE2 1 
ATOM   189  C  CZ  . PHE A 1 33  ? 34.435 131.143 17.072  1.00   37.69 ? 27   PHE A CZ  1 
ATOM   190  N  N   . ASN A 1 34  ? 28.176 129.782 20.165  1.00   40.84 ? 28   ASN A N   1 
ATOM   191  C  CA  . ASN A 1 34  ? 26.914 129.893 20.905  1.00   42.02 ? 28   ASN A CA  1 
ATOM   192  C  C   . ASN A 1 34  ? 25.718 129.179 20.251  1.00   42.54 ? 28   ASN A C   1 
ATOM   193  O  O   . ASN A 1 34  ? 24.682 129.798 19.997  1.00   42.60 ? 28   ASN A O   1 
ATOM   194  C  CB  . ASN A 1 34  ? 26.569 131.368 21.094  1.00   43.06 ? 28   ASN A CB  1 
ATOM   195  C  CG  . ASN A 1 34  ? 27.566 132.070 21.975  1.00   47.25 ? 28   ASN A CG  1 
ATOM   196  O  OD1 . ASN A 1 34  ? 28.257 132.996 21.531  1.00   53.75 ? 28   ASN A OD1 1 
ATOM   197  N  ND2 . ASN A 1 34  ? 27.660 131.638 23.216  1.00   52.17 ? 28   ASN A ND2 1 
ATOM   198  N  N   . GLY A 1 35  ? 25.891 127.906 19.954  1.00   42.98 ? 29   GLY A N   1 
ATOM   199  C  CA  . GLY A 1 35  ? 24.857 127.067 19.339  1.00   43.43 ? 29   GLY A CA  1 
ATOM   200  C  C   . GLY A 1 35  ? 24.593 127.401 17.880  1.00   44.21 ? 29   GLY A C   1 
ATOM   201  O  O   . GLY A 1 35  ? 23.575 126.982 17.330  1.00   45.11 ? 29   GLY A O   1 
ATOM   202  N  N   . GLY A 1 36  ? 25.497 128.148 17.245  1.00   43.48 ? 30   GLY A N   1 
ATOM   203  C  CA  . GLY A 1 36  ? 25.300 128.519 15.870  1.00   42.70 ? 30   GLY A CA  1 
ATOM   204  C  C   . GLY A 1 36  ? 24.600 129.877 15.757  1.00   41.66 ? 30   GLY A C   1 
ATOM   205  O  O   . GLY A 1 36  ? 24.103 130.243 14.700  1.00   41.63 ? 30   GLY A O   1 
ATOM   206  N  N   . ASN A 1 37  ? 24.559 130.654 16.864  1.00   39.94 ? 31   ASN A N   1 
ATOM   207  C  CA  . ASN A 1 37  ? 23.915 131.965 16.844  1.00   39.46 ? 31   ASN A CA  1 
ATOM   208  C  C   . ASN A 1 37  ? 24.877 132.994 16.260  1.00   37.36 ? 31   ASN A C   1 
ATOM   209  O  O   . ASN A 1 37  ? 24.474 134.099 15.898  1.00   36.72 ? 31   ASN A O   1 
ATOM   210  C  CB  . ASN A 1 37  ? 23.475 132.394 18.249  1.00   39.95 ? 31   ASN A CB  1 
ATOM   211  C  CG  . ASN A 1 37  ? 22.176 131.760 18.715  1.00   42.60 ? 31   ASN A CG  1 
ATOM   212  O  OD1 . ASN A 1 37  ? 21.394 131.265 17.910  1.00   43.52 ? 31   ASN A OD1 1 
ATOM   213  N  ND2 . ASN A 1 37  ? 21.943 131.787 20.035  1.00   44.65 ? 31   ASN A ND2 1 
ATOM   214  N  N   . GLU A 1 38  ? 26.153 132.634 16.194  1.00   35.34 ? 32   GLU A N   1 
ATOM   215  C  CA  . GLU A 1 38  ? 27.172 133.428 15.530  1.00   34.47 ? 32   GLU A CA  1 
ATOM   216  C  C   . GLU A 1 38  ? 28.099 132.452 14.799  1.00   33.71 ? 32   GLU A C   1 
ATOM   217  O  O   . GLU A 1 38  ? 28.389 131.367 15.329  1.00   32.81 ? 32   GLU A O   1 
ATOM   218  C  CB  . GLU A 1 38  ? 27.941 134.287 16.534  1.00   34.66 ? 32   GLU A CB  1 
ATOM   219  C  CG  . GLU A 1 38  ? 29.107 135.036 15.901  1.00   36.99 ? 32   GLU A CG  1 
ATOM   220  C  CD  . GLU A 1 38  ? 29.771 136.105 16.773  1.00   40.50 ? 32   GLU A CD  1 
ATOM   221  O  OE1 . GLU A 1 38  ? 29.134 136.683 17.676  1.00   42.86 ? 32   GLU A OE1 1 
ATOM   222  O  OE2 . GLU A 1 38  ? 30.960 136.410 16.513  1.00   46.21 ? 32   GLU A OE2 1 
ATOM   223  N  N   . ILE A 1 39  ? 28.497 132.789 13.568  1.00   31.68 ? 33   ILE A N   1 
ATOM   224  C  CA  . ILE A 1 39  ? 29.474 132.004 12.824  1.00   30.68 ? 33   ILE A CA  1 
ATOM   225  C  C   . ILE A 1 39  ? 30.560 132.901 12.246  1.00   29.87 ? 33   ILE A C   1 
ATOM   226  O  O   . ILE A 1 39  ? 30.361 134.100 12.065  1.00   28.29 ? 33   ILE A O   1 
ATOM   227  C  CB  . ILE A 1 39  ? 28.836 131.137 11.711  1.00   31.65 ? 33   ILE A CB  1 
ATOM   228  C  CG1 . ILE A 1 39  ? 28.506 131.964 10.456  1.00   33.23 ? 33   ILE A CG1 1 
ATOM   229  C  CG2 . ILE A 1 39  ? 27.617 130.345 12.221  1.00   32.60 ? 33   ILE A CG2 1 
ATOM   230  C  CD1 . ILE A 1 39  ? 28.030 131.145 9.322   1.00   35.22 ? 33   ILE A CD1 1 
ATOM   231  N  N   . GLN A 1 40  ? 31.710 132.298 11.966  1.00   28.63 ? 34   GLN A N   1 
ATOM   232  C  CA  . GLN A 1 40  ? 32.826 132.937 11.309  1.00   28.52 ? 34   GLN A CA  1 
ATOM   233  C  C   . GLN A 1 40  ? 33.185 132.128 10.073  1.00   28.60 ? 34   GLN A C   1 
ATOM   234  O  O   . GLN A 1 40  ? 33.244 130.883 10.134  1.00   29.51 ? 34   GLN A O   1 
ATOM   235  C  CB  . GLN A 1 40  ? 34.029 132.956 12.232  1.00   29.08 ? 34   GLN A CB  1 
ATOM   236  C  CG  . GLN A 1 40  ? 33.898 133.808 13.464  1.00   31.30 ? 34   GLN A CG  1 
ATOM   237  C  CD  . GLN A 1 40  ? 35.199 133.823 14.299  1.00   34.22 ? 34   GLN A CD  1 
ATOM   238  O  OE1 . GLN A 1 40  ? 36.100 133.001 14.097  1.00   35.73 ? 34   GLN A OE1 1 
ATOM   239  N  NE2 . GLN A 1 40  ? 35.271 134.735 15.231  1.00   33.80 ? 34   GLN A NE2 1 
ATOM   240  N  N   . LEU A 1 41  ? 33.417 132.809 8.954   1.00   27.38 ? 35   LEU A N   1 
ATOM   241  C  CA  . LEU A 1 41  ? 33.943 132.186 7.743   1.00   27.48 ? 35   LEU A CA  1 
ATOM   242  C  C   . LEU A 1 41  ? 35.385 132.596 7.679   1.00   26.60 ? 35   LEU A C   1 
ATOM   243  O  O   . LEU A 1 41  ? 35.715 133.763 7.937   1.00   25.94 ? 35   LEU A O   1 
ATOM   244  C  CB  . LEU A 1 41  ? 33.230 132.686 6.463   1.00   27.51 ? 35   LEU A CB  1 
ATOM   245  C  CG  . LEU A 1 41  ? 31.721 132.519 6.306   1.00   29.95 ? 35   LEU A CG  1 
ATOM   246  C  CD1 . LEU A 1 41  ? 31.238 132.717 4.839   1.00   29.79 ? 35   LEU A CD1 1 
ATOM   247  C  CD2 . LEU A 1 41  ? 31.254 131.242 6.796   1.00   32.10 ? 35   LEU A CD2 1 
ATOM   248  N  N   . HIS A 1 42  ? 36.244 131.640 7.352   1.00   26.07 ? 36   HIS A N   1 
ATOM   249  C  CA  . HIS A 1 42  ? 37.679 131.872 7.252   1.00   26.80 ? 36   HIS A CA  1 
ATOM   250  C  C   . HIS A 1 42  ? 38.130 131.652 5.827   1.00   26.37 ? 36   HIS A C   1 
ATOM   251  O  O   . HIS A 1 42  ? 37.666 130.739 5.149   1.00   27.14 ? 36   HIS A O   1 
ATOM   252  C  CB  . HIS A 1 42  ? 38.503 130.920 8.161   1.00   27.61 ? 36   HIS A CB  1 
ATOM   253  C  CG  . HIS A 1 42  ? 38.277 131.124 9.635   1.00   30.27 ? 36   HIS A CG  1 
ATOM   254  N  ND1 . HIS A 1 42  ? 39.260 130.882 10.572  1.00   33.84 ? 36   HIS A ND1 1 
ATOM   255  C  CD2 . HIS A 1 42  ? 37.193 131.552 10.335  1.00   32.31 ? 36   HIS A CD2 1 
ATOM   256  C  CE1 . HIS A 1 42  ? 38.797 131.145 11.783  1.00   33.36 ? 36   HIS A CE1 1 
ATOM   257  N  NE2 . HIS A 1 42  ? 37.539 131.540 11.674  1.00   32.91 ? 36   HIS A NE2 1 
ATOM   258  N  N   . LEU A 1 43  ? 39.116 132.437 5.432   1.00   26.08 ? 37   LEU A N   1 
ATOM   259  C  CA  . LEU A 1 43  ? 39.689 132.389 4.124   1.00   26.95 ? 37   LEU A CA  1 
ATOM   260  C  C   . LEU A 1 43  ? 41.194 132.294 4.298   1.00   28.03 ? 37   LEU A C   1 
ATOM   261  O  O   . LEU A 1 43  ? 41.800 133.122 5.007   1.00   28.18 ? 37   LEU A O   1 
ATOM   262  C  CB  . LEU A 1 43  ? 39.350 133.664 3.354   1.00   26.25 ? 37   LEU A CB  1 
ATOM   263  C  CG  . LEU A 1 43  ? 40.150 133.997 2.103   1.00   28.33 ? 37   LEU A CG  1 
ATOM   264  C  CD1 . LEU A 1 43  ? 40.013 132.886 1.039   1.00   27.84 ? 37   LEU A CD1 1 
ATOM   265  C  CD2 . LEU A 1 43  ? 39.710 135.345 1.542   1.00   27.33 ? 37   LEU A CD2 1 
ATOM   266  N  N   . ASP A 1 44  ? 41.809 131.329 3.612   1.00   28.13 ? 38   ASP A N   1 
ATOM   267  C  CA  . ASP A 1 44  ? 43.257 131.317 3.507   1.00   28.85 ? 38   ASP A CA  1 
ATOM   268  C  C   . ASP A 1 44  ? 43.679 131.035 2.079   1.00   29.54 ? 38   ASP A C   1 
ATOM   269  O  O   . ASP A 1 44  ? 42.848 130.989 1.145   1.00   28.47 ? 38   ASP A O   1 
ATOM   270  C  CB  . ASP A 1 44  ? 43.871 130.341 4.524   1.00   29.53 ? 38   ASP A CB  1 
ATOM   271  C  CG  . ASP A 1 44  ? 43.382 128.931 4.356   1.00   31.25 ? 38   ASP A CG  1 
ATOM   272  O  OD1 . ASP A 1 44  ? 43.201 128.451 3.223   1.00   32.74 ? 38   ASP A OD1 1 
ATOM   273  O  OD2 . ASP A 1 44  ? 43.123 128.228 5.326   1.00   39.40 ? 38   ASP A OD2 1 
ATOM   274  N  N   . LYS A 1 45  ? 44.981 130.887 1.877   1.00   29.43 ? 39   LYS A N   1 
ATOM   275  C  CA  . LYS A 1 45  ? 45.499 130.755 0.530   1.00   30.38 ? 39   LYS A CA  1 
ATOM   276  C  C   . LYS A 1 45  ? 44.998 129.507 -0.181  1.00   28.77 ? 39   LYS A C   1 
ATOM   277  O  O   . LYS A 1 45  ? 45.030 129.461 -1.400  1.00   28.85 ? 39   LYS A O   1 
ATOM   278  C  CB  . LYS A 1 45  ? 47.041 130.746 0.533   1.00   32.11 ? 39   LYS A CB  1 
ATOM   279  C  CG  . LYS A 1 45  ? 47.648 129.468 1.091   1.00   34.88 ? 39   LYS A CG  1 
ATOM   280  C  CD  . LYS A 1 45  ? 49.059 129.687 1.658   1.00   42.06 ? 39   LYS A CD  1 
ATOM   281  C  CE  . LYS A 1 45  ? 50.157 129.393 0.649   1.00   45.69 ? 39   LYS A CE  1 
ATOM   282  N  NZ  . LYS A 1 45  ? 51.503 129.384 1.362   1.00   50.44 ? 39   LYS A NZ  1 
ATOM   283  N  N   . TYR A 1 46  ? 44.536 128.508 0.562   1.00   28.41 ? 40   TYR A N   1 
ATOM   284  C  CA  . TYR A 1 46  ? 44.017 127.274 -0.053  1.00   29.64 ? 40   TYR A CA  1 
ATOM   285  C  C   . TYR A 1 46  ? 42.513 127.289 -0.374  1.00   29.48 ? 40   TYR A C   1 
ATOM   286  O  O   . TYR A 1 46  ? 42.051 126.648 -1.337  1.00   29.22 ? 40   TYR A O   1 
ATOM   287  C  CB  . TYR A 1 46  ? 44.348 126.077 0.837   1.00   30.23 ? 40   TYR A CB  1 
ATOM   288  C  CG  . TYR A 1 46  ? 45.853 125.836 0.947   1.00   33.39 ? 40   TYR A CG  1 
ATOM   289  C  CD1 . TYR A 1 46  ? 46.597 125.406 -0.164  1.00   38.83 ? 40   TYR A CD1 1 
ATOM   290  C  CD2 . TYR A 1 46  ? 46.527 126.068 2.141   1.00   39.13 ? 40   TYR A CD2 1 
ATOM   291  C  CE1 . TYR A 1 46  ? 48.009 125.212 -0.076  1.00   40.47 ? 40   TYR A CE1 1 
ATOM   292  C  CE2 . TYR A 1 46  ? 47.929 125.863 2.257   1.00   39.65 ? 40   TYR A CE2 1 
ATOM   293  C  CZ  . TYR A 1 46  ? 48.650 125.440 1.148   1.00   41.43 ? 40   TYR A CZ  1 
ATOM   294  O  OH  . TYR A 1 46  ? 50.005 125.251 1.267   1.00   44.07 ? 40   TYR A OH  1 
ATOM   295  N  N   . THR A 1 47  ? 41.737 127.975 0.457   1.00   28.87 ? 41   THR A N   1 
ATOM   296  C  CA  . THR A 1 47  ? 40.293 127.957 0.302   1.00   27.82 ? 41   THR A CA  1 
ATOM   297  C  C   . THR A 1 47  ? 39.604 129.071 1.079   1.00   27.22 ? 41   THR A C   1 
ATOM   298  O  O   . THR A 1 47  ? 40.072 129.530 2.129   1.00   24.09 ? 41   THR A O   1 
ATOM   299  C  CB  . THR A 1 47  ? 39.735 126.586 0.729   1.00   28.54 ? 41   THR A CB  1 
ATOM   300  O  OG1 . THR A 1 47  ? 38.327 126.526 0.510   1.00   27.23 ? 41   THR A OG1 1 
ATOM   301  C  CG2 . THR A 1 47  ? 39.882 126.334 2.202   1.00   29.54 ? 41   THR A CG2 1 
ATOM   302  N  N   . GLY A 1 48  ? 38.484 129.514 0.510   1.00   27.00 ? 42   GLY A N   1 
ATOM   303  C  CA  . GLY A 1 48  ? 37.495 130.263 1.255   1.00   25.90 ? 42   GLY A CA  1 
ATOM   304  C  C   . GLY A 1 48  ? 36.404 129.304 1.614   1.00   25.64 ? 42   GLY A C   1 
ATOM   305  O  O   . GLY A 1 48  ? 36.611 128.092 1.715   1.00   24.62 ? 42   GLY A O   1 
ATOM   306  N  N   . THR A 1 49  ? 35.210 129.845 1.806   1.00   23.86 ? 43   THR A N   1 
ATOM   307  C  CA  . THR A 1 49  ? 34.101 129.046 2.204   1.00   24.12 ? 43   THR A CA  1 
ATOM   308  C  C   . THR A 1 49  ? 32.767 129.732 1.855   1.00   23.91 ? 43   THR A C   1 
ATOM   309  O  O   . THR A 1 49  ? 32.732 130.910 1.458   1.00   22.56 ? 43   THR A O   1 
ATOM   310  C  CB  . THR A 1 49  ? 34.242 128.696 3.736   1.00   25.12 ? 43   THR A CB  1 
ATOM   311  O  OG1 . THR A 1 49  ? 33.158 127.855 4.154   1.00   27.12 ? 43   THR A OG1 1 
ATOM   312  C  CG2 . THR A 1 49  ? 34.180 129.913 4.595   1.00   24.68 ? 43   THR A CG2 1 
ATOM   313  N  N   . GLY A 1 50  ? 31.690 128.981 1.990   1.00   23.87 ? 44   GLY A N   1 
ATOM   314  C  CA  . GLY A 1 50  ? 30.369 129.485 1.683   1.00   24.76 ? 44   GLY A CA  1 
ATOM   315  C  C   . GLY A 1 50  ? 29.250 128.614 2.202   1.00   24.71 ? 44   GLY A C   1 
ATOM   316  O  O   . GLY A 1 50  ? 29.471 127.448 2.562   1.00   25.59 ? 44   GLY A O   1 
ATOM   317  N  N   . PHE A 1 51  ? 28.063 129.192 2.224   1.00   23.62 ? 45   PHE A N   1 
ATOM   318  C  CA  . PHE A 1 51  ? 26.860 128.532 2.695   1.00   23.69 ? 45   PHE A CA  1 
ATOM   319  C  C   . PHE A 1 51  ? 25.651 129.016 1.898   1.00   23.21 ? 45   PHE A C   1 
ATOM   320  O  O   . PHE A 1 51  ? 25.734 129.989 1.140   1.00   23.16 ? 45   PHE A O   1 
ATOM   321  C  CB  . PHE A 1 51  ? 26.711 128.715 4.228   1.00   23.13 ? 45   PHE A CB  1 
ATOM   322  C  CG  . PHE A 1 51  ? 26.474 130.140 4.706   1.00   23.35 ? 45   PHE A CG  1 
ATOM   323  C  CD1 . PHE A 1 51  ? 25.188 130.674 4.749   1.00   24.07 ? 45   PHE A CD1 1 
ATOM   324  C  CD2 . PHE A 1 51  ? 27.509 130.898 5.236   1.00   25.10 ? 45   PHE A CD2 1 
ATOM   325  C  CE1 . PHE A 1 51  ? 24.947 131.964 5.264   1.00   24.44 ? 45   PHE A CE1 1 
ATOM   326  C  CE2 . PHE A 1 51  ? 27.280 132.175 5.747   1.00   23.75 ? 45   PHE A CE2 1 
ATOM   327  C  CZ  . PHE A 1 51  ? 25.990 132.706 5.760   1.00   24.95 ? 45   PHE A CZ  1 
ATOM   328  N  N   . GLN A 1 52  ? 24.552 128.296 2.009   1.00   23.59 ? 46   GLN A N   1 
ATOM   329  C  CA  . GLN A 1 52  ? 23.334 128.635 1.291   1.00   24.44 ? 46   GLN A CA  1 
ATOM   330  C  C   . GLN A 1 52  ? 22.128 128.226 2.095   1.00   24.99 ? 46   GLN A C   1 
ATOM   331  O  O   . GLN A 1 52  ? 22.241 127.362 2.991   1.00   24.57 ? 46   GLN A O   1 
ATOM   332  C  CB  . GLN A 1 52  ? 23.283 127.966 -0.089  1.00   24.45 ? 46   GLN A CB  1 
ATOM   333  C  CG  . GLN A 1 52  ? 23.160 126.470 -0.053  1.00   26.48 ? 46   GLN A CG  1 
ATOM   334  C  CD  . GLN A 1 52  ? 23.225 125.848 -1.425  1.00   29.72 ? 46   GLN A CD  1 
ATOM   335  O  OE1 . GLN A 1 52  ? 22.356 125.067 -1.817  1.00   36.40 ? 46   GLN A OE1 1 
ATOM   336  N  NE2 . GLN A 1 52  ? 24.246 126.173 -2.142  1.00   28.61 ? 46   GLN A NE2 1 
ATOM   337  N  N   . SER A 1 53  ? 20.977 128.846 1.798   1.00   24.96 ? 47   SER A N   1 
ATOM   338  C  CA  . SER A 1 53  ? 19.736 128.501 2.481   1.00   25.37 ? 47   SER A CA  1 
ATOM   339  C  C   . SER A 1 53  ? 19.296 127.093 2.087   1.00   26.92 ? 47   SER A C   1 
ATOM   340  O  O   . SER A 1 53  ? 19.496 126.651 0.954   1.00   26.06 ? 47   SER A O   1 
ATOM   341  C  CB  . SER A 1 53  ? 18.635 129.503 2.181   1.00   25.57 ? 47   SER A CB  1 
ATOM   342  O  OG  . SER A 1 53  ? 18.389 129.619 0.773   1.00   25.16 ? 47   SER A OG  1 
ATOM   343  N  N   . LYS A 1 54  ? 18.698 126.393 3.038   1.00   28.87 ? 48   LYS A N   1 
ATOM   344  C  CA  . LYS A 1 54  ? 18.019 125.117 2.769   1.00   31.72 ? 48   LYS A CA  1 
ATOM   345  C  C   . LYS A 1 54  ? 16.846 125.318 1.808   1.00   32.16 ? 48   LYS A C   1 
ATOM   346  O  O   . LYS A 1 54  ? 16.640 124.519 0.914   1.00   33.24 ? 48   LYS A O   1 
ATOM   347  C  CB  . LYS A 1 54  ? 17.497 124.495 4.083   1.00   32.84 ? 48   LYS A CB  1 
ATOM   348  C  CG  . LYS A 1 54  ? 18.595 124.086 5.080   1.00   35.25 ? 48   LYS A CG  1 
ATOM   349  C  CD  . LYS A 1 54  ? 17.945 123.419 6.320   1.00   39.61 ? 48   LYS A CD  1 
ATOM   350  C  CE  . LYS A 1 54  ? 18.945 123.039 7.399   1.00   41.14 ? 48   LYS A CE  1 
ATOM   351  N  NZ  . LYS A 1 54  ? 18.210 122.407 8.562   1.00   43.61 ? 48   LYS A NZ  1 
ATOM   352  N  N   . GLY A 1 55  ? 16.073 126.376 2.010   1.00   32.86 ? 49   GLY A N   1 
ATOM   353  C  CA  . GLY A 1 55  ? 14.921 126.677 1.146   1.00   33.03 ? 49   GLY A CA  1 
ATOM   354  C  C   . GLY A 1 55  ? 15.179 127.622 -0.040  1.00   32.81 ? 49   GLY A C   1 
ATOM   355  O  O   . GLY A 1 55  ? 16.227 128.270 -0.128  1.00   31.48 ? 49   GLY A O   1 
ATOM   356  N  N   . SER A 1 56  ? 14.221 127.621 -0.977  1.00   32.61 ? 50   SER A N   1 
ATOM   357  C  CA  . SER A 1 56  ? 14.118 128.562 -2.093  1.00   33.09 ? 50   SER A CA  1 
ATOM   358  C  C   . SER A 1 56  ? 12.882 129.413 -1.895  1.00   31.80 ? 50   SER A C   1 
ATOM   359  O  O   . SER A 1 56  ? 11.866 128.905 -1.437  1.00   31.04 ? 50   SER A O   1 
ATOM   360  C  CB  . SER A 1 56  ? 13.949 127.814 -3.399  1.00   33.25 ? 50   SER A CB  1 
ATOM   361  O  OG  . SER A 1 56  ? 15.009 126.895 -3.542  1.00   39.28 ? 50   SER A OG  1 
ATOM   362  N  N   . TYR A 1 57  ? 12.972 130.685 -2.271  1.00   30.82 ? 51   TYR A N   1 
ATOM   363  C  CA  . TYR A 1 57  ? 11.952 131.686 -1.952  1.00   29.47 ? 51   TYR A CA  1 
ATOM   364  C  C   . TYR A 1 57  ? 11.624 132.524 -3.166  1.00   29.80 ? 51   TYR A C   1 
ATOM   365  O  O   . TYR A 1 57  ? 12.489 132.833 -3.978  1.00   29.11 ? 51   TYR A O   1 
ATOM   366  C  CB  . TYR A 1 57  ? 12.421 132.590 -0.798  1.00   29.86 ? 51   TYR A CB  1 
ATOM   367  C  CG  . TYR A 1 57  ? 12.750 131.806 0.442   1.00   29.48 ? 51   TYR A CG  1 
ATOM   368  C  CD1 . TYR A 1 57  ? 11.771 131.480 1.365   1.00   30.30 ? 51   TYR A CD1 1 
ATOM   369  C  CD2 . TYR A 1 57  ? 14.038 131.294 0.640   1.00   30.79 ? 51   TYR A CD2 1 
ATOM   370  C  CE1 . TYR A 1 57  ? 12.081 130.692 2.504   1.00   32.51 ? 51   TYR A CE1 1 
ATOM   371  C  CE2 . TYR A 1 57  ? 14.347 130.527 1.757   1.00   30.04 ? 51   TYR A CE2 1 
ATOM   372  C  CZ  . TYR A 1 57  ? 13.381 130.227 2.688   1.00   30.19 ? 51   TYR A CZ  1 
ATOM   373  O  OH  . TYR A 1 57  ? 13.724 129.450 3.790   1.00   31.09 ? 51   TYR A OH  1 
ATOM   374  N  N   . LEU A 1 58  ? 10.352 132.880 -3.291  1.00   30.54 ? 52   LEU A N   1 
ATOM   375  C  CA  . LEU A 1 58  ? 9.889  133.836 -4.265  1.00   31.41 ? 52   LEU A CA  1 
ATOM   376  C  C   . LEU A 1 58  ? 9.234  134.993 -3.511  1.00   31.36 ? 52   LEU A C   1 
ATOM   377  O  O   . LEU A 1 58  ? 8.090  134.872 -3.077  1.00   32.81 ? 52   LEU A O   1 
ATOM   378  C  CB  . LEU A 1 58  ? 8.908  133.161 -5.225  1.00   31.63 ? 52   LEU A CB  1 
ATOM   379  C  CG  . LEU A 1 58  ? 8.476  134.077 -6.379  1.00   34.89 ? 52   LEU A CG  1 
ATOM   380  C  CD1 . LEU A 1 58  ? 9.654  134.625 -7.165  1.00   36.09 ? 52   LEU A CD1 1 
ATOM   381  C  CD2 . LEU A 1 58  ? 7.486  133.329 -7.322  1.00   37.08 ? 52   LEU A CD2 1 
ATOM   382  N  N   . PHE A 1 59  ? 9.959  136.101 -3.383  1.00   30.52 ? 53   PHE A N   1 
ATOM   383  C  CA  . PHE A 1 59  ? 9.624  137.255 -2.540  1.00   30.54 ? 53   PHE A CA  1 
ATOM   384  C  C   . PHE A 1 59  ? 9.840  137.066 -1.039  1.00   30.14 ? 53   PHE A C   1 
ATOM   385  O  O   . PHE A 1 59  ? 9.747  135.970 -0.517  1.00   29.77 ? 53   PHE A O   1 
ATOM   386  C  CB  . PHE A 1 59  ? 8.183  137.745 -2.769  1.00   31.31 ? 53   PHE A CB  1 
ATOM   387  C  CG  . PHE A 1 59  ? 7.848  137.959 -4.217  1.00   30.22 ? 53   PHE A CG  1 
ATOM   388  C  CD1 . PHE A 1 59  ? 8.648  138.739 -5.020  1.00   29.05 ? 53   PHE A CD1 1 
ATOM   389  C  CD2 . PHE A 1 59  ? 6.741  137.335 -4.776  1.00   33.49 ? 53   PHE A CD2 1 
ATOM   390  C  CE1 . PHE A 1 59  ? 8.330  138.932 -6.390  1.00   31.09 ? 53   PHE A CE1 1 
ATOM   391  C  CE2 . PHE A 1 59  ? 6.421  137.514 -6.142  1.00   31.08 ? 53   PHE A CE2 1 
ATOM   392  C  CZ  . PHE A 1 59  ? 7.209  138.309 -6.933  1.00   28.92 ? 53   PHE A CZ  1 
ATOM   393  N  N   . GLY A 1 60  ? 10.120 138.158 -0.350  1.00   29.32 ? 54   GLY A N   1 
ATOM   394  C  CA  . GLY A 1 60  ? 10.292 138.100 1.090   1.00   29.33 ? 54   GLY A CA  1 
ATOM   395  C  C   . GLY A 1 60  ? 11.236 139.154 1.609   1.00   29.49 ? 54   GLY A C   1 
ATOM   396  O  O   . GLY A 1 60  ? 11.616 140.099 0.906   1.00   28.07 ? 54   GLY A O   1 
ATOM   397  N  N   . HIS A 1 61  ? 11.613 138.959 2.867   1.00   30.63 ? 55   HIS A N   1 
ATOM   398  C  CA  . HIS A 1 61  ? 12.503 139.849 3.608   1.00   31.26 ? 55   HIS A CA  1 
ATOM   399  C  C   . HIS A 1 61  ? 13.669 138.991 4.150   1.00   30.19 ? 55   HIS A C   1 
ATOM   400  O  O   . HIS A 1 61  ? 13.458 138.056 4.896   1.00   29.89 ? 55   HIS A O   1 
ATOM   401  C  CB  . HIS A 1 61  ? 11.747 140.466 4.769   1.00   31.95 ? 55   HIS A CB  1 
ATOM   402  C  CG  . HIS A 1 61  ? 12.536 141.477 5.536   1.00   34.94 ? 55   HIS A CG  1 
ATOM   403  N  ND1 . HIS A 1 61  ? 12.329 141.715 6.876   1.00   39.95 ? 55   HIS A ND1 1 
ATOM   404  C  CD2 . HIS A 1 61  ? 13.512 142.333 5.148   1.00   38.84 ? 55   HIS A CD2 1 
ATOM   405  C  CE1 . HIS A 1 61  ? 13.145 142.674 7.281   1.00   40.20 ? 55   HIS A CE1 1 
ATOM   406  N  NE2 . HIS A 1 61  ? 13.880 143.060 6.255   1.00   39.97 ? 55   HIS A NE2 1 
ATOM   407  N  N   . PHE A 1 62  ? 14.880 139.298 3.716   1.00   29.81 ? 56   PHE A N   1 
ATOM   408  C  CA  . PHE A 1 62  ? 16.067 138.484 3.999   1.00   29.13 ? 56   PHE A CA  1 
ATOM   409  C  C   . PHE A 1 62  ? 17.082 139.409 4.627   1.00   29.01 ? 56   PHE A C   1 
ATOM   410  O  O   . PHE A 1 62  ? 17.391 140.448 4.078   1.00   29.81 ? 56   PHE A O   1 
ATOM   411  C  CB  . PHE A 1 62  ? 16.595 137.893 2.690   1.00   28.90 ? 56   PHE A CB  1 
ATOM   412  C  CG  . PHE A 1 62  ? 15.522 137.276 1.869   1.00   27.90 ? 56   PHE A CG  1 
ATOM   413  C  CD1 . PHE A 1 62  ? 14.779 138.050 0.964   1.00   29.28 ? 56   PHE A CD1 1 
ATOM   414  C  CD2 . PHE A 1 62  ? 15.189 135.955 2.041   1.00   28.03 ? 56   PHE A CD2 1 
ATOM   415  C  CE1 . PHE A 1 62  ? 13.746 137.500 0.246   1.00   27.01 ? 56   PHE A CE1 1 
ATOM   416  C  CE2 . PHE A 1 62  ? 14.150 135.403 1.329   1.00   29.27 ? 56   PHE A CE2 1 
ATOM   417  C  CZ  . PHE A 1 62  ? 13.426 136.185 0.426   1.00   28.37 ? 56   PHE A CZ  1 
ATOM   418  N  N   . SER A 1 63  ? 17.582 139.030 5.777   1.00   29.59 ? 57   SER A N   1 
ATOM   419  C  CA  . SER A 1 63  ? 18.450 139.877 6.567   1.00   29.99 ? 57   SER A CA  1 
ATOM   420  C  C   . SER A 1 63  ? 19.568 139.083 7.247   1.00   29.36 ? 57   SER A C   1 
ATOM   421  O  O   . SER A 1 63  ? 19.370 137.964 7.698   1.00   28.61 ? 57   SER A O   1 
ATOM   422  C  CB  . SER A 1 63  ? 17.641 140.620 7.635   1.00   30.73 ? 57   SER A CB  1 
ATOM   423  O  OG  . SER A 1 63  ? 18.498 141.596 8.269   1.00   34.80 ? 57   SER A OG  1 
ATOM   424  N  N   . MET A 1 64  ? 20.741 139.693 7.302   1.00   28.61 ? 58   MET A N   1 
ATOM   425  C  CA  . MET A 1 64  ? 21.905 139.100 7.911   1.00   29.22 ? 58   MET A CA  1 
ATOM   426  C  C   . MET A 1 64  ? 22.629 140.198 8.653   1.00   28.74 ? 58   MET A C   1 
ATOM   427  O  O   . MET A 1 64  ? 22.791 141.298 8.116   1.00   27.64 ? 58   MET A O   1 
ATOM   428  C  CB  . MET A 1 64  ? 22.811 138.526 6.816   1.00   29.62 ? 58   MET A CB  1 
ATOM   429  C  CG  . MET A 1 64  ? 23.928 137.684 7.310   1.00   33.47 ? 58   MET A CG  1 
ATOM   430  S  SD  . MET A 1 64  ? 23.387 136.007 7.799   1.00   36.25 ? 58   MET A SD  1 
ATOM   431  C  CE  . MET A 1 64  ? 23.041 135.257 6.279   1.00   32.47 ? 58   MET A CE  1 
ATOM   432  N  N   . GLN A 1 65  ? 23.076 139.913 9.878   1.00   27.46 ? 59   GLN A N   1 
ATOM   433  C  CA  . GLN A 1 65  ? 24.016 140.809 10.557  1.00   28.23 ? 59   GLN A CA  1 
ATOM   434  C  C   . GLN A 1 65  ? 25.412 140.347 10.227  1.00   27.28 ? 59   GLN A C   1 
ATOM   435  O  O   . GLN A 1 65  ? 25.713 139.149 10.329  1.00   26.76 ? 59   GLN A O   1 
ATOM   436  C  CB  . GLN A 1 65  ? 23.892 140.746 12.075  1.00   29.33 ? 59   GLN A CB  1 
ATOM   437  C  CG  . GLN A 1 65  ? 22.732 141.455 12.709  1.00   33.68 ? 59   GLN A CG  1 
ATOM   438  C  CD  . GLN A 1 65  ? 22.819 141.357 14.266  1.00   36.30 ? 59   GLN A CD  1 
ATOM   439  O  OE1 . GLN A 1 65  ? 23.589 142.064 14.896  1.00   38.45 ? 59   GLN A OE1 1 
ATOM   440  N  NE2 . GLN A 1 65  ? 22.053 140.459 14.840  1.00   40.80 ? 59   GLN A NE2 1 
ATOM   441  N  N   . MET A 1 66  ? 26.268 141.272 9.848   1.00   26.34 ? 60   MET A N   1 
ATOM   442  C  CA  . MET A 1 66  ? 27.597 140.914 9.468   1.00   26.41 ? 60   MET A CA  1 
ATOM   443  C  C   . MET A 1 66  ? 28.590 141.903 10.052  1.00   26.35 ? 60   MET A C   1 
ATOM   444  O  O   . MET A 1 66  ? 28.310 143.108 10.213  1.00   25.07 ? 60   MET A O   1 
ATOM   445  C  CB  . MET A 1 66  ? 27.717 140.862 7.933   1.00   26.24 ? 60   MET A CB  1 
ATOM   446  C  CG  . MET A 1 66  ? 26.779 139.868 7.274   1.00   27.42 ? 60   MET A CG  1 
ATOM   447  S  SD  . MET A 1 66  ? 26.693 140.006 5.436   1.00   29.24 ? 60   MET A SD  1 
ATOM   448  C  CE  . MET A 1 66  ? 28.384 139.758 4.996   1.00   27.86 ? 60   MET A CE  1 
ATOM   449  N  N   . LYS A 1 67  ? 29.762 141.373 10.337  1.00   25.01 ? 61   LYS A N   1 
ATOM   450  C  CA  . LYS A 1 67  ? 30.910 142.148 10.748  1.00   26.16 ? 61   LYS A CA  1 
ATOM   451  C  C   . LYS A 1 67  ? 32.060 141.686 9.876   1.00   25.98 ? 61   LYS A C   1 
ATOM   452  O  O   . LYS A 1 67  ? 32.405 140.511 9.858   1.00   24.31 ? 61   LYS A O   1 
ATOM   453  C  CB  . LYS A 1 67  ? 31.186 141.923 12.240  1.00   26.54 ? 61   LYS A CB  1 
ATOM   454  C  CG  . LYS A 1 67  ? 32.424 142.621 12.760  1.00   30.02 ? 61   LYS A CG  1 
ATOM   455  C  CD  . LYS A 1 67  ? 32.518 142.583 14.303  1.00   33.56 ? 61   LYS A CD  1 
ATOM   456  C  CE  . LYS A 1 67  ? 33.124 141.269 14.775  1.00   37.89 ? 61   LYS A CE  1 
ATOM   457  N  NZ  . LYS A 1 67  ? 32.828 140.987 16.213  1.00   41.49 ? 61   LYS A NZ  1 
ATOM   458  N  N   . LEU A 1 68  ? 32.640 142.618 9.154   1.00   26.27 ? 62   LEU A N   1 
ATOM   459  C  CA  . LEU A 1 68  ? 33.538 142.311 8.080   1.00   27.62 ? 62   LEU A CA  1 
ATOM   460  C  C   . LEU A 1 68  ? 34.979 142.017 8.559   1.00   28.34 ? 62   LEU A C   1 
ATOM   461  O  O   . LEU A 1 68  ? 35.306 142.170 9.745   1.00   28.81 ? 62   LEU A O   1 
ATOM   462  C  CB  . LEU A 1 68  ? 33.476 143.434 7.048   1.00   27.50 ? 62   LEU A CB  1 
ATOM   463  C  CG  . LEU A 1 68  ? 32.190 143.477 6.192   1.00   31.34 ? 62   LEU A CG  1 
ATOM   464  C  CD1 . LEU A 1 68  ? 32.036 142.216 5.336   1.00   33.97 ? 62   LEU A CD1 1 
ATOM   465  C  CD2 . LEU A 1 68  ? 30.963 143.541 6.968   1.00   35.09 ? 62   LEU A CD2 1 
ATOM   466  N  N   . VAL A 1 69  ? 35.812 141.572 7.631   1.00   28.76 ? 63   VAL A N   1 
ATOM   467  C  CA  . VAL A 1 69  ? 37.225 141.223 7.888   1.00   29.26 ? 63   VAL A CA  1 
ATOM   468  C  C   . VAL A 1 69  ? 37.998 142.452 8.402   1.00   29.90 ? 63   VAL A C   1 
ATOM   469  O  O   . VAL A 1 69  ? 38.094 143.448 7.683   1.00   29.78 ? 63   VAL A O   1 
ATOM   470  C  CB  . VAL A 1 69  ? 37.925 140.707 6.594   1.00   28.66 ? 63   VAL A CB  1 
ATOM   471  C  CG1 . VAL A 1 69  ? 39.387 140.378 6.870   1.00   30.10 ? 63   VAL A CG1 1 
ATOM   472  C  CG2 . VAL A 1 69  ? 37.206 139.491 6.009   1.00   28.10 ? 63   VAL A CG2 1 
ATOM   473  N  N   . PRO A 1 70  ? 38.530 142.387 9.622   1.00   31.79 ? 64   PRO A N   1 
ATOM   474  C  CA  . PRO A 1 70  ? 39.277 143.505 10.218  1.00   33.56 ? 64   PRO A CA  1 
ATOM   475  C  C   . PRO A 1 70  ? 40.703 143.591 9.693   1.00   35.28 ? 64   PRO A C   1 
ATOM   476  O  O   . PRO A 1 70  ? 41.144 142.708 8.940   1.00   35.71 ? 64   PRO A O   1 
ATOM   477  C  CB  . PRO A 1 70  ? 39.278 143.171 11.733  1.00   33.87 ? 64   PRO A CB  1 
ATOM   478  C  CG  . PRO A 1 70  ? 39.278 141.704 11.789  1.00   33.88 ? 64   PRO A CG  1 
ATOM   479  C  CD  . PRO A 1 70  ? 38.448 141.247 10.547  1.00   32.18 ? 64   PRO A CD  1 
ATOM   480  N  N   . GLY A 1 71  ? 41.404 144.665 10.060  1.00   35.88 ? 65   GLY A N   1 
ATOM   481  C  CA  . GLY A 1 71  ? 42.770 144.870 9.630   1.00   36.08 ? 65   GLY A CA  1 
ATOM   482  C  C   . GLY A 1 71  ? 42.889 144.896 8.135   1.00   36.29 ? 65   GLY A C   1 
ATOM   483  O  O   . GLY A 1 71  ? 42.092 145.562 7.466   1.00   36.72 ? 65   GLY A O   1 
ATOM   484  N  N   . ASP A 1 72  ? 43.881 144.183 7.610   1.00   36.17 ? 66   ASP A N   1 
ATOM   485  C  CA  . ASP A 1 72  ? 44.122 144.119 6.170   1.00   36.46 ? 66   ASP A CA  1 
ATOM   486  C  C   . ASP A 1 72  ? 43.208 143.071 5.540   1.00   35.35 ? 66   ASP A C   1 
ATOM   487  O  O   . ASP A 1 72  ? 43.317 141.883 5.850   1.00   36.01 ? 66   ASP A O   1 
ATOM   488  C  CB  . ASP A 1 72  ? 45.578 143.736 5.911   1.00   37.68 ? 66   ASP A CB  1 
ATOM   489  C  CG  . ASP A 1 72  ? 45.994 143.922 4.463   1.00   41.67 ? 66   ASP A CG  1 
ATOM   490  O  OD1 . ASP A 1 72  ? 45.155 143.833 3.542   1.00   45.72 ? 66   ASP A OD1 1 
ATOM   491  O  OD2 . ASP A 1 72  ? 47.174 144.164 4.143   1.00   46.80 ? 66   ASP A OD2 1 
ATOM   492  N  N   . SER A 1 73  ? 42.332 143.523 4.647   1.00   33.50 ? 67   SER A N   1 
ATOM   493  C  CA  . SER A 1 73  ? 41.345 142.679 3.973   1.00   32.24 ? 67   SER A CA  1 
ATOM   494  C  C   . SER A 1 73  ? 41.417 142.885 2.464   1.00   31.42 ? 67   SER A C   1 
ATOM   495  O  O   . SER A 1 73  ? 40.479 142.531 1.733   1.00   29.41 ? 67   SER A O   1 
ATOM   496  C  CB  . SER A 1 73  ? 39.923 143.012 4.466   1.00   32.10 ? 67   SER A CB  1 
ATOM   497  O  OG  . SER A 1 73  ? 39.654 144.383 4.275   1.00   30.91 ? 67   SER A OG  1 
ATOM   498  N  N   . ALA A 1 74  ? 42.558 143.403 1.999   1.00   30.56 ? 68   ALA A N   1 
ATOM   499  C  CA  . ALA A 1 74  ? 42.738 143.730 0.601   1.00   30.31 ? 68   ALA A CA  1 
ATOM   500  C  C   . ALA A 1 74  ? 42.638 142.459 -0.218  1.00   30.36 ? 68   ALA A C   1 
ATOM   501  O  O   . ALA A 1 74  ? 43.157 141.411 0.152   1.00   30.23 ? 68   ALA A O   1 
ATOM   502  C  CB  . ALA A 1 74  ? 44.070 144.400 0.368   1.00   30.35 ? 68   ALA A CB  1 
ATOM   503  N  N   . GLY A 1 75  ? 41.924 142.578 -1.323  1.00   30.73 ? 69   GLY A N   1 
ATOM   504  C  CA  . GLY A 1 75  ? 41.745 141.492 -2.256  1.00   30.93 ? 69   GLY A CA  1 
ATOM   505  C  C   . GLY A 1 75  ? 40.696 140.479 -1.862  1.00   30.34 ? 69   GLY A C   1 
ATOM   506  O  O   . GLY A 1 75  ? 40.548 139.504 -2.596  1.00   31.15 ? 69   GLY A O   1 
ATOM   507  N  N   . THR A 1 76  ? 39.984 140.684 -0.746  1.00   28.36 ? 70   THR A N   1 
ATOM   508  C  CA  . THR A 1 76  ? 38.925 139.772 -0.350  1.00   27.54 ? 70   THR A CA  1 
ATOM   509  C  C   . THR A 1 76  ? 37.560 140.324 -0.737  1.00   27.17 ? 70   THR A C   1 
ATOM   510  O  O   . THR A 1 76  ? 37.339 141.556 -0.752  1.00   27.56 ? 70   THR A O   1 
ATOM   511  C  CB  . THR A 1 76  ? 38.920 139.436 1.189   1.00   27.59 ? 70   THR A CB  1 
ATOM   512  O  OG1 . THR A 1 76  ? 38.595 140.590 1.977   1.00   26.73 ? 70   THR A OG1 1 
ATOM   513  C  CG2 . THR A 1 76  ? 40.301 138.979 1.681   1.00   29.59 ? 70   THR A CG2 1 
ATOM   514  N  N   . VAL A 1 77  ? 36.636 139.402 -0.979  1.00   25.23 ? 71   VAL A N   1 
ATOM   515  C  CA  . VAL A 1 77  ? 35.247 139.703 -1.241  1.00   24.82 ? 71   VAL A CA  1 
ATOM   516  C  C   . VAL A 1 77  ? 34.379 138.828 -0.374  1.00   23.72 ? 71   VAL A C   1 
ATOM   517  O  O   . VAL A 1 77  ? 34.528 137.584 -0.343  1.00   22.33 ? 71   VAL A O   1 
ATOM   518  C  CB  . VAL A 1 77  ? 34.895 139.508 -2.711  1.00   25.78 ? 71   VAL A CB  1 
ATOM   519  C  CG1 . VAL A 1 77  ? 33.398 139.746 -2.956  1.00   26.22 ? 71   VAL A CG1 1 
ATOM   520  C  CG2 . VAL A 1 77  ? 35.698 140.471 -3.545  1.00   28.51 ? 71   VAL A CG2 1 
ATOM   521  N  N   . THR A 1 78  ? 33.503 139.477 0.373   1.00   21.97 ? 72   THR A N   1 
ATOM   522  C  CA  . THR A 1 78  ? 32.505 138.797 1.157   1.00   22.70 ? 72   THR A CA  1 
ATOM   523  C  C   . THR A 1 78  ? 31.198 139.093 0.490   1.00   22.86 ? 72   THR A C   1 
ATOM   524  O  O   . THR A 1 78  ? 30.840 140.262 0.325   1.00   22.42 ? 72   THR A O   1 
ATOM   525  C  CB  . THR A 1 78  ? 32.480 139.357 2.583   1.00   23.10 ? 72   THR A CB  1 
ATOM   526  O  OG1 . THR A 1 78  ? 33.805 139.391 3.126   1.00   25.53 ? 72   THR A OG1 1 
ATOM   527  C  CG2 . THR A 1 78  ? 31.686 138.462 3.501   1.00   25.05 ? 72   THR A CG2 1 
ATOM   528  N  N   . ALA A 1 79  ? 30.470 138.057 0.112   1.00   22.34 ? 73   ALA A N   1 
ATOM   529  C  CA  . ALA A 1 79  ? 29.251 138.223 -0.636  1.00   22.51 ? 73   ALA A CA  1 
ATOM   530  C  C   . ALA A 1 79  ? 28.074 137.655 0.094   1.00   22.94 ? 73   ALA A C   1 
ATOM   531  O  O   . ALA A 1 79  ? 28.153 136.612 0.754   1.00   23.48 ? 73   ALA A O   1 
ATOM   532  C  CB  . ALA A 1 79  ? 29.400 137.581 -1.995  1.00   23.75 ? 73   ALA A CB  1 
ATOM   533  N  N   . PHE A 1 80  ? 26.959 138.359 -0.018  1.00   23.15 ? 74   PHE A N   1 
ATOM   534  C  CA  . PHE A 1 80  ? 25.682 137.971 0.565   1.00   23.04 ? 74   PHE A CA  1 
ATOM   535  C  C   . PHE A 1 80  ? 24.655 138.258 -0.528  1.00   22.69 ? 74   PHE A C   1 
ATOM   536  O  O   . PHE A 1 80  ? 24.498 139.406 -0.947  1.00   22.47 ? 74   PHE A O   1 
ATOM   537  C  CB  . PHE A 1 80  ? 25.433 138.786 1.845   1.00   22.79 ? 74   PHE A CB  1 
ATOM   538  C  CG  . PHE A 1 80  ? 24.019 138.679 2.390   1.00   23.90 ? 74   PHE A CG  1 
ATOM   539  C  CD1 . PHE A 1 80  ? 23.402 137.478 2.550   1.00   26.23 ? 74   PHE A CD1 1 
ATOM   540  C  CD2 . PHE A 1 80  ? 23.301 139.813 2.704   1.00   28.12 ? 74   PHE A CD2 1 
ATOM   541  C  CE1 . PHE A 1 80  ? 22.107 137.394 3.052   1.00   28.20 ? 74   PHE A CE1 1 
ATOM   542  C  CE2 . PHE A 1 80  ? 21.999 139.733 3.197   1.00   27.03 ? 74   PHE A CE2 1 
ATOM   543  C  CZ  . PHE A 1 80  ? 21.403 138.527 3.359   1.00   28.21 ? 74   PHE A CZ  1 
ATOM   544  N  N   . TYR A 1 81  ? 24.014 137.217 -1.047  1.00   23.04 ? 75   TYR A N   1 
ATOM   545  C  CA  . TYR A 1 81  ? 23.202 137.365 -2.230  1.00   23.21 ? 75   TYR A CA  1 
ATOM   546  C  C   . TYR A 1 81  ? 22.120 136.338 -2.362  1.00   23.88 ? 75   TYR A C   1 
ATOM   547  O  O   . TYR A 1 81  ? 22.160 135.280 -1.733  1.00   22.39 ? 75   TYR A O   1 
ATOM   548  C  CB  . TYR A 1 81  ? 24.072 137.393 -3.493  1.00   24.27 ? 75   TYR A CB  1 
ATOM   549  C  CG  . TYR A 1 81  ? 24.874 136.153 -3.799  1.00   23.86 ? 75   TYR A CG  1 
ATOM   550  C  CD1 . TYR A 1 81  ? 26.066 135.872 -3.117  1.00   24.55 ? 75   TYR A CD1 1 
ATOM   551  C  CD2 . TYR A 1 81  ? 24.447 135.264 -4.779  1.00   25.51 ? 75   TYR A CD2 1 
ATOM   552  C  CE1 . TYR A 1 81  ? 26.797 134.735 -3.407  1.00   25.94 ? 75   TYR A CE1 1 
ATOM   553  C  CE2 . TYR A 1 81  ? 25.193 134.107 -5.087  1.00   27.10 ? 75   TYR A CE2 1 
ATOM   554  C  CZ  . TYR A 1 81  ? 26.358 133.871 -4.413  1.00   26.50 ? 75   TYR A CZ  1 
ATOM   555  O  OH  . TYR A 1 81  ? 27.056 132.754 -4.725  1.00   28.19 ? 75   TYR A OH  1 
ATOM   556  N  N   . LEU A 1 82  ? 21.095 136.702 -3.118  1.00   23.69 ? 76   LEU A N   1 
ATOM   557  C  CA  . LEU A 1 82  ? 20.074 135.760 -3.561  1.00   24.78 ? 76   LEU A CA  1 
ATOM   558  C  C   . LEU A 1 82  ? 20.316 135.444 -5.014  1.00   25.07 ? 76   LEU A C   1 
ATOM   559  O  O   . LEU A 1 82  ? 20.674 136.338 -5.773  1.00   24.82 ? 76   LEU A O   1 
ATOM   560  C  CB  . LEU A 1 82  ? 18.708 136.379 -3.445  1.00   25.17 ? 76   LEU A CB  1 
ATOM   561  C  CG  . LEU A 1 82  ? 18.192 136.500 -1.999  1.00   30.32 ? 76   LEU A CG  1 
ATOM   562  C  CD1 . LEU A 1 82  ? 18.470 137.846 -1.460  1.00   34.10 ? 76   LEU A CD1 1 
ATOM   563  C  CD2 . LEU A 1 82  ? 16.729 136.270 -1.963  1.00   33.74 ? 76   LEU A CD2 1 
ATOM   564  N  N   . SER A 1 83  ? 20.140 134.182 -5.405  1.00   25.54 ? 77   SER A N   1 
ATOM   565  C  CA  . SER A 1 83  ? 20.211 133.805 -6.831  1.00   26.22 ? 77   SER A CA  1 
ATOM   566  C  C   . SER A 1 83  ? 19.290 132.635 -7.178  1.00   27.24 ? 77   SER A C   1 
ATOM   567  O  O   . SER A 1 83  ? 19.097 131.737 -6.373  1.00   25.32 ? 77   SER A O   1 
ATOM   568  C  CB  . SER A 1 83  ? 21.649 133.408 -7.194  1.00   26.33 ? 77   SER A CB  1 
ATOM   569  O  OG  . SER A 1 83  ? 21.783 133.127 -8.584  1.00   27.56 ? 77   SER A OG  1 
ATOM   570  N  N   . SER A 1 84  ? 18.708 132.653 -8.375  1.00   29.67 ? 78   SER A N   1 
ATOM   571  C  CA  . SER A 1 84  ? 18.010 131.480 -8.900  1.00   32.42 ? 78   SER A CA  1 
ATOM   572  C  C   . SER A 1 84  ? 19.055 130.565 -9.533  1.00   35.35 ? 78   SER A C   1 
ATOM   573  O  O   . SER A 1 84  ? 20.231 130.912 -9.587  1.00   34.55 ? 78   SER A O   1 
ATOM   574  C  CB  . SER A 1 84  ? 16.933 131.872 -9.915  1.00   32.10 ? 78   SER A CB  1 
ATOM   575  O  OG  . SER A 1 84  ? 17.503 132.595 -10.976 1.00   32.50 ? 78   SER A OG  1 
ATOM   576  N  N   . GLN A 1 85  ? 18.607 129.432 -10.046 1.00   39.97 ? 79   GLN A N   1 
ATOM   577  C  CA  . GLN A 1 85  ? 19.490 128.309 -10.372 1.00   44.18 ? 79   GLN A CA  1 
ATOM   578  C  C   . GLN A 1 85  ? 19.530 127.899 -11.852 1.00   46.45 ? 79   GLN A C   1 
ATOM   579  O  O   . GLN A 1 85  ? 20.465 127.228 -12.252 1.00   48.39 ? 79   GLN A O   1 
ATOM   580  C  CB  . GLN A 1 85  ? 19.084 127.080 -9.544  1.00   45.27 ? 79   GLN A CB  1 
ATOM   581  C  CG  . GLN A 1 85  ? 18.073 127.358 -8.421  1.00   47.23 ? 79   GLN A CG  1 
ATOM   582  C  CD  . GLN A 1 85  ? 18.711 127.478 -7.032  1.00   50.22 ? 79   GLN A CD  1 
ATOM   583  O  OE1 . GLN A 1 85  ? 18.628 126.518 -6.257  1.00   54.87 ? 79   GLN A OE1 1 
ATOM   584  N  NE2 . GLN A 1 85  ? 19.326 128.656 -6.704  1.00   44.73 ? 79   GLN A NE2 1 
ATOM   585  N  N   . ASN A 1 86  ? 18.546 128.261 -12.671 1.00   48.53 ? 80   ASN A N   1 
ATOM   586  C  CA  . ASN A 1 86  ? 18.596 127.840 -14.088 1.00   49.99 ? 80   ASN A CA  1 
ATOM   587  C  C   . ASN A 1 86  ? 19.409 128.859 -14.881 1.00   49.84 ? 80   ASN A C   1 
ATOM   588  O  O   . ASN A 1 86  ? 19.928 129.821 -14.311 1.00   50.19 ? 80   ASN A O   1 
ATOM   589  C  CB  . ASN A 1 86  ? 17.186 127.661 -14.688 1.00   50.71 ? 80   ASN A CB  1 
ATOM   590  C  CG  . ASN A 1 86  ? 17.045 126.366 -15.562 1.00   54.32 ? 80   ASN A CG  1 
ATOM   591  O  OD1 . ASN A 1 86  ? 17.882 126.068 -16.436 1.00   57.58 ? 80   ASN A OD1 1 
ATOM   592  N  ND2 . ASN A 1 86  ? 15.963 125.618 -15.331 1.00   57.13 ? 80   ASN A ND2 1 
ATOM   593  N  N   . SER A 1 87  ? 19.563 128.617 -16.185 1.00   49.39 ? 81   SER A N   1 
ATOM   594  C  CA  . SER A 1 87  ? 20.051 129.633 -17.127 1.00   48.58 ? 81   SER A CA  1 
ATOM   595  C  C   . SER A 1 87  ? 19.064 130.807 -17.148 1.00   46.95 ? 81   SER A C   1 
ATOM   596  O  O   . SER A 1 87  ? 17.940 130.680 -16.674 1.00   47.99 ? 81   SER A O   1 
ATOM   597  C  CB  . SER A 1 87  ? 20.195 129.024 -18.537 1.00   49.06 ? 81   SER A CB  1 
ATOM   598  O  OG  . SER A 1 87  ? 18.960 128.439 -18.967 1.00   50.72 ? 81   SER A OG  1 
ATOM   599  N  N   . GLU A 1 88  ? 19.488 131.944 -17.686 1.00   45.01 ? 82   GLU A N   1 
ATOM   600  C  CA  . GLU A 1 88  ? 18.722 133.189 -17.614 1.00   43.68 ? 82   GLU A CA  1 
ATOM   601  C  C   . GLU A 1 88  ? 18.331 133.559 -16.164 1.00   41.14 ? 82   GLU A C   1 
ATOM   602  O  O   . GLU A 1 88  ? 17.201 133.958 -15.878 1.00   39.82 ? 82   GLU A O   1 
ATOM   603  C  CB  . GLU A 1 88  ? 17.505 133.137 -18.547 1.00   44.42 ? 82   GLU A CB  1 
ATOM   604  C  CG  . GLU A 1 88  ? 17.869 132.729 -19.980 1.00   48.38 ? 82   GLU A CG  1 
ATOM   605  C  CD  . GLU A 1 88  ? 16.808 133.102 -21.018 1.00   53.64 ? 82   GLU A CD  1 
ATOM   606  O  OE1 . GLU A 1 88  ? 15.687 133.535 -20.651 1.00   55.85 ? 82   GLU A OE1 1 
ATOM   607  O  OE2 . GLU A 1 88  ? 17.109 132.966 -22.226 1.00   58.69 ? 82   GLU A OE2 1 
ATOM   608  N  N   . HIS A 1 89  ? 19.319 133.458 -15.276 1.00   38.55 ? 83   HIS A N   1 
ATOM   609  C  CA  . HIS A 1 89  ? 19.111 133.549 -13.829 1.00   36.52 ? 83   HIS A CA  1 
ATOM   610  C  C   . HIS A 1 89  ? 18.873 134.975 -13.334 1.00   34.37 ? 83   HIS A C   1 
ATOM   611  O  O   . HIS A 1 89  ? 19.290 135.957 -13.954 1.00   33.41 ? 83   HIS A O   1 
ATOM   612  C  CB  . HIS A 1 89  ? 20.286 132.856 -13.067 1.00   36.31 ? 83   HIS A CB  1 
ATOM   613  C  CG  . HIS A 1 89  ? 21.504 133.710 -12.887 1.00   37.05 ? 83   HIS A CG  1 
ATOM   614  N  ND1 . HIS A 1 89  ? 22.244 134.205 -13.943 1.00   38.45 ? 83   HIS A ND1 1 
ATOM   615  C  CD2 . HIS A 1 89  ? 22.123 134.148 -11.762 1.00   38.32 ? 83   HIS A CD2 1 
ATOM   616  C  CE1 . HIS A 1 89  ? 23.255 134.919 -13.478 1.00   39.15 ? 83   HIS A CE1 1 
ATOM   617  N  NE2 . HIS A 1 89  ? 23.206 134.899 -12.156 1.00   38.64 ? 83   HIS A NE2 1 
ATOM   618  N  N   . ASP A 1 90  ? 18.180 135.070 -12.209 1.00   32.77 ? 84   ASP A N   1 
ATOM   619  C  CA  . ASP A 1 90  ? 18.010 136.322 -11.473 1.00   31.38 ? 84   ASP A CA  1 
ATOM   620  C  C   . ASP A 1 90  ? 18.936 136.287 -10.244 1.00   30.40 ? 84   ASP A C   1 
ATOM   621  O  O   . ASP A 1 90  ? 19.204 135.224 -9.704  1.00   29.04 ? 84   ASP A O   1 
ATOM   622  C  CB  . ASP A 1 90  ? 16.563 136.476 -11.006 1.00   31.58 ? 84   ASP A CB  1 
ATOM   623  C  CG  . ASP A 1 90  ? 15.540 136.522 -12.154 1.00   33.26 ? 84   ASP A CG  1 
ATOM   624  O  OD1 . ASP A 1 90  ? 15.875 136.953 -13.286 1.00   36.39 ? 84   ASP A OD1 1 
ATOM   625  O  OD2 . ASP A 1 90  ? 14.350 136.139 -11.992 1.00   34.18 ? 84   ASP A OD2 1 
ATOM   626  N  N   . GLU A 1 91  ? 19.400 137.451 -9.807  1.00   29.98 ? 85   GLU A N   1 
ATOM   627  C  CA  . GLU A 1 91  ? 20.322 137.557 -8.694  1.00   30.58 ? 85   GLU A CA  1 
ATOM   628  C  C   . GLU A 1 91  ? 20.279 138.975 -8.104  1.00   30.30 ? 85   GLU A C   1 
ATOM   629  O  O   . GLU A 1 91  ? 20.149 139.955 -8.846  1.00   29.96 ? 85   GLU A O   1 
ATOM   630  C  CB  . GLU A 1 91  ? 21.720 137.168 -9.200  1.00   30.89 ? 85   GLU A CB  1 
ATOM   631  C  CG  . GLU A 1 91  ? 22.837 137.299 -8.225  1.00   34.65 ? 85   GLU A CG  1 
ATOM   632  C  CD  . GLU A 1 91  ? 24.168 136.896 -8.836  1.00   39.38 ? 85   GLU A CD  1 
ATOM   633  O  OE1 . GLU A 1 91  ? 24.194 136.148 -9.845  1.00   42.36 ? 85   GLU A OE1 1 
ATOM   634  O  OE2 . GLU A 1 91  ? 25.207 137.354 -8.324  1.00   44.00 ? 85   GLU A OE2 1 
ATOM   635  N  N   . ILE A 1 92  ? 20.335 139.066 -6.774  1.00   28.90 ? 86   ILE A N   1 
ATOM   636  C  CA  . ILE A 1 92  ? 20.400 140.319 -6.027  1.00   28.86 ? 86   ILE A CA  1 
ATOM   637  C  C   . ILE A 1 92  ? 21.635 140.215 -5.117  1.00   28.74 ? 86   ILE A C   1 
ATOM   638  O  O   . ILE A 1 92  ? 21.650 139.345 -4.231  1.00   27.39 ? 86   ILE A O   1 
ATOM   639  C  CB  . ILE A 1 92  ? 19.120 140.460 -5.144  1.00   28.81 ? 86   ILE A CB  1 
ATOM   640  C  CG1 . ILE A 1 92  ? 17.842 140.403 -5.976  1.00   30.72 ? 86   ILE A CG1 1 
ATOM   641  C  CG2 . ILE A 1 92  ? 19.176 141.723 -4.346  1.00   31.03 ? 86   ILE A CG2 1 
ATOM   642  C  CD1 . ILE A 1 92  ? 16.561 140.250 -5.142  1.00   32.48 ? 86   ILE A CD1 1 
ATOM   643  N  N   . ASP A 1 93  ? 22.632 141.089 -5.295  1.00   27.88 ? 87   ASP A N   1 
ATOM   644  C  CA  . ASP A 1 93  ? 23.960 140.944 -4.673  1.00   28.22 ? 87   ASP A CA  1 
ATOM   645  C  C   . ASP A 1 93  ? 24.397 142.085 -3.759  1.00   27.27 ? 87   ASP A C   1 
ATOM   646  O  O   . ASP A 1 93  ? 24.275 143.262 -4.142  1.00   26.67 ? 87   ASP A O   1 
ATOM   647  C  CB  . ASP A 1 93  ? 25.073 140.949 -5.732  1.00   29.98 ? 87   ASP A CB  1 
ATOM   648  C  CG  . ASP A 1 93  ? 24.991 139.827 -6.698  1.00   35.15 ? 87   ASP A CG  1 
ATOM   649  O  OD1 . ASP A 1 93  ? 24.768 138.668 -6.269  1.00   41.02 ? 87   ASP A OD1 1 
ATOM   650  O  OD2 . ASP A 1 93  ? 25.186 140.014 -7.929  1.00   43.32 ? 87   ASP A OD2 1 
ATOM   651  N  N   . PHE A 1 94  ? 24.952 141.730 -2.594  1.00   25.08 ? 88   PHE A N   1 
ATOM   652  C  CA  . PHE A 1 94  ? 25.860 142.587 -1.822  1.00   25.55 ? 88   PHE A CA  1 
ATOM   653  C  C   . PHE A 1 94  ? 27.252 141.940 -1.948  1.00   25.08 ? 88   PHE A C   1 
ATOM   654  O  O   . PHE A 1 94  ? 27.409 140.722 -1.709  1.00   24.66 ? 88   PHE A O   1 
ATOM   655  C  CB  . PHE A 1 94  ? 25.550 142.572 -0.319  1.00   25.47 ? 88   PHE A CB  1 
ATOM   656  C  CG  . PHE A 1 94  ? 24.292 143.299 0.108   1.00   27.13 ? 88   PHE A CG  1 
ATOM   657  C  CD1 . PHE A 1 94  ? 23.089 142.647 0.188   1.00   27.04 ? 88   PHE A CD1 1 
ATOM   658  C  CD2 . PHE A 1 94  ? 24.358 144.609 0.575   1.00   29.75 ? 88   PHE A CD2 1 
ATOM   659  C  CE1 . PHE A 1 94  ? 21.957 143.302 0.668   1.00   29.48 ? 88   PHE A CE1 1 
ATOM   660  C  CE2 . PHE A 1 94  ? 23.216 145.262 1.046   1.00   30.49 ? 88   PHE A CE2 1 
ATOM   661  C  CZ  . PHE A 1 94  ? 22.031 144.611 1.088   1.00   29.95 ? 88   PHE A CZ  1 
ATOM   662  N  N   . GLU A 1 95  ? 28.250 142.720 -2.296  1.00   24.65 ? 89   GLU A N   1 
ATOM   663  C  CA  . GLU A 1 95  ? 29.641 142.285 -2.283  1.00   25.48 ? 89   GLU A CA  1 
ATOM   664  C  C   . GLU A 1 95  ? 30.464 143.339 -1.542  1.00   25.15 ? 89   GLU A C   1 
ATOM   665  O  O   . GLU A 1 95  ? 30.493 144.496 -1.962  1.00   24.37 ? 89   GLU A O   1 
ATOM   666  C  CB  . GLU A 1 95  ? 30.159 142.105 -3.710  1.00   25.17 ? 89   GLU A CB  1 
ATOM   667  C  CG  . GLU A 1 95  ? 29.503 140.954 -4.450  1.00   30.28 ? 89   GLU A CG  1 
ATOM   668  C  CD  . GLU A 1 95  ? 29.886 140.899 -5.935  1.00   38.62 ? 89   GLU A CD  1 
ATOM   669  O  OE1 . GLU A 1 95  ? 29.295 141.670 -6.728  1.00   43.94 ? 89   GLU A OE1 1 
ATOM   670  O  OE2 . GLU A 1 95  ? 30.774 140.096 -6.301  1.00   42.93 ? 89   GLU A OE2 1 
ATOM   671  N  N   . PHE A 1 96  ? 31.102 142.943 -0.438  1.00   24.60 ? 90   PHE A N   1 
ATOM   672  C  CA  . PHE A 1 96  ? 31.981 143.805 0.346   1.00   24.60 ? 90   PHE A CA  1 
ATOM   673  C  C   . PHE A 1 96  ? 33.440 143.565 -0.087  1.00   25.43 ? 90   PHE A C   1 
ATOM   674  O  O   . PHE A 1 96  ? 33.971 142.428 0.039   1.00   24.85 ? 90   PHE A O   1 
ATOM   675  C  CB  . PHE A 1 96  ? 31.839 143.517 1.855   1.00   25.68 ? 90   PHE A CB  1 
ATOM   676  C  CG  . PHE A 1 96  ? 30.428 143.648 2.404   1.00   26.47 ? 90   PHE A CG  1 
ATOM   677  C  CD1 . PHE A 1 96  ? 29.526 142.604 2.305   1.00   25.61 ? 90   PHE A CD1 1 
ATOM   678  C  CD2 . PHE A 1 96  ? 30.015 144.823 3.043   1.00   27.91 ? 90   PHE A CD2 1 
ATOM   679  C  CE1 . PHE A 1 96  ? 28.231 142.717 2.801   1.00   27.68 ? 90   PHE A CE1 1 
ATOM   680  C  CE2 . PHE A 1 96  ? 28.740 144.936 3.536   1.00   27.89 ? 90   PHE A CE2 1 
ATOM   681  C  CZ  . PHE A 1 96  ? 27.844 143.868 3.435   1.00   27.91 ? 90   PHE A CZ  1 
ATOM   682  N  N   . LEU A 1 97  ? 34.070 144.618 -0.598  1.00   24.53 ? 91   LEU A N   1 
ATOM   683  C  CA  . LEU A 1 97  ? 35.412 144.582 -1.133  1.00   25.38 ? 91   LEU A CA  1 
ATOM   684  C  C   . LEU A 1 97  ? 36.354 145.248 -0.118  1.00   26.08 ? 91   LEU A C   1 
ATOM   685  O  O   . LEU A 1 97  ? 36.183 146.433 0.223   1.00   23.80 ? 91   LEU A O   1 
ATOM   686  C  CB  . LEU A 1 97  ? 35.479 145.330 -2.473  1.00   26.09 ? 91   LEU A CB  1 
ATOM   687  C  CG  . LEU A 1 97  ? 34.292 145.176 -3.438  1.00   27.68 ? 91   LEU A CG  1 
ATOM   688  C  CD1 . LEU A 1 97  ? 34.501 146.045 -4.676  1.00   29.52 ? 91   LEU A CD1 1 
ATOM   689  C  CD2 . LEU A 1 97  ? 34.080 143.745 -3.835  1.00   30.93 ? 91   LEU A CD2 1 
ATOM   690  N  N   . GLY A 1 98  ? 37.311 144.460 0.374   1.00   26.63 ? 92   GLY A N   1 
ATOM   691  C  CA  . GLY A 1 98  ? 38.184 144.832 1.459   1.00   27.88 ? 92   GLY A CA  1 
ATOM   692  C  C   . GLY A 1 98  ? 39.306 145.760 1.003   1.00   29.04 ? 92   GLY A C   1 
ATOM   693  O  O   . GLY A 1 98  ? 39.398 146.146 -0.172  1.00   28.72 ? 92   GLY A O   1 
ATOM   694  N  N   . ASN A 1 99  ? 40.168 146.101 1.946   1.00   29.75 ? 93   ASN A N   1 
ATOM   695  C  CA  . ASN A 1 99  ? 41.215 147.092 1.703   1.00   31.61 ? 93   ASN A CA  1 
ATOM   696  C  C   . ASN A 1 99  ? 42.415 146.918 2.636   1.00   32.55 ? 93   ASN A C   1 
ATOM   697  O  O   . ASN A 1 99  ? 42.336 146.245 3.658   1.00   30.94 ? 93   ASN A O   1 
ATOM   698  C  CB  . ASN A 1 99  ? 40.632 148.511 1.887   1.00   31.33 ? 93   ASN A CB  1 
ATOM   699  C  CG  . ASN A 1 99  ? 41.101 149.492 0.824   1.00   32.19 ? 93   ASN A CG  1 
ATOM   700  O  OD1 . ASN A 1 99  ? 42.182 149.351 0.277   1.00   33.54 ? 93   ASN A OD1 1 
ATOM   701  N  ND2 . ASN A 1 99  ? 40.273 150.498 0.540   1.00   36.24 ? 93   ASN A ND2 1 
ATOM   702  N  N   . ARG A 1 100 ? 43.524 147.548 2.275   1.00   35.13 ? 94   ARG A N   1 
ATOM   703  C  CA  . ARG A 1 100 ? 44.648 147.732 3.204   1.00   37.23 ? 94   ARG A CA  1 
ATOM   704  C  C   . ARG A 1 100 ? 44.173 148.332 4.523   1.00   38.87 ? 94   ARG A C   1 
ATOM   705  O  O   . ARG A 1 100 ? 43.129 148.966 4.569   1.00   38.81 ? 94   ARG A O   1 
ATOM   706  C  CB  . ARG A 1 100 ? 45.691 148.667 2.605   1.00   37.26 ? 94   ARG A CB  1 
ATOM   707  C  CG  . ARG A 1 100 ? 46.430 148.081 1.449   1.00   38.91 ? 94   ARG A CG  1 
ATOM   708  C  CD  . ARG A 1 100 ? 47.366 146.907 1.835   1.00   41.17 ? 94   ARG A CD  1 
ATOM   709  N  NE  . ARG A 1 100 ? 47.780 146.293 0.598   1.00   41.53 ? 94   ARG A NE  1 
ATOM   710  C  CZ  . ARG A 1 100 ? 47.734 145.022 0.298   1.00   39.23 ? 94   ARG A CZ  1 
ATOM   711  N  NH1 . ARG A 1 100 ? 47.399 144.086 1.178   1.00   40.35 ? 94   ARG A NH1 1 
ATOM   712  N  NH2 . ARG A 1 100 ? 48.105 144.685 -0.915  1.00   41.17 ? 94   ARG A NH2 1 
ATOM   713  N  N   . THR A 1 101 ? 44.945 148.116 5.584   1.00   40.36 ? 95   THR A N   1 
ATOM   714  C  CA  . THR A 1 101 ? 44.570 148.549 6.919   1.00   42.40 ? 95   THR A CA  1 
ATOM   715  C  C   . THR A 1 101 ? 44.320 150.048 6.939   1.00   42.64 ? 95   THR A C   1 
ATOM   716  O  O   . THR A 1 101 ? 45.050 150.816 6.318   1.00   43.16 ? 95   THR A O   1 
ATOM   717  C  CB  . THR A 1 101 ? 45.671 148.171 7.928   1.00   43.13 ? 95   THR A CB  1 
ATOM   718  O  OG1 . THR A 1 101 ? 45.684 146.750 8.090   1.00   46.76 ? 95   THR A OG1 1 
ATOM   719  C  CG2 . THR A 1 101 ? 45.348 148.666 9.331   1.00   44.89 ? 95   THR A CG2 1 
ATOM   720  N  N   . GLY A 1 102 ? 43.249 150.443 7.616   1.00   43.19 ? 96   GLY A N   1 
ATOM   721  C  CA  . GLY A 1 102 ? 42.878 151.839 7.741   1.00   43.16 ? 96   GLY A CA  1 
ATOM   722  C  C   . GLY A 1 102 ? 42.310 152.457 6.485   1.00   43.25 ? 96   GLY A C   1 
ATOM   723  O  O   . GLY A 1 102 ? 42.086 153.664 6.456   1.00   44.04 ? 96   GLY A O   1 
ATOM   724  N  N   . GLN A 1 103 ? 42.086 151.662 5.438   1.00   42.05 ? 97   GLN A N   1 
ATOM   725  C  CA  . GLN A 1 103 ? 41.468 152.170 4.220   1.00   40.92 ? 97   GLN A CA  1 
ATOM   726  C  C   . GLN A 1 103 ? 40.060 151.574 4.092   1.00   39.29 ? 97   GLN A C   1 
ATOM   727  O  O   . GLN A 1 103 ? 39.794 150.519 4.648   1.00   39.42 ? 97   GLN A O   1 
ATOM   728  C  CB  . GLN A 1 103 ? 42.348 151.862 3.015   1.00   41.28 ? 97   GLN A CB  1 
ATOM   729  C  CG  . GLN A 1 103 ? 43.727 152.525 3.070   1.00   43.22 ? 97   GLN A CG  1 
ATOM   730  C  CD  . GLN A 1 103 ? 43.634 154.048 3.021   1.00   46.76 ? 97   GLN A CD  1 
ATOM   731  O  OE1 . GLN A 1 103 ? 44.030 154.735 3.974   1.00   48.46 ? 97   GLN A OE1 1 
ATOM   732  N  NE2 . GLN A 1 103 ? 43.147 154.575 1.907   1.00   47.63 ? 97   GLN A NE2 1 
ATOM   733  N  N   . PRO A 1 104 ? 39.137 152.272 3.428   1.00   37.18 ? 98   PRO A N   1 
ATOM   734  C  CA  . PRO A 1 104 ? 37.716 151.941 3.551   1.00   35.46 ? 98   PRO A CA  1 
ATOM   735  C  C   . PRO A 1 104 ? 37.262 150.769 2.665   1.00   33.78 ? 98   PRO A C   1 
ATOM   736  O  O   . PRO A 1 104 ? 37.700 150.622 1.528   1.00   33.39 ? 98   PRO A O   1 
ATOM   737  C  CB  . PRO A 1 104 ? 37.029 153.249 3.108   1.00   35.43 ? 98   PRO A CB  1 
ATOM   738  C  CG  . PRO A 1 104 ? 37.940 153.838 2.121   1.00   36.48 ? 98   PRO A CG  1 
ATOM   739  C  CD  . PRO A 1 104 ? 39.338 153.439 2.545   1.00   37.40 ? 98   PRO A CD  1 
ATOM   740  N  N   . TYR A 1 105 ? 36.364 149.954 3.203   1.00   32.61 ? 99   TYR A N   1 
ATOM   741  C  CA  . TYR A 1 105 ? 35.632 148.960 2.424   1.00   31.47 ? 99   TYR A CA  1 
ATOM   742  C  C   . TYR A 1 105 ? 34.752 149.645 1.372   1.00   30.67 ? 99   TYR A C   1 
ATOM   743  O  O   . TYR A 1 105 ? 34.298 150.769 1.589   1.00   31.23 ? 99   TYR A O   1 
ATOM   744  C  CB  . TYR A 1 105 ? 34.696 148.204 3.355   1.00   31.70 ? 99   TYR A CB  1 
ATOM   745  C  CG  . TYR A 1 105 ? 35.146 146.829 3.749   1.00   31.39 ? 99   TYR A CG  1 
ATOM   746  C  CD1 . TYR A 1 105 ? 34.788 145.713 2.991   1.00   30.90 ? 99   TYR A CD1 1 
ATOM   747  C  CD2 . TYR A 1 105 ? 35.911 146.635 4.890   1.00   31.97 ? 99   TYR A CD2 1 
ATOM   748  C  CE1 . TYR A 1 105 ? 35.202 144.433 3.362   1.00   30.68 ? 99   TYR A CE1 1 
ATOM   749  C  CE2 . TYR A 1 105 ? 36.338 145.372 5.259   1.00   30.22 ? 99   TYR A CE2 1 
ATOM   750  C  CZ  . TYR A 1 105 ? 35.987 144.288 4.495   1.00   31.60 ? 99   TYR A CZ  1 
ATOM   751  O  OH  . TYR A 1 105 ? 36.380 143.043 4.881   1.00   35.38 ? 99   TYR A OH  1 
ATOM   752  N  N   . ILE A 1 106 ? 34.489 148.957 0.271   1.00   28.97 ? 100  ILE A N   1 
ATOM   753  C  CA  . ILE A 1 106 ? 33.388 149.293 -0.619  1.00   28.51 ? 100  ILE A CA  1 
ATOM   754  C  C   . ILE A 1 106 ? 32.287 148.261 -0.503  1.00   28.09 ? 100  ILE A C   1 
ATOM   755  O  O   . ILE A 1 106 ? 32.561 147.047 -0.447  1.00   27.49 ? 100  ILE A O   1 
ATOM   756  C  CB  . ILE A 1 106 ? 33.878 149.363 -2.087  1.00   28.72 ? 100  ILE A CB  1 
ATOM   757  C  CG1 . ILE A 1 106 ? 34.697 150.638 -2.280  1.00   29.36 ? 100  ILE A CG1 1 
ATOM   758  C  CG2 . ILE A 1 106 ? 32.717 149.355 -3.060  1.00   28.88 ? 100  ILE A CG2 1 
ATOM   759  C  CD1 . ILE A 1 106 ? 35.476 150.691 -3.565  1.00   32.00 ? 100  ILE A CD1 1 
ATOM   760  N  N   . LEU A 1 107 ? 31.047 148.732 -0.442  1.00   26.35 ? 101  LEU A N   1 
ATOM   761  C  CA  . LEU A 1 107 ? 29.888 147.867 -0.623  1.00   26.79 ? 101  LEU A CA  1 
ATOM   762  C  C   . LEU A 1 107 ? 29.379 148.011 -2.058  1.00   27.60 ? 101  LEU A C   1 
ATOM   763  O  O   . LEU A 1 107 ? 28.905 149.098 -2.463  1.00   27.76 ? 101  LEU A O   1 
ATOM   764  C  CB  . LEU A 1 107 ? 28.790 148.182 0.376   1.00   26.03 ? 101  LEU A CB  1 
ATOM   765  C  CG  . LEU A 1 107 ? 27.461 147.455 0.183   1.00   27.13 ? 101  LEU A CG  1 
ATOM   766  C  CD1 . LEU A 1 107 ? 27.621 145.958 0.012   1.00   29.86 ? 101  LEU A CD1 1 
ATOM   767  C  CD2 . LEU A 1 107 ? 26.512 147.755 1.352   1.00   26.68 ? 101  LEU A CD2 1 
ATOM   768  N  N   . GLN A 1 108 ? 29.502 146.933 -2.827  1.00   26.49 ? 102  GLN A N   1 
ATOM   769  C  CA  . GLN A 1 108 ? 29.005 146.887 -4.183  1.00   26.80 ? 102  GLN A CA  1 
ATOM   770  C  C   . GLN A 1 108 ? 27.693 146.125 -4.225  1.00   26.84 ? 102  GLN A C   1 
ATOM   771  O  O   . GLN A 1 108 ? 27.588 145.002 -3.670  1.00   27.20 ? 102  GLN A O   1 
ATOM   772  C  CB  . GLN A 1 108 ? 30.029 146.212 -5.097  1.00   26.71 ? 102  GLN A CB  1 
ATOM   773  C  CG  . GLN A 1 108 ? 29.588 146.150 -6.566  1.00   29.03 ? 102  GLN A CG  1 
ATOM   774  C  CD  . GLN A 1 108 ? 30.640 145.545 -7.486  1.00   33.19 ? 102  GLN A CD  1 
ATOM   775  O  OE1 . GLN A 1 108 ? 31.557 146.227 -7.904  1.00   33.98 ? 102  GLN A OE1 1 
ATOM   776  N  NE2 . GLN A 1 108 ? 30.497 144.263 -7.798  1.00   33.90 ? 102  GLN A NE2 1 
ATOM   777  N  N   . THR A 1 109 ? 26.680 146.715 -4.842  1.00   26.59 ? 103  THR A N   1 
ATOM   778  C  CA  . THR A 1 109 ? 25.436 146.006 -5.153  1.00   27.03 ? 103  THR A CA  1 
ATOM   779  C  C   . THR A 1 109 ? 25.262 145.797 -6.645  1.00   27.70 ? 103  THR A C   1 
ATOM   780  O  O   . THR A 1 109 ? 25.885 146.469 -7.488  1.00   27.25 ? 103  THR A O   1 
ATOM   781  C  CB  . THR A 1 109 ? 24.210 146.727 -4.581  1.00   27.57 ? 103  THR A CB  1 
ATOM   782  O  OG1 . THR A 1 109 ? 24.186 148.100 -5.020  1.00   28.33 ? 103  THR A OG1 1 
ATOM   783  C  CG2 . THR A 1 109 ? 24.285 146.790 -3.032  1.00   27.97 ? 103  THR A CG2 1 
ATOM   784  N  N   . ASN A 1 110 ? 24.392 144.853 -6.965  1.00   28.13 ? 104  ASN A N   1 
ATOM   785  C  CA  . ASN A 1 110 ? 24.148 144.428 -8.340  1.00   28.65 ? 104  ASN A CA  1 
ATOM   786  C  C   . ASN A 1 110 ? 22.824 143.676 -8.402  1.00   28.95 ? 104  ASN A C   1 
ATOM   787  O  O   . ASN A 1 110 ? 22.339 143.128 -7.395  1.00   27.03 ? 104  ASN A O   1 
ATOM   788  C  CB  . ASN A 1 110 ? 25.300 143.563 -8.864  1.00   28.72 ? 104  ASN A CB  1 
ATOM   789  C  CG  . ASN A 1 110 ? 25.474 143.653 -10.388 1.00   31.06 ? 104  ASN A CG  1 
ATOM   790  O  OD1 . ASN A 1 110 ? 24.704 144.328 -11.081 1.00   31.14 ? 104  ASN A OD1 1 
ATOM   791  N  ND2 . ASN A 1 110 ? 26.474 142.945 -10.911 1.00   31.41 ? 104  ASN A ND2 1 
ATOM   792  N  N   . VAL A 1 111 ? 22.201 143.711 -9.573  1.00   29.18 ? 105  VAL A N   1 
ATOM   793  C  CA  . VAL A 1 111 ? 20.958 142.998 -9.829  1.00   30.03 ? 105  VAL A CA  1 
ATOM   794  C  C   . VAL A 1 111 ? 21.033 142.365 -11.212 1.00   31.29 ? 105  VAL A C   1 
ATOM   795  O  O   . VAL A 1 111 ? 21.311 143.063 -12.186 1.00   32.05 ? 105  VAL A O   1 
ATOM   796  C  CB  . VAL A 1 111 ? 19.741 143.940 -9.789  1.00   29.90 ? 105  VAL A CB  1 
ATOM   797  C  CG1 . VAL A 1 111 ? 18.477 143.205 -10.229 1.00   30.46 ? 105  VAL A CG1 1 
ATOM   798  C  CG2 . VAL A 1 111 ? 19.562 144.558 -8.412  1.00   31.08 ? 105  VAL A CG2 1 
ATOM   799  N  N   . PHE A 1 112 ? 20.829 141.055 -11.285 1.00   32.13 ? 106  PHE A N   1 
ATOM   800  C  CA  . PHE A 1 112 ? 20.765 140.322 -12.540 1.00   33.38 ? 106  PHE A CA  1 
ATOM   801  C  C   . PHE A 1 112 ? 19.312 139.943 -12.809 1.00   34.09 ? 106  PHE A C   1 
ATOM   802  O  O   . PHE A 1 112 ? 18.586 139.520 -11.900 1.00   32.48 ? 106  PHE A O   1 
ATOM   803  C  CB  . PHE A 1 112 ? 21.560 139.007 -12.496 1.00   34.16 ? 106  PHE A CB  1 
ATOM   804  C  CG  . PHE A 1 112 ? 23.064 139.166 -12.506 1.00   36.21 ? 106  PHE A CG  1 
ATOM   805  C  CD1 . PHE A 1 112 ? 23.735 139.637 -11.385 1.00   36.94 ? 106  PHE A CD1 1 
ATOM   806  C  CD2 . PHE A 1 112 ? 23.807 138.785 -13.614 1.00   38.40 ? 106  PHE A CD2 1 
ATOM   807  C  CE1 . PHE A 1 112 ? 25.112 139.734 -11.378 1.00   38.93 ? 106  PHE A CE1 1 
ATOM   808  C  CE2 . PHE A 1 112 ? 25.187 138.896 -13.617 1.00   39.37 ? 106  PHE A CE2 1 
ATOM   809  C  CZ  . PHE A 1 112 ? 25.841 139.373 -12.496 1.00   39.69 ? 106  PHE A CZ  1 
ATOM   810  N  N   . THR A 1 113 ? 18.898 140.101 -14.068 1.00   35.37 ? 107  THR A N   1 
ATOM   811  C  CA  . THR A 1 113 ? 17.585 139.666 -14.546 1.00   36.70 ? 107  THR A CA  1 
ATOM   812  C  C   . THR A 1 113 ? 17.759 138.969 -15.867 1.00   37.76 ? 107  THR A C   1 
ATOM   813  O  O   . THR A 1 113 ? 18.424 139.498 -16.756 1.00   37.84 ? 107  THR A O   1 
ATOM   814  C  CB  . THR A 1 113 ? 16.660 140.855 -14.761 1.00   37.50 ? 107  THR A CB  1 
ATOM   815  O  OG1 . THR A 1 113 ? 17.300 141.813 -15.610 1.00   38.92 ? 107  THR A OG1 1 
ATOM   816  C  CG2 . THR A 1 113 ? 16.399 141.611 -13.457 1.00   38.71 ? 107  THR A CG2 1 
ATOM   817  N  N   . GLY A 1 114 ? 17.172 137.783 -16.006 1.00   38.90 ? 108  GLY A N   1 
ATOM   818  C  CA  . GLY A 1 114 ? 17.325 136.998 -17.217 1.00   39.48 ? 108  GLY A CA  1 
ATOM   819  C  C   . GLY A 1 114 ? 18.767 136.751 -17.625 1.00   40.16 ? 108  GLY A C   1 
ATOM   820  O  O   . GLY A 1 114 ? 19.067 136.632 -18.808 1.00   40.86 ? 108  GLY A O   1 
ATOM   821  N  N   . GLY A 1 115 ? 19.675 136.674 -16.655 1.00   40.47 ? 109  GLY A N   1 
ATOM   822  C  CA  . GLY A 1 115 ? 21.059 136.328 -16.924 1.00   40.28 ? 109  GLY A CA  1 
ATOM   823  C  C   . GLY A 1 115 ? 21.954 137.518 -17.200 1.00   40.73 ? 109  GLY A C   1 
ATOM   824  O  O   . GLY A 1 115 ? 23.136 137.342 -17.379 1.00   41.53 ? 109  GLY A O   1 
ATOM   825  N  N   . LYS A 1 116 ? 21.395 138.719 -17.227 1.00   41.17 ? 110  LYS A N   1 
ATOM   826  C  CA  . LYS A 1 116 ? 22.134 139.928 -17.502 1.00   42.14 ? 110  LYS A CA  1 
ATOM   827  C  C   . LYS A 1 116 ? 22.206 140.819 -16.243 1.00   41.46 ? 110  LYS A C   1 
ATOM   828  O  O   . LYS A 1 116 ? 21.188 141.244 -15.693 1.00   40.49 ? 110  LYS A O   1 
ATOM   829  C  CB  . LYS A 1 116 ? 21.467 140.693 -18.660 1.00   42.88 ? 110  LYS A CB  1 
ATOM   830  C  CG  . LYS A 1 116 ? 21.866 142.184 -18.791 1.00   46.78 ? 110  LYS A CG  1 
ATOM   831  C  CD  . LYS A 1 116 ? 22.759 142.465 -20.030 1.00   50.98 ? 110  LYS A CD  1 
ATOM   832  C  CE  . LYS A 1 116 ? 23.632 143.729 -19.856 1.00   53.47 ? 110  LYS A CE  1 
ATOM   833  N  NZ  . LYS A 1 116 ? 22.834 145.002 -19.736 1.00   55.80 ? 110  LYS A NZ  1 
ATOM   834  N  N   . GLY A 1 117 ? 23.427 141.086 -15.814 1.00   41.45 ? 111  GLY A N   1 
ATOM   835  C  CA  . GLY A 1 117 ? 23.702 142.016 -14.739 1.00   41.92 ? 111  GLY A CA  1 
ATOM   836  C  C   . GLY A 1 117 ? 24.157 143.376 -15.223 1.00   41.77 ? 111  GLY A C   1 
ATOM   837  O  O   . GLY A 1 117 ? 23.386 144.105 -15.826 1.00   41.87 ? 111  GLY A O   1 
ATOM   838  N  N   . ASP A 1 118 ? 25.403 143.719 -14.898 1.00   41.98 ? 112  ASP A N   1 
ATOM   839  C  CA  . ASP A 1 118 ? 26.030 145.000 -15.249 1.00   41.45 ? 112  ASP A CA  1 
ATOM   840  C  C   . ASP A 1 118 ? 25.282 146.203 -14.735 1.00   40.01 ? 112  ASP A C   1 
ATOM   841  O  O   . ASP A 1 118 ? 25.243 147.263 -15.387 1.00   39.83 ? 112  ASP A O   1 
ATOM   842  C  CB  . ASP A 1 118 ? 26.248 145.109 -16.755 1.00   42.78 ? 112  ASP A CB  1 
ATOM   843  C  CG  . ASP A 1 118 ? 26.980 143.926 -17.298 1.00   44.58 ? 112  ASP A CG  1 
ATOM   844  O  OD1 . ASP A 1 118 ? 28.162 143.776 -16.967 1.00   48.19 ? 112  ASP A OD1 1 
ATOM   845  O  OD2 . ASP A 1 118 ? 26.442 143.064 -18.023 1.00   51.67 ? 112  ASP A OD2 1 
ATOM   846  N  N   . ARG A 1 119 ? 24.695 146.047 -13.549 1.00   37.41 ? 113  ARG A N   1 
ATOM   847  C  CA  . ARG A 1 119 ? 24.058 147.143 -12.856 1.00   35.57 ? 113  ARG A CA  1 
ATOM   848  C  C   . ARG A 1 119 ? 24.767 147.430 -11.516 1.00   34.37 ? 113  ARG A C   1 
ATOM   849  O  O   . ARG A 1 119 ? 24.138 147.617 -10.497 1.00   34.10 ? 113  ARG A O   1 
ATOM   850  C  CB  . ARG A 1 119 ? 22.596 146.817 -12.629 1.00   35.31 ? 113  ARG A CB  1 
ATOM   851  C  CG  . ARG A 1 119 ? 21.764 146.489 -13.878 1.00   36.34 ? 113  ARG A CG  1 
ATOM   852  C  CD  . ARG A 1 119 ? 20.316 146.380 -13.524 1.00   36.93 ? 113  ARG A CD  1 
ATOM   853  N  NE  . ARG A 1 119 ? 19.402 146.046 -14.601 1.00   40.69 ? 113  ARG A NE  1 
ATOM   854  C  CZ  . ARG A 1 119 ? 19.150 144.827 -15.063 1.00   44.62 ? 113  ARG A CZ  1 
ATOM   855  N  NH1 . ARG A 1 119 ? 19.785 143.754 -14.578 1.00   44.19 ? 113  ARG A NH1 1 
ATOM   856  N  NH2 . ARG A 1 119 ? 18.246 144.678 -16.037 1.00   45.21 ? 113  ARG A NH2 1 
ATOM   857  N  N   . GLU A 1 120 ? 26.082 147.474 -11.530 1.00   34.64 ? 114  GLU A N   1 
ATOM   858  C  CA  . GLU A 1 120 ? 26.861 147.764 -10.315 1.00   34.57 ? 114  GLU A CA  1 
ATOM   859  C  C   . GLU A 1 120 ? 26.642 149.162 -9.751  1.00   34.22 ? 114  GLU A C   1 
ATOM   860  O  O   . GLU A 1 120 ? 26.598 150.138 -10.505 1.00   34.63 ? 114  GLU A O   1 
ATOM   861  C  CB  . GLU A 1 120 ? 28.348 147.599 -10.577 1.00   34.43 ? 114  GLU A CB  1 
ATOM   862  C  CG  . GLU A 1 120 ? 28.754 146.186 -10.949 1.00   37.14 ? 114  GLU A CG  1 
ATOM   863  C  CD  . GLU A 1 120 ? 28.734 145.917 -12.450 1.00   40.11 ? 114  GLU A CD  1 
ATOM   864  O  OE1 . GLU A 1 120 ? 28.217 146.756 -13.217 1.00   41.11 ? 114  GLU A OE1 1 
ATOM   865  O  OE2 . GLU A 1 120 ? 29.206 144.851 -12.849 1.00   42.77 ? 114  GLU A OE2 1 
ATOM   866  N  N   . GLN A 1 121 ? 26.476 149.249 -8.464  1.00   33.20 ? 115  GLN A N   1 
ATOM   867  C  CA  . GLN A 1 121 ? 26.662 150.489 -7.719  1.00   33.40 ? 115  GLN A CA  1 
ATOM   868  C  C   . GLN A 1 121 ? 27.644 150.218 -6.589  1.00   33.31 ? 115  GLN A C   1 
ATOM   869  O  O   . GLN A 1 121 ? 27.630 149.122 -6.014  1.00   32.72 ? 115  GLN A O   1 
ATOM   870  C  CB  . GLN A 1 121 ? 25.355 150.975 -7.135  1.00   32.88 ? 115  GLN A CB  1 
ATOM   871  C  CG  . GLN A 1 121 ? 24.285 151.275 -8.196  1.00   37.45 ? 115  GLN A CG  1 
ATOM   872  C  CD  . GLN A 1 121 ? 23.010 151.820 -7.604  1.00   40.47 ? 115  GLN A CD  1 
ATOM   873  O  OE1 . GLN A 1 121 ? 22.816 151.807 -6.386  1.00   42.92 ? 115  GLN A OE1 1 
ATOM   874  N  NE2 . GLN A 1 121 ? 22.125 152.287 -8.461  1.00   45.20 ? 115  GLN A NE2 1 
ATOM   875  N  N   . ARG A 1 122 ? 28.503 151.204 -6.244  1.00   32.46 ? 116  ARG A N   1 
ATOM   876  C  CA  . ARG A 1 122 ? 29.494 151.074 -5.163  1.00   32.12 ? 116  ARG A CA  1 
ATOM   877  C  C   . ARG A 1 122 ? 29.387 152.260 -4.223  1.00   32.01 ? 116  ARG A C   1 
ATOM   878  O  O   . ARG A 1 122 ? 29.331 153.417 -4.673  1.00   31.03 ? 116  ARG A O   1 
ATOM   879  C  CB  . ARG A 1 122 ? 30.911 151.019 -5.717  1.00   32.30 ? 116  ARG A CB  1 
ATOM   880  C  CG  . ARG A 1 122 ? 31.223 149.829 -6.543  1.00   32.97 ? 116  ARG A CG  1 
ATOM   881  C  CD  . ARG A 1 122 ? 32.612 149.857 -7.134  1.00   34.66 ? 116  ARG A CD  1 
ATOM   882  N  NE  . ARG A 1 122 ? 32.927 148.560 -7.723  1.00   39.94 ? 116  ARG A NE  1 
ATOM   883  C  CZ  . ARG A 1 122 ? 34.157 148.148 -8.054  1.00   43.51 ? 116  ARG A CZ  1 
ATOM   884  N  NH1 . ARG A 1 122 ? 35.210 148.946 -7.888  1.00   44.93 ? 116  ARG A NH1 1 
ATOM   885  N  NH2 . ARG A 1 122 ? 34.337 146.938 -8.571  1.00   42.64 ? 116  ARG A NH2 1 
ATOM   886  N  N   . ILE A 1 123 ? 29.313 151.967 -2.928  1.00   31.13 ? 117  ILE A N   1 
ATOM   887  C  CA  . ILE A 1 123 ? 29.276 152.979 -1.877  1.00   30.69 ? 117  ILE A CA  1 
ATOM   888  C  C   . ILE A 1 123 ? 30.317 152.709 -0.790  1.00   31.14 ? 117  ILE A C   1 
ATOM   889  O  O   . ILE A 1 123 ? 30.772 151.559 -0.613  1.00   29.03 ? 117  ILE A O   1 
ATOM   890  C  CB  . ILE A 1 123 ? 27.882 153.079 -1.205  1.00   30.05 ? 117  ILE A CB  1 
ATOM   891  C  CG1 . ILE A 1 123 ? 27.491 151.795 -0.468  1.00   29.53 ? 117  ILE A CG1 1 
ATOM   892  C  CG2 . ILE A 1 123 ? 26.807 153.443 -2.209  1.00   31.44 ? 117  ILE A CG2 1 
ATOM   893  C  CD1 . ILE A 1 123 ? 26.469 151.990 0.550   1.00   29.22 ? 117  ILE A CD1 1 
ATOM   894  N  N   . TYR A 1 124 ? 30.686 153.784 -0.084  1.00   31.05 ? 118  TYR A N   1 
ATOM   895  C  CA  . TYR A 1 124 ? 31.346 153.717 1.203   1.00   31.59 ? 118  TYR A CA  1 
ATOM   896  C  C   . TYR A 1 124 ? 30.271 153.706 2.266   1.00   31.31 ? 118  TYR A C   1 
ATOM   897  O  O   . TYR A 1 124 ? 29.148 154.159 2.046   1.00   31.87 ? 118  TYR A O   1 
ATOM   898  C  CB  . TYR A 1 124 ? 32.273 154.942 1.434   1.00   32.13 ? 118  TYR A CB  1 
ATOM   899  C  CG  . TYR A 1 124 ? 33.558 154.989 0.637   1.00   34.61 ? 118  TYR A CG  1 
ATOM   900  C  CD1 . TYR A 1 124 ? 34.150 153.835 0.138   1.00   36.68 ? 118  TYR A CD1 1 
ATOM   901  C  CD2 . TYR A 1 124 ? 34.208 156.206 0.403   1.00   38.96 ? 118  TYR A CD2 1 
ATOM   902  C  CE1 . TYR A 1 124 ? 35.329 153.876 -0.580  1.00   37.66 ? 118  TYR A CE1 1 
ATOM   903  C  CE2 . TYR A 1 124 ? 35.418 156.259 -0.314  1.00   39.29 ? 118  TYR A CE2 1 
ATOM   904  C  CZ  . TYR A 1 124 ? 35.976 155.091 -0.788  1.00   39.85 ? 118  TYR A CZ  1 
ATOM   905  O  OH  . TYR A 1 124 ? 37.145 155.099 -1.522  1.00   40.29 ? 118  TYR A OH  1 
ATOM   906  N  N   . LEU A 1 125 ? 30.618 153.223 3.447   1.00   31.40 ? 119  LEU A N   1 
ATOM   907  C  CA  . LEU A 1 125 ? 29.668 153.169 4.540   1.00   31.84 ? 119  LEU A CA  1 
ATOM   908  C  C   . LEU A 1 125 ? 29.933 154.299 5.528   1.00   31.55 ? 119  LEU A C   1 
ATOM   909  O  O   . LEU A 1 125 ? 30.995 154.898 5.511   1.00   32.36 ? 119  LEU A O   1 
ATOM   910  C  CB  . LEU A 1 125 ? 29.724 151.810 5.224   1.00   31.55 ? 119  LEU A CB  1 
ATOM   911  C  CG  . LEU A 1 125 ? 29.391 150.644 4.268   1.00   31.80 ? 119  LEU A CG  1 
ATOM   912  C  CD1 . LEU A 1 125 ? 29.771 149.324 4.871   1.00   30.13 ? 119  LEU A CD1 1 
ATOM   913  C  CD2 . LEU A 1 125 ? 27.886 150.657 3.879   1.00   32.76 ? 119  LEU A CD2 1 
ATOM   914  N  N   . TRP A 1 126 ? 28.959 154.556 6.383   1.00   31.48 ? 120  TRP A N   1 
ATOM   915  C  CA  . TRP A 1 126 ? 28.979 155.672 7.354   1.00   31.77 ? 120  TRP A CA  1 
ATOM   916  C  C   . TRP A 1 126 ? 29.318 155.167 8.762   1.00   32.63 ? 120  TRP A C   1 
ATOM   917  O  O   . TRP A 1 126 ? 28.885 155.738 9.785   1.00   33.49 ? 120  TRP A O   1 
ATOM   918  C  CB  . TRP A 1 126 ? 27.618 156.401 7.352   1.00   31.73 ? 120  TRP A CB  1 
ATOM   919  C  CG  . TRP A 1 126 ? 26.457 155.519 7.395   1.00   29.48 ? 120  TRP A CG  1 
ATOM   920  C  CD1 . TRP A 1 126 ? 25.799 155.102 8.502   1.00   30.84 ? 120  TRP A CD1 1 
ATOM   921  C  CD2 . TRP A 1 126 ? 25.824 154.884 6.278   1.00   27.11 ? 120  TRP A CD2 1 
ATOM   922  N  NE1 . TRP A 1 126 ? 24.790 154.243 8.148   1.00   30.43 ? 120  TRP A NE1 1 
ATOM   923  C  CE2 . TRP A 1 126 ? 24.784 154.100 6.782   1.00   29.30 ? 120  TRP A CE2 1 
ATOM   924  C  CE3 . TRP A 1 126 ? 26.037 154.907 4.891   1.00   29.27 ? 120  TRP A CE3 1 
ATOM   925  C  CZ2 . TRP A 1 126 ? 23.937 153.348 5.955   1.00   30.41 ? 120  TRP A CZ2 1 
ATOM   926  C  CZ3 . TRP A 1 126 ? 25.202 154.163 4.069   1.00   30.26 ? 120  TRP A CZ3 1 
ATOM   927  C  CH2 . TRP A 1 126 ? 24.167 153.399 4.602   1.00   29.82 ? 120  TRP A CH2 1 
ATOM   928  N  N   . PHE A 1 127 ? 30.122 154.107 8.787   1.00   31.92 ? 121  PHE A N   1 
ATOM   929  C  CA  . PHE A 1 127 ? 30.570 153.426 9.991   1.00   31.96 ? 121  PHE A CA  1 
ATOM   930  C  C   . PHE A 1 127 ? 31.693 152.459 9.561   1.00   30.94 ? 121  PHE A C   1 
ATOM   931  O  O   . PHE A 1 127 ? 31.908 152.205 8.372   1.00   29.99 ? 121  PHE A O   1 
ATOM   932  C  CB  . PHE A 1 127 ? 29.424 152.652 10.678  1.00   32.42 ? 121  PHE A CB  1 
ATOM   933  C  CG  . PHE A 1 127 ? 28.705 151.659 9.744   1.00   34.36 ? 121  PHE A CG  1 
ATOM   934  C  CD1 . PHE A 1 127 ? 29.194 150.350 9.550   1.00   34.46 ? 121  PHE A CD1 1 
ATOM   935  C  CD2 . PHE A 1 127 ? 27.564 152.039 9.055   1.00   34.81 ? 121  PHE A CD2 1 
ATOM   936  C  CE1 . PHE A 1 127 ? 28.532 149.449 8.683   1.00   33.15 ? 121  PHE A CE1 1 
ATOM   937  C  CE2 . PHE A 1 127 ? 26.905 151.145 8.188   1.00   36.01 ? 121  PHE A CE2 1 
ATOM   938  C  CZ  . PHE A 1 127 ? 27.403 149.849 7.997   1.00   34.02 ? 121  PHE A CZ  1 
ATOM   939  N  N   . ASP A 1 128 ? 32.438 151.977 10.534  1.00   30.22 ? 122  ASP A N   1 
ATOM   940  C  CA  . ASP A 1 128 ? 33.466 150.987 10.297  1.00   30.92 ? 122  ASP A CA  1 
ATOM   941  C  C   . ASP A 1 128 ? 32.765 149.628 10.283  1.00   29.53 ? 122  ASP A C   1 
ATOM   942  O  O   . ASP A 1 128 ? 32.324 149.161 11.331  1.00   29.07 ? 122  ASP A O   1 
ATOM   943  C  CB  . ASP A 1 128 ? 34.496 151.044 11.417  1.00   31.22 ? 122  ASP A CB  1 
ATOM   944  C  CG  . ASP A 1 128 ? 35.649 150.077 11.209  1.00   34.97 ? 122  ASP A CG  1 
ATOM   945  O  OD1 . ASP A 1 128 ? 35.608 149.178 10.292  1.00   35.68 ? 122  ASP A OD1 1 
ATOM   946  O  OD2 . ASP A 1 128 ? 36.656 150.166 11.943  1.00   38.28 ? 122  ASP A OD2 1 
ATOM   947  N  N   . PRO A 1 129 ? 32.631 149.000 9.120   1.00   28.86 ? 123  PRO A N   1 
ATOM   948  C  CA  . PRO A 1 129 ? 31.905 147.718 9.043   1.00   29.39 ? 123  PRO A CA  1 
ATOM   949  C  C   . PRO A 1 129 ? 32.634 146.522 9.708   1.00   29.99 ? 123  PRO A C   1 
ATOM   950  O  O   . PRO A 1 129 ? 32.025 145.471 9.859   1.00   29.45 ? 123  PRO A O   1 
ATOM   951  C  CB  . PRO A 1 129 ? 31.763 147.492 7.529   1.00   29.13 ? 123  PRO A CB  1 
ATOM   952  C  CG  . PRO A 1 129 ? 32.900 148.107 6.966   1.00   29.46 ? 123  PRO A CG  1 
ATOM   953  C  CD  . PRO A 1 129 ? 33.145 149.392 7.801   1.00   29.31 ? 123  PRO A CD  1 
ATOM   954  N  N   . THR A 1 130 ? 33.902 146.696 10.082  1.00   31.55 ? 124  THR A N   1 
ATOM   955  C  CA  . THR A 1 130 ? 34.672 145.688 10.809  1.00   32.87 ? 124  THR A CA  1 
ATOM   956  C  C   . THR A 1 130 ? 34.593 145.745 12.339  1.00   34.79 ? 124  THR A C   1 
ATOM   957  O  O   . THR A 1 130 ? 35.051 144.810 13.007  1.00   35.29 ? 124  THR A O   1 
ATOM   958  C  CB  . THR A 1 130 ? 36.157 145.763 10.443  1.00   32.78 ? 124  THR A CB  1 
ATOM   959  O  OG1 . THR A 1 130 ? 36.781 146.931 11.042  1.00   31.97 ? 124  THR A OG1 1 
ATOM   960  C  CG2 . THR A 1 130 ? 36.334 145.896 8.939   1.00   31.68 ? 124  THR A CG2 1 
ATOM   961  N  N   . LYS A 1 131 ? 34.039 146.816 12.888  1.00   35.97 ? 125  LYS A N   1 
ATOM   962  C  CA  . LYS A 1 131 ? 34.071 147.054 14.328  1.00   37.37 ? 125  LYS A CA  1 
ATOM   963  C  C   . LYS A 1 131 ? 32.856 146.476 15.033  1.00   37.60 ? 125  LYS A C   1 
ATOM   964  O  O   . LYS A 1 131 ? 32.972 145.997 16.156  1.00   37.51 ? 125  LYS A O   1 
ATOM   965  C  CB  . LYS A 1 131 ? 34.172 148.561 14.597  1.00   38.57 ? 125  LYS A CB  1 
ATOM   966  C  CG  . LYS A 1 131 ? 34.565 148.941 16.042  1.00   42.42 ? 125  LYS A CG  1 
ATOM   967  C  CD  . LYS A 1 131 ? 34.433 150.471 16.266  1.00   47.16 ? 125  LYS A CD  1 
ATOM   968  C  CE  . LYS A 1 131 ? 33.642 150.844 17.548  1.00   49.04 ? 125  LYS A CE  1 
ATOM   969  N  NZ  . LYS A 1 131 ? 32.305 151.457 17.244  1.00   50.99 ? 125  LYS A NZ  1 
ATOM   970  N  N   . GLU A 1 132 ? 31.689 146.531 14.385  1.00   36.86 ? 126  GLU A N   1 
ATOM   971  C  CA  . GLU A 1 132 ? 30.453 146.006 14.959  1.00   37.44 ? 126  GLU A CA  1 
ATOM   972  C  C   . GLU A 1 132 ? 29.630 145.250 13.923  1.00   34.78 ? 126  GLU A C   1 
ATOM   973  O  O   . GLU A 1 132 ? 29.816 145.426 12.742  1.00   32.93 ? 126  GLU A O   1 
ATOM   974  C  CB  . GLU A 1 132 ? 29.559 147.156 15.471  1.00   38.31 ? 126  GLU A CB  1 
ATOM   975  C  CG  . GLU A 1 132 ? 30.217 148.086 16.470  1.00   44.09 ? 126  GLU A CG  1 
ATOM   976  C  CD  . GLU A 1 132 ? 30.459 147.437 17.827  1.00   49.49 ? 126  GLU A CD  1 
ATOM   977  O  OE1 . GLU A 1 132 ? 29.650 146.567 18.246  1.00   53.02 ? 126  GLU A OE1 1 
ATOM   978  O  OE2 . GLU A 1 132 ? 31.459 147.822 18.489  1.00   55.89 ? 126  GLU A OE2 1 
ATOM   979  N  N   . PHE A 1 133 ? 28.680 144.470 14.408  1.00   33.79 ? 127  PHE A N   1 
ATOM   980  C  CA  . PHE A 1 133 ? 27.663 143.862 13.563  1.00   33.80 ? 127  PHE A CA  1 
ATOM   981  C  C   . PHE A 1 133 ? 26.669 144.924 13.057  1.00   33.49 ? 127  PHE A C   1 
ATOM   982  O  O   . PHE A 1 133 ? 26.249 145.804 13.806  1.00   33.57 ? 127  PHE A O   1 
ATOM   983  C  CB  . PHE A 1 133 ? 26.954 142.745 14.309  1.00   33.36 ? 127  PHE A CB  1 
ATOM   984  C  CG  . PHE A 1 133 ? 27.793 141.505 14.474  1.00   33.89 ? 127  PHE A CG  1 
ATOM   985  C  CD1 . PHE A 1 133 ? 27.779 140.500 13.497  1.00   31.79 ? 127  PHE A CD1 1 
ATOM   986  C  CD2 . PHE A 1 133 ? 28.599 141.338 15.605  1.00   33.25 ? 127  PHE A CD2 1 
ATOM   987  C  CE1 . PHE A 1 133 ? 28.550 139.349 13.639  1.00   30.76 ? 127  PHE A CE1 1 
ATOM   988  C  CE2 . PHE A 1 133 ? 29.373 140.174 15.769  1.00   32.77 ? 127  PHE A CE2 1 
ATOM   989  C  CZ  . PHE A 1 133 ? 29.363 139.186 14.771  1.00   32.46 ? 127  PHE A CZ  1 
ATOM   990  N  N   . HIS A 1 134 ? 26.352 144.884 11.768  1.00   32.68 ? 128  HIS A N   1 
ATOM   991  C  CA  . HIS A 1 134 ? 25.299 145.735 11.190  1.00   32.17 ? 128  HIS A CA  1 
ATOM   992  C  C   . HIS A 1 134 ? 24.382 144.842 10.393  1.00   31.24 ? 128  HIS A C   1 
ATOM   993  O  O   . HIS A 1 134 ? 24.803 143.779 9.949   1.00   29.31 ? 128  HIS A O   1 
ATOM   994  C  CB  . HIS A 1 134 ? 25.891 146.828 10.293  1.00   31.93 ? 128  HIS A CB  1 
ATOM   995  C  CG  . HIS A 1 134 ? 26.622 147.894 11.051  1.00   37.08 ? 128  HIS A CG  1 
ATOM   996  N  ND1 . HIS A 1 134 ? 26.003 148.724 11.960  1.00   41.47 ? 128  HIS A ND1 1 
ATOM   997  C  CD2 . HIS A 1 134 ? 27.922 148.265 11.042  1.00   42.50 ? 128  HIS A CD2 1 
ATOM   998  C  CE1 . HIS A 1 134 ? 26.889 149.545 12.492  1.00   40.16 ? 128  HIS A CE1 1 
ATOM   999  N  NE2 . HIS A 1 134 ? 28.062 149.296 11.946  1.00   43.35 ? 128  HIS A NE2 1 
ATOM   1000 N  N   . TYR A 1 135 ? 23.139 145.273 10.198  1.00   30.60 ? 129  TYR A N   1 
ATOM   1001 C  CA  . TYR A 1 135 ? 22.189 144.543 9.374   1.00   30.93 ? 129  TYR A CA  1 
ATOM   1002 C  C   . TYR A 1 135 ? 22.357 144.873 7.910   1.00   29.22 ? 129  TYR A C   1 
ATOM   1003 O  O   . TYR A 1 135 ? 22.530 146.011 7.527   1.00   30.53 ? 129  TYR A O   1 
ATOM   1004 C  CB  . TYR A 1 135 ? 20.759 144.826 9.781   1.00   31.55 ? 129  TYR A CB  1 
ATOM   1005 C  CG  . TYR A 1 135 ? 20.409 144.281 11.116  1.00   36.78 ? 129  TYR A CG  1 
ATOM   1006 C  CD1 . TYR A 1 135 ? 20.618 145.042 12.266  1.00   42.20 ? 129  TYR A CD1 1 
ATOM   1007 C  CD2 . TYR A 1 135 ? 19.878 143.013 11.252  1.00   41.32 ? 129  TYR A CD2 1 
ATOM   1008 C  CE1 . TYR A 1 135 ? 20.302 144.552 13.516  1.00   44.50 ? 129  TYR A CE1 1 
ATOM   1009 C  CE2 . TYR A 1 135 ? 19.548 142.508 12.517  1.00   45.07 ? 129  TYR A CE2 1 
ATOM   1010 C  CZ  . TYR A 1 135 ? 19.768 143.289 13.638  1.00   46.69 ? 129  TYR A CZ  1 
ATOM   1011 O  OH  . TYR A 1 135 ? 19.457 142.801 14.904  1.00   52.78 ? 129  TYR A OH  1 
ATOM   1012 N  N   . TYR A 1 136 ? 22.331 143.851 7.086   1.00   27.43 ? 130  TYR A N   1 
ATOM   1013 C  CA  . TYR A 1 136 ? 22.265 144.022 5.649   1.00   26.85 ? 130  TYR A CA  1 
ATOM   1014 C  C   . TYR A 1 136 ? 21.042 143.232 5.197   1.00   27.63 ? 130  TYR A C   1 
ATOM   1015 O  O   . TYR A 1 136 ? 20.899 142.043 5.527   1.00   26.91 ? 130  TYR A O   1 
ATOM   1016 C  CB  . TYR A 1 136 ? 23.563 143.555 4.997   1.00   26.40 ? 130  TYR A CB  1 
ATOM   1017 C  CG  . TYR A 1 136 ? 24.742 144.313 5.514   1.00   22.40 ? 130  TYR A CG  1 
ATOM   1018 C  CD1 . TYR A 1 136 ? 25.084 145.529 4.973   1.00   22.47 ? 130  TYR A CD1 1 
ATOM   1019 C  CD2 . TYR A 1 136 ? 25.505 143.821 6.580   1.00   24.48 ? 130  TYR A CD2 1 
ATOM   1020 C  CE1 . TYR A 1 136 ? 26.172 146.257 5.437   1.00   23.72 ? 130  TYR A CE1 1 
ATOM   1021 C  CE2 . TYR A 1 136 ? 26.593 144.539 7.077   1.00   22.74 ? 130  TYR A CE2 1 
ATOM   1022 C  CZ  . TYR A 1 136 ? 26.920 145.768 6.506   1.00   24.46 ? 130  TYR A CZ  1 
ATOM   1023 O  OH  . TYR A 1 136 ? 27.986 146.524 6.974   1.00   22.11 ? 130  TYR A OH  1 
ATOM   1024 N  N   . SER A 1 137 ? 20.138 143.903 4.481   1.00   27.01 ? 131  SER A N   1 
ATOM   1025 C  CA  . SER A 1 137 ? 18.841 143.328 4.155   1.00   27.69 ? 131  SER A CA  1 
ATOM   1026 C  C   . SER A 1 137 ? 18.413 143.600 2.757   1.00   26.87 ? 131  SER A C   1 
ATOM   1027 O  O   . SER A 1 137 ? 18.783 144.606 2.159   1.00   25.11 ? 131  SER A O   1 
ATOM   1028 C  CB  . SER A 1 137 ? 17.729 143.913 5.042   1.00   28.23 ? 131  SER A CB  1 
ATOM   1029 O  OG  . SER A 1 137 ? 18.077 143.787 6.381   1.00   33.54 ? 131  SER A OG  1 
ATOM   1030 N  N   . VAL A 1 138 ? 17.577 142.691 2.281   1.00   27.73 ? 132  VAL A N   1 
ATOM   1031 C  CA  . VAL A 1 138 ? 16.852 142.838 1.019   1.00   29.02 ? 132  VAL A CA  1 
ATOM   1032 C  C   . VAL A 1 138 ? 15.365 142.637 1.334   1.00   29.16 ? 132  VAL A C   1 
ATOM   1033 O  O   . VAL A 1 138 ? 14.991 141.665 1.998   1.00   27.41 ? 132  VAL A O   1 
ATOM   1034 C  CB  . VAL A 1 138 ? 17.276 141.770 -0.007  1.00   29.60 ? 132  VAL A CB  1 
ATOM   1035 C  CG1 . VAL A 1 138 ? 16.423 141.841 -1.321  1.00   30.92 ? 132  VAL A CG1 1 
ATOM   1036 C  CG2 . VAL A 1 138 ? 18.738 141.875 -0.288  1.00   29.18 ? 132  VAL A CG2 1 
ATOM   1037 N  N   . LEU A 1 139 ? 14.549 143.596 0.879   1.00   29.79 ? 133  LEU A N   1 
ATOM   1038 C  CA  . LEU A 1 139 ? 13.101 143.427 0.746   1.00   30.39 ? 133  LEU A CA  1 
ATOM   1039 C  C   . LEU A 1 139 ? 12.796 143.242 -0.739  1.00   30.40 ? 133  LEU A C   1 
ATOM   1040 O  O   . LEU A 1 139 ? 13.118 144.092 -1.554  1.00   30.66 ? 133  LEU A O   1 
ATOM   1041 C  CB  . LEU A 1 139 ? 12.365 144.670 1.228   1.00   31.50 ? 133  LEU A CB  1 
ATOM   1042 C  CG  . LEU A 1 139 ? 10.824 144.532 1.239   1.00   34.44 ? 133  LEU A CG  1 
ATOM   1043 C  CD1 . LEU A 1 139 ? 10.393 143.451 2.208   1.00   34.41 ? 133  LEU A CD1 1 
ATOM   1044 C  CD2 . LEU A 1 139 ? 10.206 145.879 1.607   1.00   38.82 ? 133  LEU A CD2 1 
ATOM   1045 N  N   . TRP A 1 140 ? 12.168 142.135 -1.073  1.00   30.67 ? 134  TRP A N   1 
ATOM   1046 C  CA  . TRP A 1 140 ? 11.919 141.747 -2.446  1.00   31.17 ? 134  TRP A CA  1 
ATOM   1047 C  C   . TRP A 1 140 ? 10.431 141.395 -2.548  1.00   32.10 ? 134  TRP A C   1 
ATOM   1048 O  O   . TRP A 1 140 ? 9.988  140.399 -1.992  1.00   31.65 ? 134  TRP A O   1 
ATOM   1049 C  CB  . TRP A 1 140 ? 12.763 140.520 -2.770  1.00   31.32 ? 134  TRP A CB  1 
ATOM   1050 C  CG  . TRP A 1 140 ? 12.483 139.870 -4.111  1.00   31.80 ? 134  TRP A CG  1 
ATOM   1051 C  CD1 . TRP A 1 140 ? 12.024 140.478 -5.246  1.00   30.31 ? 134  TRP A CD1 1 
ATOM   1052 C  CD2 . TRP A 1 140 ? 12.666 138.488 -4.444  1.00   30.70 ? 134  TRP A CD2 1 
ATOM   1053 N  NE1 . TRP A 1 140 ? 11.900 139.557 -6.253  1.00   30.29 ? 134  TRP A NE1 1 
ATOM   1054 C  CE2 . TRP A 1 140 ? 12.281 138.327 -5.794  1.00   30.05 ? 134  TRP A CE2 1 
ATOM   1055 C  CE3 . TRP A 1 140 ? 13.127 137.369 -3.740  1.00   28.30 ? 134  TRP A CE3 1 
ATOM   1056 C  CZ2 . TRP A 1 140 ? 12.347 137.099 -6.453  1.00   29.12 ? 134  TRP A CZ2 1 
ATOM   1057 C  CZ3 . TRP A 1 140 ? 13.165 136.159 -4.381  1.00   28.75 ? 134  TRP A CZ3 1 
ATOM   1058 C  CH2 . TRP A 1 140 ? 12.767 136.027 -5.733  1.00   29.60 ? 134  TRP A CH2 1 
ATOM   1059 N  N   . ASN A 1 141 ? 9.664  142.241 -3.229  1.00   33.10 ? 135  ASN A N   1 
ATOM   1060 C  CA  . ASN A 1 141 ? 8.274  141.916 -3.528  1.00   33.81 ? 135  ASN A CA  1 
ATOM   1061 C  C   . ASN A 1 141 ? 7.949  142.154 -5.004  1.00   34.44 ? 135  ASN A C   1 
ATOM   1062 O  O   . ASN A 1 141 ? 8.818  142.505 -5.806  1.00   34.19 ? 135  ASN A O   1 
ATOM   1063 C  CB  . ASN A 1 141 ? 7.294  142.634 -2.547  1.00   33.45 ? 135  ASN A CB  1 
ATOM   1064 C  CG  . ASN A 1 141 ? 7.296  144.149 -2.674  1.00   33.03 ? 135  ASN A CG  1 
ATOM   1065 O  OD1 . ASN A 1 141 ? 7.739  144.723 -3.664  1.00   33.42 ? 135  ASN A OD1 1 
ATOM   1066 N  ND2 . ASN A 1 141 ? 6.800  144.811 -1.636  1.00   33.90 ? 135  ASN A ND2 1 
ATOM   1067 N  N   . MET A 1 142 ? 6.676  141.994 -5.357  1.00   36.20 ? 136  MET A N   1 
ATOM   1068 C  CA  . MET A 1 142 ? 6.239  142.161 -6.748  1.00   36.90 ? 136  MET A CA  1 
ATOM   1069 C  C   . MET A 1 142 ? 6.419  143.588 -7.260  1.00   36.06 ? 136  MET A C   1 
ATOM   1070 O  O   . MET A 1 142 ? 6.465  143.807 -8.460  1.00   36.05 ? 136  MET A O   1 
ATOM   1071 C  CB  . MET A 1 142 ? 4.783  141.703 -6.894  1.00   38.07 ? 136  MET A CB  1 
ATOM   1072 C  CG  . MET A 1 142 ? 3.743  142.542 -6.097  1.00   40.54 ? 136  MET A CG  1 
ATOM   1073 S  SD  . MET A 1 142 ? 2.128  141.712 -6.196  1.00   45.19 ? 136  MET A SD  1 
ATOM   1074 C  CE  . MET A 1 142 ? 1.414  142.101 -4.652  1.00   43.97 ? 136  MET A CE  1 
ATOM   1075 N  N   . TYR A 1 143 ? 6.567  144.549 -6.356  1.00   35.59 ? 137  TYR A N   1 
ATOM   1076 C  CA  . TYR A 1 143 ? 6.703  145.960 -6.727  1.00   35.60 ? 137  TYR A CA  1 
ATOM   1077 C  C   . TYR A 1 143 ? 8.117  146.458 -6.874  1.00   34.79 ? 137  TYR A C   1 
ATOM   1078 O  O   . TYR A 1 143 ? 8.367  147.337 -7.671  1.00   33.75 ? 137  TYR A O   1 
ATOM   1079 C  CB  . TYR A 1 143 ? 6.041  146.832 -5.656  1.00   36.54 ? 137  TYR A CB  1 
ATOM   1080 C  CG  . TYR A 1 143 ? 4.587  146.510 -5.467  1.00   40.50 ? 137  TYR A CG  1 
ATOM   1081 C  CD1 . TYR A 1 143 ? 3.663  146.805 -6.478  1.00   44.86 ? 137  TYR A CD1 1 
ATOM   1082 C  CD2 . TYR A 1 143 ? 4.130  145.893 -4.312  1.00   42.89 ? 137  TYR A CD2 1 
ATOM   1083 C  CE1 . TYR A 1 143 ? 2.313  146.507 -6.330  1.00   46.31 ? 137  TYR A CE1 1 
ATOM   1084 C  CE2 . TYR A 1 143 ? 2.773  145.586 -4.158  1.00   45.68 ? 137  TYR A CE2 1 
ATOM   1085 C  CZ  . TYR A 1 143 ? 1.878  145.902 -5.179  1.00   46.77 ? 137  TYR A CZ  1 
ATOM   1086 O  OH  . TYR A 1 143 ? 0.535  145.613 -5.056  1.00   51.92 ? 137  TYR A OH  1 
ATOM   1087 N  N   . MET A 1 144 ? 9.019  145.958 -6.025  1.00   34.22 ? 138  MET A N   1 
ATOM   1088 C  CA  . MET A 1 144 ? 10.390 146.465 -5.940  1.00   33.38 ? 138  MET A CA  1 
ATOM   1089 C  C   . MET A 1 144 ? 11.345 145.576 -5.135  1.00   32.16 ? 138  MET A C   1 
ATOM   1090 O  O   . MET A 1 144 ? 10.937 144.682 -4.415  1.00   31.58 ? 138  MET A O   1 
ATOM   1091 C  CB  . MET A 1 144 ? 10.417 147.857 -5.334  1.00   33.75 ? 138  MET A CB  1 
ATOM   1092 C  CG  . MET A 1 144 ? 9.805  147.975 -3.977  1.00   35.61 ? 138  MET A CG  1 
ATOM   1093 S  SD  . MET A 1 144 ? 10.088 149.667 -3.322  1.00   42.97 ? 138  MET A SD  1 
ATOM   1094 C  CE  . MET A 1 144 ? 9.344  149.420 -1.721  1.00   40.50 ? 138  MET A CE  1 
ATOM   1095 N  N   . ILE A 1 145 ? 12.628 145.850 -5.311  1.00   31.92 ? 139  ILE A N   1 
ATOM   1096 C  CA  . ILE A 1 145 ? 13.685 145.335 -4.460  1.00   31.35 ? 139  ILE A CA  1 
ATOM   1097 C  C   . ILE A 1 145 ? 14.359 146.533 -3.806  1.00   30.45 ? 139  ILE A C   1 
ATOM   1098 O  O   . ILE A 1 145 ? 14.780 147.454 -4.480  1.00   30.27 ? 139  ILE A O   1 
ATOM   1099 C  CB  . ILE A 1 145 ? 14.710 144.547 -5.289  1.00   31.30 ? 139  ILE A CB  1 
ATOM   1100 C  CG1 . ILE A 1 145 ? 14.060 143.277 -5.829  1.00   30.94 ? 139  ILE A CG1 1 
ATOM   1101 C  CG2 . ILE A 1 145 ? 15.921 144.157 -4.407  1.00   31.57 ? 139  ILE A CG2 1 
ATOM   1102 C  CD1 . ILE A 1 145 ? 14.760 142.714 -7.054  1.00   33.04 ? 139  ILE A CD1 1 
ATOM   1103 N  N   . VAL A 1 146 ? 14.441 146.496 -2.492  1.00   29.83 ? 140  VAL A N   1 
ATOM   1104 C  CA  . VAL A 1 146 ? 15.119 147.500 -1.699  1.00   30.13 ? 140  VAL A CA  1 
ATOM   1105 C  C   . VAL A 1 146 ? 16.317 146.841 -0.998  1.00   29.21 ? 140  VAL A C   1 
ATOM   1106 O  O   . VAL A 1 146 ? 16.166 145.795 -0.382  1.00   28.53 ? 140  VAL A O   1 
ATOM   1107 C  CB  . VAL A 1 146 ? 14.165 148.076 -0.633  1.00   30.83 ? 140  VAL A CB  1 
ATOM   1108 C  CG1 . VAL A 1 146 ? 14.839 149.221 0.160   1.00   31.40 ? 140  VAL A CG1 1 
ATOM   1109 C  CG2 . VAL A 1 146 ? 12.845 148.561 -1.303  1.00   33.80 ? 140  VAL A CG2 1 
ATOM   1110 N  N   . PHE A 1 147 ? 17.494 147.449 -1.133  1.00   29.28 ? 141  PHE A N   1 
ATOM   1111 C  CA  . PHE A 1 147 ? 18.696 147.045 -0.388  1.00   29.61 ? 141  PHE A CA  1 
ATOM   1112 C  C   . PHE A 1 147 ? 18.795 147.991 0.810   1.00   29.71 ? 141  PHE A C   1 
ATOM   1113 O  O   . PHE A 1 147 ? 18.709 149.201 0.635   1.00   30.32 ? 141  PHE A O   1 
ATOM   1114 C  CB  . PHE A 1 147 ? 19.966 147.219 -1.210  1.00   28.53 ? 141  PHE A CB  1 
ATOM   1115 C  CG  . PHE A 1 147 ? 20.037 146.401 -2.482  1.00   30.06 ? 141  PHE A CG  1 
ATOM   1116 C  CD1 . PHE A 1 147 ? 19.186 146.643 -3.556  1.00   29.44 ? 141  PHE A CD1 1 
ATOM   1117 C  CD2 . PHE A 1 147 ? 21.017 145.420 -2.634  1.00   29.35 ? 141  PHE A CD2 1 
ATOM   1118 C  CE1 . PHE A 1 147 ? 19.307 145.915 -4.745  1.00   31.32 ? 141  PHE A CE1 1 
ATOM   1119 C  CE2 . PHE A 1 147 ? 21.143 144.689 -3.827  1.00   29.92 ? 141  PHE A CE2 1 
ATOM   1120 C  CZ  . PHE A 1 147 ? 20.288 144.932 -4.875  1.00   30.52 ? 141  PHE A CZ  1 
ATOM   1121 N  N   . LEU A 1 148 ? 18.983 147.443 2.006   1.00   29.75 ? 142  LEU A N   1 
ATOM   1122 C  CA  . LEU A 1 148 ? 19.080 148.225 3.232   1.00   30.37 ? 142  LEU A CA  1 
ATOM   1123 C  C   . LEU A 1 148 ? 20.353 147.896 4.032   1.00   30.54 ? 142  LEU A C   1 
ATOM   1124 O  O   . LEU A 1 148 ? 20.778 146.729 4.120   1.00   28.34 ? 142  LEU A O   1 
ATOM   1125 C  CB  . LEU A 1 148 ? 17.873 147.951 4.114   1.00   30.54 ? 142  LEU A CB  1 
ATOM   1126 C  CG  . LEU A 1 148 ? 16.530 148.342 3.477   1.00   33.47 ? 142  LEU A CG  1 
ATOM   1127 C  CD1 . LEU A 1 148 ? 15.677 147.147 3.267   1.00   34.48 ? 142  LEU A CD1 1 
ATOM   1128 C  CD2 . LEU A 1 148 ? 15.800 149.354 4.329   1.00   37.21 ? 142  LEU A CD2 1 
ATOM   1129 N  N   . VAL A 1 149 ? 20.964 148.943 4.568   1.00   30.28 ? 143  VAL A N   1 
ATOM   1130 C  CA  . VAL A 1 149 ? 22.056 148.833 5.511   1.00   31.04 ? 143  VAL A CA  1 
ATOM   1131 C  C   . VAL A 1 149 ? 21.476 149.441 6.762   1.00   33.03 ? 143  VAL A C   1 
ATOM   1132 O  O   . VAL A 1 149 ? 21.132 150.644 6.768   1.00   32.44 ? 143  VAL A O   1 
ATOM   1133 C  CB  . VAL A 1 149 ? 23.289 149.614 5.041   1.00   30.74 ? 143  VAL A CB  1 
ATOM   1134 C  CG1 . VAL A 1 149 ? 24.365 149.611 6.100   1.00   30.65 ? 143  VAL A CG1 1 
ATOM   1135 C  CG2 . VAL A 1 149 ? 23.797 149.084 3.738   1.00   30.10 ? 143  VAL A CG2 1 
ATOM   1136 N  N   . ASP A 1 150 ? 21.349 148.596 7.789   1.00   34.63 ? 144  ASP A N   1 
ATOM   1137 C  CA  . ASP A 1 150 ? 20.541 148.839 8.985   1.00   36.66 ? 144  ASP A CA  1 
ATOM   1138 C  C   . ASP A 1 150 ? 19.160 149.327 8.502   1.00   38.25 ? 144  ASP A C   1 
ATOM   1139 O  O   . ASP A 1 150 ? 18.484 148.604 7.769   1.00   38.50 ? 144  ASP A O   1 
ATOM   1140 C  CB  . ASP A 1 150 ? 21.265 149.793 9.968   1.00   36.30 ? 144  ASP A CB  1 
ATOM   1141 C  CG  . ASP A 1 150 ? 22.609 149.222 10.476  1.00   37.42 ? 144  ASP A CG  1 
ATOM   1142 O  OD1 . ASP A 1 150 ? 22.634 148.038 10.914  1.00   34.13 ? 144  ASP A OD1 1 
ATOM   1143 O  OD2 . ASP A 1 150 ? 23.688 149.879 10.491  1.00   36.95 ? 144  ASP A OD2 1 
ATOM   1144 N  N   . ASP A 1 151 ? 18.758 150.548 8.839   1.00   39.79 ? 145  ASP A N   1 
ATOM   1145 C  CA  . ASP A 1 151 ? 17.454 151.054 8.382   1.00   41.09 ? 145  ASP A CA  1 
ATOM   1146 C  C   . ASP A 1 151 ? 17.552 152.061 7.224   1.00   40.22 ? 145  ASP A C   1 
ATOM   1147 O  O   . ASP A 1 151 ? 16.571 152.696 6.876   1.00   41.60 ? 145  ASP A O   1 
ATOM   1148 C  CB  . ASP A 1 151 ? 16.676 151.653 9.553   1.00   42.49 ? 145  ASP A CB  1 
ATOM   1149 C  CG  . ASP A 1 151 ? 17.446 152.736 10.270  1.00   46.13 ? 145  ASP A CG  1 
ATOM   1150 O  OD1 . ASP A 1 151 ? 18.696 152.834 10.110  1.00   53.76 ? 145  ASP A OD1 1 
ATOM   1151 O  OD2 . ASP A 1 151 ? 16.888 153.541 11.037  1.00   55.71 ? 145  ASP A OD2 1 
ATOM   1152 N  N   . VAL A 1 152 ? 18.727 152.109 6.601   1.00   38.48 ? 146  VAL A N   1 
ATOM   1153 C  CA  . VAL A 1 152 ? 18.941 153.012 5.498   1.00   37.36 ? 146  VAL A CA  1 
ATOM   1154 C  C   . VAL A 1 152 ? 18.836 152.334 4.149   1.00   37.57 ? 146  VAL A C   1 
ATOM   1155 O  O   . VAL A 1 152 ? 19.611 151.416 3.882   1.00   35.96 ? 146  VAL A O   1 
ATOM   1156 C  CB  . VAL A 1 152 ? 20.318 153.711 5.586   1.00   37.10 ? 146  VAL A CB  1 
ATOM   1157 C  CG1 . VAL A 1 152 ? 20.474 154.726 4.478   1.00   37.51 ? 146  VAL A CG1 1 
ATOM   1158 C  CG2 . VAL A 1 152 ? 20.505 154.379 6.948   1.00   38.67 ? 146  VAL A CG2 1 
ATOM   1159 N  N   . PRO A 1 153 ? 17.945 152.798 3.278   1.00   37.39 ? 147  PRO A N   1 
ATOM   1160 C  CA  . PRO A 1 153 ? 17.845 152.267 1.936   1.00   36.33 ? 147  PRO A CA  1 
ATOM   1161 C  C   . PRO A 1 153 ? 19.040 152.794 1.116   1.00   35.54 ? 147  PRO A C   1 
ATOM   1162 O  O   . PRO A 1 153 ? 19.249 154.002 1.014   1.00   36.23 ? 147  PRO A O   1 
ATOM   1163 C  CB  . PRO A 1 153 ? 16.522 152.779 1.374   1.00   37.35 ? 147  PRO A CB  1 
ATOM   1164 C  CG  . PRO A 1 153 ? 15.770 153.318 2.546   1.00   38.09 ? 147  PRO A CG  1 
ATOM   1165 C  CD  . PRO A 1 153 ? 16.821 153.727 3.552   1.00   38.01 ? 147  PRO A CD  1 
ATOM   1166 N  N   . ILE A 1 154 ? 19.821 151.899 0.525   1.00   33.69 ? 148  ILE A N   1 
ATOM   1167 C  CA  . ILE A 1 154 ? 20.951 152.328 -0.276  1.00   32.74 ? 148  ILE A CA  1 
ATOM   1168 C  C   . ILE A 1 154 ? 20.696 152.180 -1.801  1.00   31.77 ? 148  ILE A C   1 
ATOM   1169 O  O   . ILE A 1 154 ? 21.459 152.706 -2.622  1.00   31.59 ? 148  ILE A O   1 
ATOM   1170 C  CB  . ILE A 1 154 ? 22.231 151.571 0.119   1.00   32.27 ? 148  ILE A CB  1 
ATOM   1171 C  CG1 . ILE A 1 154 ? 22.098 150.092 -0.203  1.00   32.05 ? 148  ILE A CG1 1 
ATOM   1172 C  CG2 . ILE A 1 154 ? 22.550 151.775 1.585   1.00   32.97 ? 148  ILE A CG2 1 
ATOM   1173 C  CD1 . ILE A 1 154 ? 23.438 149.413 -0.421  1.00   33.03 ? 148  ILE A CD1 1 
ATOM   1174 N  N   . ARG A 1 155 ? 19.615 151.475 -2.164  1.00   33.00 ? 149  ARG A N   1 
ATOM   1175 C  CA  . ARG A 1 155 ? 19.252 151.223 -3.512  1.00   33.88 ? 149  ARG A CA  1 
ATOM   1176 C  C   . ARG A 1 155 ? 17.843 150.696 -3.624  1.00   35.51 ? 149  ARG A C   1 
ATOM   1177 O  O   . ARG A 1 155 ? 17.388 149.926 -2.784  1.00   34.37 ? 149  ARG A O   1 
ATOM   1178 C  CB  . ARG A 1 155 ? 20.237 150.235 -4.126  1.00   34.48 ? 149  ARG A CB  1 
ATOM   1179 C  CG  . ARG A 1 155 ? 19.884 149.796 -5.525  1.00   34.36 ? 149  ARG A CG  1 
ATOM   1180 C  CD  . ARG A 1 155 ? 20.999 148.946 -6.108  1.00   34.83 ? 149  ARG A CD  1 
ATOM   1181 N  NE  . ARG A 1 155 ? 20.719 148.663 -7.488  1.00   33.96 ? 149  ARG A NE  1 
ATOM   1182 C  CZ  . ARG A 1 155 ? 21.575 148.134 -8.322  1.00   35.96 ? 149  ARG A CZ  1 
ATOM   1183 N  NH1 . ARG A 1 155 ? 22.793 147.800 -7.934  1.00   36.60 ? 149  ARG A NH1 1 
ATOM   1184 N  NH2 . ARG A 1 155 ? 21.200 147.935 -9.573  1.00   38.53 ? 149  ARG A NH2 1 
ATOM   1185 N  N   . VAL A 1 156 ? 17.185 151.062 -4.709  1.00   36.70 ? 150  VAL A N   1 
ATOM   1186 C  CA  . VAL A 1 156 ? 15.881 150.553 -5.025  1.00   38.38 ? 150  VAL A CA  1 
ATOM   1187 C  C   . VAL A 1 156 ? 15.890 150.109 -6.484  1.00   38.84 ? 150  VAL A C   1 
ATOM   1188 O  O   . VAL A 1 156 ? 16.387 150.827 -7.342  1.00   39.70 ? 150  VAL A O   1 
ATOM   1189 C  CB  . VAL A 1 156 ? 14.758 151.581 -4.809  1.00   38.95 ? 150  VAL A CB  1 
ATOM   1190 C  CG1 . VAL A 1 156 ? 13.433 150.974 -5.238  1.00   40.94 ? 150  VAL A CG1 1 
ATOM   1191 C  CG2 . VAL A 1 156 ? 14.702 152.030 -3.351  1.00   40.11 ? 150  VAL A CG2 1 
ATOM   1192 N  N   . PHE A 1 157 ? 15.355 148.920 -6.749  1.00   39.70 ? 151  PHE A N   1 
ATOM   1193 C  CA  . PHE A 1 157 ? 15.162 148.429 -8.106  1.00   39.74 ? 151  PHE A CA  1 
ATOM   1194 C  C   . PHE A 1 157 ? 13.675 148.140 -8.273  1.00   40.62 ? 151  PHE A C   1 
ATOM   1195 O  O   . PHE A 1 157 ? 13.159 147.180 -7.723  1.00   39.58 ? 151  PHE A O   1 
ATOM   1196 C  CB  . PHE A 1 157 ? 15.998 147.185 -8.362  1.00   39.35 ? 151  PHE A CB  1 
ATOM   1197 C  CG  . PHE A 1 157 ? 16.001 146.739 -9.801  1.00   38.55 ? 151  PHE A CG  1 
ATOM   1198 C  CD1 . PHE A 1 157 ? 16.948 147.205 -10.681 1.00   38.90 ? 151  PHE A CD1 1 
ATOM   1199 C  CD2 . PHE A 1 157 ? 15.069 145.841 -10.255 1.00   38.06 ? 151  PHE A CD2 1 
ATOM   1200 C  CE1 . PHE A 1 157 ? 16.952 146.791 -11.998 1.00   40.00 ? 151  PHE A CE1 1 
ATOM   1201 C  CE2 . PHE A 1 157 ? 15.060 145.431 -11.577 1.00   39.44 ? 151  PHE A CE2 1 
ATOM   1202 C  CZ  . PHE A 1 157 ? 15.999 145.893 -12.440 1.00   40.06 ? 151  PHE A CZ  1 
ATOM   1203 N  N   . LYS A 1 158 ? 12.979 148.994 -9.025  1.00   42.63 ? 152  LYS A N   1 
ATOM   1204 C  CA  . LYS A 1 158 ? 11.511 148.927 -9.101  1.00   44.50 ? 152  LYS A CA  1 
ATOM   1205 C  C   . LYS A 1 158 ? 11.098 147.925 -10.164 1.00   44.80 ? 152  LYS A C   1 
ATOM   1206 O  O   . LYS A 1 158 ? 11.836 147.715 -11.111 1.00   44.37 ? 152  LYS A O   1 
ATOM   1207 C  CB  . LYS A 1 158 ? 10.912 150.302 -9.427  1.00   44.96 ? 152  LYS A CB  1 
ATOM   1208 C  CG  . LYS A 1 158 ? 10.862 151.258 -8.230  1.00   48.94 ? 152  LYS A CG  1 
ATOM   1209 C  CD  . LYS A 1 158 ? 9.587  151.100 -7.383  1.00   52.33 ? 152  LYS A CD  1 
ATOM   1210 C  CE  . LYS A 1 158 ? 8.660  152.304 -7.521  1.00   55.11 ? 152  LYS A CE  1 
ATOM   1211 N  NZ  . LYS A 1 158 ? 7.807  152.457 -6.315  1.00   57.75 ? 152  LYS A NZ  1 
ATOM   1212 N  N   . ASN A 1 159 ? 9.935  147.305 -9.996  1.00   46.35 ? 153  ASN A N   1 
ATOM   1213 C  CA  . ASN A 1 159 ? 9.325  146.486 -11.057 1.00   47.99 ? 153  ASN A CA  1 
ATOM   1214 C  C   . ASN A 1 159 ? 8.806  147.414 -12.171 1.00   50.10 ? 153  ASN A C   1 
ATOM   1215 O  O   . ASN A 1 159 ? 7.749  148.028 -12.022 1.00   49.68 ? 153  ASN A O   1 
ATOM   1216 C  CB  . ASN A 1 159 ? 8.165  145.646 -10.498 1.00   47.84 ? 153  ASN A CB  1 
ATOM   1217 C  CG  . ASN A 1 159 ? 7.536  144.716 -11.545 1.00   46.95 ? 153  ASN A CG  1 
ATOM   1218 O  OD1 . ASN A 1 159 ? 7.866  144.778 -12.716 1.00   45.98 ? 153  ASN A OD1 1 
ATOM   1219 N  ND2 . ASN A 1 159 ? 6.650  143.841 -11.104 1.00   44.60 ? 153  ASN A ND2 1 
ATOM   1220 N  N   . CYS A 1 160 ? 9.576  147.524 -13.252 1.00   52.55 ? 154  CYS A N   1 
ATOM   1221 C  CA  . CYS A 1 160 ? 9.211  148.326 -14.421 1.00   55.23 ? 154  CYS A CA  1 
ATOM   1222 C  C   . CYS A 1 160 ? 8.984  147.453 -15.668 1.00   55.85 ? 154  CYS A C   1 
ATOM   1223 O  O   . CYS A 1 160 ? 9.498  147.757 -16.748 1.00   56.34 ? 154  CYS A O   1 
ATOM   1224 C  CB  . CYS A 1 160 ? 10.305 149.358 -14.707 1.00   55.38 ? 154  CYS A CB  1 
ATOM   1225 S  SG  . CYS A 1 160 ? 10.850 150.326 -13.275 1.00   61.69 ? 154  CYS A SG  1 
ATOM   1226 N  N   . LYS A 1 161 ? 8.225  146.370 -15.523 1.00   56.98 ? 155  LYS A N   1 
ATOM   1227 C  CA  . LYS A 1 161 ? 7.917  145.502 -16.665 1.00   58.23 ? 155  LYS A CA  1 
ATOM   1228 C  C   . LYS A 1 161 ? 7.074  146.264 -17.689 1.00   59.38 ? 155  LYS A C   1 
ATOM   1229 O  O   . LYS A 1 161 ? 7.174  146.031 -18.888 1.00   59.46 ? 155  LYS A O   1 
ATOM   1230 C  CB  . LYS A 1 161 ? 7.199  144.224 -16.214 1.00   58.33 ? 155  LYS A CB  1 
ATOM   1231 C  CG  . LYS A 1 161 ? 8.114  143.247 -15.480 1.00   58.96 ? 155  LYS A CG  1 
ATOM   1232 C  CD  . LYS A 1 161 ? 7.738  141.787 -15.686 1.00   60.52 ? 155  LYS A CD  1 
ATOM   1233 C  CE  . LYS A 1 161 ? 6.605  141.370 -14.790 1.00   60.80 ? 155  LYS A CE  1 
ATOM   1234 N  NZ  . LYS A 1 161 ? 6.096  140.041 -15.201 1.00   61.40 ? 155  LYS A NZ  1 
ATOM   1235 N  N   . ASP A 1 162 ? 6.264  147.197 -17.195 1.00   60.61 ? 156  ASP A N   1 
ATOM   1236 C  CA  . ASP A 1 162 ? 5.471  148.078 -18.050 1.00   61.67 ? 156  ASP A CA  1 
ATOM   1237 C  C   . ASP A 1 162 ? 6.329  148.899 -19.035 1.00   61.29 ? 156  ASP A C   1 
ATOM   1238 O  O   . ASP A 1 162 ? 5.841  149.271 -20.098 1.00   62.14 ? 156  ASP A O   1 
ATOM   1239 C  CB  . ASP A 1 162 ? 4.585  148.992 -17.186 1.00   62.03 ? 156  ASP A CB  1 
ATOM   1240 C  CG  . ASP A 1 162 ? 5.391  150.003 -16.395 1.00   64.88 ? 156  ASP A CG  1 
ATOM   1241 O  OD1 . ASP A 1 162 ? 6.075  149.604 -15.416 1.00   69.68 ? 156  ASP A OD1 1 
ATOM   1242 O  OD2 . ASP A 1 162 ? 5.420  151.219 -16.690 1.00   68.34 ? 156  ASP A OD2 1 
ATOM   1243 N  N   . LEU A 1 163 ? 7.590  149.184 -18.695 1.00   60.63 ? 157  LEU A N   1 
ATOM   1244 C  CA  . LEU A 1 163 ? 8.518  149.845 -19.628 1.00   59.79 ? 157  LEU A CA  1 
ATOM   1245 C  C   . LEU A 1 163 ? 9.425  148.882 -20.389 1.00   58.63 ? 157  LEU A C   1 
ATOM   1246 O  O   . LEU A 1 163 ? 10.424 149.324 -20.958 1.00   58.88 ? 157  LEU A O   1 
ATOM   1247 C  CB  . LEU A 1 163 ? 9.433  150.850 -18.907 1.00   60.22 ? 157  LEU A CB  1 
ATOM   1248 C  CG  . LEU A 1 163 ? 8.844  151.805 -17.880 1.00   60.83 ? 157  LEU A CG  1 
ATOM   1249 C  CD1 . LEU A 1 163 ? 9.967  152.617 -17.256 1.00   60.84 ? 157  LEU A CD1 1 
ATOM   1250 C  CD2 . LEU A 1 163 ? 7.776  152.702 -18.524 1.00   62.34 ? 157  LEU A CD2 1 
ATOM   1251 N  N   . GLY A 1 164 ? 9.106  147.587 -20.389 1.00   57.15 ? 158  GLY A N   1 
ATOM   1252 C  CA  . GLY A 1 164 ? 9.926  146.579 -21.056 1.00   56.04 ? 158  GLY A CA  1 
ATOM   1253 C  C   . GLY A 1 164 ? 11.137 146.020 -20.288 1.00   54.80 ? 158  GLY A C   1 
ATOM   1254 O  O   . GLY A 1 164 ? 11.868 145.176 -20.811 1.00   54.93 ? 158  GLY A O   1 
ATOM   1255 N  N   . VAL A 1 165 ? 11.350 146.472 -19.054 1.00   53.09 ? 159  VAL A N   1 
ATOM   1256 C  CA  . VAL A 1 165 ? 12.510 146.051 -18.243 1.00   51.30 ? 159  VAL A CA  1 
ATOM   1257 C  C   . VAL A 1 165 ? 12.216 144.807 -17.414 1.00   49.07 ? 159  VAL A C   1 
ATOM   1258 O  O   . VAL A 1 165 ? 11.175 144.715 -16.767 1.00   48.49 ? 159  VAL A O   1 
ATOM   1259 C  CB  . VAL A 1 165 ? 12.923 147.170 -17.275 1.00   51.52 ? 159  VAL A CB  1 
ATOM   1260 C  CG1 . VAL A 1 165 ? 14.193 146.793 -16.498 1.00   51.69 ? 159  VAL A CG1 1 
ATOM   1261 C  CG2 . VAL A 1 165 ? 13.116 148.473 -18.049 1.00   52.41 ? 159  VAL A CG2 1 
ATOM   1262 N  N   . LYS A 1 166 ? 13.145 143.862 -17.416 1.00   46.70 ? 160  LYS A N   1 
ATOM   1263 C  CA  . LYS A 1 166 ? 12.975 142.652 -16.636 1.00   45.67 ? 160  LYS A CA  1 
ATOM   1264 C  C   . LYS A 1 166 ? 13.115 142.923 -15.123 1.00   43.29 ? 160  LYS A C   1 
ATOM   1265 O  O   . LYS A 1 166 ? 13.745 143.885 -14.710 1.00   42.42 ? 160  LYS A O   1 
ATOM   1266 C  CB  . LYS A 1 166 ? 13.943 141.579 -17.108 1.00   46.21 ? 160  LYS A CB  1 
ATOM   1267 C  CG  . LYS A 1 166 ? 13.655 141.107 -18.529 1.00   48.43 ? 160  LYS A CG  1 
ATOM   1268 C  CD  . LYS A 1 166 ? 14.251 139.743 -18.783 1.00   52.08 ? 160  LYS A CD  1 
ATOM   1269 C  CE  . LYS A 1 166 ? 13.929 139.221 -20.179 1.00   53.19 ? 160  LYS A CE  1 
ATOM   1270 N  NZ  . LYS A 1 166 ? 14.717 138.007 -20.518 1.00   54.08 ? 160  LYS A NZ  1 
ATOM   1271 N  N   . PHE A 1 167 ? 12.506 142.044 -14.336 1.00   41.45 ? 161  PHE A N   1 
ATOM   1272 C  CA  . PHE A 1 167 ? 12.472 142.112 -12.864 1.00   39.76 ? 161  PHE A CA  1 
ATOM   1273 C  C   . PHE A 1 167 ? 12.446 140.673 -12.320 1.00   39.12 ? 161  PHE A C   1 
ATOM   1274 O  O   . PHE A 1 167 ? 11.803 139.818 -12.933 1.00   38.77 ? 161  PHE A O   1 
ATOM   1275 C  CB  . PHE A 1 167 ? 11.234 142.862 -12.390 1.00   39.32 ? 161  PHE A CB  1 
ATOM   1276 C  CG  . PHE A 1 167 ? 11.083 143.085 -10.930 1.00   36.72 ? 161  PHE A CG  1 
ATOM   1277 C  CD1 . PHE A 1 167 ? 11.754 144.134 -10.309 1.00   35.79 ? 161  PHE A CD1 1 
ATOM   1278 C  CD2 . PHE A 1 167 ? 10.281 142.275 -10.164 1.00   35.99 ? 161  PHE A CD2 1 
ATOM   1279 C  CE1 . PHE A 1 167 ? 11.644 144.364 -8.946  1.00   35.35 ? 161  PHE A CE1 1 
ATOM   1280 C  CE2 . PHE A 1 167 ? 10.135 142.491 -8.795  1.00   35.06 ? 161  PHE A CE2 1 
ATOM   1281 C  CZ  . PHE A 1 167 ? 10.818 143.531 -8.183  1.00   35.18 ? 161  PHE A CZ  1 
ATOM   1282 N  N   . PRO A 1 168 ? 13.099 140.322 -11.188 1.00   38.18 ? 162  PRO A N   1 
ATOM   1283 C  CA  . PRO A 1 168 ? 13.012 138.977 -10.607 1.00   38.04 ? 162  PRO A CA  1 
ATOM   1284 C  C   . PRO A 1 168 ? 11.589 138.750 -10.125 1.00   38.19 ? 162  PRO A C   1 
ATOM   1285 O  O   . PRO A 1 168 ? 11.160 139.260 -9.076  1.00   37.72 ? 162  PRO A O   1 
ATOM   1286 C  CB  . PRO A 1 168 ? 14.015 139.002 -9.446  1.00   37.67 ? 162  PRO A CB  1 
ATOM   1287 C  CG  . PRO A 1 168 ? 14.935 140.125 -9.746  1.00   37.29 ? 162  PRO A CG  1 
ATOM   1288 C  CD  . PRO A 1 168 ? 14.103 141.143 -10.476 1.00   37.95 ? 162  PRO A CD  1 
ATOM   1289 N  N   . PHE A 1 169 ? 10.892 137.988 -10.940 1.00   38.89 ? 163  PHE A N   1 
ATOM   1290 C  CA  . PHE A 1 169 ? 9.475  137.825 -10.728 1.00   39.38 ? 163  PHE A CA  1 
ATOM   1291 C  C   . PHE A 1 169 ? 8.925  136.402 -10.545 1.00   39.76 ? 163  PHE A C   1 
ATOM   1292 O  O   . PHE A 1 169 ? 7.956  136.211 -9.801  1.00   40.33 ? 163  PHE A O   1 
ATOM   1293 C  CB  . PHE A 1 169 ? 8.754  138.526 -11.888 1.00   39.91 ? 163  PHE A CB  1 
ATOM   1294 C  CG  . PHE A 1 169 ? 7.302  138.811 -11.653 1.00   41.00 ? 163  PHE A CG  1 
ATOM   1295 C  CD1 . PHE A 1 169 ? 6.918  139.846 -10.814 1.00   40.92 ? 163  PHE A CD1 1 
ATOM   1296 C  CD2 . PHE A 1 169 ? 6.326  138.024 -12.235 1.00   41.94 ? 163  PHE A CD2 1 
ATOM   1297 C  CE1 . PHE A 1 169 ? 5.579  140.100 -10.565 1.00   42.83 ? 163  PHE A CE1 1 
ATOM   1298 C  CE2 . PHE A 1 169 ? 4.981  138.282 -12.009 1.00   43.18 ? 163  PHE A CE2 1 
ATOM   1299 C  CZ  . PHE A 1 169 ? 4.606  139.318 -11.170 1.00   43.30 ? 163  PHE A CZ  1 
ATOM   1300 N  N   . ASN A 1 170 ? 9.517  135.386 -11.224 1.00   40.22 ? 164  ASN A N   1 
ATOM   1301 C  CA  . ASN A 1 170 ? 9.004  134.012 -11.123 1.00   40.96 ? 164  ASN A CA  1 
ATOM   1302 C  C   . ASN A 1 170 ? 10.059 132.925 -11.016 1.00   39.58 ? 164  ASN A C   1 
ATOM   1303 O  O   . ASN A 1 170 ? 9.791  131.783 -11.377 1.00   40.73 ? 164  ASN A O   1 
ATOM   1304 C  CB  . ASN A 1 170 ? 8.066  133.734 -12.302 1.00   42.48 ? 164  ASN A CB  1 
ATOM   1305 C  CG  . ASN A 1 170 ? 8.685  134.028 -13.625 1.00   44.95 ? 164  ASN A CG  1 
ATOM   1306 O  OD1 . ASN A 1 170 ? 9.907  133.961 -13.775 1.00   47.32 ? 164  ASN A OD1 1 
ATOM   1307 N  ND2 . ASN A 1 170 ? 7.845  134.355 -14.590 1.00   50.98 ? 164  ASN A ND2 1 
ATOM   1308 N  N   . GLN A 1 171 ? 11.236 133.248 -10.543 1.00   38.01 ? 165  GLN A N   1 
ATOM   1309 C  CA  . GLN A 1 171 ? 12.228 132.234 -10.319 1.00   36.88 ? 165  GLN A CA  1 
ATOM   1310 C  C   . GLN A 1 171 ? 12.582 132.272 -8.850  1.00   35.24 ? 165  GLN A C   1 
ATOM   1311 O  O   . GLN A 1 171 ? 13.212 133.232 -8.401  1.00   33.07 ? 165  GLN A O   1 
ATOM   1312 C  CB  . GLN A 1 171 ? 13.488 132.464 -11.203 1.00   37.31 ? 165  GLN A CB  1 
ATOM   1313 C  CG  . GLN A 1 171 ? 13.226 132.435 -12.709 1.00   40.25 ? 165  GLN A CG  1 
ATOM   1314 C  CD  . GLN A 1 171 ? 14.478 132.612 -13.541 1.00   44.74 ? 165  GLN A CD  1 
ATOM   1315 O  OE1 . GLN A 1 171 ? 15.298 131.707 -13.675 1.00   46.51 ? 165  GLN A OE1 1 
ATOM   1316 N  NE2 . GLN A 1 171 ? 14.837 133.715 -14.193 1.00   50.12 ? 165  GLN A NE2 1 
ATOM   1317 N  N   . PRO A 1 172 ? 12.173 131.237 -8.106  1.00   34.20 ? 166  PRO A N   1 
ATOM   1318 C  CA  . PRO A 1 172 ? 12.555 131.149 -6.692  1.00   33.42 ? 166  PRO A CA  1 
ATOM   1319 C  C   . PRO A 1 172 ? 14.083 131.235 -6.519  1.00   32.09 ? 166  PRO A C   1 
ATOM   1320 O  O   . PRO A 1 172 ? 14.826 130.728 -7.358  1.00   32.27 ? 166  PRO A O   1 
ATOM   1321 C  CB  . PRO A 1 172 ? 12.004 129.795 -6.271  1.00   33.83 ? 166  PRO A CB  1 
ATOM   1322 C  CG  . PRO A 1 172 ? 10.827 129.583 -7.211  1.00   34.39 ? 166  PRO A CG  1 
ATOM   1323 C  CD  . PRO A 1 172 ? 11.360 130.083 -8.527  1.00   34.53 ? 166  PRO A CD  1 
ATOM   1324 N  N   . MET A 1 173 ? 14.534 131.932 -5.483  1.00   30.41 ? 167  MET A N   1 
ATOM   1325 C  CA  . MET A 1 173 ? 15.954 132.122 -5.239  1.00   29.44 ? 167  MET A CA  1 
ATOM   1326 C  C   . MET A 1 173 ? 16.341 131.543 -3.866  1.00   28.92 ? 167  MET A C   1 
ATOM   1327 O  O   . MET A 1 173 ? 15.518 131.508 -2.917  1.00   28.48 ? 167  MET A O   1 
ATOM   1328 C  CB  . MET A 1 173 ? 16.296 133.608 -5.323  1.00   29.54 ? 167  MET A CB  1 
ATOM   1329 C  CG  . MET A 1 173 ? 16.132 134.208 -6.751  1.00   31.66 ? 167  MET A CG  1 
ATOM   1330 S  SD  . MET A 1 173 ? 16.952 135.799 -7.049  1.00   36.30 ? 167  MET A SD  1 
ATOM   1331 C  CE  . MET A 1 173 ? 16.062 136.806 -6.081  1.00   36.34 ? 167  MET A CE  1 
ATOM   1332 N  N   . LYS A 1 174 ? 17.586 131.077 -3.783  1.00   27.66 ? 168  LYS A N   1 
ATOM   1333 C  CA  . LYS A 1 174 ? 18.218 130.741 -2.508  1.00   27.30 ? 168  LYS A CA  1 
ATOM   1334 C  C   . LYS A 1 174 ? 19.097 131.900 -2.056  1.00   25.80 ? 168  LYS A C   1 
ATOM   1335 O  O   . LYS A 1 174 ? 19.468 132.752 -2.845  1.00   24.99 ? 168  LYS A O   1 
ATOM   1336 C  CB  . LYS A 1 174 ? 19.077 129.479 -2.672  1.00   27.82 ? 168  LYS A CB  1 
ATOM   1337 C  CG  . LYS A 1 174 ? 18.292 128.252 -3.070  1.00   29.90 ? 168  LYS A CG  1 
ATOM   1338 C  CD  . LYS A 1 174 ? 19.106 126.957 -2.883  1.00   33.18 ? 168  LYS A CD  1 
ATOM   1339 C  CE  . LYS A 1 174 ? 18.191 125.755 -2.626  1.00   36.45 ? 168  LYS A CE  1 
ATOM   1340 N  NZ  . LYS A 1 174 ? 18.882 124.468 -2.975  1.00   38.80 ? 168  LYS A NZ  1 
ATOM   1341 N  N   . ILE A 1 175 ? 19.417 131.923 -0.776  1.00   24.77 ? 169  ILE A N   1 
ATOM   1342 C  CA  . ILE A 1 175 ? 20.299 132.924 -0.211  1.00   25.18 ? 169  ILE A CA  1 
ATOM   1343 C  C   . ILE A 1 175 ? 21.638 132.241 -0.059  1.00   24.54 ? 169  ILE A C   1 
ATOM   1344 O  O   . ILE A 1 175 ? 21.712 131.097 0.381   1.00   25.20 ? 169  ILE A O   1 
ATOM   1345 C  CB  . ILE A 1 175 ? 19.793 133.409 1.141   1.00   25.97 ? 169  ILE A CB  1 
ATOM   1346 C  CG1 . ILE A 1 175 ? 18.377 133.943 1.007   1.00   28.59 ? 169  ILE A CG1 1 
ATOM   1347 C  CG2 . ILE A 1 175 ? 20.708 134.468 1.695   1.00   26.32 ? 169  ILE A CG2 1 
ATOM   1348 C  CD1 . ILE A 1 175 ? 17.346 133.050 1.547   1.00   30.36 ? 169  ILE A CD1 1 
ATOM   1349 N  N   . TYR A 1 176 ? 22.678 132.937 -0.475  1.00   22.90 ? 170  TYR A N   1 
ATOM   1350 C  CA  . TYR A 1 176 ? 24.042 132.482 -0.452  1.00   22.59 ? 170  TYR A CA  1 
ATOM   1351 C  C   . TYR A 1 176 ? 24.914 133.488 0.250   1.00   23.47 ? 170  TYR A C   1 
ATOM   1352 O  O   . TYR A 1 176 ? 24.642 134.695 0.216   1.00   22.34 ? 170  TYR A O   1 
ATOM   1353 C  CB  . TYR A 1 176 ? 24.565 132.365 -1.875  1.00   22.41 ? 170  TYR A CB  1 
ATOM   1354 C  CG  . TYR A 1 176 ? 23.873 131.337 -2.716  1.00   22.97 ? 170  TYR A CG  1 
ATOM   1355 C  CD1 . TYR A 1 176 ? 22.725 131.661 -3.435  1.00   24.27 ? 170  TYR A CD1 1 
ATOM   1356 C  CD2 . TYR A 1 176 ? 24.364 130.038 -2.809  1.00   24.63 ? 170  TYR A CD2 1 
ATOM   1357 C  CE1 . TYR A 1 176 ? 22.086 130.727 -4.236  1.00   26.52 ? 170  TYR A CE1 1 
ATOM   1358 C  CE2 . TYR A 1 176 ? 23.725 129.083 -3.609  1.00   23.92 ? 170  TYR A CE2 1 
ATOM   1359 C  CZ  . TYR A 1 176 ? 22.590 129.430 -4.309  1.00   26.26 ? 170  TYR A CZ  1 
ATOM   1360 O  OH  . TYR A 1 176 ? 21.952 128.516 -5.115  1.00   26.96 ? 170  TYR A OH  1 
ATOM   1361 N  N   . SER A 1 177 ? 25.989 133.001 0.871   1.00   23.30 ? 171  SER A N   1 
ATOM   1362 C  CA  . SER A 1 177 ? 27.064 133.859 1.312   1.00   23.49 ? 171  SER A CA  1 
ATOM   1363 C  C   . SER A 1 177 ? 28.396 133.126 1.243   1.00   24.44 ? 171  SER A C   1 
ATOM   1364 O  O   . SER A 1 177 ? 28.464 131.898 1.350   1.00   23.43 ? 171  SER A O   1 
ATOM   1365 C  CB  . SER A 1 177 ? 26.816 134.415 2.720   1.00   24.10 ? 171  SER A CB  1 
ATOM   1366 O  OG  . SER A 1 177 ? 27.627 135.576 2.939   1.00   26.17 ? 171  SER A OG  1 
ATOM   1367 N  N   . SER A 1 178 ? 29.452 133.888 1.007   1.00   24.19 ? 172  SER A N   1 
ATOM   1368 C  CA  . SER A 1 178 ? 30.762 133.321 0.844   1.00   24.55 ? 172  SER A CA  1 
ATOM   1369 C  C   . SER A 1 178 ? 31.826 134.394 1.040   1.00   24.09 ? 172  SER A C   1 
ATOM   1370 O  O   . SER A 1 178 ? 31.555 135.608 0.945   1.00   23.50 ? 172  SER A O   1 
ATOM   1371 C  CB  . SER A 1 178 ? 30.928 132.692 -0.542  1.00   24.90 ? 172  SER A CB  1 
ATOM   1372 O  OG  . SER A 1 178 ? 30.654 133.640 -1.555  1.00   27.28 ? 172  SER A OG  1 
ATOM   1373 N  N   . LEU A 1 179 ? 33.026 133.911 1.308   1.00   22.75 ? 173  LEU A N   1 
ATOM   1374 C  CA  . LEU A 1 179 ? 34.218 134.694 1.463   1.00   23.12 ? 173  LEU A CA  1 
ATOM   1375 C  C   . LEU A 1 179 ? 35.304 134.064 0.579   1.00   24.31 ? 173  LEU A C   1 
ATOM   1376 O  O   . LEU A 1 179 ? 35.614 132.858 0.715   1.00   23.06 ? 173  LEU A O   1 
ATOM   1377 C  CB  . LEU A 1 179 ? 34.609 134.688 2.925   1.00   22.29 ? 173  LEU A CB  1 
ATOM   1378 C  CG  . LEU A 1 179 ? 35.927 135.358 3.278   1.00   24.04 ? 173  LEU A CG  1 
ATOM   1379 C  CD1 . LEU A 1 179 ? 35.921 136.857 3.001   1.00   25.43 ? 173  LEU A CD1 1 
ATOM   1380 C  CD2 . LEU A 1 179 ? 36.254 135.091 4.747   1.00   25.69 ? 173  LEU A CD2 1 
ATOM   1381 N  N   . TRP A 1 180 ? 35.819 134.863 -0.367  1.00   25.78 ? 174  TRP A N   1 
ATOM   1382 C  CA  . TRP A 1 180 ? 36.812 134.394 -1.327  1.00   27.41 ? 174  TRP A CA  1 
ATOM   1383 C  C   . TRP A 1 180 ? 37.780 135.528 -1.707  1.00   28.57 ? 174  TRP A C   1 
ATOM   1384 O  O   . TRP A 1 180 ? 37.493 136.691 -1.473  1.00   27.79 ? 174  TRP A O   1 
ATOM   1385 C  CB  . TRP A 1 180 ? 36.123 133.820 -2.599  1.00   27.86 ? 174  TRP A CB  1 
ATOM   1386 C  CG  . TRP A 1 180 ? 36.863 132.580 -3.062  1.00   30.41 ? 174  TRP A CG  1 
ATOM   1387 C  CD1 . TRP A 1 180 ? 37.879 132.573 -3.979  1.00   34.61 ? 174  TRP A CD1 1 
ATOM   1388 C  CD2 . TRP A 1 180 ? 36.671 131.206 -2.664  1.00   27.62 ? 174  TRP A CD2 1 
ATOM   1389 N  NE1 . TRP A 1 180 ? 38.351 131.291 -4.135  1.00   34.59 ? 174  TRP A NE1 1 
ATOM   1390 C  CE2 . TRP A 1 180 ? 37.635 130.441 -3.336  1.00   30.11 ? 174  TRP A CE2 1 
ATOM   1391 C  CE3 . TRP A 1 180 ? 35.783 130.549 -1.806  1.00   26.69 ? 174  TRP A CE3 1 
ATOM   1392 C  CZ2 . TRP A 1 180 ? 37.760 129.063 -3.155  1.00   29.86 ? 174  TRP A CZ2 1 
ATOM   1393 C  CZ3 . TRP A 1 180 ? 35.885 129.184 -1.654  1.00   27.73 ? 174  TRP A CZ3 1 
ATOM   1394 C  CH2 . TRP A 1 180 ? 36.876 128.457 -2.313  1.00   27.86 ? 174  TRP A CH2 1 
ATOM   1395 N  N   . ASN A 1 181 ? 38.898 135.172 -2.280  1.00   30.26 ? 175  ASN A N   1 
ATOM   1396 C  CA  . ASN A 1 181 ? 39.870 136.112 -2.767  1.00   33.51 ? 175  ASN A CA  1 
ATOM   1397 C  C   . ASN A 1 181 ? 39.422 136.532 -4.135  1.00   35.07 ? 175  ASN A C   1 
ATOM   1398 O  O   . ASN A 1 181 ? 38.917 135.738 -4.925  1.00   34.09 ? 175  ASN A O   1 
ATOM   1399 C  CB  . ASN A 1 181 ? 41.262 135.441 -2.872  1.00   34.59 ? 175  ASN A CB  1 
ATOM   1400 C  CG  . ASN A 1 181 ? 42.246 136.211 -3.746  1.00   38.76 ? 175  ASN A CG  1 
ATOM   1401 O  OD1 . ASN A 1 181 ? 42.495 135.863 -4.905  1.00   47.07 ? 175  ASN A OD1 1 
ATOM   1402 N  ND2 . ASN A 1 181 ? 42.816 137.255 -3.180  1.00   40.96 ? 175  ASN A ND2 1 
ATOM   1403 N  N   . ALA A 1 182 ? 39.594 137.765 -4.460  1.00   37.11 ? 176  ALA A N   1 
ATOM   1404 C  CA  . ALA A 1 182 ? 39.353 138.238 -5.797  1.00   38.99 ? 176  ALA A CA  1 
ATOM   1405 C  C   . ALA A 1 182 ? 40.420 139.339 -6.055  1.00   40.31 ? 176  ALA A C   1 
ATOM   1406 O  O   . ALA A 1 182 ? 40.084 140.493 -6.279  1.00   40.42 ? 176  ALA A O   1 
ATOM   1407 C  CB  . ALA A 1 182 ? 37.937 138.775 -5.969  1.00   39.80 ? 176  ALA A CB  1 
ATOM   1408 N  N   . ASP A 1 183 ? 41.712 138.936 -6.022  1.00   42.43 ? 177  ASP A N   1 
ATOM   1409 C  CA  . ASP A 1 183 ? 42.928 139.719 -6.256  1.00   44.20 ? 177  ASP A CA  1 
ATOM   1410 C  C   . ASP A 1 183 ? 42.895 140.572 -7.528  1.00   44.06 ? 177  ASP A C   1 
ATOM   1411 O  O   . ASP A 1 183 ? 43.396 141.709 -7.560  1.00   44.34 ? 177  ASP A O   1 
ATOM   1412 C  CB  . ASP A 1 183 ? 44.135 138.777 -6.358  1.00   44.84 ? 177  ASP A CB  1 
ATOM   1413 C  CG  . ASP A 1 183 ? 45.111 138.841 -5.173  1.00   48.16 ? 177  ASP A CG  1 
ATOM   1414 O  OD1 . ASP A 1 183 ? 44.657 139.220 -4.062  1.00   52.11 ? 177  ASP A OD1 1 
ATOM   1415 O  OD2 . ASP A 1 183 ? 46.316 138.518 -5.350  1.00   55.11 ? 177  ASP A OD2 1 
ATOM   1416 N  N   . ASP A 1 184 ? 42.315 139.964 -8.572  1.00   44.80 ? 178  ASP A N   1 
ATOM   1417 C  CA  . ASP A 1 184 ? 42.248 140.575 -9.909  1.00   45.68 ? 178  ASP A CA  1 
ATOM   1418 C  C   . ASP A 1 184 ? 41.456 141.870 -9.988  1.00   44.93 ? 178  ASP A C   1 
ATOM   1419 O  O   . ASP A 1 184 ? 41.706 142.650 -10.901 1.00   45.46 ? 178  ASP A O   1 
ATOM   1420 C  CB  . ASP A 1 184 ? 41.694 139.564 -10.912 1.00   46.53 ? 178  ASP A CB  1 
ATOM   1421 C  CG  . ASP A 1 184 ? 40.670 138.587 -10.357 1.00   50.38 ? 178  ASP A CG  1 
ATOM   1422 O  OD1 . ASP A 1 184 ? 40.934 137.989 -9.294  1.00   52.33 ? 178  ASP A OD1 1 
ATOM   1423 O  OD2 . ASP A 1 184 ? 39.601 138.422 -10.982 1.00   56.65 ? 178  ASP A OD2 1 
ATOM   1424 N  N   . TRP A 1 185 ? 40.511 142.120 -9.071  1.00   43.77 ? 179  TRP A N   1 
ATOM   1425 C  CA  . TRP A 1 185 ? 39.629 143.284 -9.204  1.00   42.38 ? 179  TRP A CA  1 
ATOM   1426 C  C   . TRP A 1 185 ? 39.095 143.961 -7.930  1.00   41.60 ? 179  TRP A C   1 
ATOM   1427 O  O   . TRP A 1 185 ? 38.631 145.084 -8.028  1.00   41.23 ? 179  TRP A O   1 
ATOM   1428 C  CB  . TRP A 1 185 ? 38.436 142.912 -10.094 1.00   42.44 ? 179  TRP A CB  1 
ATOM   1429 C  CG  . TRP A 1 185 ? 37.501 141.885 -9.494  1.00   41.49 ? 179  TRP A CG  1 
ATOM   1430 C  CD1 . TRP A 1 185 ? 37.557 140.544 -9.672  1.00   42.13 ? 179  TRP A CD1 1 
ATOM   1431 C  CD2 . TRP A 1 185 ? 36.377 142.127 -8.640  1.00   40.93 ? 179  TRP A CD2 1 
ATOM   1432 N  NE1 . TRP A 1 185 ? 36.541 139.924 -8.989  1.00   41.55 ? 179  TRP A NE1 1 
ATOM   1433 C  CE2 . TRP A 1 185 ? 35.801 140.874 -8.340  1.00   42.05 ? 179  TRP A CE2 1 
ATOM   1434 C  CE3 . TRP A 1 185 ? 35.783 143.280 -8.109  1.00   40.85 ? 179  TRP A CE3 1 
ATOM   1435 C  CZ2 . TRP A 1 185 ? 34.664 140.736 -7.529  1.00   41.70 ? 179  TRP A CZ2 1 
ATOM   1436 C  CZ3 . TRP A 1 185 ? 34.661 143.143 -7.301  1.00   41.23 ? 179  TRP A CZ3 1 
ATOM   1437 C  CH2 . TRP A 1 185 ? 34.108 141.882 -7.025  1.00   40.58 ? 179  TRP A CH2 1 
ATOM   1438 N  N   . ALA A 1 186 ? 39.144 143.304 -6.767  1.00   40.74 ? 180  ALA A N   1 
ATOM   1439 C  CA  . ALA A 1 186 ? 38.462 143.800 -5.551  1.00   40.45 ? 180  ALA A CA  1 
ATOM   1440 C  C   . ALA A 1 186 ? 38.993 145.125 -5.011  1.00   40.58 ? 180  ALA A C   1 
ATOM   1441 O  O   . ALA A 1 186 ? 38.216 146.033 -4.708  1.00   40.39 ? 180  ALA A O   1 
ATOM   1442 C  CB  . ALA A 1 186 ? 38.503 142.747 -4.430  1.00   39.99 ? 180  ALA A CB  1 
ATOM   1443 N  N   . THR A 1 187 ? 40.306 145.234 -4.863  1.00   40.50 ? 181  THR A N   1 
ATOM   1444 C  CA  . THR A 1 187 ? 40.872 146.382 -4.191  1.00   41.16 ? 181  THR A CA  1 
ATOM   1445 C  C   . THR A 1 187 ? 41.657 147.254 -5.170  1.00   42.94 ? 181  THR A C   1 
ATOM   1446 O  O   . THR A 1 187 ? 42.611 146.789 -5.804  1.00   42.02 ? 181  THR A O   1 
ATOM   1447 C  CB  . THR A 1 187 ? 41.735 145.949 -2.998  1.00   41.31 ? 181  THR A CB  1 
ATOM   1448 O  OG1 . THR A 1 187 ? 40.982 145.076 -2.141  1.00   39.39 ? 181  THR A OG1 1 
ATOM   1449 C  CG2 . THR A 1 187 ? 42.093 147.157 -2.099  1.00   39.92 ? 181  THR A CG2 1 
ATOM   1450 N  N   . ARG A 1 188 ? 41.216 148.513 -5.264  1.00   44.92 ? 182  ARG A N   1 
ATOM   1451 C  CA  . ARG A 1 188 ? 41.748 149.533 -6.165  1.00   46.79 ? 182  ARG A CA  1 
ATOM   1452 C  C   . ARG A 1 188 ? 41.833 149.019 -7.581  1.00   47.77 ? 182  ARG A C   1 
ATOM   1453 O  O   . ARG A 1 188 ? 42.845 149.192 -8.236  1.00   48.58 ? 182  ARG A O   1 
ATOM   1454 C  CB  . ARG A 1 188 ? 43.109 150.055 -5.680  1.00   47.23 ? 182  ARG A CB  1 
ATOM   1455 C  CG  . ARG A 1 188 ? 43.040 150.826 -4.367  1.00   48.77 ? 182  ARG A CG  1 
ATOM   1456 C  CD  . ARG A 1 188 ? 44.377 151.430 -3.910  1.00   51.51 ? 182  ARG A CD  1 
ATOM   1457 N  NE  . ARG A 1 188 ? 44.923 152.322 -4.934  1.00   54.08 ? 182  ARG A NE  1 
ATOM   1458 C  CZ  . ARG A 1 188 ? 46.104 152.177 -5.536  1.00   55.84 ? 182  ARG A CZ  1 
ATOM   1459 N  NH1 . ARG A 1 188 ? 46.929 151.179 -5.239  1.00   57.72 ? 182  ARG A NH1 1 
ATOM   1460 N  NH2 . ARG A 1 188 ? 46.466 153.049 -6.459  1.00   57.09 ? 182  ARG A NH2 1 
ATOM   1461 N  N   . GLY A 1 189 ? 40.764 148.360 -8.033  1.00   48.79 ? 183  GLY A N   1 
ATOM   1462 C  CA  . GLY A 1 189 ? 40.680 147.817 -9.377  1.00   49.24 ? 183  GLY A CA  1 
ATOM   1463 C  C   . GLY A 1 189 ? 41.579 146.627 -9.629  1.00   49.91 ? 183  GLY A C   1 
ATOM   1464 O  O   . GLY A 1 189 ? 41.749 146.207 -10.773 1.00   50.80 ? 183  GLY A O   1 
ATOM   1465 N  N   . GLY A 1 190 ? 42.148 146.064 -8.572  1.00   50.18 ? 184  GLY A N   1 
ATOM   1466 C  CA  . GLY A 1 190 ? 43.054 144.940 -8.700  1.00   50.27 ? 184  GLY A CA  1 
ATOM   1467 C  C   . GLY A 1 190 ? 44.515 145.274 -8.480  1.00   50.59 ? 184  GLY A C   1 
ATOM   1468 O  O   . GLY A 1 190 ? 45.353 144.398 -8.641  1.00   51.12 ? 184  GLY A O   1 
ATOM   1469 N  N   . LEU A 1 191 ? 44.823 146.514 -8.095  1.00   51.07 ? 185  LEU A N   1 
ATOM   1470 C  CA  . LEU A 1 191 ? 46.207 146.930 -7.831  1.00   51.44 ? 185  LEU A CA  1 
ATOM   1471 C  C   . LEU A 1 191 ? 46.737 146.444 -6.490  1.00   50.78 ? 185  LEU A C   1 
ATOM   1472 O  O   . LEU A 1 191 ? 47.917 146.101 -6.375  1.00   51.75 ? 185  LEU A O   1 
ATOM   1473 C  CB  . LEU A 1 191 ? 46.341 148.456 -7.918  1.00   51.89 ? 185  LEU A CB  1 
ATOM   1474 C  CG  . LEU A 1 191 ? 46.265 148.985 -9.350  1.00   53.46 ? 185  LEU A CG  1 
ATOM   1475 C  CD1 . LEU A 1 191 ? 46.211 150.511 -9.360  1.00   54.63 ? 185  LEU A CD1 1 
ATOM   1476 C  CD2 . LEU A 1 191 ? 47.438 148.462 -10.199 1.00   54.81 ? 185  LEU A CD2 1 
ATOM   1477 N  N   . GLU A 1 192 ? 45.873 146.411 -5.477  1.00   49.67 ? 186  GLU A N   1 
ATOM   1478 C  CA  . GLU A 1 192 ? 46.234 145.884 -4.162  1.00   48.79 ? 186  GLU A CA  1 
ATOM   1479 C  C   . GLU A 1 192 ? 45.909 144.388 -4.029  1.00   47.93 ? 186  GLU A C   1 
ATOM   1480 O  O   . GLU A 1 192 ? 44.733 143.993 -3.984  1.00   48.13 ? 186  GLU A O   1 
ATOM   1481 C  CB  . GLU A 1 192 ? 45.514 146.671 -3.063  1.00   48.88 ? 186  GLU A CB  1 
ATOM   1482 C  CG  . GLU A 1 192 ? 45.817 148.161 -3.068  1.00   49.78 ? 186  GLU A CG  1 
ATOM   1483 C  CD  . GLU A 1 192 ? 47.222 148.511 -2.589  1.00   51.64 ? 186  GLU A CD  1 
ATOM   1484 O  OE1 . GLU A 1 192 ? 48.004 147.607 -2.204  1.00   52.12 ? 186  GLU A OE1 1 
ATOM   1485 O  OE2 . GLU A 1 192 ? 47.539 149.717 -2.580  1.00   54.08 ? 186  GLU A OE2 1 
ATOM   1486 N  N   . LYS A 1 193 ? 46.957 143.572 -3.932  1.00   46.67 ? 187  LYS A N   1 
ATOM   1487 C  CA  . LYS A 1 193 ? 46.837 142.119 -3.891  1.00   45.60 ? 187  LYS A CA  1 
ATOM   1488 C  C   . LYS A 1 193 ? 46.760 141.660 -2.465  1.00   44.22 ? 187  LYS A C   1 
ATOM   1489 O  O   . LYS A 1 193 ? 47.135 142.371 -1.541  1.00   44.18 ? 187  LYS A O   1 
ATOM   1490 C  CB  . LYS A 1 193 ? 48.031 141.459 -4.569  1.00   46.03 ? 187  LYS A CB  1 
ATOM   1491 C  CG  . LYS A 1 193 ? 48.315 141.986 -5.976  1.00   47.12 ? 187  LYS A CG  1 
ATOM   1492 C  CD  . LYS A 1 193 ? 47.303 141.476 -6.973  1.00   47.95 ? 187  LYS A CD  1 
ATOM   1493 C  CE  . LYS A 1 193 ? 47.483 142.134 -8.328  1.00   48.67 ? 187  LYS A CE  1 
ATOM   1494 N  NZ  . LYS A 1 193 ? 46.253 142.036 -9.169  1.00   47.58 ? 187  LYS A NZ  1 
ATOM   1495 N  N   . THR A 1 194 ? 46.293 140.447 -2.281  1.00   42.84 ? 188  THR A N   1 
ATOM   1496 C  CA  . THR A 1 194 ? 46.136 139.906 -0.956  1.00   42.32 ? 188  THR A CA  1 
ATOM   1497 C  C   . THR A 1 194 ? 47.482 139.603 -0.337  1.00   42.60 ? 188  THR A C   1 
ATOM   1498 O  O   . THR A 1 194 ? 48.361 139.033 -0.970  1.00   42.86 ? 188  THR A O   1 
ATOM   1499 C  CB  . THR A 1 194 ? 45.316 138.631 -1.031  1.00   42.18 ? 188  THR A CB  1 
ATOM   1500 O  OG1 . THR A 1 194 ? 44.007 138.951 -1.503  1.00   41.37 ? 188  THR A OG1 1 
ATOM   1501 C  CG2 . THR A 1 194 ? 45.101 138.037 0.339   1.00   41.34 ? 188  THR A CG2 1 
ATOM   1502 N  N   . ASP A 1 195 ? 47.628 139.975 0.918   1.00   42.45 ? 189  ASP A N   1 
ATOM   1503 C  CA  . ASP A 1 195 ? 48.789 139.612 1.689   1.00   42.15 ? 189  ASP A CA  1 
ATOM   1504 C  C   . ASP A 1 195 ? 48.460 138.353 2.465   1.00   41.45 ? 189  ASP A C   1 
ATOM   1505 O  O   . ASP A 1 195 ? 47.904 138.437 3.543   1.00   39.78 ? 189  ASP A O   1 
ATOM   1506 C  CB  . ASP A 1 195 ? 49.127 140.755 2.644   1.00   42.40 ? 189  ASP A CB  1 
ATOM   1507 C  CG  . ASP A 1 195 ? 50.419 140.527 3.387   1.00   44.38 ? 189  ASP A CG  1 
ATOM   1508 O  OD1 . ASP A 1 195 ? 50.977 139.395 3.314   1.00   45.66 ? 189  ASP A OD1 1 
ATOM   1509 O  OD2 . ASP A 1 195 ? 50.941 141.430 4.075   1.00   46.07 ? 189  ASP A OD2 1 
ATOM   1510 N  N   . TRP A 1 196 ? 48.833 137.189 1.923   1.00   41.43 ? 190  TRP A N   1 
ATOM   1511 C  CA  . TRP A 1 196 ? 48.483 135.901 2.536   1.00   41.76 ? 190  TRP A CA  1 
ATOM   1512 C  C   . TRP A 1 196 ? 49.127 135.620 3.878   1.00   41.89 ? 190  TRP A C   1 
ATOM   1513 O  O   . TRP A 1 196 ? 48.650 134.763 4.600   1.00   41.93 ? 190  TRP A O   1 
ATOM   1514 C  CB  . TRP A 1 196 ? 48.747 134.742 1.570   1.00   41.52 ? 190  TRP A CB  1 
ATOM   1515 C  CG  . TRP A 1 196 ? 47.844 134.829 0.415   1.00   40.89 ? 190  TRP A CG  1 
ATOM   1516 C  CD1 . TRP A 1 196 ? 48.163 135.201 -0.860  1.00   39.52 ? 190  TRP A CD1 1 
ATOM   1517 C  CD2 . TRP A 1 196 ? 46.437 134.611 0.430   1.00   38.21 ? 190  TRP A CD2 1 
ATOM   1518 N  NE1 . TRP A 1 196 ? 47.038 135.204 -1.643  1.00   39.61 ? 190  TRP A NE1 1 
ATOM   1519 C  CE2 . TRP A 1 196 ? 45.965 134.833 -0.878  1.00   39.52 ? 190  TRP A CE2 1 
ATOM   1520 C  CE3 . TRP A 1 196 ? 45.526 134.234 1.415   1.00   38.17 ? 190  TRP A CE3 1 
ATOM   1521 C  CZ2 . TRP A 1 196 ? 44.627 134.701 -1.217  1.00   39.43 ? 190  TRP A CZ2 1 
ATOM   1522 C  CZ3 . TRP A 1 196 ? 44.197 134.102 1.080   1.00   37.59 ? 190  TRP A CZ3 1 
ATOM   1523 C  CH2 . TRP A 1 196 ? 43.760 134.330 -0.220  1.00   38.78 ? 190  TRP A CH2 1 
ATOM   1524 N  N   . SER A 1 197 ? 50.179 136.352 4.237   1.00   43.11 ? 191  SER A N   1 
ATOM   1525 C  CA  . SER A 1 197 ? 50.734 136.268 5.602   1.00   44.24 ? 191  SER A CA  1 
ATOM   1526 C  C   . SER A 1 197 ? 49.788 136.848 6.644   1.00   44.17 ? 191  SER A C   1 
ATOM   1527 O  O   . SER A 1 197 ? 49.995 136.645 7.840   1.00   45.04 ? 191  SER A O   1 
ATOM   1528 C  CB  . SER A 1 197 ? 52.104 136.961 5.715   1.00   44.62 ? 191  SER A CB  1 
ATOM   1529 O  OG  . SER A 1 197 ? 52.035 138.299 5.240   1.00   46.71 ? 191  SER A OG  1 
ATOM   1530 N  N   . LYS A 1 198 ? 48.733 137.538 6.193   1.00   43.85 ? 192  LYS A N   1 
ATOM   1531 C  CA  . LYS A 1 198 ? 47.752 138.138 7.090   1.00   43.33 ? 192  LYS A CA  1 
ATOM   1532 C  C   . LYS A 1 198 ? 46.490 137.298 7.232   1.00   42.40 ? 192  LYS A C   1 
ATOM   1533 O  O   . LYS A 1 198 ? 45.502 137.758 7.789   1.00   42.18 ? 192  LYS A O   1 
ATOM   1534 C  CB  . LYS A 1 198 ? 47.404 139.544 6.612   1.00   44.14 ? 192  LYS A CB  1 
ATOM   1535 C  CG  . LYS A 1 198 ? 48.625 140.447 6.363   1.00   46.13 ? 192  LYS A CG  1 
ATOM   1536 C  CD  . LYS A 1 198 ? 49.266 140.943 7.647   1.00   47.96 ? 192  LYS A CD  1 
ATOM   1537 C  CE  . LYS A 1 198 ? 50.192 142.122 7.351   1.00   50.58 ? 192  LYS A CE  1 
ATOM   1538 N  NZ  . LYS A 1 198 ? 50.853 142.615 8.586   1.00   53.98 ? 192  LYS A NZ  1 
ATOM   1539 N  N   . ALA A 1 199 ? 46.541 136.055 6.760   1.00   40.81 ? 193  ALA A N   1 
ATOM   1540 C  CA  . ALA A 1 199 ? 45.429 135.133 6.863   1.00   39.89 ? 193  ALA A CA  1 
ATOM   1541 C  C   . ALA A 1 199 ? 45.496 134.471 8.234   1.00   39.06 ? 193  ALA A C   1 
ATOM   1542 O  O   . ALA A 1 199 ? 46.557 134.443 8.823   1.00   39.83 ? 193  ALA A O   1 
ATOM   1543 C  CB  . ALA A 1 199 ? 45.518 134.093 5.746   1.00   39.86 ? 193  ALA A CB  1 
ATOM   1544 N  N   . PRO A 1 200 ? 44.401 133.924 8.761   1.00   37.81 ? 194  PRO A N   1 
ATOM   1545 C  CA  . PRO A 1 200 ? 43.097 133.839 8.089   1.00   36.12 ? 194  PRO A CA  1 
ATOM   1546 C  C   . PRO A 1 200 ? 42.304 135.155 8.104   1.00   34.60 ? 194  PRO A C   1 
ATOM   1547 O  O   . PRO A 1 200 ? 42.357 135.925 9.077   1.00   33.82 ? 194  PRO A O   1 
ATOM   1548 C  CB  . PRO A 1 200 ? 42.366 132.776 8.908   1.00   36.16 ? 194  PRO A CB  1 
ATOM   1549 C  CG  . PRO A 1 200 ? 42.964 132.907 10.300  1.00   37.41 ? 194  PRO A CG  1 
ATOM   1550 C  CD  . PRO A 1 200 ? 44.371 133.318 10.109  1.00   37.55 ? 194  PRO A CD  1 
ATOM   1551 N  N   . PHE A 1 201 ? 41.610 135.416 6.994   1.00   32.60 ? 195  PHE A N   1 
ATOM   1552 C  CA  . PHE A 1 201 ? 40.655 136.521 6.905   1.00   29.95 ? 195  PHE A CA  1 
ATOM   1553 C  C   . PHE A 1 201 ? 39.331 135.968 7.399   1.00   28.88 ? 195  PHE A C   1 
ATOM   1554 O  O   . PHE A 1 201 ? 38.884 134.910 6.938   1.00   28.36 ? 195  PHE A O   1 
ATOM   1555 C  CB  . PHE A 1 201 ? 40.586 137.021 5.484   1.00   29.95 ? 195  PHE A CB  1 
ATOM   1556 C  CG  . PHE A 1 201 ? 41.917 137.424 4.932   1.00   30.78 ? 195  PHE A CG  1 
ATOM   1557 C  CD1 . PHE A 1 201 ? 42.481 138.648 5.271   1.00   30.89 ? 195  PHE A CD1 1 
ATOM   1558 C  CD2 . PHE A 1 201 ? 42.639 136.557 4.114   1.00   33.98 ? 195  PHE A CD2 1 
ATOM   1559 C  CE1 . PHE A 1 201 ? 43.710 139.009 4.789   1.00   31.61 ? 195  PHE A CE1 1 
ATOM   1560 C  CE2 . PHE A 1 201 ? 43.887 136.916 3.613   1.00   33.64 ? 195  PHE A CE2 1 
ATOM   1561 C  CZ  . PHE A 1 201 ? 44.426 138.142 3.939   1.00   33.36 ? 195  PHE A CZ  1 
ATOM   1562 N  N   . ILE A 1 202 ? 38.756 136.638 8.387   1.00   27.56 ? 196  ILE A N   1 
ATOM   1563 C  CA  . ILE A 1 202 ? 37.578 136.180 9.094   1.00   28.06 ? 196  ILE A CA  1 
ATOM   1564 C  C   . ILE A 1 202 ? 36.379 137.173 8.957   1.00   27.56 ? 196  ILE A C   1 
ATOM   1565 O  O   . ILE A 1 202 ? 36.495 138.311 9.367   1.00   27.19 ? 196  ILE A O   1 
ATOM   1566 C  CB  . ILE A 1 202 ? 37.912 135.986 10.568  1.00   27.90 ? 196  ILE A CB  1 
ATOM   1567 C  CG1 . ILE A 1 202 ? 38.996 134.888 10.735  1.00   31.00 ? 196  ILE A CG1 1 
ATOM   1568 C  CG2 . ILE A 1 202 ? 36.651 135.676 11.325  1.00   28.64 ? 196  ILE A CG2 1 
ATOM   1569 C  CD1 . ILE A 1 202 ? 39.706 134.843 12.145  1.00   31.59 ? 196  ILE A CD1 1 
ATOM   1570 N  N   . ALA A 1 203 ? 35.255 136.708 8.403   1.00   26.54 ? 197  ALA A N   1 
ATOM   1571 C  CA  . ALA A 1 203 ? 33.994 137.459 8.338   1.00   26.43 ? 197  ALA A CA  1 
ATOM   1572 C  C   . ALA A 1 203 ? 33.033 136.800 9.276   1.00   26.15 ? 197  ALA A C   1 
ATOM   1573 O  O   . ALA A 1 203 ? 33.002 135.567 9.352   1.00   26.73 ? 197  ALA A O   1 
ATOM   1574 C  CB  . ALA A 1 203 ? 33.436 137.438 6.912   1.00   25.92 ? 197  ALA A CB  1 
ATOM   1575 N  N   . SER A 1 204 ? 32.280 137.583 10.039  1.00   25.14 ? 198  SER A N   1 
ATOM   1576 C  CA  . SER A 1 204 ? 31.372 137.035 11.055  1.00   25.24 ? 198  SER A CA  1 
ATOM   1577 C  C   . SER A 1 204 ? 29.922 137.378 10.782  1.00   25.72 ? 198  SER A C   1 
ATOM   1578 O  O   . SER A 1 204 ? 29.617 138.439 10.257  1.00   24.99 ? 198  SER A O   1 
ATOM   1579 C  CB  . SER A 1 204 ? 31.764 137.570 12.460  1.00   25.79 ? 198  SER A CB  1 
ATOM   1580 O  OG  . SER A 1 204 ? 33.188 137.552 12.616  1.00   26.55 ? 198  SER A OG  1 
ATOM   1581 N  N   . TYR A 1 205 ? 29.031 136.490 11.188  1.00   25.96 ? 199  TYR A N   1 
ATOM   1582 C  CA  . TYR A 1 205 ? 27.631 136.575 10.883  1.00   26.94 ? 199  TYR A CA  1 
ATOM   1583 C  C   . TYR A 1 205 ? 26.796 136.254 12.110  1.00   28.40 ? 199  TYR A C   1 
ATOM   1584 O  O   . TYR A 1 205 ? 27.186 135.410 12.917  1.00   26.97 ? 199  TYR A O   1 
ATOM   1585 C  CB  . TYR A 1 205 ? 27.267 135.519 9.850   1.00   26.31 ? 199  TYR A CB  1 
ATOM   1586 C  CG  . TYR A 1 205 ? 27.913 135.666 8.517   1.00   26.85 ? 199  TYR A CG  1 
ATOM   1587 C  CD1 . TYR A 1 205 ? 29.259 135.380 8.334   1.00   24.92 ? 199  TYR A CD1 1 
ATOM   1588 C  CD2 . TYR A 1 205 ? 27.163 136.048 7.416   1.00   25.18 ? 199  TYR A CD2 1 
ATOM   1589 C  CE1 . TYR A 1 205 ? 29.846 135.522 7.110   1.00   26.49 ? 199  TYR A CE1 1 
ATOM   1590 C  CE2 . TYR A 1 205 ? 27.739 136.175 6.164   1.00   26.28 ? 199  TYR A CE2 1 
ATOM   1591 C  CZ  . TYR A 1 205 ? 29.078 135.912 6.014   1.00   26.01 ? 199  TYR A CZ  1 
ATOM   1592 O  OH  . TYR A 1 205 ? 29.647 136.018 4.766   1.00   28.52 ? 199  TYR A OH  1 
ATOM   1593 N  N   . ARG A 1 206 ? 25.622 136.882 12.181  1.00   29.64 ? 200  ARG A N   1 
ATOM   1594 C  CA  . ARG A 1 206 ? 24.540 136.585 13.128  1.00   30.95 ? 200  ARG A CA  1 
ATOM   1595 C  C   . ARG A 1 206 ? 23.162 136.784 12.457  1.00   32.41 ? 200  ARG A C   1 
ATOM   1596 O  O   . ARG A 1 206 ? 23.083 137.272 11.320  1.00   30.63 ? 200  ARG A O   1 
ATOM   1597 C  CB  . ARG A 1 206 ? 24.589 137.537 14.313  1.00   31.46 ? 200  ARG A CB  1 
ATOM   1598 C  CG  . ARG A 1 206 ? 25.765 137.434 15.217  1.00   33.31 ? 200  ARG A CG  1 
ATOM   1599 C  CD  . ARG A 1 206 ? 25.696 138.436 16.377  1.00   36.08 ? 200  ARG A CD  1 
ATOM   1600 N  NE  . ARG A 1 206 ? 26.864 138.316 17.262  1.00   41.03 ? 200  ARG A NE  1 
ATOM   1601 C  CZ  . ARG A 1 206 ? 27.224 139.235 18.177  1.00   46.15 ? 200  ARG A CZ  1 
ATOM   1602 N  NH1 . ARG A 1 206 ? 26.515 140.347 18.334  1.00   47.36 ? 200  ARG A NH1 1 
ATOM   1603 N  NH2 . ARG A 1 206 ? 28.306 139.051 18.933  1.00   47.07 ? 200  ARG A NH2 1 
ATOM   1604 N  N   . SER A 1 207 ? 22.106 136.409 13.193  1.00   33.63 ? 201  SER A N   1 
ATOM   1605 C  CA  . SER A 1 207 ? 20.677 136.585 12.856  1.00   35.37 ? 201  SER A CA  1 
ATOM   1606 C  C   . SER A 1 207 ? 20.115 135.585 11.859  1.00   35.35 ? 201  SER A C   1 
ATOM   1607 O  O   . SER A 1 207 ? 19.234 134.827 12.201  1.00   35.47 ? 201  SER A O   1 
ATOM   1608 C  CB  . SER A 1 207 ? 20.318 138.002 12.414  1.00   36.25 ? 201  SER A CB  1 
ATOM   1609 O  OG  . SER A 1 207 ? 20.662 138.900 13.455  1.00   42.41 ? 201  SER A OG  1 
ATOM   1610 N  N   . PHE A 1 208 ? 20.573 135.575 10.619  1.00   35.96 ? 202  PHE A N   1 
ATOM   1611 C  CA  . PHE A 1 208 ? 20.198 134.452 9.740   1.00   36.28 ? 202  PHE A CA  1 
ATOM   1612 C  C   . PHE A 1 208 ? 18.706 134.460 9.471   1.00   36.77 ? 202  PHE A C   1 
ATOM   1613 O  O   . PHE A 1 208 ? 18.082 133.400 9.374   1.00   37.63 ? 202  PHE A O   1 
ATOM   1614 C  CB  . PHE A 1 208 ? 20.601 133.099 10.364  1.00   35.98 ? 202  PHE A CB  1 
ATOM   1615 C  CG  . PHE A 1 208 ? 22.050 133.043 10.739  1.00   34.89 ? 202  PHE A CG  1 
ATOM   1616 C  CD1 . PHE A 1 208 ? 23.014 133.161 9.764   1.00   31.61 ? 202  PHE A CD1 1 
ATOM   1617 C  CD2 . PHE A 1 208 ? 22.451 132.930 12.075  1.00   33.21 ? 202  PHE A CD2 1 
ATOM   1618 C  CE1 . PHE A 1 208 ? 24.363 133.166 10.091  1.00   30.66 ? 202  PHE A CE1 1 
ATOM   1619 C  CE2 . PHE A 1 208 ? 23.801 132.947 12.397  1.00   31.72 ? 202  PHE A CE2 1 
ATOM   1620 C  CZ  . PHE A 1 208 ? 24.746 133.054 11.396  1.00   31.05 ? 202  PHE A CZ  1 
ATOM   1621 N  N   . HIS A 1 209 ? 18.151 135.668 9.388   1.00   37.21 ? 203  HIS A N   1 
ATOM   1622 C  CA  . HIS A 1 209 ? 16.704 135.874 9.309   1.00   37.78 ? 203  HIS A CA  1 
ATOM   1623 C  C   . HIS A 1 209 ? 16.178 135.604 7.921   1.00   36.82 ? 203  HIS A C   1 
ATOM   1624 O  O   . HIS A 1 209 ? 16.606 136.245 6.948   1.00   36.73 ? 203  HIS A O   1 
ATOM   1625 C  CB  . HIS A 1 209 ? 16.347 137.322 9.700   1.00   38.23 ? 203  HIS A CB  1 
ATOM   1626 C  CG  . HIS A 1 209 ? 14.869 137.600 9.678   1.00   41.69 ? 203  HIS A CG  1 
ATOM   1627 N  ND1 . HIS A 1 209 ? 14.284 138.496 8.799   1.00   46.19 ? 203  HIS A ND1 1 
ATOM   1628 C  CD2 . HIS A 1 209 ? 13.858 137.088 10.421  1.00   45.86 ? 203  HIS A CD2 1 
ATOM   1629 C  CE1 . HIS A 1 209 ? 12.979 138.528 9.012   1.00   47.43 ? 203  HIS A CE1 1 
ATOM   1630 N  NE2 . HIS A 1 209 ? 12.694 137.687 9.994   1.00   47.95 ? 203  HIS A NE2 1 
ATOM   1631 N  N   . ILE A 1 210 ? 15.254 134.662 7.810   1.00   36.99 ? 204  ILE A N   1 
ATOM   1632 C  CA  . ILE A 1 210 ? 14.513 134.491 6.557   1.00   36.74 ? 204  ILE A CA  1 
ATOM   1633 C  C   . ILE A 1 210 ? 13.005 134.550 6.773   1.00   36.86 ? 204  ILE A C   1 
ATOM   1634 O  O   . ILE A 1 210 ? 12.443 133.678 7.407   1.00   37.76 ? 204  ILE A O   1 
ATOM   1635 C  CB  . ILE A 1 210 ? 14.842 133.168 5.877   1.00   36.71 ? 204  ILE A CB  1 
ATOM   1636 C  CG1 . ILE A 1 210 ? 16.362 133.024 5.652   1.00   36.07 ? 204  ILE A CG1 1 
ATOM   1637 C  CG2 . ILE A 1 210 ? 14.071 133.065 4.562   1.00   36.97 ? 204  ILE A CG2 1 
ATOM   1638 C  CD1 . ILE A 1 210 ? 16.748 131.674 5.072   1.00   35.32 ? 204  ILE A CD1 1 
ATOM   1639 N  N   . ASP A 1 211 ? 12.364 135.543 6.178   1.00   36.61 ? 205  ASP A N   1 
ATOM   1640 C  CA  . ASP A 1 211 ? 10.917 135.654 6.180   1.00   37.08 ? 205  ASP A CA  1 
ATOM   1641 C  C   . ASP A 1 211 ? 10.458 135.762 4.721   1.00   37.08 ? 205  ASP A C   1 
ATOM   1642 O  O   . ASP A 1 211 ? 10.448 136.833 4.140   1.00   35.37 ? 205  ASP A O   1 
ATOM   1643 C  CB  . ASP A 1 211 ? 10.555 136.887 6.972   1.00   37.25 ? 205  ASP A CB  1 
ATOM   1644 C  CG  . ASP A 1 211 ? 9.070  137.016 7.229   1.00   39.88 ? 205  ASP A CG  1 
ATOM   1645 O  OD1 . ASP A 1 211 ? 8.299  136.041 7.110   1.00   38.83 ? 205  ASP A OD1 1 
ATOM   1646 O  OD2 . ASP A 1 211 ? 8.616  138.103 7.597   1.00   44.49 ? 205  ASP A OD2 1 
ATOM   1647 N  N   . GLY A 1 212 ? 10.103 134.633 4.136   1.00   38.73 ? 206  GLY A N   1 
ATOM   1648 C  CA  . GLY A 1 212 ? 9.807  134.580 2.730   1.00   40.92 ? 206  GLY A CA  1 
ATOM   1649 C  C   . GLY A 1 212 ? 8.761  133.573 2.327   1.00   43.10 ? 206  GLY A C   1 
ATOM   1650 O  O   . GLY A 1 212 ? 8.377  132.702 3.096   1.00   41.95 ? 206  GLY A O   1 
ATOM   1651 N  N   . CYS A 1 213 ? 8.320  133.727 1.083   1.00   46.15 ? 207  CYS A N   1 
ATOM   1652 C  CA  . CYS A 1 213 ? 7.407  132.797 0.433   1.00   49.73 ? 207  CYS A CA  1 
ATOM   1653 C  C   . CYS A 1 213 ? 8.155  131.545 -0.048  1.00   51.07 ? 207  CYS A C   1 
ATOM   1654 O  O   . CYS A 1 213 ? 8.742  131.542 -1.135  1.00   50.66 ? 207  CYS A O   1 
ATOM   1655 C  CB  . CYS A 1 213 ? 6.748  133.476 -0.778  1.00   50.06 ? 207  CYS A CB  1 
ATOM   1656 S  SG  . CYS A 1 213 ? 5.132  134.233 -0.490  1.00   56.67 ? 207  CYS A SG  1 
ATOM   1657 N  N   . GLU A 1 214 ? 8.114  130.484 0.743   1.00   53.04 ? 208  GLU A N   1 
ATOM   1658 C  CA  . GLU A 1 214 ? 8.697  129.210 0.339   1.00   55.66 ? 208  GLU A CA  1 
ATOM   1659 C  C   . GLU A 1 214 ? 8.086  128.628 -0.934  1.00   57.34 ? 208  GLU A C   1 
ATOM   1660 O  O   . GLU A 1 214 ? 6.886  128.341 -0.990  1.00   57.31 ? 208  GLU A O   1 
ATOM   1661 C  CB  . GLU A 1 214 ? 8.522  128.183 1.436   1.00   56.12 ? 208  GLU A CB  1 
ATOM   1662 C  CG  . GLU A 1 214 ? 9.634  128.172 2.442   1.00   58.85 ? 208  GLU A CG  1 
ATOM   1663 C  CD  . GLU A 1 214 ? 10.094 126.768 2.732   1.00   63.04 ? 208  GLU A CD  1 
ATOM   1664 O  OE1 . GLU A 1 214 ? 10.915 126.237 1.937   1.00   65.27 ? 208  GLU A OE1 1 
ATOM   1665 O  OE2 . GLU A 1 214 ? 9.610  126.200 3.741   1.00   66.04 ? 208  GLU A OE2 1 
ATOM   1666 N  N   . ALA A 1 215 ? 8.930  128.421 -1.934  1.00   59.30 ? 209  ALA A N   1 
ATOM   1667 C  CA  . ALA A 1 215 ? 8.484  127.976 -3.236  1.00   61.58 ? 209  ALA A CA  1 
ATOM   1668 C  C   . ALA A 1 215 ? 9.565  127.122 -3.843  1.00   64.09 ? 209  ALA A C   1 
ATOM   1669 O  O   . ALA A 1 215 ? 10.612 127.633 -4.245  1.00   64.71 ? 209  ALA A O   1 
ATOM   1670 C  CB  . ALA A 1 215 ? 8.204  129.158 -4.117  1.00   61.61 ? 209  ALA A CB  1 
ATOM   1671 N  N   . SER A 1 216 ? 9.309  125.819 -3.903  1.00   66.90 ? 210  SER A N   1 
ATOM   1672 C  CA  . SER A 1 216 ? 10.277 124.834 -4.411  1.00   68.97 ? 210  SER A CA  1 
ATOM   1673 C  C   . SER A 1 216 ? 10.796 125.145 -5.836  1.00   70.45 ? 210  SER A C   1 
ATOM   1674 O  O   . SER A 1 216 ? 10.128 125.822 -6.621  1.00   70.77 ? 210  SER A O   1 
ATOM   1675 C  CB  . SER A 1 216 ? 9.638  123.434 -4.366  1.00   69.13 ? 210  SER A CB  1 
ATOM   1676 O  OG  . SER A 1 216 ? 10.583 122.410 -4.639  1.00   70.85 ? 210  SER A OG  1 
ATOM   1677 N  N   . VAL A 1 217 ? 11.999 124.660 -6.154  1.00   72.22 ? 211  VAL A N   1 
ATOM   1678 C  CA  . VAL A 1 217 ? 12.531 124.726 -7.526  1.00   73.51 ? 211  VAL A CA  1 
ATOM   1679 C  C   . VAL A 1 217 ? 11.645 123.860 -8.467  1.00   74.59 ? 211  VAL A C   1 
ATOM   1680 O  O   . VAL A 1 217 ? 11.539 124.137 -9.668  1.00   74.97 ? 211  VAL A O   1 
ATOM   1681 C  CB  . VAL A 1 217 ? 14.040 124.275 -7.602  1.00   73.65 ? 211  VAL A CB  1 
ATOM   1682 C  CG1 . VAL A 1 217 ? 14.614 124.490 -9.011  1.00   73.48 ? 211  VAL A CG1 1 
ATOM   1683 C  CG2 . VAL A 1 217 ? 14.900 125.007 -6.541  1.00   73.75 ? 211  VAL A CG2 1 
ATOM   1684 N  N   . GLU A 1 218 ? 11.003 122.833 -7.901  1.00   75.67 ? 212  GLU A N   1 
ATOM   1685 C  CA  . GLU A 1 218 ? 10.044 121.990 -8.630  1.00   76.35 ? 212  GLU A CA  1 
ATOM   1686 C  C   . GLU A 1 218 ? 8.636  122.616 -8.743  1.00   76.61 ? 212  GLU A C   1 
ATOM   1687 O  O   . GLU A 1 218 ? 8.219  123.000 -9.843  1.00   77.16 ? 212  GLU A O   1 
ATOM   1688 C  CB  . GLU A 1 218 ? 9.966  120.603 -7.981  1.00   76.48 ? 212  GLU A CB  1 
ATOM   1689 C  CG  . GLU A 1 218 ? 9.319  119.549 -8.862  1.00   77.19 ? 212  GLU A CG  1 
ATOM   1690 C  CD  . GLU A 1 218 ? 9.580  118.144 -8.366  1.00   78.47 ? 212  GLU A CD  1 
ATOM   1691 O  OE1 . GLU A 1 218 ? 9.547  117.929 -7.133  1.00   79.55 ? 212  GLU A OE1 1 
ATOM   1692 O  OE2 . GLU A 1 218 ? 9.818  117.252 -9.209  1.00   79.97 ? 212  GLU A OE2 1 
ATOM   1693 N  N   . ALA A 1 219 ? 7.910  122.713 -7.623  1.00   76.63 ? 213  ALA A N   1 
ATOM   1694 C  CA  . ALA A 1 219 ? 6.562  123.303 -7.611  1.00   76.41 ? 213  ALA A CA  1 
ATOM   1695 C  C   . ALA A 1 219 ? 6.580  124.742 -8.153  1.00   76.23 ? 213  ALA A C   1 
ATOM   1696 O  O   . ALA A 1 219 ? 5.683  125.141 -8.899  1.00   76.30 ? 213  ALA A O   1 
ATOM   1697 C  CB  . ALA A 1 219 ? 5.960  123.261 -6.196  1.00   76.40 ? 213  ALA A CB  1 
ATOM   1698 N  N   . LYS A 1 220 ? 7.607  125.503 -7.760  1.00   75.81 ? 214  LYS A N   1 
ATOM   1699 C  CA  . LYS A 1 220 ? 7.920  126.838 -8.314  1.00   75.25 ? 214  LYS A CA  1 
ATOM   1700 C  C   . LYS A 1 220 ? 6.923  127.961 -7.940  1.00   74.67 ? 214  LYS A C   1 
ATOM   1701 O  O   . LYS A 1 220 ? 6.903  129.021 -8.583  1.00   74.78 ? 214  LYS A O   1 
ATOM   1702 C  CB  . LYS A 1 220 ? 8.143  126.764 -9.845  1.00   75.38 ? 214  LYS A CB  1 
ATOM   1703 C  CG  . LYS A 1 220 ? 9.521  127.288 -10.300 1.00   75.37 ? 214  LYS A CG  1 
ATOM   1704 C  CD  . LYS A 1 220 ? 9.636  127.381 -11.826 1.00   74.89 ? 214  LYS A CD  1 
ATOM   1705 C  CE  . LYS A 1 220 ? 8.912  128.608 -12.391 1.00   74.57 ? 214  LYS A CE  1 
ATOM   1706 N  NZ  . LYS A 1 220 ? 9.787  129.435 -13.278 1.00   74.35 ? 214  LYS A NZ  1 
ATOM   1707 N  N   . PHE A 1 221 ? 6.125  127.739 -6.892  1.00   73.76 ? 215  PHE A N   1 
ATOM   1708 C  CA  . PHE A 1 221 ? 5.181  128.760 -6.413  1.00   73.00 ? 215  PHE A CA  1 
ATOM   1709 C  C   . PHE A 1 221 ? 4.838  128.608 -4.928  1.00   71.84 ? 215  PHE A C   1 
ATOM   1710 O  O   . PHE A 1 221 ? 5.016  127.542 -4.330  1.00   72.01 ? 215  PHE A O   1 
ATOM   1711 C  CB  . PHE A 1 221 ? 3.896  128.784 -7.276  1.00   73.22 ? 215  PHE A CB  1 
ATOM   1712 C  CG  . PHE A 1 221 ? 2.817  127.826 -6.817  1.00   74.15 ? 215  PHE A CG  1 
ATOM   1713 C  CD1 . PHE A 1 221 ? 2.929  126.457 -7.066  1.00   75.33 ? 215  PHE A CD1 1 
ATOM   1714 C  CD2 . PHE A 1 221 ? 1.685  128.294 -6.143  1.00   75.19 ? 215  PHE A CD2 1 
ATOM   1715 C  CE1 . PHE A 1 221 ? 1.934  125.561 -6.644  1.00   75.36 ? 215  PHE A CE1 1 
ATOM   1716 C  CE2 . PHE A 1 221 ? 0.683  127.404 -5.716  1.00   75.30 ? 215  PHE A CE2 1 
ATOM   1717 C  CZ  . PHE A 1 221 ? 0.812  126.037 -5.970  1.00   75.61 ? 215  PHE A CZ  1 
ATOM   1718 N  N   . CYS A 1 222 ? 4.350  129.695 -4.345  1.00   70.33 ? 216  CYS A N   1 
ATOM   1719 C  CA  . CYS A 1 222 ? 3.931  129.707 -2.952  1.00   69.03 ? 216  CYS A CA  1 
ATOM   1720 C  C   . CYS A 1 222 ? 2.431  129.975 -2.850  1.00   67.84 ? 216  CYS A C   1 
ATOM   1721 O  O   . CYS A 1 222 ? 1.916  130.864 -3.516  1.00   67.73 ? 216  CYS A O   1 
ATOM   1722 C  CB  . CYS A 1 222 ? 4.705  130.775 -2.191  1.00   68.98 ? 216  CYS A CB  1 
ATOM   1723 S  SG  . CYS A 1 222 ? 4.303  130.802 -0.437  1.00   68.87 ? 216  CYS A SG  1 
ATOM   1724 N  N   . ALA A 1 223 ? 1.750  129.220 -1.991  1.00   66.49 ? 217  ALA A N   1 
ATOM   1725 C  CA  . ALA A 1 223 ? 0.291  129.292 -1.861  1.00   65.51 ? 217  ALA A CA  1 
ATOM   1726 C  C   . ALA A 1 223 ? -0.251 130.591 -1.220  1.00   64.63 ? 217  ALA A C   1 
ATOM   1727 O  O   . ALA A 1 223 ? -1.366 131.020 -1.558  1.00   65.19 ? 217  ALA A O   1 
ATOM   1728 C  CB  . ALA A 1 223 ? -0.222 128.079 -1.106  1.00   65.44 ? 217  ALA A CB  1 
ATOM   1729 N  N   . THR A 1 224 ? 0.518  131.225 -0.324  1.00   62.96 ? 218  THR A N   1 
ATOM   1730 C  CA  . THR A 1 224 ? 0.067  132.470 0.327   1.00   61.48 ? 218  THR A CA  1 
ATOM   1731 C  C   . THR A 1 224 ? 0.472  133.758 -0.433  1.00   59.97 ? 218  THR A C   1 
ATOM   1732 O  O   . THR A 1 224 ? 0.463  134.843 0.150   1.00   59.77 ? 218  THR A O   1 
ATOM   1733 C  CB  . THR A 1 224 ? 0.554  132.524 1.802   1.00   61.80 ? 218  THR A CB  1 
ATOM   1734 O  OG1 . THR A 1 224 ? 1.963  132.261 1.880   1.00   62.59 ? 218  THR A OG1 1 
ATOM   1735 C  CG2 . THR A 1 224 ? -0.065 131.392 2.642   1.00   62.14 ? 218  THR A CG2 1 
ATOM   1736 N  N   . GLN A 1 225 ? 0.770  133.639 -1.734  1.00   57.98 ? 219  GLN A N   1 
ATOM   1737 C  CA  . GLN A 1 225 ? 1.298  134.745 -2.548  1.00   56.47 ? 219  GLN A CA  1 
ATOM   1738 C  C   . GLN A 1 225 ? 0.269  135.863 -2.766  1.00   55.95 ? 219  GLN A C   1 
ATOM   1739 O  O   . GLN A 1 225 ? -0.894 135.598 -3.056  1.00   55.21 ? 219  GLN A O   1 
ATOM   1740 C  CB  . GLN A 1 225 ? 1.793  134.216 -3.912  1.00   56.14 ? 219  GLN A CB  1 
ATOM   1741 C  CG  . GLN A 1 225 ? 2.258  135.283 -4.939  1.00   54.92 ? 219  GLN A CG  1 
ATOM   1742 C  CD  . GLN A 1 225 ? 3.211  136.331 -4.352  1.00   54.92 ? 219  GLN A CD  1 
ATOM   1743 O  OE1 . GLN A 1 225 ? 4.173  136.000 -3.621  1.00   52.78 ? 219  GLN A OE1 1 
ATOM   1744 N  NE2 . GLN A 1 225 ? 2.963  137.592 -4.686  1.00   53.79 ? 219  GLN A NE2 1 
ATOM   1745 N  N   . GLY A 1 226 ? 0.722  137.109 -2.641  1.00   55.20 ? 220  GLY A N   1 
ATOM   1746 C  CA  . GLY A 1 226 ? -0.127 138.284 -2.807  1.00   55.02 ? 220  GLY A CA  1 
ATOM   1747 C  C   . GLY A 1 226 ? -0.803 138.729 -1.519  1.00   54.55 ? 220  GLY A C   1 
ATOM   1748 O  O   . GLY A 1 226 ? -1.373 139.824 -1.468  1.00   55.27 ? 220  GLY A O   1 
ATOM   1749 N  N   . ALA A 1 227 ? -0.695 137.888 -0.487  1.00   54.04 ? 221  ALA A N   1 
ATOM   1750 C  CA  . ALA A 1 227 ? -1.357 138.045 0.818   1.00   53.42 ? 221  ALA A CA  1 
ATOM   1751 C  C   . ALA A 1 227 ? -0.380 138.221 1.988   1.00   52.60 ? 221  ALA A C   1 
ATOM   1752 O  O   . ALA A 1 227 ? -0.799 138.227 3.142   1.00   52.91 ? 221  ALA A O   1 
ATOM   1753 C  CB  . ALA A 1 227 ? -2.209 136.804 1.097   1.00   53.68 ? 221  ALA A CB  1 
ATOM   1754 N  N   . ARG A 1 228 ? 0.920  138.314 1.714   1.00   50.93 ? 222  ARG A N   1 
ATOM   1755 C  CA  . ARG A 1 228 ? 1.908  138.443 2.790   1.00   49.49 ? 222  ARG A CA  1 
ATOM   1756 C  C   . ARG A 1 228 ? 2.009  139.899 3.212   1.00   47.56 ? 222  ARG A C   1 
ATOM   1757 O  O   . ARG A 1 228 ? 1.534  140.779 2.509   1.00   47.53 ? 222  ARG A O   1 
ATOM   1758 C  CB  . ARG A 1 228 ? 3.278  137.898 2.324   1.00   49.74 ? 222  ARG A CB  1 
ATOM   1759 C  CG  . ARG A 1 228 ? 3.242  136.446 1.825   1.00   49.69 ? 222  ARG A CG  1 
ATOM   1760 C  CD  . ARG A 1 228 ? 2.788  135.419 2.849   1.00   51.17 ? 222  ARG A CD  1 
ATOM   1761 N  NE  . ARG A 1 228 ? 3.734  135.247 3.958   1.00   52.71 ? 222  ARG A NE  1 
ATOM   1762 C  CZ  . ARG A 1 228 ? 4.636  134.261 4.084   1.00   53.77 ? 222  ARG A CZ  1 
ATOM   1763 N  NH1 . ARG A 1 228 ? 4.768  133.292 3.172   1.00   53.86 ? 222  ARG A NH1 1 
ATOM   1764 N  NH2 . ARG A 1 228 ? 5.429  134.252 5.147   1.00   54.17 ? 222  ARG A NH2 1 
ATOM   1765 N  N   . TRP A 1 229 ? 2.640  140.176 4.342   1.00   46.26 ? 223  TRP A N   1 
ATOM   1766 C  CA  . TRP A 1 229 ? 2.775  141.570 4.766   1.00   45.47 ? 223  TRP A CA  1 
ATOM   1767 C  C   . TRP A 1 229 ? 3.549  142.469 3.802   1.00   44.93 ? 223  TRP A C   1 
ATOM   1768 O  O   . TRP A 1 229 ? 3.250  143.660 3.718   1.00   44.29 ? 223  TRP A O   1 
ATOM   1769 C  CB  . TRP A 1 229 ? 3.332  141.686 6.179   1.00   45.65 ? 223  TRP A CB  1 
ATOM   1770 C  CG  . TRP A 1 229 ? 4.703  141.141 6.397   1.00   45.41 ? 223  TRP A CG  1 
ATOM   1771 C  CD1 . TRP A 1 229 ? 5.016  139.942 6.949   1.00   46.23 ? 223  TRP A CD1 1 
ATOM   1772 C  CD2 . TRP A 1 229 ? 5.942  141.798 6.128   1.00   43.65 ? 223  TRP A CD2 1 
ATOM   1773 N  NE1 . TRP A 1 229 ? 6.381  139.794 7.021   1.00   47.13 ? 223  TRP A NE1 1 
ATOM   1774 C  CE2 . TRP A 1 229 ? 6.976  140.927 6.532   1.00   44.87 ? 223  TRP A CE2 1 
ATOM   1775 C  CE3 . TRP A 1 229 ? 6.289  143.025 5.570   1.00   44.11 ? 223  TRP A CE3 1 
ATOM   1776 C  CZ2 . TRP A 1 229 ? 8.324  141.243 6.395   1.00   43.23 ? 223  TRP A CZ2 1 
ATOM   1777 C  CZ3 . TRP A 1 229 ? 7.646  143.342 5.443   1.00   45.32 ? 223  TRP A CZ3 1 
ATOM   1778 C  CH2 . TRP A 1 229 ? 8.639  142.452 5.863   1.00   42.85 ? 223  TRP A CH2 1 
ATOM   1779 N  N   . TRP A 1 230 ? 4.519  141.913 3.067   1.00   44.11 ? 224  TRP A N   1 
ATOM   1780 C  CA  . TRP A 1 230 ? 5.258  142.693 2.068   1.00   44.11 ? 224  TRP A CA  1 
ATOM   1781 C  C   . TRP A 1 230 ? 4.455  142.910 0.771   1.00   44.87 ? 224  TRP A C   1 
ATOM   1782 O  O   . TRP A 1 230 ? 4.904  143.631 -0.101  1.00   44.77 ? 224  TRP A O   1 
ATOM   1783 C  CB  . TRP A 1 230 ? 6.632  142.054 1.744   1.00   43.70 ? 224  TRP A CB  1 
ATOM   1784 C  CG  . TRP A 1 230 ? 6.514  140.636 1.315   1.00   40.32 ? 224  TRP A CG  1 
ATOM   1785 C  CD1 . TRP A 1 230 ? 6.084  140.200 0.117   1.00   37.64 ? 224  TRP A CD1 1 
ATOM   1786 C  CD2 . TRP A 1 230 ? 6.767  139.470 2.103   1.00   37.56 ? 224  TRP A CD2 1 
ATOM   1787 N  NE1 . TRP A 1 230 ? 6.069  138.833 0.090   1.00   37.38 ? 224  TRP A NE1 1 
ATOM   1788 C  CE2 . TRP A 1 230 ? 6.479  138.357 1.304   1.00   35.97 ? 224  TRP A CE2 1 
ATOM   1789 C  CE3 . TRP A 1 230 ? 7.196  139.255 3.418   1.00   39.29 ? 224  TRP A CE3 1 
ATOM   1790 C  CZ2 . TRP A 1 230 ? 6.629  137.045 1.750   1.00   37.29 ? 224  TRP A CZ2 1 
ATOM   1791 C  CZ3 . TRP A 1 230 ? 7.341  137.950 3.872   1.00   39.31 ? 224  TRP A CZ3 1 
ATOM   1792 C  CH2 . TRP A 1 230 ? 7.060  136.861 3.040   1.00   39.11 ? 224  TRP A CH2 1 
ATOM   1793 N  N   . ASP A 1 231 ? 3.259  142.339 0.669   1.00   46.28 ? 225  ASP A N   1 
ATOM   1794 C  CA  . ASP A 1 231 ? 2.371  142.540 -0.494  1.00   47.31 ? 225  ASP A CA  1 
ATOM   1795 C  C   . ASP A 1 231 ? 1.386  143.677 -0.274  1.00   48.57 ? 225  ASP A C   1 
ATOM   1796 O  O   . ASP A 1 231 ? 0.607  143.986 -1.163  1.00   49.20 ? 225  ASP A O   1 
ATOM   1797 C  CB  . ASP A 1 231 ? 1.554  141.288 -0.820  1.00   47.38 ? 225  ASP A CB  1 
ATOM   1798 C  CG  . ASP A 1 231 ? 2.413  140.160 -1.302  1.00   46.73 ? 225  ASP A CG  1 
ATOM   1799 O  OD1 . ASP A 1 231 ? 3.348  140.424 -2.094  1.00   49.50 ? 225  ASP A OD1 1 
ATOM   1800 O  OD2 . ASP A 1 231 ? 2.157  138.993 -0.903  1.00   44.80 ? 225  ASP A OD2 1 
ATOM   1801 N  N   . GLN A 1 232 ? 1.383  144.261 0.905   1.00   49.54 ? 226  GLN A N   1 
ATOM   1802 C  CA  . GLN A 1 232 ? 0.457  145.333 1.251   1.00   50.28 ? 226  GLN A CA  1 
ATOM   1803 C  C   . GLN A 1 232 ? 0.887  146.626 0.659   1.00   50.40 ? 226  GLN A C   1 
ATOM   1804 O  O   . GLN A 1 232 ? 2.050  146.827 0.285   1.00   50.51 ? 226  GLN A O   1 
ATOM   1805 C  CB  . GLN A 1 232 ? 0.285  145.421 2.778   1.00   50.60 ? 226  GLN A CB  1 
ATOM   1806 C  CG  . GLN A 1 232 ? -0.186 144.103 3.421   1.00   51.70 ? 226  GLN A CG  1 
ATOM   1807 C  CD  . GLN A 1 232 ? -1.388 143.475 2.743   1.00   55.45 ? 226  GLN A CD  1 
ATOM   1808 O  OE1 . GLN A 1 232 ? -2.371 144.152 2.434   1.00   56.29 ? 226  GLN A OE1 1 
ATOM   1809 N  NE2 . GLN A 1 232 ? -1.512 142.209 2.404   1.00   58.48 ? 226  GLN A NE2 1 
ATOM   1810 N  N   . LYS A 1 233 ? -0.068 147.492 0.575   1.00   50.61 ? 227  LYS A N   1 
ATOM   1811 C  CA  . LYS A 1 233 ? 0.122  148.712 -0.119  1.00   50.84 ? 227  LYS A CA  1 
ATOM   1812 C  C   . LYS A 1 233 ? 1.222  149.678 0.410   1.00   51.03 ? 227  LYS A C   1 
ATOM   1813 O  O   . LYS A 1 233 ? 1.792  150.443 -0.371  1.00   50.50 ? 227  LYS A O   1 
ATOM   1814 C  CB  . LYS A 1 233 ? -1.319 149.170 -0.264  1.00   51.25 ? 227  LYS A CB  1 
ATOM   1815 C  CG  . LYS A 1 233 ? -1.546 150.636 -0.487  0.0000 45.12 ? 227  LYS A CG  1 
ATOM   1816 C  CD  . LYS A 1 233 ? -1.146 151.459 0.704   0.0000 48.25 ? 227  LYS A CD  1 
ATOM   1817 C  CE  . LYS A 1 233 ? -0.724 152.857 0.294   0.0000 49.67 ? 227  LYS A CE  1 
ATOM   1818 N  NZ  . LYS A 1 233 ? -1.613 153.427 -0.755  0.0000 51.91 ? 227  LYS A NZ  1 
ATOM   1819 N  N   . GLU A 1 234 ? 1.545  149.595 1.697   1.00   52.04 ? 228  GLU A N   1 
ATOM   1820 C  CA  . GLU A 1 234 ? 2.613  150.385 2.313   1.00   53.01 ? 228  GLU A CA  1 
ATOM   1821 C  C   . GLU A 1 234 ? 3.984  150.046 1.701   1.00   52.12 ? 228  GLU A C   1 
ATOM   1822 O  O   . GLU A 1 234 ? 4.936  150.813 1.805   1.00   52.02 ? 228  GLU A O   1 
ATOM   1823 C  CB  . GLU A 1 234 ? 2.678  150.123 3.818   1.00   53.68 ? 228  GLU A CB  1 
ATOM   1824 C  CG  . GLU A 1 234 ? 1.388  150.410 4.572   1.00   57.69 ? 228  GLU A CG  1 
ATOM   1825 C  CD  . GLU A 1 234 ? 0.387  149.261 4.506   1.00   62.18 ? 228  GLU A CD  1 
ATOM   1826 O  OE1 . GLU A 1 234 ? 0.725  148.144 4.917   1.00   65.55 ? 228  GLU A OE1 1 
ATOM   1827 O  OE2 . GLU A 1 234 ? -0.747 149.481 4.039   1.00   65.80 ? 228  GLU A OE2 1 
ATOM   1828 N  N   . PHE A 1 235 ? 4.094  148.878 1.059   1.00   51.32 ? 229  PHE A N   1 
ATOM   1829 C  CA  . PHE A 1 235 ? 5.359  148.398 0.491   1.00   50.90 ? 229  PHE A CA  1 
ATOM   1830 C  C   . PHE A 1 235 ? 5.438  148.444 -1.030  1.00   50.81 ? 229  PHE A C   1 
ATOM   1831 O  O   . PHE A 1 235 ? 6.304  147.802 -1.615  1.00   49.95 ? 229  PHE A O   1 
ATOM   1832 C  CB  . PHE A 1 235 ? 5.656  146.982 1.002   1.00   50.25 ? 229  PHE A CB  1 
ATOM   1833 C  CG  . PHE A 1 235 ? 5.769  146.911 2.493   1.00   49.99 ? 229  PHE A CG  1 
ATOM   1834 C  CD1 . PHE A 1 235 ? 6.916  147.369 3.135   1.00   50.28 ? 229  PHE A CD1 1 
ATOM   1835 C  CD2 . PHE A 1 235 ? 4.712  146.439 3.262   1.00   48.94 ? 229  PHE A CD2 1 
ATOM   1836 C  CE1 . PHE A 1 235 ? 7.017  147.327 4.523   1.00   49.66 ? 229  PHE A CE1 1 
ATOM   1837 C  CE2 . PHE A 1 235 ? 4.801  146.386 4.639   1.00   49.25 ? 229  PHE A CE2 1 
ATOM   1838 C  CZ  . PHE A 1 235 ? 5.948  146.836 5.278   1.00   50.00 ? 229  PHE A CZ  1 
ATOM   1839 N  N   . GLN A 1 236 ? 4.561  149.217 -1.664  1.00   50.59 ? 230  GLN A N   1 
ATOM   1840 C  CA  . GLN A 1 236 ? 4.617  149.443 -3.102  1.00   51.01 ? 230  GLN A CA  1 
ATOM   1841 C  C   . GLN A 1 236 ? 5.713  150.440 -3.419  1.00   50.93 ? 230  GLN A C   1 
ATOM   1842 O  O   . GLN A 1 236 ? 6.228  150.481 -4.546  1.00   50.37 ? 230  GLN A O   1 
ATOM   1843 C  CB  . GLN A 1 236 ? 3.267  149.993 -3.629  1.00   51.41 ? 230  GLN A CB  1 
ATOM   1844 C  CG  . GLN A 1 236 ? 2.112  149.005 -3.654  1.00   52.88 ? 230  GLN A CG  1 
ATOM   1845 C  CD  . GLN A 1 236 ? 0.799  149.688 -4.035  1.00   55.38 ? 230  GLN A CD  1 
ATOM   1846 O  OE1 . GLN A 1 236 ? 0.811  150.675 -4.766  1.00   56.95 ? 230  GLN A OE1 1 
ATOM   1847 N  NE2 . GLN A 1 236 ? -0.417 149.344 -3.652  1.00   58.11 ? 230  GLN A NE2 1 
ATOM   1848 N  N   . ASP A 1 237 ? 6.083  151.257 -2.431  1.00   51.67 ? 231  ASP A N   1 
ATOM   1849 C  CA  . ASP A 1 237 ? 7.108  152.298 -2.606  1.00   52.42 ? 231  ASP A CA  1 
ATOM   1850 C  C   . ASP A 1 237 ? 7.732  152.709 -1.269  1.00   52.03 ? 231  ASP A C   1 
ATOM   1851 O  O   . ASP A 1 237 ? 7.182  152.446 -0.211  1.00   51.17 ? 231  ASP A O   1 
ATOM   1852 C  CB  . ASP A 1 237 ? 6.471  153.529 -3.266  1.00   53.04 ? 231  ASP A CB  1 
ATOM   1853 C  CG  . ASP A 1 237 ? 7.469  154.411 -4.003  1.00   55.98 ? 231  ASP A CG  1 
ATOM   1854 O  OD1 . ASP A 1 237 ? 8.704  154.164 -3.979  1.00   60.58 ? 231  ASP A OD1 1 
ATOM   1855 O  OD2 . ASP A 1 237 ? 7.091  155.413 -4.653  1.00   61.85 ? 231  ASP A OD2 1 
ATOM   1856 N  N   . LEU A 1 238 ? 8.899  153.342 -1.332  1.00   52.30 ? 232  LEU A N   1 
ATOM   1857 C  CA  . LEU A 1 238 ? 9.471  154.031 -0.172  1.00   52.78 ? 232  LEU A CA  1 
ATOM   1858 C  C   . LEU A 1 238 ? 8.701  155.336 0.097   1.00   53.38 ? 232  LEU A C   1 
ATOM   1859 O  O   . LEU A 1 238 ? 8.228  155.966 -0.843  1.00   53.21 ? 232  LEU A O   1 
ATOM   1860 C  CB  . LEU A 1 238 ? 10.932 154.388 -0.444  1.00   52.27 ? 232  LEU A CB  1 
ATOM   1861 C  CG  . LEU A 1 238 ? 11.920 153.250 -0.733  1.00   51.83 ? 232  LEU A CG  1 
ATOM   1862 C  CD1 . LEU A 1 238 ? 13.308 153.832 -0.899  1.00   51.88 ? 232  LEU A CD1 1 
ATOM   1863 C  CD2 . LEU A 1 238 ? 11.900 152.222 0.389   1.00   50.58 ? 232  LEU A CD2 1 
ATOM   1864 N  N   . ASP A 1 239 ? 8.607  155.737 1.362   1.00   53.99 ? 233  ASP A N   1 
ATOM   1865 C  CA  . ASP A 1 239 ? 8.068  157.057 1.725   1.00   54.82 ? 233  ASP A CA  1 
ATOM   1866 C  C   . ASP A 1 239 ? 9.125  158.152 1.551   1.00   54.88 ? 233  ASP A C   1 
ATOM   1867 O  O   . ASP A 1 239 ? 10.279 157.865 1.193   1.00   55.11 ? 233  ASP A O   1 
ATOM   1868 C  CB  . ASP A 1 239 ? 7.499  157.061 3.151   1.00   55.20 ? 233  ASP A CB  1 
ATOM   1869 C  CG  . ASP A 1 239 ? 8.516  156.659 4.205   1.00   57.10 ? 233  ASP A CG  1 
ATOM   1870 O  OD1 . ASP A 1 239 ? 9.648  157.197 4.209   1.00   59.93 ? 233  ASP A OD1 1 
ATOM   1871 O  OD2 . ASP A 1 239 ? 8.259  155.817 5.091   1.00   58.96 ? 233  ASP A OD2 1 
ATOM   1872 N  N   . ALA A 1 240 ? 8.737  159.403 1.796   1.00   54.35 ? 234  ALA A N   1 
ATOM   1873 C  CA  . ALA A 1 240 ? 9.593  160.550 1.481   1.00   54.04 ? 234  ALA A CA  1 
ATOM   1874 C  C   . ALA A 1 240 ? 10.855 160.591 2.337   1.00   53.41 ? 234  ALA A C   1 
ATOM   1875 O  O   . ALA A 1 240 ? 11.887 161.041 1.862   1.00   52.69 ? 234  ALA A O   1 
ATOM   1876 C  CB  . ALA A 1 240 ? 8.812  161.880 1.614   1.00   54.08 ? 234  ALA A CB  1 
ATOM   1877 N  N   . PHE A 1 241 ? 10.753 160.132 3.581   1.00   52.96 ? 235  PHE A N   1 
ATOM   1878 C  CA  . PHE A 1 241 ? 11.885 160.107 4.501   1.00   53.88 ? 235  PHE A CA  1 
ATOM   1879 C  C   . PHE A 1 241 ? 12.972 159.105 4.028   1.00   53.32 ? 235  PHE A C   1 
ATOM   1880 O  O   . PHE A 1 241 ? 14.160 159.428 3.981   1.00   53.36 ? 235  PHE A O   1 
ATOM   1881 C  CB  . PHE A 1 241 ? 11.391 159.766 5.921   1.00   54.55 ? 235  PHE A CB  1 
ATOM   1882 C  CG  . PHE A 1 241 ? 12.475 159.768 6.971   1.00   57.94 ? 235  PHE A CG  1 
ATOM   1883 C  CD1 . PHE A 1 241 ? 13.437 160.782 7.011   1.00   60.83 ? 235  PHE A CD1 1 
ATOM   1884 C  CD2 . PHE A 1 241 ? 12.536 158.748 7.925   1.00   61.76 ? 235  PHE A CD2 1 
ATOM   1885 C  CE1 . PHE A 1 241 ? 14.447 160.776 7.979   1.00   63.11 ? 235  PHE A CE1 1 
ATOM   1886 C  CE2 . PHE A 1 241 ? 13.545 158.731 8.896   1.00   63.31 ? 235  PHE A CE2 1 
ATOM   1887 C  CZ  . PHE A 1 241 ? 14.499 159.750 8.924   1.00   63.33 ? 235  PHE A CZ  1 
ATOM   1888 N  N   . GLN A 1 242 ? 12.530 157.908 3.654   1.00   52.42 ? 236  GLN A N   1 
ATOM   1889 C  CA  . GLN A 1 242 ? 13.389 156.872 3.104   1.00   51.41 ? 236  GLN A CA  1 
ATOM   1890 C  C   . GLN A 1 242 ? 14.051 157.340 1.804   1.00   50.85 ? 236  GLN A C   1 
ATOM   1891 O  O   . GLN A 1 242 ? 15.245 157.086 1.596   1.00   49.52 ? 236  GLN A O   1 
ATOM   1892 C  CB  . GLN A 1 242 ? 12.576 155.591 2.898   1.00   51.41 ? 236  GLN A CB  1 
ATOM   1893 C  CG  . GLN A 1 242 ? 12.164 154.920 4.212   1.00   51.11 ? 236  GLN A CG  1 
ATOM   1894 C  CD  . GLN A 1 242 ? 11.259 153.696 4.007   1.00   53.27 ? 236  GLN A CD  1 
ATOM   1895 O  OE1 . GLN A 1 242 ? 11.431 152.673 4.674   1.00   55.69 ? 236  GLN A OE1 1 
ATOM   1896 N  NE2 . GLN A 1 242 ? 10.300 153.802 3.095   1.00   51.50 ? 236  GLN A NE2 1 
ATOM   1897 N  N   . TYR A 1 243 ? 13.315 158.077 0.964   1.00   49.86 ? 237  TYR A N   1 
ATOM   1898 C  CA  . TYR A 1 243 ? 13.892 158.597 -0.281  1.00   49.71 ? 237  TYR A CA  1 
ATOM   1899 C  C   . TYR A 1 243 ? 14.953 159.652 -0.018  1.00   49.01 ? 237  TYR A C   1 
ATOM   1900 O  O   . TYR A 1 243 ? 15.900 159.773 -0.781  1.00   47.85 ? 237  TYR A O   1 
ATOM   1901 C  CB  . TYR A 1 243 ? 12.819 159.141 -1.256  1.00   50.00 ? 237  TYR A CB  1 
ATOM   1902 C  CG  . TYR A 1 243 ? 12.329 158.097 -2.232  1.00   52.30 ? 237  TYR A CG  1 
ATOM   1903 C  CD1 . TYR A 1 243 ? 13.230 157.388 -3.025  1.00   55.82 ? 237  TYR A CD1 1 
ATOM   1904 C  CD2 . TYR A 1 243 ? 10.979 157.782 -2.342  1.00   54.42 ? 237  TYR A CD2 1 
ATOM   1905 C  CE1 . TYR A 1 243 ? 12.793 156.395 -3.921  1.00   56.80 ? 237  TYR A CE1 1 
ATOM   1906 C  CE2 . TYR A 1 243 ? 10.530 156.791 -3.240  1.00   55.52 ? 237  TYR A CE2 1 
ATOM   1907 C  CZ  . TYR A 1 243 ? 11.445 156.109 -4.027  1.00   57.10 ? 237  TYR A CZ  1 
ATOM   1908 O  OH  . TYR A 1 243 ? 11.038 155.130 -4.923  1.00   59.41 ? 237  TYR A OH  1 
ATOM   1909 N  N   . ARG A 1 244 ? 14.795 160.419 1.055   1.00   48.90 ? 238  ARG A N   1 
ATOM   1910 C  CA  . ARG A 1 244 ? 15.785 161.444 1.400   1.00   49.37 ? 238  ARG A CA  1 
ATOM   1911 C  C   . ARG A 1 244 ? 17.076 160.795 1.937   1.00   48.28 ? 238  ARG A C   1 
ATOM   1912 O  O   . ARG A 1 244 ? 18.171 161.281 1.675   1.00   48.16 ? 238  ARG A O   1 
ATOM   1913 C  CB  . ARG A 1 244 ? 15.225 162.426 2.437   1.00   50.23 ? 238  ARG A CB  1 
ATOM   1914 C  CG  . ARG A 1 244 ? 14.800 163.782 1.867   1.00   53.36 ? 238  ARG A CG  1 
ATOM   1915 C  CD  . ARG A 1 244 ? 14.195 164.711 2.922   1.00   57.66 ? 238  ARG A CD  1 
ATOM   1916 N  NE  . ARG A 1 244 ? 12.763 164.437 3.105   1.00   61.18 ? 238  ARG A NE  1 
ATOM   1917 C  CZ  . ARG A 1 244 ? 12.139 164.184 4.271   1.00   63.23 ? 238  ARG A CZ  1 
ATOM   1918 N  NH1 . ARG A 1 244 ? 12.791 164.162 5.438   1.00   63.80 ? 238  ARG A NH1 1 
ATOM   1919 N  NH2 . ARG A 1 244 ? 10.826 163.942 4.259   1.00   64.01 ? 238  ARG A NH2 1 
ATOM   1920 N  N   . ARG A 1 245 ? 16.931 159.701 2.680   1.00   47.27 ? 239  ARG A N   1 
ATOM   1921 C  CA  . ARG A 1 245 ? 18.086 158.913 3.132   1.00   47.01 ? 239  ARG A CA  1 
ATOM   1922 C  C   . ARG A 1 245 ? 18.830 158.381 1.926   1.00   45.18 ? 239  ARG A C   1 
ATOM   1923 O  O   . ARG A 1 245 ? 20.047 158.512 1.827   1.00   44.93 ? 239  ARG A O   1 
ATOM   1924 C  CB  . ARG A 1 245 ? 17.647 157.764 4.035   1.00   46.97 ? 239  ARG A CB  1 
ATOM   1925 C  CG  . ARG A 1 245 ? 16.965 158.263 5.273   1.00   50.60 ? 239  ARG A CG  1 
ATOM   1926 C  CD  . ARG A 1 245 ? 16.702 157.227 6.364   1.00   53.76 ? 239  ARG A CD  1 
ATOM   1927 N  NE  . ARG A 1 245 ? 17.435 157.632 7.558   1.00   57.48 ? 239  ARG A NE  1 
ATOM   1928 C  CZ  . ARG A 1 245 ? 17.835 156.818 8.520   1.00   60.88 ? 239  ARG A CZ  1 
ATOM   1929 N  NH1 . ARG A 1 245 ? 17.547 155.522 8.487   1.00   63.19 ? 239  ARG A NH1 1 
ATOM   1930 N  NH2 . ARG A 1 245 ? 18.528 157.315 9.539   1.00   62.72 ? 239  ARG A NH2 1 
ATOM   1931 N  N   . LEU A 1 246 ? 18.081 157.826 0.989   1.00   44.38 ? 240  LEU A N   1 
ATOM   1932 C  CA  . LEU A 1 246 ? 18.646 157.266 -0.223  1.00   43.61 ? 240  LEU A CA  1 
ATOM   1933 C  C   . LEU A 1 246 ? 19.409 158.314 -1.014  1.00   43.18 ? 240  LEU A C   1 
ATOM   1934 O  O   . LEU A 1 246 ? 20.509 158.049 -1.495  1.00   41.97 ? 240  LEU A O   1 
ATOM   1935 C  CB  . LEU A 1 246 ? 17.540 156.656 -1.080  1.00   44.01 ? 240  LEU A CB  1 
ATOM   1936 C  CG  . LEU A 1 246 ? 17.927 156.083 -2.446  1.00   45.05 ? 240  LEU A CG  1 
ATOM   1937 C  CD1 . LEU A 1 246 ? 18.959 154.966 -2.257  1.00   46.68 ? 240  LEU A CD1 1 
ATOM   1938 C  CD2 . LEU A 1 246 ? 16.696 155.544 -3.149  1.00   45.91 ? 240  LEU A CD2 1 
ATOM   1939 N  N   . SER A 1 247 ? 18.834 159.519 -1.139  1.00   42.49 ? 241  SER A N   1 
ATOM   1940 C  CA  . SER A 1 247 ? 19.465 160.584 -1.928  1.00   41.45 ? 241  SER A CA  1 
ATOM   1941 C  C   . SER A 1 247 ? 20.729 161.045 -1.224  1.00   39.62 ? 241  SER A C   1 
ATOM   1942 O  O   . SER A 1 247 ? 21.698 161.395 -1.852  1.00   39.80 ? 241  SER A O   1 
ATOM   1943 C  CB  . SER A 1 247 ? 18.484 161.771 -2.151  1.00   42.07 ? 241  SER A CB  1 
ATOM   1944 O  OG  . SER A 1 247 ? 19.153 162.857 -2.782  1.00   43.83 ? 241  SER A OG  1 
ATOM   1945 N  N   . TRP A 1 248 ? 20.725 161.021 0.095   1.00   38.92 ? 242  TRP A N   1 
ATOM   1946 C  CA  . TRP A 1 248 ? 21.932 161.328 0.840   1.00   39.08 ? 242  TRP A CA  1 
ATOM   1947 C  C   . TRP A 1 248 ? 23.055 160.295 0.550   1.00   37.90 ? 242  TRP A C   1 
ATOM   1948 O  O   . TRP A 1 248 ? 24.211 160.673 0.328   1.00   36.93 ? 242  TRP A O   1 
ATOM   1949 C  CB  . TRP A 1 248 ? 21.629 161.401 2.335   1.00   39.28 ? 242  TRP A CB  1 
ATOM   1950 C  CG  . TRP A 1 248 ? 22.754 162.006 3.113   1.00   43.72 ? 242  TRP A CG  1 
ATOM   1951 C  CD1 . TRP A 1 248 ? 23.508 161.393 4.073   1.00   46.20 ? 242  TRP A CD1 1 
ATOM   1952 C  CD2 . TRP A 1 248 ? 23.280 163.340 2.983   1.00   48.07 ? 242  TRP A CD2 1 
ATOM   1953 N  NE1 . TRP A 1 248 ? 24.464 162.256 4.553   1.00   47.13 ? 242  TRP A NE1 1 
ATOM   1954 C  CE2 . TRP A 1 248 ? 24.347 163.461 3.905   1.00   49.61 ? 242  TRP A CE2 1 
ATOM   1955 C  CE3 . TRP A 1 248 ? 22.948 164.455 2.187   1.00   49.64 ? 242  TRP A CE3 1 
ATOM   1956 C  CZ2 . TRP A 1 248 ? 25.083 164.660 4.065   1.00   51.61 ? 242  TRP A CZ2 1 
ATOM   1957 C  CZ3 . TRP A 1 248 ? 23.686 165.636 2.327   1.00   50.16 ? 242  TRP A CZ3 1 
ATOM   1958 C  CH2 . TRP A 1 248 ? 24.738 165.729 3.267   1.00   51.53 ? 242  TRP A CH2 1 
ATOM   1959 N  N   . VAL A 1 249 ? 22.691 159.007 0.514   1.00   37.15 ? 243  VAL A N   1 
ATOM   1960 C  CA  . VAL A 1 249 ? 23.629 157.952 0.123   1.00   36.89 ? 243  VAL A CA  1 
ATOM   1961 C  C   . VAL A 1 249 ? 24.139 158.254 -1.266  1.00   37.45 ? 243  VAL A C   1 
ATOM   1962 O  O   . VAL A 1 249 ? 25.343 158.249 -1.509  1.00   35.70 ? 243  VAL A O   1 
ATOM   1963 C  CB  . VAL A 1 249 ? 22.998 156.522 0.182   1.00   36.36 ? 243  VAL A CB  1 
ATOM   1964 C  CG1 . VAL A 1 249 ? 23.990 155.475 -0.355  1.00   35.48 ? 243  VAL A CG1 1 
ATOM   1965 C  CG2 . VAL A 1 249 ? 22.618 156.180 1.596   1.00   35.70 ? 243  VAL A CG2 1 
ATOM   1966 N  N   . ARG A 1 250 ? 23.217 158.588 -2.159  1.00   39.35 ? 244  ARG A N   1 
ATOM   1967 C  CA  . ARG A 1 250 ? 23.575 158.928 -3.534  1.00   41.85 ? 244  ARG A CA  1 
ATOM   1968 C  C   . ARG A 1 250 ? 24.526 160.119 -3.616  1.00   42.99 ? 244  ARG A C   1 
ATOM   1969 O  O   . ARG A 1 250 ? 25.476 160.114 -4.386  1.00   43.39 ? 244  ARG A O   1 
ATOM   1970 C  CB  . ARG A 1 250 ? 22.320 159.225 -4.362  1.00   42.60 ? 244  ARG A CB  1 
ATOM   1971 C  CG  . ARG A 1 250 ? 21.375 158.040 -4.532  1.00   44.96 ? 244  ARG A CG  1 
ATOM   1972 C  CD  . ARG A 1 250 ? 21.697 157.190 -5.735  1.00   47.86 ? 244  ARG A CD  1 
ATOM   1973 N  NE  . ARG A 1 250 ? 22.856 156.367 -5.437  1.00   50.92 ? 244  ARG A NE  1 
ATOM   1974 C  CZ  . ARG A 1 250 ? 22.805 155.150 -4.898  1.00   53.05 ? 244  ARG A CZ  1 
ATOM   1975 N  NH1 . ARG A 1 250 ? 21.634 154.556 -4.636  1.00   53.45 ? 244  ARG A NH1 1 
ATOM   1976 N  NH2 . ARG A 1 250 ? 23.940 154.509 -4.643  1.00   52.50 ? 244  ARG A NH2 1 
ATOM   1977 N  N   . GLN A 1 251 ? 24.316 161.121 -2.782  1.00   45.06 ? 245  GLN A N   1 
ATOM   1978 C  CA  . GLN A 1 251 ? 25.091 162.361 -2.911  1.00   46.57 ? 245  GLN A CA  1 
ATOM   1979 C  C   . GLN A 1 251 ? 26.448 162.336 -2.211  1.00   45.94 ? 245  GLN A C   1 
ATOM   1980 O  O   . GLN A 1 251 ? 27.405 162.935 -2.713  1.00   46.93 ? 245  GLN A O   1 
ATOM   1981 C  CB  . GLN A 1 251 ? 24.264 163.571 -2.415  1.00   47.38 ? 245  GLN A CB  1 
ATOM   1982 C  CG  . GLN A 1 251 ? 23.269 164.098 -3.456  1.00   51.93 ? 245  GLN A CG  1 
ATOM   1983 C  CD  . GLN A 1 251 ? 23.916 164.339 -4.834  1.00   58.09 ? 245  GLN A CD  1 
ATOM   1984 O  OE1 . GLN A 1 251 ? 23.470 163.783 -5.852  1.00   62.76 ? 245  GLN A OE1 1 
ATOM   1985 N  NE2 . GLN A 1 251 ? 24.974 165.158 -4.863  1.00   61.92 ? 245  GLN A NE2 1 
ATOM   1986 N  N   . LYS A 1 252 ? 26.540 161.666 -1.068  1.00   45.00 ? 246  LYS A N   1 
ATOM   1987 C  CA  . LYS A 1 252 ? 27.746 161.734 -0.233  1.00   44.49 ? 246  LYS A CA  1 
ATOM   1988 C  C   . LYS A 1 252 ? 28.554 160.420 -0.123  1.00   43.12 ? 246  LYS A C   1 
ATOM   1989 O  O   . LYS A 1 252 ? 29.772 160.463 0.087   1.00   42.66 ? 246  LYS A O   1 
ATOM   1990 C  CB  . LYS A 1 252 ? 27.378 162.219 1.169   1.00   44.98 ? 246  LYS A CB  1 
ATOM   1991 C  CG  . LYS A 1 252 ? 26.929 163.716 1.258   1.00   49.67 ? 246  LYS A CG  1 
ATOM   1992 C  CD  . LYS A 1 252 ? 27.903 164.737 0.594   1.00   52.41 ? 246  LYS A CD  1 
ATOM   1993 C  CE  . LYS A 1 252 ? 27.532 166.213 0.945   1.00   55.07 ? 246  LYS A CE  1 
ATOM   1994 N  NZ  . LYS A 1 252 ? 27.542 167.144 -0.237  1.00   55.43 ? 246  LYS A NZ  1 
ATOM   1995 N  N   . TYR A 1 253 ? 27.891 159.269 -0.273  1.00   41.34 ? 247  TYR A N   1 
ATOM   1996 C  CA  . TYR A 1 253 ? 28.536 157.961 -0.056  1.00   39.89 ? 247  TYR A CA  1 
ATOM   1997 C  C   . TYR A 1 253 ? 28.786 157.118 -1.310  1.00   39.50 ? 247  TYR A C   1 
ATOM   1998 O  O   . TYR A 1 253 ? 29.493 156.101 -1.243  1.00   38.50 ? 247  TYR A O   1 
ATOM   1999 C  CB  . TYR A 1 253 ? 27.753 157.192 1.007   1.00   39.49 ? 247  TYR A CB  1 
ATOM   2000 C  CG  . TYR A 1 253 ? 27.929 157.818 2.365   1.00   38.12 ? 247  TYR A CG  1 
ATOM   2001 C  CD1 . TYR A 1 253 ? 29.015 157.493 3.152   1.00   37.57 ? 247  TYR A CD1 1 
ATOM   2002 C  CD2 . TYR A 1 253 ? 27.033 158.774 2.844   1.00   37.38 ? 247  TYR A CD2 1 
ATOM   2003 C  CE1 . TYR A 1 253 ? 29.212 158.083 4.386   1.00   38.56 ? 247  TYR A CE1 1 
ATOM   2004 C  CE2 . TYR A 1 253 ? 27.224 159.384 4.090   1.00   37.29 ? 247  TYR A CE2 1 
ATOM   2005 C  CZ  . TYR A 1 253 ? 28.315 159.053 4.841   1.00   38.05 ? 247  TYR A CZ  1 
ATOM   2006 O  OH  . TYR A 1 253 ? 28.514 159.611 6.081   1.00   38.93 ? 247  TYR A OH  1 
ATOM   2007 N  N   . THR A 1 254 ? 28.281 157.572 -2.461  1.00   38.94 ? 248  THR A N   1 
ATOM   2008 C  CA  . THR A 1 254 ? 28.349 156.810 -3.698  1.00   38.41 ? 248  THR A CA  1 
ATOM   2009 C  C   . THR A 1 254 ? 29.586 157.132 -4.491  1.00   39.66 ? 248  THR A C   1 
ATOM   2010 O  O   . THR A 1 254 ? 29.844 158.281 -4.794  1.00   40.01 ? 248  THR A O   1 
ATOM   2011 C  CB  . THR A 1 254 ? 27.094 157.054 -4.578  1.00   38.26 ? 248  THR A CB  1 
ATOM   2012 O  OG1 . THR A 1 254 ? 25.915 156.628 -3.885  1.00   36.23 ? 248  THR A OG1 1 
ATOM   2013 C  CG2 . THR A 1 254 ? 27.126 156.175 -5.841  1.00   37.19 ? 248  THR A CG2 1 
ATOM   2014 N  N   . ILE A 1 255 ? 30.361 156.117 -4.850  1.00   39.68 ? 249  ILE A N   1 
ATOM   2015 C  CA  . ILE A 1 255 ? 31.540 156.352 -5.667  1.00   40.70 ? 249  ILE A CA  1 
ATOM   2016 C  C   . ILE A 1 255 ? 31.417 155.819 -7.085  1.00   40.54 ? 249  ILE A C   1 
ATOM   2017 O  O   . ILE A 1 255 ? 32.211 156.172 -7.934  1.00   40.59 ? 249  ILE A O   1 
ATOM   2018 C  CB  . ILE A 1 255 ? 32.822 155.821 -4.981  1.00   41.13 ? 249  ILE A CB  1 
ATOM   2019 C  CG1 . ILE A 1 255 ? 32.821 154.300 -4.870  1.00   41.96 ? 249  ILE A CG1 1 
ATOM   2020 C  CG2 . ILE A 1 255 ? 32.975 156.464 -3.601  1.00   42.10 ? 249  ILE A CG2 1 
ATOM   2021 C  CD1 . ILE A 1 255 ? 34.121 153.751 -4.327  1.00   44.00 ? 249  ILE A CD1 1 
ATOM   2022 N  N   . TYR A 1 256 ? 30.450 154.947 -7.335  1.00   40.75 ? 250  TYR A N   1 
ATOM   2023 C  CA  . TYR A 1 256 ? 30.178 154.476 -8.693  1.00   41.57 ? 250  TYR A CA  1 
ATOM   2024 C  C   . TYR A 1 256 ? 28.701 154.127 -8.832  1.00   42.52 ? 250  TYR A C   1 
ATOM   2025 O  O   . TYR A 1 256 ? 28.117 153.524 -7.945  1.00   41.20 ? 250  TYR A O   1 
ATOM   2026 C  CB  . TYR A 1 256 ? 31.060 153.278 -9.097  1.00   41.51 ? 250  TYR A CB  1 
ATOM   2027 C  CG  . TYR A 1 256 ? 30.665 152.796 -10.469 1.00   43.55 ? 250  TYR A CG  1 
ATOM   2028 C  CD1 . TYR A 1 256 ? 31.112 153.462 -11.616 1.00   45.49 ? 250  TYR A CD1 1 
ATOM   2029 C  CD2 . TYR A 1 256 ? 29.760 151.744 -10.628 1.00   43.75 ? 250  TYR A CD2 1 
ATOM   2030 C  CE1 . TYR A 1 256 ? 30.698 153.057 -12.894 1.00   45.74 ? 250  TYR A CE1 1 
ATOM   2031 C  CE2 . TYR A 1 256 ? 29.344 151.334 -11.879 1.00   44.89 ? 250  TYR A CE2 1 
ATOM   2032 C  CZ  . TYR A 1 256 ? 29.810 151.997 -13.017 1.00   46.96 ? 250  TYR A CZ  1 
ATOM   2033 O  OH  . TYR A 1 256 ? 29.402 151.582 -14.265 1.00   47.10 ? 250  TYR A OH  1 
ATOM   2034 N  N   . ASN A 1 257 ? 28.089 154.533 -9.935  1.00   44.26 ? 251  ASN A N   1 
ATOM   2035 C  CA  . ASN A 1 257 ? 26.661 154.296 -10.150 1.00   46.41 ? 251  ASN A CA  1 
ATOM   2036 C  C   . ASN A 1 257 ? 26.389 154.091 -11.633 1.00   47.86 ? 251  ASN A C   1 
ATOM   2037 O  O   . ASN A 1 257 ? 26.577 155.009 -12.449 1.00   47.52 ? 251  ASN A O   1 
ATOM   2038 C  CB  . ASN A 1 257 ? 25.841 155.458 -9.587  1.00   46.82 ? 251  ASN A CB  1 
ATOM   2039 C  CG  . ASN A 1 257 ? 24.337 155.223 -9.667  1.00   48.72 ? 251  ASN A CG  1 
ATOM   2040 O  OD1 . ASN A 1 257 ? 23.870 154.168 -10.097 1.00   52.10 ? 251  ASN A OD1 1 
ATOM   2041 N  ND2 . ASN A 1 257 ? 23.570 156.223 -9.258  1.00   51.35 ? 251  ASN A ND2 1 
ATOM   2042 N  N   . TYR A 1 258 ? 25.971 152.876 -11.980 1.00   49.09 ? 252  TYR A N   1 
ATOM   2043 C  CA  . TYR A 1 258 ? 25.737 152.506 -13.379 1.00   50.54 ? 252  TYR A CA  1 
ATOM   2044 C  C   . TYR A 1 258 ? 24.643 153.385 -13.999 1.00   52.22 ? 252  TYR A C   1 
ATOM   2045 O  O   . TYR A 1 258 ? 24.658 153.616 -15.188 1.00   52.42 ? 252  TYR A O   1 
ATOM   2046 C  CB  . TYR A 1 258 ? 25.368 151.010 -13.525 1.00   49.96 ? 252  TYR A CB  1 
ATOM   2047 C  CG  . TYR A 1 258 ? 23.905 150.714 -13.255 1.00   47.69 ? 252  TYR A CG  1 
ATOM   2048 C  CD1 . TYR A 1 258 ? 23.383 150.813 -11.969 1.00   45.34 ? 252  TYR A CD1 1 
ATOM   2049 C  CD2 . TYR A 1 258 ? 23.039 150.357 -14.290 1.00   47.40 ? 252  TYR A CD2 1 
ATOM   2050 C  CE1 . TYR A 1 258 ? 22.041 150.566 -11.707 1.00   45.66 ? 252  TYR A CE1 1 
ATOM   2051 C  CE2 . TYR A 1 258 ? 21.677 150.090 -14.036 1.00   46.23 ? 252  TYR A CE2 1 
ATOM   2052 C  CZ  . TYR A 1 258 ? 21.192 150.204 -12.752 1.00   46.50 ? 252  TYR A CZ  1 
ATOM   2053 O  OH  . TYR A 1 258 ? 19.874 149.948 -12.489 1.00   46.62 ? 252  TYR A OH  1 
ATOM   2054 N  N   . CYS A 1 259 ? 23.695 153.827 -13.175 1.00   55.05 ? 253  CYS A N   1 
ATOM   2055 C  CA  . CYS A 1 259 ? 22.593 154.687 -13.594 1.00   57.52 ? 253  CYS A CA  1 
ATOM   2056 C  C   . CYS A 1 259 ? 23.052 156.017 -14.168 1.00   58.70 ? 253  CYS A C   1 
ATOM   2057 O  O   . CYS A 1 259 ? 22.498 156.475 -15.168 1.00   59.30 ? 253  CYS A O   1 
ATOM   2058 C  CB  . CYS A 1 259 ? 21.689 155.013 -12.416 1.00   57.71 ? 253  CYS A CB  1 
ATOM   2059 S  SG  . CYS A 1 259 ? 20.325 153.880 -12.221 1.00   63.31 ? 253  CYS A SG  1 
ATOM   2060 N  N   . THR A 1 260 ? 24.021 156.654 -13.506 1.00   59.63 ? 254  THR A N   1 
ATOM   2061 C  CA  . THR A 1 260 ? 24.551 157.940 -13.966 1.00   60.50 ? 254  THR A CA  1 
ATOM   2062 C  C   . THR A 1 260 ? 25.832 157.782 -14.766 1.00   61.16 ? 254  THR A C   1 
ATOM   2063 O  O   . THR A 1 260 ? 26.467 158.768 -15.090 1.00   61.42 ? 254  THR A O   1 
ATOM   2064 C  CB  . THR A 1 260 ? 24.799 158.904 -12.786 1.00   60.24 ? 254  THR A CB  1 
ATOM   2065 O  OG1 . THR A 1 260 ? 25.652 158.283 -11.821 1.00   61.04 ? 254  THR A OG1 1 
ATOM   2066 C  CG2 . THR A 1 260 ? 23.511 159.193 -12.021 1.00   60.53 ? 254  THR A CG2 1 
ATOM   2067 N  N   . ASP A 1 261 ? 26.208 156.555 -15.095 1.00   62.02 ? 255  ASP A N   1 
ATOM   2068 C  CA  . ASP A 1 261 ? 27.374 156.319 -15.933 1.00   63.15 ? 255  ASP A CA  1 
ATOM   2069 C  C   . ASP A 1 261 ? 26.947 156.382 -17.411 1.00   64.65 ? 255  ASP A C   1 
ATOM   2070 O  O   . ASP A 1 261 ? 26.354 155.429 -17.939 1.00   64.16 ? 255  ASP A O   1 
ATOM   2071 C  CB  . ASP A 1 261 ? 27.985 154.956 -15.595 1.00   63.03 ? 255  ASP A CB  1 
ATOM   2072 C  CG  . ASP A 1 261 ? 29.207 154.628 -16.430 1.00   62.93 ? 255  ASP A CG  1 
ATOM   2073 O  OD1 . ASP A 1 261 ? 29.595 155.470 -17.271 1.00   63.14 ? 255  ASP A OD1 1 
ATOM   2074 O  OD2 . ASP A 1 261 ? 29.846 153.546 -16.313 1.00   59.98 ? 255  ASP A OD2 1 
ATOM   2075 N  N   . ARG A 1 262 ? 27.252 157.512 -18.062 1.00   66.38 ? 256  ARG A N   1 
ATOM   2076 C  CA  . ARG A 1 262 ? 26.876 157.771 -19.467 1.00   67.58 ? 256  ARG A CA  1 
ATOM   2077 C  C   . ARG A 1 262 ? 27.923 157.296 -20.482 1.00   68.78 ? 256  ARG A C   1 
ATOM   2078 O  O   . ARG A 1 262 ? 27.674 157.313 -21.685 1.00   69.34 ? 256  ARG A O   1 
ATOM   2079 C  CB  . ARG A 1 262 ? 26.600 159.262 -19.681 1.00   67.58 ? 256  ARG A CB  1 
ATOM   2080 C  CG  . ARG A 1 262 ? 25.510 159.839 -18.774 1.00   67.09 ? 256  ARG A CG  1 
ATOM   2081 C  CD  . ARG A 1 262 ? 24.077 159.646 -19.289 1.00   66.78 ? 256  ARG A CD  1 
ATOM   2082 N  NE  . ARG A 1 262 ? 23.103 159.799 -18.203 1.00   66.88 ? 256  ARG A NE  1 
ATOM   2083 C  CZ  . ARG A 1 262 ? 22.465 158.794 -17.589 1.00   67.41 ? 256  ARG A CZ  1 
ATOM   2084 N  NH1 . ARG A 1 262 ? 22.679 157.523 -17.937 1.00   67.21 ? 256  ARG A NH1 1 
ATOM   2085 N  NH2 . ARG A 1 262 ? 21.608 159.069 -16.605 1.00   66.51 ? 256  ARG A NH2 1 
ATOM   2086 N  N   . SER A 1 263 ? 29.084 156.876 -19.988 1.00   70.37 ? 257  SER A N   1 
ATOM   2087 C  CA  . SER A 1 263 ? 30.136 156.275 -20.816 1.00   71.49 ? 257  SER A CA  1 
ATOM   2088 C  C   . SER A 1 263 ? 29.837 154.816 -21.204 1.00   72.70 ? 257  SER A C   1 
ATOM   2089 O  O   . SER A 1 263 ? 30.170 154.391 -22.310 1.00   72.74 ? 257  SER A O   1 
ATOM   2090 C  CB  . SER A 1 263 ? 31.487 156.373 -20.084 1.00   71.62 ? 257  SER A CB  1 
ATOM   2091 O  OG  . SER A 1 263 ? 32.300 155.224 -20.286 1.00   72.23 ? 257  SER A OG  1 
ATOM   2092 N  N   . ARG A 1 264 ? 29.248 154.047 -20.281 1.00   74.34 ? 258  ARG A N   1 
ATOM   2093 C  CA  . ARG A 1 264 ? 28.839 152.648 -20.537 1.00   75.35 ? 258  ARG A CA  1 
ATOM   2094 C  C   . ARG A 1 264 ? 27.358 152.560 -20.911 1.00   76.43 ? 258  ARG A C   1 
ATOM   2095 O  O   . ARG A 1 264 ? 26.950 151.665 -21.648 1.00   76.68 ? 258  ARG A O   1 
ATOM   2096 C  CB  . ARG A 1 264 ? 29.086 151.763 -19.299 1.00   75.35 ? 258  ARG A CB  1 
ATOM   2097 C  CG  . ARG A 1 264 ? 30.133 150.641 -19.474 1.00   75.01 ? 258  ARG A CG  1 
ATOM   2098 C  CD  . ARG A 1 264 ? 30.029 149.460 -18.459 1.00   74.97 ? 258  ARG A CD  1 
ATOM   2099 N  NE  . ARG A 1 264 ? 29.131 149.707 -17.322 1.00   74.34 ? 258  ARG A NE  1 
ATOM   2100 C  CZ  . ARG A 1 264 ? 28.853 148.822 -16.356 1.00   74.16 ? 258  ARG A CZ  1 
ATOM   2101 N  NH1 . ARG A 1 264 ? 29.410 147.615 -16.337 1.00   73.08 ? 258  ARG A NH1 1 
ATOM   2102 N  NH2 . ARG A 1 264 ? 28.022 149.166 -15.376 1.00   74.04 ? 258  ARG A NH2 1 
ATOM   2103 N  N   . TYR A 1 265 ? 26.567 153.504 -20.402 1.00   77.85 ? 259  TYR A N   1 
ATOM   2104 C  CA  . TYR A 1 265 ? 25.115 153.518 -20.560 1.00   79.04 ? 259  TYR A CA  1 
ATOM   2105 C  C   . TYR A 1 265 ? 24.658 154.829 -21.238 1.00   79.81 ? 259  TYR A C   1 
ATOM   2106 O  O   . TYR A 1 265 ? 24.031 155.692 -20.586 1.00   79.46 ? 259  TYR A O   1 
ATOM   2107 C  CB  . TYR A 1 265 ? 24.454 153.343 -19.172 1.00   79.48 ? 259  TYR A CB  1 
ATOM   2108 C  CG  . TYR A 1 265 ? 23.438 152.215 -19.076 1.00   80.81 ? 259  TYR A CG  1 
ATOM   2109 C  CD1 . TYR A 1 265 ? 22.139 152.406 -19.519 1.00   82.13 ? 259  TYR A CD1 1 
ATOM   2110 C  CD2 . TYR A 1 265 ? 23.773 150.971 -18.534 1.00   82.06 ? 259  TYR A CD2 1 
ATOM   2111 C  CE1 . TYR A 1 265 ? 21.182 151.403 -19.440 1.00   82.71 ? 259  TYR A CE1 1 
ATOM   2112 C  CE2 . TYR A 1 265 ? 22.821 149.948 -18.451 1.00   82.62 ? 259  TYR A CE2 1 
ATOM   2113 C  CZ  . TYR A 1 265 ? 21.520 150.179 -18.908 1.00   83.19 ? 259  TYR A CZ  1 
ATOM   2114 O  OH  . TYR A 1 265 ? 20.544 149.205 -18.843 1.00   84.20 ? 259  TYR A OH  1 
ATOM   2115 N  N   . PRO A 1 266 ? 24.922 154.955 -22.567 1.00   80.82 ? 260  PRO A N   1 
ATOM   2116 C  CA  . PRO A 1 266 ? 24.513 156.138 -23.335 1.00   81.37 ? 260  PRO A CA  1 
ATOM   2117 C  C   . PRO A 1 266 ? 23.011 156.401 -23.156 1.00   81.87 ? 260  PRO A C   1 
ATOM   2118 O  O   . PRO A 1 266 ? 22.585 157.535 -22.899 1.00   81.81 ? 260  PRO A O   1 
ATOM   2119 C  CB  . PRO A 1 266 ? 24.877 155.771 -24.787 0.0000 81.47 ? 260  PRO A CB  1 
ATOM   2120 C  CG  . PRO A 1 266 ? 26.044 154.842 -24.625 0.0000 81.28 ? 260  PRO A CG  1 
ATOM   2121 C  CD  . PRO A 1 266 ? 25.844 154.086 -23.338 0.0000 80.87 ? 260  PRO A CD  1 
ATOM   2122 N  N   . SER A 1 267 ? 22.235 155.327 -23.278 1.00   82.27 ? 261  SER A N   1 
ATOM   2123 C  CA  . SER A 1 267 ? 20.796 155.348 -23.078 1.00   82.68 ? 261  SER A CA  1 
ATOM   2124 C  C   . SER A 1 267 ? 20.515 154.927 -21.631 1.00   82.84 ? 261  SER A C   1 
ATOM   2125 O  O   . SER A 1 267 ? 20.515 153.727 -21.308 1.00   82.82 ? 261  SER A O   1 
ATOM   2126 C  CB  . SER A 1 267 ? 20.099 154.414 -24.083 0.0000 82.64 ? 261  SER A CB  1 
ATOM   2127 O  OG  . SER A 1 267 ? 18.732 154.755 -24.231 0.0000 82.89 ? 261  SER A OG  1 
ATOM   2128 N  N   . MET A 1 268 ? 20.277 155.930 -20.767 1.00   82.99 ? 262  MET A N   1 
ATOM   2129 C  CA  . MET A 1 268 ? 20.028 155.687 -19.322 1.00   82.98 ? 262  MET A CA  1 
ATOM   2130 C  C   . MET A 1 268 ? 19.114 154.477 -19.040 1.00   83.25 ? 262  MET A C   1 
ATOM   2131 O  O   . MET A 1 268 ? 18.147 154.302 -19.759 1.00   83.45 ? 262  MET A O   1 
ATOM   2132 C  CB  . MET A 1 268 ? 19.421 156.923 -18.672 1.00   83.00 ? 262  MET A CB  1 
ATOM   2133 C  CG  . MET A 1 268 ? 19.186 156.808 -17.166 1.00   83.70 ? 262  MET A CG  1 
ATOM   2134 S  SD  . MET A 1 268 ? 17.442 156.706 -16.735 1.00   86.20 ? 262  MET A SD  1 
ATOM   2135 C  CE  . MET A 1 268 ? 16.831 155.548 -17.967 1.00   85.27 ? 262  MET A CE  1 
ATOM   2136 N  N   . PRO A 1 269 ? 19.377 153.653 -18.024 1.00   83.15 ? 263  PRO A N   1 
ATOM   2137 C  CA  . PRO A 1 269 ? 18.541 152.492 -17.683 1.00   83.02 ? 263  PRO A CA  1 
ATOM   2138 C  C   . PRO A 1 269 ? 17.124 152.912 -17.296 1.00   82.99 ? 263  PRO A C   1 
ATOM   2139 O  O   . PRO A 1 269 ? 16.949 153.648 -16.324 1.00   82.94 ? 263  PRO A O   1 
ATOM   2140 C  CB  . PRO A 1 269 ? 19.249 151.828 -16.499 1.00   82.96 ? 263  PRO A CB  1 
ATOM   2141 C  CG  . PRO A 1 269 ? 20.624 152.426 -16.497 1.00   82.90 ? 263  PRO A CG  1 
ATOM   2142 C  CD  . PRO A 1 269 ? 20.483 153.813 -17.064 1.00   83.12 ? 263  PRO A CD  1 
ATOM   2143 N  N   . PRO A 1 270 ? 16.104 152.451 -18.021 1.00   82.96 ? 264  PRO A N   1 
ATOM   2144 C  CA  . PRO A 1 270 ? 14.717 152.873 -17.767 1.00   82.96 ? 264  PRO A CA  1 
ATOM   2145 C  C   . PRO A 1 270 ? 14.295 152.942 -16.286 1.00   83.15 ? 264  PRO A C   1 
ATOM   2146 O  O   . PRO A 1 270 ? 13.401 153.695 -15.926 1.00   83.15 ? 264  PRO A O   1 
ATOM   2147 C  CB  . PRO A 1 270 ? 13.887 151.812 -18.501 1.00   82.97 ? 264  PRO A CB  1 
ATOM   2148 C  CG  . PRO A 1 270 ? 14.788 151.280 -19.568 1.00   82.81 ? 264  PRO A CG  1 
ATOM   2149 C  CD  . PRO A 1 270 ? 16.202 151.403 -19.050 1.00   82.88 ? 264  PRO A CD  1 
ATOM   2150 N  N   . GLU A 1 271 ? 14.928 152.147 -15.422 1.00   83.39 ? 265  GLU A N   1 
ATOM   2151 C  CA  . GLU A 1 271 ? 14.549 152.083 -14.006 1.00   83.36 ? 265  GLU A CA  1 
ATOM   2152 C  C   . GLU A 1 271 ? 14.946 153.290 -13.129 1.00   83.96 ? 265  GLU A C   1 
ATOM   2153 O  O   . GLU A 1 271 ? 14.286 153.584 -12.123 1.00   83.92 ? 265  GLU A O   1 
ATOM   2154 C  CB  . GLU A 1 271 ? 15.186 150.845 -13.344 1.00   83.13 ? 265  GLU A CB  1 
ATOM   2155 C  CG  . GLU A 1 271 ? 15.361 149.615 -14.227 1.00   82.35 ? 265  GLU A CG  1 
ATOM   2156 C  CD  . GLU A 1 271 ? 16.768 149.432 -14.791 1.00   80.74 ? 265  GLU A CD  1 
ATOM   2157 O  OE1 . GLU A 1 271 ? 17.739 149.397 -14.001 1.00   78.83 ? 265  GLU A OE1 1 
ATOM   2158 O  OE2 . GLU A 1 271 ? 16.898 149.333 -16.033 1.00   79.37 ? 265  GLU A OE2 1 
ATOM   2159 N  N   . CYS A 1 272 ? 16.008 153.977 -13.502 1.00   84.51 ? 266  CYS A N   1 
ATOM   2160 C  CA  . CYS A 1 272 ? 16.575 155.080 -12.708 1.00   85.12 ? 266  CYS A CA  1 
ATOM   2161 C  C   . CYS A 1 272 ? 15.650 156.149 -12.122 1.00   84.99 ? 266  CYS A C   1 
ATOM   2162 O  O   . CYS A 1 272 ? 15.718 156.433 -10.933 1.00   84.91 ? 266  CYS A O   1 
ATOM   2163 C  CB  . CYS A 1 272 ? 17.622 155.775 -13.578 0.0000 85.22 ? 266  CYS A CB  1 
ATOM   2164 S  SG  . CYS A 1 272 ? 19.261 154.989 -13.559 0.0000 87.29 ? 266  CYS A SG  1 
ATOM   2165 N  N   . LYS A 1 273 ? 14.830 156.768 -12.963 1.00   84.94 ? 267  LYS A N   1 
ATOM   2166 C  CA  . LYS A 1 273 ? 13.961 157.861 -12.540 1.00   85.00 ? 267  LYS A CA  1 
ATOM   2167 C  C   . LYS A 1 273 ? 12.953 157.434 -11.458 1.00   85.11 ? 267  LYS A C   1 
ATOM   2168 O  O   . LYS A 1 273 ? 12.656 158.198 -10.526 1.00   85.20 ? 267  LYS A O   1 
ATOM   2169 C  CB  . LYS A 1 273 ? 13.246 158.454 -13.778 0.0000 84.97 ? 267  LYS A CB  1 
ATOM   2170 C  CG  . LYS A 1 273 ? 14.158 158.762 -14.959 0.0000 47.08 ? 267  LYS A CG  1 
ATOM   2171 C  CD  . LYS A 1 273 ? 15.527 159.264 -14.527 0.0000 49.09 ? 267  LYS A CD  1 
ATOM   2172 C  CE  . LYS A 1 273 ? 15.999 160.436 -15.365 0.0000 49.62 ? 267  LYS A CE  1 
ATOM   2173 N  NZ  . LYS A 1 273 ? 17.471 160.398 -15.597 0.0000 50.28 ? 267  LYS A NZ  1 
ATOM   2174 N  N   . ARG A 1 274 ? 12.481 156.205 -11.557 1.00   85.07 ? 268  ARG A N   1 
ATOM   2175 C  CA  . ARG A 1 274 ? 11.544 155.595 -10.609 1.00   84.98 ? 268  ARG A CA  1 
ATOM   2176 C  C   . ARG A 1 274 ? 12.257 155.284 -9.277  1.00   84.97 ? 268  ARG A C   1 
ATOM   2177 O  O   . ARG A 1 274 ? 11.689 155.443 -8.193  1.00   85.07 ? 268  ARG A O   1 
ATOM   2178 C  CB  . ARG A 1 274 ? 10.951 154.305 -11.202 1.00   84.96 ? 268  ARG A CB  1 
ATOM   2179 C  CG  . ARG A 1 274 ? 9.455  154.132 -11.003 1.00   85.12 ? 268  ARG A CG  1 
ATOM   2180 C  CD  . ARG A 1 274 ? 8.942  152.851 -11.657 1.00   85.05 ? 268  ARG A CD  1 
ATOM   2181 N  NE  . ARG A 1 274 ? 7.730  153.099 -12.451 1.00   85.21 ? 268  ARG A NE  1 
ATOM   2182 C  CZ  . ARG A 1 274 ? 7.576  152.711 -13.719 1.00   85.19 ? 268  ARG A CZ  1 
ATOM   2183 N  NH1 . ARG A 1 274 ? 8.531  152.044 -14.335 1.00   84.83 ? 268  ARG A NH1 1 
ATOM   2184 N  NH2 . ARG A 1 274 ? 6.447  153.005 -14.351 1.00   85.05 ? 268  ARG A NH2 1 
ATOM   2185 N  N   . ASP A 1 275 ? 13.505 154.822 -9.387  1.00   84.91 ? 269  ASP A N   1 
ATOM   2186 C  CA  . ASP A 1 275 ? 14.337 154.396 -8.251  1.00   84.81 ? 269  ASP A CA  1 
ATOM   2187 C  C   . ASP A 1 275 ? 15.077 155.553 -7.557  1.00   85.02 ? 269  ASP A C   1 
ATOM   2188 O  O   . ASP A 1 275 ? 15.695 155.357 -6.506  1.00   84.92 ? 269  ASP A O   1 
ATOM   2189 C  CB  . ASP A 1 275 ? 15.346 153.341 -8.707  1.00   84.65 ? 269  ASP A CB  1 
ATOM   2190 C  CG  . ASP A 1 275 ? 14.741 152.165 -9.426  1.00   84.36 ? 269  ASP A CG  1 
ATOM   2191 O  OD1 . ASP A 1 275 ? 13.624 151.767 -9.054  1.00   84.22 ? 269  ASP A OD1 1 
ATOM   2192 O  OD2 . ASP A 1 275 ? 15.394 151.648 -10.367 1.00   82.41 ? 269  ASP A OD2 1 
ATOM   2193 N  N   . ARG A 1 276 ? 15.046 156.744 -8.157  1.00   85.30 ? 270  ARG A N   1 
ATOM   2194 C  CA  . ARG A 1 276 ? 15.740 157.936 -7.691  1.00   85.51 ? 270  ARG A CA  1 
ATOM   2195 C  C   . ARG A 1 276 ? 17.265 157.732 -7.595  1.00   85.80 ? 270  ARG A C   1 
ATOM   2196 O  O   . ARG A 1 276 ? 17.927 158.296 -6.713  1.00   85.74 ? 270  ARG A O   1 
ATOM   2197 C  CB  . ARG A 1 276 ? 15.142 158.444 -6.385  0.0000 85.44 ? 270  ARG A CB  1 
ATOM   2198 C  CG  . ARG A 1 276 ? 13.608 158.404 -6.315  0.0000 85.14 ? 270  ARG A CG  1 
ATOM   2199 C  CD  . ARG A 1 276 ? 12.936 159.633 -6.944  0.0000 84.69 ? 270  ARG A CD  1 
ATOM   2200 N  NE  . ARG A 1 276 ? 11.722 160.025 -6.216  0.0000 84.11 ? 270  ARG A NE  1 
ATOM   2201 C  CZ  . ARG A 1 276 ? 10.569 159.346 -6.212  0.0000 83.58 ? 270  ARG A CZ  1 
ATOM   2202 N  NH1 . ARG A 1 276 ? 10.458 158.218 -6.910  0.0000 83.95 ? 270  ARG A NH1 1 
ATOM   2203 N  NH2 . ARG A 1 276 ? 9.541  159.803 -5.505  0.0000 82.98 ? 270  ARG A NH2 1 
ATOM   2204 N  N   . ASP A 1 277 ? 17.810 156.930 -8.511  1.00   86.18 ? 271  ASP A N   1 
ATOM   2205 C  CA  . ASP A 1 277 ? 19.260 156.723 -8.616  1.00   86.40 ? 271  ASP A CA  1 
ATOM   2206 C  C   . ASP A 1 277 ? 19.918 157.879 -9.372  1.00   86.52 ? 271  ASP A C   1 
ATOM   2207 O  O   . ASP A 1 277 ? 21.115 158.133 -9.209  1.00   86.62 ? 271  ASP A O   1 
ATOM   2208 C  CB  . ASP A 1 277 ? 19.583 155.390 -9.312  0.0000 86.38 ? 271  ASP A CB  1 
ATOM   2209 C  CG  . ASP A 1 277 ? 19.534 154.190 -8.360  0.0000 86.42 ? 271  ASP A CG  1 
ATOM   2210 O  OD1 . ASP A 1 277 ? 20.059 154.298 -7.224  0.0000 86.00 ? 271  ASP A OD1 1 
ATOM   2211 O  OD2 . ASP A 1 277 ? 19.001 153.096 -8.668  0.0000 85.63 ? 271  ASP A OD2 1 
ATOM   2212 N  N   . ILE A 1 278 ? 19.128 158.564 -10.201 1.00   86.71 ? 272  ILE A N   1 
ATOM   2213 C  CA  . ILE A 1 278 ? 19.562 159.799 -10.874 1.00   86.65 ? 272  ILE A CA  1 
ATOM   2214 C  C   . ILE A 1 278 ? 19.638 161.008 -9.904  1.00   86.84 ? 272  ILE A C   1 
ATOM   2215 O  O   . ILE A 1 278 ? 19.978 162.142 -10.264 1.00   87.04 ? 272  ILE A O   1 
ATOM   2216 C  CB  . ILE A 1 278 ? 18.666 160.122 -12.141 1.00   86.53 ? 272  ILE A CB  1 
ATOM   2217 C  CG1 . ILE A 1 278 ? 17.159 159.882 -11.898 1.00   86.06 ? 272  ILE A CG1 1 
ATOM   2218 C  CG2 . ILE A 1 278 ? 19.134 159.298 -13.346 1.00   85.91 ? 272  ILE A CG2 1 
ATOM   2219 C  CD1 . ILE A 1 278 ? 16.580 160.529 -10.633 1.00   85.53 ? 272  ILE A CD1 1 
ATOM   2220 O  OXT . ILE A 1 278 ? 19.388 160.940 -8.692  1.00   86.70 ? 272  ILE A OXT 1 
ATOM   2221 N  N   . VAL B 1 15  ? 12.702 173.676 26.475  1.00   58.96 ? 9    VAL B N   1 
ATOM   2222 C  CA  . VAL B 1 15  ? 11.846 172.495 26.145  1.00   58.48 ? 9    VAL B CA  1 
ATOM   2223 C  C   . VAL B 1 15  ? 12.712 171.280 25.762  1.00   57.76 ? 9    VAL B C   1 
ATOM   2224 O  O   . VAL B 1 15  ? 13.945 171.391 25.692  1.00   58.14 ? 9    VAL B O   1 
ATOM   2225 C  CB  . VAL B 1 15  ? 10.851 172.839 25.003  1.00   58.83 ? 9    VAL B CB  1 
ATOM   2226 C  CG1 . VAL B 1 15  ? 9.959  174.020 25.409  1.00   58.70 ? 9    VAL B CG1 1 
ATOM   2227 C  CG2 . VAL B 1 15  ? 11.591 173.166 23.697  1.00   59.49 ? 9    VAL B CG2 1 
ATOM   2228 N  N   . ALA B 1 16  ? 12.063 170.133 25.530  1.00   56.29 ? 10   ALA B N   1 
ATOM   2229 C  CA  . ALA B 1 16  ? 12.756 168.904 25.148  1.00   55.07 ? 10   ALA B CA  1 
ATOM   2230 C  C   . ALA B 1 16  ? 12.950 168.819 23.631  1.00   53.28 ? 10   ALA B C   1 
ATOM   2231 O  O   . ALA B 1 16  ? 12.071 169.180 22.852  1.00   53.23 ? 10   ALA B O   1 
ATOM   2232 C  CB  . ALA B 1 16  ? 11.982 167.669 25.637  1.00   55.24 ? 10   ALA B CB  1 
ATOM   2233 N  N   . PHE B 1 17  ? 14.101 168.291 23.239  1.00   51.45 ? 11   PHE B N   1 
ATOM   2234 C  CA  . PHE B 1 17  ? 14.426 168.008 21.851  1.00   50.01 ? 11   PHE B CA  1 
ATOM   2235 C  C   . PHE B 1 17  ? 13.300 167.253 21.140  1.00   49.78 ? 11   PHE B C   1 
ATOM   2236 O  O   . PHE B 1 17  ? 12.896 167.636 20.050  1.00   49.35 ? 11   PHE B O   1 
ATOM   2237 C  CB  . PHE B 1 17  ? 15.729 167.203 21.810  1.00   49.53 ? 11   PHE B CB  1 
ATOM   2238 C  CG  . PHE B 1 17  ? 16.139 166.773 20.431  1.00   48.56 ? 11   PHE B CG  1 
ATOM   2239 C  CD1 . PHE B 1 17  ? 16.884 167.622 19.620  1.00   45.23 ? 11   PHE B CD1 1 
ATOM   2240 C  CD2 . PHE B 1 17  ? 15.786 165.516 19.943  1.00   46.71 ? 11   PHE B CD2 1 
ATOM   2241 C  CE1 . PHE B 1 17  ? 17.272 167.232 18.366  1.00   44.65 ? 11   PHE B CE1 1 
ATOM   2242 C  CE2 . PHE B 1 17  ? 16.167 165.130 18.675  1.00   46.24 ? 11   PHE B CE2 1 
ATOM   2243 C  CZ  . PHE B 1 17  ? 16.917 166.000 17.883  1.00   45.39 ? 11   PHE B CZ  1 
ATOM   2244 N  N   . GLY B 1 18  ? 12.768 166.215 21.785  1.00   49.47 ? 12   GLY B N   1 
ATOM   2245 C  CA  . GLY B 1 18  ? 11.876 165.252 21.157  1.00   49.48 ? 12   GLY B CA  1 
ATOM   2246 C  C   . GLY B 1 18  ? 10.496 165.776 20.851  1.00   49.91 ? 12   GLY B C   1 
ATOM   2247 O  O   . GLY B 1 18  ? 9.800  165.234 20.003  1.00   50.72 ? 12   GLY B O   1 
ATOM   2248 N  N   . ARG B 1 19  ? 10.097 166.833 21.542  1.00   50.61 ? 13   ARG B N   1 
ATOM   2249 C  CA  . ARG B 1 19  ? 8.857  167.535 21.227  1.00   51.02 ? 13   ARG B CA  1 
ATOM   2250 C  C   . ARG B 1 19  ? 8.898  168.238 19.854  1.00   49.29 ? 13   ARG B C   1 
ATOM   2251 O  O   . ARG B 1 19  ? 7.912  168.180 19.114  1.00   49.62 ? 13   ARG B O   1 
ATOM   2252 C  CB  . ARG B 1 19  ? 8.520  168.572 22.313  1.00   51.83 ? 13   ARG B CB  1 
ATOM   2253 C  CG  . ARG B 1 19  ? 7.503  169.647 21.838  1.00   56.38 ? 13   ARG B CG  1 
ATOM   2254 C  CD  . ARG B 1 19  ? 6.539  170.194 22.892  1.00   61.48 ? 13   ARG B CD  1 
ATOM   2255 N  NE  . ARG B 1 19  ? 5.630  171.197 22.301  1.00   65.72 ? 13   ARG B NE  1 
ATOM   2256 C  CZ  . ARG B 1 19  ? 5.647  172.517 22.553  1.00   68.12 ? 13   ARG B CZ  1 
ATOM   2257 N  NH1 . ARG B 1 19  ? 6.518  173.049 23.410  1.00   68.95 ? 13   ARG B NH1 1 
ATOM   2258 N  NH2 . ARG B 1 19  ? 4.769  173.315 21.944  1.00   68.68 ? 13   ARG B NH2 1 
ATOM   2259 N  N   . ASN B 1 20  ? 10.011 168.913 19.532  1.00   46.88 ? 14   ASN B N   1 
ATOM   2260 C  CA  . ASN B 1 20  ? 10.076 169.774 18.335  1.00   45.09 ? 14   ASN B CA  1 
ATOM   2261 C  C   . ASN B 1 20  ? 10.913 169.246 17.162  1.00   42.58 ? 14   ASN B C   1 
ATOM   2262 O  O   . ASN B 1 20  ? 10.663 169.612 16.013  1.00   41.17 ? 14   ASN B O   1 
ATOM   2263 C  CB  . ASN B 1 20  ? 10.597 171.160 18.730  1.00   45.68 ? 14   ASN B CB  1 
ATOM   2264 C  CG  . ASN B 1 20  ? 9.512  172.072 19.325  1.00   47.55 ? 14   ASN B CG  1 
ATOM   2265 O  OD1 . ASN B 1 20  ? 8.325  171.872 19.070  1.00   51.05 ? 14   ASN B OD1 1 
ATOM   2266 N  ND2 . ASN B 1 20  ? 9.912  173.042 20.132  1.00   50.35 ? 14   ASN B ND2 1 
ATOM   2267 N  N   . TYR B 1 21  ? 11.867 168.372 17.463  1.00   40.38 ? 15   TYR B N   1 
ATOM   2268 C  CA  . TYR B 1 21  ? 12.894 167.934 16.524  1.00   39.58 ? 15   TYR B CA  1 
ATOM   2269 C  C   . TYR B 1 21  ? 12.982 166.395 16.419  1.00   39.35 ? 15   TYR B C   1 
ATOM   2270 O  O   . TYR B 1 21  ? 12.600 165.675 17.349  1.00   38.94 ? 15   TYR B O   1 
ATOM   2271 C  CB  . TYR B 1 21  ? 14.243 168.512 16.967  1.00   38.94 ? 15   TYR B CB  1 
ATOM   2272 C  CG  . TYR B 1 21  ? 14.329 170.035 16.868  1.00   38.28 ? 15   TYR B CG  1 
ATOM   2273 C  CD1 . TYR B 1 21  ? 14.573 170.647 15.653  1.00   37.09 ? 15   TYR B CD1 1 
ATOM   2274 C  CD2 . TYR B 1 21  ? 14.178 170.851 17.991  1.00   39.47 ? 15   TYR B CD2 1 
ATOM   2275 C  CE1 . TYR B 1 21  ? 14.671 172.020 15.528  1.00   37.75 ? 15   TYR B CE1 1 
ATOM   2276 C  CE2 . TYR B 1 21  ? 14.266 172.275 17.881  1.00   39.88 ? 15   TYR B CE2 1 
ATOM   2277 C  CZ  . TYR B 1 21  ? 14.512 172.837 16.642  1.00   39.93 ? 15   TYR B CZ  1 
ATOM   2278 O  OH  . TYR B 1 21  ? 14.608 174.203 16.475  1.00   41.68 ? 15   TYR B OH  1 
ATOM   2279 N  N   . VAL B 1 22  ? 13.458 165.918 15.274  1.00   38.69 ? 16   VAL B N   1 
ATOM   2280 C  CA  . VAL B 1 22  ? 13.774 164.518 15.056  1.00   38.67 ? 16   VAL B CA  1 
ATOM   2281 C  C   . VAL B 1 22  ? 15.159 164.402 14.401  1.00   38.97 ? 16   VAL B C   1 
ATOM   2282 O  O   . VAL B 1 22  ? 15.564 165.285 13.648  1.00   37.10 ? 16   VAL B O   1 
ATOM   2283 C  CB  . VAL B 1 22  ? 12.763 163.807 14.099  1.00   38.92 ? 16   VAL B CB  1 
ATOM   2284 C  CG1 . VAL B 1 22  ? 11.391 163.612 14.746  1.00   38.96 ? 16   VAL B CG1 1 
ATOM   2285 C  CG2 . VAL B 1 22  ? 12.624 164.570 12.761  1.00   39.49 ? 16   VAL B CG2 1 
ATOM   2286 N  N   . PRO B 1 23  ? 15.867 163.300 14.655  1.00   39.53 ? 17   PRO B N   1 
ATOM   2287 C  CA  . PRO B 1 23  ? 17.128 163.018 13.963  1.00   40.00 ? 17   PRO B CA  1 
ATOM   2288 C  C   . PRO B 1 23  ? 16.967 162.895 12.455  1.00   40.67 ? 17   PRO B C   1 
ATOM   2289 O  O   . PRO B 1 23  ? 15.906 162.492 11.981  1.00   41.27 ? 17   PRO B O   1 
ATOM   2290 C  CB  . PRO B 1 23  ? 17.559 161.664 14.548  1.00   40.46 ? 17   PRO B CB  1 
ATOM   2291 C  CG  . PRO B 1 23  ? 16.876 161.558 15.834  1.00   40.11 ? 17   PRO B CG  1 
ATOM   2292 C  CD  . PRO B 1 23  ? 15.539 162.250 15.643  1.00   40.02 ? 17   PRO B CD  1 
ATOM   2293 N  N   . THR B 1 24  ? 18.013 163.254 11.722  1.00   40.91 ? 18   THR B N   1 
ATOM   2294 C  CA  . THR B 1 24  ? 18.025 163.266 10.253  1.00   41.56 ? 18   THR B CA  1 
ATOM   2295 C  C   . THR B 1 24  ? 18.878 162.132 9.690   1.00   40.77 ? 18   THR B C   1 
ATOM   2296 O  O   . THR B 1 24  ? 18.570 161.544 8.656   1.00   41.01 ? 18   THR B O   1 
ATOM   2297 C  CB  . THR B 1 24  ? 18.620 164.622 9.794   1.00   41.64 ? 18   THR B CB  1 
ATOM   2298 O  OG1 . THR B 1 24  ? 17.666 165.659 10.042  1.00   45.61 ? 18   THR B OG1 1 
ATOM   2299 C  CG2 . THR B 1 24  ? 18.845 164.689 8.289   1.00   43.79 ? 18   THR B CG2 1 
ATOM   2300 N  N   . TRP B 1 25  ? 19.982 161.855 10.368  1.00   39.98 ? 19   TRP B N   1 
ATOM   2301 C  CA  . TRP B 1 25  ? 21.021 160.979 9.856   1.00   39.31 ? 19   TRP B CA  1 
ATOM   2302 C  C   . TRP B 1 25  ? 21.921 160.569 11.004  1.00   39.74 ? 19   TRP B C   1 
ATOM   2303 O  O   . TRP B 1 25  ? 22.271 161.412 11.850  1.00   39.33 ? 19   TRP B O   1 
ATOM   2304 C  CB  . TRP B 1 25  ? 21.847 161.707 8.802   1.00   38.84 ? 19   TRP B CB  1 
ATOM   2305 C  CG  . TRP B 1 25  ? 22.934 160.846 8.198   1.00   38.46 ? 19   TRP B CG  1 
ATOM   2306 C  CD1 . TRP B 1 25  ? 24.267 160.896 8.470   1.00   36.48 ? 19   TRP B CD1 1 
ATOM   2307 C  CD2 . TRP B 1 25  ? 22.766 159.811 7.215   1.00   35.61 ? 19   TRP B CD2 1 
ATOM   2308 N  NE1 . TRP B 1 25  ? 24.948 159.969 7.720   1.00   33.84 ? 19   TRP B NE1 1 
ATOM   2309 C  CE2 . TRP B 1 25  ? 24.052 159.280 6.944   1.00   36.39 ? 19   TRP B CE2 1 
ATOM   2310 C  CE3 . TRP B 1 25  ? 21.660 159.276 6.540   1.00   36.48 ? 19   TRP B CE3 1 
ATOM   2311 C  CZ2 . TRP B 1 25  ? 24.266 158.239 6.027   1.00   36.22 ? 19   TRP B CZ2 1 
ATOM   2312 C  CZ3 . TRP B 1 25  ? 21.866 158.238 5.616   1.00   37.21 ? 19   TRP B CZ3 1 
ATOM   2313 C  CH2 . TRP B 1 25  ? 23.166 157.724 5.381   1.00   37.78 ? 19   TRP B CH2 1 
ATOM   2314 N  N   . ALA B 1 26  ? 22.297 159.289 11.023  1.00   39.83 ? 20   ALA B N   1 
ATOM   2315 C  CA  . ALA B 1 26  ? 23.217 158.730 11.997  1.00   40.32 ? 20   ALA B CA  1 
ATOM   2316 C  C   . ALA B 1 26  ? 22.719 158.978 13.394  1.00   41.93 ? 20   ALA B C   1 
ATOM   2317 O  O   . ALA B 1 26  ? 23.353 159.698 14.183  1.00   41.94 ? 20   ALA B O   1 
ATOM   2318 C  CB  . ALA B 1 26  ? 24.597 159.296 11.816  1.00   40.20 ? 20   ALA B CB  1 
ATOM   2319 N  N   . PHE B 1 27  ? 21.575 158.363 13.693  1.00   43.23 ? 21   PHE B N   1 
ATOM   2320 C  CA  . PHE B 1 27  ? 20.842 158.561 14.942  1.00   44.66 ? 21   PHE B CA  1 
ATOM   2321 C  C   . PHE B 1 27  ? 21.714 158.318 16.168  1.00   44.56 ? 21   PHE B C   1 
ATOM   2322 O  O   . PHE B 1 27  ? 21.515 158.956 17.204  1.00   44.99 ? 21   PHE B O   1 
ATOM   2323 C  CB  . PHE B 1 27  ? 19.628 157.624 15.018  1.00   45.45 ? 21   PHE B CB  1 
ATOM   2324 C  CG  . PHE B 1 27  ? 18.528 157.948 14.030  1.00   49.39 ? 21   PHE B CG  1 
ATOM   2325 C  CD1 . PHE B 1 27  ? 18.761 158.738 12.897  1.00   52.25 ? 21   PHE B CD1 1 
ATOM   2326 C  CD2 . PHE B 1 27  ? 17.244 157.445 14.240  1.00   52.47 ? 21   PHE B CD2 1 
ATOM   2327 C  CE1 . PHE B 1 27  ? 17.737 159.013 11.992  1.00   54.11 ? 21   PHE B CE1 1 
ATOM   2328 C  CE2 . PHE B 1 27  ? 16.212 157.729 13.355  1.00   54.54 ? 21   PHE B CE2 1 
ATOM   2329 C  CZ  . PHE B 1 27  ? 16.456 158.517 12.224  1.00   55.19 ? 21   PHE B CZ  1 
ATOM   2330 N  N   . ASP B 1 28  ? 22.668 157.398 16.049  1.00   44.59 ? 22   ASP B N   1 
ATOM   2331 C  CA  . ASP B 1 28  ? 23.540 157.054 17.172  1.00   45.18 ? 22   ASP B CA  1 
ATOM   2332 C  C   . ASP B 1 28  ? 24.714 158.029 17.413  1.00   44.13 ? 22   ASP B C   1 
ATOM   2333 O  O   . ASP B 1 28  ? 25.421 157.918 18.415  1.00   44.43 ? 22   ASP B O   1 
ATOM   2334 C  CB  . ASP B 1 28  ? 24.023 155.601 17.058  1.00   45.77 ? 22   ASP B CB  1 
ATOM   2335 C  CG  . ASP B 1 28  ? 25.068 155.396 15.971  1.00   48.79 ? 22   ASP B CG  1 
ATOM   2336 O  OD1 . ASP B 1 28  ? 24.921 155.924 14.843  1.00   51.57 ? 22   ASP B OD1 1 
ATOM   2337 O  OD2 . ASP B 1 28  ? 26.073 154.689 16.161  1.00   54.75 ? 22   ASP B OD2 1 
ATOM   2338 N  N   . HIS B 1 29  ? 24.894 158.987 16.504  1.00   42.74 ? 23   HIS B N   1 
ATOM   2339 C  CA  . HIS B 1 29  ? 25.801 160.115 16.705  1.00   41.48 ? 23   HIS B CA  1 
ATOM   2340 C  C   . HIS B 1 29  ? 25.181 161.298 17.477  1.00   40.43 ? 23   HIS B C   1 
ATOM   2341 O  O   . HIS B 1 29  ? 25.852 162.278 17.730  1.00   39.80 ? 23   HIS B O   1 
ATOM   2342 C  CB  . HIS B 1 29  ? 26.376 160.548 15.356  1.00   41.41 ? 23   HIS B CB  1 
ATOM   2343 C  CG  . HIS B 1 29  ? 27.362 159.570 14.812  1.00   43.30 ? 23   HIS B CG  1 
ATOM   2344 N  ND1 . HIS B 1 29  ? 26.980 158.394 14.206  1.00   45.24 ? 23   HIS B ND1 1 
ATOM   2345 C  CD2 . HIS B 1 29  ? 28.716 159.618 14.721  1.00   45.33 ? 23   HIS B CD2 1 
ATOM   2346 C  CE1 . HIS B 1 29  ? 28.057 157.750 13.778  1.00   46.38 ? 23   HIS B CE1 1 
ATOM   2347 N  NE2 . HIS B 1 29  ? 29.123 158.465 14.092  1.00   45.66 ? 23   HIS B NE2 1 
ATOM   2348 N  N   . ILE B 1 30  ? 23.916 161.184 17.858  1.00   39.81 ? 24   ILE B N   1 
ATOM   2349 C  CA  . ILE B 1 30  ? 23.248 162.153 18.719  1.00   39.86 ? 24   ILE B CA  1 
ATOM   2350 C  C   . ILE B 1 30  ? 23.056 161.565 20.117  1.00   41.13 ? 24   ILE B C   1 
ATOM   2351 O  O   . ILE B 1 30  ? 22.343 160.584 20.270  1.00   41.48 ? 24   ILE B O   1 
ATOM   2352 C  CB  . ILE B 1 30  ? 21.879 162.531 18.136  1.00   39.02 ? 24   ILE B CB  1 
ATOM   2353 C  CG1 . ILE B 1 30  ? 22.047 163.138 16.740  1.00   38.61 ? 24   ILE B CG1 1 
ATOM   2354 C  CG2 . ILE B 1 30  ? 21.155 163.483 19.052  1.00   38.78 ? 24   ILE B CG2 1 
ATOM   2355 C  CD1 . ILE B 1 30  ? 20.772 163.464 16.064  1.00   40.40 ? 24   ILE B CD1 1 
ATOM   2356 N  N   . LYS B 1 31  ? 23.675 162.166 21.130  1.00   42.22 ? 25   LYS B N   1 
ATOM   2357 C  CA  . LYS B 1 31  ? 23.529 161.709 22.523  1.00   43.48 ? 25   LYS B CA  1 
ATOM   2358 C  C   . LYS B 1 31  ? 22.633 162.645 23.309  1.00   44.50 ? 25   LYS B C   1 
ATOM   2359 O  O   . LYS B 1 31  ? 22.745 163.872 23.178  1.00   44.22 ? 25   LYS B O   1 
ATOM   2360 C  CB  . LYS B 1 31  ? 24.869 161.653 23.221  1.00   43.75 ? 25   LYS B CB  1 
ATOM   2361 C  CG  . LYS B 1 31  ? 26.022 161.226 22.378  1.00   44.96 ? 25   LYS B CG  1 
ATOM   2362 C  CD  . LYS B 1 31  ? 25.852 159.843 21.805  1.00   46.80 ? 25   LYS B CD  1 
ATOM   2363 C  CE  . LYS B 1 31  ? 27.207 159.245 21.433  1.00   48.19 ? 25   LYS B CE  1 
ATOM   2364 N  NZ  . LYS B 1 31  ? 27.036 158.084 20.499  1.00   49.61 ? 25   LYS B NZ  1 
ATOM   2365 N  N   . TYR B 1 32  ? 21.761 162.066 24.131  1.00   45.34 ? 26   TYR B N   1 
ATOM   2366 C  CA  . TYR B 1 32  ? 20.737 162.788 24.873  1.00   46.64 ? 26   TYR B CA  1 
ATOM   2367 C  C   . TYR B 1 32  ? 21.073 162.874 26.361  1.00   47.73 ? 26   TYR B C   1 
ATOM   2368 O  O   . TYR B 1 32  ? 21.495 161.885 26.960  1.00   48.04 ? 26   TYR B O   1 
ATOM   2369 C  CB  . TYR B 1 32  ? 19.380 162.094 24.719  1.00   46.78 ? 26   TYR B CB  1 
ATOM   2370 C  CG  . TYR B 1 32  ? 18.928 161.978 23.296  1.00   48.14 ? 26   TYR B CG  1 
ATOM   2371 C  CD1 . TYR B 1 32  ? 19.485 161.019 22.444  1.00   49.13 ? 26   TYR B CD1 1 
ATOM   2372 C  CD2 . TYR B 1 32  ? 17.964 162.846 22.776  1.00   49.00 ? 26   TYR B CD2 1 
ATOM   2373 C  CE1 . TYR B 1 32  ? 19.085 160.921 21.112  1.00   49.10 ? 26   TYR B CE1 1 
ATOM   2374 C  CE2 . TYR B 1 32  ? 17.546 162.740 21.444  1.00   49.99 ? 26   TYR B CE2 1 
ATOM   2375 C  CZ  . TYR B 1 32  ? 18.119 161.783 20.621  1.00   50.58 ? 26   TYR B CZ  1 
ATOM   2376 O  OH  . TYR B 1 32  ? 17.732 161.679 19.307  1.00   52.06 ? 26   TYR B OH  1 
ATOM   2377 N  N   . PHE B 1 33  ? 20.838 164.049 26.944  1.00   48.80 ? 27   PHE B N   1 
ATOM   2378 C  CA  . PHE B 1 33  ? 21.125 164.347 28.353  1.00   49.80 ? 27   PHE B CA  1 
ATOM   2379 C  C   . PHE B 1 33  ? 19.905 165.030 28.967  1.00   51.38 ? 27   PHE B C   1 
ATOM   2380 O  O   . PHE B 1 33  ? 19.248 165.834 28.296  1.00   51.33 ? 27   PHE B O   1 
ATOM   2381 C  CB  . PHE B 1 33  ? 22.320 165.295 28.495  1.00   49.46 ? 27   PHE B CB  1 
ATOM   2382 C  CG  . PHE B 1 33  ? 23.618 164.721 28.034  1.00   48.49 ? 27   PHE B CG  1 
ATOM   2383 C  CD1 . PHE B 1 33  ? 23.915 164.639 26.670  1.00   47.76 ? 27   PHE B CD1 1 
ATOM   2384 C  CD2 . PHE B 1 33  ? 24.556 164.264 28.958  1.00   47.06 ? 27   PHE B CD2 1 
ATOM   2385 C  CE1 . PHE B 1 33  ? 25.130 164.097 26.240  1.00   48.40 ? 27   PHE B CE1 1 
ATOM   2386 C  CE2 . PHE B 1 33  ? 25.774 163.724 28.541  1.00   46.87 ? 27   PHE B CE2 1 
ATOM   2387 C  CZ  . PHE B 1 33  ? 26.067 163.628 27.193  1.00   47.99 ? 27   PHE B CZ  1 
ATOM   2388 N  N   . ASN B 1 34  ? 19.612 164.720 30.239  1.00   52.69 ? 28   ASN B N   1 
ATOM   2389 C  CA  . ASN B 1 34  ? 18.501 165.327 30.993  1.00   53.84 ? 28   ASN B CA  1 
ATOM   2390 C  C   . ASN B 1 34  ? 17.156 165.299 30.271  1.00   53.92 ? 28   ASN B C   1 
ATOM   2391 O  O   . ASN B 1 34  ? 16.458 166.318 30.185  1.00   54.34 ? 28   ASN B O   1 
ATOM   2392 C  CB  . ASN B 1 34  ? 18.834 166.770 31.406  1.00   54.49 ? 28   ASN B CB  1 
ATOM   2393 C  CG  . ASN B 1 34  ? 17.824 167.349 32.428  1.00   57.74 ? 28   ASN B CG  1 
ATOM   2394 O  OD1 . ASN B 1 34  ? 17.238 166.609 33.239  1.00   61.26 ? 28   ASN B OD1 1 
ATOM   2395 N  ND2 . ASN B 1 34  ? 17.615 168.675 32.379  1.00   59.93 ? 28   ASN B ND2 1 
ATOM   2396 N  N   . GLY B 1 35  ? 16.800 164.130 29.758  1.00   53.91 ? 29   GLY B N   1 
ATOM   2397 C  CA  . GLY B 1 35  ? 15.530 163.940 29.076  1.00   54.19 ? 29   GLY B CA  1 
ATOM   2398 C  C   . GLY B 1 35  ? 15.427 164.640 27.734  1.00   53.88 ? 29   GLY B C   1 
ATOM   2399 O  O   . GLY B 1 35  ? 14.320 164.953 27.284  1.00   55.02 ? 29   GLY B O   1 
ATOM   2400 N  N   . GLY B 1 36  ? 16.572 164.854 27.081  1.00   53.16 ? 30   GLY B N   1 
ATOM   2401 C  CA  . GLY B 1 36  ? 16.635 165.625 25.849  1.00   52.07 ? 30   GLY B CA  1 
ATOM   2402 C  C   . GLY B 1 36  ? 16.560 167.139 26.041  1.00   51.21 ? 30   GLY B C   1 
ATOM   2403 O  O   . GLY B 1 36  ? 16.223 167.869 25.109  1.00   50.16 ? 30   GLY B O   1 
ATOM   2404 N  N   . ASN B 1 37  ? 16.864 167.624 27.239  1.00   50.22 ? 31   ASN B N   1 
ATOM   2405 C  CA  . ASN B 1 37  ? 17.002 169.070 27.441  1.00   49.89 ? 31   ASN B CA  1 
ATOM   2406 C  C   . ASN B 1 37  ? 18.372 169.558 26.936  1.00   48.61 ? 31   ASN B C   1 
ATOM   2407 O  O   . ASN B 1 37  ? 18.574 170.749 26.742  1.00   48.74 ? 31   ASN B O   1 
ATOM   2408 C  CB  . ASN B 1 37  ? 16.792 169.455 28.914  1.00   49.88 ? 31   ASN B CB  1 
ATOM   2409 C  CG  . ASN B 1 37  ? 15.317 169.676 29.267  1.00   52.06 ? 31   ASN B CG  1 
ATOM   2410 O  OD1 . ASN B 1 37  ? 14.403 169.209 28.578  1.00   52.77 ? 31   ASN B OD1 1 
ATOM   2411 N  ND2 . ASN B 1 37  ? 15.084 170.389 30.363  1.00   55.75 ? 31   ASN B ND2 1 
ATOM   2412 N  N   . GLU B 1 38  ? 19.308 168.630 26.768  1.00   47.05 ? 32   GLU B N   1 
ATOM   2413 C  CA  . GLU B 1 38  ? 20.602 168.901 26.139  1.00   46.24 ? 32   GLU B CA  1 
ATOM   2414 C  C   . GLU B 1 38  ? 20.955 167.705 25.219  1.00   44.54 ? 32   GLU B C   1 
ATOM   2415 O  O   . GLU B 1 38  ? 20.630 166.556 25.558  1.00   43.53 ? 32   GLU B O   1 
ATOM   2416 C  CB  . GLU B 1 38  ? 21.688 169.133 27.214  1.00   46.34 ? 32   GLU B CB  1 
ATOM   2417 C  CG  . GLU B 1 38  ? 23.119 169.063 26.696  1.00   49.13 ? 32   GLU B CG  1 
ATOM   2418 C  CD  . GLU B 1 38  ? 24.163 169.689 27.625  1.00   52.59 ? 32   GLU B CD  1 
ATOM   2419 O  OE1 . GLU B 1 38  ? 23.797 170.211 28.703  1.00   55.77 ? 32   GLU B OE1 1 
ATOM   2420 O  OE2 . GLU B 1 38  ? 25.369 169.661 27.277  1.00   53.75 ? 32   GLU B OE2 1 
ATOM   2421 N  N   . ILE B 1 39  ? 21.572 167.986 24.063  1.00   41.48 ? 33   ILE B N   1 
ATOM   2422 C  CA  . ILE B 1 39  ? 22.115 166.958 23.175  1.00   39.69 ? 33   ILE B CA  1 
ATOM   2423 C  C   . ILE B 1 39  ? 23.527 167.281 22.673  1.00   37.98 ? 33   ILE B C   1 
ATOM   2424 O  O   . ILE B 1 39  ? 23.961 168.451 22.633  1.00   36.24 ? 33   ILE B O   1 
ATOM   2425 C  CB  . ILE B 1 39  ? 21.164 166.687 21.973  1.00   39.80 ? 33   ILE B CB  1 
ATOM   2426 C  CG1 . ILE B 1 39  ? 21.181 167.848 20.979  1.00   42.15 ? 33   ILE B CG1 1 
ATOM   2427 C  CG2 . ILE B 1 39  ? 19.730 166.428 22.451  1.00   40.30 ? 33   ILE B CG2 1 
ATOM   2428 C  CD1 . ILE B 1 39  ? 20.840 167.463 19.568  1.00   44.58 ? 33   ILE B CD1 1 
ATOM   2429 N  N   . GLN B 1 40  ? 24.251 166.237 22.293  1.00   36.37 ? 34   GLN B N   1 
ATOM   2430 C  CA  . GLN B 1 40  ? 25.501 166.372 21.590  1.00   35.52 ? 34   GLN B CA  1 
ATOM   2431 C  C   . GLN B 1 40  ? 25.383 165.733 20.207  1.00   35.30 ? 34   GLN B C   1 
ATOM   2432 O  O   . GLN B 1 40  ? 24.693 164.695 20.046  1.00   35.28 ? 34   GLN B O   1 
ATOM   2433 C  CB  . GLN B 1 40  ? 26.622 165.695 22.340  1.00   36.36 ? 34   GLN B CB  1 
ATOM   2434 C  CG  . GLN B 1 40  ? 26.901 166.250 23.725  1.00   37.18 ? 34   GLN B CG  1 
ATOM   2435 C  CD  . GLN B 1 40  ? 28.014 165.485 24.420  1.00   38.86 ? 34   GLN B CD  1 
ATOM   2436 O  OE1 . GLN B 1 40  ? 28.345 164.356 24.031  1.00   42.22 ? 34   GLN B OE1 1 
ATOM   2437 N  NE2 . GLN B 1 40  ? 28.596 166.089 25.431  1.00   37.99 ? 34   GLN B NE2 1 
ATOM   2438 N  N   . LEU B 1 41  ? 26.038 166.358 19.228  1.00   32.89 ? 35   LEU B N   1 
ATOM   2439 C  CA  . LEU B 1 41  ? 26.162 165.849 17.874  1.00   32.67 ? 35   LEU B CA  1 
ATOM   2440 C  C   . LEU B 1 41  ? 27.617 165.490 17.740  1.00   31.98 ? 35   LEU B C   1 
ATOM   2441 O  O   . LEU B 1 41  ? 28.490 166.279 18.084  1.00   31.68 ? 35   LEU B O   1 
ATOM   2442 C  CB  . LEU B 1 41  ? 25.773 166.917 16.822  1.00   32.92 ? 35   LEU B CB  1 
ATOM   2443 C  CG  . LEU B 1 41  ? 24.308 166.921 16.385  1.00   33.65 ? 35   LEU B CG  1 
ATOM   2444 C  CD1 . LEU B 1 41  ? 23.442 166.900 17.570  1.00   35.33 ? 35   LEU B CD1 1 
ATOM   2445 C  CD2 . LEU B 1 41  ? 23.949 168.092 15.453  1.00   33.46 ? 35   LEU B CD2 1 
ATOM   2446 N  N   . HIS B 1 42  ? 27.887 164.291 17.259  1.00   31.63 ? 36   HIS B N   1 
ATOM   2447 C  CA  . HIS B 1 42  ? 29.243 163.778 17.165  1.00   32.57 ? 36   HIS B CA  1 
ATOM   2448 C  C   . HIS B 1 42  ? 29.613 163.614 15.717  1.00   32.06 ? 36   HIS B C   1 
ATOM   2449 O  O   . HIS B 1 42  ? 28.823 163.098 14.934  1.00   33.69 ? 36   HIS B O   1 
ATOM   2450 C  CB  . HIS B 1 42  ? 29.333 162.392 17.801  1.00   33.82 ? 36   HIS B CB  1 
ATOM   2451 C  CG  . HIS B 1 42  ? 29.455 162.385 19.291  1.00   36.15 ? 36   HIS B CG  1 
ATOM   2452 N  ND1 . HIS B 1 42  ? 28.368 162.332 20.130  1.00   42.87 ? 36   HIS B ND1 1 
ATOM   2453 C  CD2 . HIS B 1 42  ? 30.542 162.356 20.092  1.00   39.64 ? 36   HIS B CD2 1 
ATOM   2454 C  CE1 . HIS B 1 42  ? 28.784 162.302 21.385  1.00   41.35 ? 36   HIS B CE1 1 
ATOM   2455 N  NE2 . HIS B 1 42  ? 30.098 162.309 21.388  1.00   40.35 ? 36   HIS B NE2 1 
ATOM   2456 N  N   . LEU B 1 43  ? 30.828 163.995 15.360  1.00   31.97 ? 37   LEU B N   1 
ATOM   2457 C  CA  . LEU B 1 43  ? 31.344 163.810 14.022  1.00   32.36 ? 37   LEU B CA  1 
ATOM   2458 C  C   . LEU B 1 43  ? 32.640 162.984 14.055  1.00   33.38 ? 37   LEU B C   1 
ATOM   2459 O  O   . LEU B 1 43  ? 33.543 163.254 14.848  1.00   32.68 ? 37   LEU B O   1 
ATOM   2460 C  CB  . LEU B 1 43  ? 31.612 165.165 13.380  1.00   31.97 ? 37   LEU B CB  1 
ATOM   2461 C  CG  . LEU B 1 43  ? 32.547 165.262 12.192  1.00   31.48 ? 37   LEU B CG  1 
ATOM   2462 C  CD1 . LEU B 1 43  ? 31.943 164.616 10.929  1.00   30.85 ? 37   LEU B CD1 1 
ATOM   2463 C  CD2 . LEU B 1 43  ? 32.936 166.740 11.921  1.00   31.27 ? 37   LEU B CD2 1 
ATOM   2464 N  N   . ASP B 1 44  ? 32.726 161.984 13.175  1.00   34.26 ? 38   ASP B N   1 
ATOM   2465 C  CA  . ASP B 1 44  ? 33.980 161.255 12.941  1.00   35.11 ? 38   ASP B CA  1 
ATOM   2466 C  C   . ASP B 1 44  ? 34.183 161.082 11.450  1.00   35.04 ? 38   ASP B C   1 
ATOM   2467 O  O   . ASP B 1 44  ? 33.408 161.608 10.646  1.00   33.84 ? 38   ASP B O   1 
ATOM   2468 C  CB  . ASP B 1 44  ? 34.007 159.925 13.703  1.00   35.75 ? 38   ASP B CB  1 
ATOM   2469 C  CG  . ASP B 1 44  ? 32.961 158.925 13.199  1.00   37.98 ? 38   ASP B CG  1 
ATOM   2470 O  OD1 . ASP B 1 44  ? 32.570 158.964 12.017  1.00   41.26 ? 38   ASP B OD1 1 
ATOM   2471 O  OD2 . ASP B 1 44  ? 32.446 158.075 13.927  1.00   42.69 ? 38   ASP B OD2 1 
ATOM   2472 N  N   . LYS B 1 45  ? 35.244 160.373 11.073  1.00   36.02 ? 39   LYS B N   1 
ATOM   2473 C  CA  . LYS B 1 45  ? 35.644 160.280 9.665   1.00   36.63 ? 39   LYS B CA  1 
ATOM   2474 C  C   . LYS B 1 45  ? 34.644 159.520 8.808   1.00   36.57 ? 39   LYS B C   1 
ATOM   2475 O  O   . LYS B 1 45  ? 34.654 159.643 7.583   1.00   37.48 ? 39   LYS B O   1 
ATOM   2476 C  CB  . LYS B 1 45  ? 37.054 159.676 9.511   1.00   37.73 ? 39   LYS B CB  1 
ATOM   2477 C  CG  . LYS B 1 45  ? 37.259 158.248 10.063  1.00   40.32 ? 39   LYS B CG  1 
ATOM   2478 C  CD  . LYS B 1 45  ? 38.536 157.608 9.450   1.00   44.86 ? 39   LYS B CD  1 
ATOM   2479 C  CE  . LYS B 1 45  ? 39.017 156.398 10.264  1.00   46.87 ? 39   LYS B CE  1 
ATOM   2480 N  NZ  . LYS B 1 45  ? 40.267 155.773 9.695   1.00   48.79 ? 39   LYS B NZ  1 
ATOM   2481 N  N   . TYR B 1 46  ? 33.765 158.758 9.440   1.00   36.29 ? 40   TYR B N   1 
ATOM   2482 C  CA  . TYR B 1 46  ? 32.751 158.005 8.698   1.00   37.03 ? 40   TYR B CA  1 
ATOM   2483 C  C   . TYR B 1 46  ? 31.511 158.835 8.385   1.00   36.43 ? 40   TYR B C   1 
ATOM   2484 O  O   . TYR B 1 46  ? 30.892 158.677 7.320   1.00   35.74 ? 40   TYR B O   1 
ATOM   2485 C  CB  . TYR B 1 46  ? 32.364 156.736 9.485   1.00   37.48 ? 40   TYR B CB  1 
ATOM   2486 C  CG  . TYR B 1 46  ? 33.555 155.832 9.705   1.00   38.85 ? 40   TYR B CG  1 
ATOM   2487 C  CD1 . TYR B 1 46  ? 34.113 155.130 8.635   1.00   41.43 ? 40   TYR B CD1 1 
ATOM   2488 C  CD2 . TYR B 1 46  ? 34.154 155.720 10.956  1.00   41.05 ? 40   TYR B CD2 1 
ATOM   2489 C  CE1 . TYR B 1 46  ? 35.237 154.311 8.812   1.00   42.65 ? 40   TYR B CE1 1 
ATOM   2490 C  CE2 . TYR B 1 46  ? 35.289 154.901 11.148  1.00   42.60 ? 40   TYR B CE2 1 
ATOM   2491 C  CZ  . TYR B 1 46  ? 35.808 154.199 10.068  1.00   43.22 ? 40   TYR B CZ  1 
ATOM   2492 O  OH  . TYR B 1 46  ? 36.908 153.399 10.226  1.00   47.19 ? 40   TYR B OH  1 
ATOM   2493 N  N   . THR B 1 47  ? 31.127 159.699 9.325   1.00   35.73 ? 41   THR B N   1 
ATOM   2494 C  CA  . THR B 1 47  ? 29.893 160.467 9.188   1.00   34.77 ? 41   THR B CA  1 
ATOM   2495 C  C   . THR B 1 47  ? 29.751 161.580 10.229  1.00   33.79 ? 41   THR B C   1 
ATOM   2496 O  O   . THR B 1 47  ? 30.236 161.471 11.369  1.00   32.05 ? 41   THR B O   1 
ATOM   2497 C  CB  . THR B 1 47  ? 28.667 159.516 9.324   1.00   35.17 ? 41   THR B CB  1 
ATOM   2498 O  OG1 . THR B 1 47  ? 27.438 160.238 9.114   1.00   36.29 ? 41   THR B OG1 1 
ATOM   2499 C  CG2 . THR B 1 47  ? 28.548 158.946 10.750  1.00   34.85 ? 41   THR B CG2 1 
ATOM   2500 N  N   . GLY B 1 48  ? 29.029 162.617 9.814   1.00   31.93 ? 42   GLY B N   1 
ATOM   2501 C  CA  . GLY B 1 48  ? 28.478 163.591 10.738  1.00   31.62 ? 42   GLY B CA  1 
ATOM   2502 C  C   . GLY B 1 48  ? 27.047 163.245 11.021  1.00   31.25 ? 42   GLY B C   1 
ATOM   2503 O  O   . GLY B 1 48  ? 26.621 162.084 10.883  1.00   31.86 ? 42   GLY B O   1 
ATOM   2504 N  N   . THR B 1 49  ? 26.285 164.243 11.438  1.00   29.83 ? 43   THR B N   1 
ATOM   2505 C  CA  . THR B 1 49  ? 24.947 164.004 11.921  1.00   29.19 ? 43   THR B CA  1 
ATOM   2506 C  C   . THR B 1 49  ? 24.135 165.284 11.906  1.00   29.17 ? 43   THR B C   1 
ATOM   2507 O  O   . THR B 1 49  ? 24.666 166.371 11.684  1.00   27.00 ? 43   THR B O   1 
ATOM   2508 C  CB  . THR B 1 49  ? 24.996 163.300 13.330  1.00   29.83 ? 43   THR B CB  1 
ATOM   2509 O  OG1 . THR B 1 49  ? 23.670 162.920 13.746  1.00   30.94 ? 43   THR B OG1 1 
ATOM   2510 C  CG2 . THR B 1 49  ? 25.523 164.205 14.458  1.00   30.24 ? 43   THR B CG2 1 
ATOM   2511 N  N   . GLY B 1 50  ? 22.831 165.148 12.094  1.00   29.03 ? 44   GLY B N   1 
ATOM   2512 C  CA  . GLY B 1 50  ? 21.987 166.313 12.217  1.00   29.19 ? 44   GLY B CA  1 
ATOM   2513 C  C   . GLY B 1 50  ? 20.546 165.988 12.526  1.00   29.69 ? 44   GLY B C   1 
ATOM   2514 O  O   . GLY B 1 50  ? 20.158 164.809 12.687  1.00   30.77 ? 44   GLY B O   1 
ATOM   2515 N  N   . PHE B 1 51  ? 19.766 167.046 12.636  1.00   28.42 ? 45   PHE B N   1 
ATOM   2516 C  CA  . PHE B 1 51  ? 18.371 166.964 12.986  1.00   28.40 ? 45   PHE B CA  1 
ATOM   2517 C  C   . PHE B 1 51  ? 17.599 168.077 12.303  1.00   28.53 ? 45   PHE B C   1 
ATOM   2518 O  O   . PHE B 1 51  ? 18.183 168.993 11.691  1.00   26.48 ? 45   PHE B O   1 
ATOM   2519 C  CB  . PHE B 1 51  ? 18.172 166.947 14.498  1.00   28.32 ? 45   PHE B CB  1 
ATOM   2520 C  CG  . PHE B 1 51  ? 18.685 168.163 15.232  1.00   27.57 ? 45   PHE B CG  1 
ATOM   2521 C  CD1 . PHE B 1 51  ? 17.865 169.250 15.446  1.00   29.30 ? 45   PHE B CD1 1 
ATOM   2522 C  CD2 . PHE B 1 51  ? 19.963 168.177 15.779  1.00   27.39 ? 45   PHE B CD2 1 
ATOM   2523 C  CE1 . PHE B 1 51  ? 18.334 170.359 16.158  1.00   31.71 ? 45   PHE B CE1 1 
ATOM   2524 C  CE2 . PHE B 1 51  ? 20.425 169.272 16.467  1.00   28.36 ? 45   PHE B CE2 1 
ATOM   2525 C  CZ  . PHE B 1 51  ? 19.618 170.364 16.657  1.00   29.58 ? 45   PHE B CZ  1 
ATOM   2526 N  N   . GLN B 1 52  ? 16.285 167.911 12.321  1.00   29.04 ? 46   GLN B N   1 
ATOM   2527 C  CA  . GLN B 1 52  ? 15.352 168.826 11.717  1.00   29.63 ? 46   GLN B CA  1 
ATOM   2528 C  C   . GLN B 1 52  ? 14.103 168.943 12.562  1.00   29.86 ? 46   GLN B C   1 
ATOM   2529 O  O   . GLN B 1 52  ? 13.774 168.045 13.328  1.00   30.09 ? 46   GLN B O   1 
ATOM   2530 C  CB  . GLN B 1 52  ? 14.988 168.395 10.309  1.00   29.95 ? 46   GLN B CB  1 
ATOM   2531 C  CG  . GLN B 1 52  ? 14.134 167.135 10.194  1.00   32.08 ? 46   GLN B CG  1 
ATOM   2532 C  CD  . GLN B 1 52  ? 13.908 166.718 8.746   1.00   34.53 ? 46   GLN B CD  1 
ATOM   2533 O  OE1 . GLN B 1 52  ? 12.774 166.645 8.287   1.00   39.17 ? 46   GLN B OE1 1 
ATOM   2534 N  NE2 . GLN B 1 52  ? 14.976 166.474 8.028   1.00   37.96 ? 46   GLN B NE2 1 
ATOM   2535 N  N   . SER B 1 53  ? 13.401 170.053 12.398  1.00   29.39 ? 47   SER B N   1 
ATOM   2536 C  CA  . SER B 1 53  ? 12.137 170.263 13.071  1.00   30.25 ? 47   SER B CA  1 
ATOM   2537 C  C   . SER B 1 53  ? 11.057 169.378 12.453  1.00   30.76 ? 47   SER B C   1 
ATOM   2538 O  O   . SER B 1 53  ? 11.089 169.080 11.254  1.00   28.61 ? 47   SER B O   1 
ATOM   2539 C  CB  . SER B 1 53  ? 11.702 171.725 12.970  1.00   30.23 ? 47   SER B CB  1 
ATOM   2540 O  OG  . SER B 1 53  ? 11.570 172.122 11.612  1.00   28.74 ? 47   SER B OG  1 
ATOM   2541 N  N   . LYS B 1 54  ? 10.096 168.990 13.288  1.00   32.31 ? 48   LYS B N   1 
ATOM   2542 C  CA  . LYS B 1 54  ? 8.916  168.217 12.858  1.00   34.05 ? 48   LYS B CA  1 
ATOM   2543 C  C   . LYS B 1 54  ? 8.044  169.008 11.920  1.00   33.11 ? 48   LYS B C   1 
ATOM   2544 O  O   . LYS B 1 54  ? 7.666  168.538 10.882  1.00   34.84 ? 48   LYS B O   1 
ATOM   2545 C  CB  . LYS B 1 54  ? 8.086  167.824 14.085  1.00   35.45 ? 48   LYS B CB  1 
ATOM   2546 C  CG  . LYS B 1 54  ? 8.775  166.845 15.046  1.00   38.89 ? 48   LYS B CG  1 
ATOM   2547 C  CD  . LYS B 1 54  ? 7.767  166.213 16.017  1.00   43.76 ? 48   LYS B CD  1 
ATOM   2548 C  CE  . LYS B 1 54  ? 8.338  164.979 16.700  1.00   46.88 ? 48   LYS B CE  1 
ATOM   2549 N  NZ  . LYS B 1 54  ? 9.629  165.316 17.373  1.00   51.98 ? 48   LYS B NZ  1 
ATOM   2550 N  N   . GLY B 1 55  ? 7.722  170.233 12.287  1.00   33.69 ? 49   GLY B N   1 
ATOM   2551 C  CA  . GLY B 1 55  ? 6.936  171.103 11.431  1.00   32.42 ? 49   GLY B CA  1 
ATOM   2552 C  C   . GLY B 1 55  ? 7.737  172.052 10.548  1.00   32.28 ? 49   GLY B C   1 
ATOM   2553 O  O   . GLY B 1 55  ? 8.966  172.131 10.615  1.00   32.31 ? 49   GLY B O   1 
ATOM   2554 N  N   . SER B 1 56  ? 6.999  172.735 9.689   1.00   32.04 ? 50   SER B N   1 
ATOM   2555 C  CA  . SER B 1 56  ? 7.456  173.802 8.835   1.00   32.48 ? 50   SER B CA  1 
ATOM   2556 C  C   . SER B 1 56  ? 6.810  175.111 9.295   1.00   31.89 ? 50   SER B C   1 
ATOM   2557 O  O   . SER B 1 56  ? 5.687  175.109 9.782   1.00   31.22 ? 50   SER B O   1 
ATOM   2558 C  CB  . SER B 1 56  ? 7.032  173.487 7.402   1.00   33.06 ? 50   SER B CB  1 
ATOM   2559 O  OG  . SER B 1 56  ? 7.803  172.419 6.894   1.00   38.09 ? 50   SER B OG  1 
ATOM   2560 N  N   . TYR B 1 57  ? 7.498  176.233 9.101   1.00   31.11 ? 51   TYR B N   1 
ATOM   2561 C  CA  . TYR B 1 57  ? 7.070  177.520 9.641   1.00   30.62 ? 51   TYR B CA  1 
ATOM   2562 C  C   . TYR B 1 57  ? 7.156  178.646 8.626   1.00   29.99 ? 51   TYR B C   1 
ATOM   2563 O  O   . TYR B 1 57  ? 8.052  178.667 7.788   1.00   30.46 ? 51   TYR B O   1 
ATOM   2564 C  CB  . TYR B 1 57  ? 7.921  177.862 10.880  1.00   30.80 ? 51   TYR B CB  1 
ATOM   2565 C  CG  . TYR B 1 57  ? 7.798  176.818 11.944  1.00   30.79 ? 51   TYR B CG  1 
ATOM   2566 C  CD1 . TYR B 1 57  ? 8.628  175.719 11.955  1.00   31.21 ? 51   TYR B CD1 1 
ATOM   2567 C  CD2 . TYR B 1 57  ? 6.798  176.899 12.912  1.00   32.68 ? 51   TYR B CD2 1 
ATOM   2568 C  CE1 . TYR B 1 57  ? 8.495  174.735 12.902  1.00   31.90 ? 51   TYR B CE1 1 
ATOM   2569 C  CE2 . TYR B 1 57  ? 6.662  175.909 13.898  1.00   31.67 ? 51   TYR B CE2 1 
ATOM   2570 C  CZ  . TYR B 1 57  ? 7.494  174.838 13.871  1.00   32.71 ? 51   TYR B CZ  1 
ATOM   2571 O  OH  . TYR B 1 57  ? 7.377  173.871 14.804  1.00   34.61 ? 51   TYR B OH  1 
ATOM   2572 N  N   . LEU B 1 58  ? 6.223  179.589 8.710   1.00   29.58 ? 52   LEU B N   1 
ATOM   2573 C  CA  . LEU B 1 58  ? 6.297  180.823 7.977   1.00   30.46 ? 52   LEU B CA  1 
ATOM   2574 C  C   . LEU B 1 58  ? 6.254  181.992 8.962   1.00   30.54 ? 52   LEU B C   1 
ATOM   2575 O  O   . LEU B 1 58  ? 5.173  182.359 9.445   1.00   30.89 ? 52   LEU B O   1 
ATOM   2576 C  CB  . LEU B 1 58  ? 5.142  180.887 6.964   1.00   31.29 ? 52   LEU B CB  1 
ATOM   2577 C  CG  . LEU B 1 58  ? 5.232  181.879 5.824   1.00   33.69 ? 52   LEU B CG  1 
ATOM   2578 C  CD1 . LEU B 1 58  ? 6.378  181.552 4.881   1.00   34.44 ? 52   LEU B CD1 1 
ATOM   2579 C  CD2 . LEU B 1 58  ? 3.893  181.867 5.039   1.00   38.00 ? 52   LEU B CD2 1 
ATOM   2580 N  N   . PHE B 1 59  ? 7.438  182.545 9.266   1.00   29.12 ? 53   PHE B N   1 
ATOM   2581 C  CA  . PHE B 1 59  ? 7.647  183.622 10.231  1.00   28.58 ? 53   PHE B CA  1 
ATOM   2582 C  C   . PHE B 1 59  ? 7.744  183.101 11.646  1.00   27.87 ? 53   PHE B C   1 
ATOM   2583 O  O   . PHE B 1 59  ? 7.181  182.059 11.980  1.00   28.20 ? 53   PHE B O   1 
ATOM   2584 C  CB  . PHE B 1 59  ? 6.598  184.762 10.118  1.00   28.97 ? 53   PHE B CB  1 
ATOM   2585 C  CG  . PHE B 1 59  ? 6.419  185.272 8.717   1.00   30.80 ? 53   PHE B CG  1 
ATOM   2586 C  CD1 . PHE B 1 59  ? 7.507  185.763 8.005   1.00   29.68 ? 53   PHE B CD1 1 
ATOM   2587 C  CD2 . PHE B 1 59  ? 5.171  185.222 8.090   1.00   32.56 ? 53   PHE B CD2 1 
ATOM   2588 C  CE1 . PHE B 1 59  ? 7.356  186.206 6.715   1.00   33.78 ? 53   PHE B CE1 1 
ATOM   2589 C  CE2 . PHE B 1 59  ? 5.017  185.657 6.804   1.00   33.22 ? 53   PHE B CE2 1 
ATOM   2590 C  CZ  . PHE B 1 59  ? 6.103  186.174 6.106   1.00   33.56 ? 53   PHE B CZ  1 
ATOM   2591 N  N   . GLY B 1 60  ? 8.515  183.799 12.467  1.00   27.19 ? 54   GLY B N   1 
ATOM   2592 C  CA  . GLY B 1 60  ? 8.647  183.472 13.869  1.00   26.90 ? 54   GLY B CA  1 
ATOM   2593 C  C   . GLY B 1 60  ? 9.991  183.804 14.438  1.00   26.84 ? 54   GLY B C   1 
ATOM   2594 O  O   . GLY B 1 60  ? 10.818 184.466 13.812  1.00   26.39 ? 54   GLY B O   1 
ATOM   2595 N  N   . HIS B 1 61  ? 10.199 183.303 15.639  1.00   27.77 ? 55   HIS B N   1 
ATOM   2596 C  CA  . HIS B 1 61  ? 11.396 183.464 16.412  1.00   28.80 ? 55   HIS B CA  1 
ATOM   2597 C  C   . HIS B 1 61  ? 11.953 182.076 16.724  1.00   28.36 ? 55   HIS B C   1 
ATOM   2598 O  O   . HIS B 1 61  ? 11.282 181.244 17.346  1.00   29.61 ? 55   HIS B O   1 
ATOM   2599 C  CB  . HIS B 1 61  ? 11.040 184.235 17.692  1.00   29.73 ? 55   HIS B CB  1 
ATOM   2600 C  CG  . HIS B 1 61  ? 12.212 184.562 18.565  1.00   31.88 ? 55   HIS B CG  1 
ATOM   2601 N  ND1 . HIS B 1 61  ? 12.124 184.573 19.942  1.00   37.40 ? 55   HIS B ND1 1 
ATOM   2602 C  CD2 . HIS B 1 61  ? 13.482 184.937 18.268  1.00   34.53 ? 55   HIS B CD2 1 
ATOM   2603 C  CE1 . HIS B 1 61  ? 13.296 184.912 20.456  1.00   36.93 ? 55   HIS B CE1 1 
ATOM   2604 N  NE2 . HIS B 1 61  ? 14.136 185.145 19.462  1.00   35.03 ? 55   HIS B NE2 1 
ATOM   2605 N  N   . PHE B 1 62  ? 13.169 181.815 16.263  1.00   28.15 ? 56   PHE B N   1 
ATOM   2606 C  CA  . PHE B 1 62  ? 13.811 180.507 16.363  1.00   27.91 ? 56   PHE B CA  1 
ATOM   2607 C  C   . PHE B 1 62  ? 15.166 180.667 17.020  1.00   29.11 ? 56   PHE B C   1 
ATOM   2608 O  O   . PHE B 1 62  ? 16.010 181.499 16.590  1.00   28.54 ? 56   PHE B O   1 
ATOM   2609 C  CB  . PHE B 1 62  ? 13.968 179.931 14.969  1.00   28.13 ? 56   PHE B CB  1 
ATOM   2610 C  CG  . PHE B 1 62  ? 12.727 180.046 14.148  1.00   26.77 ? 56   PHE B CG  1 
ATOM   2611 C  CD1 . PHE B 1 62  ? 12.463 181.188 13.431  1.00   26.80 ? 56   PHE B CD1 1 
ATOM   2612 C  CD2 . PHE B 1 62  ? 11.787 179.028 14.151  1.00   28.17 ? 56   PHE B CD2 1 
ATOM   2613 C  CE1 . PHE B 1 62  ? 11.283 181.319 12.712  1.00   27.04 ? 56   PHE B CE1 1 
ATOM   2614 C  CE2 . PHE B 1 62  ? 10.610 179.148 13.429  1.00   27.40 ? 56   PHE B CE2 1 
ATOM   2615 C  CZ  . PHE B 1 62  ? 10.363 180.295 12.700  1.00   28.17 ? 56   PHE B CZ  1 
ATOM   2616 N  N   . SER B 1 63  ? 15.400 179.866 18.038  1.00   29.30 ? 57   SER B N   1 
ATOM   2617 C  CA  . SER B 1 63  ? 16.548 180.048 18.900  1.00   31.25 ? 57   SER B CA  1 
ATOM   2618 C  C   . SER B 1 63  ? 17.109 178.713 19.355  1.00   31.97 ? 57   SER B C   1 
ATOM   2619 O  O   . SER B 1 63  ? 16.372 177.770 19.604  1.00   33.25 ? 57   SER B O   1 
ATOM   2620 C  CB  . SER B 1 63  ? 16.170 180.913 20.099  1.00   31.02 ? 57   SER B CB  1 
ATOM   2621 O  OG  . SER B 1 63  ? 17.355 181.237 20.798  1.00   36.04 ? 57   SER B OG  1 
ATOM   2622 N  N   . MET B 1 64  ? 18.422 178.602 19.376  1.00   32.02 ? 58   MET B N   1 
ATOM   2623 C  CA  . MET B 1 64  ? 19.084 177.472 19.964  1.00   32.49 ? 58   MET B CA  1 
ATOM   2624 C  C   . MET B 1 64  ? 20.261 177.978 20.758  1.00   31.91 ? 58   MET B C   1 
ATOM   2625 O  O   . MET B 1 64  ? 20.931 178.947 20.365  1.00   31.34 ? 58   MET B O   1 
ATOM   2626 C  CB  . MET B 1 64  ? 19.565 176.457 18.916  1.00   33.47 ? 58   MET B CB  1 
ATOM   2627 C  CG  . MET B 1 64  ? 19.064 174.947 19.221  1.00   38.17 ? 58   MET B CG  1 
ATOM   2628 S  SD  . MET B 1 64  ? 19.028 174.158 17.649  1.00   52.98 ? 58   MET B SD  1 
ATOM   2629 C  CE  . MET B 1 64  ? 17.408 174.029 17.396  1.00   52.01 ? 58   MET B CE  1 
ATOM   2630 N  N   . GLN B 1 65  ? 20.498 177.305 21.879  1.00   30.41 ? 59   GLN B N   1 
ATOM   2631 C  CA  . GLN B 1 65  ? 21.679 177.475 22.668  1.00   30.71 ? 59   GLN B CA  1 
ATOM   2632 C  C   . GLN B 1 65  ? 22.704 176.468 22.186  1.00   29.65 ? 59   GLN B C   1 
ATOM   2633 O  O   . GLN B 1 65  ? 22.392 175.270 22.054  1.00   28.88 ? 59   GLN B O   1 
ATOM   2634 C  CB  . GLN B 1 65  ? 21.345 177.223 24.139  1.00   32.16 ? 59   GLN B CB  1 
ATOM   2635 C  CG  . GLN B 1 65  ? 21.315 178.455 25.000  1.00   35.66 ? 59   GLN B CG  1 
ATOM   2636 C  CD  . GLN B 1 65  ? 21.202 178.105 26.491  1.00   38.65 ? 59   GLN B CD  1 
ATOM   2637 O  OE1 . GLN B 1 65  ? 22.108 178.360 27.264  1.00   39.90 ? 59   GLN B OE1 1 
ATOM   2638 N  NE2 . GLN B 1 65  ? 20.087 177.520 26.865  1.00   42.91 ? 59   GLN B NE2 1 
ATOM   2639 N  N   . MET B 1 66  ? 23.907 176.926 21.868  1.00   28.25 ? 60   MET B N   1 
ATOM   2640 C  CA  . MET B 1 66  ? 24.923 176.032 21.325  1.00   28.57 ? 60   MET B CA  1 
ATOM   2641 C  C   . MET B 1 66  ? 26.263 176.308 21.953  1.00   28.04 ? 60   MET B C   1 
ATOM   2642 O  O   . MET B 1 66  ? 26.615 177.467 22.247  1.00   27.23 ? 60   MET B O   1 
ATOM   2643 C  CB  . MET B 1 66  ? 25.028 176.198 19.790  1.00   28.66 ? 60   MET B CB  1 
ATOM   2644 C  CG  . MET B 1 66  ? 23.738 175.878 19.046  1.00   30.16 ? 60   MET B CG  1 
ATOM   2645 S  SD  . MET B 1 66  ? 23.736 176.445 17.306  1.00   31.60 ? 60   MET B SD  1 
ATOM   2646 C  CE  . MET B 1 66  ? 25.093 175.555 16.708  1.00   31.96 ? 60   MET B CE  1 
ATOM   2647 N  N   . LYS B 1 67  ? 27.011 175.240 22.157  1.00   28.25 ? 61   LYS B N   1 
ATOM   2648 C  CA  . LYS B 1 67  ? 28.397 175.303 22.564  1.00   29.40 ? 61   LYS B CA  1 
ATOM   2649 C  C   . LYS B 1 67  ? 29.154 174.517 21.546  1.00   29.40 ? 61   LYS B C   1 
ATOM   2650 O  O   . LYS B 1 67  ? 28.851 173.342 21.302  1.00   28.74 ? 61   LYS B O   1 
ATOM   2651 C  CB  . LYS B 1 67  ? 28.598 174.722 23.975  1.00   30.63 ? 61   LYS B CB  1 
ATOM   2652 C  CG  . LYS B 1 67  ? 30.002 174.868 24.501  1.00   33.59 ? 61   LYS B CG  1 
ATOM   2653 C  CD  . LYS B 1 67  ? 30.118 174.526 25.978  1.00   38.75 ? 61   LYS B CD  1 
ATOM   2654 C  CE  . LYS B 1 67  ? 29.860 173.052 26.235  1.00   41.32 ? 61   LYS B CE  1 
ATOM   2655 N  NZ  . LYS B 1 67  ? 30.770 172.518 27.275  1.00   45.10 ? 61   LYS B NZ  1 
ATOM   2656 N  N   . LEU B 1 68  ? 30.138 175.162 20.931  1.00   29.18 ? 62   LEU B N   1 
ATOM   2657 C  CA  . LEU B 1 68  ? 30.778 174.624 19.746  1.00   29.95 ? 62   LEU B CA  1 
ATOM   2658 C  C   . LEU B 1 68  ? 31.882 173.610 20.065  1.00   30.13 ? 62   LEU B C   1 
ATOM   2659 O  O   . LEU B 1 68  ? 32.183 173.363 21.229  1.00   30.34 ? 62   LEU B O   1 
ATOM   2660 C  CB  . LEU B 1 68  ? 31.277 175.771 18.854  1.00   30.17 ? 62   LEU B CB  1 
ATOM   2661 C  CG  . LEU B 1 68  ? 30.170 176.499 18.043  1.00   32.54 ? 62   LEU B CG  1 
ATOM   2662 C  CD1 . LEU B 1 68  ? 29.674 175.634 16.914  1.00   36.24 ? 62   LEU B CD1 1 
ATOM   2663 C  CD2 . LEU B 1 68  ? 28.977 176.901 18.814  1.00   34.65 ? 62   LEU B CD2 1 
ATOM   2664 N  N   . VAL B 1 69  ? 32.450 173.022 19.018  1.00   30.91 ? 63   VAL B N   1 
ATOM   2665 C  CA  . VAL B 1 69  ? 33.508 172.022 19.118  1.00   31.43 ? 63   VAL B CA  1 
ATOM   2666 C  C   . VAL B 1 69  ? 34.816 172.594 19.734  1.00   32.97 ? 63   VAL B C   1 
ATOM   2667 O  O   . VAL B 1 69  ? 35.480 173.475 19.145  1.00   31.13 ? 63   VAL B O   1 
ATOM   2668 C  CB  . VAL B 1 69  ? 33.821 171.375 17.742  1.00   31.29 ? 63   VAL B CB  1 
ATOM   2669 C  CG1 . VAL B 1 69  ? 34.845 170.252 17.890  1.00   30.93 ? 63   VAL B CG1 1 
ATOM   2670 C  CG2 . VAL B 1 69  ? 32.528 170.820 17.070  1.00   30.18 ? 63   VAL B CG2 1 
ATOM   2671 N  N   . PRO B 1 70  ? 35.185 172.077 20.909  1.00   34.60 ? 64   PRO B N   1 
ATOM   2672 C  CA  . PRO B 1 70  ? 36.382 172.553 21.619  1.00   35.63 ? 64   PRO B CA  1 
ATOM   2673 C  C   . PRO B 1 70  ? 37.657 171.999 20.997  1.00   36.85 ? 64   PRO B C   1 
ATOM   2674 O  O   . PRO B 1 70  ? 37.598 171.088 20.173  1.00   36.74 ? 64   PRO B O   1 
ATOM   2675 C  CB  . PRO B 1 70  ? 36.181 172.037 23.051  1.00   36.22 ? 64   PRO B CB  1 
ATOM   2676 C  CG  . PRO B 1 70  ? 35.329 170.784 22.918  1.00   36.89 ? 64   PRO B CG  1 
ATOM   2677 C  CD  . PRO B 1 70  ? 34.503 170.984 21.633  1.00   34.89 ? 64   PRO B CD  1 
ATOM   2678 N  N   . GLY B 1 71  ? 38.797 172.590 21.339  1.00   36.92 ? 65   GLY B N   1 
ATOM   2679 C  CA  . GLY B 1 71  ? 40.066 172.113 20.867  1.00   37.03 ? 65   GLY B CA  1 
ATOM   2680 C  C   . GLY B 1 71  ? 40.270 172.366 19.401  1.00   37.56 ? 65   GLY B C   1 
ATOM   2681 O  O   . GLY B 1 71  ? 39.895 173.421 18.857  1.00   37.82 ? 65   GLY B O   1 
ATOM   2682 N  N   . ASP B 1 72  ? 40.878 171.382 18.745  1.00   37.22 ? 66   ASP B N   1 
ATOM   2683 C  CA  . ASP B 1 72  ? 41.016 171.392 17.313  1.00   37.47 ? 66   ASP B CA  1 
ATOM   2684 C  C   . ASP B 1 72  ? 39.657 171.032 16.680  1.00   36.90 ? 66   ASP B C   1 
ATOM   2685 O  O   . ASP B 1 72  ? 39.123 169.939 16.884  1.00   36.40 ? 66   ASP B O   1 
ATOM   2686 C  CB  . ASP B 1 72  ? 42.093 170.402 16.914  1.00   38.35 ? 66   ASP B CB  1 
ATOM   2687 C  CG  . ASP B 1 72  ? 42.460 170.503 15.472  1.00   41.58 ? 66   ASP B CG  1 
ATOM   2688 O  OD1 . ASP B 1 72  ? 41.640 171.011 14.672  1.00   45.89 ? 66   ASP B OD1 1 
ATOM   2689 O  OD2 . ASP B 1 72  ? 43.538 170.084 15.027  1.00   43.88 ? 66   ASP B OD2 1 
ATOM   2690 N  N   . SER B 1 73  ? 39.094 171.990 15.943  1.00   35.43 ? 67   SER B N   1 
ATOM   2691 C  CA  . SER B 1 73  ? 37.826 171.828 15.234  1.00   33.71 ? 67   SER B CA  1 
ATOM   2692 C  C   . SER B 1 73  ? 38.003 172.167 13.775  1.00   32.76 ? 67   SER B C   1 
ATOM   2693 O  O   . SER B 1 73  ? 37.026 172.422 13.049  1.00   32.08 ? 67   SER B O   1 
ATOM   2694 C  CB  . SER B 1 73  ? 36.787 172.755 15.866  1.00   34.45 ? 67   SER B CB  1 
ATOM   2695 O  OG  . SER B 1 73  ? 37.234 174.095 15.832  1.00   32.53 ? 67   SER B OG  1 
ATOM   2696 N  N   . ALA B 1 74  ? 39.256 172.160 13.325  1.00   31.52 ? 68   ALA B N   1 
ATOM   2697 C  CA  . ALA B 1 74  ? 39.586 172.579 11.977  1.00   31.43 ? 68   ALA B CA  1 
ATOM   2698 C  C   . ALA B 1 74  ? 38.924 171.671 10.929  1.00   31.76 ? 68   ALA B C   1 
ATOM   2699 O  O   . ALA B 1 74  ? 38.885 170.451 11.075  1.00   32.07 ? 68   ALA B O   1 
ATOM   2700 C  CB  . ALA B 1 74  ? 41.083 172.591 11.782  1.00   31.80 ? 68   ALA B CB  1 
ATOM   2701 N  N   . GLY B 1 75  ? 38.401 172.294 9.890   1.00   31.16 ? 69   GLY B N   1 
ATOM   2702 C  CA  . GLY B 1 75  ? 37.721 171.603 8.823   1.00   31.34 ? 69   GLY B CA  1 
ATOM   2703 C  C   . GLY B 1 75  ? 36.290 171.209 9.106   1.00   30.66 ? 69   GLY B C   1 
ATOM   2704 O  O   . GLY B 1 75  ? 35.641 170.650 8.228   1.00   31.28 ? 69   GLY B O   1 
ATOM   2705 N  N   . THR B 1 76  ? 35.793 171.461 10.311  1.00   30.15 ? 70   THR B N   1 
ATOM   2706 C  CA  . THR B 1 76  ? 34.403 171.162 10.628  1.00   30.30 ? 70   THR B CA  1 
ATOM   2707 C  C   . THR B 1 76  ? 33.510 172.391 10.464  1.00   28.96 ? 70   THR B C   1 
ATOM   2708 O  O   . THR B 1 76  ? 33.949 173.541 10.615  1.00   27.73 ? 70   THR B O   1 
ATOM   2709 C  CB  . THR B 1 76  ? 34.257 170.576 12.045  1.00   30.68 ? 70   THR B CB  1 
ATOM   2710 O  OG1 . THR B 1 76  ? 34.516 171.577 13.024  1.00   31.91 ? 70   THR B OG1 1 
ATOM   2711 C  CG2 . THR B 1 76  ? 35.325 169.502 12.320  1.00   33.08 ? 70   THR B CG2 1 
ATOM   2712 N  N   . VAL B 1 77  ? 32.246 172.120 10.161  1.00   27.33 ? 71   VAL B N   1 
ATOM   2713 C  CA  . VAL B 1 77  ? 31.208 173.121 10.047  1.00   26.79 ? 71   VAL B CA  1 
ATOM   2714 C  C   . VAL B 1 77  ? 30.022 172.635 10.884  1.00   25.94 ? 71   VAL B C   1 
ATOM   2715 O  O   . VAL B 1 77  ? 29.549 171.490 10.712  1.00   25.53 ? 71   VAL B O   1 
ATOM   2716 C  CB  . VAL B 1 77  ? 30.762 173.342 8.570   1.00   26.89 ? 71   VAL B CB  1 
ATOM   2717 C  CG1 . VAL B 1 77  ? 29.622 174.384 8.488   1.00   26.28 ? 71   VAL B CG1 1 
ATOM   2718 C  CG2 . VAL B 1 77  ? 31.910 173.797 7.718   1.00   29.53 ? 71   VAL B CG2 1 
ATOM   2719 N  N   . THR B 1 78  ? 29.563 173.487 11.791  1.00   24.84 ? 72   THR B N   1 
ATOM   2720 C  CA  . THR B 1 78  ? 28.343 173.281 12.537  1.00   24.36 ? 72   THR B CA  1 
ATOM   2721 C  C   . THR B 1 78  ? 27.367 174.308 12.001  1.00   25.03 ? 72   THR B C   1 
ATOM   2722 O  O   . THR B 1 78  ? 27.673 175.510 11.980  1.00   23.26 ? 72   THR B O   1 
ATOM   2723 C  CB  . THR B 1 78  ? 28.577 173.512 14.030  1.00   25.28 ? 72   THR B CB  1 
ATOM   2724 O  OG1 . THR B 1 78  ? 29.699 172.734 14.491  1.00   26.62 ? 72   THR B OG1 1 
ATOM   2725 C  CG2 . THR B 1 78  ? 27.398 173.062 14.844  1.00   26.35 ? 72   THR B CG2 1 
ATOM   2726 N  N   . ALA B 1 79  ? 26.206 173.855 11.560  1.00   24.43 ? 73   ALA B N   1 
ATOM   2727 C  CA  . ALA B 1 79  ? 25.235 174.721 10.917  1.00   25.37 ? 73   ALA B CA  1 
ATOM   2728 C  C   . ALA B 1 79  ? 23.927 174.670 11.655  1.00   25.31 ? 73   ALA B C   1 
ATOM   2729 O  O   . ALA B 1 79  ? 23.527 173.606 12.187  1.00   25.53 ? 73   ALA B O   1 
ATOM   2730 C  CB  . ALA B 1 79  ? 25.046 174.316 9.491   1.00   26.24 ? 73   ALA B CB  1 
ATOM   2731 N  N   . PHE B 1 80  ? 23.290 175.835 11.743  1.00   23.82 ? 74   PHE B N   1 
ATOM   2732 C  CA  . PHE B 1 80  ? 21.974 175.993 12.313  1.00   22.89 ? 74   PHE B CA  1 
ATOM   2733 C  C   . PHE B 1 80  ? 21.259 176.892 11.338  1.00   22.93 ? 74   PHE B C   1 
ATOM   2734 O  O   . PHE B 1 80  ? 21.657 178.061 11.157  1.00   21.34 ? 74   PHE B O   1 
ATOM   2735 C  CB  . PHE B 1 80  ? 22.089 176.634 13.703  1.00   22.93 ? 74   PHE B CB  1 
ATOM   2736 C  CG  . PHE B 1 80  ? 20.794 177.168 14.252  1.00   24.15 ? 74   PHE B CG  1 
ATOM   2737 C  CD1 . PHE B 1 80  ? 19.652 176.418 14.234  1.00   25.63 ? 74   PHE B CD1 1 
ATOM   2738 C  CD2 . PHE B 1 80  ? 20.740 178.432 14.810  1.00   28.52 ? 74   PHE B CD2 1 
ATOM   2739 C  CE1 . PHE B 1 80  ? 18.470 176.914 14.759  1.00   30.29 ? 74   PHE B CE1 1 
ATOM   2740 C  CE2 . PHE B 1 80  ? 19.569 178.927 15.330  1.00   30.77 ? 74   PHE B CE2 1 
ATOM   2741 C  CZ  . PHE B 1 80  ? 18.426 178.168 15.310  1.00   29.14 ? 74   PHE B CZ  1 
ATOM   2742 N  N   . TYR B 1 81  ? 20.202 176.379 10.717  1.00   22.12 ? 75   TYR B N   1 
ATOM   2743 C  CA  . TYR B 1 81  ? 19.569 177.090 9.632   1.00   23.27 ? 75   TYR B CA  1 
ATOM   2744 C  C   . TYR B 1 81  ? 18.105 176.753 9.396   1.00   24.12 ? 75   TYR B C   1 
ATOM   2745 O  O   . TYR B 1 81  ? 17.598 175.717 9.873   1.00   23.32 ? 75   TYR B O   1 
ATOM   2746 C  CB  . TYR B 1 81  ? 20.402 176.883 8.349   1.00   23.92 ? 75   TYR B CB  1 
ATOM   2747 C  CG  . TYR B 1 81  ? 20.486 175.472 7.844   1.00   24.89 ? 75   TYR B CG  1 
ATOM   2748 C  CD1 . TYR B 1 81  ? 21.392 174.566 8.392   1.00   25.72 ? 75   TYR B CD1 1 
ATOM   2749 C  CD2 . TYR B 1 81  ? 19.676 175.039 6.801   1.00   27.48 ? 75   TYR B CD2 1 
ATOM   2750 C  CE1 . TYR B 1 81  ? 21.482 173.279 7.917   1.00   28.27 ? 75   TYR B CE1 1 
ATOM   2751 C  CE2 . TYR B 1 81  ? 19.768 173.757 6.324   1.00   27.90 ? 75   TYR B CE2 1 
ATOM   2752 C  CZ  . TYR B 1 81  ? 20.680 172.886 6.871   1.00   28.76 ? 75   TYR B CZ  1 
ATOM   2753 O  OH  . TYR B 1 81  ? 20.732 171.583 6.417   1.00   30.19 ? 75   TYR B OH  1 
ATOM   2754 N  N   . LEU B 1 82  ? 17.413 177.656 8.711   1.00   24.12 ? 76   LEU B N   1 
ATOM   2755 C  CA  . LEU B 1 82  ? 16.066 177.420 8.213   1.00   25.01 ? 76   LEU B CA  1 
ATOM   2756 C  C   . LEU B 1 82  ? 16.122 177.279 6.722   1.00   25.20 ? 76   LEU B C   1 
ATOM   2757 O  O   . LEU B 1 82  ? 16.842 178.025 6.076   1.00   24.82 ? 76   LEU B O   1 
ATOM   2758 C  CB  . LEU B 1 82  ? 15.146 178.595 8.523   1.00   25.48 ? 76   LEU B CB  1 
ATOM   2759 C  CG  . LEU B 1 82  ? 14.599 178.583 9.948   1.00   30.37 ? 76   LEU B CG  1 
ATOM   2760 C  CD1 . LEU B 1 82  ? 15.607 179.125 10.905  1.00   31.73 ? 76   LEU B CD1 1 
ATOM   2761 C  CD2 . LEU B 1 82  ? 13.332 179.412 10.013  1.00   35.33 ? 76   LEU B CD2 1 
ATOM   2762 N  N   . SER B 1 83  ? 15.338 176.365 6.169   1.00   24.95 ? 77   SER B N   1 
ATOM   2763 C  CA  . SER B 1 83  ? 15.266 176.203 4.729   1.00   26.33 ? 77   SER B CA  1 
ATOM   2764 C  C   . SER B 1 83  ? 13.935 175.575 4.271   1.00   27.57 ? 77   SER B C   1 
ATOM   2765 O  O   . SER B 1 83  ? 13.408 174.697 4.920   1.00   25.05 ? 77   SER B O   1 
ATOM   2766 C  CB  . SER B 1 83  ? 16.424 175.333 4.232   1.00   26.35 ? 77   SER B CB  1 
ATOM   2767 O  OG  . SER B 1 83  ? 16.375 175.211 2.825   1.00   26.99 ? 77   SER B OG  1 
ATOM   2768 N  N   . SER B 1 84  ? 13.406 176.071 3.158   1.00   30.56 ? 78   SER B N   1 
ATOM   2769 C  CA  . SER B 1 84  ? 12.348 175.393 2.404   1.00   33.60 ? 78   SER B CA  1 
ATOM   2770 C  C   . SER B 1 84  ? 12.959 174.252 1.561   1.00   37.22 ? 78   SER B C   1 
ATOM   2771 O  O   . SER B 1 84  ? 14.177 174.153 1.440   1.00   37.17 ? 78   SER B O   1 
ATOM   2772 C  CB  . SER B 1 84  ? 11.611 176.380 1.502   1.00   33.81 ? 78   SER B CB  1 
ATOM   2773 O  OG  . SER B 1 84  ? 12.482 176.967 0.542   1.00   31.42 ? 78   SER B OG  1 
ATOM   2774 N  N   . GLN B 1 85  ? 12.119 173.359 1.025   1.00   41.78 ? 79   GLN B N   1 
ATOM   2775 C  CA  . GLN B 1 85  ? 12.598 172.146 0.354   1.00   45.47 ? 79   GLN B CA  1 
ATOM   2776 C  C   . GLN B 1 85  ? 12.363 172.089 -1.155  1.00   47.91 ? 79   GLN B C   1 
ATOM   2777 O  O   . GLN B 1 85  ? 12.781 171.148 -1.811  1.00   49.88 ? 79   GLN B O   1 
ATOM   2778 C  CB  . GLN B 1 85  ? 11.946 170.908 1.028   1.00   46.31 ? 79   GLN B CB  1 
ATOM   2779 C  CG  . GLN B 1 85  ? 12.442 170.595 2.420   1.00   48.18 ? 79   GLN B CG  1 
ATOM   2780 C  CD  . GLN B 1 85  ? 11.804 171.454 3.499   1.00   50.59 ? 79   GLN B CD  1 
ATOM   2781 O  OE1 . GLN B 1 85  ? 10.602 171.700 3.466   1.00   45.36 ? 79   GLN B OE1 1 
ATOM   2782 N  NE2 . GLN B 1 85  ? 12.428 172.006 4.534   1.00   51.21 ? 79   GLN B NE2 1 
ATOM   2783 N  N   . ASN B 1 86  ? 11.698 173.111 -1.698  1.00   50.47 ? 80   ASN B N   1 
ATOM   2784 C  CA  . ASN B 1 86  ? 11.389 173.161 -3.141  1.00   52.10 ? 80   ASN B CA  1 
ATOM   2785 C  C   . ASN B 1 86  ? 12.595 173.657 -3.933  1.00   52.50 ? 80   ASN B C   1 
ATOM   2786 O  O   . ASN B 1 86  ? 13.581 174.139 -3.384  1.00   53.29 ? 80   ASN B O   1 
ATOM   2787 C  CB  . ASN B 1 86  ? 10.175 174.077 -3.389  1.00   52.79 ? 80   ASN B CB  1 
ATOM   2788 C  CG  . ASN B 1 86  ? 10.406 175.542 -3.084  1.00   56.11 ? 80   ASN B CG  1 
ATOM   2789 O  OD1 . ASN B 1 86  ? 9.967  176.408 -3.845  1.00   61.99 ? 80   ASN B OD1 1 
ATOM   2790 N  ND2 . ASN B 1 86  ? 11.084 175.822 -1.971  1.00   54.20 ? 80   ASN B ND2 1 
ATOM   2791 N  N   . SER B 1 87  ? 12.513 173.514 -5.278  1.00   52.43 ? 81   SER B N   1 
ATOM   2792 C  CA  . SER B 1 87  ? 13.504 174.144 -6.136  1.00   52.00 ? 81   SER B CA  1 
ATOM   2793 C  C   . SER B 1 87  ? 13.201 175.663 -5.977  1.00   50.69 ? 81   SER B C   1 
ATOM   2794 O  O   . SER B 1 87  ? 12.059 176.001 -5.676  1.00   52.43 ? 81   SER B O   1 
ATOM   2795 C  CB  . SER B 1 87  ? 13.394 173.693 -7.581  1.00   52.49 ? 81   SER B CB  1 
ATOM   2796 O  OG  . SER B 1 87  ? 13.046 174.775 -8.427  1.00   54.53 ? 81   SER B OG  1 
ATOM   2797 N  N   . GLU B 1 88  ? 14.167 176.590 -6.147  1.00   47.98 ? 82   GLU B N   1 
ATOM   2798 C  CA  . GLU B 1 88  ? 13.876 177.988 -5.911  1.00   45.57 ? 82   GLU B CA  1 
ATOM   2799 C  C   . GLU B 1 88  ? 13.606 178.166 -4.428  1.00   42.20 ? 82   GLU B C   1 
ATOM   2800 O  O   . GLU B 1 88  ? 12.620 178.790 -4.041  1.00   40.42 ? 82   GLU B O   1 
ATOM   2801 C  CB  . GLU B 1 88  ? 12.678 178.474 -6.783  1.00   46.44 ? 82   GLU B CB  1 
ATOM   2802 C  CG  . GLU B 1 88  ? 13.015 178.647 -8.288  1.00   50.63 ? 82   GLU B CG  1 
ATOM   2803 C  CD  . GLU B 1 88  ? 12.149 179.666 -9.059  1.00   55.73 ? 82   GLU B CD  1 
ATOM   2804 O  OE1 . GLU B 1 88  ? 10.929 179.764 -8.777  1.00   59.58 ? 82   GLU B OE1 1 
ATOM   2805 O  OE2 . GLU B 1 88  ? 12.703 180.343 -9.953  1.00   61.74 ? 82   GLU B OE2 1 
ATOM   2806 N  N   . HIS B 1 89  ? 14.512 177.657 -3.607  1.00   38.78 ? 83   HIS B N   1 
ATOM   2807 C  CA  . HIS B 1 89  ? 14.345 177.668 -2.155  1.00   36.97 ? 83   HIS B CA  1 
ATOM   2808 C  C   . HIS B 1 89  ? 14.819 178.963 -1.437  1.00   34.80 ? 83   HIS B C   1 
ATOM   2809 O  O   . HIS B 1 89  ? 15.652 179.726 -1.916  1.00   33.23 ? 83   HIS B O   1 
ATOM   2810 C  CB  . HIS B 1 89  ? 15.022 176.419 -1.587  1.00   36.82 ? 83   HIS B CB  1 
ATOM   2811 C  CG  . HIS B 1 89  ? 16.524 176.567 -1.322  1.00   38.67 ? 83   HIS B CG  1 
ATOM   2812 N  ND1 . HIS B 1 89  ? 17.408 176.957 -2.309  1.00   42.05 ? 83   HIS B ND1 1 
ATOM   2813 C  CD2 . HIS B 1 89  ? 17.270 176.375 -0.208  1.00   40.53 ? 83   HIS B CD2 1 
ATOM   2814 C  CE1 . HIS B 1 89  ? 18.631 177.014 -1.807  1.00   41.35 ? 83   HIS B CE1 1 
ATOM   2815 N  NE2 . HIS B 1 89  ? 18.574 176.668 -0.532  1.00   40.43 ? 83   HIS B NE2 1 
ATOM   2816 N  N   . ASP B 1 90  ? 14.258 179.136 -0.235  1.00   32.75 ? 84   ASP B N   1 
ATOM   2817 C  CA  . ASP B 1 90  ? 14.593 180.225 0.669   1.00   31.68 ? 84   ASP B CA  1 
ATOM   2818 C  C   . ASP B 1 90  ? 15.377 179.569 1.804   1.00   30.44 ? 84   ASP B C   1 
ATOM   2819 O  O   . ASP B 1 90  ? 15.097 178.435 2.158   1.00   28.49 ? 84   ASP B O   1 
ATOM   2820 C  CB  . ASP B 1 90  ? 13.343 180.924 1.246   1.00   31.65 ? 84   ASP B CB  1 
ATOM   2821 C  CG  . ASP B 1 90  ? 12.544 181.695 0.203   1.00   33.75 ? 84   ASP B CG  1 
ATOM   2822 O  OD1 . ASP B 1 90  ? 13.153 182.205 -0.764  1.00   34.53 ? 84   ASP B OD1 1 
ATOM   2823 O  OD2 . ASP B 1 90  ? 11.303 181.776 0.357   1.00   34.79 ? 84   ASP B OD2 1 
ATOM   2824 N  N   . GLU B 1 91  ? 16.336 180.292 2.375   1.00   29.34 ? 85   GLU B N   1 
ATOM   2825 C  CA  . GLU B 1 91  ? 17.178 179.738 3.428   1.00   29.46 ? 85   GLU B CA  1 
ATOM   2826 C  C   . GLU B 1 91  ? 17.848 180.846 4.242   1.00   28.39 ? 85   GLU B C   1 
ATOM   2827 O  O   . GLU B 1 91  ? 18.292 181.862 3.699   1.00   27.49 ? 85   GLU B O   1 
ATOM   2828 C  CB  . GLU B 1 91  ? 18.196 178.773 2.812   1.00   29.87 ? 85   GLU B CB  1 
ATOM   2829 C  CG  . GLU B 1 91  ? 19.317 178.301 3.718   1.00   32.62 ? 85   GLU B CG  1 
ATOM   2830 C  CD  . GLU B 1 91  ? 20.207 177.269 3.041   1.00   35.63 ? 85   GLU B CD  1 
ATOM   2831 O  OE1 . GLU B 1 91  ? 19.950 176.934 1.863   1.00   39.05 ? 85   GLU B OE1 1 
ATOM   2832 O  OE2 . GLU B 1 91  ? 21.179 176.796 3.684   1.00   40.46 ? 85   GLU B OE2 1 
ATOM   2833 N  N   . ILE B 1 92  ? 17.927 180.641 5.556   1.00   26.93 ? 86   ILE B N   1 
ATOM   2834 C  CA  . ILE B 1 92  ? 18.559 181.559 6.501   1.00   26.21 ? 86   ILE B CA  1 
ATOM   2835 C  C   . ILE B 1 92  ? 19.560 180.734 7.287   1.00   25.17 ? 86   ILE B C   1 
ATOM   2836 O  O   . ILE B 1 92  ? 19.154 179.802 7.978   1.00   23.63 ? 86   ILE B O   1 
ATOM   2837 C  CB  . ILE B 1 92  ? 17.484 182.176 7.454   1.00   26.50 ? 86   ILE B CB  1 
ATOM   2838 C  CG1 . ILE B 1 92  ? 16.379 182.879 6.683   1.00   28.42 ? 86   ILE B CG1 1 
ATOM   2839 C  CG2 . ILE B 1 92  ? 18.125 183.170 8.441   1.00   27.95 ? 86   ILE B CG2 1 
ATOM   2840 C  CD1 . ILE B 1 92  ? 15.138 183.257 7.578   1.00   30.67 ? 86   ILE B CD1 1 
ATOM   2841 N  N   . ASP B 1 93  ? 20.853 181.053 7.193   1.00   24.64 ? 87   ASP B N   1 
ATOM   2842 C  CA  . ASP B 1 93  ? 21.918 180.171 7.671   1.00   26.30 ? 87   ASP B CA  1 
ATOM   2843 C  C   . ASP B 1 93  ? 22.843 180.823 8.684   1.00   25.39 ? 87   ASP B C   1 
ATOM   2844 O  O   . ASP B 1 93  ? 23.287 181.971 8.461   1.00   24.48 ? 87   ASP B O   1 
ATOM   2845 C  CB  . ASP B 1 93  ? 22.908 179.806 6.562   1.00   28.63 ? 87   ASP B CB  1 
ATOM   2846 C  CG  . ASP B 1 93  ? 22.319 179.010 5.461   1.00   34.73 ? 87   ASP B CG  1 
ATOM   2847 O  OD1 . ASP B 1 93  ? 21.768 177.917 5.714   1.00   42.62 ? 87   ASP B OD1 1 
ATOM   2848 O  OD2 . ASP B 1 93  ? 22.436 179.390 4.279   1.00   42.37 ? 87   ASP B OD2 1 
ATOM   2849 N  N   . PHE B 1 94  ? 23.197 180.051 9.708   1.00   23.92 ? 88   PHE B N   1 
ATOM   2850 C  CA  . PHE B 1 94  ? 24.387 180.252 10.540  1.00   24.49 ? 88   PHE B CA  1 
ATOM   2851 C  C   . PHE B 1 94  ? 25.321 179.057 10.232  1.00   24.52 ? 88   PHE B C   1 
ATOM   2852 O  O   . PHE B 1 94  ? 24.878 177.897 10.300  1.00   24.12 ? 88   PHE B O   1 
ATOM   2853 C  CB  . PHE B 1 94  ? 24.102 180.132 12.035  1.00   24.15 ? 88   PHE B CB  1 
ATOM   2854 C  CG  . PHE B 1 94  ? 23.375 181.302 12.678  1.00   26.88 ? 88   PHE B CG  1 
ATOM   2855 C  CD1 . PHE B 1 94  ? 22.012 181.355 12.692  1.00   29.15 ? 88   PHE B CD1 1 
ATOM   2856 C  CD2 . PHE B 1 94  ? 24.059 182.271 13.365  1.00   28.25 ? 88   PHE B CD2 1 
ATOM   2857 C  CE1 . PHE B 1 94  ? 21.348 182.403 13.355  1.00   30.02 ? 88   PHE B CE1 1 
ATOM   2858 C  CE2 . PHE B 1 94  ? 23.389 183.301 14.018  1.00   28.78 ? 88   PHE B CE2 1 
ATOM   2859 C  CZ  . PHE B 1 94  ? 22.051 183.354 13.999  1.00   28.57 ? 88   PHE B CZ  1 
ATOM   2860 N  N   . GLU B 1 95  ? 26.585 179.305 9.917   1.00   23.24 ? 89   GLU B N   1 
ATOM   2861 C  CA  . GLU B 1 95  ? 27.570 178.234 9.764   1.00   23.85 ? 89   GLU B CA  1 
ATOM   2862 C  C   . GLU B 1 95  ? 28.803 178.584 10.581  1.00   23.34 ? 89   GLU B C   1 
ATOM   2863 O  O   . GLU B 1 95  ? 29.383 179.643 10.390  1.00   22.61 ? 89   GLU B O   1 
ATOM   2864 C  CB  . GLU B 1 95  ? 27.919 178.030 8.293   1.00   24.26 ? 89   GLU B CB  1 
ATOM   2865 C  CG  . GLU B 1 95  ? 26.737 177.553 7.481   1.00   29.48 ? 89   GLU B CG  1 
ATOM   2866 C  CD  . GLU B 1 95  ? 27.043 177.486 5.991   1.00   37.74 ? 89   GLU B CD  1 
ATOM   2867 O  OE1 . GLU B 1 95  ? 27.588 176.458 5.526   1.00   42.93 ? 89   GLU B OE1 1 
ATOM   2868 O  OE2 . GLU B 1 95  ? 26.741 178.474 5.288   1.00   43.62 ? 89   GLU B OE2 1 
ATOM   2869 N  N   . PHE B 1 96  ? 29.141 177.746 11.557  1.00   22.35 ? 90   PHE B N   1 
ATOM   2870 C  CA  . PHE B 1 96  ? 30.306 177.940 12.408  1.00   22.90 ? 90   PHE B CA  1 
ATOM   2871 C  C   . PHE B 1 96  ? 31.484 177.126 11.849  1.00   23.60 ? 90   PHE B C   1 
ATOM   2872 O  O   . PHE B 1 96  ? 31.414 175.876 11.757  1.00   23.30 ? 90   PHE B O   1 
ATOM   2873 C  CB  . PHE B 1 96  ? 30.024 177.492 13.835  1.00   23.33 ? 90   PHE B CB  1 
ATOM   2874 C  CG  . PHE B 1 96  ? 28.896 178.211 14.506  1.00   23.80 ? 90   PHE B CG  1 
ATOM   2875 C  CD1 . PHE B 1 96  ? 27.584 177.821 14.293  1.00   25.75 ? 90   PHE B CD1 1 
ATOM   2876 C  CD2 . PHE B 1 96  ? 29.148 179.257 15.380  1.00   26.71 ? 90   PHE B CD2 1 
ATOM   2877 C  CE1 . PHE B 1 96  ? 26.548 178.469 14.893  1.00   25.92 ? 90   PHE B CE1 1 
ATOM   2878 C  CE2 . PHE B 1 96  ? 28.112 179.918 15.997  1.00   27.21 ? 90   PHE B CE2 1 
ATOM   2879 C  CZ  . PHE B 1 96  ? 26.803 179.509 15.764  1.00   26.39 ? 90   PHE B CZ  1 
ATOM   2880 N  N   . LEU B 1 97  ? 32.537 177.828 11.458  1.00   23.93 ? 91   LEU B N   1 
ATOM   2881 C  CA  . LEU B 1 97  ? 33.716 177.244 10.809  1.00   25.17 ? 91   LEU B CA  1 
ATOM   2882 C  C   . LEU B 1 97  ? 34.823 177.099 11.845  1.00   26.13 ? 91   LEU B C   1 
ATOM   2883 O  O   . LEU B 1 97  ? 35.277 178.087 12.439  1.00   24.69 ? 91   LEU B O   1 
ATOM   2884 C  CB  . LEU B 1 97  ? 34.170 178.138 9.649   1.00   25.67 ? 91   LEU B CB  1 
ATOM   2885 C  CG  . LEU B 1 97  ? 33.063 178.698 8.723   1.00   28.84 ? 91   LEU B CG  1 
ATOM   2886 C  CD1 . LEU B 1 97  ? 33.677 179.432 7.512   1.00   31.19 ? 91   LEU B CD1 1 
ATOM   2887 C  CD2 . LEU B 1 97  ? 32.146 177.646 8.231   1.00   30.82 ? 91   LEU B CD2 1 
ATOM   2888 N  N   . GLY B 1 98  ? 35.210 175.860 12.118  1.00   26.94 ? 92   GLY B N   1 
ATOM   2889 C  CA  . GLY B 1 98  ? 36.140 175.549 13.175  1.00   27.59 ? 92   GLY B CA  1 
ATOM   2890 C  C   . GLY B 1 98  ? 37.572 175.892 12.800  1.00   28.90 ? 92   GLY B C   1 
ATOM   2891 O  O   . GLY B 1 98  ? 37.859 176.391 11.710  1.00   28.42 ? 92   GLY B O   1 
ATOM   2892 N  N   . ASN B 1 99  ? 38.484 175.615 13.726  1.00   31.06 ? 93   ASN B N   1 
ATOM   2893 C  CA  . ASN B 1 99  ? 39.886 176.044 13.584  1.00   32.61 ? 93   ASN B CA  1 
ATOM   2894 C  C   . ASN B 1 99  ? 40.839 175.209 14.452  1.00   34.03 ? 93   ASN B C   1 
ATOM   2895 O  O   . ASN B 1 99  ? 40.424 174.591 15.410  1.00   32.13 ? 93   ASN B O   1 
ATOM   2896 C  CB  . ASN B 1 99  ? 40.027 177.522 13.990  1.00   32.16 ? 93   ASN B CB  1 
ATOM   2897 C  CG  . ASN B 1 99  ? 40.981 178.293 13.111  1.00   32.55 ? 93   ASN B CG  1 
ATOM   2898 O  OD1 . ASN B 1 99  ? 41.889 177.720 12.456  1.00   31.12 ? 93   ASN B OD1 1 
ATOM   2899 N  ND2 . ASN B 1 99  ? 40.787 179.618 13.084  1.00   31.09 ? 93   ASN B ND2 1 
ATOM   2900 N  N   . ARG B 1 100 ? 42.128 175.259 14.122  1.00   36.86 ? 94   ARG B N   1 
ATOM   2901 C  CA  . ARG B 1 100 ? 43.183 174.683 14.969  1.00   38.81 ? 94   ARG B CA  1 
ATOM   2902 C  C   . ARG B 1 100 ? 43.071 175.215 16.380  1.00   40.37 ? 94   ARG B C   1 
ATOM   2903 O  O   . ARG B 1 100 ? 42.510 176.303 16.602  1.00   40.54 ? 94   ARG B O   1 
ATOM   2904 C  CB  . ARG B 1 100 ? 44.583 174.967 14.387  1.00   39.53 ? 94   ARG B CB  1 
ATOM   2905 C  CG  . ARG B 1 100 ? 44.764 174.538 12.918  1.00   40.45 ? 94   ARG B CG  1 
ATOM   2906 C  CD  . ARG B 1 100 ? 45.662 173.314 12.691  1.00   43.25 ? 94   ARG B CD  1 
ATOM   2907 N  NE  . ARG B 1 100 ? 44.949 172.061 12.875  1.00   42.33 ? 94   ARG B NE  1 
ATOM   2908 C  CZ  . ARG B 1 100 ? 44.556 171.216 11.916  1.00   41.39 ? 94   ARG B CZ  1 
ATOM   2909 N  NH1 . ARG B 1 100 ? 44.768 171.445 10.632  1.00   39.94 ? 94   ARG B NH1 1 
ATOM   2910 N  NH2 . ARG B 1 100 ? 43.903 170.117 12.269  1.00   41.57 ? 94   ARG B NH2 1 
ATOM   2911 N  N   . THR B 1 101 ? 43.575 174.438 17.341  1.00   41.84 ? 95   THR B N   1 
ATOM   2912 C  CA  . THR B 1 101 ? 43.473 174.767 18.768  1.00   43.14 ? 95   THR B CA  1 
ATOM   2913 C  C   . THR B 1 101 ? 43.927 176.191 19.073  1.00   43.08 ? 95   THR B C   1 
ATOM   2914 O  O   . THR B 1 101 ? 44.944 176.654 18.550  1.00   43.27 ? 95   THR B O   1 
ATOM   2915 C  CB  . THR B 1 101 ? 44.326 173.792 19.624  1.00   43.82 ? 95   THR B CB  1 
ATOM   2916 O  OG1 . THR B 1 101 ? 44.132 172.451 19.165  1.00   47.57 ? 95   THR B OG1 1 
ATOM   2917 C  CG2 . THR B 1 101 ? 43.819 173.755 21.052  1.00   44.80 ? 95   THR B CG2 1 
ATOM   2918 N  N   . GLY B 1 102 ? 43.153 176.873 19.909  1.00   42.91 ? 96   GLY B N   1 
ATOM   2919 C  CA  . GLY B 1 102 ? 43.411 178.255 20.256  1.00   42.73 ? 96   GLY B CA  1 
ATOM   2920 C  C   . GLY B 1 102 ? 43.219 179.291 19.163  1.00   42.37 ? 96   GLY B C   1 
ATOM   2921 O  O   . GLY B 1 102 ? 43.469 180.467 19.417  1.00   42.67 ? 96   GLY B O   1 
ATOM   2922 N  N   . GLN B 1 103 ? 42.792 178.881 17.964  1.00   41.01 ? 97   GLN B N   1 
ATOM   2923 C  CA  . GLN B 1 103 ? 42.565 179.810 16.862  1.00   39.91 ? 97   GLN B CA  1 
ATOM   2924 C  C   . GLN B 1 103 ? 41.059 180.046 16.687  1.00   37.71 ? 97   GLN B C   1 
ATOM   2925 O  O   . GLN B 1 103 ? 40.259 179.187 17.004  1.00   37.11 ? 97   GLN B O   1 
ATOM   2926 C  CB  . GLN B 1 103 ? 43.194 179.292 15.578  1.00   40.50 ? 97   GLN B CB  1 
ATOM   2927 C  CG  . GLN B 1 103 ? 44.719 179.093 15.667  1.00   43.65 ? 97   GLN B CG  1 
ATOM   2928 C  CD  . GLN B 1 103 ? 45.488 180.402 15.877  1.00   46.86 ? 97   GLN B CD  1 
ATOM   2929 O  OE1 . GLN B 1 103 ? 46.238 180.538 16.847  1.00   51.31 ? 97   GLN B OE1 1 
ATOM   2930 N  NE2 . GLN B 1 103 ? 45.292 181.356 14.985  1.00   47.15 ? 97   GLN B NE2 1 
ATOM   2931 N  N   . PRO B 1 104 ? 40.660 181.236 16.257  1.00   35.41 ? 98   PRO B N   1 
ATOM   2932 C  CA  . PRO B 1 104 ? 39.234 181.605 16.314  1.00   33.68 ? 98   PRO B CA  1 
ATOM   2933 C  C   . PRO B 1 104 ? 38.296 180.948 15.273  1.00   31.49 ? 98   PRO B C   1 
ATOM   2934 O  O   . PRO B 1 104 ? 38.612 180.822 14.099  1.00   30.52 ? 98   PRO B O   1 
ATOM   2935 C  CB  . PRO B 1 104 ? 39.270 183.136 16.142  1.00   33.91 ? 98   PRO B CB  1 
ATOM   2936 C  CG  . PRO B 1 104 ? 40.496 183.397 15.368  1.00   34.55 ? 98   PRO B CG  1 
ATOM   2937 C  CD  . PRO B 1 104 ? 41.500 182.343 15.771  1.00   35.15 ? 98   PRO B CD  1 
ATOM   2938 N  N   . TYR B 1 105 ? 37.141 180.525 15.763  1.00   30.52 ? 99   TYR B N   1 
ATOM   2939 C  CA  . TYR B 1 105 ? 35.947 180.232 14.961  1.00   29.33 ? 99   TYR B CA  1 
ATOM   2940 C  C   . TYR B 1 105 ? 35.526 181.427 14.116  1.00   28.64 ? 99   TYR B C   1 
ATOM   2941 O  O   . TYR B 1 105 ? 35.709 182.596 14.517  1.00   27.72 ? 99   TYR B O   1 
ATOM   2942 C  CB  . TYR B 1 105 ? 34.803 179.882 15.904  1.00   29.69 ? 99   TYR B CB  1 
ATOM   2943 C  CG  . TYR B 1 105 ? 34.515 178.412 16.027  1.00   29.04 ? 99   TYR B CG  1 
ATOM   2944 C  CD1 . TYR B 1 105 ? 33.631 177.798 15.156  1.00   28.98 ? 99   TYR B CD1 1 
ATOM   2945 C  CD2 . TYR B 1 105 ? 35.123 177.631 17.017  1.00   29.96 ? 99   TYR B CD2 1 
ATOM   2946 C  CE1 . TYR B 1 105 ? 33.351 176.433 15.253  1.00   31.49 ? 99   TYR B CE1 1 
ATOM   2947 C  CE2 . TYR B 1 105 ? 34.834 176.259 17.126  1.00   30.92 ? 99   TYR B CE2 1 
ATOM   2948 C  CZ  . TYR B 1 105 ? 33.971 175.671 16.227  1.00   31.58 ? 99   TYR B CZ  1 
ATOM   2949 O  OH  . TYR B 1 105 ? 33.668 174.334 16.284  1.00   35.89 ? 99   TYR B OH  1 
ATOM   2950 N  N   . ILE B 1 106 ? 34.984 181.145 12.936  1.00   27.58 ? 100  ILE B N   1 
ATOM   2951 C  CA  . ILE B 1 106 ? 34.247 182.151 12.169  1.00   25.78 ? 100  ILE B CA  1 
ATOM   2952 C  C   . ILE B 1 106 ? 32.771 181.760 12.218  1.00   25.69 ? 100  ILE B C   1 
ATOM   2953 O  O   . ILE B 1 106 ? 32.410 180.562 12.197  1.00   24.48 ? 100  ILE B O   1 
ATOM   2954 C  CB  . ILE B 1 106 ? 34.755 182.220 10.706  1.00   26.18 ? 100  ILE B CB  1 
ATOM   2955 C  CG1 . ILE B 1 106 ? 36.123 182.916 10.632  1.00   27.74 ? 100  ILE B CG1 1 
ATOM   2956 C  CG2 . ILE B 1 106 ? 33.738 182.896 9.824   1.00   24.68 ? 100  ILE B CG2 1 
ATOM   2957 C  CD1 . ILE B 1 106 ? 36.828 182.777 9.252   1.00   30.34 ? 100  ILE B CD1 1 
ATOM   2958 N  N   . LEU B 1 107 ? 31.911 182.765 12.362  1.00   24.19 ? 101  LEU B N   1 
ATOM   2959 C  CA  . LEU B 1 107 ? 30.497 182.577 12.195  1.00   23.52 ? 101  LEU B CA  1 
ATOM   2960 C  C   . LEU B 1 107 ? 30.169 183.179 10.870  1.00   23.76 ? 101  LEU B C   1 
ATOM   2961 O  O   . LEU B 1 107 ? 30.341 184.405 10.697  1.00   23.37 ? 101  LEU B O   1 
ATOM   2962 C  CB  . LEU B 1 107 ? 29.710 183.226 13.329  1.00   23.70 ? 101  LEU B CB  1 
ATOM   2963 C  CG  . LEU B 1 107 ? 28.208 183.257 13.136  1.00   24.98 ? 101  LEU B CG  1 
ATOM   2964 C  CD1 . LEU B 1 107 ? 27.708 181.855 12.798  1.00   28.88 ? 101  LEU B CD1 1 
ATOM   2965 C  CD2 . LEU B 1 107 ? 27.510 183.805 14.389  1.00   25.88 ? 101  LEU B CD2 1 
ATOM   2966 N  N   . GLN B 1 108 ? 29.795 182.322 9.908   1.00   22.67 ? 102  GLN B N   1 
ATOM   2967 C  CA  . GLN B 1 108 ? 29.294 182.756 8.605   1.00   23.60 ? 102  GLN B CA  1 
ATOM   2968 C  C   . GLN B 1 108 ? 27.773 182.763 8.567   1.00   23.68 ? 102  GLN B C   1 
ATOM   2969 O  O   . GLN B 1 108 ? 27.145 181.770 8.964   1.00   23.53 ? 102  GLN B O   1 
ATOM   2970 C  CB  . GLN B 1 108 ? 29.819 181.841 7.491   1.00   23.48 ? 102  GLN B CB  1 
ATOM   2971 C  CG  . GLN B 1 108 ? 29.392 182.252 6.118   1.00   25.09 ? 102  GLN B CG  1 
ATOM   2972 C  CD  . GLN B 1 108 ? 30.030 181.410 5.020   1.00   30.20 ? 102  GLN B CD  1 
ATOM   2973 O  OE1 . GLN B 1 108 ? 31.146 181.653 4.622   1.00   32.18 ? 102  GLN B OE1 1 
ATOM   2974 N  NE2 . GLN B 1 108 ? 29.312 180.408 4.554   1.00   32.12 ? 102  GLN B NE2 1 
ATOM   2975 N  N   . THR B 1 109 ? 27.168 183.859 8.116   1.00   22.44 ? 103  THR B N   1 
ATOM   2976 C  CA  . THR B 1 109 ? 25.744 183.886 7.845   1.00   22.96 ? 103  THR B CA  1 
ATOM   2977 C  C   . THR B 1 109 ? 25.500 184.029 6.353   1.00   23.62 ? 103  THR B C   1 
ATOM   2978 O  O   . THR B 1 109 ? 26.372 184.476 5.606   1.00   24.41 ? 103  THR B O   1 
ATOM   2979 C  CB  . THR B 1 109 ? 25.038 184.994 8.599   1.00   22.89 ? 103  THR B CB  1 
ATOM   2980 O  OG1 . THR B 1 109 ? 25.686 186.249 8.347   1.00   22.83 ? 103  THR B OG1 1 
ATOM   2981 C  CG2 . THR B 1 109 ? 25.173 184.775 10.146  1.00   23.63 ? 103  THR B CG2 1 
ATOM   2982 N  N   . ASN B 1 110 ? 24.315 183.632 5.933   1.00   23.25 ? 104  ASN B N   1 
ATOM   2983 C  CA  . ASN B 1 110 ? 23.895 183.709 4.539   1.00   23.83 ? 104  ASN B CA  1 
ATOM   2984 C  C   . ASN B 1 110 ? 22.375 183.785 4.481   1.00   24.46 ? 104  ASN B C   1 
ATOM   2985 O  O   . ASN B 1 110 ? 21.673 183.336 5.417   1.00   23.14 ? 104  ASN B O   1 
ATOM   2986 C  CB  . ASN B 1 110 ? 24.444 182.492 3.779   1.00   23.81 ? 104  ASN B CB  1 
ATOM   2987 C  CG  . ASN B 1 110 ? 24.629 182.744 2.256   1.00   26.68 ? 104  ASN B CG  1 
ATOM   2988 O  OD1 . ASN B 1 110 ? 25.060 181.845 1.528   1.00   31.45 ? 104  ASN B OD1 1 
ATOM   2989 N  ND2 . ASN B 1 110 ? 24.281 183.922 1.792   1.00   20.84 ? 104  ASN B ND2 1 
ATOM   2990 N  N   . VAL B 1 111 ? 21.853 184.381 3.406   1.00   25.52 ? 105  VAL B N   1 
ATOM   2991 C  CA  . VAL B 1 111 ? 20.433 184.346 3.070   1.00   26.86 ? 105  VAL B CA  1 
ATOM   2992 C  C   . VAL B 1 111 ? 20.214 183.928 1.588   1.00   28.38 ? 105  VAL B C   1 
ATOM   2993 O  O   . VAL B 1 111 ? 20.804 184.533 0.680   1.00   27.81 ? 105  VAL B O   1 
ATOM   2994 C  CB  . VAL B 1 111 ? 19.793 185.733 3.294   1.00   27.91 ? 105  VAL B CB  1 
ATOM   2995 C  CG1 . VAL B 1 111 ? 18.289 185.699 2.969   1.00   29.18 ? 105  VAL B CG1 1 
ATOM   2996 C  CG2 . VAL B 1 111 ? 20.012 186.216 4.727   1.00   27.98 ? 105  VAL B CG2 1 
ATOM   2997 N  N   . PHE B 1 112 ? 19.383 182.904 1.352   1.00   29.48 ? 106  PHE B N   1 
ATOM   2998 C  CA  . PHE B 1 112 ? 18.954 182.521 0.013   1.00   30.47 ? 106  PHE B CA  1 
ATOM   2999 C  C   . PHE B 1 112 ? 17.493 182.962 -0.197  1.00   32.02 ? 106  PHE B C   1 
ATOM   3000 O  O   . PHE B 1 112 ? 16.636 182.803 0.701   1.00   29.23 ? 106  PHE B O   1 
ATOM   3001 C  CB  . PHE B 1 112 ? 19.006 181.005 -0.184  1.00   31.25 ? 106  PHE B CB  1 
ATOM   3002 C  CG  . PHE B 1 112 ? 20.380 180.418 -0.299  1.00   32.82 ? 106  PHE B CG  1 
ATOM   3003 C  CD1 . PHE B 1 112 ? 21.199 180.290 0.818   1.00   35.48 ? 106  PHE B CD1 1 
ATOM   3004 C  CD2 . PHE B 1 112 ? 20.829 179.910 -1.517  1.00   35.49 ? 106  PHE B CD2 1 
ATOM   3005 C  CE1 . PHE B 1 112 ? 22.454 179.697 0.712   1.00   36.05 ? 106  PHE B CE1 1 
ATOM   3006 C  CE2 . PHE B 1 112 ? 22.083 179.318 -1.635  1.00   35.68 ? 106  PHE B CE2 1 
ATOM   3007 C  CZ  . PHE B 1 112 ? 22.900 179.209 -0.525  1.00   36.08 ? 106  PHE B CZ  1 
ATOM   3008 N  N   . THR B 1 113 ? 17.229 183.515 -1.388  1.00   33.39 ? 107  THR B N   1 
ATOM   3009 C  CA  . THR B 1 113 ? 15.892 183.900 -1.852  1.00   35.30 ? 107  THR B CA  1 
ATOM   3010 C  C   . THR B 1 113 ? 15.699 183.418 -3.286  1.00   36.55 ? 107  THR B C   1 
ATOM   3011 O  O   . THR B 1 113 ? 16.494 183.761 -4.156  1.00   37.23 ? 107  THR B O   1 
ATOM   3012 C  CB  . THR B 1 113 ? 15.730 185.436 -1.877  1.00   35.62 ? 107  THR B CB  1 
ATOM   3013 O  OG1 . THR B 1 113 ? 16.806 186.033 -2.623  1.00   36.50 ? 107  THR B OG1 1 
ATOM   3014 C  CG2 . THR B 1 113 ? 15.837 186.054 -0.512  1.00   36.73 ? 107  THR B CG2 1 
ATOM   3015 N  N   . GLY B 1 114 ? 14.671 182.618 -3.539  1.00   37.96 ? 108  GLY B N   1 
ATOM   3016 C  CA  . GLY B 1 114 ? 14.395 182.132 -4.888  1.00   38.41 ? 108  GLY B CA  1 
ATOM   3017 C  C   . GLY B 1 114 ? 15.558 181.361 -5.482  1.00   38.63 ? 108  GLY B C   1 
ATOM   3018 O  O   . GLY B 1 114 ? 15.870 181.491 -6.664  1.00   39.84 ? 108  GLY B O   1 
ATOM   3019 N  N   . GLY B 1 115 ? 16.223 180.571 -4.649  1.00   38.00 ? 109  GLY B N   1 
ATOM   3020 C  CA  . GLY B 1 115 ? 17.318 179.726 -5.079  1.00   37.33 ? 109  GLY B CA  1 
ATOM   3021 C  C   . GLY B 1 115 ? 18.672 180.393 -5.123  1.00   36.99 ? 109  GLY B C   1 
ATOM   3022 O  O   . GLY B 1 115 ? 19.662 179.731 -5.306  1.00   37.90 ? 109  GLY B O   1 
ATOM   3023 N  N   . LYS B 1 116 ? 18.712 181.706 -4.961  1.00   37.06 ? 110  LYS B N   1 
ATOM   3024 C  CA  . LYS B 1 116 ? 19.939 182.477 -5.049  1.00   37.14 ? 110  LYS B CA  1 
ATOM   3025 C  C   . LYS B 1 116 ? 20.441 182.959 -3.654  1.00   35.59 ? 110  LYS B C   1 
ATOM   3026 O  O   . LYS B 1 116 ? 19.761 183.703 -2.971  1.00   33.20 ? 110  LYS B O   1 
ATOM   3027 C  CB  . LYS B 1 116 ? 19.659 183.697 -5.929  1.00   37.32 ? 110  LYS B CB  1 
ATOM   3028 C  CG  . LYS B 1 116 ? 20.803 184.694 -6.005  1.00   42.19 ? 110  LYS B CG  1 
ATOM   3029 C  CD  . LYS B 1 116 ? 22.108 184.002 -6.414  1.00   46.69 ? 110  LYS B CD  1 
ATOM   3030 C  CE  . LYS B 1 116 ? 23.055 184.980 -7.126  1.00   49.59 ? 110  LYS B CE  1 
ATOM   3031 N  NZ  . LYS B 1 116 ? 23.214 186.248 -6.360  1.00   52.38 ? 110  LYS B NZ  1 
ATOM   3032 N  N   . GLY B 1 117 ? 21.642 182.539 -3.285  1.00   35.30 ? 111  GLY B N   1 
ATOM   3033 C  CA  . GLY B 1 117 ? 22.319 182.986 -2.082  1.00   35.37 ? 111  GLY B CA  1 
ATOM   3034 C  C   . GLY B 1 117 ? 23.433 183.981 -2.369  1.00   35.12 ? 111  GLY B C   1 
ATOM   3035 O  O   . GLY B 1 117 ? 23.187 185.109 -2.788  1.00   35.25 ? 111  GLY B O   1 
ATOM   3036 N  N   . ASP B 1 118 ? 24.664 183.562 -2.118  1.00   35.15 ? 112  ASP B N   1 
ATOM   3037 C  CA  . ASP B 1 118 ? 25.845 184.410 -2.303  1.00   35.32 ? 112  ASP B CA  1 
ATOM   3038 C  C   . ASP B 1 118 ? 25.795 185.707 -1.507  1.00   34.38 ? 112  ASP B C   1 
ATOM   3039 O  O   . ASP B 1 118 ? 26.339 186.724 -1.956  1.00   34.74 ? 112  ASP B O   1 
ATOM   3040 C  CB  . ASP B 1 118 ? 26.060 184.713 -3.799  1.00   36.81 ? 112  ASP B CB  1 
ATOM   3041 C  CG  . ASP B 1 118 ? 26.102 183.474 -4.620  1.00   38.40 ? 112  ASP B CG  1 
ATOM   3042 O  OD1 . ASP B 1 118 ? 26.970 182.620 -4.355  1.00   41.11 ? 112  ASP B OD1 1 
ATOM   3043 O  OD2 . ASP B 1 118 ? 25.264 183.243 -5.513  1.00   46.32 ? 112  ASP B OD2 1 
ATOM   3044 N  N   . ARG B 1 119 ? 25.142 185.687 -0.334  1.00   31.66 ? 113  ARG B N   1 
ATOM   3045 C  CA  . ARG B 1 119 ? 25.124 186.837 0.553   1.00   30.25 ? 113  ARG B CA  1 
ATOM   3046 C  C   . ARG B 1 119 ? 25.877 186.566 1.872   1.00   29.48 ? 113  ARG B C   1 
ATOM   3047 O  O   . ARG B 1 119 ? 25.401 186.880 2.964   1.00   28.14 ? 113  ARG B O   1 
ATOM   3048 C  CB  . ARG B 1 119 ? 23.686 187.261 0.866   1.00   30.30 ? 113  ARG B CB  1 
ATOM   3049 C  CG  . ARG B 1 119 ? 22.785 187.601 -0.318  1.00   31.87 ? 113  ARG B CG  1 
ATOM   3050 C  CD  . ARG B 1 119 ? 21.486 188.209 0.149   1.00   32.82 ? 113  ARG B CD  1 
ATOM   3051 N  NE  . ARG B 1 119 ? 20.599 188.588 -0.948  1.00   35.22 ? 113  ARG B NE  1 
ATOM   3052 C  CZ  . ARG B 1 119 ? 19.767 187.778 -1.578  1.00   35.81 ? 113  ARG B CZ  1 
ATOM   3053 N  NH1 . ARG B 1 119 ? 19.676 186.487 -1.250  1.00   34.70 ? 113  ARG B NH1 1 
ATOM   3054 N  NH2 . ARG B 1 119 ? 19.017 188.270 -2.570  1.00   37.89 ? 113  ARG B NH2 1 
ATOM   3055 N  N   . GLU B 1 120 ? 27.054 185.985 1.773   1.00   29.30 ? 114  GLU B N   1 
ATOM   3056 C  CA  . GLU B 1 120 ? 27.815 185.594 2.953   1.00   28.26 ? 114  GLU B CA  1 
ATOM   3057 C  C   . GLU B 1 120 ? 28.371 186.803 3.720   1.00   28.35 ? 114  GLU B C   1 
ATOM   3058 O  O   . GLU B 1 120 ? 28.831 187.794 3.122   1.00   26.35 ? 114  GLU B O   1 
ATOM   3059 C  CB  . GLU B 1 120 ? 28.973 184.677 2.578   1.00   28.87 ? 114  GLU B CB  1 
ATOM   3060 C  CG  . GLU B 1 120 ? 28.580 183.346 1.978   1.00   30.53 ? 114  GLU B CG  1 
ATOM   3061 C  CD  . GLU B 1 120 ? 28.485 183.369 0.439   1.00   36.79 ? 114  GLU B CD  1 
ATOM   3062 O  OE1 . GLU B 1 120 ? 28.421 184.470 -0.181  1.00   35.41 ? 114  GLU B OE1 1 
ATOM   3063 O  OE2 . GLU B 1 120 ? 28.439 182.275 -0.144  1.00   37.43 ? 114  GLU B OE2 1 
ATOM   3064 N  N   . GLN B 1 121 ? 28.279 186.734 5.049   1.00   27.00 ? 115  GLN B N   1 
ATOM   3065 C  CA  . GLN B 1 121 ? 29.073 187.579 5.927   1.00   26.96 ? 115  GLN B CA  1 
ATOM   3066 C  C   . GLN B 1 121 ? 29.788 186.704 6.915   1.00   26.24 ? 115  GLN B C   1 
ATOM   3067 O  O   . GLN B 1 121 ? 29.250 185.653 7.309   1.00   25.36 ? 115  GLN B O   1 
ATOM   3068 C  CB  . GLN B 1 121 ? 28.192 188.564 6.653   1.00   27.05 ? 115  GLN B CB  1 
ATOM   3069 C  CG  . GLN B 1 121 ? 27.414 189.415 5.740   1.00   29.55 ? 115  GLN B CG  1 
ATOM   3070 C  CD  . GLN B 1 121 ? 26.612 190.453 6.480   1.00   33.78 ? 115  GLN B CD  1 
ATOM   3071 O  OE1 . GLN B 1 121 ? 26.270 190.282 7.669   1.00   32.46 ? 115  GLN B OE1 1 
ATOM   3072 N  NE2 . GLN B 1 121 ? 26.302 191.538 5.790   1.00   33.93 ? 115  GLN B NE2 1 
ATOM   3073 N  N   . ARG B 1 122 ? 31.019 187.071 7.273   1.00   24.68 ? 116  ARG B N   1 
ATOM   3074 C  CA  . ARG B 1 122 ? 31.784 186.305 8.255   1.00   24.72 ? 116  ARG B CA  1 
ATOM   3075 C  C   . ARG B 1 122 ? 32.246 187.209 9.366   1.00   25.29 ? 116  ARG B C   1 
ATOM   3076 O  O   . ARG B 1 122 ? 32.816 188.296 9.090   1.00   24.42 ? 116  ARG B O   1 
ATOM   3077 C  CB  . ARG B 1 122 ? 33.013 185.674 7.611   1.00   25.33 ? 116  ARG B CB  1 
ATOM   3078 C  CG  . ARG B 1 122 ? 32.711 184.595 6.655   1.00   26.63 ? 116  ARG B CG  1 
ATOM   3079 C  CD  . ARG B 1 122 ? 33.950 184.045 5.957   1.00   30.58 ? 116  ARG B CD  1 
ATOM   3080 N  NE  . ARG B 1 122 ? 33.573 182.899 5.153   1.00   32.93 ? 116  ARG B NE  1 
ATOM   3081 C  CZ  . ARG B 1 122 ? 34.435 182.032 4.615   1.00   36.94 ? 116  ARG B CZ  1 
ATOM   3082 N  NH1 . ARG B 1 122 ? 35.745 182.188 4.770   1.00   36.29 ? 116  ARG B NH1 1 
ATOM   3083 N  NH2 . ARG B 1 122 ? 33.970 181.008 3.903   1.00   36.54 ? 116  ARG B NH2 1 
ATOM   3084 N  N   . ILE B 1 123 ? 32.019 186.790 10.609  1.00   23.48 ? 117  ILE B N   1 
ATOM   3085 C  CA  . ILE B 1 123 ? 32.496 187.525 11.756  1.00   23.55 ? 117  ILE B CA  1 
ATOM   3086 C  C   . ILE B 1 123 ? 33.291 186.611 12.656  1.00   25.09 ? 117  ILE B C   1 
ATOM   3087 O  O   . ILE B 1 123 ? 33.173 185.355 12.577  1.00   24.06 ? 117  ILE B O   1 
ATOM   3088 C  CB  . ILE B 1 123 ? 31.340 188.167 12.550  1.00   23.77 ? 117  ILE B CB  1 
ATOM   3089 C  CG1 . ILE B 1 123 ? 30.372 187.132 13.175  1.00   22.98 ? 117  ILE B CG1 1 
ATOM   3090 C  CG2 . ILE B 1 123 ? 30.517 189.120 11.674  1.00   24.04 ? 117  ILE B CG2 1 
ATOM   3091 C  CD1 . ILE B 1 123 ? 29.488 187.736 14.277  1.00   23.02 ? 117  ILE B CD1 1 
ATOM   3092 N  N   . TYR B 1 124 ? 34.131 187.231 13.472  1.00   25.35 ? 118  TYR B N   1 
ATOM   3093 C  CA  . TYR B 1 124 ? 34.656 186.618 14.686  1.00   25.78 ? 118  TYR B CA  1 
ATOM   3094 C  C   . TYR B 1 124 ? 33.712 186.938 15.796  1.00   25.43 ? 118  TYR B C   1 
ATOM   3095 O  O   . TYR B 1 124 ? 32.937 187.895 15.718  1.00   25.87 ? 118  TYR B O   1 
ATOM   3096 C  CB  . TYR B 1 124 ? 36.046 187.185 15.062  1.00   25.91 ? 118  TYR B CB  1 
ATOM   3097 C  CG  . TYR B 1 124 ? 37.194 186.735 14.212  1.00   28.00 ? 118  TYR B CG  1 
ATOM   3098 C  CD1 . TYR B 1 124 ? 37.217 185.482 13.634  1.00   31.51 ? 118  TYR B CD1 1 
ATOM   3099 C  CD2 . TYR B 1 124 ? 38.276 187.578 13.977  1.00   33.07 ? 118  TYR B CD2 1 
ATOM   3100 C  CE1 . TYR B 1 124 ? 38.274 185.071 12.840  1.00   30.99 ? 118  TYR B CE1 1 
ATOM   3101 C  CE2 . TYR B 1 124 ? 39.348 187.180 13.198  1.00   34.13 ? 118  TYR B CE2 1 
ATOM   3102 C  CZ  . TYR B 1 124 ? 39.348 185.912 12.634  1.00   33.66 ? 118  TYR B CZ  1 
ATOM   3103 O  OH  . TYR B 1 124 ? 40.393 185.479 11.846  1.00   33.67 ? 118  TYR B OH  1 
ATOM   3104 N  N   . LEU B 1 125 ? 33.774 186.157 16.867  1.00   25.81 ? 119  LEU B N   1 
ATOM   3105 C  CA  . LEU B 1 125 ? 32.917 186.414 18.015  1.00   26.01 ? 119  LEU B CA  1 
ATOM   3106 C  C   . LEU B 1 125 ? 33.681 187.126 19.149  1.00   25.75 ? 119  LEU B C   1 
ATOM   3107 O  O   . LEU B 1 125 ? 34.884 187.082 19.203  1.00   26.52 ? 119  LEU B O   1 
ATOM   3108 C  CB  . LEU B 1 125 ? 32.306 185.103 18.507  1.00   26.01 ? 119  LEU B CB  1 
ATOM   3109 C  CG  . LEU B 1 125 ? 31.328 184.473 17.501  1.00   28.00 ? 119  LEU B CG  1 
ATOM   3110 C  CD1 . LEU B 1 125 ? 30.975 183.088 17.895  1.00   28.41 ? 119  LEU B CD1 1 
ATOM   3111 C  CD2 . LEU B 1 125 ? 30.060 185.276 17.369  1.00   29.09 ? 119  LEU B CD2 1 
ATOM   3112 N  N   . TRP B 1 126 ? 32.943 187.688 20.087  1.00   26.02 ? 120  TRP B N   1 
ATOM   3113 C  CA  . TRP B 1 126 ? 33.492 188.452 21.213  1.00   27.03 ? 120  TRP B CA  1 
ATOM   3114 C  C   . TRP B 1 126 ? 33.532 187.606 22.509  1.00   28.18 ? 120  TRP B C   1 
ATOM   3115 O  O   . TRP B 1 126 ? 33.410 188.125 23.590  1.00   28.74 ? 120  TRP B O   1 
ATOM   3116 C  CB  . TRP B 1 126 ? 32.664 189.727 21.424  1.00   26.15 ? 120  TRP B CB  1 
ATOM   3117 C  CG  . TRP B 1 126 ? 31.221 189.507 21.477  1.00   25.73 ? 120  TRP B CG  1 
ATOM   3118 C  CD1 . TRP B 1 126 ? 30.471 189.284 22.588  1.00   25.76 ? 120  TRP B CD1 1 
ATOM   3119 C  CD2 . TRP B 1 126 ? 30.314 189.451 20.360  1.00   25.41 ? 120  TRP B CD2 1 
ATOM   3120 N  NE1 . TRP B 1 126 ? 29.157 189.100 22.238  1.00   27.09 ? 120  TRP B NE1 1 
ATOM   3121 C  CE2 . TRP B 1 126 ? 29.038 189.185 20.875  1.00   24.95 ? 120  TRP B CE2 1 
ATOM   3122 C  CE3 . TRP B 1 126 ? 30.465 189.572 18.971  1.00   25.79 ? 120  TRP B CE3 1 
ATOM   3123 C  CZ2 . TRP B 1 126 ? 27.915 189.063 20.068  1.00   27.17 ? 120  TRP B CZ2 1 
ATOM   3124 C  CZ3 . TRP B 1 126 ? 29.333 189.468 18.166  1.00   25.01 ? 120  TRP B CZ3 1 
ATOM   3125 C  CH2 . TRP B 1 126 ? 28.083 189.200 18.720  1.00   25.62 ? 120  TRP B CH2 1 
ATOM   3126 N  N   . PHE B 1 127 ? 33.673 186.291 22.347  1.00   29.08 ? 121  PHE B N   1 
ATOM   3127 C  CA  . PHE B 1 127 ? 33.779 185.316 23.428  1.00   29.42 ? 121  PHE B CA  1 
ATOM   3128 C  C   . PHE B 1 127 ? 34.274 184.027 22.777  1.00   30.36 ? 121  PHE B C   1 
ATOM   3129 O  O   . PHE B 1 127 ? 34.319 183.905 21.539  1.00   29.23 ? 121  PHE B O   1 
ATOM   3130 C  CB  . PHE B 1 127 ? 32.400 185.073 24.098  1.00   29.48 ? 121  PHE B CB  1 
ATOM   3131 C  CG  . PHE B 1 127 ? 31.278 184.721 23.116  1.00   29.66 ? 121  PHE B CG  1 
ATOM   3132 C  CD1 . PHE B 1 127 ? 31.096 183.394 22.674  1.00   28.34 ? 121  PHE B CD1 1 
ATOM   3133 C  CD2 . PHE B 1 127 ? 30.433 185.701 22.635  1.00   28.55 ? 121  PHE B CD2 1 
ATOM   3134 C  CE1 . PHE B 1 127 ? 30.073 183.091 21.774  1.00   29.20 ? 121  PHE B CE1 1 
ATOM   3135 C  CE2 . PHE B 1 127 ? 29.436 185.391 21.748  1.00   31.04 ? 121  PHE B CE2 1 
ATOM   3136 C  CZ  . PHE B 1 127 ? 29.253 184.089 21.311  1.00   29.24 ? 121  PHE B CZ  1 
ATOM   3137 N  N   . ASP B 1 128 ? 34.644 183.063 23.611  1.00   31.41 ? 122  ASP B N   1 
ATOM   3138 C  CA  . ASP B 1 128 ? 35.070 181.743 23.156  1.00   31.99 ? 122  ASP B CA  1 
ATOM   3139 C  C   . ASP B 1 128 ? 33.809 180.911 23.029  1.00   31.02 ? 122  ASP B C   1 
ATOM   3140 O  O   . ASP B 1 128 ? 33.218 180.525 24.047  1.00   31.67 ? 122  ASP B O   1 
ATOM   3141 C  CB  . ASP B 1 128 ? 36.072 181.133 24.152  1.00   32.96 ? 122  ASP B CB  1 
ATOM   3142 C  CG  . ASP B 1 128 ? 36.517 179.738 23.746  1.00   36.19 ? 122  ASP B CG  1 
ATOM   3143 O  OD1 . ASP B 1 128 ? 35.798 179.114 22.946  1.00   37.50 ? 122  ASP B OD1 1 
ATOM   3144 O  OD2 . ASP B 1 128 ? 37.562 179.261 24.229  1.00   40.29 ? 122  ASP B OD2 1 
ATOM   3145 N  N   . PRO B 1 129 ? 33.347 180.646 21.805  1.00   30.08 ? 123  PRO B N   1 
ATOM   3146 C  CA  . PRO B 1 129 ? 32.096 179.876 21.626  1.00   30.04 ? 123  PRO B CA  1 
ATOM   3147 C  C   . PRO B 1 129 ? 32.148 178.410 22.085  1.00   30.23 ? 123  PRO B C   1 
ATOM   3148 O  O   . PRO B 1 129 ? 31.111 177.740 22.157  1.00   29.21 ? 123  PRO B O   1 
ATOM   3149 C  CB  . PRO B 1 129 ? 31.816 179.993 20.134  1.00   29.37 ? 123  PRO B CB  1 
ATOM   3150 C  CG  . PRO B 1 129 ? 33.119 180.342 19.491  1.00   29.68 ? 123  PRO B CG  1 
ATOM   3151 C  CD  . PRO B 1 129 ? 33.938 181.070 20.520  1.00   30.57 ? 123  PRO B CD  1 
ATOM   3152 N  N   . THR B 1 130 ? 33.337 177.926 22.422  1.00   31.78 ? 124  THR B N   1 
ATOM   3153 C  CA  . THR B 1 130 ? 33.496 176.536 22.855  1.00   33.80 ? 124  THR B CA  1 
ATOM   3154 C  C   . THR B 1 130 ? 33.415 176.408 24.371  1.00   36.13 ? 124  THR B C   1 
ATOM   3155 O  O   . THR B 1 130 ? 33.202 175.318 24.877  1.00   38.14 ? 124  THR B O   1 
ATOM   3156 C  CB  . THR B 1 130 ? 34.829 175.928 22.402  1.00   34.21 ? 124  THR B CB  1 
ATOM   3157 O  OG1 . THR B 1 130 ? 35.900 176.477 23.189  1.00   34.58 ? 124  THR B OG1 1 
ATOM   3158 C  CG2 . THR B 1 130 ? 35.066 176.208 20.913  1.00   32.99 ? 124  THR B CG2 1 
ATOM   3159 N  N   . LYS B 1 131 ? 33.602 177.556 25.096  1.00   37.36 ? 125  LYS B N   1 
ATOM   3160 C  CA  . LYS B 1 131 ? 33.641 177.688 26.604  1.00   38.54 ? 125  LYS B CA  1 
ATOM   3161 C  C   . LYS B 1 131 ? 32.289 177.475 27.253  1.00   39.17 ? 125  LYS B C   1 
ATOM   3162 O  O   . LYS B 1 131 ? 32.153 176.758 28.243  1.00   40.62 ? 125  LYS B O   1 
ATOM   3163 C  CB  . LYS B 1 131 ? 34.194 179.134 27.010  1.00   39.27 ? 125  LYS B CB  1 
ATOM   3164 C  CG  . LYS B 1 131 ? 34.097 179.661 28.473  0.0000 36.52 ? 125  LYS B CG  1 
ATOM   3165 C  CD  . LYS B 1 131 ? 34.781 181.002 28.799  0.0000 40.51 ? 125  LYS B CD  1 
ATOM   3166 C  CE  . LYS B 1 131 ? 34.493 181.479 30.213  0.0000 42.59 ? 125  LYS B CE  1 
ATOM   3167 N  NZ  . LYS B 1 131 ? 33.914 182.854 30.242  0.0000 44.04 ? 125  LYS B NZ  1 
ATOM   3168 N  N   . GLU B 1 132 ? 31.271 178.096 26.673  1.00   38.90 ? 126  GLU B N   1 
ATOM   3169 C  CA  . GLU B 1 132 ? 29.958 178.102 27.242  1.00   38.95 ? 126  GLU B CA  1 
ATOM   3170 C  C   . GLU B 1 132 ? 28.872 178.123 26.194  1.00   37.20 ? 126  GLU B C   1 
ATOM   3171 O  O   . GLU B 1 132 ? 29.141 178.322 25.013  1.00   37.41 ? 126  GLU B O   1 
ATOM   3172 C  CB  . GLU B 1 132 ? 29.853 179.333 28.128  1.00   40.19 ? 126  GLU B CB  1 
ATOM   3173 C  CG  . GLU B 1 132 ? 28.580 179.469 28.903  1.00   45.40 ? 126  GLU B CG  1 
ATOM   3174 C  CD  . GLU B 1 132 ? 28.406 178.310 29.841  1.00   49.87 ? 126  GLU B CD  1 
ATOM   3175 O  OE1 . GLU B 1 132 ? 29.271 178.140 30.734  1.00   55.07 ? 126  GLU B OE1 1 
ATOM   3176 O  OE2 . GLU B 1 132 ? 27.403 177.567 29.703  1.00   50.72 ? 126  GLU B OE2 1 
ATOM   3177 N  N   . PHE B 1 133 ? 27.630 177.938 26.642  1.00   34.87 ? 127  PHE B N   1 
ATOM   3178 C  CA  . PHE B 1 133 ? 26.467 177.993 25.762  1.00   34.37 ? 127  PHE B CA  1 
ATOM   3179 C  C   . PHE B 1 133 ? 26.080 179.442 25.498  1.00   33.32 ? 127  PHE B C   1 
ATOM   3180 O  O   . PHE B 1 133 ? 26.018 180.255 26.417  1.00   33.29 ? 127  PHE B O   1 
ATOM   3181 C  CB  . PHE B 1 133 ? 25.277 177.279 26.378  1.00   34.24 ? 127  PHE B CB  1 
ATOM   3182 C  CG  . PHE B 1 133 ? 25.355 175.782 26.265  1.00   35.97 ? 127  PHE B CG  1 
ATOM   3183 C  CD1 . PHE B 1 133 ? 24.834 175.128 25.153  1.00   35.07 ? 127  PHE B CD1 1 
ATOM   3184 C  CD2 . PHE B 1 133 ? 25.941 175.024 27.282  1.00   37.68 ? 127  PHE B CD2 1 
ATOM   3185 C  CE1 . PHE B 1 133 ? 24.899 173.737 25.042  1.00   36.51 ? 127  PHE B CE1 1 
ATOM   3186 C  CE2 . PHE B 1 133 ? 26.007 173.627 27.183  1.00   39.53 ? 127  PHE B CE2 1 
ATOM   3187 C  CZ  . PHE B 1 133 ? 25.485 172.986 26.048  1.00   38.26 ? 127  PHE B CZ  1 
ATOM   3188 N  N   . HIS B 1 134 ? 25.812 179.760 24.256  1.00   31.22 ? 128  HIS B N   1 
ATOM   3189 C  CA  . HIS B 1 134 ? 25.310 181.027 23.847  1.00   30.45 ? 128  HIS B CA  1 
ATOM   3190 C  C   . HIS B 1 134 ? 24.090 180.825 22.989  1.00   29.55 ? 128  HIS B C   1 
ATOM   3191 O  O   . HIS B 1 134 ? 23.904 179.776 22.393  1.00   28.22 ? 128  HIS B O   1 
ATOM   3192 C  CB  . HIS B 1 134 ? 26.377 181.831 23.094  1.00   30.48 ? 128  HIS B CB  1 
ATOM   3193 C  CG  . HIS B 1 134 ? 27.472 182.334 24.042  1.00   32.12 ? 128  HIS B CG  1 
ATOM   3194 N  ND1 . HIS B 1 134 ? 27.447 183.595 24.605  1.00   35.79 ? 128  HIS B ND1 1 
ATOM   3195 C  CD2 . HIS B 1 134 ? 28.587 181.729 24.493  1.00   34.04 ? 128  HIS B CD2 1 
ATOM   3196 C  CE1 . HIS B 1 134 ? 28.524 183.730 25.346  1.00   32.17 ? 128  HIS B CE1 1 
ATOM   3197 N  NE2 . HIS B 1 134 ? 29.246 182.627 25.290  1.00   32.83 ? 128  HIS B NE2 1 
ATOM   3198 N  N   . TYR B 1 135 ? 23.219 181.855 22.931  1.00   28.13 ? 129  TYR B N   1 
ATOM   3199 C  CA  . TYR B 1 135 ? 22.039 181.828 22.096  1.00   28.46 ? 129  TYR B CA  1 
ATOM   3200 C  C   . TYR B 1 135 ? 22.339 182.330 20.674  1.00   27.12 ? 129  TYR B C   1 
ATOM   3201 O  O   . TYR B 1 135 ? 23.068 183.314 20.475  1.00   25.82 ? 129  TYR B O   1 
ATOM   3202 C  CB  . TYR B 1 135 ? 20.919 182.666 22.685  1.00   29.92 ? 129  TYR B CB  1 
ATOM   3203 C  CG  . TYR B 1 135 ? 20.217 182.046 23.857  1.00   36.52 ? 129  TYR B CG  1 
ATOM   3204 C  CD1 . TYR B 1 135 ? 20.657 182.280 25.151  1.00   43.55 ? 129  TYR B CD1 1 
ATOM   3205 C  CD2 . TYR B 1 135 ? 19.082 181.266 23.677  1.00   42.98 ? 129  TYR B CD2 1 
ATOM   3206 C  CE1 . TYR B 1 135 ? 19.993 181.728 26.247  1.00   47.24 ? 129  TYR B CE1 1 
ATOM   3207 C  CE2 . TYR B 1 135 ? 18.407 180.710 24.764  1.00   46.11 ? 129  TYR B CE2 1 
ATOM   3208 C  CZ  . TYR B 1 135 ? 18.867 180.947 26.040  1.00   48.83 ? 129  TYR B CZ  1 
ATOM   3209 O  OH  . TYR B 1 135 ? 18.208 180.392 27.127  1.00   54.99 ? 129  TYR B OH  1 
ATOM   3210 N  N   . TYR B 1 136 ? 21.756 181.644 19.704  1.00   24.81 ? 130  TYR B N   1 
ATOM   3211 C  CA  . TYR B 1 136 ? 21.850 182.002 18.311  1.00   24.30 ? 130  TYR B CA  1 
ATOM   3212 C  C   . TYR B 1 136 ? 20.426 181.948 17.840  1.00   24.53 ? 130  TYR B C   1 
ATOM   3213 O  O   . TYR B 1 136 ? 19.749 180.920 18.011  1.00   24.65 ? 130  TYR B O   1 
ATOM   3214 C  CB  . TYR B 1 136 ? 22.798 181.060 17.533  1.00   23.75 ? 130  TYR B CB  1 
ATOM   3215 C  CG  . TYR B 1 136 ? 24.206 181.062 18.091  1.00   21.68 ? 130  TYR B CG  1 
ATOM   3216 C  CD1 . TYR B 1 136 ? 25.136 182.007 17.704  1.00   20.79 ? 130  TYR B CD1 1 
ATOM   3217 C  CD2 . TYR B 1 136 ? 24.614 180.100 19.005  1.00   21.82 ? 130  TYR B CD2 1 
ATOM   3218 C  CE1 . TYR B 1 136 ? 26.438 182.018 18.246  1.00   21.02 ? 130  TYR B CE1 1 
ATOM   3219 C  CE2 . TYR B 1 136 ? 25.893 180.112 19.540  1.00   21.65 ? 130  TYR B CE2 1 
ATOM   3220 C  CZ  . TYR B 1 136 ? 26.794 181.087 19.177  1.00   21.88 ? 130  TYR B CZ  1 
ATOM   3221 O  OH  . TYR B 1 136 ? 28.080 181.076 19.702  1.00   21.77 ? 130  TYR B OH  1 
ATOM   3222 N  N   . SER B 1 137 ? 19.926 183.075 17.353  1.00   24.44 ? 131  SER B N   1 
ATOM   3223 C  CA  . SER B 1 137 ? 18.536 183.158 16.905  1.00   25.36 ? 131  SER B CA  1 
ATOM   3224 C  C   . SER B 1 137 ? 18.305 183.945 15.665  1.00   24.80 ? 131  SER B C   1 
ATOM   3225 O  O   . SER B 1 137 ? 19.142 184.729 15.198  1.00   23.48 ? 131  SER B O   1 
ATOM   3226 C  CB  . SER B 1 137 ? 17.566 183.719 17.987  1.00   26.62 ? 131  SER B CB  1 
ATOM   3227 O  OG  . SER B 1 137 ? 18.195 184.576 18.855  1.00   31.72 ? 131  SER B OG  1 
ATOM   3228 N  N   . VAL B 1 138 ? 17.111 183.720 15.151  1.00   24.99 ? 132  VAL B N   1 
ATOM   3229 C  CA  . VAL B 1 138 ? 16.607 184.372 13.997  1.00   26.29 ? 132  VAL B CA  1 
ATOM   3230 C  C   . VAL B 1 138 ? 15.222 184.891 14.332  1.00   26.42 ? 132  VAL B C   1 
ATOM   3231 O  O   . VAL B 1 138 ? 14.380 184.152 14.863  1.00   27.10 ? 132  VAL B O   1 
ATOM   3232 C  CB  . VAL B 1 138 ? 16.477 183.393 12.816  1.00   27.11 ? 132  VAL B CB  1 
ATOM   3233 C  CG1 . VAL B 1 138 ? 15.826 184.096 11.640  1.00   27.79 ? 132  VAL B CG1 1 
ATOM   3234 C  CG2 . VAL B 1 138 ? 17.829 182.832 12.421  1.00   29.10 ? 132  VAL B CG2 1 
ATOM   3235 N  N   . LEU B 1 139 ? 14.988 186.147 14.002  1.00   26.17 ? 133  LEU B N   1 
ATOM   3236 C  CA  . LEU B 1 139 ? 13.653 186.692 13.965  1.00   26.93 ? 133  LEU B CA  1 
ATOM   3237 C  C   . LEU B 1 139 ? 13.296 186.938 12.527  1.00   26.03 ? 133  LEU B C   1 
ATOM   3238 O  O   . LEU B 1 139 ? 14.009 187.617 11.816  1.00   25.82 ? 133  LEU B O   1 
ATOM   3239 C  CB  . LEU B 1 139 ? 13.586 187.986 14.768  1.00   27.22 ? 133  LEU B CB  1 
ATOM   3240 C  CG  . LEU B 1 139 ? 12.156 188.529 14.954  1.00   31.38 ? 133  LEU B CG  1 
ATOM   3241 C  CD1 . LEU B 1 139 ? 11.366 187.716 15.986  1.00   33.30 ? 133  LEU B CD1 1 
ATOM   3242 C  CD2 . LEU B 1 139 ? 12.235 189.947 15.377  1.00   34.19 ? 133  LEU B CD2 1 
ATOM   3243 N  N   . TRP B 1 140 ? 12.185 186.372 12.095  1.00   25.82 ? 134  TRP B N   1 
ATOM   3244 C  CA  . TRP B 1 140 ? 11.769 186.416 10.703  1.00   25.95 ? 134  TRP B CA  1 
ATOM   3245 C  C   . TRP B 1 140 ? 10.316 186.874 10.660  1.00   27.60 ? 134  TRP B C   1 
ATOM   3246 O  O   . TRP B 1 140 ? 9.428  186.180 11.163  1.00   26.54 ? 134  TRP B O   1 
ATOM   3247 C  CB  . TRP B 1 140 ? 11.926 185.027 10.109  1.00   26.12 ? 134  TRP B CB  1 
ATOM   3248 C  CG  . TRP B 1 140 ? 11.400 184.803 8.725   1.00   24.91 ? 134  TRP B CG  1 
ATOM   3249 C  CD1 . TRP B 1 140 ? 11.253 185.714 7.744   1.00   25.87 ? 134  TRP B CD1 1 
ATOM   3250 C  CD2 . TRP B 1 140 ? 10.925 183.562 8.195   1.00   24.47 ? 134  TRP B CD2 1 
ATOM   3251 N  NE1 . TRP B 1 140 ? 10.730 185.121 6.621   1.00   25.05 ? 134  TRP B NE1 1 
ATOM   3252 C  CE2 . TRP B 1 140 ? 10.508 183.801 6.877   1.00   25.04 ? 134  TRP B CE2 1 
ATOM   3253 C  CE3 . TRP B 1 140 ? 10.810 182.265 8.711   1.00   25.32 ? 134  TRP B CE3 1 
ATOM   3254 C  CZ2 . TRP B 1 140 ? 9.990  182.807 6.061   1.00   27.43 ? 134  TRP B CZ2 1 
ATOM   3255 C  CZ3 . TRP B 1 140 ? 10.269 181.267 7.906   1.00   26.91 ? 134  TRP B CZ3 1 
ATOM   3256 C  CH2 . TRP B 1 140 ? 9.870  181.543 6.599   1.00   28.69 ? 134  TRP B CH2 1 
ATOM   3257 N  N   . ASN B 1 141 ? 10.094 188.062 10.102  1.00   28.87 ? 135  ASN B N   1 
ATOM   3258 C  CA  . ASN B 1 141 ? 8.742  188.571 9.851   1.00   30.68 ? 135  ASN B CA  1 
ATOM   3259 C  C   . ASN B 1 141 ? 8.658  189.139 8.448   1.00   32.02 ? 135  ASN B C   1 
ATOM   3260 O  O   . ASN B 1 141 ? 9.597  189.000 7.651   1.00   30.55 ? 135  ASN B O   1 
ATOM   3261 C  CB  . ASN B 1 141 ? 8.276  189.573 10.952  1.00   30.33 ? 135  ASN B CB  1 
ATOM   3262 C  CG  . ASN B 1 141 ? 9.130  190.837 11.020  1.00   31.61 ? 135  ASN B CG  1 
ATOM   3263 O  OD1 . ASN B 1 141 ? 9.746  191.240 10.028  1.00   31.76 ? 135  ASN B OD1 1 
ATOM   3264 N  ND2 . ASN B 1 141 ? 9.141  191.492 12.193  1.00   30.10 ? 135  ASN B ND2 1 
ATOM   3265 N  N   . MET B 1 142 ? 7.529  189.766 8.117   1.00   33.66 ? 136  MET B N   1 
ATOM   3266 C  CA  . MET B 1 142 ? 7.334  190.224 6.751   1.00   35.52 ? 136  MET B CA  1 
ATOM   3267 C  C   . MET B 1 142 ? 8.197  191.432 6.430   1.00   34.43 ? 136  MET B C   1 
ATOM   3268 O  O   . MET B 1 142 ? 8.390  191.748 5.263   1.00   34.64 ? 136  MET B O   1 
ATOM   3269 C  CB  . MET B 1 142 ? 5.853  190.535 6.473   1.00   37.14 ? 136  MET B CB  1 
ATOM   3270 C  CG  . MET B 1 142 ? 5.528  190.541 4.961   1.00   44.05 ? 136  MET B CG  1 
ATOM   3271 S  SD  . MET B 1 142 ? 4.665  189.083 4.353   1.00   56.92 ? 136  MET B SD  1 
ATOM   3272 C  CE  . MET B 1 142 ? 4.177  189.638 2.691   1.00   58.79 ? 136  MET B CE  1 
ATOM   3273 N  N   . TYR B 1 143 ? 8.724  192.085 7.458   1.00   33.93 ? 137  TYR B N   1 
ATOM   3274 C  CA  . TYR B 1 143 ? 9.555  193.292 7.285   1.00   34.70 ? 137  TYR B CA  1 
ATOM   3275 C  C   . TYR B 1 143 ? 11.067 193.031 7.260   1.00   32.81 ? 137  TYR B C   1 
ATOM   3276 O  O   . TYR B 1 143 ? 11.812 193.730 6.563   1.00   31.96 ? 137  TYR B O   1 
ATOM   3277 C  CB  . TYR B 1 143 ? 9.235  194.310 8.379   1.00   35.73 ? 137  TYR B CB  1 
ATOM   3278 C  CG  . TYR B 1 143 ? 7.752  194.567 8.536   1.00   41.81 ? 137  TYR B CG  1 
ATOM   3279 C  CD1 . TYR B 1 143 ? 6.984  193.779 9.378   1.00   47.65 ? 137  TYR B CD1 1 
ATOM   3280 C  CD2 . TYR B 1 143 ? 7.116  195.587 7.827   1.00   49.46 ? 137  TYR B CD2 1 
ATOM   3281 C  CE1 . TYR B 1 143 ? 5.620  193.987 9.518   1.00   52.05 ? 137  TYR B CE1 1 
ATOM   3282 C  CE2 . TYR B 1 143 ? 5.735  195.820 7.973   1.00   50.67 ? 137  TYR B CE2 1 
ATOM   3283 C  CZ  . TYR B 1 143 ? 5.001  195.013 8.821   1.00   53.05 ? 137  TYR B CZ  1 
ATOM   3284 O  OH  . TYR B 1 143 ? 3.638  195.202 8.992   1.00   58.41 ? 137  TYR B OH  1 
ATOM   3285 N  N   . MET B 1 144 ? 11.531 192.038 8.012   1.00   30.76 ? 138  MET B N   1 
ATOM   3286 C  CA  . MET B 1 144 ? 12.959 191.780 8.083   1.00   29.85 ? 138  MET B CA  1 
ATOM   3287 C  C   . MET B 1 144 ? 13.291 190.411 8.678   1.00   28.69 ? 138  MET B C   1 
ATOM   3288 O  O   . MET B 1 144 ? 12.433 189.742 9.265   1.00   27.20 ? 138  MET B O   1 
ATOM   3289 C  CB  . MET B 1 144 ? 13.616 192.843 8.947   1.00   30.21 ? 138  MET B CB  1 
ATOM   3290 C  CG  . MET B 1 144 ? 13.117 192.875 10.368  1.00   31.48 ? 138  MET B CG  1 
ATOM   3291 S  SD  . MET B 1 144 ? 13.931 194.170 11.336  1.00   35.83 ? 138  MET B SD  1 
ATOM   3292 C  CE  . MET B 1 144 ? 13.196 193.892 12.918  1.00   35.82 ? 138  MET B CE  1 
ATOM   3293 N  N   . ILE B 1 145 ? 14.551 190.036 8.501   1.00   26.98 ? 139  ILE B N   1 
ATOM   3294 C  CA  . ILE B 1 145 ? 15.160 188.911 9.152   1.00   26.84 ? 139  ILE B CA  1 
ATOM   3295 C  C   . ILE B 1 145 ? 16.335 189.445 9.963   1.00   26.68 ? 139  ILE B C   1 
ATOM   3296 O  O   . ILE B 1 145 ? 17.202 190.147 9.432   1.00   27.40 ? 139  ILE B O   1 
ATOM   3297 C  CB  . ILE B 1 145 ? 15.640 187.897 8.133   1.00   26.43 ? 139  ILE B CB  1 
ATOM   3298 C  CG1 . ILE B 1 145 ? 14.442 187.284 7.410   1.00   27.95 ? 139  ILE B CG1 1 
ATOM   3299 C  CG2 . ILE B 1 145 ? 16.491 186.838 8.831   1.00   27.10 ? 139  ILE B CG2 1 
ATOM   3300 C  CD1 . ILE B 1 145 ? 14.783 186.526 6.164   1.00   30.52 ? 139  ILE B CD1 1 
ATOM   3301 N  N   . VAL B 1 146 ? 16.363 189.131 11.248  1.00   25.57 ? 140  VAL B N   1 
ATOM   3302 C  CA  . VAL B 1 146 ? 17.456 189.543 12.112  1.00   24.67 ? 140  VAL B CA  1 
ATOM   3303 C  C   . VAL B 1 146 ? 18.161 188.299 12.608  1.00   23.23 ? 140  VAL B C   1 
ATOM   3304 O  O   . VAL B 1 146 ? 17.504 187.357 13.019  1.00   22.55 ? 140  VAL B O   1 
ATOM   3305 C  CB  . VAL B 1 146 ? 16.945 190.344 13.348  1.00   24.78 ? 140  VAL B CB  1 
ATOM   3306 C  CG1 . VAL B 1 146 ? 18.112 191.014 14.083  1.00   26.14 ? 140  VAL B CG1 1 
ATOM   3307 C  CG2 . VAL B 1 146 ? 15.893 191.379 12.957  1.00   27.65 ? 140  VAL B CG2 1 
ATOM   3308 N  N   . PHE B 1 147 ? 19.492 188.309 12.567  1.00   21.98 ? 141  PHE B N   1 
ATOM   3309 C  CA  . PHE B 1 147 ? 20.335 187.259 13.113  1.00   21.50 ? 141  PHE B CA  1 
ATOM   3310 C  C   . PHE B 1 147 ? 20.880 187.810 14.412  1.00   21.96 ? 141  PHE B C   1 
ATOM   3311 O  O   . PHE B 1 147 ? 21.422 188.919 14.427  1.00   22.34 ? 141  PHE B O   1 
ATOM   3312 C  CB  . PHE B 1 147 ? 21.534 186.963 12.195  1.00   20.90 ? 141  PHE B CB  1 
ATOM   3313 C  CG  . PHE B 1 147 ? 21.205 186.374 10.846  1.00   22.62 ? 141  PHE B CG  1 
ATOM   3314 C  CD1 . PHE B 1 147 ? 20.637 187.148 9.833   1.00   24.38 ? 141  PHE B CD1 1 
ATOM   3315 C  CD2 . PHE B 1 147 ? 21.581 185.080 10.542  1.00   25.09 ? 141  PHE B CD2 1 
ATOM   3316 C  CE1 . PHE B 1 147 ? 20.389 186.623 8.553   1.00   25.04 ? 141  PHE B CE1 1 
ATOM   3317 C  CE2 . PHE B 1 147 ? 21.339 184.541 9.262   1.00   26.59 ? 141  PHE B CE2 1 
ATOM   3318 C  CZ  . PHE B 1 147 ? 20.734 185.318 8.273   1.00   27.16 ? 141  PHE B CZ  1 
ATOM   3319 N  N   . LEU B 1 148 ? 20.758 187.057 15.501  1.00   22.67 ? 142  LEU B N   1 
ATOM   3320 C  CA  . LEU B 1 148 ? 21.204 187.494 16.826  1.00   23.83 ? 142  LEU B CA  1 
ATOM   3321 C  C   . LEU B 1 148 ? 22.109 186.463 17.496  1.00   23.79 ? 142  LEU B C   1 
ATOM   3322 O  O   . LEU B 1 148 ? 21.902 185.254 17.373  1.00   23.87 ? 142  LEU B O   1 
ATOM   3323 C  CB  . LEU B 1 148 ? 20.011 187.793 17.711  1.00   24.59 ? 142  LEU B CB  1 
ATOM   3324 C  CG  . LEU B 1 148 ? 19.011 188.816 17.188  1.00   26.92 ? 142  LEU B CG  1 
ATOM   3325 C  CD1 . LEU B 1 148 ? 17.690 188.187 16.774  1.00   27.83 ? 142  LEU B CD1 1 
ATOM   3326 C  CD2 . LEU B 1 148 ? 18.756 189.921 18.226  1.00   28.01 ? 142  LEU B CD2 1 
ATOM   3327 N  N   . VAL B 1 149 ? 23.168 186.960 18.110  1.00   24.29 ? 143  VAL B N   1 
ATOM   3328 C  CA  . VAL B 1 149 ? 24.050 186.223 18.972  1.00   24.82 ? 143  VAL B CA  1 
ATOM   3329 C  C   . VAL B 1 149 ? 23.836 186.839 20.344  1.00   27.05 ? 143  VAL B C   1 
ATOM   3330 O  O   . VAL B 1 149 ? 24.129 188.020 20.546  1.00   26.84 ? 143  VAL B O   1 
ATOM   3331 C  CB  . VAL B 1 149 ? 25.499 186.399 18.564  1.00   24.49 ? 143  VAL B CB  1 
ATOM   3332 C  CG1 . VAL B 1 149 ? 26.402 185.698 19.555  1.00   26.52 ? 143  VAL B CG1 1 
ATOM   3333 C  CG2 . VAL B 1 149 ? 25.725 185.869 17.183  1.00   24.27 ? 143  VAL B CG2 1 
ATOM   3334 N  N   . ASP B 1 150 ? 23.341 186.026 21.272  1.00   28.85 ? 144  ASP B N   1 
ATOM   3335 C  CA  . ASP B 1 150 ? 22.685 186.475 22.498  1.00   30.50 ? 144  ASP B CA  1 
ATOM   3336 C  C   . ASP B 1 150 ? 21.688 187.601 22.204  1.00   31.97 ? 144  ASP B C   1 
ATOM   3337 O  O   . ASP B 1 150 ? 20.754 187.406 21.425  1.00   31.36 ? 144  ASP B O   1 
ATOM   3338 C  CB  . ASP B 1 150 ? 23.749 186.788 23.547  1.00   30.73 ? 144  ASP B CB  1 
ATOM   3339 C  CG  . ASP B 1 150 ? 24.608 185.573 23.869  1.00   32.99 ? 144  ASP B CG  1 
ATOM   3340 O  OD1 . ASP B 1 150 ? 24.039 184.456 24.093  1.00   33.19 ? 144  ASP B OD1 1 
ATOM   3341 O  OD2 . ASP B 1 150 ? 25.851 185.606 23.921  1.00   34.00 ? 144  ASP B OD2 1 
ATOM   3342 N  N   . ASP B 1 151 ? 21.890 188.784 22.766  1.00   33.47 ? 145  ASP B N   1 
ATOM   3343 C  CA  . ASP B 1 151 ? 20.992 189.908 22.475  1.00   34.71 ? 145  ASP B CA  1 
ATOM   3344 C  C   . ASP B 1 151 ? 21.544 190.828 21.381  1.00   33.96 ? 145  ASP B C   1 
ATOM   3345 O  O   . ASP B 1 151 ? 20.937 191.870 21.092  1.00   34.51 ? 145  ASP B O   1 
ATOM   3346 C  CB  . ASP B 1 151 ? 20.700 190.749 23.748  1.00   36.66 ? 145  ASP B CB  1 
ATOM   3347 C  CG  . ASP B 1 151 ? 21.851 190.750 24.731  1.00   41.97 ? 145  ASP B CG  1 
ATOM   3348 O  OD1 . ASP B 1 151 ? 23.084 190.646 24.400  1.00   48.07 ? 145  ASP B OD1 1 
ATOM   3349 O  OD2 . ASP B 1 151 ? 21.537 190.807 25.949  1.00   50.44 ? 145  ASP B OD2 1 
ATOM   3350 N  N   . VAL B 1 152 ? 22.679 190.456 20.779  1.00   31.98 ? 146  VAL B N   1 
ATOM   3351 C  CA  . VAL B 1 152 ? 23.335 191.293 19.786  1.00   30.40 ? 146  VAL B CA  1 
ATOM   3352 C  C   . VAL B 1 152 ? 22.956 190.951 18.352  1.00   29.37 ? 146  VAL B C   1 
ATOM   3353 O  O   . VAL B 1 152 ? 23.219 189.834 17.898  1.00   27.95 ? 146  VAL B O   1 
ATOM   3354 C  CB  . VAL B 1 152 ? 24.884 191.145 19.905  1.00   30.04 ? 146  VAL B CB  1 
ATOM   3355 C  CG1 . VAL B 1 152 ? 25.559 191.947 18.804  1.00   29.58 ? 146  VAL B CG1 1 
ATOM   3356 C  CG2 . VAL B 1 152 ? 25.373 191.622 21.260  1.00   32.37 ? 146  VAL B CG2 1 
ATOM   3357 N  N   . PRO B 1 153 ? 22.382 191.930 17.627  1.00   29.18 ? 147  PRO B N   1 
ATOM   3358 C  CA  . PRO B 1 153 ? 22.107 191.738 16.225  1.00   28.72 ? 147  PRO B CA  1 
ATOM   3359 C  C   . PRO B 1 153 ? 23.430 191.778 15.457  1.00   27.65 ? 147  PRO B C   1 
ATOM   3360 O  O   . PRO B 1 153 ? 24.207 192.722 15.587  1.00   27.86 ? 147  PRO B O   1 
ATOM   3361 C  CB  . PRO B 1 153 ? 21.190 192.910 15.837  1.00   29.45 ? 147  PRO B CB  1 
ATOM   3362 C  CG  . PRO B 1 153 ? 21.020 193.741 17.072  1.00   30.34 ? 147  PRO B CG  1 
ATOM   3363 C  CD  . PRO B 1 153 ? 21.878 193.193 18.179  1.00   29.75 ? 147  PRO B CD  1 
ATOM   3364 N  N   . ILE B 1 154 ? 23.693 190.751 14.656  1.00   25.61 ? 148  ILE B N   1 
ATOM   3365 C  CA  . ILE B 1 154 ? 24.927 190.702 13.882  1.00   24.43 ? 148  ILE B CA  1 
ATOM   3366 C  C   . ILE B 1 154 ? 24.640 190.984 12.416  1.00   24.05 ? 148  ILE B C   1 
ATOM   3367 O  O   . ILE B 1 154 ? 25.552 191.235 11.627  1.00   24.07 ? 148  ILE B O   1 
ATOM   3368 C  CB  . ILE B 1 154 ? 25.677 189.348 14.068  1.00   23.25 ? 148  ILE B CB  1 
ATOM   3369 C  CG1 . ILE B 1 154 ? 24.821 188.155 13.605  1.00   24.01 ? 148  ILE B CG1 1 
ATOM   3370 C  CG2 . ILE B 1 154 ? 26.102 189.175 15.526  1.00   24.93 ? 148  ILE B CG2 1 
ATOM   3371 C  CD1 . ILE B 1 154 ? 25.633 186.945 13.209  1.00   24.78 ? 148  ILE B CD1 1 
ATOM   3372 N  N   . ARG B 1 155 ? 23.371 190.952 12.107  1.00   25.11 ? 149  ARG B N   1 
ATOM   3373 C  CA  . ARG B 1 155 ? 22.936 191.110 10.759  1.00   26.29 ? 149  ARG B CA  1 
ATOM   3374 C  C   . ARG B 1 155 ? 21.442 191.391 10.616  1.00   27.20 ? 149  ARG B C   1 
ATOM   3375 O  O   . ARG B 1 155 ? 20.654 190.802 11.357  1.00   25.96 ? 149  ARG B O   1 
ATOM   3376 C  CB  . ARG B 1 155 ? 23.314 189.862 9.966   1.00   26.88 ? 149  ARG B CB  1 
ATOM   3377 C  CG  . ARG B 1 155 ? 22.718 189.843 8.588   1.00   27.57 ? 149  ARG B CG  1 
ATOM   3378 C  CD  . ARG B 1 155 ? 23.281 188.707 7.781   1.00   28.53 ? 149  ARG B CD  1 
ATOM   3379 N  NE  . ARG B 1 155 ? 23.062 188.938 6.381   1.00   27.02 ? 149  ARG B NE  1 
ATOM   3380 C  CZ  . ARG B 1 155 ? 23.606 188.250 5.407   1.00   28.10 ? 149  ARG B CZ  1 
ATOM   3381 N  NH1 . ARG B 1 155 ? 24.437 187.244 5.669   1.00   27.70 ? 149  ARG B NH1 1 
ATOM   3382 N  NH2 . ARG B 1 155 ? 23.316 188.550 4.158   1.00   30.83 ? 149  ARG B NH2 1 
ATOM   3383 N  N   . VAL B 1 156 ? 21.047 192.254 9.667   1.00   27.12 ? 150  VAL B N   1 
ATOM   3384 C  CA  . VAL B 1 156 ? 19.630 192.435 9.386   1.00   29.15 ? 150  VAL B CA  1 
ATOM   3385 C  C   . VAL B 1 156 ? 19.455 192.375 7.879   1.00   30.24 ? 150  VAL B C   1 
ATOM   3386 O  O   . VAL B 1 156 ? 20.196 192.998 7.113   1.00   31.83 ? 150  VAL B O   1 
ATOM   3387 C  CB  . VAL B 1 156 ? 19.053 193.724 10.058  1.00   29.37 ? 150  VAL B CB  1 
ATOM   3388 C  CG1 . VAL B 1 156 ? 19.728 194.979 9.520   1.00   30.87 ? 150  VAL B CG1 1 
ATOM   3389 C  CG2 . VAL B 1 156 ? 17.555 193.796 9.861   1.00   31.28 ? 150  VAL B CG2 1 
ATOM   3390 N  N   . PHE B 1 157 ? 18.461 191.617 7.442   1.00   30.71 ? 151  PHE B N   1 
ATOM   3391 C  CA  . PHE B 1 157 ? 18.113 191.524 6.037   1.00   31.56 ? 151  PHE B CA  1 
ATOM   3392 C  C   . PHE B 1 157 ? 16.668 192.007 5.871   1.00   32.88 ? 151  PHE B C   1 
ATOM   3393 O  O   . PHE B 1 157 ? 15.718 191.341 6.292   1.00   31.44 ? 151  PHE B O   1 
ATOM   3394 C  CB  . PHE B 1 157 ? 18.259 190.083 5.532   1.00   31.57 ? 151  PHE B CB  1 
ATOM   3395 C  CG  . PHE B 1 157 ? 18.031 189.936 4.053   1.00   32.67 ? 151  PHE B CG  1 
ATOM   3396 C  CD1 . PHE B 1 157 ? 19.034 190.279 3.144   1.00   34.54 ? 151  PHE B CD1 1 
ATOM   3397 C  CD2 . PHE B 1 157 ? 16.811 189.483 3.567   1.00   33.55 ? 151  PHE B CD2 1 
ATOM   3398 C  CE1 . PHE B 1 157 ? 18.821 190.166 1.768   1.00   35.88 ? 151  PHE B CE1 1 
ATOM   3399 C  CE2 . PHE B 1 157 ? 16.574 189.357 2.201   1.00   34.44 ? 151  PHE B CE2 1 
ATOM   3400 C  CZ  . PHE B 1 157 ? 17.570 189.695 1.289   1.00   35.48 ? 151  PHE B CZ  1 
ATOM   3401 N  N   . LYS B 1 158 ? 16.508 193.189 5.278   1.00   34.87 ? 152  LYS B N   1 
ATOM   3402 C  CA  . LYS B 1 158 ? 15.198 193.812 5.168   1.00   37.56 ? 152  LYS B CA  1 
ATOM   3403 C  C   . LYS B 1 158 ? 14.458 193.431 3.898   1.00   38.61 ? 152  LYS B C   1 
ATOM   3404 O  O   . LYS B 1 158 ? 15.075 193.118 2.865   1.00   38.50 ? 152  LYS B O   1 
ATOM   3405 C  CB  . LYS B 1 158 ? 15.314 195.334 5.277   1.00   37.98 ? 152  LYS B CB  1 
ATOM   3406 C  CG  . LYS B 1 158 ? 15.679 195.775 6.675   1.00   41.22 ? 152  LYS B CG  1 
ATOM   3407 C  CD  . LYS B 1 158 ? 15.567 197.259 6.824   1.00   45.21 ? 152  LYS B CD  1 
ATOM   3408 C  CE  . LYS B 1 158 ? 16.166 197.679 8.146   1.00   47.27 ? 152  LYS B CE  1 
ATOM   3409 N  NZ  . LYS B 1 158 ? 16.211 199.160 8.291   1.00   49.44 ? 152  LYS B NZ  1 
ATOM   3410 N  N   . ASN B 1 159 ? 13.132 193.452 3.986   1.00   40.58 ? 153  ASN B N   1 
ATOM   3411 C  CA  . ASN B 1 159 ? 12.260 193.230 2.848   1.00   42.26 ? 153  ASN B CA  1 
ATOM   3412 C  C   . ASN B 1 159 ? 12.239 194.550 2.119   1.00   44.62 ? 153  ASN B C   1 
ATOM   3413 O  O   . ASN B 1 159 ? 11.536 195.459 2.525   1.00   44.58 ? 153  ASN B O   1 
ATOM   3414 C  CB  . ASN B 1 159 ? 10.839 192.823 3.295   1.00   41.89 ? 153  ASN B CB  1 
ATOM   3415 C  CG  . ASN B 1 159 ? 9.964  192.343 2.145   1.00   41.37 ? 153  ASN B CG  1 
ATOM   3416 O  OD1 . ASN B 1 159 ? 10.328 192.510 0.986   1.00   42.34 ? 153  ASN B OD1 1 
ATOM   3417 N  ND2 . ASN B 1 159 ? 8.823  191.743 2.479   1.00   38.29 ? 153  ASN B ND2 1 
ATOM   3418 N  N   . CYS B 1 160 ? 13.017 194.673 1.046   1.00   47.85 ? 154  CYS B N   1 
ATOM   3419 C  CA  . CYS B 1 160 ? 13.050 195.893 0.272   1.00   50.21 ? 154  CYS B CA  1 
ATOM   3420 C  C   . CYS B 1 160 ? 12.660 195.594 -1.162  1.00   52.90 ? 154  CYS B C   1 
ATOM   3421 O  O   . CYS B 1 160 ? 13.414 195.750 -2.106  1.00   53.03 ? 154  CYS B O   1 
ATOM   3422 C  CB  . CYS B 1 160 ? 14.403 196.620 0.388   1.00   50.65 ? 154  CYS B CB  1 
ATOM   3423 S  SG  . CYS B 1 160 ? 14.387 198.081 1.481   1.00   47.21 ? 154  CYS B SG  1 
ATOM   3424 N  N   . LYS B 1 161 ? 11.381 195.138 -1.252  1.00   55.47 ? 155  LYS B N   1 
ATOM   3425 C  CA  . LYS B 1 161 ? 10.713 194.766 -2.513  1.00   57.70 ? 155  LYS B CA  1 
ATOM   3426 C  C   . LYS B 1 161 ? 10.601 195.939 -3.480  1.00   58.78 ? 155  LYS B C   1 
ATOM   3427 O  O   . LYS B 1 161 ? 10.664 195.757 -4.700  1.00   59.11 ? 155  LYS B O   1 
ATOM   3428 C  CB  . LYS B 1 161 ? 9.306  194.197 -2.213  1.00   58.15 ? 155  LYS B CB  1 
ATOM   3429 C  CG  . LYS B 1 161 ? 8.404  195.057 -1.341  1.00   60.31 ? 155  LYS B CG  1 
ATOM   3430 C  CD  . LYS B 1 161 ? 6.979  194.520 -1.306  1.00   62.83 ? 155  LYS B CD  1 
ATOM   3431 C  CE  . LYS B 1 161 ? 6.234  195.031 -0.077  1.00   63.65 ? 155  LYS B CE  1 
ATOM   3432 N  NZ  . LYS B 1 161 ? 5.810  193.927 0.825   1.00   65.39 ? 155  LYS B NZ  1 
ATOM   3433 N  N   . ASP B 1 162 ? 10.427 197.132 -2.926  1.00   59.94 ? 156  ASP B N   1 
ATOM   3434 C  CA  . ASP B 1 162 ? 10.329 198.361 -3.721  1.00   60.82 ? 156  ASP B CA  1 
ATOM   3435 C  C   . ASP B 1 162 ? 11.638 198.723 -4.428  1.00   60.75 ? 156  ASP B C   1 
ATOM   3436 O  O   . ASP B 1 162 ? 11.649 199.542 -5.335  1.00   61.13 ? 156  ASP B O   1 
ATOM   3437 C  CB  . ASP B 1 162 ? 9.785  199.491 -2.856  1.00   61.15 ? 156  ASP B CB  1 
ATOM   3438 C  CG  . ASP B 1 162 ? 10.672 199.800 -1.663  1.00   63.46 ? 156  ASP B CG  1 
ATOM   3439 O  OD1 . ASP B 1 162 ? 11.852 200.191 -1.872  1.00   66.35 ? 156  ASP B OD1 1 
ATOM   3440 O  OD2 . ASP B 1 162 ? 10.212 199.660 -0.513  1.00   66.49 ? 156  ASP B OD2 1 
ATOM   3441 N  N   . LEU B 1 163 ? 12.751 198.099 -4.010  1.00   60.03 ? 157  LEU B N   1 
ATOM   3442 C  CA  . LEU B 1 163 ? 14.028 198.170 -4.742  1.00   59.30 ? 157  LEU B CA  1 
ATOM   3443 C  C   . LEU B 1 163 ? 14.253 196.934 -5.628  1.00   58.61 ? 157  LEU B C   1 
ATOM   3444 O  O   . LEU B 1 163 ? 15.327 196.761 -6.212  1.00   59.02 ? 157  LEU B O   1 
ATOM   3445 C  CB  . LEU B 1 163 ? 15.210 198.313 -3.782  1.00   59.43 ? 157  LEU B CB  1 
ATOM   3446 C  CG  . LEU B 1 163 ? 15.222 199.460 -2.766  1.00   60.09 ? 157  LEU B CG  1 
ATOM   3447 C  CD1 . LEU B 1 163 ? 16.306 199.200 -1.728  1.00   59.79 ? 157  LEU B CD1 1 
ATOM   3448 C  CD2 . LEU B 1 163 ? 15.438 200.829 -3.429  1.00   60.55 ? 157  LEU B CD2 1 
ATOM   3449 N  N   . GLY B 1 164 ? 13.248 196.073 -5.713  1.00   57.56 ? 158  GLY B N   1 
ATOM   3450 C  CA  . GLY B 1 164 ? 13.289 194.906 -6.574  1.00   56.78 ? 158  GLY B CA  1 
ATOM   3451 C  C   . GLY B 1 164 ? 14.003 193.688 -6.007  1.00   55.79 ? 158  GLY B C   1 
ATOM   3452 O  O   . GLY B 1 164 ? 14.378 192.804 -6.772  1.00   56.07 ? 158  GLY B O   1 
ATOM   3453 N  N   . VAL B 1 165 ? 14.171 193.621 -4.685  1.00   54.36 ? 159  VAL B N   1 
ATOM   3454 C  CA  . VAL B 1 165 ? 14.845 192.481 -4.046  1.00   53.21 ? 159  VAL B CA  1 
ATOM   3455 C  C   . VAL B 1 165 ? 13.850 191.450 -3.520  1.00   51.40 ? 159  VAL B C   1 
ATOM   3456 O  O   . VAL B 1 165 ? 12.785 191.795 -3.020  1.00   51.58 ? 159  VAL B O   1 
ATOM   3457 C  CB  . VAL B 1 165 ? 15.770 192.920 -2.885  1.00   53.44 ? 159  VAL B CB  1 
ATOM   3458 C  CG1 . VAL B 1 165 ? 16.717 191.769 -2.479  1.00   53.30 ? 159  VAL B CG1 1 
ATOM   3459 C  CG2 . VAL B 1 165 ? 16.570 194.152 -3.286  1.00   53.91 ? 159  VAL B CG2 1 
ATOM   3460 N  N   . LYS B 1 166 ? 14.203 190.176 -3.653  1.00   49.51 ? 160  LYS B N   1 
ATOM   3461 C  CA  . LYS B 1 166 ? 13.384 189.108 -3.100  1.00   48.03 ? 160  LYS B CA  1 
ATOM   3462 C  C   . LYS B 1 166 ? 13.610 189.007 -1.572  1.00   45.56 ? 160  LYS B C   1 
ATOM   3463 O  O   . LYS B 1 166 ? 14.563 189.559 -1.000  1.00   45.51 ? 160  LYS B O   1 
ATOM   3464 C  CB  . LYS B 1 166 ? 13.669 187.776 -3.805  1.00   48.54 ? 160  LYS B CB  1 
ATOM   3465 C  CG  . LYS B 1 166 ? 13.135 187.708 -5.255  1.00   51.36 ? 160  LYS B CG  1 
ATOM   3466 C  CD  . LYS B 1 166 ? 13.893 186.664 -6.111  1.00   54.40 ? 160  LYS B CD  1 
ATOM   3467 C  CE  . LYS B 1 166 ? 13.170 186.372 -7.440  1.00   56.04 ? 160  LYS B CE  1 
ATOM   3468 N  NZ  . LYS B 1 166 ? 12.699 184.960 -7.497  1.00   56.27 ? 160  LYS B NZ  1 
ATOM   3469 N  N   . PHE B 1 167 ? 12.687 188.331 -0.926  1.00   42.53 ? 161  PHE B N   1 
ATOM   3470 C  CA  . PHE B 1 167 ? 12.673 188.209 0.508   1.00   40.37 ? 161  PHE B CA  1 
ATOM   3471 C  C   . PHE B 1 167 ? 11.858 186.955 0.798   1.00   39.57 ? 161  PHE B C   1 
ATOM   3472 O  O   . PHE B 1 167 ? 10.883 186.726 0.100   1.00   38.64 ? 161  PHE B O   1 
ATOM   3473 C  CB  . PHE B 1 167 ? 11.997 189.436 1.111   1.00   39.96 ? 161  PHE B CB  1 
ATOM   3474 C  CG  . PHE B 1 167 ? 11.969 189.433 2.604   1.00   37.28 ? 161  PHE B CG  1 
ATOM   3475 C  CD1 . PHE B 1 167 ? 13.074 189.869 3.326   1.00   33.31 ? 161  PHE B CD1 1 
ATOM   3476 C  CD2 . PHE B 1 167 ? 10.852 188.995 3.283   1.00   35.24 ? 161  PHE B CD2 1 
ATOM   3477 C  CE1 . PHE B 1 167 ? 13.059 189.894 4.691   1.00   33.56 ? 161  PHE B CE1 1 
ATOM   3478 C  CE2 . PHE B 1 167 ? 10.836 188.984 4.670   1.00   35.09 ? 161  PHE B CE2 1 
ATOM   3479 C  CZ  . PHE B 1 167 ? 11.944 189.431 5.380   1.00   34.30 ? 161  PHE B CZ  1 
ATOM   3480 N  N   . PRO B 1 168 ? 12.248 186.137 1.787   1.00   37.86 ? 162  PRO B N   1 
ATOM   3481 C  CA  . PRO B 1 168 ? 11.453 184.958 2.146   1.00   37.51 ? 162  PRO B CA  1 
ATOM   3482 C  C   . PRO B 1 168 ? 10.107 185.345 2.789   1.00   37.49 ? 162  PRO B C   1 
ATOM   3483 O  O   . PRO B 1 168 ? 10.062 185.831 3.906   1.00   36.51 ? 162  PRO B O   1 
ATOM   3484 C  CB  . PRO B 1 168 ? 12.360 184.208 3.135   1.00   37.36 ? 162  PRO B CB  1 
ATOM   3485 C  CG  . PRO B 1 168 ? 13.715 184.821 2.951   1.00   37.41 ? 162  PRO B CG  1 
ATOM   3486 C  CD  . PRO B 1 168 ? 13.462 186.250 2.614   1.00   37.37 ? 162  PRO B CD  1 
ATOM   3487 N  N   . PHE B 1 169 ? 9.018  185.165 2.054   1.00   37.77 ? 163  PHE B N   1 
ATOM   3488 C  CA  . PHE B 1 169 ? 7.692  185.541 2.546   1.00   38.39 ? 163  PHE B CA  1 
ATOM   3489 C  C   . PHE B 1 169 ? 6.594  184.533 2.275   1.00   37.67 ? 163  PHE B C   1 
ATOM   3490 O  O   . PHE B 1 169 ? 5.533  184.645 2.879   1.00   36.88 ? 163  PHE B O   1 
ATOM   3491 C  CB  . PHE B 1 169 ? 7.271  186.906 1.987   1.00   39.27 ? 163  PHE B CB  1 
ATOM   3492 C  CG  . PHE B 1 169 ? 6.756  186.864 0.561   1.00   43.51 ? 163  PHE B CG  1 
ATOM   3493 C  CD1 . PHE B 1 169 ? 7.622  186.618 -0.504  1.00   46.99 ? 163  PHE B CD1 1 
ATOM   3494 C  CD2 . PHE B 1 169 ? 5.411  187.099 0.285   1.00   48.28 ? 163  PHE B CD2 1 
ATOM   3495 C  CE1 . PHE B 1 169 ? 7.161  186.601 -1.820  1.00   49.20 ? 163  PHE B CE1 1 
ATOM   3496 C  CE2 . PHE B 1 169 ? 4.938  187.082 -1.043  1.00   49.52 ? 163  PHE B CE2 1 
ATOM   3497 C  CZ  . PHE B 1 169 ? 5.820  186.827 -2.087  1.00   49.67 ? 163  PHE B CZ  1 
ATOM   3498 N  N   . ASN B 1 170 ? 6.827  183.569 1.383   1.00   37.33 ? 164  ASN B N   1 
ATOM   3499 C  CA  . ASN B 1 170 ? 5.763  182.634 0.999   1.00   37.97 ? 164  ASN B CA  1 
ATOM   3500 C  C   . ASN B 1 170 ? 6.173  181.172 0.874   1.00   37.25 ? 164  ASN B C   1 
ATOM   3501 O  O   . ASN B 1 170 ? 5.419  180.391 0.324   1.00   37.62 ? 164  ASN B O   1 
ATOM   3502 C  CB  . ASN B 1 170 ? 5.034  183.128 -0.278  1.00   38.31 ? 164  ASN B CB  1 
ATOM   3503 C  CG  . ASN B 1 170 ? 5.861  182.962 -1.559  1.00   41.52 ? 164  ASN B CG  1 
ATOM   3504 O  OD1 . ASN B 1 170 ? 7.049  182.636 -1.531  1.00   44.55 ? 164  ASN B OD1 1 
ATOM   3505 N  ND2 . ASN B 1 170 ? 5.223  183.200 -2.693  1.00   46.49 ? 164  ASN B ND2 1 
ATOM   3506 N  N   . GLN B 1 171 ? 7.345  180.797 1.404   1.00   36.43 ? 165  GLN B N   1 
ATOM   3507 C  CA  . GLN B 1 171 ? 7.783  179.401 1.436   1.00   35.57 ? 165  GLN B CA  1 
ATOM   3508 C  C   . GLN B 1 171 ? 8.110  178.988 2.892   1.00   34.50 ? 165  GLN B C   1 
ATOM   3509 O  O   . GLN B 1 171 ? 9.123  179.401 3.457   1.00   34.07 ? 165  GLN B O   1 
ATOM   3510 C  CB  . GLN B 1 171 ? 9.005  179.152 0.553   1.00   35.79 ? 165  GLN B CB  1 
ATOM   3511 C  CG  . GLN B 1 171 ? 8.901  179.615 -0.894  1.00   38.25 ? 165  GLN B CG  1 
ATOM   3512 C  CD  . GLN B 1 171 ? 10.168 179.270 -1.703  1.00   41.21 ? 165  GLN B CD  1 
ATOM   3513 O  OE1 . GLN B 1 171 ? 10.693 178.169 -1.590  1.00   48.42 ? 165  GLN B OE1 1 
ATOM   3514 N  NE2 . GLN B 1 171 ? 10.651 180.204 -2.492  1.00   43.84 ? 165  GLN B NE2 1 
ATOM   3515 N  N   . PRO B 1 172 ? 7.242  178.184 3.497   1.00   32.93 ? 166  PRO B N   1 
ATOM   3516 C  CA  . PRO B 1 172 ? 7.482  177.699 4.862   1.00   32.35 ? 166  PRO B CA  1 
ATOM   3517 C  C   . PRO B 1 172 ? 8.793  176.903 4.956   1.00   30.78 ? 166  PRO B C   1 
ATOM   3518 O  O   . PRO B 1 172 ? 9.208  176.247 4.021   1.00   30.85 ? 166  PRO B O   1 
ATOM   3519 C  CB  . PRO B 1 172 ? 6.254  176.821 5.148   1.00   32.67 ? 166  PRO B CB  1 
ATOM   3520 C  CG  . PRO B 1 172 ? 5.192  177.324 4.161   1.00   34.01 ? 166  PRO B CG  1 
ATOM   3521 C  CD  . PRO B 1 172 ? 5.972  177.683 2.938   1.00   32.87 ? 166  PRO B CD  1 
ATOM   3522 N  N   . MET B 1 173 ? 9.452  177.000 6.088   1.00   29.67 ? 167  MET B N   1 
ATOM   3523 C  CA  . MET B 1 173 ? 10.786 176.470 6.247   1.00   29.38 ? 167  MET B CA  1 
ATOM   3524 C  C   . MET B 1 173 ? 10.798 175.563 7.452   1.00   28.50 ? 167  MET B C   1 
ATOM   3525 O  O   . MET B 1 173 ? 10.122 175.831 8.451   1.00   28.16 ? 167  MET B O   1 
ATOM   3526 C  CB  . MET B 1 173 ? 11.775 177.640 6.466   1.00   29.45 ? 167  MET B CB  1 
ATOM   3527 C  CG  . MET B 1 173 ? 11.833 178.604 5.291   1.00   31.41 ? 167  MET B CG  1 
ATOM   3528 S  SD  . MET B 1 173 ? 13.414 179.501 5.062   1.00   35.82 ? 167  MET B SD  1 
ATOM   3529 C  CE  . MET B 1 173 ? 13.031 180.901 5.775   1.00   37.35 ? 167  MET B CE  1 
ATOM   3530 N  N   . LYS B 1 174 ? 11.608 174.522 7.371   1.00   27.53 ? 168  LYS B N   1 
ATOM   3531 C  CA  . LYS B 1 174 ? 11.969 173.713 8.515   1.00   28.02 ? 168  LYS B CA  1 
ATOM   3532 C  C   . LYS B 1 174 ? 13.273 174.255 9.098   1.00   27.02 ? 168  LYS B C   1 
ATOM   3533 O  O   . LYS B 1 174 ? 14.062 174.923 8.404   1.00   24.73 ? 168  LYS B O   1 
ATOM   3534 C  CB  . LYS B 1 174 ? 12.180 172.245 8.093   1.00   28.58 ? 168  LYS B CB  1 
ATOM   3535 C  CG  . LYS B 1 174 ? 10.927 171.528 7.699   1.00   34.13 ? 168  LYS B CG  1 
ATOM   3536 C  CD  . LYS B 1 174 ? 11.105 170.015 7.716   1.00   38.71 ? 168  LYS B CD  1 
ATOM   3537 C  CE  . LYS B 1 174 ? 9.748  169.323 7.792   1.00   42.95 ? 168  LYS B CE  1 
ATOM   3538 N  NZ  . LYS B 1 174 ? 8.824  169.802 6.717   1.00   47.54 ? 168  LYS B NZ  1 
ATOM   3539 N  N   . ILE B 1 175 ? 13.486 173.949 10.368  1.00   26.27 ? 169  ILE B N   1 
ATOM   3540 C  CA  . ILE B 1 175 ? 14.707 174.266 11.065  1.00   27.22 ? 169  ILE B CA  1 
ATOM   3541 C  C   . ILE B 1 175 ? 15.600 173.049 11.019  1.00   26.55 ? 169  ILE B C   1 
ATOM   3542 O  O   . ILE B 1 175 ? 15.148 171.930 11.246  1.00   27.76 ? 169  ILE B O   1 
ATOM   3543 C  CB  . ILE B 1 175 ? 14.420 174.615 12.514  1.00   28.12 ? 169  ILE B CB  1 
ATOM   3544 C  CG1 . ILE B 1 175 ? 13.546 175.856 12.599  1.00   30.97 ? 169  ILE B CG1 1 
ATOM   3545 C  CG2 . ILE B 1 175 ? 15.728 174.837 13.275  1.00   28.68 ? 169  ILE B CG2 1 
ATOM   3546 C  CD1 . ILE B 1 175 ? 12.116 175.573 12.678  1.00   35.33 ? 169  ILE B CD1 1 
ATOM   3547 N  N   . TYR B 1 176 ? 16.871 173.265 10.752  1.00   25.08 ? 170  TYR B N   1 
ATOM   3548 C  CA  . TYR B 1 176 ? 17.872 172.210 10.689  1.00   25.24 ? 170  TYR B CA  1 
ATOM   3549 C  C   . TYR B 1 176 ? 19.101 172.558 11.487  1.00   25.64 ? 170  TYR B C   1 
ATOM   3550 O  O   . TYR B 1 176 ? 19.450 173.733 11.660  1.00   24.29 ? 170  TYR B O   1 
ATOM   3551 C  CB  . TYR B 1 176 ? 18.340 171.966 9.252   1.00   25.20 ? 170  TYR B CB  1 
ATOM   3552 C  CG  . TYR B 1 176 ? 17.270 171.599 8.277   1.00   25.45 ? 170  TYR B CG  1 
ATOM   3553 C  CD1 . TYR B 1 176 ? 16.548 172.577 7.594   1.00   26.27 ? 170  TYR B CD1 1 
ATOM   3554 C  CD2 . TYR B 1 176 ? 16.976 170.262 8.011   1.00   26.13 ? 170  TYR B CD2 1 
ATOM   3555 C  CE1 . TYR B 1 176 ? 15.565 172.229 6.663   1.00   28.48 ? 170  TYR B CE1 1 
ATOM   3556 C  CE2 . TYR B 1 176 ? 15.993 169.905 7.078   1.00   26.78 ? 170  TYR B CE2 1 
ATOM   3557 C  CZ  . TYR B 1 176 ? 15.286 170.892 6.413   1.00   30.43 ? 170  TYR B CZ  1 
ATOM   3558 O  OH  . TYR B 1 176 ? 14.306 170.554 5.493   1.00   30.21 ? 170  TYR B OH  1 
ATOM   3559 N  N   . SER B 1 177 ? 19.797 171.529 11.953  1.00   25.25 ? 171  SER B N   1 
ATOM   3560 C  CA  . SER B 1 177 ? 21.143 171.708 12.428  1.00   25.92 ? 171  SER B CA  1 
ATOM   3561 C  C   . SER B 1 177 ? 21.949 170.462 12.122  1.00   27.24 ? 171  SER B C   1 
ATOM   3562 O  O   . SER B 1 177 ? 21.410 169.350 12.057  1.00   27.45 ? 171  SER B O   1 
ATOM   3563 C  CB  . SER B 1 177 ? 21.189 172.042 13.922  1.00   26.14 ? 171  SER B CB  1 
ATOM   3564 O  OG  . SER B 1 177 ? 22.487 172.486 14.271  1.00   29.16 ? 171  SER B OG  1 
ATOM   3565 N  N   . SER B 1 178 ? 23.241 170.652 11.919  1.00   26.93 ? 172  SER B N   1 
ATOM   3566 C  CA  . SER B 1 178 ? 24.115 169.567 11.530  1.00   27.36 ? 172  SER B CA  1 
ATOM   3567 C  C   . SER B 1 178 ? 25.572 169.888 11.822  1.00   27.13 ? 172  SER B C   1 
ATOM   3568 O  O   . SER B 1 178 ? 25.949 171.058 12.017  1.00   25.26 ? 172  SER B O   1 
ATOM   3569 C  CB  . SER B 1 178 ? 23.915 169.244 10.042  1.00   27.97 ? 172  SER B CB  1 
ATOM   3570 O  OG  . SER B 1 178 ? 24.233 170.347 9.217   1.00   29.74 ? 172  SER B OG  1 
ATOM   3571 N  N   . LEU B 1 179 ? 26.367 168.830 11.912  1.00   26.19 ? 173  LEU B N   1 
ATOM   3572 C  CA  . LEU B 1 179 ? 27.803 168.888 12.072  1.00   27.08 ? 173  LEU B CA  1 
ATOM   3573 C  C   . LEU B 1 179 ? 28.423 167.957 11.039  1.00   28.71 ? 173  LEU B C   1 
ATOM   3574 O  O   . LEU B 1 179 ? 28.081 166.751 11.017  1.00   27.03 ? 173  LEU B O   1 
ATOM   3575 C  CB  . LEU B 1 179 ? 28.191 168.433 13.469  1.00   26.63 ? 173  LEU B CB  1 
ATOM   3576 C  CG  . LEU B 1 179 ? 29.671 168.356 13.782  1.00   28.52 ? 173  LEU B CG  1 
ATOM   3577 C  CD1 . LEU B 1 179 ? 30.351 169.690 13.727  1.00   29.41 ? 173  LEU B CD1 1 
ATOM   3578 C  CD2 . LEU B 1 179 ? 29.877 167.753 15.168  1.00   31.51 ? 173  LEU B CD2 1 
ATOM   3579 N  N   . TRP B 1 180 ? 29.270 168.526 10.206  1.00   29.85 ? 174  TRP B N   1 
ATOM   3580 C  CA  . TRP B 1 180 ? 29.828 167.843 9.063   1.00   32.38 ? 174  TRP B CA  1 
ATOM   3581 C  C   . TRP B 1 180 ? 31.262 168.338 8.797   1.00   33.40 ? 174  TRP B C   1 
ATOM   3582 O  O   . TRP B 1 180 ? 31.693 169.394 9.302   1.00   32.74 ? 174  TRP B O   1 
ATOM   3583 C  CB  . TRP B 1 180 ? 28.850 167.964 7.840   1.00   32.88 ? 174  TRP B CB  1 
ATOM   3584 C  CG  A TRP B 1 180 ? 28.367 166.546 7.540   0.50   34.98 ? 174  TRP B CG  1 
ATOM   3585 C  CG  B TRP B 1 180 ? 28.305 169.424 7.706   0.50   35.56 ? 174  TRP B CG  1 
ATOM   3586 C  CD1 A TRP B 1 180 ? 29.089 165.511 7.044   0.50   36.80 ? 174  TRP B CD1 1 
ATOM   3587 C  CD1 B TRP B 1 180 ? 27.412 170.055 8.573   0.50   36.32 ? 174  TRP B CD1 1 
ATOM   3588 C  CD2 A TRP B 1 180 ? 27.047 166.026 7.769   0.50   36.75 ? 174  TRP B CD2 1 
ATOM   3589 C  CD2 B TRP B 1 180 ? 28.528 170.363 6.640   0.50   37.88 ? 174  TRP B CD2 1 
ATOM   3590 N  NE1 A TRP B 1 180 ? 28.307 164.384 6.950   0.50   37.48 ? 174  TRP B NE1 1 
ATOM   3591 N  NE1 B TRP B 1 180 ? 27.119 171.314 8.125   0.50   36.80 ? 174  TRP B NE1 1 
ATOM   3592 C  CE2 A TRP B 1 180 ? 27.050 164.682 7.392   0.50   35.73 ? 174  TRP B CE2 1 
ATOM   3593 C  CE2 B TRP B 1 180 ? 27.775 171.528 6.937   0.50   38.89 ? 174  TRP B CE2 1 
ATOM   3594 C  CE3 A TRP B 1 180 ? 25.849 166.574 8.252   0.50   36.40 ? 174  TRP B CE3 1 
ATOM   3595 C  CE3 B TRP B 1 180 ? 29.301 170.348 5.471   0.50   39.74 ? 174  TRP B CE3 1 
ATOM   3596 C  CZ2 A TRP B 1 180 ? 25.913 163.890 7.479   0.50   36.82 ? 174  TRP B CZ2 1 
ATOM   3597 C  CZ2 B TRP B 1 180 ? 27.784 172.658 6.114   0.50   39.96 ? 174  TRP B CZ2 1 
ATOM   3598 C  CZ3 A TRP B 1 180 ? 24.725 165.767 8.332   0.50   31.87 ? 174  TRP B CZ3 1 
ATOM   3599 C  CZ3 B TRP B 1 180 ? 29.300 171.461 4.655   0.50   41.12 ? 174  TRP B CZ3 1 
ATOM   3600 C  CH2 A TRP B 1 180 ? 24.759 164.479 7.955   0.50   33.23 ? 174  TRP B CH2 1 
ATOM   3601 C  CH2 B TRP B 1 180 ? 28.549 172.607 4.984   0.50   41.41 ? 174  TRP B CH2 1 
ATOM   3602 N  N   . ASN B 1 181 ? 32.018 167.588 8.028   1.00   34.99 ? 175  ASN B N   1 
ATOM   3603 C  CA  . ASN B 1 181 ? 33.339 167.941 7.593   1.00   36.66 ? 175  ASN B CA  1 
ATOM   3604 C  C   . ASN B 1 181 ? 33.216 168.756 6.291   1.00   37.15 ? 175  ASN B C   1 
ATOM   3605 O  O   . ASN B 1 181 ? 32.424 168.439 5.412   1.00   37.54 ? 175  ASN B O   1 
ATOM   3606 C  CB  . ASN B 1 181 ? 34.187 166.691 7.306   1.00   37.72 ? 175  ASN B CB  1 
ATOM   3607 C  CG  . ASN B 1 181 ? 35.531 167.019 6.682   1.00   39.36 ? 175  ASN B CG  1 
ATOM   3608 O  OD1 . ASN B 1 181 ? 35.728 166.885 5.469   1.00   44.45 ? 175  ASN B OD1 1 
ATOM   3609 N  ND2 . ASN B 1 181 ? 36.474 167.465 7.499   1.00   44.92 ? 175  ASN B ND2 1 
ATOM   3610 N  N   . ALA B 1 182 ? 34.046 169.788 6.230   1.00   38.32 ? 176  ALA B N   1 
ATOM   3611 C  CA  . ALA B 1 182 ? 34.161 170.673 5.065   1.00   39.57 ? 176  ALA B CA  1 
ATOM   3612 C  C   . ALA B 1 182 ? 35.613 171.081 4.937   1.00   41.01 ? 176  ALA B C   1 
ATOM   3613 O  O   . ALA B 1 182 ? 35.983 172.232 5.086   1.00   40.23 ? 176  ALA B O   1 
ATOM   3614 C  CB  . ALA B 1 182 ? 33.273 171.896 5.190   1.00   40.33 ? 176  ALA B CB  1 
ATOM   3615 N  N   . ASP B 1 183 ? 36.426 170.100 4.670   1.00   42.38 ? 177  ASP B N   1 
ATOM   3616 C  CA  . ASP B 1 183 ? 37.879 170.209 4.563   1.00   43.94 ? 177  ASP B CA  1 
ATOM   3617 C  C   . ASP B 1 183 ? 38.313 171.094 3.419   1.00   43.31 ? 177  ASP B C   1 
ATOM   3618 O  O   . ASP B 1 183 ? 39.360 171.738 3.503   1.00   43.57 ? 177  ASP B O   1 
ATOM   3619 C  CB  . ASP B 1 183 ? 38.451 168.802 4.321   1.00   44.33 ? 177  ASP B CB  1 
ATOM   3620 C  CG  . ASP B 1 183 ? 39.257 168.266 5.479   1.00   47.38 ? 177  ASP B CG  1 
ATOM   3621 O  OD1 . ASP B 1 183 ? 39.161 168.827 6.587   1.00   53.62 ? 177  ASP B OD1 1 
ATOM   3622 O  OD2 . ASP B 1 183 ? 39.997 167.291 5.271   1.00   54.35 ? 177  ASP B OD2 1 
ATOM   3623 N  N   . ASP B 1 184 ? 37.545 171.155 2.333   1.00   43.80 ? 178  ASP B N   1 
ATOM   3624 C  CA  . ASP B 1 184 ? 37.919 171.926 1.140   1.00   44.61 ? 178  ASP B CA  1 
ATOM   3625 C  C   . ASP B 1 184 ? 37.815 173.447 1.280   1.00   44.22 ? 178  ASP B C   1 
ATOM   3626 O  O   . ASP B 1 184 ? 38.390 174.158 0.463   1.00   44.62 ? 178  ASP B O   1 
ATOM   3627 C  CB  . ASP B 1 184 ? 37.060 171.522 -0.061  1.00   45.78 ? 178  ASP B CB  1 
ATOM   3628 C  CG  . ASP B 1 184 ? 37.129 170.048 -0.360  1.00   48.13 ? 178  ASP B CG  1 
ATOM   3629 O  OD1 . ASP B 1 184 ? 38.074 169.381 0.083   1.00   52.37 ? 178  ASP B OD1 1 
ATOM   3630 O  OD2 . ASP B 1 184 ? 36.214 169.547 -1.049  1.00   52.52 ? 178  ASP B OD2 1 
ATOM   3631 N  N   . TRP B 1 185 ? 37.110 173.958 2.282   1.00   42.85 ? 179  TRP B N   1 
ATOM   3632 C  CA  . TRP B 1 185 ? 36.935 175.397 2.375   1.00   41.50 ? 179  TRP B CA  1 
ATOM   3633 C  C   . TRP B 1 185 ? 36.783 175.984 3.787   1.00   40.55 ? 179  TRP B C   1 
ATOM   3634 O  O   . TRP B 1 185 ? 36.851 177.216 3.941   1.00   40.62 ? 179  TRP B O   1 
ATOM   3635 C  CB  . TRP B 1 185 ? 35.665 175.771 1.565   1.00   41.58 ? 179  TRP B CB  1 
ATOM   3636 C  CG  . TRP B 1 185 ? 34.350 175.217 2.048   1.00   41.79 ? 179  TRP B CG  1 
ATOM   3637 C  CD1 . TRP B 1 185 ? 33.735 174.050 1.665   1.00   41.41 ? 179  TRP B CD1 1 
ATOM   3638 C  CD2 . TRP B 1 185 ? 33.453 175.844 2.992   1.00   39.94 ? 179  TRP B CD2 1 
ATOM   3639 N  NE1 . TRP B 1 185 ? 32.528 173.916 2.317   1.00   42.02 ? 179  TRP B NE1 1 
ATOM   3640 C  CE2 . TRP B 1 185 ? 32.328 174.998 3.134   1.00   40.36 ? 179  TRP B CE2 1 
ATOM   3641 C  CE3 . TRP B 1 185 ? 33.477 177.044 3.748   1.00   39.80 ? 179  TRP B CE3 1 
ATOM   3642 C  CZ2 . TRP B 1 185 ? 31.262 175.292 4.004   1.00   39.11 ? 179  TRP B CZ2 1 
ATOM   3643 C  CZ3 . TRP B 1 185 ? 32.405 177.336 4.588   1.00   39.11 ? 179  TRP B CZ3 1 
ATOM   3644 C  CH2 . TRP B 1 185 ? 31.321 176.456 4.717   1.00   37.66 ? 179  TRP B CH2 1 
ATOM   3645 N  N   . ALA B 1 186 ? 36.566 175.170 4.813   1.00   39.44 ? 180  ALA B N   1 
ATOM   3646 C  CA  . ALA B 1 186 ? 36.118 175.704 6.103   1.00   38.71 ? 180  ALA B CA  1 
ATOM   3647 C  C   . ALA B 1 186 ? 37.162 176.528 6.837   1.00   38.84 ? 180  ALA B C   1 
ATOM   3648 O  O   . ALA B 1 186 ? 36.851 177.592 7.349   1.00   38.30 ? 180  ALA B O   1 
ATOM   3649 C  CB  . ALA B 1 186 ? 35.634 174.589 7.014   1.00   38.73 ? 180  ALA B CB  1 
ATOM   3650 N  N   . THR B 1 187 ? 38.385 176.009 6.929   1.00   38.83 ? 181  THR B N   1 
ATOM   3651 C  CA  . THR B 1 187 ? 39.399 176.573 7.806   1.00   39.23 ? 181  THR B CA  1 
ATOM   3652 C  C   . THR B 1 187 ? 40.575 177.076 6.969   1.00   40.71 ? 181  THR B C   1 
ATOM   3653 O  O   . THR B 1 187 ? 41.167 176.316 6.183   1.00   40.16 ? 181  THR B O   1 
ATOM   3654 C  CB  . THR B 1 187 ? 39.824 175.525 8.833   1.00   39.70 ? 181  THR B CB  1 
ATOM   3655 O  OG1 . THR B 1 187 ? 38.685 175.165 9.645   1.00   37.77 ? 181  THR B OG1 1 
ATOM   3656 C  CG2 . THR B 1 187 ? 40.852 176.089 9.842   1.00   38.66 ? 181  THR B CG2 1 
ATOM   3657 N  N   . ARG B 1 188 ? 40.868 178.372 7.126   1.00   41.61 ? 182  ARG B N   1 
ATOM   3658 C  CA  . ARG B 1 188 ? 41.857 179.102 6.339   1.00   43.00 ? 182  ARG B CA  1 
ATOM   3659 C  C   . ARG B 1 188 ? 41.686 178.853 4.839   1.00   43.82 ? 182  ARG B C   1 
ATOM   3660 O  O   . ARG B 1 188 ? 42.655 178.588 4.133   1.00   43.49 ? 182  ARG B O   1 
ATOM   3661 C  CB  . ARG B 1 188 ? 43.288 178.771 6.804   1.00   43.39 ? 182  ARG B CB  1 
ATOM   3662 C  CG  . ARG B 1 188 ? 43.605 179.212 8.248   1.00   45.28 ? 182  ARG B CG  1 
ATOM   3663 C  CD  . ARG B 1 188 ? 45.096 179.139 8.644   1.00   47.72 ? 182  ARG B CD  1 
ATOM   3664 N  NE  . ARG B 1 188 ? 45.945 179.777 7.631   1.00   49.87 ? 182  ARG B NE  1 
ATOM   3665 C  CZ  . ARG B 1 188 ? 46.996 179.208 7.025   1.00   52.13 ? 182  ARG B CZ  1 
ATOM   3666 N  NH1 . ARG B 1 188 ? 47.372 177.971 7.310   1.00   52.51 ? 182  ARG B NH1 1 
ATOM   3667 N  NH2 . ARG B 1 188 ? 47.681 179.897 6.120   1.00   52.90 ? 182  ARG B NH2 1 
ATOM   3668 N  N   . GLY B 1 189 ? 40.439 178.931 4.371   1.00   44.37 ? 183  GLY B N   1 
ATOM   3669 C  CA  . GLY B 1 189 ? 40.116 178.732 2.973   1.00   45.00 ? 183  GLY B CA  1 
ATOM   3670 C  C   . GLY B 1 189 ? 40.328 177.324 2.432   1.00   45.58 ? 183  GLY B C   1 
ATOM   3671 O  O   . GLY B 1 189 ? 40.401 177.138 1.217   1.00   45.90 ? 183  GLY B O   1 
ATOM   3672 N  N   . GLY B 1 190 ? 40.407 176.330 3.311   1.00   45.92 ? 184  GLY B N   1 
ATOM   3673 C  CA  . GLY B 1 190 ? 40.649 174.963 2.886   1.00   46.31 ? 184  GLY B CA  1 
ATOM   3674 C  C   . GLY B 1 190 ? 42.058 174.456 3.131   1.00   46.85 ? 184  GLY B C   1 
ATOM   3675 O  O   . GLY B 1 190 ? 42.330 173.273 2.921   1.00   46.92 ? 184  GLY B O   1 
ATOM   3676 N  N   . LEU B 1 191 ? 42.947 175.339 3.581   1.00   47.14 ? 185  LEU B N   1 
ATOM   3677 C  CA  . LEU B 1 191 ? 44.342 174.990 3.824   1.00   47.65 ? 185  LEU B CA  1 
ATOM   3678 C  C   . LEU B 1 191 ? 44.533 174.123 5.060   1.00   47.27 ? 185  LEU B C   1 
ATOM   3679 O  O   . LEU B 1 191 ? 45.470 173.339 5.085   1.00   47.97 ? 185  LEU B O   1 
ATOM   3680 C  CB  . LEU B 1 191 ? 45.231 176.257 3.930   1.00   47.97 ? 185  LEU B CB  1 
ATOM   3681 C  CG  . LEU B 1 191 ? 45.420 177.040 2.626   1.00   49.68 ? 185  LEU B CG  1 
ATOM   3682 C  CD1 . LEU B 1 191 ? 46.105 178.385 2.877   1.00   52.58 ? 185  LEU B CD1 1 
ATOM   3683 C  CD2 . LEU B 1 191 ? 46.227 176.237 1.609   1.00   52.08 ? 185  LEU B CD2 1 
ATOM   3684 N  N   . GLU B 1 192 ? 43.684 174.259 6.086   1.00   46.26 ? 186  GLU B N   1 
ATOM   3685 C  CA  . GLU B 1 192 ? 43.778 173.410 7.274   1.00   45.71 ? 186  GLU B CA  1 
ATOM   3686 C  C   . GLU B 1 192 ? 42.787 172.238 7.196   1.00   45.51 ? 186  GLU B C   1 
ATOM   3687 O  O   . GLU B 1 192 ? 41.561 172.419 7.230   1.00   45.13 ? 186  GLU B O   1 
ATOM   3688 C  CB  . GLU B 1 192 ? 43.533 174.207 8.555   1.00   45.79 ? 186  GLU B CB  1 
ATOM   3689 C  CG  . GLU B 1 192 ? 44.523 175.346 8.828   1.00   47.48 ? 186  GLU B CG  1 
ATOM   3690 C  CD  . GLU B 1 192 ? 45.961 174.882 9.105   1.00   49.58 ? 186  GLU B CD  1 
ATOM   3691 O  OE1 . GLU B 1 192 ? 46.166 173.782 9.656   1.00   49.24 ? 186  GLU B OE1 1 
ATOM   3692 O  OE2 . GLU B 1 192 ? 46.906 175.635 8.781   1.00   51.79 ? 186  GLU B OE2 1 
ATOM   3693 N  N   . LYS B 1 193 ? 43.332 171.034 7.113   1.00   44.96 ? 187  LYS B N   1 
ATOM   3694 C  CA  . LYS B 1 193 ? 42.547 169.827 6.909   1.00   44.54 ? 187  LYS B CA  1 
ATOM   3695 C  C   . LYS B 1 193 ? 42.218 169.239 8.250   1.00   43.71 ? 187  LYS B C   1 
ATOM   3696 O  O   . LYS B 1 193 ? 42.949 169.421 9.191   1.00   43.31 ? 187  LYS B O   1 
ATOM   3697 C  CB  . LYS B 1 193 ? 43.326 168.797 6.063   1.00   44.66 ? 187  LYS B CB  1 
ATOM   3698 C  CG  . LYS B 1 193 ? 43.773 169.309 4.708   1.00   44.69 ? 187  LYS B CG  1 
ATOM   3699 C  CD  . LYS B 1 193 ? 42.583 169.689 3.856   1.00   45.43 ? 187  LYS B CD  1 
ATOM   3700 C  CE  . LYS B 1 193 ? 42.960 170.010 2.426   1.00   44.24 ? 187  LYS B CE  1 
ATOM   3701 N  NZ  . LYS B 1 193 ? 41.931 170.885 1.800   1.00   43.92 ? 187  LYS B NZ  1 
ATOM   3702 N  N   . THR B 1 194 ? 41.114 168.508 8.326   1.00   43.56 ? 188  THR B N   1 
ATOM   3703 C  CA  . THR B 1 194 ? 40.694 167.901 9.567   1.00   43.87 ? 188  THR B CA  1 
ATOM   3704 C  C   . THR B 1 194 ? 41.710 166.862 10.022  1.00   44.69 ? 188  THR B C   1 
ATOM   3705 O  O   . THR B 1 194 ? 42.146 166.029 9.236   1.00   44.92 ? 188  THR B O   1 
ATOM   3706 C  CB  . THR B 1 194 ? 39.324 167.227 9.395   1.00   43.81 ? 188  THR B CB  1 
ATOM   3707 O  OG1 . THR B 1 194 ? 38.347 168.201 9.002   1.00   44.41 ? 188  THR B OG1 1 
ATOM   3708 C  CG2 . THR B 1 194 ? 38.822 166.686 10.713  1.00   42.94 ? 188  THR B CG2 1 
ATOM   3709 N  N   . ASP B 1 195 ? 42.078 166.928 11.295  1.00   45.55 ? 189  ASP B N   1 
ATOM   3710 C  CA  . ASP B 1 195 ? 42.917 165.923 11.923  1.00   46.28 ? 189  ASP B CA  1 
ATOM   3711 C  C   . ASP B 1 195 ? 42.016 164.841 12.529  1.00   45.99 ? 189  ASP B C   1 
ATOM   3712 O  O   . ASP B 1 195 ? 41.506 164.989 13.622  1.00   45.46 ? 189  ASP B O   1 
ATOM   3713 C  CB  . ASP B 1 195 ? 43.788 166.577 12.995  1.00   46.83 ? 189  ASP B CB  1 
ATOM   3714 C  CG  . ASP B 1 195 ? 44.787 165.617 13.602  1.00   48.71 ? 189  ASP B CG  1 
ATOM   3715 O  OD1 . ASP B 1 195 ? 44.645 164.380 13.592  1.00   51.40 ? 189  ASP B OD1 1 
ATOM   3716 O  OD2 . ASP B 1 195 ? 45.802 166.090 14.143  1.00   52.83 ? 189  ASP B OD2 1 
ATOM   3717 N  N   . TRP B 1 196 ? 41.829 163.746 11.806  1.00   46.36 ? 190  TRP B N   1 
ATOM   3718 C  CA  . TRP B 1 196 ? 40.832 162.741 12.198  1.00   46.52 ? 190  TRP B CA  1 
ATOM   3719 C  C   . TRP B 1 196 ? 41.191 161.951 13.456  1.00   47.46 ? 190  TRP B C   1 
ATOM   3720 O  O   . TRP B 1 196 ? 40.329 161.294 14.021  1.00   47.55 ? 190  TRP B O   1 
ATOM   3721 C  CB  . TRP B 1 196 ? 40.520 161.816 11.023  1.00   46.39 ? 190  TRP B CB  1 
ATOM   3722 C  CG  . TRP B 1 196 ? 39.710 162.509 9.986   1.00   44.31 ? 190  TRP B CG  1 
ATOM   3723 C  CD1 . TRP B 1 196 ? 40.081 162.814 8.709   1.00   43.14 ? 190  TRP B CD1 1 
ATOM   3724 C  CD2 . TRP B 1 196 ? 38.375 163.006 10.148  1.00   41.09 ? 190  TRP B CD2 1 
ATOM   3725 N  NE1 . TRP B 1 196 ? 39.050 163.459 8.067   1.00   42.53 ? 190  TRP B NE1 1 
ATOM   3726 C  CE2 . TRP B 1 196 ? 37.997 163.596 8.936   1.00   40.09 ? 190  TRP B CE2 1 
ATOM   3727 C  CE3 . TRP B 1 196 ? 37.460 163.009 11.209  1.00   40.55 ? 190  TRP B CE3 1 
ATOM   3728 C  CZ2 . TRP B 1 196 ? 36.746 164.179 8.746   1.00   39.92 ? 190  TRP B CZ2 1 
ATOM   3729 C  CZ3 . TRP B 1 196 ? 36.217 163.593 11.022  1.00   39.48 ? 190  TRP B CZ3 1 
ATOM   3730 C  CH2 . TRP B 1 196 ? 35.877 164.173 9.809   1.00   39.22 ? 190  TRP B CH2 1 
ATOM   3731 N  N   . SER B 1 197 ? 42.433 162.062 13.933  1.00   48.76 ? 191  SER B N   1 
ATOM   3732 C  CA  . SER B 1 197 ? 42.815 161.482 15.236  1.00   49.87 ? 191  SER B CA  1 
ATOM   3733 C  C   . SER B 1 197 ? 42.253 162.243 16.440  1.00   50.14 ? 191  SER B C   1 
ATOM   3734 O  O   . SER B 1 197 ? 42.219 161.722 17.565  1.00   50.55 ? 191  SER B O   1 
ATOM   3735 C  CB  . SER B 1 197 ? 44.343 161.338 15.357  1.00   50.13 ? 191  SER B CB  1 
ATOM   3736 O  OG  . SER B 1 197 ? 45.021 162.492 14.894  1.00   52.50 ? 191  SER B OG  1 
ATOM   3737 N  N   . LYS B 1 198 ? 41.802 163.475 16.216  1.00   50.23 ? 192  LYS B N   1 
ATOM   3738 C  CA  . LYS B 1 198 ? 41.191 164.258 17.285  1.00   50.11 ? 192  LYS B CA  1 
ATOM   3739 C  C   . LYS B 1 198 ? 39.657 164.130 17.313  1.00   48.51 ? 192  LYS B C   1 
ATOM   3740 O  O   . LYS B 1 198 ? 39.004 164.879 18.010  1.00   48.25 ? 192  LYS B O   1 
ATOM   3741 C  CB  . LYS B 1 198 ? 41.608 165.735 17.185  1.00   51.12 ? 192  LYS B CB  1 
ATOM   3742 C  CG  . LYS B 1 198 ? 43.111 166.009 17.000  1.00   53.29 ? 192  LYS B CG  1 
ATOM   3743 C  CD  . LYS B 1 198 ? 43.936 165.919 18.300  1.00   56.77 ? 192  LYS B CD  1 
ATOM   3744 C  CE  . LYS B 1 198 ? 45.301 165.213 18.065  1.00   59.38 ? 192  LYS B CE  1 
ATOM   3745 N  NZ  . LYS B 1 198 ? 45.901 164.574 19.301  1.00   61.87 ? 192  LYS B NZ  1 
ATOM   3746 N  N   . ALA B 1 199 ? 39.095 163.173 16.571  1.00   47.10 ? 193  ALA B N   1 
ATOM   3747 C  CA  . ALA B 1 199 ? 37.663 162.863 16.633  1.00   45.81 ? 193  ALA B CA  1 
ATOM   3748 C  C   . ALA B 1 199 ? 37.403 162.067 17.905  1.00   44.40 ? 193  ALA B C   1 
ATOM   3749 O  O   . ALA B 1 199 ? 38.331 161.520 18.456  1.00   44.65 ? 193  ALA B O   1 
ATOM   3750 C  CB  . ALA B 1 199 ? 37.236 162.085 15.406  1.00   46.07 ? 193  ALA B CB  1 
ATOM   3751 N  N   . PRO B 1 200 ? 36.174 162.021 18.422  1.00   42.71 ? 194  PRO B N   1 
ATOM   3752 C  CA  . PRO B 1 200 ? 34.981 162.639 17.826  1.00   41.44 ? 194  PRO B CA  1 
ATOM   3753 C  C   . PRO B 1 200 ? 34.864 164.147 18.119  1.00   39.84 ? 194  PRO B C   1 
ATOM   3754 O  O   . PRO B 1 200 ? 35.216 164.612 19.222  1.00   39.15 ? 194  PRO B O   1 
ATOM   3755 C  CB  . PRO B 1 200 ? 33.843 161.905 18.528  1.00   41.27 ? 194  PRO B CB  1 
ATOM   3756 C  CG  . PRO B 1 200 ? 34.396 161.567 19.879  1.00   42.19 ? 194  PRO B CG  1 
ATOM   3757 C  CD  . PRO B 1 200 ? 35.862 161.360 19.701  1.00   42.39 ? 194  PRO B CD  1 
ATOM   3758 N  N   . PHE B 1 201 ? 34.380 164.884 17.121  1.00   37.68 ? 195  PHE B N   1 
ATOM   3759 C  CA  . PHE B 1 201 ? 34.163 166.324 17.232  1.00   35.52 ? 195  PHE B CA  1 
ATOM   3760 C  C   . PHE B 1 201 ? 32.756 166.504 17.718  1.00   33.87 ? 195  PHE B C   1 
ATOM   3761 O  O   . PHE B 1 201 ? 31.816 166.010 17.101  1.00   33.61 ? 195  PHE B O   1 
ATOM   3762 C  CB  . PHE B 1 201 ? 34.378 167.001 15.895  1.00   35.36 ? 195  PHE B CB  1 
ATOM   3763 C  CG  . PHE B 1 201 ? 35.748 166.804 15.341  1.00   35.42 ? 195  PHE B CG  1 
ATOM   3764 C  CD1 . PHE B 1 201 ? 36.808 167.591 15.771  1.00   36.95 ? 195  PHE B CD1 1 
ATOM   3765 C  CD2 . PHE B 1 201 ? 35.992 165.818 14.401  1.00   37.54 ? 195  PHE B CD2 1 
ATOM   3766 C  CE1 . PHE B 1 201 ? 38.086 167.398 15.272  1.00   36.99 ? 195  PHE B CE1 1 
ATOM   3767 C  CE2 . PHE B 1 201 ? 37.265 165.621 13.889  1.00   37.44 ? 195  PHE B CE2 1 
ATOM   3768 C  CZ  . PHE B 1 201 ? 38.323 166.416 14.329  1.00   37.32 ? 195  PHE B CZ  1 
ATOM   3769 N  N   . ILE B 1 202 ? 32.598 167.195 18.834  1.00   32.10 ? 196  ILE B N   1 
ATOM   3770 C  CA  . ILE B 1 202 ? 31.324 167.227 19.527  1.00   31.48 ? 196  ILE B CA  1 
ATOM   3771 C  C   . ILE B 1 202 ? 30.764 168.658 19.676  1.00   31.14 ? 196  ILE B C   1 
ATOM   3772 O  O   . ILE B 1 202 ? 31.390 169.508 20.308  1.00   30.93 ? 196  ILE B O   1 
ATOM   3773 C  CB  . ILE B 1 202 ? 31.488 166.597 20.893  1.00   31.75 ? 196  ILE B CB  1 
ATOM   3774 C  CG1 . ILE B 1 202 ? 31.894 165.114 20.789  1.00   33.81 ? 196  ILE B CG1 1 
ATOM   3775 C  CG2 . ILE B 1 202 ? 30.226 166.732 21.694  1.00   31.62 ? 196  ILE B CG2 1 
ATOM   3776 C  CD1 . ILE B 1 202 ? 32.260 164.523 22.182  1.00   36.92 ? 196  ILE B CD1 1 
ATOM   3777 N  N   . ALA B 1 203 ? 29.571 168.891 19.127  1.00   30.52 ? 197  ALA B N   1 
ATOM   3778 C  CA  . ALA B 1 203 ? 28.836 170.150 19.285  1.00   30.50 ? 197  ALA B CA  1 
ATOM   3779 C  C   . ALA B 1 203 ? 27.659 169.907 20.199  1.00   30.43 ? 197  ALA B C   1 
ATOM   3780 O  O   . ALA B 1 203 ? 26.965 168.875 20.067  1.00   30.50 ? 197  ALA B O   1 
ATOM   3781 C  CB  . ALA B 1 203 ? 28.338 170.651 17.889  1.00   30.78 ? 197  ALA B CB  1 
ATOM   3782 N  N   . SER B 1 204 ? 27.399 170.846 21.108  1.00   28.85 ? 198  SER B N   1 
ATOM   3783 C  CA  . SER B 1 204 ? 26.319 170.711 22.069  1.00   28.95 ? 198  SER B CA  1 
ATOM   3784 C  C   . SER B 1 204 ? 25.236 171.739 21.941  1.00   29.39 ? 198  SER B C   1 
ATOM   3785 O  O   . SER B 1 204 ? 25.495 172.889 21.564  1.00   28.67 ? 198  SER B O   1 
ATOM   3786 C  CB  . SER B 1 204 ? 26.870 170.752 23.501  1.00   29.11 ? 198  SER B CB  1 
ATOM   3787 O  OG  . SER B 1 204 ? 27.970 169.908 23.572  1.00   27.81 ? 198  SER B OG  1 
ATOM   3788 N  N   . TYR B 1 205 ? 24.033 171.315 22.285  1.00   29.38 ? 199  TYR B N   1 
ATOM   3789 C  CA  . TYR B 1 205 ? 22.808 172.068 22.081  1.00   30.95 ? 199  TYR B CA  1 
ATOM   3790 C  C   . TYR B 1 205 ? 21.890 172.002 23.286  1.00   33.06 ? 199  TYR B C   1 
ATOM   3791 O  O   . TYR B 1 205 ? 21.830 170.971 23.968  1.00   33.60 ? 199  TYR B O   1 
ATOM   3792 C  CB  . TYR B 1 205 ? 21.994 171.487 20.921  1.00   30.61 ? 199  TYR B CB  1 
ATOM   3793 C  CG  . TYR B 1 205 ? 22.645 171.554 19.572  1.00   29.62 ? 199  TYR B CG  1 
ATOM   3794 C  CD1 . TYR B 1 205 ? 23.688 170.717 19.252  1.00   28.77 ? 199  TYR B CD1 1 
ATOM   3795 C  CD2 . TYR B 1 205 ? 22.187 172.445 18.607  1.00   28.26 ? 199  TYR B CD2 1 
ATOM   3796 C  CE1 . TYR B 1 205 ? 24.284 170.762 18.021  1.00   30.29 ? 199  TYR B CE1 1 
ATOM   3797 C  CE2 . TYR B 1 205 ? 22.772 172.499 17.360  1.00   30.33 ? 199  TYR B CE2 1 
ATOM   3798 C  CZ  . TYR B 1 205 ? 23.825 171.655 17.073  1.00   30.49 ? 199  TYR B CZ  1 
ATOM   3799 O  OH  . TYR B 1 205 ? 24.414 171.696 15.841  1.00   32.90 ? 199  TYR B OH  1 
ATOM   3800 N  N   . ARG B 1 206 ? 21.137 173.088 23.485  1.00   34.99 ? 200  ARG B N   1 
ATOM   3801 C  CA  . ARG B 1 206 ? 20.040 173.212 24.445  1.00   36.71 ? 200  ARG B CA  1 
ATOM   3802 C  C   . ARG B 1 206 ? 18.950 174.150 23.891  1.00   37.59 ? 200  ARG B C   1 
ATOM   3803 O  O   . ARG B 1 206 ? 19.113 174.818 22.850  1.00   35.94 ? 200  ARG B O   1 
ATOM   3804 C  CB  . ARG B 1 206 ? 20.525 173.871 25.728  1.00   37.52 ? 200  ARG B CB  1 
ATOM   3805 C  CG  . ARG B 1 206 ? 21.264 173.057 26.697  1.00   39.71 ? 200  ARG B CG  1 
ATOM   3806 C  CD  . ARG B 1 206 ? 21.664 173.890 27.944  1.00   43.13 ? 200  ARG B CD  1 
ATOM   3807 N  NE  . ARG B 1 206 ? 22.718 173.247 28.720  1.00   47.13 ? 200  ARG B NE  1 
ATOM   3808 C  CZ  . ARG B 1 206 ? 23.520 173.869 29.593  1.00   51.09 ? 200  ARG B CZ  1 
ATOM   3809 N  NH1 . ARG B 1 206 ? 23.388 175.173 29.846  1.00   52.70 ? 200  ARG B NH1 1 
ATOM   3810 N  NH2 . ARG B 1 206 ? 24.471 173.178 30.214  1.00   50.61 ? 200  ARG B NH2 1 
ATOM   3811 N  N   . SER B 1 207 ? 17.833 174.163 24.609  1.00   38.98 ? 201  SER B N   1 
ATOM   3812 C  CA  . SER B 1 207 ? 16.754 175.146 24.477  1.00   40.95 ? 201  SER B CA  1 
ATOM   3813 C  C   . SER B 1 207 ? 15.775 174.818 23.359  1.00   42.04 ? 201  SER B C   1 
ATOM   3814 O  O   . SER B 1 207 ? 14.561 174.761 23.589  1.00   43.54 ? 201  SER B O   1 
ATOM   3815 C  CB  . SER B 1 207 ? 17.298 176.584 24.357  1.00   41.32 ? 201  SER B CB  1 
ATOM   3816 O  OG  . SER B 1 207 ? 16.245 177.516 24.504  1.00   44.13 ? 201  SER B OG  1 
ATOM   3817 N  N   . PHE B 1 208 ? 16.249 174.626 22.138  1.00   42.77 ? 202  PHE B N   1 
ATOM   3818 C  CA  . PHE B 1 208 ? 15.382 174.019 21.132  1.00   42.91 ? 202  PHE B CA  1 
ATOM   3819 C  C   . PHE B 1 208 ? 14.079 174.778 21.047  1.00   43.53 ? 202  PHE B C   1 
ATOM   3820 O  O   . PHE B 1 208 ? 12.969 174.167 20.972  1.00   44.63 ? 202  PHE B O   1 
ATOM   3821 C  CB  . PHE B 1 208 ? 15.089 172.566 21.496  1.00   42.83 ? 202  PHE B CB  1 
ATOM   3822 C  CG  . PHE B 1 208 ? 16.310 171.780 21.747  1.00   40.92 ? 202  PHE B CG  1 
ATOM   3823 C  CD1 . PHE B 1 208 ? 17.264 171.665 20.763  1.00   38.80 ? 202  PHE B CD1 1 
ATOM   3824 C  CD2 . PHE B 1 208 ? 16.522 171.176 22.959  1.00   40.70 ? 202  PHE B CD2 1 
ATOM   3825 C  CE1 . PHE B 1 208 ? 18.390 170.969 20.974  1.00   38.43 ? 202  PHE B CE1 1 
ATOM   3826 C  CE2 . PHE B 1 208 ? 17.664 170.472 23.172  1.00   40.05 ? 202  PHE B CE2 1 
ATOM   3827 C  CZ  . PHE B 1 208 ? 18.599 170.373 22.175  1.00   39.46 ? 202  PHE B CZ  1 
ATOM   3828 N  N   . HIS B 1 209 ? 14.226 176.105 21.060  1.00   42.31 ? 203  HIS B N   1 
ATOM   3829 C  CA  . HIS B 1 209 ? 13.096 177.019 21.130  1.00   41.38 ? 203  HIS B CA  1 
ATOM   3830 C  C   . HIS B 1 209 ? 12.508 177.337 19.772  1.00   39.46 ? 203  HIS B C   1 
ATOM   3831 O  O   . HIS B 1 209 ? 13.217 177.847 18.859  1.00   38.41 ? 203  HIS B O   1 
ATOM   3832 C  CB  . HIS B 1 209 ? 13.504 178.315 21.825  1.00   41.63 ? 203  HIS B CB  1 
ATOM   3833 C  CG  . HIS B 1 209 ? 12.387 179.308 21.920  1.00   45.57 ? 203  HIS B CG  1 
ATOM   3834 N  ND1 . HIS B 1 209 ? 12.487 180.589 21.414  1.00   51.16 ? 203  HIS B ND1 1 
ATOM   3835 C  CD2 . HIS B 1 209 ? 11.129 179.193 22.415  1.00   48.75 ? 203  HIS B CD2 1 
ATOM   3836 C  CE1 . HIS B 1 209 ? 11.349 181.229 21.622  1.00   51.62 ? 203  HIS B CE1 1 
ATOM   3837 N  NE2 . HIS B 1 209 ? 10.510 180.408 22.232  1.00   50.65 ? 203  HIS B NE2 1 
ATOM   3838 N  N   . ILE B 1 210 ? 11.213 177.049 19.634  1.00   37.48 ? 204  ILE B N   1 
ATOM   3839 C  CA  . ILE B 1 210 ? 10.460 177.455 18.455  1.00   36.38 ? 204  ILE B CA  1 
ATOM   3840 C  C   . ILE B 1 210 ? 9.173  178.189 18.786  1.00   36.49 ? 204  ILE B C   1 
ATOM   3841 O  O   . ILE B 1 210 ? 8.245  177.622 19.360  1.00   36.62 ? 204  ILE B O   1 
ATOM   3842 C  CB  . ILE B 1 210 ? 10.096 176.245 17.568  1.00   36.61 ? 204  ILE B CB  1 
ATOM   3843 C  CG1 . ILE B 1 210 ? 11.342 175.443 17.195  1.00   35.30 ? 204  ILE B CG1 1 
ATOM   3844 C  CG2 . ILE B 1 210 ? 9.344  176.732 16.325  1.00   35.97 ? 204  ILE B CG2 1 
ATOM   3845 C  CD1 . ILE B 1 210 ? 11.029 174.226 16.408  1.00   36.15 ? 204  ILE B CD1 1 
ATOM   3846 N  N   . ASP B 1 211 ? 9.084  179.425 18.322  1.00   35.95 ? 205  ASP B N   1 
ATOM   3847 C  CA  . ASP B 1 211 ? 7.874  180.201 18.426  1.00   35.79 ? 205  ASP B CA  1 
ATOM   3848 C  C   . ASP B 1 211 ? 7.566  180.752 17.045  1.00   35.35 ? 205  ASP B C   1 
ATOM   3849 O  O   . ASP B 1 211 ? 7.969  181.853 16.693  1.00   34.67 ? 205  ASP B O   1 
ATOM   3850 C  CB  . ASP B 1 211 ? 8.094  181.293 19.460  1.00   35.87 ? 205  ASP B CB  1 
ATOM   3851 C  CG  . ASP B 1 211 ? 6.886  182.195 19.645  1.00   37.22 ? 205  ASP B CG  1 
ATOM   3852 O  OD1 . ASP B 1 211 ? 5.769  181.882 19.170  1.00   37.45 ? 205  ASP B OD1 1 
ATOM   3853 O  OD2 . ASP B 1 211 ? 6.986  183.265 20.261  1.00   38.17 ? 205  ASP B OD2 1 
ATOM   3854 N  N   . GLY B 1 212 ? 6.842  179.977 16.255  1.00   35.30 ? 206  GLY B N   1 
ATOM   3855 C  CA  . GLY B 1 212 ? 6.608  180.326 14.875  1.00   36.54 ? 206  GLY B CA  1 
ATOM   3856 C  C   . GLY B 1 212 ? 5.217  180.020 14.418  1.00   37.66 ? 206  GLY B C   1 
ATOM   3857 O  O   . GLY B 1 212 ? 4.461  179.340 15.097  1.00   37.35 ? 206  GLY B O   1 
ATOM   3858 N  N   . CYS B 1 213 ? 4.861  180.535 13.256  1.00   39.01 ? 207  CYS B N   1 
ATOM   3859 C  CA  . CYS B 1 213 ? 3.576  180.220 12.705  1.00   41.51 ? 207  CYS B CA  1 
ATOM   3860 C  C   . CYS B 1 213 ? 3.667  178.933 11.875  1.00   41.60 ? 207  CYS B C   1 
ATOM   3861 O  O   . CYS B 1 213 ? 4.213  178.911 10.775  1.00   39.80 ? 207  CYS B O   1 
ATOM   3862 C  CB  . CYS B 1 213 ? 3.021  181.385 11.907  1.00   42.40 ? 207  CYS B CB  1 
ATOM   3863 S  SG  . CYS B 1 213 ? 1.384  181.005 11.257  1.00   51.80 ? 207  CYS B SG  1 
ATOM   3864 N  N   . GLU B 1 214 ? 3.125  177.859 12.441  1.00   42.42 ? 208  GLU B N   1 
ATOM   3865 C  CA  . GLU B 1 214 ? 3.079  176.565 11.790  1.00   43.98 ? 208  GLU B CA  1 
ATOM   3866 C  C   . GLU B 1 214 ? 2.391  176.708 10.447  1.00   44.16 ? 208  GLU B C   1 
ATOM   3867 O  O   . GLU B 1 214 ? 1.399  177.407 10.321  1.00   44.22 ? 208  GLU B O   1 
ATOM   3868 C  CB  . GLU B 1 214 ? 2.311  175.563 12.653  1.00   44.73 ? 208  GLU B CB  1 
ATOM   3869 C  CG  . GLU B 1 214 ? 3.110  175.025 13.829  1.00   48.99 ? 208  GLU B CG  1 
ATOM   3870 C  CD  . GLU B 1 214 ? 2.808  175.728 15.158  1.00   54.36 ? 208  GLU B CD  1 
ATOM   3871 O  OE1 . GLU B 1 214 ? 2.313  176.877 15.156  1.00   57.69 ? 208  GLU B OE1 1 
ATOM   3872 O  OE2 . GLU B 1 214 ? 3.072  175.122 16.225  1.00   57.66 ? 208  GLU B OE2 1 
ATOM   3873 N  N   . ALA B 1 215 ? 2.926  176.057 9.432   1.00   44.56 ? 209  ALA B N   1 
ATOM   3874 C  CA  . ALA B 1 215 ? 2.363  176.166 8.091   1.00   45.48 ? 209  ALA B CA  1 
ATOM   3875 C  C   . ALA B 1 215 ? 2.684  174.881 7.362   1.00   46.25 ? 209  ALA B C   1 
ATOM   3876 O  O   . ALA B 1 215 ? 3.786  174.356 7.487   1.00   47.28 ? 209  ALA B O   1 
ATOM   3877 C  CB  . ALA B 1 215 ? 2.932  177.364 7.331   1.00   44.79 ? 209  ALA B CB  1 
ATOM   3878 N  N   . SER B 1 216 ? 1.727  174.351 6.616   1.00   47.28 ? 210  SER B N   1 
ATOM   3879 C  CA  . SER B 1 216 ? 1.998  173.154 5.830   1.00   47.95 ? 210  SER B CA  1 
ATOM   3880 C  C   . SER B 1 216 ? 2.971  173.518 4.694   1.00   48.52 ? 210  SER B C   1 
ATOM   3881 O  O   . SER B 1 216 ? 2.988  174.641 4.195   1.00   47.55 ? 210  SER B O   1 
ATOM   3882 C  CB  . SER B 1 216 ? 0.691  172.533 5.309   1.00   47.91 ? 210  SER B CB  1 
ATOM   3883 O  OG  . SER B 1 216 ? 0.325  173.088 4.056   1.00   48.84 ? 210  SER B OG  1 
ATOM   3884 N  N   . VAL B 1 217 ? 3.781  172.554 4.297   1.00   50.08 ? 211  VAL B N   1 
ATOM   3885 C  CA  . VAL B 1 217 ? 4.830  172.774 3.300   1.00   51.65 ? 211  VAL B CA  1 
ATOM   3886 C  C   . VAL B 1 217 ? 4.348  173.486 2.031   1.00   52.11 ? 211  VAL B C   1 
ATOM   3887 O  O   . VAL B 1 217 ? 5.056  174.340 1.497   1.00   52.26 ? 211  VAL B O   1 
ATOM   3888 C  CB  . VAL B 1 217 ? 5.533  171.425 3.020   1.00   52.11 ? 211  VAL B CB  1 
ATOM   3889 C  CG1 . VAL B 1 217 ? 4.672  170.568 2.102   1.00   52.82 ? 211  VAL B CG1 1 
ATOM   3890 C  CG2 . VAL B 1 217 ? 6.921  171.651 2.425   1.00   53.12 ? 211  VAL B CG2 1 
ATOM   3891 N  N   . GLU B 1 218 ? 3.168  173.171 1.573   1.00   52.84 ? 212  GLU B N   1 
ATOM   3892 C  CA  . GLU B 1 218 ? 2.746  173.787 0.323   1.00   53.03 ? 212  GLU B CA  1 
ATOM   3893 C  C   . GLU B 1 218 ? 2.036  175.137 0.520   1.00   52.89 ? 212  GLU B C   1 
ATOM   3894 O  O   . GLU B 1 218 ? 1.760  175.816 -0.458  1.00   53.29 ? 212  GLU B O   1 
ATOM   3895 C  CB  . GLU B 1 218 ? 1.970  172.695 -0.456  1.00   53.30 ? 212  GLU B CB  1 
ATOM   3896 C  CG  . GLU B 1 218 ? 1.106  171.812 0.398   0.0000 45.65 ? 212  GLU B CG  1 
ATOM   3897 C  CD  . GLU B 1 218 ? 0.068  172.729 0.964   0.0000 49.38 ? 212  GLU B CD  1 
ATOM   3898 O  OE1 . GLU B 1 218 ? -0.201 173.779 0.336   0.0000 53.65 ? 212  GLU B OE1 1 
ATOM   3899 O  OE2 . GLU B 1 218 ? -0.497 172.413 2.020   0.0000 52.28 ? 212  GLU B OE2 1 
ATOM   3900 N  N   . ALA B 1 219 ? 1.753  175.539 1.768   1.00   51.75 ? 213  ALA B N   1 
ATOM   3901 C  CA  . ALA B 1 219 ? 1.076  176.811 2.069   1.00   51.15 ? 213  ALA B CA  1 
ATOM   3902 C  C   . ALA B 1 219 ? 1.886  178.015 1.597   1.00   50.73 ? 213  ALA B C   1 
ATOM   3903 O  O   . ALA B 1 219 ? 3.113  177.985 1.571   1.00   49.99 ? 213  ALA B O   1 
ATOM   3904 C  CB  . ALA B 1 219 ? 0.798  176.906 3.573   1.00   51.20 ? 213  ALA B CB  1 
ATOM   3905 N  N   . LYS B 1 220 ? 1.175  179.079 1.201   1.00   50.59 ? 214  LYS B N   1 
ATOM   3906 C  CA  . LYS B 1 220 ? 1.779  180.305 0.689   1.00   50.80 ? 214  LYS B CA  1 
ATOM   3907 C  C   . LYS B 1 220 ? 1.664  181.479 1.658   1.00   49.96 ? 214  LYS B C   1 
ATOM   3908 O  O   . LYS B 1 220 ? 2.184  182.565 1.399   1.00   49.63 ? 214  LYS B O   1 
ATOM   3909 C  CB  . LYS B 1 220 ? 1.142  180.711 -0.668  1.00   51.05 ? 214  LYS B CB  1 
ATOM   3910 C  CG  . LYS B 1 220 ? 1.065  179.605 -1.702  1.00   53.61 ? 214  LYS B CG  1 
ATOM   3911 C  CD  . LYS B 1 220 ? 1.988  179.883 -2.878  1.00   56.65 ? 214  LYS B CD  1 
ATOM   3912 C  CE  . LYS B 1 220 ? 3.444  179.846 -2.457  1.00   58.83 ? 214  LYS B CE  1 
ATOM   3913 N  NZ  . LYS B 1 220 ? 4.205  178.816 -3.214  1.00   61.41 ? 214  LYS B NZ  1 
ATOM   3914 N  N   . PHE B 1 221 ? 0.957  181.273 2.781   1.00   49.76 ? 215  PHE B N   1 
ATOM   3915 C  CA  . PHE B 1 221 ? 0.827  182.331 3.773   1.00   50.28 ? 215  PHE B CA  1 
ATOM   3916 C  C   . PHE B 1 221 ? 0.529  181.806 5.171   1.00   49.86 ? 215  PHE B C   1 
ATOM   3917 O  O   . PHE B 1 221 ? 0.128  180.653 5.367   1.00   49.47 ? 215  PHE B O   1 
ATOM   3918 C  CB  . PHE B 1 221 ? -0.253 183.346 3.349   1.00   50.94 ? 215  PHE B CB  1 
ATOM   3919 C  CG  . PHE B 1 221 ? -1.594 182.731 3.107   1.00   52.96 ? 215  PHE B CG  1 
ATOM   3920 C  CD1 . PHE B 1 221 ? -2.452 182.469 4.170   1.00   55.41 ? 215  PHE B CD1 1 
ATOM   3921 C  CD2 . PHE B 1 221 ? -2.000 182.405 1.807   1.00   55.37 ? 215  PHE B CD2 1 
ATOM   3922 C  CE1 . PHE B 1 221 ? -3.710 181.884 3.922   1.00   57.28 ? 215  PHE B CE1 1 
ATOM   3923 C  CE2 . PHE B 1 221 ? -3.255 181.820 1.568   1.00   56.69 ? 215  PHE B CE2 1 
ATOM   3924 C  CZ  . PHE B 1 221 ? -4.112 181.556 2.638   1.00   57.44 ? 215  PHE B CZ  1 
ATOM   3925 N  N   . CYS B 1 222 ? 0.726  182.696 6.132   1.00   50.15 ? 216  CYS B N   1 
ATOM   3926 C  CA  . CYS B 1 222 ? 0.511  182.430 7.548   1.00   50.95 ? 216  CYS B CA  1 
ATOM   3927 C  C   . CYS B 1 222 ? -0.936 182.846 7.864   1.00   49.93 ? 216  CYS B C   1 
ATOM   3928 O  O   . CYS B 1 222 ? -1.331 183.977 7.572   1.00   49.83 ? 216  CYS B O   1 
ATOM   3929 C  CB  . CYS B 1 222 ? 1.548  183.239 8.363   1.00   51.14 ? 216  CYS B CB  1 
ATOM   3930 S  SG  . CYS B 1 222 ? 1.176  183.585 10.106  1.00   56.07 ? 216  CYS B SG  1 
ATOM   3931 N  N   . ALA B 1 223 ? -1.721 181.918 8.418   1.00   48.92 ? 217  ALA B N   1 
ATOM   3932 C  CA  . ALA B 1 223 ? -3.130 182.162 8.763   1.00   48.08 ? 217  ALA B CA  1 
ATOM   3933 C  C   . ALA B 1 223 ? -3.337 183.322 9.747   1.00   47.11 ? 217  ALA B C   1 
ATOM   3934 O  O   . ALA B 1 223 ? -4.383 183.965 9.740   1.00   46.09 ? 217  ALA B O   1 
ATOM   3935 C  CB  . ALA B 1 223 ? -3.754 180.890 9.339   1.00   48.45 ? 217  ALA B CB  1 
ATOM   3936 N  N   . THR B 1 224 ? -2.330 183.577 10.584  1.00   45.76 ? 218  THR B N   1 
ATOM   3937 C  CA  . THR B 1 224 ? -2.409 184.591 11.611  1.00   45.06 ? 218  THR B CA  1 
ATOM   3938 C  C   . THR B 1 224 ? -1.490 185.768 11.324  1.00   44.93 ? 218  THR B C   1 
ATOM   3939 O  O   . THR B 1 224 ? -1.153 186.535 12.217  1.00   43.40 ? 218  THR B O   1 
ATOM   3940 C  CB  . THR B 1 224 ? -2.061 183.956 12.958  1.00   45.34 ? 218  THR B CB  1 
ATOM   3941 O  OG1 . THR B 1 224 ? -0.810 183.266 12.858  1.00   44.11 ? 218  THR B OG1 1 
ATOM   3942 C  CG2 . THR B 1 224 ? -3.061 182.872 13.296  1.00   44.17 ? 218  THR B CG2 1 
ATOM   3943 N  N   . GLN B 1 225 ? -1.109 185.908 10.056  1.00   45.13 ? 219  GLN B N   1 
ATOM   3944 C  CA  . GLN B 1 225 ? -0.298 187.034 9.593   1.00   45.24 ? 219  GLN B CA  1 
ATOM   3945 C  C   . GLN B 1 225 ? -0.918 188.362 10.001  1.00   44.08 ? 219  GLN B C   1 
ATOM   3946 O  O   . GLN B 1 225 ? -2.079 188.641 9.687   1.00   44.28 ? 219  GLN B O   1 
ATOM   3947 C  CB  . GLN B 1 225 ? -0.149 186.981 8.057   1.00   45.78 ? 219  GLN B CB  1 
ATOM   3948 C  CG  . GLN B 1 225 ? 0.461  188.236 7.401   1.00   49.10 ? 219  GLN B CG  1 
ATOM   3949 C  CD  . GLN B 1 225 ? 1.818  188.609 7.969   1.00   51.61 ? 219  GLN B CD  1 
ATOM   3950 O  OE1 . GLN B 1 225 ? 2.220  189.779 7.941   1.00   53.01 ? 219  GLN B OE1 1 
ATOM   3951 N  NE2 . GLN B 1 225 ? 2.533  187.614 8.473   1.00   54.43 ? 219  GLN B NE2 1 
ATOM   3952 N  N   . GLY B 1 226 ? -0.130 189.178 10.690  1.00   42.42 ? 220  GLY B N   1 
ATOM   3953 C  CA  . GLY B 1 226 ? -0.569 190.485 11.143  1.00   41.42 ? 220  GLY B CA  1 
ATOM   3954 C  C   . GLY B 1 226 ? -0.886 190.545 12.618  1.00   40.30 ? 220  GLY B C   1 
ATOM   3955 O  O   . GLY B 1 226 ? -0.861 191.617 13.172  1.00   40.49 ? 220  GLY B O   1 
ATOM   3956 N  N   . ALA B 1 227 ? -1.133 189.401 13.254  1.00   38.89 ? 221  ALA B N   1 
ATOM   3957 C  CA  . ALA B 1 227 ? -1.540 189.343 14.665  1.00   37.82 ? 221  ALA B CA  1 
ATOM   3958 C  C   . ALA B 1 227 ? -0.471 188.807 15.623  1.00   37.14 ? 221  ALA B C   1 
ATOM   3959 O  O   . ALA B 1 227 ? -0.667 188.820 16.845  1.00   35.84 ? 221  ALA B O   1 
ATOM   3960 C  CB  . ALA B 1 227 ? -2.779 188.485 14.776  1.00   38.06 ? 221  ALA B CB  1 
ATOM   3961 N  N   . ARG B 1 228 ? 0.659  188.319 15.094  1.00   35.89 ? 222  ARG B N   1 
ATOM   3962 C  CA  . ARG B 1 228 ? 1.676  187.707 15.947  1.00   35.29 ? 222  ARG B CA  1 
ATOM   3963 C  C   . ARG B 1 228 ? 2.424  188.823 16.644  1.00   34.46 ? 222  ARG B C   1 
ATOM   3964 O  O   . ARG B 1 228 ? 2.429  189.946 16.166  1.00   34.16 ? 222  ARG B O   1 
ATOM   3965 C  CB  . ARG B 1 228 ? 2.651  186.829 15.125  1.00   35.69 ? 222  ARG B CB  1 
ATOM   3966 C  CG  . ARG B 1 228 ? 1.997  185.678 14.347  1.00   37.19 ? 222  ARG B CG  1 
ATOM   3967 C  CD  . ARG B 1 228 ? 1.014  184.820 15.144  1.00   40.13 ? 222  ARG B CD  1 
ATOM   3968 N  NE  . ARG B 1 228 ? 1.667  183.890 16.054  1.00   42.27 ? 222  ARG B NE  1 
ATOM   3969 C  CZ  . ARG B 1 228 ? 1.575  182.555 15.997  1.00   41.79 ? 222  ARG B CZ  1 
ATOM   3970 N  NH1 . ARG B 1 228 ? 0.844  181.949 15.091  1.00   41.24 ? 222  ARG B NH1 1 
ATOM   3971 N  NH2 . ARG B 1 228 ? 2.215  181.816 16.884  1.00   42.56 ? 222  ARG B NH2 1 
ATOM   3972 N  N   . TRP B 1 229 ? 3.069  188.539 17.755  1.00   34.04 ? 223  TRP B N   1 
ATOM   3973 C  CA  . TRP B 1 229 ? 3.829  189.595 18.417  1.00   35.12 ? 223  TRP B CA  1 
ATOM   3974 C  C   . TRP B 1 229 ? 4.953  190.169 17.537  1.00   35.37 ? 223  TRP B C   1 
ATOM   3975 O  O   . TRP B 1 229 ? 5.288  191.344 17.654  1.00   35.12 ? 223  TRP B O   1 
ATOM   3976 C  CB  . TRP B 1 229 ? 4.351  189.137 19.774  1.00   34.76 ? 223  TRP B CB  1 
ATOM   3977 C  CG  . TRP B 1 229 ? 5.314  187.968 19.797  1.00   37.25 ? 223  TRP B CG  1 
ATOM   3978 C  CD1 . TRP B 1 229 ? 5.016  186.683 20.124  1.00   38.54 ? 223  TRP B CD1 1 
ATOM   3979 C  CD2 . TRP B 1 229 ? 6.739  188.003 19.576  1.00   34.91 ? 223  TRP B CD2 1 
ATOM   3980 N  NE1 . TRP B 1 229 ? 6.152  185.915 20.114  1.00   38.68 ? 223  TRP B NE1 1 
ATOM   3981 C  CE2 . TRP B 1 229 ? 7.223  186.695 19.767  1.00   37.64 ? 223  TRP B CE2 1 
ATOM   3982 C  CE3 . TRP B 1 229 ? 7.643  189.003 19.225  1.00   35.41 ? 223  TRP B CE3 1 
ATOM   3983 C  CZ2 . TRP B 1 229 ? 8.578  186.354 19.615  1.00   36.51 ? 223  TRP B CZ2 1 
ATOM   3984 C  CZ3 . TRP B 1 229 ? 9.005  188.665 19.074  1.00   36.51 ? 223  TRP B CZ3 1 
ATOM   3985 C  CH2 . TRP B 1 229 ? 9.446  187.346 19.267  1.00   36.12 ? 223  TRP B CH2 1 
ATOM   3986 N  N   . TRP B 1 230 ? 5.495  189.356 16.619  1.00   35.64 ? 224  TRP B N   1 
ATOM   3987 C  CA  . TRP B 1 230 ? 6.576  189.818 15.736  1.00   35.56 ? 224  TRP B CA  1 
ATOM   3988 C  C   . TRP B 1 230 ? 6.078  190.667 14.599  1.00   36.88 ? 224  TRP B C   1 
ATOM   3989 O  O   . TRP B 1 230 ? 6.882  191.227 13.861  1.00   37.66 ? 224  TRP B O   1 
ATOM   3990 C  CB  . TRP B 1 230 ? 7.397  188.634 15.195  1.00   35.28 ? 224  TRP B CB  1 
ATOM   3991 C  CG  . TRP B 1 230 ? 6.590  187.538 14.553  1.00   31.26 ? 224  TRP B CG  1 
ATOM   3992 C  CD1 . TRP B 1 230 ? 6.055  187.537 13.315  1.00   29.33 ? 224  TRP B CD1 1 
ATOM   3993 C  CD2 . TRP B 1 230 ? 6.253  186.289 15.135  1.00   28.66 ? 224  TRP B CD2 1 
ATOM   3994 N  NE1 . TRP B 1 230 ? 5.390  186.360 13.083  1.00   29.79 ? 224  TRP B NE1 1 
ATOM   3995 C  CE2 . TRP B 1 230 ? 5.501  185.574 14.197  1.00   28.81 ? 224  TRP B CE2 1 
ATOM   3996 C  CE3 . TRP B 1 230 ? 6.485  185.707 16.380  1.00   30.69 ? 224  TRP B CE3 1 
ATOM   3997 C  CZ2 . TRP B 1 230 ? 4.984  184.305 14.459  1.00   30.01 ? 224  TRP B CZ2 1 
ATOM   3998 C  CZ3 . TRP B 1 230 ? 5.994  184.442 16.634  1.00   30.30 ? 224  TRP B CZ3 1 
ATOM   3999 C  CH2 . TRP B 1 230 ? 5.240  183.758 15.686  1.00   29.15 ? 224  TRP B CH2 1 
ATOM   4000 N  N   . ASP B 1 231 ? 4.757  190.751 14.425  1.00   38.23 ? 225  ASP B N   1 
ATOM   4001 C  CA  . ASP B 1 231 ? 4.154  191.610 13.413  1.00   39.26 ? 225  ASP B CA  1 
ATOM   4002 C  C   . ASP B 1 231 ? 3.844  193.030 13.905  1.00   40.25 ? 225  ASP B C   1 
ATOM   4003 O  O   . ASP B 1 231 ? 3.428  193.880 13.116  1.00   40.76 ? 225  ASP B O   1 
ATOM   4004 C  CB  . ASP B 1 231 ? 2.869  190.983 12.891  1.00   39.61 ? 225  ASP B CB  1 
ATOM   4005 C  CG  . ASP B 1 231 ? 3.115  189.686 12.140  1.00   40.85 ? 225  ASP B CG  1 
ATOM   4006 O  OD1 . ASP B 1 231 ? 4.139  189.585 11.432  1.00   43.06 ? 225  ASP B OD1 1 
ATOM   4007 O  OD2 . ASP B 1 231 ? 2.341  188.710 12.219  1.00   42.97 ? 225  ASP B OD2 1 
ATOM   4008 N  N   . GLN B 1 232 ? 4.036  193.280 15.189  1.00   41.55 ? 226  GLN B N   1 
ATOM   4009 C  CA  . GLN B 1 232 ? 3.663  194.562 15.788  1.00   42.89 ? 226  GLN B CA  1 
ATOM   4010 C  C   . GLN B 1 232 ? 4.692  195.631 15.443  1.00   44.33 ? 226  GLN B C   1 
ATOM   4011 O  O   . GLN B 1 232 ? 5.814  195.311 15.002  1.00   44.00 ? 226  GLN B O   1 
ATOM   4012 C  CB  . GLN B 1 232 ? 3.490  194.416 17.310  1.00   42.48 ? 226  GLN B CB  1 
ATOM   4013 C  CG  . GLN B 1 232 ? 2.384  193.407 17.714  1.00   42.52 ? 226  GLN B CG  1 
ATOM   4014 C  CD  . GLN B 1 232 ? 1.160  193.422 16.782  1.00   41.65 ? 226  GLN B CD  1 
ATOM   4015 O  OE1 . GLN B 1 232 ? 0.505  194.459 16.603  1.00   42.58 ? 226  GLN B OE1 1 
ATOM   4016 N  NE2 . GLN B 1 232 ? 0.846  192.275 16.206  1.00   40.70 ? 226  GLN B NE2 1 
ATOM   4017 N  N   . LYS B 1 233 ? 4.311  196.896 15.645  1.00   45.91 ? 227  LYS B N   1 
ATOM   4018 C  CA  . LYS B 1 233 ? 5.088  198.045 15.137  1.00   47.33 ? 227  LYS B CA  1 
ATOM   4019 C  C   . LYS B 1 233 ? 6.549  198.053 15.607  1.00   46.71 ? 227  LYS B C   1 
ATOM   4020 O  O   . LYS B 1 233 ? 7.437  198.472 14.866  1.00   47.46 ? 227  LYS B O   1 
ATOM   4021 C  CB  . LYS B 1 233 ? 4.418  199.383 15.519  1.00   48.48 ? 227  LYS B CB  1 
ATOM   4022 C  CG  . LYS B 1 233 ? 4.857  200.590 14.636  0.0000 52.11 ? 227  LYS B CG  1 
ATOM   4023 C  CD  . LYS B 1 233 ? 5.893  201.503 15.338  0.0000 57.06 ? 227  LYS B CD  1 
ATOM   4024 C  CE  . LYS B 1 233 ? 6.968  202.038 14.351  0.0000 60.08 ? 227  LYS B CE  1 
ATOM   4025 N  NZ  . LYS B 1 233 ? 6.395  202.903 13.263  0.0000 61.82 ? 227  LYS B NZ  1 
ATOM   4026 N  N   . GLU B 1 234 ? 6.785  197.573 16.822  1.00   46.03 ? 228  GLU B N   1 
ATOM   4027 C  CA  . GLU B 1 234 ? 8.106  197.593 17.438  1.00   46.60 ? 228  GLU B CA  1 
ATOM   4028 C  C   . GLU B 1 234 ? 9.122  196.646 16.735  1.00   45.75 ? 228  GLU B C   1 
ATOM   4029 O  O   . GLU B 1 234 ? 10.313 196.752 16.979  1.00   44.70 ? 228  GLU B O   1 
ATOM   4030 C  CB  . GLU B 1 234 ? 8.020  197.207 18.921  1.00   47.19 ? 228  GLU B CB  1 
ATOM   4031 C  CG  . GLU B 1 234 ? 6.848  197.809 19.700  1.00   51.34 ? 228  GLU B CG  1 
ATOM   4032 C  CD  . GLU B 1 234 ? 5.624  196.893 19.759  1.00   54.51 ? 228  GLU B CD  1 
ATOM   4033 O  OE1 . GLU B 1 234 ? 5.662  195.820 20.425  1.00   56.59 ? 228  GLU B OE1 1 
ATOM   4034 O  OE2 . GLU B 1 234 ? 4.615  197.253 19.130  1.00   57.74 ? 228  GLU B OE2 1 
ATOM   4035 N  N   . PHE B 1 235 ? 8.631  195.726 15.898  1.00   44.72 ? 229  PHE B N   1 
ATOM   4036 C  CA  . PHE B 1 235 ? 9.470  194.739 15.215  1.00   44.15 ? 229  PHE B CA  1 
ATOM   4037 C  C   . PHE B 1 235 ? 9.508  194.953 13.734  1.00   43.74 ? 229  PHE B C   1 
ATOM   4038 O  O   . PHE B 1 235 ? 9.992  194.098 13.010  1.00   44.35 ? 229  PHE B O   1 
ATOM   4039 C  CB  . PHE B 1 235 ? 8.973  193.327 15.512  1.00   43.69 ? 229  PHE B CB  1 
ATOM   4040 C  CG  . PHE B 1 235 ? 9.071  192.962 16.941  1.00   42.11 ? 229  PHE B CG  1 
ATOM   4041 C  CD1 . PHE B 1 235 ? 10.255 192.480 17.455  1.00   41.73 ? 229  PHE B CD1 1 
ATOM   4042 C  CD2 . PHE B 1 235 ? 7.983  193.123 17.790  1.00   42.54 ? 229  PHE B CD2 1 
ATOM   4043 C  CE1 . PHE B 1 235 ? 10.360 192.150 18.787  1.00   41.40 ? 229  PHE B CE1 1 
ATOM   4044 C  CE2 . PHE B 1 235 ? 8.085  192.799 19.133  1.00   40.59 ? 229  PHE B CE2 1 
ATOM   4045 C  CZ  . PHE B 1 235 ? 9.263  192.308 19.631  1.00   41.19 ? 229  PHE B CZ  1 
ATOM   4046 N  N   . GLN B 1 236 ? 8.993  196.088 13.276  1.00   43.40 ? 230  GLN B N   1 
ATOM   4047 C  CA  . GLN B 1 236 ? 9.153  196.480 11.887  1.00   43.60 ? 230  GLN B CA  1 
ATOM   4048 C  C   . GLN B 1 236 ? 10.584 196.935 11.573  1.00   42.14 ? 230  GLN B C   1 
ATOM   4049 O  O   . GLN B 1 236 ? 10.971 197.000 10.422  1.00   41.71 ? 230  GLN B O   1 
ATOM   4050 C  CB  . GLN B 1 236 ? 8.162  197.582 11.533  1.00   43.96 ? 230  GLN B CB  1 
ATOM   4051 C  CG  . GLN B 1 236 ? 6.701  197.119 11.674  1.00   47.52 ? 230  GLN B CG  1 
ATOM   4052 C  CD  . GLN B 1 236 ? 5.684  198.110 11.099  1.00   50.77 ? 230  GLN B CD  1 
ATOM   4053 O  OE1 . GLN B 1 236 ? 6.073  199.177 10.623  1.00   56.41 ? 230  GLN B OE1 1 
ATOM   4054 N  NE2 . GLN B 1 236 ? 4.401  197.766 11.143  1.00   51.27 ? 230  GLN B NE2 1 
ATOM   4055 N  N   . ASP B 1 237 ? 11.358 197.246 12.601  1.00   41.60 ? 231  ASP B N   1 
ATOM   4056 C  CA  . ASP B 1 237 ? 12.750 197.693 12.431  1.00   41.54 ? 231  ASP B CA  1 
ATOM   4057 C  C   . ASP B 1 237 ? 13.526 197.459 13.708  1.00   40.79 ? 231  ASP B C   1 
ATOM   4058 O  O   . ASP B 1 237 ? 12.924 197.293 14.763  1.00   40.90 ? 231  ASP B O   1 
ATOM   4059 C  CB  . ASP B 1 237 ? 12.782 199.185 12.104  1.00   41.54 ? 231  ASP B CB  1 
ATOM   4060 C  CG  . ASP B 1 237 ? 14.093 199.629 11.466  1.00   43.51 ? 231  ASP B CG  1 
ATOM   4061 O  OD1 . ASP B 1 237 ? 14.947 198.791 11.075  1.00   44.85 ? 231  ASP B OD1 1 
ATOM   4062 O  OD2 . ASP B 1 237 ? 14.354 200.832 11.314  1.00   47.82 ? 231  ASP B OD2 1 
ATOM   4063 N  N   . LEU B 1 238 ? 14.854 197.436 13.628  1.00   39.74 ? 232  LEU B N   1 
ATOM   4064 C  CA  . LEU B 1 238 ? 15.666 197.449 14.842  1.00   39.73 ? 232  LEU B CA  1 
ATOM   4065 C  C   . LEU B 1 238 ? 15.511 198.810 15.498  1.00   39.80 ? 232  LEU B C   1 
ATOM   4066 O  O   . LEU B 1 238 ? 15.347 199.805 14.793  1.00   39.60 ? 232  LEU B O   1 
ATOM   4067 C  CB  . LEU B 1 238 ? 17.147 197.234 14.519  1.00   39.30 ? 232  LEU B CB  1 
ATOM   4068 C  CG  . LEU B 1 238 ? 17.550 195.911 13.862  1.00   39.26 ? 232  LEU B CG  1 
ATOM   4069 C  CD1 . LEU B 1 238 ? 19.057 195.817 13.843  1.00   40.06 ? 232  LEU B CD1 1 
ATOM   4070 C  CD2 . LEU B 1 238 ? 16.965 194.740 14.599  1.00   39.21 ? 232  LEU B CD2 1 
ATOM   4071 N  N   . ASP B 1 239 ? 15.573 198.863 16.827  1.00   40.62 ? 233  ASP B N   1 
ATOM   4072 C  CA  . ASP B 1 239 ? 15.632 200.148 17.529  1.00   41.27 ? 233  ASP B CA  1 
ATOM   4073 C  C   . ASP B 1 239 ? 17.072 200.677 17.605  1.00   41.58 ? 233  ASP B C   1 
ATOM   4074 O  O   . ASP B 1 239 ? 18.036 199.981 17.208  1.00   39.96 ? 233  ASP B O   1 
ATOM   4075 C  CB  . ASP B 1 239 ? 14.948 200.077 18.902  1.00   41.86 ? 233  ASP B CB  1 
ATOM   4076 C  CG  . ASP B 1 239 ? 15.708 199.263 19.907  1.00   43.83 ? 233  ASP B CG  1 
ATOM   4077 O  OD1 . ASP B 1 239 ? 16.947 199.246 19.872  1.00   47.66 ? 233  ASP B OD1 1 
ATOM   4078 O  OD2 . ASP B 1 239 ? 15.141 198.596 20.793  1.00   49.51 ? 233  ASP B OD2 1 
ATOM   4079 N  N   . ALA B 1 240 ? 17.216 201.911 18.108  1.00   41.38 ? 234  ALA B N   1 
ATOM   4080 C  CA  . ALA B 1 240 ? 18.481 202.630 18.010  1.00   41.58 ? 234  ALA B CA  1 
ATOM   4081 C  C   . ALA B 1 240 ? 19.591 201.905 18.779  1.00   40.95 ? 234  ALA B C   1 
ATOM   4082 O  O   . ALA B 1 240 ? 20.726 201.905 18.353  1.00   40.02 ? 234  ALA B O   1 
ATOM   4083 C  CB  . ALA B 1 240 ? 18.333 204.115 18.493  1.00   42.14 ? 234  ALA B CB  1 
ATOM   4084 N  N   . PHE B 1 241 ? 19.245 201.264 19.885  1.00   40.88 ? 235  PHE B N   1 
ATOM   4085 C  CA  . PHE B 1 241 ? 20.235 200.549 20.695  1.00   41.18 ? 235  PHE B CA  1 
ATOM   4086 C  C   . PHE B 1 241 ? 20.793 199.303 19.955  1.00   39.32 ? 235  PHE B C   1 
ATOM   4087 O  O   . PHE B 1 241 ? 21.967 198.980 20.054  1.00   39.01 ? 235  PHE B O   1 
ATOM   4088 C  CB  . PHE B 1 241 ? 19.613 200.119 22.024  1.00   42.30 ? 235  PHE B CB  1 
ATOM   4089 C  CG  . PHE B 1 241 ? 18.972 201.256 22.796  1.00   48.27 ? 235  PHE B CG  1 
ATOM   4090 C  CD1 . PHE B 1 241 ? 19.747 202.082 23.607  1.00   51.61 ? 235  PHE B CD1 1 
ATOM   4091 C  CD2 . PHE B 1 241 ? 17.595 201.499 22.703  1.00   53.15 ? 235  PHE B CD2 1 
ATOM   4092 C  CE1 . PHE B 1 241 ? 19.172 203.125 24.318  1.00   53.50 ? 235  PHE B CE1 1 
ATOM   4093 C  CE2 . PHE B 1 241 ? 17.006 202.548 23.422  1.00   55.20 ? 235  PHE B CE2 1 
ATOM   4094 C  CZ  . PHE B 1 241 ? 17.802 203.362 24.228  1.00   55.02 ? 235  PHE B CZ  1 
ATOM   4095 N  N   . GLN B 1 242 ? 19.906 198.602 19.263  1.00   37.45 ? 236  GLN B N   1 
ATOM   4096 C  CA  . GLN B 1 242 ? 20.264 197.480 18.403  1.00   36.03 ? 236  GLN B CA  1 
ATOM   4097 C  C   . GLN B 1 242 ? 21.175 197.871 17.233  1.00   34.09 ? 236  GLN B C   1 
ATOM   4098 O  O   . GLN B 1 242 ? 22.141 197.163 16.937  1.00   31.56 ? 236  GLN B O   1 
ATOM   4099 C  CB  . GLN B 1 242 ? 18.986 196.797 17.914  1.00   35.42 ? 236  GLN B CB  1 
ATOM   4100 C  CG  . GLN B 1 242 ? 18.285 196.033 19.068  1.00   37.81 ? 236  GLN B CG  1 
ATOM   4101 C  CD  . GLN B 1 242 ? 16.923 195.445 18.691  1.00   40.28 ? 236  GLN B CD  1 
ATOM   4102 O  OE1 . GLN B 1 242 ? 16.570 194.343 19.141  1.00   43.13 ? 236  GLN B OE1 1 
ATOM   4103 N  NE2 . GLN B 1 242 ? 16.159 196.172 17.886  1.00   36.73 ? 236  GLN B NE2 1 
ATOM   4104 N  N   . TYR B 1 243 ? 20.879 198.999 16.589  1.00   32.90 ? 237  TYR B N   1 
ATOM   4105 C  CA  . TYR B 1 243 ? 21.709 199.492 15.487  1.00   32.75 ? 237  TYR B CA  1 
ATOM   4106 C  C   . TYR B 1 243 ? 23.109 199.911 15.997  1.00   32.75 ? 237  TYR B C   1 
ATOM   4107 O  O   . TYR B 1 243 ? 24.084 199.744 15.292  1.00   32.42 ? 237  TYR B O   1 
ATOM   4108 C  CB  . TYR B 1 243 ? 21.049 200.652 14.722  1.00   32.72 ? 237  TYR B CB  1 
ATOM   4109 C  CG  . TYR B 1 243 ? 20.094 200.237 13.619  1.00   33.54 ? 237  TYR B CG  1 
ATOM   4110 C  CD1 . TYR B 1 243 ? 20.523 199.465 12.550  1.00   35.44 ? 237  TYR B CD1 1 
ATOM   4111 C  CD2 . TYR B 1 243 ? 18.751 200.623 13.647  1.00   35.88 ? 237  TYR B CD2 1 
ATOM   4112 C  CE1 . TYR B 1 243 ? 19.646 199.066 11.533  1.00   37.42 ? 237  TYR B CE1 1 
ATOM   4113 C  CE2 . TYR B 1 243 ? 17.864 200.243 12.636  1.00   38.12 ? 237  TYR B CE2 1 
ATOM   4114 C  CZ  . TYR B 1 243 ? 18.323 199.465 11.569  1.00   39.26 ? 237  TYR B CZ  1 
ATOM   4115 O  OH  . TYR B 1 243 ? 17.465 199.075 10.554  1.00   39.49 ? 237  TYR B OH  1 
ATOM   4116 N  N   . ARG B 1 244 ? 23.217 200.421 17.218  1.00   32.25 ? 238  ARG B N   1 
ATOM   4117 C  CA  . ARG B 1 244 ? 24.550 200.702 17.757  1.00   33.54 ? 238  ARG B CA  1 
ATOM   4118 C  C   . ARG B 1 244 ? 25.367 199.406 17.968  1.00   31.81 ? 238  ARG B C   1 
ATOM   4119 O  O   . ARG B 1 244 ? 26.547 199.392 17.709  1.00   29.80 ? 238  ARG B O   1 
ATOM   4120 C  CB  . ARG B 1 244 ? 24.465 201.494 19.056  1.00   34.46 ? 238  ARG B CB  1 
ATOM   4121 C  CG  . ARG B 1 244 ? 23.588 202.719 18.909  1.00   38.83 ? 238  ARG B CG  1 
ATOM   4122 C  CD  . ARG B 1 244 ? 23.890 203.834 19.848  1.00   45.13 ? 238  ARG B CD  1 
ATOM   4123 N  NE  . ARG B 1 244 ? 23.329 203.659 21.190  1.00   48.52 ? 238  ARG B NE  1 
ATOM   4124 C  CZ  . ARG B 1 244 ? 22.387 204.430 21.754  1.00   51.44 ? 238  ARG B CZ  1 
ATOM   4125 N  NH1 . ARG B 1 244 ? 21.823 205.436 21.098  1.00   52.42 ? 238  ARG B NH1 1 
ATOM   4126 N  NH2 . ARG B 1 244 ? 22.007 204.190 23.009  1.00   52.31 ? 238  ARG B NH2 1 
ATOM   4127 N  N   . ARG B 1 245 ? 24.722 198.330 18.422  1.00   30.98 ? 239  ARG B N   1 
ATOM   4128 C  CA  . ARG B 1 245 ? 25.436 197.074 18.623  1.00   30.89 ? 239  ARG B CA  1 
ATOM   4129 C  C   . ARG B 1 245 ? 25.874 196.523 17.276  1.00   28.38 ? 239  ARG B C   1 
ATOM   4130 O  O   . ARG B 1 245 ? 27.007 196.087 17.127  1.00   27.22 ? 239  ARG B O   1 
ATOM   4131 C  CB  . ARG B 1 245 ? 24.596 196.045 19.383  1.00   31.80 ? 239  ARG B CB  1 
ATOM   4132 C  CG  . ARG B 1 245 ? 24.541 196.248 20.929  1.00   38.98 ? 239  ARG B CG  1 
ATOM   4133 C  CD  . ARG B 1 245 ? 23.147 196.490 21.382  1.00   45.68 ? 239  ARG B CD  1 
ATOM   4134 N  NE  . ARG B 1 245 ? 22.943 197.009 22.746  1.00   52.34 ? 239  ARG B NE  1 
ATOM   4135 C  CZ  . ARG B 1 245 ? 23.319 198.205 23.233  1.00   55.43 ? 239  ARG B CZ  1 
ATOM   4136 N  NH1 . ARG B 1 245 ? 24.052 199.086 22.553  1.00   56.25 ? 239  ARG B NH1 1 
ATOM   4137 N  NH2 . ARG B 1 245 ? 22.959 198.508 24.463  1.00   58.49 ? 239  ARG B NH2 1 
ATOM   4138 N  N   . LEU B 1 246 ? 24.976 196.561 16.304  1.00   27.38 ? 240  LEU B N   1 
ATOM   4139 C  CA  . LEU B 1 246 ? 25.258 196.084 14.962  1.00   27.54 ? 240  LEU B CA  1 
ATOM   4140 C  C   . LEU B 1 246 ? 26.447 196.839 14.361  1.00   27.54 ? 240  LEU B C   1 
ATOM   4141 O  O   . LEU B 1 246 ? 27.285 196.253 13.676  1.00   25.53 ? 240  LEU B O   1 
ATOM   4142 C  CB  . LEU B 1 246 ? 24.034 196.230 14.066  1.00   27.14 ? 240  LEU B CB  1 
ATOM   4143 C  CG  . LEU B 1 246 ? 24.191 195.879 12.591  1.00   29.12 ? 240  LEU B CG  1 
ATOM   4144 C  CD1 . LEU B 1 246 ? 24.494 194.400 12.366  1.00   32.03 ? 240  LEU B CD1 1 
ATOM   4145 C  CD2 . LEU B 1 246 ? 22.934 196.215 11.866  1.00   31.74 ? 240  LEU B CD2 1 
ATOM   4146 N  N   . SER B 1 247 ? 26.532 198.147 14.633  1.00   27.95 ? 241  SER B N   1 
ATOM   4147 C  CA  . SER B 1 247 ? 27.645 198.949 14.118  1.00   27.99 ? 241  SER B CA  1 
ATOM   4148 C  C   . SER B 1 247 ? 28.982 198.481 14.701  1.00   27.16 ? 241  SER B C   1 
ATOM   4149 O  O   . SER B 1 247 ? 29.963 198.420 13.995  1.00   27.04 ? 241  SER B O   1 
ATOM   4150 C  CB  . SER B 1 247 ? 27.427 200.439 14.429  1.00   29.14 ? 241  SER B CB  1 
ATOM   4151 O  OG  . SER B 1 247 ? 28.422 201.172 13.772  1.00   34.55 ? 241  SER B OG  1 
ATOM   4152 N  N   . TRP B 1 248 ? 29.029 198.155 15.991  1.00   26.67 ? 242  TRP B N   1 
ATOM   4153 C  CA  . TRP B 1 248 ? 30.246 197.572 16.564  1.00   27.46 ? 242  TRP B CA  1 
ATOM   4154 C  C   . TRP B 1 248 ? 30.638 196.247 15.884  1.00   26.52 ? 242  TRP B C   1 
ATOM   4155 O  O   . TRP B 1 248 ? 31.822 195.958 15.688  1.00   25.38 ? 242  TRP B O   1 
ATOM   4156 C  CB  . TRP B 1 248 ? 30.054 197.304 18.052  1.00   27.85 ? 242  TRP B CB  1 
ATOM   4157 C  CG  . TRP B 1 248 ? 30.207 198.504 18.925  1.00   32.00 ? 242  TRP B CG  1 
ATOM   4158 C  CD1 . TRP B 1 248 ? 29.213 199.235 19.519  1.00   34.37 ? 242  TRP B CD1 1 
ATOM   4159 C  CD2 . TRP B 1 248 ? 31.432 199.098 19.323  1.00   33.88 ? 242  TRP B CD2 1 
ATOM   4160 N  NE1 . TRP B 1 248 ? 29.755 200.266 20.248  1.00   33.63 ? 242  TRP B NE1 1 
ATOM   4161 C  CE2 . TRP B 1 248 ? 31.119 200.201 20.151  1.00   35.82 ? 242  TRP B CE2 1 
ATOM   4162 C  CE3 . TRP B 1 248 ? 32.775 198.804 19.077  1.00   36.67 ? 242  TRP B CE3 1 
ATOM   4163 C  CZ2 . TRP B 1 248 ? 32.108 201.001 20.751  1.00   36.73 ? 242  TRP B CZ2 1 
ATOM   4164 C  CZ3 . TRP B 1 248 ? 33.765 199.614 19.659  1.00   39.24 ? 242  TRP B CZ3 1 
ATOM   4165 C  CH2 . TRP B 1 248 ? 33.416 200.699 20.481  1.00   37.58 ? 242  TRP B CH2 1 
ATOM   4166 N  N   . VAL B 1 249 ? 29.643 195.432 15.545  1.00   25.76 ? 243  VAL B N   1 
ATOM   4167 C  CA  . VAL B 1 249 ? 29.924 194.144 14.897  1.00   25.61 ? 243  VAL B CA  1 
ATOM   4168 C  C   . VAL B 1 249 ? 30.499 194.418 13.507  1.00   25.88 ? 243  VAL B C   1 
ATOM   4169 O  O   . VAL B 1 249 ? 31.482 193.815 13.103  1.00   25.03 ? 243  VAL B O   1 
ATOM   4170 C  CB  . VAL B 1 249 ? 28.655 193.257 14.789  1.00   25.05 ? 243  VAL B CB  1 
ATOM   4171 C  CG1 . VAL B 1 249 ? 28.906 192.024 13.916  1.00   25.08 ? 243  VAL B CG1 1 
ATOM   4172 C  CG2 . VAL B 1 249 ? 28.187 192.870 16.151  1.00   24.31 ? 243  VAL B CG2 1 
ATOM   4173 N  N   . ARG B 1 250 ? 29.891 195.355 12.791  1.00   27.67 ? 244  ARG B N   1 
ATOM   4174 C  CA  . ARG B 1 250 ? 30.339 195.680 11.445  1.00   29.11 ? 244  ARG B CA  1 
ATOM   4175 C  C   . ARG B 1 250 ? 31.753 196.255 11.428  1.00   30.00 ? 244  ARG B C   1 
ATOM   4176 O  O   . ARG B 1 250 ? 32.534 195.923 10.547  1.00   30.39 ? 244  ARG B O   1 
ATOM   4177 C  CB  . ARG B 1 250 ? 29.392 196.672 10.762  1.00   29.70 ? 244  ARG B CB  1 
ATOM   4178 C  CG  . ARG B 1 250 ? 28.054 196.107 10.327  1.00   30.81 ? 244  ARG B CG  1 
ATOM   4179 C  CD  . ARG B 1 250 ? 28.070 195.371 8.987   1.00   33.54 ? 244  ARG B CD  1 
ATOM   4180 N  NE  . ARG B 1 250 ? 28.649 194.052 9.196   1.00   34.47 ? 244  ARG B NE  1 
ATOM   4181 C  CZ  . ARG B 1 250 ? 27.967 192.966 9.554   1.00   32.81 ? 244  ARG B CZ  1 
ATOM   4182 N  NH1 . ARG B 1 250 ? 26.650 192.995 9.646   1.00   32.46 ? 244  ARG B NH1 1 
ATOM   4183 N  NH2 . ARG B 1 250 ? 28.624 191.833 9.790   1.00   32.14 ? 244  ARG B NH2 1 
ATOM   4184 N  N   . GLN B 1 251 ? 32.088 197.096 12.399  1.00   30.81 ? 245  GLN B N   1 
ATOM   4185 C  CA  . GLN B 1 251 ? 33.386 197.797 12.372  1.00   32.24 ? 245  GLN B CA  1 
ATOM   4186 C  C   . GLN B 1 251 ? 34.527 197.026 13.012  1.00   31.09 ? 245  GLN B C   1 
ATOM   4187 O  O   . GLN B 1 251 ? 35.654 197.179 12.611  1.00   31.20 ? 245  GLN B O   1 
ATOM   4188 C  CB  . GLN B 1 251 ? 33.272 199.142 13.082  1.00   33.34 ? 245  GLN B CB  1 
ATOM   4189 C  CG  . GLN B 1 251 ? 32.251 200.067 12.460  1.00   36.94 ? 245  GLN B CG  1 
ATOM   4190 C  CD  . GLN B 1 251 ? 32.167 201.377 13.221  1.00   44.92 ? 245  GLN B CD  1 
ATOM   4191 O  OE1 . GLN B 1 251 ? 33.024 202.277 13.063  1.00   49.84 ? 245  GLN B OE1 1 
ATOM   4192 N  NE2 . GLN B 1 251 ? 31.126 201.501 14.045  1.00   49.44 ? 245  GLN B NE2 1 
ATOM   4193 N  N   . LYS B 1 252 ? 34.234 196.200 14.008  1.00   29.98 ? 246  LYS B N   1 
ATOM   4194 C  CA  . LYS B 1 252 ? 35.275 195.543 14.776  1.00   29.62 ? 246  LYS B CA  1 
ATOM   4195 C  C   . LYS B 1 252 ? 35.369 194.018 14.623  1.00   29.60 ? 246  LYS B C   1 
ATOM   4196 O  O   . LYS B 1 252 ? 36.432 193.464 14.901  1.00   29.99 ? 246  LYS B O   1 
ATOM   4197 C  CB  . LYS B 1 252 ? 35.129 195.874 16.258  1.00   29.73 ? 246  LYS B CB  1 
ATOM   4198 C  CG  . LYS B 1 252 ? 35.211 197.388 16.593  1.00   31.15 ? 246  LYS B CG  1 
ATOM   4199 C  CD  . LYS B 1 252 ? 36.579 197.942 16.208  1.00   32.11 ? 246  LYS B CD  1 
ATOM   4200 C  CE  . LYS B 1 252 ? 36.915 199.274 16.907  1.00   34.47 ? 246  LYS B CE  1 
ATOM   4201 N  NZ  . LYS B 1 252 ? 38.200 199.757 16.297  1.00   36.92 ? 246  LYS B NZ  1 
ATOM   4202 N  N   . TYR B 1 253 ? 34.290 193.343 14.211  1.00   28.04 ? 247  TYR B N   1 
ATOM   4203 C  CA  . TYR B 1 253 ? 34.249 191.869 14.209  1.00   27.04 ? 247  TYR B CA  1 
ATOM   4204 C  C   . TYR B 1 253 ? 34.080 191.261 12.800  1.00   27.54 ? 247  TYR B C   1 
ATOM   4205 O  O   . TYR B 1 253 ? 34.137 190.051 12.653  1.00   26.70 ? 247  TYR B O   1 
ATOM   4206 C  CB  . TYR B 1 253 ? 33.119 191.377 15.161  1.00   26.39 ? 247  TYR B CB  1 
ATOM   4207 C  CG  . TYR B 1 253 ? 33.494 191.634 16.609  1.00   26.27 ? 247  TYR B CG  1 
ATOM   4208 C  CD1 . TYR B 1 253 ? 34.316 190.736 17.295  1.00   27.05 ? 247  TYR B CD1 1 
ATOM   4209 C  CD2 . TYR B 1 253 ? 33.159 192.818 17.238  1.00   25.50 ? 247  TYR B CD2 1 
ATOM   4210 C  CE1 . TYR B 1 253 ? 34.722 190.960 18.559  1.00   28.15 ? 247  TYR B CE1 1 
ATOM   4211 C  CE2 . TYR B 1 253 ? 33.582 193.071 18.548  1.00   27.40 ? 247  TYR B CE2 1 
ATOM   4212 C  CZ  . TYR B 1 253 ? 34.377 192.139 19.195  1.00   28.79 ? 247  TYR B CZ  1 
ATOM   4213 O  OH  . TYR B 1 253 ? 34.805 192.338 20.490  1.00   29.96 ? 247  TYR B OH  1 
ATOM   4214 N  N   . THR B 1 254 ? 33.859 192.081 11.781  1.00   27.50 ? 248  THR B N   1 
ATOM   4215 C  CA  . THR B 1 254 ? 33.531 191.565 10.462  1.00   28.19 ? 248  THR B CA  1 
ATOM   4216 C  C   . THR B 1 254 ? 34.772 191.374 9.636   1.00   29.46 ? 248  THR B C   1 
ATOM   4217 O  O   . THR B 1 254 ? 35.571 192.302 9.462   1.00   28.93 ? 248  THR B O   1 
ATOM   4218 C  CB  . THR B 1 254 ? 32.547 192.486 9.779   1.00   28.40 ? 248  THR B CB  1 
ATOM   4219 O  OG1 . THR B 1 254 ? 31.362 192.553 10.577  1.00   28.35 ? 248  THR B OG1 1 
ATOM   4220 C  CG2 . THR B 1 254 ? 32.058 191.933 8.432   1.00   27.30 ? 248  THR B CG2 1 
ATOM   4221 N  N   . ILE B 1 255 ? 34.965 190.154 9.123   1.00   29.96 ? 249  ILE B N   1 
ATOM   4222 C  CA  . ILE B 1 255 ? 36.118 189.901 8.270   1.00   30.40 ? 249  ILE B CA  1 
ATOM   4223 C  C   . ILE B 1 255 ? 35.777 189.682 6.815   1.00   29.94 ? 249  ILE B C   1 
ATOM   4224 O  O   . ILE B 1 255 ? 36.660 189.667 5.986   1.00   30.75 ? 249  ILE B O   1 
ATOM   4225 C  CB  . ILE B 1 255 ? 36.971 188.750 8.826   1.00   31.42 ? 249  ILE B CB  1 
ATOM   4226 C  CG1 . ILE B 1 255 ? 36.227 187.428 8.825   1.00   32.89 ? 249  ILE B CG1 1 
ATOM   4227 C  CG2 . ILE B 1 255 ? 37.440 189.082 10.254  1.00   32.52 ? 249  ILE B CG2 1 
ATOM   4228 C  CD1 . ILE B 1 255 ? 37.134 186.260 9.203   1.00   36.37 ? 249  ILE B CD1 1 
ATOM   4229 N  N   . TYR B 1 256 ? 34.509 189.468 6.505   1.00   29.17 ? 250  TYR B N   1 
ATOM   4230 C  CA  . TYR B 1 256 ? 34.067 189.356 5.119   1.00   28.37 ? 250  TYR B CA  1 
ATOM   4231 C  C   . TYR B 1 256 ? 32.637 189.827 5.074   1.00   28.58 ? 250  TYR B C   1 
ATOM   4232 O  O   . TYR B 1 256 ? 31.799 189.467 5.929   1.00   26.82 ? 250  TYR B O   1 
ATOM   4233 C  CB  . TYR B 1 256 ? 34.218 187.930 4.524   1.00   28.74 ? 250  TYR B CB  1 
ATOM   4234 C  CG  . TYR B 1 256 ? 33.674 187.875 3.113   1.00   28.42 ? 250  TYR B CG  1 
ATOM   4235 C  CD1 . TYR B 1 256 ? 34.442 188.309 2.030   1.00   30.01 ? 250  TYR B CD1 1 
ATOM   4236 C  CD2 . TYR B 1 256 ? 32.363 187.513 2.872   1.00   26.62 ? 250  TYR B CD2 1 
ATOM   4237 C  CE1 . TYR B 1 256 ? 33.923 188.332 0.744   1.00   29.01 ? 250  TYR B CE1 1 
ATOM   4238 C  CE2 . TYR B 1 256 ? 31.836 187.518 1.593   1.00   29.26 ? 250  TYR B CE2 1 
ATOM   4239 C  CZ  . TYR B 1 256 ? 32.634 187.938 0.522   1.00   30.01 ? 250  TYR B CZ  1 
ATOM   4240 O  OH  . TYR B 1 256 ? 32.088 187.990 -0.734  1.00   31.33 ? 250  TYR B OH  1 
ATOM   4241 N  N   . ASN B 1 257 ? 32.353 190.653 4.075   1.00   28.68 ? 251  ASN B N   1 
ATOM   4242 C  CA  . ASN B 1 257 ? 31.036 191.180 3.860   1.00   30.07 ? 251  ASN B CA  1 
ATOM   4243 C  C   . ASN B 1 257 ? 30.763 191.217 2.357   1.00   31.28 ? 251  ASN B C   1 
ATOM   4244 O  O   . ASN B 1 257 ? 31.441 191.951 1.617   1.00   30.55 ? 251  ASN B O   1 
ATOM   4245 C  CB  . ASN B 1 257 ? 30.958 192.563 4.505   1.00   30.79 ? 251  ASN B CB  1 
ATOM   4246 C  CG  . ASN B 1 257 ? 29.574 193.133 4.496   1.00   33.02 ? 251  ASN B CG  1 
ATOM   4247 O  OD1 . ASN B 1 257 ? 28.633 192.524 3.975   1.00   37.45 ? 251  ASN B OD1 1 
ATOM   4248 N  ND2 . ASN B 1 257 ? 29.424 194.321 5.078   1.00   37.28 ? 251  ASN B ND2 1 
ATOM   4249 N  N   . TYR B 1 258 ? 29.777 190.437 1.895   1.00   31.28 ? 252  TYR B N   1 
ATOM   4250 C  CA  . TYR B 1 258 ? 29.466 190.389 0.480   1.00   32.93 ? 252  TYR B CA  1 
ATOM   4251 C  C   . TYR B 1 258 ? 29.122 191.777 -0.126  1.00   34.46 ? 252  TYR B C   1 
ATOM   4252 O  O   . TYR B 1 258 ? 29.391 192.001 -1.297  1.00   33.94 ? 252  TYR B O   1 
ATOM   4253 C  CB  . TYR B 1 258 ? 28.326 189.420 0.193   1.00   32.35 ? 252  TYR B CB  1 
ATOM   4254 C  CG  . TYR B 1 258 ? 26.948 189.952 0.512   1.00   31.70 ? 252  TYR B CG  1 
ATOM   4255 C  CD1 . TYR B 1 258 ? 26.481 190.003 1.822   1.00   30.87 ? 252  TYR B CD1 1 
ATOM   4256 C  CD2 . TYR B 1 258 ? 26.096 190.384 -0.507  1.00   33.83 ? 252  TYR B CD2 1 
ATOM   4257 C  CE1 . TYR B 1 258 ? 25.190 190.489 2.113   1.00   31.59 ? 252  TYR B CE1 1 
ATOM   4258 C  CE2 . TYR B 1 258 ? 24.819 190.864 -0.238  1.00   33.17 ? 252  TYR B CE2 1 
ATOM   4259 C  CZ  . TYR B 1 258 ? 24.367 190.911 1.077   1.00   33.12 ? 252  TYR B CZ  1 
ATOM   4260 O  OH  . TYR B 1 258 ? 23.108 191.371 1.343   1.00   33.06 ? 252  TYR B OH  1 
ATOM   4261 N  N   . CYS B 1 259 ? 28.532 192.657 0.692   1.00   35.81 ? 253  CYS B N   1 
ATOM   4262 C  CA  . CYS B 1 259 ? 28.133 194.022 0.327   1.00   37.72 ? 253  CYS B CA  1 
ATOM   4263 C  C   . CYS B 1 259 ? 29.273 194.866 -0.236  1.00   37.74 ? 253  CYS B C   1 
ATOM   4264 O  O   . CYS B 1 259 ? 29.046 195.677 -1.124  1.00   35.96 ? 253  CYS B O   1 
ATOM   4265 C  CB  . CYS B 1 259 ? 27.584 194.779 1.556   1.00   37.23 ? 253  CYS B CB  1 
ATOM   4266 S  SG  . CYS B 1 259 ? 26.012 194.116 2.158   1.00   47.70 ? 253  CYS B SG  1 
ATOM   4267 N  N   . THR B 1 260 ? 30.458 194.709 0.357   1.00   38.32 ? 254  THR B N   1 
ATOM   4268 C  CA  . THR B 1 260 ? 31.656 195.460 -0.021  1.00   39.02 ? 254  THR B CA  1 
ATOM   4269 C  C   . THR B 1 260 ? 32.658 194.650 -0.854  1.00   38.77 ? 254  THR B C   1 
ATOM   4270 O  O   . THR B 1 260 ? 33.743 195.122 -1.110  1.00   38.24 ? 254  THR B O   1 
ATOM   4271 C  CB  . THR B 1 260 ? 32.373 195.977 1.245   1.00   39.26 ? 254  THR B CB  1 
ATOM   4272 O  OG1 . THR B 1 260 ? 32.749 194.869 2.066   1.00   40.60 ? 254  THR B OG1 1 
ATOM   4273 C  CG2 . THR B 1 260 ? 31.442 196.777 2.125   1.00   40.83 ? 254  THR B CG2 1 
ATOM   4274 N  N   . ASP B 1 261 ? 32.306 193.436 -1.258  1.00   38.84 ? 255  ASP B N   1 
ATOM   4275 C  CA  . ASP B 1 261 ? 33.183 192.627 -2.085  1.00   39.28 ? 255  ASP B CA  1 
ATOM   4276 C  C   . ASP B 1 261 ? 32.945 193.006 -3.553  1.00   39.95 ? 255  ASP B C   1 
ATOM   4277 O  O   . ASP B 1 261 ? 32.011 192.510 -4.204  1.00   38.65 ? 255  ASP B O   1 
ATOM   4278 C  CB  . ASP B 1 261 ? 32.892 191.149 -1.851  1.00   39.47 ? 255  ASP B CB  1 
ATOM   4279 C  CG  . ASP B 1 261 ? 33.833 190.241 -2.599  1.00   40.82 ? 255  ASP B CG  1 
ATOM   4280 O  OD1 . ASP B 1 261 ? 34.650 190.752 -3.391  1.00   43.19 ? 255  ASP B OD1 1 
ATOM   4281 O  OD2 . ASP B 1 261 ? 33.829 189.003 -2.462  1.00   40.97 ? 255  ASP B OD2 1 
ATOM   4282 N  N   . ARG B 1 262 ? 33.776 193.919 -4.060  1.00   40.98 ? 256  ARG B N   1 
ATOM   4283 C  CA  . ARG B 1 262 ? 33.609 194.431 -5.427  1.00   41.48 ? 256  ARG B CA  1 
ATOM   4284 C  C   . ARG B 1 262 ? 34.125 193.463 -6.510  1.00   42.28 ? 256  ARG B C   1 
ATOM   4285 O  O   . ARG B 1 262 ? 33.802 193.625 -7.690  1.00   42.58 ? 256  ARG B O   1 
ATOM   4286 C  CB  . ARG B 1 262 ? 34.234 195.823 -5.567  1.00   41.07 ? 256  ARG B CB  1 
ATOM   4287 C  CG  . ARG B 1 262 ? 33.474 196.908 -4.830  1.00   39.33 ? 256  ARG B CG  1 
ATOM   4288 C  CD  . ARG B 1 262 ? 32.119 197.294 -5.414  1.00   38.63 ? 256  ARG B CD  1 
ATOM   4289 N  NE  . ARG B 1 262 ? 31.336 197.951 -4.377  1.00   38.26 ? 256  ARG B NE  1 
ATOM   4290 C  CZ  . ARG B 1 262 ? 30.505 197.327 -3.526  1.00   38.31 ? 256  ARG B CZ  1 
ATOM   4291 N  NH1 . ARG B 1 262 ? 30.273 196.018 -3.617  1.00   35.05 ? 256  ARG B NH1 1 
ATOM   4292 N  NH2 . ARG B 1 262 ? 29.894 198.036 -2.593  1.00   37.01 ? 256  ARG B NH2 1 
ATOM   4293 N  N   . SER B 1 263 ? 34.887 192.448 -6.115  1.00   43.21 ? 257  SER B N   1 
ATOM   4294 C  CA  . SER B 1 263 ? 35.257 191.368 -7.039  1.00   44.59 ? 257  SER B CA  1 
ATOM   4295 C  C   . SER B 1 263 ? 34.124 190.367 -7.326  1.00   45.04 ? 257  SER B C   1 
ATOM   4296 O  O   . SER B 1 263 ? 34.203 189.586 -8.284  1.00   46.16 ? 257  SER B O   1 
ATOM   4297 C  CB  . SER B 1 263 ? 36.471 190.615 -6.504  1.00   44.72 ? 257  SER B CB  1 
ATOM   4298 O  OG  . SER B 1 263 ? 36.121 189.901 -5.324  1.00   49.03 ? 257  SER B OG  1 
ATOM   4299 N  N   . ARG B 1 264 ? 33.086 190.358 -6.491  1.00   44.88 ? 258  ARG B N   1 
ATOM   4300 C  CA  . ARG B 1 264 ? 31.928 189.491 -6.706  1.00   44.27 ? 258  ARG B CA  1 
ATOM   4301 C  C   . ARG B 1 264 ? 30.706 190.303 -7.035  1.00   43.02 ? 258  ARG B C   1 
ATOM   4302 O  O   . ARG B 1 264 ? 29.880 189.876 -7.821  1.00   43.04 ? 258  ARG B O   1 
ATOM   4303 C  CB  . ARG B 1 264 ? 31.634 188.650 -5.456  1.00   44.57 ? 258  ARG B CB  1 
ATOM   4304 C  CG  . ARG B 1 264 ? 32.447 187.380 -5.323  1.00   46.12 ? 258  ARG B CG  1 
ATOM   4305 C  CD  . ARG B 1 264 ? 32.220 186.690 -3.961  1.00   46.81 ? 258  ARG B CD  1 
ATOM   4306 N  NE  . ARG B 1 264 ? 31.069 185.809 -4.006  1.00   45.96 ? 258  ARG B NE  1 
ATOM   4307 C  CZ  . ARG B 1 264 ? 30.267 185.500 -2.986  1.00   46.86 ? 258  ARG B CZ  1 
ATOM   4308 N  NH1 . ARG B 1 264 ? 30.423 186.013 -1.754  1.00   43.32 ? 258  ARG B NH1 1 
ATOM   4309 N  NH2 . ARG B 1 264 ? 29.278 184.656 -3.221  1.00   47.88 ? 258  ARG B NH2 1 
ATOM   4310 N  N   . TYR B 1 265 ? 30.589 191.468 -6.405  1.00   42.52 ? 259  TYR B N   1 
ATOM   4311 C  CA  . TYR B 1 265 ? 29.484 192.396 -6.601  1.00   42.01 ? 259  TYR B CA  1 
ATOM   4312 C  C   . TYR B 1 265 ? 30.052 193.755 -7.071  1.00   42.26 ? 259  TYR B C   1 
ATOM   4313 O  O   . TYR B 1 265 ? 30.289 194.661 -6.266  1.00   40.52 ? 259  TYR B O   1 
ATOM   4314 C  CB  . TYR B 1 265 ? 28.687 192.553 -5.301  1.00   42.66 ? 259  TYR B CB  1 
ATOM   4315 C  CG  . TYR B 1 265 ? 27.807 191.352 -4.991  1.00   43.76 ? 259  TYR B CG  1 
ATOM   4316 C  CD1 . TYR B 1 265 ? 26.543 191.219 -5.580  1.00   45.02 ? 259  TYR B CD1 1 
ATOM   4317 C  CD2 . TYR B 1 265 ? 28.247 190.351 -4.131  1.00   44.24 ? 259  TYR B CD2 1 
ATOM   4318 C  CE1 . TYR B 1 265 ? 25.726 190.108 -5.302  1.00   47.98 ? 259  TYR B CE1 1 
ATOM   4319 C  CE2 . TYR B 1 265 ? 27.441 189.223 -3.844  1.00   46.02 ? 259  TYR B CE2 1 
ATOM   4320 C  CZ  . TYR B 1 265 ? 26.185 189.117 -4.432  1.00   47.15 ? 259  TYR B CZ  1 
ATOM   4321 O  OH  . TYR B 1 265 ? 25.401 188.028 -4.175  1.00   50.79 ? 259  TYR B OH  1 
ATOM   4322 N  N   . PRO B 1 266 ? 30.325 193.862 -8.371  1.00   43.03 ? 260  PRO B N   1 
ATOM   4323 C  CA  . PRO B 1 266 ? 30.779 195.121 -8.991  1.00   42.94 ? 260  PRO B CA  1 
ATOM   4324 C  C   . PRO B 1 266 ? 30.016 196.336 -8.490  1.00   42.20 ? 260  PRO B C   1 
ATOM   4325 O  O   . PRO B 1 266 ? 30.585 197.388 -8.239  1.00   41.71 ? 260  PRO B O   1 
ATOM   4326 C  CB  . PRO B 1 266 ? 30.458 194.909 -10.479 1.00   43.36 ? 260  PRO B CB  1 
ATOM   4327 C  CG  . PRO B 1 266 ? 30.463 193.417 -10.686 1.00   44.59 ? 260  PRO B CG  1 
ATOM   4328 C  CD  . PRO B 1 266 ? 30.270 192.751 -9.349  1.00   43.42 ? 260  PRO B CD  1 
ATOM   4329 N  N   . SER B 1 267 ? 28.725 196.154 -8.330  1.00   42.34 ? 261  SER B N   1 
ATOM   4330 C  CA  . SER B 1 267 ? 27.828 197.156 -7.790  1.00   44.21 ? 261  SER B CA  1 
ATOM   4331 C  C   . SER B 1 267 ? 27.226 196.680 -6.445  1.00   44.98 ? 261  SER B C   1 
ATOM   4332 O  O   . SER B 1 267 ? 27.044 195.488 -6.226  1.00   45.28 ? 261  SER B O   1 
ATOM   4333 C  CB  . SER B 1 267 ? 26.719 197.396 -8.830  1.00   44.45 ? 261  SER B CB  1 
ATOM   4334 O  OG  . SER B 1 267 ? 25.559 197.925 -8.237  1.00   45.92 ? 261  SER B OG  1 
ATOM   4335 N  N   . MET B 1 268 ? 26.928 197.621 -5.565  1.00   45.86 ? 262  MET B N   1 
ATOM   4336 C  CA  . MET B 1 268 ? 26.434 197.318 -4.231  1.00   46.96 ? 262  MET B CA  1 
ATOM   4337 C  C   . MET B 1 268 ? 25.025 196.715 -4.307  1.00   47.03 ? 262  MET B C   1 
ATOM   4338 O  O   . MET B 1 268 ? 24.104 197.383 -4.780  1.00   46.41 ? 262  MET B O   1 
ATOM   4339 C  CB  . MET B 1 268 ? 26.376 198.597 -3.409  1.00   47.13 ? 262  MET B CB  1 
ATOM   4340 C  CG  . MET B 1 268 ? 26.045 198.397 -1.946  1.00   49.77 ? 262  MET B CG  1 
ATOM   4341 S  SD  . MET B 1 268 ? 25.346 199.859 -1.238  0.50   52.30 ? 262  MET B SD  1 
ATOM   4342 C  CE  . MET B 1 268 ? 23.594 199.797 -1.917  1.00   54.27 ? 262  MET B CE  1 
ATOM   4343 N  N   . PRO B 1 269 ? 24.835 195.484 -3.820  1.00   47.04 ? 263  PRO B N   1 
ATOM   4344 C  CA  . PRO B 1 269 ? 23.490 194.884 -3.828  1.00   46.94 ? 263  PRO B CA  1 
ATOM   4345 C  C   . PRO B 1 269 ? 22.517 195.874 -3.195  1.00   46.98 ? 263  PRO B C   1 
ATOM   4346 O  O   . PRO B 1 269 ? 22.914 196.549 -2.235  1.00   46.12 ? 263  PRO B O   1 
ATOM   4347 C  CB  . PRO B 1 269 ? 23.645 193.619 -2.984  1.00   47.09 ? 263  PRO B CB  1 
ATOM   4348 C  CG  . PRO B 1 269 ? 25.111 193.293 -3.017  1.00   46.95 ? 263  PRO B CG  1 
ATOM   4349 C  CD  . PRO B 1 269 ? 25.845 194.592 -3.230  1.00   46.86 ? 263  PRO B CD  1 
ATOM   4350 N  N   . PRO B 1 270 ? 21.297 195.992 -3.717  1.00   47.35 ? 264  PRO B N   1 
ATOM   4351 C  CA  . PRO B 1 270 ? 20.417 197.097 -3.326  1.00   48.11 ? 264  PRO B CA  1 
ATOM   4352 C  C   . PRO B 1 270 ? 20.028 197.105 -1.839  1.00   48.47 ? 264  PRO B C   1 
ATOM   4353 O  O   . PRO B 1 270 ? 19.840 198.189 -1.284  1.00   49.03 ? 264  PRO B O   1 
ATOM   4354 C  CB  . PRO B 1 270 ? 19.168 196.907 -4.219  1.00   48.30 ? 264  PRO B CB  1 
ATOM   4355 C  CG  . PRO B 1 270 ? 19.519 195.873 -5.215  1.00   48.51 ? 264  PRO B CG  1 
ATOM   4356 C  CD  . PRO B 1 270 ? 20.652 195.077 -4.672  1.00   47.75 ? 264  PRO B CD  1 
ATOM   4357 N  N   . GLU B 1 271 ? 19.923 195.929 -1.212  1.00   48.67 ? 265  GLU B N   1 
ATOM   4358 C  CA  . GLU B 1 271 ? 19.504 195.835 0.201   1.00   49.07 ? 265  GLU B CA  1 
ATOM   4359 C  C   . GLU B 1 271 ? 20.512 196.449 1.180   1.00   49.20 ? 265  GLU B C   1 
ATOM   4360 O  O   . GLU B 1 271 ? 20.145 196.855 2.289   1.00   48.58 ? 265  GLU B O   1 
ATOM   4361 C  CB  . GLU B 1 271 ? 19.241 194.368 0.603   1.00   49.14 ? 265  GLU B CB  1 
ATOM   4362 C  CG  . GLU B 1 271 ? 20.473 193.448 0.602   1.00   48.85 ? 265  GLU B CG  1 
ATOM   4363 C  CD  . GLU B 1 271 ? 20.674 192.704 -0.708  1.00   49.69 ? 265  GLU B CD  1 
ATOM   4364 O  OE1 . GLU B 1 271 ? 20.192 193.206 -1.759  1.00   49.24 ? 265  GLU B OE1 1 
ATOM   4365 O  OE2 . GLU B 1 271 ? 21.314 191.612 -0.692  1.00   49.39 ? 265  GLU B OE2 1 
ATOM   4366 N  N   . CYS B 1 272 ? 21.770 196.532 0.755   1.00   49.62 ? 266  CYS B N   1 
ATOM   4367 C  CA  . CYS B 1 272 ? 22.889 196.774 1.669   1.00   50.32 ? 266  CYS B CA  1 
ATOM   4368 C  C   . CYS B 1 272 ? 22.841 198.085 2.453   1.00   50.33 ? 266  CYS B C   1 
ATOM   4369 O  O   . CYS B 1 272 ? 23.178 198.102 3.650   1.00   49.73 ? 266  CYS B O   1 
ATOM   4370 C  CB  . CYS B 1 272 ? 24.221 196.606 0.930   1.00   50.38 ? 266  CYS B CB  1 
ATOM   4371 S  SG  . CYS B 1 272 ? 24.661 194.852 0.770   1.00   53.74 ? 266  CYS B SG  1 
ATOM   4372 N  N   . LYS B 1 273 ? 22.404 199.167 1.815   1.00   50.29 ? 267  LYS B N   1 
ATOM   4373 C  CA  . LYS B 1 273 ? 22.316 200.453 2.514   1.00   51.09 ? 267  LYS B CA  1 
ATOM   4374 C  C   . LYS B 1 273 ? 21.236 200.449 3.604   1.00   50.47 ? 267  LYS B C   1 
ATOM   4375 O  O   . LYS B 1 273 ? 21.477 200.908 4.716   1.00   49.52 ? 267  LYS B O   1 
ATOM   4376 C  CB  . LYS B 1 273 ? 22.081 201.627 1.544   1.00   51.59 ? 267  LYS B CB  1 
ATOM   4377 C  CG  . LYS B 1 273 ? 23.324 202.504 1.337   1.00   54.68 ? 267  LYS B CG  1 
ATOM   4378 C  CD  . LYS B 1 273 ? 23.536 203.539 2.467   1.00   58.46 ? 267  LYS B CD  1 
ATOM   4379 C  CE  . LYS B 1 273 ? 23.357 204.992 1.975   1.00   59.91 ? 267  LYS B CE  1 
ATOM   4380 N  NZ  . LYS B 1 273 ? 21.920 205.320 1.649   1.00   61.59 ? 267  LYS B NZ  1 
ATOM   4381 N  N   . ARG B 1 274 ? 20.060 199.926 3.275   1.00   50.35 ? 268  ARG B N   1 
ATOM   4382 C  CA  . ARG B 1 274 ? 18.969 199.805 4.249   1.00   51.10 ? 268  ARG B CA  1 
ATOM   4383 C  C   . ARG B 1 274 ? 19.312 198.827 5.405   1.00   50.24 ? 268  ARG B C   1 
ATOM   4384 O  O   . ARG B 1 274 ? 18.838 199.007 6.528   1.00   49.75 ? 268  ARG B O   1 
ATOM   4385 C  CB  . ARG B 1 274 ? 17.648 199.397 3.551   1.00   51.53 ? 268  ARG B CB  1 
ATOM   4386 C  CG  . ARG B 1 274 ? 16.927 200.571 2.840   1.00   54.57 ? 268  ARG B CG  1 
ATOM   4387 C  CD  . ARG B 1 274 ? 15.383 200.497 2.825   1.00   57.57 ? 268  ARG B CD  1 
ATOM   4388 N  NE  . ARG B 1 274 ? 14.811 201.362 1.780   1.00   60.36 ? 268  ARG B NE  1 
ATOM   4389 C  CZ  . ARG B 1 274 ? 13.863 201.027 0.892   1.00   61.13 ? 268  ARG B CZ  1 
ATOM   4390 N  NH1 . ARG B 1 274 ? 13.309 199.819 0.863   1.00   61.37 ? 268  ARG B NH1 1 
ATOM   4391 N  NH2 . ARG B 1 274 ? 13.473 201.937 0.005   1.00   62.41 ? 268  ARG B NH2 1 
ATOM   4392 N  N   . ASP B 1 275 ? 20.148 197.822 5.121   1.00   49.45 ? 269  ASP B N   1 
ATOM   4393 C  CA  . ASP B 1 275 ? 20.570 196.826 6.114   1.00   49.11 ? 269  ASP B CA  1 
ATOM   4394 C  C   . ASP B 1 275 ? 21.690 197.373 7.035   1.00   49.55 ? 269  ASP B C   1 
ATOM   4395 O  O   . ASP B 1 275 ? 22.085 196.704 7.998   1.00   49.37 ? 269  ASP B O   1 
ATOM   4396 C  CB  . ASP B 1 275 ? 21.076 195.546 5.407   1.00   48.60 ? 269  ASP B CB  1 
ATOM   4397 C  CG  . ASP B 1 275 ? 19.949 194.725 4.736   1.00   48.21 ? 269  ASP B CG  1 
ATOM   4398 O  OD1 . ASP B 1 275 ? 18.753 195.019 4.957   1.00   44.41 ? 269  ASP B OD1 1 
ATOM   4399 O  OD2 . ASP B 1 275 ? 20.181 193.751 3.966   1.00   46.81 ? 269  ASP B OD2 1 
ATOM   4400 N  N   . ARG B 1 276 ? 22.202 198.570 6.720   1.00   50.01 ? 270  ARG B N   1 
ATOM   4401 C  CA  . ARG B 1 276 ? 23.366 199.174 7.372   1.00   50.74 ? 270  ARG B CA  1 
ATOM   4402 C  C   . ARG B 1 276 ? 24.602 198.261 7.349   1.00   50.84 ? 270  ARG B C   1 
ATOM   4403 O  O   . ARG B 1 276 ? 25.394 198.247 8.300   1.00   50.40 ? 270  ARG B O   1 
ATOM   4404 C  CB  . ARG B 1 276 ? 23.038 199.594 8.812   1.00   51.22 ? 270  ARG B CB  1 
ATOM   4405 C  CG  . ARG B 1 276 ? 21.783 200.475 8.932   1.00   54.15 ? 270  ARG B CG  1 
ATOM   4406 C  CD  . ARG B 1 276 ? 22.041 201.913 9.354   1.00   57.67 ? 270  ARG B CD  1 
ATOM   4407 N  NE  . ARG B 1 276 ? 21.212 202.349 10.488  1.00   60.67 ? 270  ARG B NE  1 
ATOM   4408 C  CZ  . ARG B 1 276 ? 19.899 202.577 10.443  1.00   62.48 ? 270  ARG B CZ  1 
ATOM   4409 N  NH1 . ARG B 1 276 ? 19.207 202.398 9.315   1.00   64.04 ? 270  ARG B NH1 1 
ATOM   4410 N  NH2 . ARG B 1 276 ? 19.268 202.993 11.538  1.00   62.63 ? 270  ARG B NH2 1 
ATOM   4411 N  N   . ASP B 1 277 ? 24.756 197.499 6.269   1.00   51.15 ? 271  ASP B N   1 
ATOM   4412 C  CA  . ASP B 1 277 ? 25.965 196.715 6.041   1.00   51.96 ? 271  ASP B CA  1 
ATOM   4413 C  C   . ASP B 1 277 ? 27.045 197.538 5.298   1.00   52.93 ? 271  ASP B C   1 
ATOM   4414 O  O   . ASP B 1 277 ? 28.118 197.020 4.988   1.00   52.28 ? 271  ASP B O   1 
ATOM   4415 C  CB  . ASP B 1 277 ? 25.632 195.424 5.273   1.00   51.61 ? 271  ASP B CB  1 
ATOM   4416 C  CG  . ASP B 1 277 ? 24.976 194.344 6.165   1.00   52.13 ? 271  ASP B CG  1 
ATOM   4417 O  OD1 . ASP B 1 277 ? 25.278 194.297 7.384   1.00   52.09 ? 271  ASP B OD1 1 
ATOM   4418 O  OD2 . ASP B 1 277 ? 24.152 193.492 5.726   1.00   49.79 ? 271  ASP B OD2 1 
ATOM   4419 N  N   . ILE B 1 278 ? 26.745 198.809 5.020   1.00   54.21 ? 272  ILE B N   1 
ATOM   4420 C  CA  . ILE B 1 278 ? 27.677 199.727 4.339   1.00   55.64 ? 272  ILE B CA  1 
ATOM   4421 C  C   . ILE B 1 278 ? 27.312 201.205 4.617   1.00   55.71 ? 272  ILE B C   1 
ATOM   4422 O  O   . ILE B 1 278 ? 26.141 201.552 4.824   1.00   56.27 ? 272  ILE B O   1 
ATOM   4423 C  CB  . ILE B 1 278 ? 27.694 199.430 2.794   1.00   56.14 ? 272  ILE B CB  1 
ATOM   4424 C  CG1 . ILE B 1 278 ? 28.977 199.958 2.098   1.00   57.46 ? 272  ILE B CG1 1 
ATOM   4425 C  CG2 . ILE B 1 278 ? 26.437 199.970 2.119   1.00   56.63 ? 272  ILE B CG2 1 
ATOM   4426 C  CD1 . ILE B 1 278 ? 29.502 201.329 2.564   1.00   58.89 ? 272  ILE B CD1 1 
HETATM 4427 C  C1  . NAG C 2 .   ? 40.651 151.257 -0.640  1.00   39.12 ? 1    NAG C C1  1 
HETATM 4428 C  C2  . NAG C 2 .   ? 39.280 151.697 -1.189  1.00   39.11 ? 1    NAG C C2  1 
HETATM 4429 C  C3  . NAG C 2 .   ? 39.436 152.597 -2.421  1.00   37.87 ? 1    NAG C C3  1 
HETATM 4430 C  C4  . NAG C 2 .   ? 40.324 153.793 -2.106  1.00   39.86 ? 1    NAG C C4  1 
HETATM 4431 C  C5  . NAG C 2 .   ? 41.565 153.336 -1.360  1.00   40.95 ? 1    NAG C C5  1 
HETATM 4432 C  C6  . NAG C 2 .   ? 42.367 154.525 -0.829  1.00   43.19 ? 1    NAG C C6  1 
HETATM 4433 C  C7  . NAG C 2 .   ? 38.689 149.577 -2.287  1.00   37.86 ? 1    NAG C C7  1 
HETATM 4434 C  C8  . NAG C 2 .   ? 37.857 148.333 -2.148  1.00   39.56 ? 1    NAG C C8  1 
HETATM 4435 N  N2  . NAG C 2 .   ? 38.384 150.575 -1.474  1.00   38.83 ? 1    NAG C N2  1 
HETATM 4436 O  O3  . NAG C 2 .   ? 38.193 153.059 -2.880  1.00   36.30 ? 1    NAG C O3  1 
HETATM 4437 O  O4  . NAG C 2 .   ? 40.732 154.342 -3.345  1.00   41.90 ? 1    NAG C O4  1 
HETATM 4438 O  O5  . NAG C 2 .   ? 41.305 152.455 -0.266  1.00   38.61 ? 1    NAG C O5  1 
HETATM 4439 O  O6  . NAG C 2 .   ? 43.594 153.976 -0.388  1.00   43.40 ? 1    NAG C O6  1 
HETATM 4440 O  O7  . NAG C 2 .   ? 39.586 149.601 -3.111  1.00   37.29 ? 1    NAG C O7  1 
HETATM 4441 C  C1  . NAG C 2 .   ? 40.220 155.669 -3.576  1.00   44.84 ? 2    NAG C C1  1 
HETATM 4442 C  C2  . NAG C 2 .   ? 41.096 156.411 -4.593  1.00   46.96 ? 2    NAG C C2  1 
HETATM 4443 C  C3  . NAG C 2 .   ? 40.586 157.840 -4.847  1.00   49.81 ? 2    NAG C C3  1 
HETATM 4444 C  C4  . NAG C 2 .   ? 39.091 157.835 -5.150  1.00   51.08 ? 2    NAG C C4  1 
HETATM 4445 C  C5  . NAG C 2 .   ? 38.356 156.944 -4.136  1.00   49.52 ? 2    NAG C C5  1 
HETATM 4446 C  C6  . NAG C 2 .   ? 36.881 156.845 -4.475  1.00   46.32 ? 2    NAG C C6  1 
HETATM 4447 C  C7  . NAG C 2 .   ? 43.400 155.599 -4.530  1.00   46.43 ? 2    NAG C C7  1 
HETATM 4448 C  C8  . NAG C 2 .   ? 44.733 155.735 -3.849  1.00   47.40 ? 2    NAG C C8  1 
HETATM 4449 N  N2  . NAG C 2 .   ? 42.459 156.446 -4.132  1.00   46.21 ? 2    NAG C N2  1 
HETATM 4450 O  O3  . NAG C 2 .   ? 41.266 158.433 -5.939  1.00   51.25 ? 2    NAG C O3  1 
HETATM 4451 O  O4  . NAG C 2 .   ? 38.660 159.157 -4.969  1.00   56.47 ? 2    NAG C O4  1 
HETATM 4452 O  O5  . NAG C 2 .   ? 38.940 155.646 -4.140  1.00   45.53 ? 2    NAG C O5  1 
HETATM 4453 O  O6  . NAG C 2 .   ? 36.835 156.214 -5.728  1.00   47.35 ? 2    NAG C O6  1 
HETATM 4454 O  O7  . NAG C 2 .   ? 43.219 154.762 -5.408  1.00   47.70 ? 2    NAG C O7  1 
HETATM 4455 C  C1  . BMA C 2 .   ? 37.879 159.719 -6.036  1.00   60.02 ? 3    BMA C C1  1 
HETATM 4456 C  C2  . BMA C 2 .   ? 37.367 161.051 -5.500  1.00   60.94 ? 3    BMA C C2  1 
HETATM 4457 C  C3  . BMA C 2 .   ? 36.439 161.701 -6.519  1.00   62.34 ? 3    BMA C C3  1 
HETATM 4458 C  C4  . BMA C 2 .   ? 37.169 161.843 -7.844  1.00   63.20 ? 3    BMA C C4  1 
HETATM 4459 C  C5  . BMA C 2 .   ? 37.847 160.532 -8.273  1.00   63.78 ? 3    BMA C C5  1 
HETATM 4460 C  C6  . BMA C 2 .   ? 38.766 160.798 -9.462  1.00   64.41 ? 3    BMA C C6  1 
HETATM 4461 O  O2  . BMA C 2 .   ? 38.476 161.879 -5.235  1.00   61.21 ? 3    BMA C O2  1 
HETATM 4462 O  O3  . BMA C 2 .   ? 35.932 162.943 -6.061  1.00   61.90 ? 3    BMA C O3  1 
HETATM 4463 O  O4  . BMA C 2 .   ? 36.196 162.205 -8.793  1.00   64.28 ? 3    BMA C O4  1 
HETATM 4464 O  O5  . BMA C 2 .   ? 38.605 159.923 -7.230  1.00   62.37 ? 3    BMA C O5  1 
HETATM 4465 O  O6  . BMA C 2 .   ? 39.584 159.677 -9.723  1.00   65.34 ? 3    BMA C O6  1 
HETATM 4466 C  C1  . NAG D 2 .   ? 41.450 180.294 12.005  1.00   32.84 ? 1    NAG D C1  1 
HETATM 4467 C  C2  . NAG D 2 .   ? 40.474 181.405 11.608  1.00   33.44 ? 1    NAG D C2  1 
HETATM 4468 C  C3  . NAG D 2 .   ? 41.091 182.265 10.503  1.00   33.86 ? 1    NAG D C3  1 
HETATM 4469 C  C4  . NAG D 2 .   ? 42.499 182.748 10.882  1.00   34.94 ? 1    NAG D C4  1 
HETATM 4470 C  C5  . NAG D 2 .   ? 43.328 181.650 11.518  1.00   37.71 ? 1    NAG D C5  1 
HETATM 4471 C  C6  . NAG D 2 .   ? 44.581 182.225 12.180  1.00   39.81 ? 1    NAG D C6  1 
HETATM 4472 C  C7  . NAG D 2 .   ? 38.947 180.025 10.253  1.00   32.79 ? 1    NAG D C7  1 
HETATM 4473 C  C8  . NAG D 2 .   ? 37.620 179.326 10.180  1.00   32.52 ? 1    NAG D C8  1 
HETATM 4474 N  N2  . NAG D 2 .   ? 39.150 180.872 11.252  1.00   33.65 ? 1    NAG D N2  1 
HETATM 4475 O  O3  . NAG D 2 .   ? 40.277 183.373 10.146  1.00   31.23 ? 1    NAG D O3  1 
HETATM 4476 O  O4  . NAG D 2 .   ? 43.133 183.196 9.697   1.00   35.43 ? 1    NAG D O4  1 
HETATM 4477 O  O5  . NAG D 2 .   ? 42.612 180.930 12.515  1.00   34.82 ? 1    NAG D O5  1 
HETATM 4478 O  O6  . NAG D 2 .   ? 45.435 181.118 12.326  1.00   40.58 ? 1    NAG D O6  1 
HETATM 4479 O  O7  . NAG D 2 .   ? 39.775 179.800 9.385   1.00   31.70 ? 1    NAG D O7  1 
HETATM 4480 C  C1  . NAG D 2 .   ? 43.392 184.618 9.711   1.00   38.91 ? 2    NAG D C1  1 
HETATM 4481 C  C2  . NAG D 2 .   ? 44.589 184.950 8.804   1.00   41.33 ? 2    NAG D C2  1 
HETATM 4482 C  C3  . NAG D 2 .   ? 44.843 186.463 8.812   1.00   42.69 ? 2    NAG D C3  1 
HETATM 4483 C  C4  . NAG D 2 .   ? 43.554 187.198 8.444   1.00   43.26 ? 2    NAG D C4  1 
HETATM 4484 C  C5  . NAG D 2 .   ? 42.438 186.755 9.395   1.00   40.29 ? 2    NAG D C5  1 
HETATM 4485 C  C6  . NAG D 2 .   ? 41.116 187.450 9.079   1.00   39.33 ? 2    NAG D C6  1 
HETATM 4486 C  C7  . NAG D 2 .   ? 46.245 183.155 8.669   1.00   41.47 ? 2    NAG D C7  1 
HETATM 4487 C  C8  . NAG D 2 .   ? 47.545 182.616 9.221   1.00   41.47 ? 2    NAG D C8  1 
HETATM 4488 N  N2  . NAG D 2 .   ? 45.771 184.240 9.262   1.00   41.02 ? 2    NAG D N2  1 
HETATM 4489 O  O3  . NAG D 2 .   ? 45.861 186.790 7.904   1.00   44.15 ? 2    NAG D O3  1 
HETATM 4490 O  O4  . NAG D 2 .   ? 43.763 188.583 8.572   1.00   46.81 ? 2    NAG D O4  1 
HETATM 4491 O  O5  . NAG D 2 .   ? 42.273 185.360 9.276   1.00   39.20 ? 2    NAG D O5  1 
HETATM 4492 O  O6  . NAG D 2 .   ? 40.667 187.077 7.789   1.00   38.52 ? 2    NAG D O6  1 
HETATM 4493 O  O7  . NAG D 2 .   ? 45.677 182.607 7.720   1.00   41.12 ? 2    NAG D O7  1 
HETATM 4494 C  C1  . BMA D 2 .   ? 43.467 189.343 7.388   1.00   49.93 ? 3    BMA D C1  1 
HETATM 4495 C  C2  . BMA D 2 .   ? 43.353 190.798 7.852   1.00   50.54 ? 3    BMA D C2  1 
HETATM 4496 C  C3  . BMA D 2 .   ? 43.115 191.748 6.701   1.00   53.74 ? 3    BMA D C3  1 
HETATM 4497 C  C4  . BMA D 2 .   ? 44.106 191.472 5.577   1.00   55.00 ? 3    BMA D C4  1 
HETATM 4498 C  C5  . BMA D 2 .   ? 44.277 189.980 5.231   1.00   54.31 ? 3    BMA D C5  1 
HETATM 4499 C  C6  . BMA D 2 .   ? 45.519 189.845 4.348   1.00   55.38 ? 3    BMA D C6  1 
HETATM 4500 O  O2  . BMA D 2 .   ? 44.542 191.188 8.479   1.00   49.92 ? 3    BMA D O2  1 
HETATM 4501 O  O3  . BMA D 2 .   ? 43.256 193.086 7.163   1.00   54.41 ? 3    BMA D O3  1 
HETATM 4502 O  O4  . BMA D 2 .   ? 43.651 192.180 4.445   1.00   57.52 ? 3    BMA D O4  1 
HETATM 4503 O  O5  . BMA D 2 .   ? 44.457 189.191 6.390   1.00   50.73 ? 3    BMA D O5  1 
HETATM 4504 O  O6  . BMA D 2 .   ? 45.802 188.513 3.966   1.00   57.91 ? 3    BMA D O6  1 
HETATM 4505 AU AU  . AU  E 3 .   ? 13.894 197.819 2.999   1.00   84.98 ? 1276 AU  B AU  1 
HETATM 4506 O  O   . HOH F 4 .   ? 38.879 122.915 2.719   1.00   58.59 ? 2001 HOH A O   1 
HETATM 4507 O  O   . HOH F 4 .   ? 23.444 126.103 14.051  1.00   37.23 ? 2002 HOH A O   1 
HETATM 4508 O  O   . HOH F 4 .   ? 37.349 121.562 1.838   1.00   41.09 ? 2003 HOH A O   1 
HETATM 4509 O  O   . HOH F 4 .   ? 14.173 132.747 9.842   1.00   50.90 ? 2004 HOH A O   1 
HETATM 4510 O  O   . HOH F 4 .   ? 19.540 135.540 6.561   1.00   37.64 ? 2005 HOH A O   1 
HETATM 4511 O  O   . HOH F 4 .   ? 26.794 127.428 -1.958  1.00   41.48 ? 2006 HOH A O   1 
HETATM 4512 O  O   . HOH F 4 .   ? 35.489 121.014 0.802   1.00   34.89 ? 2007 HOH A O   1 
HETATM 4513 O  O   . HOH F 4 .   ? 33.827 120.371 1.116   1.00   52.48 ? 2008 HOH A O   1 
HETATM 4514 O  O   . HOH F 4 .   ? 44.025 127.636 -4.990  1.00   51.27 ? 2009 HOH A O   1 
HETATM 4515 O  O   . HOH F 4 .   ? 45.990 132.202 -3.674  1.00   58.16 ? 2010 HOH A O   1 
HETATM 4516 O  O   . HOH F 4 .   ? 35.025 120.461 3.990   1.00   49.38 ? 2011 HOH A O   1 
HETATM 4517 O  O   . HOH F 4 .   ? 32.708 123.562 10.848  1.00   51.05 ? 2012 HOH A O   1 
HETATM 4518 O  O   . HOH F 4 .   ? 30.527 123.510 8.570   1.00   50.27 ? 2013 HOH A O   1 
HETATM 4519 O  O   . HOH F 4 .   ? 30.612 129.161 21.529  1.00   39.94 ? 2014 HOH A O   1 
HETATM 4520 O  O   . HOH F 4 .   ? 43.254 141.303 12.024  1.00   58.82 ? 2015 HOH A O   1 
HETATM 4521 O  O   . HOH F 4 .   ? 21.922 134.768 15.581  1.00   35.50 ? 2016 HOH A O   1 
HETATM 4522 O  O   . HOH F 4 .   ? 33.399 134.939 19.327  1.00   54.44 ? 2017 HOH A O   1 
HETATM 4523 O  O   . HOH F 4 .   ? 33.302 136.425 15.366  1.00   42.64 ? 2018 HOH A O   1 
HETATM 4524 O  O   . HOH F 4 .   ? 42.000 131.186 -1.627  1.00   43.27 ? 2019 HOH A O   1 
HETATM 4525 O  O   . HOH F 4 .   ? 46.977 131.625 3.928   1.00   38.96 ? 2020 HOH A O   1 
HETATM 4526 O  O   . HOH F 4 .   ? 45.655 129.608 -3.640  1.00   47.93 ? 2021 HOH A O   1 
HETATM 4527 O  O   . HOH F 4 .   ? 27.751 129.944 -1.198  1.00   28.03 ? 2022 HOH A O   1 
HETATM 4528 O  O   . HOH F 4 .   ? 20.100 124.256 -0.322  1.00   39.84 ? 2023 HOH A O   1 
HETATM 4529 O  O   . HOH F 4 .   ? 11.960 129.661 5.520   1.00   51.42 ? 2024 HOH A O   1 
HETATM 4530 O  O   . HOH F 4 .   ? 16.139 128.214 4.259   1.00   32.35 ? 2025 HOH A O   1 
HETATM 4531 O  O   . HOH F 4 .   ? 24.222 141.683 17.441  1.00   56.83 ? 2026 HOH A O   1 
HETATM 4532 O  O   . HOH F 4 .   ? 29.280 145.358 9.212   1.00   26.46 ? 2027 HOH A O   1 
HETATM 4533 O  O   . HOH F 4 .   ? 31.000 143.094 18.025  1.00   52.97 ? 2028 HOH A O   1 
HETATM 4534 O  O   . HOH F 4 .   ? 35.945 142.400 12.292  1.00   41.56 ? 2029 HOH A O   1 
HETATM 4535 O  O   . HOH F 4 .   ? 39.534 145.446 6.773   1.00   27.68 ? 2030 HOH A O   1 
HETATM 4536 O  O   . HOH F 4 .   ? 42.053 140.388 9.553   1.00   38.76 ? 2031 HOH A O   1 
HETATM 4537 O  O   . HOH F 4 .   ? 44.129 140.223 7.931   1.00   42.36 ? 2032 HOH A O   1 
HETATM 4538 O  O   . HOH F 4 .   ? 47.582 146.458 4.886   1.00   51.84 ? 2033 HOH A O   1 
HETATM 4539 O  O   . HOH F 4 .   ? 45.575 142.302 9.332   1.00   38.43 ? 2034 HOH A O   1 
HETATM 4540 O  O   . HOH F 4 .   ? 45.311 141.272 2.089   1.00   34.51 ? 2035 HOH A O   1 
HETATM 4541 O  O   . HOH F 4 .   ? 35.749 141.206 2.151   1.00   24.84 ? 2036 HOH A O   1 
HETATM 4542 O  O   . HOH F 4 .   ? 25.751 129.979 -6.308  1.00   41.37 ? 2037 HOH A O   1 
HETATM 4543 O  O   . HOH F 4 .   ? 28.614 131.809 -2.929  1.00   39.40 ? 2038 HOH A O   1 
HETATM 4544 O  O   . HOH F 4 .   ? 40.367 138.364 12.808  1.00   51.28 ? 2039 HOH A O   1 
HETATM 4545 O  O   . HOH F 4 .   ? 11.850 136.219 -13.040 1.00   37.97 ? 2040 HOH A O   1 
HETATM 4546 O  O   . HOH F 4 .   ? 12.925 135.703 -9.686  1.00   35.05 ? 2041 HOH A O   1 
HETATM 4547 O  O   . HOH F 4 .   ? 14.216 138.403 -14.721 1.00   44.21 ? 2042 HOH A O   1 
HETATM 4548 O  O   . HOH F 4 .   ? 28.648 136.468 -6.689  1.00   41.37 ? 2043 HOH A O   1 
HETATM 4549 O  O   . HOH F 4 .   ? 27.603 143.327 -6.126  1.00   49.68 ? 2044 HOH A O   1 
HETATM 4550 O  O   . HOH F 4 .   ? 27.971 141.421 -9.046  1.00   41.37 ? 2045 HOH A O   1 
HETATM 4551 O  O   . HOH F 4 .   ? 38.946 148.247 6.707   1.00   47.52 ? 2046 HOH A O   1 
HETATM 4552 O  O   . HOH F 4 .   ? 35.540 150.917 5.900   1.00   44.38 ? 2047 HOH A O   1 
HETATM 4553 O  O   . HOH F 4 .   ? 34.584 141.175 5.075   1.00   43.52 ? 2048 HOH A O   1 
HETATM 4554 O  O   . HOH F 4 .   ? 33.389 152.056 3.702   1.00   44.33 ? 2049 HOH A O   1 
HETATM 4555 O  O   . HOH F 4 .   ? 25.829 149.821 -3.427  1.00   33.02 ? 2050 HOH A O   1 
HETATM 4556 O  O   . HOH F 4 .   ? 21.808 146.676 -17.874 1.00   60.13 ? 2051 HOH A O   1 
HETATM 4557 O  O   . HOH F 4 .   ? 25.709 140.583 -17.433 1.00   44.93 ? 2052 HOH A O   1 
HETATM 4558 O  O   . HOH F 4 .   ? 27.623 142.410 -13.551 1.00   44.79 ? 2053 HOH A O   1 
HETATM 4559 O  O   . HOH F 4 .   ? 23.986 151.755 -3.988  1.00   39.48 ? 2054 HOH A O   1 
HETATM 4560 O  O   . HOH F 4 .   ? 35.127 152.170 -7.380  1.00   56.00 ? 2055 HOH A O   1 
HETATM 4561 O  O   . HOH F 4 .   ? 33.546 152.612 6.336   1.00   48.38 ? 2056 HOH A O   1 
HETATM 4562 O  O   . HOH F 4 .   ? 36.687 149.464 7.819   1.00   43.75 ? 2057 HOH A O   1 
HETATM 4563 O  O   . HOH F 4 .   ? 37.171 152.296 13.239  1.00   56.93 ? 2058 HOH A O   1 
HETATM 4564 O  O   . HOH F 4 .   ? 30.571 149.567 13.160  1.00   43.16 ? 2059 HOH A O   1 
HETATM 4565 O  O   . HOH F 4 .   ? 32.212 153.120 13.065  1.00   38.11 ? 2060 HOH A O   1 
HETATM 4566 O  O   . HOH F 4 .   ? 39.694 146.873 11.059  1.00   45.27 ? 2061 HOH A O   1 
HETATM 4567 O  O   . HOH F 4 .   ? 28.512 144.534 17.395  1.00   47.42 ? 2062 HOH A O   1 
HETATM 4568 O  O   . HOH F 4 .   ? 23.381 152.433 10.279  1.00   51.05 ? 2063 HOH A O   1 
HETATM 4569 O  O   . HOH F 4 .   ? 19.135 146.166 6.972   1.00   34.59 ? 2064 HOH A O   1 
HETATM 4570 O  O   . HOH F 4 .   ? 18.681 149.937 -8.930  1.00   39.07 ? 2065 HOH A O   1 
HETATM 4571 O  O   . HOH F 4 .   ? 10.487 139.966 -15.864 1.00   55.98 ? 2066 HOH A O   1 
HETATM 4572 O  O   . HOH F 4 .   ? 5.080  135.604 -9.540  1.00   53.30 ? 2067 HOH A O   1 
HETATM 4573 O  O   . HOH F 4 .   ? 14.949 128.977 -9.282  1.00   39.58 ? 2068 HOH A O   1 
HETATM 4574 O  O   . HOH F 4 .   ? 23.195 126.031 -4.912  1.00   52.40 ? 2069 HOH A O   1 
HETATM 4575 O  O   . HOH F 4 .   ? 32.698 135.840 -2.061  1.00   33.43 ? 2070 HOH A O   1 
HETATM 4576 O  O   . HOH F 4 .   ? 38.223 147.995 -6.517  1.00   39.25 ? 2071 HOH A O   1 
HETATM 4577 O  O   . HOH F 4 .   ? 42.498 143.381 -5.427  1.00   38.46 ? 2072 HOH A O   1 
HETATM 4578 O  O   . HOH F 4 .   ? 49.472 144.819 -4.079  1.00   55.82 ? 2073 HOH A O   1 
HETATM 4579 O  O   . HOH F 4 .   ? 50.912 137.253 -0.493  1.00   51.06 ? 2074 HOH A O   1 
HETATM 4580 O  O   . HOH F 4 .   ? 40.827 138.074 9.944   1.00   30.98 ? 2075 HOH A O   1 
HETATM 4581 O  O   . HOH F 4 .   ? 34.796 139.213 11.412  1.00   32.79 ? 2076 HOH A O   1 
HETATM 4582 O  O   . HOH F 4 .   ? 5.699  136.413 7.074   1.00   52.37 ? 2077 HOH A O   1 
HETATM 4583 O  O   . HOH F 4 .   ? 11.987 125.540 -0.205  1.00   44.65 ? 2078 HOH A O   1 
HETATM 4584 O  O   . HOH F 4 .   ? 5.458  133.760 -3.798  1.00   50.89 ? 2079 HOH A O   1 
HETATM 4585 O  O   . HOH F 4 .   ? 1.607  144.488 5.998   1.00   53.19 ? 2080 HOH A O   1 
HETATM 4586 O  O   . HOH F 4 .   ? 5.216  140.034 -3.675  1.00   35.48 ? 2081 HOH A O   1 
HETATM 4587 O  O   . HOH F 4 .   ? 29.435 156.525 -11.856 1.00   59.91 ? 2082 HOH A O   1 
HETATM 4588 O  O   . HOH F 4 .   ? 22.361 158.630 -21.652 1.00   46.66 ? 2083 HOH A O   1 
HETATM 4589 O  O   . HOH F 4 .   ? 17.733 147.585 -17.477 1.00   56.13 ? 2084 HOH A O   1 
HETATM 4590 O  O   . HOH F 4 .   ? 18.301 153.268 -6.079  1.00   42.32 ? 2085 HOH A O   1 
HETATM 4591 O  O   . HOH F 4 .   ? 37.785 153.310 -5.393  1.00   48.28 ? 2086 HOH A O   1 
HETATM 4592 O  O   . HOH F 4 .   ? 44.155 151.254 -0.404  1.00   45.14 ? 2087 HOH A O   1 
HETATM 4593 O  O   . HOH G 4 .   ? 16.244 172.609 26.422  1.00   48.86 ? 2001 HOH B O   1 
HETATM 4594 O  O   . HOH G 4 .   ? 14.178 164.753 23.965  1.00   50.66 ? 2002 HOH B O   1 
HETATM 4595 O  O   . HOH G 4 .   ? 22.058 156.798 8.959   1.00   46.42 ? 2003 HOH B O   1 
HETATM 4596 O  O   . HOH G 4 .   ? 19.038 159.710 17.660  1.00   54.46 ? 2004 HOH B O   1 
HETATM 4597 O  O   . HOH G 4 .   ? 21.683 158.043 20.355  1.00   54.82 ? 2005 HOH B O   1 
HETATM 4598 O  O   . HOH G 4 .   ? 22.049 163.258 31.267  1.00   58.45 ? 2006 HOH B O   1 
HETATM 4599 O  O   . HOH G 4 .   ? 27.207 170.594 28.933  1.00   53.51 ? 2007 HOH B O   1 
HETATM 4600 O  O   . HOH G 4 .   ? 12.946 189.200 20.287  1.00   53.24 ? 2008 HOH B O   1 
HETATM 4601 O  O   . HOH G 4 .   ? 32.694 162.551 8.101   1.00   41.35 ? 2009 HOH B O   1 
HETATM 4602 O  O   . HOH G 4 .   ? 34.588 159.585 5.227   1.00   51.57 ? 2010 HOH B O   1 
HETATM 4603 O  O   . HOH G 4 .   ? 37.564 159.676 12.993  1.00   54.11 ? 2011 HOH B O   1 
HETATM 4604 O  O   . HOH G 4 .   ? 33.425 161.887 5.692   1.00   52.01 ? 2012 HOH B O   1 
HETATM 4605 O  O   . HOH G 4 .   ? 35.742 162.012 5.284   1.00   52.92 ? 2013 HOH B O   1 
HETATM 4606 O  O   . HOH G 4 .   ? 19.847 168.259 9.495   1.00   39.98 ? 2014 HOH B O   1 
HETATM 4607 O  O   . HOH G 4 .   ? 10.577 166.974 9.672   1.00   49.36 ? 2015 HOH B O   1 
HETATM 4608 O  O   . HOH G 4 .   ? 8.609  171.417 14.840  1.00   37.02 ? 2016 HOH B O   1 
HETATM 4609 O  O   . HOH G 4 .   ? 15.198 175.896 18.421  1.00   43.50 ? 2017 HOH B O   1 
HETATM 4610 O  O   . HOH G 4 .   ? 28.596 179.220 21.667  1.00   27.89 ? 2018 HOH B O   1 
HETATM 4611 O  O   . HOH G 4 .   ? 37.663 174.524 18.427  1.00   35.53 ? 2019 HOH B O   1 
HETATM 4612 O  O   . HOH G 4 .   ? 37.328 168.537 20.334  1.00   40.21 ? 2020 HOH B O   1 
HETATM 4613 O  O   . HOH G 4 .   ? 40.726 169.061 12.812  1.00   43.32 ? 2021 HOH B O   1 
HETATM 4614 O  O   . HOH G 4 .   ? 41.355 168.724 19.921  1.00   47.10 ? 2022 HOH B O   1 
HETATM 4615 O  O   . HOH G 4 .   ? 38.987 167.657 18.547  1.00   47.59 ? 2023 HOH B O   1 
HETATM 4616 O  O   . HOH G 4 .   ? 44.965 171.925 16.372  1.00   50.42 ? 2024 HOH B O   1 
HETATM 4617 O  O   . HOH G 4 .   ? 32.413 173.543 13.537  1.00   27.22 ? 2025 HOH B O   1 
HETATM 4618 O  O   . HOH G 4 .   ? 34.420 167.319 23.345  1.00   52.93 ? 2026 HOH B O   1 
HETATM 4619 O  O   . HOH G 4 .   ? 9.393  173.482 4.731   1.00   48.17 ? 2027 HOH B O   1 
HETATM 4620 O  O   . HOH G 4 .   ? 12.276 184.585 -1.799  1.00   57.17 ? 2028 HOH B O   1 
HETATM 4621 O  O   . HOH G 4 .   ? 9.374  183.444 -0.437  1.00   32.81 ? 2029 HOH B O   1 
HETATM 4622 O  O   . HOH G 4 .   ? 26.324 180.773 6.208   1.00   45.79 ? 2030 HOH B O   1 
HETATM 4623 O  O   . HOH G 4 .   ? 25.656 179.342 3.064   1.00   43.31 ? 2031 HOH B O   1 
HETATM 4624 O  O   . HOH G 4 .   ? 28.346 176.890 2.888   1.00   55.50 ? 2032 HOH B O   1 
HETATM 4625 O  O   . HOH G 4 .   ? 13.575 192.595 20.530  1.00   55.12 ? 2033 HOH B O   1 
HETATM 4626 O  O   . HOH G 4 .   ? 14.205 190.554 18.411  1.00   41.70 ? 2034 HOH B O   1 
HETATM 4627 O  O   . HOH G 4 .   ? 14.652 191.727 17.178  1.00   52.11 ? 2035 HOH B O   1 
HETATM 4628 O  O   . HOH G 4 .   ? 38.400 177.492 18.816  1.00   51.00 ? 2036 HOH B O   1 
HETATM 4629 O  O   . HOH G 4 .   ? 35.603 183.916 16.863  1.00   34.54 ? 2037 HOH B O   1 
HETATM 4630 O  O   . HOH G 4 .   ? 36.585 181.386 18.525  1.00   44.21 ? 2038 HOH B O   1 
HETATM 4631 O  O   . HOH G 4 .   ? 27.919 186.804 9.952   1.00   27.18 ? 2039 HOH B O   1 
HETATM 4632 O  O   . HOH G 4 .   ? 25.950 181.136 -1.229  1.00   33.59 ? 2040 HOH B O   1 
HETATM 4633 O  O   . HOH G 4 .   ? 28.637 181.464 -2.687  1.00   48.63 ? 2041 HOH B O   1 
HETATM 4634 O  O   . HOH G 4 .   ? 23.567 180.998 -4.929  1.00   55.28 ? 2042 HOH B O   1 
HETATM 4635 O  O   . HOH G 4 .   ? 27.204 189.406 10.129  1.00   27.18 ? 2043 HOH B O   1 
HETATM 4636 O  O   . HOH G 4 .   ? 37.316 184.410 5.840   1.00   49.58 ? 2044 HOH B O   1 
HETATM 4637 O  O   . HOH G 4 .   ? 39.142 182.313 3.427   1.00   55.88 ? 2045 HOH B O   1 
HETATM 4638 O  O   . HOH G 4 .   ? 39.033 182.058 6.103   1.00   58.00 ? 2046 HOH B O   1 
HETATM 4639 O  O   . HOH G 4 .   ? 42.858 185.880 13.078  1.00   43.72 ? 2047 HOH B O   1 
HETATM 4640 O  O   . HOH G 4 .   ? 36.231 183.877 19.612  1.00   38.46 ? 2048 HOH B O   1 
HETATM 4641 O  O   . HOH G 4 .   ? 31.907 181.890 26.105  1.00   46.84 ? 2049 HOH B O   1 
HETATM 4642 O  O   . HOH G 4 .   ? 37.072 179.271 19.789  1.00   47.24 ? 2050 HOH B O   1 
HETATM 4643 O  O   . HOH G 4 .   ? 34.826 183.841 26.437  1.00   42.92 ? 2051 HOH B O   1 
HETATM 4644 O  O   . HOH G 4 .   ? 38.702 180.714 26.201  1.00   59.66 ? 2052 HOH B O   1 
HETATM 4645 O  O   . HOH G 4 .   ? 37.992 174.872 23.303  1.00   56.80 ? 2053 HOH B O   1 
HETATM 4646 O  O   . HOH G 4 .   ? 33.084 172.889 23.756  1.00   49.71 ? 2054 HOH B O   1 
HETATM 4647 O  O   . HOH G 4 .   ? 20.167 185.110 20.088  1.00   28.21 ? 2055 HOH B O   1 
HETATM 4648 O  O   . HOH G 4 .   ? 11.387 196.386 5.651   1.00   57.75 ? 2056 HOH B O   1 
HETATM 4649 O  O   . HOH G 4 .   ? 27.041 187.967 24.011  1.00   56.07 ? 2057 HOH B O   1 
HETATM 4650 O  O   . HOH G 4 .   ? 18.370 192.919 20.928  1.00   40.63 ? 2058 HOH B O   1 
HETATM 4651 O  O   . HOH G 4 .   ? 25.340 189.916 24.972  1.00   57.27 ? 2059 HOH B O   1 
HETATM 4652 O  O   . HOH G 4 .   ? 22.062 191.456 5.358   1.00   38.54 ? 2060 HOH B O   1 
HETATM 4653 O  O   . HOH G 4 .   ? 6.600  194.896 3.563   1.00   58.19 ? 2061 HOH B O   1 
HETATM 4654 O  O   . HOH G 4 .   ? 10.465 191.219 -1.530  1.00   53.61 ? 2062 HOH B O   1 
HETATM 4655 O  O   . HOH G 4 .   ? 14.923 192.029 0.073   1.00   45.93 ? 2063 HOH B O   1 
HETATM 4656 O  O   . HOH G 4 .   ? 2.924  185.135 2.870   1.00   51.71 ? 2064 HOH B O   1 
HETATM 4657 O  O   . HOH G 4 .   ? 9.825  181.832 2.727   1.00   29.90 ? 2065 HOH B O   1 
HETATM 4658 O  O   . HOH G 4 .   ? 8.231  175.101 1.628   1.00   41.65 ? 2066 HOH B O   1 
HETATM 4659 O  O   . HOH G 4 .   ? 13.688 167.783 5.410   1.00   54.93 ? 2067 HOH B O   1 
HETATM 4660 O  O   . HOH G 4 .   ? 31.623 164.725 7.339   1.00   39.76 ? 2068 HOH B O   1 
HETATM 4661 O  O   . HOH G 4 .   ? 36.283 179.625 2.989   1.00   46.87 ? 2069 HOH B O   1 
HETATM 4662 O  O   . HOH G 4 .   ? 37.917 179.826 5.995   1.00   37.29 ? 2070 HOH B O   1 
HETATM 4663 O  O   . HOH G 4 .   ? 39.354 173.331 5.938   1.00   36.56 ? 2071 HOH B O   1 
HETATM 4664 O  O   . HOH G 4 .   ? 34.994 167.204 20.440  1.00   38.04 ? 2072 HOH B O   1 
HETATM 4665 O  O   . HOH G 4 .   ? 30.387 170.803 22.468  1.00   37.53 ? 2073 HOH B O   1 
HETATM 4666 O  O   . HOH G 4 .   ? 5.820  177.373 17.649  1.00   43.90 ? 2074 HOH B O   1 
HETATM 4667 O  O   . HOH G 4 .   ? 9.594  183.513 21.520  1.00   45.12 ? 2075 HOH B O   1 
HETATM 4668 O  O   . HOH G 4 .   ? 4.206  180.102 18.453  1.00   51.28 ? 2076 HOH B O   1 
HETATM 4669 O  O   . HOH G 4 .   ? 3.402  183.469 19.220  1.00   42.87 ? 2077 HOH B O   1 
HETATM 4670 O  O   . HOH G 4 .   ? -0.722 176.353 6.381   1.00   52.51 ? 2078 HOH B O   1 
HETATM 4671 O  O   . HOH G 4 .   ? -1.726 178.793 0.397   1.00   57.15 ? 2079 HOH B O   1 
HETATM 4672 O  O   . HOH G 4 .   ? 1.600  185.575 5.530   1.00   43.39 ? 2080 HOH B O   1 
HETATM 4673 O  O   . HOH G 4 .   ? 3.364  186.554 10.815  1.00   40.47 ? 2081 HOH B O   1 
HETATM 4674 O  O   . HOH G 4 .   ? 2.163  185.825 18.524  1.00   44.24 ? 2082 HOH B O   1 
HETATM 4675 O  O   . HOH G 4 .   ? 5.133  188.418 9.340   1.00   37.78 ? 2083 HOH B O   1 
HETATM 4676 O  O   . HOH G 4 .   ? 11.808 198.895 16.584  1.00   51.52 ? 2084 HOH B O   1 
HETATM 4677 O  O   . HOH G 4 .   ? 14.758 203.634 18.261  1.00   59.12 ? 2085 HOH B O   1 
HETATM 4678 O  O   . HOH G 4 .   ? 14.108 193.458 17.513  1.00   44.86 ? 2086 HOH B O   1 
HETATM 4679 O  O   . HOH G 4 .   ? 13.361 195.087 18.279  1.00   49.78 ? 2087 HOH B O   1 
HETATM 4680 O  O   . HOH G 4 .   ? 24.123 199.850 12.338  1.00   39.41 ? 2088 HOH B O   1 
HETATM 4681 O  O   . HOH G 4 .   ? 20.985 207.321 24.164  1.00   50.67 ? 2089 HOH B O   1 
HETATM 4682 O  O   . HOH G 4 .   ? 23.445 201.769 24.038  1.00   48.45 ? 2090 HOH B O   1 
HETATM 4683 O  O   . HOH G 4 .   ? 31.375 195.162 8.282   1.00   42.45 ? 2091 HOH B O   1 
HETATM 4684 O  O   . HOH G 4 .   ? 38.649 194.541 15.837  1.00   50.73 ? 2092 HOH B O   1 
HETATM 4685 O  O   . HOH G 4 .   ? 39.105 202.030 18.123  1.00   41.37 ? 2093 HOH B O   1 
HETATM 4686 O  O   . HOH G 4 .   ? 34.261 192.082 2.217   1.00   42.29 ? 2094 HOH B O   1 
HETATM 4687 O  O   . HOH G 4 .   ? 35.706 187.238 -2.844  1.00   55.95 ? 2095 HOH B O   1 
HETATM 4688 O  O   . HOH G 4 .   ? 31.307 200.505 -2.136  1.00   38.47 ? 2096 HOH B O   1 
HETATM 4689 O  O   . HOH G 4 .   ? 22.808 189.710 -3.849  1.00   59.64 ? 2097 HOH B O   1 
HETATM 4690 O  O   . HOH G 4 .   ? 22.595 193.521 3.440   1.00   48.26 ? 2098 HOH B O   1 
HETATM 4691 O  O   . HOH G 4 .   ? 25.986 199.075 10.823  1.00   37.75 ? 2099 HOH B O   1 
HETATM 4692 O  O   . HOH G 4 .   ? 23.058 193.939 8.590   1.00   31.41 ? 2100 HOH B O   1 
HETATM 4693 O  O   . HOH G 4 .   ? 40.020 184.201 7.470   1.00   46.94 ? 2101 HOH B O   1 
HETATM 4694 O  O   . HOH G 4 .   ? 42.360 182.530 6.673   1.00   55.17 ? 2102 HOH B O   1 
HETATM 4695 O  O   . HOH G 4 .   ? 39.938 189.340 6.302   1.00   52.42 ? 2103 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   UNK 1   -6  ?   ?   ?   A . n 
A 1 2   GLU 2   -5  ?   ?   ?   A . n 
A 1 3   THR 3   -4  ?   ?   ?   A . n 
A 1 4   ALA 4   -3  ?   ?   ?   A . n 
A 1 5   ALA 5   -2  ?   ?   ?   A . n 
A 1 6   PHE 6   -1  ?   ?   ?   A . n 
A 1 7   ALA 7   1   ?   ?   ?   A . n 
A 1 8   ALA 8   2   ?   ?   ?   A . n 
A 1 9   LEU 9   3   ?   ?   ?   A . n 
A 1 10  ARG 10  4   ?   ?   ?   A . n 
A 1 11  LYS 11  5   ?   ?   ?   A . n 
A 1 12  PRO 12  6   6   PRO PRO A . n 
A 1 13  VAL 13  7   7   VAL VAL A . n 
A 1 14  ASP 14  8   8   ASP ASP A . n 
A 1 15  VAL 15  9   9   VAL VAL A . n 
A 1 16  ALA 16  10  10  ALA ALA A . n 
A 1 17  PHE 17  11  11  PHE PHE A . n 
A 1 18  GLY 18  12  12  GLY GLY A . n 
A 1 19  ARG 19  13  13  ARG ARG A . n 
A 1 20  ASN 20  14  14  ASN ASN A . n 
A 1 21  TYR 21  15  15  TYR TYR A . n 
A 1 22  VAL 22  16  16  VAL VAL A . n 
A 1 23  PRO 23  17  17  PRO PRO A . n 
A 1 24  THR 24  18  18  THR THR A . n 
A 1 25  TRP 25  19  19  TRP TRP A . n 
A 1 26  ALA 26  20  20  ALA ALA A . n 
A 1 27  PHE 27  21  21  PHE PHE A . n 
A 1 28  ASP 28  22  22  ASP ASP A . n 
A 1 29  HIS 29  23  23  HIS HIS A . n 
A 1 30  ILE 30  24  24  ILE ILE A . n 
A 1 31  LYS 31  25  25  LYS LYS A . n 
A 1 32  TYR 32  26  26  TYR TYR A . n 
A 1 33  PHE 33  27  27  PHE PHE A . n 
A 1 34  ASN 34  28  28  ASN ASN A . n 
A 1 35  GLY 35  29  29  GLY GLY A . n 
A 1 36  GLY 36  30  30  GLY GLY A . n 
A 1 37  ASN 37  31  31  ASN ASN A . n 
A 1 38  GLU 38  32  32  GLU GLU A . n 
A 1 39  ILE 39  33  33  ILE ILE A . n 
A 1 40  GLN 40  34  34  GLN GLN A . n 
A 1 41  LEU 41  35  35  LEU LEU A . n 
A 1 42  HIS 42  36  36  HIS HIS A . n 
A 1 43  LEU 43  37  37  LEU LEU A . n 
A 1 44  ASP 44  38  38  ASP ASP A . n 
A 1 45  LYS 45  39  39  LYS LYS A . n 
A 1 46  TYR 46  40  40  TYR TYR A . n 
A 1 47  THR 47  41  41  THR THR A . n 
A 1 48  GLY 48  42  42  GLY GLY A . n 
A 1 49  THR 49  43  43  THR THR A . n 
A 1 50  GLY 50  44  44  GLY GLY A . n 
A 1 51  PHE 51  45  45  PHE PHE A . n 
A 1 52  GLN 52  46  46  GLN GLN A . n 
A 1 53  SER 53  47  47  SER SER A . n 
A 1 54  LYS 54  48  48  LYS LYS A . n 
A 1 55  GLY 55  49  49  GLY GLY A . n 
A 1 56  SER 56  50  50  SER SER A . n 
A 1 57  TYR 57  51  51  TYR TYR A . n 
A 1 58  LEU 58  52  52  LEU LEU A . n 
A 1 59  PHE 59  53  53  PHE PHE A . n 
A 1 60  GLY 60  54  54  GLY GLY A . n 
A 1 61  HIS 61  55  55  HIS HIS A . n 
A 1 62  PHE 62  56  56  PHE PHE A . n 
A 1 63  SER 63  57  57  SER SER A . n 
A 1 64  MET 64  58  58  MET MET A . n 
A 1 65  GLN 65  59  59  GLN GLN A . n 
A 1 66  MET 66  60  60  MET MET A . n 
A 1 67  LYS 67  61  61  LYS LYS A . n 
A 1 68  LEU 68  62  62  LEU LEU A . n 
A 1 69  VAL 69  63  63  VAL VAL A . n 
A 1 70  PRO 70  64  64  PRO PRO A . n 
A 1 71  GLY 71  65  65  GLY GLY A . n 
A 1 72  ASP 72  66  66  ASP ASP A . n 
A 1 73  SER 73  67  67  SER SER A . n 
A 1 74  ALA 74  68  68  ALA ALA A . n 
A 1 75  GLY 75  69  69  GLY GLY A . n 
A 1 76  THR 76  70  70  THR THR A . n 
A 1 77  VAL 77  71  71  VAL VAL A . n 
A 1 78  THR 78  72  72  THR THR A . n 
A 1 79  ALA 79  73  73  ALA ALA A . n 
A 1 80  PHE 80  74  74  PHE PHE A . n 
A 1 81  TYR 81  75  75  TYR TYR A . n 
A 1 82  LEU 82  76  76  LEU LEU A . n 
A 1 83  SER 83  77  77  SER SER A . n 
A 1 84  SER 84  78  78  SER SER A . n 
A 1 85  GLN 85  79  79  GLN GLN A . n 
A 1 86  ASN 86  80  80  ASN ASN A . n 
A 1 87  SER 87  81  81  SER SER A . n 
A 1 88  GLU 88  82  82  GLU GLU A . n 
A 1 89  HIS 89  83  83  HIS HIS A . n 
A 1 90  ASP 90  84  84  ASP ASP A . n 
A 1 91  GLU 91  85  85  GLU GLU A . n 
A 1 92  ILE 92  86  86  ILE ILE A . n 
A 1 93  ASP 93  87  87  ASP ASP A . n 
A 1 94  PHE 94  88  88  PHE PHE A . n 
A 1 95  GLU 95  89  89  GLU GLU A . n 
A 1 96  PHE 96  90  90  PHE PHE A . n 
A 1 97  LEU 97  91  91  LEU LEU A . n 
A 1 98  GLY 98  92  92  GLY GLY A . n 
A 1 99  ASN 99  93  93  ASN ASN A . n 
A 1 100 ARG 100 94  94  ARG ARG A . n 
A 1 101 THR 101 95  95  THR THR A . n 
A 1 102 GLY 102 96  96  GLY GLY A . n 
A 1 103 GLN 103 97  97  GLN GLN A . n 
A 1 104 PRO 104 98  98  PRO PRO A . n 
A 1 105 TYR 105 99  99  TYR TYR A . n 
A 1 106 ILE 106 100 100 ILE ILE A . n 
A 1 107 LEU 107 101 101 LEU LEU A . n 
A 1 108 GLN 108 102 102 GLN GLN A . n 
A 1 109 THR 109 103 103 THR THR A . n 
A 1 110 ASN 110 104 104 ASN ASN A . n 
A 1 111 VAL 111 105 105 VAL VAL A . n 
A 1 112 PHE 112 106 106 PHE PHE A . n 
A 1 113 THR 113 107 107 THR THR A . n 
A 1 114 GLY 114 108 108 GLY GLY A . n 
A 1 115 GLY 115 109 109 GLY GLY A . n 
A 1 116 LYS 116 110 110 LYS LYS A . n 
A 1 117 GLY 117 111 111 GLY GLY A . n 
A 1 118 ASP 118 112 112 ASP ASP A . n 
A 1 119 ARG 119 113 113 ARG ARG A . n 
A 1 120 GLU 120 114 114 GLU GLU A . n 
A 1 121 GLN 121 115 115 GLN GLN A . n 
A 1 122 ARG 122 116 116 ARG ARG A . n 
A 1 123 ILE 123 117 117 ILE ILE A . n 
A 1 124 TYR 124 118 118 TYR TYR A . n 
A 1 125 LEU 125 119 119 LEU LEU A . n 
A 1 126 TRP 126 120 120 TRP TRP A . n 
A 1 127 PHE 127 121 121 PHE PHE A . n 
A 1 128 ASP 128 122 122 ASP ASP A . n 
A 1 129 PRO 129 123 123 PRO PRO A . n 
A 1 130 THR 130 124 124 THR THR A . n 
A 1 131 LYS 131 125 125 LYS LYS A . n 
A 1 132 GLU 132 126 126 GLU GLU A . n 
A 1 133 PHE 133 127 127 PHE PHE A . n 
A 1 134 HIS 134 128 128 HIS HIS A . n 
A 1 135 TYR 135 129 129 TYR TYR A . n 
A 1 136 TYR 136 130 130 TYR TYR A . n 
A 1 137 SER 137 131 131 SER SER A . n 
A 1 138 VAL 138 132 132 VAL VAL A . n 
A 1 139 LEU 139 133 133 LEU LEU A . n 
A 1 140 TRP 140 134 134 TRP TRP A . n 
A 1 141 ASN 141 135 135 ASN ASN A . n 
A 1 142 MET 142 136 136 MET MET A . n 
A 1 143 TYR 143 137 137 TYR TYR A . n 
A 1 144 MET 144 138 138 MET MET A . n 
A 1 145 ILE 145 139 139 ILE ILE A . n 
A 1 146 VAL 146 140 140 VAL VAL A . n 
A 1 147 PHE 147 141 141 PHE PHE A . n 
A 1 148 LEU 148 142 142 LEU LEU A . n 
A 1 149 VAL 149 143 143 VAL VAL A . n 
A 1 150 ASP 150 144 144 ASP ASP A . n 
A 1 151 ASP 151 145 145 ASP ASP A . n 
A 1 152 VAL 152 146 146 VAL VAL A . n 
A 1 153 PRO 153 147 147 PRO PRO A . n 
A 1 154 ILE 154 148 148 ILE ILE A . n 
A 1 155 ARG 155 149 149 ARG ARG A . n 
A 1 156 VAL 156 150 150 VAL VAL A . n 
A 1 157 PHE 157 151 151 PHE PHE A . n 
A 1 158 LYS 158 152 152 LYS LYS A . n 
A 1 159 ASN 159 153 153 ASN ASN A . n 
A 1 160 CYS 160 154 154 CYS CYS A . n 
A 1 161 LYS 161 155 155 LYS LYS A . n 
A 1 162 ASP 162 156 156 ASP ASP A . n 
A 1 163 LEU 163 157 157 LEU LEU A . n 
A 1 164 GLY 164 158 158 GLY GLY A . n 
A 1 165 VAL 165 159 159 VAL VAL A . n 
A 1 166 LYS 166 160 160 LYS LYS A . n 
A 1 167 PHE 167 161 161 PHE PHE A . n 
A 1 168 PRO 168 162 162 PRO PRO A . n 
A 1 169 PHE 169 163 163 PHE PHE A . n 
A 1 170 ASN 170 164 164 ASN ASN A . n 
A 1 171 GLN 171 165 165 GLN GLN A . n 
A 1 172 PRO 172 166 166 PRO PRO A . n 
A 1 173 MET 173 167 167 MET MET A . n 
A 1 174 LYS 174 168 168 LYS LYS A . n 
A 1 175 ILE 175 169 169 ILE ILE A . n 
A 1 176 TYR 176 170 170 TYR TYR A . n 
A 1 177 SER 177 171 171 SER SER A . n 
A 1 178 SER 178 172 172 SER SER A . n 
A 1 179 LEU 179 173 173 LEU LEU A . n 
A 1 180 TRP 180 174 174 TRP TRP A . n 
A 1 181 ASN 181 175 175 ASN ASN A . n 
A 1 182 ALA 182 176 176 ALA ALA A . n 
A 1 183 ASP 183 177 177 ASP ASP A . n 
A 1 184 ASP 184 178 178 ASP ASP A . n 
A 1 185 TRP 185 179 179 TRP TRP A . n 
A 1 186 ALA 186 180 180 ALA ALA A . n 
A 1 187 THR 187 181 181 THR THR A . n 
A 1 188 ARG 188 182 182 ARG ARG A . n 
A 1 189 GLY 189 183 183 GLY GLY A . n 
A 1 190 GLY 190 184 184 GLY GLY A . n 
A 1 191 LEU 191 185 185 LEU LEU A . n 
A 1 192 GLU 192 186 186 GLU GLU A . n 
A 1 193 LYS 193 187 187 LYS LYS A . n 
A 1 194 THR 194 188 188 THR THR A . n 
A 1 195 ASP 195 189 189 ASP ASP A . n 
A 1 196 TRP 196 190 190 TRP TRP A . n 
A 1 197 SER 197 191 191 SER SER A . n 
A 1 198 LYS 198 192 192 LYS LYS A . n 
A 1 199 ALA 199 193 193 ALA ALA A . n 
A 1 200 PRO 200 194 194 PRO PRO A . n 
A 1 201 PHE 201 195 195 PHE PHE A . n 
A 1 202 ILE 202 196 196 ILE ILE A . n 
A 1 203 ALA 203 197 197 ALA ALA A . n 
A 1 204 SER 204 198 198 SER SER A . n 
A 1 205 TYR 205 199 199 TYR TYR A . n 
A 1 206 ARG 206 200 200 ARG ARG A . n 
A 1 207 SER 207 201 201 SER SER A . n 
A 1 208 PHE 208 202 202 PHE PHE A . n 
A 1 209 HIS 209 203 203 HIS HIS A . n 
A 1 210 ILE 210 204 204 ILE ILE A . n 
A 1 211 ASP 211 205 205 ASP ASP A . n 
A 1 212 GLY 212 206 206 GLY GLY A . n 
A 1 213 CYS 213 207 207 CYS CYS A . n 
A 1 214 GLU 214 208 208 GLU GLU A . n 
A 1 215 ALA 215 209 209 ALA ALA A . n 
A 1 216 SER 216 210 210 SER SER A . n 
A 1 217 VAL 217 211 211 VAL VAL A . n 
A 1 218 GLU 218 212 212 GLU GLU A . n 
A 1 219 ALA 219 213 213 ALA ALA A . n 
A 1 220 LYS 220 214 214 LYS LYS A . n 
A 1 221 PHE 221 215 215 PHE PHE A . n 
A 1 222 CYS 222 216 216 CYS CYS A . n 
A 1 223 ALA 223 217 217 ALA ALA A . n 
A 1 224 THR 224 218 218 THR THR A . n 
A 1 225 GLN 225 219 219 GLN GLN A . n 
A 1 226 GLY 226 220 220 GLY GLY A . n 
A 1 227 ALA 227 221 221 ALA ALA A . n 
A 1 228 ARG 228 222 222 ARG ARG A . n 
A 1 229 TRP 229 223 223 TRP TRP A . n 
A 1 230 TRP 230 224 224 TRP TRP A . n 
A 1 231 ASP 231 225 225 ASP ASP A . n 
A 1 232 GLN 232 226 226 GLN GLN A . n 
A 1 233 LYS 233 227 227 LYS LYS A . n 
A 1 234 GLU 234 228 228 GLU GLU A . n 
A 1 235 PHE 235 229 229 PHE PHE A . n 
A 1 236 GLN 236 230 230 GLN GLN A . n 
A 1 237 ASP 237 231 231 ASP ASP A . n 
A 1 238 LEU 238 232 232 LEU LEU A . n 
A 1 239 ASP 239 233 233 ASP ASP A . n 
A 1 240 ALA 240 234 234 ALA ALA A . n 
A 1 241 PHE 241 235 235 PHE PHE A . n 
A 1 242 GLN 242 236 236 GLN GLN A . n 
A 1 243 TYR 243 237 237 TYR TYR A . n 
A 1 244 ARG 244 238 238 ARG ARG A . n 
A 1 245 ARG 245 239 239 ARG ARG A . n 
A 1 246 LEU 246 240 240 LEU LEU A . n 
A 1 247 SER 247 241 241 SER SER A . n 
A 1 248 TRP 248 242 242 TRP TRP A . n 
A 1 249 VAL 249 243 243 VAL VAL A . n 
A 1 250 ARG 250 244 244 ARG ARG A . n 
A 1 251 GLN 251 245 245 GLN GLN A . n 
A 1 252 LYS 252 246 246 LYS LYS A . n 
A 1 253 TYR 253 247 247 TYR TYR A . n 
A 1 254 THR 254 248 248 THR THR A . n 
A 1 255 ILE 255 249 249 ILE ILE A . n 
A 1 256 TYR 256 250 250 TYR TYR A . n 
A 1 257 ASN 257 251 251 ASN ASN A . n 
A 1 258 TYR 258 252 252 TYR TYR A . n 
A 1 259 CYS 259 253 253 CYS CYS A . n 
A 1 260 THR 260 254 254 THR THR A . n 
A 1 261 ASP 261 255 255 ASP ASP A . n 
A 1 262 ARG 262 256 256 ARG ARG A . n 
A 1 263 SER 263 257 257 SER SER A . n 
A 1 264 ARG 264 258 258 ARG ARG A . n 
A 1 265 TYR 265 259 259 TYR TYR A . n 
A 1 266 PRO 266 260 260 PRO PRO A . n 
A 1 267 SER 267 261 261 SER SER A . n 
A 1 268 MET 268 262 262 MET MET A . n 
A 1 269 PRO 269 263 263 PRO PRO A . n 
A 1 270 PRO 270 264 264 PRO PRO A . n 
A 1 271 GLU 271 265 265 GLU GLU A . n 
A 1 272 CYS 272 266 266 CYS CYS A . n 
A 1 273 LYS 273 267 267 LYS LYS A . n 
A 1 274 ARG 274 268 268 ARG ARG A . n 
A 1 275 ASP 275 269 269 ASP ASP A . n 
A 1 276 ARG 276 270 270 ARG ARG A . n 
A 1 277 ASP 277 271 271 ASP ASP A . n 
A 1 278 ILE 278 272 272 ILE ILE A . n 
B 1 1   UNK 1   -6  ?   ?   ?   B . n 
B 1 2   GLU 2   -5  ?   ?   ?   B . n 
B 1 3   THR 3   -4  ?   ?   ?   B . n 
B 1 4   ALA 4   -3  ?   ?   ?   B . n 
B 1 5   ALA 5   -2  ?   ?   ?   B . n 
B 1 6   PHE 6   -1  ?   ?   ?   B . n 
B 1 7   ALA 7   1   ?   ?   ?   B . n 
B 1 8   ALA 8   2   ?   ?   ?   B . n 
B 1 9   LEU 9   3   ?   ?   ?   B . n 
B 1 10  ARG 10  4   ?   ?   ?   B . n 
B 1 11  LYS 11  5   ?   ?   ?   B . n 
B 1 12  PRO 12  6   ?   ?   ?   B . n 
B 1 13  VAL 13  7   ?   ?   ?   B . n 
B 1 14  ASP 14  8   ?   ?   ?   B . n 
B 1 15  VAL 15  9   9   VAL VAL B . n 
B 1 16  ALA 16  10  10  ALA ALA B . n 
B 1 17  PHE 17  11  11  PHE PHE B . n 
B 1 18  GLY 18  12  12  GLY GLY B . n 
B 1 19  ARG 19  13  13  ARG ARG B . n 
B 1 20  ASN 20  14  14  ASN ASN B . n 
B 1 21  TYR 21  15  15  TYR TYR B . n 
B 1 22  VAL 22  16  16  VAL VAL B . n 
B 1 23  PRO 23  17  17  PRO PRO B . n 
B 1 24  THR 24  18  18  THR THR B . n 
B 1 25  TRP 25  19  19  TRP TRP B . n 
B 1 26  ALA 26  20  20  ALA ALA B . n 
B 1 27  PHE 27  21  21  PHE PHE B . n 
B 1 28  ASP 28  22  22  ASP ASP B . n 
B 1 29  HIS 29  23  23  HIS HIS B . n 
B 1 30  ILE 30  24  24  ILE ILE B . n 
B 1 31  LYS 31  25  25  LYS LYS B . n 
B 1 32  TYR 32  26  26  TYR TYR B . n 
B 1 33  PHE 33  27  27  PHE PHE B . n 
B 1 34  ASN 34  28  28  ASN ASN B . n 
B 1 35  GLY 35  29  29  GLY GLY B . n 
B 1 36  GLY 36  30  30  GLY GLY B . n 
B 1 37  ASN 37  31  31  ASN ASN B . n 
B 1 38  GLU 38  32  32  GLU GLU B . n 
B 1 39  ILE 39  33  33  ILE ILE B . n 
B 1 40  GLN 40  34  34  GLN GLN B . n 
B 1 41  LEU 41  35  35  LEU LEU B . n 
B 1 42  HIS 42  36  36  HIS HIS B . n 
B 1 43  LEU 43  37  37  LEU LEU B . n 
B 1 44  ASP 44  38  38  ASP ASP B . n 
B 1 45  LYS 45  39  39  LYS LYS B . n 
B 1 46  TYR 46  40  40  TYR TYR B . n 
B 1 47  THR 47  41  41  THR THR B . n 
B 1 48  GLY 48  42  42  GLY GLY B . n 
B 1 49  THR 49  43  43  THR THR B . n 
B 1 50  GLY 50  44  44  GLY GLY B . n 
B 1 51  PHE 51  45  45  PHE PHE B . n 
B 1 52  GLN 52  46  46  GLN GLN B . n 
B 1 53  SER 53  47  47  SER SER B . n 
B 1 54  LYS 54  48  48  LYS LYS B . n 
B 1 55  GLY 55  49  49  GLY GLY B . n 
B 1 56  SER 56  50  50  SER SER B . n 
B 1 57  TYR 57  51  51  TYR TYR B . n 
B 1 58  LEU 58  52  52  LEU LEU B . n 
B 1 59  PHE 59  53  53  PHE PHE B . n 
B 1 60  GLY 60  54  54  GLY GLY B . n 
B 1 61  HIS 61  55  55  HIS HIS B . n 
B 1 62  PHE 62  56  56  PHE PHE B . n 
B 1 63  SER 63  57  57  SER SER B . n 
B 1 64  MET 64  58  58  MET MET B . n 
B 1 65  GLN 65  59  59  GLN GLN B . n 
B 1 66  MET 66  60  60  MET MET B . n 
B 1 67  LYS 67  61  61  LYS LYS B . n 
B 1 68  LEU 68  62  62  LEU LEU B . n 
B 1 69  VAL 69  63  63  VAL VAL B . n 
B 1 70  PRO 70  64  64  PRO PRO B . n 
B 1 71  GLY 71  65  65  GLY GLY B . n 
B 1 72  ASP 72  66  66  ASP ASP B . n 
B 1 73  SER 73  67  67  SER SER B . n 
B 1 74  ALA 74  68  68  ALA ALA B . n 
B 1 75  GLY 75  69  69  GLY GLY B . n 
B 1 76  THR 76  70  70  THR THR B . n 
B 1 77  VAL 77  71  71  VAL VAL B . n 
B 1 78  THR 78  72  72  THR THR B . n 
B 1 79  ALA 79  73  73  ALA ALA B . n 
B 1 80  PHE 80  74  74  PHE PHE B . n 
B 1 81  TYR 81  75  75  TYR TYR B . n 
B 1 82  LEU 82  76  76  LEU LEU B . n 
B 1 83  SER 83  77  77  SER SER B . n 
B 1 84  SER 84  78  78  SER SER B . n 
B 1 85  GLN 85  79  79  GLN GLN B . n 
B 1 86  ASN 86  80  80  ASN ASN B . n 
B 1 87  SER 87  81  81  SER SER B . n 
B 1 88  GLU 88  82  82  GLU GLU B . n 
B 1 89  HIS 89  83  83  HIS HIS B . n 
B 1 90  ASP 90  84  84  ASP ASP B . n 
B 1 91  GLU 91  85  85  GLU GLU B . n 
B 1 92  ILE 92  86  86  ILE ILE B . n 
B 1 93  ASP 93  87  87  ASP ASP B . n 
B 1 94  PHE 94  88  88  PHE PHE B . n 
B 1 95  GLU 95  89  89  GLU GLU B . n 
B 1 96  PHE 96  90  90  PHE PHE B . n 
B 1 97  LEU 97  91  91  LEU LEU B . n 
B 1 98  GLY 98  92  92  GLY GLY B . n 
B 1 99  ASN 99  93  93  ASN ASN B . n 
B 1 100 ARG 100 94  94  ARG ARG B . n 
B 1 101 THR 101 95  95  THR THR B . n 
B 1 102 GLY 102 96  96  GLY GLY B . n 
B 1 103 GLN 103 97  97  GLN GLN B . n 
B 1 104 PRO 104 98  98  PRO PRO B . n 
B 1 105 TYR 105 99  99  TYR TYR B . n 
B 1 106 ILE 106 100 100 ILE ILE B . n 
B 1 107 LEU 107 101 101 LEU LEU B . n 
B 1 108 GLN 108 102 102 GLN GLN B . n 
B 1 109 THR 109 103 103 THR THR B . n 
B 1 110 ASN 110 104 104 ASN ASN B . n 
B 1 111 VAL 111 105 105 VAL VAL B . n 
B 1 112 PHE 112 106 106 PHE PHE B . n 
B 1 113 THR 113 107 107 THR THR B . n 
B 1 114 GLY 114 108 108 GLY GLY B . n 
B 1 115 GLY 115 109 109 GLY GLY B . n 
B 1 116 LYS 116 110 110 LYS LYS B . n 
B 1 117 GLY 117 111 111 GLY GLY B . n 
B 1 118 ASP 118 112 112 ASP ASP B . n 
B 1 119 ARG 119 113 113 ARG ARG B . n 
B 1 120 GLU 120 114 114 GLU GLU B . n 
B 1 121 GLN 121 115 115 GLN GLN B . n 
B 1 122 ARG 122 116 116 ARG ARG B . n 
B 1 123 ILE 123 117 117 ILE ILE B . n 
B 1 124 TYR 124 118 118 TYR TYR B . n 
B 1 125 LEU 125 119 119 LEU LEU B . n 
B 1 126 TRP 126 120 120 TRP TRP B . n 
B 1 127 PHE 127 121 121 PHE PHE B . n 
B 1 128 ASP 128 122 122 ASP ASP B . n 
B 1 129 PRO 129 123 123 PRO PRO B . n 
B 1 130 THR 130 124 124 THR THR B . n 
B 1 131 LYS 131 125 125 LYS LYS B . n 
B 1 132 GLU 132 126 126 GLU GLU B . n 
B 1 133 PHE 133 127 127 PHE PHE B . n 
B 1 134 HIS 134 128 128 HIS HIS B . n 
B 1 135 TYR 135 129 129 TYR TYR B . n 
B 1 136 TYR 136 130 130 TYR TYR B . n 
B 1 137 SER 137 131 131 SER SER B . n 
B 1 138 VAL 138 132 132 VAL VAL B . n 
B 1 139 LEU 139 133 133 LEU LEU B . n 
B 1 140 TRP 140 134 134 TRP TRP B . n 
B 1 141 ASN 141 135 135 ASN ASN B . n 
B 1 142 MET 142 136 136 MET MET B . n 
B 1 143 TYR 143 137 137 TYR TYR B . n 
B 1 144 MET 144 138 138 MET MET B . n 
B 1 145 ILE 145 139 139 ILE ILE B . n 
B 1 146 VAL 146 140 140 VAL VAL B . n 
B 1 147 PHE 147 141 141 PHE PHE B . n 
B 1 148 LEU 148 142 142 LEU LEU B . n 
B 1 149 VAL 149 143 143 VAL VAL B . n 
B 1 150 ASP 150 144 144 ASP ASP B . n 
B 1 151 ASP 151 145 145 ASP ASP B . n 
B 1 152 VAL 152 146 146 VAL VAL B . n 
B 1 153 PRO 153 147 147 PRO PRO B . n 
B 1 154 ILE 154 148 148 ILE ILE B . n 
B 1 155 ARG 155 149 149 ARG ARG B . n 
B 1 156 VAL 156 150 150 VAL VAL B . n 
B 1 157 PHE 157 151 151 PHE PHE B . n 
B 1 158 LYS 158 152 152 LYS LYS B . n 
B 1 159 ASN 159 153 153 ASN ASN B . n 
B 1 160 CYS 160 154 154 CYS CYS B . n 
B 1 161 LYS 161 155 155 LYS LYS B . n 
B 1 162 ASP 162 156 156 ASP ASP B . n 
B 1 163 LEU 163 157 157 LEU LEU B . n 
B 1 164 GLY 164 158 158 GLY GLY B . n 
B 1 165 VAL 165 159 159 VAL VAL B . n 
B 1 166 LYS 166 160 160 LYS LYS B . n 
B 1 167 PHE 167 161 161 PHE PHE B . n 
B 1 168 PRO 168 162 162 PRO PRO B . n 
B 1 169 PHE 169 163 163 PHE PHE B . n 
B 1 170 ASN 170 164 164 ASN ASN B . n 
B 1 171 GLN 171 165 165 GLN GLN B . n 
B 1 172 PRO 172 166 166 PRO PRO B . n 
B 1 173 MET 173 167 167 MET MET B . n 
B 1 174 LYS 174 168 168 LYS LYS B . n 
B 1 175 ILE 175 169 169 ILE ILE B . n 
B 1 176 TYR 176 170 170 TYR TYR B . n 
B 1 177 SER 177 171 171 SER SER B . n 
B 1 178 SER 178 172 172 SER SER B . n 
B 1 179 LEU 179 173 173 LEU LEU B . n 
B 1 180 TRP 180 174 174 TRP TRP B . n 
B 1 181 ASN 181 175 175 ASN ASN B . n 
B 1 182 ALA 182 176 176 ALA ALA B . n 
B 1 183 ASP 183 177 177 ASP ASP B . n 
B 1 184 ASP 184 178 178 ASP ASP B . n 
B 1 185 TRP 185 179 179 TRP TRP B . n 
B 1 186 ALA 186 180 180 ALA ALA B . n 
B 1 187 THR 187 181 181 THR THR B . n 
B 1 188 ARG 188 182 182 ARG ARG B . n 
B 1 189 GLY 189 183 183 GLY GLY B . n 
B 1 190 GLY 190 184 184 GLY GLY B . n 
B 1 191 LEU 191 185 185 LEU LEU B . n 
B 1 192 GLU 192 186 186 GLU GLU B . n 
B 1 193 LYS 193 187 187 LYS LYS B . n 
B 1 194 THR 194 188 188 THR THR B . n 
B 1 195 ASP 195 189 189 ASP ASP B . n 
B 1 196 TRP 196 190 190 TRP TRP B . n 
B 1 197 SER 197 191 191 SER SER B . n 
B 1 198 LYS 198 192 192 LYS LYS B . n 
B 1 199 ALA 199 193 193 ALA ALA B . n 
B 1 200 PRO 200 194 194 PRO PRO B . n 
B 1 201 PHE 201 195 195 PHE PHE B . n 
B 1 202 ILE 202 196 196 ILE ILE B . n 
B 1 203 ALA 203 197 197 ALA ALA B . n 
B 1 204 SER 204 198 198 SER SER B . n 
B 1 205 TYR 205 199 199 TYR TYR B . n 
B 1 206 ARG 206 200 200 ARG ARG B . n 
B 1 207 SER 207 201 201 SER SER B . n 
B 1 208 PHE 208 202 202 PHE PHE B . n 
B 1 209 HIS 209 203 203 HIS HIS B . n 
B 1 210 ILE 210 204 204 ILE ILE B . n 
B 1 211 ASP 211 205 205 ASP ASP B . n 
B 1 212 GLY 212 206 206 GLY GLY B . n 
B 1 213 CYS 213 207 207 CYS CYS B . n 
B 1 214 GLU 214 208 208 GLU GLU B . n 
B 1 215 ALA 215 209 209 ALA ALA B . n 
B 1 216 SER 216 210 210 SER SER B . n 
B 1 217 VAL 217 211 211 VAL VAL B . n 
B 1 218 GLU 218 212 212 GLU GLU B . n 
B 1 219 ALA 219 213 213 ALA ALA B . n 
B 1 220 LYS 220 214 214 LYS LYS B . n 
B 1 221 PHE 221 215 215 PHE PHE B . n 
B 1 222 CYS 222 216 216 CYS CYS B . n 
B 1 223 ALA 223 217 217 ALA ALA B . n 
B 1 224 THR 224 218 218 THR THR B . n 
B 1 225 GLN 225 219 219 GLN GLN B . n 
B 1 226 GLY 226 220 220 GLY GLY B . n 
B 1 227 ALA 227 221 221 ALA ALA B . n 
B 1 228 ARG 228 222 222 ARG ARG B . n 
B 1 229 TRP 229 223 223 TRP TRP B . n 
B 1 230 TRP 230 224 224 TRP TRP B . n 
B 1 231 ASP 231 225 225 ASP ASP B . n 
B 1 232 GLN 232 226 226 GLN GLN B . n 
B 1 233 LYS 233 227 227 LYS LYS B . n 
B 1 234 GLU 234 228 228 GLU GLU B . n 
B 1 235 PHE 235 229 229 PHE PHE B . n 
B 1 236 GLN 236 230 230 GLN GLN B . n 
B 1 237 ASP 237 231 231 ASP ASP B . n 
B 1 238 LEU 238 232 232 LEU LEU B . n 
B 1 239 ASP 239 233 233 ASP ASP B . n 
B 1 240 ALA 240 234 234 ALA ALA B . n 
B 1 241 PHE 241 235 235 PHE PHE B . n 
B 1 242 GLN 242 236 236 GLN GLN B . n 
B 1 243 TYR 243 237 237 TYR TYR B . n 
B 1 244 ARG 244 238 238 ARG ARG B . n 
B 1 245 ARG 245 239 239 ARG ARG B . n 
B 1 246 LEU 246 240 240 LEU LEU B . n 
B 1 247 SER 247 241 241 SER SER B . n 
B 1 248 TRP 248 242 242 TRP TRP B . n 
B 1 249 VAL 249 243 243 VAL VAL B . n 
B 1 250 ARG 250 244 244 ARG ARG B . n 
B 1 251 GLN 251 245 245 GLN GLN B . n 
B 1 252 LYS 252 246 246 LYS LYS B . n 
B 1 253 TYR 253 247 247 TYR TYR B . n 
B 1 254 THR 254 248 248 THR THR B . n 
B 1 255 ILE 255 249 249 ILE ILE B . n 
B 1 256 TYR 256 250 250 TYR TYR B . n 
B 1 257 ASN 257 251 251 ASN ASN B . n 
B 1 258 TYR 258 252 252 TYR TYR B . n 
B 1 259 CYS 259 253 253 CYS CYS B . n 
B 1 260 THR 260 254 254 THR THR B . n 
B 1 261 ASP 261 255 255 ASP ASP B . n 
B 1 262 ARG 262 256 256 ARG ARG B . n 
B 1 263 SER 263 257 257 SER SER B . n 
B 1 264 ARG 264 258 258 ARG ARG B . n 
B 1 265 TYR 265 259 259 TYR TYR B . n 
B 1 266 PRO 266 260 260 PRO PRO B . n 
B 1 267 SER 267 261 261 SER SER B . n 
B 1 268 MET 268 262 262 MET MET B . n 
B 1 269 PRO 269 263 263 PRO PRO B . n 
B 1 270 PRO 270 264 264 PRO PRO B . n 
B 1 271 GLU 271 265 265 GLU GLU B . n 
B 1 272 CYS 272 266 266 CYS CYS B . n 
B 1 273 LYS 273 267 267 LYS LYS B . n 
B 1 274 ARG 274 268 268 ARG ARG B . n 
B 1 275 ASP 275 269 269 ASP ASP B . n 
B 1 276 ARG 276 270 270 ARG ARG B . n 
B 1 277 ASP 277 271 271 ASP ASP B . n 
B 1 278 ILE 278 272 272 ILE ILE B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 AU  1   1276 1276 AU  AU  B . 
F 4 HOH 1   2001 2001 HOH HOH A . 
F 4 HOH 2   2002 2002 HOH HOH A . 
F 4 HOH 3   2003 2003 HOH HOH A . 
F 4 HOH 4   2004 2004 HOH HOH A . 
F 4 HOH 5   2005 2005 HOH HOH A . 
F 4 HOH 6   2006 2006 HOH HOH A . 
F 4 HOH 7   2007 2007 HOH HOH A . 
F 4 HOH 8   2008 2008 HOH HOH A . 
F 4 HOH 9   2009 2009 HOH HOH A . 
F 4 HOH 10  2010 2010 HOH HOH A . 
F 4 HOH 11  2011 2011 HOH HOH A . 
F 4 HOH 12  2012 2012 HOH HOH A . 
F 4 HOH 13  2013 2013 HOH HOH A . 
F 4 HOH 14  2014 2014 HOH HOH A . 
F 4 HOH 15  2015 2015 HOH HOH A . 
F 4 HOH 16  2016 2016 HOH HOH A . 
F 4 HOH 17  2017 2017 HOH HOH A . 
F 4 HOH 18  2018 2018 HOH HOH A . 
F 4 HOH 19  2019 2019 HOH HOH A . 
F 4 HOH 20  2020 2020 HOH HOH A . 
F 4 HOH 21  2021 2021 HOH HOH A . 
F 4 HOH 22  2022 2022 HOH HOH A . 
F 4 HOH 23  2023 2023 HOH HOH A . 
F 4 HOH 24  2024 2024 HOH HOH A . 
F 4 HOH 25  2025 2025 HOH HOH A . 
F 4 HOH 26  2026 2026 HOH HOH A . 
F 4 HOH 27  2027 2027 HOH HOH A . 
F 4 HOH 28  2028 2028 HOH HOH A . 
F 4 HOH 29  2029 2029 HOH HOH A . 
F 4 HOH 30  2030 2030 HOH HOH A . 
F 4 HOH 31  2031 2031 HOH HOH A . 
F 4 HOH 32  2032 2032 HOH HOH A . 
F 4 HOH 33  2033 2033 HOH HOH A . 
F 4 HOH 34  2034 2034 HOH HOH A . 
F 4 HOH 35  2035 2035 HOH HOH A . 
F 4 HOH 36  2036 2036 HOH HOH A . 
F 4 HOH 37  2037 2037 HOH HOH A . 
F 4 HOH 38  2038 2038 HOH HOH A . 
F 4 HOH 39  2039 2039 HOH HOH A . 
F 4 HOH 40  2040 2040 HOH HOH A . 
F 4 HOH 41  2041 2041 HOH HOH A . 
F 4 HOH 42  2042 2042 HOH HOH A . 
F 4 HOH 43  2043 2043 HOH HOH A . 
F 4 HOH 44  2044 2044 HOH HOH A . 
F 4 HOH 45  2045 2045 HOH HOH A . 
F 4 HOH 46  2046 2046 HOH HOH A . 
F 4 HOH 47  2047 2047 HOH HOH A . 
F 4 HOH 48  2048 2048 HOH HOH A . 
F 4 HOH 49  2049 2049 HOH HOH A . 
F 4 HOH 50  2050 2050 HOH HOH A . 
F 4 HOH 51  2051 2051 HOH HOH A . 
F 4 HOH 52  2052 2052 HOH HOH A . 
F 4 HOH 53  2053 2053 HOH HOH A . 
F 4 HOH 54  2054 2054 HOH HOH A . 
F 4 HOH 55  2055 2055 HOH HOH A . 
F 4 HOH 56  2056 2056 HOH HOH A . 
F 4 HOH 57  2057 2057 HOH HOH A . 
F 4 HOH 58  2058 2058 HOH HOH A . 
F 4 HOH 59  2059 2059 HOH HOH A . 
F 4 HOH 60  2060 2060 HOH HOH A . 
F 4 HOH 61  2061 2061 HOH HOH A . 
F 4 HOH 62  2062 2062 HOH HOH A . 
F 4 HOH 63  2063 2063 HOH HOH A . 
F 4 HOH 64  2064 2064 HOH HOH A . 
F 4 HOH 65  2065 2065 HOH HOH A . 
F 4 HOH 66  2066 2066 HOH HOH A . 
F 4 HOH 67  2067 2067 HOH HOH A . 
F 4 HOH 68  2068 2068 HOH HOH A . 
F 4 HOH 69  2069 2069 HOH HOH A . 
F 4 HOH 70  2070 2070 HOH HOH A . 
F 4 HOH 71  2071 2071 HOH HOH A . 
F 4 HOH 72  2072 2072 HOH HOH A . 
F 4 HOH 73  2073 2073 HOH HOH A . 
F 4 HOH 74  2074 2074 HOH HOH A . 
F 4 HOH 75  2075 2075 HOH HOH A . 
F 4 HOH 76  2076 2076 HOH HOH A . 
F 4 HOH 77  2077 2077 HOH HOH A . 
F 4 HOH 78  2078 2078 HOH HOH A . 
F 4 HOH 79  2079 2079 HOH HOH A . 
F 4 HOH 80  2080 2080 HOH HOH A . 
F 4 HOH 81  2081 2081 HOH HOH A . 
F 4 HOH 82  2082 2082 HOH HOH A . 
F 4 HOH 83  2083 2083 HOH HOH A . 
F 4 HOH 84  2084 2084 HOH HOH A . 
F 4 HOH 85  2085 2085 HOH HOH A . 
F 4 HOH 86  2086 2086 HOH HOH A . 
F 4 HOH 87  2087 2087 HOH HOH A . 
G 4 HOH 1   2001 2001 HOH HOH B . 
G 4 HOH 2   2002 2002 HOH HOH B . 
G 4 HOH 3   2003 2003 HOH HOH B . 
G 4 HOH 4   2004 2004 HOH HOH B . 
G 4 HOH 5   2005 2005 HOH HOH B . 
G 4 HOH 6   2006 2006 HOH HOH B . 
G 4 HOH 7   2007 2007 HOH HOH B . 
G 4 HOH 8   2008 2008 HOH HOH B . 
G 4 HOH 9   2009 2009 HOH HOH B . 
G 4 HOH 10  2010 2010 HOH HOH B . 
G 4 HOH 11  2011 2011 HOH HOH B . 
G 4 HOH 12  2012 2012 HOH HOH B . 
G 4 HOH 13  2013 2013 HOH HOH B . 
G 4 HOH 14  2014 2014 HOH HOH B . 
G 4 HOH 15  2015 2015 HOH HOH B . 
G 4 HOH 16  2016 2016 HOH HOH B . 
G 4 HOH 17  2017 2017 HOH HOH B . 
G 4 HOH 18  2018 2018 HOH HOH B . 
G 4 HOH 19  2019 2019 HOH HOH B . 
G 4 HOH 20  2020 2020 HOH HOH B . 
G 4 HOH 21  2021 2021 HOH HOH B . 
G 4 HOH 22  2022 2022 HOH HOH B . 
G 4 HOH 23  2023 2023 HOH HOH B . 
G 4 HOH 24  2024 2024 HOH HOH B . 
G 4 HOH 25  2025 2025 HOH HOH B . 
G 4 HOH 26  2026 2026 HOH HOH B . 
G 4 HOH 27  2027 2027 HOH HOH B . 
G 4 HOH 28  2028 2028 HOH HOH B . 
G 4 HOH 29  2029 2029 HOH HOH B . 
G 4 HOH 30  2030 2030 HOH HOH B . 
G 4 HOH 31  2031 2031 HOH HOH B . 
G 4 HOH 32  2032 2032 HOH HOH B . 
G 4 HOH 33  2033 2033 HOH HOH B . 
G 4 HOH 34  2034 2034 HOH HOH B . 
G 4 HOH 35  2035 2035 HOH HOH B . 
G 4 HOH 36  2036 2036 HOH HOH B . 
G 4 HOH 37  2037 2037 HOH HOH B . 
G 4 HOH 38  2038 2038 HOH HOH B . 
G 4 HOH 39  2039 2039 HOH HOH B . 
G 4 HOH 40  2040 2040 HOH HOH B . 
G 4 HOH 41  2041 2041 HOH HOH B . 
G 4 HOH 42  2042 2042 HOH HOH B . 
G 4 HOH 43  2043 2043 HOH HOH B . 
G 4 HOH 44  2044 2044 HOH HOH B . 
G 4 HOH 45  2045 2045 HOH HOH B . 
G 4 HOH 46  2046 2046 HOH HOH B . 
G 4 HOH 47  2047 2047 HOH HOH B . 
G 4 HOH 48  2048 2048 HOH HOH B . 
G 4 HOH 49  2049 2049 HOH HOH B . 
G 4 HOH 50  2050 2050 HOH HOH B . 
G 4 HOH 51  2051 2051 HOH HOH B . 
G 4 HOH 52  2052 2052 HOH HOH B . 
G 4 HOH 53  2053 2053 HOH HOH B . 
G 4 HOH 54  2054 2054 HOH HOH B . 
G 4 HOH 55  2055 2055 HOH HOH B . 
G 4 HOH 56  2056 2056 HOH HOH B . 
G 4 HOH 57  2057 2057 HOH HOH B . 
G 4 HOH 58  2058 2058 HOH HOH B . 
G 4 HOH 59  2059 2059 HOH HOH B . 
G 4 HOH 60  2060 2060 HOH HOH B . 
G 4 HOH 61  2061 2061 HOH HOH B . 
G 4 HOH 62  2062 2062 HOH HOH B . 
G 4 HOH 63  2063 2063 HOH HOH B . 
G 4 HOH 64  2064 2064 HOH HOH B . 
G 4 HOH 65  2065 2065 HOH HOH B . 
G 4 HOH 66  2066 2066 HOH HOH B . 
G 4 HOH 67  2067 2067 HOH HOH B . 
G 4 HOH 68  2068 2068 HOH HOH B . 
G 4 HOH 69  2069 2069 HOH HOH B . 
G 4 HOH 70  2070 2070 HOH HOH B . 
G 4 HOH 71  2071 2071 HOH HOH B . 
G 4 HOH 72  2072 2072 HOH HOH B . 
G 4 HOH 73  2073 2073 HOH HOH B . 
G 4 HOH 74  2074 2074 HOH HOH B . 
G 4 HOH 75  2075 2075 HOH HOH B . 
G 4 HOH 76  2076 2076 HOH HOH B . 
G 4 HOH 77  2077 2077 HOH HOH B . 
G 4 HOH 78  2078 2078 HOH HOH B . 
G 4 HOH 79  2079 2079 HOH HOH B . 
G 4 HOH 80  2080 2080 HOH HOH B . 
G 4 HOH 81  2081 2081 HOH HOH B . 
G 4 HOH 82  2082 2082 HOH HOH B . 
G 4 HOH 83  2083 2083 HOH HOH B . 
G 4 HOH 84  2084 2084 HOH HOH B . 
G 4 HOH 85  2085 2085 HOH HOH B . 
G 4 HOH 86  2086 2086 HOH HOH B . 
G 4 HOH 87  2087 2087 HOH HOH B . 
G 4 HOH 88  2088 2088 HOH HOH B . 
G 4 HOH 89  2089 2089 HOH HOH B . 
G 4 HOH 90  2090 2090 HOH HOH B . 
G 4 HOH 91  2091 2091 HOH HOH B . 
G 4 HOH 92  2092 2092 HOH HOH B . 
G 4 HOH 93  2093 2093 HOH HOH B . 
G 4 HOH 94  2094 2094 HOH HOH B . 
G 4 HOH 95  2095 2095 HOH HOH B . 
G 4 HOH 96  2096 2096 HOH HOH B . 
G 4 HOH 97  2097 2097 HOH HOH B . 
G 4 HOH 98  2098 2098 HOH HOH B . 
G 4 HOH 99  2099 2099 HOH HOH B . 
G 4 HOH 100 2100 2100 HOH HOH B . 
G 4 HOH 101 2101 2101 HOH HOH B . 
G 4 HOH 102 2102 2102 HOH HOH B . 
G 4 HOH 103 2103 2103 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 99 A ASN 93 ? ASN 'GLYCOSYLATION SITE' 
2 B ASN 99 B ASN 93 ? ASN 'GLYCOSYLATION SITE' 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS monomeric 1 
2 author_and_software_defined_assembly PQS monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,F   
2 1 B,D,E,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-03-18 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Atomic model'              
5 4 'Structure model' 'Data collection'           
6 4 'Structure model' 'Derived calculations'      
7 4 'Structure model' Other                       
8 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' entity                        
4  4 'Structure model' pdbx_branch_scheme            
5  4 'Structure model' pdbx_chem_comp_identifier     
6  4 'Structure model' pdbx_database_status          
7  4 'Structure model' pdbx_entity_branch            
8  4 'Structure model' pdbx_entity_branch_descriptor 
9  4 'Structure model' pdbx_entity_branch_link       
10 4 'Structure model' pdbx_entity_branch_list       
11 4 'Structure model' pdbx_entity_nonpoly           
12 4 'Structure model' pdbx_nonpoly_scheme           
13 4 'Structure model' pdbx_struct_assembly_gen      
14 4 'Structure model' pdbx_unobs_or_zero_occ_atoms  
15 4 'Structure model' struct_asym                   
16 4 'Structure model' struct_conn                   
17 4 'Structure model' struct_site                   
18 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.auth_asym_id'                
2  4 'Structure model' '_atom_site.auth_seq_id'                 
3  4 'Structure model' '_atom_site.label_asym_id'               
4  4 'Structure model' '_atom_site.label_entity_id'             
5  4 'Structure model' '_chem_comp.name'                        
6  4 'Structure model' '_chem_comp.type'                        
7  4 'Structure model' '_pdbx_database_status.status_code_sf'   
8  4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 
9  4 'Structure model' '_struct_conn.pdbx_dist_value'           
10 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'    
11 4 'Structure model' '_struct_conn.pdbx_role'                 
12 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'        
13 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'        
14 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'         
15 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'       
16 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'       
17 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'       
18 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'        
19 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'        
20 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'        
21 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'         
22 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'       
23 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.1.19 ? 1 
DENZO     'data reduction' .      ? 2 
SCALEPACK 'data scaling'   .      ? 3 
RSPS      phasing          .      ? 4 
MLPHARE   phasing          .      ? 5 
SHARP     phasing          .      ? 6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 SG B CYS 154  ? ? AU  B AU  1276 ? ? 1.62 
2 1 O  A PRO 260  ? ? O   A HOH 2083 ? ? 1.67 
3 1 O  B HOH 2034 ? ? O   B HOH 2035 ? ? 1.76 
4 1 O  A HOH 2007 ? ? O   A HOH 2008 ? ? 1.81 
5 1 O  B HOH 2035 ? ? O   B HOH 2086 ? ? 1.85 
6 1 O  B HOH 2086 ? ? O   B HOH 2087 ? ? 1.95 
7 1 SG B CYS 154  ? ? NH1 B ARG 268  ? ? 2.14 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2014 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     2096 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   6_655 
_pdbx_validate_symm_contact.dist              1.93 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 94  ? ? CZ A ARG 94  ? ? NH2 A ARG 94  ? ? 116.87 120.30 -3.43 0.50 N 
2 1 CB B ASP 145 ? ? CG B ASP 145 ? ? OD1 B ASP 145 ? ? 124.34 118.30 6.04  0.90 N 
3 1 NE B ARG 239 ? ? CZ B ARG 239 ? ? NH1 B ARG 239 ? ? 123.84 120.30 3.54  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 53  ? ? 75.24   151.34  
2 1 ASP A 144 ? ? 48.03   -117.46 
3 1 TRP A 179 ? ? -149.22 -17.19  
4 1 SER A 201 ? ? 78.55   -64.96  
5 1 PHE B 53  ? ? 83.18   149.31  
6 1 ASP B 144 ? ? 45.24   -118.49 
7 1 TRP B 179 ? ? -149.78 -12.52  
8 1 SER B 201 ? ? 83.39   -54.63  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A UNK -6 ? A UNK 1  
2  1 Y 1 A GLU -5 ? A GLU 2  
3  1 Y 1 A THR -4 ? A THR 3  
4  1 Y 1 A ALA -3 ? A ALA 4  
5  1 Y 1 A ALA -2 ? A ALA 5  
6  1 Y 1 A PHE -1 ? A PHE 6  
7  1 Y 1 A ALA 1  ? A ALA 7  
8  1 Y 1 A ALA 2  ? A ALA 8  
9  1 Y 1 A LEU 3  ? A LEU 9  
10 1 Y 1 A ARG 4  ? A ARG 10 
11 1 Y 1 A LYS 5  ? A LYS 11 
12 1 Y 1 B UNK -6 ? B UNK 1  
13 1 Y 1 B GLU -5 ? B GLU 2  
14 1 Y 1 B THR -4 ? B THR 3  
15 1 Y 1 B ALA -3 ? B ALA 4  
16 1 Y 1 B ALA -2 ? B ALA 5  
17 1 Y 1 B PHE -1 ? B PHE 6  
18 1 Y 1 B ALA 1  ? B ALA 7  
19 1 Y 1 B ALA 2  ? B ALA 8  
20 1 Y 1 B LEU 3  ? B LEU 9  
21 1 Y 1 B ARG 4  ? B ARG 10 
22 1 Y 1 B LYS 5  ? B LYS 11 
23 1 Y 1 B PRO 6  ? B PRO 12 
24 1 Y 1 B VAL 7  ? B VAL 13 
25 1 Y 1 B ASP 8  ? B ASP 14 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 A NAG 1273 n 
C 2 NAG 2 C NAG 2 A NAG 1274 n 
C 2 BMA 3 C BMA 3 A BMA 1275 n 
D 2 NAG 1 D NAG 1 B NAG 1273 n 
D 2 NAG 2 D NAG 2 B NAG 1274 n 
D 2 BMA 3 D BMA 3 B BMA 1275 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpb                         
BMA 'COMMON NAME'                         GMML     1.0 b-D-mannopyranose              
BMA 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Manp                       
BMA 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DManpb1-4DGlcpNAcb1-4DGlcpNAcb1-                                             'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5]/1-1-2/a4-b1_b4-c1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{}}}}'        LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 BMA C1 O1 2 NAG O4 HO4 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 BMA 3 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'GOLD ION' AU  
4 water      HOH 
#