data_1UST
# 
_entry.id   1UST 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1UST         
PDBE  EBI-14057    
WWPDB D_1290014057 
BMRB  6161         
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB  1USS unspecified 'YEAST HISTONE H1 GLOBULAR DOMAIN II, HHO1P GII, SOLUTION NMR STRUCTURES' 
BMRB 6161 unspecified .                                                                         
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1UST 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2003-11-30 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ali, T.'       1 
'Coles, P.'     2 
'Stevens, T.J.' 3 
'Stott, K.'     4 
'Thomas, J.O.'  5 
# 
_citation.id                        primary 
_citation.title                     
'Two Homologous Domains of Similar Structure But Different Stability in the Yeast Linker Histone, Hho1P' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            338 
_citation.page_first                139 
_citation.page_last                 ? 
_citation.year                      2004 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15050829 
_citation.pdbx_database_id_DOI      10.1016/J.JMB.2004.02.046 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ali, T.'       1 ? 
primary 'Coles, P.'     2 ? 
primary 'Stevens, T.J.' 3 ? 
primary 'Stott, K.'     4 ? 
primary 'Thomas, J.O.'  5 ? 
# 
_cell.entry_id           1UST 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1UST 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'HISTONE H1' 
_entity.formula_weight             10277.848 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'GLOBULAR DOMAIN I, RESIDUES 38-130' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASNFDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAK
KKSPEVKKEKEVS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KKEEASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASNFDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAK
KKSPEVKKEKEVS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  LYS n 
1 2  LYS n 
1 3  GLU n 
1 4  GLU n 
1 5  ALA n 
1 6  SER n 
1 7  SER n 
1 8  LYS n 
1 9  SER n 
1 10 TYR n 
1 11 ARG n 
1 12 GLU n 
1 13 LEU n 
1 14 ILE n 
1 15 ILE n 
1 16 GLU n 
1 17 GLY n 
1 18 LEU n 
1 19 THR n 
1 20 ALA n 
1 21 LEU n 
1 22 LYS n 
1 23 GLU n 
1 24 ARG n 
1 25 LYS n 
1 26 GLY n 
1 27 SER n 
1 28 SER n 
1 29 ARG n 
1 30 PRO n 
1 31 ALA n 
1 32 LEU n 
1 33 LYS n 
1 34 LYS n 
1 35 PHE n 
1 36 ILE n 
1 37 LYS n 
1 38 GLU n 
1 39 ASN n 
1 40 TYR n 
1 41 PRO n 
1 42 ILE n 
1 43 VAL n 
1 44 GLY n 
1 45 SER n 
1 46 ALA n 
1 47 SER n 
1 48 ASN n 
1 49 PHE n 
1 50 ASP n 
1 51 LEU n 
1 52 TYR n 
1 53 PHE n 
1 54 ASN n 
1 55 ASN n 
1 56 ALA n 
1 57 ILE n 
1 58 LYS n 
1 59 LYS n 
1 60 GLY n 
1 61 VAL n 
1 62 GLU n 
1 63 ALA n 
1 64 GLY n 
1 65 ASP n 
1 66 PHE n 
1 67 GLU n 
1 68 GLN n 
1 69 PRO n 
1 70 LYS n 
1 71 GLY n 
1 72 PRO n 
1 73 ALA n 
1 74 GLY n 
1 75 ALA n 
1 76 VAL n 
1 77 LYS n 
1 78 LEU n 
1 79 ALA n 
1 80 LYS n 
1 81 LYS n 
1 82 LYS n 
1 83 SER n 
1 84 PRO n 
1 85 GLU n 
1 86 VAL n 
1 87 LYS n 
1 88 LYS n 
1 89 GLU n 
1 90 LYS n 
1 91 GLU n 
1 92 VAL n 
1 93 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;BAKER'S YEAST
;
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'SACCHAROMYCES CEREVISIAE' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET17B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    H1_YEAST 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P53551 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1UST 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 93 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P53551 
_struct_ref_seq.db_align_beg                  38 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  130 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       38 
_struct_ref_seq.pdbx_auth_seq_align_end       130 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            288 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               1 
_pdbx_nmr_exptl_sample_conditions.pH                     7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             DRX 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    500 
# 
_pdbx_nmr_refine.entry_id           1UST 
_pdbx_nmr_refine.method             'DISTANCE GEOMETRY, BOND ANGLE GEOMETRY' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                             1UST 
_pdbx_nmr_ensemble.conformers_calculated_total_number   100 
_pdbx_nmr_ensemble.conformers_submitted_total_number    10 
_pdbx_nmr_ensemble.conformer_selection_criteria         'MINIMUM ENERGY' 
# 
_pdbx_nmr_representative.entry_id             1UST 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           CNS  ? 
'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ, RICE,SIMONSON,WARREN' 1 
'structure solution' ARIA ? ? 2 
'structure solution' CNS  ? ? 3 
# 
_exptl.entry_id          1UST 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1UST 
_struct.title                     'YEAST HISTONE H1 GLOBULAR DOMAIN I, HHO1P GI, SOLUTION NMR STRUCTURES' 
_struct.pdbx_descriptor           'HISTONE H1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UST 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            'DNA BINDING PROTEIN, LINKER HISTONE, DNA BINDING DOMAIN, WINGED HELIX FOLD' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 9  ? THR A 19 ? SER A 46 THR A 56  1 ? 11 
HELX_P HELX_P2 2 ARG A 29 ? TYR A 40 ? ARG A 66 TYR A 77  1 ? 12 
HELX_P HELX_P3 3 TYR A 40 ? SER A 45 ? TYR A 77 SER A 82  1 ? 6  
HELX_P HELX_P4 4 ASN A 48 ? ALA A 63 ? ASN A 85 ALA A 100 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 SER A 27 ? SER A 28 ? SER A 64  SER A 65  
AA 2 ALA A 75 ? LEU A 78 ? ALA A 112 LEU A 115 
AA 3 PHE A 66 ? GLU A 67 ? PHE A 103 GLU A 104 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N SER A 27 ? N SER A 64  O VAL A 76 ? O VAL A 113 
AA 2 3 N LYS A 77 ? N LYS A 114 O GLU A 67 ? O GLU A 104 
# 
_database_PDB_matrix.entry_id          1UST 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1UST 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . LYS A 1 2  ? 16.171  -0.355  11.816  1.00 0.00 ? 39  LYS A N    1  
ATOM 2     C CA   . LYS A 1 2  ? 16.937  -0.105  13.059  1.00 0.00 ? 39  LYS A CA   1  
ATOM 3     C C    . LYS A 1 2  ? 18.412  -0.450  12.876  1.00 0.00 ? 39  LYS A C    1  
ATOM 4     O O    . LYS A 1 2  ? 19.291  0.271   13.345  1.00 0.00 ? 39  LYS A O    1  
ATOM 5     C CB   . LYS A 1 2  ? 16.320  -0.921  14.205  1.00 0.00 ? 39  LYS A CB   1  
ATOM 6     C CG   . LYS A 1 2  ? 16.225  -2.415  13.929  1.00 0.00 ? 39  LYS A CG   1  
ATOM 7     C CD   . LYS A 1 2  ? 15.669  -3.170  15.125  1.00 0.00 ? 39  LYS A CD   1  
ATOM 8     C CE   . LYS A 1 2  ? 15.556  -4.660  14.850  1.00 0.00 ? 39  LYS A CE   1  
ATOM 9     N NZ   . LYS A 1 2  ? 14.593  -4.954  13.758  1.00 0.00 ? 39  LYS A NZ   1  
ATOM 10    H H1   . LYS A 1 2  ? 16.709  -0.008  10.989  1.00 0.00 ? 39  LYS A H1   1  
ATOM 11    H H2   . LYS A 1 2  ? 15.989  -1.369  11.695  1.00 0.00 ? 39  LYS A H2   1  
ATOM 12    H H3   . LYS A 1 2  ? 15.257  0.145   11.852  1.00 0.00 ? 39  LYS A H3   1  
ATOM 13    H HA   . LYS A 1 2  ? 16.857  0.944   13.296  1.00 0.00 ? 39  LYS A HA   1  
ATOM 14    H HB2  . LYS A 1 2  ? 16.921  -0.781  15.091  1.00 0.00 ? 39  LYS A HB2  1  
ATOM 15    H HB3  . LYS A 1 2  ? 15.324  -0.549  14.396  1.00 0.00 ? 39  LYS A HB3  1  
ATOM 16    H HG2  . LYS A 1 2  ? 15.574  -2.574  13.081  1.00 0.00 ? 39  LYS A HG2  1  
ATOM 17    H HG3  . LYS A 1 2  ? 17.212  -2.791  13.702  1.00 0.00 ? 39  LYS A HG3  1  
ATOM 18    H HD2  . LYS A 1 2  ? 16.326  -3.021  15.968  1.00 0.00 ? 39  LYS A HD2  1  
ATOM 19    H HD3  . LYS A 1 2  ? 14.689  -2.780  15.359  1.00 0.00 ? 39  LYS A HD3  1  
ATOM 20    H HE2  . LYS A 1 2  ? 16.527  -5.037  14.573  1.00 0.00 ? 39  LYS A HE2  1  
ATOM 21    H HE3  . LYS A 1 2  ? 15.223  -5.155  15.753  1.00 0.00 ? 39  LYS A HE3  1  
ATOM 22    H HZ1  . LYS A 1 2  ? 13.696  -4.447  13.924  1.00 0.00 ? 39  LYS A HZ1  1  
ATOM 23    H HZ2  . LYS A 1 2  ? 14.987  -4.648  12.840  1.00 0.00 ? 39  LYS A HZ2  1  
ATOM 24    H HZ3  . LYS A 1 2  ? 14.396  -5.978  13.714  1.00 0.00 ? 39  LYS A HZ3  1  
ATOM 25    N N    . GLU A 1 3  ? 18.683  -1.522  12.143  1.00 0.00 ? 40  GLU A N    1  
ATOM 26    C CA   . GLU A 1 3  ? 20.049  -1.927  11.866  1.00 0.00 ? 40  GLU A CA   1  
ATOM 27    C C    . GLU A 1 3  ? 20.097  -2.656  10.536  1.00 0.00 ? 40  GLU A C    1  
ATOM 28    O O    . GLU A 1 3  ? 20.830  -2.278  9.627   1.00 0.00 ? 40  GLU A O    1  
ATOM 29    C CB   . GLU A 1 3  ? 20.569  -2.832  12.986  1.00 0.00 ? 40  GLU A CB   1  
ATOM 30    C CG   . GLU A 1 3  ? 22.031  -3.199  12.833  1.00 0.00 ? 40  GLU A CG   1  
ATOM 31    C CD   . GLU A 1 3  ? 22.911  -1.974  12.743  1.00 0.00 ? 40  GLU A CD   1  
ATOM 32    O OE1  . GLU A 1 3  ? 22.987  -1.219  13.733  1.00 0.00 ? 40  GLU A OE1  1  
ATOM 33    O OE2  . GLU A 1 3  ? 23.510  -1.746  11.675  1.00 0.00 ? 40  GLU A OE2  1  
ATOM 34    H H    . GLU A 1 3  ? 17.948  -2.039  11.753  1.00 0.00 ? 40  GLU A H    1  
ATOM 35    H HA   . GLU A 1 3  ? 20.662  -1.040  11.807  1.00 0.00 ? 40  GLU A HA   1  
ATOM 36    H HB2  . GLU A 1 3  ? 20.443  -2.325  13.930  1.00 0.00 ? 40  GLU A HB2  1  
ATOM 37    H HB3  . GLU A 1 3  ? 19.989  -3.744  12.995  1.00 0.00 ? 40  GLU A HB3  1  
ATOM 38    H HG2  . GLU A 1 3  ? 22.337  -3.786  13.685  1.00 0.00 ? 40  GLU A HG2  1  
ATOM 39    H HG3  . GLU A 1 3  ? 22.154  -3.781  11.931  1.00 0.00 ? 40  GLU A HG3  1  
ATOM 40    N N    . GLU A 1 4  ? 19.228  -3.640  10.406  1.00 0.00 ? 41  GLU A N    1  
ATOM 41    C CA   . GLU A 1 4  ? 19.063  -4.381  9.174   1.00 0.00 ? 41  GLU A CA   1  
ATOM 42    C C    . GLU A 1 4  ? 18.488  -3.477  8.085   1.00 0.00 ? 41  GLU A C    1  
ATOM 43    O O    . GLU A 1 4  ? 17.688  -2.578  8.367   1.00 0.00 ? 41  GLU A O    1  
ATOM 44    C CB   . GLU A 1 4  ? 18.143  -5.594  9.400   1.00 0.00 ? 41  GLU A CB   1  
ATOM 45    C CG   . GLU A 1 4  ? 16.688  -5.240  9.707   1.00 0.00 ? 41  GLU A CG   1  
ATOM 46    C CD   . GLU A 1 4  ? 16.474  -4.613  11.078  1.00 0.00 ? 41  GLU A CD   1  
ATOM 47    O OE1  . GLU A 1 4  ? 17.401  -4.633  11.910  1.00 0.00 ? 41  GLU A OE1  1  
ATOM 48    O OE2  . GLU A 1 4  ? 15.365  -4.105  11.335  1.00 0.00 ? 41  GLU A OE2  1  
ATOM 49    H H    . GLU A 1 4  ? 18.636  -3.857  11.165  1.00 0.00 ? 41  GLU A H    1  
ATOM 50    H HA   . GLU A 1 4  ? 20.037  -4.729  8.863   1.00 0.00 ? 41  GLU A HA   1  
ATOM 51    H HB2  . GLU A 1 4  ? 18.158  -6.208  8.514   1.00 0.00 ? 41  GLU A HB2  1  
ATOM 52    H HB3  . GLU A 1 4  ? 18.529  -6.168  10.230  1.00 0.00 ? 41  GLU A HB3  1  
ATOM 53    H HG2  . GLU A 1 4  ? 16.341  -4.544  8.958   1.00 0.00 ? 41  GLU A HG2  1  
ATOM 54    H HG3  . GLU A 1 4  ? 16.098  -6.144  9.648   1.00 0.00 ? 41  GLU A HG3  1  
ATOM 55    N N    . ALA A 1 5  ? 18.869  -3.733  6.845   1.00 0.00 ? 42  ALA A N    1  
ATOM 56    C CA   . ALA A 1 5  ? 18.366  -2.968  5.712   1.00 0.00 ? 42  ALA A CA   1  
ATOM 57    C C    . ALA A 1 5  ? 17.000  -3.489  5.264   1.00 0.00 ? 42  ALA A C    1  
ATOM 58    O O    . ALA A 1 5  ? 16.725  -3.599  4.067   1.00 0.00 ? 42  ALA A O    1  
ATOM 59    C CB   . ALA A 1 5  ? 19.361  -3.013  4.562   1.00 0.00 ? 42  ALA A CB   1  
ATOM 60    H H    . ALA A 1 5  ? 19.474  -4.485  6.679   1.00 0.00 ? 42  ALA A H    1  
ATOM 61    H HA   . ALA A 1 5  ? 18.262  -1.938  6.025   1.00 0.00 ? 42  ALA A HA   1  
ATOM 62    H HB1  . ALA A 1 5  ? 19.378  -4.008  4.140   1.00 0.00 ? 42  ALA A HB1  1  
ATOM 63    H HB2  . ALA A 1 5  ? 20.345  -2.759  4.927   1.00 0.00 ? 42  ALA A HB2  1  
ATOM 64    H HB3  . ALA A 1 5  ? 19.066  -2.304  3.802   1.00 0.00 ? 42  ALA A HB3  1  
ATOM 65    N N    . SER A 1 6  ? 16.145  -3.797  6.233   1.00 0.00 ? 43  SER A N    1  
ATOM 66    C CA   . SER A 1 6  ? 14.808  -4.297  5.954   1.00 0.00 ? 43  SER A CA   1  
ATOM 67    C C    . SER A 1 6  ? 13.983  -4.344  7.240   1.00 0.00 ? 43  SER A C    1  
ATOM 68    O O    . SER A 1 6  ? 14.127  -3.473  8.101   1.00 0.00 ? 43  SER A O    1  
ATOM 69    C CB   . SER A 1 6  ? 14.885  -5.688  5.310   1.00 0.00 ? 43  SER A CB   1  
ATOM 70    O OG   . SER A 1 6  ? 15.597  -6.599  6.133   1.00 0.00 ? 43  SER A OG   1  
ATOM 71    H H    . SER A 1 6  ? 16.420  -3.674  7.165   1.00 0.00 ? 43  SER A H    1  
ATOM 72    H HA   . SER A 1 6  ? 14.337  -3.613  5.262   1.00 0.00 ? 43  SER A HA   1  
ATOM 73    H HB2  . SER A 1 6  ? 13.887  -6.068  5.158   1.00 0.00 ? 43  SER A HB2  1  
ATOM 74    H HB3  . SER A 1 6  ? 15.390  -5.613  4.357   1.00 0.00 ? 43  SER A HB3  1  
ATOM 75    H HG   . SER A 1 6  ? 16.546  -6.393  6.096   1.00 0.00 ? 43  SER A HG   1  
ATOM 76    N N    . SER A 1 7  ? 13.157  -5.380  7.381   1.00 0.00 ? 44  SER A N    1  
ATOM 77    C CA   . SER A 1 7  ? 12.335  -5.589  8.572   1.00 0.00 ? 44  SER A CA   1  
ATOM 78    C C    . SER A 1 7  ? 11.430  -4.391  8.840   1.00 0.00 ? 44  SER A C    1  
ATOM 79    O O    . SER A 1 7  ? 11.054  -4.122  9.980   1.00 0.00 ? 44  SER A O    1  
ATOM 80    C CB   . SER A 1 7  ? 13.216  -5.891  9.791   1.00 0.00 ? 44  SER A CB   1  
ATOM 81    O OG   . SER A 1 7  ? 12.445  -6.342  10.897  1.00 0.00 ? 44  SER A OG   1  
ATOM 82    H H    . SER A 1 7  ? 13.122  -6.053  6.669   1.00 0.00 ? 44  SER A H    1  
ATOM 83    H HA   . SER A 1 7  ? 11.708  -6.443  8.380   1.00 0.00 ? 44  SER A HA   1  
ATOM 84    H HB2  . SER A 1 7  ? 13.930  -6.659  9.534   1.00 0.00 ? 44  SER A HB2  1  
ATOM 85    H HB3  . SER A 1 7  ? 13.745  -4.994  10.081  1.00 0.00 ? 44  SER A HB3  1  
ATOM 86    H HG   . SER A 1 7  ? 11.553  -5.969  10.842  1.00 0.00 ? 44  SER A HG   1  
ATOM 87    N N    . LYS A 1 8  ? 10.949  -3.784  7.768   1.00 0.00 ? 45  LYS A N    1  
ATOM 88    C CA   . LYS A 1 8  ? 9.913   -2.780  7.883   1.00 0.00 ? 45  LYS A CA   1  
ATOM 89    C C    . LYS A 1 8  ? 8.574   -3.430  7.588   1.00 0.00 ? 45  LYS A C    1  
ATOM 90    O O    . LYS A 1 8  ? 8.410   -4.045  6.533   1.00 0.00 ? 45  LYS A O    1  
ATOM 91    C CB   . LYS A 1 8  ? 10.142  -1.622  6.906   1.00 0.00 ? 45  LYS A CB   1  
ATOM 92    C CG   . LYS A 1 8  ? 11.451  -0.879  7.107   1.00 0.00 ? 45  LYS A CG   1  
ATOM 93    C CD   . LYS A 1 8  ? 11.518  -0.235  8.480   1.00 0.00 ? 45  LYS A CD   1  
ATOM 94    C CE   . LYS A 1 8  ? 12.723  0.687   8.611   1.00 0.00 ? 45  LYS A CE   1  
ATOM 95    N NZ   . LYS A 1 8  ? 12.673  1.487   9.862   1.00 0.00 ? 45  LYS A NZ   1  
ATOM 96    H H    . LYS A 1 8  ? 11.169  -4.144  6.882   1.00 0.00 ? 45  LYS A H    1  
ATOM 97    H HA   . LYS A 1 8  ? 9.913   -2.403  8.896   1.00 0.00 ? 45  LYS A HA   1  
ATOM 98    H HB2  . LYS A 1 8  ? 10.128  -2.011  5.899   1.00 0.00 ? 45  LYS A HB2  1  
ATOM 99    H HB3  . LYS A 1 8  ? 9.333   -0.915  7.019   1.00 0.00 ? 45  LYS A HB3  1  
ATOM 100   H HG2  . LYS A 1 8  ? 12.269  -1.575  7.006   1.00 0.00 ? 45  LYS A HG2  1  
ATOM 101   H HG3  . LYS A 1 8  ? 11.533  -0.109  6.352   1.00 0.00 ? 45  LYS A HG3  1  
ATOM 102   H HD2  . LYS A 1 8  ? 10.619  0.339   8.642   1.00 0.00 ? 45  LYS A HD2  1  
ATOM 103   H HD3  . LYS A 1 8  ? 11.591  -1.018  9.224   1.00 0.00 ? 45  LYS A HD3  1  
ATOM 104   H HE2  . LYS A 1 8  ? 13.621  0.088   8.614   1.00 0.00 ? 45  LYS A HE2  1  
ATOM 105   H HE3  . LYS A 1 8  ? 12.742  1.359   7.761   1.00 0.00 ? 45  LYS A HE3  1  
ATOM 106   H HZ1  . LYS A 1 8  ? 11.691  1.790   10.053  1.00 0.00 ? 45  LYS A HZ1  1  
ATOM 107   H HZ2  . LYS A 1 8  ? 13.009  0.920   10.670  1.00 0.00 ? 45  LYS A HZ2  1  
ATOM 108   H HZ3  . LYS A 1 8  ? 13.274  2.336   9.777   1.00 0.00 ? 45  LYS A HZ3  1  
ATOM 109   N N    . SER A 1 9  ? 7.621   -3.277  8.485   1.00 0.00 ? 46  SER A N    1  
ATOM 110   C CA   . SER A 1 9  ? 6.295   -3.803  8.241   1.00 0.00 ? 46  SER A CA   1  
ATOM 111   C C    . SER A 1 9  ? 5.612   -2.965  7.179   1.00 0.00 ? 46  SER A C    1  
ATOM 112   O O    . SER A 1 9  ? 5.474   -1.746  7.320   1.00 0.00 ? 46  SER A O    1  
ATOM 113   C CB   . SER A 1 9  ? 5.458   -3.819  9.522   1.00 0.00 ? 46  SER A CB   1  
ATOM 114   O OG   . SER A 1 9  ? 4.138   -4.265  9.265   1.00 0.00 ? 46  SER A OG   1  
ATOM 115   H H    . SER A 1 9  ? 7.791   -2.747  9.298   1.00 0.00 ? 46  SER A H    1  
ATOM 116   H HA   . SER A 1 9  ? 6.403   -4.813  7.874   1.00 0.00 ? 46  SER A HA   1  
ATOM 117   H HB2  . SER A 1 9  ? 5.906   -4.485  10.237  1.00 0.00 ? 46  SER A HB2  1  
ATOM 118   H HB3  . SER A 1 9  ? 5.415   -2.829  9.934   1.00 0.00 ? 46  SER A HB3  1  
ATOM 119   H HG   . SER A 1 9  ? 3.998   -5.115  9.710   1.00 0.00 ? 46  SER A HG   1  
ATOM 120   N N    . TYR A 1 10 ? 5.166   -3.626  6.127   1.00 0.00 ? 47  TYR A N    1  
ATOM 121   C CA   . TYR A 1 10 ? 4.461   -2.955  5.049   1.00 0.00 ? 47  TYR A CA   1  
ATOM 122   C C    . TYR A 1 10 ? 3.155   -2.390  5.579   1.00 0.00 ? 47  TYR A C    1  
ATOM 123   O O    . TYR A 1 10 ? 2.674   -1.363  5.112   1.00 0.00 ? 47  TYR A O    1  
ATOM 124   C CB   . TYR A 1 10 ? 4.207   -3.917  3.885   1.00 0.00 ? 47  TYR A CB   1  
ATOM 125   C CG   . TYR A 1 10 ? 5.466   -4.359  3.162   1.00 0.00 ? 47  TYR A CG   1  
ATOM 126   C CD1  . TYR A 1 10 ? 6.544   -4.875  3.867   1.00 0.00 ? 47  TYR A CD1  1  
ATOM 127   C CD2  . TYR A 1 10 ? 5.575   -4.260  1.779   1.00 0.00 ? 47  TYR A CD2  1  
ATOM 128   C CE1  . TYR A 1 10 ? 7.694   -5.282  3.216   1.00 0.00 ? 47  TYR A CE1  1  
ATOM 129   C CE2  . TYR A 1 10 ? 6.719   -4.663  1.121   1.00 0.00 ? 47  TYR A CE2  1  
ATOM 130   C CZ   . TYR A 1 10 ? 7.773   -5.164  1.833   1.00 0.00 ? 47  TYR A CZ   1  
ATOM 131   O OH   . TYR A 1 10 ? 8.915   -5.583  1.192   1.00 0.00 ? 47  TYR A OH   1  
ATOM 132   H H    . TYR A 1 10 ? 5.288   -4.598  6.086   1.00 0.00 ? 47  TYR A H    1  
ATOM 133   H HA   . TYR A 1 10 ? 5.081   -2.139  4.706   1.00 0.00 ? 47  TYR A HA   1  
ATOM 134   H HB2  . TYR A 1 10 ? 3.715   -4.802  4.263   1.00 0.00 ? 47  TYR A HB2  1  
ATOM 135   H HB3  . TYR A 1 10 ? 3.563   -3.434  3.166   1.00 0.00 ? 47  TYR A HB3  1  
ATOM 136   H HD1  . TYR A 1 10 ? 6.479   -4.957  4.942   1.00 0.00 ? 47  TYR A HD1  1  
ATOM 137   H HD2  . TYR A 1 10 ? 4.745   -3.860  1.216   1.00 0.00 ? 47  TYR A HD2  1  
ATOM 138   H HE1  . TYR A 1 10 ? 8.523   -5.679  3.782   1.00 0.00 ? 47  TYR A HE1  1  
ATOM 139   H HE2  . TYR A 1 10 ? 6.779   -4.580  0.045   1.00 0.00 ? 47  TYR A HE2  1  
ATOM 140   H HH   . TYR A 1 10 ? 8.833   -5.393  0.254   1.00 0.00 ? 47  TYR A HH   1  
ATOM 141   N N    . ARG A 1 11 ? 2.654   -3.020  6.635   1.00 0.00 ? 48  ARG A N    1  
ATOM 142   C CA   . ARG A 1 11 ? 1.460   -2.570  7.330   1.00 0.00 ? 48  ARG A CA   1  
ATOM 143   C C    . ARG A 1 11 ? 1.584   -1.103  7.761   1.00 0.00 ? 48  ARG A C    1  
ATOM 144   O O    . ARG A 1 11 ? 0.658   -0.311  7.587   1.00 0.00 ? 48  ARG A O    1  
ATOM 145   C CB   . ARG A 1 11 ? 1.229   -3.459  8.555   1.00 0.00 ? 48  ARG A CB   1  
ATOM 146   C CG   . ARG A 1 11 ? -0.030  -3.120  9.324   1.00 0.00 ? 48  ARG A CG   1  
ATOM 147   C CD   . ARG A 1 11 ? -0.291  -4.115  10.439  1.00 0.00 ? 48  ARG A CD   1  
ATOM 148   N NE   . ARG A 1 11 ? -1.655  -4.003  10.947  1.00 0.00 ? 48  ARG A NE   1  
ATOM 149   C CZ   . ARG A 1 11 ? -2.121  -4.663  12.005  1.00 0.00 ? 48  ARG A CZ   1  
ATOM 150   N NH1  . ARG A 1 11 ? -1.329  -5.479  12.694  1.00 0.00 ? 48  ARG A NH1  1  
ATOM 151   N NH2  . ARG A 1 11 ? -3.384  -4.506  12.375  1.00 0.00 ? 48  ARG A NH2  1  
ATOM 152   H H    . ARG A 1 11 ? 3.137   -3.798  6.990   1.00 0.00 ? 48  ARG A H    1  
ATOM 153   H HA   . ARG A 1 11 ? 0.621   -2.672  6.659   1.00 0.00 ? 48  ARG A HA   1  
ATOM 154   H HB2  . ARG A 1 11 ? 1.164   -4.488  8.233   1.00 0.00 ? 48  ARG A HB2  1  
ATOM 155   H HB3  . ARG A 1 11 ? 2.077   -3.357  9.224   1.00 0.00 ? 48  ARG A HB3  1  
ATOM 156   H HG2  . ARG A 1 11 ? 0.085   -2.137  9.752   1.00 0.00 ? 48  ARG A HG2  1  
ATOM 157   H HG3  . ARG A 1 11 ? -0.869  -3.125  8.642   1.00 0.00 ? 48  ARG A HG3  1  
ATOM 158   H HD2  . ARG A 1 11 ? -0.137  -5.114  10.059  1.00 0.00 ? 48  ARG A HD2  1  
ATOM 159   H HD3  . ARG A 1 11 ? 0.401   -3.923  11.245  1.00 0.00 ? 48  ARG A HD3  1  
ATOM 160   H HE   . ARG A 1 11 ? -2.274  -3.405  10.449  1.00 0.00 ? 48  ARG A HE   1  
ATOM 161   H HH11 . ARG A 1 11 ? -0.370  -5.608  12.423  1.00 0.00 ? 48  ARG A HH11 1  
ATOM 162   H HH12 . ARG A 1 11 ? -1.686  -5.968  13.494  1.00 0.00 ? 48  ARG A HH12 1  
ATOM 163   H HH21 . ARG A 1 11 ? -3.992  -3.889  11.860  1.00 0.00 ? 48  ARG A HH21 1  
ATOM 164   H HH22 . ARG A 1 11 ? -3.744  -5.010  13.167  1.00 0.00 ? 48  ARG A HH22 1  
ATOM 165   N N    . GLU A 1 12 ? 2.745   -0.745  8.289   1.00 0.00 ? 49  GLU A N    1  
ATOM 166   C CA   . GLU A 1 12 ? 3.002   0.624   8.731   1.00 0.00 ? 49  GLU A CA   1  
ATOM 167   C C    . GLU A 1 12 ? 3.180   1.539   7.533   1.00 0.00 ? 49  GLU A C    1  
ATOM 168   O O    . GLU A 1 12 ? 2.676   2.659   7.504   1.00 0.00 ? 49  GLU A O    1  
ATOM 169   C CB   . GLU A 1 12 ? 4.270   0.673   9.579   1.00 0.00 ? 49  GLU A CB   1  
ATOM 170   C CG   . GLU A 1 12 ? 4.384   -0.468  10.566  1.00 0.00 ? 49  GLU A CG   1  
ATOM 171   C CD   . GLU A 1 12 ? 3.423   -0.345  11.732  1.00 0.00 ? 49  GLU A CD   1  
ATOM 172   O OE1  . GLU A 1 12 ? 2.197   -0.373  11.501  1.00 0.00 ? 49  GLU A OE1  1  
ATOM 173   O OE2  . GLU A 1 12 ? 3.885   -0.225  12.884  1.00 0.00 ? 49  GLU A OE2  1  
ATOM 174   H H    . GLU A 1 12 ? 3.462   -1.410  8.366   1.00 0.00 ? 49  GLU A H    1  
ATOM 175   H HA   . GLU A 1 12 ? 2.160   0.959   9.318   1.00 0.00 ? 49  GLU A HA   1  
ATOM 176   H HB2  . GLU A 1 12 ? 5.129   0.643   8.925   1.00 0.00 ? 49  GLU A HB2  1  
ATOM 177   H HB3  . GLU A 1 12 ? 4.281   1.601   10.132  1.00 0.00 ? 49  GLU A HB3  1  
ATOM 178   H HG2  . GLU A 1 12 ? 4.169   -1.385  10.043  1.00 0.00 ? 49  GLU A HG2  1  
ATOM 179   H HG3  . GLU A 1 12 ? 5.396   -0.499  10.945  1.00 0.00 ? 49  GLU A HG3  1  
ATOM 180   N N    . LEU A 1 13 ? 3.975   1.064   6.589   1.00 0.00 ? 50  LEU A N    1  
ATOM 181   C CA   . LEU A 1 13 ? 4.343   1.832   5.406   1.00 0.00 ? 50  LEU A CA   1  
ATOM 182   C C    . LEU A 1 13 ? 3.120   2.191   4.573   1.00 0.00 ? 50  LEU A C    1  
ATOM 183   O O    . LEU A 1 13 ? 2.932   3.347   4.187   1.00 0.00 ? 50  LEU A O    1  
ATOM 184   C CB   . LEU A 1 13 ? 5.318   1.018   4.554   1.00 0.00 ? 50  LEU A CB   1  
ATOM 185   C CG   . LEU A 1 13 ? 6.797   1.019   4.988   1.00 0.00 ? 50  LEU A CG   1  
ATOM 186   C CD1  . LEU A 1 13 ? 6.956   1.075   6.498   1.00 0.00 ? 50  LEU A CD1  1  
ATOM 187   C CD2  . LEU A 1 13 ? 7.476   -0.225  4.461   1.00 0.00 ? 50  LEU A CD2  1  
ATOM 188   H H    . LEU A 1 13 ? 4.378   0.181   6.719   1.00 0.00 ? 50  LEU A H    1  
ATOM 189   H HA   . LEU A 1 13 ? 4.829   2.739   5.731   1.00 0.00 ? 50  LEU A HA   1  
ATOM 190   H HB2  . LEU A 1 13 ? 4.977   -0.006  4.546   1.00 0.00 ? 50  LEU A HB2  1  
ATOM 191   H HB3  . LEU A 1 13 ? 5.268   1.398   3.541   1.00 0.00 ? 50  LEU A HB3  1  
ATOM 192   H HG   . LEU A 1 13 ? 7.294   1.878   4.565   1.00 0.00 ? 50  LEU A HG   1  
ATOM 193   H HD11 . LEU A 1 13 ? 5.998   1.273   6.953   1.00 0.00 ? 50  LEU A HD11 1  
ATOM 194   H HD12 . LEU A 1 13 ? 7.339   0.128   6.853   1.00 0.00 ? 50  LEU A HD12 1  
ATOM 195   H HD13 . LEU A 1 13 ? 7.650   1.862   6.756   1.00 0.00 ? 50  LEU A HD13 1  
ATOM 196   H HD21 . LEU A 1 13 ? 7.357   -0.270  3.388   1.00 0.00 ? 50  LEU A HD21 1  
ATOM 197   H HD22 . LEU A 1 13 ? 8.527   -0.197  4.709   1.00 0.00 ? 50  LEU A HD22 1  
ATOM 198   H HD23 . LEU A 1 13 ? 7.022   -1.097  4.911   1.00 0.00 ? 50  LEU A HD23 1  
ATOM 199   N N    . ILE A 1 14 ? 2.299   1.190   4.289   1.00 0.00 ? 51  ILE A N    1  
ATOM 200   C CA   . ILE A 1 14 ? 1.107   1.384   3.483   1.00 0.00 ? 51  ILE A CA   1  
ATOM 201   C C    . ILE A 1 14 ? 0.145   2.331   4.169   1.00 0.00 ? 51  ILE A C    1  
ATOM 202   O O    . ILE A 1 14 ? -0.285  3.297   3.568   1.00 0.00 ? 51  ILE A O    1  
ATOM 203   C CB   . ILE A 1 14 ? 0.391   0.052   3.193   1.00 0.00 ? 51  ILE A CB   1  
ATOM 204   C CG1  . ILE A 1 14 ? 1.327   -0.901  2.453   1.00 0.00 ? 51  ILE A CG1  1  
ATOM 205   C CG2  . ILE A 1 14 ? -0.875  0.291   2.379   1.00 0.00 ? 51  ILE A CG2  1  
ATOM 206   C CD1  . ILE A 1 14 ? 0.717   -2.254  2.189   1.00 0.00 ? 51  ILE A CD1  1  
ATOM 207   H H    . ILE A 1 14 ? 2.510   0.288   4.622   1.00 0.00 ? 51  ILE A H    1  
ATOM 208   H HA   . ILE A 1 14 ? 1.404   1.822   2.538   1.00 0.00 ? 51  ILE A HA   1  
ATOM 209   H HB   . ILE A 1 14 ? 0.106   -0.391  4.136   1.00 0.00 ? 51  ILE A HB   1  
ATOM 210   H HG12 . ILE A 1 14 ? 1.595   -0.467  1.501   1.00 0.00 ? 51  ILE A HG12 1  
ATOM 211   H HG13 . ILE A 1 14 ? 2.221   -1.048  3.042   1.00 0.00 ? 51  ILE A HG13 1  
ATOM 212   H HG21 . ILE A 1 14 ? -1.125  1.341   2.404   1.00 0.00 ? 51  ILE A HG21 1  
ATOM 213   H HG22 . ILE A 1 14 ? -0.711  -0.017  1.359   1.00 0.00 ? 51  ILE A HG22 1  
ATOM 214   H HG23 . ILE A 1 14 ? -1.689  -0.282  2.803   1.00 0.00 ? 51  ILE A HG23 1  
ATOM 215   H HD11 . ILE A 1 14 ? -0.245  -2.122  1.718   1.00 0.00 ? 51  ILE A HD11 1  
ATOM 216   H HD12 . ILE A 1 14 ? 1.364   -2.821  1.537   1.00 0.00 ? 51  ILE A HD12 1  
ATOM 217   H HD13 . ILE A 1 14 ? 0.593   -2.780  3.123   1.00 0.00 ? 51  ILE A HD13 1  
ATOM 218   N N    . ILE A 1 15 ? -0.173  2.067   5.428   1.00 0.00 ? 52  ILE A N    1  
ATOM 219   C CA   . ILE A 1 15 ? -1.108  2.913   6.160   1.00 0.00 ? 52  ILE A CA   1  
ATOM 220   C C    . ILE A 1 15 ? -0.616  4.351   6.260   1.00 0.00 ? 52  ILE A C    1  
ATOM 221   O O    . ILE A 1 15 ? -1.385  5.286   6.024   1.00 0.00 ? 52  ILE A O    1  
ATOM 222   C CB   . ILE A 1 15 ? -1.402  2.362   7.566   1.00 0.00 ? 52  ILE A CB   1  
ATOM 223   C CG1  . ILE A 1 15 ? -2.311  1.138   7.448   1.00 0.00 ? 52  ILE A CG1  1  
ATOM 224   C CG2  . ILE A 1 15 ? -2.041  3.443   8.426   1.00 0.00 ? 52  ILE A CG2  1  
ATOM 225   C CD1  . ILE A 1 15 ? -2.622  0.460   8.760   1.00 0.00 ? 52  ILE A CD1  1  
ATOM 226   H H    . ILE A 1 15 ? 0.213   1.280   5.869   1.00 0.00 ? 52  ILE A H    1  
ATOM 227   H HA   . ILE A 1 15 ? -2.038  2.913   5.608   1.00 0.00 ? 52  ILE A HA   1  
ATOM 228   H HB   . ILE A 1 15 ? -0.468  2.071   8.022   1.00 0.00 ? 52  ILE A HB   1  
ATOM 229   H HG12 . ILE A 1 15 ? -3.249  1.441   7.006   1.00 0.00 ? 52  ILE A HG12 1  
ATOM 230   H HG13 . ILE A 1 15 ? -1.838  0.411   6.805   1.00 0.00 ? 52  ILE A HG13 1  
ATOM 231   H HG21 . ILE A 1 15 ? -2.012  4.384   7.889   1.00 0.00 ? 52  ILE A HG21 1  
ATOM 232   H HG22 . ILE A 1 15 ? -3.067  3.179   8.638   1.00 0.00 ? 52  ILE A HG22 1  
ATOM 233   H HG23 . ILE A 1 15 ? -1.492  3.539   9.350   1.00 0.00 ? 52  ILE A HG23 1  
ATOM 234   H HD11 . ILE A 1 15 ? -3.104  1.163   9.424   1.00 0.00 ? 52  ILE A HD11 1  
ATOM 235   H HD12 . ILE A 1 15 ? -3.283  -0.377  8.579   1.00 0.00 ? 52  ILE A HD12 1  
ATOM 236   H HD13 . ILE A 1 15 ? -1.704  0.107   9.207   1.00 0.00 ? 52  ILE A HD13 1  
ATOM 237   N N    . GLU A 1 16 ? 0.670   4.517   6.553   1.00 0.00 ? 53  GLU A N    1  
ATOM 238   C CA   . GLU A 1 16 ? 1.282   5.840   6.639   1.00 0.00 ? 53  GLU A CA   1  
ATOM 239   C C    . GLU A 1 16 ? 0.964   6.656   5.394   1.00 0.00 ? 53  GLU A C    1  
ATOM 240   O O    . GLU A 1 16 ? 0.548   7.813   5.482   1.00 0.00 ? 53  GLU A O    1  
ATOM 241   C CB   . GLU A 1 16 ? 2.796   5.698   6.806   1.00 0.00 ? 53  GLU A CB   1  
ATOM 242   C CG   . GLU A 1 16 ? 3.554   7.019   6.795   1.00 0.00 ? 53  GLU A CG   1  
ATOM 243   C CD   . GLU A 1 16 ? 3.240   7.900   7.988   1.00 0.00 ? 53  GLU A CD   1  
ATOM 244   O OE1  . GLU A 1 16 ? 2.511   7.449   8.899   1.00 0.00 ? 53  GLU A OE1  1  
ATOM 245   O OE2  . GLU A 1 16 ? 3.736   9.046   8.026   1.00 0.00 ? 53  GLU A OE2  1  
ATOM 246   H H    . GLU A 1 16 ? 1.233   3.723   6.691   1.00 0.00 ? 53  GLU A H    1  
ATOM 247   H HA   . GLU A 1 16 ? 0.876   6.343   7.504   1.00 0.00 ? 53  GLU A HA   1  
ATOM 248   H HB2  . GLU A 1 16 ? 2.994   5.205   7.747   1.00 0.00 ? 53  GLU A HB2  1  
ATOM 249   H HB3  . GLU A 1 16 ? 3.175   5.083   6.004   1.00 0.00 ? 53  GLU A HB3  1  
ATOM 250   H HG2  . GLU A 1 16 ? 4.614   6.811   6.795   1.00 0.00 ? 53  GLU A HG2  1  
ATOM 251   H HG3  . GLU A 1 16 ? 3.297   7.555   5.893   1.00 0.00 ? 53  GLU A HG3  1  
ATOM 252   N N    . GLY A 1 17 ? 1.076   6.014   4.241   1.00 0.00 ? 54  GLY A N    1  
ATOM 253   C CA   . GLY A 1 17 ? 0.725   6.664   3.005   1.00 0.00 ? 54  GLY A CA   1  
ATOM 254   C C    . GLY A 1 17 ? -0.753  6.655   2.750   1.00 0.00 ? 54  GLY A C    1  
ATOM 255   O O    . GLY A 1 17 ? -1.326  7.682   2.429   1.00 0.00 ? 54  GLY A O    1  
ATOM 256   H H    . GLY A 1 17 ? 1.352   5.071   4.239   1.00 0.00 ? 54  GLY A H    1  
ATOM 257   H HA2  . GLY A 1 17 ? 1.070   7.686   3.031   1.00 0.00 ? 54  GLY A HA2  1  
ATOM 258   H HA3  . GLY A 1 17 ? 1.207   6.152   2.194   1.00 0.00 ? 54  GLY A HA3  1  
ATOM 259   N N    . LEU A 1 18 ? -1.326  5.465   2.750   1.00 0.00 ? 55  LEU A N    1  
ATOM 260   C CA   . LEU A 1 18 ? -2.709  5.243   2.352   1.00 0.00 ? 55  LEU A CA   1  
ATOM 261   C C    . LEU A 1 18 ? -3.670  6.179   3.081   1.00 0.00 ? 55  LEU A C    1  
ATOM 262   O O    . LEU A 1 18 ? -4.692  6.591   2.528   1.00 0.00 ? 55  LEU A O    1  
ATOM 263   C CB   . LEU A 1 18 ? -3.068  3.783   2.611   1.00 0.00 ? 55  LEU A CB   1  
ATOM 264   C CG   . LEU A 1 18 ? -4.401  3.311   2.044   1.00 0.00 ? 55  LEU A CG   1  
ATOM 265   C CD1  . LEU A 1 18 ? -4.470  3.581   0.554   1.00 0.00 ? 55  LEU A CD1  1  
ATOM 266   C CD2  . LEU A 1 18 ? -4.583  1.832   2.323   1.00 0.00 ? 55  LEU A CD2  1  
ATOM 267   H H    . LEU A 1 18 ? -0.762  4.669   2.927   1.00 0.00 ? 55  LEU A H    1  
ATOM 268   H HA   . LEU A 1 18 ? -2.772  5.429   1.294   1.00 0.00 ? 55  LEU A HA   1  
ATOM 269   H HB2  . LEU A 1 18 ? -2.290  3.167   2.187   1.00 0.00 ? 55  LEU A HB2  1  
ATOM 270   H HB3  . LEU A 1 18 ? -3.081  3.625   3.676   1.00 0.00 ? 55  LEU A HB3  1  
ATOM 271   H HG   . LEU A 1 18 ? -5.206  3.849   2.524   1.00 0.00 ? 55  LEU A HG   1  
ATOM 272   H HD11 . LEU A 1 18 ? -3.471  3.671   0.157   1.00 0.00 ? 55  LEU A HD11 1  
ATOM 273   H HD12 . LEU A 1 18 ? -4.979  2.761   0.068   1.00 0.00 ? 55  LEU A HD12 1  
ATOM 274   H HD13 . LEU A 1 18 ? -5.014  4.496   0.378   1.00 0.00 ? 55  LEU A HD13 1  
ATOM 275   H HD21 . LEU A 1 18 ? -3.740  1.285   1.928   1.00 0.00 ? 55  LEU A HD21 1  
ATOM 276   H HD22 . LEU A 1 18 ? -4.648  1.672   3.390   1.00 0.00 ? 55  LEU A HD22 1  
ATOM 277   H HD23 . LEU A 1 18 ? -5.491  1.485   1.853   1.00 0.00 ? 55  LEU A HD23 1  
ATOM 278   N N    . THR A 1 19 ? -3.318  6.542   4.302   1.00 0.00 ? 56  THR A N    1  
ATOM 279   C CA   . THR A 1 19 ? -4.115  7.468   5.082   1.00 0.00 ? 56  THR A CA   1  
ATOM 280   C C    . THR A 1 19 ? -3.910  8.908   4.575   1.00 0.00 ? 56  THR A C    1  
ATOM 281   O O    . THR A 1 19 ? -4.808  9.743   4.659   1.00 0.00 ? 56  THR A O    1  
ATOM 282   C CB   . THR A 1 19 ? -3.767  7.356   6.592   1.00 0.00 ? 56  THR A CB   1  
ATOM 283   O OG1  . THR A 1 19 ? -4.863  7.822   7.394   1.00 0.00 ? 56  THR A OG1  1  
ATOM 284   C CG2  . THR A 1 19 ? -2.511  8.143   6.947   1.00 0.00 ? 56  THR A CG2  1  
ATOM 285   H H    . THR A 1 19 ? -2.475  6.203   4.678   1.00 0.00 ? 56  THR A H    1  
ATOM 286   H HA   . THR A 1 19 ? -5.153  7.198   4.951   1.00 0.00 ? 56  THR A HA   1  
ATOM 287   H HB   . THR A 1 19 ? -3.586  6.314   6.823   1.00 0.00 ? 56  THR A HB   1  
ATOM 288   H HG1  . THR A 1 19 ? -4.795  8.787   7.503   1.00 0.00 ? 56  THR A HG1  1  
ATOM 289   H HG21 . THR A 1 19 ? -2.654  9.181   6.689   1.00 0.00 ? 56  THR A HG21 1  
ATOM 290   H HG22 . THR A 1 19 ? -2.316  8.057   8.005   1.00 0.00 ? 56  THR A HG22 1  
ATOM 291   H HG23 . THR A 1 19 ? -1.673  7.747   6.392   1.00 0.00 ? 56  THR A HG23 1  
ATOM 292   N N    . ALA A 1 20 ? -2.711  9.181   4.064   1.00 0.00 ? 57  ALA A N    1  
ATOM 293   C CA   . ALA A 1 20 ? -2.346  10.511  3.589   1.00 0.00 ? 57  ALA A CA   1  
ATOM 294   C C    . ALA A 1 20 ? -2.709  10.742  2.122   1.00 0.00 ? 57  ALA A C    1  
ATOM 295   O O    . ALA A 1 20 ? -3.269  11.783  1.778   1.00 0.00 ? 57  ALA A O    1  
ATOM 296   C CB   . ALA A 1 20 ? -0.858  10.746  3.795   1.00 0.00 ? 57  ALA A CB   1  
ATOM 297   H H    . ALA A 1 20 ? -2.041  8.463   4.018   1.00 0.00 ? 57  ALA A H    1  
ATOM 298   H HA   . ALA A 1 20 ? -2.878  11.231  4.194   1.00 0.00 ? 57  ALA A HA   1  
ATOM 299   H HB1  . ALA A 1 20 ? -0.575  10.414  4.784   1.00 0.00 ? 57  ALA A HB1  1  
ATOM 300   H HB2  . ALA A 1 20 ? -0.299  10.190  3.056   1.00 0.00 ? 57  ALA A HB2  1  
ATOM 301   H HB3  . ALA A 1 20 ? -0.641  11.800  3.694   1.00 0.00 ? 57  ALA A HB3  1  
ATOM 302   N N    . LEU A 1 21 ? -2.303  9.827   1.235   1.00 0.00 ? 58  LEU A N    1  
ATOM 303   C CA   . LEU A 1 21 ? -2.485  10.034  -0.194  1.00 0.00 ? 58  LEU A CA   1  
ATOM 304   C C    . LEU A 1 21 ? -3.833  9.494   -0.657  1.00 0.00 ? 58  LEU A C    1  
ATOM 305   O O    . LEU A 1 21 ? -4.036  9.218   -1.839  1.00 0.00 ? 58  LEU A O    1  
ATOM 306   C CB   . LEU A 1 21 ? -1.336  9.394   -0.999  1.00 0.00 ? 58  LEU A CB   1  
ATOM 307   C CG   . LEU A 1 21 ? -1.544  7.939   -1.429  1.00 0.00 ? 58  LEU A CG   1  
ATOM 308   C CD1  . LEU A 1 21 ? -0.773  7.649   -2.700  1.00 0.00 ? 58  LEU A CD1  1  
ATOM 309   C CD2  . LEU A 1 21 ? -1.129  6.976   -0.356  1.00 0.00 ? 58  LEU A CD2  1  
ATOM 310   H H    . LEU A 1 21 ? -1.821  9.028   1.544   1.00 0.00 ? 58  LEU A H    1  
ATOM 311   H HA   . LEU A 1 21 ? -2.469  11.095  -0.365  1.00 0.00 ? 58  LEU A HA   1  
ATOM 312   H HB2  . LEU A 1 21 ? -1.180  9.986   -1.888  1.00 0.00 ? 58  LEU A HB2  1  
ATOM 313   H HB3  . LEU A 1 21 ? -0.440  9.440   -0.399  1.00 0.00 ? 58  LEU A HB3  1  
ATOM 314   H HG   . LEU A 1 21 ? -2.588  7.778   -1.613  1.00 0.00 ? 58  LEU A HG   1  
ATOM 315   H HD11 . LEU A 1 21 ? -0.264  8.543   -3.028  1.00 0.00 ? 58  LEU A HD11 1  
ATOM 316   H HD12 . LEU A 1 21 ? -0.046  6.871   -2.510  1.00 0.00 ? 58  LEU A HD12 1  
ATOM 317   H HD13 . LEU A 1 21 ? -1.457  7.321   -3.469  1.00 0.00 ? 58  LEU A HD13 1  
ATOM 318   H HD21 . LEU A 1 21 ? -0.951  7.520   0.560   1.00 0.00 ? 58  LEU A HD21 1  
ATOM 319   H HD22 . LEU A 1 21 ? -1.921  6.253   -0.198  1.00 0.00 ? 58  LEU A HD22 1  
ATOM 320   H HD23 . LEU A 1 21 ? -0.228  6.463   -0.656  1.00 0.00 ? 58  LEU A HD23 1  
ATOM 321   N N    . LYS A 1 22 ? -4.757  9.355   0.281   1.00 0.00 ? 59  LYS A N    1  
ATOM 322   C CA   . LYS A 1 22 ? -6.082  8.838   -0.025  1.00 0.00 ? 59  LYS A CA   1  
ATOM 323   C C    . LYS A 1 22 ? -6.793  9.724   -1.055  1.00 0.00 ? 59  LYS A C    1  
ATOM 324   O O    . LYS A 1 22 ? -7.558  9.231   -1.884  1.00 0.00 ? 59  LYS A O    1  
ATOM 325   C CB   . LYS A 1 22 ? -6.920  8.706   1.259   1.00 0.00 ? 59  LYS A CB   1  
ATOM 326   C CG   . LYS A 1 22 ? -7.642  9.973   1.698   1.00 0.00 ? 59  LYS A CG   1  
ATOM 327   C CD   . LYS A 1 22 ? -6.682  11.019  2.240   1.00 0.00 ? 59  LYS A CD   1  
ATOM 328   C CE   . LYS A 1 22 ? -7.425  12.245  2.742   1.00 0.00 ? 59  LYS A CE   1  
ATOM 329   N NZ   . LYS A 1 22 ? -6.497  13.313  3.191   1.00 0.00 ? 59  LYS A NZ   1  
ATOM 330   H H    . LYS A 1 22 ? -4.533  9.573   1.209   1.00 0.00 ? 59  LYS A H    1  
ATOM 331   H HA   . LYS A 1 22 ? -5.953  7.855   -0.455  1.00 0.00 ? 59  LYS A HA   1  
ATOM 332   H HB2  . LYS A 1 22 ? -7.662  7.938   1.107   1.00 0.00 ? 59  LYS A HB2  1  
ATOM 333   H HB3  . LYS A 1 22 ? -6.266  8.397   2.063   1.00 0.00 ? 59  LYS A HB3  1  
ATOM 334   H HG2  . LYS A 1 22 ? -8.165  10.387  0.845   1.00 0.00 ? 59  LYS A HG2  1  
ATOM 335   H HG3  . LYS A 1 22 ? -8.354  9.718   2.468   1.00 0.00 ? 59  LYS A HG3  1  
ATOM 336   H HD2  . LYS A 1 22 ? -6.119  10.590  3.055   1.00 0.00 ? 59  LYS A HD2  1  
ATOM 337   H HD3  . LYS A 1 22 ? -6.007  11.317  1.451   1.00 0.00 ? 59  LYS A HD3  1  
ATOM 338   H HE2  . LYS A 1 22 ? -8.040  12.631  1.943   1.00 0.00 ? 59  LYS A HE2  1  
ATOM 339   H HE3  . LYS A 1 22 ? -8.054  11.954  3.571   1.00 0.00 ? 59  LYS A HE3  1  
ATOM 340   H HZ1  . LYS A 1 22 ? -5.762  12.917  3.816   1.00 0.00 ? 59  LYS A HZ1  1  
ATOM 341   H HZ2  . LYS A 1 22 ? -6.036  13.755  2.365   1.00 0.00 ? 59  LYS A HZ2  1  
ATOM 342   H HZ3  . LYS A 1 22 ? -7.023  14.046  3.715   1.00 0.00 ? 59  LYS A HZ3  1  
ATOM 343   N N    . GLU A 1 23 ? -6.504  11.027  -1.015  1.00 0.00 ? 60  GLU A N    1  
ATOM 344   C CA   . GLU A 1 23 ? -7.096  11.990  -1.942  1.00 0.00 ? 60  GLU A CA   1  
ATOM 345   C C    . GLU A 1 23 ? -8.623  11.934  -1.875  1.00 0.00 ? 60  GLU A C    1  
ATOM 346   O O    . GLU A 1 23 ? -9.223  12.333  -0.874  1.00 0.00 ? 60  GLU A O    1  
ATOM 347   C CB   . GLU A 1 23 ? -6.607  11.743  -3.376  1.00 0.00 ? 60  GLU A CB   1  
ATOM 348   C CG   . GLU A 1 23 ? -5.103  11.895  -3.543  1.00 0.00 ? 60  GLU A CG   1  
ATOM 349   C CD   . GLU A 1 23 ? -4.650  11.693  -4.975  1.00 0.00 ? 60  GLU A CD   1  
ATOM 350   O OE1  . GLU A 1 23 ? -5.511  11.476  -5.858  1.00 0.00 ? 60  GLU A OE1  1  
ATOM 351   O OE2  . GLU A 1 23 ? -3.430  11.752  -5.231  1.00 0.00 ? 60  GLU A OE2  1  
ATOM 352   H H    . GLU A 1 23 ? -5.866  11.347  -0.348  1.00 0.00 ? 60  GLU A H    1  
ATOM 353   H HA   . GLU A 1 23 ? -6.777  12.973  -1.630  1.00 0.00 ? 60  GLU A HA   1  
ATOM 354   H HB2  . GLU A 1 23 ? -6.879  10.740  -3.667  1.00 0.00 ? 60  GLU A HB2  1  
ATOM 355   H HB3  . GLU A 1 23 ? -7.093  12.445  -4.035  1.00 0.00 ? 60  GLU A HB3  1  
ATOM 356   H HG2  . GLU A 1 23 ? -4.816  12.887  -3.229  1.00 0.00 ? 60  GLU A HG2  1  
ATOM 357   H HG3  . GLU A 1 23 ? -4.607  11.165  -2.919  1.00 0.00 ? 60  GLU A HG3  1  
ATOM 358   N N    . ARG A 1 24 ? -9.236  11.414  -2.932  1.00 0.00 ? 61  ARG A N    1  
ATOM 359   C CA   . ARG A 1 24 ? -10.686 11.283  -3.003  1.00 0.00 ? 61  ARG A CA   1  
ATOM 360   C C    . ARG A 1 24 ? -11.202 10.288  -1.965  1.00 0.00 ? 61  ARG A C    1  
ATOM 361   O O    . ARG A 1 24 ? -12.267 10.485  -1.384  1.00 0.00 ? 61  ARG A O    1  
ATOM 362   C CB   . ARG A 1 24 ? -11.111 10.843  -4.408  1.00 0.00 ? 61  ARG A CB   1  
ATOM 363   C CG   . ARG A 1 24 ? -10.544 9.492   -4.820  1.00 0.00 ? 61  ARG A CG   1  
ATOM 364   C CD   . ARG A 1 24 ? -10.929 9.115   -6.240  1.00 0.00 ? 61  ARG A CD   1  
ATOM 365   N NE   . ARG A 1 24 ? -12.369 8.905   -6.403  1.00 0.00 ? 61  ARG A NE   1  
ATOM 366   C CZ   . ARG A 1 24 ? -12.920 8.414   -7.514  1.00 0.00 ? 61  ARG A CZ   1  
ATOM 367   N NH1  . ARG A 1 24 ? -12.143 8.009   -8.513  1.00 0.00 ? 61  ARG A NH1  1  
ATOM 368   N NH2  . ARG A 1 24 ? -14.238 8.301   -7.622  1.00 0.00 ? 61  ARG A NH2  1  
ATOM 369   H H    . ARG A 1 24 ? -8.693  11.096  -3.684  1.00 0.00 ? 61  ARG A H    1  
ATOM 370   H HA   . ARG A 1 24 ? -11.114 12.252  -2.797  1.00 0.00 ? 61  ARG A HA   1  
ATOM 371   H HB2  . ARG A 1 24 ? -12.189 10.784  -4.446  1.00 0.00 ? 61  ARG A HB2  1  
ATOM 372   H HB3  . ARG A 1 24 ? -10.774 11.580  -5.122  1.00 0.00 ? 61  ARG A HB3  1  
ATOM 373   H HG2  . ARG A 1 24 ? -9.467  9.532   -4.750  1.00 0.00 ? 61  ARG A HG2  1  
ATOM 374   H HG3  . ARG A 1 24 ? -10.920 8.738   -4.142  1.00 0.00 ? 61  ARG A HG3  1  
ATOM 375   H HD2  . ARG A 1 24 ? -10.617 9.909   -6.903  1.00 0.00 ? 61  ARG A HD2  1  
ATOM 376   H HD3  . ARG A 1 24 ? -10.412 8.205   -6.505  1.00 0.00 ? 61  ARG A HD3  1  
ATOM 377   H HE   . ARG A 1 24 ? -12.959 9.166   -5.650  1.00 0.00 ? 61  ARG A HE   1  
ATOM 378   H HH11 . ARG A 1 24 ? -11.141 8.067   -8.432  1.00 0.00 ? 61  ARG A HH11 1  
ATOM 379   H HH12 . ARG A 1 24 ? -12.552 7.644   -9.356  1.00 0.00 ? 61  ARG A HH12 1  
ATOM 380   H HH21 . ARG A 1 24 ? -14.840 8.583   -6.865  1.00 0.00 ? 61  ARG A HH21 1  
ATOM 381   H HH22 . ARG A 1 24 ? -14.645 7.932   -8.466  1.00 0.00 ? 61  ARG A HH22 1  
ATOM 382   N N    . LYS A 1 25 ? -10.417 9.245   -1.705  1.00 0.00 ? 62  LYS A N    1  
ATOM 383   C CA   . LYS A 1 25 ? -10.779 8.220   -0.733  1.00 0.00 ? 62  LYS A CA   1  
ATOM 384   C C    . LYS A 1 25 ? -9.635  7.227   -0.570  1.00 0.00 ? 62  LYS A C    1  
ATOM 385   O O    . LYS A 1 25 ? -9.178  6.982   0.535   1.00 0.00 ? 62  LYS A O    1  
ATOM 386   C CB   . LYS A 1 25 ? -12.070 7.487   -1.149  1.00 0.00 ? 62  LYS A CB   1  
ATOM 387   C CG   . LYS A 1 25 ? -12.024 6.864   -2.540  1.00 0.00 ? 62  LYS A CG   1  
ATOM 388   C CD   . LYS A 1 25 ? -13.360 6.246   -2.926  1.00 0.00 ? 62  LYS A CD   1  
ATOM 389   C CE   . LYS A 1 25 ? -13.733 5.079   -2.021  1.00 0.00 ? 62  LYS A CE   1  
ATOM 390   N NZ   . LYS A 1 25 ? -15.069 4.519   -2.362  1.00 0.00 ? 62  LYS A NZ   1  
ATOM 391   H H    . LYS A 1 25 ? -9.530  9.202   -2.128  1.00 0.00 ? 62  LYS A H    1  
ATOM 392   H HA   . LYS A 1 25 ? -10.946 8.710   0.216   1.00 0.00 ? 62  LYS A HA   1  
ATOM 393   H HB2  . LYS A 1 25 ? -12.266 6.700   -0.437  1.00 0.00 ? 62  LYS A HB2  1  
ATOM 394   H HB3  . LYS A 1 25 ? -12.888 8.192   -1.123  1.00 0.00 ? 62  LYS A HB3  1  
ATOM 395   H HG2  . LYS A 1 25 ? -11.773 7.630   -3.258  1.00 0.00 ? 62  LYS A HG2  1  
ATOM 396   H HG3  . LYS A 1 25 ? -11.265 6.095   -2.552  1.00 0.00 ? 62  LYS A HG3  1  
ATOM 397   H HD2  . LYS A 1 25 ? -14.129 7.000   -2.853  1.00 0.00 ? 62  LYS A HD2  1  
ATOM 398   H HD3  . LYS A 1 25 ? -13.299 5.893   -3.945  1.00 0.00 ? 62  LYS A HD3  1  
ATOM 399   H HE2  . LYS A 1 25 ? -12.990 4.304   -2.129  1.00 0.00 ? 62  LYS A HE2  1  
ATOM 400   H HE3  . LYS A 1 25 ? -13.747 5.425   -0.997  1.00 0.00 ? 62  LYS A HE3  1  
ATOM 401   H HZ1  . LYS A 1 25 ? -15.632 5.226   -2.886  1.00 0.00 ? 62  LYS A HZ1  1  
ATOM 402   H HZ2  . LYS A 1 25 ? -14.963 3.670   -2.953  1.00 0.00 ? 62  LYS A HZ2  1  
ATOM 403   H HZ3  . LYS A 1 25 ? -15.586 4.260   -1.492  1.00 0.00 ? 62  LYS A HZ3  1  
ATOM 404   N N    . GLY A 1 26 ? -9.107  6.752   -1.687  1.00 0.00 ? 63  GLY A N    1  
ATOM 405   C CA   . GLY A 1 26 ? -7.968  5.859   -1.661  1.00 0.00 ? 63  GLY A CA   1  
ATOM 406   C C    . GLY A 1 26 ? -7.127  5.995   -2.913  1.00 0.00 ? 63  GLY A C    1  
ATOM 407   O O    . GLY A 1 26 ? -7.504  6.722   -3.834  1.00 0.00 ? 63  GLY A O    1  
ATOM 408   H H    . GLY A 1 26 ? -9.462  7.050   -2.545  1.00 0.00 ? 63  GLY A H    1  
ATOM 409   H HA2  . GLY A 1 26 ? -7.358  6.091   -0.800  1.00 0.00 ? 63  GLY A HA2  1  
ATOM 410   H HA3  . GLY A 1 26 ? -8.320  4.839   -1.581  1.00 0.00 ? 63  GLY A HA3  1  
ATOM 411   N N    . SER A 1 27 ? -6.014  5.281   -2.965  1.00 0.00 ? 64  SER A N    1  
ATOM 412   C CA   . SER A 1 27 ? -5.120  5.340   -4.117  1.00 0.00 ? 64  SER A CA   1  
ATOM 413   C C    . SER A 1 27 ? -4.545  3.967   -4.449  1.00 0.00 ? 64  SER A C    1  
ATOM 414   O O    . SER A 1 27 ? -4.501  3.073   -3.603  1.00 0.00 ? 64  SER A O    1  
ATOM 415   C CB   . SER A 1 27 ? -3.995  6.348   -3.879  1.00 0.00 ? 64  SER A CB   1  
ATOM 416   O OG   . SER A 1 27 ? -4.479  7.682   -3.937  1.00 0.00 ? 64  SER A OG   1  
ATOM 417   H H    . SER A 1 27 ? -5.800  4.669   -2.225  1.00 0.00 ? 64  SER A H    1  
ATOM 418   H HA   . SER A 1 27 ? -5.706  5.675   -4.961  1.00 0.00 ? 64  SER A HA   1  
ATOM 419   H HB2  . SER A 1 27 ? -3.562  6.179   -2.904  1.00 0.00 ? 64  SER A HB2  1  
ATOM 420   H HB3  . SER A 1 27 ? -3.236  6.221   -4.637  1.00 0.00 ? 64  SER A HB3  1  
ATOM 421   H HG   . SER A 1 27 ? -4.467  8.069   -3.047  1.00 0.00 ? 64  SER A HG   1  
ATOM 422   N N    . SER A 1 28 ? -4.217  3.789   -5.718  1.00 0.00 ? 65  SER A N    1  
ATOM 423   C CA   . SER A 1 28 ? -3.758  2.515   -6.253  1.00 0.00 ? 65  SER A CA   1  
ATOM 424   C C    . SER A 1 28 ? -2.400  2.114   -5.674  1.00 0.00 ? 65  SER A C    1  
ATOM 425   O O    . SER A 1 28 ? -1.650  2.960   -5.175  1.00 0.00 ? 65  SER A O    1  
ATOM 426   C CB   . SER A 1 28 ? -3.679  2.620   -7.779  1.00 0.00 ? 65  SER A CB   1  
ATOM 427   O OG   . SER A 1 28 ? -3.596  1.346   -8.395  1.00 0.00 ? 65  SER A OG   1  
ATOM 428   H H    . SER A 1 28 ? -4.333  4.545   -6.339  1.00 0.00 ? 65  SER A H    1  
ATOM 429   H HA   . SER A 1 28 ? -4.486  1.760   -5.992  1.00 0.00 ? 65  SER A HA   1  
ATOM 430   H HB2  . SER A 1 28 ? -4.561  3.121   -8.147  1.00 0.00 ? 65  SER A HB2  1  
ATOM 431   H HB3  . SER A 1 28 ? -2.805  3.194   -8.050  1.00 0.00 ? 65  SER A HB3  1  
ATOM 432   H HG   . SER A 1 28 ? -3.941  1.415   -9.302  1.00 0.00 ? 65  SER A HG   1  
ATOM 433   N N    . ARG A 1 29 ? -2.083  0.816   -5.761  1.00 0.00 ? 66  ARG A N    1  
ATOM 434   C CA   . ARG A 1 29 ? -0.813  0.286   -5.271  1.00 0.00 ? 66  ARG A CA   1  
ATOM 435   C C    . ARG A 1 29 ? 0.397   1.076   -5.786  1.00 0.00 ? 66  ARG A C    1  
ATOM 436   O O    . ARG A 1 29 ? 1.271   1.413   -4.998  1.00 0.00 ? 66  ARG A O    1  
ATOM 437   C CB   . ARG A 1 29 ? -0.643  -1.189  -5.650  1.00 0.00 ? 66  ARG A CB   1  
ATOM 438   C CG   . ARG A 1 29 ? -1.509  -2.156  -4.858  1.00 0.00 ? 66  ARG A CG   1  
ATOM 439   C CD   . ARG A 1 29 ? -2.924  -2.251  -5.406  1.00 0.00 ? 66  ARG A CD   1  
ATOM 440   N NE   . ARG A 1 29 ? -2.945  -2.477  -6.854  1.00 0.00 ? 66  ARG A NE   1  
ATOM 441   C CZ   . ARG A 1 29 ? -2.448  -3.556  -7.467  1.00 0.00 ? 66  ARG A CZ   1  
ATOM 442   N NH1  . ARG A 1 29 ? -1.975  -4.584  -6.770  1.00 0.00 ? 66  ARG A NH1  1  
ATOM 443   N NH2  . ARG A 1 29 ? -2.447  -3.612  -8.791  1.00 0.00 ? 66  ARG A NH2  1  
ATOM 444   H H    . ARG A 1 29 ? -2.720  0.199   -6.179  1.00 0.00 ? 66  ARG A H    1  
ATOM 445   H HA   . ARG A 1 29 ? -0.832  0.362   -4.194  1.00 0.00 ? 66  ARG A HA   1  
ATOM 446   H HB2  . ARG A 1 29 ? -0.886  -1.304  -6.694  1.00 0.00 ? 66  ARG A HB2  1  
ATOM 447   H HB3  . ARG A 1 29 ? 0.391   -1.465  -5.502  1.00 0.00 ? 66  ARG A HB3  1  
ATOM 448   H HG2  . ARG A 1 29 ? -1.056  -3.128  -4.901  1.00 0.00 ? 66  ARG A HG2  1  
ATOM 449   H HG3  . ARG A 1 29 ? -1.552  -1.824  -3.830  1.00 0.00 ? 66  ARG A HG3  1  
ATOM 450   H HD2  . ARG A 1 29 ? -3.428  -3.073  -4.919  1.00 0.00 ? 66  ARG A HD2  1  
ATOM 451   H HD3  . ARG A 1 29 ? -3.445  -1.332  -5.187  1.00 0.00 ? 66  ARG A HD3  1  
ATOM 452   H HE   . ARG A 1 29 ? -3.343  -1.767  -7.407  1.00 0.00 ? 66  ARG A HE   1  
ATOM 453   H HH11 . ARG A 1 29 ? -1.989  -4.567  -5.763  1.00 0.00 ? 66  ARG A HH11 1  
ATOM 454   H HH12 . ARG A 1 29 ? -1.602  -5.390  -7.244  1.00 0.00 ? 66  ARG A HH12 1  
ATOM 455   H HH21 . ARG A 1 29 ? -2.816  -2.838  -9.326  1.00 0.00 ? 66  ARG A HH21 1  
ATOM 456   H HH22 . ARG A 1 29 ? -2.086  -4.419  -9.266  1.00 0.00 ? 66  ARG A HH22 1  
ATOM 457   N N    . PRO A 1 30 ? 0.512   1.335   -7.114  1.00 0.00 ? 67  PRO A N    1  
ATOM 458   C CA   . PRO A 1 30 ? 1.667   2.043   -7.686  1.00 0.00 ? 67  PRO A CA   1  
ATOM 459   C C    . PRO A 1 30 ? 1.976   3.355   -6.964  1.00 0.00 ? 67  PRO A C    1  
ATOM 460   O O    . PRO A 1 30 ? 3.141   3.673   -6.711  1.00 0.00 ? 67  PRO A O    1  
ATOM 461   C CB   . PRO A 1 30 ? 1.255   2.315   -9.143  1.00 0.00 ? 67  PRO A CB   1  
ATOM 462   C CG   . PRO A 1 30 ? -0.192  1.963   -9.226  1.00 0.00 ? 67  PRO A CG   1  
ATOM 463   C CD   . PRO A 1 30 ? -0.419  0.922   -8.173  1.00 0.00 ? 67  PRO A CD   1  
ATOM 464   H HA   . PRO A 1 30 ? 2.549   1.421   -7.675  1.00 0.00 ? 67  PRO A HA   1  
ATOM 465   H HB2  . PRO A 1 30 ? 1.420   3.356   -9.377  1.00 0.00 ? 67  PRO A HB2  1  
ATOM 466   H HB3  . PRO A 1 30 ? 1.845   1.697   -9.803  1.00 0.00 ? 67  PRO A HB3  1  
ATOM 467   H HG2  . PRO A 1 30 ? -0.796  2.835   -9.026  1.00 0.00 ? 67  PRO A HG2  1  
ATOM 468   H HG3  . PRO A 1 30 ? -0.419  1.565   -10.202 1.00 0.00 ? 67  PRO A HG3  1  
ATOM 469   H HD2  . PRO A 1 30 ? -1.442  0.949   -7.827  1.00 0.00 ? 67  PRO A HD2  1  
ATOM 470   H HD3  . PRO A 1 30 ? -0.168  -0.060  -8.547  1.00 0.00 ? 67  PRO A HD3  1  
ATOM 471   N N    . ALA A 1 31 ? 0.931   4.080   -6.578  1.00 0.00 ? 68  ALA A N    1  
ATOM 472   C CA   . ALA A 1 31 ? 1.094   5.324   -5.840  1.00 0.00 ? 68  ALA A CA   1  
ATOM 473   C C    . ALA A 1 31 ? 1.673   5.058   -4.452  1.00 0.00 ? 68  ALA A C    1  
ATOM 474   O O    . ALA A 1 31 ? 2.640   5.701   -4.035  1.00 0.00 ? 68  ALA A O    1  
ATOM 475   C CB   . ALA A 1 31 ? -0.239  6.051   -5.742  1.00 0.00 ? 68  ALA A CB   1  
ATOM 476   H H    . ALA A 1 31 ? 0.027   3.746   -6.757  1.00 0.00 ? 68  ALA A H    1  
ATOM 477   H HA   . ALA A 1 31 ? 1.780   5.951   -6.392  1.00 0.00 ? 68  ALA A HA   1  
ATOM 478   H HB1  . ALA A 1 31 ? -0.138  7.040   -6.164  1.00 0.00 ? 68  ALA A HB1  1  
ATOM 479   H HB2  . ALA A 1 31 ? -0.532  6.128   -4.705  1.00 0.00 ? 68  ALA A HB2  1  
ATOM 480   H HB3  . ALA A 1 31 ? -0.990  5.501   -6.288  1.00 0.00 ? 68  ALA A HB3  1  
ATOM 481   N N    . LEU A 1 32 ? 1.141   4.040   -3.784  1.00 0.00 ? 69  LEU A N    1  
ATOM 482   C CA   . LEU A 1 32 ? 1.647   3.620   -2.478  1.00 0.00 ? 69  LEU A CA   1  
ATOM 483   C C    . LEU A 1 32 ? 3.086   3.120   -2.577  1.00 0.00 ? 69  LEU A C    1  
ATOM 484   O O    . LEU A 1 32 ? 3.917   3.428   -1.723  1.00 0.00 ? 69  LEU A O    1  
ATOM 485   C CB   . LEU A 1 32 ? 0.757   2.525   -1.895  1.00 0.00 ? 69  LEU A CB   1  
ATOM 486   C CG   . LEU A 1 32 ? -0.488  3.016   -1.161  1.00 0.00 ? 69  LEU A CG   1  
ATOM 487   C CD1  . LEU A 1 32 ? -1.460  1.868   -0.937  1.00 0.00 ? 69  LEU A CD1  1  
ATOM 488   C CD2  . LEU A 1 32 ? -0.093  3.645   0.167   1.00 0.00 ? 69  LEU A CD2  1  
ATOM 489   H H    . LEU A 1 32 ? 0.423   3.521   -4.205  1.00 0.00 ? 69  LEU A H    1  
ATOM 490   H HA   . LEU A 1 32 ? 1.621   4.477   -1.823  1.00 0.00 ? 69  LEU A HA   1  
ATOM 491   H HB2  . LEU A 1 32 ? 0.442   1.875   -2.700  1.00 0.00 ? 69  LEU A HB2  1  
ATOM 492   H HB3  . LEU A 1 32 ? 1.349   1.946   -1.202  1.00 0.00 ? 69  LEU A HB3  1  
ATOM 493   H HG   . LEU A 1 32 ? -0.985  3.765   -1.758  1.00 0.00 ? 69  LEU A HG   1  
ATOM 494   H HD11 . LEU A 1 32 ? -1.593  1.324   -1.861  1.00 0.00 ? 69  LEU A HD11 1  
ATOM 495   H HD12 . LEU A 1 32 ? -1.065  1.204   -0.182  1.00 0.00 ? 69  LEU A HD12 1  
ATOM 496   H HD13 . LEU A 1 32 ? -2.411  2.261   -0.610  1.00 0.00 ? 69  LEU A HD13 1  
ATOM 497   H HD21 . LEU A 1 32 ? 0.664   3.038   0.645   1.00 0.00 ? 69  LEU A HD21 1  
ATOM 498   H HD22 . LEU A 1 32 ? 0.298   4.637   -0.007  1.00 0.00 ? 69  LEU A HD22 1  
ATOM 499   H HD23 . LEU A 1 32 ? -0.961  3.709   0.807   1.00 0.00 ? 69  LEU A HD23 1  
ATOM 500   N N    . LYS A 1 33 ? 3.374   2.354   -3.624  1.00 0.00 ? 70  LYS A N    1  
ATOM 501   C CA   . LYS A 1 33 ? 4.711   1.811   -3.835  1.00 0.00 ? 70  LYS A CA   1  
ATOM 502   C C    . LYS A 1 33 ? 5.733   2.934   -3.969  1.00 0.00 ? 70  LYS A C    1  
ATOM 503   O O    . LYS A 1 33 ? 6.830   2.855   -3.417  1.00 0.00 ? 70  LYS A O    1  
ATOM 504   C CB   . LYS A 1 33 ? 4.756   0.925   -5.087  1.00 0.00 ? 70  LYS A CB   1  
ATOM 505   C CG   . LYS A 1 33 ? 3.854   -0.299  -5.026  1.00 0.00 ? 70  LYS A CG   1  
ATOM 506   C CD   . LYS A 1 33 ? 4.042   -1.188  -6.240  1.00 0.00 ? 70  LYS A CD   1  
ATOM 507   C CE   . LYS A 1 33 ? 3.215   -2.456  -6.135  1.00 0.00 ? 70  LYS A CE   1  
ATOM 508   N NZ   . LYS A 1 33 ? 3.529   -3.419  -7.218  1.00 0.00 ? 70  LYS A NZ   1  
ATOM 509   H H    . LYS A 1 33 ? 2.665   2.145   -4.273  1.00 0.00 ? 70  LYS A H    1  
ATOM 510   H HA   . LYS A 1 33 ? 4.964   1.212   -2.972  1.00 0.00 ? 70  LYS A HA   1  
ATOM 511   H HB2  . LYS A 1 33 ? 4.460   1.518   -5.940  1.00 0.00 ? 70  LYS A HB2  1  
ATOM 512   H HB3  . LYS A 1 33 ? 5.772   0.585   -5.235  1.00 0.00 ? 70  LYS A HB3  1  
ATOM 513   H HG2  . LYS A 1 33 ? 4.085   -0.870  -4.139  1.00 0.00 ? 70  LYS A HG2  1  
ATOM 514   H HG3  . LYS A 1 33 ? 2.823   0.027   -4.987  1.00 0.00 ? 70  LYS A HG3  1  
ATOM 515   H HD2  . LYS A 1 33 ? 3.739   -0.644  -7.123  1.00 0.00 ? 70  LYS A HD2  1  
ATOM 516   H HD3  . LYS A 1 33 ? 5.085   -1.454  -6.319  1.00 0.00 ? 70  LYS A HD3  1  
ATOM 517   H HE2  . LYS A 1 33 ? 3.415   -2.922  -5.183  1.00 0.00 ? 70  LYS A HE2  1  
ATOM 518   H HE3  . LYS A 1 33 ? 2.170   -2.192  -6.191  1.00 0.00 ? 70  LYS A HE3  1  
ATOM 519   H HZ1  . LYS A 1 33 ? 4.406   -3.136  -7.708  1.00 0.00 ? 70  LYS A HZ1  1  
ATOM 520   H HZ2  . LYS A 1 33 ? 3.660   -4.371  -6.822  1.00 0.00 ? 70  LYS A HZ2  1  
ATOM 521   H HZ3  . LYS A 1 33 ? 2.751   -3.450  -7.912  1.00 0.00 ? 70  LYS A HZ3  1  
ATOM 522   N N    . LYS A 1 34 ? 5.339   4.007   -4.646  1.00 0.00 ? 71  LYS A N    1  
ATOM 523   C CA   . LYS A 1 34 ? 6.201   5.168   -4.800  1.00 0.00 ? 71  LYS A CA   1  
ATOM 524   C C    . LYS A 1 34 ? 6.386   5.860   -3.466  1.00 0.00 ? 71  LYS A C    1  
ATOM 525   O O    . LYS A 1 34 ? 7.504   6.170   -3.065  1.00 0.00 ? 71  LYS A O    1  
ATOM 526   C CB   . LYS A 1 34 ? 5.614   6.159   -5.801  1.00 0.00 ? 71  LYS A CB   1  
ATOM 527   C CG   . LYS A 1 34 ? 6.489   7.384   -6.003  1.00 0.00 ? 71  LYS A CG   1  
ATOM 528   C CD   . LYS A 1 34 ? 5.900   8.355   -7.011  1.00 0.00 ? 71  LYS A CD   1  
ATOM 529   C CE   . LYS A 1 34 ? 6.744   9.617   -7.109  1.00 0.00 ? 71  LYS A CE   1  
ATOM 530   N NZ   . LYS A 1 34 ? 6.231   10.557  -8.137  1.00 0.00 ? 71  LYS A NZ   1  
ATOM 531   H H    . LYS A 1 34 ? 4.422   4.045   -4.989  1.00 0.00 ? 71  LYS A H    1  
ATOM 532   H HA   . LYS A 1 34 ? 7.161   4.827   -5.155  1.00 0.00 ? 71  LYS A HA   1  
ATOM 533   H HB2  . LYS A 1 34 ? 5.486   5.664   -6.747  1.00 0.00 ? 71  LYS A HB2  1  
ATOM 534   H HB3  . LYS A 1 34 ? 4.650   6.486   -5.441  1.00 0.00 ? 71  LYS A HB3  1  
ATOM 535   H HG2  . LYS A 1 34 ? 6.597   7.892   -5.058  1.00 0.00 ? 71  LYS A HG2  1  
ATOM 536   H HG3  . LYS A 1 34 ? 7.460   7.065   -6.353  1.00 0.00 ? 71  LYS A HG3  1  
ATOM 537   H HD2  . LYS A 1 34 ? 5.868   7.878   -7.979  1.00 0.00 ? 71  LYS A HD2  1  
ATOM 538   H HD3  . LYS A 1 34 ? 4.900   8.620   -6.701  1.00 0.00 ? 71  LYS A HD3  1  
ATOM 539   H HE2  . LYS A 1 34 ? 6.740   10.110  -6.149  1.00 0.00 ? 71  LYS A HE2  1  
ATOM 540   H HE3  . LYS A 1 34 ? 7.755   9.337   -7.363  1.00 0.00 ? 71  LYS A HE3  1  
ATOM 541   H HZ1  . LYS A 1 34 ? 5.790   10.029  -8.921  1.00 0.00 ? 71  LYS A HZ1  1  
ATOM 542   H HZ2  . LYS A 1 34 ? 5.520   11.199  -7.719  1.00 0.00 ? 71  LYS A HZ2  1  
ATOM 543   H HZ3  . LYS A 1 34 ? 7.016   11.129  -8.517  1.00 0.00 ? 71  LYS A HZ3  1  
ATOM 544   N N    . PHE A 1 35 ? 5.270   6.069   -2.787  1.00 0.00 ? 72  PHE A N    1  
ATOM 545   C CA   . PHE A 1 35 ? 5.262   6.706   -1.477  1.00 0.00 ? 72  PHE A CA   1  
ATOM 546   C C    . PHE A 1 35 ? 6.266   6.036   -0.544  1.00 0.00 ? 72  PHE A C    1  
ATOM 547   O O    . PHE A 1 35 ? 7.048   6.708   0.128   1.00 0.00 ? 72  PHE A O    1  
ATOM 548   C CB   . PHE A 1 35 ? 3.861   6.635   -0.859  1.00 0.00 ? 72  PHE A CB   1  
ATOM 549   C CG   . PHE A 1 35 ? 3.772   7.286   0.488   1.00 0.00 ? 72  PHE A CG   1  
ATOM 550   C CD1  . PHE A 1 35 ? 3.473   8.632   0.600   1.00 0.00 ? 72  PHE A CD1  1  
ATOM 551   C CD2  . PHE A 1 35 ? 4.010   6.556   1.639   1.00 0.00 ? 72  PHE A CD2  1  
ATOM 552   C CE1  . PHE A 1 35 ? 3.406   9.239   1.839   1.00 0.00 ? 72  PHE A CE1  1  
ATOM 553   C CE2  . PHE A 1 35 ? 3.949   7.155   2.882   1.00 0.00 ? 72  PHE A CE2  1  
ATOM 554   C CZ   . PHE A 1 35 ? 3.646   8.500   2.983   1.00 0.00 ? 72  PHE A CZ   1  
ATOM 555   H H    . PHE A 1 35 ? 4.417   5.788   -3.187  1.00 0.00 ? 72  PHE A H    1  
ATOM 556   H HA   . PHE A 1 35 ? 5.537   7.742   -1.606  1.00 0.00 ? 72  PHE A HA   1  
ATOM 557   H HB2  . PHE A 1 35 ? 3.160   7.131   -1.514  1.00 0.00 ? 72  PHE A HB2  1  
ATOM 558   H HB3  . PHE A 1 35 ? 3.574   5.599   -0.749  1.00 0.00 ? 72  PHE A HB3  1  
ATOM 559   H HD1  . PHE A 1 35 ? 3.286   9.204   -0.296  1.00 0.00 ? 72  PHE A HD1  1  
ATOM 560   H HD2  . PHE A 1 35 ? 4.247   5.503   1.556   1.00 0.00 ? 72  PHE A HD2  1  
ATOM 561   H HE1  . PHE A 1 35 ? 3.172   10.291  1.914   1.00 0.00 ? 72  PHE A HE1  1  
ATOM 562   H HE2  . PHE A 1 35 ? 4.135   6.575   3.773   1.00 0.00 ? 72  PHE A HE2  1  
ATOM 563   H HZ   . PHE A 1 35 ? 3.592   8.972   3.953   1.00 0.00 ? 72  PHE A HZ   1  
ATOM 564   N N    . ILE A 1 36 ? 6.241   4.710   -0.512  1.00 0.00 ? 73  ILE A N    1  
ATOM 565   C CA   . ILE A 1 36 ? 7.142   3.956   0.343   1.00 0.00 ? 73  ILE A CA   1  
ATOM 566   C C    . ILE A 1 36 ? 8.587   4.094   -0.126  1.00 0.00 ? 73  ILE A C    1  
ATOM 567   O O    . ILE A 1 36 ? 9.490   4.252   0.685   1.00 0.00 ? 73  ILE A O    1  
ATOM 568   C CB   . ILE A 1 36 ? 6.750   2.467   0.404   1.00 0.00 ? 73  ILE A CB   1  
ATOM 569   C CG1  . ILE A 1 36 ? 5.329   2.324   0.956   1.00 0.00 ? 73  ILE A CG1  1  
ATOM 570   C CG2  . ILE A 1 36 ? 7.740   1.690   1.263   1.00 0.00 ? 73  ILE A CG2  1  
ATOM 571   C CD1  . ILE A 1 36 ? 4.843   0.893   1.022   1.00 0.00 ? 73  ILE A CD1  1  
ATOM 572   H H    . ILE A 1 36 ? 5.601   4.227   -1.081  1.00 0.00 ? 73  ILE A H    1  
ATOM 573   H HA   . ILE A 1 36 ? 7.063   4.363   1.341   1.00 0.00 ? 73  ILE A HA   1  
ATOM 574   H HB   . ILE A 1 36 ? 6.785   2.065   -0.597  1.00 0.00 ? 73  ILE A HB   1  
ATOM 575   H HG12 . ILE A 1 36 ? 5.294   2.730   1.955   1.00 0.00 ? 73  ILE A HG12 1  
ATOM 576   H HG13 . ILE A 1 36 ? 4.648   2.877   0.324   1.00 0.00 ? 73  ILE A HG13 1  
ATOM 577   H HG21 . ILE A 1 36 ? 8.735   2.079   1.103   1.00 0.00 ? 73  ILE A HG21 1  
ATOM 578   H HG22 . ILE A 1 36 ? 7.477   1.798   2.304   1.00 0.00 ? 73  ILE A HG22 1  
ATOM 579   H HG23 . ILE A 1 36 ? 7.712   0.645   0.991   1.00 0.00 ? 73  ILE A HG23 1  
ATOM 580   H HD11 . ILE A 1 36 ? 5.180   0.358   0.147   1.00 0.00 ? 73  ILE A HD11 1  
ATOM 581   H HD12 . ILE A 1 36 ? 5.237   0.419   1.908   1.00 0.00 ? 73  ILE A HD12 1  
ATOM 582   H HD13 . ILE A 1 36 ? 3.763   0.881   1.057   1.00 0.00 ? 73  ILE A HD13 1  
ATOM 583   N N    . LYS A 1 37 ? 8.800   4.063   -1.434  1.00 0.00 ? 74  LYS A N    1  
ATOM 584   C CA   . LYS A 1 37 ? 10.144  4.194   -1.985  1.00 0.00 ? 74  LYS A CA   1  
ATOM 585   C C    . LYS A 1 37 ? 10.755  5.554   -1.662  1.00 0.00 ? 74  LYS A C    1  
ATOM 586   O O    . LYS A 1 37 ? 11.946  5.651   -1.353  1.00 0.00 ? 74  LYS A O    1  
ATOM 587   C CB   . LYS A 1 37 ? 10.140  3.943   -3.494  1.00 0.00 ? 74  LYS A CB   1  
ATOM 588   C CG   . LYS A 1 37 ? 9.947   2.479   -3.848  1.00 0.00 ? 74  LYS A CG   1  
ATOM 589   C CD   . LYS A 1 37 ? 9.951   2.250   -5.350  1.00 0.00 ? 74  LYS A CD   1  
ATOM 590   C CE   . LYS A 1 37 ? 9.768   0.776   -5.686  1.00 0.00 ? 74  LYS A CE   1  
ATOM 591   N NZ   . LYS A 1 37 ? 9.754   0.527   -7.153  1.00 0.00 ? 74  LYS A NZ   1  
ATOM 592   H H    . LYS A 1 37 ? 8.038   3.953   -2.045  1.00 0.00 ? 74  LYS A H    1  
ATOM 593   H HA   . LYS A 1 37 ? 10.751  3.441   -1.520  1.00 0.00 ? 74  LYS A HA   1  
ATOM 594   H HB2  . LYS A 1 37 ? 9.339   4.513   -3.941  1.00 0.00 ? 74  LYS A HB2  1  
ATOM 595   H HB3  . LYS A 1 37 ? 11.083  4.274   -3.908  1.00 0.00 ? 74  LYS A HB3  1  
ATOM 596   H HG2  . LYS A 1 37 ? 10.748  1.905   -3.408  1.00 0.00 ? 74  LYS A HG2  1  
ATOM 597   H HG3  . LYS A 1 37 ? 9.001   2.144   -3.445  1.00 0.00 ? 74  LYS A HG3  1  
ATOM 598   H HD2  . LYS A 1 37 ? 9.145   2.814   -5.793  1.00 0.00 ? 74  LYS A HD2  1  
ATOM 599   H HD3  . LYS A 1 37 ? 10.896  2.587   -5.753  1.00 0.00 ? 74  LYS A HD3  1  
ATOM 600   H HE2  . LYS A 1 37 ? 10.578  0.215   -5.245  1.00 0.00 ? 74  LYS A HE2  1  
ATOM 601   H HE3  . LYS A 1 37 ? 8.831   0.441   -5.265  1.00 0.00 ? 74  LYS A HE3  1  
ATOM 602   H HZ1  . LYS A 1 37 ? 9.980   1.401   -7.673  1.00 0.00 ? 74  LYS A HZ1  1  
ATOM 603   H HZ2  . LYS A 1 37 ? 10.457  -0.203  -7.402  1.00 0.00 ? 74  LYS A HZ2  1  
ATOM 604   H HZ3  . LYS A 1 37 ? 8.807   0.195   -7.451  1.00 0.00 ? 74  LYS A HZ3  1  
ATOM 605   N N    . GLU A 1 38 ? 9.946   6.601   -1.737  1.00 0.00 ? 75  GLU A N    1  
ATOM 606   C CA   . GLU A 1 38 ? 10.421  7.948   -1.462  1.00 0.00 ? 75  GLU A CA   1  
ATOM 607   C C    . GLU A 1 38 ? 10.648  8.163   0.037   1.00 0.00 ? 75  GLU A C    1  
ATOM 608   O O    . GLU A 1 38 ? 11.535  8.916   0.435   1.00 0.00 ? 75  GLU A O    1  
ATOM 609   C CB   . GLU A 1 38 ? 9.430   8.996   -1.983  1.00 0.00 ? 75  GLU A CB   1  
ATOM 610   C CG   . GLU A 1 38 ? 9.083   8.865   -3.461  1.00 0.00 ? 75  GLU A CG   1  
ATOM 611   C CD   . GLU A 1 38 ? 10.299  8.857   -4.367  1.00 0.00 ? 75  GLU A CD   1  
ATOM 612   O OE1  . GLU A 1 38 ? 10.973  7.809   -4.455  1.00 0.00 ? 75  GLU A OE1  1  
ATOM 613   O OE2  . GLU A 1 38 ? 10.593  9.895   -4.994  1.00 0.00 ? 75  GLU A OE2  1  
ATOM 614   H H    . GLU A 1 38 ? 9.010   6.466   -2.010  1.00 0.00 ? 75  GLU A H    1  
ATOM 615   H HA   . GLU A 1 38 ? 11.363  8.076   -1.976  1.00 0.00 ? 75  GLU A HA   1  
ATOM 616   H HB2  . GLU A 1 38 ? 8.516   8.915   -1.418  1.00 0.00 ? 75  GLU A HB2  1  
ATOM 617   H HB3  . GLU A 1 38 ? 9.851   9.978   -1.824  1.00 0.00 ? 75  GLU A HB3  1  
ATOM 618   H HG2  . GLU A 1 38 ? 8.542   7.942   -3.607  1.00 0.00 ? 75  GLU A HG2  1  
ATOM 619   H HG3  . GLU A 1 38 ? 8.451   9.695   -3.742  1.00 0.00 ? 75  GLU A HG3  1  
ATOM 620   N N    . ASN A 1 39 ? 9.753   7.620   0.852   1.00 0.00 ? 76  ASN A N    1  
ATOM 621   C CA   . ASN A 1 39 ? 9.759   7.906   2.291   1.00 0.00 ? 76  ASN A CA   1  
ATOM 622   C C    . ASN A 1 39 ? 10.540  6.873   3.096   1.00 0.00 ? 76  ASN A C    1  
ATOM 623   O O    . ASN A 1 39 ? 11.243  7.224   4.043   1.00 0.00 ? 76  ASN A O    1  
ATOM 624   C CB   . ASN A 1 39 ? 8.322   7.994   2.811   1.00 0.00 ? 76  ASN A CB   1  
ATOM 625   C CG   . ASN A 1 39 ? 7.640   9.282   2.400   1.00 0.00 ? 76  ASN A CG   1  
ATOM 626   O OD1  . ASN A 1 39 ? 7.906   10.346  2.962   1.00 0.00 ? 76  ASN A OD1  1  
ATOM 627   N ND2  . ASN A 1 39 ? 6.780   9.202   1.398   1.00 0.00 ? 76  ASN A ND2  1  
ATOM 628   H H    . ASN A 1 39 ? 9.003   7.119   0.468   1.00 0.00 ? 76  ASN A H    1  
ATOM 629   H HA   . ASN A 1 39 ? 10.230  8.868   2.427   1.00 0.00 ? 76  ASN A HA   1  
ATOM 630   H HB2  . ASN A 1 39 ? 7.751   7.166   2.419   1.00 0.00 ? 76  ASN A HB2  1  
ATOM 631   H HB3  . ASN A 1 39 ? 8.332   7.941   3.889   1.00 0.00 ? 76  ASN A HB3  1  
ATOM 632   H HD21 . ASN A 1 39 ? 6.634   8.324   0.983   1.00 0.00 ? 76  ASN A HD21 1  
ATOM 633   H HD22 . ASN A 1 39 ? 6.334   10.029  1.100   1.00 0.00 ? 76  ASN A HD22 1  
ATOM 634   N N    . TYR A 1 40 ? 10.385  5.602   2.756   1.00 0.00 ? 77  TYR A N    1  
ATOM 635   C CA   . TYR A 1 40 ? 11.044  4.516   3.484   1.00 0.00 ? 77  TYR A CA   1  
ATOM 636   C C    . TYR A 1 40 ? 11.968  3.718   2.561   1.00 0.00 ? 77  TYR A C    1  
ATOM 637   O O    . TYR A 1 40 ? 11.646  2.591   2.191   1.00 0.00 ? 77  TYR A O    1  
ATOM 638   C CB   . TYR A 1 40 ? 10.006  3.564   4.097   1.00 0.00 ? 77  TYR A CB   1  
ATOM 639   C CG   . TYR A 1 40 ? 9.162   4.160   5.205   1.00 0.00 ? 77  TYR A CG   1  
ATOM 640   C CD1  . TYR A 1 40 ? 8.252   5.170   4.929   1.00 0.00 ? 77  TYR A CD1  1  
ATOM 641   C CD2  . TYR A 1 40 ? 9.281   3.728   6.522   1.00 0.00 ? 77  TYR A CD2  1  
ATOM 642   C CE1  . TYR A 1 40 ? 7.483   5.734   5.929   1.00 0.00 ? 77  TYR A CE1  1  
ATOM 643   C CE2  . TYR A 1 40 ? 8.516   4.288   7.529   1.00 0.00 ? 77  TYR A CE2  1  
ATOM 644   C CZ   . TYR A 1 40 ? 7.608   5.220   7.257   1.00 0.00 ? 77  TYR A CZ   1  
ATOM 645   O OH   . TYR A 1 40 ? 6.857   5.857   8.225   1.00 0.00 ? 77  TYR A OH   1  
ATOM 646   H H    . TYR A 1 40 ? 9.801   5.377   1.995   1.00 0.00 ? 77  TYR A H    1  
ATOM 647   H HA   . TYR A 1 40 ? 11.632  4.954   4.277   1.00 0.00 ? 77  TYR A HA   1  
ATOM 648   H HB2  . TYR A 1 40 ? 9.334   3.233   3.320   1.00 0.00 ? 77  TYR A HB2  1  
ATOM 649   H HB3  . TYR A 1 40 ? 10.521  2.704   4.502   1.00 0.00 ? 77  TYR A HB3  1  
ATOM 650   H HD1  . TYR A 1 40 ? 8.145   5.517   3.912   1.00 0.00 ? 77  TYR A HD1  1  
ATOM 651   H HD2  . TYR A 1 40 ? 9.983   2.941   6.756   1.00 0.00 ? 77  TYR A HD2  1  
ATOM 652   H HE1  . TYR A 1 40 ? 6.780   6.519   5.691   1.00 0.00 ? 77  TYR A HE1  1  
ATOM 653   H HE2  . TYR A 1 40 ? 8.622   3.939   8.546   1.00 0.00 ? 77  TYR A HE2  1  
ATOM 654   H HH   . TYR A 1 40 ? 6.190   5.216   8.524   1.00 0.00 ? 77  TYR A HH   1  
ATOM 655   N N    . PRO A 1 41 ? 13.129  4.284   2.180   1.00 0.00 ? 78  PRO A N    1  
ATOM 656   C CA   . PRO A 1 41 ? 14.076  3.631   1.257   1.00 0.00 ? 78  PRO A CA   1  
ATOM 657   C C    . PRO A 1 41 ? 14.548  2.261   1.735   1.00 0.00 ? 78  PRO A C    1  
ATOM 658   O O    . PRO A 1 41 ? 14.953  1.426   0.928   1.00 0.00 ? 78  PRO A O    1  
ATOM 659   C CB   . PRO A 1 41 ? 15.252  4.602   1.203   1.00 0.00 ? 78  PRO A CB   1  
ATOM 660   C CG   . PRO A 1 41 ? 14.664  5.920   1.561   1.00 0.00 ? 78  PRO A CG   1  
ATOM 661   C CD   . PRO A 1 41 ? 13.602  5.622   2.577   1.00 0.00 ? 78  PRO A CD   1  
ATOM 662   H HA   . PRO A 1 41 ? 13.650  3.530   0.268   1.00 0.00 ? 78  PRO A HA   1  
ATOM 663   H HB2  . PRO A 1 41 ? 16.007  4.299   1.914   1.00 0.00 ? 78  PRO A HB2  1  
ATOM 664   H HB3  . PRO A 1 41 ? 15.667  4.611   0.207   1.00 0.00 ? 78  PRO A HB3  1  
ATOM 665   H HG2  . PRO A 1 41 ? 15.425  6.557   1.986   1.00 0.00 ? 78  PRO A HG2  1  
ATOM 666   H HG3  . PRO A 1 41 ? 14.230  6.380   0.687   1.00 0.00 ? 78  PRO A HG3  1  
ATOM 667   H HD2  . PRO A 1 41 ? 14.025  5.604   3.570   1.00 0.00 ? 78  PRO A HD2  1  
ATOM 668   H HD3  . PRO A 1 41 ? 12.804  6.348   2.516   1.00 0.00 ? 78  PRO A HD3  1  
ATOM 669   N N    . ILE A 1 42 ? 14.478  2.039   3.046   1.00 0.00 ? 79  ILE A N    1  
ATOM 670   C CA   . ILE A 1 42 ? 14.876  0.770   3.650   1.00 0.00 ? 79  ILE A CA   1  
ATOM 671   C C    . ILE A 1 42 ? 14.218  -0.393  2.925   1.00 0.00 ? 79  ILE A C    1  
ATOM 672   O O    . ILE A 1 42 ? 14.880  -1.285  2.391   1.00 0.00 ? 79  ILE A O    1  
ATOM 673   C CB   . ILE A 1 42 ? 14.439  0.692   5.131   1.00 0.00 ? 79  ILE A CB   1  
ATOM 674   C CG1  . ILE A 1 42 ? 14.869  1.943   5.912   1.00 0.00 ? 79  ILE A CG1  1  
ATOM 675   C CG2  . ILE A 1 42 ? 15.015  -0.555  5.785   1.00 0.00 ? 79  ILE A CG2  1  
ATOM 676   C CD1  . ILE A 1 42 ? 13.890  3.096   5.825   1.00 0.00 ? 79  ILE A CD1  1  
ATOM 677   H H    . ILE A 1 42 ? 14.138  2.749   3.627   1.00 0.00 ? 79  ILE A H    1  
ATOM 678   H HA   . ILE A 1 42 ? 15.949  0.675   3.596   1.00 0.00 ? 79  ILE A HA   1  
ATOM 679   H HB   . ILE A 1 42 ? 13.350  0.610   5.146   1.00 0.00 ? 79  ILE A HB   1  
ATOM 680   H HG12 . ILE A 1 42 ? 14.981  1.687   6.957   1.00 0.00 ? 79  ILE A HG12 1  
ATOM 681   H HG13 . ILE A 1 42 ? 15.819  2.288   5.530   1.00 0.00 ? 79  ILE A HG13 1  
ATOM 682   H HG21 . ILE A 1 42 ? 15.401  -1.215  5.021   1.00 0.00 ? 79  ILE A HG21 1  
ATOM 683   H HG22 . ILE A 1 42 ? 15.814  -0.274  6.456   1.00 0.00 ? 79  ILE A HG22 1  
ATOM 684   H HG23 . ILE A 1 42 ? 14.239  -1.062  6.341   1.00 0.00 ? 79  ILE A HG23 1  
ATOM 685   H HD11 . ILE A 1 42 ? 13.119  2.859   5.105   1.00 0.00 ? 79  ILE A HD11 1  
ATOM 686   H HD12 . ILE A 1 42 ? 13.440  3.261   6.792   1.00 0.00 ? 79  ILE A HD12 1  
ATOM 687   H HD13 . ILE A 1 42 ? 14.412  3.988   5.513   1.00 0.00 ? 79  ILE A HD13 1  
ATOM 688   N N    . VAL A 1 43 ? 12.905  -0.328  2.880   1.00 0.00 ? 80  VAL A N    1  
ATOM 689   C CA   . VAL A 1 43 ? 12.091  -1.311  2.213   1.00 0.00 ? 80  VAL A CA   1  
ATOM 690   C C    . VAL A 1 43 ? 11.849  -0.884  0.775   1.00 0.00 ? 80  VAL A C    1  
ATOM 691   O O    . VAL A 1 43 ? 11.711  -1.711  -0.124  1.00 0.00 ? 80  VAL A O    1  
ATOM 692   C CB   . VAL A 1 43 ? 10.765  -1.475  2.973   1.00 0.00 ? 80  VAL A CB   1  
ATOM 693   C CG1  . VAL A 1 43 ? 9.581   -1.316  2.066   1.00 0.00 ? 80  VAL A CG1  1  
ATOM 694   C CG2  . VAL A 1 43 ? 10.712  -2.808  3.687   1.00 0.00 ? 80  VAL A CG2  1  
ATOM 695   H H    . VAL A 1 43 ? 12.463  0.446   3.280   1.00 0.00 ? 80  VAL A H    1  
ATOM 696   H HA   . VAL A 1 43 ? 12.607  -2.256  2.220   1.00 0.00 ? 80  VAL A HA   1  
ATOM 697   H HB   . VAL A 1 43 ? 10.714  -0.696  3.708   1.00 0.00 ? 80  VAL A HB   1  
ATOM 698   H HG11 . VAL A 1 43 ? 9.851   -1.645  1.075   1.00 0.00 ? 80  VAL A HG11 1  
ATOM 699   H HG12 . VAL A 1 43 ? 8.762   -1.905  2.437   1.00 0.00 ? 80  VAL A HG12 1  
ATOM 700   H HG13 . VAL A 1 43 ? 9.301   -0.273  2.040   1.00 0.00 ? 80  VAL A HG13 1  
ATOM 701   H HG21 . VAL A 1 43 ? 11.717  -3.136  3.912   1.00 0.00 ? 80  VAL A HG21 1  
ATOM 702   H HG22 . VAL A 1 43 ? 10.152  -2.699  4.606   1.00 0.00 ? 80  VAL A HG22 1  
ATOM 703   H HG23 . VAL A 1 43 ? 10.227  -3.535  3.053   1.00 0.00 ? 80  VAL A HG23 1  
ATOM 704   N N    . GLY A 1 44 ? 11.780  0.422   0.577   1.00 0.00 ? 81  GLY A N    1  
ATOM 705   C CA   . GLY A 1 44 ? 11.531  0.960   -0.733  1.00 0.00 ? 81  GLY A CA   1  
ATOM 706   C C    . GLY A 1 44 ? 12.531  0.465   -1.759  1.00 0.00 ? 81  GLY A C    1  
ATOM 707   O O    . GLY A 1 44 ? 12.162  0.097   -2.873  1.00 0.00 ? 81  GLY A O    1  
ATOM 708   H H    . GLY A 1 44 ? 11.861  1.030   1.346   1.00 0.00 ? 81  GLY A H    1  
ATOM 709   H HA2  . GLY A 1 44 ? 10.536  0.677   -1.036  1.00 0.00 ? 81  GLY A HA2  1  
ATOM 710   H HA3  . GLY A 1 44 ? 11.593  2.033   -0.676  1.00 0.00 ? 81  GLY A HA3  1  
ATOM 711   N N    . SER A 1 45 ? 13.789  0.408   -1.355  1.00 0.00 ? 82  SER A N    1  
ATOM 712   C CA   . SER A 1 45 ? 14.845  -0.093  -2.210  1.00 0.00 ? 82  SER A CA   1  
ATOM 713   C C    . SER A 1 45 ? 15.190  -1.533  -1.826  1.00 0.00 ? 82  SER A C    1  
ATOM 714   O O    . SER A 1 45 ? 16.339  -1.966  -1.936  1.00 0.00 ? 82  SER A O    1  
ATOM 715   C CB   . SER A 1 45 ? 16.080  0.810   -2.093  1.00 0.00 ? 82  SER A CB   1  
ATOM 716   O OG   . SER A 1 45 ? 17.000  0.571   -3.148  1.00 0.00 ? 82  SER A OG   1  
ATOM 717   H H    . SER A 1 45 ? 14.010  0.686   -0.440  1.00 0.00 ? 82  SER A H    1  
ATOM 718   H HA   . SER A 1 45 ? 14.489  -0.076  -3.229  1.00 0.00 ? 82  SER A HA   1  
ATOM 719   H HB2  . SER A 1 45 ? 15.771  1.844   -2.130  1.00 0.00 ? 82  SER A HB2  1  
ATOM 720   H HB3  . SER A 1 45 ? 16.575  0.617   -1.153  1.00 0.00 ? 82  SER A HB3  1  
ATOM 721   H HG   . SER A 1 45 ? 17.027  1.346   -3.727  1.00 0.00 ? 82  SER A HG   1  
ATOM 722   N N    . ALA A 1 46 ? 14.189  -2.281  -1.384  1.00 0.00 ? 83  ALA A N    1  
ATOM 723   C CA   . ALA A 1 46 ? 14.382  -3.685  -1.043  1.00 0.00 ? 83  ALA A CA   1  
ATOM 724   C C    . ALA A 1 46 ? 14.175  -4.554  -2.273  1.00 0.00 ? 83  ALA A C    1  
ATOM 725   O O    . ALA A 1 46 ? 13.374  -4.221  -3.151  1.00 0.00 ? 83  ALA A O    1  
ATOM 726   C CB   . ALA A 1 46 ? 13.446  -4.118  0.079   1.00 0.00 ? 83  ALA A CB   1  
ATOM 727   H H    . ALA A 1 46 ? 13.282  -1.895  -1.335  1.00 0.00 ? 83  ALA A H    1  
ATOM 728   H HA   . ALA A 1 46 ? 15.399  -3.805  -0.699  1.00 0.00 ? 83  ALA A HA   1  
ATOM 729   H HB1  . ALA A 1 46 ? 13.211  -3.267  0.705   1.00 0.00 ? 83  ALA A HB1  1  
ATOM 730   H HB2  . ALA A 1 46 ? 12.535  -4.514  -0.344  1.00 0.00 ? 83  ALA A HB2  1  
ATOM 731   H HB3  . ALA A 1 46 ? 13.925  -4.880  0.674   1.00 0.00 ? 83  ALA A HB3  1  
ATOM 732   N N    . SER A 1 47 ? 14.935  -5.632  -2.361  1.00 0.00 ? 84  SER A N    1  
ATOM 733   C CA   . SER A 1 47 ? 14.846  -6.523  -3.500  1.00 0.00 ? 84  SER A CA   1  
ATOM 734   C C    . SER A 1 47 ? 13.475  -7.192  -3.544  1.00 0.00 ? 84  SER A C    1  
ATOM 735   O O    . SER A 1 47 ? 13.024  -7.774  -2.555  1.00 0.00 ? 84  SER A O    1  
ATOM 736   C CB   . SER A 1 47 ? 15.960  -7.568  -3.432  1.00 0.00 ? 84  SER A CB   1  
ATOM 737   O OG   . SER A 1 47 ? 17.230  -6.941  -3.330  1.00 0.00 ? 84  SER A OG   1  
ATOM 738   H H    . SER A 1 47 ? 15.584  -5.827  -1.648  1.00 0.00 ? 84  SER A H    1  
ATOM 739   H HA   . SER A 1 47 ? 14.972  -5.932  -4.395  1.00 0.00 ? 84  SER A HA   1  
ATOM 740   H HB2  . SER A 1 47 ? 15.812  -8.197  -2.565  1.00 0.00 ? 84  SER A HB2  1  
ATOM 741   H HB3  . SER A 1 47 ? 15.943  -8.174  -4.326  1.00 0.00 ? 84  SER A HB3  1  
ATOM 742   H HG   . SER A 1 47 ? 17.106  -5.985  -3.186  1.00 0.00 ? 84  SER A HG   1  
ATOM 743   N N    . ASN A 1 48 ? 12.804  -7.047  -4.683  1.00 0.00 ? 85  ASN A N    1  
ATOM 744   C CA   . ASN A 1 48 ? 11.463  -7.591  -4.896  1.00 0.00 ? 85  ASN A CA   1  
ATOM 745   C C    . ASN A 1 48 ? 10.433  -6.922  -3.986  1.00 0.00 ? 85  ASN A C    1  
ATOM 746   O O    . ASN A 1 48 ? 9.380   -7.497  -3.708  1.00 0.00 ? 85  ASN A O    1  
ATOM 747   C CB   . ASN A 1 48 ? 11.431  -9.115  -4.684  1.00 0.00 ? 85  ASN A CB   1  
ATOM 748   C CG   . ASN A 1 48 ? 12.215  -9.894  -5.731  1.00 0.00 ? 85  ASN A CG   1  
ATOM 749   O OD1  . ASN A 1 48 ? 12.224  -11.127 -5.722  1.00 0.00 ? 85  ASN A OD1  1  
ATOM 750   N ND2  . ASN A 1 48 ? 12.878  -9.190  -6.636  1.00 0.00 ? 85  ASN A ND2  1  
ATOM 751   H H    . ASN A 1 48 ? 13.220  -6.522  -5.410  1.00 0.00 ? 85  ASN A H    1  
ATOM 752   H HA   . ASN A 1 48 ? 11.191  -7.383  -5.921  1.00 0.00 ? 85  ASN A HA   1  
ATOM 753   H HB2  . ASN A 1 48 ? 11.849  -9.343  -3.715  1.00 0.00 ? 85  ASN A HB2  1  
ATOM 754   H HB3  . ASN A 1 48 ? 10.404  -9.449  -4.711  1.00 0.00 ? 85  ASN A HB3  1  
ATOM 755   H HD21 . ASN A 1 48 ? 12.833  -8.211  -6.588  1.00 0.00 ? 85  ASN A HD21 1  
ATOM 756   H HD22 . ASN A 1 48 ? 13.398  -9.675  -7.312  1.00 0.00 ? 85  ASN A HD22 1  
ATOM 757   N N    . PHE A 1 49 ? 10.676  -5.657  -3.643  1.00 0.00 ? 86  PHE A N    1  
ATOM 758   C CA   . PHE A 1 49 ? 9.715   -4.866  -2.876  1.00 0.00 ? 86  PHE A CA   1  
ATOM 759   C C    . PHE A 1 49 ? 8.410   -4.735  -3.650  1.00 0.00 ? 86  PHE A C    1  
ATOM 760   O O    . PHE A 1 49 ? 7.318   -4.880  -3.095  1.00 0.00 ? 86  PHE A O    1  
ATOM 761   C CB   . PHE A 1 49 ? 10.284  -3.472  -2.581  1.00 0.00 ? 86  PHE A CB   1  
ATOM 762   C CG   . PHE A 1 49 ? 9.241   -2.475  -2.155  1.00 0.00 ? 86  PHE A CG   1  
ATOM 763   C CD1  . PHE A 1 49 ? 8.575   -2.625  -0.948  1.00 0.00 ? 86  PHE A CD1  1  
ATOM 764   C CD2  . PHE A 1 49 ? 8.937   -1.384  -2.950  1.00 0.00 ? 86  PHE A CD2  1  
ATOM 765   C CE1  . PHE A 1 49 ? 7.632   -1.701  -0.542  1.00 0.00 ? 86  PHE A CE1  1  
ATOM 766   C CE2  . PHE A 1 49 ? 7.992   -0.461  -2.549  1.00 0.00 ? 86  PHE A CE2  1  
ATOM 767   C CZ   . PHE A 1 49 ? 7.289   -0.649  -1.397  1.00 0.00 ? 86  PHE A CZ   1  
ATOM 768   H H    . PHE A 1 49 ? 11.482  -5.219  -3.987  1.00 0.00 ? 86  PHE A H    1  
ATOM 769   H HA   . PHE A 1 49 ? 9.522   -5.378  -1.943  1.00 0.00 ? 86  PHE A HA   1  
ATOM 770   H HB2  . PHE A 1 49 ? 11.013  -3.549  -1.787  1.00 0.00 ? 86  PHE A HB2  1  
ATOM 771   H HB3  . PHE A 1 49 ? 10.765  -3.091  -3.471  1.00 0.00 ? 86  PHE A HB3  1  
ATOM 772   H HD1  . PHE A 1 49 ? 8.804   -3.472  -0.319  1.00 0.00 ? 86  PHE A HD1  1  
ATOM 773   H HD2  . PHE A 1 49 ? 9.443   -1.262  -3.897  1.00 0.00 ? 86  PHE A HD2  1  
ATOM 774   H HE1  . PHE A 1 49 ? 7.121   -1.830  0.402   1.00 0.00 ? 86  PHE A HE1  1  
ATOM 775   H HE2  . PHE A 1 49 ? 7.765   0.385   -3.182  1.00 0.00 ? 86  PHE A HE2  1  
ATOM 776   H HZ   . PHE A 1 49 ? 6.530   0.057   -1.101  1.00 0.00 ? 86  PHE A HZ   1  
ATOM 777   N N    . ASP A 1 50 ? 8.543   -4.473  -4.943  1.00 0.00 ? 87  ASP A N    1  
ATOM 778   C CA   . ASP A 1 50 ? 7.397   -4.318  -5.836  1.00 0.00 ? 87  ASP A CA   1  
ATOM 779   C C    . ASP A 1 50 ? 6.471   -5.533  -5.754  1.00 0.00 ? 87  ASP A C    1  
ATOM 780   O O    . ASP A 1 50 ? 5.249   -5.389  -5.666  1.00 0.00 ? 87  ASP A O    1  
ATOM 781   C CB   . ASP A 1 50 ? 7.879   -4.122  -7.275  1.00 0.00 ? 87  ASP A CB   1  
ATOM 782   C CG   . ASP A 1 50 ? 6.743   -3.874  -8.246  1.00 0.00 ? 87  ASP A CG   1  
ATOM 783   O OD1  . ASP A 1 50 ? 6.019   -2.870  -8.082  1.00 0.00 ? 87  ASP A OD1  1  
ATOM 784   O OD2  . ASP A 1 50 ? 6.560   -4.688  -9.173  1.00 0.00 ? 87  ASP A OD2  1  
ATOM 785   H H    . ASP A 1 50 ? 9.449   -4.373  -5.308  1.00 0.00 ? 87  ASP A H    1  
ATOM 786   H HA   . ASP A 1 50 ? 6.849   -3.440  -5.525  1.00 0.00 ? 87  ASP A HA   1  
ATOM 787   H HB2  . ASP A 1 50 ? 8.546   -3.274  -7.312  1.00 0.00 ? 87  ASP A HB2  1  
ATOM 788   H HB3  . ASP A 1 50 ? 8.412   -5.007  -7.592  1.00 0.00 ? 87  ASP A HB3  1  
ATOM 789   N N    . LEU A 1 51 ? 7.069   -6.720  -5.719  1.00 0.00 ? 88  LEU A N    1  
ATOM 790   C CA   . LEU A 1 51 ? 6.322   -7.967  -5.599  1.00 0.00 ? 88  LEU A CA   1  
ATOM 791   C C    . LEU A 1 51 ? 5.749   -8.120  -4.187  1.00 0.00 ? 88  LEU A C    1  
ATOM 792   O O    . LEU A 1 51 ? 4.562   -8.410  -4.017  1.00 0.00 ? 88  LEU A O    1  
ATOM 793   C CB   . LEU A 1 51 ? 7.245   -9.151  -5.956  1.00 0.00 ? 88  LEU A CB   1  
ATOM 794   C CG   . LEU A 1 51 ? 6.630   -10.563 -5.914  1.00 0.00 ? 88  LEU A CG   1  
ATOM 795   C CD1  . LEU A 1 51 ? 6.800   -11.191 -4.542  1.00 0.00 ? 88  LEU A CD1  1  
ATOM 796   C CD2  . LEU A 1 51 ? 5.159   -10.535 -6.297  1.00 0.00 ? 88  LEU A CD2  1  
ATOM 797   H H    . LEU A 1 51 ? 8.048   -6.755  -5.738  1.00 0.00 ? 88  LEU A H    1  
ATOM 798   H HA   . LEU A 1 51 ? 5.505   -7.935  -6.304  1.00 0.00 ? 88  LEU A HA   1  
ATOM 799   H HB2  . LEU A 1 51 ? 7.622   -8.985  -6.954  1.00 0.00 ? 88  LEU A HB2  1  
ATOM 800   H HB3  . LEU A 1 51 ? 8.083   -9.135  -5.274  1.00 0.00 ? 88  LEU A HB3  1  
ATOM 801   H HG   . LEU A 1 51 ? 7.148   -11.191 -6.626  1.00 0.00 ? 88  LEU A HG   1  
ATOM 802   H HD11 . LEU A 1 51 ? 7.842   -11.161 -4.259  1.00 0.00 ? 88  LEU A HD11 1  
ATOM 803   H HD12 . LEU A 1 51 ? 6.213   -10.642 -3.822  1.00 0.00 ? 88  LEU A HD12 1  
ATOM 804   H HD13 . LEU A 1 51 ? 6.464   -12.218 -4.572  1.00 0.00 ? 88  LEU A HD13 1  
ATOM 805   H HD21 . LEU A 1 51 ? 4.965   -9.673  -6.916  1.00 0.00 ? 88  LEU A HD21 1  
ATOM 806   H HD22 . LEU A 1 51 ? 4.908   -11.435 -6.837  1.00 0.00 ? 88  LEU A HD22 1  
ATOM 807   H HD23 . LEU A 1 51 ? 4.561   -10.473 -5.398  1.00 0.00 ? 88  LEU A HD23 1  
ATOM 808   N N    . TYR A 1 52 ? 6.599   -7.921  -3.188  1.00 0.00 ? 89  TYR A N    1  
ATOM 809   C CA   . TYR A 1 52 ? 6.206   -8.073  -1.788  1.00 0.00 ? 89  TYR A CA   1  
ATOM 810   C C    . TYR A 1 52 ? 5.020   -7.181  -1.438  1.00 0.00 ? 89  TYR A C    1  
ATOM 811   O O    . TYR A 1 52 ? 4.153   -7.569  -0.654  1.00 0.00 ? 89  TYR A O    1  
ATOM 812   C CB   . TYR A 1 52 ? 7.380   -7.747  -0.867  1.00 0.00 ? 89  TYR A CB   1  
ATOM 813   C CG   . TYR A 1 52 ? 8.452   -8.813  -0.812  1.00 0.00 ? 89  TYR A CG   1  
ATOM 814   C CD1  . TYR A 1 52 ? 8.538   -9.793  -1.791  1.00 0.00 ? 89  TYR A CD1  1  
ATOM 815   C CD2  . TYR A 1 52 ? 9.386   -8.828  0.214   1.00 0.00 ? 89  TYR A CD2  1  
ATOM 816   C CE1  . TYR A 1 52 ? 9.521   -10.760 -1.751  1.00 0.00 ? 89  TYR A CE1  1  
ATOM 817   C CE2  . TYR A 1 52 ? 10.373  -9.791  0.265   1.00 0.00 ? 89  TYR A CE2  1  
ATOM 818   C CZ   . TYR A 1 52 ? 10.437  -10.756 -0.721  1.00 0.00 ? 89  TYR A CZ   1  
ATOM 819   O OH   . TYR A 1 52 ? 11.421  -11.718 -0.674  1.00 0.00 ? 89  TYR A OH   1  
ATOM 820   H H    . TYR A 1 52 ? 7.534   -7.692  -3.396  1.00 0.00 ? 89  TYR A H    1  
ATOM 821   H HA   . TYR A 1 52 ? 5.920   -9.104  -1.639  1.00 0.00 ? 89  TYR A HA   1  
ATOM 822   H HB2  . TYR A 1 52 ? 7.844   -6.834  -1.203  1.00 0.00 ? 89  TYR A HB2  1  
ATOM 823   H HB3  . TYR A 1 52 ? 7.003   -7.606  0.131   1.00 0.00 ? 89  TYR A HB3  1  
ATOM 824   H HD1  . TYR A 1 52 ? 7.819   -9.790  -2.594  1.00 0.00 ? 89  TYR A HD1  1  
ATOM 825   H HD2  . TYR A 1 52 ? 9.331   -8.072  0.985   1.00 0.00 ? 89  TYR A HD2  1  
ATOM 826   H HE1  . TYR A 1 52 ? 9.568   -11.509 -2.526  1.00 0.00 ? 89  TYR A HE1  1  
ATOM 827   H HE2  . TYR A 1 52 ? 11.092  -9.784  1.072   1.00 0.00 ? 89  TYR A HE2  1  
ATOM 828   H HH   . TYR A 1 52 ? 12.264  -11.326 -0.945  1.00 0.00 ? 89  TYR A HH   1  
ATOM 829   N N    . PHE A 1 53 ? 5.007   -5.981  -2.000  1.00 0.00 ? 90  PHE A N    1  
ATOM 830   C CA   . PHE A 1 53 ? 3.951   -5.017  -1.732  1.00 0.00 ? 90  PHE A CA   1  
ATOM 831   C C    . PHE A 1 53 ? 2.581   -5.580  -2.108  1.00 0.00 ? 90  PHE A C    1  
ATOM 832   O O    . PHE A 1 53 ? 1.606   -5.386  -1.386  1.00 0.00 ? 90  PHE A O    1  
ATOM 833   C CB   . PHE A 1 53 ? 4.199   -3.724  -2.505  1.00 0.00 ? 90  PHE A CB   1  
ATOM 834   C CG   . PHE A 1 53 ? 3.229   -2.637  -2.157  1.00 0.00 ? 90  PHE A CG   1  
ATOM 835   C CD1  . PHE A 1 53 ? 3.411   -1.870  -1.021  1.00 0.00 ? 90  PHE A CD1  1  
ATOM 836   C CD2  . PHE A 1 53 ? 2.137   -2.379  -2.967  1.00 0.00 ? 90  PHE A CD2  1  
ATOM 837   C CE1  . PHE A 1 53 ? 2.520   -0.869  -0.701  1.00 0.00 ? 90  PHE A CE1  1  
ATOM 838   C CE2  . PHE A 1 53 ? 1.244   -1.380  -2.649  1.00 0.00 ? 90  PHE A CE2  1  
ATOM 839   C CZ   . PHE A 1 53 ? 1.436   -0.623  -1.515  1.00 0.00 ? 90  PHE A CZ   1  
ATOM 840   H H    . PHE A 1 53 ? 5.757   -5.720  -2.587  1.00 0.00 ? 90  PHE A H    1  
ATOM 841   H HA   . PHE A 1 53 ? 3.960   -4.799  -0.673  1.00 0.00 ? 90  PHE A HA   1  
ATOM 842   H HB2  . PHE A 1 53 ? 5.193   -3.366  -2.284  1.00 0.00 ? 90  PHE A HB2  1  
ATOM 843   H HB3  . PHE A 1 53 ? 4.118   -3.920  -3.564  1.00 0.00 ? 90  PHE A HB3  1  
ATOM 844   H HD1  . PHE A 1 53 ? 4.261   -2.063  -0.384  1.00 0.00 ? 90  PHE A HD1  1  
ATOM 845   H HD2  . PHE A 1 53 ? 1.984   -2.974  -3.856  1.00 0.00 ? 90  PHE A HD2  1  
ATOM 846   H HE1  . PHE A 1 53 ? 2.672   -0.276  0.189   1.00 0.00 ? 90  PHE A HE1  1  
ATOM 847   H HE2  . PHE A 1 53 ? 0.396   -1.188  -3.292  1.00 0.00 ? 90  PHE A HE2  1  
ATOM 848   H HZ   . PHE A 1 53 ? 0.736   0.159   -1.263  1.00 0.00 ? 90  PHE A HZ   1  
ATOM 849   N N    . ASN A 1 54 ? 2.514   -6.271  -3.239  1.00 0.00 ? 91  ASN A N    1  
ATOM 850   C CA   . ASN A 1 54 ? 1.254   -6.849  -3.707  1.00 0.00 ? 91  ASN A CA   1  
ATOM 851   C C    . ASN A 1 54 ? 0.721   -7.856  -2.697  1.00 0.00 ? 91  ASN A C    1  
ATOM 852   O O    . ASN A 1 54 ? -0.446  -7.800  -2.306  1.00 0.00 ? 91  ASN A O    1  
ATOM 853   C CB   . ASN A 1 54 ? 1.437   -7.527  -5.067  1.00 0.00 ? 91  ASN A CB   1  
ATOM 854   C CG   . ASN A 1 54 ? 1.911   -6.567  -6.137  1.00 0.00 ? 91  ASN A CG   1  
ATOM 855   O OD1  . ASN A 1 54 ? 1.248   -5.576  -6.445  1.00 0.00 ? 91  ASN A OD1  1  
ATOM 856   N ND2  . ASN A 1 54 ? 3.067   -6.852  -6.710  1.00 0.00 ? 91  ASN A ND2  1  
ATOM 857   H H    . ASN A 1 54 ? 3.330   -6.399  -3.771  1.00 0.00 ? 91  ASN A H    1  
ATOM 858   H HA   . ASN A 1 54 ? 0.538   -6.047  -3.809  1.00 0.00 ? 91  ASN A HA   1  
ATOM 859   H HB2  . ASN A 1 54 ? 2.170   -8.316  -4.973  1.00 0.00 ? 91  ASN A HB2  1  
ATOM 860   H HB3  . ASN A 1 54 ? 0.496   -7.954  -5.382  1.00 0.00 ? 91  ASN A HB3  1  
ATOM 861   H HD21 . ASN A 1 54 ? 3.540   -7.659  -6.415  1.00 0.00 ? 91  ASN A HD21 1  
ATOM 862   H HD22 . ASN A 1 54 ? 3.412   -6.238  -7.399  1.00 0.00 ? 91  ASN A HD22 1  
ATOM 863   N N    . ASN A 1 55 ? 1.613   -8.713  -2.215  1.00 0.00 ? 92  ASN A N    1  
ATOM 864   C CA   . ASN A 1 55 ? 1.270   -9.691  -1.188  1.00 0.00 ? 92  ASN A CA   1  
ATOM 865   C C    . ASN A 1 55 ? 0.878   -8.994  0.107   1.00 0.00 ? 92  ASN A C    1  
ATOM 866   O O    . ASN A 1 55 ? -0.039  -9.427  0.804   1.00 0.00 ? 92  ASN A O    1  
ATOM 867   C CB   . ASN A 1 55 ? 2.440   -10.646 -0.939  1.00 0.00 ? 92  ASN A CB   1  
ATOM 868   C CG   . ASN A 1 55 ? 2.687   -11.587 -2.103  1.00 0.00 ? 92  ASN A CG   1  
ATOM 869   O OD1  . ASN A 1 55 ? 1.800   -12.342 -2.504  1.00 0.00 ? 92  ASN A OD1  1  
ATOM 870   N ND2  . ASN A 1 55 ? 3.888   -11.553 -2.656  1.00 0.00 ? 92  ASN A ND2  1  
ATOM 871   H H    . ASN A 1 55 ? 2.541   -8.658  -2.528  1.00 0.00 ? 92  ASN A H    1  
ATOM 872   H HA   . ASN A 1 55 ? 0.422   -10.260 -1.543  1.00 0.00 ? 92  ASN A HA   1  
ATOM 873   H HB2  . ASN A 1 55 ? 3.338   -10.069 -0.773  1.00 0.00 ? 92  ASN A HB2  1  
ATOM 874   H HB3  . ASN A 1 55 ? 2.232   -11.237 -0.058  1.00 0.00 ? 92  ASN A HB3  1  
ATOM 875   H HD21 . ASN A 1 55 ? 4.549   -10.928 -2.291  1.00 0.00 ? 92  ASN A HD21 1  
ATOM 876   H HD22 . ASN A 1 55 ? 4.076   -12.169 -3.405  1.00 0.00 ? 92  ASN A HD22 1  
ATOM 877   N N    . ALA A 1 56 ? 1.551   -7.884  0.395   1.00 0.00 ? 93  ALA A N    1  
ATOM 878   C CA   . ALA A 1 56 ? 1.264   -7.090  1.582   1.00 0.00 ? 93  ALA A CA   1  
ATOM 879   C C    . ALA A 1 56 ? -0.155  -6.534  1.536   1.00 0.00 ? 93  ALA A C    1  
ATOM 880   O O    . ALA A 1 56 ? -0.891  -6.606  2.520   1.00 0.00 ? 93  ALA A O    1  
ATOM 881   C CB   . ALA A 1 56 ? 2.275   -5.961  1.717   1.00 0.00 ? 93  ALA A CB   1  
ATOM 882   H H    . ALA A 1 56 ? 2.244   -7.574  -0.229  1.00 0.00 ? 93  ALA A H    1  
ATOM 883   H HA   . ALA A 1 56 ? 1.359   -7.734  2.444   1.00 0.00 ? 93  ALA A HA   1  
ATOM 884   H HB1  . ALA A 1 56 ? 3.260   -6.378  1.874   1.00 0.00 ? 93  ALA A HB1  1  
ATOM 885   H HB2  . ALA A 1 56 ? 2.274   -5.367  0.815   1.00 0.00 ? 93  ALA A HB2  1  
ATOM 886   H HB3  . ALA A 1 56 ? 2.010   -5.338  2.558   1.00 0.00 ? 93  ALA A HB3  1  
ATOM 887   N N    . ILE A 1 57 ? -0.552  -6.043  0.365   1.00 0.00 ? 94  ILE A N    1  
ATOM 888   C CA   . ILE A 1 57 ? -1.906  -5.541  0.159   1.00 0.00 ? 94  ILE A CA   1  
ATOM 889   C C    . ILE A 1 57 ? -2.921  -6.650  0.395   1.00 0.00 ? 94  ILE A C    1  
ATOM 890   O O    . ILE A 1 57 ? -3.891  -6.477  1.134   1.00 0.00 ? 94  ILE A O    1  
ATOM 891   C CB   . ILE A 1 57 ? -2.094  -4.984  -1.269  1.00 0.00 ? 94  ILE A CB   1  
ATOM 892   C CG1  . ILE A 1 57 ? -1.192  -3.773  -1.499  1.00 0.00 ? 94  ILE A CG1  1  
ATOM 893   C CG2  . ILE A 1 57 ? -3.551  -4.613  -1.516  1.00 0.00 ? 94  ILE A CG2  1  
ATOM 894   C CD1  . ILE A 1 57 ? -1.499  -2.611  -0.583  1.00 0.00 ? 94  ILE A CD1  1  
ATOM 895   H H    . ILE A 1 57 ? 0.074   -6.056  -0.392  1.00 0.00 ? 94  ILE A H    1  
ATOM 896   H HA   . ILE A 1 57 ? -2.082  -4.742  0.868   1.00 0.00 ? 94  ILE A HA   1  
ATOM 897   H HB   . ILE A 1 57 ? -1.824  -5.759  -1.971  1.00 0.00 ? 94  ILE A HB   1  
ATOM 898   H HG12 . ILE A 1 57 ? -0.164  -4.061  -1.333  1.00 0.00 ? 94  ILE A HG12 1  
ATOM 899   H HG13 . ILE A 1 57 ? -1.305  -3.434  -2.518  1.00 0.00 ? 94  ILE A HG13 1  
ATOM 900   H HG21 . ILE A 1 57 ? -4.099  -4.674  -0.587  1.00 0.00 ? 94  ILE A HG21 1  
ATOM 901   H HG22 . ILE A 1 57 ? -3.606  -3.606  -1.902  1.00 0.00 ? 94  ILE A HG22 1  
ATOM 902   H HG23 . ILE A 1 57 ? -3.980  -5.297  -2.233  1.00 0.00 ? 94  ILE A HG23 1  
ATOM 903   H HD11 . ILE A 1 57 ? -2.274  -2.901  0.110   1.00 0.00 ? 94  ILE A HD11 1  
ATOM 904   H HD12 . ILE A 1 57 ? -0.610  -2.338  -0.038  1.00 0.00 ? 94  ILE A HD12 1  
ATOM 905   H HD13 . ILE A 1 57 ? -1.834  -1.768  -1.171  1.00 0.00 ? 94  ILE A HD13 1  
ATOM 906   N N    . LYS A 1 58 ? -2.654  -7.802  -0.203  1.00 0.00 ? 95  LYS A N    1  
ATOM 907   C CA   . LYS A 1 58 ? -3.516  -8.969  -0.051  1.00 0.00 ? 95  LYS A CA   1  
ATOM 908   C C    . LYS A 1 58 ? -3.619  -9.384  1.412   1.00 0.00 ? 95  LYS A C    1  
ATOM 909   O O    . LYS A 1 58 ? -4.704  -9.700  1.896   1.00 0.00 ? 95  LYS A O    1  
ATOM 910   C CB   . LYS A 1 58 ? -2.998  -10.140 -0.885  1.00 0.00 ? 95  LYS A CB   1  
ATOM 911   C CG   . LYS A 1 58 ? -3.021  -9.884  -2.381  1.00 0.00 ? 95  LYS A CG   1  
ATOM 912   C CD   . LYS A 1 58 ? -2.604  -11.118 -3.162  1.00 0.00 ? 95  LYS A CD   1  
ATOM 913   C CE   . LYS A 1 58 ? -2.661  -10.870 -4.659  1.00 0.00 ? 95  LYS A CE   1  
ATOM 914   N NZ   . LYS A 1 58 ? -2.412  -12.110 -5.439  1.00 0.00 ? 95  LYS A NZ   1  
ATOM 915   H H    . LYS A 1 58 ? -1.842  -7.873  -0.752  1.00 0.00 ? 95  LYS A H    1  
ATOM 916   H HA   . LYS A 1 58 ? -4.501  -8.698  -0.403  1.00 0.00 ? 95  LYS A HA   1  
ATOM 917   H HB2  . LYS A 1 58 ? -1.980  -10.348 -0.595  1.00 0.00 ? 95  LYS A HB2  1  
ATOM 918   H HB3  . LYS A 1 58 ? -3.607  -11.009 -0.681  1.00 0.00 ? 95  LYS A HB3  1  
ATOM 919   H HG2  . LYS A 1 58 ? -4.023  -9.606  -2.674  1.00 0.00 ? 95  LYS A HG2  1  
ATOM 920   H HG3  . LYS A 1 58 ? -2.340  -9.078  -2.608  1.00 0.00 ? 95  LYS A HG3  1  
ATOM 921   H HD2  . LYS A 1 58 ? -1.592  -11.380 -2.889  1.00 0.00 ? 95  LYS A HD2  1  
ATOM 922   H HD3  . LYS A 1 58 ? -3.267  -11.933 -2.913  1.00 0.00 ? 95  LYS A HD3  1  
ATOM 923   H HE2  . LYS A 1 58 ? -3.640  -10.490 -4.912  1.00 0.00 ? 95  LYS A HE2  1  
ATOM 924   H HE3  . LYS A 1 58 ? -1.912  -10.136 -4.919  1.00 0.00 ? 95  LYS A HE3  1  
ATOM 925   H HZ1  . LYS A 1 58 ? -1.850  -12.784 -4.876  1.00 0.00 ? 95  LYS A HZ1  1  
ATOM 926   H HZ2  . LYS A 1 58 ? -3.317  -12.560 -5.699  1.00 0.00 ? 95  LYS A HZ2  1  
ATOM 927   H HZ3  . LYS A 1 58 ? -1.887  -11.886 -6.311  1.00 0.00 ? 95  LYS A HZ3  1  
ATOM 928   N N    . LYS A 1 59 ? -2.489  -9.365  2.106   1.00 0.00 ? 96  LYS A N    1  
ATOM 929   C CA   . LYS A 1 59 ? -2.439  -9.711  3.522   1.00 0.00 ? 96  LYS A CA   1  
ATOM 930   C C    . LYS A 1 59 ? -3.218  -8.685  4.345   1.00 0.00 ? 96  LYS A C    1  
ATOM 931   O O    . LYS A 1 59 ? -3.904  -9.029  5.306   1.00 0.00 ? 96  LYS A O    1  
ATOM 932   C CB   . LYS A 1 59 ? -0.975  -9.792  3.981   1.00 0.00 ? 96  LYS A CB   1  
ATOM 933   C CG   . LYS A 1 59 ? -0.769  -10.413 5.360   1.00 0.00 ? 96  LYS A CG   1  
ATOM 934   C CD   . LYS A 1 59 ? -1.062  -9.426  6.476   1.00 0.00 ? 96  LYS A CD   1  
ATOM 935   C CE   . LYS A 1 59 ? -0.808  -10.034 7.842   1.00 0.00 ? 96  LYS A CE   1  
ATOM 936   N NZ   . LYS A 1 59 ? 0.608   -10.460 8.005   1.00 0.00 ? 96  LYS A NZ   1  
ATOM 937   H H    . LYS A 1 59 ? -1.655  -9.105  1.651   1.00 0.00 ? 96  LYS A H    1  
ATOM 938   H HA   . LYS A 1 59 ? -2.901  -10.677 3.648   1.00 0.00 ? 96  LYS A HA   1  
ATOM 939   H HB2  . LYS A 1 59 ? -0.422  -10.381 3.266   1.00 0.00 ? 96  LYS A HB2  1  
ATOM 940   H HB3  . LYS A 1 59 ? -0.563  -8.793  4.000   1.00 0.00 ? 96  LYS A HB3  1  
ATOM 941   H HG2  . LYS A 1 59 ? -1.429  -11.258 5.462   1.00 0.00 ? 96  LYS A HG2  1  
ATOM 942   H HG3  . LYS A 1 59 ? 0.256   -10.742 5.444   1.00 0.00 ? 96  LYS A HG3  1  
ATOM 943   H HD2  . LYS A 1 59 ? -0.432  -8.559  6.354   1.00 0.00 ? 96  LYS A HD2  1  
ATOM 944   H HD3  . LYS A 1 59 ? -2.100  -9.130  6.411   1.00 0.00 ? 96  LYS A HD3  1  
ATOM 945   H HE2  . LYS A 1 59 ? -1.042  -9.298  8.598   1.00 0.00 ? 96  LYS A HE2  1  
ATOM 946   H HE3  . LYS A 1 59 ? -1.451  -10.892 7.966   1.00 0.00 ? 96  LYS A HE3  1  
ATOM 947   H HZ1  . LYS A 1 59 ? 1.217   -9.959  7.322   1.00 0.00 ? 96  LYS A HZ1  1  
ATOM 948   H HZ2  . LYS A 1 59 ? 0.938   -10.245 8.969   1.00 0.00 ? 96  LYS A HZ2  1  
ATOM 949   H HZ3  . LYS A 1 59 ? 0.692   -11.488 7.842   1.00 0.00 ? 96  LYS A HZ3  1  
ATOM 950   N N    . GLY A 1 60 ? -3.093  -7.425  3.977   1.00 0.00 ? 97  GLY A N    1  
ATOM 951   C CA   . GLY A 1 60 ? -3.767  -6.375  4.706   1.00 0.00 ? 97  GLY A CA   1  
ATOM 952   C C    . GLY A 1 60 ? -5.273  -6.399  4.528   1.00 0.00 ? 97  GLY A C    1  
ATOM 953   O O    . GLY A 1 60 ? -6.016  -6.130  5.473   1.00 0.00 ? 97  GLY A O    1  
ATOM 954   H H    . GLY A 1 60 ? -2.510  -7.199  3.217   1.00 0.00 ? 97  GLY A H    1  
ATOM 955   H HA2  . GLY A 1 60 ? -3.541  -6.483  5.757   1.00 0.00 ? 97  GLY A HA2  1  
ATOM 956   H HA3  . GLY A 1 60 ? -3.392  -5.422  4.367   1.00 0.00 ? 97  GLY A HA3  1  
ATOM 957   N N    . VAL A 1 61 ? -5.733  -6.655  3.307   1.00 0.00 ? 98  VAL A N    1  
ATOM 958   C CA   . VAL A 1 61 ? -7.167  -6.644  3.030   1.00 0.00 ? 98  VAL A CA   1  
ATOM 959   C C    . VAL A 1 61 ? -7.869  -7.837  3.685   1.00 0.00 ? 98  VAL A C    1  
ATOM 960   O O    . VAL A 1 61 ? -8.953  -7.687  4.247   1.00 0.00 ? 98  VAL A O    1  
ATOM 961   C CB   . VAL A 1 61 ? -7.491  -6.589  1.515   1.00 0.00 ? 98  VAL A CB   1  
ATOM 962   C CG1  . VAL A 1 61 ? -6.953  -5.307  0.893   1.00 0.00 ? 98  VAL A CG1  1  
ATOM 963   C CG2  . VAL A 1 61 ? -6.941  -7.796  0.782   1.00 0.00 ? 98  VAL A CG2  1  
ATOM 964   H H    . VAL A 1 61 ? -5.098  -6.809  2.571   1.00 0.00 ? 98  VAL A H    1  
ATOM 965   H HA   . VAL A 1 61 ? -7.563  -5.743  3.479   1.00 0.00 ? 98  VAL A HA   1  
ATOM 966   H HB   . VAL A 1 61 ? -8.565  -6.589  1.400   1.00 0.00 ? 98  VAL A HB   1  
ATOM 967   H HG11 . VAL A 1 61 ? -5.891  -5.231  1.078   1.00 0.00 ? 98  VAL A HG11 1  
ATOM 968   H HG12 . VAL A 1 61 ? -7.132  -5.318  -0.172  1.00 0.00 ? 98  VAL A HG12 1  
ATOM 969   H HG13 . VAL A 1 61 ? -7.455  -4.456  1.332   1.00 0.00 ? 98  VAL A HG13 1  
ATOM 970   H HG21 . VAL A 1 61 ? -6.923  -8.645  1.450   1.00 0.00 ? 98  VAL A HG21 1  
ATOM 971   H HG22 . VAL A 1 61 ? -7.568  -8.016  -0.067  1.00 0.00 ? 98  VAL A HG22 1  
ATOM 972   H HG23 . VAL A 1 61 ? -5.937  -7.583  0.444   1.00 0.00 ? 98  VAL A HG23 1  
ATOM 973   N N    . GLU A 1 62 ? -7.206  -8.995  3.711   1.00 0.00 ? 99  GLU A N    1  
ATOM 974   C CA   . GLU A 1 62 ? -7.751  -10.162 4.404   1.00 0.00 ? 99  GLU A CA   1  
ATOM 975   C C    . GLU A 1 62 ? -7.771  -9.923  5.912   1.00 0.00 ? 99  GLU A C    1  
ATOM 976   O O    . GLU A 1 62 ? -8.682  -10.365 6.610   1.00 0.00 ? 99  GLU A O    1  
ATOM 977   C CB   . GLU A 1 62 ? -6.948  -11.428 4.088   1.00 0.00 ? 99  GLU A CB   1  
ATOM 978   C CG   . GLU A 1 62 ? -5.457  -11.273 4.320   1.00 0.00 ? 99  GLU A CG   1  
ATOM 979   C CD   . GLU A 1 62 ? -4.791  -12.544 4.794   1.00 0.00 ? 99  GLU A CD   1  
ATOM 980   O OE1  . GLU A 1 62 ? -5.152  -13.043 5.878   1.00 0.00 ? 99  GLU A OE1  1  
ATOM 981   O OE2  . GLU A 1 62 ? -3.888  -13.041 4.090   1.00 0.00 ? 99  GLU A OE2  1  
ATOM 982   H H    . GLU A 1 62 ? -6.309  -9.045  3.313   1.00 0.00 ? 99  GLU A H    1  
ATOM 983   H HA   . GLU A 1 62 ? -8.768  -10.299 4.063   1.00 0.00 ? 99  GLU A HA   1  
ATOM 984   H HB2  . GLU A 1 62 ? -7.303  -12.234 4.713   1.00 0.00 ? 99  GLU A HB2  1  
ATOM 985   H HB3  . GLU A 1 62 ? -7.104  -11.690 3.053   1.00 0.00 ? 99  GLU A HB3  1  
ATOM 986   H HG2  . GLU A 1 62 ? -4.996  -10.975 3.390   1.00 0.00 ? 99  GLU A HG2  1  
ATOM 987   H HG3  . GLU A 1 62 ? -5.300  -10.498 5.060   1.00 0.00 ? 99  GLU A HG3  1  
ATOM 988   N N    . ALA A 1 63 ? -6.756  -9.217  6.403   1.00 0.00 ? 100 ALA A N    1  
ATOM 989   C CA   . ALA A 1 63 ? -6.650  -8.894  7.821   1.00 0.00 ? 100 ALA A CA   1  
ATOM 990   C C    . ALA A 1 63 ? -7.677  -7.839  8.216   1.00 0.00 ? 100 ALA A C    1  
ATOM 991   O O    . ALA A 1 63 ? -7.903  -7.586  9.400   1.00 0.00 ? 100 ALA A O    1  
ATOM 992   C CB   . ALA A 1 63 ? -5.244  -8.416  8.149   1.00 0.00 ? 100 ALA A CB   1  
ATOM 993   H H    . ALA A 1 63 ? -6.053  -8.907  5.791   1.00 0.00 ? 100 ALA A H    1  
ATOM 994   H HA   . ALA A 1 63 ? -6.838  -9.797  8.384   1.00 0.00 ? 100 ALA A HA   1  
ATOM 995   H HB1  . ALA A 1 63 ? -5.250  -7.910  9.104   1.00 0.00 ? 100 ALA A HB1  1  
ATOM 996   H HB2  . ALA A 1 63 ? -4.907  -7.734  7.382   1.00 0.00 ? 100 ALA A HB2  1  
ATOM 997   H HB3  . ALA A 1 63 ? -4.576  -9.263  8.195   1.00 0.00 ? 100 ALA A HB3  1  
ATOM 998   N N    . GLY A 1 64 ? -8.263  -7.197  7.215   1.00 0.00 ? 101 GLY A N    1  
ATOM 999   C CA   . GLY A 1 64 ? -9.225  -6.146  7.463   1.00 0.00 ? 101 GLY A CA   1  
ATOM 1000  C C    . GLY A 1 64 ? -8.560  -4.866  7.915   1.00 0.00 ? 101 GLY A C    1  
ATOM 1001  O O    . GLY A 1 64 ? -9.089  -4.145  8.758   1.00 0.00 ? 101 GLY A O    1  
ATOM 1002  H H    . GLY A 1 64 ? -8.018  -7.423  6.293   1.00 0.00 ? 101 GLY A H    1  
ATOM 1003  H HA2  . GLY A 1 64 ? -9.776  -5.954  6.555   1.00 0.00 ? 101 GLY A HA2  1  
ATOM 1004  H HA3  . GLY A 1 64 ? -9.914  -6.473  8.228   1.00 0.00 ? 101 GLY A HA3  1  
ATOM 1005  N N    . ASP A 1 65 ? -7.406  -4.573  7.333   1.00 0.00 ? 102 ASP A N    1  
ATOM 1006  C CA   . ASP A 1 65 ? -6.674  -3.359  7.660   1.00 0.00 ? 102 ASP A CA   1  
ATOM 1007  C C    . ASP A 1 65 ? -6.656  -2.436  6.451   1.00 0.00 ? 102 ASP A C    1  
ATOM 1008  O O    . ASP A 1 65 ? -6.815  -1.222  6.576   1.00 0.00 ? 102 ASP A O    1  
ATOM 1009  C CB   . ASP A 1 65 ? -5.245  -3.682  8.102   1.00 0.00 ? 102 ASP A CB   1  
ATOM 1010  C CG   . ASP A 1 65 ? -4.720  -2.687  9.122   1.00 0.00 ? 102 ASP A CG   1  
ATOM 1011  O OD1  . ASP A 1 65 ? -5.489  -1.802  9.550   1.00 0.00 ? 102 ASP A OD1  1  
ATOM 1012  O OD2  . ASP A 1 65 ? -3.519  -2.750  9.462   1.00 0.00 ? 102 ASP A OD2  1  
ATOM 1013  H H    . ASP A 1 65 ? -7.041  -5.185  6.655   1.00 0.00 ? 102 ASP A H    1  
ATOM 1014  H HA   . ASP A 1 65 ? -7.192  -2.863  8.467   1.00 0.00 ? 102 ASP A HA   1  
ATOM 1015  H HB2  . ASP A 1 65 ? -5.224  -4.668  8.544   1.00 0.00 ? 102 ASP A HB2  1  
ATOM 1016  H HB3  . ASP A 1 65 ? -4.594  -3.664  7.239   1.00 0.00 ? 102 ASP A HB3  1  
ATOM 1017  N N    . PHE A 1 66 ? -6.639  -3.040  5.269   1.00 0.00 ? 103 PHE A N    1  
ATOM 1018  C CA   . PHE A 1 66 ? -6.814  -2.289  4.035   1.00 0.00 ? 103 PHE A CA   1  
ATOM 1019  C C    . PHE A 1 66 ? -8.024  -2.835  3.284   1.00 0.00 ? 103 PHE A C    1  
ATOM 1020  O O    . PHE A 1 66 ? -8.427  -3.977  3.503   1.00 0.00 ? 103 PHE A O    1  
ATOM 1021  C CB   . PHE A 1 66 ? -5.577  -2.368  3.127   1.00 0.00 ? 103 PHE A CB   1  
ATOM 1022  C CG   . PHE A 1 66 ? -4.259  -2.323  3.841   1.00 0.00 ? 103 PHE A CG   1  
ATOM 1023  C CD1  . PHE A 1 66 ? -3.881  -1.212  4.573   1.00 0.00 ? 103 PHE A CD1  1  
ATOM 1024  C CD2  . PHE A 1 66 ? -3.387  -3.392  3.756   1.00 0.00 ? 103 PHE A CD2  1  
ATOM 1025  C CE1  . PHE A 1 66 ? -2.658  -1.175  5.212   1.00 0.00 ? 103 PHE A CE1  1  
ATOM 1026  C CE2  . PHE A 1 66 ? -2.165  -3.363  4.395   1.00 0.00 ? 103 PHE A CE2  1  
ATOM 1027  C CZ   . PHE A 1 66 ? -1.798  -2.253  5.125   1.00 0.00 ? 103 PHE A CZ   1  
ATOM 1028  H H    . PHE A 1 66 ? -6.652  -4.023  5.232   1.00 0.00 ? 103 PHE A H    1  
ATOM 1029  H HA   . PHE A 1 66 ? -6.999  -1.257  4.294   1.00 0.00 ? 103 PHE A HA   1  
ATOM 1030  H HB2  . PHE A 1 66 ? -5.612  -3.287  2.564   1.00 0.00 ? 103 PHE A HB2  1  
ATOM 1031  H HB3  . PHE A 1 66 ? -5.599  -1.536  2.438   1.00 0.00 ? 103 PHE A HB3  1  
ATOM 1032  H HD1  . PHE A 1 66 ? -4.555  -0.372  4.647   1.00 0.00 ? 103 PHE A HD1  1  
ATOM 1033  H HD2  . PHE A 1 66 ? -3.676  -4.263  3.184   1.00 0.00 ? 103 PHE A HD2  1  
ATOM 1034  H HE1  . PHE A 1 66 ? -2.373  -0.303  5.779   1.00 0.00 ? 103 PHE A HE1  1  
ATOM 1035  H HE2  . PHE A 1 66 ? -1.501  -4.214  4.326   1.00 0.00 ? 103 PHE A HE2  1  
ATOM 1036  H HZ   . PHE A 1 66 ? -0.841  -2.224  5.623   1.00 0.00 ? 103 PHE A HZ   1  
ATOM 1037  N N    . GLU A 1 67 ? -8.587  -2.028  2.403   1.00 0.00 ? 104 GLU A N    1  
ATOM 1038  C CA   . GLU A 1 67 ? -9.730  -2.433  1.593   1.00 0.00 ? 104 GLU A CA   1  
ATOM 1039  C C    . GLU A 1 67 ? -9.598  -1.819  0.207   1.00 0.00 ? 104 GLU A C    1  
ATOM 1040  O O    . GLU A 1 67 ? -9.051  -0.728  0.065   1.00 0.00 ? 104 GLU A O    1  
ATOM 1041  C CB   . GLU A 1 67 ? -11.050 -1.991  2.248   1.00 0.00 ? 104 GLU A CB   1  
ATOM 1042  C CG   . GLU A 1 67 ? -11.171 -0.484  2.435   1.00 0.00 ? 104 GLU A CG   1  
ATOM 1043  C CD   . GLU A 1 67 ? -12.488 -0.063  3.058   1.00 0.00 ? 104 GLU A CD   1  
ATOM 1044  O OE1  . GLU A 1 67 ? -12.772 -0.476  4.198   1.00 0.00 ? 104 GLU A OE1  1  
ATOM 1045  O OE2  . GLU A 1 67 ? -13.236 0.703   2.412   1.00 0.00 ? 104 GLU A OE2  1  
ATOM 1046  H H    . GLU A 1 67 ? -8.218  -1.130  2.274   1.00 0.00 ? 104 GLU A H    1  
ATOM 1047  H HA   . GLU A 1 67 ? -9.717  -3.510  1.503   1.00 0.00 ? 104 GLU A HA   1  
ATOM 1048  H HB2  . GLU A 1 67 ? -11.873 -2.322  1.632   1.00 0.00 ? 104 GLU A HB2  1  
ATOM 1049  H HB3  . GLU A 1 67 ? -11.128 -2.459  3.218   1.00 0.00 ? 104 GLU A HB3  1  
ATOM 1050  H HG2  . GLU A 1 67 ? -10.367 -0.151  3.075   1.00 0.00 ? 104 GLU A HG2  1  
ATOM 1051  H HG3  . GLU A 1 67 ? -11.079 -0.009  1.472   1.00 0.00 ? 104 GLU A HG3  1  
ATOM 1052  N N    . GLN A 1 68 ? -10.004 -2.541  -0.822  1.00 0.00 ? 105 GLN A N    1  
ATOM 1053  C CA   . GLN A 1 68 ? -9.877  -2.038  -2.182  1.00 0.00 ? 105 GLN A CA   1  
ATOM 1054  C C    . GLN A 1 68 ? -11.244 -1.741  -2.785  1.00 0.00 ? 105 GLN A C    1  
ATOM 1055  O O    . GLN A 1 68 ? -11.987 -2.654  -3.154  1.00 0.00 ? 105 GLN A O    1  
ATOM 1056  C CB   . GLN A 1 68 ? -9.108  -3.026  -3.062  1.00 0.00 ? 105 GLN A CB   1  
ATOM 1057  C CG   . GLN A 1 68 ? -7.658  -3.199  -2.647  1.00 0.00 ? 105 GLN A CG   1  
ATOM 1058  C CD   . GLN A 1 68 ? -6.872  -4.080  -3.596  1.00 0.00 ? 105 GLN A CD   1  
ATOM 1059  O OE1  . GLN A 1 68 ? -6.654  -3.730  -4.758  1.00 0.00 ? 105 GLN A OE1  1  
ATOM 1060  N NE2  . GLN A 1 68 ? -6.436  -5.227  -3.105  1.00 0.00 ? 105 GLN A NE2  1  
ATOM 1061  H H    . GLN A 1 68 ? -10.394 -3.433  -0.668  1.00 0.00 ? 105 GLN A H    1  
ATOM 1062  H HA   . GLN A 1 68 ? -9.318  -1.114  -2.131  1.00 0.00 ? 105 GLN A HA   1  
ATOM 1063  H HB2  . GLN A 1 68 ? -9.594  -3.989  -3.012  1.00 0.00 ? 105 GLN A HB2  1  
ATOM 1064  H HB3  . GLN A 1 68 ? -9.129  -2.673  -4.082  1.00 0.00 ? 105 GLN A HB3  1  
ATOM 1065  H HG2  . GLN A 1 68 ? -7.190  -2.227  -2.612  1.00 0.00 ? 105 GLN A HG2  1  
ATOM 1066  H HG3  . GLN A 1 68 ? -7.631  -3.644  -1.662  1.00 0.00 ? 105 GLN A HG3  1  
ATOM 1067  H HE21 . GLN A 1 68 ? -6.642  -5.439  -2.174  1.00 0.00 ? 105 GLN A HE21 1  
ATOM 1068  H HE22 . GLN A 1 68 ? -5.922  -5.824  -3.702  1.00 0.00 ? 105 GLN A HE22 1  
ATOM 1069  N N    . PRO A 1 69 ? -11.604 -0.451  -2.868  1.00 0.00 ? 106 PRO A N    1  
ATOM 1070  C CA   . PRO A 1 69 ? -12.890 -0.009  -3.419  1.00 0.00 ? 106 PRO A CA   1  
ATOM 1071  C C    . PRO A 1 69 ? -13.060 -0.393  -4.886  1.00 0.00 ? 106 PRO A C    1  
ATOM 1072  O O    . PRO A 1 69 ? -14.166 -0.683  -5.337  1.00 0.00 ? 106 PRO A O    1  
ATOM 1073  C CB   . PRO A 1 69 ? -12.843 1.518   -3.278  1.00 0.00 ? 106 PRO A CB   1  
ATOM 1074  C CG   . PRO A 1 69 ? -11.400 1.853   -3.122  1.00 0.00 ? 106 PRO A CG   1  
ATOM 1075  C CD   . PRO A 1 69 ? -10.787 0.685   -2.412  1.00 0.00 ? 106 PRO A CD   1  
ATOM 1076  H HA   . PRO A 1 69 ? -13.718 -0.401  -2.850  1.00 0.00 ? 106 PRO A HA   1  
ATOM 1077  H HB2  . PRO A 1 69 ? -13.261 1.975   -4.162  1.00 0.00 ? 106 PRO A HB2  1  
ATOM 1078  H HB3  . PRO A 1 69 ? -13.413 1.818   -2.410  1.00 0.00 ? 106 PRO A HB3  1  
ATOM 1079  H HG2  . PRO A 1 69 ? -10.945 1.983   -4.093  1.00 0.00 ? 106 PRO A HG2  1  
ATOM 1080  H HG3  . PRO A 1 69 ? -11.292 2.750   -2.532  1.00 0.00 ? 106 PRO A HG3  1  
ATOM 1081  H HD2  . PRO A 1 69 ? -9.755  0.562   -2.707  1.00 0.00 ? 106 PRO A HD2  1  
ATOM 1082  H HD3  . PRO A 1 69 ? -10.864 0.809   -1.343  1.00 0.00 ? 106 PRO A HD3  1  
ATOM 1083  N N    . LYS A 1 70 ? -11.959 -0.362  -5.630  1.00 0.00 ? 107 LYS A N    1  
ATOM 1084  C CA   . LYS A 1 70 ? -11.986 -0.679  -7.053  1.00 0.00 ? 107 LYS A CA   1  
ATOM 1085  C C    . LYS A 1 70 ? -11.609 -2.135  -7.303  1.00 0.00 ? 107 LYS A C    1  
ATOM 1086  O O    . LYS A 1 70 ? -11.082 -2.473  -8.368  1.00 0.00 ? 107 LYS A O    1  
ATOM 1087  C CB   . LYS A 1 70 ? -11.034 0.234   -7.828  1.00 0.00 ? 107 LYS A CB   1  
ATOM 1088  C CG   . LYS A 1 70 ? -11.387 1.710   -7.744  1.00 0.00 ? 107 LYS A CG   1  
ATOM 1089  C CD   . LYS A 1 70 ? -10.477 2.540   -8.635  1.00 0.00 ? 107 LYS A CD   1  
ATOM 1090  C CE   . LYS A 1 70 ? -10.854 4.013   -8.609  1.00 0.00 ? 107 LYS A CE   1  
ATOM 1091  N NZ   . LYS A 1 70 ? -10.030 4.807   -9.557  1.00 0.00 ? 107 LYS A NZ   1  
ATOM 1092  H H    . LYS A 1 70 ? -11.107 -0.119  -5.210  1.00 0.00 ? 107 LYS A H    1  
ATOM 1093  H HA   . LYS A 1 70 ? -12.993 -0.517  -7.408  1.00 0.00 ? 107 LYS A HA   1  
ATOM 1094  H HB2  . LYS A 1 70 ? -10.034 0.104   -7.442  1.00 0.00 ? 107 LYS A HB2  1  
ATOM 1095  H HB3  . LYS A 1 70 ? -11.046 -0.057  -8.869  1.00 0.00 ? 107 LYS A HB3  1  
ATOM 1096  H HG2  . LYS A 1 70 ? -12.410 1.844   -8.063  1.00 0.00 ? 107 LYS A HG2  1  
ATOM 1097  H HG3  . LYS A 1 70 ? -11.276 2.039   -6.721  1.00 0.00 ? 107 LYS A HG3  1  
ATOM 1098  H HD2  . LYS A 1 70 ? -9.460  2.436   -8.290  1.00 0.00 ? 107 LYS A HD2  1  
ATOM 1099  H HD3  . LYS A 1 70 ? -10.553 2.176   -9.650  1.00 0.00 ? 107 LYS A HD3  1  
ATOM 1100  H HE2  . LYS A 1 70 ? -11.895 4.113   -8.881  1.00 0.00 ? 107 LYS A HE2  1  
ATOM 1101  H HE3  . LYS A 1 70 ? -10.706 4.394   -7.608  1.00 0.00 ? 107 LYS A HE3  1  
ATOM 1102  H HZ1  . LYS A 1 70 ? -9.799  4.236   -10.399 1.00 0.00 ? 107 LYS A HZ1  1  
ATOM 1103  H HZ2  . LYS A 1 70 ? -10.552 5.657   -9.864  1.00 0.00 ? 107 LYS A HZ2  1  
ATOM 1104  H HZ3  . LYS A 1 70 ? -9.139  5.104   -9.101  1.00 0.00 ? 107 LYS A HZ3  1  
ATOM 1105  N N    . GLY A 1 71 ? -11.896 -2.994  -6.334  1.00 0.00 ? 108 GLY A N    1  
ATOM 1106  C CA   . GLY A 1 71 ? -11.599 -4.403  -6.479  1.00 0.00 ? 108 GLY A CA   1  
ATOM 1107  C C    . GLY A 1 71 ? -10.130 -4.712  -6.330  1.00 0.00 ? 108 GLY A C    1  
ATOM 1108  O O    . GLY A 1 71 ? -9.306  -3.801  -6.231  1.00 0.00 ? 108 GLY A O    1  
ATOM 1109  H H    . GLY A 1 71 ? -12.316 -2.669  -5.512  1.00 0.00 ? 108 GLY A H    1  
ATOM 1110  H HA2  . GLY A 1 71 ? -12.144 -4.955  -5.729  1.00 0.00 ? 108 GLY A HA2  1  
ATOM 1111  H HA3  . GLY A 1 71 ? -11.924 -4.730  -7.454  1.00 0.00 ? 108 GLY A HA3  1  
ATOM 1112  N N    . PRO A 1 72 ? -9.770  -6.001  -6.342  1.00 0.00 ? 109 PRO A N    1  
ATOM 1113  C CA   . PRO A 1 72 ? -8.381  -6.432  -6.239  1.00 0.00 ? 109 PRO A CA   1  
ATOM 1114  C C    . PRO A 1 72 ? -7.562  -5.953  -7.424  1.00 0.00 ? 109 PRO A C    1  
ATOM 1115  O O    . PRO A 1 72 ? -8.066  -5.892  -8.552  1.00 0.00 ? 109 PRO A O    1  
ATOM 1116  C CB   . PRO A 1 72 ? -8.461  -7.961  -6.233  1.00 0.00 ? 109 PRO A CB   1  
ATOM 1117  C CG   . PRO A 1 72 ? -9.885  -8.282  -5.940  1.00 0.00 ? 109 PRO A CG   1  
ATOM 1118  C CD   . PRO A 1 72 ? -10.685 -7.142  -6.492  1.00 0.00 ? 109 PRO A CD   1  
ATOM 1119  H HA   . PRO A 1 72 ? -7.925  -6.086  -5.324  1.00 0.00 ? 109 PRO A HA   1  
ATOM 1120  H HB2  . PRO A 1 72 ? -8.164  -8.341  -7.199  1.00 0.00 ? 109 PRO A HB2  1  
ATOM 1121  H HB3  . PRO A 1 72 ? -7.805  -8.347  -5.471  1.00 0.00 ? 109 PRO A HB3  1  
ATOM 1122  H HG2  . PRO A 1 72 ? -10.162 -9.204  -6.429  1.00 0.00 ? 109 PRO A HG2  1  
ATOM 1123  H HG3  . PRO A 1 72 ? -10.033 -8.362  -4.872  1.00 0.00 ? 109 PRO A HG3  1  
ATOM 1124  H HD2  . PRO A 1 72 ? -10.924 -7.316  -7.531  1.00 0.00 ? 109 PRO A HD2  1  
ATOM 1125  H HD3  . PRO A 1 72 ? -11.585 -6.993  -5.913  1.00 0.00 ? 109 PRO A HD3  1  
ATOM 1126  N N    . ALA A 1 73 ? -6.336  -5.537  -7.138  1.00 0.00 ? 110 ALA A N    1  
ATOM 1127  C CA   . ALA A 1 73 ? -5.442  -4.972  -8.141  1.00 0.00 ? 110 ALA A CA   1  
ATOM 1128  C C    . ALA A 1 73 ? -5.960  -3.620  -8.621  1.00 0.00 ? 110 ALA A C    1  
ATOM 1129  O O    . ALA A 1 73 ? -5.884  -3.290  -9.806  1.00 0.00 ? 110 ALA A O    1  
ATOM 1130  C CB   . ALA A 1 73 ? -5.246  -5.936  -9.309  1.00 0.00 ? 110 ALA A CB   1  
ATOM 1131  H H    . ALA A 1 73 ? -6.045  -5.554  -6.202  1.00 0.00 ? 110 ALA A H    1  
ATOM 1132  H HA   . ALA A 1 73 ? -4.481  -4.822  -7.671  1.00 0.00 ? 110 ALA A HA   1  
ATOM 1133  H HB1  . ALA A 1 73 ? -5.528  -5.446  -10.229 1.00 0.00 ? 110 ALA A HB1  1  
ATOM 1134  H HB2  . ALA A 1 73 ? -4.209  -6.231  -9.361  1.00 0.00 ? 110 ALA A HB2  1  
ATOM 1135  H HB3  . ALA A 1 73 ? -5.863  -6.810  -9.161  1.00 0.00 ? 110 ALA A HB3  1  
ATOM 1136  N N    . GLY A 1 74 ? -6.445  -2.827  -7.676  1.00 0.00 ? 111 GLY A N    1  
ATOM 1137  C CA   . GLY A 1 74 ? -6.921  -1.497  -7.991  1.00 0.00 ? 111 GLY A CA   1  
ATOM 1138  C C    . GLY A 1 74 ? -6.431  -0.476  -6.987  1.00 0.00 ? 111 GLY A C    1  
ATOM 1139  O O    . GLY A 1 74 ? -5.289  -0.543  -6.530  1.00 0.00 ? 111 GLY A O    1  
ATOM 1140  H H    . GLY A 1 74 ? -6.465  -3.142  -6.744  1.00 0.00 ? 111 GLY A H    1  
ATOM 1141  H HA2  . GLY A 1 74 ? -6.569  -1.221  -8.975  1.00 0.00 ? 111 GLY A HA2  1  
ATOM 1142  H HA3  . GLY A 1 74 ? -8.000  -1.499  -7.990  1.00 0.00 ? 111 GLY A HA3  1  
ATOM 1143  N N    . ALA A 1 75 ? -7.309  0.437   -6.603  1.00 0.00 ? 112 ALA A N    1  
ATOM 1144  C CA   . ALA A 1 75 ? -6.983  1.423   -5.588  1.00 0.00 ? 112 ALA A CA   1  
ATOM 1145  C C    . ALA A 1 75 ? -7.247  0.862   -4.199  1.00 0.00 ? 112 ALA A C    1  
ATOM 1146  O O    . ALA A 1 75 ? -8.299  0.276   -3.956  1.00 0.00 ? 112 ALA A O    1  
ATOM 1147  C CB   . ALA A 1 75 ? -7.776  2.704   -5.809  1.00 0.00 ? 112 ALA A CB   1  
ATOM 1148  H H    . ALA A 1 75 ? -8.217  0.404   -6.963  1.00 0.00 ? 112 ALA A H    1  
ATOM 1149  H HA   . ALA A 1 75 ? -5.930  1.656   -5.677  1.00 0.00 ? 112 ALA A HA   1  
ATOM 1150  H HB1  . ALA A 1 75 ? -7.997  2.815   -6.859  1.00 0.00 ? 112 ALA A HB1  1  
ATOM 1151  H HB2  . ALA A 1 75 ? -8.698  2.659   -5.249  1.00 0.00 ? 112 ALA A HB2  1  
ATOM 1152  H HB3  . ALA A 1 75 ? -7.192  3.550   -5.473  1.00 0.00 ? 112 ALA A HB3  1  
ATOM 1153  N N    . VAL A 1 76 ? -6.309  1.074   -3.289  1.00 0.00 ? 113 VAL A N    1  
ATOM 1154  C CA   . VAL A 1 76 ? -6.472  0.645   -1.910  1.00 0.00 ? 113 VAL A CA   1  
ATOM 1155  C C    . VAL A 1 76 ? -6.943  1.818   -1.054  1.00 0.00 ? 113 VAL A C    1  
ATOM 1156  O O    . VAL A 1 76 ? -6.768  2.979   -1.422  1.00 0.00 ? 113 VAL A O    1  
ATOM 1157  C CB   . VAL A 1 76 ? -5.160  0.058   -1.324  1.00 0.00 ? 113 VAL A CB   1  
ATOM 1158  C CG1  . VAL A 1 76 ? -5.383  -0.500  0.081   1.00 0.00 ? 113 VAL A CG1  1  
ATOM 1159  C CG2  . VAL A 1 76 ? -4.607  -1.025  -2.238  1.00 0.00 ? 113 VAL A CG2  1  
ATOM 1160  H H    . VAL A 1 76 ? -5.513  1.597   -3.535  1.00 0.00 ? 113 VAL A H    1  
ATOM 1161  H HA   . VAL A 1 76 ? -7.227  -0.127  -1.889  1.00 0.00 ? 113 VAL A HA   1  
ATOM 1162  H HB   . VAL A 1 76 ? -4.428  0.850   -1.261  1.00 0.00 ? 113 VAL A HB   1  
ATOM 1163  H HG11 . VAL A 1 76 ? -6.139  -1.269  0.047   1.00 0.00 ? 113 VAL A HG11 1  
ATOM 1164  H HG12 . VAL A 1 76 ? -4.460  -0.920  0.455   1.00 0.00 ? 113 VAL A HG12 1  
ATOM 1165  H HG13 . VAL A 1 76 ? -5.711  0.296   0.742   1.00 0.00 ? 113 VAL A HG13 1  
ATOM 1166  H HG21 . VAL A 1 76 ? -5.371  -1.329  -2.937  1.00 0.00 ? 113 VAL A HG21 1  
ATOM 1167  H HG22 . VAL A 1 76 ? -3.757  -0.639  -2.779  1.00 0.00 ? 113 VAL A HG22 1  
ATOM 1168  H HG23 . VAL A 1 76 ? -4.303  -1.876  -1.646  1.00 0.00 ? 113 VAL A HG23 1  
ATOM 1169  N N    . LYS A 1 77 ? -7.621  1.501   0.026   1.00 0.00 ? 114 LYS A N    1  
ATOM 1170  C CA   . LYS A 1 77 ? -8.194  2.486   0.917   1.00 0.00 ? 114 LYS A CA   1  
ATOM 1171  C C    . LYS A 1 77 ? -8.100  1.971   2.340   1.00 0.00 ? 114 LYS A C    1  
ATOM 1172  O O    . LYS A 1 77 ? -8.321  0.787   2.580   1.00 0.00 ? 114 LYS A O    1  
ATOM 1173  C CB   . LYS A 1 77 ? -9.657  2.710   0.526   1.00 0.00 ? 114 LYS A CB   1  
ATOM 1174  C CG   . LYS A 1 77 ? -10.520 3.414   1.566   1.00 0.00 ? 114 LYS A CG   1  
ATOM 1175  C CD   . LYS A 1 77 ? -9.921  4.722   2.028   1.00 0.00 ? 114 LYS A CD   1  
ATOM 1176  C CE   . LYS A 1 77 ? -10.763 5.377   3.107   1.00 0.00 ? 114 LYS A CE   1  
ATOM 1177  N NZ   . LYS A 1 77 ? -10.111 6.603   3.629   1.00 0.00 ? 114 LYS A NZ   1  
ATOM 1178  H H    . LYS A 1 77 ? -7.800  0.548   0.208   1.00 0.00 ? 114 LYS A H    1  
ATOM 1179  H HA   . LYS A 1 77 ? -7.642  3.408   0.820   1.00 0.00 ? 114 LYS A HA   1  
ATOM 1180  H HB2  . LYS A 1 77 ? -9.691  3.286   -0.385  1.00 0.00 ? 114 LYS A HB2  1  
ATOM 1181  H HB3  . LYS A 1 77 ? -10.090 1.743   0.345   1.00 0.00 ? 114 LYS A HB3  1  
ATOM 1182  H HG2  . LYS A 1 77 ? -11.484 3.618   1.127   1.00 0.00 ? 114 LYS A HG2  1  
ATOM 1183  H HG3  . LYS A 1 77 ? -10.640 2.763   2.416   1.00 0.00 ? 114 LYS A HG3  1  
ATOM 1184  H HD2  . LYS A 1 77 ? -8.938  4.536   2.420   1.00 0.00 ? 114 LYS A HD2  1  
ATOM 1185  H HD3  . LYS A 1 77 ? -9.850  5.392   1.184   1.00 0.00 ? 114 LYS A HD3  1  
ATOM 1186  H HE2  . LYS A 1 77 ? -11.723 5.639   2.691   1.00 0.00 ? 114 LYS A HE2  1  
ATOM 1187  H HE3  . LYS A 1 77 ? -10.899 4.677   3.918   1.00 0.00 ? 114 LYS A HE3  1  
ATOM 1188  H HZ1  . LYS A 1 77 ? -9.102  6.611   3.366   1.00 0.00 ? 114 LYS A HZ1  1  
ATOM 1189  H HZ2  . LYS A 1 77 ? -10.568 7.454   3.233   1.00 0.00 ? 114 LYS A HZ2  1  
ATOM 1190  H HZ3  . LYS A 1 77 ? -10.184 6.633   4.670   1.00 0.00 ? 114 LYS A HZ3  1  
ATOM 1191  N N    . LEU A 1 78 ? -7.644  2.817   3.256   1.00 0.00 ? 115 LEU A N    1  
ATOM 1192  C CA   . LEU A 1 78 ? -7.505  2.415   4.634   1.00 0.00 ? 115 LEU A CA   1  
ATOM 1193  C C    . LEU A 1 78 ? -8.832  1.884   5.174   1.00 0.00 ? 115 LEU A C    1  
ATOM 1194  O O    . LEU A 1 78 ? -9.822  2.619   5.237   1.00 0.00 ? 115 LEU A O    1  
ATOM 1195  C CB   . LEU A 1 78 ? -7.077  3.617   5.460   1.00 0.00 ? 115 LEU A CB   1  
ATOM 1196  C CG   . LEU A 1 78 ? -5.858  3.397   6.332   1.00 0.00 ? 115 LEU A CG   1  
ATOM 1197  C CD1  . LEU A 1 78 ? -6.142  2.349   7.396   1.00 0.00 ? 115 LEU A CD1  1  
ATOM 1198  C CD2  . LEU A 1 78 ? -4.681  2.987   5.478   1.00 0.00 ? 115 LEU A CD2  1  
ATOM 1199  H H    . LEU A 1 78 ? -7.312  3.704   2.985   1.00 0.00 ? 115 LEU A H    1  
ATOM 1200  H HA   . LEU A 1 78 ? -6.751  1.641   4.684   1.00 0.00 ? 115 LEU A HA   1  
ATOM 1201  H HB2  . LEU A 1 78 ? -6.866  4.433   4.784   1.00 0.00 ? 115 LEU A HB2  1  
ATOM 1202  H HB3  . LEU A 1 78 ? -7.900  3.902   6.097   1.00 0.00 ? 115 LEU A HB3  1  
ATOM 1203  H HG   . LEU A 1 78 ? -5.612  4.322   6.816   1.00 0.00 ? 115 LEU A HG   1  
ATOM 1204  H HD11 . LEU A 1 78 ? -6.980  2.668   7.998   1.00 0.00 ? 115 LEU A HD11 1  
ATOM 1205  H HD12 . LEU A 1 78 ? -6.381  1.411   6.917   1.00 0.00 ? 115 LEU A HD12 1  
ATOM 1206  H HD13 . LEU A 1 78 ? -5.271  2.225   8.023   1.00 0.00 ? 115 LEU A HD13 1  
ATOM 1207  H HD21 . LEU A 1 78 ? -5.032  2.742   4.482   1.00 0.00 ? 115 LEU A HD21 1  
ATOM 1208  H HD22 . LEU A 1 78 ? -3.977  3.804   5.420   1.00 0.00 ? 115 LEU A HD22 1  
ATOM 1209  H HD23 . LEU A 1 78 ? -4.201  2.125   5.916   1.00 0.00 ? 115 LEU A HD23 1  
ATOM 1210  N N    . ALA A 1 79 ? -8.840  0.624   5.584   1.00 0.00 ? 116 ALA A N    1  
ATOM 1211  C CA   . ALA A 1 79 ? -10.043 0.016   6.128   1.00 0.00 ? 116 ALA A CA   1  
ATOM 1212  C C    . ALA A 1 79 ? -10.200 0.348   7.602   1.00 0.00 ? 116 ALA A C    1  
ATOM 1213  O O    . ALA A 1 79 ? -9.286  0.145   8.403   1.00 0.00 ? 116 ALA A O    1  
ATOM 1214  C CB   . ALA A 1 79 ? -10.026 -1.491  5.927   1.00 0.00 ? 116 ALA A CB   1  
ATOM 1215  H H    . ALA A 1 79 ? -8.012  0.099   5.542   1.00 0.00 ? 116 ALA A H    1  
ATOM 1216  H HA   . ALA A 1 79 ? -10.888 0.416   5.590   1.00 0.00 ? 116 ALA A HA   1  
ATOM 1217  H HB1  . ALA A 1 79 ? -9.816  -1.711  4.890   1.00 0.00 ? 116 ALA A HB1  1  
ATOM 1218  H HB2  . ALA A 1 79 ? -10.989 -1.898  6.193   1.00 0.00 ? 116 ALA A HB2  1  
ATOM 1219  H HB3  . ALA A 1 79 ? -9.263  -1.930  6.551   1.00 0.00 ? 116 ALA A HB3  1  
ATOM 1220  N N    . LYS A 1 80 ? -11.376 0.826   7.959   1.00 0.00 ? 117 LYS A N    1  
ATOM 1221  C CA   . LYS A 1 80 ? -11.693 1.143   9.341   1.00 0.00 ? 117 LYS A CA   1  
ATOM 1222  C C    . LYS A 1 80 ? -13.034 0.532   9.707   1.00 0.00 ? 117 LYS A C    1  
ATOM 1223  O O    . LYS A 1 80 ? -13.189 -0.072  10.768  1.00 0.00 ? 117 LYS A O    1  
ATOM 1224  C CB   . LYS A 1 80 ? -11.725 2.659   9.559   1.00 0.00 ? 117 LYS A CB   1  
ATOM 1225  C CG   . LYS A 1 80 ? -10.375 3.340   9.377   1.00 0.00 ? 117 LYS A CG   1  
ATOM 1226  C CD   . LYS A 1 80 ? -9.369  2.869   10.415  1.00 0.00 ? 117 LYS A CD   1  
ATOM 1227  C CE   . LYS A 1 80 ? -8.019  3.547   10.240  1.00 0.00 ? 117 LYS A CE   1  
ATOM 1228  N NZ   . LYS A 1 80 ? -8.087  5.011   10.501  1.00 0.00 ? 117 LYS A NZ   1  
ATOM 1229  H H    . LYS A 1 80 ? -12.069 0.940   7.267   1.00 0.00 ? 117 LYS A H    1  
ATOM 1230  H HA   . LYS A 1 80 ? -10.927 0.708   9.966   1.00 0.00 ? 117 LYS A HA   1  
ATOM 1231  H HB2  . LYS A 1 80 ? -12.418 3.097   8.856   1.00 0.00 ? 117 LYS A HB2  1  
ATOM 1232  H HB3  . LYS A 1 80 ? -12.070 2.859   10.563  1.00 0.00 ? 117 LYS A HB3  1  
ATOM 1233  H HG2  . LYS A 1 80 ? -9.997  3.109   8.393   1.00 0.00 ? 117 LYS A HG2  1  
ATOM 1234  H HG3  . LYS A 1 80 ? -10.504 4.408   9.473   1.00 0.00 ? 117 LYS A HG3  1  
ATOM 1235  H HD2  . LYS A 1 80 ? -9.750  3.099   11.398  1.00 0.00 ? 117 LYS A HD2  1  
ATOM 1236  H HD3  . LYS A 1 80 ? -9.241  1.801   10.318  1.00 0.00 ? 117 LYS A HD3  1  
ATOM 1237  H HE2  . LYS A 1 80 ? -7.317  3.102   10.929  1.00 0.00 ? 117 LYS A HE2  1  
ATOM 1238  H HE3  . LYS A 1 80 ? -7.679  3.387   9.228   1.00 0.00 ? 117 LYS A HE3  1  
ATOM 1239  H HZ1  . LYS A 1 80 ? -8.902  5.432   10.007  1.00 0.00 ? 117 LYS A HZ1  1  
ATOM 1240  H HZ2  . LYS A 1 80 ? -8.185  5.190   11.522  1.00 0.00 ? 117 LYS A HZ2  1  
ATOM 1241  H HZ3  . LYS A 1 80 ? -7.214  5.475   10.161  1.00 0.00 ? 117 LYS A HZ3  1  
ATOM 1242  N N    . LYS A 1 81 ? -13.972 0.614   8.778   1.00 0.00 ? 118 LYS A N    1  
ATOM 1243  C CA   . LYS A 1 81 ? -15.282 0.009   8.947   1.00 0.00 ? 118 LYS A CA   1  
ATOM 1244  C C    . LYS A 1 81 ? -15.731 -0.624  7.641   1.00 0.00 ? 118 LYS A C    1  
ATOM 1245  O O    . LYS A 1 81 ? -15.599 -0.017  6.578   1.00 0.00 ? 118 LYS A O    1  
ATOM 1246  C CB   . LYS A 1 81 ? -16.313 1.055   9.389   1.00 0.00 ? 118 LYS A CB   1  
ATOM 1247  C CG   . LYS A 1 81 ? -16.108 1.572   10.803  1.00 0.00 ? 118 LYS A CG   1  
ATOM 1248  C CD   . LYS A 1 81 ? -16.312 0.477   11.839  1.00 0.00 ? 118 LYS A CD   1  
ATOM 1249  C CE   . LYS A 1 81 ? -17.749 -0.026  11.853  1.00 0.00 ? 118 LYS A CE   1  
ATOM 1250  N NZ   . LYS A 1 81 ? -17.963 -1.053  12.908  1.00 0.00 ? 118 LYS A NZ   1  
ATOM 1251  H H    . LYS A 1 81 ? -13.760 1.057   7.927   1.00 0.00 ? 118 LYS A H    1  
ATOM 1252  H HA   . LYS A 1 81 ? -15.204 -0.756  9.702   1.00 0.00 ? 118 LYS A HA   1  
ATOM 1253  H HB2  . LYS A 1 81 ? -16.265 1.895   8.712   1.00 0.00 ? 118 LYS A HB2  1  
ATOM 1254  H HB3  . LYS A 1 81 ? -17.298 0.617   9.328   1.00 0.00 ? 118 LYS A HB3  1  
ATOM 1255  H HG2  . LYS A 1 81 ? -15.101 1.954   10.894  1.00 0.00 ? 118 LYS A HG2  1  
ATOM 1256  H HG3  . LYS A 1 81 ? -16.814 2.368   10.989  1.00 0.00 ? 118 LYS A HG3  1  
ATOM 1257  H HD2  . LYS A 1 81 ? -15.656 -0.350  11.609  1.00 0.00 ? 118 LYS A HD2  1  
ATOM 1258  H HD3  . LYS A 1 81 ? -16.069 0.869   12.817  1.00 0.00 ? 118 LYS A HD3  1  
ATOM 1259  H HE2  . LYS A 1 81 ? -18.408 0.809   12.035  1.00 0.00 ? 118 LYS A HE2  1  
ATOM 1260  H HE3  . LYS A 1 81 ? -17.974 -0.459  10.890  1.00 0.00 ? 118 LYS A HE3  1  
ATOM 1261  H HZ1  . LYS A 1 81 ? -17.425 -0.804  13.765  1.00 0.00 ? 118 LYS A HZ1  1  
ATOM 1262  H HZ2  . LYS A 1 81 ? -18.977 -1.113  13.150  1.00 0.00 ? 118 LYS A HZ2  1  
ATOM 1263  H HZ3  . LYS A 1 81 ? -17.644 -1.987  12.572  1.00 0.00 ? 118 LYS A HZ3  1  
ATOM 1264  N N    . LYS A 1 82 ? -16.295 -1.820  7.725   1.00 0.00 ? 119 LYS A N    1  
ATOM 1265  C CA   . LYS A 1 82 ? -16.826 -2.499  6.547   1.00 0.00 ? 119 LYS A CA   1  
ATOM 1266  C C    . LYS A 1 82 ? -18.173 -1.901  6.147   1.00 0.00 ? 119 LYS A C    1  
ATOM 1267  O O    . LYS A 1 82 ? -19.196 -2.586  6.124   1.00 0.00 ? 119 LYS A O    1  
ATOM 1268  C CB   . LYS A 1 82 ? -16.950 -4.008  6.788   1.00 0.00 ? 119 LYS A CB   1  
ATOM 1269  C CG   . LYS A 1 82 ? -15.709 -4.796  6.385   1.00 0.00 ? 119 LYS A CG   1  
ATOM 1270  C CD   . LYS A 1 82 ? -14.505 -4.483  7.261   1.00 0.00 ? 119 LYS A CD   1  
ATOM 1271  C CE   . LYS A 1 82 ? -14.672 -5.039  8.665   1.00 0.00 ? 119 LYS A CE   1  
ATOM 1272  N NZ   . LYS A 1 82 ? -13.449 -4.839  9.488   1.00 0.00 ? 119 LYS A NZ   1  
ATOM 1273  H H    . LYS A 1 82 ? -16.406 -2.236  8.610   1.00 0.00 ? 119 LYS A H    1  
ATOM 1274  H HA   . LYS A 1 82 ? -16.130 -2.334  5.738   1.00 0.00 ? 119 LYS A HA   1  
ATOM 1275  H HB2  . LYS A 1 82 ? -17.134 -4.179  7.840   1.00 0.00 ? 119 LYS A HB2  1  
ATOM 1276  H HB3  . LYS A 1 82 ? -17.789 -4.382  6.220   1.00 0.00 ? 119 LYS A HB3  1  
ATOM 1277  H HG2  . LYS A 1 82 ? -15.927 -5.850  6.464   1.00 0.00 ? 119 LYS A HG2  1  
ATOM 1278  H HG3  . LYS A 1 82 ? -15.466 -4.559  5.361   1.00 0.00 ? 119 LYS A HG3  1  
ATOM 1279  H HD2  . LYS A 1 82 ? -13.624 -4.922  6.815   1.00 0.00 ? 119 LYS A HD2  1  
ATOM 1280  H HD3  . LYS A 1 82 ? -14.384 -3.409  7.320   1.00 0.00 ? 119 LYS A HD3  1  
ATOM 1281  H HE2  . LYS A 1 82 ? -15.502 -4.536  9.141   1.00 0.00 ? 119 LYS A HE2  1  
ATOM 1282  H HE3  . LYS A 1 82 ? -14.882 -6.096  8.596   1.00 0.00 ? 119 LYS A HE3  1  
ATOM 1283  H HZ1  . LYS A 1 82 ? -12.792 -4.185  9.009   1.00 0.00 ? 119 LYS A HZ1  1  
ATOM 1284  H HZ2  . LYS A 1 82 ? -13.698 -4.438  10.416  1.00 0.00 ? 119 LYS A HZ2  1  
ATOM 1285  H HZ3  . LYS A 1 82 ? -12.963 -5.754  9.633   1.00 0.00 ? 119 LYS A HZ3  1  
ATOM 1286  N N    . SER A 1 83 ? -18.157 -0.609  5.873   1.00 0.00 ? 120 SER A N    1  
ATOM 1287  C CA   . SER A 1 83 ? -19.342 0.136   5.496   1.00 0.00 ? 120 SER A CA   1  
ATOM 1288  C C    . SER A 1 83 ? -19.824 -0.251  4.099   1.00 0.00 ? 120 SER A C    1  
ATOM 1289  O O    . SER A 1 83 ? -19.055 -0.784  3.293   1.00 0.00 ? 120 SER A O    1  
ATOM 1290  C CB   . SER A 1 83 ? -19.020 1.627   5.556   1.00 0.00 ? 120 SER A CB   1  
ATOM 1291  O OG   . SER A 1 83 ? -17.714 1.872   5.060   1.00 0.00 ? 120 SER A OG   1  
ATOM 1292  H H    . SER A 1 83 ? -17.302 -0.128  5.926   1.00 0.00 ? 120 SER A H    1  
ATOM 1293  H HA   . SER A 1 83 ? -20.120 -0.085  6.211   1.00 0.00 ? 120 SER A HA   1  
ATOM 1294  H HB2  . SER A 1 83 ? -19.733 2.172   4.954   1.00 0.00 ? 120 SER A HB2  1  
ATOM 1295  H HB3  . SER A 1 83 ? -19.076 1.966   6.580   1.00 0.00 ? 120 SER A HB3  1  
ATOM 1296  H HG   . SER A 1 83 ? -17.293 2.562   5.593   1.00 0.00 ? 120 SER A HG   1  
ATOM 1297  N N    . PRO A 1 84 ? -21.117 -0.024  3.811   1.00 0.00 ? 121 PRO A N    1  
ATOM 1298  C CA   . PRO A 1 84 ? -21.707 -0.342  2.508   1.00 0.00 ? 121 PRO A CA   1  
ATOM 1299  C C    . PRO A 1 84 ? -21.155 0.536   1.383   1.00 0.00 ? 121 PRO A C    1  
ATOM 1300  O O    . PRO A 1 84 ? -20.247 1.346   1.598   1.00 0.00 ? 121 PRO A O    1  
ATOM 1301  C CB   . PRO A 1 84 ? -23.200 -0.073  2.708   1.00 0.00 ? 121 PRO A CB   1  
ATOM 1302  C CG   . PRO A 1 84 ? -23.270 0.884   3.843   1.00 0.00 ? 121 PRO A CG   1  
ATOM 1303  C CD   . PRO A 1 84 ? -22.105 0.563   4.734   1.00 0.00 ? 121 PRO A CD   1  
ATOM 1304  H HA   . PRO A 1 84 ? -21.559 -1.382  2.252   1.00 0.00 ? 121 PRO A HA   1  
ATOM 1305  H HB2  . PRO A 1 84 ? -23.612 0.356   1.807   1.00 0.00 ? 121 PRO A HB2  1  
ATOM 1306  H HB3  . PRO A 1 84 ? -23.709 -0.994  2.939   1.00 0.00 ? 121 PRO A HB3  1  
ATOM 1307  H HG2  . PRO A 1 84 ? -23.194 1.897   3.477   1.00 0.00 ? 121 PRO A HG2  1  
ATOM 1308  H HG3  . PRO A 1 84 ? -24.198 0.747   4.378   1.00 0.00 ? 121 PRO A HG3  1  
ATOM 1309  H HD2  . PRO A 1 84 ? -21.720 1.462   5.190   1.00 0.00 ? 121 PRO A HD2  1  
ATOM 1310  H HD3  . PRO A 1 84 ? -22.393 -0.151  5.491   1.00 0.00 ? 121 PRO A HD3  1  
ATOM 1311  N N    . GLU A 1 85 ? -21.675 0.314   0.176   1.00 0.00 ? 122 GLU A N    1  
ATOM 1312  C CA   . GLU A 1 85 ? -21.210 1.002   -1.025  1.00 0.00 ? 122 GLU A CA   1  
ATOM 1313  C C    . GLU A 1 85 ? -19.756 0.659   -1.311  1.00 0.00 ? 122 GLU A C    1  
ATOM 1314  O O    . GLU A 1 85 ? -19.009 1.455   -1.883  1.00 0.00 ? 122 GLU A O    1  
ATOM 1315  C CB   . GLU A 1 85 ? -21.411 2.518   -0.929  1.00 0.00 ? 122 GLU A CB   1  
ATOM 1316  C CG   . GLU A 1 85 ? -22.850 2.950   -1.161  1.00 0.00 ? 122 GLU A CG   1  
ATOM 1317  C CD   . GLU A 1 85 ? -23.026 4.453   -1.103  1.00 0.00 ? 122 GLU A CD   1  
ATOM 1318  O OE1  . GLU A 1 85 ? -22.823 5.039   -0.018  1.00 0.00 ? 122 GLU A OE1  1  
ATOM 1319  O OE2  . GLU A 1 85 ? -23.372 5.059   -2.136  1.00 0.00 ? 122 GLU A OE2  1  
ATOM 1320  H H    . GLU A 1 85 ? -22.350 -0.396  0.080   1.00 0.00 ? 122 GLU A H    1  
ATOM 1321  H HA   . GLU A 1 85 ? -21.802 0.631   -1.847  1.00 0.00 ? 122 GLU A HA   1  
ATOM 1322  H HB2  . GLU A 1 85 ? -21.113 2.850   0.055   1.00 0.00 ? 122 GLU A HB2  1  
ATOM 1323  H HB3  . GLU A 1 85 ? -20.787 3.002   -1.667  1.00 0.00 ? 122 GLU A HB3  1  
ATOM 1324  H HG2  . GLU A 1 85 ? -23.164 2.605   -2.135  1.00 0.00 ? 122 GLU A HG2  1  
ATOM 1325  H HG3  . GLU A 1 85 ? -23.474 2.500   -0.402  1.00 0.00 ? 122 GLU A HG3  1  
ATOM 1326  N N    . VAL A 1 86 ? -19.425 -0.597  -1.056  1.00 0.00 ? 123 VAL A N    1  
ATOM 1327  C CA   . VAL A 1 86 ? -18.134 -1.150  -1.428  1.00 0.00 ? 123 VAL A CA   1  
ATOM 1328  C C    . VAL A 1 86 ? -18.371 -2.493  -2.103  1.00 0.00 ? 123 VAL A C    1  
ATOM 1329  O O    . VAL A 1 86 ? -17.918 -3.541  -1.642  1.00 0.00 ? 123 VAL A O    1  
ATOM 1330  C CB   . VAL A 1 86 ? -17.186 -1.329  -0.218  1.00 0.00 ? 123 VAL A CB   1  
ATOM 1331  C CG1  . VAL A 1 86 ? -15.776 -1.658  -0.684  1.00 0.00 ? 123 VAL A CG1  1  
ATOM 1332  C CG2  . VAL A 1 86 ? -17.178 -0.091  0.661   1.00 0.00 ? 123 VAL A CG2  1  
ATOM 1333  H H    . VAL A 1 86 ? -20.115 -1.202  -0.705  1.00 0.00 ? 123 VAL A H    1  
ATOM 1334  H HA   . VAL A 1 86 ? -17.673 -0.476  -2.137  1.00 0.00 ? 123 VAL A HA   1  
ATOM 1335  H HB   . VAL A 1 86 ? -17.545 -2.161  0.373   1.00 0.00 ? 123 VAL A HB   1  
ATOM 1336  H HG11 . VAL A 1 86 ? -15.462 -0.934  -1.422  1.00 0.00 ? 123 VAL A HG11 1  
ATOM 1337  H HG12 . VAL A 1 86 ? -15.103 -1.628  0.159   1.00 0.00 ? 123 VAL A HG12 1  
ATOM 1338  H HG13 . VAL A 1 86 ? -15.762 -2.646  -1.121  1.00 0.00 ? 123 VAL A HG13 1  
ATOM 1339  H HG21 . VAL A 1 86 ? -17.922 0.607   0.308   1.00 0.00 ? 123 VAL A HG21 1  
ATOM 1340  H HG22 . VAL A 1 86 ? -17.402 -0.372  1.680   1.00 0.00 ? 123 VAL A HG22 1  
ATOM 1341  H HG23 . VAL A 1 86 ? -16.202 0.372   0.622   1.00 0.00 ? 123 VAL A HG23 1  
ATOM 1342  N N    . LYS A 1 87 ? -19.193 -2.460  -3.135  1.00 0.00 ? 124 LYS A N    1  
ATOM 1343  C CA   . LYS A 1 87 ? -19.596 -3.668  -3.839  1.00 0.00 ? 124 LYS A CA   1  
ATOM 1344  C C    . LYS A 1 87 ? -19.008 -3.690  -5.243  1.00 0.00 ? 124 LYS A C    1  
ATOM 1345  O O    . LYS A 1 87 ? -19.672 -4.050  -6.218  1.00 0.00 ? 124 LYS A O    1  
ATOM 1346  C CB   . LYS A 1 87 ? -21.129 -3.795  -3.867  1.00 0.00 ? 124 LYS A CB   1  
ATOM 1347  C CG   . LYS A 1 87 ? -21.863 -2.539  -4.312  1.00 0.00 ? 124 LYS A CG   1  
ATOM 1348  C CD   . LYS A 1 87 ? -23.358 -2.643  -4.048  1.00 0.00 ? 124 LYS A CD   1  
ATOM 1349  C CE   . LYS A 1 87 ? -24.073 -1.339  -4.367  1.00 0.00 ? 124 LYS A CE   1  
ATOM 1350  N NZ   . LYS A 1 87 ? -25.492 -1.360  -3.924  1.00 0.00 ? 124 LYS A NZ   1  
ATOM 1351  H H    . LYS A 1 87 ? -19.556 -1.589  -3.424  1.00 0.00 ? 124 LYS A H    1  
ATOM 1352  H HA   . LYS A 1 87 ? -19.192 -4.507  -3.292  1.00 0.00 ? 124 LYS A HA   1  
ATOM 1353  H HB2  . LYS A 1 87 ? -21.391 -4.594  -4.542  1.00 0.00 ? 124 LYS A HB2  1  
ATOM 1354  H HB3  . LYS A 1 87 ? -21.472 -4.051  -2.875  1.00 0.00 ? 124 LYS A HB3  1  
ATOM 1355  H HG2  . LYS A 1 87 ? -21.475 -1.691  -3.770  1.00 0.00 ? 124 LYS A HG2  1  
ATOM 1356  H HG3  . LYS A 1 87 ? -21.703 -2.394  -5.371  1.00 0.00 ? 124 LYS A HG3  1  
ATOM 1357  H HD2  . LYS A 1 87 ? -23.770 -3.428  -4.665  1.00 0.00 ? 124 LYS A HD2  1  
ATOM 1358  H HD3  . LYS A 1 87 ? -23.513 -2.881  -3.007  1.00 0.00 ? 124 LYS A HD3  1  
ATOM 1359  H HE2  . LYS A 1 87 ? -23.562 -0.531  -3.866  1.00 0.00 ? 124 LYS A HE2  1  
ATOM 1360  H HE3  . LYS A 1 87 ? -24.039 -1.177  -5.436  1.00 0.00 ? 124 LYS A HE3  1  
ATOM 1361  H HZ1  . LYS A 1 87 ? -25.946 -2.255  -4.205  1.00 0.00 ? 124 LYS A HZ1  1  
ATOM 1362  H HZ2  . LYS A 1 87 ? -25.543 -1.269  -2.887  1.00 0.00 ? 124 LYS A HZ2  1  
ATOM 1363  H HZ3  . LYS A 1 87 ? -26.018 -0.570  -4.356  1.00 0.00 ? 124 LYS A HZ3  1  
ATOM 1364  N N    . LYS A 1 88 ? -17.732 -3.345  -5.320  1.00 0.00 ? 125 LYS A N    1  
ATOM 1365  C CA   . LYS A 1 88 ? -16.999 -3.366  -6.577  1.00 0.00 ? 125 LYS A CA   1  
ATOM 1366  C C    . LYS A 1 88 ? -15.691 -4.119  -6.388  1.00 0.00 ? 125 LYS A C    1  
ATOM 1367  O O    . LYS A 1 88 ? -14.706 -3.855  -7.075  1.00 0.00 ? 125 LYS A O    1  
ATOM 1368  C CB   . LYS A 1 88 ? -16.694 -1.939  -7.045  1.00 0.00 ? 125 LYS A CB   1  
ATOM 1369  C CG   . LYS A 1 88 ? -17.901 -1.020  -7.092  1.00 0.00 ? 125 LYS A CG   1  
ATOM 1370  C CD   . LYS A 1 88 ? -17.485 0.395   -7.449  1.00 0.00 ? 125 LYS A CD   1  
ATOM 1371  C CE   . LYS A 1 88 ? -18.664 1.354   -7.446  1.00 0.00 ? 125 LYS A CE   1  
ATOM 1372  N NZ   . LYS A 1 88 ? -18.239 2.732   -7.799  1.00 0.00 ? 125 LYS A NZ   1  
ATOM 1373  H H    . LYS A 1 88 ? -17.258 -3.101  -4.499  1.00 0.00 ? 125 LYS A H    1  
ATOM 1374  H HA   . LYS A 1 88 ? -17.602 -3.870  -7.317  1.00 0.00 ? 125 LYS A HA   1  
ATOM 1375  H HB2  . LYS A 1 88 ? -15.967 -1.503  -6.377  1.00 0.00 ? 125 LYS A HB2  1  
ATOM 1376  H HB3  . LYS A 1 88 ? -16.268 -1.986  -8.037  1.00 0.00 ? 125 LYS A HB3  1  
ATOM 1377  H HG2  . LYS A 1 88 ? -18.593 -1.384  -7.838  1.00 0.00 ? 125 LYS A HG2  1  
ATOM 1378  H HG3  . LYS A 1 88 ? -18.378 -1.014  -6.125  1.00 0.00 ? 125 LYS A HG3  1  
ATOM 1379  H HD2  . LYS A 1 88 ? -16.759 0.739   -6.730  1.00 0.00 ? 125 LYS A HD2  1  
ATOM 1380  H HD3  . LYS A 1 88 ? -17.041 0.391   -8.433  1.00 0.00 ? 125 LYS A HD3  1  
ATOM 1381  H HE2  . LYS A 1 88 ? -19.394 1.013   -8.167  1.00 0.00 ? 125 LYS A HE2  1  
ATOM 1382  H HE3  . LYS A 1 88 ? -19.104 1.360   -6.461  1.00 0.00 ? 125 LYS A HE3  1  
ATOM 1383  H HZ1  . LYS A 1 88 ? -17.645 2.713   -8.654  1.00 0.00 ? 125 LYS A HZ1  1  
ATOM 1384  H HZ2  . LYS A 1 88 ? -19.072 3.333   -7.983  1.00 0.00 ? 125 LYS A HZ2  1  
ATOM 1385  H HZ3  . LYS A 1 88 ? -17.691 3.151   -7.018  1.00 0.00 ? 125 LYS A HZ3  1  
ATOM 1386  N N    . GLU A 1 89 ? -15.667 -5.004  -5.400  1.00 0.00 ? 126 GLU A N    1  
ATOM 1387  C CA   . GLU A 1 89 ? -14.449 -5.720  -5.039  1.00 0.00 ? 126 GLU A CA   1  
ATOM 1388  C C    . GLU A 1 89 ? -14.441 -7.134  -5.615  1.00 0.00 ? 126 GLU A C    1  
ATOM 1389  O O    . GLU A 1 89 ? -13.464 -7.866  -5.464  1.00 0.00 ? 126 GLU A O    1  
ATOM 1390  C CB   . GLU A 1 89 ? -14.300 -5.763  -3.517  1.00 0.00 ? 126 GLU A CB   1  
ATOM 1391  C CG   . GLU A 1 89 ? -15.420 -6.511  -2.819  1.00 0.00 ? 126 GLU A CG   1  
ATOM 1392  C CD   . GLU A 1 89 ? -15.312 -6.481  -1.309  1.00 0.00 ? 126 GLU A CD   1  
ATOM 1393  O OE1  . GLU A 1 89 ? -14.348 -5.890  -0.778  1.00 0.00 ? 126 GLU A OE1  1  
ATOM 1394  O OE2  . GLU A 1 89 ? -16.203 -7.048  -0.645  1.00 0.00 ? 126 GLU A OE2  1  
ATOM 1395  H H    . GLU A 1 89 ? -16.482 -5.147  -4.867  1.00 0.00 ? 126 GLU A H    1  
ATOM 1396  H HA   . GLU A 1 89 ? -13.616 -5.177  -5.455  1.00 0.00 ? 126 GLU A HA   1  
ATOM 1397  H HB2  . GLU A 1 89 ? -13.365 -6.246  -3.270  1.00 0.00 ? 126 GLU A HB2  1  
ATOM 1398  H HB3  . GLU A 1 89 ? -14.284 -4.752  -3.141  1.00 0.00 ? 126 GLU A HB3  1  
ATOM 1399  H HG2  . GLU A 1 89 ? -16.364 -6.069  -3.102  1.00 0.00 ? 126 GLU A HG2  1  
ATOM 1400  H HG3  . GLU A 1 89 ? -15.400 -7.542  -3.144  1.00 0.00 ? 126 GLU A HG3  1  
ATOM 1401  N N    . LYS A 1 90 ? -15.548 -7.511  -6.250  1.00 0.00 ? 127 LYS A N    1  
ATOM 1402  C CA   . LYS A 1 90 ? -15.723 -8.842  -6.837  1.00 0.00 ? 127 LYS A CA   1  
ATOM 1403  C C    . LYS A 1 90 ? -15.815 -9.925  -5.762  1.00 0.00 ? 127 LYS A C    1  
ATOM 1404  O O    . LYS A 1 90 ? -16.887 -10.483 -5.535  1.00 0.00 ? 127 LYS A O    1  
ATOM 1405  C CB   . LYS A 1 90 ? -14.588 -9.194  -7.811  1.00 0.00 ? 127 LYS A CB   1  
ATOM 1406  C CG   . LYS A 1 90 ? -14.773 -10.557 -8.470  1.00 0.00 ? 127 LYS A CG   1  
ATOM 1407  C CD   . LYS A 1 90 ? -13.451 -11.273 -8.700  1.00 0.00 ? 127 LYS A CD   1  
ATOM 1408  C CE   . LYS A 1 90 ? -12.585 -10.568 -9.729  1.00 0.00 ? 127 LYS A CE   1  
ATOM 1409  N NZ   . LYS A 1 90 ? -11.334 -11.324 -10.001 1.00 0.00 ? 127 LYS A NZ   1  
ATOM 1410  H H    . LYS A 1 90 ? -16.295 -6.875  -6.303  1.00 0.00 ? 127 LYS A H    1  
ATOM 1411  H HA   . LYS A 1 90 ? -16.653 -8.829  -7.385  1.00 0.00 ? 127 LYS A HA   1  
ATOM 1412  H HB2  . LYS A 1 90 ? -14.545 -8.443  -8.585  1.00 0.00 ? 127 LYS A HB2  1  
ATOM 1413  H HB3  . LYS A 1 90 ? -13.651 -9.202  -7.271  1.00 0.00 ? 127 LYS A HB3  1  
ATOM 1414  H HG2  . LYS A 1 90 ? -15.390 -11.171 -7.831  1.00 0.00 ? 127 LYS A HG2  1  
ATOM 1415  H HG3  . LYS A 1 90 ? -15.267 -10.419 -9.421  1.00 0.00 ? 127 LYS A HG3  1  
ATOM 1416  H HD2  . LYS A 1 90 ? -12.912 -11.315 -7.767  1.00 0.00 ? 127 LYS A HD2  1  
ATOM 1417  H HD3  . LYS A 1 90 ? -13.653 -12.277 -9.043  1.00 0.00 ? 127 LYS A HD3  1  
ATOM 1418  H HE2  . LYS A 1 90 ? -13.144 -10.471 -10.648 1.00 0.00 ? 127 LYS A HE2  1  
ATOM 1419  H HE3  . LYS A 1 90 ? -12.330 -9.587  -9.356  1.00 0.00 ? 127 LYS A HE3  1  
ATOM 1420  H HZ1  . LYS A 1 90 ? -11.284 -12.169 -9.392  1.00 0.00 ? 127 LYS A HZ1  1  
ATOM 1421  H HZ2  . LYS A 1 90 ? -11.308 -11.631 -10.996 1.00 0.00 ? 127 LYS A HZ2  1  
ATOM 1422  H HZ3  . LYS A 1 90 ? -10.500 -10.726 -9.811  1.00 0.00 ? 127 LYS A HZ3  1  
ATOM 1423  N N    . GLU A 1 91 ? -14.679 -10.253 -5.149  1.00 0.00 ? 128 GLU A N    1  
ATOM 1424  C CA   . GLU A 1 91 ? -14.606 -11.340 -4.175  1.00 0.00 ? 128 GLU A CA   1  
ATOM 1425  C C    . GLU A 1 91 ? -13.405 -11.186 -3.248  1.00 0.00 ? 128 GLU A C    1  
ATOM 1426  O O    . GLU A 1 91 ? -12.628 -12.125 -3.067  1.00 0.00 ? 128 GLU A O    1  
ATOM 1427  C CB   . GLU A 1 91 ? -14.512 -12.698 -4.887  1.00 0.00 ? 128 GLU A CB   1  
ATOM 1428  C CG   . GLU A 1 91 ? -15.847 -13.269 -5.338  1.00 0.00 ? 128 GLU A CG   1  
ATOM 1429  C CD   . GLU A 1 91 ? -16.779 -13.585 -4.183  1.00 0.00 ? 128 GLU A CD   1  
ATOM 1430  O OE1  . GLU A 1 91 ? -16.392 -13.364 -3.015  1.00 0.00 ? 128 GLU A OE1  1  
ATOM 1431  O OE2  . GLU A 1 91 ? -17.905 -14.067 -4.432  1.00 0.00 ? 128 GLU A OE2  1  
ATOM 1432  H H    . GLU A 1 91 ? -13.854 -9.779  -5.394  1.00 0.00 ? 128 GLU A H    1  
ATOM 1433  H HA   . GLU A 1 91 ? -15.507 -11.318 -3.584  1.00 0.00 ? 128 GLU A HA   1  
ATOM 1434  H HB2  . GLU A 1 91 ? -13.883 -12.589 -5.758  1.00 0.00 ? 128 GLU A HB2  1  
ATOM 1435  H HB3  . GLU A 1 91 ? -14.053 -13.410 -4.215  1.00 0.00 ? 128 GLU A HB3  1  
ATOM 1436  H HG2  . GLU A 1 91 ? -16.331 -12.546 -5.979  1.00 0.00 ? 128 GLU A HG2  1  
ATOM 1437  H HG3  . GLU A 1 91 ? -15.668 -14.177 -5.895  1.00 0.00 ? 128 GLU A HG3  1  
ATOM 1438  N N    . VAL A 1 92 ? -13.286 -10.036 -2.599  1.00 0.00 ? 129 VAL A N    1  
ATOM 1439  C CA   . VAL A 1 92 ? -12.233 -9.840  -1.605  1.00 0.00 ? 129 VAL A CA   1  
ATOM 1440  C C    . VAL A 1 92 ? -12.669 -10.441 -0.263  1.00 0.00 ? 129 VAL A C    1  
ATOM 1441  O O    . VAL A 1 92 ? -12.837 -9.734  0.735   1.00 0.00 ? 129 VAL A O    1  
ATOM 1442  C CB   . VAL A 1 92 ? -11.860 -8.348  -1.430  1.00 0.00 ? 129 VAL A CB   1  
ATOM 1443  C CG1  . VAL A 1 92 ? -10.659 -8.191  -0.503  1.00 0.00 ? 129 VAL A CG1  1  
ATOM 1444  C CG2  . VAL A 1 92 ? -11.565 -7.712  -2.777  1.00 0.00 ? 129 VAL A CG2  1  
ATOM 1445  H H    . VAL A 1 92 ? -13.964 -9.340  -2.723  1.00 0.00 ? 129 VAL A H    1  
ATOM 1446  H HA   . VAL A 1 92 ? -11.357 -10.371 -1.950  1.00 0.00 ? 129 VAL A HA   1  
ATOM 1447  H HB   . VAL A 1 92 ? -12.699 -7.834  -0.988  1.00 0.00 ? 129 VAL A HB   1  
ATOM 1448  H HG11 . VAL A 1 92 ? -10.710 -8.934  0.279   1.00 0.00 ? 129 VAL A HG11 1  
ATOM 1449  H HG12 . VAL A 1 92 ? -9.750  -8.326  -1.070  1.00 0.00 ? 129 VAL A HG12 1  
ATOM 1450  H HG13 . VAL A 1 92 ? -10.670 -7.205  -0.065  1.00 0.00 ? 129 VAL A HG13 1  
ATOM 1451  H HG21 . VAL A 1 92 ? -12.310 -8.027  -3.494  1.00 0.00 ? 129 VAL A HG21 1  
ATOM 1452  H HG22 . VAL A 1 92 ? -11.591 -6.636  -2.680  1.00 0.00 ? 129 VAL A HG22 1  
ATOM 1453  H HG23 . VAL A 1 92 ? -10.587 -8.020  -3.113  1.00 0.00 ? 129 VAL A HG23 1  
ATOM 1454  N N    . SER A 1 93 ? -12.948 -11.736 -0.281  1.00 0.00 ? 130 SER A N    1  
ATOM 1455  C CA   . SER A 1 93 ? -13.448 -12.439 0.884   1.00 0.00 ? 130 SER A CA   1  
ATOM 1456  C C    . SER A 1 93 ? -13.370 -13.936 0.635   1.00 0.00 ? 130 SER A C    1  
ATOM 1457  O O    . SER A 1 93 ? -12.984 -14.327 -0.489  1.00 0.00 ? 130 SER A O    1  
ATOM 1458  C CB   . SER A 1 93 ? -14.893 -12.028 1.169   1.00 0.00 ? 130 SER A CB   1  
ATOM 1459  O OG   . SER A 1 93 ? -15.359 -12.570 2.395   1.00 0.00 ? 130 SER A OG   1  
ATOM 1460  O OXT  . SER A 1 93 ? -13.693 -14.715 1.553   1.00 0.00 ? 130 SER A OXT  1  
ATOM 1461  H H    . SER A 1 93 ? -12.856 -12.232 -1.126  1.00 0.00 ? 130 SER A H    1  
ATOM 1462  H HA   . SER A 1 93 ? -12.826 -12.185 1.730   1.00 0.00 ? 130 SER A HA   1  
ATOM 1463  H HB2  . SER A 1 93 ? -14.953 -10.951 1.224   1.00 0.00 ? 130 SER A HB2  1  
ATOM 1464  H HB3  . SER A 1 93 ? -15.529 -12.380 0.371   1.00 0.00 ? 130 SER A HB3  1  
ATOM 1465  H HG   . SER A 1 93 ? -14.958 -13.446 2.526   1.00 0.00 ? 130 SER A HG   1  
ATOM 1466  N N    . LYS A 1 2  ? 24.440  -2.392  11.827  1.00 0.00 ? 39  LYS A N    2  
ATOM 1467  C CA   . LYS A 1 2  ? 24.262  -0.953  11.526  1.00 0.00 ? 39  LYS A CA   2  
ATOM 1468  C C    . LYS A 1 2  ? 22.983  -0.733  10.732  1.00 0.00 ? 39  LYS A C    2  
ATOM 1469  O O    . LYS A 1 2  ? 22.657  -1.526  9.847   1.00 0.00 ? 39  LYS A O    2  
ATOM 1470  C CB   . LYS A 1 2  ? 25.470  -0.434  10.733  1.00 0.00 ? 39  LYS A CB   2  
ATOM 1471  C CG   . LYS A 1 2  ? 26.736  -0.262  11.562  1.00 0.00 ? 39  LYS A CG   2  
ATOM 1472  C CD   . LYS A 1 2  ? 27.401  -1.593  11.873  1.00 0.00 ? 39  LYS A CD   2  
ATOM 1473  C CE   . LYS A 1 2  ? 28.629  -1.411  12.750  1.00 0.00 ? 39  LYS A CE   2  
ATOM 1474  N NZ   . LYS A 1 2  ? 29.668  -0.583  12.085  1.00 0.00 ? 39  LYS A NZ   2  
ATOM 1475  H H1   . LYS A 1 2  ? 23.509  -2.861  11.883  1.00 0.00 ? 39  LYS A H1   2  
ATOM 1476  H H2   . LYS A 1 2  ? 25.002  -2.852  11.078  1.00 0.00 ? 39  LYS A H2   2  
ATOM 1477  H H3   . LYS A 1 2  ? 24.929  -2.512  12.741  1.00 0.00 ? 39  LYS A H3   2  
ATOM 1478  H HA   . LYS A 1 2  ? 24.189  -0.414  12.459  1.00 0.00 ? 39  LYS A HA   2  
ATOM 1479  H HB2  . LYS A 1 2  ? 25.685  -1.127  9.934   1.00 0.00 ? 39  LYS A HB2  2  
ATOM 1480  H HB3  . LYS A 1 2  ? 25.216  0.525   10.305  1.00 0.00 ? 39  LYS A HB3  2  
ATOM 1481  H HG2  . LYS A 1 2  ? 27.431  0.354   11.011  1.00 0.00 ? 39  LYS A HG2  2  
ATOM 1482  H HG3  . LYS A 1 2  ? 26.481  0.227   12.490  1.00 0.00 ? 39  LYS A HG3  2  
ATOM 1483  H HD2  . LYS A 1 2  ? 26.693  -2.226  12.389  1.00 0.00 ? 39  LYS A HD2  2  
ATOM 1484  H HD3  . LYS A 1 2  ? 27.697  -2.062  10.947  1.00 0.00 ? 39  LYS A HD3  2  
ATOM 1485  H HE2  . LYS A 1 2  ? 28.331  -0.930  13.669  1.00 0.00 ? 39  LYS A HE2  2  
ATOM 1486  H HE3  . LYS A 1 2  ? 29.045  -2.384  12.972  1.00 0.00 ? 39  LYS A HE3  2  
ATOM 1487  H HZ1  . LYS A 1 2  ? 29.231  0.052   11.382  1.00 0.00 ? 39  LYS A HZ1  2  
ATOM 1488  H HZ2  . LYS A 1 2  ? 30.175  -0.007  12.788  1.00 0.00 ? 39  LYS A HZ2  2  
ATOM 1489  H HZ3  . LYS A 1 2  ? 30.356  -1.198  11.599  1.00 0.00 ? 39  LYS A HZ3  2  
ATOM 1490  N N    . GLU A 1 3  ? 22.240  0.310   11.096  1.00 0.00 ? 40  GLU A N    2  
ATOM 1491  C CA   . GLU A 1 3  ? 20.963  0.622   10.462  1.00 0.00 ? 40  GLU A CA   2  
ATOM 1492  C C    . GLU A 1 3  ? 19.994  -0.555  10.579  1.00 0.00 ? 40  GLU A C    2  
ATOM 1493  O O    . GLU A 1 3  ? 19.924  -1.224  11.612  1.00 0.00 ? 40  GLU A O    2  
ATOM 1494  C CB   . GLU A 1 3  ? 21.156  0.983   8.983   1.00 0.00 ? 40  GLU A CB   2  
ATOM 1495  C CG   . GLU A 1 3  ? 21.927  2.268   8.740   1.00 0.00 ? 40  GLU A CG   2  
ATOM 1496  C CD   . GLU A 1 3  ? 22.104  2.550   7.263   1.00 0.00 ? 40  GLU A CD   2  
ATOM 1497  O OE1  . GLU A 1 3  ? 21.714  1.690   6.438   1.00 0.00 ? 40  GLU A OE1  2  
ATOM 1498  O OE2  . GLU A 1 3  ? 22.642  3.620   6.913   1.00 0.00 ? 40  GLU A OE2  2  
ATOM 1499  H H    . GLU A 1 3  ? 22.542  0.869   11.847  1.00 0.00 ? 40  GLU A H    2  
ATOM 1500  H HA   . GLU A 1 3  ? 20.541  1.471   10.977  1.00 0.00 ? 40  GLU A HA   2  
ATOM 1501  H HB2  . GLU A 1 3  ? 21.686  0.178   8.496   1.00 0.00 ? 40  GLU A HB2  2  
ATOM 1502  H HB3  . GLU A 1 3  ? 20.182  1.084   8.525   1.00 0.00 ? 40  GLU A HB3  2  
ATOM 1503  H HG2  . GLU A 1 3  ? 21.387  3.089   9.187   1.00 0.00 ? 40  GLU A HG2  2  
ATOM 1504  H HG3  . GLU A 1 3  ? 22.902  2.183   9.197   1.00 0.00 ? 40  GLU A HG3  2  
ATOM 1505  N N    . GLU A 1 4  ? 19.322  -0.843  9.479   1.00 0.00 ? 41  GLU A N    2  
ATOM 1506  C CA   . GLU A 1 4  ? 18.413  -1.965  9.385   1.00 0.00 ? 41  GLU A CA   2  
ATOM 1507  C C    . GLU A 1 4  ? 18.118  -2.220  7.918   1.00 0.00 ? 41  GLU A C    2  
ATOM 1508  O O    . GLU A 1 4  ? 18.049  -1.277  7.124   1.00 0.00 ? 41  GLU A O    2  
ATOM 1509  C CB   . GLU A 1 4  ? 17.114  -1.676  10.138  1.00 0.00 ? 41  GLU A CB   2  
ATOM 1510  C CG   . GLU A 1 4  ? 16.166  -2.862  10.190  1.00 0.00 ? 41  GLU A CG   2  
ATOM 1511  C CD   . GLU A 1 4  ? 14.849  -2.523  10.844  1.00 0.00 ? 41  GLU A CD   2  
ATOM 1512  O OE1  . GLU A 1 4  ? 14.088  -1.716  10.272  1.00 0.00 ? 41  GLU A OE1  2  
ATOM 1513  O OE2  . GLU A 1 4  ? 14.575  -3.048  11.942  1.00 0.00 ? 41  GLU A OE2  2  
ATOM 1514  H H    . GLU A 1 4  ? 19.481  -0.305  8.676   1.00 0.00 ? 41  GLU A H    2  
ATOM 1515  H HA   . GLU A 1 4  ? 18.895  -2.832  9.810   1.00 0.00 ? 41  GLU A HA   2  
ATOM 1516  H HB2  . GLU A 1 4  ? 17.353  -1.390  11.152  1.00 0.00 ? 41  GLU A HB2  2  
ATOM 1517  H HB3  . GLU A 1 4  ? 16.605  -0.856  9.652   1.00 0.00 ? 41  GLU A HB3  2  
ATOM 1518  H HG2  . GLU A 1 4  ? 15.977  -3.198  9.181   1.00 0.00 ? 41  GLU A HG2  2  
ATOM 1519  H HG3  . GLU A 1 4  ? 16.637  -3.657  10.752  1.00 0.00 ? 41  GLU A HG3  2  
ATOM 1520  N N    . ALA A 1 5  ? 17.993  -3.484  7.549   1.00 0.00 ? 42  ALA A N    2  
ATOM 1521  C CA   . ALA A 1 5  ? 17.723  -3.847  6.167   1.00 0.00 ? 42  ALA A CA   2  
ATOM 1522  C C    . ALA A 1 5  ? 16.258  -3.590  5.823   1.00 0.00 ? 42  ALA A C    2  
ATOM 1523  O O    . ALA A 1 5  ? 15.619  -2.699  6.396   1.00 0.00 ? 42  ALA A O    2  
ATOM 1524  C CB   . ALA A 1 5  ? 18.090  -5.303  5.928   1.00 0.00 ? 42  ALA A CB   2  
ATOM 1525  H H    . ALA A 1 5  ? 18.075  -4.194  8.226   1.00 0.00 ? 42  ALA A H    2  
ATOM 1526  H HA   . ALA A 1 5  ? 18.344  -3.233  5.533   1.00 0.00 ? 42  ALA A HA   2  
ATOM 1527  H HB1  . ALA A 1 5  ? 17.282  -5.938  6.257   1.00 0.00 ? 42  ALA A HB1  2  
ATOM 1528  H HB2  . ALA A 1 5  ? 18.984  -5.544  6.483   1.00 0.00 ? 42  ALA A HB2  2  
ATOM 1529  H HB3  . ALA A 1 5  ? 18.267  -5.463  4.874   1.00 0.00 ? 42  ALA A HB3  2  
ATOM 1530  N N    . SER A 1 6  ? 15.695  -4.420  4.955   1.00 0.00 ? 43  SER A N    2  
ATOM 1531  C CA   . SER A 1 6  ? 14.295  -4.297  4.585   1.00 0.00 ? 43  SER A CA   2  
ATOM 1532  C C    . SER A 1 6  ? 13.390  -4.907  5.656   1.00 0.00 ? 43  SER A C    2  
ATOM 1533  O O    . SER A 1 6  ? 12.270  -5.324  5.370   1.00 0.00 ? 43  SER A O    2  
ATOM 1534  C CB   . SER A 1 6  ? 14.057  -4.980  3.239   1.00 0.00 ? 43  SER A CB   2  
ATOM 1535  O OG   . SER A 1 6  ? 14.992  -4.525  2.271   1.00 0.00 ? 43  SER A OG   2  
ATOM 1536  H H    . SER A 1 6  ? 16.227  -5.153  4.573   1.00 0.00 ? 43  SER A H    2  
ATOM 1537  H HA   . SER A 1 6  ? 14.068  -3.245  4.491   1.00 0.00 ? 43  SER A HA   2  
ATOM 1538  H HB2  . SER A 1 6  ? 14.167  -6.048  3.354   1.00 0.00 ? 43  SER A HB2  2  
ATOM 1539  H HB3  . SER A 1 6  ? 13.057  -4.756  2.892   1.00 0.00 ? 43  SER A HB3  2  
ATOM 1540  H HG   . SER A 1 6  ? 15.696  -4.026  2.712   1.00 0.00 ? 43  SER A HG   2  
ATOM 1541  N N    . SER A 1 7  ? 13.862  -4.889  6.899   1.00 0.00 ? 44  SER A N    2  
ATOM 1542  C CA   . SER A 1 7  ? 13.112  -5.420  8.031   1.00 0.00 ? 44  SER A CA   2  
ATOM 1543  C C    . SER A 1 7  ? 12.015  -4.450  8.469   1.00 0.00 ? 44  SER A C    2  
ATOM 1544  O O    . SER A 1 7  ? 11.700  -4.338  9.652   1.00 0.00 ? 44  SER A O    2  
ATOM 1545  C CB   . SER A 1 7  ? 14.073  -5.690  9.190   1.00 0.00 ? 44  SER A CB   2  
ATOM 1546  O OG   . SER A 1 7  ? 15.297  -6.229  8.716   1.00 0.00 ? 44  SER A OG   2  
ATOM 1547  H H    . SER A 1 7  ? 14.747  -4.505  7.062   1.00 0.00 ? 44  SER A H    2  
ATOM 1548  H HA   . SER A 1 7  ? 12.658  -6.346  7.724   1.00 0.00 ? 44  SER A HA   2  
ATOM 1549  H HB2  . SER A 1 7  ? 14.278  -4.767  9.709   1.00 0.00 ? 44  SER A HB2  2  
ATOM 1550  H HB3  . SER A 1 7  ? 13.622  -6.396  9.873   1.00 0.00 ? 44  SER A HB3  2  
ATOM 1551  H HG   . SER A 1 7  ? 15.135  -7.100  8.320   1.00 0.00 ? 44  SER A HG   2  
ATOM 1552  N N    . LYS A 1 8  ? 11.377  -3.823  7.494   1.00 0.00 ? 45  LYS A N    2  
ATOM 1553  C CA   . LYS A 1 8  ? 10.236  -2.968  7.753   1.00 0.00 ? 45  LYS A CA   2  
ATOM 1554  C C    . LYS A 1 8  ? 8.974   -3.812  7.651   1.00 0.00 ? 45  LYS A C    2  
ATOM 1555  O O    . LYS A 1 8  ? 8.956   -4.800  6.919   1.00 0.00 ? 45  LYS A O    2  
ATOM 1556  C CB   . LYS A 1 8  ? 10.191  -1.813  6.747   1.00 0.00 ? 45  LYS A CB   2  
ATOM 1557  C CG   . LYS A 1 8  ? 11.535  -1.125  6.533   1.00 0.00 ? 45  LYS A CG   2  
ATOM 1558  C CD   . LYS A 1 8  ? 11.963  -0.322  7.747   1.00 0.00 ? 45  LYS A CD   2  
ATOM 1559  C CE   . LYS A 1 8  ? 13.310  0.358   7.535   1.00 0.00 ? 45  LYS A CE   2  
ATOM 1560  N NZ   . LYS A 1 8  ? 14.449  -0.508  7.948   1.00 0.00 ? 45  LYS A NZ   2  
ATOM 1561  H H    . LYS A 1 8  ? 11.605  -4.039  6.566   1.00 0.00 ? 45  LYS A H    2  
ATOM 1562  H HA   . LYS A 1 8  ? 10.324  -2.575  8.757   1.00 0.00 ? 45  LYS A HA   2  
ATOM 1563  H HB2  . LYS A 1 8  ? 9.850   -2.192  5.796   1.00 0.00 ? 45  LYS A HB2  2  
ATOM 1564  H HB3  . LYS A 1 8  ? 9.485   -1.073  7.103   1.00 0.00 ? 45  LYS A HB3  2  
ATOM 1565  H HG2  . LYS A 1 8  ? 12.284  -1.878  6.331   1.00 0.00 ? 45  LYS A HG2  2  
ATOM 1566  H HG3  . LYS A 1 8  ? 11.455  -0.462  5.684   1.00 0.00 ? 45  LYS A HG3  2  
ATOM 1567  H HD2  . LYS A 1 8  ? 11.220  0.436   7.946   1.00 0.00 ? 45  LYS A HD2  2  
ATOM 1568  H HD3  . LYS A 1 8  ? 12.040  -0.990  8.592   1.00 0.00 ? 45  LYS A HD3  2  
ATOM 1569  H HE2  . LYS A 1 8  ? 13.415  0.602   6.486   1.00 0.00 ? 45  LYS A HE2  2  
ATOM 1570  H HE3  . LYS A 1 8  ? 13.331  1.268   8.117   1.00 0.00 ? 45  LYS A HE3  2  
ATOM 1571  H HZ1  . LYS A 1 8  ? 14.180  -1.081  8.781   1.00 0.00 ? 45  LYS A HZ1  2  
ATOM 1572  H HZ2  . LYS A 1 8  ? 14.724  -1.148  7.174   1.00 0.00 ? 45  LYS A HZ2  2  
ATOM 1573  H HZ3  . LYS A 1 8  ? 15.272  0.084   8.206   1.00 0.00 ? 45  LYS A HZ3  2  
ATOM 1574  N N    . SER A 1 9  ? 7.967   -3.488  8.443   1.00 0.00 ? 46  SER A N    2  
ATOM 1575  C CA   . SER A 1 9  ? 6.746   -4.290  8.493   1.00 0.00 ? 46  SER A CA   2  
ATOM 1576  C C    . SER A 1 9  ? 5.937   -4.151  7.208   1.00 0.00 ? 46  SER A C    2  
ATOM 1577  O O    . SER A 1 9  ? 5.002   -4.917  6.964   1.00 0.00 ? 46  SER A O    2  
ATOM 1578  C CB   . SER A 1 9  ? 5.900   -3.880  9.702   1.00 0.00 ? 46  SER A CB   2  
ATOM 1579  O OG   . SER A 1 9  ? 4.826   -4.780  9.916   1.00 0.00 ? 46  SER A OG   2  
ATOM 1580  H H    . SER A 1 9  ? 8.069   -2.727  9.063   1.00 0.00 ? 46  SER A H    2  
ATOM 1581  H HA   . SER A 1 9  ? 7.039   -5.313  8.597   1.00 0.00 ? 46  SER A HA   2  
ATOM 1582  H HB2  . SER A 1 9  ? 6.519   -3.867  10.584  1.00 0.00 ? 46  SER A HB2  2  
ATOM 1583  H HB3  . SER A 1 9  ? 5.494   -2.894  9.537   1.00 0.00 ? 46  SER A HB3  2  
ATOM 1584  H HG   . SER A 1 9  ? 4.997   -5.291  10.724  1.00 0.00 ? 46  SER A HG   2  
ATOM 1585  N N    . TYR A 1 10 ? 6.254   -3.109  6.453   1.00 0.00 ? 47  TYR A N    2  
ATOM 1586  C CA   . TYR A 1 10 ? 5.530   -2.733  5.227   1.00 0.00 ? 47  TYR A CA   2  
ATOM 1587  C C    . TYR A 1 10 ? 4.155   -2.165  5.552   1.00 0.00 ? 47  TYR A C    2  
ATOM 1588  O O    . TYR A 1 10 ? 3.782   -1.120  5.033   1.00 0.00 ? 47  TYR A O    2  
ATOM 1589  C CB   . TYR A 1 10 ? 5.386   -3.900  4.238   1.00 0.00 ? 47  TYR A CB   2  
ATOM 1590  C CG   . TYR A 1 10 ? 6.635   -4.192  3.435   1.00 0.00 ? 47  TYR A CG   2  
ATOM 1591  C CD1  . TYR A 1 10 ? 7.780   -4.698  4.036   1.00 0.00 ? 47  TYR A CD1  2  
ATOM 1592  C CD2  . TYR A 1 10 ? 6.664   -3.947  2.068   1.00 0.00 ? 47  TYR A CD2  2  
ATOM 1593  C CE1  . TYR A 1 10 ? 8.919   -4.953  3.296   1.00 0.00 ? 47  TYR A CE1  2  
ATOM 1594  C CE2  . TYR A 1 10 ? 7.797   -4.201  1.323   1.00 0.00 ? 47  TYR A CE2  2  
ATOM 1595  C CZ   . TYR A 1 10 ? 8.923   -4.703  1.939   1.00 0.00 ? 47  TYR A CZ   2  
ATOM 1596  O OH   . TYR A 1 10 ? 10.057  -4.955  1.196   1.00 0.00 ? 47  TYR A OH   2  
ATOM 1597  H H    . TYR A 1 10 ? 6.984   -2.541  6.762   1.00 0.00 ? 47  TYR A H    2  
ATOM 1598  H HA   . TYR A 1 10 ? 6.105   -1.952  4.748   1.00 0.00 ? 47  TYR A HA   2  
ATOM 1599  H HB2  . TYR A 1 10 ? 5.125   -4.795  4.782   1.00 0.00 ? 47  TYR A HB2  2  
ATOM 1600  H HB3  . TYR A 1 10 ? 4.595   -3.669  3.541   1.00 0.00 ? 47  TYR A HB3  2  
ATOM 1601  H HD1  . TYR A 1 10 ? 7.774   -4.892  5.098   1.00 0.00 ? 47  TYR A HD1  2  
ATOM 1602  H HD2  . TYR A 1 10 ? 5.780   -3.553  1.589   1.00 0.00 ? 47  TYR A HD2  2  
ATOM 1603  H HE1  . TYR A 1 10 ? 9.800   -5.347  3.780   1.00 0.00 ? 47  TYR A HE1  2  
ATOM 1604  H HE2  . TYR A 1 10 ? 7.797   -4.005  0.261   1.00 0.00 ? 47  TYR A HE2  2  
ATOM 1605  H HH   . TYR A 1 10 ? 10.398  -4.128  0.841   1.00 0.00 ? 47  TYR A HH   2  
ATOM 1606  N N    . ARG A 1 11 ? 3.447   -2.819  6.466   1.00 0.00 ? 48  ARG A N    2  
ATOM 1607  C CA   . ARG A 1 11 ? 2.145   -2.359  6.930   1.00 0.00 ? 48  ARG A CA   2  
ATOM 1608  C C    . ARG A 1 11 ? 2.232   -0.924  7.432   1.00 0.00 ? 48  ARG A C    2  
ATOM 1609  O O    . ARG A 1 11 ? 1.445   -0.067  7.040   1.00 0.00 ? 48  ARG A O    2  
ATOM 1610  C CB   . ARG A 1 11 ? 1.635   -3.297  8.033   1.00 0.00 ? 48  ARG A CB   2  
ATOM 1611  C CG   . ARG A 1 11 ? 0.736   -2.629  9.059   1.00 0.00 ? 48  ARG A CG   2  
ATOM 1612  C CD   . ARG A 1 11 ? -0.202  -3.625  9.720   1.00 0.00 ? 48  ARG A CD   2  
ATOM 1613  N NE   . ARG A 1 11 ? -1.163  -4.172  8.762   1.00 0.00 ? 48  ARG A NE   2  
ATOM 1614  C CZ   . ARG A 1 11 ? -0.982  -5.288  8.054   1.00 0.00 ? 48  ARG A CZ   2  
ATOM 1615  N NH1  . ARG A 1 11 ? 0.026   -6.114  8.329   1.00 0.00 ? 48  ARG A NH1  2  
ATOM 1616  N NH2  . ARG A 1 11 ? -1.838  -5.586  7.091   1.00 0.00 ? 48  ARG A NH2  2  
ATOM 1617  H H    . ARG A 1 11 ? 3.837   -3.626  6.873   1.00 0.00 ? 48  ARG A H    2  
ATOM 1618  H HA   . ARG A 1 11 ? 1.463   -2.395  6.094   1.00 0.00 ? 48  ARG A HA   2  
ATOM 1619  H HB2  . ARG A 1 11 ? 1.078   -4.102  7.575   1.00 0.00 ? 48  ARG A HB2  2  
ATOM 1620  H HB3  . ARG A 1 11 ? 2.485   -3.716  8.553   1.00 0.00 ? 48  ARG A HB3  2  
ATOM 1621  H HG2  . ARG A 1 11 ? 1.357   -2.176  9.820   1.00 0.00 ? 48  ARG A HG2  2  
ATOM 1622  H HG3  . ARG A 1 11 ? 0.151   -1.865  8.568   1.00 0.00 ? 48  ARG A HG3  2  
ATOM 1623  H HD2  . ARG A 1 11 ? 0.382   -4.434  10.133  1.00 0.00 ? 48  ARG A HD2  2  
ATOM 1624  H HD3  . ARG A 1 11 ? -0.740  -3.126  10.513  1.00 0.00 ? 48  ARG A HD3  2  
ATOM 1625  H HE   . ARG A 1 11 ? -1.974  -3.628  8.579   1.00 0.00 ? 48  ARG A HE   2  
ATOM 1626  H HH11 . ARG A 1 11 ? 0.662   -5.908  9.083   1.00 0.00 ? 48  ARG A HH11 2  
ATOM 1627  H HH12 . ARG A 1 11 ? 0.167   -6.944  7.775   1.00 0.00 ? 48  ARG A HH12 2  
ATOM 1628  H HH21 . ARG A 1 11 ? -2.612  -4.970  6.901   1.00 0.00 ? 48  ARG A HH21 2  
ATOM 1629  H HH22 . ARG A 1 11 ? -1.715  -6.421  6.538   1.00 0.00 ? 48  ARG A HH22 2  
ATOM 1630  N N    . GLU A 1 12 ? 3.261   -0.662  8.222   1.00 0.00 ? 49  GLU A N    2  
ATOM 1631  C CA   . GLU A 1 12 ? 3.533   0.670   8.733   1.00 0.00 ? 49  GLU A CA   2  
ATOM 1632  C C    . GLU A 1 12 ? 3.757   1.663   7.592   1.00 0.00 ? 49  GLU A C    2  
ATOM 1633  O O    . GLU A 1 12 ? 3.182   2.749   7.583   1.00 0.00 ? 49  GLU A O    2  
ATOM 1634  C CB   . GLU A 1 12 ? 4.757   0.616   9.651   1.00 0.00 ? 49  GLU A CB   2  
ATOM 1635  C CG   . GLU A 1 12 ? 5.906   -0.204  9.088   1.00 0.00 ? 49  GLU A CG   2  
ATOM 1636  C CD   . GLU A 1 12 ? 7.020   -0.427  10.089  1.00 0.00 ? 49  GLU A CD   2  
ATOM 1637  O OE1  . GLU A 1 12 ? 6.862   -0.034  11.262  1.00 0.00 ? 49  GLU A OE1  2  
ATOM 1638  O OE2  . GLU A 1 12 ? 8.052   -1.021  9.704   1.00 0.00 ? 49  GLU A OE2  2  
ATOM 1639  H H    . GLU A 1 12 ? 3.880   -1.383  8.443   1.00 0.00 ? 49  GLU A H    2  
ATOM 1640  H HA   . GLU A 1 12 ? 2.672   0.983   9.308   1.00 0.00 ? 49  GLU A HA   2  
ATOM 1641  H HB2  . GLU A 1 12 ? 5.116   1.621   9.813   1.00 0.00 ? 49  GLU A HB2  2  
ATOM 1642  H HB3  . GLU A 1 12 ? 4.468   0.186   10.596  1.00 0.00 ? 49  GLU A HB3  2  
ATOM 1643  H HG2  . GLU A 1 12 ? 5.526   -1.164  8.777   1.00 0.00 ? 49  GLU A HG2  2  
ATOM 1644  H HG3  . GLU A 1 12 ? 6.310   0.313   8.233   1.00 0.00 ? 49  GLU A HG3  2  
ATOM 1645  N N    . LEU A 1 13 ? 4.565   1.255   6.617   1.00 0.00 ? 50  LEU A N    2  
ATOM 1646  C CA   . LEU A 1 13 ? 4.869   2.079   5.452   1.00 0.00 ? 50  LEU A CA   2  
ATOM 1647  C C    . LEU A 1 13 ? 3.618   2.371   4.626   1.00 0.00 ? 50  LEU A C    2  
ATOM 1648  O O    . LEU A 1 13 ? 3.338   3.519   4.281   1.00 0.00 ? 50  LEU A O    2  
ATOM 1649  C CB   . LEU A 1 13 ? 5.891   1.348   4.579   1.00 0.00 ? 50  LEU A CB   2  
ATOM 1650  C CG   . LEU A 1 13 ? 7.370   1.539   4.937   1.00 0.00 ? 50  LEU A CG   2  
ATOM 1651  C CD1  . LEU A 1 13 ? 7.613   1.467   6.429   1.00 0.00 ? 50  LEU A CD1  2  
ATOM 1652  C CD2  . LEU A 1 13 ? 8.194   0.474   4.251   1.00 0.00 ? 50  LEU A CD2  2  
ATOM 1653  H H    . LEU A 1 13 ? 4.971   0.366   6.679   1.00 0.00 ? 50  LEU A H    2  
ATOM 1654  H HA   . LEU A 1 13 ? 5.295   3.009   5.795   1.00 0.00 ? 50  LEU A HA   2  
ATOM 1655  H HB2  . LEU A 1 13 ? 5.673   0.292   4.627   1.00 0.00 ? 50  LEU A HB2  2  
ATOM 1656  H HB3  . LEU A 1 13 ? 5.751   1.674   3.559   1.00 0.00 ? 50  LEU A HB3  2  
ATOM 1657  H HG   . LEU A 1 13 ? 7.703   2.503   4.588   1.00 0.00 ? 50  LEU A HG   2  
ATOM 1658  H HD11 . LEU A 1 13 ? 6.781   1.913   6.952   1.00 0.00 ? 50  LEU A HD11 2  
ATOM 1659  H HD12 . LEU A 1 13 ? 7.719   0.434   6.722   1.00 0.00 ? 50  LEU A HD12 2  
ATOM 1660  H HD13 . LEU A 1 13 ? 8.520   2.004   6.667   1.00 0.00 ? 50  LEU A HD13 2  
ATOM 1661  H HD21 . LEU A 1 13 ? 7.742   -0.491  4.432   1.00 0.00 ? 50  LEU A HD21 2  
ATOM 1662  H HD22 . LEU A 1 13 ? 8.222   0.664   3.190   1.00 0.00 ? 50  LEU A HD22 2  
ATOM 1663  H HD23 . LEU A 1 13 ? 9.199   0.481   4.648   1.00 0.00 ? 50  LEU A HD23 2  
ATOM 1664  N N    . ILE A 1 14 ? 2.902   1.311   4.270   1.00 0.00 ? 51  ILE A N    2  
ATOM 1665  C CA   . ILE A 1 14 ? 1.719   1.422   3.427   1.00 0.00 ? 51  ILE A CA   2  
ATOM 1666  C C    . ILE A 1 14 ? 0.635   2.238   4.096   1.00 0.00 ? 51  ILE A C    2  
ATOM 1667  O O    . ILE A 1 14 ? 0.099   3.151   3.492   1.00 0.00 ? 51  ILE A O    2  
ATOM 1668  C CB   . ILE A 1 14 ? 1.145   0.036   3.075   1.00 0.00 ? 51  ILE A CB   2  
ATOM 1669  C CG1  . ILE A 1 14 ? 2.184   -0.786  2.320   1.00 0.00 ? 51  ILE A CG1  2  
ATOM 1670  C CG2  . ILE A 1 14 ? -0.127  0.177   2.248   1.00 0.00 ? 51  ILE A CG2  2  
ATOM 1671  C CD1  . ILE A 1 14 ? 1.733   -2.196  2.032   1.00 0.00 ? 51  ILE A CD1  2  
ATOM 1672  H H    . ILE A 1 14 ? 3.205   0.419   4.552   1.00 0.00 ? 51  ILE A H    2  
ATOM 1673  H HA   . ILE A 1 14 ? 2.003   1.911   2.507   1.00 0.00 ? 51  ILE A HA   2  
ATOM 1674  H HB   . ILE A 1 14 ? 0.893   -0.470  3.995   1.00 0.00 ? 51  ILE A HB   2  
ATOM 1675  H HG12 . ILE A 1 14 ? 2.398   -0.308  1.378   1.00 0.00 ? 51  ILE A HG12 2  
ATOM 1676  H HG13 . ILE A 1 14 ? 3.089   -0.839  2.908   1.00 0.00 ? 51  ILE A HG13 2  
ATOM 1677  H HG21 . ILE A 1 14 ? 0.036   0.893   1.455   1.00 0.00 ? 51  ILE A HG21 2  
ATOM 1678  H HG22 . ILE A 1 14 ? -0.387  -0.780  1.820   1.00 0.00 ? 51  ILE A HG22 2  
ATOM 1679  H HG23 . ILE A 1 14 ? -0.932  0.520   2.882   1.00 0.00 ? 51  ILE A HG23 2  
ATOM 1680  H HD11 . ILE A 1 14 ? 0.708   -2.311  2.354   1.00 0.00 ? 51  ILE A HD11 2  
ATOM 1681  H HD12 . ILE A 1 14 ? 1.802   -2.383  0.970   1.00 0.00 ? 51  ILE A HD12 2  
ATOM 1682  H HD13 . ILE A 1 14 ? 2.362   -2.893  2.567   1.00 0.00 ? 51  ILE A HD13 2  
ATOM 1683  N N    . ILE A 1 15 ? 0.286   1.882   5.322   1.00 0.00 ? 52  ILE A N    2  
ATOM 1684  C CA   . ILE A 1 15 ? -0.801  2.550   6.022   1.00 0.00 ? 52  ILE A CA   2  
ATOM 1685  C C    . ILE A 1 15 ? -0.496  4.021   6.271   1.00 0.00 ? 52  ILE A C    2  
ATOM 1686  O O    . ILE A 1 15 ? -1.357  4.878   6.059   1.00 0.00 ? 52  ILE A O    2  
ATOM 1687  C CB   . ILE A 1 15 ? -1.132  1.853   7.349   1.00 0.00 ? 52  ILE A CB   2  
ATOM 1688  C CG1  . ILE A 1 15 ? -1.771  0.496   7.060   1.00 0.00 ? 52  ILE A CG1  2  
ATOM 1689  C CG2  . ILE A 1 15 ? -2.053  2.726   8.185   1.00 0.00 ? 52  ILE A CG2  2  
ATOM 1690  C CD1  . ILE A 1 15 ? -2.030  -0.342  8.287   1.00 0.00 ? 52  ILE A CD1  2  
ATOM 1691  H H    . ILE A 1 15 ? 0.735   1.118   5.750   1.00 0.00 ? 52  ILE A H    2  
ATOM 1692  H HA   . ILE A 1 15 ? -1.676  2.489   5.389   1.00 0.00 ? 52  ILE A HA   2  
ATOM 1693  H HB   . ILE A 1 15 ? -0.214  1.705   7.898   1.00 0.00 ? 52  ILE A HB   2  
ATOM 1694  H HG12 . ILE A 1 15 ? -2.718  0.651   6.564   1.00 0.00 ? 52  ILE A HG12 2  
ATOM 1695  H HG13 . ILE A 1 15 ? -1.120  -0.066  6.407   1.00 0.00 ? 52  ILE A HG13 2  
ATOM 1696  H HG21 . ILE A 1 15 ? -2.089  3.719   7.752   1.00 0.00 ? 52  ILE A HG21 2  
ATOM 1697  H HG22 . ILE A 1 15 ? -3.046  2.300   8.194   1.00 0.00 ? 52  ILE A HG22 2  
ATOM 1698  H HG23 . ILE A 1 15 ? -1.677  2.784   9.196   1.00 0.00 ? 52  ILE A HG23 2  
ATOM 1699  H HD11 . ILE A 1 15 ? -2.660  0.209   8.971   1.00 0.00 ? 52  ILE A HD11 2  
ATOM 1700  H HD12 . ILE A 1 15 ? -2.527  -1.262  7.997   1.00 0.00 ? 52  ILE A HD12 2  
ATOM 1701  H HD13 . ILE A 1 15 ? -1.090  -0.574  8.768   1.00 0.00 ? 52  ILE A HD13 2  
ATOM 1702  N N    . GLU A 1 16 ? 0.745   4.315   6.652   1.00 0.00 ? 53  GLU A N    2  
ATOM 1703  C CA   . GLU A 1 16 ? 1.166   5.692   6.871   1.00 0.00 ? 53  GLU A CA   2  
ATOM 1704  C C    . GLU A 1 16 ? 0.925   6.512   5.611   1.00 0.00 ? 53  GLU A C    2  
ATOM 1705  O O    . GLU A 1 16 ? 0.443   7.644   5.672   1.00 0.00 ? 53  GLU A O    2  
ATOM 1706  C CB   . GLU A 1 16 ? 2.640   5.751   7.273   1.00 0.00 ? 53  GLU A CB   2  
ATOM 1707  C CG   . GLU A 1 16 ? 3.111   7.150   7.641   1.00 0.00 ? 53  GLU A CG   2  
ATOM 1708  C CD   . GLU A 1 16 ? 4.544   7.185   8.134   1.00 0.00 ? 53  GLU A CD   2  
ATOM 1709  O OE1  . GLU A 1 16 ? 5.459   6.861   7.354   1.00 0.00 ? 53  GLU A OE1  2  
ATOM 1710  O OE2  . GLU A 1 16 ? 4.759   7.558   9.307   1.00 0.00 ? 53  GLU A OE2  2  
ATOM 1711  H H    . GLU A 1 16 ? 1.404   3.591   6.745   1.00 0.00 ? 53  GLU A H    2  
ATOM 1712  H HA   . GLU A 1 16 ? 0.566   6.099   7.672   1.00 0.00 ? 53  GLU A HA   2  
ATOM 1713  H HB2  . GLU A 1 16 ? 2.793   5.102   8.123   1.00 0.00 ? 53  GLU A HB2  2  
ATOM 1714  H HB3  . GLU A 1 16 ? 3.240   5.394   6.447   1.00 0.00 ? 53  GLU A HB3  2  
ATOM 1715  H HG2  . GLU A 1 16 ? 3.033   7.785   6.770   1.00 0.00 ? 53  GLU A HG2  2  
ATOM 1716  H HG3  . GLU A 1 16 ? 2.470   7.537   8.420   1.00 0.00 ? 53  GLU A HG3  2  
ATOM 1717  N N    . GLY A 1 17 ? 1.154   5.891   4.466   1.00 0.00 ? 54  GLY A N    2  
ATOM 1718  C CA   . GLY A 1 17 ? 0.845   6.533   3.213   1.00 0.00 ? 54  GLY A CA   2  
ATOM 1719  C C    . GLY A 1 17 ? -0.620  6.488   2.893   1.00 0.00 ? 54  GLY A C    2  
ATOM 1720  O O    . GLY A 1 17 ? -1.227  7.516   2.622   1.00 0.00 ? 54  GLY A O    2  
ATOM 1721  H H    . GLY A 1 17 ? 1.465   4.961   4.477   1.00 0.00 ? 54  GLY A H    2  
ATOM 1722  H HA2  . GLY A 1 17 ? 1.166   7.562   3.252   1.00 0.00 ? 54  GLY A HA2  2  
ATOM 1723  H HA3  . GLY A 1 17 ? 1.376   6.030   2.424   1.00 0.00 ? 54  GLY A HA3  2  
ATOM 1724  N N    . LEU A 1 18 ? -1.148  5.278   2.815   1.00 0.00 ? 55  LEU A N    2  
ATOM 1725  C CA   . LEU A 1 18 ? -2.509  5.024   2.367   1.00 0.00 ? 55  LEU A CA   2  
ATOM 1726  C C    . LEU A 1 18 ? -3.534  5.909   3.084   1.00 0.00 ? 55  LEU A C    2  
ATOM 1727  O O    . LEU A 1 18 ? -4.530  6.324   2.496   1.00 0.00 ? 55  LEU A O    2  
ATOM 1728  C CB   . LEU A 1 18 ? -2.822  3.541   2.571   1.00 0.00 ? 55  LEU A CB   2  
ATOM 1729  C CG   . LEU A 1 18 ? -4.155  3.054   2.017   1.00 0.00 ? 55  LEU A CG   2  
ATOM 1730  C CD1  . LEU A 1 18 ? -4.265  3.368   0.540   1.00 0.00 ? 55  LEU A CD1  2  
ATOM 1731  C CD2  . LEU A 1 18 ? -4.297  1.560   2.240   1.00 0.00 ? 55  LEU A CD2  2  
ATOM 1732  H H    . LEU A 1 18 ? -0.560  4.499   2.974   1.00 0.00 ? 55  LEU A H    2  
ATOM 1733  H HA   . LEU A 1 18 ? -2.544  5.237   1.311   1.00 0.00 ? 55  LEU A HA   2  
ATOM 1734  H HB2  . LEU A 1 18 ? -2.036  2.968   2.099   1.00 0.00 ? 55  LEU A HB2  2  
ATOM 1735  H HB3  . LEU A 1 18 ? -2.803  3.336   3.630   1.00 0.00 ? 55  LEU A HB3  2  
ATOM 1736  H HG   . LEU A 1 18 ? -4.962  3.553   2.531   1.00 0.00 ? 55  LEU A HG   2  
ATOM 1737  H HD11 . LEU A 1 18 ? -3.288  3.587   0.142   1.00 0.00 ? 55  LEU A HD11 2  
ATOM 1738  H HD12 . LEU A 1 18 ? -4.681  2.511   0.027   1.00 0.00 ? 55  LEU A HD12 2  
ATOM 1739  H HD13 . LEU A 1 18 ? -4.915  4.220   0.402   1.00 0.00 ? 55  LEU A HD13 2  
ATOM 1740  H HD21 . LEU A 1 18 ? -4.090  1.329   3.275   1.00 0.00 ? 55  LEU A HD21 2  
ATOM 1741  H HD22 . LEU A 1 18 ? -5.303  1.255   1.996   1.00 0.00 ? 55  LEU A HD22 2  
ATOM 1742  H HD23 . LEU A 1 18 ? -3.598  1.034   1.607   1.00 0.00 ? 55  LEU A HD23 2  
ATOM 1743  N N    . THR A 1 19 ? -3.261  6.231   4.340   1.00 0.00 ? 56  THR A N    2  
ATOM 1744  C CA   . THR A 1 19 ? -4.127  7.109   5.112   1.00 0.00 ? 56  THR A CA   2  
ATOM 1745  C C    . THR A 1 19 ? -3.978  8.568   4.648   1.00 0.00 ? 56  THR A C    2  
ATOM 1746  O O    . THR A 1 19 ? -4.910  9.366   4.752   1.00 0.00 ? 56  THR A O    2  
ATOM 1747  C CB   . THR A 1 19 ? -3.818  6.994   6.628   1.00 0.00 ? 56  THR A CB   2  
ATOM 1748  O OG1  . THR A 1 19 ? -4.865  7.595   7.400   1.00 0.00 ? 56  THR A OG1  2  
ATOM 1749  C CG2  . THR A 1 19 ? -2.496  7.656   6.980   1.00 0.00 ? 56  THR A CG2  2  
ATOM 1750  H H    . THR A 1 19 ? -2.431  5.900   4.746   1.00 0.00 ? 56  THR A H    2  
ATOM 1751  H HA   . THR A 1 19 ? -5.146  6.795   4.949   1.00 0.00 ? 56  THR A HA   2  
ATOM 1752  H HB   . THR A 1 19 ? -3.746  5.946   6.885   1.00 0.00 ? 56  THR A HB   2  
ATOM 1753  H HG1  . THR A 1 19 ? -4.678  8.543   7.517   1.00 0.00 ? 56  THR A HG1  2  
ATOM 1754  H HG21 . THR A 1 19 ? -2.072  8.105   6.093   1.00 0.00 ? 56  THR A HG21 2  
ATOM 1755  H HG22 . THR A 1 19 ? -2.662  8.420   7.724   1.00 0.00 ? 56  THR A HG22 2  
ATOM 1756  H HG23 . THR A 1 19 ? -1.814  6.915   7.371   1.00 0.00 ? 56  THR A HG23 2  
ATOM 1757  N N    . ALA A 1 20 ? -2.777  8.918   4.198   1.00 0.00 ? 57  ALA A N    2  
ATOM 1758  C CA   . ALA A 1 20 ? -2.458  10.287  3.808   1.00 0.00 ? 57  ALA A CA   2  
ATOM 1759  C C    . ALA A 1 20 ? -2.785  10.579  2.343   1.00 0.00 ? 57  ALA A C    2  
ATOM 1760  O O    . ALA A 1 20 ? -3.328  11.637  2.030   1.00 0.00 ? 57  ALA A O    2  
ATOM 1761  C CB   . ALA A 1 20 ? -0.988  10.574  4.082   1.00 0.00 ? 57  ALA A CB   2  
ATOM 1762  H H    . ALA A 1 20 ? -2.072  8.237   4.154   1.00 0.00 ? 57  ALA A H    2  
ATOM 1763  H HA   . ALA A 1 20 ? -3.042  10.949  4.430   1.00 0.00 ? 57  ALA A HA   2  
ATOM 1764  H HB1  . ALA A 1 20 ? -0.716  10.174  5.047   1.00 0.00 ? 57  ALA A HB1  2  
ATOM 1765  H HB2  . ALA A 1 20 ? -0.381  10.111  3.316   1.00 0.00 ? 57  ALA A HB2  2  
ATOM 1766  H HB3  . ALA A 1 20 ? -0.823  11.642  4.075   1.00 0.00 ? 57  ALA A HB3  2  
ATOM 1767  N N    . LEU A 1 21 ? -2.326  9.723   1.430   1.00 0.00 ? 58  LEU A N    2  
ATOM 1768  C CA   . LEU A 1 21 ? -2.439  10.033  0.010   1.00 0.00 ? 58  LEU A CA   2  
ATOM 1769  C C    . LEU A 1 21 ? -3.722  9.470   -0.593  1.00 0.00 ? 58  LEU A C    2  
ATOM 1770  O O    . LEU A 1 21 ? -3.852  9.371   -1.813  1.00 0.00 ? 58  LEU A O    2  
ATOM 1771  C CB   . LEU A 1 21 ? -1.209  9.538   -0.775  1.00 0.00 ? 58  LEU A CB   2  
ATOM 1772  C CG   . LEU A 1 21 ? -1.239  8.081   -1.243  1.00 0.00 ? 58  LEU A CG   2  
ATOM 1773  C CD1  . LEU A 1 21 ? -0.435  7.920   -2.523  1.00 0.00 ? 58  LEU A CD1  2  
ATOM 1774  C CD2  . LEU A 1 21 ? -0.704  7.156   -0.183  1.00 0.00 ? 58  LEU A CD2  2  
ATOM 1775  H H    . LEU A 1 21 ? -1.826  8.925   1.714   1.00 0.00 ? 58  LEU A H    2  
ATOM 1776  H HA   . LEU A 1 21 ? -2.476  11.103  -0.072  1.00 0.00 ? 58  LEU A HA   2  
ATOM 1777  H HB2  . LEU A 1 21 ? -1.096  10.165  -1.648  1.00 0.00 ? 58  LEU A HB2  2  
ATOM 1778  H HB3  . LEU A 1 21 ? -0.337  9.671   -0.150  1.00 0.00 ? 58  LEU A HB3  2  
ATOM 1779  H HG   . LEU A 1 21 ? -2.258  7.794   -1.440  1.00 0.00 ? 58  LEU A HG   2  
ATOM 1780  H HD11 . LEU A 1 21 ? 0.512   8.428   -2.420  1.00 0.00 ? 58  LEU A HD11 2  
ATOM 1781  H HD12 . LEU A 1 21 ? -0.261  6.870   -2.709  1.00 0.00 ? 58  LEU A HD12 2  
ATOM 1782  H HD13 . LEU A 1 21 ? -0.986  8.344   -3.350  1.00 0.00 ? 58  LEU A HD13 2  
ATOM 1783  H HD21 . LEU A 1 21 ? -0.303  7.741   0.631   1.00 0.00 ? 58  LEU A HD21 2  
ATOM 1784  H HD22 . LEU A 1 21 ? -1.510  6.529   0.186   1.00 0.00 ? 58  LEU A HD22 2  
ATOM 1785  H HD23 . LEU A 1 21 ? 0.072   6.536   -0.603  1.00 0.00 ? 58  LEU A HD23 2  
ATOM 1786  N N    . LYS A 1 22 ? -4.683  9.123   0.257   1.00 0.00 ? 59  LYS A N    2  
ATOM 1787  C CA   . LYS A 1 22 ? -5.953  8.595   -0.212  1.00 0.00 ? 59  LYS A CA   2  
ATOM 1788  C C    . LYS A 1 22 ? -6.751  9.679   -0.937  1.00 0.00 ? 59  LYS A C    2  
ATOM 1789  O O    . LYS A 1 22 ? -7.568  9.386   -1.811  1.00 0.00 ? 59  LYS A O    2  
ATOM 1790  C CB   . LYS A 1 22 ? -6.754  8.032   0.961   1.00 0.00 ? 59  LYS A CB   2  
ATOM 1791  C CG   . LYS A 1 22 ? -7.391  9.092   1.839   1.00 0.00 ? 59  LYS A CG   2  
ATOM 1792  C CD   . LYS A 1 22 ? -7.797  8.522   3.184   1.00 0.00 ? 59  LYS A CD   2  
ATOM 1793  C CE   . LYS A 1 22 ? -8.547  9.545   4.019   1.00 0.00 ? 59  LYS A CE   2  
ATOM 1794  N NZ   . LYS A 1 22 ? -9.885  9.856   3.449   1.00 0.00 ? 59  LYS A NZ   2  
ATOM 1795  H H    . LYS A 1 22 ? -4.528  9.206   1.223   1.00 0.00 ? 59  LYS A H    2  
ATOM 1796  H HA   . LYS A 1 22 ? -5.737  7.799   -0.906  1.00 0.00 ? 59  LYS A HA   2  
ATOM 1797  H HB2  . LYS A 1 22 ? -7.538  7.403   0.573   1.00 0.00 ? 59  LYS A HB2  2  
ATOM 1798  H HB3  . LYS A 1 22 ? -6.098  7.434   1.574   1.00 0.00 ? 59  LYS A HB3  2  
ATOM 1799  H HG2  . LYS A 1 22 ? -6.682  9.892   1.995   1.00 0.00 ? 59  LYS A HG2  2  
ATOM 1800  H HG3  . LYS A 1 22 ? -8.269  9.477   1.337   1.00 0.00 ? 59  LYS A HG3  2  
ATOM 1801  H HD2  . LYS A 1 22 ? -8.435  7.666   3.022   1.00 0.00 ? 59  LYS A HD2  2  
ATOM 1802  H HD3  . LYS A 1 22 ? -6.906  8.216   3.714   1.00 0.00 ? 59  LYS A HD3  2  
ATOM 1803  H HE2  . LYS A 1 22 ? -8.674  9.153   5.019   1.00 0.00 ? 59  LYS A HE2  2  
ATOM 1804  H HE3  . LYS A 1 22 ? -7.963  10.454  4.062   1.00 0.00 ? 59  LYS A HE3  2  
ATOM 1805  H HZ1  . LYS A 1 22 ? -9.845  9.858   2.412   1.00 0.00 ? 59  LYS A HZ1  2  
ATOM 1806  H HZ2  . LYS A 1 22 ? -10.579 9.139   3.757   1.00 0.00 ? 59  LYS A HZ2  2  
ATOM 1807  H HZ3  . LYS A 1 22 ? -10.206 10.794  3.772   1.00 0.00 ? 59  LYS A HZ3  2  
ATOM 1808  N N    . GLU A 1 23 ? -6.526  10.927  -0.530  1.00 0.00 ? 60  GLU A N    2  
ATOM 1809  C CA   . GLU A 1 23 ? -7.213  12.077  -1.106  1.00 0.00 ? 60  GLU A CA   2  
ATOM 1810  C C    . GLU A 1 23 ? -8.728  11.941  -0.942  1.00 0.00 ? 60  GLU A C    2  
ATOM 1811  O O    . GLU A 1 23 ? -9.247  12.025  0.173   1.00 0.00 ? 60  GLU A O    2  
ATOM 1812  C CB   . GLU A 1 23 ? -6.832  12.256  -2.581  1.00 0.00 ? 60  GLU A CB   2  
ATOM 1813  C CG   . GLU A 1 23 ? -5.346  12.490  -2.801  1.00 0.00 ? 60  GLU A CG   2  
ATOM 1814  C CD   . GLU A 1 23 ? -4.995  12.728  -4.256  1.00 0.00 ? 60  GLU A CD   2  
ATOM 1815  O OE1  . GLU A 1 23 ? -5.915  12.770  -5.099  1.00 0.00 ? 60  GLU A OE1  2  
ATOM 1816  O OE2  . GLU A 1 23 ? -3.796  12.877  -4.565  1.00 0.00 ? 60  GLU A OE2  2  
ATOM 1817  H H    . GLU A 1 23 ? -5.891  11.079  0.201   1.00 0.00 ? 60  GLU A H    2  
ATOM 1818  H HA   . GLU A 1 23 ? -6.890  12.950  -0.559  1.00 0.00 ? 60  GLU A HA   2  
ATOM 1819  H HB2  . GLU A 1 23 ? -7.121  11.369  -3.125  1.00 0.00 ? 60  GLU A HB2  2  
ATOM 1820  H HB3  . GLU A 1 23 ? -7.372  13.102  -2.980  1.00 0.00 ? 60  GLU A HB3  2  
ATOM 1821  H HG2  . GLU A 1 23 ? -5.043  13.355  -2.229  1.00 0.00 ? 60  GLU A HG2  2  
ATOM 1822  H HG3  . GLU A 1 23 ? -4.804  11.622  -2.454  1.00 0.00 ? 60  GLU A HG3  2  
ATOM 1823  N N    . ARG A 1 24 ? -9.434  11.786  -2.058  1.00 0.00 ? 61  ARG A N    2  
ATOM 1824  C CA   . ARG A 1 24 ? -10.893 11.715  -2.044  1.00 0.00 ? 61  ARG A CA   2  
ATOM 1825  C C    . ARG A 1 24 ? -11.396 10.447  -1.356  1.00 0.00 ? 61  ARG A C    2  
ATOM 1826  O O    . ARG A 1 24 ? -12.489 10.449  -0.787  1.00 0.00 ? 61  ARG A O    2  
ATOM 1827  C CB   . ARG A 1 24 ? -11.450 11.802  -3.467  1.00 0.00 ? 61  ARG A CB   2  
ATOM 1828  C CG   . ARG A 1 24 ? -11.183 10.570  -4.312  1.00 0.00 ? 61  ARG A CG   2  
ATOM 1829  C CD   . ARG A 1 24 ? -11.295 10.883  -5.794  1.00 0.00 ? 61  ARG A CD   2  
ATOM 1830  N NE   . ARG A 1 24 ? -10.351 11.927  -6.192  1.00 0.00 ? 61  ARG A NE   2  
ATOM 1831  C CZ   . ARG A 1 24 ? -9.026  11.788  -6.153  1.00 0.00 ? 61  ARG A CZ   2  
ATOM 1832  N NH1  . ARG A 1 24 ? -8.480  10.614  -5.859  1.00 0.00 ? 61  ARG A NH1  2  
ATOM 1833  N NH2  . ARG A 1 24 ? -8.248  12.824  -6.423  1.00 0.00 ? 61  ARG A NH2  2  
ATOM 1834  H H    . ARG A 1 24 ? -8.965  11.777  -2.918  1.00 0.00 ? 61  ARG A H    2  
ATOM 1835  H HA   . ARG A 1 24 ? -11.250 12.566  -1.485  1.00 0.00 ? 61  ARG A HA   2  
ATOM 1836  H HB2  . ARG A 1 24 ? -12.518 11.947  -3.414  1.00 0.00 ? 61  ARG A HB2  2  
ATOM 1837  H HB3  . ARG A 1 24 ? -11.004 12.653  -3.961  1.00 0.00 ? 61  ARG A HB3  2  
ATOM 1838  H HG2  . ARG A 1 24 ? -10.185 10.211  -4.104  1.00 0.00 ? 61  ARG A HG2  2  
ATOM 1839  H HG3  . ARG A 1 24 ? -11.903 9.808   -4.058  1.00 0.00 ? 61  ARG A HG3  2  
ATOM 1840  H HD2  . ARG A 1 24 ? -11.086 9.985   -6.359  1.00 0.00 ? 61  ARG A HD2  2  
ATOM 1841  H HD3  . ARG A 1 24 ? -12.299 11.218  -6.005  1.00 0.00 ? 61  ARG A HD3  2  
ATOM 1842  H HE   . ARG A 1 24 ? -10.731 12.800  -6.461  1.00 0.00 ? 61  ARG A HE   2  
ATOM 1843  H HH11 . ARG A 1 24 ? -9.062  9.818   -5.656  1.00 0.00 ? 61  ARG A HH11 2  
ATOM 1844  H HH12 . ARG A 1 24 ? -7.477  10.511  -5.847  1.00 0.00 ? 61  ARG A HH12 2  
ATOM 1845  H HH21 . ARG A 1 24 ? -8.650  13.711  -6.662  1.00 0.00 ? 61  ARG A HH21 2  
ATOM 1846  H HH22 . ARG A 1 24 ? -7.245  12.735  -6.357  1.00 0.00 ? 61  ARG A HH22 2  
ATOM 1847  N N    . LYS A 1 25 ? -10.598 9.376   -1.378  1.00 0.00 ? 62  LYS A N    2  
ATOM 1848  C CA   . LYS A 1 25 ? -10.994 8.132   -0.722  1.00 0.00 ? 62  LYS A CA   2  
ATOM 1849  C C    . LYS A 1 25 ? -9.880  7.086   -0.721  1.00 0.00 ? 62  LYS A C    2  
ATOM 1850  O O    . LYS A 1 25 ? -9.694  6.395   0.279   1.00 0.00 ? 62  LYS A O    2  
ATOM 1851  C CB   . LYS A 1 25 ? -12.266 7.545   -1.362  1.00 0.00 ? 62  LYS A CB   2  
ATOM 1852  C CG   . LYS A 1 25 ? -12.167 7.296   -2.858  1.00 0.00 ? 62  LYS A CG   2  
ATOM 1853  C CD   . LYS A 1 25 ? -13.484 6.785   -3.418  1.00 0.00 ? 62  LYS A CD   2  
ATOM 1854  C CE   . LYS A 1 25 ? -13.410 6.574   -4.919  1.00 0.00 ? 62  LYS A CE   2  
ATOM 1855  N NZ   . LYS A 1 25 ? -14.713 6.126   -5.478  1.00 0.00 ? 62  LYS A NZ   2  
ATOM 1856  H H    . LYS A 1 25 ? -9.707  9.444   -1.785  1.00 0.00 ? 62  LYS A H    2  
ATOM 1857  H HA   . LYS A 1 25 ? -11.218 8.377   0.305   1.00 0.00 ? 62  LYS A HA   2  
ATOM 1858  H HB2  . LYS A 1 25 ? -12.489 6.605   -0.882  1.00 0.00 ? 62  LYS A HB2  2  
ATOM 1859  H HB3  . LYS A 1 25 ? -13.084 8.228   -1.187  1.00 0.00 ? 62  LYS A HB3  2  
ATOM 1860  H HG2  . LYS A 1 25 ? -11.913 8.222   -3.350  1.00 0.00 ? 62  LYS A HG2  2  
ATOM 1861  H HG3  . LYS A 1 25 ? -11.397 6.562   -3.042  1.00 0.00 ? 62  LYS A HG3  2  
ATOM 1862  H HD2  . LYS A 1 25 ? -13.723 5.845   -2.944  1.00 0.00 ? 62  LYS A HD2  2  
ATOM 1863  H HD3  . LYS A 1 25 ? -14.258 7.507   -3.202  1.00 0.00 ? 62  LYS A HD3  2  
ATOM 1864  H HE2  . LYS A 1 25 ? -13.128 7.505   -5.389  1.00 0.00 ? 62  LYS A HE2  2  
ATOM 1865  H HE3  . LYS A 1 25 ? -12.661 5.824   -5.128  1.00 0.00 ? 62  LYS A HE3  2  
ATOM 1866  H HZ1  . LYS A 1 25 ? -15.061 5.292   -4.958  1.00 0.00 ? 62  LYS A HZ1  2  
ATOM 1867  H HZ2  . LYS A 1 25 ? -15.422 6.890   -5.394  1.00 0.00 ? 62  LYS A HZ2  2  
ATOM 1868  H HZ3  . LYS A 1 25 ? -14.607 5.874   -6.483  1.00 0.00 ? 62  LYS A HZ3  2  
ATOM 1869  N N    . GLY A 1 26 ? -9.179  6.922   -1.838  1.00 0.00 ? 63  GLY A N    2  
ATOM 1870  C CA   . GLY A 1 26 ? -8.177  5.872   -1.912  1.00 0.00 ? 63  GLY A CA   2  
ATOM 1871  C C    . GLY A 1 26 ? -7.029  6.182   -2.846  1.00 0.00 ? 63  GLY A C    2  
ATOM 1872  O O    . GLY A 1 26 ? -7.138  7.044   -3.720  1.00 0.00 ? 63  GLY A O    2  
ATOM 1873  H H    . GLY A 1 26 ? -9.380  7.467   -2.629  1.00 0.00 ? 63  GLY A H    2  
ATOM 1874  H HA2  . GLY A 1 26 ? -7.772  5.722   -0.923  1.00 0.00 ? 63  GLY A HA2  2  
ATOM 1875  H HA3  . GLY A 1 26 ? -8.654  4.959   -2.234  1.00 0.00 ? 63  GLY A HA3  2  
ATOM 1876  N N    . SER A 1 27 ? -5.914  5.504   -2.620  1.00 0.00 ? 64  SER A N    2  
ATOM 1877  C CA   . SER A 1 27 ? -4.699  5.717   -3.385  1.00 0.00 ? 64  SER A CA   2  
ATOM 1878  C C    . SER A 1 27 ? -4.451  4.569   -4.354  1.00 0.00 ? 64  SER A C    2  
ATOM 1879  O O    . SER A 1 27 ? -4.637  3.401   -4.010  1.00 0.00 ? 64  SER A O    2  
ATOM 1880  C CB   . SER A 1 27 ? -3.512  5.826   -2.435  1.00 0.00 ? 64  SER A CB   2  
ATOM 1881  O OG   . SER A 1 27 ? -3.896  6.444   -1.220  1.00 0.00 ? 64  SER A OG   2  
ATOM 1882  H H    . SER A 1 27 ? -5.904  4.836   -1.898  1.00 0.00 ? 64  SER A H    2  
ATOM 1883  H HA   . SER A 1 27 ? -4.801  6.637   -3.939  1.00 0.00 ? 64  SER A HA   2  
ATOM 1884  H HB2  . SER A 1 27 ? -3.129  4.839   -2.223  1.00 0.00 ? 64  SER A HB2  2  
ATOM 1885  H HB3  . SER A 1 27 ? -2.738  6.421   -2.897  1.00 0.00 ? 64  SER A HB3  2  
ATOM 1886  H HG   . SER A 1 27 ? -4.128  7.363   -1.391  1.00 0.00 ? 64  SER A HG   2  
ATOM 1887  N N    . SER A 1 28 ? -3.921  4.897   -5.519  1.00 0.00 ? 65  SER A N    2  
ATOM 1888  C CA   . SER A 1 28 ? -3.515  3.889   -6.479  1.00 0.00 ? 65  SER A CA   2  
ATOM 1889  C C    . SER A 1 28 ? -2.374  3.053   -5.892  1.00 0.00 ? 65  SER A C    2  
ATOM 1890  O O    . SER A 1 28 ? -1.530  3.575   -5.160  1.00 0.00 ? 65  SER A O    2  
ATOM 1891  C CB   . SER A 1 28 ? -3.078  4.571   -7.776  1.00 0.00 ? 65  SER A CB   2  
ATOM 1892  O OG   . SER A 1 28 ? -2.993  3.652   -8.851  1.00 0.00 ? 65  SER A OG   2  
ATOM 1893  H H    . SER A 1 28 ? -3.717  5.838   -5.706  1.00 0.00 ? 65  SER A H    2  
ATOM 1894  H HA   . SER A 1 28 ? -4.364  3.249   -6.677  1.00 0.00 ? 65  SER A HA   2  
ATOM 1895  H HB2  . SER A 1 28 ? -3.793  5.338   -8.036  1.00 0.00 ? 65  SER A HB2  2  
ATOM 1896  H HB3  . SER A 1 28 ? -2.107  5.022   -7.630  1.00 0.00 ? 65  SER A HB3  2  
ATOM 1897  H HG   . SER A 1 28 ? -2.591  4.091   -9.615  1.00 0.00 ? 65  SER A HG   2  
ATOM 1898  N N    . ARG A 1 29 ? -2.386  1.753   -6.163  1.00 0.00 ? 66  ARG A N    2  
ATOM 1899  C CA   . ARG A 1 29 ? -1.370  0.843   -5.628  1.00 0.00 ? 66  ARG A CA   2  
ATOM 1900  C C    . ARG A 1 29 ? 0.057   1.289   -5.981  1.00 0.00 ? 66  ARG A C    2  
ATOM 1901  O O    . ARG A 1 29 ? 0.902   1.389   -5.092  1.00 0.00 ? 66  ARG A O    2  
ATOM 1902  C CB   . ARG A 1 29 ? -1.635  -0.590  -6.100  1.00 0.00 ? 66  ARG A CB   2  
ATOM 1903  C CG   . ARG A 1 29 ? -2.854  -1.206  -5.436  1.00 0.00 ? 66  ARG A CG   2  
ATOM 1904  C CD   . ARG A 1 29 ? -3.350  -2.450  -6.159  1.00 0.00 ? 66  ARG A CD   2  
ATOM 1905  N NE   . ARG A 1 29 ? -2.933  -3.695  -5.507  1.00 0.00 ? 66  ARG A NE   2  
ATOM 1906  C CZ   . ARG A 1 29 ? -1.768  -4.305  -5.716  1.00 0.00 ? 66  ARG A CZ   2  
ATOM 1907  N NH1  . ARG A 1 29 ? -0.916  -3.836  -6.619  1.00 0.00 ? 66  ARG A NH1  2  
ATOM 1908  N NH2  . ARG A 1 29 ? -1.473  -5.414  -5.051  1.00 0.00 ? 66  ARG A NH2  2  
ATOM 1909  H H    . ARG A 1 29 ? -3.108  1.388   -6.729  1.00 0.00 ? 66  ARG A H    2  
ATOM 1910  H HA   . ARG A 1 29 ? -1.468  0.865   -4.551  1.00 0.00 ? 66  ARG A HA   2  
ATOM 1911  H HB2  . ARG A 1 29 ? -1.792  -0.587  -7.171  1.00 0.00 ? 66  ARG A HB2  2  
ATOM 1912  H HB3  . ARG A 1 29 ? -0.776  -1.201  -5.868  1.00 0.00 ? 66  ARG A HB3  2  
ATOM 1913  H HG2  . ARG A 1 29 ? -2.590  -1.476  -4.426  1.00 0.00 ? 66  ARG A HG2  2  
ATOM 1914  H HG3  . ARG A 1 29 ? -3.647  -0.472  -5.418  1.00 0.00 ? 66  ARG A HG3  2  
ATOM 1915  H HD2  . ARG A 1 29 ? -4.429  -2.422  -6.190  1.00 0.00 ? 66  ARG A HD2  2  
ATOM 1916  H HD3  . ARG A 1 29 ? -2.964  -2.439  -7.168  1.00 0.00 ? 66  ARG A HD3  2  
ATOM 1917  H HE   . ARG A 1 29 ? -3.564  -4.095  -4.869  1.00 0.00 ? 66  ARG A HE   2  
ATOM 1918  H HH11 . ARG A 1 29 ? -1.146  -3.016  -7.160  1.00 0.00 ? 66  ARG A HH11 2  
ATOM 1919  H HH12 . ARG A 1 29 ? -0.039  -4.302  -6.781  1.00 0.00 ? 66  ARG A HH12 2  
ATOM 1920  H HH21 . ARG A 1 29 ? -2.127  -5.802  -4.384  1.00 0.00 ? 66  ARG A HH21 2  
ATOM 1921  H HH22 . ARG A 1 29 ? -0.601  -5.887  -5.222  1.00 0.00 ? 66  ARG A HH22 2  
ATOM 1922  N N    . PRO A 1 30 ? 0.359   1.603   -7.264  1.00 0.00 ? 67  PRO A N    2  
ATOM 1923  C CA   . PRO A 1 30 ? 1.687   2.101   -7.651  1.00 0.00 ? 67  PRO A CA   2  
ATOM 1924  C C    . PRO A 1 30 ? 2.062   3.384   -6.903  1.00 0.00 ? 67  PRO A C    2  
ATOM 1925  O O    . PRO A 1 30 ? 3.236   3.627   -6.616  1.00 0.00 ? 67  PRO A O    2  
ATOM 1926  C CB   . PRO A 1 30 ? 1.562   2.374   -9.153  1.00 0.00 ? 67  PRO A CB   2  
ATOM 1927  C CG   . PRO A 1 30 ? 0.097   2.459   -9.417  1.00 0.00 ? 67  PRO A CG   2  
ATOM 1928  C CD   . PRO A 1 30 ? -0.551  1.542   -8.423  1.00 0.00 ? 67  PRO A CD   2  
ATOM 1929  H HA   . PRO A 1 30 ? 2.451   1.354   -7.479  1.00 0.00 ? 67  PRO A HA   2  
ATOM 1930  H HB2  . PRO A 1 30 ? 2.059   3.301   -9.394  1.00 0.00 ? 67  PRO A HB2  2  
ATOM 1931  H HB3  . PRO A 1 30 ? 2.015   1.563   -9.706  1.00 0.00 ? 67  PRO A HB3  2  
ATOM 1932  H HG2  . PRO A 1 30 ? -0.243  3.473   -9.269  1.00 0.00 ? 67  PRO A HG2  2  
ATOM 1933  H HG3  . PRO A 1 30 ? -0.116  2.133   -10.425 1.00 0.00 ? 67  PRO A HG3  2  
ATOM 1934  H HD2  . PRO A 1 30 ? -1.535  1.902   -8.160  1.00 0.00 ? 67  PRO A HD2  2  
ATOM 1935  H HD3  . PRO A 1 30 ? -0.608  0.537   -8.815  1.00 0.00 ? 67  PRO A HD3  2  
ATOM 1936  N N    . ALA A 1 31 ? 1.050   4.170   -6.531  1.00 0.00 ? 68  ALA A N    2  
ATOM 1937  C CA   . ALA A 1 31 ? 1.269   5.392   -5.763  1.00 0.00 ? 68  ALA A CA   2  
ATOM 1938  C C    . ALA A 1 31 ? 1.761   5.068   -4.358  1.00 0.00 ? 68  ALA A C    2  
ATOM 1939  O O    . ALA A 1 31 ? 2.671   5.722   -3.844  1.00 0.00 ? 68  ALA A O    2  
ATOM 1940  C CB   . ALA A 1 31 ? -0.003  6.222   -5.702  1.00 0.00 ? 68  ALA A CB   2  
ATOM 1941  H H    . ALA A 1 31 ? 0.131   3.888   -6.725  1.00 0.00 ? 68  ALA A H    2  
ATOM 1942  H HA   . ALA A 1 31 ? 2.025   5.971   -6.272  1.00 0.00 ? 68  ALA A HA   2  
ATOM 1943  H HB1  . ALA A 1 31 ? 0.143   7.143   -6.248  1.00 0.00 ? 68  ALA A HB1  2  
ATOM 1944  H HB2  . ALA A 1 31 ? -0.236  6.448   -4.670  1.00 0.00 ? 68  ALA A HB2  2  
ATOM 1945  H HB3  . ALA A 1 31 ? -0.818  5.667   -6.144  1.00 0.00 ? 68  ALA A HB3  2  
ATOM 1946  N N    . LEU A 1 32 ? 1.204   4.011   -3.770  1.00 0.00 ? 69  LEU A N    2  
ATOM 1947  C CA   . LEU A 1 32 ? 1.642   3.538   -2.462  1.00 0.00 ? 69  LEU A CA   2  
ATOM 1948  C C    . LEU A 1 32 ? 3.096   3.090   -2.519  1.00 0.00 ? 69  LEU A C    2  
ATOM 1949  O O    . LEU A 1 32 ? 3.903   3.468   -1.670  1.00 0.00 ? 69  LEU A O    2  
ATOM 1950  C CB   . LEU A 1 32 ? 0.759   2.385   -1.982  1.00 0.00 ? 69  LEU A CB   2  
ATOM 1951  C CG   . LEU A 1 32 ? -0.601  2.792   -1.419  1.00 0.00 ? 69  LEU A CG   2  
ATOM 1952  C CD1  . LEU A 1 32 ? -1.473  1.568   -1.195  1.00 0.00 ? 69  LEU A CD1  2  
ATOM 1953  C CD2  . LEU A 1 32 ? -0.419  3.561   -0.121  1.00 0.00 ? 69  LEU A CD2  2  
ATOM 1954  H H    . LEU A 1 32 ? 0.514   3.505   -4.254  1.00 0.00 ? 69  LEU A H    2  
ATOM 1955  H HA   . LEU A 1 32 ? 1.557   4.359   -1.766  1.00 0.00 ? 69  LEU A HA   2  
ATOM 1956  H HB2  . LEU A 1 32 ? 0.592   1.717   -2.816  1.00 0.00 ? 69  LEU A HB2  2  
ATOM 1957  H HB3  . LEU A 1 32 ? 1.294   1.844   -1.215  1.00 0.00 ? 69  LEU A HB3  2  
ATOM 1958  H HG   . LEU A 1 32 ? -1.102  3.439   -2.124  1.00 0.00 ? 69  LEU A HG   2  
ATOM 1959  H HD11 . LEU A 1 32 ? -0.858  0.680   -1.209  1.00 0.00 ? 69  LEU A HD11 2  
ATOM 1960  H HD12 . LEU A 1 32 ? -1.967  1.647   -0.238  1.00 0.00 ? 69  LEU A HD12 2  
ATOM 1961  H HD13 . LEU A 1 32 ? -2.213  1.505   -1.978  1.00 0.00 ? 69  LEU A HD13 2  
ATOM 1962  H HD21 . LEU A 1 32 ? 0.621   3.825   0.000   1.00 0.00 ? 69  LEU A HD21 2  
ATOM 1963  H HD22 . LEU A 1 32 ? -1.018  4.460   -0.147  1.00 0.00 ? 69  LEU A HD22 2  
ATOM 1964  H HD23 . LEU A 1 32 ? -0.730  2.945   0.709   1.00 0.00 ? 69  LEU A HD23 2  
ATOM 1965  N N    . LYS A 1 33 ? 3.435   2.356   -3.576  1.00 0.00 ? 70  LYS A N    2  
ATOM 1966  C CA   . LYS A 1 33 ? 4.810   1.926   -3.802  1.00 0.00 ? 70  LYS A CA   2  
ATOM 1967  C C    . LYS A 1 33 ? 5.747   3.127   -3.864  1.00 0.00 ? 70  LYS A C    2  
ATOM 1968  O O    . LYS A 1 33 ? 6.851   3.098   -3.326  1.00 0.00 ? 70  LYS A O    2  
ATOM 1969  C CB   . LYS A 1 33 ? 4.925   1.148   -5.113  1.00 0.00 ? 70  LYS A CB   2  
ATOM 1970  C CG   . LYS A 1 33 ? 4.134   -0.149  -5.159  1.00 0.00 ? 70  LYS A CG   2  
ATOM 1971  C CD   . LYS A 1 33 ? 4.413   -0.894  -6.454  1.00 0.00 ? 70  LYS A CD   2  
ATOM 1972  C CE   . LYS A 1 33 ? 3.637   -2.194  -6.541  1.00 0.00 ? 70  LYS A CE   2  
ATOM 1973  N NZ   . LYS A 1 33 ? 3.938   -2.933  -7.793  1.00 0.00 ? 70  LYS A NZ   2  
ATOM 1974  H H    . LYS A 1 33 ? 2.750   2.132   -4.242  1.00 0.00 ? 70  LYS A H    2  
ATOM 1975  H HA   . LYS A 1 33 ? 5.105   1.288   -2.981  1.00 0.00 ? 70  LYS A HA   2  
ATOM 1976  H HB2  . LYS A 1 33 ? 4.577   1.778   -5.917  1.00 0.00 ? 70  LYS A HB2  2  
ATOM 1977  H HB3  . LYS A 1 33 ? 5.965   0.911   -5.282  1.00 0.00 ? 70  LYS A HB3  2  
ATOM 1978  H HG2  . LYS A 1 33 ? 4.425   -0.766  -4.323  1.00 0.00 ? 70  LYS A HG2  2  
ATOM 1979  H HG3  . LYS A 1 33 ? 3.076   0.072   -5.099  1.00 0.00 ? 70  LYS A HG3  2  
ATOM 1980  H HD2  . LYS A 1 33 ? 4.130   -0.266  -7.285  1.00 0.00 ? 70  LYS A HD2  2  
ATOM 1981  H HD3  . LYS A 1 33 ? 5.470   -1.112  -6.509  1.00 0.00 ? 70  LYS A HD3  2  
ATOM 1982  H HE2  . LYS A 1 33 ? 3.900   -2.815  -5.697  1.00 0.00 ? 70  LYS A HE2  2  
ATOM 1983  H HE3  . LYS A 1 33 ? 2.581   -1.973  -6.509  1.00 0.00 ? 70  LYS A HE3  2  
ATOM 1984  H HZ1  . LYS A 1 33 ? 4.447   -2.321  -8.464  1.00 0.00 ? 70  LYS A HZ1  2  
ATOM 1985  H HZ2  . LYS A 1 33 ? 4.533   -3.769  -7.582  1.00 0.00 ? 70  LYS A HZ2  2  
ATOM 1986  H HZ3  . LYS A 1 33 ? 3.055   -3.259  -8.238  1.00 0.00 ? 70  LYS A HZ3  2  
ATOM 1987  N N    . LYS A 1 34 ? 5.287   4.182   -4.520  1.00 0.00 ? 71  LYS A N    2  
ATOM 1988  C CA   . LYS A 1 34 ? 6.075   5.387   -4.686  1.00 0.00 ? 71  LYS A CA   2  
ATOM 1989  C C    . LYS A 1 34 ? 6.266   6.085   -3.356  1.00 0.00 ? 71  LYS A C    2  
ATOM 1990  O O    . LYS A 1 34 ? 7.380   6.456   -2.989  1.00 0.00 ? 71  LYS A O    2  
ATOM 1991  C CB   . LYS A 1 34 ? 5.388   6.325   -5.667  1.00 0.00 ? 71  LYS A CB   2  
ATOM 1992  C CG   . LYS A 1 34 ? 6.178   7.589   -5.930  1.00 0.00 ? 71  LYS A CG   2  
ATOM 1993  C CD   . LYS A 1 34 ? 5.591   8.395   -7.068  1.00 0.00 ? 71  LYS A CD   2  
ATOM 1994  C CE   . LYS A 1 34 ? 6.514   9.533   -7.456  1.00 0.00 ? 71  LYS A CE   2  
ATOM 1995  N NZ   . LYS A 1 34 ? 7.807   9.039   -7.999  1.00 0.00 ? 71  LYS A NZ   2  
ATOM 1996  H H    . LYS A 1 34 ? 4.380   4.156   -4.888  1.00 0.00 ? 71  LYS A H    2  
ATOM 1997  H HA   . LYS A 1 34 ? 7.042   5.106   -5.077  1.00 0.00 ? 71  LYS A HA   2  
ATOM 1998  H HB2  . LYS A 1 34 ? 5.242   5.809   -6.600  1.00 0.00 ? 71  LYS A HB2  2  
ATOM 1999  H HB3  . LYS A 1 34 ? 4.424   6.603   -5.266  1.00 0.00 ? 71  LYS A HB3  2  
ATOM 2000  H HG2  . LYS A 1 34 ? 6.174   8.195   -5.037  1.00 0.00 ? 71  LYS A HG2  2  
ATOM 2001  H HG3  . LYS A 1 34 ? 7.195   7.319   -6.180  1.00 0.00 ? 71  LYS A HG3  2  
ATOM 2002  H HD2  . LYS A 1 34 ? 5.448   7.749   -7.921  1.00 0.00 ? 71  LYS A HD2  2  
ATOM 2003  H HD3  . LYS A 1 34 ? 4.640   8.804   -6.757  1.00 0.00 ? 71  LYS A HD3  2  
ATOM 2004  H HE2  . LYS A 1 34 ? 6.025   10.137  -8.205  1.00 0.00 ? 71  LYS A HE2  2  
ATOM 2005  H HE3  . LYS A 1 34 ? 6.709   10.133  -6.579  1.00 0.00 ? 71  LYS A HE3  2  
ATOM 2006  H HZ1  . LYS A 1 34 ? 7.639   8.439   -8.837  1.00 0.00 ? 71  LYS A HZ1  2  
ATOM 2007  H HZ2  . LYS A 1 34 ? 8.411   9.842   -8.280  1.00 0.00 ? 71  LYS A HZ2  2  
ATOM 2008  H HZ3  . LYS A 1 34 ? 8.313   8.474   -7.283  1.00 0.00 ? 71  LYS A HZ3  2  
ATOM 2009  N N    . PHE A 1 35 ? 5.168   6.227   -2.632  1.00 0.00 ? 72  PHE A N    2  
ATOM 2010  C CA   . PHE A 1 35 ? 5.181   6.846   -1.316  1.00 0.00 ? 72  PHE A CA   2  
ATOM 2011  C C    . PHE A 1 35 ? 6.231   6.188   -0.431  1.00 0.00 ? 72  PHE A C    2  
ATOM 2012  O O    . PHE A 1 35 ? 7.000   6.864   0.256   1.00 0.00 ? 72  PHE A O    2  
ATOM 2013  C CB   . PHE A 1 35 ? 3.803   6.723   -0.660  1.00 0.00 ? 72  PHE A CB   2  
ATOM 2014  C CG   . PHE A 1 35 ? 3.751   7.266   0.740   1.00 0.00 ? 72  PHE A CG   2  
ATOM 2015  C CD1  . PHE A 1 35 ? 4.090   6.465   1.817   1.00 0.00 ? 72  PHE A CD1  2  
ATOM 2016  C CD2  . PHE A 1 35 ? 3.380   8.576   0.975   1.00 0.00 ? 72  PHE A CD2  2  
ATOM 2017  C CE1  . PHE A 1 35 ? 4.064   6.963   3.107   1.00 0.00 ? 72  PHE A CE1  2  
ATOM 2018  C CE2  . PHE A 1 35 ? 3.351   9.085   2.262   1.00 0.00 ? 72  PHE A CE2  2  
ATOM 2019  C CZ   . PHE A 1 35 ? 3.694   8.275   3.330   1.00 0.00 ? 72  PHE A CZ   2  
ATOM 2020  H H    . PHE A 1 35 ? 4.317   5.888   -2.997  1.00 0.00 ? 72  PHE A H    2  
ATOM 2021  H HA   . PHE A 1 35 ? 5.429   7.890   -1.439  1.00 0.00 ? 72  PHE A HA   2  
ATOM 2022  H HB2  . PHE A 1 35 ? 3.081   7.264   -1.253  1.00 0.00 ? 72  PHE A HB2  2  
ATOM 2023  H HB3  . PHE A 1 35 ? 3.522   5.680   -0.624  1.00 0.00 ? 72  PHE A HB3  2  
ATOM 2024  H HD1  . PHE A 1 35 ? 4.382   5.438   1.638   1.00 0.00 ? 72  PHE A HD1  2  
ATOM 2025  H HD2  . PHE A 1 35 ? 3.111   9.206   0.139   1.00 0.00 ? 72  PHE A HD2  2  
ATOM 2026  H HE1  . PHE A 1 35 ? 4.332   6.328   3.937   1.00 0.00 ? 72  PHE A HE1  2  
ATOM 2027  H HE2  . PHE A 1 35 ? 3.058   10.110  2.433   1.00 0.00 ? 72  PHE A HE2  2  
ATOM 2028  H HZ   . PHE A 1 35 ? 3.670   8.668   4.336   1.00 0.00 ? 72  PHE A HZ   2  
ATOM 2029  N N    . ILE A 1 36 ? 6.243   4.864   -0.449  1.00 0.00 ? 73  ILE A N    2  
ATOM 2030  C CA   . ILE A 1 36 ? 7.177   4.101   0.355   1.00 0.00 ? 73  ILE A CA   2  
ATOM 2031  C C    . ILE A 1 36 ? 8.614   4.371   -0.074  1.00 0.00 ? 73  ILE A C    2  
ATOM 2032  O O    . ILE A 1 36 ? 9.479   4.587   0.764   1.00 0.00 ? 73  ILE A O    2  
ATOM 2033  C CB   . ILE A 1 36 ? 6.882   2.591   0.281   1.00 0.00 ? 73  ILE A CB   2  
ATOM 2034  C CG1  . ILE A 1 36 ? 5.507   2.290   0.887   1.00 0.00 ? 73  ILE A CG1  2  
ATOM 2035  C CG2  . ILE A 1 36 ? 7.968   1.803   0.999   1.00 0.00 ? 73  ILE A CG2  2  
ATOM 2036  C CD1  . ILE A 1 36 ? 5.157   0.815   0.908   1.00 0.00 ? 73  ILE A CD1  2  
ATOM 2037  H H    . ILE A 1 36 ? 5.593   4.388   -1.013  1.00 0.00 ? 73  ILE A H    2  
ATOM 2038  H HA   . ILE A 1 36 ? 7.058   4.415   1.382   1.00 0.00 ? 73  ILE A HA   2  
ATOM 2039  H HB   . ILE A 1 36 ? 6.883   2.296   -0.758  1.00 0.00 ? 73  ILE A HB   2  
ATOM 2040  H HG12 . ILE A 1 36 ? 5.486   2.648   1.904   1.00 0.00 ? 73  ILE A HG12 2  
ATOM 2041  H HG13 . ILE A 1 36 ? 4.749   2.803   0.313   1.00 0.00 ? 73  ILE A HG13 2  
ATOM 2042  H HG21 . ILE A 1 36 ? 8.261   2.331   1.894   1.00 0.00 ? 73  ILE A HG21 2  
ATOM 2043  H HG22 . ILE A 1 36 ? 7.587   0.827   1.263   1.00 0.00 ? 73  ILE A HG22 2  
ATOM 2044  H HG23 . ILE A 1 36 ? 8.822   1.694   0.349   1.00 0.00 ? 73  ILE A HG23 2  
ATOM 2045  H HD11 . ILE A 1 36 ? 5.778   0.289   0.200   1.00 0.00 ? 73  ILE A HD11 2  
ATOM 2046  H HD12 . ILE A 1 36 ? 5.327   0.422   1.900   1.00 0.00 ? 73  ILE A HD12 2  
ATOM 2047  H HD13 . ILE A 1 36 ? 4.118   0.689   0.642   1.00 0.00 ? 73  ILE A HD13 2  
ATOM 2048  N N    . LYS A 1 37 ? 8.856   4.389   -1.374  1.00 0.00 ? 74  LYS A N    2  
ATOM 2049  C CA   . LYS A 1 37 ? 10.196  4.641   -1.895  1.00 0.00 ? 74  LYS A CA   2  
ATOM 2050  C C    . LYS A 1 37 ? 10.681  6.045   -1.547  1.00 0.00 ? 74  LYS A C    2  
ATOM 2051  O O    . LYS A 1 37 ? 11.864  6.248   -1.263  1.00 0.00 ? 74  LYS A O    2  
ATOM 2052  C CB   . LYS A 1 37 ? 10.229  4.424   -3.405  1.00 0.00 ? 74  LYS A CB   2  
ATOM 2053  C CG   . LYS A 1 37 ? 9.886   3.002   -3.807  1.00 0.00 ? 74  LYS A CG   2  
ATOM 2054  C CD   . LYS A 1 37 ? 10.052  2.782   -5.298  1.00 0.00 ? 74  LYS A CD   2  
ATOM 2055  C CE   . LYS A 1 37 ? 9.691   1.358   -5.684  1.00 0.00 ? 74  LYS A CE   2  
ATOM 2056  N NZ   . LYS A 1 37 ? 9.847   1.120   -7.142  1.00 0.00 ? 74  LYS A NZ   2  
ATOM 2057  H H    . LYS A 1 37 ? 8.121   4.222   -2.002  1.00 0.00 ? 74  LYS A H    2  
ATOM 2058  H HA   . LYS A 1 37 ? 10.858  3.933   -1.430  1.00 0.00 ? 74  LYS A HA   2  
ATOM 2059  H HB2  . LYS A 1 37 ? 9.518   5.090   -3.872  1.00 0.00 ? 74  LYS A HB2  2  
ATOM 2060  H HB3  . LYS A 1 37 ? 11.219  4.652   -3.771  1.00 0.00 ? 74  LYS A HB3  2  
ATOM 2061  H HG2  . LYS A 1 37 ? 10.538  2.322   -3.278  1.00 0.00 ? 74  LYS A HG2  2  
ATOM 2062  H HG3  . LYS A 1 37 ? 8.861   2.801   -3.537  1.00 0.00 ? 74  LYS A HG3  2  
ATOM 2063  H HD2  . LYS A 1 37 ? 9.406   3.464   -5.829  1.00 0.00 ? 74  LYS A HD2  2  
ATOM 2064  H HD3  . LYS A 1 37 ? 11.082  2.969   -5.567  1.00 0.00 ? 74  LYS A HD3  2  
ATOM 2065  H HE2  . LYS A 1 37 ? 10.337  0.679   -5.148  1.00 0.00 ? 74  LYS A HE2  2  
ATOM 2066  H HE3  . LYS A 1 37 ? 8.666   1.175   -5.406  1.00 0.00 ? 74  LYS A HE3  2  
ATOM 2067  H HZ1  . LYS A 1 37 ? 10.817  1.352   -7.443  1.00 0.00 ? 74  LYS A HZ1  2  
ATOM 2068  H HZ2  . LYS A 1 37 ? 9.655   0.122   -7.365  1.00 0.00 ? 74  LYS A HZ2  2  
ATOM 2069  H HZ3  . LYS A 1 37 ? 9.179   1.716   -7.678  1.00 0.00 ? 74  LYS A HZ3  2  
ATOM 2070  N N    . GLU A 1 38 ? 9.774   7.009   -1.579  1.00 0.00 ? 75  GLU A N    2  
ATOM 2071  C CA   . GLU A 1 38 ? 10.118  8.393   -1.282  1.00 0.00 ? 75  GLU A CA   2  
ATOM 2072  C C    . GLU A 1 38 ? 10.451  8.579   0.200   1.00 0.00 ? 75  GLU A C    2  
ATOM 2073  O O    . GLU A 1 38 ? 11.308  9.389   0.554   1.00 0.00 ? 75  GLU A O    2  
ATOM 2074  C CB   . GLU A 1 38 ? 8.969   9.321   -1.681  1.00 0.00 ? 75  GLU A CB   2  
ATOM 2075  C CG   . GLU A 1 38 ? 8.653   9.295   -3.169  1.00 0.00 ? 75  GLU A CG   2  
ATOM 2076  C CD   . GLU A 1 38 ? 9.819   9.742   -4.028  1.00 0.00 ? 75  GLU A CD   2  
ATOM 2077  O OE1  . GLU A 1 38 ? 10.280  10.889  -3.862  1.00 0.00 ? 75  GLU A OE1  2  
ATOM 2078  O OE2  . GLU A 1 38 ? 10.270  8.954   -4.884  1.00 0.00 ? 75  GLU A OE2  2  
ATOM 2079  H H    . GLU A 1 38 ? 8.847   6.788   -1.831  1.00 0.00 ? 75  GLU A H    2  
ATOM 2080  H HA   . GLU A 1 38 ? 10.989  8.647   -1.867  1.00 0.00 ? 75  GLU A HA   2  
ATOM 2081  H HB2  . GLU A 1 38 ? 8.081   9.026   -1.142  1.00 0.00 ? 75  GLU A HB2  2  
ATOM 2082  H HB3  . GLU A 1 38 ? 9.227   10.332  -1.408  1.00 0.00 ? 75  GLU A HB3  2  
ATOM 2083  H HG2  . GLU A 1 38 ? 8.390   8.286   -3.449  1.00 0.00 ? 75  GLU A HG2  2  
ATOM 2084  H HG3  . GLU A 1 38 ? 7.815   9.949   -3.357  1.00 0.00 ? 75  GLU A HG3  2  
ATOM 2085  N N    . ASN A 1 39 ? 9.701   7.911   1.064   1.00 0.00 ? 76  ASN A N    2  
ATOM 2086  C CA   . ASN A 1 39 ? 9.841   8.101   2.508   1.00 0.00 ? 76  ASN A CA   2  
ATOM 2087  C C    . ASN A 1 39 ? 10.784  7.076   3.135   1.00 0.00 ? 76  ASN A C    2  
ATOM 2088  O O    . ASN A 1 39 ? 11.583  7.412   4.008   1.00 0.00 ? 76  ASN A O    2  
ATOM 2089  C CB   . ASN A 1 39 ? 8.468   8.033   3.178   1.00 0.00 ? 76  ASN A CB   2  
ATOM 2090  C CG   . ASN A 1 39 ? 7.610   9.240   2.858   1.00 0.00 ? 76  ASN A CG   2  
ATOM 2091  O OD1  . ASN A 1 39 ? 7.784   10.315  3.432   1.00 0.00 ? 76  ASN A OD1  2  
ATOM 2092  N ND2  . ASN A 1 39 ? 6.701   9.082   1.911   1.00 0.00 ? 76  ASN A ND2  2  
ATOM 2093  H H    . ASN A 1 39 ? 8.977   7.340   0.725   1.00 0.00 ? 76  ASN A H    2  
ATOM 2094  H HA   . ASN A 1 39 ? 10.253  9.084   2.668   1.00 0.00 ? 76  ASN A HA   2  
ATOM 2095  H HB2  . ASN A 1 39 ? 7.952   7.146   2.840   1.00 0.00 ? 76  ASN A HB2  2  
ATOM 2096  H HB3  . ASN A 1 39 ? 8.599   7.982   4.247   1.00 0.00 ? 76  ASN A HB3  2  
ATOM 2097  H HD21 . ASN A 1 39 ? 6.633   8.204   1.476   1.00 0.00 ? 76  ASN A HD21 2  
ATOM 2098  H HD22 . ASN A 1 39 ? 6.144   9.857   1.663   1.00 0.00 ? 76  ASN A HD22 2  
ATOM 2099  N N    . TYR A 1 40 ? 10.678  5.828   2.705   1.00 0.00 ? 77  TYR A N    2  
ATOM 2100  C CA   . TYR A 1 40 ? 11.510  4.756   3.244   1.00 0.00 ? 77  TYR A CA   2  
ATOM 2101  C C    . TYR A 1 40 ? 12.292  4.069   2.127   1.00 0.00 ? 77  TYR A C    2  
ATOM 2102  O O    . TYR A 1 40 ? 11.941  2.963   1.711   1.00 0.00 ? 77  TYR A O    2  
ATOM 2103  C CB   . TYR A 1 40 ? 10.660  3.709   3.971   1.00 0.00 ? 77  TYR A CB   2  
ATOM 2104  C CG   . TYR A 1 40 ? 9.851   4.244   5.134   1.00 0.00 ? 77  TYR A CG   2  
ATOM 2105  C CD1  . TYR A 1 40 ? 8.683   4.962   4.922   1.00 0.00 ? 77  TYR A CD1  2  
ATOM 2106  C CD2  . TYR A 1 40 ? 10.247  4.011   6.445   1.00 0.00 ? 77  TYR A CD2  2  
ATOM 2107  C CE1  . TYR A 1 40 ? 7.933   5.435   5.978   1.00 0.00 ? 77  TYR A CE1  2  
ATOM 2108  C CE2  . TYR A 1 40 ? 9.501   4.479   7.508   1.00 0.00 ? 77  TYR A CE2  2  
ATOM 2109  C CZ   . TYR A 1 40 ? 8.346   5.191   7.269   1.00 0.00 ? 77  TYR A CZ   2  
ATOM 2110  O OH   . TYR A 1 40 ? 7.595   5.661   8.323   1.00 0.00 ? 77  TYR A OH   2  
ATOM 2111  H H    . TYR A 1 40 ? 10.027  5.617   1.999   1.00 0.00 ? 77  TYR A H    2  
ATOM 2112  H HA   . TYR A 1 40 ? 12.206  5.193   3.940   1.00 0.00 ? 77  TYR A HA   2  
ATOM 2113  H HB2  . TYR A 1 40 ? 9.970   3.269   3.269   1.00 0.00 ? 77  TYR A HB2  2  
ATOM 2114  H HB3  . TYR A 1 40 ? 11.313  2.936   4.352   1.00 0.00 ? 77  TYR A HB3  2  
ATOM 2115  H HD1  . TYR A 1 40 ? 8.362   5.154   3.908   1.00 0.00 ? 77  TYR A HD1  2  
ATOM 2116  H HD2  . TYR A 1 40 ? 11.154  3.456   6.629   1.00 0.00 ? 77  TYR A HD2  2  
ATOM 2117  H HE1  . TYR A 1 40 ? 7.030   5.993   5.790   1.00 0.00 ? 77  TYR A HE1  2  
ATOM 2118  H HE2  . TYR A 1 40 ? 9.823   4.288   8.522   1.00 0.00 ? 77  TYR A HE2  2  
ATOM 2119  H HH   . TYR A 1 40 ? 6.745   5.999   7.985   1.00 0.00 ? 77  TYR A HH   2  
ATOM 2120  N N    . PRO A 1 41 ? 13.373  4.699   1.640   1.00 0.00 ? 78  PRO A N    2  
ATOM 2121  C CA   . PRO A 1 41 ? 14.199  4.146   0.558   1.00 0.00 ? 78  PRO A CA   2  
ATOM 2122  C C    . PRO A 1 41 ? 14.814  2.793   0.914   1.00 0.00 ? 78  PRO A C    2  
ATOM 2123  O O    . PRO A 1 41 ? 15.222  2.040   0.031   1.00 0.00 ? 78  PRO A O    2  
ATOM 2124  C CB   . PRO A 1 41 ? 15.294  5.193   0.352   1.00 0.00 ? 78  PRO A CB   2  
ATOM 2125  C CG   . PRO A 1 41 ? 15.290  6.023   1.591   1.00 0.00 ? 78  PRO A CG   2  
ATOM 2126  C CD   . PRO A 1 41 ? 13.875  6.008   2.093   1.00 0.00 ? 78  PRO A CD   2  
ATOM 2127  H HA   . PRO A 1 41 ? 13.627  4.041   -0.353  1.00 0.00 ? 78  PRO A HA   2  
ATOM 2128  H HB2  . PRO A 1 41 ? 16.244  4.699   0.211   1.00 0.00 ? 78  PRO A HB2  2  
ATOM 2129  H HB3  . PRO A 1 41 ? 15.062  5.787   -0.520  1.00 0.00 ? 78  PRO A HB3  2  
ATOM 2130  H HG2  . PRO A 1 41 ? 15.954  5.591   2.325   1.00 0.00 ? 78  PRO A HG2  2  
ATOM 2131  H HG3  . PRO A 1 41 ? 15.595  7.032   1.358   1.00 0.00 ? 78  PRO A HG3  2  
ATOM 2132  H HD2  . PRO A 1 41 ? 13.856  6.077   3.172   1.00 0.00 ? 78  PRO A HD2  2  
ATOM 2133  H HD3  . PRO A 1 41 ? 13.308  6.815   1.651   1.00 0.00 ? 78  PRO A HD3  2  
ATOM 2134  N N    . ILE A 1 42 ? 14.838  2.482   2.210   1.00 0.00 ? 79  ILE A N    2  
ATOM 2135  C CA   . ILE A 1 42 ? 15.346  1.204   2.695   1.00 0.00 ? 79  ILE A CA   2  
ATOM 2136  C C    . ILE A 1 42 ? 14.608  0.063   2.022   1.00 0.00 ? 79  ILE A C    2  
ATOM 2137  O O    . ILE A 1 42 ? 15.160  -0.688  1.219   1.00 0.00 ? 79  ILE A O    2  
ATOM 2138  C CB   . ILE A 1 42 ? 15.124  1.040   4.214   1.00 0.00 ? 79  ILE A CB   2  
ATOM 2139  C CG1  . ILE A 1 42 ? 15.462  2.323   4.986   1.00 0.00 ? 79  ILE A CG1  2  
ATOM 2140  C CG2  . ILE A 1 42 ? 15.959  -0.114  4.736   1.00 0.00 ? 79  ILE A CG2  2  
ATOM 2141  C CD1  . ILE A 1 42 ? 14.298  3.280   5.124   1.00 0.00 ? 79  ILE A CD1  2  
ATOM 2142  H H    . ILE A 1 42 ? 14.465  3.118   2.855   1.00 0.00 ? 79  ILE A H    2  
ATOM 2143  H HA   . ILE A 1 42 ? 16.402  1.138   2.481   1.00 0.00 ? 79  ILE A HA   2  
ATOM 2144  H HB   . ILE A 1 42 ? 14.071  0.793   4.370   1.00 0.00 ? 79  ILE A HB   2  
ATOM 2145  H HG12 . ILE A 1 42 ? 15.791  2.061   5.980   1.00 0.00 ? 79  ILE A HG12 2  
ATOM 2146  H HG13 . ILE A 1 42 ? 16.260  2.843   4.475   1.00 0.00 ? 79  ILE A HG13 2  
ATOM 2147  H HG21 . ILE A 1 42 ? 16.409  -0.639  3.904   1.00 0.00 ? 79  ILE A HG21 2  
ATOM 2148  H HG22 . ILE A 1 42 ? 16.736  0.266   5.383   1.00 0.00 ? 79  ILE A HG22 2  
ATOM 2149  H HG23 . ILE A 1 42 ? 15.328  -0.792  5.290   1.00 0.00 ? 79  ILE A HG23 2  
ATOM 2150  H HD11 . ILE A 1 42 ? 13.641  3.169   4.275   1.00 0.00 ? 79  ILE A HD11 2  
ATOM 2151  H HD12 . ILE A 1 42 ? 13.756  3.059   6.031   1.00 0.00 ? 79  ILE A HD12 2  
ATOM 2152  H HD13 . ILE A 1 42 ? 14.669  4.293   5.164   1.00 0.00 ? 79  ILE A HD13 2  
ATOM 2153  N N    . VAL A 1 43 ? 13.329  0.004   2.320   1.00 0.00 ? 80  VAL A N    2  
ATOM 2154  C CA   . VAL A 1 43 ? 12.435  -0.970  1.740   1.00 0.00 ? 80  VAL A CA   2  
ATOM 2155  C C    . VAL A 1 43 ? 12.087  -0.579  0.313   1.00 0.00 ? 80  VAL A C    2  
ATOM 2156  O O    . VAL A 1 43 ? 11.831  -1.434  -0.530  1.00 0.00 ? 80  VAL A O    2  
ATOM 2157  C CB   . VAL A 1 43 ? 11.167  -1.084  2.598   1.00 0.00 ? 80  VAL A CB   2  
ATOM 2158  C CG1  . VAL A 1 43 ? 9.920   -0.968  1.772   1.00 0.00 ? 80  VAL A CG1  2  
ATOM 2159  C CG2  . VAL A 1 43 ? 11.155  -2.380  3.376   1.00 0.00 ? 80  VAL A CG2  2  
ATOM 2160  H H    . VAL A 1 43 ? 12.958  0.680   2.922   1.00 0.00 ? 80  VAL A H    2  
ATOM 2161  H HA   . VAL A 1 43 ? 12.927  -1.927  1.731   1.00 0.00 ? 80  VAL A HA   2  
ATOM 2162  H HB   . VAL A 1 43 ? 11.173  -0.272  3.297   1.00 0.00 ? 80  VAL A HB   2  
ATOM 2163  H HG11 . VAL A 1 43 ? 10.085  -1.445  0.820   1.00 0.00 ? 80  VAL A HG11 2  
ATOM 2164  H HG12 . VAL A 1 43 ? 9.104   -1.445  2.284   1.00 0.00 ? 80  VAL A HG12 2  
ATOM 2165  H HG13 . VAL A 1 43 ? 9.699   0.077   1.623   1.00 0.00 ? 80  VAL A HG13 2  
ATOM 2166  H HG21 . VAL A 1 43 ? 12.169  -2.709  3.549   1.00 0.00 ? 80  VAL A HG21 2  
ATOM 2167  H HG22 . VAL A 1 43 ? 10.657  -2.222  4.324   1.00 0.00 ? 80  VAL A HG22 2  
ATOM 2168  H HG23 . VAL A 1 43 ? 10.621  -3.128  2.809   1.00 0.00 ? 80  VAL A HG23 2  
ATOM 2169  N N    . GLY A 1 44 ? 12.020  0.725   0.073   1.00 0.00 ? 81  GLY A N    2  
ATOM 2170  C CA   . GLY A 1 44 ? 11.649  1.217   -1.231  1.00 0.00 ? 81  GLY A CA   2  
ATOM 2171  C C    . GLY A 1 44 ? 12.471  0.597   -2.346  1.00 0.00 ? 81  GLY A C    2  
ATOM 2172  O O    . GLY A 1 44 ? 11.935  0.210   -3.383  1.00 0.00 ? 81  GLY A O    2  
ATOM 2173  H H    . GLY A 1 44 ? 12.157  1.360   0.815   1.00 0.00 ? 81  GLY A H    2  
ATOM 2174  H HA2  . GLY A 1 44 ? 10.607  0.995   -1.394  1.00 0.00 ? 81  GLY A HA2  2  
ATOM 2175  H HA3  . GLY A 1 44 ? 11.789  2.284   -1.251  1.00 0.00 ? 81  GLY A HA3  2  
ATOM 2176  N N    . SER A 1 45 ? 13.769  0.473   -2.114  1.00 0.00 ? 82  SER A N    2  
ATOM 2177  C CA   . SER A 1 45 ? 14.661  -0.129  -3.085  1.00 0.00 ? 82  SER A CA   2  
ATOM 2178  C C    . SER A 1 45 ? 14.998  -1.572  -2.697  1.00 0.00 ? 82  SER A C    2  
ATOM 2179  O O    . SER A 1 45 ? 16.085  -2.072  -3.001  1.00 0.00 ? 82  SER A O    2  
ATOM 2180  C CB   . SER A 1 45 ? 15.934  0.706   -3.177  1.00 0.00 ? 82  SER A CB   2  
ATOM 2181  O OG   . SER A 1 45 ? 15.626  2.079   -3.371  1.00 0.00 ? 82  SER A OG   2  
ATOM 2182  H H    . SER A 1 45 ? 14.138  0.793   -1.266  1.00 0.00 ? 82  SER A H    2  
ATOM 2183  H HA   . SER A 1 45 ? 14.167  -0.129  -4.044  1.00 0.00 ? 82  SER A HA   2  
ATOM 2184  H HB2  . SER A 1 45 ? 16.499  0.603   -2.262  1.00 0.00 ? 82  SER A HB2  2  
ATOM 2185  H HB3  . SER A 1 45 ? 16.526  0.363   -4.007  1.00 0.00 ? 82  SER A HB3  2  
ATOM 2186  H HG   . SER A 1 45 ? 15.255  2.202   -4.259  1.00 0.00 ? 82  SER A HG   2  
ATOM 2187  N N    . ALA A 1 46 ? 14.058  -2.244  -2.039  1.00 0.00 ? 83  ALA A N    2  
ATOM 2188  C CA   . ALA A 1 46 ? 14.249  -3.629  -1.629  1.00 0.00 ? 83  ALA A CA   2  
ATOM 2189  C C    . ALA A 1 46 ? 14.128  -4.567  -2.825  1.00 0.00 ? 83  ALA A C    2  
ATOM 2190  O O    . ALA A 1 46 ? 13.432  -4.261  -3.797  1.00 0.00 ? 83  ALA A O    2  
ATOM 2191  C CB   . ALA A 1 46 ? 13.254  -4.012  -0.542  1.00 0.00 ? 83  ALA A CB   2  
ATOM 2192  H H    . ALA A 1 46 ? 13.204  -1.799  -1.839  1.00 0.00 ? 83  ALA A H    2  
ATOM 2193  H HA   . ALA A 1 46 ? 15.244  -3.720  -1.220  1.00 0.00 ? 83  ALA A HA   2  
ATOM 2194  H HB1  . ALA A 1 46 ? 13.004  -3.134  0.043   1.00 0.00 ? 83  ALA A HB1  2  
ATOM 2195  H HB2  . ALA A 1 46 ? 12.358  -4.407  -0.997  1.00 0.00 ? 83  ALA A HB2  2  
ATOM 2196  H HB3  . ALA A 1 46 ? 13.693  -4.760  0.100   1.00 0.00 ? 83  ALA A HB3  2  
ATOM 2197  N N    . SER A 1 47 ? 14.863  -5.671  -2.779  1.00 0.00 ? 84  SER A N    2  
ATOM 2198  C CA   . SER A 1 47 ? 14.912  -6.615  -3.889  1.00 0.00 ? 84  SER A CA   2  
ATOM 2199  C C    . SER A 1 47 ? 13.531  -7.139  -4.264  1.00 0.00 ? 84  SER A C    2  
ATOM 2200  O O    . SER A 1 47 ? 13.156  -7.135  -5.437  1.00 0.00 ? 84  SER A O    2  
ATOM 2201  C CB   . SER A 1 47 ? 15.844  -7.773  -3.533  1.00 0.00 ? 84  SER A CB   2  
ATOM 2202  O OG   . SER A 1 47 ? 15.843  -8.016  -2.133  1.00 0.00 ? 84  SER A OG   2  
ATOM 2203  H H    . SER A 1 47 ? 15.428  -5.835  -1.992  1.00 0.00 ? 84  SER A H    2  
ATOM 2204  H HA   . SER A 1 47 ? 15.315  -6.093  -4.741  1.00 0.00 ? 84  SER A HA   2  
ATOM 2205  H HB2  . SER A 1 47 ? 15.516  -8.667  -4.041  1.00 0.00 ? 84  SER A HB2  2  
ATOM 2206  H HB3  . SER A 1 47 ? 16.852  -7.532  -3.843  1.00 0.00 ? 84  SER A HB3  2  
ATOM 2207  H HG   . SER A 1 47 ? 15.138  -8.644  -1.910  1.00 0.00 ? 84  SER A HG   2  
ATOM 2208  N N    . ASN A 1 48 ? 12.761  -7.558  -3.276  1.00 0.00 ? 85  ASN A N    2  
ATOM 2209  C CA   . ASN A 1 48 ? 11.427  -8.074  -3.536  1.00 0.00 ? 85  ASN A CA   2  
ATOM 2210  C C    . ASN A 1 48 ? 10.373  -7.153  -2.953  1.00 0.00 ? 85  ASN A C    2  
ATOM 2211  O O    . ASN A 1 48 ? 9.308   -7.605  -2.539  1.00 0.00 ? 85  ASN A O    2  
ATOM 2212  C CB   . ASN A 1 48 ? 11.274  -9.481  -2.961  1.00 0.00 ? 85  ASN A CB   2  
ATOM 2213  C CG   . ASN A 1 48 ? 12.144  -10.495 -3.673  1.00 0.00 ? 85  ASN A CG   2  
ATOM 2214  O OD1  . ASN A 1 48 ? 11.949  -10.773 -4.858  1.00 0.00 ? 85  ASN A OD1  2  
ATOM 2215  N ND2  . ASN A 1 48 ? 13.119  -11.040 -2.962  1.00 0.00 ? 85  ASN A ND2  2  
ATOM 2216  H H    . ASN A 1 48 ? 13.089  -7.513  -2.351  1.00 0.00 ? 85  ASN A H    2  
ATOM 2217  H HA   . ASN A 1 48 ? 11.295  -8.118  -4.606  1.00 0.00 ? 85  ASN A HA   2  
ATOM 2218  H HB2  . ASN A 1 48 ? 11.551  -9.470  -1.918  1.00 0.00 ? 85  ASN A HB2  2  
ATOM 2219  H HB3  . ASN A 1 48 ? 10.243  -9.791  -3.053  1.00 0.00 ? 85  ASN A HB3  2  
ATOM 2220  H HD21 . ASN A 1 48 ? 13.226  -10.755 -2.024  1.00 0.00 ? 85  ASN A HD21 2  
ATOM 2221  H HD22 . ASN A 1 48 ? 13.697  -11.705 -3.396  1.00 0.00 ? 85  ASN A HD22 2  
ATOM 2222  N N    . PHE A 1 49 ? 10.652  -5.853  -2.986  1.00 0.00 ? 86  PHE A N    2  
ATOM 2223  C CA   . PHE A 1 49 ? 9.711   -4.854  -2.500  1.00 0.00 ? 86  PHE A CA   2  
ATOM 2224  C C    . PHE A 1 49 ? 8.365   -5.009  -3.187  1.00 0.00 ? 86  PHE A C    2  
ATOM 2225  O O    . PHE A 1 49 ? 7.316   -4.982  -2.543  1.00 0.00 ? 86  PHE A O    2  
ATOM 2226  C CB   . PHE A 1 49 ? 10.244  -3.444  -2.756  1.00 0.00 ? 86  PHE A CB   2  
ATOM 2227  C CG   . PHE A 1 49 ? 9.240   -2.375  -2.449  1.00 0.00 ? 86  PHE A CG   2  
ATOM 2228  C CD1  . PHE A 1 49 ? 8.773   -2.202  -1.161  1.00 0.00 ? 86  PHE A CD1  2  
ATOM 2229  C CD2  . PHE A 1 49 ? 8.739   -1.564  -3.454  1.00 0.00 ? 86  PHE A CD2  2  
ATOM 2230  C CE1  . PHE A 1 49 ? 7.832   -1.239  -0.873  1.00 0.00 ? 86  PHE A CE1  2  
ATOM 2231  C CE2  . PHE A 1 49 ? 7.796   -0.594  -3.173  1.00 0.00 ? 86  PHE A CE2  2  
ATOM 2232  C CZ   . PHE A 1 49 ? 7.340   -0.433  -1.881  1.00 0.00 ? 86  PHE A CZ   2  
ATOM 2233  H H    . PHE A 1 49 ? 11.500  -5.558  -3.382  1.00 0.00 ? 86  PHE A H    2  
ATOM 2234  H HA   . PHE A 1 49 ? 9.582   -5.002  -1.438  1.00 0.00 ? 86  PHE A HA   2  
ATOM 2235  H HB2  . PHE A 1 49 ? 11.113  -3.274  -2.135  1.00 0.00 ? 86  PHE A HB2  2  
ATOM 2236  H HB3  . PHE A 1 49 ? 10.523  -3.352  -3.794  1.00 0.00 ? 86  PHE A HB3  2  
ATOM 2237  H HD1  . PHE A 1 49 ? 9.157   -2.830  -0.372  1.00 0.00 ? 86  PHE A HD1  2  
ATOM 2238  H HD2  . PHE A 1 49 ? 9.097   -1.689  -4.464  1.00 0.00 ? 86  PHE A HD2  2  
ATOM 2239  H HE1  . PHE A 1 49 ? 7.482   -1.116  0.143   1.00 0.00 ? 86  PHE A HE1  2  
ATOM 2240  H HE2  . PHE A 1 49 ? 7.412   0.030   -3.966  1.00 0.00 ? 86  PHE A HE2  2  
ATOM 2241  H HZ   . PHE A 1 49 ? 6.600   0.325   -1.657  1.00 0.00 ? 86  PHE A HZ   2  
ATOM 2242  N N    . ASP A 1 50 ? 8.411   -5.164  -4.502  1.00 0.00 ? 87  ASP A N    2  
ATOM 2243  C CA   . ASP A 1 50 ? 7.203   -5.300  -5.307  1.00 0.00 ? 87  ASP A CA   2  
ATOM 2244  C C    . ASP A 1 50 ? 6.374   -6.501  -4.846  1.00 0.00 ? 87  ASP A C    2  
ATOM 2245  O O    . ASP A 1 50 ? 5.171   -6.386  -4.608  1.00 0.00 ? 87  ASP A O    2  
ATOM 2246  C CB   . ASP A 1 50 ? 7.580   -5.458  -6.784  1.00 0.00 ? 87  ASP A CB   2  
ATOM 2247  C CG   . ASP A 1 50 ? 6.381   -5.491  -7.713  1.00 0.00 ? 87  ASP A CG   2  
ATOM 2248  O OD1  . ASP A 1 50 ? 5.270   -5.121  -7.290  1.00 0.00 ? 87  ASP A OD1  2  
ATOM 2249  O OD2  . ASP A 1 50 ? 6.555   -5.866  -8.892  1.00 0.00 ? 87  ASP A OD2  2  
ATOM 2250  H H    . ASP A 1 50 ? 9.293   -5.171  -4.949  1.00 0.00 ? 87  ASP A H    2  
ATOM 2251  H HA   . ASP A 1 50 ? 6.620   -4.400  -5.183  1.00 0.00 ? 87  ASP A HA   2  
ATOM 2252  H HB2  . ASP A 1 50 ? 8.207   -4.627  -7.074  1.00 0.00 ? 87  ASP A HB2  2  
ATOM 2253  H HB3  . ASP A 1 50 ? 8.133   -6.377  -6.910  1.00 0.00 ? 87  ASP A HB3  2  
ATOM 2254  N N    . LEU A 1 51 ? 7.038   -7.634  -4.665  1.00 0.00 ? 88  LEU A N    2  
ATOM 2255  C CA   . LEU A 1 51 ? 6.378   -8.855  -4.218  1.00 0.00 ? 88  LEU A CA   2  
ATOM 2256  C C    . LEU A 1 51 ? 5.822   -8.683  -2.806  1.00 0.00 ? 88  LEU A C    2  
ATOM 2257  O O    . LEU A 1 51 ? 4.662   -9.002  -2.537  1.00 0.00 ? 88  LEU A O    2  
ATOM 2258  C CB   . LEU A 1 51 ? 7.373   -10.030 -4.290  1.00 0.00 ? 88  LEU A CB   2  
ATOM 2259  C CG   . LEU A 1 51 ? 6.843   -11.416 -3.883  1.00 0.00 ? 88  LEU A CG   2  
ATOM 2260  C CD1  . LEU A 1 51 ? 7.028   -11.658 -2.392  1.00 0.00 ? 88  LEU A CD1  2  
ATOM 2261  C CD2  . LEU A 1 51 ? 5.378   -11.568 -4.264  1.00 0.00 ? 88  LEU A CD2  2  
ATOM 2262  H H    . LEU A 1 51 ? 8.009   -7.642  -4.804  1.00 0.00 ? 88  LEU A H    2  
ATOM 2263  H HA   . LEU A 1 51 ? 5.558   -9.050  -4.891  1.00 0.00 ? 88  LEU A HA   2  
ATOM 2264  H HB2  . LEU A 1 51 ? 7.733   -10.099 -5.304  1.00 0.00 ? 88  LEU A HB2  2  
ATOM 2265  H HB3  . LEU A 1 51 ? 8.212   -9.793  -3.650  1.00 0.00 ? 88  LEU A HB3  2  
ATOM 2266  H HG   . LEU A 1 51 ? 7.406   -12.171 -4.410  1.00 0.00 ? 88  LEU A HG   2  
ATOM 2267  H HD11 . LEU A 1 51 ? 6.565   -10.857 -1.836  1.00 0.00 ? 88  LEU A HD11 2  
ATOM 2268  H HD12 . LEU A 1 51 ? 6.567   -12.596 -2.122  1.00 0.00 ? 88  LEU A HD12 2  
ATOM 2269  H HD13 . LEU A 1 51 ? 8.084   -11.695 -2.161  1.00 0.00 ? 88  LEU A HD13 2  
ATOM 2270  H HD21 . LEU A 1 51 ? 4.815   -10.752 -3.833  1.00 0.00 ? 88  LEU A HD21 2  
ATOM 2271  H HD22 . LEU A 1 51 ? 5.281   -11.549 -5.339  1.00 0.00 ? 88  LEU A HD22 2  
ATOM 2272  H HD23 . LEU A 1 51 ? 5.003   -12.506 -3.883  1.00 0.00 ? 88  LEU A HD23 2  
ATOM 2273  N N    . TYR A 1 52 ? 6.652   -8.169  -1.919  1.00 0.00 ? 89  TYR A N    2  
ATOM 2274  C CA   . TYR A 1 52 ? 6.268   -7.968  -0.530  1.00 0.00 ? 89  TYR A CA   2  
ATOM 2275  C C    . TYR A 1 52 ? 5.056   -7.047  -0.419  1.00 0.00 ? 89  TYR A C    2  
ATOM 2276  O O    . TYR A 1 52 ? 4.113   -7.341  0.315   1.00 0.00 ? 89  TYR A O    2  
ATOM 2277  C CB   . TYR A 1 52 ? 7.436   -7.381  0.253   1.00 0.00 ? 89  TYR A CB   2  
ATOM 2278  C CG   . TYR A 1 52 ? 8.557   -8.358  0.561   1.00 0.00 ? 89  TYR A CG   2  
ATOM 2279  C CD1  . TYR A 1 52 ? 8.814   -9.452  -0.256  1.00 0.00 ? 89  TYR A CD1  2  
ATOM 2280  C CD2  . TYR A 1 52 ? 9.378   -8.161  1.663   1.00 0.00 ? 89  TYR A CD2  2  
ATOM 2281  C CE1  . TYR A 1 52 ? 9.857   -10.317 0.015   1.00 0.00 ? 89  TYR A CE1  2  
ATOM 2282  C CE2  . TYR A 1 52 ? 10.419  -9.023  1.943   1.00 0.00 ? 89  TYR A CE2  2  
ATOM 2283  C CZ   . TYR A 1 52 ? 10.654  -10.099 1.116   1.00 0.00 ? 89  TYR A CZ   2  
ATOM 2284  O OH   . TYR A 1 52 ? 11.701  -10.952 1.385   1.00 0.00 ? 89  TYR A OH   2  
ATOM 2285  H H    . TYR A 1 52 ? 7.564   -7.924  -2.202  1.00 0.00 ? 89  TYR A H    2  
ATOM 2286  H HA   . TYR A 1 52 ? 6.013   -8.930  -0.111  1.00 0.00 ? 89  TYR A HA   2  
ATOM 2287  H HB2  . TYR A 1 52 ? 7.862   -6.568  -0.315  1.00 0.00 ? 89  TYR A HB2  2  
ATOM 2288  H HB3  . TYR A 1 52 ? 7.065   -6.998  1.183   1.00 0.00 ? 89  TYR A HB3  2  
ATOM 2289  H HD1  . TYR A 1 52 ? 8.184   -9.622  -1.119  1.00 0.00 ? 89  TYR A HD1  2  
ATOM 2290  H HD2  . TYR A 1 52 ? 9.191   -7.318  2.312   1.00 0.00 ? 89  TYR A HD2  2  
ATOM 2291  H HE1  . TYR A 1 52 ? 10.039  -11.161 -0.634  1.00 0.00 ? 89  TYR A HE1  2  
ATOM 2292  H HE2  . TYR A 1 52 ? 11.044  -8.852  2.808   1.00 0.00 ? 89  TYR A HE2  2  
ATOM 2293  H HH   . TYR A 1 52 ? 12.458  -10.434 1.713   1.00 0.00 ? 89  TYR A HH   2  
ATOM 2294  N N    . PHE A 1 53 ? 5.082   -5.950  -1.172  1.00 0.00 ? 90  PHE A N    2  
ATOM 2295  C CA   . PHE A 1 53 ? 3.986   -4.985  -1.180  1.00 0.00 ? 90  PHE A CA   2  
ATOM 2296  C C    . PHE A 1 53 ? 2.670   -5.658  -1.553  1.00 0.00 ? 90  PHE A C    2  
ATOM 2297  O O    . PHE A 1 53 ? 1.645   -5.442  -0.906  1.00 0.00 ? 90  PHE A O    2  
ATOM 2298  C CB   . PHE A 1 53 ? 4.290   -3.859  -2.175  1.00 0.00 ? 90  PHE A CB   2  
ATOM 2299  C CG   . PHE A 1 53 ? 3.180   -2.855  -2.309  1.00 0.00 ? 90  PHE A CG   2  
ATOM 2300  C CD1  . PHE A 1 53 ? 2.964   -1.903  -1.324  1.00 0.00 ? 90  PHE A CD1  2  
ATOM 2301  C CD2  . PHE A 1 53 ? 2.360   -2.860  -3.422  1.00 0.00 ? 90  PHE A CD2  2  
ATOM 2302  C CE1  . PHE A 1 53 ? 1.946   -0.980  -1.449  1.00 0.00 ? 90  PHE A CE1  2  
ATOM 2303  C CE2  . PHE A 1 53 ? 1.337   -1.939  -3.552  1.00 0.00 ? 90  PHE A CE2  2  
ATOM 2304  C CZ   . PHE A 1 53 ? 1.133   -0.998  -2.563  1.00 0.00 ? 90  PHE A CZ   2  
ATOM 2305  H H    . PHE A 1 53 ? 5.864   -5.785  -1.748  1.00 0.00 ? 90  PHE A H    2  
ATOM 2306  H HA   . PHE A 1 53 ? 3.900   -4.565  -0.189  1.00 0.00 ? 90  PHE A HA   2  
ATOM 2307  H HB2  . PHE A 1 53 ? 5.175   -3.333  -1.852  1.00 0.00 ? 90  PHE A HB2  2  
ATOM 2308  H HB3  . PHE A 1 53 ? 4.469   -4.286  -3.151  1.00 0.00 ? 90  PHE A HB3  2  
ATOM 2309  H HD1  . PHE A 1 53 ? 3.600   -1.889  -0.453  1.00 0.00 ? 90  PHE A HD1  2  
ATOM 2310  H HD2  . PHE A 1 53 ? 2.518   -3.599  -4.196  1.00 0.00 ? 90  PHE A HD2  2  
ATOM 2311  H HE1  . PHE A 1 53 ? 1.787   -0.245  -0.675  1.00 0.00 ? 90  PHE A HE1  2  
ATOM 2312  H HE2  . PHE A 1 53 ? 0.704   -1.952  -4.425  1.00 0.00 ? 90  PHE A HE2  2  
ATOM 2313  H HZ   . PHE A 1 53 ? 0.331   -0.278  -2.660  1.00 0.00 ? 90  PHE A HZ   2  
ATOM 2314  N N    . ASN A 1 54 ? 2.706   -6.457  -2.608  1.00 0.00 ? 91  ASN A N    2  
ATOM 2315  C CA   . ASN A 1 54 ? 1.514   -7.133  -3.108  1.00 0.00 ? 91  ASN A CA   2  
ATOM 2316  C C    . ASN A 1 54 ? 0.932   -8.092  -2.073  1.00 0.00 ? 91  ASN A C    2  
ATOM 2317  O O    . ASN A 1 54 ? -0.273  -8.074  -1.823  1.00 0.00 ? 91  ASN A O    2  
ATOM 2318  C CB   . ASN A 1 54 ? 1.831   -7.867  -4.411  1.00 0.00 ? 91  ASN A CB   2  
ATOM 2319  C CG   . ASN A 1 54 ? 1.791   -6.941  -5.614  1.00 0.00 ? 91  ASN A CG   2  
ATOM 2320  O OD1  . ASN A 1 54 ? 0.723   -6.541  -6.067  1.00 0.00 ? 91  ASN A OD1  2  
ATOM 2321  N ND2  . ASN A 1 54 ? 2.953   -6.548  -6.105  1.00 0.00 ? 91  ASN A ND2  2  
ATOM 2322  H H    . ASN A 1 54 ? 3.556   -6.574  -3.084  1.00 0.00 ? 91  ASN A H    2  
ATOM 2323  H HA   . ASN A 1 54 ? 0.777   -6.373  -3.315  1.00 0.00 ? 91  ASN A HA   2  
ATOM 2324  H HB2  . ASN A 1 54 ? 2.817   -8.301  -4.344  1.00 0.00 ? 91  ASN A HB2  2  
ATOM 2325  H HB3  . ASN A 1 54 ? 1.102   -8.653  -4.559  1.00 0.00 ? 91  ASN A HB3  2  
ATOM 2326  H HD21 . ASN A 1 54 ? 3.776   -6.867  -5.670  1.00 0.00 ? 91  ASN A HD21 2  
ATOM 2327  H HD22 . ASN A 1 54 ? 2.951   -5.950  -6.885  1.00 0.00 ? 91  ASN A HD22 2  
ATOM 2328  N N    . ASN A 1 55 ? 1.788   -8.868  -1.418  1.00 0.00 ? 92  ASN A N    2  
ATOM 2329  C CA   . ASN A 1 55 ? 1.331   -9.772  -0.362  1.00 0.00 ? 92  ASN A CA   2  
ATOM 2330  C C    . ASN A 1 55 ? 0.795   -8.985  0.829   1.00 0.00 ? 92  ASN A C    2  
ATOM 2331  O O    . ASN A 1 55 ? -0.199  -9.375  1.447   1.00 0.00 ? 92  ASN A O    2  
ATOM 2332  C CB   . ASN A 1 55 ? 2.448   -10.702 0.110   1.00 0.00 ? 92  ASN A CB   2  
ATOM 2333  C CG   . ASN A 1 55 ? 2.782   -11.792 -0.888  1.00 0.00 ? 92  ASN A CG   2  
ATOM 2334  O OD1  . ASN A 1 55 ? 1.893   -12.425 -1.462  1.00 0.00 ? 92  ASN A OD1  2  
ATOM 2335  N ND2  . ASN A 1 55 ? 4.065   -12.053 -1.066  1.00 0.00 ? 92  ASN A ND2  2  
ATOM 2336  H H    . ASN A 1 55 ? 2.750   -8.802  -1.616  1.00 0.00 ? 92  ASN A H    2  
ATOM 2337  H HA   . ASN A 1 55 ? 0.527   -10.369 -0.769  1.00 0.00 ? 92  ASN A HA   2  
ATOM 2338  H HB2  . ASN A 1 55 ? 3.335   -10.116 0.279   1.00 0.00 ? 92  ASN A HB2  2  
ATOM 2339  H HB3  . ASN A 1 55 ? 2.151   -11.166 1.039   1.00 0.00 ? 92  ASN A HB3  2  
ATOM 2340  H HD21 . ASN A 1 55 ? 4.719   -11.530 -0.547  1.00 0.00 ? 92  ASN A HD21 2  
ATOM 2341  H HD22 . ASN A 1 55 ? 4.314   -12.764 -1.697  1.00 0.00 ? 92  ASN A HD22 2  
ATOM 2342  N N    . ALA A 1 56 ? 1.456   -7.880  1.149   1.00 0.00 ? 93  ALA A N    2  
ATOM 2343  C CA   . ALA A 1 56 ? 1.033   -7.030  2.252   1.00 0.00 ? 93  ALA A CA   2  
ATOM 2344  C C    . ALA A 1 56 ? -0.370  -6.491  1.999   1.00 0.00 ? 93  ALA A C    2  
ATOM 2345  O O    . ALA A 1 56 ? -1.251  -6.602  2.857   1.00 0.00 ? 93  ALA A O    2  
ATOM 2346  C CB   . ALA A 1 56 ? 2.019   -5.888  2.454   1.00 0.00 ? 93  ALA A CB   2  
ATOM 2347  H H    . ALA A 1 56 ? 2.251   -7.627  0.625   1.00 0.00 ? 93  ALA A H    2  
ATOM 2348  H HA   . ALA A 1 56 ? 1.023   -7.631  3.152   1.00 0.00 ? 93  ALA A HA   2  
ATOM 2349  H HB1  . ALA A 1 56 ? 2.984   -6.167  2.053   1.00 0.00 ? 93  ALA A HB1  2  
ATOM 2350  H HB2  . ALA A 1 56 ? 2.114   -5.677  3.509   1.00 0.00 ? 93  ALA A HB2  2  
ATOM 2351  H HB3  . ALA A 1 56 ? 1.659   -5.009  1.941   1.00 0.00 ? 93  ALA A HB3  2  
ATOM 2352  N N    . ILE A 1 57 ? -0.591  -5.991  0.785   1.00 0.00 ? 94  ILE A N    2  
ATOM 2353  C CA   . ILE A 1 57 ? -1.901  -5.490  0.379   1.00 0.00 ? 94  ILE A CA   2  
ATOM 2354  C C    . ILE A 1 57 ? -2.948  -6.600  0.421   1.00 0.00 ? 94  ILE A C    2  
ATOM 2355  O O    . ILE A 1 57 ? -4.039  -6.414  0.965   1.00 0.00 ? 94  ILE A O    2  
ATOM 2356  C CB   . ILE A 1 57 ? -1.874  -4.902  -1.055  1.00 0.00 ? 94  ILE A CB   2  
ATOM 2357  C CG1  . ILE A 1 57 ? -0.915  -3.711  -1.147  1.00 0.00 ? 94  ILE A CG1  2  
ATOM 2358  C CG2  . ILE A 1 57 ? -3.275  -4.489  -1.496  1.00 0.00 ? 94  ILE A CG2  2  
ATOM 2359  C CD1  . ILE A 1 57 ? -1.349  -2.504  -0.343  1.00 0.00 ? 94  ILE A CD1  2  
ATOM 2360  H H    . ILE A 1 57 ? 0.144   -5.987  0.132   1.00 0.00 ? 94  ILE A H    2  
ATOM 2361  H HA   . ILE A 1 57 ? -2.189  -4.706  1.065   1.00 0.00 ? 94  ILE A HA   2  
ATOM 2362  H HB   . ILE A 1 57 ? -1.532  -5.676  -1.725  1.00 0.00 ? 94  ILE A HB   2  
ATOM 2363  H HG12 . ILE A 1 57 ? 0.054   -4.013  -0.787  1.00 0.00 ? 94  ILE A HG12 2  
ATOM 2364  H HG13 . ILE A 1 57 ? -0.831  -3.407  -2.180  1.00 0.00 ? 94  ILE A HG13 2  
ATOM 2365  H HG21 . ILE A 1 57 ? -3.984  -4.739  -0.719  1.00 0.00 ? 94  ILE A HG21 2  
ATOM 2366  H HG22 . ILE A 1 57 ? -3.298  -3.426  -1.674  1.00 0.00 ? 94  ILE A HG22 2  
ATOM 2367  H HG23 . ILE A 1 57 ? -3.536  -5.014  -2.403  1.00 0.00 ? 94  ILE A HG23 2  
ATOM 2368  H HD11 . ILE A 1 57 ? -2.101  -2.799  0.373   1.00 0.00 ? 94  ILE A HD11 2  
ATOM 2369  H HD12 . ILE A 1 57 ? -0.496  -2.096  0.177   1.00 0.00 ? 94  ILE A HD12 2  
ATOM 2370  H HD13 . ILE A 1 57 ? -1.756  -1.757  -1.010  1.00 0.00 ? 94  ILE A HD13 2  
ATOM 2371  N N    . LYS A 1 58 ? -2.640  -7.722  -0.226  1.00 0.00 ? 95  LYS A N    2  
ATOM 2372  C CA   . LYS A 1 58 ? -3.605  -8.804  -0.370  1.00 0.00 ? 95  LYS A CA   2  
ATOM 2373  C C    . LYS A 1 58 ? -4.014  -9.376  0.985   1.00 0.00 ? 95  LYS A C    2  
ATOM 2374  O O    . LYS A 1 58 ? -5.192  -9.634  1.217   1.00 0.00 ? 95  LYS A O    2  
ATOM 2375  C CB   . LYS A 1 58 ? -3.064  -9.904  -1.294  1.00 0.00 ? 95  LYS A CB   2  
ATOM 2376  C CG   . LYS A 1 58 ? -2.033  -10.817 -0.661  1.00 0.00 ? 95  LYS A CG   2  
ATOM 2377  C CD   . LYS A 1 58 ? -1.652  -11.973 -1.579  1.00 0.00 ? 95  LYS A CD   2  
ATOM 2378  C CE   . LYS A 1 58 ? -2.684  -13.100 -1.565  1.00 0.00 ? 95  LYS A CE   2  
ATOM 2379  N NZ   . LYS A 1 58 ? -3.963  -12.725 -2.230  1.00 0.00 ? 95  LYS A NZ   2  
ATOM 2380  H H    . LYS A 1 58 ? -1.775  -7.788  -0.690  1.00 0.00 ? 95  LYS A H    2  
ATOM 2381  H HA   . LYS A 1 58 ? -4.486  -8.381  -0.829  1.00 0.00 ? 95  LYS A HA   2  
ATOM 2382  H HB2  . LYS A 1 58 ? -3.888  -10.514 -1.628  1.00 0.00 ? 95  LYS A HB2  2  
ATOM 2383  H HB3  . LYS A 1 58 ? -2.607  -9.436  -2.154  1.00 0.00 ? 95  LYS A HB3  2  
ATOM 2384  H HG2  . LYS A 1 58 ? -1.146  -10.240 -0.442  1.00 0.00 ? 95  LYS A HG2  2  
ATOM 2385  H HG3  . LYS A 1 58 ? -2.442  -11.211 0.256   1.00 0.00 ? 95  LYS A HG3  2  
ATOM 2386  H HD2  . LYS A 1 58 ? -1.564  -11.599 -2.590  1.00 0.00 ? 95  LYS A HD2  2  
ATOM 2387  H HD3  . LYS A 1 58 ? -0.699  -12.368 -1.260  1.00 0.00 ? 95  LYS A HD3  2  
ATOM 2388  H HE2  . LYS A 1 58 ? -2.266  -13.954 -2.076  1.00 0.00 ? 95  LYS A HE2  2  
ATOM 2389  H HE3  . LYS A 1 58 ? -2.888  -13.364 -0.539  1.00 0.00 ? 95  LYS A HE3  2  
ATOM 2390  H HZ1  . LYS A 1 58 ? -3.874  -11.798 -2.698  1.00 0.00 ? 95  LYS A HZ1  2  
ATOM 2391  H HZ2  . LYS A 1 58 ? -4.218  -13.436 -2.949  1.00 0.00 ? 95  LYS A HZ2  2  
ATOM 2392  H HZ3  . LYS A 1 58 ? -4.733  -12.671 -1.526  1.00 0.00 ? 95  LYS A HZ3  2  
ATOM 2393  N N    . LYS A 1 59 ? -3.061  -9.539  1.893   1.00 0.00 ? 96  LYS A N    2  
ATOM 2394  C CA   . LYS A 1 59 ? -3.372  -10.055 3.216   1.00 0.00 ? 96  LYS A CA   2  
ATOM 2395  C C    . LYS A 1 59 ? -4.125  -9.007  4.028   1.00 0.00 ? 96  LYS A C    2  
ATOM 2396  O O    . LYS A 1 59 ? -4.981  -9.332  4.850   1.00 0.00 ? 96  LYS A O    2  
ATOM 2397  C CB   . LYS A 1 59 ? -2.105  -10.482 3.958   1.00 0.00 ? 96  LYS A CB   2  
ATOM 2398  C CG   . LYS A 1 59 ? -2.397  -11.188 5.274   1.00 0.00 ? 96  LYS A CG   2  
ATOM 2399  C CD   . LYS A 1 59 ? -3.183  -12.467 5.044   1.00 0.00 ? 96  LYS A CD   2  
ATOM 2400  C CE   . LYS A 1 59 ? -3.672  -13.071 6.346   1.00 0.00 ? 96  LYS A CE   2  
ATOM 2401  N NZ   . LYS A 1 59 ? -4.632  -14.180 6.106   1.00 0.00 ? 96  LYS A NZ   2  
ATOM 2402  H H    . LYS A 1 59 ? -2.133  -9.300  1.671   1.00 0.00 ? 96  LYS A H    2  
ATOM 2403  H HA   . LYS A 1 59 ? -4.011  -10.919 3.089   1.00 0.00 ? 96  LYS A HA   2  
ATOM 2404  H HB2  . LYS A 1 59 ? -1.539  -11.154 3.328   1.00 0.00 ? 96  LYS A HB2  2  
ATOM 2405  H HB3  . LYS A 1 59 ? -1.510  -9.607  4.167   1.00 0.00 ? 96  LYS A HB3  2  
ATOM 2406  H HG2  . LYS A 1 59 ? -1.464  -11.430 5.760   1.00 0.00 ? 96  LYS A HG2  2  
ATOM 2407  H HG3  . LYS A 1 59 ? -2.978  -10.528 5.904   1.00 0.00 ? 96  LYS A HG3  2  
ATOM 2408  H HD2  . LYS A 1 59 ? -4.036  -12.245 4.421   1.00 0.00 ? 96  LYS A HD2  2  
ATOM 2409  H HD3  . LYS A 1 59 ? -2.545  -13.181 4.541   1.00 0.00 ? 96  LYS A HD3  2  
ATOM 2410  H HE2  . LYS A 1 59 ? -2.823  -13.453 6.892   1.00 0.00 ? 96  LYS A HE2  2  
ATOM 2411  H HE3  . LYS A 1 59 ? -4.159  -12.300 6.927   1.00 0.00 ? 96  LYS A HE3  2  
ATOM 2412  H HZ1  . LYS A 1 59 ? -5.206  -13.981 5.253   1.00 0.00 ? 96  LYS A HZ1  2  
ATOM 2413  H HZ2  . LYS A 1 59 ? -4.120  -15.078 5.967   1.00 0.00 ? 96  LYS A HZ2  2  
ATOM 2414  H HZ3  . LYS A 1 59 ? -5.272  -14.282 6.924   1.00 0.00 ? 96  LYS A HZ3  2  
ATOM 2415  N N    . GLY A 1 60 ? -3.780  -7.750  3.811   1.00 0.00 ? 97  GLY A N    2  
ATOM 2416  C CA   . GLY A 1 60 ? -4.400  -6.676  4.553   1.00 0.00 ? 97  GLY A CA   2  
ATOM 2417  C C    . GLY A 1 60 ? -5.864  -6.493  4.215   1.00 0.00 ? 97  GLY A C    2  
ATOM 2418  O O    . GLY A 1 60 ? -6.671  -6.202  5.097   1.00 0.00 ? 97  GLY A O    2  
ATOM 2419  H H    . GLY A 1 60 ? -3.073  -7.551  3.158   1.00 0.00 ? 97  GLY A H    2  
ATOM 2420  H HA2  . GLY A 1 60 ? -4.312  -6.888  5.609   1.00 0.00 ? 97  GLY A HA2  2  
ATOM 2421  H HA3  . GLY A 1 60 ? -3.873  -5.759  4.340   1.00 0.00 ? 97  GLY A HA3  2  
ATOM 2422  N N    . VAL A 1 61 ? -6.211  -6.608  2.936   1.00 0.00 ? 98  VAL A N    2  
ATOM 2423  C CA   . VAL A 1 61 ? -7.594  -6.400  2.513   1.00 0.00 ? 98  VAL A CA   2  
ATOM 2424  C C    . VAL A 1 61 ? -8.519  -7.468  3.098   1.00 0.00 ? 98  VAL A C    2  
ATOM 2425  O O    . VAL A 1 61 ? -9.576  -7.143  3.636   1.00 0.00 ? 98  VAL A O    2  
ATOM 2426  C CB   . VAL A 1 61 ? -7.754  -6.333  0.971   1.00 0.00 ? 98  VAL A CB   2  
ATOM 2427  C CG1  . VAL A 1 61 ? -7.113  -5.069  0.427   1.00 0.00 ? 98  VAL A CG1  2  
ATOM 2428  C CG2  . VAL A 1 61 ? -7.161  -7.551  0.284   1.00 0.00 ? 98  VAL A CG2  2  
ATOM 2429  H H    . VAL A 1 61 ? -5.521  -6.808  2.262   1.00 0.00 ? 98  VAL A H    2  
ATOM 2430  H HA   . VAL A 1 61 ? -7.902  -5.442  2.913   1.00 0.00 ? 98  VAL A HA   2  
ATOM 2431  H HB   . VAL A 1 61 ? -8.810  -6.298  0.744   1.00 0.00 ? 98  VAL A HB   2  
ATOM 2432  H HG11 . VAL A 1 61 ? -6.115  -4.971  0.825   1.00 0.00 ? 98  VAL A HG11 2  
ATOM 2433  H HG12 . VAL A 1 61 ? -7.067  -5.125  -0.651  1.00 0.00 ? 98  VAL A HG12 2  
ATOM 2434  H HG13 . VAL A 1 61 ? -7.704  -4.212  0.718   1.00 0.00 ? 98  VAL A HG13 2  
ATOM 2435  H HG21 . VAL A 1 61 ? -6.485  -8.054  0.960   1.00 0.00 ? 98  VAL A HG21 2  
ATOM 2436  H HG22 . VAL A 1 61 ? -7.954  -8.227  -0.001  1.00 0.00 ? 98  VAL A HG22 2  
ATOM 2437  H HG23 . VAL A 1 61 ? -6.620  -7.238  -0.598  1.00 0.00 ? 98  VAL A HG23 2  
ATOM 2438  N N    . GLU A 1 62 ? -8.070  -8.718  3.094   1.00 0.00 ? 99  GLU A N    2  
ATOM 2439  C CA   . GLU A 1 62 ? -8.844  -9.806  3.687   1.00 0.00 ? 99  GLU A CA   2  
ATOM 2440  C C    . GLU A 1 62 ? -8.933  -9.664  5.206   1.00 0.00 ? 99  GLU A C    2  
ATOM 2441  O O    . GLU A 1 62 ? -9.980  -9.922  5.802   1.00 0.00 ? 99  GLU A O    2  
ATOM 2442  C CB   . GLU A 1 62 ? -8.250  -11.169 3.318   1.00 0.00 ? 99  GLU A CB   2  
ATOM 2443  C CG   . GLU A 1 62 ? -6.735  -11.205 3.292   1.00 0.00 ? 99  GLU A CG   2  
ATOM 2444  C CD   . GLU A 1 62 ? -6.186  -12.619 3.264   1.00 0.00 ? 99  GLU A CD   2  
ATOM 2445  O OE1  . GLU A 1 62 ? -6.407  -13.371 4.236   1.00 0.00 ? 99  GLU A OE1  2  
ATOM 2446  O OE2  . GLU A 1 62 ? -5.536  -12.995 2.264   1.00 0.00 ? 99  GLU A OE2  2  
ATOM 2447  H H    . GLU A 1 62 ? -7.186  -8.910  2.716   1.00 0.00 ? 99  GLU A H    2  
ATOM 2448  H HA   . GLU A 1 62 ? -9.843  -9.744  3.282   1.00 0.00 ? 99  GLU A HA   2  
ATOM 2449  H HB2  . GLU A 1 62 ? -8.585  -11.896 4.039   1.00 0.00 ? 99  GLU A HB2  2  
ATOM 2450  H HB3  . GLU A 1 62 ? -8.612  -11.450 2.340   1.00 0.00 ? 99  GLU A HB3  2  
ATOM 2451  H HG2  . GLU A 1 62 ? -6.394  -10.688 2.405   1.00 0.00 ? 99  GLU A HG2  2  
ATOM 2452  H HG3  . GLU A 1 62 ? -6.354  -10.693 4.169   1.00 0.00 ? 99  GLU A HG3  2  
ATOM 2453  N N    . ALA A 1 63 ? -7.823  -9.285  5.828   1.00 0.00 ? 100 ALA A N    2  
ATOM 2454  C CA   . ALA A 1 63 ? -7.758  -9.147  7.282   1.00 0.00 ? 100 ALA A CA   2  
ATOM 2455  C C    . ALA A 1 63 ? -8.654  -8.018  7.780   1.00 0.00 ? 100 ALA A C    2  
ATOM 2456  O O    . ALA A 1 63 ? -9.091  -8.019  8.931   1.00 0.00 ? 100 ALA A O    2  
ATOM 2457  C CB   . ALA A 1 63 ? -6.322  -8.910  7.722   1.00 0.00 ? 100 ALA A CB   2  
ATOM 2458  H H    . ALA A 1 63 ? -7.010  -9.129  5.300   1.00 0.00 ? 100 ALA A H    2  
ATOM 2459  H HA   . ALA A 1 63 ? -8.092  -10.078 7.718   1.00 0.00 ? 100 ALA A HA   2  
ATOM 2460  H HB1  . ALA A 1 63 ? -6.176  -7.857  7.920   1.00 0.00 ? 100 ALA A HB1  2  
ATOM 2461  H HB2  . ALA A 1 63 ? -6.123  -9.475  8.621   1.00 0.00 ? 100 ALA A HB2  2  
ATOM 2462  H HB3  . ALA A 1 63 ? -5.648  -9.226  6.940   1.00 0.00 ? 100 ALA A HB3  2  
ATOM 2463  N N    . GLY A 1 64 ? -8.861  -7.022  6.932   1.00 0.00 ? 101 GLY A N    2  
ATOM 2464  C CA   . GLY A 1 64 ? -9.633  -5.861  7.326   1.00 0.00 ? 101 GLY A CA   2  
ATOM 2465  C C    . GLY A 1 64 ? -8.740  -4.724  7.767   1.00 0.00 ? 101 GLY A C    2  
ATOM 2466  O O    . GLY A 1 64 ? -9.070  -3.965  8.679   1.00 0.00 ? 101 GLY A O    2  
ATOM 2467  H H    . GLY A 1 64 ? -8.442  -7.055  6.046   1.00 0.00 ? 101 GLY A H    2  
ATOM 2468  H HA2  . GLY A 1 64 ? -10.228 -5.534  6.484   1.00 0.00 ? 101 GLY A HA2  2  
ATOM 2469  H HA3  . GLY A 1 64 ? -10.287 -6.130  8.139   1.00 0.00 ? 101 GLY A HA3  2  
ATOM 2470  N N    . ASP A 1 65 ? -7.612  -4.603  7.088   1.00 0.00 ? 102 ASP A N    2  
ATOM 2471  C CA   . ASP A 1 65 ? -6.644  -3.555  7.370   1.00 0.00 ? 102 ASP A CA   2  
ATOM 2472  C C    . ASP A 1 65 ? -6.567  -2.604  6.187   1.00 0.00 ? 102 ASP A C    2  
ATOM 2473  O O    . ASP A 1 65 ? -6.695  -1.389  6.339   1.00 0.00 ? 102 ASP A O    2  
ATOM 2474  C CB   . ASP A 1 65 ? -5.274  -4.172  7.637   1.00 0.00 ? 102 ASP A CB   2  
ATOM 2475  C CG   . ASP A 1 65 ? -4.283  -3.179  8.185   1.00 0.00 ? 102 ASP A CG   2  
ATOM 2476  O OD1  . ASP A 1 65 ? -4.557  -2.576  9.243   1.00 0.00 ? 102 ASP A OD1  2  
ATOM 2477  O OD2  . ASP A 1 65 ? -3.208  -3.037  7.581   1.00 0.00 ? 102 ASP A OD2  2  
ATOM 2478  H H    . ASP A 1 65 ? -7.423  -5.242  6.368   1.00 0.00 ? 102 ASP A H    2  
ATOM 2479  H HA   . ASP A 1 65 ? -6.974  -3.012  8.243   1.00 0.00 ? 102 ASP A HA   2  
ATOM 2480  H HB2  . ASP A 1 65 ? -5.378  -4.977  8.348   1.00 0.00 ? 102 ASP A HB2  2  
ATOM 2481  H HB3  . ASP A 1 65 ? -4.877  -4.560  6.712   1.00 0.00 ? 102 ASP A HB3  2  
ATOM 2482  N N    . PHE A 1 66 ? -6.571  -3.181  4.992   1.00 0.00 ? 103 PHE A N    2  
ATOM 2483  C CA   . PHE A 1 66 ? -6.700  -2.390  3.777   1.00 0.00 ? 103 PHE A CA   2  
ATOM 2484  C C    . PHE A 1 66 ? -8.016  -2.736  3.100   1.00 0.00 ? 103 PHE A C    2  
ATOM 2485  O O    . PHE A 1 66 ? -8.731  -3.633  3.551   1.00 0.00 ? 103 PHE A O    2  
ATOM 2486  C CB   . PHE A 1 66 ? -5.535  -2.630  2.808   1.00 0.00 ? 103 PHE A CB   2  
ATOM 2487  C CG   . PHE A 1 66 ? -4.178  -2.651  3.446   1.00 0.00 ? 103 PHE A CG   2  
ATOM 2488  C CD1  . PHE A 1 66 ? -3.627  -1.502  3.988   1.00 0.00 ? 103 PHE A CD1  2  
ATOM 2489  C CD2  . PHE A 1 66 ? -3.440  -3.817  3.475   1.00 0.00 ? 103 PHE A CD2  2  
ATOM 2490  C CE1  . PHE A 1 66 ? -2.369  -1.525  4.557   1.00 0.00 ? 103 PHE A CE1  2  
ATOM 2491  C CE2  . PHE A 1 66 ? -2.183  -3.849  4.045   1.00 0.00 ? 103 PHE A CE2  2  
ATOM 2492  C CZ   . PHE A 1 66 ? -1.645  -2.701  4.585   1.00 0.00 ? 103 PHE A CZ   2  
ATOM 2493  H H    . PHE A 1 66 ? -6.642  -4.162  4.934   1.00 0.00 ? 103 PHE A H    2  
ATOM 2494  H HA   . PHE A 1 66 ? -6.719  -1.349  4.061   1.00 0.00 ? 103 PHE A HA   2  
ATOM 2495  H HB2  . PHE A 1 66 ? -5.679  -3.572  2.307   1.00 0.00 ? 103 PHE A HB2  2  
ATOM 2496  H HB3  . PHE A 1 66 ? -5.536  -1.838  2.073   1.00 0.00 ? 103 PHE A HB3  2  
ATOM 2497  H HD1  . PHE A 1 66 ? -4.195  -0.584  3.973   1.00 0.00 ? 103 PHE A HD1  2  
ATOM 2498  H HD2  . PHE A 1 66 ? -3.859  -4.714  3.047   1.00 0.00 ? 103 PHE A HD2  2  
ATOM 2499  H HE1  . PHE A 1 66 ? -1.950  -0.623  4.979   1.00 0.00 ? 103 PHE A HE1  2  
ATOM 2500  H HE2  . PHE A 1 66 ? -1.624  -4.773  4.065   1.00 0.00 ? 103 PHE A HE2  2  
ATOM 2501  H HZ   . PHE A 1 66 ? -0.661  -2.720  5.028   1.00 0.00 ? 103 PHE A HZ   2  
ATOM 2502  N N    . GLU A 1 67 ? -8.365  -1.986  2.072   1.00 0.00 ? 104 GLU A N    2  
ATOM 2503  C CA   . GLU A 1 67 ? -9.639  -2.166  1.397   1.00 0.00 ? 104 GLU A CA   2  
ATOM 2504  C C    . GLU A 1 67 ? -9.509  -1.691  -0.052  1.00 0.00 ? 104 GLU A C    2  
ATOM 2505  O O    . GLU A 1 67 ? -8.877  -0.673  -0.315  1.00 0.00 ? 104 GLU A O    2  
ATOM 2506  C CB   . GLU A 1 67 ? -10.709 -1.361  2.148   1.00 0.00 ? 104 GLU A CB   2  
ATOM 2507  C CG   . GLU A 1 67 ? -12.123 -1.931  2.082   1.00 0.00 ? 104 GLU A CG   2  
ATOM 2508  C CD   . GLU A 1 67 ? -12.774 -1.776  0.724   1.00 0.00 ? 104 GLU A CD   2  
ATOM 2509  O OE1  . GLU A 1 67 ? -13.375 -0.706  0.479   1.00 0.00 ? 104 GLU A OE1  2  
ATOM 2510  O OE2  . GLU A 1 67 ? -12.662 -2.703  -0.103  1.00 0.00 ? 104 GLU A OE2  2  
ATOM 2511  H H    . GLU A 1 67 ? -7.786  -1.243  1.799   1.00 0.00 ? 104 GLU A H    2  
ATOM 2512  H HA   . GLU A 1 67 ? -9.893  -3.216  1.412   1.00 0.00 ? 104 GLU A HA   2  
ATOM 2513  H HB2  . GLU A 1 67 ? -10.426 -1.301  3.188   1.00 0.00 ? 104 GLU A HB2  2  
ATOM 2514  H HB3  . GLU A 1 67 ? -10.731 -0.362  1.739   1.00 0.00 ? 104 GLU A HB3  2  
ATOM 2515  H HG2  . GLU A 1 67 ? -12.083 -2.980  2.325   1.00 0.00 ? 104 GLU A HG2  2  
ATOM 2516  H HG3  . GLU A 1 67 ? -12.731 -1.418  2.814   1.00 0.00 ? 104 GLU A HG3  2  
ATOM 2517  N N    . GLN A 1 68 ? -10.049 -2.458  -0.980  1.00 0.00 ? 105 GLN A N    2  
ATOM 2518  C CA   . GLN A 1 68 ? -9.985  -2.114  -2.393  1.00 0.00 ? 105 GLN A CA   2  
ATOM 2519  C C    . GLN A 1 68 ? -11.387 -2.015  -2.985  1.00 0.00 ? 105 GLN A C    2  
ATOM 2520  O O    . GLN A 1 68 ? -12.033 -3.032  -3.240  1.00 0.00 ? 105 GLN A O    2  
ATOM 2521  C CB   . GLN A 1 68 ? -9.188  -3.164  -3.165  1.00 0.00 ? 105 GLN A CB   2  
ATOM 2522  C CG   . GLN A 1 68 ? -7.711  -3.209  -2.821  1.00 0.00 ? 105 GLN A CG   2  
ATOM 2523  C CD   . GLN A 1 68 ? -7.005  -4.361  -3.505  1.00 0.00 ? 105 GLN A CD   2  
ATOM 2524  O OE1  . GLN A 1 68 ? -7.238  -5.526  -3.185  1.00 0.00 ? 105 GLN A OE1  2  
ATOM 2525  N NE2  . GLN A 1 68 ? -6.150  -4.045  -4.462  1.00 0.00 ? 105 GLN A NE2  2  
ATOM 2526  H H    . GLN A 1 68 ? -10.519 -3.277  -0.710  1.00 0.00 ? 105 GLN A H    2  
ATOM 2527  H HA   . GLN A 1 68 ? -9.494  -1.156  -2.485  1.00 0.00 ? 105 GLN A HA   2  
ATOM 2528  H HB2  . GLN A 1 68 ? -9.610  -4.136  -2.956  1.00 0.00 ? 105 GLN A HB2  2  
ATOM 2529  H HB3  . GLN A 1 68 ? -9.283  -2.964  -4.223  1.00 0.00 ? 105 GLN A HB3  2  
ATOM 2530  H HG2  . GLN A 1 68 ? -7.251  -2.284  -3.135  1.00 0.00 ? 105 GLN A HG2  2  
ATOM 2531  H HG3  . GLN A 1 68 ? -7.605  -3.322  -1.753  1.00 0.00 ? 105 GLN A HG3  2  
ATOM 2532  H HE21 . GLN A 1 68 ? -6.024  -3.095  -4.675  1.00 0.00 ? 105 GLN A HE21 2  
ATOM 2533  H HE22 . GLN A 1 68 ? -5.689  -4.779  -4.932  1.00 0.00 ? 105 GLN A HE22 2  
ATOM 2534  N N    . PRO A 1 69 ? -11.860 -0.790  -3.244  1.00 0.00 ? 106 PRO A N    2  
ATOM 2535  C CA   . PRO A 1 69 ? -13.180 -0.557  -3.835  1.00 0.00 ? 106 PRO A CA   2  
ATOM 2536  C C    . PRO A 1 69 ? -13.295 -1.167  -5.230  1.00 0.00 ? 106 PRO A C    2  
ATOM 2537  O O    . PRO A 1 69 ? -14.338 -1.702  -5.603  1.00 0.00 ? 106 PRO A O    2  
ATOM 2538  C CB   . PRO A 1 69 ? -13.290 0.971   -3.902  1.00 0.00 ? 106 PRO A CB   2  
ATOM 2539  C CG   . PRO A 1 69 ? -11.886 1.467   -3.826  1.00 0.00 ? 106 PRO A CG   2  
ATOM 2540  C CD   . PRO A 1 69 ? -11.140 0.466   -2.990  1.00 0.00 ? 106 PRO A CD   2  
ATOM 2541  H HA   . PRO A 1 69 ? -13.967 -0.950  -3.208  1.00 0.00 ? 106 PRO A HA   2  
ATOM 2542  H HB2  . PRO A 1 69 ? -13.760 1.259   -4.833  1.00 0.00 ? 106 PRO A HB2  2  
ATOM 2543  H HB3  . PRO A 1 69 ? -13.880 1.328   -3.071  1.00 0.00 ? 106 PRO A HB3  2  
ATOM 2544  H HG2  . PRO A 1 69 ? -11.459 1.521   -4.816  1.00 0.00 ? 106 PRO A HG2  2  
ATOM 2545  H HG3  . PRO A 1 69 ? -11.864 2.440   -3.354  1.00 0.00 ? 106 PRO A HG3  2  
ATOM 2546  H HD2  . PRO A 1 69 ? -10.112 0.392   -3.316  1.00 0.00 ? 106 PRO A HD2  2  
ATOM 2547  H HD3  . PRO A 1 69 ? -11.189 0.734   -1.946  1.00 0.00 ? 106 PRO A HD3  2  
ATOM 2548  N N    . LYS A 1 70 ? -12.200 -1.122  -5.983  1.00 0.00 ? 107 LYS A N    2  
ATOM 2549  C CA   . LYS A 1 70 ? -12.171 -1.692  -7.325  1.00 0.00 ? 107 LYS A CA   2  
ATOM 2550  C C    . LYS A 1 70 ? -11.696 -3.143  -7.295  1.00 0.00 ? 107 LYS A C    2  
ATOM 2551  O O    . LYS A 1 70 ? -11.358 -3.715  -8.330  1.00 0.00 ? 107 LYS A O    2  
ATOM 2552  C CB   . LYS A 1 70 ? -11.266 -0.859  -8.236  1.00 0.00 ? 107 LYS A CB   2  
ATOM 2553  C CG   . LYS A 1 70 ? -11.759 0.563   -8.444  1.00 0.00 ? 107 LYS A CG   2  
ATOM 2554  C CD   . LYS A 1 70 ? -10.830 1.349   -9.353  1.00 0.00 ? 107 LYS A CD   2  
ATOM 2555  C CE   . LYS A 1 70 ? -11.348 2.759   -9.592  1.00 0.00 ? 107 LYS A CE   2  
ATOM 2556  N NZ   . LYS A 1 70 ? -10.421 3.563   -10.430 1.00 0.00 ? 107 LYS A NZ   2  
ATOM 2557  H H    . LYS A 1 70 ? -11.388 -0.720  -5.615  1.00 0.00 ? 107 LYS A H    2  
ATOM 2558  H HA   . LYS A 1 70 ? -13.177 -1.667  -7.716  1.00 0.00 ? 107 LYS A HA   2  
ATOM 2559  H HB2  . LYS A 1 70 ? -10.278 -0.815  -7.799  1.00 0.00 ? 107 LYS A HB2  2  
ATOM 2560  H HB3  . LYS A 1 70 ? -11.202 -1.341  -9.200  1.00 0.00 ? 107 LYS A HB3  2  
ATOM 2561  H HG2  . LYS A 1 70 ? -12.740 0.531   -8.892  1.00 0.00 ? 107 LYS A HG2  2  
ATOM 2562  H HG3  . LYS A 1 70 ? -11.813 1.058   -7.486  1.00 0.00 ? 107 LYS A HG3  2  
ATOM 2563  H HD2  . LYS A 1 70 ? -9.855  1.409   -8.892  1.00 0.00 ? 107 LYS A HD2  2  
ATOM 2564  H HD3  . LYS A 1 70 ? -10.753 0.840   -10.301 1.00 0.00 ? 107 LYS A HD3  2  
ATOM 2565  H HE2  . LYS A 1 70 ? -12.305 2.696   -10.089 1.00 0.00 ? 107 LYS A HE2  2  
ATOM 2566  H HE3  . LYS A 1 70 ? -11.474 3.248   -8.637  1.00 0.00 ? 107 LYS A HE3  2  
ATOM 2567  H HZ1  . LYS A 1 70 ? -9.526  3.043   -10.576 1.00 0.00 ? 107 LYS A HZ1  2  
ATOM 2568  H HZ2  . LYS A 1 70 ? -10.851 3.758   -11.358 1.00 0.00 ? 107 LYS A HZ2  2  
ATOM 2569  H HZ3  . LYS A 1 70 ? -10.211 4.470   -9.959  1.00 0.00 ? 107 LYS A HZ3  2  
ATOM 2570  N N    . GLY A 1 71 ? -11.719 -3.741  -6.111  1.00 0.00 ? 108 GLY A N    2  
ATOM 2571  C CA   . GLY A 1 71 ? -11.323 -5.127  -5.959  1.00 0.00 ? 108 GLY A CA   2  
ATOM 2572  C C    . GLY A 1 71 ? -9.874  -5.373  -6.335  1.00 0.00 ? 108 GLY A C    2  
ATOM 2573  O O    . GLY A 1 71 ? -9.019  -4.510  -6.121  1.00 0.00 ? 108 GLY A O    2  
ATOM 2574  H H    . GLY A 1 71 ? -12.025 -3.238  -5.327  1.00 0.00 ? 108 GLY A H    2  
ATOM 2575  H HA2  . GLY A 1 71 ? -11.468 -5.419  -4.930  1.00 0.00 ? 108 GLY A HA2  2  
ATOM 2576  H HA3  . GLY A 1 71 ? -11.954 -5.738  -6.588  1.00 0.00 ? 108 GLY A HA3  2  
ATOM 2577  N N    . PRO A 1 72 ? -9.565  -6.555  -6.890  1.00 0.00 ? 109 PRO A N    2  
ATOM 2578  C CA   . PRO A 1 72 ? -8.201  -6.927  -7.276  1.00 0.00 ? 109 PRO A CA   2  
ATOM 2579  C C    . PRO A 1 72 ? -7.598  -5.961  -8.288  1.00 0.00 ? 109 PRO A C    2  
ATOM 2580  O O    . PRO A 1 72 ? -8.257  -5.567  -9.254  1.00 0.00 ? 109 PRO A O    2  
ATOM 2581  C CB   . PRO A 1 72 ? -8.362  -8.314  -7.900  1.00 0.00 ? 109 PRO A CB   2  
ATOM 2582  C CG   . PRO A 1 72 ? -9.640  -8.837  -7.343  1.00 0.00 ? 109 PRO A CG   2  
ATOM 2583  C CD   . PRO A 1 72 ? -10.525 -7.638  -7.163  1.00 0.00 ? 109 PRO A CD   2  
ATOM 2584  H HA   . PRO A 1 72 ? -7.554  -6.992  -6.415  1.00 0.00 ? 109 PRO A HA   2  
ATOM 2585  H HB2  . PRO A 1 72 ? -8.407  -8.226  -8.976  1.00 0.00 ? 109 PRO A HB2  2  
ATOM 2586  H HB3  . PRO A 1 72 ? -7.524  -8.936  -7.620  1.00 0.00 ? 109 PRO A HB3  2  
ATOM 2587  H HG2  . PRO A 1 72 ? -10.087 -9.534  -8.036  1.00 0.00 ? 109 PRO A HG2  2  
ATOM 2588  H HG3  . PRO A 1 72 ? -9.458  -9.315  -6.391  1.00 0.00 ? 109 PRO A HG3  2  
ATOM 2589  H HD2  . PRO A 1 72 ? -11.086 -7.441  -8.064  1.00 0.00 ? 109 PRO A HD2  2  
ATOM 2590  H HD3  . PRO A 1 72 ? -11.189 -7.783  -6.325  1.00 0.00 ? 109 PRO A HD3  2  
ATOM 2591  N N    . ALA A 1 73 ? -6.355  -5.567  -8.025  1.00 0.00 ? 110 ALA A N    2  
ATOM 2592  C CA   . ALA A 1 73 ? -5.624  -4.624  -8.865  1.00 0.00 ? 110 ALA A CA   2  
ATOM 2593  C C    . ALA A 1 73 ? -6.326  -3.271  -8.911  1.00 0.00 ? 110 ALA A C    2  
ATOM 2594  O O    . ALA A 1 73 ? -6.215  -2.527  -9.886  1.00 0.00 ? 110 ALA A O    2  
ATOM 2595  C CB   . ALA A 1 73 ? -5.426  -5.189  -10.265 1.00 0.00 ? 110 ALA A CB   2  
ATOM 2596  H H    . ALA A 1 73 ? -5.917  -5.910  -7.213  1.00 0.00 ? 110 ALA A H    2  
ATOM 2597  H HA   . ALA A 1 73 ? -4.647  -4.486  -8.424  1.00 0.00 ? 110 ALA A HA   2  
ATOM 2598  H HB1  . ALA A 1 73 ? -6.079  -4.676  -10.957 1.00 0.00 ? 110 ALA A HB1  2  
ATOM 2599  H HB2  . ALA A 1 73 ? -5.660  -6.244  -10.264 1.00 0.00 ? 110 ALA A HB2  2  
ATOM 2600  H HB3  . ALA A 1 73 ? -4.399  -5.048  -10.569 1.00 0.00 ? 110 ALA A HB3  2  
ATOM 2601  N N    . GLY A 1 74 ? -7.002  -2.940  -7.822  1.00 0.00 ? 111 GLY A N    2  
ATOM 2602  C CA   . GLY A 1 74 ? -7.671  -1.664  -7.717  1.00 0.00 ? 111 GLY A CA   2  
ATOM 2603  C C    . GLY A 1 74 ? -7.061  -0.805  -6.636  1.00 0.00 ? 111 GLY A C    2  
ATOM 2604  O O    . GLY A 1 74 ? -6.358  -1.318  -5.758  1.00 0.00 ? 111 GLY A O    2  
ATOM 2605  H H    . GLY A 1 74 ? -7.033  -3.564  -7.066  1.00 0.00 ? 111 GLY A H    2  
ATOM 2606  H HA2  . GLY A 1 74 ? -7.595  -1.149  -8.664  1.00 0.00 ? 111 GLY A HA2  2  
ATOM 2607  H HA3  . GLY A 1 74 ? -8.714  -1.831  -7.487  1.00 0.00 ? 111 GLY A HA3  2  
ATOM 2608  N N    . ALA A 1 75 ? -7.302  0.501   -6.714  1.00 0.00 ? 112 ALA A N    2  
ATOM 2609  C CA   . ALA A 1 75 ? -6.772  1.447   -5.738  1.00 0.00 ? 112 ALA A CA   2  
ATOM 2610  C C    . ALA A 1 75 ? -7.173  1.049   -4.323  1.00 0.00 ? 112 ALA A C    2  
ATOM 2611  O O    . ALA A 1 75 ? -8.334  0.742   -4.060  1.00 0.00 ? 112 ALA A O    2  
ATOM 2612  C CB   . ALA A 1 75 ? -7.259  2.856   -6.045  1.00 0.00 ? 112 ALA A CB   2  
ATOM 2613  H H    . ALA A 1 75 ? -7.847  0.839   -7.451  1.00 0.00 ? 112 ALA A H    2  
ATOM 2614  H HA   . ALA A 1 75 ? -5.695  1.437   -5.812  1.00 0.00 ? 112 ALA A HA   2  
ATOM 2615  H HB1  . ALA A 1 75 ? -6.862  3.174   -6.998  1.00 0.00 ? 112 ALA A HB1  2  
ATOM 2616  H HB2  . ALA A 1 75 ? -8.339  2.864   -6.082  1.00 0.00 ? 112 ALA A HB2  2  
ATOM 2617  H HB3  . ALA A 1 75 ? -6.920  3.531   -5.272  1.00 0.00 ? 112 ALA A HB3  2  
ATOM 2618  N N    . VAL A 1 76 ? -6.193  1.022   -3.435  1.00 0.00 ? 113 VAL A N    2  
ATOM 2619  C CA   . VAL A 1 76 ? -6.417  0.637   -2.051  1.00 0.00 ? 113 VAL A CA   2  
ATOM 2620  C C    . VAL A 1 76 ? -6.760  1.852   -1.211  1.00 0.00 ? 113 VAL A C    2  
ATOM 2621  O O    . VAL A 1 76 ? -6.401  2.977   -1.547  1.00 0.00 ? 113 VAL A O    2  
ATOM 2622  C CB   . VAL A 1 76 ? -5.178  -0.062  -1.448  1.00 0.00 ? 113 VAL A CB   2  
ATOM 2623  C CG1  . VAL A 1 76 ? -5.491  -0.670  -0.083  1.00 0.00 ? 113 VAL A CG1  2  
ATOM 2624  C CG2  . VAL A 1 76 ? -4.667  -1.123  -2.396  1.00 0.00 ? 113 VAL A CG2  2  
ATOM 2625  H H    . VAL A 1 76 ? -5.292  1.286   -3.715  1.00 0.00 ? 113 VAL A H    2  
ATOM 2626  H HA   . VAL A 1 76 ? -7.247  -0.054  -2.027  1.00 0.00 ? 113 VAL A HA   2  
ATOM 2627  H HB   . VAL A 1 76 ? -4.398  0.674   -1.316  1.00 0.00 ? 113 VAL A HB   2  
ATOM 2628  H HG11 . VAL A 1 76 ? -6.388  -1.270  -0.153  1.00 0.00 ? 113 VAL A HG11 2  
ATOM 2629  H HG12 . VAL A 1 76 ? -4.666  -1.292  0.231   1.00 0.00 ? 113 VAL A HG12 2  
ATOM 2630  H HG13 . VAL A 1 76 ? -5.644  0.121   0.646   1.00 0.00 ? 113 VAL A HG13 2  
ATOM 2631  H HG21 . VAL A 1 76 ? -5.469  -1.428  -3.050  1.00 0.00 ? 113 VAL A HG21 2  
ATOM 2632  H HG22 . VAL A 1 76 ? -3.856  -0.717  -2.981  1.00 0.00 ? 113 VAL A HG22 2  
ATOM 2633  H HG23 . VAL A 1 76 ? -4.317  -1.972  -1.831  1.00 0.00 ? 113 VAL A HG23 2  
ATOM 2634  N N    . LYS A 1 77 ? -7.449  1.611   -0.118  1.00 0.00 ? 114 LYS A N    2  
ATOM 2635  C CA   . LYS A 1 77 ? -7.800  2.650   0.816   1.00 0.00 ? 114 LYS A CA   2  
ATOM 2636  C C    . LYS A 1 77 ? -7.945  2.064   2.196   1.00 0.00 ? 114 LYS A C    2  
ATOM 2637  O O    . LYS A 1 77 ? -8.377  0.923   2.343   1.00 0.00 ? 114 LYS A O    2  
ATOM 2638  C CB   . LYS A 1 77 ? -9.076  3.362   0.380   1.00 0.00 ? 114 LYS A CB   2  
ATOM 2639  C CG   . LYS A 1 77 ? -10.037 2.504   -0.427  1.00 0.00 ? 114 LYS A CG   2  
ATOM 2640  C CD   . LYS A 1 77 ? -10.963 1.673   0.448   1.00 0.00 ? 114 LYS A CD   2  
ATOM 2641  C CE   . LYS A 1 77 ? -12.099 2.504   1.017   1.00 0.00 ? 114 LYS A CE   2  
ATOM 2642  N NZ   . LYS A 1 77 ? -13.105 1.660   1.712   1.00 0.00 ? 114 LYS A NZ   2  
ATOM 2643  H H    . LYS A 1 77 ? -7.727  0.688   0.073   1.00 0.00 ? 114 LYS A H    2  
ATOM 2644  H HA   . LYS A 1 77 ? -6.989  3.363   0.829   1.00 0.00 ? 114 LYS A HA   2  
ATOM 2645  H HB2  . LYS A 1 77 ? -9.594  3.719   1.257   1.00 0.00 ? 114 LYS A HB2  2  
ATOM 2646  H HB3  . LYS A 1 77 ? -8.790  4.201   -0.223  1.00 0.00 ? 114 LYS A HB3  2  
ATOM 2647  H HG2  . LYS A 1 77 ? -10.635 3.148   -1.051  1.00 0.00 ? 114 LYS A HG2  2  
ATOM 2648  H HG3  . LYS A 1 77 ? -9.459  1.838   -1.052  1.00 0.00 ? 114 LYS A HG3  2  
ATOM 2649  H HD2  . LYS A 1 77 ? -11.381 0.874   -0.146  1.00 0.00 ? 114 LYS A HD2  2  
ATOM 2650  H HD3  . LYS A 1 77 ? -10.391 1.255   1.263   1.00 0.00 ? 114 LYS A HD3  2  
ATOM 2651  H HE2  . LYS A 1 77 ? -11.690 3.215   1.720   1.00 0.00 ? 114 LYS A HE2  2  
ATOM 2652  H HE3  . LYS A 1 77 ? -12.582 3.035   0.209   1.00 0.00 ? 114 LYS A HE3  2  
ATOM 2653  H HZ1  . LYS A 1 77 ? -13.215 0.743   1.215   1.00 0.00 ? 114 LYS A HZ1  2  
ATOM 2654  H HZ2  . LYS A 1 77 ? -12.804 1.477   2.692   1.00 0.00 ? 114 LYS A HZ2  2  
ATOM 2655  H HZ3  . LYS A 1 77 ? -14.026 2.146   1.729   1.00 0.00 ? 114 LYS A HZ3  2  
ATOM 2656  N N    . LEU A 1 78 ? -7.403  2.768   3.179   1.00 0.00 ? 115 LEU A N    2  
ATOM 2657  C CA   . LEU A 1 78 ? -7.365  2.266   4.536   1.00 0.00 ? 115 LEU A CA   2  
ATOM 2658  C C    . LEU A 1 78 ? -8.749  1.805   4.982   1.00 0.00 ? 115 LEU A C    2  
ATOM 2659  O O    . LEU A 1 78 ? -9.716  2.566   4.911   1.00 0.00 ? 115 LEU A O    2  
ATOM 2660  C CB   . LEU A 1 78 ? -6.877  3.371   5.468   1.00 0.00 ? 115 LEU A CB   2  
ATOM 2661  C CG   . LEU A 1 78 ? -5.630  3.049   6.283   1.00 0.00 ? 115 LEU A CG   2  
ATOM 2662  C CD1  . LEU A 1 78 ? -5.896  1.923   7.268   1.00 0.00 ? 115 LEU A CD1  2  
ATOM 2663  C CD2  . LEU A 1 78 ? -4.480  2.688   5.369   1.00 0.00 ? 115 LEU A CD2  2  
ATOM 2664  H H    . LEU A 1 78 ? -6.909  3.596   2.964   1.00 0.00 ? 115 LEU A H    2  
ATOM 2665  H HA   . LEU A 1 78 ? -6.677  1.432   4.564   1.00 0.00 ? 115 LEU A HA   2  
ATOM 2666  H HB2  . LEU A 1 78 ? -6.672  4.247   4.873   1.00 0.00 ? 115 LEU A HB2  2  
ATOM 2667  H HB3  . LEU A 1 78 ? -7.675  3.609   6.157   1.00 0.00 ? 115 LEU A HB3  2  
ATOM 2668  H HG   . LEU A 1 78 ? -5.347  3.928   6.837   1.00 0.00 ? 115 LEU A HG   2  
ATOM 2669  H HD11 . LEU A 1 78 ? -6.949  1.682   7.262   1.00 0.00 ? 115 LEU A HD11 2  
ATOM 2670  H HD12 . LEU A 1 78 ? -5.328  1.052   6.980   1.00 0.00 ? 115 LEU A HD12 2  
ATOM 2671  H HD13 . LEU A 1 78 ? -5.602  2.234   8.259   1.00 0.00 ? 115 LEU A HD13 2  
ATOM 2672  H HD21 . LEU A 1 78 ? -4.789  2.810   4.338   1.00 0.00 ? 115 LEU A HD21 2  
ATOM 2673  H HD22 . LEU A 1 78 ? -3.640  3.335   5.570   1.00 0.00 ? 115 LEU A HD22 2  
ATOM 2674  H HD23 . LEU A 1 78 ? -4.194  1.661   5.537   1.00 0.00 ? 115 LEU A HD23 2  
ATOM 2675  N N    . ALA A 1 79 ? -8.833  0.575   5.471   1.00 0.00 ? 116 ALA A N    2  
ATOM 2676  C CA   . ALA A 1 79 ? -10.092 0.059   5.984   1.00 0.00 ? 116 ALA A CA   2  
ATOM 2677  C C    . ALA A 1 79 ? -10.447 0.764   7.284   1.00 0.00 ? 116 ALA A C    2  
ATOM 2678  O O    . ALA A 1 79 ? -9.613  0.872   8.187   1.00 0.00 ? 116 ALA A O    2  
ATOM 2679  C CB   . ALA A 1 79 ? -10.023 -1.445  6.195   1.00 0.00 ? 116 ALA A CB   2  
ATOM 2680  H H    . ALA A 1 79 ? -8.021  0.025   5.537   1.00 0.00 ? 116 ALA A H    2  
ATOM 2681  H HA   . ALA A 1 79 ? -10.860 0.259   5.250   1.00 0.00 ? 116 ALA A HA   2  
ATOM 2682  H HB1  . ALA A 1 79 ? -9.860  -1.936  5.247   1.00 0.00 ? 116 ALA A HB1  2  
ATOM 2683  H HB2  . ALA A 1 79 ? -10.953 -1.787  6.624   1.00 0.00 ? 116 ALA A HB2  2  
ATOM 2684  H HB3  . ALA A 1 79 ? -9.211  -1.678  6.867   1.00 0.00 ? 116 ALA A HB3  2  
ATOM 2685  N N    . LYS A 1 80 ? -11.655 1.295   7.350   1.00 0.00 ? 117 LYS A N    2  
ATOM 2686  C CA   . LYS A 1 80 ? -12.096 2.027   8.526   1.00 0.00 ? 117 LYS A CA   2  
ATOM 2687  C C    . LYS A 1 80 ? -12.438 1.052   9.645   1.00 0.00 ? 117 LYS A C    2  
ATOM 2688  O O    . LYS A 1 80 ? -13.534 0.489   9.664   1.00 0.00 ? 117 LYS A O    2  
ATOM 2689  C CB   . LYS A 1 80 ? -13.310 2.897   8.184   1.00 0.00 ? 117 LYS A CB   2  
ATOM 2690  C CG   . LYS A 1 80 ? -13.548 4.037   9.164   1.00 0.00 ? 117 LYS A CG   2  
ATOM 2691  C CD   . LYS A 1 80 ? -12.431 5.067   9.101   1.00 0.00 ? 117 LYS A CD   2  
ATOM 2692  C CE   . LYS A 1 80 ? -12.692 6.237   10.036  1.00 0.00 ? 117 LYS A CE   2  
ATOM 2693  N NZ   . LYS A 1 80 ? -11.587 7.232   10.005  1.00 0.00 ? 117 LYS A NZ   2  
ATOM 2694  H H    . LYS A 1 80 ? -12.265 1.191   6.591   1.00 0.00 ? 117 LYS A H    2  
ATOM 2695  H HA   . LYS A 1 80 ? -11.285 2.660   8.849   1.00 0.00 ? 117 LYS A HA   2  
ATOM 2696  H HB2  . LYS A 1 80 ? -13.166 3.322   7.203   1.00 0.00 ? 117 LYS A HB2  2  
ATOM 2697  H HB3  . LYS A 1 80 ? -14.192 2.273   8.170   1.00 0.00 ? 117 LYS A HB3  2  
ATOM 2698  H HG2  . LYS A 1 80 ? -14.483 4.518   8.918   1.00 0.00 ? 117 LYS A HG2  2  
ATOM 2699  H HG3  . LYS A 1 80 ? -13.602 3.634   10.166  1.00 0.00 ? 117 LYS A HG3  2  
ATOM 2700  H HD2  . LYS A 1 80 ? -11.503 4.595   9.383   1.00 0.00 ? 117 LYS A HD2  2  
ATOM 2701  H HD3  . LYS A 1 80 ? -12.355 5.437   8.089   1.00 0.00 ? 117 LYS A HD3  2  
ATOM 2702  H HE2  . LYS A 1 80 ? -13.609 6.722   9.735   1.00 0.00 ? 117 LYS A HE2  2  
ATOM 2703  H HE3  . LYS A 1 80 ? -12.800 5.859   11.042  1.00 0.00 ? 117 LYS A HE3  2  
ATOM 2704  H HZ1  . LYS A 1 80 ? -11.399 7.535   9.025   1.00 0.00 ? 117 LYS A HZ1  2  
ATOM 2705  H HZ2  . LYS A 1 80 ? -11.841 8.070   10.571  1.00 0.00 ? 117 LYS A HZ2  2  
ATOM 2706  H HZ3  . LYS A 1 80 ? -10.714 6.815   10.398  1.00 0.00 ? 117 LYS A HZ3  2  
ATOM 2707  N N    . LYS A 1 81 ? -11.438 0.781   10.494  1.00 0.00 ? 118 LYS A N    2  
ATOM 2708  C CA   . LYS A 1 81 ? -11.526 -0.198  11.587  1.00 0.00 ? 118 LYS A CA   2  
ATOM 2709  C C    . LYS A 1 81 ? -11.772 -1.616  11.054  1.00 0.00 ? 118 LYS A C    2  
ATOM 2710  O O    . LYS A 1 81 ? -11.876 -1.824  9.840   1.00 0.00 ? 118 LYS A O    2  
ATOM 2711  C CB   . LYS A 1 81 ? -12.582 0.211   12.637  1.00 0.00 ? 118 LYS A CB   2  
ATOM 2712  C CG   . LYS A 1 81 ? -13.996 -0.271  12.368  1.00 0.00 ? 118 LYS A CG   2  
ATOM 2713  C CD   . LYS A 1 81 ? -14.994 0.418   13.280  1.00 0.00 ? 118 LYS A CD   2  
ATOM 2714  C CE   . LYS A 1 81 ? -16.410 -0.062  13.017  1.00 0.00 ? 118 LYS A CE   2  
ATOM 2715  N NZ   . LYS A 1 81 ? -16.756 -0.002  11.574  1.00 0.00 ? 118 LYS A NZ   2  
ATOM 2716  H H    . LYS A 1 81 ? -10.571 1.213   10.333  1.00 0.00 ? 118 LYS A H    2  
ATOM 2717  H HA   . LYS A 1 81 ? -10.560 -0.201  12.070  1.00 0.00 ? 118 LYS A HA   2  
ATOM 2718  H HB2  . LYS A 1 81 ? -12.277 -0.181  13.595  1.00 0.00 ? 118 LYS A HB2  2  
ATOM 2719  H HB3  . LYS A 1 81 ? -12.601 1.289   12.699  1.00 0.00 ? 118 LYS A HB3  2  
ATOM 2720  H HG2  . LYS A 1 81 ? -14.252 -0.054  11.341  1.00 0.00 ? 118 LYS A HG2  2  
ATOM 2721  H HG3  . LYS A 1 81 ? -14.042 -1.337  12.535  1.00 0.00 ? 118 LYS A HG3  2  
ATOM 2722  H HD2  . LYS A 1 81 ? -14.737 0.203   14.306  1.00 0.00 ? 118 LYS A HD2  2  
ATOM 2723  H HD3  . LYS A 1 81 ? -14.946 1.484   13.109  1.00 0.00 ? 118 LYS A HD3  2  
ATOM 2724  H HE2  . LYS A 1 81 ? -16.498 -1.081  13.355  1.00 0.00 ? 118 LYS A HE2  2  
ATOM 2725  H HE3  . LYS A 1 81 ? -17.097 0.563   13.570  1.00 0.00 ? 118 LYS A HE3  2  
ATOM 2726  H HZ1  . LYS A 1 81 ? -16.269 0.796   11.122  1.00 0.00 ? 118 LYS A HZ1  2  
ATOM 2727  H HZ2  . LYS A 1 81 ? -16.467 -0.884  11.101  1.00 0.00 ? 118 LYS A HZ2  2  
ATOM 2728  H HZ3  . LYS A 1 81 ? -17.787 0.121   11.458  1.00 0.00 ? 118 LYS A HZ3  2  
ATOM 2729  N N    . LYS A 1 82 ? -11.675 -2.599  11.944  1.00 0.00 ? 119 LYS A N    2  
ATOM 2730  C CA   . LYS A 1 82 ? -11.733 -4.007  11.551  1.00 0.00 ? 119 LYS A CA   2  
ATOM 2731  C C    . LYS A 1 82 ? -13.055 -4.342  10.873  1.00 0.00 ? 119 LYS A C    2  
ATOM 2732  O O    . LYS A 1 82 ? -13.078 -4.897  9.773   1.00 0.00 ? 119 LYS A O    2  
ATOM 2733  C CB   . LYS A 1 82 ? -11.543 -4.916  12.767  1.00 0.00 ? 119 LYS A CB   2  
ATOM 2734  C CG   . LYS A 1 82 ? -10.282 -4.620  13.565  1.00 0.00 ? 119 LYS A CG   2  
ATOM 2735  C CD   . LYS A 1 82 ? -9.045  -4.611  12.679  1.00 0.00 ? 119 LYS A CD   2  
ATOM 2736  C CE   . LYS A 1 82 ? -7.794  -4.249  13.464  1.00 0.00 ? 119 LYS A CE   2  
ATOM 2737  N NZ   . LYS A 1 82 ? -7.497  -5.239  14.533  1.00 0.00 ? 119 LYS A NZ   2  
ATOM 2738  H H    . LYS A 1 82 ? -11.456 -2.375  12.876  1.00 0.00 ? 119 LYS A H    2  
ATOM 2739  H HA   . LYS A 1 82 ? -10.930 -4.186  10.851  1.00 0.00 ? 119 LYS A HA   2  
ATOM 2740  H HB2  . LYS A 1 82 ? -12.395 -4.800  13.423  1.00 0.00 ? 119 LYS A HB2  2  
ATOM 2741  H HB3  . LYS A 1 82 ? -11.499 -5.941  12.432  1.00 0.00 ? 119 LYS A HB3  2  
ATOM 2742  H HG2  . LYS A 1 82 ? -10.383 -3.651  14.031  1.00 0.00 ? 119 LYS A HG2  2  
ATOM 2743  H HG3  . LYS A 1 82 ? -10.165 -5.378  14.325  1.00 0.00 ? 119 LYS A HG3  2  
ATOM 2744  H HD2  . LYS A 1 82 ? -8.915  -5.594  12.249  1.00 0.00 ? 119 LYS A HD2  2  
ATOM 2745  H HD3  . LYS A 1 82 ? -9.188  -3.886  11.891  1.00 0.00 ? 119 LYS A HD3  2  
ATOM 2746  H HE2  . LYS A 1 82 ? -6.958  -4.206  12.784  1.00 0.00 ? 119 LYS A HE2  2  
ATOM 2747  H HE3  . LYS A 1 82 ? -7.939  -3.277  13.916  1.00 0.00 ? 119 LYS A HE3  2  
ATOM 2748  H HZ1  . LYS A 1 82 ? -7.891  -6.172  14.282  1.00 0.00 ? 119 LYS A HZ1  2  
ATOM 2749  H HZ2  . LYS A 1 82 ? -6.465  -5.337  14.655  1.00 0.00 ? 119 LYS A HZ2  2  
ATOM 2750  H HZ3  . LYS A 1 82 ? -7.915  -4.930  15.436  1.00 0.00 ? 119 LYS A HZ3  2  
ATOM 2751  N N    . SER A 1 83 ? -14.150 -4.021  11.542  1.00 0.00 ? 120 SER A N    2  
ATOM 2752  C CA   . SER A 1 83 ? -15.471 -4.284  11.004  1.00 0.00 ? 120 SER A CA   2  
ATOM 2753  C C    . SER A 1 83 ? -15.783 -3.308  9.874   1.00 0.00 ? 120 SER A C    2  
ATOM 2754  O O    . SER A 1 83 ? -15.440 -2.125  9.955   1.00 0.00 ? 120 SER A O    2  
ATOM 2755  C CB   . SER A 1 83 ? -16.512 -4.195  12.115  1.00 0.00 ? 120 SER A CB   2  
ATOM 2756  O OG   . SER A 1 83 ? -16.404 -2.971  12.811  1.00 0.00 ? 120 SER A OG   2  
ATOM 2757  H H    . SER A 1 83 ? -14.067 -3.585  12.418  1.00 0.00 ? 120 SER A H    2  
ATOM 2758  H HA   . SER A 1 83 ? -15.469 -5.288  10.604  1.00 0.00 ? 120 SER A HA   2  
ATOM 2759  H HB2  . SER A 1 83 ? -17.501 -4.267  11.685  1.00 0.00 ? 120 SER A HB2  2  
ATOM 2760  H HB3  . SER A 1 83 ? -16.360 -5.006  12.812  1.00 0.00 ? 120 SER A HB3  2  
ATOM 2761  H HG   . SER A 1 83 ? -15.687 -3.032  13.456  1.00 0.00 ? 120 SER A HG   2  
ATOM 2762  N N    . PRO A 1 84 ? -16.346 -3.820  8.768   1.00 0.00 ? 121 PRO A N    2  
ATOM 2763  C CA   . PRO A 1 84 ? -16.602 -3.045  7.553   1.00 0.00 ? 121 PRO A CA   2  
ATOM 2764  C C    . PRO A 1 84 ? -17.264 -1.697  7.809   1.00 0.00 ? 121 PRO A C    2  
ATOM 2765  O O    . PRO A 1 84 ? -18.254 -1.592  8.545   1.00 0.00 ? 121 PRO A O    2  
ATOM 2766  C CB   . PRO A 1 84 ? -17.538 -3.943  6.732   1.00 0.00 ? 121 PRO A CB   2  
ATOM 2767  C CG   . PRO A 1 84 ? -17.796 -5.156  7.569   1.00 0.00 ? 121 PRO A CG   2  
ATOM 2768  C CD   . PRO A 1 84 ? -16.680 -5.231  8.566   1.00 0.00 ? 121 PRO A CD   2  
ATOM 2769  H HA   . PRO A 1 84 ? -15.689 -2.886  6.998   1.00 0.00 ? 121 PRO A HA   2  
ATOM 2770  H HB2  . PRO A 1 84 ? -18.451 -3.405  6.530   1.00 0.00 ? 121 PRO A HB2  2  
ATOM 2771  H HB3  . PRO A 1 84 ? -17.058 -4.204  5.801   1.00 0.00 ? 121 PRO A HB3  2  
ATOM 2772  H HG2  . PRO A 1 84 ? -18.745 -5.056  8.076   1.00 0.00 ? 121 PRO A HG2  2  
ATOM 2773  H HG3  . PRO A 1 84 ? -17.796 -6.036  6.942   1.00 0.00 ? 121 PRO A HG3  2  
ATOM 2774  H HD2  . PRO A 1 84 ? -17.021 -5.685  9.484   1.00 0.00 ? 121 PRO A HD2  2  
ATOM 2775  H HD3  . PRO A 1 84 ? -15.840 -5.772  8.158   1.00 0.00 ? 121 PRO A HD3  2  
ATOM 2776  N N    . GLU A 1 85 ? -16.731 -0.683  7.149   1.00 0.00 ? 122 GLU A N    2  
ATOM 2777  C CA   . GLU A 1 85 ? -17.252 0.670   7.220   1.00 0.00 ? 122 GLU A CA   2  
ATOM 2778  C C    . GLU A 1 85 ? -16.976 1.364   5.892   1.00 0.00 ? 122 GLU A C    2  
ATOM 2779  O O    . GLU A 1 85 ? -16.392 2.447   5.836   1.00 0.00 ? 122 GLU A O    2  
ATOM 2780  C CB   . GLU A 1 85 ? -16.605 1.438   8.381   1.00 0.00 ? 122 GLU A CB   2  
ATOM 2781  C CG   . GLU A 1 85 ? -17.589 2.241   9.219   1.00 0.00 ? 122 GLU A CG   2  
ATOM 2782  C CD   . GLU A 1 85 ? -18.152 3.457   8.507   1.00 0.00 ? 122 GLU A CD   2  
ATOM 2783  O OE1  . GLU A 1 85 ? -18.779 3.302   7.440   1.00 0.00 ? 122 GLU A OE1  2  
ATOM 2784  O OE2  . GLU A 1 85 ? -17.991 4.579   9.035   1.00 0.00 ? 122 GLU A OE2  2  
ATOM 2785  H H    . GLU A 1 85 ? -15.962 -0.859  6.566   1.00 0.00 ? 122 GLU A H    2  
ATOM 2786  H HA   . GLU A 1 85 ? -18.320 0.614   7.374   1.00 0.00 ? 122 GLU A HA   2  
ATOM 2787  H HB2  . GLU A 1 85 ? -16.107 0.733   9.028   1.00 0.00 ? 122 GLU A HB2  2  
ATOM 2788  H HB3  . GLU A 1 85 ? -15.871 2.121   7.977   1.00 0.00 ? 122 GLU A HB3  2  
ATOM 2789  H HG2  . GLU A 1 85 ? -18.413 1.597   9.490   1.00 0.00 ? 122 GLU A HG2  2  
ATOM 2790  H HG3  . GLU A 1 85 ? -17.087 2.572   10.117  1.00 0.00 ? 122 GLU A HG3  2  
ATOM 2791  N N    . VAL A 1 86 ? -17.337 0.679   4.818   1.00 0.00 ? 123 VAL A N    2  
ATOM 2792  C CA   . VAL A 1 86 ? -17.101 1.173   3.473   1.00 0.00 ? 123 VAL A CA   2  
ATOM 2793  C C    . VAL A 1 86 ? -18.328 1.915   2.967   1.00 0.00 ? 123 VAL A C    2  
ATOM 2794  O O    . VAL A 1 86 ? -19.454 1.445   3.121   1.00 0.00 ? 123 VAL A O    2  
ATOM 2795  C CB   . VAL A 1 86 ? -16.767 0.019   2.505   1.00 0.00 ? 123 VAL A CB   2  
ATOM 2796  C CG1  . VAL A 1 86 ? -16.378 0.553   1.134   1.00 0.00 ? 123 VAL A CG1  2  
ATOM 2797  C CG2  . VAL A 1 86 ? -15.662 -0.856  3.079   1.00 0.00 ? 123 VAL A CG2  2  
ATOM 2798  H H    . VAL A 1 86 ? -17.781 -0.191  4.934   1.00 0.00 ? 123 VAL A H    2  
ATOM 2799  H HA   . VAL A 1 86 ? -16.262 1.852   3.505   1.00 0.00 ? 123 VAL A HA   2  
ATOM 2800  H HB   . VAL A 1 86 ? -17.652 -0.590  2.388   1.00 0.00 ? 123 VAL A HB   2  
ATOM 2801  H HG11 . VAL A 1 86 ? -17.087 1.309   0.829   1.00 0.00 ? 123 VAL A HG11 2  
ATOM 2802  H HG12 . VAL A 1 86 ? -15.389 0.986   1.184   1.00 0.00 ? 123 VAL A HG12 2  
ATOM 2803  H HG13 . VAL A 1 86 ? -16.382 -0.255  0.418   1.00 0.00 ? 123 VAL A HG13 2  
ATOM 2804  H HG21 . VAL A 1 86 ? -15.157 -0.322  3.869   1.00 0.00 ? 123 VAL A HG21 2  
ATOM 2805  H HG22 . VAL A 1 86 ? -16.092 -1.763  3.476   1.00 0.00 ? 123 VAL A HG22 2  
ATOM 2806  H HG23 . VAL A 1 86 ? -14.954 -1.101  2.302   1.00 0.00 ? 123 VAL A HG23 2  
ATOM 2807  N N    . LYS A 1 87 ? -18.104 3.086   2.393   1.00 0.00 ? 124 LYS A N    2  
ATOM 2808  C CA   . LYS A 1 87 ? -19.194 3.902   1.875   1.00 0.00 ? 124 LYS A CA   2  
ATOM 2809  C C    . LYS A 1 87 ? -19.759 3.275   0.606   1.00 0.00 ? 124 LYS A C    2  
ATOM 2810  O O    . LYS A 1 87 ? -20.971 3.251   0.396   1.00 0.00 ? 124 LYS A O    2  
ATOM 2811  C CB   . LYS A 1 87 ? -18.729 5.343   1.631   1.00 0.00 ? 124 LYS A CB   2  
ATOM 2812  C CG   . LYS A 1 87 ? -18.521 6.138   2.917   1.00 0.00 ? 124 LYS A CG   2  
ATOM 2813  C CD   . LYS A 1 87 ? -17.345 5.614   3.733   1.00 0.00 ? 124 LYS A CD   2  
ATOM 2814  C CE   . LYS A 1 87 ? -17.403 6.084   5.178   1.00 0.00 ? 124 LYS A CE   2  
ATOM 2815  N NZ   . LYS A 1 87 ? -18.583 5.533   5.903   1.00 0.00 ? 124 LYS A NZ   2  
ATOM 2816  H H    . LYS A 1 87 ? -17.180 3.413   2.315   1.00 0.00 ? 124 LYS A H    2  
ATOM 2817  H HA   . LYS A 1 87 ? -19.973 3.911   2.624   1.00 0.00 ? 124 LYS A HA   2  
ATOM 2818  H HB2  . LYS A 1 87 ? -17.794 5.323   1.087   1.00 0.00 ? 124 LYS A HB2  2  
ATOM 2819  H HB3  . LYS A 1 87 ? -19.470 5.853   1.033   1.00 0.00 ? 124 LYS A HB3  2  
ATOM 2820  H HG2  . LYS A 1 87 ? -18.334 7.170   2.664   1.00 0.00 ? 124 LYS A HG2  2  
ATOM 2821  H HG3  . LYS A 1 87 ? -19.418 6.070   3.515   1.00 0.00 ? 124 LYS A HG3  2  
ATOM 2822  H HD2  . LYS A 1 87 ? -17.362 4.535   3.717   1.00 0.00 ? 124 LYS A HD2  2  
ATOM 2823  H HD3  . LYS A 1 87 ? -16.425 5.965   3.287   1.00 0.00 ? 124 LYS A HD3  2  
ATOM 2824  H HE2  . LYS A 1 87 ? -16.503 5.764   5.683   1.00 0.00 ? 124 LYS A HE2  2  
ATOM 2825  H HE3  . LYS A 1 87 ? -17.457 7.162   5.190   1.00 0.00 ? 124 LYS A HE3  2  
ATOM 2826  H HZ1  . LYS A 1 87 ? -19.385 5.403   5.249   1.00 0.00 ? 124 LYS A HZ1  2  
ATOM 2827  H HZ2  . LYS A 1 87 ? -18.348 4.610   6.333   1.00 0.00 ? 124 LYS A HZ2  2  
ATOM 2828  H HZ3  . LYS A 1 87 ? -18.871 6.186   6.661   1.00 0.00 ? 124 LYS A HZ3  2  
ATOM 2829  N N    . LYS A 1 88 ? -18.878 2.627   -0.145  1.00 0.00 ? 125 LYS A N    2  
ATOM 2830  C CA   . LYS A 1 88 ? -19.284 1.820   -1.283  1.00 0.00 ? 125 LYS A CA   2  
ATOM 2831  C C    . LYS A 1 88 ? -19.953 0.541   -0.784  1.00 0.00 ? 125 LYS A C    2  
ATOM 2832  O O    . LYS A 1 88 ? -19.662 0.076   0.322   1.00 0.00 ? 125 LYS A O    2  
ATOM 2833  C CB   . LYS A 1 88 ? -18.062 1.483   -2.152  1.00 0.00 ? 125 LYS A CB   2  
ATOM 2834  C CG   . LYS A 1 88 ? -18.362 0.565   -3.328  1.00 0.00 ? 125 LYS A CG   2  
ATOM 2835  C CD   . LYS A 1 88 ? -17.106 0.243   -4.120  1.00 0.00 ? 125 LYS A CD   2  
ATOM 2836  C CE   . LYS A 1 88 ? -17.378 -0.788  -5.205  1.00 0.00 ? 125 LYS A CE   2  
ATOM 2837  N NZ   . LYS A 1 88 ? -18.370 -0.309  -6.204  1.00 0.00 ? 125 LYS A NZ   2  
ATOM 2838  H H    . LYS A 1 88 ? -17.946 2.590   0.150   1.00 0.00 ? 125 LYS A H    2  
ATOM 2839  H HA   . LYS A 1 88 ? -19.993 2.387   -1.866  1.00 0.00 ? 125 LYS A HA   2  
ATOM 2840  H HB2  . LYS A 1 88 ? -17.650 2.402   -2.540  1.00 0.00 ? 125 LYS A HB2  2  
ATOM 2841  H HB3  . LYS A 1 88 ? -17.318 1.002   -1.530  1.00 0.00 ? 125 LYS A HB3  2  
ATOM 2842  H HG2  . LYS A 1 88 ? -18.785 -0.356  -2.955  1.00 0.00 ? 125 LYS A HG2  2  
ATOM 2843  H HG3  . LYS A 1 88 ? -19.072 1.052   -3.981  1.00 0.00 ? 125 LYS A HG3  2  
ATOM 2844  H HD2  . LYS A 1 88 ? -16.743 1.149   -4.584  1.00 0.00 ? 125 LYS A HD2  2  
ATOM 2845  H HD3  . LYS A 1 88 ? -16.357 -0.145  -3.447  1.00 0.00 ? 125 LYS A HD3  2  
ATOM 2846  H HE2  . LYS A 1 88 ? -16.451 -1.011  -5.709  1.00 0.00 ? 125 LYS A HE2  2  
ATOM 2847  H HE3  . LYS A 1 88 ? -17.759 -1.686  -4.738  1.00 0.00 ? 125 LYS A HE3  2  
ATOM 2848  H HZ1  . LYS A 1 88 ? -18.224 0.707   -6.401  1.00 0.00 ? 125 LYS A HZ1  2  
ATOM 2849  H HZ2  . LYS A 1 88 ? -18.265 -0.840  -7.097  1.00 0.00 ? 125 LYS A HZ2  2  
ATOM 2850  H HZ3  . LYS A 1 88 ? -19.339 -0.444  -5.846  1.00 0.00 ? 125 LYS A HZ3  2  
ATOM 2851  N N    . GLU A 1 89 ? -20.862 -0.010  -1.580  1.00 0.00 ? 126 GLU A N    2  
ATOM 2852  C CA   . GLU A 1 89 ? -21.569 -1.241  -1.231  1.00 0.00 ? 126 GLU A CA   2  
ATOM 2853  C C    . GLU A 1 89 ? -20.635 -2.456  -1.321  1.00 0.00 ? 126 GLU A C    2  
ATOM 2854  O O    . GLU A 1 89 ? -20.879 -3.393  -2.083  1.00 0.00 ? 126 GLU A O    2  
ATOM 2855  C CB   . GLU A 1 89 ? -22.766 -1.429  -2.160  1.00 0.00 ? 126 GLU A CB   2  
ATOM 2856  C CG   . GLU A 1 89 ? -23.739 -0.265  -2.116  1.00 0.00 ? 126 GLU A CG   2  
ATOM 2857  C CD   . GLU A 1 89 ? -24.761 -0.307  -3.231  1.00 0.00 ? 126 GLU A CD   2  
ATOM 2858  O OE1  . GLU A 1 89 ? -24.726 -1.251  -4.048  1.00 0.00 ? 126 GLU A OE1  2  
ATOM 2859  O OE2  . GLU A 1 89 ? -25.598 0.616   -3.306  1.00 0.00 ? 126 GLU A OE2  2  
ATOM 2860  H H    . GLU A 1 89 ? -21.070 0.431   -2.436  1.00 0.00 ? 126 GLU A H    2  
ATOM 2861  H HA   . GLU A 1 89 ? -21.923 -1.146  -0.215  1.00 0.00 ? 126 GLU A HA   2  
ATOM 2862  H HB2  . GLU A 1 89 ? -22.407 -1.537  -3.174  1.00 0.00 ? 126 GLU A HB2  2  
ATOM 2863  H HB3  . GLU A 1 89 ? -23.294 -2.326  -1.874  1.00 0.00 ? 126 GLU A HB3  2  
ATOM 2864  H HG2  . GLU A 1 89 ? -24.261 -0.287  -1.171  1.00 0.00 ? 126 GLU A HG2  2  
ATOM 2865  H HG3  . GLU A 1 89 ? -23.180 0.655   -2.195  1.00 0.00 ? 126 GLU A HG3  2  
ATOM 2866  N N    . LYS A 1 90 ? -19.511 -2.368  -0.626  1.00 0.00 ? 127 LYS A N    2  
ATOM 2867  C CA   . LYS A 1 90 ? -18.480 -3.385  -0.666  1.00 0.00 ? 127 LYS A CA   2  
ATOM 2868  C C    . LYS A 1 90 ? -18.901 -4.628  0.108   1.00 0.00 ? 127 LYS A C    2  
ATOM 2869  O O    . LYS A 1 90 ? -18.706 -5.753  -0.361  1.00 0.00 ? 127 LYS A O    2  
ATOM 2870  C CB   . LYS A 1 90 ? -17.181 -2.823  -0.078  1.00 0.00 ? 127 LYS A CB   2  
ATOM 2871  C CG   . LYS A 1 90 ? -16.025 -3.808  -0.073  1.00 0.00 ? 127 LYS A CG   2  
ATOM 2872  C CD   . LYS A 1 90 ? -15.497 -4.060  -1.474  1.00 0.00 ? 127 LYS A CD   2  
ATOM 2873  C CE   . LYS A 1 90 ? -14.371 -5.077  -1.463  1.00 0.00 ? 127 LYS A CE   2  
ATOM 2874  N NZ   . LYS A 1 90 ? -13.702 -5.176  -2.785  1.00 0.00 ? 127 LYS A NZ   2  
ATOM 2875  H H    . LYS A 1 90 ? -19.342 -1.552  -0.111  1.00 0.00 ? 127 LYS A H    2  
ATOM 2876  H HA   . LYS A 1 90 ? -18.316 -3.646  -1.695  1.00 0.00 ? 127 LYS A HA   2  
ATOM 2877  H HB2  . LYS A 1 90 ? -16.882 -1.960  -0.654  1.00 0.00 ? 127 LYS A HB2  2  
ATOM 2878  H HB3  . LYS A 1 90 ? -17.366 -2.517  0.941   1.00 0.00 ? 127 LYS A HB3  2  
ATOM 2879  H HG2  . LYS A 1 90 ? -15.227 -3.408  0.535   1.00 0.00 ? 127 LYS A HG2  2  
ATOM 2880  H HG3  . LYS A 1 90 ? -16.365 -4.744  0.349   1.00 0.00 ? 127 LYS A HG3  2  
ATOM 2881  H HD2  . LYS A 1 90 ? -16.302 -4.436  -2.088  1.00 0.00 ? 127 LYS A HD2  2  
ATOM 2882  H HD3  . LYS A 1 90 ? -15.129 -3.130  -1.882  1.00 0.00 ? 127 LYS A HD3  2  
ATOM 2883  H HE2  . LYS A 1 90 ? -13.643 -4.782  -0.723  1.00 0.00 ? 127 LYS A HE2  2  
ATOM 2884  H HE3  . LYS A 1 90 ? -14.778 -6.044  -1.203  1.00 0.00 ? 127 LYS A HE3  2  
ATOM 2885  H HZ1  . LYS A 1 90 ? -14.382 -4.977  -3.550  1.00 0.00 ? 127 LYS A HZ1  2  
ATOM 2886  H HZ2  . LYS A 1 90 ? -12.924 -4.483  -2.842  1.00 0.00 ? 127 LYS A HZ2  2  
ATOM 2887  H HZ3  . LYS A 1 90 ? -13.313 -6.132  -2.924  1.00 0.00 ? 127 LYS A HZ3  2  
ATOM 2888  N N    . GLU A 1 91 ? -19.380 -4.407  1.337   1.00 0.00 ? 128 GLU A N    2  
ATOM 2889  C CA   . GLU A 1 91 ? -19.743 -5.483  2.274   1.00 0.00 ? 128 GLU A CA   2  
ATOM 2890  C C    . GLU A 1 91 ? -18.497 -6.129  2.880   1.00 0.00 ? 128 GLU A C    2  
ATOM 2891  O O    . GLU A 1 91 ? -18.498 -6.529  4.043   1.00 0.00 ? 128 GLU A O    2  
ATOM 2892  C CB   . GLU A 1 91 ? -20.621 -6.548  1.602   1.00 0.00 ? 128 GLU A CB   2  
ATOM 2893  C CG   . GLU A 1 91 ? -21.132 -7.615  2.558   1.00 0.00 ? 128 GLU A CG   2  
ATOM 2894  C CD   . GLU A 1 91 ? -21.829 -8.748  1.838   1.00 0.00 ? 128 GLU A CD   2  
ATOM 2895  O OE1  . GLU A 1 91 ? -22.818 -8.484  1.120   1.00 0.00 ? 128 GLU A OE1  2  
ATOM 2896  O OE2  . GLU A 1 91 ? -21.380 -9.908  1.974   1.00 0.00 ? 128 GLU A OE2  2  
ATOM 2897  H H    . GLU A 1 91 ? -19.433 -3.478  1.657   1.00 0.00 ? 128 GLU A H    2  
ATOM 2898  H HA   . GLU A 1 91 ? -20.301 -5.031  3.070   1.00 0.00 ? 128 GLU A HA   2  
ATOM 2899  H HB2  . GLU A 1 91 ? -21.474 -6.061  1.152   1.00 0.00 ? 128 GLU A HB2  2  
ATOM 2900  H HB3  . GLU A 1 91 ? -20.046 -7.034  0.828   1.00 0.00 ? 128 GLU A HB3  2  
ATOM 2901  H HG2  . GLU A 1 91 ? -20.295 -8.017  3.108   1.00 0.00 ? 128 GLU A HG2  2  
ATOM 2902  H HG3  . GLU A 1 91 ? -21.829 -7.159  3.247   1.00 0.00 ? 128 GLU A HG3  2  
ATOM 2903  N N    . VAL A 1 92 ? -17.449 -6.223  2.073   1.00 0.00 ? 129 VAL A N    2  
ATOM 2904  C CA   . VAL A 1 92 ? -16.164 -6.817  2.463   1.00 0.00 ? 129 VAL A CA   2  
ATOM 2905  C C    . VAL A 1 92 ? -16.252 -8.340  2.524   1.00 0.00 ? 129 VAL A C    2  
ATOM 2906  O O    . VAL A 1 92 ? -15.487 -9.030  1.850   1.00 0.00 ? 129 VAL A O    2  
ATOM 2907  C CB   . VAL A 1 92 ? -15.635 -6.265  3.808   1.00 0.00 ? 129 VAL A CB   2  
ATOM 2908  C CG1  . VAL A 1 92 ? -14.350 -6.970  4.214   1.00 0.00 ? 129 VAL A CG1  2  
ATOM 2909  C CG2  . VAL A 1 92 ? -15.410 -4.762  3.718   1.00 0.00 ? 129 VAL A CG2  2  
ATOM 2910  H H    . VAL A 1 92 ? -17.555 -5.896  1.157   1.00 0.00 ? 129 VAL A H    2  
ATOM 2911  H HA   . VAL A 1 92 ? -15.450 -6.556  1.696   1.00 0.00 ? 129 VAL A HA   2  
ATOM 2912  H HB   . VAL A 1 92 ? -16.378 -6.452  4.570   1.00 0.00 ? 129 VAL A HB   2  
ATOM 2913  H HG11 . VAL A 1 92 ? -13.850 -7.347  3.331   1.00 0.00 ? 129 VAL A HG11 2  
ATOM 2914  H HG12 . VAL A 1 92 ? -13.702 -6.275  4.723   1.00 0.00 ? 129 VAL A HG12 2  
ATOM 2915  H HG13 . VAL A 1 92 ? -14.583 -7.794  4.873   1.00 0.00 ? 129 VAL A HG13 2  
ATOM 2916  H HG21 . VAL A 1 92 ? -15.295 -4.478  2.682   1.00 0.00 ? 129 VAL A HG21 2  
ATOM 2917  H HG22 . VAL A 1 92 ? -16.260 -4.246  4.139   1.00 0.00 ? 129 VAL A HG22 2  
ATOM 2918  H HG23 . VAL A 1 92 ? -14.519 -4.497  4.265   1.00 0.00 ? 129 VAL A HG23 2  
ATOM 2919  N N    . SER A 1 93 ? -17.253 -8.847  3.230   1.00 0.00 ? 130 SER A N    2  
ATOM 2920  C CA   . SER A 1 93 ? -17.520 -10.279 3.290   1.00 0.00 ? 130 SER A CA   2  
ATOM 2921  C C    . SER A 1 93 ? -16.303 -11.038 3.825   1.00 0.00 ? 130 SER A C    2  
ATOM 2922  O O    . SER A 1 93 ? -15.942 -10.833 5.005   1.00 0.00 ? 130 SER A O    2  
ATOM 2923  C CB   . SER A 1 93 ? -17.905 -10.798 1.899   1.00 0.00 ? 130 SER A CB   2  
ATOM 2924  O OG   . SER A 1 93 ? -18.807 -9.912  1.252   1.00 0.00 ? 130 SER A OG   2  
ATOM 2925  O OXT  . SER A 1 93 ? -15.708 -11.838 3.068   1.00 0.00 ? 130 SER A OXT  2  
ATOM 2926  H H    . SER A 1 93 ? -17.869 -8.230  3.680   1.00 0.00 ? 130 SER A H    2  
ATOM 2927  H HA   . SER A 1 93 ? -18.351 -10.432 3.962   1.00 0.00 ? 130 SER A HA   2  
ATOM 2928  H HB2  . SER A 1 93 ? -17.017 -10.891 1.293   1.00 0.00 ? 130 SER A HB2  2  
ATOM 2929  H HB3  . SER A 1 93 ? -18.376 -11.765 1.996   1.00 0.00 ? 130 SER A HB3  2  
ATOM 2930  H HG   . SER A 1 93 ? -19.664 -9.930  1.708   1.00 0.00 ? 130 SER A HG   2  
ATOM 2931  N N    . LYS A 1 2  ? 15.167  -4.205  14.888  1.00 0.00 ? 39  LYS A N    3  
ATOM 2932  C CA   . LYS A 1 2  ? 16.468  -3.854  15.504  1.00 0.00 ? 39  LYS A CA   3  
ATOM 2933  C C    . LYS A 1 2  ? 17.433  -3.297  14.459  1.00 0.00 ? 39  LYS A C    3  
ATOM 2934  O O    . LYS A 1 2  ? 18.421  -3.943  14.100  1.00 0.00 ? 39  LYS A O    3  
ATOM 2935  C CB   . LYS A 1 2  ? 17.050  -5.102  16.182  1.00 0.00 ? 39  LYS A CB   3  
ATOM 2936  C CG   . LYS A 1 2  ? 17.075  -6.340  15.300  1.00 0.00 ? 39  LYS A CG   3  
ATOM 2937  C CD   . LYS A 1 2  ? 17.767  -7.502  15.992  1.00 0.00 ? 39  LYS A CD   3  
ATOM 2938  C CE   . LYS A 1 2  ? 17.856  -8.723  15.091  1.00 0.00 ? 39  LYS A CE   3  
ATOM 2939  N NZ   . LYS A 1 2  ? 16.517  -9.286  14.776  1.00 0.00 ? 39  LYS A NZ   3  
ATOM 2940  H H1   . LYS A 1 2  ? 15.318  -4.601  13.931  1.00 0.00 ? 39  LYS A H1   3  
ATOM 2941  H H2   . LYS A 1 2  ? 14.672  -4.913  15.471  1.00 0.00 ? 39  LYS A H2   3  
ATOM 2942  H H3   . LYS A 1 2  ? 14.562  -3.358  14.806  1.00 0.00 ? 39  LYS A H3   3  
ATOM 2943  H HA   . LYS A 1 2  ? 16.293  -3.094  16.252  1.00 0.00 ? 39  LYS A HA   3  
ATOM 2944  H HB2  . LYS A 1 2  ? 18.063  -4.888  16.492  1.00 0.00 ? 39  LYS A HB2  3  
ATOM 2945  H HB3  . LYS A 1 2  ? 16.459  -5.325  17.059  1.00 0.00 ? 39  LYS A HB3  3  
ATOM 2946  H HG2  . LYS A 1 2  ? 16.059  -6.624  15.067  1.00 0.00 ? 39  LYS A HG2  3  
ATOM 2947  H HG3  . LYS A 1 2  ? 17.605  -6.106  14.385  1.00 0.00 ? 39  LYS A HG3  3  
ATOM 2948  H HD2  . LYS A 1 2  ? 18.764  -7.200  16.272  1.00 0.00 ? 39  LYS A HD2  3  
ATOM 2949  H HD3  . LYS A 1 2  ? 17.208  -7.762  16.879  1.00 0.00 ? 39  LYS A HD3  3  
ATOM 2950  H HE2  . LYS A 1 2  ? 18.344  -8.441  14.170  1.00 0.00 ? 39  LYS A HE2  3  
ATOM 2951  H HE3  . LYS A 1 2  ? 18.445  -9.480  15.592  1.00 0.00 ? 39  LYS A HE3  3  
ATOM 2952  H HZ1  . LYS A 1 2  ? 15.913  -8.560  14.327  1.00 0.00 ? 39  LYS A HZ1  3  
ATOM 2953  H HZ2  . LYS A 1 2  ? 16.612  -10.091 14.121  1.00 0.00 ? 39  LYS A HZ2  3  
ATOM 2954  H HZ3  . LYS A 1 2  ? 16.050  -9.616  15.649  1.00 0.00 ? 39  LYS A HZ3  3  
ATOM 2955  N N    . GLU A 1 3  ? 17.100  -2.122  13.929  1.00 0.00 ? 40  GLU A N    3  
ATOM 2956  C CA   . GLU A 1 3  ? 17.875  -1.497  12.862  1.00 0.00 ? 40  GLU A CA   3  
ATOM 2957  C C    . GLU A 1 3  ? 17.882  -2.409  11.642  1.00 0.00 ? 40  GLU A C    3  
ATOM 2958  O O    . GLU A 1 3  ? 18.925  -2.925  11.226  1.00 0.00 ? 40  GLU A O    3  
ATOM 2959  C CB   . GLU A 1 3  ? 19.301  -1.173  13.328  1.00 0.00 ? 40  GLU A CB   3  
ATOM 2960  C CG   . GLU A 1 3  ? 20.048  -0.233  12.390  1.00 0.00 ? 40  GLU A CG   3  
ATOM 2961  C CD   . GLU A 1 3  ? 19.380  1.126   12.257  1.00 0.00 ? 40  GLU A CD   3  
ATOM 2962  O OE1  . GLU A 1 3  ? 18.389  1.388   12.972  1.00 0.00 ? 40  GLU A OE1  3  
ATOM 2963  O OE2  . GLU A 1 3  ? 19.845  1.940   11.434  1.00 0.00 ? 40  GLU A OE2  3  
ATOM 2964  H H    . GLU A 1 3  ? 16.274  -1.683  14.232  1.00 0.00 ? 40  GLU A H    3  
ATOM 2965  H HA   . GLU A 1 3  ? 17.377  -0.575  12.597  1.00 0.00 ? 40  GLU A HA   3  
ATOM 2966  H HB2  . GLU A 1 3  ? 19.255  -0.711  14.304  1.00 0.00 ? 40  GLU A HB2  3  
ATOM 2967  H HB3  . GLU A 1 3  ? 19.863  -2.093  13.401  1.00 0.00 ? 40  GLU A HB3  3  
ATOM 2968  H HG2  . GLU A 1 3  ? 21.049  -0.087  12.769  1.00 0.00 ? 40  GLU A HG2  3  
ATOM 2969  H HG3  . GLU A 1 3  ? 20.099  -0.689  11.413  1.00 0.00 ? 40  GLU A HG3  3  
ATOM 2970  N N    . GLU A 1 4  ? 16.683  -2.704  11.165  1.00 0.00 ? 41  GLU A N    3  
ATOM 2971  C CA   . GLU A 1 4  ? 16.488  -3.647  10.071  1.00 0.00 ? 41  GLU A CA   3  
ATOM 2972  C C    . GLU A 1 4  ? 17.173  -3.162  8.810   1.00 0.00 ? 41  GLU A C    3  
ATOM 2973  O O    . GLU A 1 4  ? 17.147  -1.969  8.495   1.00 0.00 ? 41  GLU A O    3  
ATOM 2974  C CB   . GLU A 1 4  ? 15.002  -3.838  9.774   1.00 0.00 ? 41  GLU A CB   3  
ATOM 2975  C CG   . GLU A 1 4  ? 14.145  -4.124  10.990  1.00 0.00 ? 41  GLU A CG   3  
ATOM 2976  C CD   . GLU A 1 4  ? 14.576  -5.359  11.756  1.00 0.00 ? 41  GLU A CD   3  
ATOM 2977  O OE1  . GLU A 1 4  ? 15.608  -5.299  12.456  1.00 0.00 ? 41  GLU A OE1  3  
ATOM 2978  O OE2  . GLU A 1 4  ? 13.893  -6.399  11.660  1.00 0.00 ? 41  GLU A OE2  3  
ATOM 2979  H H    . GLU A 1 4  ? 15.893  -2.311  11.601  1.00 0.00 ? 41  GLU A H    3  
ATOM 2980  H HA   . GLU A 1 4  ? 16.914  -4.593  10.364  1.00 0.00 ? 41  GLU A HA   3  
ATOM 2981  H HB2  . GLU A 1 4  ? 14.628  -2.939  9.307   1.00 0.00 ? 41  GLU A HB2  3  
ATOM 2982  H HB3  . GLU A 1 4  ? 14.891  -4.660  9.082   1.00 0.00 ? 41  GLU A HB3  3  
ATOM 2983  H HG2  . GLU A 1 4  ? 14.200  -3.276  11.650  1.00 0.00 ? 41  GLU A HG2  3  
ATOM 2984  H HG3  . GLU A 1 4  ? 13.127  -4.259  10.665  1.00 0.00 ? 41  GLU A HG3  3  
ATOM 2985  N N    . ALA A 1 5  ? 17.701  -4.094  8.045   1.00 0.00 ? 42  ALA A N    3  
ATOM 2986  C CA   . ALA A 1 5  ? 18.293  -3.764  6.769   1.00 0.00 ? 42  ALA A CA   3  
ATOM 2987  C C    . ALA A 1 5  ? 17.222  -3.692  5.690   1.00 0.00 ? 42  ALA A C    3  
ATOM 2988  O O    . ALA A 1 5  ? 17.375  -2.986  4.697   1.00 0.00 ? 42  ALA A O    3  
ATOM 2989  C CB   . ALA A 1 5  ? 19.371  -4.768  6.394   1.00 0.00 ? 42  ALA A CB   3  
ATOM 2990  H H    . ALA A 1 5  ? 17.616  -5.039  8.308   1.00 0.00 ? 42  ALA A H    3  
ATOM 2991  H HA   . ALA A 1 5  ? 18.747  -2.795  6.874   1.00 0.00 ? 42  ALA A HA   3  
ATOM 2992  H HB1  . ALA A 1 5  ? 19.588  -5.397  7.245   1.00 0.00 ? 42  ALA A HB1  3  
ATOM 2993  H HB2  . ALA A 1 5  ? 19.026  -5.379  5.574   1.00 0.00 ? 42  ALA A HB2  3  
ATOM 2994  H HB3  . ALA A 1 5  ? 20.268  -4.241  6.100   1.00 0.00 ? 42  ALA A HB3  3  
ATOM 2995  N N    . SER A 1 6  ? 16.156  -4.467  5.871   1.00 0.00 ? 43  SER A N    3  
ATOM 2996  C CA   . SER A 1 6  ? 15.082  -4.525  4.888   1.00 0.00 ? 43  SER A CA   3  
ATOM 2997  C C    . SER A 1 6  ? 13.765  -4.990  5.515   1.00 0.00 ? 43  SER A C    3  
ATOM 2998  O O    . SER A 1 6  ? 12.726  -5.009  4.855   1.00 0.00 ? 43  SER A O    3  
ATOM 2999  C CB   . SER A 1 6  ? 15.482  -5.460  3.743   1.00 0.00 ? 43  SER A CB   3  
ATOM 3000  O OG   . SER A 1 6  ? 16.049  -6.662  4.244   1.00 0.00 ? 43  SER A OG   3  
ATOM 3001  H H    . SER A 1 6  ? 16.128  -5.059  6.654   1.00 0.00 ? 43  SER A H    3  
ATOM 3002  H HA   . SER A 1 6  ? 14.943  -3.532  4.490   1.00 0.00 ? 43  SER A HA   3  
ATOM 3003  H HB2  . SER A 1 6  ? 14.607  -5.705  3.158   1.00 0.00 ? 43  SER A HB2  3  
ATOM 3004  H HB3  . SER A 1 6  ? 16.210  -4.970  3.114   1.00 0.00 ? 43  SER A HB3  3  
ATOM 3005  H HG   . SER A 1 6  ? 15.391  -7.125  4.784   1.00 0.00 ? 43  SER A HG   3  
ATOM 3006  N N    . SER A 1 7  ? 13.820  -5.419  6.772   1.00 0.00 ? 44  SER A N    3  
ATOM 3007  C CA   . SER A 1 7  ? 12.645  -5.958  7.453   1.00 0.00 ? 44  SER A CA   3  
ATOM 3008  C C    . SER A 1 7  ? 11.716  -4.860  7.973   1.00 0.00 ? 44  SER A C    3  
ATOM 3009  O O    . SER A 1 7  ? 11.304  -4.881  9.135   1.00 0.00 ? 44  SER A O    3  
ATOM 3010  C CB   . SER A 1 7  ? 13.080  -6.862  8.606   1.00 0.00 ? 44  SER A CB   3  
ATOM 3011  O OG   . SER A 1 7  ? 14.022  -7.828  8.172   1.00 0.00 ? 44  SER A OG   3  
ATOM 3012  H H    . SER A 1 7  ? 14.683  -5.433  7.236   1.00 0.00 ? 44  SER A H    3  
ATOM 3013  H HA   . SER A 1 7  ? 12.100  -6.551  6.737   1.00 0.00 ? 44  SER A HA   3  
ATOM 3014  H HB2  . SER A 1 7  ? 13.531  -6.259  9.378   1.00 0.00 ? 44  SER A HB2  3  
ATOM 3015  H HB3  . SER A 1 7  ? 12.216  -7.371  9.007   1.00 0.00 ? 44  SER A HB3  3  
ATOM 3016  H HG   . SER A 1 7  ? 13.780  -8.133  7.283   1.00 0.00 ? 44  SER A HG   3  
ATOM 3017  N N    . LYS A 1 8  ? 11.289  -3.975  7.086   1.00 0.00 ? 45  LYS A N    3  
ATOM 3018  C CA   . LYS A 1 8  ? 10.278  -2.989  7.439   1.00 0.00 ? 45  LYS A CA   3  
ATOM 3019  C C    . LYS A 1 8  ? 8.898   -3.609  7.313   1.00 0.00 ? 45  LYS A C    3  
ATOM 3020  O O    . LYS A 1 8  ? 8.609   -4.283  6.324   1.00 0.00 ? 45  LYS A O    3  
ATOM 3021  C CB   . LYS A 1 8  ? 10.355  -1.755  6.540   1.00 0.00 ? 45  LYS A CB   3  
ATOM 3022  C CG   . LYS A 1 8  ? 11.653  -0.979  6.654   1.00 0.00 ? 45  LYS A CG   3  
ATOM 3023  C CD   . LYS A 1 8  ? 11.898  -0.522  8.079   1.00 0.00 ? 45  LYS A CD   3  
ATOM 3024  C CE   . LYS A 1 8  ? 12.989  0.532   8.146   1.00 0.00 ? 45  LYS A CE   3  
ATOM 3025  N NZ   . LYS A 1 8  ? 13.177  1.052   9.525   1.00 0.00 ? 45  LYS A NZ   3  
ATOM 3026  H H    . LYS A 1 8  ? 11.558  -4.073  6.147   1.00 0.00 ? 45  LYS A H    3  
ATOM 3027  H HA   . LYS A 1 8  ? 10.441  -2.694  8.466   1.00 0.00 ? 45  LYS A HA   3  
ATOM 3028  H HB2  . LYS A 1 8  ? 10.237  -2.065  5.514   1.00 0.00 ? 45  LYS A HB2  3  
ATOM 3029  H HB3  . LYS A 1 8  ? 9.540   -1.091  6.800   1.00 0.00 ? 45  LYS A HB3  3  
ATOM 3030  H HG2  . LYS A 1 8  ? 12.468  -1.615  6.344   1.00 0.00 ? 45  LYS A HG2  3  
ATOM 3031  H HG3  . LYS A 1 8  ? 11.602  -0.113  6.010   1.00 0.00 ? 45  LYS A HG3  3  
ATOM 3032  H HD2  . LYS A 1 8  ? 10.984  -0.109  8.481   1.00 0.00 ? 45  LYS A HD2  3  
ATOM 3033  H HD3  . LYS A 1 8  ? 12.199  -1.378  8.668   1.00 0.00 ? 45  LYS A HD3  3  
ATOM 3034  H HE2  . LYS A 1 8  ? 13.916  0.095   7.806   1.00 0.00 ? 45  LYS A HE2  3  
ATOM 3035  H HE3  . LYS A 1 8  ? 12.721  1.352   7.494   1.00 0.00 ? 45  LYS A HE3  3  
ATOM 3036  H HZ1  . LYS A 1 8  ? 12.282  0.986   10.061  1.00 0.00 ? 45  LYS A HZ1  3  
ATOM 3037  H HZ2  . LYS A 1 8  ? 13.909  0.497   10.018  1.00 0.00 ? 45  LYS A HZ2  3  
ATOM 3038  H HZ3  . LYS A 1 8  ? 13.479  2.050   9.496   1.00 0.00 ? 45  LYS A HZ3  3  
ATOM 3039  N N    . SER A 1 9  ? 8.029   -3.325  8.264   1.00 0.00 ? 46  SER A N    3  
ATOM 3040  C CA   . SER A 1 9  ? 6.656   -3.781  8.171   1.00 0.00 ? 46  SER A CA   3  
ATOM 3041  C C    . SER A 1 9  ? 5.926   -2.977  7.105   1.00 0.00 ? 46  SER A C    3  
ATOM 3042  O O    . SER A 1 9  ? 5.779   -1.758  7.224   1.00 0.00 ? 46  SER A O    3  
ATOM 3043  C CB   . SER A 1 9  ? 5.952   -3.643  9.520   1.00 0.00 ? 46  SER A CB   3  
ATOM 3044  O OG   . SER A 1 9  ? 6.632   -4.377  10.526  1.00 0.00 ? 46  SER A OG   3  
ATOM 3045  H H    . SER A 1 9  ? 8.289   -2.721  8.996   1.00 0.00 ? 46  SER A H    3  
ATOM 3046  H HA   . SER A 1 9  ? 6.670   -4.820  7.882   1.00 0.00 ? 46  SER A HA   3  
ATOM 3047  H HB2  . SER A 1 9  ? 5.925   -2.604  9.804   1.00 0.00 ? 46  SER A HB2  3  
ATOM 3048  H HB3  . SER A 1 9  ? 4.942   -4.019  9.437   1.00 0.00 ? 46  SER A HB3  3  
ATOM 3049  H HG   . SER A 1 9  ? 6.968   -5.207  10.144  1.00 0.00 ? 46  SER A HG   3  
ATOM 3050  N N    . TYR A 1 10 ? 5.505   -3.660  6.050   1.00 0.00 ? 47  TYR A N    3  
ATOM 3051  C CA   . TYR A 1 10 ? 4.819   -3.014  4.941   1.00 0.00 ? 47  TYR A CA   3  
ATOM 3052  C C    . TYR A 1 10 ? 3.517   -2.392  5.410   1.00 0.00 ? 47  TYR A C    3  
ATOM 3053  O O    . TYR A 1 10 ? 3.103   -1.360  4.898   1.00 0.00 ? 47  TYR A O    3  
ATOM 3054  C CB   . TYR A 1 10 ? 4.551   -3.997  3.802   1.00 0.00 ? 47  TYR A CB   3  
ATOM 3055  C CG   . TYR A 1 10 ? 5.786   -4.342  2.997   1.00 0.00 ? 47  TYR A CG   3  
ATOM 3056  C CD1  . TYR A 1 10 ? 6.889   -4.926  3.604   1.00 0.00 ? 47  TYR A CD1  3  
ATOM 3057  C CD2  . TYR A 1 10 ? 5.848   -4.084  1.635   1.00 0.00 ? 47  TYR A CD2  3  
ATOM 3058  C CE1  . TYR A 1 10 ? 8.019   -5.245  2.874   1.00 0.00 ? 47  TYR A CE1  3  
ATOM 3059  C CE2  . TYR A 1 10 ? 6.973   -4.399  0.900   1.00 0.00 ? 47  TYR A CE2  3  
ATOM 3060  C CZ   . TYR A 1 10 ? 8.050   -4.972  1.513   1.00 0.00 ? 47  TYR A CZ   3  
ATOM 3061  O OH   . TYR A 1 10 ? 9.176   -5.292  0.789   1.00 0.00 ? 47  TYR A OH   3  
ATOM 3062  H H    . TYR A 1 10 ? 5.676   -4.629  6.008   1.00 0.00 ? 47  TYR A H    3  
ATOM 3063  H HA   . TYR A 1 10 ? 5.461   -2.225  4.575   1.00 0.00 ? 47  TYR A HA   3  
ATOM 3064  H HB2  . TYR A 1 10 ? 4.158   -4.916  4.213   1.00 0.00 ? 47  TYR A HB2  3  
ATOM 3065  H HB3  . TYR A 1 10 ? 3.824   -3.568  3.130   1.00 0.00 ? 47  TYR A HB3  3  
ATOM 3066  H HD1  . TYR A 1 10 ? 6.857   -5.138  4.664   1.00 0.00 ? 47  TYR A HD1  3  
ATOM 3067  H HD2  . TYR A 1 10 ? 4.998   -3.630  1.147   1.00 0.00 ? 47  TYR A HD2  3  
ATOM 3068  H HE1  . TYR A 1 10 ? 8.868   -5.698  3.363   1.00 0.00 ? 47  TYR A HE1  3  
ATOM 3069  H HE2  . TYR A 1 10 ? 7.001   -4.190  -0.159  1.00 0.00 ? 47  TYR A HE2  3  
ATOM 3070  H HH   . TYR A 1 10 ? 9.088   -4.926  -0.097  1.00 0.00 ? 47  TYR A HH   3  
ATOM 3071  N N    . ARG A 1 11 ? 2.916   -3.000  6.424   1.00 0.00 ? 48  ARG A N    3  
ATOM 3072  C CA   . ARG A 1 11 ? 1.684   -2.493  7.015   1.00 0.00 ? 48  ARG A CA   3  
ATOM 3073  C C    . ARG A 1 11 ? 1.828   -1.024  7.403   1.00 0.00 ? 48  ARG A C    3  
ATOM 3074  O O    . ARG A 1 11 ? 0.988   -0.195  7.058   1.00 0.00 ? 48  ARG A O    3  
ATOM 3075  C CB   . ARG A 1 11 ? 1.335   -3.307  8.256   1.00 0.00 ? 48  ARG A CB   3  
ATOM 3076  C CG   . ARG A 1 11 ? -0.003  -2.934  8.859   1.00 0.00 ? 48  ARG A CG   3  
ATOM 3077  C CD   . ARG A 1 11 ? -0.189  -3.563  10.225  1.00 0.00 ? 48  ARG A CD   3  
ATOM 3078  N NE   . ARG A 1 11 ? -1.564  -3.434  10.691  1.00 0.00 ? 48  ARG A NE   3  
ATOM 3079  C CZ   . ARG A 1 11 ? -1.975  -3.757  11.911  1.00 0.00 ? 48  ARG A CZ   3  
ATOM 3080  N NH1  . ARG A 1 11 ? -1.100  -4.132  12.837  1.00 0.00 ? 48  ARG A NH1  3  
ATOM 3081  N NH2  . ARG A 1 11 ? -3.263  -3.685  12.207  1.00 0.00 ? 48  ARG A NH2  3  
ATOM 3082  H H    . ARG A 1 11 ? 3.326   -3.813  6.802   1.00 0.00 ? 48  ARG A H    3  
ATOM 3083  H HA   . ARG A 1 11 ? 0.892   -2.593  6.287   1.00 0.00 ? 48  ARG A HA   3  
ATOM 3084  H HB2  . ARG A 1 11 ? 1.309   -4.356  7.990   1.00 0.00 ? 48  ARG A HB2  3  
ATOM 3085  H HB3  . ARG A 1 11 ? 2.102   -3.153  9.003   1.00 0.00 ? 48  ARG A HB3  3  
ATOM 3086  H HG2  . ARG A 1 11 ? -0.057  -1.860  8.956   1.00 0.00 ? 48  ARG A HG2  3  
ATOM 3087  H HG3  . ARG A 1 11 ? -0.790  -3.279  8.205   1.00 0.00 ? 48  ARG A HG3  3  
ATOM 3088  H HD2  . ARG A 1 11 ? 0.067   -4.609  10.164  1.00 0.00 ? 48  ARG A HD2  3  
ATOM 3089  H HD3  . ARG A 1 11 ? 0.469   -3.071  10.926  1.00 0.00 ? 48  ARG A HD3  3  
ATOM 3090  H HE   . ARG A 1 11 ? -2.236  -3.109  10.029  1.00 0.00 ? 48  ARG A HE   3  
ATOM 3091  H HH11 . ARG A 1 11 ? -0.120  -4.171  12.619  1.00 0.00 ? 48  ARG A HH11 3  
ATOM 3092  H HH12 . ARG A 1 11 ? -1.414  -4.379  13.757  1.00 0.00 ? 48  ARG A HH12 3  
ATOM 3093  H HH21 . ARG A 1 11 ? -3.926  -3.390  11.505  1.00 0.00 ? 48  ARG A HH21 3  
ATOM 3094  H HH22 . ARG A 1 11 ? -3.584  -3.924  13.135  1.00 0.00 ? 48  ARG A HH22 3  
ATOM 3095  N N    . GLU A 1 12 ? 2.919   -0.712  8.097   1.00 0.00 ? 49  GLU A N    3  
ATOM 3096  C CA   . GLU A 1 12 ? 3.194   0.652   8.534   1.00 0.00 ? 49  GLU A CA   3  
ATOM 3097  C C    . GLU A 1 12 ? 3.357   1.563   7.333   1.00 0.00 ? 49  GLU A C    3  
ATOM 3098  O O    . GLU A 1 12 ? 2.809   2.662   7.288   1.00 0.00 ? 49  GLU A O    3  
ATOM 3099  C CB   . GLU A 1 12 ? 4.480   0.699   9.359   1.00 0.00 ? 49  GLU A CB   3  
ATOM 3100  C CG   . GLU A 1 12 ? 4.607   -0.418  10.376  1.00 0.00 ? 49  GLU A CG   3  
ATOM 3101  C CD   . GLU A 1 12 ? 3.591   -0.329  11.504  1.00 0.00 ? 49  GLU A CD   3  
ATOM 3102  O OE1  . GLU A 1 12 ? 2.720   0.568   11.472  1.00 0.00 ? 49  GLU A OE1  3  
ATOM 3103  O OE2  . GLU A 1 12 ? 3.663   -1.160  12.434  1.00 0.00 ? 49  GLU A OE2  3  
ATOM 3104  H H    . GLU A 1 12 ? 3.562   -1.417  8.310   1.00 0.00 ? 49  GLU A H    3  
ATOM 3105  H HA   . GLU A 1 12 ? 2.366   0.993   9.135   1.00 0.00 ? 49  GLU A HA   3  
ATOM 3106  H HB2  . GLU A 1 12 ? 5.324   0.636   8.687   1.00 0.00 ? 49  GLU A HB2  3  
ATOM 3107  H HB3  . GLU A 1 12 ? 4.522   1.642   9.885   1.00 0.00 ? 49  GLU A HB3  3  
ATOM 3108  H HG2  . GLU A 1 12 ? 4.468   -1.357  9.862   1.00 0.00 ? 49  GLU A HG2  3  
ATOM 3109  H HG3  . GLU A 1 12 ? 5.601   -0.387  10.796  1.00 0.00 ? 49  GLU A HG3  3  
ATOM 3110  N N    . LEU A 1 13 ? 4.139   1.091   6.378   1.00 0.00 ? 50  LEU A N    3  
ATOM 3111  C CA   . LEU A 1 13 ? 4.438   1.836   5.163   1.00 0.00 ? 50  LEU A CA   3  
ATOM 3112  C C    . LEU A 1 13 ? 3.165   2.142   4.389   1.00 0.00 ? 50  LEU A C    3  
ATOM 3113  O O    . LEU A 1 13 ? 2.935   3.275   3.962   1.00 0.00 ? 50  LEU A O    3  
ATOM 3114  C CB   . LEU A 1 13 ? 5.382   1.013   4.282   1.00 0.00 ? 50  LEU A CB   3  
ATOM 3115  C CG   . LEU A 1 13 ? 6.882   1.084   4.617   1.00 0.00 ? 50  LEU A CG   3  
ATOM 3116  C CD1  . LEU A 1 13 ? 7.139   1.278   6.100   1.00 0.00 ? 50  LEU A CD1  3  
ATOM 3117  C CD2  . LEU A 1 13 ? 7.560   -0.190  4.161   1.00 0.00 ? 50  LEU A CD2  3  
ATOM 3118  H H    . LEU A 1 13 ? 4.540   0.202   6.496   1.00 0.00 ? 50  LEU A H    3  
ATOM 3119  H HA   . LEU A 1 13 ? 4.920   2.760   5.438   1.00 0.00 ? 50  LEU A HA   3  
ATOM 3120  H HB2  . LEU A 1 13 ? 5.076   -0.020  4.346   1.00 0.00 ? 50  LEU A HB2  3  
ATOM 3121  H HB3  . LEU A 1 13 ? 5.251   1.339   3.259   1.00 0.00 ? 50  LEU A HB3  3  
ATOM 3122  H HG   . LEU A 1 13 ? 7.328   1.910   4.086   1.00 0.00 ? 50  LEU A HG   3  
ATOM 3123  H HD11 . LEU A 1 13 ? 6.316   0.870   6.666   1.00 0.00 ? 50  LEU A HD11 3  
ATOM 3124  H HD12 . LEU A 1 13 ? 8.054   0.766   6.370   1.00 0.00 ? 50  LEU A HD12 3  
ATOM 3125  H HD13 . LEU A 1 13 ? 7.237   2.331   6.312   1.00 0.00 ? 50  LEU A HD13 3  
ATOM 3126  H HD21 . LEU A 1 13 ? 7.177   -0.473  3.192   1.00 0.00 ? 50  LEU A HD21 3  
ATOM 3127  H HD22 . LEU A 1 13 ? 8.626   -0.026  4.097   1.00 0.00 ? 50  LEU A HD22 3  
ATOM 3128  H HD23 . LEU A 1 13 ? 7.357   -0.978  4.875   1.00 0.00 ? 50  LEU A HD23 3  
ATOM 3129  N N    . ILE A 1 14 ? 2.353   1.113   4.204   1.00 0.00 ? 51  ILE A N    3  
ATOM 3130  C CA   . ILE A 1 14 ? 1.118   1.233   3.457   1.00 0.00 ? 51  ILE A CA   3  
ATOM 3131  C C    . ILE A 1 14 ? 0.150   2.169   4.152   1.00 0.00 ? 51  ILE A C    3  
ATOM 3132  O O    . ILE A 1 14 ? -0.320  3.112   3.544   1.00 0.00 ? 51  ILE A O    3  
ATOM 3133  C CB   . ILE A 1 14 ? 0.449   -0.138  3.255   1.00 0.00 ? 51  ILE A CB   3  
ATOM 3134  C CG1  . ILE A 1 14 ? 1.368   -1.049  2.445   1.00 0.00 ? 51  ILE A CG1  3  
ATOM 3135  C CG2  . ILE A 1 14 ? -0.900  0.014   2.560   1.00 0.00 ? 51  ILE A CG2  3  
ATOM 3136  C CD1  . ILE A 1 14 ? 0.798   -2.425  2.214   1.00 0.00 ? 51  ILE A CD1  3  
ATOM 3137  H H    . ILE A 1 14 ? 2.608   0.234   4.565   1.00 0.00 ? 51  ILE A H    3  
ATOM 3138  H HA   . ILE A 1 14 ? 1.355   1.640   2.485   1.00 0.00 ? 51  ILE A HA   3  
ATOM 3139  H HB   . ILE A 1 14 ? 0.279   -0.580  4.225   1.00 0.00 ? 51  ILE A HB   3  
ATOM 3140  H HG12 . ILE A 1 14 ? 1.552   -0.600  1.481   1.00 0.00 ? 51  ILE A HG12 3  
ATOM 3141  H HG13 . ILE A 1 14 ? 2.307   -1.162  2.970   1.00 0.00 ? 51  ILE A HG13 3  
ATOM 3142  H HG21 . ILE A 1 14 ? -1.263  1.022   2.694   1.00 0.00 ? 51  ILE A HG21 3  
ATOM 3143  H HG22 . ILE A 1 14 ? -0.788  -0.191  1.505   1.00 0.00 ? 51  ILE A HG22 3  
ATOM 3144  H HG23 . ILE A 1 14 ? -1.605  -0.682  2.991   1.00 0.00 ? 51  ILE A HG23 3  
ATOM 3145  H HD11 . ILE A 1 14 ? -0.261  -2.413  2.432   1.00 0.00 ? 51  ILE A HD11 3  
ATOM 3146  H HD12 . ILE A 1 14 ? 0.949   -2.707  1.183   1.00 0.00 ? 51  ILE A HD12 3  
ATOM 3147  H HD13 . ILE A 1 14 ? 1.292   -3.135  2.860   1.00 0.00 ? 51  ILE A HD13 3  
ATOM 3148  N N    . ILE A 1 15 ? -0.138  1.914   5.420   1.00 0.00 ? 52  ILE A N    3  
ATOM 3149  C CA   . ILE A 1 15 ? -1.096  2.731   6.155   1.00 0.00 ? 52  ILE A CA   3  
ATOM 3150  C C    . ILE A 1 15 ? -0.661  4.189   6.232   1.00 0.00 ? 52  ILE A C    3  
ATOM 3151  O O    . ILE A 1 15 ? -1.462  5.092   5.978   1.00 0.00 ? 52  ILE A O    3  
ATOM 3152  C CB   . ILE A 1 15 ? -1.344  2.190   7.575   1.00 0.00 ? 52  ILE A CB   3  
ATOM 3153  C CG1  . ILE A 1 15 ? -2.173  0.907   7.492   1.00 0.00 ? 52  ILE A CG1  3  
ATOM 3154  C CG2  . ILE A 1 15 ? -2.044  3.242   8.422   1.00 0.00 ? 52  ILE A CG2  3  
ATOM 3155  C CD1  . ILE A 1 15 ? -2.435  0.240   8.823   1.00 0.00 ? 52  ILE A CD1  3  
ATOM 3156  H H    . ILE A 1 15 ? 0.279   1.140   5.865   1.00 0.00 ? 52  ILE A H    3  
ATOM 3157  H HA   . ILE A 1 15 ? -2.034  2.687   5.621   1.00 0.00 ? 52  ILE A HA   3  
ATOM 3158  H HB   . ILE A 1 15 ? -0.390  1.970   8.028   1.00 0.00 ? 52  ILE A HB   3  
ATOM 3159  H HG12 . ILE A 1 15 ? -3.128  1.138   7.048   1.00 0.00 ? 52  ILE A HG12 3  
ATOM 3160  H HG13 . ILE A 1 15 ? -1.654  0.197   6.863   1.00 0.00 ? 52  ILE A HG13 3  
ATOM 3161  H HG21 . ILE A 1 15 ? -1.929  4.209   7.944   1.00 0.00 ? 52  ILE A HG21 3  
ATOM 3162  H HG22 . ILE A 1 15 ? -3.091  3.002   8.503   1.00 0.00 ? 52  ILE A HG22 3  
ATOM 3163  H HG23 . ILE A 1 15 ? -1.598  3.270   9.405   1.00 0.00 ? 52  ILE A HG23 3  
ATOM 3164  H HD11 . ILE A 1 15 ? -1.500  0.091   9.342   1.00 0.00 ? 52  ILE A HD11 3  
ATOM 3165  H HD12 . ILE A 1 15 ? -3.084  0.867   9.416   1.00 0.00 ? 52  ILE A HD12 3  
ATOM 3166  H HD13 . ILE A 1 15 ? -2.914  -0.716  8.653   1.00 0.00 ? 52  ILE A HD13 3  
ATOM 3167  N N    . GLU A 1 16 ? 0.611   4.409   6.548   1.00 0.00 ? 53  GLU A N    3  
ATOM 3168  C CA   . GLU A 1 16 ? 1.163   5.757   6.654   1.00 0.00 ? 53  GLU A CA   3  
ATOM 3169  C C    . GLU A 1 16 ? 0.909   6.540   5.372   1.00 0.00 ? 53  GLU A C    3  
ATOM 3170  O O    . GLU A 1 16 ? 0.521   7.708   5.408   1.00 0.00 ? 53  GLU A O    3  
ATOM 3171  C CB   . GLU A 1 16 ? 2.659   5.672   6.944   1.00 0.00 ? 53  GLU A CB   3  
ATOM 3172  C CG   . GLU A 1 16 ? 3.317   6.999   7.282   1.00 0.00 ? 53  GLU A CG   3  
ATOM 3173  C CD   . GLU A 1 16 ? 4.673   6.819   7.938   1.00 0.00 ? 53  GLU A CD   3  
ATOM 3174  O OE1  . GLU A 1 16 ? 4.742   6.240   9.041   1.00 0.00 ? 53  GLU A OE1  3  
ATOM 3175  O OE2  . GLU A 1 16 ? 5.683   7.262   7.351   1.00 0.00 ? 53  GLU A OE2  3  
ATOM 3176  H H    . GLU A 1 16 ? 1.201   3.640   6.715   1.00 0.00 ? 53  GLU A H    3  
ATOM 3177  H HA   . GLU A 1 16 ? 0.672   6.256   7.475   1.00 0.00 ? 53  GLU A HA   3  
ATOM 3178  H HB2  . GLU A 1 16 ? 2.809   5.001   7.773   1.00 0.00 ? 53  GLU A HB2  3  
ATOM 3179  H HB3  . GLU A 1 16 ? 3.150   5.265   6.072   1.00 0.00 ? 53  GLU A HB3  3  
ATOM 3180  H HG2  . GLU A 1 16 ? 3.445   7.566   6.373   1.00 0.00 ? 53  GLU A HG2  3  
ATOM 3181  H HG3  . GLU A 1 16 ? 2.675   7.543   7.959   1.00 0.00 ? 53  GLU A HG3  3  
ATOM 3182  N N    . GLY A 1 17 ? 1.037   5.858   4.244   1.00 0.00 ? 54  GLY A N    3  
ATOM 3183  C CA   . GLY A 1 17 ? 0.725   6.469   2.977   1.00 0.00 ? 54  GLY A CA   3  
ATOM 3184  C C    . GLY A 1 17 ? -0.751  6.480   2.693   1.00 0.00 ? 54  GLY A C    3  
ATOM 3185  O O    . GLY A 1 17 ? -1.319  7.530   2.428   1.00 0.00 ? 54  GLY A O    3  
ATOM 3186  H H    . GLY A 1 17 ? 1.282   4.908   4.283   1.00 0.00 ? 54  GLY A H    3  
ATOM 3187  H HA2  . GLY A 1 17 ? 1.093   7.484   2.972   1.00 0.00 ? 54  GLY A HA2  3  
ATOM 3188  H HA3  . GLY A 1 17 ? 1.214   5.916   2.195   1.00 0.00 ? 54  GLY A HA3  3  
ATOM 3189  N N    . LEU A 1 18 ? -1.328  5.287   2.646   1.00 0.00 ? 55  LEU A N    3  
ATOM 3190  C CA   . LEU A 1 18 ? -2.717  5.061   2.247   1.00 0.00 ? 55  LEU A CA   3  
ATOM 3191  C C    . LEU A 1 18 ? -3.684  6.037   2.914   1.00 0.00 ? 55  LEU A C    3  
ATOM 3192  O O    . LEU A 1 18 ? -4.661  6.473   2.305   1.00 0.00 ? 55  LEU A O    3  
ATOM 3193  C CB   . LEU A 1 18 ? -3.088  3.626   2.609   1.00 0.00 ? 55  LEU A CB   3  
ATOM 3194  C CG   . LEU A 1 18 ? -4.345  3.073   1.958   1.00 0.00 ? 55  LEU A CG   3  
ATOM 3195  C CD1  . LEU A 1 18 ? -4.205  3.097   0.451   1.00 0.00 ? 55  LEU A CD1  3  
ATOM 3196  C CD2  . LEU A 1 18 ? -4.599  1.656   2.444   1.00 0.00 ? 55  LEU A CD2  3  
ATOM 3197  H H    . LEU A 1 18 ? -0.765  4.489   2.811   1.00 0.00 ? 55  LEU A H    3  
ATOM 3198  H HA   . LEU A 1 18 ? -2.778  5.179   1.177   1.00 0.00 ? 55  LEU A HA   3  
ATOM 3199  H HB2  . LEU A 1 18 ? -2.262  2.989   2.332   1.00 0.00 ? 55  LEU A HB2  3  
ATOM 3200  H HB3  . LEU A 1 18 ? -3.211  3.572   3.678   1.00 0.00 ? 55  LEU A HB3  3  
ATOM 3201  H HG   . LEU A 1 18 ? -5.191  3.685   2.233   1.00 0.00 ? 55  LEU A HG   3  
ATOM 3202  H HD11 . LEU A 1 18 ? -3.283  2.612   0.168   1.00 0.00 ? 55  LEU A HD11 3  
ATOM 3203  H HD12 . LEU A 1 18 ? -5.040  2.576   0.004   1.00 0.00 ? 55  LEU A HD12 3  
ATOM 3204  H HD13 . LEU A 1 18 ? -4.194  4.119   0.107   1.00 0.00 ? 55  LEU A HD13 3  
ATOM 3205  H HD21 . LEU A 1 18 ? -4.344  1.583   3.492   1.00 0.00 ? 55  LEU A HD21 3  
ATOM 3206  H HD22 . LEU A 1 18 ? -5.643  1.412   2.310   1.00 0.00 ? 55  LEU A HD22 3  
ATOM 3207  H HD23 . LEU A 1 18 ? -3.991  0.968   1.877   1.00 0.00 ? 55  LEU A HD23 3  
ATOM 3208  N N    . THR A 1 19 ? -3.400  6.380   4.158   1.00 0.00 ? 56  THR A N    3  
ATOM 3209  C CA   . THR A 1 19 ? -4.221  7.315   4.905   1.00 0.00 ? 56  THR A CA   3  
ATOM 3210  C C    . THR A 1 19 ? -4.092  8.727   4.319   1.00 0.00 ? 56  THR A C    3  
ATOM 3211  O O    . THR A 1 19 ? -5.034  9.517   4.351   1.00 0.00 ? 56  THR A O    3  
ATOM 3212  C CB   . THR A 1 19 ? -3.827  7.317   6.405   1.00 0.00 ? 56  THR A CB   3  
ATOM 3213  O OG1  . THR A 1 19 ? -4.849  7.947   7.193   1.00 0.00 ? 56  THR A OG1  3  
ATOM 3214  C CG2  . THR A 1 19 ? -2.500  8.030   6.634   1.00 0.00 ? 56  THR A CG2  3  
ATOM 3215  H H    . THR A 1 19 ? -2.596  6.013   4.580   1.00 0.00 ? 56  THR A H    3  
ATOM 3216  H HA   . THR A 1 19 ? -5.250  6.993   4.823   1.00 0.00 ? 56  THR A HA   3  
ATOM 3217  H HB   . THR A 1 19 ? -3.715  6.291   6.729   1.00 0.00 ? 56  THR A HB   3  
ATOM 3218  H HG1  . THR A 1 19 ? -5.442  7.261   7.552   1.00 0.00 ? 56  THR A HG1  3  
ATOM 3219  H HG21 . THR A 1 19 ? -2.573  9.044   6.271   1.00 0.00 ? 56  THR A HG21 3  
ATOM 3220  H HG22 . THR A 1 19 ? -2.273  8.038   7.689   1.00 0.00 ? 56  THR A HG22 3  
ATOM 3221  H HG23 . THR A 1 19 ? -1.717  7.514   6.098   1.00 0.00 ? 56  THR A HG23 3  
ATOM 3222  N N    . ALA A 1 20 ? -2.900  9.042   3.827   1.00 0.00 ? 57  ALA A N    3  
ATOM 3223  C CA   . ALA A 1 20 ? -2.599  10.369  3.311   1.00 0.00 ? 57  ALA A CA   3  
ATOM 3224  C C    . ALA A 1 20 ? -2.954  10.528  1.832   1.00 0.00 ? 57  ALA A C    3  
ATOM 3225  O O    . ALA A 1 20 ? -3.584  11.515  1.449   1.00 0.00 ? 57  ALA A O    3  
ATOM 3226  C CB   . ALA A 1 20 ? -1.128  10.689  3.534   1.00 0.00 ? 57  ALA A CB   3  
ATOM 3227  H H    . ALA A 1 20 ? -2.184  8.364   3.844   1.00 0.00 ? 57  ALA A H    3  
ATOM 3228  H HA   . ALA A 1 20 ? -3.180  11.079  3.881   1.00 0.00 ? 57  ALA A HA   3  
ATOM 3229  H HB1  . ALA A 1 20 ? -0.773  10.158  4.406   1.00 0.00 ? 57  ALA A HB1  3  
ATOM 3230  H HB2  . ALA A 1 20 ? -0.557  10.385  2.670   1.00 0.00 ? 57  ALA A HB2  3  
ATOM 3231  H HB3  . ALA A 1 20 ? -1.010  11.752  3.688   1.00 0.00 ? 57  ALA A HB3  3  
ATOM 3232  N N    . LEU A 1 21 ? -2.453  9.634   0.976   1.00 0.00 ? 58  LEU A N    3  
ATOM 3233  C CA   . LEU A 1 21 ? -2.587  9.835   -0.460  1.00 0.00 ? 58  LEU A CA   3  
ATOM 3234  C C    . LEU A 1 21 ? -3.849  9.178   -1.012  1.00 0.00 ? 58  LEU A C    3  
ATOM 3235  O O    . LEU A 1 21 ? -3.963  8.960   -2.219  1.00 0.00 ? 58  LEU A O    3  
ATOM 3236  C CB   . LEU A 1 21 ? -1.341  9.330   -1.208  1.00 0.00 ? 58  LEU A CB   3  
ATOM 3237  C CG   . LEU A 1 21 ? -1.307  7.839   -1.550  1.00 0.00 ? 58  LEU A CG   3  
ATOM 3238  C CD1  . LEU A 1 21 ? -0.299  7.580   -2.655  1.00 0.00 ? 58  LEU A CD1  3  
ATOM 3239  C CD2  . LEU A 1 21 ? -0.967  6.999   -0.353  1.00 0.00 ? 58  LEU A CD2  3  
ATOM 3240  H H    . LEU A 1 21 ? -1.903  8.889   1.308   1.00 0.00 ? 58  LEU A H    3  
ATOM 3241  H HA   . LEU A 1 21 ? -2.666  10.896  -0.624  1.00 0.00 ? 58  LEU A HA   3  
ATOM 3242  H HB2  . LEU A 1 21 ? -1.254  9.887   -2.128  1.00 0.00 ? 58  LEU A HB2  3  
ATOM 3243  H HB3  . LEU A 1 21 ? -0.476  9.550   -0.599  1.00 0.00 ? 58  LEU A HB3  3  
ATOM 3244  H HG   . LEU A 1 21 ? -2.276  7.535   -1.888  1.00 0.00 ? 58  LEU A HG   3  
ATOM 3245  H HD11 . LEU A 1 21 ? 0.577   8.191   -2.491  1.00 0.00 ? 58  LEU A HD11 3  
ATOM 3246  H HD12 . LEU A 1 21 ? -0.015  6.537   -2.648  1.00 0.00 ? 58  LEU A HD12 3  
ATOM 3247  H HD13 . LEU A 1 21 ? -0.737  7.828   -3.609  1.00 0.00 ? 58  LEU A HD13 3  
ATOM 3248  H HD21 . LEU A 1 21 ? -0.514  7.622   0.403   1.00 0.00 ? 58  LEU A HD21 3  
ATOM 3249  H HD22 . LEU A 1 21 ? -1.874  6.552   0.042   1.00 0.00 ? 58  LEU A HD22 3  
ATOM 3250  H HD23 . LEU A 1 21 ? -0.278  6.220   -0.642  1.00 0.00 ? 58  LEU A HD23 3  
ATOM 3251  N N    . LYS A 1 22 ? -4.814  8.911   -0.134  1.00 0.00 ? 59  LYS A N    3  
ATOM 3252  C CA   . LYS A 1 22 ? -6.076  8.292   -0.541  1.00 0.00 ? 59  LYS A CA   3  
ATOM 3253  C C    . LYS A 1 22 ? -6.828  9.156   -1.559  1.00 0.00 ? 59  LYS A C    3  
ATOM 3254  O O    . LYS A 1 22 ? -7.761  8.686   -2.207  1.00 0.00 ? 59  LYS A O    3  
ATOM 3255  C CB   . LYS A 1 22 ? -6.981  8.032   0.677   1.00 0.00 ? 59  LYS A CB   3  
ATOM 3256  C CG   . LYS A 1 22 ? -7.853  9.218   1.084   1.00 0.00 ? 59  LYS A CG   3  
ATOM 3257  C CD   . LYS A 1 22 ? -7.036  10.320  1.744   1.00 0.00 ? 59  LYS A CD   3  
ATOM 3258  C CE   . LYS A 1 22 ? -7.859  11.579  1.981   1.00 0.00 ? 59  LYS A CE   3  
ATOM 3259  N NZ   . LYS A 1 22 ? -9.024  11.346  2.877   1.00 0.00 ? 59  LYS A NZ   3  
ATOM 3260  H H    . LYS A 1 22 ? -4.657  9.097   0.817   1.00 0.00 ? 59  LYS A H    3  
ATOM 3261  H HA   . LYS A 1 22 ? -5.840  7.346   -1.004  1.00 0.00 ? 59  LYS A HA   3  
ATOM 3262  H HB2  . LYS A 1 22 ? -7.629  7.202   0.452   1.00 0.00 ? 59  LYS A HB2  3  
ATOM 3263  H HB3  . LYS A 1 22 ? -6.358  7.769   1.519   1.00 0.00 ? 59  LYS A HB3  3  
ATOM 3264  H HG2  . LYS A 1 22 ? -8.335  9.618   0.197   1.00 0.00 ? 59  LYS A HG2  3  
ATOM 3265  H HG3  . LYS A 1 22 ? -8.606  8.875   1.778   1.00 0.00 ? 59  LYS A HG3  3  
ATOM 3266  H HD2  . LYS A 1 22 ? -6.667  9.963   2.693   1.00 0.00 ? 59  LYS A HD2  3  
ATOM 3267  H HD3  . LYS A 1 22 ? -6.200  10.565  1.103   1.00 0.00 ? 59  LYS A HD3  3  
ATOM 3268  H HE2  . LYS A 1 22 ? -7.223  12.329  2.426   1.00 0.00 ? 59  LYS A HE2  3  
ATOM 3269  H HE3  . LYS A 1 22 ? -8.221  11.938  1.026   1.00 0.00 ? 59  LYS A HE3  3  
ATOM 3270  H HZ1  . LYS A 1 22 ? -9.212  10.328  2.973   1.00 0.00 ? 59  LYS A HZ1  3  
ATOM 3271  H HZ2  . LYS A 1 22 ? -8.833  11.742  3.825   1.00 0.00 ? 59  LYS A HZ2  3  
ATOM 3272  H HZ3  . LYS A 1 22 ? -9.872  11.808  2.488   1.00 0.00 ? 59  LYS A HZ3  3  
ATOM 3273  N N    . GLU A 1 23 ? -6.484  10.445  -1.607  1.00 0.00 ? 60  GLU A N    3  
ATOM 3274  C CA   . GLU A 1 23 ? -7.176  11.407  -2.460  1.00 0.00 ? 60  GLU A CA   3  
ATOM 3275  C C    . GLU A 1 23 ? -8.634  11.537  -2.024  1.00 0.00 ? 60  GLU A C    3  
ATOM 3276  O O    . GLU A 1 23 ? -8.914  11.954  -0.900  1.00 0.00 ? 60  GLU A O    3  
ATOM 3277  C CB   . GLU A 1 23 ? -7.090  11.007  -3.938  1.00 0.00 ? 60  GLU A CB   3  
ATOM 3278  C CG   . GLU A 1 23 ? -5.675  10.844  -4.461  1.00 0.00 ? 60  GLU A CG   3  
ATOM 3279  C CD   . GLU A 1 23 ? -5.647  10.442  -5.922  1.00 0.00 ? 60  GLU A CD   3  
ATOM 3280  O OE1  . GLU A 1 23 ? -6.120  11.230  -6.774  1.00 0.00 ? 60  GLU A OE1  3  
ATOM 3281  O OE2  . GLU A 1 23 ? -5.136  9.345   -6.228  1.00 0.00 ? 60  GLU A OE2  3  
ATOM 3282  H H    . GLU A 1 23 ? -5.783  10.768  -1.006  1.00 0.00 ? 60  GLU A H    3  
ATOM 3283  H HA   . GLU A 1 23 ? -6.690  12.365  -2.329  1.00 0.00 ? 60  GLU A HA   3  
ATOM 3284  H HB2  . GLU A 1 23 ? -7.607  10.070  -4.073  1.00 0.00 ? 60  GLU A HB2  3  
ATOM 3285  H HB3  . GLU A 1 23 ? -7.583  11.765  -4.530  1.00 0.00 ? 60  GLU A HB3  3  
ATOM 3286  H HG2  . GLU A 1 23 ? -5.150  11.782  -4.349  1.00 0.00 ? 60  GLU A HG2  3  
ATOM 3287  H HG3  . GLU A 1 23 ? -5.173  10.081  -3.883  1.00 0.00 ? 60  GLU A HG3  3  
ATOM 3288  N N    . ARG A 1 24 ? -9.550  11.134  -2.891  1.00 0.00 ? 61  ARG A N    3  
ATOM 3289  C CA   . ARG A 1 24 ? -10.972 11.179  -2.580  1.00 0.00 ? 61  ARG A CA   3  
ATOM 3290  C C    . ARG A 1 24 ? -11.351 10.092  -1.578  1.00 0.00 ? 61  ARG A C    3  
ATOM 3291  O O    . ARG A 1 24 ? -12.058 10.355  -0.600  1.00 0.00 ? 61  ARG A O    3  
ATOM 3292  C CB   . ARG A 1 24 ? -11.798 11.007  -3.858  1.00 0.00 ? 61  ARG A CB   3  
ATOM 3293  C CG   . ARG A 1 24 ? -13.301 10.989  -3.620  1.00 0.00 ? 61  ARG A CG   3  
ATOM 3294  C CD   . ARG A 1 24 ? -14.056 10.564  -4.871  1.00 0.00 ? 61  ARG A CD   3  
ATOM 3295  N NE   . ARG A 1 24 ? -13.855 11.491  -5.982  1.00 0.00 ? 61  ARG A NE   3  
ATOM 3296  C CZ   . ARG A 1 24 ? -14.420 12.693  -6.074  1.00 0.00 ? 61  ARG A CZ   3  
ATOM 3297  N NH1  . ARG A 1 24 ? -15.322 13.090  -5.178  1.00 0.00 ? 61  ARG A NH1  3  
ATOM 3298  N NH2  . ARG A 1 24 ? -14.103 13.483  -7.089  1.00 0.00 ? 61  ARG A NH2  3  
ATOM 3299  H H    . ARG A 1 24 ? -9.263  10.759  -3.751  1.00 0.00 ? 61  ARG A H    3  
ATOM 3300  H HA   . ARG A 1 24 ? -11.187 12.144  -2.148  1.00 0.00 ? 61  ARG A HA   3  
ATOM 3301  H HB2  . ARG A 1 24 ? -11.572 11.823  -4.529  1.00 0.00 ? 61  ARG A HB2  3  
ATOM 3302  H HB3  . ARG A 1 24 ? -11.519 10.077  -4.330  1.00 0.00 ? 61  ARG A HB3  3  
ATOM 3303  H HG2  . ARG A 1 24 ? -13.521 10.294  -2.825  1.00 0.00 ? 61  ARG A HG2  3  
ATOM 3304  H HG3  . ARG A 1 24 ? -13.622 11.981  -3.335  1.00 0.00 ? 61  ARG A HG3  3  
ATOM 3305  H HD2  . ARG A 1 24 ? -13.711 9.584   -5.166  1.00 0.00 ? 61  ARG A HD2  3  
ATOM 3306  H HD3  . ARG A 1 24 ? -15.110 10.518  -4.638  1.00 0.00 ? 61  ARG A HD3  3  
ATOM 3307  H HE   . ARG A 1 24 ? -13.235 11.209  -6.698  1.00 0.00 ? 61  ARG A HE   3  
ATOM 3308  H HH11 . ARG A 1 24 ? -15.593 12.479  -4.423  1.00 0.00 ? 61  ARG A HH11 3  
ATOM 3309  H HH12 . ARG A 1 24 ? -15.731 14.004  -5.246  1.00 0.00 ? 61  ARG A HH12 3  
ATOM 3310  H HH21 . ARG A 1 24 ? -13.443 13.172  -7.781  1.00 0.00 ? 61  ARG A HH21 3  
ATOM 3311  H HH22 . ARG A 1 24 ? -14.532 14.390  -7.182  1.00 0.00 ? 61  ARG A HH22 3  
ATOM 3312  N N    . LYS A 1 25 ? -10.903 8.864   -1.845  1.00 0.00 ? 62  LYS A N    3  
ATOM 3313  C CA   . LYS A 1 25 ? -11.267 7.706   -1.022  1.00 0.00 ? 62  LYS A CA   3  
ATOM 3314  C C    . LYS A 1 25 ? -10.602 6.430   -1.537  1.00 0.00 ? 62  LYS A C    3  
ATOM 3315  O O    . LYS A 1 25 ? -11.113 5.329   -1.331  1.00 0.00 ? 62  LYS A O    3  
ATOM 3316  C CB   . LYS A 1 25 ? -12.788 7.507   -1.023  1.00 0.00 ? 62  LYS A CB   3  
ATOM 3317  C CG   . LYS A 1 25 ? -13.364 7.241   -2.409  1.00 0.00 ? 62  LYS A CG   3  
ATOM 3318  C CD   . LYS A 1 25 ? -14.855 6.943   -2.354  1.00 0.00 ? 62  LYS A CD   3  
ATOM 3319  C CE   . LYS A 1 25 ? -15.647 8.136   -1.845  1.00 0.00 ? 62  LYS A CE   3  
ATOM 3320  N NZ   . LYS A 1 25 ? -17.103 7.846   -1.764  1.00 0.00 ? 62  LYS A NZ   3  
ATOM 3321  H H    . LYS A 1 25 ? -10.326 8.732   -2.625  1.00 0.00 ? 62  LYS A H    3  
ATOM 3322  H HA   . LYS A 1 25 ? -10.936 7.896   -0.013  1.00 0.00 ? 62  LYS A HA   3  
ATOM 3323  H HB2  . LYS A 1 25 ? -13.031 6.668   -0.388  1.00 0.00 ? 62  LYS A HB2  3  
ATOM 3324  H HB3  . LYS A 1 25 ? -13.260 8.394   -0.626  1.00 0.00 ? 62  LYS A HB3  3  
ATOM 3325  H HG2  . LYS A 1 25 ? -13.205 8.113   -3.025  1.00 0.00 ? 62  LYS A HG2  3  
ATOM 3326  H HG3  . LYS A 1 25 ? -12.852 6.394   -2.841  1.00 0.00 ? 62  LYS A HG3  3  
ATOM 3327  H HD2  . LYS A 1 25 ? -15.198 6.696   -3.347  1.00 0.00 ? 62  LYS A HD2  3  
ATOM 3328  H HD3  . LYS A 1 25 ? -15.022 6.105   -1.695  1.00 0.00 ? 62  LYS A HD3  3  
ATOM 3329  H HE2  . LYS A 1 25 ? -15.286 8.397   -0.863  1.00 0.00 ? 62  LYS A HE2  3  
ATOM 3330  H HE3  . LYS A 1 25 ? -15.490 8.967   -2.517  1.00 0.00 ? 62  LYS A HE3  3  
ATOM 3331  H HZ1  . LYS A 1 25 ? -17.279 6.828   -1.912  1.00 0.00 ? 62  LYS A HZ1  3  
ATOM 3332  H HZ2  . LYS A 1 25 ? -17.470 8.116   -0.828  1.00 0.00 ? 62  LYS A HZ2  3  
ATOM 3333  H HZ3  . LYS A 1 25 ? -17.618 8.386   -2.495  1.00 0.00 ? 62  LYS A HZ3  3  
ATOM 3334  N N    . GLY A 1 26 ? -9.454  6.577   -2.179  1.00 0.00 ? 63  GLY A N    3  
ATOM 3335  C CA   . GLY A 1 26 ? -8.742  5.420   -2.682  1.00 0.00 ? 63  GLY A CA   3  
ATOM 3336  C C    . GLY A 1 26 ? -7.538  5.797   -3.520  1.00 0.00 ? 63  GLY A C    3  
ATOM 3337  O O    . GLY A 1 26 ? -7.658  6.537   -4.500  1.00 0.00 ? 63  GLY A O    3  
ATOM 3338  H H    . GLY A 1 26 ? -9.072  7.478   -2.295  1.00 0.00 ? 63  GLY A H    3  
ATOM 3339  H HA2  . GLY A 1 26 ? -8.411  4.826   -1.843  1.00 0.00 ? 63  GLY A HA2  3  
ATOM 3340  H HA3  . GLY A 1 26 ? -9.416  4.829   -3.283  1.00 0.00 ? 63  GLY A HA3  3  
ATOM 3341  N N    . SER A 1 27 ? -6.389  5.261   -3.152  1.00 0.00 ? 64  SER A N    3  
ATOM 3342  C CA   . SER A 1 27 ? -5.156  5.499   -3.880  1.00 0.00 ? 64  SER A CA   3  
ATOM 3343  C C    . SER A 1 27 ? -4.673  4.219   -4.537  1.00 0.00 ? 64  SER A C    3  
ATOM 3344  O O    . SER A 1 27 ? -4.644  3.163   -3.900  1.00 0.00 ? 64  SER A O    3  
ATOM 3345  C CB   . SER A 1 27 ? -4.086  6.040   -2.936  1.00 0.00 ? 64  SER A CB   3  
ATOM 3346  O OG   . SER A 1 27 ? -4.180  5.434   -1.658  1.00 0.00 ? 64  SER A OG   3  
ATOM 3347  H H    . SER A 1 27 ? -6.372  4.655   -2.377  1.00 0.00 ? 64  SER A H    3  
ATOM 3348  H HA   . SER A 1 27 ? -5.355  6.231   -4.648  1.00 0.00 ? 64  SER A HA   3  
ATOM 3349  H HB2  . SER A 1 27 ? -3.109  5.833   -3.347  1.00 0.00 ? 64  SER A HB2  3  
ATOM 3350  H HB3  . SER A 1 27 ? -4.211  7.105   -2.826  1.00 0.00 ? 64  SER A HB3  3  
ATOM 3351  H HG   . SER A 1 27 ? -4.284  4.482   -1.762  1.00 0.00 ? 64  SER A HG   3  
ATOM 3352  N N    . SER A 1 28 ? -4.297  4.316   -5.804  1.00 0.00 ? 65  SER A N    3  
ATOM 3353  C CA   . SER A 1 28 ? -3.796  3.170   -6.543  1.00 0.00 ? 65  SER A CA   3  
ATOM 3354  C C    . SER A 1 28 ? -2.577  2.587   -5.835  1.00 0.00 ? 65  SER A C    3  
ATOM 3355  O O    . SER A 1 28 ? -1.730  3.336   -5.348  1.00 0.00 ? 65  SER A O    3  
ATOM 3356  C CB   . SER A 1 28 ? -3.427  3.587   -7.967  1.00 0.00 ? 65  SER A CB   3  
ATOM 3357  O OG   . SER A 1 28 ? -4.485  4.311   -8.580  1.00 0.00 ? 65  SER A OG   3  
ATOM 3358  H H    . SER A 1 28 ? -4.332  5.192   -6.246  1.00 0.00 ? 65  SER A H    3  
ATOM 3359  H HA   . SER A 1 28 ? -4.575  2.424   -6.578  1.00 0.00 ? 65  SER A HA   3  
ATOM 3360  H HB2  . SER A 1 28 ? -2.548  4.214   -7.940  1.00 0.00 ? 65  SER A HB2  3  
ATOM 3361  H HB3  . SER A 1 28 ? -3.222  2.706   -8.555  1.00 0.00 ? 65  SER A HB3  3  
ATOM 3362  H HG   . SER A 1 28 ? -4.597  5.163   -8.129  1.00 0.00 ? 65  SER A HG   3  
ATOM 3363  N N    . ARG A 1 29 ? -2.524  1.263   -5.717  1.00 0.00 ? 66  ARG A N    3  
ATOM 3364  C CA   . ARG A 1 29 ? -1.437  0.608   -4.990  1.00 0.00 ? 66  ARG A CA   3  
ATOM 3365  C C    . ARG A 1 29 ? -0.034  1.024   -5.496  1.00 0.00 ? 66  ARG A C    3  
ATOM 3366  O O    . ARG A 1 29 ? 0.840   1.292   -4.676  1.00 0.00 ? 66  ARG A O    3  
ATOM 3367  C CB   . ARG A 1 29 ? -1.606  -0.927  -4.958  1.00 0.00 ? 66  ARG A CB   3  
ATOM 3368  C CG   . ARG A 1 29 ? -1.720  -1.607  -6.314  1.00 0.00 ? 66  ARG A CG   3  
ATOM 3369  C CD   . ARG A 1 29 ? -1.790  -3.122  -6.168  1.00 0.00 ? 66  ARG A CD   3  
ATOM 3370  N NE   . ARG A 1 29 ? -1.716  -3.807  -7.460  1.00 0.00 ? 66  ARG A NE   3  
ATOM 3371  C CZ   . ARG A 1 29 ? -1.642  -5.133  -7.595  1.00 0.00 ? 66  ARG A CZ   3  
ATOM 3372  N NH1  . ARG A 1 29 ? -1.746  -5.922  -6.534  1.00 0.00 ? 66  ARG A NH1  3  
ATOM 3373  N NH2  . ARG A 1 29 ? -1.492  -5.680  -8.795  1.00 0.00 ? 66  ARG A NH2  3  
ATOM 3374  H H    . ARG A 1 29 ? -3.262  0.720   -6.070  1.00 0.00 ? 66  ARG A H    3  
ATOM 3375  H HA   . ARG A 1 29 ? -1.513  0.960   -3.971  1.00 0.00 ? 66  ARG A HA   3  
ATOM 3376  H HB2  . ARG A 1 29 ? -0.757  -1.353  -4.449  1.00 0.00 ? 66  ARG A HB2  3  
ATOM 3377  H HB3  . ARG A 1 29 ? -2.497  -1.160  -4.392  1.00 0.00 ? 66  ARG A HB3  3  
ATOM 3378  H HG2  . ARG A 1 29 ? -2.617  -1.260  -6.806  1.00 0.00 ? 66  ARG A HG2  3  
ATOM 3379  H HG3  . ARG A 1 29 ? -0.859  -1.351  -6.910  1.00 0.00 ? 66  ARG A HG3  3  
ATOM 3380  H HD2  . ARG A 1 29 ? -0.965  -3.450  -5.554  1.00 0.00 ? 66  ARG A HD2  3  
ATOM 3381  H HD3  . ARG A 1 29 ? -2.721  -3.383  -5.688  1.00 0.00 ? 66  ARG A HD3  3  
ATOM 3382  H HE   . ARG A 1 29 ? -1.690  -3.240  -8.272  1.00 0.00 ? 66  ARG A HE   3  
ATOM 3383  H HH11 . ARG A 1 29 ? -1.887  -5.530  -5.621  1.00 0.00 ? 66  ARG A HH11 3  
ATOM 3384  H HH12 . ARG A 1 29 ? -1.683  -6.924  -6.638  1.00 0.00 ? 66  ARG A HH12 3  
ATOM 3385  H HH21 . ARG A 1 29 ? -1.440  -5.097  -9.617  1.00 0.00 ? 66  ARG A HH21 3  
ATOM 3386  H HH22 . ARG A 1 29 ? -1.420  -6.681  -8.888  1.00 0.00 ? 66  ARG A HH22 3  
ATOM 3387  N N    . PRO A 1 30 ? 0.213   1.161   -6.830  1.00 0.00 ? 67  PRO A N    3  
ATOM 3388  C CA   . PRO A 1 30 ? 1.524   1.607   -7.332  1.00 0.00 ? 67  PRO A CA   3  
ATOM 3389  C C    . PRO A 1 30 ? 1.934   2.977   -6.780  1.00 0.00 ? 67  PRO A C    3  
ATOM 3390  O O    . PRO A 1 30 ? 3.122   3.263   -6.628  1.00 0.00 ? 67  PRO A O    3  
ATOM 3391  C CB   . PRO A 1 30 ? 1.337   1.678   -8.852  1.00 0.00 ? 67  PRO A CB   3  
ATOM 3392  C CG   . PRO A 1 30 ? -0.133  1.747   -9.056  1.00 0.00 ? 67  PRO A CG   3  
ATOM 3393  C CD   . PRO A 1 30 ? -0.732  0.944   -7.943  1.00 0.00 ? 67  PRO A CD   3  
ATOM 3394  H HA   . PRO A 1 30 ? 2.295   0.886   -7.098  1.00 0.00 ? 67  PRO A HA   3  
ATOM 3395  H HB2  . PRO A 1 30 ? 1.830   2.557   -9.237  1.00 0.00 ? 67  PRO A HB2  3  
ATOM 3396  H HB3  . PRO A 1 30 ? 1.756   0.795   -9.310  1.00 0.00 ? 67  PRO A HB3  3  
ATOM 3397  H HG2  . PRO A 1 30 ? -0.463  2.775   -9.002  1.00 0.00 ? 67  PRO A HG2  3  
ATOM 3398  H HG3  . PRO A 1 30 ? -0.393  1.317   -10.012 1.00 0.00 ? 67  PRO A HG3  3  
ATOM 3399  H HD2  . PRO A 1 30 ? -1.716  1.315   -7.695  1.00 0.00 ? 67  PRO A HD2  3  
ATOM 3400  H HD3  . PRO A 1 30 ? -0.776  -0.101  -8.210  1.00 0.00 ? 67  PRO A HD3  3  
ATOM 3401  N N    . ALA A 1 31 ? 0.947   3.810   -6.462  1.00 0.00 ? 68  ALA A N    3  
ATOM 3402  C CA   . ALA A 1 31 ? 1.206   5.133   -5.907  1.00 0.00 ? 68  ALA A CA   3  
ATOM 3403  C C    . ALA A 1 31 ? 1.908   5.024   -4.558  1.00 0.00 ? 68  ALA A C    3  
ATOM 3404  O O    . ALA A 1 31 ? 2.909   5.702   -4.313  1.00 0.00 ? 68  ALA A O    3  
ATOM 3405  C CB   . ALA A 1 31 ? -0.088  5.918   -5.769  1.00 0.00 ? 68  ALA A CB   3  
ATOM 3406  H H    . ALA A 1 31 ? 0.018   3.513   -6.572  1.00 0.00 ? 68  ALA A H    3  
ATOM 3407  H HA   . ALA A 1 31 ? 1.850   5.662   -6.595  1.00 0.00 ? 68  ALA A HA   3  
ATOM 3408  H HB1  . ALA A 1 31 ? 0.010   6.868   -6.278  1.00 0.00 ? 68  ALA A HB1  3  
ATOM 3409  H HB2  . ALA A 1 31 ? -0.295  6.089   -4.722  1.00 0.00 ? 68  ALA A HB2  3  
ATOM 3410  H HB3  . ALA A 1 31 ? -0.900  5.358   -6.210  1.00 0.00 ? 68  ALA A HB3  3  
ATOM 3411  N N    . LEU A 1 32 ? 1.399   4.141   -3.701  1.00 0.00 ? 69  LEU A N    3  
ATOM 3412  C CA   . LEU A 1 32 ? 1.997   3.908   -2.392  1.00 0.00 ? 69  LEU A CA   3  
ATOM 3413  C C    . LEU A 1 32 ? 3.438   3.439   -2.515  1.00 0.00 ? 69  LEU A C    3  
ATOM 3414  O O    . LEU A 1 32 ? 4.271   3.770   -1.678  1.00 0.00 ? 69  LEU A O    3  
ATOM 3415  C CB   . LEU A 1 32 ? 1.192   2.885   -1.586  1.00 0.00 ? 69  LEU A CB   3  
ATOM 3416  C CG   . LEU A 1 32 ? -0.117  3.403   -1.003  1.00 0.00 ? 69  LEU A CG   3  
ATOM 3417  C CD1  . LEU A 1 32 ? -1.220  3.410   -2.047  1.00 0.00 ? 69  LEU A CD1  3  
ATOM 3418  C CD2  . LEU A 1 32 ? -0.518  2.579   0.206   1.00 0.00 ? 69  LEU A CD2  3  
ATOM 3419  H H    . LEU A 1 32 ? 0.599   3.633   -3.954  1.00 0.00 ? 69  LEU A H    3  
ATOM 3420  H HA   . LEU A 1 32 ? 1.985   4.848   -1.862  1.00 0.00 ? 69  LEU A HA   3  
ATOM 3421  H HB2  . LEU A 1 32 ? 0.967   2.044   -2.230  1.00 0.00 ? 69  LEU A HB2  3  
ATOM 3422  H HB3  . LEU A 1 32 ? 1.810   2.538   -0.771  1.00 0.00 ? 69  LEU A HB3  3  
ATOM 3423  H HG   . LEU A 1 32 ? 0.030   4.421   -0.681  1.00 0.00 ? 69  LEU A HG   3  
ATOM 3424  H HD11 . LEU A 1 32 ? -1.239  2.458   -2.556  1.00 0.00 ? 69  LEU A HD11 3  
ATOM 3425  H HD12 . LEU A 1 32 ? -2.170  3.582   -1.563  1.00 0.00 ? 69  LEU A HD12 3  
ATOM 3426  H HD13 . LEU A 1 32 ? -1.031  4.197   -2.762  1.00 0.00 ? 69  LEU A HD13 3  
ATOM 3427  H HD21 . LEU A 1 32 ? 0.368   2.294   0.758   1.00 0.00 ? 69  LEU A HD21 3  
ATOM 3428  H HD22 . LEU A 1 32 ? -1.168  3.161   0.842   1.00 0.00 ? 69  LEU A HD22 3  
ATOM 3429  H HD23 . LEU A 1 32 ? -1.037  1.689   -0.122  1.00 0.00 ? 69  LEU A HD23 3  
ATOM 3430  N N    . LYS A 1 33 ? 3.735   2.683   -3.568  1.00 0.00 ? 70  LYS A N    3  
ATOM 3431  C CA   . LYS A 1 33 ? 5.090   2.190   -3.799  1.00 0.00 ? 70  LYS A CA   3  
ATOM 3432  C C    . LYS A 1 33 ? 6.079   3.345   -3.872  1.00 0.00 ? 70  LYS A C    3  
ATOM 3433  O O    . LYS A 1 33 ? 7.165   3.280   -3.301  1.00 0.00 ? 70  LYS A O    3  
ATOM 3434  C CB   . LYS A 1 33 ? 5.166   1.374   -5.089  1.00 0.00 ? 70  LYS A CB   3  
ATOM 3435  C CG   . LYS A 1 33 ? 4.235   0.176   -5.116  1.00 0.00 ? 70  LYS A CG   3  
ATOM 3436  C CD   . LYS A 1 33 ? 4.980   -1.105  -5.458  1.00 0.00 ? 70  LYS A CD   3  
ATOM 3437  C CE   . LYS A 1 33 ? 5.745   -0.986  -6.768  1.00 0.00 ? 70  LYS A CE   3  
ATOM 3438  N NZ   . LYS A 1 33 ? 4.849   -0.718  -7.923  1.00 0.00 ? 70  LYS A NZ   3  
ATOM 3439  H H    . LYS A 1 33 ? 3.027   2.461   -4.211  1.00 0.00 ? 70  LYS A H    3  
ATOM 3440  H HA   . LYS A 1 33 ? 5.356   1.556   -2.966  1.00 0.00 ? 70  LYS A HA   3  
ATOM 3441  H HB2  . LYS A 1 33 ? 4.913   2.015   -5.921  1.00 0.00 ? 70  LYS A HB2  3  
ATOM 3442  H HB3  . LYS A 1 33 ? 6.177   1.019   -5.215  1.00 0.00 ? 70  LYS A HB3  3  
ATOM 3443  H HG2  . LYS A 1 33 ? 3.778   0.066   -4.142  1.00 0.00 ? 70  LYS A HG2  3  
ATOM 3444  H HG3  . LYS A 1 33 ? 3.468   0.346   -5.859  1.00 0.00 ? 70  LYS A HG3  3  
ATOM 3445  H HD2  . LYS A 1 33 ? 5.679   -1.325  -4.664  1.00 0.00 ? 70  LYS A HD2  3  
ATOM 3446  H HD3  . LYS A 1 33 ? 4.266   -1.910  -5.542  1.00 0.00 ? 70  LYS A HD3  3  
ATOM 3447  H HE2  . LYS A 1 33 ? 6.458   -0.180  -6.682  1.00 0.00 ? 70  LYS A HE2  3  
ATOM 3448  H HE3  . LYS A 1 33 ? 6.273   -1.912  -6.942  1.00 0.00 ? 70  LYS A HE3  3  
ATOM 3449  H HZ1  . LYS A 1 33 ? 3.873   -1.002  -7.695  1.00 0.00 ? 70  LYS A HZ1  3  
ATOM 3450  H HZ2  . LYS A 1 33 ? 4.859   0.297   -8.163  1.00 0.00 ? 70  LYS A HZ2  3  
ATOM 3451  H HZ3  . LYS A 1 33 ? 5.170   -1.261  -8.755  1.00 0.00 ? 70  LYS A HZ3  3  
ATOM 3452  N N    . LYS A 1 34 ? 5.651   4.437   -4.492  1.00 0.00 ? 71  LYS A N    3  
ATOM 3453  C CA   . LYS A 1 34 ? 6.460   5.644   -4.568  1.00 0.00 ? 71  LYS A CA   3  
ATOM 3454  C C    . LYS A 1 34 ? 6.619   6.251   -3.191  1.00 0.00 ? 71  LYS A C    3  
ATOM 3455  O O    . LYS A 1 34 ? 7.732   6.498   -2.728  1.00 0.00 ? 71  LYS A O    3  
ATOM 3456  C CB   . LYS A 1 34 ? 5.797   6.657   -5.500  1.00 0.00 ? 71  LYS A CB   3  
ATOM 3457  C CG   . LYS A 1 34 ? 6.431   8.038   -5.456  1.00 0.00 ? 71  LYS A CG   3  
ATOM 3458  C CD   . LYS A 1 34 ? 5.763   8.990   -6.431  1.00 0.00 ? 71  LYS A CD   3  
ATOM 3459  C CE   . LYS A 1 34 ? 6.319   10.398  -6.296  1.00 0.00 ? 71  LYS A CE   3  
ATOM 3460  N NZ   . LYS A 1 34 ? 7.779   10.458  -6.572  1.00 0.00 ? 71  LYS A NZ   3  
ATOM 3461  H H    . LYS A 1 34 ? 4.726   4.464   -4.817  1.00 0.00 ? 71  LYS A H    3  
ATOM 3462  H HA   . LYS A 1 34 ? 7.430   5.380   -4.955  1.00 0.00 ? 71  LYS A HA   3  
ATOM 3463  H HB2  . LYS A 1 34 ? 5.853   6.288   -6.507  1.00 0.00 ? 71  LYS A HB2  3  
ATOM 3464  H HB3  . LYS A 1 34 ? 4.758   6.755   -5.221  1.00 0.00 ? 71  LYS A HB3  3  
ATOM 3465  H HG2  . LYS A 1 34 ? 6.329   8.436   -4.456  1.00 0.00 ? 71  LYS A HG2  3  
ATOM 3466  H HG3  . LYS A 1 34 ? 7.478   7.954   -5.706  1.00 0.00 ? 71  LYS A HG3  3  
ATOM 3467  H HD2  . LYS A 1 34 ? 5.937   8.639   -7.437  1.00 0.00 ? 71  LYS A HD2  3  
ATOM 3468  H HD3  . LYS A 1 34 ? 4.702   9.010   -6.231  1.00 0.00 ? 71  LYS A HD3  3  
ATOM 3469  H HE2  . LYS A 1 34 ? 5.805   11.041  -6.995  1.00 0.00 ? 71  LYS A HE2  3  
ATOM 3470  H HE3  . LYS A 1 34 ? 6.137   10.746  -5.290  1.00 0.00 ? 71  LYS A HE3  3  
ATOM 3471  H HZ1  . LYS A 1 34 ? 8.089   9.604   -7.085  1.00 0.00 ? 71  LYS A HZ1  3  
ATOM 3472  H HZ2  . LYS A 1 34 ? 7.999   11.298  -7.150  1.00 0.00 ? 71  LYS A HZ2  3  
ATOM 3473  H HZ3  . LYS A 1 34 ? 8.311   10.525  -5.675  1.00 0.00 ? 71  LYS A HZ3  3  
ATOM 3474  N N    . PHE A 1 35 ? 5.485   6.450   -2.541  1.00 0.00 ? 72  PHE A N    3  
ATOM 3475  C CA   . PHE A 1 35 ? 5.439   7.021   -1.202  1.00 0.00 ? 72  PHE A CA   3  
ATOM 3476  C C    . PHE A 1 35 ? 6.364   6.258   -0.254  1.00 0.00 ? 72  PHE A C    3  
ATOM 3477  O O    . PHE A 1 35 ? 7.076   6.856   0.557   1.00 0.00 ? 72  PHE A O    3  
ATOM 3478  C CB   . PHE A 1 35 ? 4.005   6.974   -0.673  1.00 0.00 ? 72  PHE A CB   3  
ATOM 3479  C CG   . PHE A 1 35 ? 3.827   7.650   0.654   1.00 0.00 ? 72  PHE A CG   3  
ATOM 3480  C CD1  . PHE A 1 35 ? 3.506   8.994   0.721   1.00 0.00 ? 72  PHE A CD1  3  
ATOM 3481  C CD2  . PHE A 1 35 ? 3.989   6.941   1.831   1.00 0.00 ? 72  PHE A CD2  3  
ATOM 3482  C CE1  . PHE A 1 35 ? 3.347   9.623   1.942   1.00 0.00 ? 72  PHE A CE1  3  
ATOM 3483  C CE2  . PHE A 1 35 ? 3.835   7.562   3.055   1.00 0.00 ? 72  PHE A CE2  3  
ATOM 3484  C CZ   . PHE A 1 35 ? 3.511   8.905   3.112   1.00 0.00 ? 72  PHE A CZ   3  
ATOM 3485  H H    . PHE A 1 35 ? 4.643   6.212   -2.988  1.00 0.00 ? 72  PHE A H    3  
ATOM 3486  H HA   . PHE A 1 35 ? 5.764   8.049   -1.264  1.00 0.00 ? 72  PHE A HA   3  
ATOM 3487  H HB2  . PHE A 1 35 ? 3.351   7.461   -1.381  1.00 0.00 ? 72  PHE A HB2  3  
ATOM 3488  H HB3  . PHE A 1 35 ? 3.705   5.942   -0.565  1.00 0.00 ? 72  PHE A HB3  3  
ATOM 3489  H HD1  . PHE A 1 35 ? 3.377   9.552   -0.196  1.00 0.00 ? 72  PHE A HD1  3  
ATOM 3490  H HD2  . PHE A 1 35 ? 4.243   5.892   1.784   1.00 0.00 ? 72  PHE A HD2  3  
ATOM 3491  H HE1  . PHE A 1 35 ? 3.095   10.671  1.982   1.00 0.00 ? 72  PHE A HE1  3  
ATOM 3492  H HE2  . PHE A 1 35 ? 3.964   6.997   3.967   1.00 0.00 ? 72  PHE A HE2  3  
ATOM 3493  H HZ   . PHE A 1 35 ? 3.387   9.392   4.067   1.00 0.00 ? 72  PHE A HZ   3  
ATOM 3494  N N    . ILE A 1 36 ? 6.327   4.937   -0.347  1.00 0.00 ? 73  ILE A N    3  
ATOM 3495  C CA   . ILE A 1 36 ? 7.133   4.086   0.509   1.00 0.00 ? 73  ILE A CA   3  
ATOM 3496  C C    . ILE A 1 36 ? 8.618   4.268   0.224   1.00 0.00 ? 73  ILE A C    3  
ATOM 3497  O O    . ILE A 1 36 ? 9.407   4.423   1.146   1.00 0.00 ? 73  ILE A O    3  
ATOM 3498  C CB   . ILE A 1 36 ? 6.755   2.602   0.349   1.00 0.00 ? 73  ILE A CB   3  
ATOM 3499  C CG1  . ILE A 1 36 ? 5.320   2.364   0.827   1.00 0.00 ? 73  ILE A CG1  3  
ATOM 3500  C CG2  . ILE A 1 36 ? 7.729   1.721   1.115   1.00 0.00 ? 73  ILE A CG2  3  
ATOM 3501  C CD1  . ILE A 1 36 ? 4.838   0.944   0.626   1.00 0.00 ? 73  ILE A CD1  3  
ATOM 3502  H H    . ILE A 1 36 ? 5.722   4.520   -1.003  1.00 0.00 ? 73  ILE A H    3  
ATOM 3503  H HA   . ILE A 1 36 ? 6.939   4.372   1.533   1.00 0.00 ? 73  ILE A HA   3  
ATOM 3504  H HB   . ILE A 1 36 ? 6.825   2.346   -0.700  1.00 0.00 ? 73  ILE A HB   3  
ATOM 3505  H HG12 . ILE A 1 36 ? 5.257   2.588   1.881   1.00 0.00 ? 73  ILE A HG12 3  
ATOM 3506  H HG13 . ILE A 1 36 ? 4.653   3.019   0.285   1.00 0.00 ? 73  ILE A HG13 3  
ATOM 3507  H HG21 . ILE A 1 36 ? 8.277   2.322   1.827   1.00 0.00 ? 73  ILE A HG21 3  
ATOM 3508  H HG22 . ILE A 1 36 ? 7.182   0.951   1.639   1.00 0.00 ? 73  ILE A HG22 3  
ATOM 3509  H HG23 . ILE A 1 36 ? 8.422   1.264   0.424   1.00 0.00 ? 73  ILE A HG23 3  
ATOM 3510  H HD11 . ILE A 1 36 ? 5.508   0.428   -0.050  1.00 0.00 ? 73  ILE A HD11 3  
ATOM 3511  H HD12 . ILE A 1 36 ? 4.822   0.430   1.576   1.00 0.00 ? 73  ILE A HD12 3  
ATOM 3512  H HD13 . ILE A 1 36 ? 3.842   0.955   0.207   1.00 0.00 ? 73  ILE A HD13 3  
ATOM 3513  N N    . LYS A 1 37 ? 8.994   4.259   -1.048  1.00 0.00 ? 74  LYS A N    3  
ATOM 3514  C CA   . LYS A 1 37 ? 10.395  4.416   -1.429  1.00 0.00 ? 74  LYS A CA   3  
ATOM 3515  C C    . LYS A 1 37 ? 10.956  5.753   -0.953  1.00 0.00 ? 74  LYS A C    3  
ATOM 3516  O O    . LYS A 1 37 ? 12.092  5.827   -0.486  1.00 0.00 ? 74  LYS A O    3  
ATOM 3517  C CB   . LYS A 1 37 ? 10.560  4.312   -2.943  1.00 0.00 ? 74  LYS A CB   3  
ATOM 3518  C CG   . LYS A 1 37 ? 10.179  2.959   -3.506  1.00 0.00 ? 74  LYS A CG   3  
ATOM 3519  C CD   . LYS A 1 37 ? 10.506  2.868   -4.984  1.00 0.00 ? 74  LYS A CD   3  
ATOM 3520  C CE   . LYS A 1 37 ? 10.106  1.526   -5.565  1.00 0.00 ? 74  LYS A CE   3  
ATOM 3521  N NZ   . LYS A 1 37 ? 10.513  1.401   -6.986  1.00 0.00 ? 74  LYS A NZ   3  
ATOM 3522  H H    . LYS A 1 37 ? 8.317   4.132   -1.749  1.00 0.00 ? 74  LYS A H    3  
ATOM 3523  H HA   . LYS A 1 37 ? 10.954  3.621   -0.963  1.00 0.00 ? 74  LYS A HA   3  
ATOM 3524  H HB2  . LYS A 1 37 ? 9.941   5.061   -3.414  1.00 0.00 ? 74  LYS A HB2  3  
ATOM 3525  H HB3  . LYS A 1 37 ? 11.593  4.504   -3.194  1.00 0.00 ? 74  LYS A HB3  3  
ATOM 3526  H HG2  . LYS A 1 37 ? 10.721  2.191   -2.979  1.00 0.00 ? 74  LYS A HG2  3  
ATOM 3527  H HG3  . LYS A 1 37 ? 9.116   2.810   -3.373  1.00 0.00 ? 74  LYS A HG3  3  
ATOM 3528  H HD2  . LYS A 1 37 ? 9.975   3.648   -5.508  1.00 0.00 ? 74  LYS A HD2  3  
ATOM 3529  H HD3  . LYS A 1 37 ? 11.571  3.004   -5.116  1.00 0.00 ? 74  LYS A HD3  3  
ATOM 3530  H HE2  . LYS A 1 37 ? 10.580  0.743   -4.992  1.00 0.00 ? 74  LYS A HE2  3  
ATOM 3531  H HE3  . LYS A 1 37 ? 9.031   1.422   -5.495  1.00 0.00 ? 74  LYS A HE3  3  
ATOM 3532  H HZ1  . LYS A 1 37 ? 10.551  2.342   -7.434  1.00 0.00 ? 74  LYS A HZ1  3  
ATOM 3533  H HZ2  . LYS A 1 37 ? 11.456  0.958   -7.051  1.00 0.00 ? 74  LYS A HZ2  3  
ATOM 3534  H HZ3  . LYS A 1 37 ? 9.828   0.810   -7.504  1.00 0.00 ? 74  LYS A HZ3  3  
ATOM 3535  N N    . GLU A 1 38 ? 10.176  6.809   -1.125  1.00 0.00 ? 75  GLU A N    3  
ATOM 3536  C CA   . GLU A 1 38 ? 10.621  8.153   -0.784  1.00 0.00 ? 75  GLU A CA   3  
ATOM 3537  C C    . GLU A 1 38 ? 10.823  8.312   0.721   1.00 0.00 ? 75  GLU A C    3  
ATOM 3538  O O    . GLU A 1 38 ? 11.708  9.043   1.165   1.00 0.00 ? 75  GLU A O    3  
ATOM 3539  C CB   . GLU A 1 38 ? 9.615   9.186   -1.293  1.00 0.00 ? 75  GLU A CB   3  
ATOM 3540  C CG   . GLU A 1 38 ? 9.378   9.107   -2.794  1.00 0.00 ? 75  GLU A CG   3  
ATOM 3541  C CD   . GLU A 1 38 ? 8.457   10.193  -3.299  1.00 0.00 ? 75  GLU A CD   3  
ATOM 3542  O OE1  . GLU A 1 38 ? 7.290   10.242  -2.852  1.00 0.00 ? 75  GLU A OE1  3  
ATOM 3543  O OE2  . GLU A 1 38 ? 8.888   11.004  -4.141  1.00 0.00 ? 75  GLU A OE2  3  
ATOM 3544  H H    . GLU A 1 38 ? 9.294   6.689   -1.546  1.00 0.00 ? 75  GLU A H    3  
ATOM 3545  H HA   . GLU A 1 38 ? 11.566  8.320   -1.277  1.00 0.00 ? 75  GLU A HA   3  
ATOM 3546  H HB2  . GLU A 1 38 ? 8.671   9.030   -0.793  1.00 0.00 ? 75  GLU A HB2  3  
ATOM 3547  H HB3  . GLU A 1 38 ? 9.979   10.174  -1.059  1.00 0.00 ? 75  GLU A HB3  3  
ATOM 3548  H HG2  . GLU A 1 38 ? 10.326  9.197   -3.301  1.00 0.00 ? 75  GLU A HG2  3  
ATOM 3549  H HG3  . GLU A 1 38 ? 8.938   8.148   -3.026  1.00 0.00 ? 75  GLU A HG3  3  
ATOM 3550  N N    . ASN A 1 39 ? 9.963   7.674   1.501   1.00 0.00 ? 76  ASN A N    3  
ATOM 3551  C CA   . ASN A 1 39 ? 9.999   7.819   2.953   1.00 0.00 ? 76  ASN A CA   3  
ATOM 3552  C C    . ASN A 1 39 ? 10.827  6.721   3.612   1.00 0.00 ? 76  ASN A C    3  
ATOM 3553  O O    . ASN A 1 39 ? 11.461  6.943   4.645   1.00 0.00 ? 76  ASN A O    3  
ATOM 3554  C CB   . ASN A 1 39 ? 8.577   7.819   3.514   1.00 0.00 ? 76  ASN A CB   3  
ATOM 3555  C CG   . ASN A 1 39 ? 7.843   9.109   3.212   1.00 0.00 ? 76  ASN A CG   3  
ATOM 3556  O OD1  . ASN A 1 39 ? 8.129   10.155  3.799   1.00 0.00 ? 76  ASN A OD1  3  
ATOM 3557  N ND2  . ASN A 1 39 ? 6.918   9.061   2.267   1.00 0.00 ? 76  ASN A ND2  3  
ATOM 3558  H H    . ASN A 1 39 ? 9.250   7.140   1.089   1.00 0.00 ? 76  ASN A H    3  
ATOM 3559  H HA   . ASN A 1 39 ? 10.456  8.771   3.175   1.00 0.00 ? 76  ASN A HA   3  
ATOM 3560  H HB2  . ASN A 1 39 ? 8.023   7.000   3.077   1.00 0.00 ? 76  ASN A HB2  3  
ATOM 3561  H HB3  . ASN A 1 39 ? 8.618   7.690   4.586   1.00 0.00 ? 76  ASN A HB3  3  
ATOM 3562  H HD21 . ASN A 1 39 ? 6.763   8.200   1.814   1.00 0.00 ? 76  ASN A HD21 3  
ATOM 3563  H HD22 . ASN A 1 39 ? 6.428   9.881   2.056   1.00 0.00 ? 76  ASN A HD22 3  
ATOM 3564  N N    . TYR A 1 40 ? 10.797  5.530   3.031   1.00 0.00 ? 77  TYR A N    3  
ATOM 3565  C CA   . TYR A 1 40 ? 11.520  4.386   3.573   1.00 0.00 ? 77  TYR A CA   3  
ATOM 3566  C C    . TYR A 1 40 ? 12.348  3.709   2.481   1.00 0.00 ? 77  TYR A C    3  
ATOM 3567  O O    . TYR A 1 40 ? 11.979  2.637   1.994   1.00 0.00 ? 77  TYR A O    3  
ATOM 3568  C CB   . TYR A 1 40 ? 10.557  3.355   4.181   1.00 0.00 ? 77  TYR A CB   3  
ATOM 3569  C CG   . TYR A 1 40 ? 9.717   3.876   5.327   1.00 0.00 ? 77  TYR A CG   3  
ATOM 3570  C CD1  . TYR A 1 40 ? 8.588   4.651   5.095   1.00 0.00 ? 77  TYR A CD1  3  
ATOM 3571  C CD2  . TYR A 1 40 ? 10.041  3.566   6.641   1.00 0.00 ? 77  TYR A CD2  3  
ATOM 3572  C CE1  . TYR A 1 40 ? 7.810   5.110   6.138   1.00 0.00 ? 77  TYR A CE1  3  
ATOM 3573  C CE2  . TYR A 1 40 ? 9.267   4.019   7.691   1.00 0.00 ? 77  TYR A CE2  3  
ATOM 3574  C CZ   . TYR A 1 40 ? 8.154   4.791   7.433   1.00 0.00 ? 77  TYR A CZ   3  
ATOM 3575  O OH   . TYR A 1 40 ? 7.379   5.247   8.478   1.00 0.00 ? 77  TYR A OH   3  
ATOM 3576  H H    . TYR A 1 40 ? 10.259  5.405   2.215   1.00 0.00 ? 77  TYR A H    3  
ATOM 3577  H HA   . TYR A 1 40 ? 12.184  4.746   4.344   1.00 0.00 ? 77  TYR A HA   3  
ATOM 3578  H HB2  . TYR A 1 40 ? 9.884   3.013   3.411   1.00 0.00 ? 77  TYR A HB2  3  
ATOM 3579  H HB3  . TYR A 1 40 ? 11.131  2.517   4.545   1.00 0.00 ? 77  TYR A HB3  3  
ATOM 3580  H HD1  . TYR A 1 40 ? 8.321   4.897   4.078   1.00 0.00 ? 77  TYR A HD1  3  
ATOM 3581  H HD2  . TYR A 1 40 ? 10.915  2.964   6.838   1.00 0.00 ? 77  TYR A HD2  3  
ATOM 3582  H HE1  . TYR A 1 40 ? 6.939   5.713   5.936   1.00 0.00 ? 77  TYR A HE1  3  
ATOM 3583  H HE2  . TYR A 1 40 ? 9.534   3.766   8.704   1.00 0.00 ? 77  TYR A HE2  3  
ATOM 3584  H HH   . TYR A 1 40 ? 6.692   5.848   8.134   1.00 0.00 ? 77  TYR A HH   3  
ATOM 3585  N N    . PRO A 1 41 ? 13.488  4.311   2.097   1.00 0.00 ? 78  PRO A N    3  
ATOM 3586  C CA   . PRO A 1 41 ? 14.382  3.755   1.068   1.00 0.00 ? 78  PRO A CA   3  
ATOM 3587  C C    . PRO A 1 41 ? 14.847  2.338   1.402   1.00 0.00 ? 78  PRO A C    3  
ATOM 3588  O O    . PRO A 1 41 ? 15.232  1.574   0.516   1.00 0.00 ? 78  PRO A O    3  
ATOM 3589  C CB   . PRO A 1 41 ? 15.575  4.716   1.054   1.00 0.00 ? 78  PRO A CB   3  
ATOM 3590  C CG   . PRO A 1 41 ? 15.474  5.492   2.324   1.00 0.00 ? 78  PRO A CG   3  
ATOM 3591  C CD   . PRO A 1 41 ? 14.011  5.572   2.640   1.00 0.00 ? 78  PRO A CD   3  
ATOM 3592  H HA   . PRO A 1 41 ? 13.909  3.753   0.097   1.00 0.00 ? 78  PRO A HA   3  
ATOM 3593  H HB2  . PRO A 1 41 ? 16.494  4.149   1.012   1.00 0.00 ? 78  PRO A HB2  3  
ATOM 3594  H HB3  . PRO A 1 41 ? 15.506  5.361   0.193   1.00 0.00 ? 78  PRO A HB3  3  
ATOM 3595  H HG2  . PRO A 1 41 ? 16.001  4.975   3.114   1.00 0.00 ? 78  PRO A HG2  3  
ATOM 3596  H HG3  . PRO A 1 41 ? 15.881  6.482   2.185   1.00 0.00 ? 78  PRO A HG3  3  
ATOM 3597  H HD2  . PRO A 1 41 ? 13.856  5.629   3.707   1.00 0.00 ? 78  PRO A HD2  3  
ATOM 3598  H HD3  . PRO A 1 41 ? 13.562  6.420   2.145   1.00 0.00 ? 78  PRO A HD3  3  
ATOM 3599  N N    . ILE A 1 42 ? 14.772  1.997   2.686   1.00 0.00 ? 79  ILE A N    3  
ATOM 3600  C CA   . ILE A 1 42 ? 15.130  0.672   3.173   1.00 0.00 ? 79  ILE A CA   3  
ATOM 3601  C C    . ILE A 1 42 ? 14.393  -0.403  2.386   1.00 0.00 ? 79  ILE A C    3  
ATOM 3602  O O    . ILE A 1 42 ? 14.974  -1.127  1.581   1.00 0.00 ? 79  ILE A O    3  
ATOM 3603  C CB   . ILE A 1 42 ? 14.737  0.506   4.659   1.00 0.00 ? 79  ILE A CB   3  
ATOM 3604  C CG1  . ILE A 1 42 ? 15.357  1.605   5.534   1.00 0.00 ? 79  ILE A CG1  3  
ATOM 3605  C CG2  . ILE A 1 42 ? 15.154  -0.861  5.168   1.00 0.00 ? 79  ILE A CG2  3  
ATOM 3606  C CD1  . ILE A 1 42 ? 14.564  2.895   5.570   1.00 0.00 ? 79  ILE A CD1  3  
ATOM 3607  H H    . ILE A 1 42 ? 14.424  2.653   3.323   1.00 0.00 ? 79  ILE A H    3  
ATOM 3608  H HA   . ILE A 1 42 ? 16.195  0.537   3.073   1.00 0.00 ? 79  ILE A HA   3  
ATOM 3609  H HB   . ILE A 1 42 ? 13.653  0.568   4.718   1.00 0.00 ? 79  ILE A HB   3  
ATOM 3610  H HG12 . ILE A 1 42 ? 15.437  1.242   6.547   1.00 0.00 ? 79  ILE A HG12 3  
ATOM 3611  H HG13 . ILE A 1 42 ? 16.344  1.833   5.162   1.00 0.00 ? 79  ILE A HG13 3  
ATOM 3612  H HG21 . ILE A 1 42 ? 15.781  -1.342  4.431   1.00 0.00 ? 79  ILE A HG21 3  
ATOM 3613  H HG22 . ILE A 1 42 ? 15.702  -0.752  6.092   1.00 0.00 ? 79  ILE A HG22 3  
ATOM 3614  H HG23 . ILE A 1 42 ? 14.274  -1.465  5.341   1.00 0.00 ? 79  ILE A HG23 3  
ATOM 3615  H HD11 . ILE A 1 42 ? 13.794  2.867   4.811   1.00 0.00 ? 79  ILE A HD11 3  
ATOM 3616  H HD12 . ILE A 1 42 ? 14.106  3.012   6.541   1.00 0.00 ? 79  ILE A HD12 3  
ATOM 3617  H HD13 . ILE A 1 42 ? 15.224  3.729   5.381   1.00 0.00 ? 79  ILE A HD13 3  
ATOM 3618  N N    . VAL A 1 43 ? 13.090  -0.434  2.592   1.00 0.00 ? 80  VAL A N    3  
ATOM 3619  C CA   . VAL A 1 43 ? 12.210  -1.344  1.894   1.00 0.00 ? 80  VAL A CA   3  
ATOM 3620  C C    . VAL A 1 43 ? 12.034  -0.901  0.449   1.00 0.00 ? 80  VAL A C    3  
ATOM 3621  O O    . VAL A 1 43 ? 11.782  -1.717  -0.437  1.00 0.00 ? 80  VAL A O    3  
ATOM 3622  C CB   . VAL A 1 43 ? 10.851  -1.412  2.613   1.00 0.00 ? 80  VAL A CB   3  
ATOM 3623  C CG1  . VAL A 1 43 ? 9.724   -1.035  1.693   1.00 0.00 ? 80  VAL A CG1  3  
ATOM 3624  C CG2  . VAL A 1 43 ? 10.618  -2.785  3.214   1.00 0.00 ? 80  VAL A CG2  3  
ATOM 3625  H H    . VAL A 1 43 ? 12.697  0.212   3.215   1.00 0.00 ? 80  VAL A H    3  
ATOM 3626  H HA   . VAL A 1 43 ? 12.648  -2.325  1.908   1.00 0.00 ? 80  VAL A HA   3  
ATOM 3627  H HB   . VAL A 1 43 ? 10.870  -0.694  3.408   1.00 0.00 ? 80  VAL A HB   3  
ATOM 3628  H HG11 . VAL A 1 43 ? 9.938   -1.410  0.707   1.00 0.00 ? 80  VAL A HG11 3  
ATOM 3629  H HG12 . VAL A 1 43 ? 8.802   -1.462  2.056   1.00 0.00 ? 80  VAL A HG12 3  
ATOM 3630  H HG13 . VAL A 1 43 ? 9.643   0.040   1.664   1.00 0.00 ? 80  VAL A HG13 3  
ATOM 3631  H HG21 . VAL A 1 43 ? 11.567  -3.273  3.383   1.00 0.00 ? 80  VAL A HG21 3  
ATOM 3632  H HG22 . VAL A 1 43 ? 10.095  -2.680  4.154   1.00 0.00 ? 80  VAL A HG22 3  
ATOM 3633  H HG23 . VAL A 1 43 ? 10.022  -3.379  2.536   1.00 0.00 ? 80  VAL A HG23 3  
ATOM 3634  N N    . GLY A 1 44 ? 12.115  0.408   0.239   1.00 0.00 ? 81  GLY A N    3  
ATOM 3635  C CA   . GLY A 1 44 ? 11.902  0.965   -1.079  1.00 0.00 ? 81  GLY A CA   3  
ATOM 3636  C C    . GLY A 1 44 ? 12.751  0.294   -2.147  1.00 0.00 ? 81  GLY A C    3  
ATOM 3637  O O    . GLY A 1 44 ? 12.304  0.103   -3.279  1.00 0.00 ? 81  GLY A O    3  
ATOM 3638  H H    . GLY A 1 44 ? 12.250  1.011   1.006   1.00 0.00 ? 81  GLY A H    3  
ATOM 3639  H HA2  . GLY A 1 44 ? 10.861  0.842   -1.327  1.00 0.00 ? 81  GLY A HA2  3  
ATOM 3640  H HA3  . GLY A 1 44 ? 12.135  2.019   -1.055  1.00 0.00 ? 81  GLY A HA3  3  
ATOM 3641  N N    . SER A 1 45 ? 13.957  -0.111  -1.774  1.00 0.00 ? 82  SER A N    3  
ATOM 3642  C CA   . SER A 1 45 ? 14.834  -0.820  -2.686  1.00 0.00 ? 82  SER A CA   3  
ATOM 3643  C C    . SER A 1 45 ? 15.072  -2.248  -2.188  1.00 0.00 ? 82  SER A C    3  
ATOM 3644  O O    . SER A 1 45 ? 16.198  -2.748  -2.203  1.00 0.00 ? 82  SER A O    3  
ATOM 3645  C CB   . SER A 1 45 ? 16.160  -0.068  -2.829  1.00 0.00 ? 82  SER A CB   3  
ATOM 3646  O OG   . SER A 1 45 ? 16.872  -0.494  -3.980  1.00 0.00 ? 82  SER A OG   3  
ATOM 3647  H H    . SER A 1 45 ? 14.245  0.035   -0.848  1.00 0.00 ? 82  SER A H    3  
ATOM 3648  H HA   . SER A 1 45 ? 14.347  -0.863  -3.649  1.00 0.00 ? 82  SER A HA   3  
ATOM 3649  H HB2  . SER A 1 45 ? 15.963  0.991   -2.912  1.00 0.00 ? 82  SER A HB2  3  
ATOM 3650  H HB3  . SER A 1 45 ? 16.770  -0.253  -1.955  1.00 0.00 ? 82  SER A HB3  3  
ATOM 3651  H HG   . SER A 1 45 ? 17.805  -0.232  -3.900  1.00 0.00 ? 82  SER A HG   3  
ATOM 3652  N N    . ALA A 1 46 ? 14.008  -2.896  -1.716  1.00 0.00 ? 83  ALA A N    3  
ATOM 3653  C CA   . ALA A 1 46 ? 14.106  -4.255  -1.177  1.00 0.00 ? 83  ALA A CA   3  
ATOM 3654  C C    . ALA A 1 46 ? 14.113  -5.310  -2.291  1.00 0.00 ? 83  ALA A C    3  
ATOM 3655  O O    . ALA A 1 46 ? 13.934  -6.501  -2.021  1.00 0.00 ? 83  ALA A O    3  
ATOM 3656  C CB   . ALA A 1 46 ? 12.967  -4.527  -0.202  1.00 0.00 ? 83  ALA A CB   3  
ATOM 3657  H H    . ALA A 1 46 ? 13.139  -2.434  -1.692  1.00 0.00 ? 83  ALA A H    3  
ATOM 3658  H HA   . ALA A 1 46 ? 15.035  -4.325  -0.629  1.00 0.00 ? 83  ALA A HA   3  
ATOM 3659  H HB1  . ALA A 1 46 ? 12.030  -4.554  -0.741  1.00 0.00 ? 83  ALA A HB1  3  
ATOM 3660  H HB2  . ALA A 1 46 ? 12.931  -3.742  0.540   1.00 0.00 ? 83  ALA A HB2  3  
ATOM 3661  H HB3  . ALA A 1 46 ? 13.128  -5.478  0.286   1.00 0.00 ? 83  ALA A HB3  3  
ATOM 3662  N N    . SER A 1 47 ? 14.349  -4.859  -3.525  1.00 0.00 ? 84  SER A N    3  
ATOM 3663  C CA   . SER A 1 47 ? 14.437  -5.724  -4.709  1.00 0.00 ? 84  SER A CA   3  
ATOM 3664  C C    . SER A 1 47 ? 13.082  -6.322  -5.099  1.00 0.00 ? 84  SER A C    3  
ATOM 3665  O O    . SER A 1 47 ? 12.538  -5.992  -6.151  1.00 0.00 ? 84  SER A O    3  
ATOM 3666  C CB   . SER A 1 47 ? 15.473  -6.830  -4.491  1.00 0.00 ? 84  SER A CB   3  
ATOM 3667  O OG   . SER A 1 47 ? 16.753  -6.271  -4.243  1.00 0.00 ? 84  SER A OG   3  
ATOM 3668  H H    . SER A 1 47 ? 14.482  -3.896  -3.647  1.00 0.00 ? 84  SER A H    3  
ATOM 3669  H HA   . SER A 1 47 ? 14.773  -5.104  -5.526  1.00 0.00 ? 84  SER A HA   3  
ATOM 3670  H HB2  . SER A 1 47 ? 15.185  -7.432  -3.641  1.00 0.00 ? 84  SER A HB2  3  
ATOM 3671  H HB3  . SER A 1 47 ? 15.528  -7.450  -5.374  1.00 0.00 ? 84  SER A HB3  3  
ATOM 3672  H HG   . SER A 1 47 ? 17.101  -6.621  -3.405  1.00 0.00 ? 84  SER A HG   3  
ATOM 3673  N N    . ASN A 1 48 ? 12.495  -7.121  -4.221  1.00 0.00 ? 85  ASN A N    3  
ATOM 3674  C CA   . ASN A 1 48 ? 11.169  -7.680  -4.471  1.00 0.00 ? 85  ASN A CA   3  
ATOM 3675  C C    . ASN A 1 48 ? 10.114  -6.861  -3.754  1.00 0.00 ? 85  ASN A C    3  
ATOM 3676  O O    . ASN A 1 48 ? 9.067   -7.376  -3.366  1.00 0.00 ? 85  ASN A O    3  
ATOM 3677  C CB   . ASN A 1 48 ? 11.083  -9.139  -4.014  1.00 0.00 ? 85  ASN A CB   3  
ATOM 3678  C CG   . ASN A 1 48 ? 11.869  -10.089 -4.896  1.00 0.00 ? 85  ASN A CG   3  
ATOM 3679  O OD1  . ASN A 1 48 ? 13.091  -9.989  -5.006  1.00 0.00 ? 85  ASN A OD1  3  
ATOM 3680  N ND2  . ASN A 1 48 ? 11.173  -11.023 -5.527  1.00 0.00 ? 85  ASN A ND2  3  
ATOM 3681  H H    . ASN A 1 48 ? 12.930  -7.285  -3.356  1.00 0.00 ? 85  ASN A H    3  
ATOM 3682  H HA   . ASN A 1 48 ? 10.984  -7.632  -5.533  1.00 0.00 ? 85  ASN A HA   3  
ATOM 3683  H HB2  . ASN A 1 48 ? 11.463  -9.217  -3.008  1.00 0.00 ? 85  ASN A HB2  3  
ATOM 3684  H HB3  . ASN A 1 48 ? 10.045  -9.444  -4.023  1.00 0.00 ? 85  ASN A HB3  3  
ATOM 3685  H HD21 . ASN A 1 48 ? 10.203  -11.047 -5.394  1.00 0.00 ? 85  ASN A HD21 3  
ATOM 3686  H HD22 . ASN A 1 48 ? 11.655  -11.653 -6.106  1.00 0.00 ? 85  ASN A HD22 3  
ATOM 3687  N N    . PHE A 1 49 ? 10.404  -5.579  -3.591  1.00 0.00 ? 86  PHE A N    3  
ATOM 3688  C CA   . PHE A 1 49 ? 9.508   -4.659  -2.907  1.00 0.00 ? 86  PHE A CA   3  
ATOM 3689  C C    . PHE A 1 49 ? 8.127   -4.640  -3.554  1.00 0.00 ? 86  PHE A C    3  
ATOM 3690  O O    . PHE A 1 49 ? 7.116   -4.689  -2.861  1.00 0.00 ? 86  PHE A O    3  
ATOM 3691  C CB   . PHE A 1 49 ? 10.105  -3.249  -2.910  1.00 0.00 ? 86  PHE A CB   3  
ATOM 3692  C CG   . PHE A 1 49 ? 9.122   -2.179  -2.529  1.00 0.00 ? 86  PHE A CG   3  
ATOM 3693  C CD1  . PHE A 1 49 ? 8.446   -2.233  -1.324  1.00 0.00 ? 86  PHE A CD1  3  
ATOM 3694  C CD2  . PHE A 1 49 ? 8.858   -1.128  -3.391  1.00 0.00 ? 86  PHE A CD2  3  
ATOM 3695  C CE1  . PHE A 1 49 ? 7.528   -1.261  -0.983  1.00 0.00 ? 86  PHE A CE1  3  
ATOM 3696  C CE2  . PHE A 1 49 ? 7.944   -0.150  -3.056  1.00 0.00 ? 86  PHE A CE2  3  
ATOM 3697  C CZ   . PHE A 1 49 ? 7.276   -0.217  -1.851  1.00 0.00 ? 86  PHE A CZ   3  
ATOM 3698  H H    . PHE A 1 49 ? 11.257  -5.241  -3.935  1.00 0.00 ? 86  PHE A H    3  
ATOM 3699  H HA   . PHE A 1 49 ? 9.407   -4.995  -1.886  1.00 0.00 ? 86  PHE A HA   3  
ATOM 3700  H HB2  . PHE A 1 49 ? 10.925  -3.211  -2.207  1.00 0.00 ? 86  PHE A HB2  3  
ATOM 3701  H HB3  . PHE A 1 49 ? 10.475  -3.024  -3.900  1.00 0.00 ? 86  PHE A HB3  3  
ATOM 3702  H HD1  . PHE A 1 49 ? 8.643   -3.049  -0.640  1.00 0.00 ? 86  PHE A HD1  3  
ATOM 3703  H HD2  . PHE A 1 49 ? 9.381   -1.074  -4.335  1.00 0.00 ? 86  PHE A HD2  3  
ATOM 3704  H HE1  . PHE A 1 49 ? 7.008   -1.317  -0.037  1.00 0.00 ? 86  PHE A HE1  3  
ATOM 3705  H HE2  . PHE A 1 49 ? 7.749   0.663   -3.738  1.00 0.00 ? 86  PHE A HE2  3  
ATOM 3706  H HZ   . PHE A 1 49 ? 6.560   0.545   -1.587  1.00 0.00 ? 86  PHE A HZ   3  
ATOM 3707  N N    . ASP A 1 50 ? 8.089   -4.555  -4.875  1.00 0.00 ? 87  ASP A N    3  
ATOM 3708  C CA   . ASP A 1 50 ? 6.820   -4.471  -5.593  1.00 0.00 ? 87  ASP A CA   3  
ATOM 3709  C C    . ASP A 1 50 ? 5.982   -5.725  -5.363  1.00 0.00 ? 87  ASP A C    3  
ATOM 3710  O O    . ASP A 1 50 ? 4.780   -5.642  -5.126  1.00 0.00 ? 87  ASP A O    3  
ATOM 3711  C CB   . ASP A 1 50 ? 7.041   -4.252  -7.097  1.00 0.00 ? 87  ASP A CB   3  
ATOM 3712  C CG   . ASP A 1 50 ? 7.561   -5.483  -7.816  1.00 0.00 ? 87  ASP A CG   3  
ATOM 3713  O OD1  . ASP A 1 50 ? 8.679   -5.930  -7.500  1.00 0.00 ? 87  ASP A OD1  3  
ATOM 3714  O OD2  . ASP A 1 50 ? 6.851   -6.010  -8.696  1.00 0.00 ? 87  ASP A OD2  3  
ATOM 3715  H H    . ASP A 1 50 ? 8.934   -4.526  -5.377  1.00 0.00 ? 87  ASP A H    3  
ATOM 3716  H HA   . ASP A 1 50 ? 6.281   -3.622  -5.195  1.00 0.00 ? 87  ASP A HA   3  
ATOM 3717  H HB2  . ASP A 1 50 ? 6.105   -3.968  -7.553  1.00 0.00 ? 87  ASP A HB2  3  
ATOM 3718  H HB3  . ASP A 1 50 ? 7.756   -3.453  -7.231  1.00 0.00 ? 87  ASP A HB3  3  
ATOM 3719  N N    . LEU A 1 51 ? 6.632   -6.878  -5.397  1.00 0.00 ? 88  LEU A N    3  
ATOM 3720  C CA   . LEU A 1 51 ? 5.955   -8.147  -5.188  1.00 0.00 ? 88  LEU A CA   3  
ATOM 3721  C C    . LEU A 1 51 ? 5.475   -8.255  -3.746  1.00 0.00 ? 88  LEU A C    3  
ATOM 3722  O O    . LEU A 1 51 ? 4.316   -8.585  -3.478  1.00 0.00 ? 88  LEU A O    3  
ATOM 3723  C CB   . LEU A 1 51 ? 6.908   -9.301  -5.540  1.00 0.00 ? 88  LEU A CB   3  
ATOM 3724  C CG   . LEU A 1 51 ? 6.313   -10.714 -5.488  1.00 0.00 ? 88  LEU A CG   3  
ATOM 3725  C CD1  . LEU A 1 51 ? 6.523   -11.343 -4.120  1.00 0.00 ? 88  LEU A CD1  3  
ATOM 3726  C CD2  . LEU A 1 51 ? 4.832   -10.680 -5.827  1.00 0.00 ? 88  LEU A CD2  3  
ATOM 3727  H H    . LEU A 1 51 ? 7.598   -6.876  -5.562  1.00 0.00 ? 88  LEU A H    3  
ATOM 3728  H HA   . LEU A 1 51 ? 5.099   -8.179  -5.845  1.00 0.00 ? 88  LEU A HA   3  
ATOM 3729  H HB2  . LEU A 1 51 ? 7.280   -9.132  -6.540  1.00 0.00 ? 88  LEU A HB2  3  
ATOM 3730  H HB3  . LEU A 1 51 ? 7.744   -9.265  -4.857  1.00 0.00 ? 88  LEU A HB3  3  
ATOM 3731  H HG   . LEU A 1 51 ? 6.812   -11.334 -6.217  1.00 0.00 ? 88  LEU A HG   3  
ATOM 3732  H HD11 . LEU A 1 51 ? 7.574   -11.315 -3.869  1.00 0.00 ? 88  LEU A HD11 3  
ATOM 3733  H HD12 . LEU A 1 51 ? 5.961   -10.790 -3.381  1.00 0.00 ? 88  LEU A HD12 3  
ATOM 3734  H HD13 . LEU A 1 51 ? 6.184   -12.367 -4.139  1.00 0.00 ? 88  LEU A HD13 3  
ATOM 3735  H HD21 . LEU A 1 51 ? 4.635   -9.852  -6.494  1.00 0.00 ? 88  LEU A HD21 3  
ATOM 3736  H HD22 . LEU A 1 51 ? 4.548   -11.605 -6.303  1.00 0.00 ? 88  LEU A HD22 3  
ATOM 3737  H HD23 . LEU A 1 51 ? 4.263   -10.547 -4.917  1.00 0.00 ? 88  LEU A HD23 3  
ATOM 3738  N N    . TYR A 1 52 ? 6.370   -7.959  -2.822  1.00 0.00 ? 89  TYR A N    3  
ATOM 3739  C CA   . TYR A 1 52 ? 6.062   -8.022  -1.406  1.00 0.00 ? 89  TYR A CA   3  
ATOM 3740  C C    . TYR A 1 52 ? 4.940   -7.056  -1.052  1.00 0.00 ? 89  TYR A C    3  
ATOM 3741  O O    . TYR A 1 52 ? 4.028   -7.396  -0.298  1.00 0.00 ? 89  TYR A O    3  
ATOM 3742  C CB   . TYR A 1 52 ? 7.309   -7.711  -0.587  1.00 0.00 ? 89  TYR A CB   3  
ATOM 3743  C CG   . TYR A 1 52 ? 8.294   -8.860  -0.490  1.00 0.00 ? 89  TYR A CG   3  
ATOM 3744  C CD1  . TYR A 1 52 ? 8.396   -9.797  -1.510  1.00 0.00 ? 89  TYR A CD1  3  
ATOM 3745  C CD2  . TYR A 1 52 ? 9.132   -9.000  0.612   1.00 0.00 ? 89  TYR A CD2  3  
ATOM 3746  C CE1  . TYR A 1 52 ? 9.300   -10.838 -1.434  1.00 0.00 ? 89  TYR A CE1  3  
ATOM 3747  C CE2  . TYR A 1 52 ? 10.035  -10.039 0.697   1.00 0.00 ? 89  TYR A CE2  3  
ATOM 3748  C CZ   . TYR A 1 52 ? 10.086  -10.978 -0.299  1.00 0.00 ? 89  TYR A CZ   3  
ATOM 3749  O OH   . TYR A 1 52 ? 11.029  -11.982 -0.258  1.00 0.00 ? 89  TYR A OH   3  
ATOM 3750  H H    . TYR A 1 52 ? 7.277   -7.695  -3.102  1.00 0.00 ? 89  TYR A H    3  
ATOM 3751  H HA   . TYR A 1 52 ? 5.736   -9.028  -1.183  1.00 0.00 ? 89  TYR A HA   3  
ATOM 3752  H HB2  . TYR A 1 52 ? 7.821   -6.872  -1.032  1.00 0.00 ? 89  TYR A HB2  3  
ATOM 3753  H HB3  . TYR A 1 52 ? 7.008   -7.450  0.410   1.00 0.00 ? 89  TYR A HB3  3  
ATOM 3754  H HD1  . TYR A 1 52 ? 7.753   -9.706  -2.374  1.00 0.00 ? 89  TYR A HD1  3  
ATOM 3755  H HD2  . TYR A 1 52 ? 9.064   -8.280  1.416   1.00 0.00 ? 89  TYR A HD2  3  
ATOM 3756  H HE1  . TYR A 1 52 ? 9.359   -11.561 -2.236  1.00 0.00 ? 89  TYR A HE1  3  
ATOM 3757  H HE2  . TYR A 1 52 ? 10.673  -10.130 1.563   1.00 0.00 ? 89  TYR A HE2  3  
ATOM 3758  H HH   . TYR A 1 52 ? 11.003  -12.375 0.628   1.00 0.00 ? 89  TYR A HH   3  
ATOM 3759  N N    . PHE A 1 53 ? 4.990   -5.869  -1.636  1.00 0.00 ? 90  PHE A N    3  
ATOM 3760  C CA   . PHE A 1 53 ? 3.968   -4.855  -1.420  1.00 0.00 ? 90  PHE A CA   3  
ATOM 3761  C C    . PHE A 1 53 ? 2.592   -5.368  -1.843  1.00 0.00 ? 90  PHE A C    3  
ATOM 3762  O O    . PHE A 1 53 ? 1.604   -5.174  -1.137  1.00 0.00 ? 90  PHE A O    3  
ATOM 3763  C CB   . PHE A 1 53 ? 4.315   -3.593  -2.207  1.00 0.00 ? 90  PHE A CB   3  
ATOM 3764  C CG   . PHE A 1 53 ? 3.255   -2.534  -2.139  1.00 0.00 ? 90  PHE A CG   3  
ATOM 3765  C CD1  . PHE A 1 53 ? 2.954   -1.904  -0.944  1.00 0.00 ? 90  PHE A CD1  3  
ATOM 3766  C CD2  . PHE A 1 53 ? 2.559   -2.171  -3.277  1.00 0.00 ? 90  PHE A CD2  3  
ATOM 3767  C CE1  . PHE A 1 53 ? 1.975   -0.932  -0.887  1.00 0.00 ? 90  PHE A CE1  3  
ATOM 3768  C CE2  . PHE A 1 53 ? 1.580   -1.201  -3.225  1.00 0.00 ? 90  PHE A CE2  3  
ATOM 3769  C CZ   . PHE A 1 53 ? 1.287   -0.581  -2.029  1.00 0.00 ? 90  PHE A CZ   3  
ATOM 3770  H H    . PHE A 1 53 ? 5.740   -5.666  -2.243  1.00 0.00 ? 90  PHE A H    3  
ATOM 3771  H HA   . PHE A 1 53 ? 3.946   -4.622  -0.367  1.00 0.00 ? 90  PHE A HA   3  
ATOM 3772  H HB2  . PHE A 1 53 ? 5.229   -3.174  -1.815  1.00 0.00 ? 90  PHE A HB2  3  
ATOM 3773  H HB3  . PHE A 1 53 ? 4.459   -3.854  -3.245  1.00 0.00 ? 90  PHE A HB3  3  
ATOM 3774  H HD1  . PHE A 1 53 ? 3.494   -2.179  -0.050  1.00 0.00 ? 90  PHE A HD1  3  
ATOM 3775  H HD2  . PHE A 1 53 ? 2.788   -2.653  -4.217  1.00 0.00 ? 90  PHE A HD2  3  
ATOM 3776  H HE1  . PHE A 1 53 ? 1.749   -0.447  0.051   1.00 0.00 ? 90  PHE A HE1  3  
ATOM 3777  H HE2  . PHE A 1 53 ? 1.043   -0.926  -4.121  1.00 0.00 ? 90  PHE A HE2  3  
ATOM 3778  H HZ   . PHE A 1 53 ? 0.520   0.178   -1.986  1.00 0.00 ? 90  PHE A HZ   3  
ATOM 3779  N N    . ASN A 1 54 ? 2.538   -6.027  -2.996  1.00 0.00 ? 91  ASN A N    3  
ATOM 3780  C CA   . ASN A 1 54 ? 1.283   -6.572  -3.509  1.00 0.00 ? 91  ASN A CA   3  
ATOM 3781  C C    . ASN A 1 54 ? 0.716   -7.603  -2.540  1.00 0.00 ? 91  ASN A C    3  
ATOM 3782  O O    . ASN A 1 54 ? -0.471  -7.564  -2.200  1.00 0.00 ? 91  ASN A O    3  
ATOM 3783  C CB   . ASN A 1 54 ? 1.491   -7.213  -4.888  1.00 0.00 ? 91  ASN A CB   3  
ATOM 3784  C CG   . ASN A 1 54 ? 1.891   -6.219  -5.973  1.00 0.00 ? 91  ASN A CG   3  
ATOM 3785  O OD1  . ASN A 1 54 ? 2.120   -6.601  -7.119  1.00 0.00 ? 91  ASN A OD1  3  
ATOM 3786  N ND2  . ASN A 1 54 ? 1.991   -4.943  -5.631  1.00 0.00 ? 91  ASN A ND2  3  
ATOM 3787  H H    . ASN A 1 54 ? 3.367   -6.155  -3.511  1.00 0.00 ? 91  ASN A H    3  
ATOM 3788  H HA   . ASN A 1 54 ? 0.579   -5.760  -3.601  1.00 0.00 ? 91  ASN A HA   3  
ATOM 3789  H HB2  . ASN A 1 54 ? 2.269   -7.957  -4.814  1.00 0.00 ? 91  ASN A HB2  3  
ATOM 3790  H HB3  . ASN A 1 54 ? 0.573   -7.693  -5.193  1.00 0.00 ? 91  ASN A HB3  3  
ATOM 3791  H HD21 . ASN A 1 54 ? 1.803   -4.692  -4.704  1.00 0.00 ? 91  ASN A HD21 3  
ATOM 3792  H HD22 . ASN A 1 54 ? 2.267   -4.305  -6.322  1.00 0.00 ? 91  ASN A HD22 3  
ATOM 3793  N N    . ASN A 1 55 ? 1.591   -8.465  -2.034  1.00 0.00 ? 92  ASN A N    3  
ATOM 3794  C CA   . ASN A 1 55 ? 1.205   -9.465  -1.041  1.00 0.00 ? 92  ASN A CA   3  
ATOM 3795  C C    . ASN A 1 55 ? 0.758   -8.800  0.253   1.00 0.00 ? 92  ASN A C    3  
ATOM 3796  O O    . ASN A 1 55 ? -0.188  -9.254  0.898   1.00 0.00 ? 92  ASN A O    3  
ATOM 3797  C CB   . ASN A 1 55 ? 2.360   -10.430 -0.758  1.00 0.00 ? 92  ASN A CB   3  
ATOM 3798  C CG   . ASN A 1 55 ? 2.515   -11.486 -1.833  1.00 0.00 ? 92  ASN A CG   3  
ATOM 3799  O OD1  . ASN A 1 55 ? 1.605   -12.281 -2.077  1.00 0.00 ? 92  ASN A OD1  3  
ATOM 3800  N ND2  . ASN A 1 55 ? 3.665   -11.505 -2.485  1.00 0.00 ? 92  ASN A ND2  3  
ATOM 3801  H H    . ASN A 1 55 ? 2.534   -8.400  -2.305  1.00 0.00 ? 92  ASN A H    3  
ATOM 3802  H HA   . ASN A 1 55 ? 0.375   -10.026 -1.448  1.00 0.00 ? 92  ASN A HA   3  
ATOM 3803  H HB2  . ASN A 1 55 ? 3.281   -9.870  -0.697  1.00 0.00 ? 92  ASN A HB2  3  
ATOM 3804  H HB3  . ASN A 1 55 ? 2.182   -10.927 0.184   1.00 0.00 ? 92  ASN A HB3  3  
ATOM 3805  H HD21 . ASN A 1 55 ? 4.348   -10.844 -2.243  1.00 0.00 ? 92  ASN A HD21 3  
ATOM 3806  H HD22 . ASN A 1 55 ? 3.794   -12.187 -3.185  1.00 0.00 ? 92  ASN A HD22 3  
ATOM 3807  N N    . ALA A 1 56 ? 1.440   -7.721  0.624   1.00 0.00 ? 93  ALA A N    3  
ATOM 3808  C CA   . ALA A 1 56 ? 1.106   -6.971  1.831   1.00 0.00 ? 93  ALA A CA   3  
ATOM 3809  C C    . ALA A 1 56 ? -0.302  -6.389  1.735   1.00 0.00 ? 93  ALA A C    3  
ATOM 3810  O O    . ALA A 1 56 ? -1.083  -6.478  2.684   1.00 0.00 ? 93  ALA A O    3  
ATOM 3811  C CB   . ALA A 1 56 ? 2.124   -5.866  2.062   1.00 0.00 ? 93  ALA A CB   3  
ATOM 3812  H H    . ALA A 1 56 ? 2.194   -7.419  0.068   1.00 0.00 ? 93  ALA A H    3  
ATOM 3813  H HA   . ALA A 1 56 ? 1.149   -7.650  2.670   1.00 0.00 ? 93  ALA A HA   3  
ATOM 3814  H HB1  . ALA A 1 56 ? 2.866   -6.203  2.768   1.00 0.00 ? 93  ALA A HB1  3  
ATOM 3815  H HB2  . ALA A 1 56 ? 2.602   -5.615  1.127   1.00 0.00 ? 93  ALA A HB2  3  
ATOM 3816  H HB3  . ALA A 1 56 ? 1.624   -4.991  2.454   1.00 0.00 ? 93  ALA A HB3  3  
ATOM 3817  N N    . ILE A 1 57 ? -0.637  -5.864  0.559   1.00 0.00 ? 94  ILE A N    3  
ATOM 3818  C CA   . ILE A 1 57 ? -1.979  -5.349  0.299   1.00 0.00 ? 94  ILE A CA   3  
ATOM 3819  C C    . ILE A 1 57 ? -3.011  -6.454  0.474   1.00 0.00 ? 94  ILE A C    3  
ATOM 3820  O O    . ILE A 1 57 ? -4.006  -6.289  1.185   1.00 0.00 ? 94  ILE A O    3  
ATOM 3821  C CB   . ILE A 1 57 ? -2.101  -4.785  -1.138  1.00 0.00 ? 94  ILE A CB   3  
ATOM 3822  C CG1  . ILE A 1 57 ? -1.156  -3.601  -1.338  1.00 0.00 ? 94  ILE A CG1  3  
ATOM 3823  C CG2  . ILE A 1 57 ? -3.537  -4.368  -1.429  1.00 0.00 ? 94  ILE A CG2  3  
ATOM 3824  C CD1  . ILE A 1 57 ? -1.466  -2.437  -0.431  1.00 0.00 ? 94  ILE A CD1  3  
ATOM 3825  H H    . ILE A 1 57 ? 0.023   -5.869  -0.168  1.00 0.00 ? 94  ILE A H    3  
ATOM 3826  H HA   . ILE A 1 57 ? -2.182  -4.554  1.002   1.00 0.00 ? 94  ILE A HA   3  
ATOM 3827  H HB   . ILE A 1 57 ? -1.835  -5.569  -1.830  1.00 0.00 ? 94  ILE A HB   3  
ATOM 3828  H HG12 . ILE A 1 57 ? -0.143  -3.916  -1.139  1.00 0.00 ? 94  ILE A HG12 3  
ATOM 3829  H HG13 . ILE A 1 57 ? -1.229  -3.257  -2.359  1.00 0.00 ? 94  ILE A HG13 3  
ATOM 3830  H HG21 . ILE A 1 57 ? -4.213  -5.113  -1.036  1.00 0.00 ? 94  ILE A HG21 3  
ATOM 3831  H HG22 . ILE A 1 57 ? -3.737  -3.417  -0.959  1.00 0.00 ? 94  ILE A HG22 3  
ATOM 3832  H HG23 . ILE A 1 57 ? -3.679  -4.281  -2.496  1.00 0.00 ? 94  ILE A HG23 3  
ATOM 3833  H HD11 . ILE A 1 57 ? -1.541  -2.792  0.586   1.00 0.00 ? 94  ILE A HD11 3  
ATOM 3834  H HD12 . ILE A 1 57 ? -0.675  -1.703  -0.499  1.00 0.00 ? 94  ILE A HD12 3  
ATOM 3835  H HD13 . ILE A 1 57 ? -2.402  -1.990  -0.727  1.00 0.00 ? 94  ILE A HD13 3  
ATOM 3836  N N    . LYS A 1 58 ? -2.732  -7.589  -0.154  1.00 0.00 ? 95  LYS A N    3  
ATOM 3837  C CA   . LYS A 1 58 ? -3.606  -8.757  -0.084  1.00 0.00 ? 95  LYS A CA   3  
ATOM 3838  C C    . LYS A 1 58 ? -3.824  -9.197  1.358   1.00 0.00 ? 95  LYS A C    3  
ATOM 3839  O O    . LYS A 1 58 ? -4.957  -9.417  1.782   1.00 0.00 ? 95  LYS A O    3  
ATOM 3840  C CB   . LYS A 1 58 ? -3.015  -9.921  -0.882  1.00 0.00 ? 95  LYS A CB   3  
ATOM 3841  C CG   . LYS A 1 58 ? -2.989  -9.690  -2.380  1.00 0.00 ? 95  LYS A CG   3  
ATOM 3842  C CD   . LYS A 1 58 ? -2.459  -10.905 -3.138  1.00 0.00 ? 95  LYS A CD   3  
ATOM 3843  C CE   . LYS A 1 58 ? -3.445  -12.074 -3.127  1.00 0.00 ? 95  LYS A CE   3  
ATOM 3844  N NZ   . LYS A 1 58 ? -3.497  -12.773 -1.814  1.00 0.00 ? 95  LYS A NZ   3  
ATOM 3845  H H    . LYS A 1 58 ? -1.905  -7.641  -0.680  1.00 0.00 ? 95  LYS A H    3  
ATOM 3846  H HA   . LYS A 1 58 ? -4.559  -8.486  -0.512  1.00 0.00 ? 95  LYS A HA   3  
ATOM 3847  H HB2  . LYS A 1 58 ? -2.003  -10.091 -0.548  1.00 0.00 ? 95  LYS A HB2  3  
ATOM 3848  H HB3  . LYS A 1 58 ? -3.600  -10.808 -0.686  1.00 0.00 ? 95  LYS A HB3  3  
ATOM 3849  H HG2  . LYS A 1 58 ? -3.993  -9.480  -2.719  1.00 0.00 ? 95  LYS A HG2  3  
ATOM 3850  H HG3  . LYS A 1 58 ? -2.352  -8.842  -2.591  1.00 0.00 ? 95  LYS A HG3  3  
ATOM 3851  H HD2  . LYS A 1 58 ? -2.274  -10.621 -4.162  1.00 0.00 ? 95  LYS A HD2  3  
ATOM 3852  H HD3  . LYS A 1 58 ? -1.535  -11.224 -2.679  1.00 0.00 ? 95  LYS A HD3  3  
ATOM 3853  H HE2  . LYS A 1 58 ? -4.429  -11.699 -3.358  1.00 0.00 ? 95  LYS A HE2  3  
ATOM 3854  H HE3  . LYS A 1 58 ? -3.145  -12.782 -3.886  1.00 0.00 ? 95  LYS A HE3  3  
ATOM 3855  H HZ1  . LYS A 1 58 ? -2.550  -12.786 -1.373  1.00 0.00 ? 95  LYS A HZ1  3  
ATOM 3856  H HZ2  . LYS A 1 58 ? -4.161  -12.287 -1.170  1.00 0.00 ? 95  LYS A HZ2  3  
ATOM 3857  H HZ3  . LYS A 1 58 ? -3.818  -13.755 -1.943  1.00 0.00 ? 95  LYS A HZ3  3  
ATOM 3858  N N    . LYS A 1 59 ? -2.734  -9.306  2.105   1.00 0.00 ? 96  LYS A N    3  
ATOM 3859  C CA   . LYS A 1 59 ? -2.798  -9.724  3.497   1.00 0.00 ? 96  LYS A CA   3  
ATOM 3860  C C    . LYS A 1 59 ? -3.594  -8.712  4.316   1.00 0.00 ? 96  LYS A C    3  
ATOM 3861  O O    . LYS A 1 59 ? -4.397  -9.083  5.166   1.00 0.00 ? 96  LYS A O    3  
ATOM 3862  C CB   . LYS A 1 59 ? -1.384  -9.885  4.064   1.00 0.00 ? 96  LYS A CB   3  
ATOM 3863  C CG   . LYS A 1 59 ? -1.312  -10.733 5.329   1.00 0.00 ? 96  LYS A CG   3  
ATOM 3864  C CD   . LYS A 1 59 ? -1.646  -9.940  6.584   1.00 0.00 ? 96  LYS A CD   3  
ATOM 3865  C CE   . LYS A 1 59 ? -1.509  -10.800 7.828   1.00 0.00 ? 96  LYS A CE   3  
ATOM 3866  N NZ   . LYS A 1 59 ? -1.759  -10.032 9.074   1.00 0.00 ? 96  LYS A NZ   3  
ATOM 3867  H H    . LYS A 1 59 ? -1.859  -9.111  1.704   1.00 0.00 ? 96  LYS A H    3  
ATOM 3868  H HA   . LYS A 1 59 ? -3.303  -10.677 3.537   1.00 0.00 ? 96  LYS A HA   3  
ATOM 3869  H HB2  . LYS A 1 59 ? -0.761  -10.348 3.312   1.00 0.00 ? 96  LYS A HB2  3  
ATOM 3870  H HB3  . LYS A 1 59 ? -0.988  -8.906  4.291   1.00 0.00 ? 96  LYS A HB3  3  
ATOM 3871  H HG2  . LYS A 1 59 ? -2.021  -11.544 5.238   1.00 0.00 ? 96  LYS A HG2  3  
ATOM 3872  H HG3  . LYS A 1 59 ? -0.314  -11.135 5.422   1.00 0.00 ? 96  LYS A HG3  3  
ATOM 3873  H HD2  . LYS A 1 59 ? -0.970  -9.102  6.660   1.00 0.00 ? 96  LYS A HD2  3  
ATOM 3874  H HD3  . LYS A 1 59 ? -2.664  -9.582  6.512   1.00 0.00 ? 96  LYS A HD3  3  
ATOM 3875  H HE2  . LYS A 1 59 ? -2.218  -11.612 7.771   1.00 0.00 ? 96  LYS A HE2  3  
ATOM 3876  H HE3  . LYS A 1 59 ? -0.507  -11.203 7.860   1.00 0.00 ? 96  LYS A HE3  3  
ATOM 3877  H HZ1  . LYS A 1 59 ? -2.173  -9.099  8.850   1.00 0.00 ? 96  LYS A HZ1  3  
ATOM 3878  H HZ2  . LYS A 1 59 ? -2.421  -10.552 9.690   1.00 0.00 ? 96  LYS A HZ2  3  
ATOM 3879  H HZ3  . LYS A 1 59 ? -0.864  -9.885  9.591   1.00 0.00 ? 96  LYS A HZ3  3  
ATOM 3880  N N    . GLY A 1 60 ? -3.373  -7.438  4.043   1.00 0.00 ? 97  GLY A N    3  
ATOM 3881  C CA   . GLY A 1 60 ? -4.066  -6.397  4.770   1.00 0.00 ? 97  GLY A CA   3  
ATOM 3882  C C    . GLY A 1 60 ? -5.562  -6.389  4.517   1.00 0.00 ? 97  GLY A C    3  
ATOM 3883  O O    . GLY A 1 60 ? -6.350  -6.192  5.442   1.00 0.00 ? 97  GLY A O    3  
ATOM 3884  H H    . GLY A 1 60 ? -2.724  -7.199  3.343   1.00 0.00 ? 97  GLY A H    3  
ATOM 3885  H HA2  . GLY A 1 60 ? -3.893  -6.538  5.826   1.00 0.00 ? 97  GLY A HA2  3  
ATOM 3886  H HA3  . GLY A 1 60 ? -3.660  -5.441  4.476   1.00 0.00 ? 97  GLY A HA3  3  
ATOM 3887  N N    . VAL A 1 61 ? -5.964  -6.542  3.262   1.00 0.00 ? 98  VAL A N    3  
ATOM 3888  C CA   . VAL A 1 61 ? -7.381  -6.492  2.920   1.00 0.00 ? 98  VAL A CA   3  
ATOM 3889  C C    . VAL A 1 61 ? -8.133  -7.712  3.452   1.00 0.00 ? 98  VAL A C    3  
ATOM 3890  O O    . VAL A 1 61 ? -9.271  -7.595  3.906   1.00 0.00 ? 98  VAL A O    3  
ATOM 3891  C CB   . VAL A 1 61 ? -7.629  -6.325  1.400   1.00 0.00 ? 98  VAL A CB   3  
ATOM 3892  C CG1  . VAL A 1 61 ? -7.139  -4.964  0.926   1.00 0.00 ? 98  VAL A CG1  3  
ATOM 3893  C CG2  . VAL A 1 61 ? -6.962  -7.431  0.601   1.00 0.00 ? 98  VAL A CG2  3  
ATOM 3894  H H    . VAL A 1 61 ? -5.293  -6.649  2.549   1.00 0.00 ? 98  VAL A H    3  
ATOM 3895  H HA   . VAL A 1 61 ? -7.789  -5.617  3.410   1.00 0.00 ? 98  VAL A HA   3  
ATOM 3896  H HB   . VAL A 1 61 ? -8.692  -6.378  1.224   1.00 0.00 ? 98  VAL A HB   3  
ATOM 3897  H HG11 . VAL A 1 61 ? -7.257  -4.244  1.721   1.00 0.00 ? 98  VAL A HG11 3  
ATOM 3898  H HG12 . VAL A 1 61 ? -6.097  -5.031  0.651   1.00 0.00 ? 98  VAL A HG12 3  
ATOM 3899  H HG13 . VAL A 1 61 ? -7.720  -4.655  0.070   1.00 0.00 ? 98  VAL A HG13 3  
ATOM 3900  H HG21 . VAL A 1 61 ? -6.640  -8.214  1.273   1.00 0.00 ? 98  VAL A HG21 3  
ATOM 3901  H HG22 . VAL A 1 61 ? -7.666  -7.832  -0.112  1.00 0.00 ? 98  VAL A HG22 3  
ATOM 3902  H HG23 . VAL A 1 61 ? -6.106  -7.030  0.079   1.00 0.00 ? 98  VAL A HG23 3  
ATOM 3903  N N    . GLU A 1 62 ? -7.480  -8.872  3.453   1.00 0.00 ? 99  GLU A N    3  
ATOM 3904  C CA   . GLU A 1 62 ? -8.092  -10.087 3.987   1.00 0.00 ? 99  GLU A CA   3  
ATOM 3905  C C    . GLU A 1 62 ? -8.133  -10.048 5.517   1.00 0.00 ? 99  GLU A C    3  
ATOM 3906  O O    . GLU A 1 62 ? -9.060  -10.567 6.139   1.00 0.00 ? 99  GLU A O    3  
ATOM 3907  C CB   . GLU A 1 62 ? -7.351  -11.333 3.493   1.00 0.00 ? 99  GLU A CB   3  
ATOM 3908  C CG   . GLU A 1 62 ? -5.910  -11.427 3.938   1.00 0.00 ? 99  GLU A CG   3  
ATOM 3909  C CD   . GLU A 1 62 ? -5.130  -12.481 3.175   1.00 0.00 ? 99  GLU A CD   3  
ATOM 3910  O OE1  . GLU A 1 62 ? -5.678  -13.055 2.208   1.00 0.00 ? 99  GLU A OE1  3  
ATOM 3911  O OE2  . GLU A 1 62 ? -3.954  -12.728 3.525   1.00 0.00 ? 99  GLU A OE2  3  
ATOM 3912  H H    . GLU A 1 62 ? -6.559  -8.908  3.110   1.00 0.00 ? 99  GLU A H    3  
ATOM 3913  H HA   . GLU A 1 62 ? -9.109  -10.123 3.622   1.00 0.00 ? 99  GLU A HA   3  
ATOM 3914  H HB2  . GLU A 1 62 ? -7.866  -12.209 3.853   1.00 0.00 ? 99  GLU A HB2  3  
ATOM 3915  H HB3  . GLU A 1 62 ? -7.362  -11.341 2.423   1.00 0.00 ? 99  GLU A HB3  3  
ATOM 3916  H HG2  . GLU A 1 62 ? -5.434  -10.464 3.793   1.00 0.00 ? 99  GLU A HG2  3  
ATOM 3917  H HG3  . GLU A 1 62 ? -5.901  -11.677 4.977   1.00 0.00 ? 99  GLU A HG3  3  
ATOM 3918  N N    . ALA A 1 63 ? -7.120  -9.432  6.117   1.00 0.00 ? 100 ALA A N    3  
ATOM 3919  C CA   . ALA A 1 63 ? -7.029  -9.323  7.569   1.00 0.00 ? 100 ALA A CA   3  
ATOM 3920  C C    . ALA A 1 63 ? -7.991  -8.269  8.108   1.00 0.00 ? 100 ALA A C    3  
ATOM 3921  O O    . ALA A 1 63 ? -8.272  -8.221  9.307   1.00 0.00 ? 100 ALA A O    3  
ATOM 3922  C CB   . ALA A 1 63 ? -5.606  -8.994  7.984   1.00 0.00 ? 100 ALA A CB   3  
ATOM 3923  H H    . ALA A 1 63 ? -6.397  -9.061  5.567   1.00 0.00 ? 100 ALA A H    3  
ATOM 3924  H HA   . ALA A 1 63 ? -7.289  -10.282 7.993   1.00 0.00 ? 100 ALA A HA   3  
ATOM 3925  H HB1  . ALA A 1 63 ? -5.526  -7.938  8.191   1.00 0.00 ? 100 ALA A HB1  3  
ATOM 3926  H HB2  . ALA A 1 63 ? -5.351  -9.555  8.871   1.00 0.00 ? 100 ALA A HB2  3  
ATOM 3927  H HB3  . ALA A 1 63 ? -4.930  -9.257  7.184   1.00 0.00 ? 100 ALA A HB3  3  
ATOM 3928  N N    . GLY A 1 64 ? -8.437  -7.382  7.231   1.00 0.00 ? 101 GLY A N    3  
ATOM 3929  C CA   . GLY A 1 64 ? -9.316  -6.307  7.644   1.00 0.00 ? 101 GLY A CA   3  
ATOM 3930  C C    . GLY A 1 64 ? -8.541  -5.115  8.159   1.00 0.00 ? 101 GLY A C    3  
ATOM 3931  O O    . GLY A 1 64 ? -8.892  -4.521  9.184   1.00 0.00 ? 101 GLY A O    3  
ATOM 3932  H H    . GLY A 1 64 ? -8.128  -7.433  6.301   1.00 0.00 ? 101 GLY A H    3  
ATOM 3933  H HA2  . GLY A 1 64 ? -9.915  -5.999  6.800   1.00 0.00 ? 101 GLY A HA2  3  
ATOM 3934  H HA3  . GLY A 1 64 ? -9.966  -6.666  8.427   1.00 0.00 ? 101 GLY A HA3  3  
ATOM 3935  N N    . ASP A 1 65 ? -7.468  -4.787  7.461   1.00 0.00 ? 102 ASP A N    3  
ATOM 3936  C CA   . ASP A 1 65 ? -6.624  -3.658  7.818   1.00 0.00 ? 102 ASP A CA   3  
ATOM 3937  C C    . ASP A 1 65 ? -6.658  -2.630  6.695   1.00 0.00 ? 102 ASP A C    3  
ATOM 3938  O O    . ASP A 1 65 ? -6.811  -1.435  6.932   1.00 0.00 ? 102 ASP A O    3  
ATOM 3939  C CB   . ASP A 1 65 ? -5.193  -4.130  8.075   1.00 0.00 ? 102 ASP A CB   3  
ATOM 3940  C CG   . ASP A 1 65 ? -4.471  -3.274  9.091   1.00 0.00 ? 102 ASP A CG   3  
ATOM 3941  O OD1  . ASP A 1 65 ? -5.016  -3.074  10.205  1.00 0.00 ? 102 ASP A OD1  3  
ATOM 3942  O OD2  . ASP A 1 65 ? -3.340  -2.846  8.811   1.00 0.00 ? 102 ASP A OD2  3  
ATOM 3943  H H    . ASP A 1 65 ? -7.228  -5.332  6.678   1.00 0.00 ? 102 ASP A H    3  
ATOM 3944  H HA   . ASP A 1 65 ? -7.022  -3.212  8.717   1.00 0.00 ? 102 ASP A HA   3  
ATOM 3945  H HB2  . ASP A 1 65 ? -5.213  -5.148  8.436   1.00 0.00 ? 102 ASP A HB2  3  
ATOM 3946  H HB3  . ASP A 1 65 ? -4.637  -4.094  7.148   1.00 0.00 ? 102 ASP A HB3  3  
ATOM 3947  N N    . PHE A 1 66 ? -6.685  -3.129  5.462   1.00 0.00 ? 103 PHE A N    3  
ATOM 3948  C CA   . PHE A 1 66 ? -6.894  -2.280  4.296   1.00 0.00 ? 103 PHE A CA   3  
ATOM 3949  C C    . PHE A 1 66 ? -8.177  -2.711  3.593   1.00 0.00 ? 103 PHE A C    3  
ATOM 3950  O O    . PHE A 1 66 ? -8.643  -3.835  3.792   1.00 0.00 ? 103 PHE A O    3  
ATOM 3951  C CB   . PHE A 1 66 ? -5.726  -2.381  3.305   1.00 0.00 ? 103 PHE A CB   3  
ATOM 3952  C CG   . PHE A 1 66 ? -4.363  -2.423  3.935   1.00 0.00 ? 103 PHE A CG   3  
ATOM 3953  C CD1  . PHE A 1 66 ? -3.960  -1.409  4.783   1.00 0.00 ? 103 PHE A CD1  3  
ATOM 3954  C CD2  . PHE A 1 66 ? -3.491  -3.469  3.688   1.00 0.00 ? 103 PHE A CD2  3  
ATOM 3955  C CE1  . PHE A 1 66 ? -2.714  -1.432  5.373   1.00 0.00 ? 103 PHE A CE1  3  
ATOM 3956  C CE2  . PHE A 1 66 ? -2.242  -3.498  4.276   1.00 0.00 ? 103 PHE A CE2  3  
ATOM 3957  C CZ   . PHE A 1 66 ? -1.834  -2.527  5.078   1.00 0.00 ? 103 PHE A CZ   3  
ATOM 3958  H H    . PHE A 1 66 ? -6.681  -4.104  5.345   1.00 0.00 ? 103 PHE A H    3  
ATOM 3959  H HA   . PHE A 1 66 ? -6.996  -1.258  4.633   1.00 0.00 ? 103 PHE A HA   3  
ATOM 3960  H HB2  . PHE A 1 66 ? -5.841  -3.279  2.719   1.00 0.00 ? 103 PHE A HB2  3  
ATOM 3961  H HB3  . PHE A 1 66 ? -5.754  -1.524  2.645   1.00 0.00 ? 103 PHE A HB3  3  
ATOM 3962  H HD1  . PHE A 1 66 ? -4.633  -0.589  4.979   1.00 0.00 ? 103 PHE A HD1  3  
ATOM 3963  H HD2  . PHE A 1 66 ? -3.796  -4.269  3.027   1.00 0.00 ? 103 PHE A HD2  3  
ATOM 3964  H HE1  . PHE A 1 66 ? -2.413  -0.629  6.030   1.00 0.00 ? 103 PHE A HE1  3  
ATOM 3965  H HE2  . PHE A 1 66 ? -1.570  -4.317  4.073   1.00 0.00 ? 103 PHE A HE2  3  
ATOM 3966  H HZ   . PHE A 1 66 ? -0.852  -2.568  5.524   1.00 0.00 ? 103 PHE A HZ   3  
ATOM 3967  N N    . GLU A 1 67 ? -8.730  -1.849  2.752   1.00 0.00 ? 104 GLU A N    3  
ATOM 3968  C CA   . GLU A 1 67 ? -9.912  -2.199  1.979   1.00 0.00 ? 104 GLU A CA   3  
ATOM 3969  C C    . GLU A 1 67 ? -9.815  -1.601  0.578   1.00 0.00 ? 104 GLU A C    3  
ATOM 3970  O O    . GLU A 1 67 ? -9.423  -0.448  0.410   1.00 0.00 ? 104 GLU A O    3  
ATOM 3971  C CB   . GLU A 1 67 ? -11.199 -1.741  2.691   1.00 0.00 ? 104 GLU A CB   3  
ATOM 3972  C CG   . GLU A 1 67 ? -11.322 -0.234  2.889   1.00 0.00 ? 104 GLU A CG   3  
ATOM 3973  C CD   . GLU A 1 67 ? -12.535 0.160   3.721   1.00 0.00 ? 104 GLU A CD   3  
ATOM 3974  O OE1  . GLU A 1 67 ? -13.142 -0.733  4.351   1.00 0.00 ? 104 GLU A OE1  3  
ATOM 3975  O OE2  . GLU A 1 67 ? -12.903 1.356   3.730   1.00 0.00 ? 104 GLU A OE2  3  
ATOM 3976  H H    . GLU A 1 67 ? -8.310  -0.972  2.615   1.00 0.00 ? 104 GLU A H    3  
ATOM 3977  H HA   . GLU A 1 67 ? -9.930  -3.276  1.890   1.00 0.00 ? 104 GLU A HA   3  
ATOM 3978  H HB2  . GLU A 1 67 ? -12.050 -2.071  2.112   1.00 0.00 ? 104 GLU A HB2  3  
ATOM 3979  H HB3  . GLU A 1 67 ? -11.240 -2.210  3.663   1.00 0.00 ? 104 GLU A HB3  3  
ATOM 3980  H HG2  . GLU A 1 67 ? -10.434 0.124   3.388   1.00 0.00 ? 104 GLU A HG2  3  
ATOM 3981  H HG3  . GLU A 1 67 ? -11.401 0.236   1.920   1.00 0.00 ? 104 GLU A HG3  3  
ATOM 3982  N N    . GLN A 1 68 ? -10.056 -2.426  -0.431  1.00 0.00 ? 105 GLN A N    3  
ATOM 3983  C CA   . GLN A 1 68 ? -9.930  -1.991  -1.816  1.00 0.00 ? 105 GLN A CA   3  
ATOM 3984  C C    . GLN A 1 68 ? -11.300 -1.814  -2.454  1.00 0.00 ? 105 GLN A C    3  
ATOM 3985  O O    . GLN A 1 68 ? -12.022 -2.784  -2.665  1.00 0.00 ? 105 GLN A O    3  
ATOM 3986  C CB   . GLN A 1 68 ? -9.107  -2.997  -2.621  1.00 0.00 ? 105 GLN A CB   3  
ATOM 3987  C CG   . GLN A 1 68 ? -7.624  -2.958  -2.301  1.00 0.00 ? 105 GLN A CG   3  
ATOM 3988  C CD   . GLN A 1 68 ? -6.844  -4.044  -3.006  1.00 0.00 ? 105 GLN A CD   3  
ATOM 3989  O OE1  . GLN A 1 68 ? -7.081  -5.234  -2.793  1.00 0.00 ? 105 GLN A OE1  3  
ATOM 3990  N NE2  . GLN A 1 68 ? -5.903  -3.643  -3.846  1.00 0.00 ? 105 GLN A NE2  3  
ATOM 3991  H H    . GLN A 1 68 ? -10.294 -3.357  -0.241  1.00 0.00 ? 105 GLN A H    3  
ATOM 3992  H HA   . GLN A 1 68 ? -9.420  -1.041  -1.818  1.00 0.00 ? 105 GLN A HA   3  
ATOM 3993  H HB2  . GLN A 1 68 ? -9.473  -3.992  -2.412  1.00 0.00 ? 105 GLN A HB2  3  
ATOM 3994  H HB3  . GLN A 1 68 ? -9.233  -2.790  -3.673  1.00 0.00 ? 105 GLN A HB3  3  
ATOM 3995  H HG2  . GLN A 1 68 ? -7.228  -1.999  -2.601  1.00 0.00 ? 105 GLN A HG2  3  
ATOM 3996  H HG3  . GLN A 1 68 ? -7.495  -3.080  -1.240  1.00 0.00 ? 105 GLN A HG3  3  
ATOM 3997  H HE21 . GLN A 1 68 ? -5.762  -2.683  -3.961  1.00 0.00 ? 105 GLN A HE21 3  
ATOM 3998  H HE22 . GLN A 1 68 ? -5.391  -4.332  -4.330  1.00 0.00 ? 105 GLN A HE22 3  
ATOM 3999  N N    . PRO A 1 69 ? -11.687 -0.561  -2.734  1.00 0.00 ? 106 PRO A N    3  
ATOM 4000  C CA   . PRO A 1 69 ? -12.994 -0.240  -3.310  1.00 0.00 ? 106 PRO A CA   3  
ATOM 4001  C C    . PRO A 1 69 ? -13.115 -0.663  -4.772  1.00 0.00 ? 106 PRO A C    3  
ATOM 4002  O O    . PRO A 1 69 ? -14.198 -1.017  -5.236  1.00 0.00 ? 106 PRO A O    3  
ATOM 4003  C CB   . PRO A 1 69 ? -13.093 1.286   -3.190  1.00 0.00 ? 106 PRO A CB   3  
ATOM 4004  C CG   . PRO A 1 69 ? -11.952 1.705   -2.320  1.00 0.00 ? 106 PRO A CG   3  
ATOM 4005  C CD   . PRO A 1 69 ? -10.899 0.649   -2.469  1.00 0.00 ? 106 PRO A CD   3  
ATOM 4006  H HA   . PRO A 1 69 ? -13.792 -0.691  -2.747  1.00 0.00 ? 106 PRO A HA   3  
ATOM 4007  H HB2  . PRO A 1 69 ? -13.018 1.724   -4.170  1.00 0.00 ? 106 PRO A HB2  3  
ATOM 4008  H HB3  . PRO A 1 69 ? -14.041 1.551   -2.747  1.00 0.00 ? 106 PRO A HB3  3  
ATOM 4009  H HG2  . PRO A 1 69 ? -11.573 2.662   -2.648  1.00 0.00 ? 106 PRO A HG2  3  
ATOM 4010  H HG3  . PRO A 1 69 ? -12.280 1.764   -1.293  1.00 0.00 ? 106 PRO A HG3  3  
ATOM 4011  H HD2  . PRO A 1 69 ? -10.247 0.877   -3.301  1.00 0.00 ? 106 PRO A HD2  3  
ATOM 4012  H HD3  . PRO A 1 69 ? -10.332 0.548   -1.558  1.00 0.00 ? 106 PRO A HD3  3  
ATOM 4013  N N    . LYS A 1 70 ? -12.025 -0.521  -5.515  1.00 0.00 ? 107 LYS A N    3  
ATOM 4014  C CA   . LYS A 1 70 ? -12.049 -0.782  -6.947  1.00 0.00 ? 107 LYS A CA   3  
ATOM 4015  C C    . LYS A 1 70 ? -11.796 -2.255  -7.250  1.00 0.00 ? 107 LYS A C    3  
ATOM 4016  O O    . LYS A 1 70 ? -12.521 -2.869  -8.033  1.00 0.00 ? 107 LYS A O    3  
ATOM 4017  C CB   . LYS A 1 70 ? -11.013 0.090   -7.654  1.00 0.00 ? 107 LYS A CB   3  
ATOM 4018  C CG   . LYS A 1 70 ? -11.213 1.578   -7.409  1.00 0.00 ? 107 LYS A CG   3  
ATOM 4019  C CD   . LYS A 1 70 ? -10.155 2.414   -8.109  1.00 0.00 ? 107 LYS A CD   3  
ATOM 4020  C CE   . LYS A 1 70 ? -10.306 2.365   -9.620  1.00 0.00 ? 107 LYS A CE   3  
ATOM 4021  N NZ   . LYS A 1 70 ? -9.236  3.137   -10.304 1.00 0.00 ? 107 LYS A NZ   3  
ATOM 4022  H H    . LYS A 1 70 ? -11.202 -0.181  -5.101  1.00 0.00 ? 107 LYS A H    3  
ATOM 4023  H HA   . LYS A 1 70 ? -13.032 -0.522  -7.311  1.00 0.00 ? 107 LYS A HA   3  
ATOM 4024  H HB2  . LYS A 1 70 ? -10.028 -0.183  -7.305  1.00 0.00 ? 107 LYS A HB2  3  
ATOM 4025  H HB3  . LYS A 1 70 ? -11.073 -0.089  -8.718  1.00 0.00 ? 107 LYS A HB3  3  
ATOM 4026  H HG2  . LYS A 1 70 ? -12.185 1.866   -7.780  1.00 0.00 ? 107 LYS A HG2  3  
ATOM 4027  H HG3  . LYS A 1 70 ? -11.164 1.768   -6.346  1.00 0.00 ? 107 LYS A HG3  3  
ATOM 4028  H HD2  . LYS A 1 70 ? -10.249 3.439   -7.784  1.00 0.00 ? 107 LYS A HD2  3  
ATOM 4029  H HD3  . LYS A 1 70 ? -9.179  2.038   -7.841  1.00 0.00 ? 107 LYS A HD3  3  
ATOM 4030  H HE2  . LYS A 1 70 ? -10.257 1.334   -9.941  1.00 0.00 ? 107 LYS A HE2  3  
ATOM 4031  H HE3  . LYS A 1 70 ? -11.264 2.781   -9.887  1.00 0.00 ? 107 LYS A HE3  3  
ATOM 4032  H HZ1  . LYS A 1 70 ? -8.296  2.841   -9.955  1.00 0.00 ? 107 LYS A HZ1  3  
ATOM 4033  H HZ2  . LYS A 1 70 ? -9.278  2.972   -11.334 1.00 0.00 ? 107 LYS A HZ2  3  
ATOM 4034  H HZ3  . LYS A 1 70 ? -9.355  4.156   -10.121 1.00 0.00 ? 107 LYS A HZ3  3  
ATOM 4035  N N    . GLY A 1 71 ? -10.757 -2.814  -6.649  1.00 0.00 ? 108 GLY A N    3  
ATOM 4036  C CA   . GLY A 1 71 ? -10.418 -4.198  -6.895  1.00 0.00 ? 108 GLY A CA   3  
ATOM 4037  C C    . GLY A 1 71 ? -9.106  -4.578  -6.247  1.00 0.00 ? 108 GLY A C    3  
ATOM 4038  O O    . GLY A 1 71 ? -8.388  -3.706  -5.754  1.00 0.00 ? 108 GLY A O    3  
ATOM 4039  H H    . GLY A 1 71 ? -10.199 -2.278  -6.047  1.00 0.00 ? 108 GLY A H    3  
ATOM 4040  H HA2  . GLY A 1 71 ? -11.203 -4.826  -6.499  1.00 0.00 ? 108 GLY A HA2  3  
ATOM 4041  H HA3  . GLY A 1 71 ? -10.343 -4.357  -7.960  1.00 0.00 ? 108 GLY A HA3  3  
ATOM 4042  N N    . PRO A 1 72 ? -8.762  -5.874  -6.235  1.00 0.00 ? 109 PRO A N    3  
ATOM 4043  C CA   . PRO A 1 72 ? -7.520  -6.366  -5.629  1.00 0.00 ? 109 PRO A CA   3  
ATOM 4044  C C    . PRO A 1 72 ? -6.276  -5.792  -6.297  1.00 0.00 ? 109 PRO A C    3  
ATOM 4045  O O    . PRO A 1 72 ? -5.262  -5.541  -5.645  1.00 0.00 ? 109 PRO A O    3  
ATOM 4046  C CB   . PRO A 1 72 ? -7.581  -7.877  -5.832  1.00 0.00 ? 109 PRO A CB   3  
ATOM 4047  C CG   . PRO A 1 72 ? -8.570  -8.088  -6.927  1.00 0.00 ? 109 PRO A CG   3  
ATOM 4048  C CD   . PRO A 1 72 ? -9.561  -6.969  -6.807  1.00 0.00 ? 109 PRO A CD   3  
ATOM 4049  H HA   . PRO A 1 72 ? -7.485  -6.153  -4.575  1.00 0.00 ? 109 PRO A HA   3  
ATOM 4050  H HB2  . PRO A 1 72 ? -6.604  -8.230  -6.106  1.00 0.00 ? 109 PRO A HB2  3  
ATOM 4051  H HB3  . PRO A 1 72 ? -7.898  -8.352  -4.917  1.00 0.00 ? 109 PRO A HB3  3  
ATOM 4052  H HG2  . PRO A 1 72 ? -8.072  -8.051  -7.885  1.00 0.00 ? 109 PRO A HG2  3  
ATOM 4053  H HG3  . PRO A 1 72 ? -9.062  -9.041  -6.796  1.00 0.00 ? 109 PRO A HG3  3  
ATOM 4054  H HD2  . PRO A 1 72 ? -9.947  -6.698  -7.778  1.00 0.00 ? 109 PRO A HD2  3  
ATOM 4055  H HD3  . PRO A 1 72 ? -10.366 -7.247  -6.142  1.00 0.00 ? 109 PRO A HD3  3  
ATOM 4056  N N    . ALA A 1 73 ? -6.363  -5.572  -7.592  1.00 0.00 ? 110 ALA A N    3  
ATOM 4057  C CA   . ALA A 1 73 ? -5.256  -5.008  -8.335  1.00 0.00 ? 110 ALA A CA   3  
ATOM 4058  C C    . ALA A 1 73 ? -5.518  -3.546  -8.662  1.00 0.00 ? 110 ALA A C    3  
ATOM 4059  O O    . ALA A 1 73 ? -5.309  -3.109  -9.792  1.00 0.00 ? 110 ALA A O    3  
ATOM 4060  C CB   . ALA A 1 73 ? -5.010  -5.810  -9.604  1.00 0.00 ? 110 ALA A CB   3  
ATOM 4061  H H    . ALA A 1 73 ? -7.203  -5.765  -8.058  1.00 0.00 ? 110 ALA A H    3  
ATOM 4062  H HA   . ALA A 1 73 ? -4.370  -5.076  -7.717  1.00 0.00 ? 110 ALA A HA   3  
ATOM 4063  H HB1  . ALA A 1 73 ? -5.568  -5.376  -10.420 1.00 0.00 ? 110 ALA A HB1  3  
ATOM 4064  H HB2  . ALA A 1 73 ? -5.329  -6.831  -9.454  1.00 0.00 ? 110 ALA A HB2  3  
ATOM 4065  H HB3  . ALA A 1 73 ? -3.956  -5.793  -9.841  1.00 0.00 ? 110 ALA A HB3  3  
ATOM 4066  N N    . GLY A 1 74 ? -6.018  -2.789  -7.688  1.00 0.00 ? 111 GLY A N    3  
ATOM 4067  C CA   . GLY A 1 74 ? -6.318  -1.402  -7.948  1.00 0.00 ? 111 GLY A CA   3  
ATOM 4068  C C    . GLY A 1 74 ? -6.062  -0.507  -6.758  1.00 0.00 ? 111 GLY A C    3  
ATOM 4069  O O    . GLY A 1 74 ? -5.089  -0.693  -6.023  1.00 0.00 ? 111 GLY A O    3  
ATOM 4070  H H    . GLY A 1 74 ? -6.212  -3.182  -6.803  1.00 0.00 ? 111 GLY A H    3  
ATOM 4071  H HA2  . GLY A 1 74 ? -5.709  -1.063  -8.772  1.00 0.00 ? 111 GLY A HA2  3  
ATOM 4072  H HA3  . GLY A 1 74 ? -7.359  -1.319  -8.228  1.00 0.00 ? 111 GLY A HA3  3  
ATOM 4073  N N    . ALA A 1 75 ? -6.903  0.506   -6.605  1.00 0.00 ? 112 ALA A N    3  
ATOM 4074  C CA   . ALA A 1 75 ? -6.750  1.477   -5.536  1.00 0.00 ? 112 ALA A CA   3  
ATOM 4075  C C    . ALA A 1 75 ? -7.167  0.898   -4.192  1.00 0.00 ? 112 ALA A C    3  
ATOM 4076  O O    . ALA A 1 75 ? -8.209  0.247   -4.079  1.00 0.00 ? 112 ALA A O    3  
ATOM 4077  C CB   . ALA A 1 75 ? -7.550  2.733   -5.840  1.00 0.00 ? 112 ALA A CB   3  
ATOM 4078  H H    . ALA A 1 75 ? -7.631  0.619   -7.249  1.00 0.00 ? 112 ALA A H    3  
ATOM 4079  H HA   . ALA A 1 75 ? -5.706  1.751   -5.483  1.00 0.00 ? 112 ALA A HA   3  
ATOM 4080  H HB1  . ALA A 1 75 ? -7.603  2.876   -6.909  1.00 0.00 ? 112 ALA A HB1  3  
ATOM 4081  H HB2  . ALA A 1 75 ? -8.546  2.630   -5.438  1.00 0.00 ? 112 ALA A HB2  3  
ATOM 4082  H HB3  . ALA A 1 75 ? -7.063  3.586   -5.387  1.00 0.00 ? 112 ALA A HB3  3  
ATOM 4083  N N    . VAL A 1 76 ? -6.379  1.195   -3.173  1.00 0.00 ? 113 VAL A N    3  
ATOM 4084  C CA   . VAL A 1 76 ? -6.684  0.792   -1.811  1.00 0.00 ? 113 VAL A CA   3  
ATOM 4085  C C    . VAL A 1 76 ? -7.098  2.008   -0.999  1.00 0.00 ? 113 VAL A C    3  
ATOM 4086  O O    . VAL A 1 76 ? -6.731  3.140   -1.323  1.00 0.00 ? 113 VAL A O    3  
ATOM 4087  C CB   . VAL A 1 76 ? -5.468  0.124   -1.122  1.00 0.00 ? 113 VAL A CB   3  
ATOM 4088  C CG1  . VAL A 1 76 ? -5.873  -0.553  0.183   1.00 0.00 ? 113 VAL A CG1  3  
ATOM 4089  C CG2  . VAL A 1 76 ? -4.798  -0.873  -2.048  1.00 0.00 ? 113 VAL A CG2  3  
ATOM 4090  H H    . VAL A 1 76 ? -5.601  1.778   -3.331  1.00 0.00 ? 113 VAL A H    3  
ATOM 4091  H HA   . VAL A 1 76 ? -7.500  0.086   -1.839  1.00 0.00 ? 113 VAL A HA   3  
ATOM 4092  H HB   . VAL A 1 76 ? -4.749  0.898   -0.889  1.00 0.00 ? 113 VAL A HB   3  
ATOM 4093  H HG11 . VAL A 1 76 ? -6.798  -1.090  0.038   1.00 0.00 ? 113 VAL A HG11 3  
ATOM 4094  H HG12 . VAL A 1 76 ? -5.099  -1.243  0.485   1.00 0.00 ? 113 VAL A HG12 3  
ATOM 4095  H HG13 . VAL A 1 76 ? -6.008  0.198   0.956   1.00 0.00 ? 113 VAL A HG13 3  
ATOM 4096  H HG21 . VAL A 1 76 ? -5.369  -0.955  -2.963  1.00 0.00 ? 113 VAL A HG21 3  
ATOM 4097  H HG22 . VAL A 1 76 ? -3.797  -0.538  -2.276  1.00 0.00 ? 113 VAL A HG22 3  
ATOM 4098  H HG23 . VAL A 1 76 ? -4.755  -1.837  -1.561  1.00 0.00 ? 113 VAL A HG23 3  
ATOM 4099  N N    . LYS A 1 77 ? -7.803  1.762   0.084   1.00 0.00 ? 114 LYS A N    3  
ATOM 4100  C CA   . LYS A 1 77 ? -8.180  2.796   1.022   1.00 0.00 ? 114 LYS A CA   3  
ATOM 4101  C C    . LYS A 1 77 ? -8.039  2.249   2.429   1.00 0.00 ? 114 LYS A C    3  
ATOM 4102  O O    . LYS A 1 77 ? -8.285  1.064   2.657   1.00 0.00 ? 114 LYS A O    3  
ATOM 4103  C CB   . LYS A 1 77 ? -9.627  3.229   0.791   1.00 0.00 ? 114 LYS A CB   3  
ATOM 4104  C CG   . LYS A 1 77 ? -10.138 4.240   1.809   1.00 0.00 ? 114 LYS A CG   3  
ATOM 4105  C CD   . LYS A 1 77 ? -9.357  5.544   1.755   1.00 0.00 ? 114 LYS A CD   3  
ATOM 4106  C CE   . LYS A 1 77 ? -9.634  6.416   2.972   1.00 0.00 ? 114 LYS A CE   3  
ATOM 4107  N NZ   . LYS A 1 77 ? -11.063 6.817   3.079   1.00 0.00 ? 114 LYS A NZ   3  
ATOM 4108  H H    . LYS A 1 77 ? -8.037  0.831   0.296   1.00 0.00 ? 114 LYS A H    3  
ATOM 4109  H HA   . LYS A 1 77 ? -7.520  3.642   0.892   1.00 0.00 ? 114 LYS A HA   3  
ATOM 4110  H HB2  . LYS A 1 77 ? -9.711  3.661   -0.194  1.00 0.00 ? 114 LYS A HB2  3  
ATOM 4111  H HB3  . LYS A 1 77 ? -10.247 2.350   0.849   1.00 0.00 ? 114 LYS A HB3  3  
ATOM 4112  H HG2  . LYS A 1 77 ? -11.176 4.449   1.601   1.00 0.00 ? 114 LYS A HG2  3  
ATOM 4113  H HG3  . LYS A 1 77 ? -10.046 3.817   2.798   1.00 0.00 ? 114 LYS A HG3  3  
ATOM 4114  H HD2  . LYS A 1 77 ? -8.302  5.317   1.721   1.00 0.00 ? 114 LYS A HD2  3  
ATOM 4115  H HD3  . LYS A 1 77 ? -9.642  6.084   0.863   1.00 0.00 ? 114 LYS A HD3  3  
ATOM 4116  H HE2  . LYS A 1 77 ? -9.360  5.865   3.858   1.00 0.00 ? 114 LYS A HE2  3  
ATOM 4117  H HE3  . LYS A 1 77 ? -9.024  7.304   2.903   1.00 0.00 ? 114 LYS A HE3  3  
ATOM 4118  H HZ1  . LYS A 1 77 ? -11.666 6.185   2.505   1.00 0.00 ? 114 LYS A HZ1  3  
ATOM 4119  H HZ2  . LYS A 1 77 ? -11.374 6.761   4.073   1.00 0.00 ? 114 LYS A HZ2  3  
ATOM 4120  H HZ3  . LYS A 1 77 ? -11.187 7.797   2.744   1.00 0.00 ? 114 LYS A HZ3  3  
ATOM 4121  N N    . LEU A 1 78 ? -7.559  3.074   3.348   1.00 0.00 ? 115 LEU A N    3  
ATOM 4122  C CA   . LEU A 1 78 ? -7.401  2.651   4.718   1.00 0.00 ? 115 LEU A CA   3  
ATOM 4123  C C    . LEU A 1 78 ? -8.732  2.153   5.271   1.00 0.00 ? 115 LEU A C    3  
ATOM 4124  O O    . LEU A 1 78 ? -9.716  2.893   5.290   1.00 0.00 ? 115 LEU A O    3  
ATOM 4125  C CB   . LEU A 1 78 ? -6.914  3.832   5.541   1.00 0.00 ? 115 LEU A CB   3  
ATOM 4126  C CG   . LEU A 1 78 ? -5.746  3.542   6.461   1.00 0.00 ? 115 LEU A CG   3  
ATOM 4127  C CD1  . LEU A 1 78 ? -6.153  2.581   7.567   1.00 0.00 ? 115 LEU A CD1  3  
ATOM 4128  C CD2  . LEU A 1 78 ? -4.584  2.986   5.666   1.00 0.00 ? 115 LEU A CD2  3  
ATOM 4129  H H    . LEU A 1 78 ? -7.259  3.975   3.093   1.00 0.00 ? 115 LEU A H    3  
ATOM 4130  H HA   . LEU A 1 78 ? -6.674  1.854   4.745   1.00 0.00 ? 115 LEU A HA   3  
ATOM 4131  H HB2  . LEU A 1 78 ? -6.622  4.620   4.862   1.00 0.00 ? 115 LEU A HB2  3  
ATOM 4132  H HB3  . LEU A 1 78 ? -7.736  4.189   6.143   1.00 0.00 ? 115 LEU A HB3  3  
ATOM 4133  H HG   . LEU A 1 78 ? -5.432  4.466   6.906   1.00 0.00 ? 115 LEU A HG   3  
ATOM 4134  H HD11 . LEU A 1 78 ? -6.936  1.930   7.206   1.00 0.00 ? 115 LEU A HD11 3  
ATOM 4135  H HD12 . LEU A 1 78 ? -5.299  1.989   7.861   1.00 0.00 ? 115 LEU A HD12 3  
ATOM 4136  H HD13 . LEU A 1 78 ? -6.513  3.142   8.418   1.00 0.00 ? 115 LEU A HD13 3  
ATOM 4137  H HD21 . LEU A 1 78 ? -4.930  2.709   4.679   1.00 0.00 ? 115 LEU A HD21 3  
ATOM 4138  H HD22 . LEU A 1 78 ? -3.814  3.739   5.582   1.00 0.00 ? 115 LEU A HD22 3  
ATOM 4139  H HD23 . LEU A 1 78 ? -4.187  2.116   6.167   1.00 0.00 ? 115 LEU A HD23 3  
ATOM 4140  N N    . ALA A 1 79 ? -8.768  0.898   5.682   1.00 0.00 ? 116 ALA A N    3  
ATOM 4141  C CA   . ALA A 1 79 ? -9.991  0.307   6.194   1.00 0.00 ? 116 ALA A CA   3  
ATOM 4142  C C    . ALA A 1 79 ? -10.266 0.767   7.609   1.00 0.00 ? 116 ALA A C    3  
ATOM 4143  O O    . ALA A 1 79 ? -9.387  0.708   8.471   1.00 0.00 ? 116 ALA A O    3  
ATOM 4144  C CB   . ALA A 1 79 ? -9.921  -1.207  6.148   1.00 0.00 ? 116 ALA A CB   3  
ATOM 4145  H H    . ALA A 1 79 ? -7.954  0.353   5.641   1.00 0.00 ? 116 ALA A H    3  
ATOM 4146  H HA   . ALA A 1 79 ? -10.806 0.623   5.557   1.00 0.00 ? 116 ALA A HA   3  
ATOM 4147  H HB1  . ALA A 1 79 ? -10.685 -1.582  5.485   1.00 0.00 ? 116 ALA A HB1  3  
ATOM 4148  H HB2  . ALA A 1 79 ? -8.951  -1.510  5.788   1.00 0.00 ? 116 ALA A HB2  3  
ATOM 4149  H HB3  . ALA A 1 79 ? -10.079 -1.605  7.140   1.00 0.00 ? 116 ALA A HB3  3  
ATOM 4150  N N    . LYS A 1 80 ? -11.508 1.144   7.864   1.00 0.00 ? 117 LYS A N    3  
ATOM 4151  C CA   . LYS A 1 80 ? -11.913 1.485   9.215   1.00 0.00 ? 117 LYS A CA   3  
ATOM 4152  C C    . LYS A 1 80 ? -11.898 0.230   10.070  1.00 0.00 ? 117 LYS A C    3  
ATOM 4153  O O    . LYS A 1 80 ? -12.571 -0.753  9.750   1.00 0.00 ? 117 LYS A O    3  
ATOM 4154  C CB   . LYS A 1 80 ? -13.317 2.100   9.259   1.00 0.00 ? 117 LYS A CB   3  
ATOM 4155  C CG   . LYS A 1 80 ? -13.501 3.352   8.418   1.00 0.00 ? 117 LYS A CG   3  
ATOM 4156  C CD   . LYS A 1 80 ? -14.006 3.018   7.024   1.00 0.00 ? 117 LYS A CD   3  
ATOM 4157  C CE   . LYS A 1 80 ? -14.590 4.244   6.338   1.00 0.00 ? 117 LYS A CE   3  
ATOM 4158  N NZ   . LYS A 1 80 ? -15.776 4.775   7.064   1.00 0.00 ? 117 LYS A NZ   3  
ATOM 4159  H H    . LYS A 1 80 ? -12.176 1.104   7.152   1.00 0.00 ? 117 LYS A H    3  
ATOM 4160  H HA   . LYS A 1 80 ? -11.200 2.190   9.612   1.00 0.00 ? 117 LYS A HA   3  
ATOM 4161  H HB2  . LYS A 1 80 ? -14.025 1.360   8.915   1.00 0.00 ? 117 LYS A HB2  3  
ATOM 4162  H HB3  . LYS A 1 80 ? -13.548 2.347   10.285  1.00 0.00 ? 117 LYS A HB3  3  
ATOM 4163  H HG2  . LYS A 1 80 ? -14.218 3.997   8.904   1.00 0.00 ? 117 LYS A HG2  3  
ATOM 4164  H HG3  . LYS A 1 80 ? -12.552 3.861   8.336   1.00 0.00 ? 117 LYS A HG3  3  
ATOM 4165  H HD2  . LYS A 1 80 ? -13.185 2.645   6.432   1.00 0.00 ? 117 LYS A HD2  3  
ATOM 4166  H HD3  . LYS A 1 80 ? -14.773 2.261   7.101   1.00 0.00 ? 117 LYS A HD3  3  
ATOM 4167  H HE2  . LYS A 1 80 ? -13.832 5.011   6.295   1.00 0.00 ? 117 LYS A HE2  3  
ATOM 4168  H HE3  . LYS A 1 80 ? -14.883 3.971   5.336   1.00 0.00 ? 117 LYS A HE3  3  
ATOM 4169  H HZ1  . LYS A 1 80 ? -16.032 4.143   7.855   1.00 0.00 ? 117 LYS A HZ1  3  
ATOM 4170  H HZ2  . LYS A 1 80 ? -15.571 5.725   7.445   1.00 0.00 ? 117 LYS A HZ2  3  
ATOM 4171  H HZ3  . LYS A 1 80 ? -16.593 4.845   6.416   1.00 0.00 ? 117 LYS A HZ3  3  
ATOM 4172  N N    . LYS A 1 81 ? -11.138 0.267   11.148  1.00 0.00 ? 118 LYS A N    3  
ATOM 4173  C CA   . LYS A 1 81 ? -11.076 -0.853  12.065  1.00 0.00 ? 118 LYS A CA   3  
ATOM 4174  C C    . LYS A 1 81 ? -12.419 -0.983  12.766  1.00 0.00 ? 118 LYS A C    3  
ATOM 4175  O O    . LYS A 1 81 ? -12.950 -2.081  12.931  1.00 0.00 ? 118 LYS A O    3  
ATOM 4176  C CB   . LYS A 1 81 ? -9.954  -0.653  13.085  1.00 0.00 ? 118 LYS A CB   3  
ATOM 4177  C CG   . LYS A 1 81 ? -9.202  -1.930  13.422  1.00 0.00 ? 118 LYS A CG   3  
ATOM 4178  C CD   . LYS A 1 81 ? -8.526  -2.506  12.188  1.00 0.00 ? 118 LYS A CD   3  
ATOM 4179  C CE   . LYS A 1 81 ? -7.722  -3.752  12.514  1.00 0.00 ? 118 LYS A CE   3  
ATOM 4180  N NZ   . LYS A 1 81 ? -7.083  -4.325  11.300  1.00 0.00 ? 118 LYS A NZ   3  
ATOM 4181  H H    . LYS A 1 81 ? -10.620 1.083   11.347  1.00 0.00 ? 118 LYS A H    3  
ATOM 4182  H HA   . LYS A 1 81 ? -10.887 -1.749  11.490  1.00 0.00 ? 118 LYS A HA   3  
ATOM 4183  H HB2  . LYS A 1 81 ? -9.248  0.062   12.691  1.00 0.00 ? 118 LYS A HB2  3  
ATOM 4184  H HB3  . LYS A 1 81 ? -10.379 -0.261  13.998  1.00 0.00 ? 118 LYS A HB3  3  
ATOM 4185  H HG2  . LYS A 1 81 ? -8.449  -1.711  14.164  1.00 0.00 ? 118 LYS A HG2  3  
ATOM 4186  H HG3  . LYS A 1 81 ? -9.898  -2.657  13.812  1.00 0.00 ? 118 LYS A HG3  3  
ATOM 4187  H HD2  . LYS A 1 81 ? -9.284  -2.761  11.463  1.00 0.00 ? 118 LYS A HD2  3  
ATOM 4188  H HD3  . LYS A 1 81 ? -7.865  -1.760  11.772  1.00 0.00 ? 118 LYS A HD3  3  
ATOM 4189  H HE2  . LYS A 1 81 ? -6.953  -3.495  13.228  1.00 0.00 ? 118 LYS A HE2  3  
ATOM 4190  H HE3  . LYS A 1 81 ? -8.383  -4.489  12.946  1.00 0.00 ? 118 LYS A HE3  3  
ATOM 4191  H HZ1  . LYS A 1 81 ? -7.789  -4.447  10.546  1.00 0.00 ? 118 LYS A HZ1  3  
ATOM 4192  H HZ2  . LYS A 1 81 ? -6.328  -3.692  10.953  1.00 0.00 ? 118 LYS A HZ2  3  
ATOM 4193  H HZ3  . LYS A 1 81 ? -6.664  -5.257  11.521  1.00 0.00 ? 118 LYS A HZ3  3  
ATOM 4194  N N    . LYS A 1 82 ? -13.007 0.169   13.063  1.00 0.00 ? 119 LYS A N    3  
ATOM 4195  C CA   . LYS A 1 82 ? -14.341 0.235   13.638  1.00 0.00 ? 119 LYS A CA   3  
ATOM 4196  C C    . LYS A 1 82 ? -15.402 0.155   12.548  1.00 0.00 ? 119 LYS A C    3  
ATOM 4197  O O    . LYS A 1 82 ? -15.974 1.177   12.163  1.00 0.00 ? 119 LYS A O    3  
ATOM 4198  C CB   . LYS A 1 82 ? -14.533 1.524   14.438  1.00 0.00 ? 119 LYS A CB   3  
ATOM 4199  C CG   . LYS A 1 82 ? -13.741 1.582   15.736  1.00 0.00 ? 119 LYS A CG   3  
ATOM 4200  C CD   . LYS A 1 82 ? -12.264 1.867   15.504  1.00 0.00 ? 119 LYS A CD   3  
ATOM 4201  C CE   . LYS A 1 82 ? -11.495 1.873   16.812  1.00 0.00 ? 119 LYS A CE   3  
ATOM 4202  N NZ   . LYS A 1 82 ? -10.070 2.245   16.623  1.00 0.00 ? 119 LYS A NZ   3  
ATOM 4203  H H    . LYS A 1 82 ? -12.557 1.003   12.817  1.00 0.00 ? 119 LYS A H    3  
ATOM 4204  H HA   . LYS A 1 82 ? -14.457 -0.610  14.301  1.00 0.00 ? 119 LYS A HA   3  
ATOM 4205  H HB2  . LYS A 1 82 ? -14.235 2.360   13.823  1.00 0.00 ? 119 LYS A HB2  3  
ATOM 4206  H HB3  . LYS A 1 82 ? -15.583 1.625   14.676  1.00 0.00 ? 119 LYS A HB3  3  
ATOM 4207  H HG2  . LYS A 1 82 ? -14.150 2.362   16.359  1.00 0.00 ? 119 LYS A HG2  3  
ATOM 4208  H HG3  . LYS A 1 82 ? -13.835 0.632   16.242  1.00 0.00 ? 119 LYS A HG3  3  
ATOM 4209  H HD2  . LYS A 1 82 ? -11.856 1.099   14.863  1.00 0.00 ? 119 LYS A HD2  3  
ATOM 4210  H HD3  . LYS A 1 82 ? -12.161 2.831   15.029  1.00 0.00 ? 119 LYS A HD3  3  
ATOM 4211  H HE2  . LYS A 1 82 ? -11.955 2.586   17.483  1.00 0.00 ? 119 LYS A HE2  3  
ATOM 4212  H HE3  . LYS A 1 82 ? -11.547 0.887   17.250  1.00 0.00 ? 119 LYS A HE3  3  
ATOM 4213  H HZ1  . LYS A 1 82 ? -9.829  2.253   15.608  1.00 0.00 ? 119 LYS A HZ1  3  
ATOM 4214  H HZ2  . LYS A 1 82 ? -9.892  3.194   17.017  1.00 0.00 ? 119 LYS A HZ2  3  
ATOM 4215  H HZ3  . LYS A 1 82 ? -9.449  1.562   17.109  1.00 0.00 ? 119 LYS A HZ3  3  
ATOM 4216  N N    . SER A 1 83 ? -15.657 -1.060  12.075  1.00 0.00 ? 120 SER A N    3  
ATOM 4217  C CA   . SER A 1 83 ? -16.659 -1.323  11.045  1.00 0.00 ? 120 SER A CA   3  
ATOM 4218  C C    . SER A 1 83 ? -16.218 -0.826  9.664   1.00 0.00 ? 120 SER A C    3  
ATOM 4219  O O    . SER A 1 83 ? -16.000 0.366   9.448   1.00 0.00 ? 120 SER A O    3  
ATOM 4220  C CB   . SER A 1 83 ? -18.002 -0.698  11.428  1.00 0.00 ? 120 SER A CB   3  
ATOM 4221  O OG   . SER A 1 83 ? -18.499 -1.255  12.636  1.00 0.00 ? 120 SER A OG   3  
ATOM 4222  H H    . SER A 1 83 ? -15.160 -1.821  12.448  1.00 0.00 ? 120 SER A H    3  
ATOM 4223  H HA   . SER A 1 83 ? -16.787 -2.394  10.992  1.00 0.00 ? 120 SER A HA   3  
ATOM 4224  H HB2  . SER A 1 83 ? -17.871 0.368   11.565  1.00 0.00 ? 120 SER A HB2  3  
ATOM 4225  H HB3  . SER A 1 83 ? -18.717 -0.878  10.636  1.00 0.00 ? 120 SER A HB3  3  
ATOM 4226  H HG   . SER A 1 83 ? -18.521 -2.225  12.553  1.00 0.00 ? 120 SER A HG   3  
ATOM 4227  N N    . PRO A 1 84 ? -16.128 -1.754  8.701   1.00 0.00 ? 121 PRO A N    3  
ATOM 4228  C CA   . PRO A 1 84 ? -15.758 -1.457  7.311   1.00 0.00 ? 121 PRO A CA   3  
ATOM 4229  C C    . PRO A 1 84 ? -16.799 -0.599  6.599   1.00 0.00 ? 121 PRO A C    3  
ATOM 4230  O O    . PRO A 1 84 ? -17.983 -0.639  6.940   1.00 0.00 ? 121 PRO A O    3  
ATOM 4231  C CB   . PRO A 1 84 ? -15.704 -2.838  6.648   1.00 0.00 ? 121 PRO A CB   3  
ATOM 4232  C CG   . PRO A 1 84 ? -15.635 -3.810  7.770   1.00 0.00 ? 121 PRO A CG   3  
ATOM 4233  C CD   . PRO A 1 84 ? -16.413 -3.183  8.885   1.00 0.00 ? 121 PRO A CD   3  
ATOM 4234  H HA   . PRO A 1 84 ? -14.790 -0.981  7.247   1.00 0.00 ? 121 PRO A HA   3  
ATOM 4235  H HB2  . PRO A 1 84 ? -16.600 -2.984  6.062   1.00 0.00 ? 121 PRO A HB2  3  
ATOM 4236  H HB3  . PRO A 1 84 ? -14.836 -2.905  6.011   1.00 0.00 ? 121 PRO A HB3  3  
ATOM 4237  H HG2  . PRO A 1 84 ? -16.085 -4.749  7.476   1.00 0.00 ? 121 PRO A HG2  3  
ATOM 4238  H HG3  . PRO A 1 84 ? -14.607 -3.960  8.066   1.00 0.00 ? 121 PRO A HG3  3  
ATOM 4239  H HD2  . PRO A 1 84 ? -17.467 -3.387  8.774   1.00 0.00 ? 121 PRO A HD2  3  
ATOM 4240  H HD3  . PRO A 1 84 ? -16.055 -3.529  9.842   1.00 0.00 ? 121 PRO A HD3  3  
ATOM 4241  N N    . GLU A 1 85 ? -16.383 0.081   5.536   1.00 0.00 ? 122 GLU A N    3  
ATOM 4242  C CA   . GLU A 1 85 ? -17.314 0.827   4.700   1.00 0.00 ? 122 GLU A CA   3  
ATOM 4243  C C    . GLU A 1 85 ? -16.786 0.905   3.270   1.00 0.00 ? 122 GLU A C    3  
ATOM 4244  O O    . GLU A 1 85 ? -16.878 1.935   2.601   1.00 0.00 ? 122 GLU A O    3  
ATOM 4245  C CB   . GLU A 1 85 ? -17.557 2.233   5.258   1.00 0.00 ? 122 GLU A CB   3  
ATOM 4246  C CG   . GLU A 1 85 ? -18.807 2.889   4.692   1.00 0.00 ? 122 GLU A CG   3  
ATOM 4247  C CD   . GLU A 1 85 ? -18.946 4.349   5.068   1.00 0.00 ? 122 GLU A CD   3  
ATOM 4248  O OE1  . GLU A 1 85 ? -18.032 4.902   5.710   1.00 0.00 ? 122 GLU A OE1  3  
ATOM 4249  O OE2  . GLU A 1 85 ? -19.974 4.959   4.704   1.00 0.00 ? 122 GLU A OE2  3  
ATOM 4250  H H    . GLU A 1 85 ? -15.443 0.006   5.256   1.00 0.00 ? 122 GLU A H    3  
ATOM 4251  H HA   . GLU A 1 85 ? -18.250 0.286   4.691   1.00 0.00 ? 122 GLU A HA   3  
ATOM 4252  H HB2  . GLU A 1 85 ? -17.660 2.171   6.331   1.00 0.00 ? 122 GLU A HB2  3  
ATOM 4253  H HB3  . GLU A 1 85 ? -16.708 2.855   5.019   1.00 0.00 ? 122 GLU A HB3  3  
ATOM 4254  H HG2  . GLU A 1 85 ? -18.775 2.818   3.615   1.00 0.00 ? 122 GLU A HG2  3  
ATOM 4255  H HG3  . GLU A 1 85 ? -19.673 2.356   5.058   1.00 0.00 ? 122 GLU A HG3  3  
ATOM 4256  N N    . VAL A 1 86 ? -16.263 -0.211  2.796   1.00 0.00 ? 123 VAL A N    3  
ATOM 4257  C CA   . VAL A 1 86 ? -15.771 -0.301  1.434   1.00 0.00 ? 123 VAL A CA   3  
ATOM 4258  C C    . VAL A 1 86 ? -16.857 -0.868  0.526   1.00 0.00 ? 123 VAL A C    3  
ATOM 4259  O O    . VAL A 1 86 ? -17.545 -1.816  0.907   1.00 0.00 ? 123 VAL A O    3  
ATOM 4260  C CB   . VAL A 1 86 ? -14.499 -1.180  1.347   1.00 0.00 ? 123 VAL A CB   3  
ATOM 4261  C CG1  . VAL A 1 86 ? -14.766 -2.591  1.851   1.00 0.00 ? 123 VAL A CG1  3  
ATOM 4262  C CG2  . VAL A 1 86 ? -13.959 -1.214  -0.072  1.00 0.00 ? 123 VAL A CG2  3  
ATOM 4263  H H    . VAL A 1 86 ? -16.252 -1.010  3.362   1.00 0.00 ? 123 VAL A H    3  
ATOM 4264  H HA   . VAL A 1 86 ? -15.522 0.695   1.103   1.00 0.00 ? 123 VAL A HA   3  
ATOM 4265  H HB   . VAL A 1 86 ? -13.744 -0.738  1.981   1.00 0.00 ? 123 VAL A HB   3  
ATOM 4266  H HG11 . VAL A 1 86 ? -15.817 -2.699  2.074   1.00 0.00 ? 123 VAL A HG11 3  
ATOM 4267  H HG12 . VAL A 1 86 ? -14.485 -3.306  1.092   1.00 0.00 ? 123 VAL A HG12 3  
ATOM 4268  H HG13 . VAL A 1 86 ? -14.189 -2.770  2.746   1.00 0.00 ? 123 VAL A HG13 3  
ATOM 4269  H HG21 . VAL A 1 86 ? -14.691 -0.791  -0.747  1.00 0.00 ? 123 VAL A HG21 3  
ATOM 4270  H HG22 . VAL A 1 86 ? -13.047 -0.639  -0.125  1.00 0.00 ? 123 VAL A HG22 3  
ATOM 4271  H HG23 . VAL A 1 86 ? -13.758 -2.236  -0.356  1.00 0.00 ? 123 VAL A HG23 3  
ATOM 4272  N N    . LYS A 1 87 ? -17.031 -0.244  -0.650  1.00 0.00 ? 124 LYS A N    3  
ATOM 4273  C CA   . LYS A 1 87 ? -18.040 -0.645  -1.641  1.00 0.00 ? 124 LYS A CA   3  
ATOM 4274  C C    . LYS A 1 87 ? -19.364 -1.041  -0.983  1.00 0.00 ? 124 LYS A C    3  
ATOM 4275  O O    . LYS A 1 87 ? -19.738 -2.217  -0.963  1.00 0.00 ? 124 LYS A O    3  
ATOM 4276  C CB   . LYS A 1 87 ? -17.509 -1.767  -2.559  1.00 0.00 ? 124 LYS A CB   3  
ATOM 4277  C CG   . LYS A 1 87 ? -17.011 -3.007  -1.830  1.00 0.00 ? 124 LYS A CG   3  
ATOM 4278  C CD   . LYS A 1 87 ? -16.419 -4.027  -2.785  1.00 0.00 ? 124 LYS A CD   3  
ATOM 4279  C CE   . LYS A 1 87 ? -15.914 -5.247  -2.037  1.00 0.00 ? 124 LYS A CE   3  
ATOM 4280  N NZ   . LYS A 1 87 ? -15.287 -6.240  -2.946  1.00 0.00 ? 124 LYS A NZ   3  
ATOM 4281  H H    . LYS A 1 87 ? -16.465 0.534   -0.849  1.00 0.00 ? 124 LYS A H    3  
ATOM 4282  H HA   . LYS A 1 87 ? -18.230 0.226   -2.255  1.00 0.00 ? 124 LYS A HA   3  
ATOM 4283  H HB2  . LYS A 1 87 ? -18.301 -2.070  -3.228  1.00 0.00 ? 124 LYS A HB2  3  
ATOM 4284  H HB3  . LYS A 1 87 ? -16.692 -1.373  -3.147  1.00 0.00 ? 124 LYS A HB3  3  
ATOM 4285  H HG2  . LYS A 1 87 ? -16.252 -2.714  -1.121  1.00 0.00 ? 124 LYS A HG2  3  
ATOM 4286  H HG3  . LYS A 1 87 ? -17.840 -3.460  -1.305  1.00 0.00 ? 124 LYS A HG3  3  
ATOM 4287  H HD2  . LYS A 1 87 ? -17.180 -4.336  -3.485  1.00 0.00 ? 124 LYS A HD2  3  
ATOM 4288  H HD3  . LYS A 1 87 ? -15.596 -3.573  -3.319  1.00 0.00 ? 124 LYS A HD3  3  
ATOM 4289  H HE2  . LYS A 1 87 ? -15.183 -4.932  -1.309  1.00 0.00 ? 124 LYS A HE2  3  
ATOM 4290  H HE3  . LYS A 1 87 ? -16.747 -5.712  -1.532  1.00 0.00 ? 124 LYS A HE3  3  
ATOM 4291  H HZ1  . LYS A 1 87 ? -15.934 -6.470  -3.734  1.00 0.00 ? 124 LYS A HZ1  3  
ATOM 4292  H HZ2  . LYS A 1 87 ? -14.402 -5.855  -3.342  1.00 0.00 ? 124 LYS A HZ2  3  
ATOM 4293  H HZ3  . LYS A 1 87 ? -15.068 -7.115  -2.426  1.00 0.00 ? 124 LYS A HZ3  3  
ATOM 4294  N N    . LYS A 1 88 ? -20.030 -0.058  -0.378  1.00 0.00 ? 125 LYS A N    3  
ATOM 4295  C CA   . LYS A 1 88 ? -21.276 -0.294  0.358   1.00 0.00 ? 125 LYS A CA   3  
ATOM 4296  C C    . LYS A 1 88 ? -22.439 -0.631  -0.593  1.00 0.00 ? 125 LYS A C    3  
ATOM 4297  O O    . LYS A 1 88 ? -23.520 -0.044  -0.518  1.00 0.00 ? 125 LYS A O    3  
ATOM 4298  C CB   . LYS A 1 88 ? -21.622 0.932   1.212   1.00 0.00 ? 125 LYS A CB   3  
ATOM 4299  C CG   . LYS A 1 88 ? -22.688 0.673   2.272   1.00 0.00 ? 125 LYS A CG   3  
ATOM 4300  C CD   . LYS A 1 88 ? -22.179 -0.246  3.374   1.00 0.00 ? 125 LYS A CD   3  
ATOM 4301  C CE   . LYS A 1 88 ? -23.265 -0.541  4.398   1.00 0.00 ? 125 LYS A CE   3  
ATOM 4302  N NZ   . LYS A 1 88 ? -22.745 -1.304  5.564   1.00 0.00 ? 125 LYS A NZ   3  
ATOM 4303  H H    . LYS A 1 88 ? -19.644 0.845   -0.382  1.00 0.00 ? 125 LYS A H    3  
ATOM 4304  H HA   . LYS A 1 88 ? -21.113 -1.139  1.010   1.00 0.00 ? 125 LYS A HA   3  
ATOM 4305  H HB2  . LYS A 1 88 ? -20.727 1.270   1.713   1.00 0.00 ? 125 LYS A HB2  3  
ATOM 4306  H HB3  . LYS A 1 88 ? -21.977 1.717   0.563   1.00 0.00 ? 125 LYS A HB3  3  
ATOM 4307  H HG2  . LYS A 1 88 ? -22.979 1.615   2.711   1.00 0.00 ? 125 LYS A HG2  3  
ATOM 4308  H HG3  . LYS A 1 88 ? -23.545 0.213   1.801   1.00 0.00 ? 125 LYS A HG3  3  
ATOM 4309  H HD2  . LYS A 1 88 ? -21.850 -1.174  2.930   1.00 0.00 ? 125 LYS A HD2  3  
ATOM 4310  H HD3  . LYS A 1 88 ? -21.347 0.232   3.871   1.00 0.00 ? 125 LYS A HD3  3  
ATOM 4311  H HE2  . LYS A 1 88 ? -23.674 0.395   4.748   1.00 0.00 ? 125 LYS A HE2  3  
ATOM 4312  H HE3  . LYS A 1 88 ? -24.043 -1.117  3.920   1.00 0.00 ? 125 LYS A HE3  3  
ATOM 4313  H HZ1  . LYS A 1 88 ? -21.706 -1.345  5.538   1.00 0.00 ? 125 LYS A HZ1  3  
ATOM 4314  H HZ2  . LYS A 1 88 ? -23.036 -0.840  6.454   1.00 0.00 ? 125 LYS A HZ2  3  
ATOM 4315  H HZ3  . LYS A 1 88 ? -23.120 -2.277  5.560   1.00 0.00 ? 125 LYS A HZ3  3  
ATOM 4316  N N    . GLU A 1 89 ? -22.210 -1.595  -1.468  1.00 0.00 ? 126 GLU A N    3  
ATOM 4317  C CA   . GLU A 1 89 ? -23.225 -2.054  -2.404  1.00 0.00 ? 126 GLU A CA   3  
ATOM 4318  C C    . GLU A 1 89 ? -24.287 -2.872  -1.676  1.00 0.00 ? 126 GLU A C    3  
ATOM 4319  O O    . GLU A 1 89 ? -25.443 -2.935  -2.096  1.00 0.00 ? 126 GLU A O    3  
ATOM 4320  C CB   . GLU A 1 89 ? -22.583 -2.893  -3.514  1.00 0.00 ? 126 GLU A CB   3  
ATOM 4321  C CG   . GLU A 1 89 ? -21.828 -4.112  -3.001  1.00 0.00 ? 126 GLU A CG   3  
ATOM 4322  C CD   . GLU A 1 89 ? -21.297 -4.990  -4.114  1.00 0.00 ? 126 GLU A CD   3  
ATOM 4323  O OE1  . GLU A 1 89 ? -21.482 -4.634  -5.292  1.00 0.00 ? 126 GLU A OE1  3  
ATOM 4324  O OE2  . GLU A 1 89 ? -20.688 -6.038  -3.819  1.00 0.00 ? 126 GLU A OE2  3  
ATOM 4325  H H    . GLU A 1 89 ? -21.329 -2.032  -1.468  1.00 0.00 ? 126 GLU A H    3  
ATOM 4326  H HA   . GLU A 1 89 ? -23.693 -1.185  -2.844  1.00 0.00 ? 126 GLU A HA   3  
ATOM 4327  H HB2  . GLU A 1 89 ? -23.357 -3.233  -4.186  1.00 0.00 ? 126 GLU A HB2  3  
ATOM 4328  H HB3  . GLU A 1 89 ? -21.890 -2.273  -4.063  1.00 0.00 ? 126 GLU A HB3  3  
ATOM 4329  H HG2  . GLU A 1 89 ? -20.994 -3.778  -2.405  1.00 0.00 ? 126 GLU A HG2  3  
ATOM 4330  H HG3  . GLU A 1 89 ? -22.494 -4.700  -2.387  1.00 0.00 ? 126 GLU A HG3  3  
ATOM 4331  N N    . LYS A 1 90 ? -23.878 -3.500  -0.580  1.00 0.00 ? 127 LYS A N    3  
ATOM 4332  C CA   . LYS A 1 90 ? -24.763 -4.328  0.213   1.00 0.00 ? 127 LYS A CA   3  
ATOM 4333  C C    . LYS A 1 90 ? -24.148 -4.572  1.592   1.00 0.00 ? 127 LYS A C    3  
ATOM 4334  O O    . LYS A 1 90 ? -23.496 -3.684  2.142   1.00 0.00 ? 127 LYS A O    3  
ATOM 4335  C CB   . LYS A 1 90 ? -25.044 -5.649  -0.521  1.00 0.00 ? 127 LYS A CB   3  
ATOM 4336  C CG   . LYS A 1 90 ? -23.793 -6.455  -0.841  1.00 0.00 ? 127 LYS A CG   3  
ATOM 4337  C CD   . LYS A 1 90 ? -24.071 -7.542  -1.865  1.00 0.00 ? 127 LYS A CD   3  
ATOM 4338  C CE   . LYS A 1 90 ? -22.947 -8.562  -1.920  1.00 0.00 ? 127 LYS A CE   3  
ATOM 4339  N NZ   . LYS A 1 90 ? -21.616 -7.928  -2.109  1.00 0.00 ? 127 LYS A NZ   3  
ATOM 4340  H H    . LYS A 1 90 ? -22.952 -3.393  -0.291  1.00 0.00 ? 127 LYS A H    3  
ATOM 4341  H HA   . LYS A 1 90 ? -25.684 -3.787  0.336   1.00 0.00 ? 127 LYS A HA   3  
ATOM 4342  H HB2  . LYS A 1 90 ? -25.689 -6.258  0.096   1.00 0.00 ? 127 LYS A HB2  3  
ATOM 4343  H HB3  . LYS A 1 90 ? -25.551 -5.429  -1.448  1.00 0.00 ? 127 LYS A HB3  3  
ATOM 4344  H HG2  . LYS A 1 90 ? -23.039 -5.791  -1.235  1.00 0.00 ? 127 LYS A HG2  3  
ATOM 4345  H HG3  . LYS A 1 90 ? -23.430 -6.915  0.067   1.00 0.00 ? 127 LYS A HG3  3  
ATOM 4346  H HD2  . LYS A 1 90 ? -24.987 -8.046  -1.600  1.00 0.00 ? 127 LYS A HD2  3  
ATOM 4347  H HD3  . LYS A 1 90 ? -24.178 -7.086  -2.838  1.00 0.00 ? 127 LYS A HD3  3  
ATOM 4348  H HE2  . LYS A 1 90 ? -22.940 -9.120  -0.996  1.00 0.00 ? 127 LYS A HE2  3  
ATOM 4349  H HE3  . LYS A 1 90 ? -23.134 -9.237  -2.744  1.00 0.00 ? 127 LYS A HE3  3  
ATOM 4350  H HZ1  . LYS A 1 90 ? -21.447 -7.210  -1.371  1.00 0.00 ? 127 LYS A HZ1  3  
ATOM 4351  H HZ2  . LYS A 1 90 ? -20.865 -8.652  -2.046  1.00 0.00 ? 127 LYS A HZ2  3  
ATOM 4352  H HZ3  . LYS A 1 90 ? -21.558 -7.470  -3.045  1.00 0.00 ? 127 LYS A HZ3  3  
ATOM 4353  N N    . GLU A 1 91 ? -24.330 -5.771  2.132   1.00 0.00 ? 128 GLU A N    3  
ATOM 4354  C CA   . GLU A 1 91 ? -23.770 -6.116  3.430   1.00 0.00 ? 128 GLU A CA   3  
ATOM 4355  C C    . GLU A 1 91 ? -22.244 -6.165  3.361   1.00 0.00 ? 128 GLU A C    3  
ATOM 4356  O O    . GLU A 1 91 ? -21.666 -6.889  2.544   1.00 0.00 ? 128 GLU A O    3  
ATOM 4357  C CB   . GLU A 1 91 ? -24.327 -7.460  3.903   1.00 0.00 ? 128 GLU A CB   3  
ATOM 4358  C CG   . GLU A 1 91 ? -23.861 -7.859  5.290   1.00 0.00 ? 128 GLU A CG   3  
ATOM 4359  C CD   . GLU A 1 91 ? -24.369 -9.223  5.708   1.00 0.00 ? 128 GLU A CD   3  
ATOM 4360  O OE1  . GLU A 1 91 ? -25.093 -9.856  4.916   1.00 0.00 ? 128 GLU A OE1  3  
ATOM 4361  O OE2  . GLU A 1 91 ? -24.065 -9.664  6.838   1.00 0.00 ? 128 GLU A OE2  3  
ATOM 4362  H H    . GLU A 1 91 ? -24.838 -6.449  1.636   1.00 0.00 ? 128 GLU A H    3  
ATOM 4363  H HA   . GLU A 1 91 ? -24.060 -5.347  4.131   1.00 0.00 ? 128 GLU A HA   3  
ATOM 4364  H HB2  . GLU A 1 91 ? -25.406 -7.405  3.912   1.00 0.00 ? 128 GLU A HB2  3  
ATOM 4365  H HB3  . GLU A 1 91 ? -24.020 -8.228  3.208   1.00 0.00 ? 128 GLU A HB3  3  
ATOM 4366  H HG2  . GLU A 1 91 ? -22.781 -7.878  5.299   1.00 0.00 ? 128 GLU A HG2  3  
ATOM 4367  H HG3  . GLU A 1 91 ? -24.212 -7.127  6.000   1.00 0.00 ? 128 GLU A HG3  3  
ATOM 4368  N N    . VAL A 1 92 ? -21.603 -5.372  4.208   1.00 0.00 ? 129 VAL A N    3  
ATOM 4369  C CA   . VAL A 1 92 ? -20.150 -5.284  4.239   1.00 0.00 ? 129 VAL A CA   3  
ATOM 4370  C C    . VAL A 1 92 ? -19.707 -4.575  5.525   1.00 0.00 ? 129 VAL A C    3  
ATOM 4371  O O    . VAL A 1 92 ? -18.886 -3.655  5.526   1.00 0.00 ? 129 VAL A O    3  
ATOM 4372  C CB   . VAL A 1 92 ? -19.603 -4.570  2.970   1.00 0.00 ? 129 VAL A CB   3  
ATOM 4373  C CG1  . VAL A 1 92 ? -20.087 -3.128  2.879   1.00 0.00 ? 129 VAL A CG1  3  
ATOM 4374  C CG2  . VAL A 1 92 ? -18.080 -4.644  2.906   1.00 0.00 ? 129 VAL A CG2  3  
ATOM 4375  H H    . VAL A 1 92 ? -22.128 -4.801  4.813   1.00 0.00 ? 129 VAL A H    3  
ATOM 4376  H HA   . VAL A 1 92 ? -19.763 -6.292  4.253   1.00 0.00 ? 129 VAL A HA   3  
ATOM 4377  H HB   . VAL A 1 92 ? -19.990 -5.097  2.110   1.00 0.00 ? 129 VAL A HB   3  
ATOM 4378  H HG11 . VAL A 1 92 ? -20.175 -2.713  3.872   1.00 0.00 ? 129 VAL A HG11 3  
ATOM 4379  H HG12 . VAL A 1 92 ? -19.378 -2.546  2.308   1.00 0.00 ? 129 VAL A HG12 3  
ATOM 4380  H HG13 . VAL A 1 92 ? -21.050 -3.101  2.391   1.00 0.00 ? 129 VAL A HG13 3  
ATOM 4381  H HG21 . VAL A 1 92 ? -17.767 -5.678  2.923   1.00 0.00 ? 129 VAL A HG21 3  
ATOM 4382  H HG22 . VAL A 1 92 ? -17.736 -4.179  1.994   1.00 0.00 ? 129 VAL A HG22 3  
ATOM 4383  H HG23 . VAL A 1 92 ? -17.658 -4.128  3.755   1.00 0.00 ? 129 VAL A HG23 3  
ATOM 4384  N N    . SER A 1 93 ? -20.289 -5.010  6.631   1.00 0.00 ? 130 SER A N    3  
ATOM 4385  C CA   . SER A 1 93 ? -19.987 -4.457  7.940   1.00 0.00 ? 130 SER A CA   3  
ATOM 4386  C C    . SER A 1 93 ? -20.312 -5.491  9.008   1.00 0.00 ? 130 SER A C    3  
ATOM 4387  O O    . SER A 1 93 ? -21.180 -6.354  8.744   1.00 0.00 ? 130 SER A O    3  
ATOM 4388  C CB   . SER A 1 93 ? -20.791 -3.172  8.181   1.00 0.00 ? 130 SER A CB   3  
ATOM 4389  O OG   . SER A 1 93 ? -20.520 -2.201  7.180   1.00 0.00 ? 130 SER A OG   3  
ATOM 4390  O OXT  . SER A 1 93 ? -19.679 -5.462  10.082  1.00 0.00 ? 130 SER A OXT  3  
ATOM 4391  H H    . SER A 1 93 ? -20.936 -5.746  6.572   1.00 0.00 ? 130 SER A H    3  
ATOM 4392  H HA   . SER A 1 93 ? -18.932 -4.230  7.976   1.00 0.00 ? 130 SER A HA   3  
ATOM 4393  H HB2  . SER A 1 93 ? -21.845 -3.399  8.166   1.00 0.00 ? 130 SER A HB2  3  
ATOM 4394  H HB3  . SER A 1 93 ? -20.526 -2.761  9.144   1.00 0.00 ? 130 SER A HB3  3  
ATOM 4395  H HG   . SER A 1 93 ? -19.687 -2.427  6.734   1.00 0.00 ? 130 SER A HG   3  
ATOM 4396  N N    . LYS A 1 2  ? 16.323  -4.009  15.660  1.00 0.00 ? 39  LYS A N    4  
ATOM 4397  C CA   . LYS A 1 2  ? 15.814  -4.322  14.305  1.00 0.00 ? 39  LYS A CA   4  
ATOM 4398  C C    . LYS A 1 2  ? 16.887  -4.073  13.248  1.00 0.00 ? 39  LYS A C    4  
ATOM 4399  O O    . LYS A 1 2  ? 16.608  -3.544  12.173  1.00 0.00 ? 39  LYS A O    4  
ATOM 4400  C CB   . LYS A 1 2  ? 14.570  -3.463  14.033  1.00 0.00 ? 39  LYS A CB   4  
ATOM 4401  C CG   . LYS A 1 2  ? 14.794  -1.966  14.205  1.00 0.00 ? 39  LYS A CG   4  
ATOM 4402  C CD   . LYS A 1 2  ? 13.541  -1.161  13.880  1.00 0.00 ? 39  LYS A CD   4  
ATOM 4403  C CE   . LYS A 1 2  ? 12.394  -1.498  14.821  1.00 0.00 ? 39  LYS A CE   4  
ATOM 4404  N NZ   . LYS A 1 2  ? 11.172  -0.708  14.511  1.00 0.00 ? 39  LYS A NZ   4  
ATOM 4405  H H1   . LYS A 1 2  ? 16.859  -3.111  15.645  1.00 0.00 ? 39  LYS A H1   4  
ATOM 4406  H H2   . LYS A 1 2  ? 15.531  -3.914  16.332  1.00 0.00 ? 39  LYS A H2   4  
ATOM 4407  H H3   . LYS A 1 2  ? 16.957  -4.768  15.990  1.00 0.00 ? 39  LYS A H3   4  
ATOM 4408  H HA   . LYS A 1 2  ? 15.536  -5.366  14.280  1.00 0.00 ? 39  LYS A HA   4  
ATOM 4409  H HB2  . LYS A 1 2  ? 14.242  -3.640  13.019  1.00 0.00 ? 39  LYS A HB2  4  
ATOM 4410  H HB3  . LYS A 1 2  ? 13.786  -3.767  14.710  1.00 0.00 ? 39  LYS A HB3  4  
ATOM 4411  H HG2  . LYS A 1 2  ? 15.075  -1.772  15.228  1.00 0.00 ? 39  LYS A HG2  4  
ATOM 4412  H HG3  . LYS A 1 2  ? 15.590  -1.654  13.546  1.00 0.00 ? 39  LYS A HG3  4  
ATOM 4413  H HD2  . LYS A 1 2  ? 13.767  -0.110  13.971  1.00 0.00 ? 39  LYS A HD2  4  
ATOM 4414  H HD3  . LYS A 1 2  ? 13.240  -1.380  12.865  1.00 0.00 ? 39  LYS A HD3  4  
ATOM 4415  H HE2  . LYS A 1 2  ? 12.164  -2.549  14.726  1.00 0.00 ? 39  LYS A HE2  4  
ATOM 4416  H HE3  . LYS A 1 2  ? 12.703  -1.286  15.834  1.00 0.00 ? 39  LYS A HE3  4  
ATOM 4417  H HZ1  . LYS A 1 2  ? 10.950  -0.768  13.494  1.00 0.00 ? 39  LYS A HZ1  4  
ATOM 4418  H HZ2  . LYS A 1 2  ? 10.361  -1.071  15.053  1.00 0.00 ? 39  LYS A HZ2  4  
ATOM 4419  H HZ3  . LYS A 1 2  ? 11.321  0.295   14.763  1.00 0.00 ? 39  LYS A HZ3  4  
ATOM 4420  N N    . GLU A 1 3  ? 18.117  -4.479  13.552  1.00 0.00 ? 40  GLU A N    4  
ATOM 4421  C CA   . GLU A 1 3  ? 19.236  -4.308  12.634  1.00 0.00 ? 40  GLU A CA   4  
ATOM 4422  C C    . GLU A 1 3  ? 19.222  -5.368  11.534  1.00 0.00 ? 40  GLU A C    4  
ATOM 4423  O O    . GLU A 1 3  ? 20.183  -6.115  11.363  1.00 0.00 ? 40  GLU A O    4  
ATOM 4424  C CB   . GLU A 1 3  ? 20.564  -4.365  13.388  1.00 0.00 ? 40  GLU A CB   4  
ATOM 4425  C CG   . GLU A 1 3  ? 20.739  -3.251  14.405  1.00 0.00 ? 40  GLU A CG   4  
ATOM 4426  C CD   . GLU A 1 3  ? 22.088  -3.314  15.091  1.00 0.00 ? 40  GLU A CD   4  
ATOM 4427  O OE1  . GLU A 1 3  ? 22.411  -4.363  15.687  1.00 0.00 ? 40  GLU A OE1  4  
ATOM 4428  O OE2  . GLU A 1 3  ? 22.832  -2.313  15.035  1.00 0.00 ? 40  GLU A OE2  4  
ATOM 4429  H H    . GLU A 1 3  ? 18.274  -4.921  14.418  1.00 0.00 ? 40  GLU A H    4  
ATOM 4430  H HA   . GLU A 1 3  ? 19.137  -3.336  12.175  1.00 0.00 ? 40  GLU A HA   4  
ATOM 4431  H HB2  . GLU A 1 3  ? 20.629  -5.309  13.907  1.00 0.00 ? 40  GLU A HB2  4  
ATOM 4432  H HB3  . GLU A 1 3  ? 21.371  -4.300  12.674  1.00 0.00 ? 40  GLU A HB3  4  
ATOM 4433  H HG2  . GLU A 1 3  ? 20.653  -2.300  13.901  1.00 0.00 ? 40  GLU A HG2  4  
ATOM 4434  H HG3  . GLU A 1 3  ? 19.966  -3.336  15.154  1.00 0.00 ? 40  GLU A HG3  4  
ATOM 4435  N N    . GLU A 1 4  ? 18.154  -5.386  10.760  1.00 0.00 ? 41  GLU A N    4  
ATOM 4436  C CA   . GLU A 1 4  ? 18.040  -6.284  9.625   1.00 0.00 ? 41  GLU A CA   4  
ATOM 4437  C C    . GLU A 1 4  ? 17.561  -5.496  8.416   1.00 0.00 ? 41  GLU A C    4  
ATOM 4438  O O    . GLU A 1 4  ? 16.931  -4.447  8.570   1.00 0.00 ? 41  GLU A O    4  
ATOM 4439  C CB   . GLU A 1 4  ? 17.069  -7.426  9.925   1.00 0.00 ? 41  GLU A CB   4  
ATOM 4440  C CG   . GLU A 1 4  ? 15.645  -6.952  10.140  1.00 0.00 ? 41  GLU A CG   4  
ATOM 4441  C CD   . GLU A 1 4  ? 14.681  -8.058  10.515  1.00 0.00 ? 41  GLU A CD   4  
ATOM 4442  O OE1  . GLU A 1 4  ? 15.112  -9.225  10.650  1.00 0.00 ? 41  GLU A OE1  4  
ATOM 4443  O OE2  . GLU A 1 4  ? 13.481  -7.760  10.688  1.00 0.00 ? 41  GLU A OE2  4  
ATOM 4444  H H    . GLU A 1 4  ? 17.441  -4.728  10.918  1.00 0.00 ? 41  GLU A H    4  
ATOM 4445  H HA   . GLU A 1 4  ? 19.020  -6.690  9.418   1.00 0.00 ? 41  GLU A HA   4  
ATOM 4446  H HB2  . GLU A 1 4  ? 17.076  -8.118  9.095   1.00 0.00 ? 41  GLU A HB2  4  
ATOM 4447  H HB3  . GLU A 1 4  ? 17.396  -7.940  10.816  1.00 0.00 ? 41  GLU A HB3  4  
ATOM 4448  H HG2  . GLU A 1 4  ? 15.643  -6.217  10.931  1.00 0.00 ? 41  GLU A HG2  4  
ATOM 4449  H HG3  . GLU A 1 4  ? 15.299  -6.491  9.225   1.00 0.00 ? 41  GLU A HG3  4  
ATOM 4450  N N    . ALA A 1 5  ? 17.908  -5.960  7.230   1.00 0.00 ? 42  ALA A N    4  
ATOM 4451  C CA   . ALA A 1 5  ? 17.544  -5.259  6.011   1.00 0.00 ? 42  ALA A CA   4  
ATOM 4452  C C    . ALA A 1 5  ? 16.035  -5.228  5.821   1.00 0.00 ? 42  ALA A C    4  
ATOM 4453  O O    . ALA A 1 5  ? 15.354  -6.243  5.995   1.00 0.00 ? 42  ALA A O    4  
ATOM 4454  C CB   . ALA A 1 5  ? 18.216  -5.896  4.807   1.00 0.00 ? 42  ALA A CB   4  
ATOM 4455  H H    . ALA A 1 5  ? 18.437  -6.786  7.169   1.00 0.00 ? 42  ALA A H    4  
ATOM 4456  H HA   . ALA A 1 5  ? 17.902  -4.243  6.099   1.00 0.00 ? 42  ALA A HA   4  
ATOM 4457  H HB1  . ALA A 1 5  ? 18.432  -6.932  5.023   1.00 0.00 ? 42  ALA A HB1  4  
ATOM 4458  H HB2  . ALA A 1 5  ? 17.558  -5.834  3.953   1.00 0.00 ? 42  ALA A HB2  4  
ATOM 4459  H HB3  . ALA A 1 5  ? 19.137  -5.374  4.591   1.00 0.00 ? 42  ALA A HB3  4  
ATOM 4460  N N    . SER A 1 6  ? 15.533  -4.046  5.475   1.00 0.00 ? 43  SER A N    4  
ATOM 4461  C CA   . SER A 1 6  ? 14.111  -3.807  5.230   1.00 0.00 ? 43  SER A CA   4  
ATOM 4462  C C    . SER A 1 6  ? 13.246  -4.283  6.400   1.00 0.00 ? 43  SER A C    4  
ATOM 4463  O O    . SER A 1 6  ? 12.230  -4.950  6.209   1.00 0.00 ? 43  SER A O    4  
ATOM 4464  C CB   . SER A 1 6  ? 13.661  -4.452  3.905   1.00 0.00 ? 43  SER A CB   4  
ATOM 4465  O OG   . SER A 1 6  ? 13.900  -5.849  3.879   1.00 0.00 ? 43  SER A OG   4  
ATOM 4466  H H    . SER A 1 6  ? 16.153  -3.291  5.394   1.00 0.00 ? 43  SER A H    4  
ATOM 4467  H HA   . SER A 1 6  ? 13.984  -2.737  5.142   1.00 0.00 ? 43  SER A HA   4  
ATOM 4468  H HB2  . SER A 1 6  ? 12.604  -4.282  3.769   1.00 0.00 ? 43  SER A HB2  4  
ATOM 4469  H HB3  . SER A 1 6  ? 14.201  -3.993  3.087   1.00 0.00 ? 43  SER A HB3  4  
ATOM 4470  H HG   . SER A 1 6  ? 14.289  -6.118  4.724   1.00 0.00 ? 43  SER A HG   4  
ATOM 4471  N N    . SER A 1 7  ? 13.615  -3.866  7.606   1.00 0.00 ? 44  SER A N    4  
ATOM 4472  C CA   . SER A 1 7  ? 12.854  -4.204  8.800   1.00 0.00 ? 44  SER A CA   4  
ATOM 4473  C C    . SER A 1 7  ? 11.722  -3.207  9.009   1.00 0.00 ? 44  SER A C    4  
ATOM 4474  O O    . SER A 1 7  ? 11.149  -3.109  10.095  1.00 0.00 ? 44  SER A O    4  
ATOM 4475  C CB   . SER A 1 7  ? 13.767  -4.214  10.028  1.00 0.00 ? 44  SER A CB   4  
ATOM 4476  O OG   . SER A 1 7  ? 13.196  -4.956  11.095  1.00 0.00 ? 44  SER A OG   4  
ATOM 4477  H H    . SER A 1 7  ? 14.398  -3.274  7.691   1.00 0.00 ? 44  SER A H    4  
ATOM 4478  H HA   . SER A 1 7  ? 12.431  -5.187  8.658   1.00 0.00 ? 44  SER A HA   4  
ATOM 4479  H HB2  . SER A 1 7  ? 14.714  -4.658  9.764   1.00 0.00 ? 44  SER A HB2  4  
ATOM 4480  H HB3  . SER A 1 7  ? 13.928  -3.198  10.359  1.00 0.00 ? 44  SER A HB3  4  
ATOM 4481  H HG   . SER A 1 7  ? 13.273  -5.905  10.905  1.00 0.00 ? 44  SER A HG   4  
ATOM 4482  N N    . LYS A 1 8  ? 11.350  -2.525  7.944   1.00 0.00 ? 45  LYS A N    4  
ATOM 4483  C CA   . LYS A 1 8  ? 10.222  -1.623  7.996   1.00 0.00 ? 45  LYS A CA   4  
ATOM 4484  C C    . LYS A 1 8  ? 8.950   -2.417  7.776   1.00 0.00 ? 45  LYS A C    4  
ATOM 4485  O O    . LYS A 1 8  ? 8.820   -3.128  6.776   1.00 0.00 ? 45  LYS A O    4  
ATOM 4486  C CB   . LYS A 1 8  ? 10.347  -0.528  6.934   1.00 0.00 ? 45  LYS A CB   4  
ATOM 4487  C CG   . LYS A 1 8  ? 11.710  0.143   6.899   1.00 0.00 ? 45  LYS A CG   4  
ATOM 4488  C CD   . LYS A 1 8  ? 12.033  0.832   8.214   1.00 0.00 ? 45  LYS A CD   4  
ATOM 4489  C CE   . LYS A 1 8  ? 13.482  1.290   8.253   1.00 0.00 ? 45  LYS A CE   4  
ATOM 4490  N NZ   . LYS A 1 8  ? 13.800  2.051   9.488   1.00 0.00 ? 45  LYS A NZ   4  
ATOM 4491  H H    . LYS A 1 8  ? 11.789  -2.699  7.088   1.00 0.00 ? 45  LYS A H    4  
ATOM 4492  H HA   . LYS A 1 8  ? 10.193  -1.172  8.976   1.00 0.00 ? 45  LYS A HA   4  
ATOM 4493  H HB2  . LYS A 1 8  ? 10.158  -0.960  5.964   1.00 0.00 ? 45  LYS A HB2  4  
ATOM 4494  H HB3  . LYS A 1 8  ? 9.602   0.230   7.130   1.00 0.00 ? 45  LYS A HB3  4  
ATOM 4495  H HG2  . LYS A 1 8  ? 12.464  -0.605  6.704   1.00 0.00 ? 45  LYS A HG2  4  
ATOM 4496  H HG3  . LYS A 1 8  ? 11.718  0.879   6.107   1.00 0.00 ? 45  LYS A HG3  4  
ATOM 4497  H HD2  . LYS A 1 8  ? 11.389  1.695   8.328   1.00 0.00 ? 45  LYS A HD2  4  
ATOM 4498  H HD3  . LYS A 1 8  ? 11.859  0.139   9.025   1.00 0.00 ? 45  LYS A HD3  4  
ATOM 4499  H HE2  . LYS A 1 8  ? 14.122  0.418   8.205   1.00 0.00 ? 45  LYS A HE2  4  
ATOM 4500  H HE3  . LYS A 1 8  ? 13.670  1.918   7.393   1.00 0.00 ? 45  LYS A HE3  4  
ATOM 4501  H HZ1  . LYS A 1 8  ? 12.943  2.518   9.857   1.00 0.00 ? 45  LYS A HZ1  4  
ATOM 4502  H HZ2  . LYS A 1 8  ? 14.174  1.406   10.221  1.00 0.00 ? 45  LYS A HZ2  4  
ATOM 4503  H HZ3  . LYS A 1 8  ? 14.522  2.778   9.284   1.00 0.00 ? 45  LYS A HZ3  4  
ATOM 4504  N N    . SER A 1 9  ? 8.045   -2.345  8.727   1.00 0.00 ? 46  SER A N    4  
ATOM 4505  C CA   . SER A 1 9  ? 6.800   -3.075  8.627   1.00 0.00 ? 46  SER A CA   4  
ATOM 4506  C C    . SER A 1 9  ? 5.931   -2.455  7.538   1.00 0.00 ? 46  SER A C    4  
ATOM 4507  O O    . SER A 1 9  ? 5.637   -1.258  7.569   1.00 0.00 ? 46  SER A O    4  
ATOM 4508  C CB   . SER A 1 9  ? 6.076   -3.065  9.972   1.00 0.00 ? 46  SER A CB   4  
ATOM 4509  O OG   . SER A 1 9  ? 6.970   -3.343  11.038  1.00 0.00 ? 46  SER A OG   4  
ATOM 4510  H H    . SER A 1 9  ? 8.218   -1.791  9.524   1.00 0.00 ? 46  SER A H    4  
ATOM 4511  H HA   . SER A 1 9  ? 7.031   -4.094  8.354   1.00 0.00 ? 46  SER A HA   4  
ATOM 4512  H HB2  . SER A 1 9  ? 5.640   -2.097  10.132  1.00 0.00 ? 46  SER A HB2  4  
ATOM 4513  H HB3  . SER A 1 9  ? 5.299   -3.815  9.964   1.00 0.00 ? 46  SER A HB3  4  
ATOM 4514  H HG   . SER A 1 9  ? 6.987   -2.582  11.644  1.00 0.00 ? 46  SER A HG   4  
ATOM 4515  N N    . TYR A 1 10 ? 5.583   -3.261  6.543   1.00 0.00 ? 47  TYR A N    4  
ATOM 4516  C CA   . TYR A 1 10 ? 4.809   -2.787  5.401   1.00 0.00 ? 47  TYR A CA   4  
ATOM 4517  C C    . TYR A 1 10 ? 3.474   -2.206  5.852   1.00 0.00 ? 47  TYR A C    4  
ATOM 4518  O O    . TYR A 1 10 ? 3.008   -1.215  5.301   1.00 0.00 ? 47  TYR A O    4  
ATOM 4519  C CB   . TYR A 1 10 ? 4.588   -3.917  4.387   1.00 0.00 ? 47  TYR A CB   4  
ATOM 4520  C CG   . TYR A 1 10 ? 5.829   -4.298  3.601   1.00 0.00 ? 47  TYR A CG   4  
ATOM 4521  C CD1  . TYR A 1 10 ? 7.028   -4.551  4.254   1.00 0.00 ? 47  TYR A CD1  4  
ATOM 4522  C CD2  . TYR A 1 10 ? 5.808   -4.406  2.213   1.00 0.00 ? 47  TYR A CD2  4  
ATOM 4523  C CE1  . TYR A 1 10 ? 8.167   -4.901  3.552   1.00 0.00 ? 47  TYR A CE1  4  
ATOM 4524  C CE2  . TYR A 1 10 ? 6.942   -4.756  1.502   1.00 0.00 ? 47  TYR A CE2  4  
ATOM 4525  C CZ   . TYR A 1 10 ? 8.098   -4.994  2.138   1.00 0.00 ? 47  TYR A CZ   4  
ATOM 4526  O OH   . TYR A 1 10 ? 9.257   -5.353  1.480   1.00 0.00 ? 47  TYR A OH   4  
ATOM 4527  H H    . TYR A 1 10 ? 5.897   -4.189  6.553   1.00 0.00 ? 47  TYR A H    4  
ATOM 4528  H HA   . TYR A 1 10 ? 5.379   -2.002  4.925   1.00 0.00 ? 47  TYR A HA   4  
ATOM 4529  H HB2  . TYR A 1 10 ? 4.244   -4.798  4.908   1.00 0.00 ? 47  TYR A HB2  4  
ATOM 4530  H HB3  . TYR A 1 10 ? 3.832   -3.608  3.679   1.00 0.00 ? 47  TYR A HB3  4  
ATOM 4531  H HD1  . TYR A 1 10 ? 7.066   -4.472  5.331   1.00 0.00 ? 47  TYR A HD1  4  
ATOM 4532  H HD2  . TYR A 1 10 ? 4.885   -4.215  1.688   1.00 0.00 ? 47  TYR A HD2  4  
ATOM 4533  H HE1  . TYR A 1 10 ? 9.089   -5.092  4.082   1.00 0.00 ? 47  TYR A HE1  4  
ATOM 4534  H HE2  . TYR A 1 10 ? 6.900   -4.835  0.423   1.00 0.00 ? 47  TYR A HE2  4  
ATOM 4535  H HH   . TYR A 1 10 ? 9.178   -5.067  0.559   1.00 0.00 ? 47  TYR A HH   4  
ATOM 4536  N N    . ARG A 1 11 ? 2.916   -2.780  6.910   1.00 0.00 ? 48  ARG A N    4  
ATOM 4537  C CA   . ARG A 1 11 ? 1.673   -2.288  7.500   1.00 0.00 ? 48  ARG A CA   4  
ATOM 4538  C C    . ARG A 1 11 ? 1.771   -0.804  7.868   1.00 0.00 ? 48  ARG A C    4  
ATOM 4539  O O    . ARG A 1 11 ? 0.840   -0.035  7.637   1.00 0.00 ? 48  ARG A O    4  
ATOM 4540  C CB   . ARG A 1 11 ? 1.328   -3.133  8.732   1.00 0.00 ? 48  ARG A CB   4  
ATOM 4541  C CG   . ARG A 1 11 ? 0.349   -2.476  9.692   1.00 0.00 ? 48  ARG A CG   4  
ATOM 4542  C CD   . ARG A 1 11 ? -0.144  -3.470  10.727  1.00 0.00 ? 48  ARG A CD   4  
ATOM 4543  N NE   . ARG A 1 11 ? -1.262  -4.265  10.225  1.00 0.00 ? 48  ARG A NE   4  
ATOM 4544  C CZ   . ARG A 1 11 ? -1.680  -5.407  10.764  1.00 0.00 ? 48  ARG A CZ   4  
ATOM 4545  N NH1  . ARG A 1 11 ? -0.998  -5.974  11.753  1.00 0.00 ? 48  ARG A NH1  4  
ATOM 4546  N NH2  . ARG A 1 11 ? -2.775  -5.988  10.292  1.00 0.00 ? 48  ARG A NH2  4  
ATOM 4547  H H    . ARG A 1 11 ? 3.375   -3.542  7.333   1.00 0.00 ? 48  ARG A H    4  
ATOM 4548  H HA   . ARG A 1 11 ? 0.892   -2.410  6.766   1.00 0.00 ? 48  ARG A HA   4  
ATOM 4549  H HB2  . ARG A 1 11 ? 0.895   -4.063  8.402   1.00 0.00 ? 48  ARG A HB2  4  
ATOM 4550  H HB3  . ARG A 1 11 ? 2.239   -3.342  9.273   1.00 0.00 ? 48  ARG A HB3  4  
ATOM 4551  H HG2  . ARG A 1 11 ? 0.843   -1.658  10.194  1.00 0.00 ? 48  ARG A HG2  4  
ATOM 4552  H HG3  . ARG A 1 11 ? -0.495  -2.103  9.132   1.00 0.00 ? 48  ARG A HG3  4  
ATOM 4553  H HD2  . ARG A 1 11 ? 0.668   -4.132  10.989  1.00 0.00 ? 48  ARG A HD2  4  
ATOM 4554  H HD3  . ARG A 1 11 ? -0.464  -2.929  11.604  1.00 0.00 ? 48  ARG A HD3  4  
ATOM 4555  H HE   . ARG A 1 11 ? -1.769  -3.894  9.451   1.00 0.00 ? 48  ARG A HE   4  
ATOM 4556  H HH11 . ARG A 1 11 ? -0.155  -5.543  12.097  1.00 0.00 ? 48  ARG A HH11 4  
ATOM 4557  H HH12 . ARG A 1 11 ? -1.316  -6.837  12.158  1.00 0.00 ? 48  ARG A HH12 4  
ATOM 4558  H HH21 . ARG A 1 11 ? -3.276  -5.567  9.532   1.00 0.00 ? 48  ARG A HH21 4  
ATOM 4559  H HH22 . ARG A 1 11 ? -3.099  -6.859  10.681  1.00 0.00 ? 48  ARG A HH22 4  
ATOM 4560  N N    . GLU A 1 12 ? 2.918   -0.396  8.398   1.00 0.00 ? 49  GLU A N    4  
ATOM 4561  C CA   . GLU A 1 12 ? 3.135   1.002   8.752   1.00 0.00 ? 49  GLU A CA   4  
ATOM 4562  C C    . GLU A 1 12 ? 3.245   1.846   7.497   1.00 0.00 ? 49  GLU A C    4  
ATOM 4563  O O    . GLU A 1 12 ? 2.571   2.861   7.349   1.00 0.00 ? 49  GLU A O    4  
ATOM 4564  C CB   . GLU A 1 12 ? 4.422   1.153   9.560   1.00 0.00 ? 49  GLU A CB   4  
ATOM 4565  C CG   . GLU A 1 12 ? 4.590   0.096   10.627  1.00 0.00 ? 49  GLU A CG   4  
ATOM 4566  C CD   . GLU A 1 12 ? 3.735   0.343   11.853  1.00 0.00 ? 49  GLU A CD   4  
ATOM 4567  O OE1  . GLU A 1 12 ? 2.501   0.462   11.702  1.00 0.00 ? 49  GLU A OE1  4  
ATOM 4568  O OE2  . GLU A 1 12 ? 4.288   0.438   12.971  1.00 0.00 ? 49  GLU A OE2  4  
ATOM 4569  H H    . GLU A 1 12 ? 3.648   -1.039  8.515   1.00 0.00 ? 49  GLU A H    4  
ATOM 4570  H HA   . GLU A 1 12 ? 2.295   1.341   9.339   1.00 0.00 ? 49  GLU A HA   4  
ATOM 4571  H HB2  . GLU A 1 12 ? 5.265   1.092   8.888   1.00 0.00 ? 49  GLU A HB2  4  
ATOM 4572  H HB3  . GLU A 1 12 ? 4.422   2.122   10.038  1.00 0.00 ? 49  GLU A HB3  4  
ATOM 4573  H HG2  . GLU A 1 12 ? 4.313   -0.854  10.203  1.00 0.00 ? 49  GLU A HG2  4  
ATOM 4574  H HG3  . GLU A 1 12 ? 5.629   0.070   10.923  1.00 0.00 ? 49  GLU A HG3  4  
ATOM 4575  N N    . LEU A 1 13 ? 4.130   1.407   6.618   1.00 0.00 ? 50  LEU A N    4  
ATOM 4576  C CA   . LEU A 1 13 ? 4.437   2.113   5.385   1.00 0.00 ? 50  LEU A CA   4  
ATOM 4577  C C    . LEU A 1 13 ? 3.194   2.326   4.534   1.00 0.00 ? 50  LEU A C    4  
ATOM 4578  O O    . LEU A 1 13 ? 2.936   3.434   4.062   1.00 0.00 ? 50  LEU A O    4  
ATOM 4579  C CB   . LEU A 1 13 ? 5.475   1.315   4.598   1.00 0.00 ? 50  LEU A CB   4  
ATOM 4580  C CG   . LEU A 1 13 ? 6.942   1.534   4.990   1.00 0.00 ? 50  LEU A CG   4  
ATOM 4581  C CD1  . LEU A 1 13 ? 7.119   1.706   6.487   1.00 0.00 ? 50  LEU A CD1  4  
ATOM 4582  C CD2  . LEU A 1 13 ? 7.763   0.356   4.525   1.00 0.00 ? 50  LEU A CD2  4  
ATOM 4583  H H    . LEU A 1 13 ? 4.636   0.591   6.828   1.00 0.00 ? 50  LEU A H    4  
ATOM 4584  H HA   . LEU A 1 13 ? 4.854   3.074   5.644   1.00 0.00 ? 50  LEU A HA   4  
ATOM 4585  H HB2  . LEU A 1 13 ? 5.251   0.267   4.721   1.00 0.00 ? 50  LEU A HB2  4  
ATOM 4586  H HB3  . LEU A 1 13 ? 5.367   1.564   3.553   1.00 0.00 ? 50  LEU A HB3  4  
ATOM 4587  H HG   . LEU A 1 13 ? 7.314   2.421   4.501   1.00 0.00 ? 50  LEU A HG   4  
ATOM 4588  H HD11 . LEU A 1 13 ? 6.151   1.744   6.964   1.00 0.00 ? 50  LEU A HD11 4  
ATOM 4589  H HD12 . LEU A 1 13 ? 7.681   0.869   6.877   1.00 0.00 ? 50  LEU A HD12 4  
ATOM 4590  H HD13 . LEU A 1 13 ? 7.655   2.622   6.682   1.00 0.00 ? 50  LEU A HD13 4  
ATOM 4591  H HD21 . LEU A 1 13 ? 7.537   0.143   3.490   1.00 0.00 ? 50  LEU A HD21 4  
ATOM 4592  H HD22 . LEU A 1 13 ? 8.813   0.589   4.624   1.00 0.00 ? 50  LEU A HD22 4  
ATOM 4593  H HD23 . LEU A 1 13 ? 7.525   -0.506  5.135   1.00 0.00 ? 50  LEU A HD23 4  
ATOM 4594  N N    . ILE A 1 14 ? 2.434   1.259   4.334   1.00 0.00 ? 51  ILE A N    4  
ATOM 4595  C CA   . ILE A 1 14 ? 1.233   1.327   3.522   1.00 0.00 ? 51  ILE A CA   4  
ATOM 4596  C C    . ILE A 1 14 ? 0.214   2.257   4.140   1.00 0.00 ? 51  ILE A C    4  
ATOM 4597  O O    . ILE A 1 14 ? -0.318  3.114   3.463   1.00 0.00 ? 51  ILE A O    4  
ATOM 4598  C CB   . ILE A 1 14 ? 0.577   -0.050  3.334   1.00 0.00 ? 51  ILE A CB   4  
ATOM 4599  C CG1  . ILE A 1 14 ? 1.538   -0.999  2.626   1.00 0.00 ? 51  ILE A CG1  4  
ATOM 4600  C CG2  . ILE A 1 14 ? -0.725  0.085   2.548   1.00 0.00 ? 51  ILE A CG2  4  
ATOM 4601  C CD1  . ILE A 1 14 ? 1.001   -2.401  2.513   1.00 0.00 ? 51  ILE A CD1  4  
ATOM 4602  H H    . ILE A 1 14 ? 2.696   0.399   4.736   1.00 0.00 ? 51  ILE A H    4  
ATOM 4603  H HA   . ILE A 1 14 ? 1.508   1.707   2.549   1.00 0.00 ? 51  ILE A HA   4  
ATOM 4604  H HB   . ILE A 1 14 ? 0.340   -0.450  4.309   1.00 0.00 ? 51  ILE A HB   4  
ATOM 4605  H HG12 . ILE A 1 14 ? 1.728   -0.635  1.626   1.00 0.00 ? 51  ILE A HG12 4  
ATOM 4606  H HG13 . ILE A 1 14 ? 2.467   -1.041  3.174   1.00 0.00 ? 51  ILE A HG13 4  
ATOM 4607  H HG21 . ILE A 1 14 ? -0.608  0.844   1.788   1.00 0.00 ? 51  ILE A HG21 4  
ATOM 4608  H HG22 . ILE A 1 14 ? -0.967  -0.858  2.080   1.00 0.00 ? 51  ILE A HG22 4  
ATOM 4609  H HG23 . ILE A 1 14 ? -1.525  0.371   3.221   1.00 0.00 ? 51  ILE A HG23 4  
ATOM 4610  H HD11 . ILE A 1 14 ? -0.073  -2.377  2.618   1.00 0.00 ? 51  ILE A HD11 4  
ATOM 4611  H HD12 . ILE A 1 14 ? 1.260   -2.809  1.549   1.00 0.00 ? 51  ILE A HD12 4  
ATOM 4612  H HD13 . ILE A 1 14 ? 1.428   -3.012  3.295   1.00 0.00 ? 51  ILE A HD13 4  
ATOM 4613  N N    . ILE A 1 15 ? -0.106  2.041   5.405   1.00 0.00 ? 52  ILE A N    4  
ATOM 4614  C CA   . ILE A 1 15 ? -1.141  2.821   6.060   1.00 0.00 ? 52  ILE A CA   4  
ATOM 4615  C C    . ILE A 1 15 ? -0.769  4.299   6.154   1.00 0.00 ? 52  ILE A C    4  
ATOM 4616  O O    . ILE A 1 15 ? -1.578  5.167   5.812   1.00 0.00 ? 52  ILE A O    4  
ATOM 4617  C CB   . ILE A 1 15 ? -1.469  2.257   7.454   1.00 0.00 ? 52  ILE A CB   4  
ATOM 4618  C CG1  . ILE A 1 15 ? -2.295  0.976   7.293   1.00 0.00 ? 52  ILE A CG1  4  
ATOM 4619  C CG2  . ILE A 1 15 ? -2.212  3.295   8.278   1.00 0.00 ? 52  ILE A CG2  4  
ATOM 4620  C CD1  . ILE A 1 15 ? -2.458  0.165   8.557   1.00 0.00 ? 52  ILE A CD1  4  
ATOM 4621  H H    . ILE A 1 15 ? 0.317   1.298   5.888   1.00 0.00 ? 52  ILE A H    4  
ATOM 4622  H HA   . ILE A 1 15 ? -2.033  2.737   5.456   1.00 0.00 ? 52  ILE A HA   4  
ATOM 4623  H HB   . ILE A 1 15 ? -0.542  2.024   7.956   1.00 0.00 ? 52  ILE A HB   4  
ATOM 4624  H HG12 . ILE A 1 15 ? -3.283  1.239   6.946   1.00 0.00 ? 52  ILE A HG12 4  
ATOM 4625  H HG13 . ILE A 1 15 ? -1.821  0.344   6.554   1.00 0.00 ? 52  ILE A HG13 4  
ATOM 4626  H HG21 . ILE A 1 15 ? -2.054  4.272   7.837   1.00 0.00 ? 52  ILE A HG21 4  
ATOM 4627  H HG22 . ILE A 1 15 ? -3.267  3.067   8.281   1.00 0.00 ? 52  ILE A HG22 4  
ATOM 4628  H HG23 . ILE A 1 15 ? -1.835  3.290   9.289   1.00 0.00 ? 52  ILE A HG23 4  
ATOM 4629  H HD11 . ILE A 1 15 ? -1.490  0.005   9.012   1.00 0.00 ? 52  ILE A HD11 4  
ATOM 4630  H HD12 . ILE A 1 15 ? -3.099  0.695   9.247   1.00 0.00 ? 52  ILE A HD12 4  
ATOM 4631  H HD13 . ILE A 1 15 ? -2.906  -0.792  8.313   1.00 0.00 ? 52  ILE A HD13 4  
ATOM 4632  N N    . GLU A 1 16 ? 0.469   4.576   6.546   1.00 0.00 ? 53  GLU A N    4  
ATOM 4633  C CA   . GLU A 1 16 ? 0.960   5.947   6.622   1.00 0.00 ? 53  GLU A CA   4  
ATOM 4634  C C    . GLU A 1 16 ? 0.855   6.612   5.255   1.00 0.00 ? 53  GLU A C    4  
ATOM 4635  O O    . GLU A 1 16 ? 0.421   7.760   5.129   1.00 0.00 ? 53  GLU A O    4  
ATOM 4636  C CB   . GLU A 1 16 ? 2.414   5.952   7.098   1.00 0.00 ? 53  GLU A CB   4  
ATOM 4637  C CG   . GLU A 1 16 ? 2.944   7.327   7.467   1.00 0.00 ? 53  GLU A CG   4  
ATOM 4638  C CD   . GLU A 1 16 ? 2.258   7.905   8.684   1.00 0.00 ? 53  GLU A CD   4  
ATOM 4639  O OE1  . GLU A 1 16 ? 1.076   8.297   8.582   1.00 0.00 ? 53  GLU A OE1  4  
ATOM 4640  O OE2  . GLU A 1 16 ? 2.891   7.952   9.756   1.00 0.00 ? 53  GLU A OE2  4  
ATOM 4641  H H    . GLU A 1 16 ? 1.083   3.837   6.760   1.00 0.00 ? 53  GLU A H    4  
ATOM 4642  H HA   . GLU A 1 16 ? 0.350   6.490   7.329   1.00 0.00 ? 53  GLU A HA   4  
ATOM 4643  H HB2  . GLU A 1 16 ? 2.492   5.317   7.967   1.00 0.00 ? 53  GLU A HB2  4  
ATOM 4644  H HB3  . GLU A 1 16 ? 3.036   5.550   6.312   1.00 0.00 ? 53  GLU A HB3  4  
ATOM 4645  H HG2  . GLU A 1 16 ? 4.001   7.248   7.674   1.00 0.00 ? 53  GLU A HG2  4  
ATOM 4646  H HG3  . GLU A 1 16 ? 2.790   7.994   6.632   1.00 0.00 ? 53  GLU A HG3  4  
ATOM 4647  N N    . GLY A 1 17 ? 1.194   5.851   4.230   1.00 0.00 ? 54  GLY A N    4  
ATOM 4648  C CA   . GLY A 1 17 ? 1.085   6.332   2.878   1.00 0.00 ? 54  GLY A CA   4  
ATOM 4649  C C    . GLY A 1 17 ? -0.348  6.455   2.419   1.00 0.00 ? 54  GLY A C    4  
ATOM 4650  O O    . GLY A 1 17 ? -0.762  7.497   1.921   1.00 0.00 ? 54  GLY A O    4  
ATOM 4651  H H    . GLY A 1 17 ? 1.487   4.928   4.396   1.00 0.00 ? 54  GLY A H    4  
ATOM 4652  H HA2  . GLY A 1 17 ? 1.567   7.294   2.802   1.00 0.00 ? 54  GLY A HA2  4  
ATOM 4653  H HA3  . GLY A 1 17 ? 1.590   5.632   2.238   1.00 0.00 ? 54  GLY A HA3  4  
ATOM 4654  N N    . LEU A 1 18 ? -1.080  5.366   2.560   1.00 0.00 ? 55  LEU A N    4  
ATOM 4655  C CA   . LEU A 1 18 ? -2.459  5.259   2.114   1.00 0.00 ? 55  LEU A CA   4  
ATOM 4656  C C    . LEU A 1 18 ? -3.332  6.376   2.686   1.00 0.00 ? 55  LEU A C    4  
ATOM 4657  O O    . LEU A 1 18 ? -4.214  6.898   2.004   1.00 0.00 ? 55  LEU A O    4  
ATOM 4658  C CB   . LEU A 1 18 ? -2.993  3.880   2.513   1.00 0.00 ? 55  LEU A CB   4  
ATOM 4659  C CG   . LEU A 1 18 ? -4.416  3.546   2.082   1.00 0.00 ? 55  LEU A CG   4  
ATOM 4660  C CD1  . LEU A 1 18 ? -4.574  3.667   0.587   1.00 0.00 ? 55  LEU A CD1  4  
ATOM 4661  C CD2  . LEU A 1 18 ? -4.775  2.141   2.528   1.00 0.00 ? 55  LEU A CD2  4  
ATOM 4662  H H    . LEU A 1 18 ? -0.649  4.554   2.934   1.00 0.00 ? 55  LEU A H    4  
ATOM 4663  H HA   . LEU A 1 18 ? -2.460  5.332   1.036   1.00 0.00 ? 55  LEU A HA   4  
ATOM 4664  H HB2  . LEU A 1 18 ? -2.337  3.135   2.088   1.00 0.00 ? 55  LEU A HB2  4  
ATOM 4665  H HB3  . LEU A 1 18 ? -2.944  3.801   3.590   1.00 0.00 ? 55  LEU A HB3  4  
ATOM 4666  H HG   . LEU A 1 18 ? -5.102  4.232   2.550   1.00 0.00 ? 55  LEU A HG   4  
ATOM 4667  H HD11 . LEU A 1 18 ? -3.605  3.798   0.131   1.00 0.00 ? 55  LEU A HD11 4  
ATOM 4668  H HD12 . LEU A 1 18 ? -5.035  2.766   0.208   1.00 0.00 ? 55  LEU A HD12 4  
ATOM 4669  H HD13 . LEU A 1 18 ? -5.201  4.514   0.361   1.00 0.00 ? 55  LEU A HD13 4  
ATOM 4670  H HD21 . LEU A 1 18 ? -3.914  1.676   2.985   1.00 0.00 ? 55  LEU A HD21 4  
ATOM 4671  H HD22 . LEU A 1 18 ? -5.583  2.187   3.244   1.00 0.00 ? 55  LEU A HD22 4  
ATOM 4672  H HD23 . LEU A 1 18 ? -5.085  1.561   1.670   1.00 0.00 ? 55  LEU A HD23 4  
ATOM 4673  N N    . THR A 1 19 ? -3.082  6.744   3.933   1.00 0.00 ? 56  THR A N    4  
ATOM 4674  C CA   . THR A 1 19 ? -3.849  7.793   4.576   1.00 0.00 ? 56  THR A CA   4  
ATOM 4675  C C    . THR A 1 19 ? -3.434  9.167   4.046   1.00 0.00 ? 56  THR A C    4  
ATOM 4676  O O    . THR A 1 19 ? -4.257  10.082  3.950   1.00 0.00 ? 56  THR A O    4  
ATOM 4677  C CB   . THR A 1 19 ? -3.719  7.736   6.120   1.00 0.00 ? 56  THR A CB   4  
ATOM 4678  O OG1  . THR A 1 19 ? -4.757  8.514   6.731   1.00 0.00 ? 56  THR A OG1  4  
ATOM 4679  C CG2  . THR A 1 19 ? -2.365  8.237   6.598   1.00 0.00 ? 56  THR A CG2  4  
ATOM 4680  H H    . THR A 1 19 ? -2.362  6.300   4.428   1.00 0.00 ? 56  THR A H    4  
ATOM 4681  H HA   . THR A 1 19 ? -4.889  7.632   4.326   1.00 0.00 ? 56  THR A HA   4  
ATOM 4682  H HB   . THR A 1 19 ? -3.828  6.707   6.430   1.00 0.00 ? 56  THR A HB   4  
ATOM 4683  H HG1  . THR A 1 19 ? -5.338  7.925   7.238   1.00 0.00 ? 56  THR A HG1  4  
ATOM 4684  H HG21 . THR A 1 19 ? -1.649  8.161   5.794   1.00 0.00 ? 56  THR A HG21 4  
ATOM 4685  H HG22 . THR A 1 19 ? -2.451  9.266   6.910   1.00 0.00 ? 56  THR A HG22 4  
ATOM 4686  H HG23 . THR A 1 19 ? -2.036  7.633   7.431   1.00 0.00 ? 56  THR A HG23 4  
ATOM 4687  N N    . ALA A 1 20 ? -2.164  9.292   3.667   1.00 0.00 ? 57  ALA A N    4  
ATOM 4688  C CA   . ALA A 1 20 ? -1.636  10.539  3.131   1.00 0.00 ? 57  ALA A CA   4  
ATOM 4689  C C    . ALA A 1 20 ? -2.136  10.787  1.714   1.00 0.00 ? 57  ALA A C    4  
ATOM 4690  O O    . ALA A 1 20 ? -2.704  11.839  1.419   1.00 0.00 ? 57  ALA A O    4  
ATOM 4691  C CB   . ALA A 1 20 ? -0.114  10.520  3.154   1.00 0.00 ? 57  ALA A CB   4  
ATOM 4692  H H    . ALA A 1 20 ? -1.569  8.514   3.732   1.00 0.00 ? 57  ALA A H    4  
ATOM 4693  H HA   . ALA A 1 20 ? -1.975  11.346  3.767   1.00 0.00 ? 57  ALA A HA   4  
ATOM 4694  H HB1  . ALA A 1 20 ? 0.228   10.329  4.162   1.00 0.00 ? 57  ALA A HB1  4  
ATOM 4695  H HB2  . ALA A 1 20 ? 0.265   11.475  2.821   1.00 0.00 ? 57  ALA A HB2  4  
ATOM 4696  H HB3  . ALA A 1 20 ? 0.246   9.740   2.500   1.00 0.00 ? 57  ALA A HB3  4  
ATOM 4697  N N    . LEU A 1 21 ? -1.939  9.808   0.841   1.00 0.00 ? 58  LEU A N    4  
ATOM 4698  C CA   . LEU A 1 21 ? -2.357  9.929   -0.551  1.00 0.00 ? 58  LEU A CA   4  
ATOM 4699  C C    . LEU A 1 21 ? -3.785  9.446   -0.751  1.00 0.00 ? 58  LEU A C    4  
ATOM 4700  O O    . LEU A 1 21 ? -4.123  8.898   -1.799  1.00 0.00 ? 58  LEU A O    4  
ATOM 4701  C CB   . LEU A 1 21 ? -1.402  9.159   -1.468  1.00 0.00 ? 58  LEU A CB   4  
ATOM 4702  C CG   . LEU A 1 21 ? -0.972  7.765   -0.988  1.00 0.00 ? 58  LEU A CG   4  
ATOM 4703  C CD1  . LEU A 1 21 ? -2.139  6.792   -0.952  1.00 0.00 ? 58  LEU A CD1  4  
ATOM 4704  C CD2  . LEU A 1 21 ? 0.126   7.225   -1.877  1.00 0.00 ? 58  LEU A CD2  4  
ATOM 4705  H H    . LEU A 1 21 ? -1.495  8.981   1.140   1.00 0.00 ? 58  LEU A H    4  
ATOM 4706  H HA   . LEU A 1 21 ? -2.313  10.975  -0.810  1.00 0.00 ? 58  LEU A HA   4  
ATOM 4707  H HB2  . LEU A 1 21 ? -1.884  9.044   -2.429  1.00 0.00 ? 58  LEU A HB2  4  
ATOM 4708  H HB3  . LEU A 1 21 ? -0.514  9.756   -1.604  1.00 0.00 ? 58  LEU A HB3  4  
ATOM 4709  H HG   . LEU A 1 21 ? -0.576  7.846   0.016   1.00 0.00 ? 58  LEU A HG   4  
ATOM 4710  H HD11 . LEU A 1 21 ? -2.712  6.884   -1.862  1.00 0.00 ? 58  LEU A HD11 4  
ATOM 4711  H HD12 . LEU A 1 21 ? -1.764  5.782   -0.862  1.00 0.00 ? 58  LEU A HD12 4  
ATOM 4712  H HD13 . LEU A 1 21 ? -2.772  7.018   -0.104  1.00 0.00 ? 58  LEU A HD13 4  
ATOM 4713  H HD21 . LEU A 1 21 ? -0.178  7.311   -2.911  1.00 0.00 ? 58  LEU A HD21 4  
ATOM 4714  H HD22 . LEU A 1 21 ? 1.030   7.794   -1.719  1.00 0.00 ? 58  LEU A HD22 4  
ATOM 4715  H HD23 . LEU A 1 21 ? 0.301   6.188   -1.639  1.00 0.00 ? 58  LEU A HD23 4  
ATOM 4716  N N    . LYS A 1 22 ? -4.603  9.607   0.277   1.00 0.00 ? 59  LYS A N    4  
ATOM 4717  C CA   . LYS A 1 22 ? -5.982  9.146   0.246   1.00 0.00 ? 59  LYS A CA   4  
ATOM 4718  C C    . LYS A 1 22 ? -6.729  9.724   -0.964  1.00 0.00 ? 59  LYS A C    4  
ATOM 4719  O O    . LYS A 1 22 ? -7.594  9.054   -1.532  1.00 0.00 ? 59  LYS A O    4  
ATOM 4720  C CB   . LYS A 1 22 ? -6.688  9.527   1.555   1.00 0.00 ? 59  LYS A CB   4  
ATOM 4721  C CG   . LYS A 1 22 ? -7.151  10.977  1.612   1.00 0.00 ? 59  LYS A CG   4  
ATOM 4722  C CD   . LYS A 1 22 ? -6.949  11.609  2.986   1.00 0.00 ? 59  LYS A CD   4  
ATOM 4723  C CE   . LYS A 1 22 ? -7.728  10.894  4.085   1.00 0.00 ? 59  LYS A CE   4  
ATOM 4724  N NZ   . LYS A 1 22 ? -6.970  9.753   4.668   1.00 0.00 ? 59  LYS A NZ   4  
ATOM 4725  H H    . LYS A 1 22 ? -4.248  9.985   1.110   1.00 0.00 ? 59  LYS A H    4  
ATOM 4726  H HA   . LYS A 1 22 ? -5.967  8.069   0.159   1.00 0.00 ? 59  LYS A HA   4  
ATOM 4727  H HB2  . LYS A 1 22 ? -7.551  8.894   1.681   1.00 0.00 ? 59  LYS A HB2  4  
ATOM 4728  H HB3  . LYS A 1 22 ? -6.007  9.360   2.378   1.00 0.00 ? 59  LYS A HB3  4  
ATOM 4729  H HG2  . LYS A 1 22 ? -6.591  11.547  0.884   1.00 0.00 ? 59  LYS A HG2  4  
ATOM 4730  H HG3  . LYS A 1 22 ? -8.202  11.009  1.358   1.00 0.00 ? 59  LYS A HG3  4  
ATOM 4731  H HD2  . LYS A 1 22 ? -5.899  11.577  3.232   1.00 0.00 ? 59  LYS A HD2  4  
ATOM 4732  H HD3  . LYS A 1 22 ? -7.276  12.639  2.943   1.00 0.00 ? 59  LYS A HD3  4  
ATOM 4733  H HE2  . LYS A 1 22 ? -7.945  11.601  4.871   1.00 0.00 ? 59  LYS A HE2  4  
ATOM 4734  H HE3  . LYS A 1 22 ? -8.652  10.525  3.669   1.00 0.00 ? 59  LYS A HE3  4  
ATOM 4735  H HZ1  . LYS A 1 22 ? -5.965  9.822   4.410   1.00 0.00 ? 59  LYS A HZ1  4  
ATOM 4736  H HZ2  . LYS A 1 22 ? -7.052  9.763   5.708   1.00 0.00 ? 59  LYS A HZ2  4  
ATOM 4737  H HZ3  . LYS A 1 22 ? -7.351  8.848   4.312   1.00 0.00 ? 59  LYS A HZ3  4  
ATOM 4738  N N    . GLU A 1 23 ? -6.372  10.961  -1.348  1.00 0.00 ? 60  GLU A N    4  
ATOM 4739  C CA   . GLU A 1 23 ? -6.980  11.678  -2.486  1.00 0.00 ? 60  GLU A CA   4  
ATOM 4740  C C    . GLU A 1 23 ? -8.451  12.022  -2.226  1.00 0.00 ? 60  GLU A C    4  
ATOM 4741  O O    . GLU A 1 23 ? -8.889  13.155  -2.441  1.00 0.00 ? 60  GLU A O    4  
ATOM 4742  C CB   . GLU A 1 23 ? -6.860  10.863  -3.777  1.00 0.00 ? 60  GLU A CB   4  
ATOM 4743  C CG   . GLU A 1 23 ? -5.427  10.539  -4.163  1.00 0.00 ? 60  GLU A CG   4  
ATOM 4744  C CD   . GLU A 1 23 ? -5.331  9.729   -5.438  1.00 0.00 ? 60  GLU A CD   4  
ATOM 4745  O OE1  . GLU A 1 23 ? -6.374  9.481   -6.078  1.00 0.00 ? 60  GLU A OE1  4  
ATOM 4746  O OE2  . GLU A 1 23 ? -4.204  9.338   -5.811  1.00 0.00 ? 60  GLU A OE2  4  
ATOM 4747  H H    . GLU A 1 23 ? -5.638  11.405  -0.859  1.00 0.00 ? 60  GLU A H    4  
ATOM 4748  H HA   . GLU A 1 23 ? -6.433  12.601  -2.612  1.00 0.00 ? 60  GLU A HA   4  
ATOM 4749  H HB2  . GLU A 1 23 ? -7.396  9.933   -3.652  1.00 0.00 ? 60  GLU A HB2  4  
ATOM 4750  H HB3  . GLU A 1 23 ? -7.309  11.423  -4.584  1.00 0.00 ? 60  GLU A HB3  4  
ATOM 4751  H HG2  . GLU A 1 23 ? -4.888  11.465  -4.302  1.00 0.00 ? 60  GLU A HG2  4  
ATOM 4752  H HG3  . GLU A 1 23 ? -4.971  9.976   -3.362  1.00 0.00 ? 60  GLU A HG3  4  
ATOM 4753  N N    . ARG A 1 24 ? -9.195  11.027  -1.786  1.00 0.00 ? 61  ARG A N    4  
ATOM 4754  C CA   . ARG A 1 24 ? -10.613 11.151  -1.497  1.00 0.00 ? 61  ARG A CA   4  
ATOM 4755  C C    . ARG A 1 24 ? -11.014 10.085  -0.485  1.00 0.00 ? 61  ARG A C    4  
ATOM 4756  O O    . ARG A 1 24 ? -11.882 10.306  0.361   1.00 0.00 ? 61  ARG A O    4  
ATOM 4757  C CB   . ARG A 1 24 ? -11.434 11.008  -2.783  1.00 0.00 ? 61  ARG A CB   4  
ATOM 4758  C CG   . ARG A 1 24 ? -11.083 9.772   -3.597  1.00 0.00 ? 61  ARG A CG   4  
ATOM 4759  C CD   . ARG A 1 24 ? -11.898 9.688   -4.877  1.00 0.00 ? 61  ARG A CD   4  
ATOM 4760  N NE   . ARG A 1 24 ? -13.318 9.449   -4.621  1.00 0.00 ? 61  ARG A NE   4  
ATOM 4761  C CZ   . ARG A 1 24 ? -14.239 9.333   -5.583  1.00 0.00 ? 61  ARG A CZ   4  
ATOM 4762  N NH1  . ARG A 1 24 ? -13.896 9.466   -6.859  1.00 0.00 ? 61  ARG A NH1  4  
ATOM 4763  N NH2  . ARG A 1 24 ? -15.505 9.102   -5.267  1.00 0.00 ? 61  ARG A NH2  4  
ATOM 4764  H H    . ARG A 1 24 ? -8.763  10.156  -1.659  1.00 0.00 ? 61  ARG A H    4  
ATOM 4765  H HA   . ARG A 1 24 ? -10.785 12.126  -1.070  1.00 0.00 ? 61  ARG A HA   4  
ATOM 4766  H HB2  . ARG A 1 24 ? -12.482 10.955  -2.523  1.00 0.00 ? 61  ARG A HB2  4  
ATOM 4767  H HB3  . ARG A 1 24 ? -11.270 11.880  -3.402  1.00 0.00 ? 61  ARG A HB3  4  
ATOM 4768  H HG2  . ARG A 1 24 ? -10.033 9.808   -3.852  1.00 0.00 ? 61  ARG A HG2  4  
ATOM 4769  H HG3  . ARG A 1 24 ? -11.277 8.894   -2.998  1.00 0.00 ? 61  ARG A HG3  4  
ATOM 4770  H HD2  . ARG A 1 24 ? -11.794 10.620  -5.412  1.00 0.00 ? 61  ARG A HD2  4  
ATOM 4771  H HD3  . ARG A 1 24 ? -11.510 8.882   -5.483  1.00 0.00 ? 61  ARG A HD3  4  
ATOM 4772  H HE   . ARG A 1 24 ? -13.603 9.366   -3.677  1.00 0.00 ? 61  ARG A HE   4  
ATOM 4773  H HH11 . ARG A 1 24 ? -12.939 9.657   -7.113  1.00 0.00 ? 61  ARG A HH11 4  
ATOM 4774  H HH12 . ARG A 1 24 ? -14.589 9.365   -7.584  1.00 0.00 ? 61  ARG A HH12 4  
ATOM 4775  H HH21 . ARG A 1 24 ? -15.781 9.010   -4.303  1.00 0.00 ? 61  ARG A HH21 4  
ATOM 4776  H HH22 . ARG A 1 24 ? -16.199 9.005   -5.993  1.00 0.00 ? 61  ARG A HH22 4  
ATOM 4777  N N    . LYS A 1 25 ? -10.283 8.973   -0.511  1.00 0.00 ? 62  LYS A N    4  
ATOM 4778  C CA   . LYS A 1 25 ? -10.474 7.887   0.441   1.00 0.00 ? 62  LYS A CA   4  
ATOM 4779  C C    . LYS A 1 25 ? -9.311  6.897   0.348   1.00 0.00 ? 62  LYS A C    4  
ATOM 4780  O O    . LYS A 1 25 ? -8.775  6.459   1.365   1.00 0.00 ? 62  LYS A O    4  
ATOM 4781  C CB   . LYS A 1 25 ? -11.819 7.170   0.210   1.00 0.00 ? 62  LYS A CB   4  
ATOM 4782  C CG   . LYS A 1 25 ? -11.956 6.498   -1.151  1.00 0.00 ? 62  LYS A CG   4  
ATOM 4783  C CD   . LYS A 1 25 ? -13.321 5.847   -1.317  1.00 0.00 ? 62  LYS A CD   4  
ATOM 4784  C CE   . LYS A 1 25 ? -13.393 4.986   -2.569  1.00 0.00 ? 62  LYS A CE   4  
ATOM 4785  N NZ   . LYS A 1 25 ? -13.200 5.775   -3.816  1.00 0.00 ? 62  LYS A NZ   4  
ATOM 4786  H H    . LYS A 1 25 ? -9.532  8.917   -1.140  1.00 0.00 ? 62  LYS A H    4  
ATOM 4787  H HA   . LYS A 1 25 ? -10.476 8.320   1.430   1.00 0.00 ? 62  LYS A HA   4  
ATOM 4788  H HB2  . LYS A 1 25 ? -11.939 6.412   0.969   1.00 0.00 ? 62  LYS A HB2  4  
ATOM 4789  H HB3  . LYS A 1 25 ? -12.617 7.891   0.311   1.00 0.00 ? 62  LYS A HB3  4  
ATOM 4790  H HG2  . LYS A 1 25 ? -11.826 7.239   -1.924  1.00 0.00 ? 62  LYS A HG2  4  
ATOM 4791  H HG3  . LYS A 1 25 ? -11.194 5.739   -1.245  1.00 0.00 ? 62  LYS A HG3  4  
ATOM 4792  H HD2  . LYS A 1 25 ? -13.520 5.226   -0.456  1.00 0.00 ? 62  LYS A HD2  4  
ATOM 4793  H HD3  . LYS A 1 25 ? -14.071 6.622   -1.382  1.00 0.00 ? 62  LYS A HD3  4  
ATOM 4794  H HE2  . LYS A 1 25 ? -12.624 4.230   -2.512  1.00 0.00 ? 62  LYS A HE2  4  
ATOM 4795  H HE3  . LYS A 1 25 ? -14.361 4.509   -2.604  1.00 0.00 ? 62  LYS A HE3  4  
ATOM 4796  H HZ1  . LYS A 1 25 ? -12.448 6.482   -3.685  1.00 0.00 ? 62  LYS A HZ1  4  
ATOM 4797  H HZ2  . LYS A 1 25 ? -12.933 5.142   -4.604  1.00 0.00 ? 62  LYS A HZ2  4  
ATOM 4798  H HZ3  . LYS A 1 25 ? -14.084 6.263   -4.074  1.00 0.00 ? 62  LYS A HZ3  4  
ATOM 4799  N N    . GLY A 1 26 ? -8.893  6.593   -0.875  1.00 0.00 ? 63  GLY A N    4  
ATOM 4800  C CA   . GLY A 1 26 ? -7.777  5.688   -1.088  1.00 0.00 ? 63  GLY A CA   4  
ATOM 4801  C C    . GLY A 1 26 ? -7.171  5.845   -2.470  1.00 0.00 ? 63  GLY A C    4  
ATOM 4802  O O    . GLY A 1 26 ? -7.814  6.389   -3.369  1.00 0.00 ? 63  GLY A O    4  
ATOM 4803  H H    . GLY A 1 26 ? -9.346  6.987   -1.647  1.00 0.00 ? 63  GLY A H    4  
ATOM 4804  H HA2  . GLY A 1 26 ? -7.018  5.889   -0.347  1.00 0.00 ? 63  GLY A HA2  4  
ATOM 4805  H HA3  . GLY A 1 26 ? -8.120  4.672   -0.971  1.00 0.00 ? 63  GLY A HA3  4  
ATOM 4806  N N    . SER A 1 27 ? -5.933  5.393   -2.634  1.00 0.00 ? 64  SER A N    4  
ATOM 4807  C CA   . SER A 1 27 ? -5.236  5.511   -3.909  1.00 0.00 ? 64  SER A CA   4  
ATOM 4808  C C    . SER A 1 27 ? -4.753  4.142   -4.394  1.00 0.00 ? 64  SER A C    4  
ATOM 4809  O O    . SER A 1 27 ? -4.701  3.179   -3.624  1.00 0.00 ? 64  SER A O    4  
ATOM 4810  C CB   . SER A 1 27 ? -4.048  6.467   -3.780  1.00 0.00 ? 64  SER A CB   4  
ATOM 4811  O OG   . SER A 1 27 ? -3.600  6.905   -5.053  1.00 0.00 ? 64  SER A OG   4  
ATOM 4812  H H    . SER A 1 27 ? -5.477  4.961   -1.880  1.00 0.00 ? 64  SER A H    4  
ATOM 4813  H HA   . SER A 1 27 ? -5.932  5.910   -4.631  1.00 0.00 ? 64  SER A HA   4  
ATOM 4814  H HB2  . SER A 1 27 ? -4.338  7.326   -3.201  1.00 0.00 ? 64  SER A HB2  4  
ATOM 4815  H HB3  . SER A 1 27 ? -3.235  5.958   -3.283  1.00 0.00 ? 64  SER A HB3  4  
ATOM 4816  H HG   . SER A 1 27 ? -3.893  7.822   -5.197  1.00 0.00 ? 64  SER A HG   4  
ATOM 4817  N N    . SER A 1 28 ? -4.435  4.063   -5.681  1.00 0.00 ? 65  SER A N    4  
ATOM 4818  C CA   . SER A 1 28 ? -3.980  2.828   -6.304  1.00 0.00 ? 65  SER A CA   4  
ATOM 4819  C C    . SER A 1 28 ? -2.638  2.366   -5.728  1.00 0.00 ? 65  SER A C    4  
ATOM 4820  O O    . SER A 1 28 ? -1.894  3.158   -5.141  1.00 0.00 ? 65  SER A O    4  
ATOM 4821  C CB   . SER A 1 28 ? -3.863  3.032   -7.816  1.00 0.00 ? 65  SER A CB   4  
ATOM 4822  O OG   . SER A 1 28 ? -5.043  3.627   -8.336  1.00 0.00 ? 65  SER A OG   4  
ATOM 4823  H H    . SER A 1 28 ? -4.517  4.869   -6.237  1.00 0.00 ? 65  SER A H    4  
ATOM 4824  H HA   . SER A 1 28 ? -4.720  2.067   -6.111  1.00 0.00 ? 65  SER A HA   4  
ATOM 4825  H HB2  . SER A 1 28 ? -3.025  3.677   -8.027  1.00 0.00 ? 65  SER A HB2  4  
ATOM 4826  H HB3  . SER A 1 28 ? -3.714  2.076   -8.298  1.00 0.00 ? 65  SER A HB3  4  
ATOM 4827  H HG   . SER A 1 28 ? -5.098  4.545   -8.023  1.00 0.00 ? 65  SER A HG   4  
ATOM 4828  N N    . ARG A 1 29 ? -2.342  1.080   -5.903  1.00 0.00 ? 66  ARG A N    4  
ATOM 4829  C CA   . ARG A 1 29 ? -1.104  0.485   -5.398  1.00 0.00 ? 66  ARG A CA   4  
ATOM 4830  C C    . ARG A 1 29 ? 0.155   1.235   -5.866  1.00 0.00 ? 66  ARG A C    4  
ATOM 4831  O O    . ARG A 1 29 ? 1.044   1.483   -5.055  1.00 0.00 ? 66  ARG A O    4  
ATOM 4832  C CB   . ARG A 1 29 ? -1.009  -0.989  -5.796  1.00 0.00 ? 66  ARG A CB   4  
ATOM 4833  C CG   . ARG A 1 29 ? -1.980  -1.896  -5.058  1.00 0.00 ? 66  ARG A CG   4  
ATOM 4834  C CD   . ARG A 1 29 ? -1.752  -3.351  -5.436  1.00 0.00 ? 66  ARG A CD   4  
ATOM 4835  N NE   . ARG A 1 29 ? -2.665  -4.264  -4.744  1.00 0.00 ? 66  ARG A NE   4  
ATOM 4836  C CZ   . ARG A 1 29 ? -2.692  -5.580  -4.954  1.00 0.00 ? 66  ARG A CZ   4  
ATOM 4837  N NH1  . ARG A 1 29 ? -1.807  -6.138  -5.773  1.00 0.00 ? 66  ARG A NH1  4  
ATOM 4838  N NH2  . ARG A 1 29 ? -3.588  -6.339  -4.331  1.00 0.00 ? 66  ARG A NH2  4  
ATOM 4839  H H    . ARG A 1 29 ? -2.975  0.509   -6.395  1.00 0.00 ? 66  ARG A H    4  
ATOM 4840  H HA   . ARG A 1 29 ? -1.143  0.540   -4.319  1.00 0.00 ? 66  ARG A HA   4  
ATOM 4841  H HB2  . ARG A 1 29 ? -1.207  -1.076  -6.853  1.00 0.00 ? 66  ARG A HB2  4  
ATOM 4842  H HB3  . ARG A 1 29 ? -0.006  -1.337  -5.598  1.00 0.00 ? 66  ARG A HB3  4  
ATOM 4843  H HG2  . ARG A 1 29 ? -1.833  -1.780  -3.995  1.00 0.00 ? 66  ARG A HG2  4  
ATOM 4844  H HG3  . ARG A 1 29 ? -2.990  -1.618  -5.319  1.00 0.00 ? 66  ARG A HG3  4  
ATOM 4845  H HD2  . ARG A 1 29 ? -1.895  -3.457  -6.500  1.00 0.00 ? 66  ARG A HD2  4  
ATOM 4846  H HD3  . ARG A 1 29 ? -0.737  -3.618  -5.184  1.00 0.00 ? 66  ARG A HD3  4  
ATOM 4847  H HE   . ARG A 1 29 ? -3.297  -3.869  -4.104  1.00 0.00 ? 66  ARG A HE   4  
ATOM 4848  H HH11 . ARG A 1 29 ? -1.113  -5.572  -6.230  1.00 0.00 ? 66  ARG A HH11 4  
ATOM 4849  H HH12 . ARG A 1 29 ? -1.819  -7.135  -5.943  1.00 0.00 ? 66  ARG A HH12 4  
ATOM 4850  H HH21 . ARG A 1 29 ? -4.244  -5.930  -3.693  1.00 0.00 ? 66  ARG A HH21 4  
ATOM 4851  H HH22 . ARG A 1 29 ? -3.628  -7.330  -4.511  1.00 0.00 ? 66  ARG A HH22 4  
ATOM 4852  N N    . PRO A 1 30 ? 0.299   1.551   -7.181  1.00 0.00 ? 67  PRO A N    4  
ATOM 4853  C CA   . PRO A 1 30 ? 1.487   2.243   -7.699  1.00 0.00 ? 67  PRO A CA   4  
ATOM 4854  C C    . PRO A 1 30 ? 1.818   3.510   -6.913  1.00 0.00 ? 67  PRO A C    4  
ATOM 4855  O O    . PRO A 1 30 ? 2.978   3.751   -6.579  1.00 0.00 ? 67  PRO A O    4  
ATOM 4856  C CB   . PRO A 1 30 ? 1.122   2.590   -9.152  1.00 0.00 ? 67  PRO A CB   4  
ATOM 4857  C CG   . PRO A 1 30 ? -0.333  2.296   -9.285  1.00 0.00 ? 67  PRO A CG   4  
ATOM 4858  C CD   . PRO A 1 30 ? -0.638  1.238   -8.271  1.00 0.00 ? 67  PRO A CD   4  
ATOM 4859  H HA   . PRO A 1 30 ? 2.349   1.591   -7.693  1.00 0.00 ? 67  PRO A HA   4  
ATOM 4860  H HB2  . PRO A 1 30 ? 1.327   3.636   -9.335  1.00 0.00 ? 67  PRO A HB2  4  
ATOM 4861  H HB3  . PRO A 1 30 ? 1.709   1.984   -9.826  1.00 0.00 ? 67  PRO A HB3  4  
ATOM 4862  H HG2  . PRO A 1 30 ? -0.907  3.188   -9.083  1.00 0.00 ? 67  PRO A HG2  4  
ATOM 4863  H HG3  . PRO A 1 30 ? -0.544  1.933   -10.281 1.00 0.00 ? 67  PRO A HG3  4  
ATOM 4864  H HD2  . PRO A 1 30 ? -1.661  1.318   -7.938  1.00 0.00 ? 67  PRO A HD2  4  
ATOM 4865  H HD3  . PRO A 1 30 ? -0.444  0.257   -8.676  1.00 0.00 ? 67  PRO A HD3  4  
ATOM 4866  N N    . ALA A 1 31 ? 0.792   4.272   -6.556  1.00 0.00 ? 68  ALA A N    4  
ATOM 4867  C CA   . ALA A 1 31 ? 0.976   5.476   -5.756  1.00 0.00 ? 68  ALA A CA   4  
ATOM 4868  C C    . ALA A 1 31 ? 1.558   5.132   -4.392  1.00 0.00 ? 68  ALA A C    4  
ATOM 4869  O O    . ALA A 1 31 ? 2.476   5.799   -3.909  1.00 0.00 ? 68  ALA A O    4  
ATOM 4870  C CB   . ALA A 1 31 ? -0.344  6.214   -5.599  1.00 0.00 ? 68  ALA A CB   4  
ATOM 4871  H H    . ALA A 1 31 ? -0.117  3.997   -6.803  1.00 0.00 ? 68  ALA A H    4  
ATOM 4872  H HA   . ALA A 1 31 ? 1.666   6.123   -6.278  1.00 0.00 ? 68  ALA A HA   4  
ATOM 4873  H HB1  . ALA A 1 31 ? -0.939  6.082   -6.490  1.00 0.00 ? 68  ALA A HB1  4  
ATOM 4874  H HB2  . ALA A 1 31 ? -0.878  5.817   -4.747  1.00 0.00 ? 68  ALA A HB2  4  
ATOM 4875  H HB3  . ALA A 1 31 ? -0.153  7.265   -5.445  1.00 0.00 ? 68  ALA A HB3  4  
ATOM 4876  N N    . LEU A 1 32 ? 1.032   4.076   -3.789  1.00 0.00 ? 69  LEU A N    4  
ATOM 4877  C CA   . LEU A 1 32 ? 1.504   3.613   -2.492  1.00 0.00 ? 69  LEU A CA   4  
ATOM 4878  C C    . LEU A 1 32 ? 2.961   3.157   -2.551  1.00 0.00 ? 69  LEU A C    4  
ATOM 4879  O O    . LEU A 1 32 ? 3.771   3.550   -1.710  1.00 0.00 ? 69  LEU A O    4  
ATOM 4880  C CB   . LEU A 1 32 ? 0.618   2.473   -1.989  1.00 0.00 ? 69  LEU A CB   4  
ATOM 4881  C CG   . LEU A 1 32 ? -0.724  2.905   -1.406  1.00 0.00 ? 69  LEU A CG   4  
ATOM 4882  C CD1  . LEU A 1 32 ? -1.641  1.707   -1.212  1.00 0.00 ? 69  LEU A CD1  4  
ATOM 4883  C CD2  . LEU A 1 32 ? -0.499  3.616   -0.088  1.00 0.00 ? 69  LEU A CD2  4  
ATOM 4884  H H    . LEU A 1 32 ? 0.304   3.589   -4.235  1.00 0.00 ? 69  LEU A H    4  
ATOM 4885  H HA   . LEU A 1 32 ? 1.429   4.439   -1.801  1.00 0.00 ? 69  LEU A HA   4  
ATOM 4886  H HB2  . LEU A 1 32 ? 0.430   1.798   -2.811  1.00 0.00 ? 69  LEU A HB2  4  
ATOM 4887  H HB3  . LEU A 1 32 ? 1.161   1.938   -1.224  1.00 0.00 ? 69  LEU A HB3  4  
ATOM 4888  H HG   . LEU A 1 32 ? -1.207  3.593   -2.081  1.00 0.00 ? 69  LEU A HG   4  
ATOM 4889  H HD11 . LEU A 1 32 ? -1.090  0.903   -0.748  1.00 0.00 ? 69  LEU A HD11 4  
ATOM 4890  H HD12 . LEU A 1 32 ? -2.472  1.986   -0.580  1.00 0.00 ? 69  LEU A HD12 4  
ATOM 4891  H HD13 . LEU A 1 32 ? -2.014  1.381   -2.173  1.00 0.00 ? 69  LEU A HD13 4  
ATOM 4892  H HD21 . LEU A 1 32 ? 0.526   3.483   0.222   1.00 0.00 ? 69  LEU A HD21 4  
ATOM 4893  H HD22 . LEU A 1 32 ? -0.705  4.670   -0.208  1.00 0.00 ? 69  LEU A HD22 4  
ATOM 4894  H HD23 . LEU A 1 32 ? -1.159  3.202   0.662   1.00 0.00 ? 69  LEU A HD23 4  
ATOM 4895  N N    . LYS A 1 33 ? 3.297   2.348   -3.554  1.00 0.00 ? 70  LYS A N    4  
ATOM 4896  C CA   . LYS A 1 33 ? 4.665   1.854   -3.709  1.00 0.00 ? 70  LYS A CA   4  
ATOM 4897  C C    . LYS A 1 33 ? 5.631   3.011   -3.916  1.00 0.00 ? 70  LYS A C    4  
ATOM 4898  O O    . LYS A 1 33 ? 6.755   2.997   -3.418  1.00 0.00 ? 70  LYS A O    4  
ATOM 4899  C CB   . LYS A 1 33 ? 4.786   0.884   -4.889  1.00 0.00 ? 70  LYS A CB   4  
ATOM 4900  C CG   . LYS A 1 33 ? 3.766   -0.239  -4.872  1.00 0.00 ? 70  LYS A CG   4  
ATOM 4901  C CD   . LYS A 1 33 ? 4.276   -1.493  -5.574  1.00 0.00 ? 70  LYS A CD   4  
ATOM 4902  C CE   . LYS A 1 33 ? 4.638   -1.240  -7.027  1.00 0.00 ? 70  LYS A CE   4  
ATOM 4903  N NZ   . LYS A 1 33 ? 3.490   -0.719  -7.814  1.00 0.00 ? 70  LYS A NZ   4  
ATOM 4904  H H    . LYS A 1 33 ? 2.607   2.080   -4.204  1.00 0.00 ? 70  LYS A H    4  
ATOM 4905  H HA   . LYS A 1 33 ? 4.936   1.337   -2.799  1.00 0.00 ? 70  LYS A HA   4  
ATOM 4906  H HB2  . LYS A 1 33 ? 4.664   1.439   -5.809  1.00 0.00 ? 70  LYS A HB2  4  
ATOM 4907  H HB3  . LYS A 1 33 ? 5.773   0.444   -4.876  1.00 0.00 ? 70  LYS A HB3  4  
ATOM 4908  H HG2  . LYS A 1 33 ? 3.536   -0.486  -3.847  1.00 0.00 ? 70  LYS A HG2  4  
ATOM 4909  H HG3  . LYS A 1 33 ? 2.868   0.100   -5.370  1.00 0.00 ? 70  LYS A HG3  4  
ATOM 4910  H HD2  . LYS A 1 33 ? 5.154   -1.847  -5.056  1.00 0.00 ? 70  LYS A HD2  4  
ATOM 4911  H HD3  . LYS A 1 33 ? 3.505   -2.250  -5.533  1.00 0.00 ? 70  LYS A HD3  4  
ATOM 4912  H HE2  . LYS A 1 33 ? 5.442   -0.522  -7.062  1.00 0.00 ? 70  LYS A HE2  4  
ATOM 4913  H HE3  . LYS A 1 33 ? 4.968   -2.171  -7.463  1.00 0.00 ? 70  LYS A HE3  4  
ATOM 4914  H HZ1  . LYS A 1 33 ? 2.612   -0.796  -7.262  1.00 0.00 ? 70  LYS A HZ1  4  
ATOM 4915  H HZ2  . LYS A 1 33 ? 3.652   0.283   -8.060  1.00 0.00 ? 70  LYS A HZ2  4  
ATOM 4916  H HZ3  . LYS A 1 33 ? 3.377   -1.267  -8.694  1.00 0.00 ? 70  LYS A HZ3  4  
ATOM 4917  N N    . LYS A 1 34 ? 5.166   4.020   -4.637  1.00 0.00 ? 71  LYS A N    4  
ATOM 4918  C CA   . LYS A 1 34 ? 5.959   5.200   -4.916  1.00 0.00 ? 71  LYS A CA   4  
ATOM 4919  C C    . LYS A 1 34 ? 6.246   5.954   -3.635  1.00 0.00 ? 71  LYS A C    4  
ATOM 4920  O O    . LYS A 1 34 ? 7.398   6.257   -3.322  1.00 0.00 ? 71  LYS A O    4  
ATOM 4921  C CB   . LYS A 1 34 ? 5.204   6.097   -5.892  1.00 0.00 ? 71  LYS A CB   4  
ATOM 4922  C CG   . LYS A 1 34 ? 5.871   7.432   -6.151  1.00 0.00 ? 71  LYS A CG   4  
ATOM 4923  C CD   . LYS A 1 34 ? 5.033   8.287   -7.086  1.00 0.00 ? 71  LYS A CD   4  
ATOM 4924  C CE   . LYS A 1 34 ? 5.377   9.756   -6.952  1.00 0.00 ? 71  LYS A CE   4  
ATOM 4925  N NZ   . LYS A 1 34 ? 5.055   10.272  -5.594  1.00 0.00 ? 71  LYS A NZ   4  
ATOM 4926  H H    . LYS A 1 34 ? 4.238   3.988   -4.952  1.00 0.00 ? 71  LYS A H    4  
ATOM 4927  H HA   . LYS A 1 34 ? 6.889   4.886   -5.361  1.00 0.00 ? 71  LYS A HA   4  
ATOM 4928  H HB2  . LYS A 1 34 ? 5.103   5.580   -6.829  1.00 0.00 ? 71  LYS A HB2  4  
ATOM 4929  H HB3  . LYS A 1 34 ? 4.218   6.287   -5.493  1.00 0.00 ? 71  LYS A HB3  4  
ATOM 4930  H HG2  . LYS A 1 34 ? 5.992   7.953   -5.214  1.00 0.00 ? 71  LYS A HG2  4  
ATOM 4931  H HG3  . LYS A 1 34 ? 6.836   7.261   -6.602  1.00 0.00 ? 71  LYS A HG3  4  
ATOM 4932  H HD2  . LYS A 1 34 ? 5.219   7.977   -8.104  1.00 0.00 ? 71  LYS A HD2  4  
ATOM 4933  H HD3  . LYS A 1 34 ? 3.990   8.147   -6.849  1.00 0.00 ? 71  LYS A HD3  4  
ATOM 4934  H HE2  . LYS A 1 34 ? 6.434   9.885   -7.134  1.00 0.00 ? 71  LYS A HE2  4  
ATOM 4935  H HE3  . LYS A 1 34 ? 4.814   10.314  -7.684  1.00 0.00 ? 71  LYS A HE3  4  
ATOM 4936  H HZ1  . LYS A 1 34 ? 4.556   9.541   -5.041  1.00 0.00 ? 71  LYS A HZ1  4  
ATOM 4937  H HZ2  . LYS A 1 34 ? 5.932   10.535  -5.090  1.00 0.00 ? 71  LYS A HZ2  4  
ATOM 4938  H HZ3  . LYS A 1 34 ? 4.440   11.114  -5.663  1.00 0.00 ? 71  LYS A HZ3  4  
ATOM 4939  N N    . PHE A 1 35 ? 5.185   6.199   -2.885  1.00 0.00 ? 72  PHE A N    4  
ATOM 4940  C CA   . PHE A 1 35 ? 5.267   6.898   -1.611  1.00 0.00 ? 72  PHE A CA   4  
ATOM 4941  C C    . PHE A 1 35 ? 6.283   6.234   -0.685  1.00 0.00 ? 72  PHE A C    4  
ATOM 4942  O O    . PHE A 1 35 ? 7.077   6.913   -0.023  1.00 0.00 ? 72  PHE A O    4  
ATOM 4943  C CB   . PHE A 1 35 ? 3.894   6.911   -0.936  1.00 0.00 ? 72  PHE A CB   4  
ATOM 4944  C CG   . PHE A 1 35 ? 3.884   7.603   0.397   1.00 0.00 ? 72  PHE A CG   4  
ATOM 4945  C CD1  . PHE A 1 35 ? 3.644   8.959   0.484   1.00 0.00 ? 72  PHE A CD1  4  
ATOM 4946  C CD2  . PHE A 1 35 ? 4.131   6.890   1.559   1.00 0.00 ? 72  PHE A CD2  4  
ATOM 4947  C CE1  . PHE A 1 35 ? 3.644   9.600   1.709   1.00 0.00 ? 72  PHE A CE1  4  
ATOM 4948  C CE2  . PHE A 1 35 ? 4.136   7.524   2.788   1.00 0.00 ? 72  PHE A CE2  4  
ATOM 4949  C CZ   . PHE A 1 35 ? 3.891   8.883   2.864   1.00 0.00 ? 72  PHE A CZ   4  
ATOM 4950  H H    . PHE A 1 35 ? 4.306   5.890   -3.203  1.00 0.00 ? 72  PHE A H    4  
ATOM 4951  H HA   . PHE A 1 35 ? 5.576   7.913   -1.802  1.00 0.00 ? 72  PHE A HA   4  
ATOM 4952  H HB2  . PHE A 1 35 ? 3.191   7.419   -1.578  1.00 0.00 ? 72  PHE A HB2  4  
ATOM 4953  H HB3  . PHE A 1 35 ? 3.565   5.894   -0.783  1.00 0.00 ? 72  PHE A HB3  4  
ATOM 4954  H HD1  . PHE A 1 35 ? 3.451   9.522   -0.420  1.00 0.00 ? 72  PHE A HD1  4  
ATOM 4955  H HD2  . PHE A 1 35 ? 4.326   5.829   1.495   1.00 0.00 ? 72  PHE A HD2  4  
ATOM 4956  H HE1  . PHE A 1 35 ? 3.457   10.664  1.763   1.00 0.00 ? 72  PHE A HE1  4  
ATOM 4957  H HE2  . PHE A 1 35 ? 4.326   6.960   3.689   1.00 0.00 ? 72  PHE A HE2  4  
ATOM 4958  H HZ   . PHE A 1 35 ? 3.890   9.381   3.822   1.00 0.00 ? 72  PHE A HZ   4  
ATOM 4959  N N    . ILE A 1 36 ? 6.239   4.909   -0.624  1.00 0.00 ? 73  ILE A N    4  
ATOM 4960  C CA   . ILE A 1 36 ? 7.130   4.158   0.242   1.00 0.00 ? 73  ILE A CA   4  
ATOM 4961  C C    . ILE A 1 36 ? 8.577   4.294   -0.214  1.00 0.00 ? 73  ILE A C    4  
ATOM 4962  O O    . ILE A 1 36 ? 9.474   4.463   0.601   1.00 0.00 ? 73  ILE A O    4  
ATOM 4963  C CB   . ILE A 1 36 ? 6.738   2.663   0.307   1.00 0.00 ? 73  ILE A CB   4  
ATOM 4964  C CG1  . ILE A 1 36 ? 5.318   2.517   0.868   1.00 0.00 ? 73  ILE A CG1  4  
ATOM 4965  C CG2  . ILE A 1 36 ? 7.730   1.887   1.163   1.00 0.00 ? 73  ILE A CG2  4  
ATOM 4966  C CD1  . ILE A 1 36 ? 4.829   1.084   0.945   1.00 0.00 ? 73  ILE A CD1  4  
ATOM 4967  H H    . ILE A 1 36 ? 5.580   4.425   -1.170  1.00 0.00 ? 73  ILE A H    4  
ATOM 4968  H HA   . ILE A 1 36 ? 7.043   4.569   1.238   1.00 0.00 ? 73  ILE A HA   4  
ATOM 4969  H HB   . ILE A 1 36 ? 6.769   2.259   -0.694  1.00 0.00 ? 73  ILE A HB   4  
ATOM 4970  H HG12 . ILE A 1 36 ? 5.290   2.926   1.865   1.00 0.00 ? 73  ILE A HG12 4  
ATOM 4971  H HG13 . ILE A 1 36 ? 4.633   3.066   0.239   1.00 0.00 ? 73  ILE A HG13 4  
ATOM 4972  H HG21 . ILE A 1 36 ? 8.688   2.388   1.150   1.00 0.00 ? 73  ILE A HG21 4  
ATOM 4973  H HG22 . ILE A 1 36 ? 7.366   1.836   2.178   1.00 0.00 ? 73  ILE A HG22 4  
ATOM 4974  H HG23 . ILE A 1 36 ? 7.842   0.887   0.769   1.00 0.00 ? 73  ILE A HG23 4  
ATOM 4975  H HD11 . ILE A 1 36 ? 5.255   0.513   0.132   1.00 0.00 ? 73  ILE A HD11 4  
ATOM 4976  H HD12 . ILE A 1 36 ? 5.134   0.652   1.888   1.00 0.00 ? 73  ILE A HD12 4  
ATOM 4977  H HD13 . ILE A 1 36 ? 3.751   1.067   0.873   1.00 0.00 ? 73  ILE A HD13 4  
ATOM 4978  N N    . LYS A 1 37 ? 8.799   4.247   -1.519  1.00 0.00 ? 74  LYS A N    4  
ATOM 4979  C CA   . LYS A 1 37 ? 10.148  4.360   -2.065  1.00 0.00 ? 74  LYS A CA   4  
ATOM 4980  C C    . LYS A 1 37 ? 10.731  5.758   -1.862  1.00 0.00 ? 74  LYS A C    4  
ATOM 4981  O O    . LYS A 1 37 ? 11.939  5.910   -1.673  1.00 0.00 ? 74  LYS A O    4  
ATOM 4982  C CB   . LYS A 1 37 ? 10.161  3.961   -3.545  1.00 0.00 ? 74  LYS A CB   4  
ATOM 4983  C CG   . LYS A 1 37 ? 9.831   2.491   -3.757  1.00 0.00 ? 74  LYS A CG   4  
ATOM 4984  C CD   . LYS A 1 37 ? 9.878   2.084   -5.221  1.00 0.00 ? 74  LYS A CD   4  
ATOM 4985  C CE   . LYS A 1 37 ? 9.548   0.606   -5.377  1.00 0.00 ? 74  LYS A CE   4  
ATOM 4986  N NZ   . LYS A 1 37 ? 9.575   0.154   -6.793  1.00 0.00 ? 74  LYS A NZ   4  
ATOM 4987  H H    . LYS A 1 37 ? 8.041   4.125   -2.132  1.00 0.00 ? 74  LYS A H    4  
ATOM 4988  H HA   . LYS A 1 37 ? 10.766  3.667   -1.524  1.00 0.00 ? 74  LYS A HA   4  
ATOM 4989  H HB2  . LYS A 1 37 ? 9.433   4.556   -4.076  1.00 0.00 ? 74  LYS A HB2  4  
ATOM 4990  H HB3  . LYS A 1 37 ? 11.142  4.153   -3.953  1.00 0.00 ? 74  LYS A HB3  4  
ATOM 4991  H HG2  . LYS A 1 37 ? 10.543  1.894   -3.208  1.00 0.00 ? 74  LYS A HG2  4  
ATOM 4992  H HG3  . LYS A 1 37 ? 8.837   2.301   -3.374  1.00 0.00 ? 74  LYS A HG3  4  
ATOM 4993  H HD2  . LYS A 1 37 ? 9.157   2.667   -5.773  1.00 0.00 ? 74  LYS A HD2  4  
ATOM 4994  H HD3  . LYS A 1 37 ? 10.870  2.267   -5.607  1.00 0.00 ? 74  LYS A HD3  4  
ATOM 4995  H HE2  . LYS A 1 37 ? 10.270  0.031   -4.816  1.00 0.00 ? 74  LYS A HE2  4  
ATOM 4996  H HE3  . LYS A 1 37 ? 8.563   0.430   -4.974  1.00 0.00 ? 74  LYS A HE3  4  
ATOM 4997  H HZ1  . LYS A 1 37 ? 10.434  0.511   -7.271  1.00 0.00 ? 74  LYS A HZ1  4  
ATOM 4998  H HZ2  . LYS A 1 37 ? 9.572   -0.890  -6.834  1.00 0.00 ? 74  LYS A HZ2  4  
ATOM 4999  H HZ3  . LYS A 1 37 ? 8.737   0.511   -7.299  1.00 0.00 ? 74  LYS A HZ3  4  
ATOM 5000  N N    . GLU A 1 38 ? 9.873   6.772   -1.872  1.00 0.00 ? 75  GLU A N    4  
ATOM 5001  C CA   . GLU A 1 38 ? 10.314  8.145   -1.655  1.00 0.00 ? 75  GLU A CA   4  
ATOM 5002  C C    . GLU A 1 38 ? 10.744  8.364   -0.206  1.00 0.00 ? 75  GLU A C    4  
ATOM 5003  O O    . GLU A 1 38 ? 11.730  9.052   0.063   1.00 0.00 ? 75  GLU A O    4  
ATOM 5004  C CB   . GLU A 1 38 ? 9.193   9.128   -1.994  1.00 0.00 ? 75  GLU A CB   4  
ATOM 5005  C CG   . GLU A 1 38 ? 8.645   8.970   -3.397  1.00 0.00 ? 75  GLU A CG   4  
ATOM 5006  C CD   . GLU A 1 38 ? 7.506   9.923   -3.690  1.00 0.00 ? 75  GLU A CD   4  
ATOM 5007  O OE1  . GLU A 1 38 ? 6.508   9.915   -2.942  1.00 0.00 ? 75  GLU A OE1  4  
ATOM 5008  O OE2  . GLU A 1 38 ? 7.591   10.664  -4.690  1.00 0.00 ? 75  GLU A OE2  4  
ATOM 5009  H H    . GLU A 1 38 ? 8.919   6.594   -2.025  1.00 0.00 ? 75  GLU A H    4  
ATOM 5010  H HA   . GLU A 1 38 ? 11.155  8.333   -2.304  1.00 0.00 ? 75  GLU A HA   4  
ATOM 5011  H HB2  . GLU A 1 38 ? 8.381   8.983   -1.297  1.00 0.00 ? 75  GLU A HB2  4  
ATOM 5012  H HB3  . GLU A 1 38 ? 9.570   10.134  -1.889  1.00 0.00 ? 75  GLU A HB3  4  
ATOM 5013  H HG2  . GLU A 1 38 ? 9.440   9.155   -4.101  1.00 0.00 ? 75  GLU A HG2  4  
ATOM 5014  H HG3  . GLU A 1 38 ? 8.288   7.958   -3.519  1.00 0.00 ? 75  GLU A HG3  4  
ATOM 5015  N N    . ASN A 1 39 ? 9.906   7.916   0.719   1.00 0.00 ? 76  ASN A N    4  
ATOM 5016  C CA   . ASN A 1 39 ? 10.092  8.231   2.132   1.00 0.00 ? 76  ASN A CA   4  
ATOM 5017  C C    . ASN A 1 39 ? 10.858  7.142   2.874   1.00 0.00 ? 76  ASN A C    4  
ATOM 5018  O O    . ASN A 1 39 ? 11.618  7.437   3.795   1.00 0.00 ? 76  ASN A O    4  
ATOM 5019  C CB   . ASN A 1 39 ? 8.733   8.466   2.793   1.00 0.00 ? 76  ASN A CB   4  
ATOM 5020  C CG   . ASN A 1 39 ? 8.044   9.704   2.253   1.00 0.00 ? 76  ASN A CG   4  
ATOM 5021  O OD1  . ASN A 1 39 ? 8.456   10.829  2.536   1.00 0.00 ? 76  ASN A OD1  4  
ATOM 5022  N ND2  . ASN A 1 39 ? 7.016   9.507   1.446   1.00 0.00 ? 76  ASN A ND2  4  
ATOM 5023  H H    . ASN A 1 39 ? 9.073   7.479   0.434   1.00 0.00 ? 76  ASN A H    4  
ATOM 5024  H HA   . ASN A 1 39 ? 10.660  9.146   2.187   1.00 0.00 ? 76  ASN A HA   4  
ATOM 5025  H HB2  . ASN A 1 39 ? 8.098   7.612   2.612   1.00 0.00 ? 76  ASN A HB2  4  
ATOM 5026  H HB3  . ASN A 1 39 ? 8.873   8.587   3.856   1.00 0.00 ? 76  ASN A HB3  4  
ATOM 5027  H HD21 . ASN A 1 39 ? 6.754   8.582   1.242   1.00 0.00 ? 76  ASN A HD21 4  
ATOM 5028  H HD22 . ASN A 1 39 ? 6.567   10.296  1.067   1.00 0.00 ? 76  ASN A HD22 4  
ATOM 5029  N N    . TYR A 1 40 ? 10.644  5.884   2.503   1.00 0.00 ? 77  TYR A N    4  
ATOM 5030  C CA   . TYR A 1 40 ? 11.300  4.764   3.176   1.00 0.00 ? 77  TYR A CA   4  
ATOM 5031  C C    . TYR A 1 40 ? 12.108  3.930   2.177   1.00 0.00 ? 77  TYR A C    4  
ATOM 5032  O O    . TYR A 1 40 ? 11.717  2.811   1.836   1.00 0.00 ? 77  TYR A O    4  
ATOM 5033  C CB   . TYR A 1 40 ? 10.268  3.870   3.882   1.00 0.00 ? 77  TYR A CB   4  
ATOM 5034  C CG   . TYR A 1 40 ? 9.375   4.601   4.865   1.00 0.00 ? 77  TYR A CG   4  
ATOM 5035  C CD1  . TYR A 1 40 ? 8.299   5.363   4.426   1.00 0.00 ? 77  TYR A CD1  4  
ATOM 5036  C CD2  . TYR A 1 40 ? 9.604   4.522   6.233   1.00 0.00 ? 77  TYR A CD2  4  
ATOM 5037  C CE1  . TYR A 1 40 ? 7.482   6.030   5.319   1.00 0.00 ? 77  TYR A CE1  4  
ATOM 5038  C CE2  . TYR A 1 40 ? 8.792   5.187   7.134   1.00 0.00 ? 77  TYR A CE2  4  
ATOM 5039  C CZ   . TYR A 1 40 ? 7.730   5.940   6.670   1.00 0.00 ? 77  TYR A CZ   4  
ATOM 5040  O OH   . TYR A 1 40 ? 6.920   6.616   7.558   1.00 0.00 ? 77  TYR A OH   4  
ATOM 5041  H H    . TYR A 1 40 ? 10.029  5.700   1.758   1.00 0.00 ? 77  TYR A H    4  
ATOM 5042  H HA   . TYR A 1 40 ? 11.975  5.172   3.913   1.00 0.00 ? 77  TYR A HA   4  
ATOM 5043  H HB2  . TYR A 1 40 ? 9.631   3.415   3.136   1.00 0.00 ? 77  TYR A HB2  4  
ATOM 5044  H HB3  . TYR A 1 40 ? 10.789  3.092   4.420   1.00 0.00 ? 77  TYR A HB3  4  
ATOM 5045  H HD1  . TYR A 1 40 ? 8.104   5.432   3.366   1.00 0.00 ? 77  TYR A HD1  4  
ATOM 5046  H HD2  . TYR A 1 40 ? 10.436  3.933   6.594   1.00 0.00 ? 77  TYR A HD2  4  
ATOM 5047  H HE1  . TYR A 1 40 ? 6.653   6.617   4.955   1.00 0.00 ? 77  TYR A HE1  4  
ATOM 5048  H HE2  . TYR A 1 40 ? 8.988   5.110   8.194   1.00 0.00 ? 77  TYR A HE2  4  
ATOM 5049  H HH   . TYR A 1 40 ? 6.432   7.308   7.078   1.00 0.00 ? 77  TYR A HH   4  
ATOM 5050  N N    . PRO A 1 41 ? 13.255  4.457   1.707   1.00 0.00 ? 78  PRO A N    4  
ATOM 5051  C CA   . PRO A 1 41 ? 14.119  3.778   0.725   1.00 0.00 ? 78  PRO A CA   4  
ATOM 5052  C C    . PRO A 1 41 ? 14.588  2.405   1.195   1.00 0.00 ? 78  PRO A C    4  
ATOM 5053  O O    . PRO A 1 41 ? 14.930  1.543   0.385   1.00 0.00 ? 78  PRO A O    4  
ATOM 5054  C CB   . PRO A 1 41 ? 15.315  4.721   0.580   1.00 0.00 ? 78  PRO A CB   4  
ATOM 5055  C CG   . PRO A 1 41 ? 14.796  6.050   0.999   1.00 0.00 ? 78  PRO A CG   4  
ATOM 5056  C CD   . PRO A 1 41 ? 13.802  5.771   2.085   1.00 0.00 ? 78  PRO A CD   4  
ATOM 5057  H HA   . PRO A 1 41 ? 13.623  3.676   -0.229  1.00 0.00 ? 78  PRO A HA   4  
ATOM 5058  H HB2  . PRO A 1 41 ? 16.120  4.389   1.220   1.00 0.00 ? 78  PRO A HB2  4  
ATOM 5059  H HB3  . PRO A 1 41 ? 15.647  4.735   -0.449  1.00 0.00 ? 78  PRO A HB3  4  
ATOM 5060  H HG2  . PRO A 1 41 ? 15.604  6.659   1.374   1.00 0.00 ? 78  PRO A HG2  4  
ATOM 5061  H HG3  . PRO A 1 41 ? 14.313  6.534   0.165   1.00 0.00 ? 78  PRO A HG3  4  
ATOM 5062  H HD2  . PRO A 1 41 ? 14.291  5.723   3.046   1.00 0.00 ? 78  PRO A HD2  4  
ATOM 5063  H HD3  . PRO A 1 41 ? 13.025  6.523   2.091   1.00 0.00 ? 78  PRO A HD3  4  
ATOM 5064  N N    . ILE A 1 42 ? 14.597  2.220   2.509   1.00 0.00 ? 79  ILE A N    4  
ATOM 5065  C CA   . ILE A 1 42 ? 15.006  0.964   3.123   1.00 0.00 ? 79  ILE A CA   4  
ATOM 5066  C C    . ILE A 1 42 ? 14.250  -0.199  2.516   1.00 0.00 ? 79  ILE A C    4  
ATOM 5067  O O    . ILE A 1 42 ? 14.824  -1.127  1.953   1.00 0.00 ? 79  ILE A O    4  
ATOM 5068  C CB   . ILE A 1 42 ? 14.690  0.951   4.631   1.00 0.00 ? 79  ILE A CB   4  
ATOM 5069  C CG1  . ILE A 1 42 ? 15.206  2.215   5.328   1.00 0.00 ? 79  ILE A CG1  4  
ATOM 5070  C CG2  . ILE A 1 42 ? 15.285  -0.286  5.281   1.00 0.00 ? 79  ILE A CG2  4  
ATOM 5071  C CD1  . ILE A 1 42 ? 14.234  3.375   5.298   1.00 0.00 ? 79  ILE A CD1  4  
ATOM 5072  H H    . ILE A 1 42 ? 14.307  2.955   3.085   1.00 0.00 ? 79  ILE A H    4  
ATOM 5073  H HA   . ILE A 1 42 ? 16.066  0.830   2.982   1.00 0.00 ? 79  ILE A HA   4  
ATOM 5074  H HB   . ILE A 1 42 ? 13.607  0.895   4.736   1.00 0.00 ? 79  ILE A HB   4  
ATOM 5075  H HG12 . ILE A 1 42 ? 15.412  1.985   6.363   1.00 0.00 ? 79  ILE A HG12 4  
ATOM 5076  H HG13 . ILE A 1 42 ? 16.119  2.533   4.848   1.00 0.00 ? 79  ILE A HG13 4  
ATOM 5077  H HG21 . ILE A 1 42 ? 15.034  -1.158  4.693   1.00 0.00 ? 79  ILE A HG21 4  
ATOM 5078  H HG22 . ILE A 1 42 ? 16.359  -0.185  5.335   1.00 0.00 ? 79  ILE A HG22 4  
ATOM 5079  H HG23 . ILE A 1 42 ? 14.883  -0.397  6.278   1.00 0.00 ? 79  ILE A HG23 4  
ATOM 5080  H HD11 . ILE A 1 42 ? 13.223  2.997   5.284   1.00 0.00 ? 79  ILE A HD11 4  
ATOM 5081  H HD12 . ILE A 1 42 ? 14.378  3.987   6.174   1.00 0.00 ? 79  ILE A HD12 4  
ATOM 5082  H HD13 . ILE A 1 42 ? 14.409  3.966   4.411   1.00 0.00 ? 79  ILE A HD13 4  
ATOM 5083  N N    . VAL A 1 43 ? 12.946  -0.112  2.645   1.00 0.00 ? 80  VAL A N    4  
ATOM 5084  C CA   . VAL A 1 43 ? 12.049  -1.116  2.134   1.00 0.00 ? 80  VAL A CA   4  
ATOM 5085  C C    . VAL A 1 43 ? 11.715  -0.810  0.687   1.00 0.00 ? 80  VAL A C    4  
ATOM 5086  O O    . VAL A 1 43 ? 11.520  -1.710  -0.122  1.00 0.00 ? 80  VAL A O    4  
ATOM 5087  C CB   . VAL A 1 43 ? 10.777  -1.161  2.995   1.00 0.00 ? 80  VAL A CB   4  
ATOM 5088  C CG1  . VAL A 1 43 ? 9.540   -1.077  2.148   1.00 0.00 ? 80  VAL A CG1  4  
ATOM 5089  C CG2  . VAL A 1 43 ? 10.747  -2.410  3.856   1.00 0.00 ? 80  VAL A CG2  4  
ATOM 5090  H H    . VAL A 1 43 ? 12.568  0.685   3.074   1.00 0.00 ? 80  VAL A H    4  
ATOM 5091  H HA   . VAL A 1 43 ? 12.536  -2.075  2.190   1.00 0.00 ? 80  VAL A HA   4  
ATOM 5092  H HB   . VAL A 1 43 ? 10.790  -0.304  3.641   1.00 0.00 ? 80  VAL A HB   4  
ATOM 5093  H HG11 . VAL A 1 43 ? 9.682   -1.668  1.257   1.00 0.00 ? 80  VAL A HG11 4  
ATOM 5094  H HG12 . VAL A 1 43 ? 8.697   -1.447  2.707   1.00 0.00 ? 80  VAL A HG12 4  
ATOM 5095  H HG13 . VAL A 1 43 ? 9.377   -0.045  1.878   1.00 0.00 ? 80  VAL A HG13 4  
ATOM 5096  H HG21 . VAL A 1 43 ? 11.757  -2.701  4.105   1.00 0.00 ? 80  VAL A HG21 4  
ATOM 5097  H HG22 . VAL A 1 43 ? 10.195  -2.208  4.762   1.00 0.00 ? 80  VAL A HG22 4  
ATOM 5098  H HG23 . VAL A 1 43 ? 10.266  -3.210  3.309   1.00 0.00 ? 80  VAL A HG23 4  
ATOM 5099  N N    . GLY A 1 44 ? 11.637  0.478   0.379   1.00 0.00 ? 81  GLY A N    4  
ATOM 5100  C CA   . GLY A 1 44 ? 11.310  0.895   -0.961  1.00 0.00 ? 81  GLY A CA   4  
ATOM 5101  C C    . GLY A 1 44 ? 12.226  0.274   -1.996  1.00 0.00 ? 81  GLY A C    4  
ATOM 5102  O O    . GLY A 1 44 ? 11.775  -0.220  -3.028  1.00 0.00 ? 81  GLY A O    4  
ATOM 5103  H H    . GLY A 1 44 ? 11.762  1.152   1.086   1.00 0.00 ? 81  GLY A H    4  
ATOM 5104  H HA2  . GLY A 1 44 ? 10.292  0.606   -1.168  1.00 0.00 ? 81  GLY A HA2  4  
ATOM 5105  H HA3  . GLY A 1 44 ? 11.392  1.965   -1.020  1.00 0.00 ? 81  GLY A HA3  4  
ATOM 5106  N N    . SER A 1 45 ? 13.513  0.236   -1.683  1.00 0.00 ? 82  SER A N    4  
ATOM 5107  C CA   . SER A 1 45 ? 14.492  -0.382  -2.550  1.00 0.00 ? 82  SER A CA   4  
ATOM 5108  C C    . SER A 1 45 ? 14.884  -1.763  -2.029  1.00 0.00 ? 82  SER A C    4  
ATOM 5109  O O    . SER A 1 45 ? 16.002  -2.231  -2.247  1.00 0.00 ? 82  SER A O    4  
ATOM 5110  C CB   . SER A 1 45 ? 15.715  0.523   -2.657  1.00 0.00 ? 82  SER A CB   4  
ATOM 5111  O OG   . SER A 1 45 ? 15.340  1.817   -3.101  1.00 0.00 ? 82  SER A OG   4  
ATOM 5112  H H    . SER A 1 45 ? 13.809  0.610   -0.826  1.00 0.00 ? 82  SER A H    4  
ATOM 5113  H HA   . SER A 1 45 ? 14.049  -0.490  -3.529  1.00 0.00 ? 82  SER A HA   4  
ATOM 5114  H HB2  . SER A 1 45 ? 16.187  0.610   -1.689  1.00 0.00 ? 82  SER A HB2  4  
ATOM 5115  H HB3  . SER A 1 45 ? 16.412  0.098   -3.360  1.00 0.00 ? 82  SER A HB3  4  
ATOM 5116  H HG   . SER A 1 45 ? 15.967  2.470   -2.754  1.00 0.00 ? 82  SER A HG   4  
ATOM 5117  N N    . ALA A 1 46 ? 13.935  -2.440  -1.395  1.00 0.00 ? 83  ALA A N    4  
ATOM 5118  C CA   . ALA A 1 46 ? 14.150  -3.800  -0.928  1.00 0.00 ? 83  ALA A CA   4  
ATOM 5119  C C    . ALA A 1 46 ? 13.923  -4.780  -2.069  1.00 0.00 ? 83  ALA A C    4  
ATOM 5120  O O    . ALA A 1 46 ? 13.176  -4.491  -3.008  1.00 0.00 ? 83  ALA A O    4  
ATOM 5121  C CB   . ALA A 1 46 ? 13.247  -4.127  0.255   1.00 0.00 ? 83  ALA A CB   4  
ATOM 5122  H H    . ALA A 1 46 ? 13.042  -2.036  -1.296  1.00 0.00 ? 83  ALA A H    4  
ATOM 5123  H HA   . ALA A 1 46 ? 15.177  -3.878  -0.600  1.00 0.00 ? 83  ALA A HA   4  
ATOM 5124  H HB1  . ALA A 1 46 ? 12.797  -3.215  0.629   1.00 0.00 ? 83  ALA A HB1  4  
ATOM 5125  H HB2  . ALA A 1 46 ? 12.470  -4.807  -0.061  1.00 0.00 ? 83  ALA A HB2  4  
ATOM 5126  H HB3  . ALA A 1 46 ? 13.833  -4.586  1.037   1.00 0.00 ? 83  ALA A HB3  4  
ATOM 5127  N N    . SER A 1 47 ? 14.630  -5.893  -2.030  1.00 0.00 ? 84  SER A N    4  
ATOM 5128  C CA   . SER A 1 47 ? 14.540  -6.886  -3.084  1.00 0.00 ? 84  SER A CA   4  
ATOM 5129  C C    . SER A 1 47 ? 13.141  -7.490  -3.145  1.00 0.00 ? 84  SER A C    4  
ATOM 5130  O O    . SER A 1 47 ? 12.625  -8.001  -2.145  1.00 0.00 ? 84  SER A O    4  
ATOM 5131  C CB   . SER A 1 47 ? 15.597  -7.966  -2.863  1.00 0.00 ? 84  SER A CB   4  
ATOM 5132  O OG   . SER A 1 47 ? 15.886  -8.115  -1.483  1.00 0.00 ? 84  SER A OG   4  
ATOM 5133  H H    . SER A 1 47 ? 15.246  -6.045  -1.283  1.00 0.00 ? 84  SER A H    4  
ATOM 5134  H HA   . SER A 1 47 ? 14.738  -6.386  -4.023  1.00 0.00 ? 84  SER A HA   4  
ATOM 5135  H HB2  . SER A 1 47 ? 15.233  -8.908  -3.248  1.00 0.00 ? 84  SER A HB2  4  
ATOM 5136  H HB3  . SER A 1 47 ? 16.503  -7.691  -3.381  1.00 0.00 ? 84  SER A HB3  4  
ATOM 5137  H HG   . SER A 1 47 ? 16.471  -7.395  -1.199  1.00 0.00 ? 84  SER A HG   4  
ATOM 5138  N N    . ASN A 1 48 ? 12.512  -7.339  -4.308  1.00 0.00 ? 85  ASN A N    4  
ATOM 5139  C CA   . ASN A 1 48 ? 11.140  -7.786  -4.543  1.00 0.00 ? 85  ASN A CA   4  
ATOM 5140  C C    . ASN A 1 48 ? 10.154  -7.032  -3.656  1.00 0.00 ? 85  ASN A C    4  
ATOM 5141  O O    . ASN A 1 48 ? 9.109   -7.569  -3.295  1.00 0.00 ? 85  ASN A O    4  
ATOM 5142  C CB   . ASN A 1 48 ? 10.992  -9.294  -4.316  1.00 0.00 ? 85  ASN A CB   4  
ATOM 5143  C CG   . ASN A 1 48 ? 11.781  -10.121 -5.310  1.00 0.00 ? 85  ASN A CG   4  
ATOM 5144  O OD1  . ASN A 1 48 ? 11.600  -10.003 -6.520  1.00 0.00 ? 85  ASN A OD1  4  
ATOM 5145  N ND2  . ASN A 1 48 ? 12.661  -10.967 -4.805  1.00 0.00 ? 85  ASN A ND2  4  
ATOM 5146  H H    . ASN A 1 48 ? 12.973  -6.848  -5.028  1.00 0.00 ? 85  ASN A H    4  
ATOM 5147  H HA   . ASN A 1 48 ? 10.903  -7.567  -5.573  1.00 0.00 ? 85  ASN A HA   4  
ATOM 5148  H HB2  . ASN A 1 48 ? 11.333  -9.538  -3.321  1.00 0.00 ? 85  ASN A HB2  4  
ATOM 5149  H HB3  . ASN A 1 48 ? 9.950   -9.561  -4.407  1.00 0.00 ? 85  ASN A HB3  4  
ATOM 5150  H HD21 . ASN A 1 48 ? 12.756  -11.013 -3.825  1.00 0.00 ? 85  ASN A HD21 4  
ATOM 5151  H HD22 . ASN A 1 48 ? 13.182  -11.525 -5.428  1.00 0.00 ? 85  ASN A HD22 4  
ATOM 5152  N N    . PHE A 1 49 ? 10.453  -5.766  -3.378  1.00 0.00 ? 86  PHE A N    4  
ATOM 5153  C CA   . PHE A 1 49 ? 9.552   -4.920  -2.601  1.00 0.00 ? 86  PHE A CA   4  
ATOM 5154  C C    . PHE A 1 49 ? 8.194   -4.833  -3.279  1.00 0.00 ? 86  PHE A C    4  
ATOM 5155  O O    . PHE A 1 49 ? 7.154   -4.951  -2.637  1.00 0.00 ? 86  PHE A O    4  
ATOM 5156  C CB   . PHE A 1 49 ? 10.125  -3.508  -2.438  1.00 0.00 ? 86  PHE A CB   4  
ATOM 5157  C CG   . PHE A 1 49 ? 9.095   -2.499  -2.002  1.00 0.00 ? 86  PHE A CG   4  
ATOM 5158  C CD1  . PHE A 1 49 ? 8.475   -2.603  -0.765  1.00 0.00 ? 86  PHE A CD1  4  
ATOM 5159  C CD2  . PHE A 1 49 ? 8.720   -1.466  -2.845  1.00 0.00 ? 86  PHE A CD2  4  
ATOM 5160  C CE1  . PHE A 1 49 ? 7.505   -1.696  -0.383  1.00 0.00 ? 86  PHE A CE1  4  
ATOM 5161  C CE2  . PHE A 1 49 ? 7.755   -0.554  -2.464  1.00 0.00 ? 86  PHE A CE2  4  
ATOM 5162  C CZ   . PHE A 1 49 ? 7.146   -0.671  -1.233  1.00 0.00 ? 86  PHE A CZ   4  
ATOM 5163  H H    . PHE A 1 49 ? 11.281  -5.380  -3.737  1.00 0.00 ? 86  PHE A H    4  
ATOM 5164  H HA   . PHE A 1 49 ? 9.430   -5.367  -1.627  1.00 0.00 ? 86  PHE A HA   4  
ATOM 5165  H HB2  . PHE A 1 49 ? 10.910  -3.527  -1.696  1.00 0.00 ? 86  PHE A HB2  4  
ATOM 5166  H HB3  . PHE A 1 49 ? 10.535  -3.181  -3.382  1.00 0.00 ? 86  PHE A HB3  4  
ATOM 5167  H HD1  . PHE A 1 49 ? 8.762   -3.399  -0.093  1.00 0.00 ? 86  PHE A HD1  4  
ATOM 5168  H HD2  . PHE A 1 49 ? 9.196   -1.373  -3.811  1.00 0.00 ? 86  PHE A HD2  4  
ATOM 5169  H HE1  . PHE A 1 49 ? 7.030   -1.789  0.584   1.00 0.00 ? 86  PHE A HE1  4  
ATOM 5170  H HE2  . PHE A 1 49 ? 7.475   0.250   -3.131  1.00 0.00 ? 86  PHE A HE2  4  
ATOM 5171  H HZ   . PHE A 1 49 ? 6.387   0.039   -0.934  1.00 0.00 ? 86  PHE A HZ   4  
ATOM 5172  N N    . ASP A 1 50 ? 8.225   -4.603  -4.582  1.00 0.00 ? 87  ASP A N    4  
ATOM 5173  C CA   . ASP A 1 50 ? 7.010   -4.471  -5.378  1.00 0.00 ? 87  ASP A CA   4  
ATOM 5174  C C    . ASP A 1 50 ? 6.127   -5.705  -5.223  1.00 0.00 ? 87  ASP A C    4  
ATOM 5175  O O    . ASP A 1 50 ? 4.928   -5.599  -4.965  1.00 0.00 ? 87  ASP A O    4  
ATOM 5176  C CB   . ASP A 1 50 ? 7.364   -4.266  -6.855  1.00 0.00 ? 87  ASP A CB   4  
ATOM 5177  C CG   . ASP A 1 50 ? 8.013   -2.921  -7.142  1.00 0.00 ? 87  ASP A CG   4  
ATOM 5178  O OD1  . ASP A 1 50 ? 9.042   -2.589  -6.511  1.00 0.00 ? 87  ASP A OD1  4  
ATOM 5179  O OD2  . ASP A 1 50 ? 7.511   -2.196  -8.026  1.00 0.00 ? 87  ASP A OD2  4  
ATOM 5180  H H    . ASP A 1 50 ? 9.095   -4.498  -5.022  1.00 0.00 ? 87  ASP A H    4  
ATOM 5181  H HA   . ASP A 1 50 ? 6.470   -3.608  -5.020  1.00 0.00 ? 87  ASP A HA   4  
ATOM 5182  H HB2  . ASP A 1 50 ? 8.051   -5.040  -7.160  1.00 0.00 ? 87  ASP A HB2  4  
ATOM 5183  H HB3  . ASP A 1 50 ? 6.463   -4.341  -7.446  1.00 0.00 ? 87  ASP A HB3  4  
ATOM 5184  N N    . LEU A 1 51 ? 6.749   -6.873  -5.300  1.00 0.00 ? 88  LEU A N    4  
ATOM 5185  C CA   . LEU A 1 51 ? 6.053   -8.143  -5.133  1.00 0.00 ? 88  LEU A CA   4  
ATOM 5186  C C    . LEU A 1 51 ? 5.531   -8.279  -3.704  1.00 0.00 ? 88  LEU A C    4  
ATOM 5187  O O    . LEU A 1 51 ? 4.375   -8.648  -3.480  1.00 0.00 ? 88  LEU A O    4  
ATOM 5188  C CB   . LEU A 1 51 ? 7.010   -9.293  -5.495  1.00 0.00 ? 88  LEU A CB   4  
ATOM 5189  C CG   . LEU A 1 51 ? 6.438   -10.719 -5.444  1.00 0.00 ? 88  LEU A CG   4  
ATOM 5190  C CD1  . LEU A 1 51 ? 6.652   -11.345 -4.077  1.00 0.00 ? 88  LEU A CD1  4  
ATOM 5191  C CD2  . LEU A 1 51 ? 4.963   -10.724 -5.799  1.00 0.00 ? 88  LEU A CD2  4  
ATOM 5192  H H    . LEU A 1 51 ? 7.723   -6.883  -5.432  1.00 0.00 ? 88  LEU A H    4  
ATOM 5193  H HA   . LEU A 1 51 ? 5.214   -8.154  -5.814  1.00 0.00 ? 88  LEU A HA   4  
ATOM 5194  H HB2  . LEU A 1 51 ? 7.371   -9.119  -6.497  1.00 0.00 ? 88  LEU A HB2  4  
ATOM 5195  H HB3  . LEU A 1 51 ? 7.854   -9.248  -4.821  1.00 0.00 ? 88  LEU A HB3  4  
ATOM 5196  H HG   . LEU A 1 51 ? 6.956   -11.328 -6.170  1.00 0.00 ? 88  LEU A HG   4  
ATOM 5197  H HD11 . LEU A 1 51 ? 7.687   -11.241 -3.790  1.00 0.00 ? 88  LEU A HD11 4  
ATOM 5198  H HD12 . LEU A 1 51 ? 6.024   -10.848 -3.351  1.00 0.00 ? 88  LEU A HD12 4  
ATOM 5199  H HD13 . LEU A 1 51 ? 6.394   -12.393 -4.118  1.00 0.00 ? 88  LEU A HD13 4  
ATOM 5200  H HD21 . LEU A 1 51 ? 4.770   -9.965  -6.542  1.00 0.00 ? 88  LEU A HD21 4  
ATOM 5201  H HD22 . LEU A 1 51 ? 4.691   -11.691 -6.189  1.00 0.00 ? 88  LEU A HD22 4  
ATOM 5202  H HD23 . LEU A 1 51 ? 4.384   -10.515 -4.911  1.00 0.00 ? 88  LEU A HD23 4  
ATOM 5203  N N    . TYR A 1 52 ? 6.383   -7.960  -2.746  1.00 0.00 ? 89  TYR A N    4  
ATOM 5204  C CA   . TYR A 1 52 ? 6.026   -8.043  -1.338  1.00 0.00 ? 89  TYR A CA   4  
ATOM 5205  C C    . TYR A 1 52 ? 4.867   -7.111  -1.015  1.00 0.00 ? 89  TYR A C    4  
ATOM 5206  O O    . TYR A 1 52 ? 3.952   -7.481  -0.281  1.00 0.00 ? 89  TYR A O    4  
ATOM 5207  C CB   . TYR A 1 52 ? 7.226   -7.704  -0.458  1.00 0.00 ? 89  TYR A CB   4  
ATOM 5208  C CG   . TYR A 1 52 ? 8.284   -8.789  -0.400  1.00 0.00 ? 89  TYR A CG   4  
ATOM 5209  C CD1  . TYR A 1 52 ? 8.327   -9.799  -1.349  1.00 0.00 ? 89  TYR A CD1  4  
ATOM 5210  C CD2  . TYR A 1 52 ? 9.253   -8.788  0.597   1.00 0.00 ? 89  TYR A CD2  4  
ATOM 5211  C CE1  . TYR A 1 52 ? 9.297   -10.777 -1.312  1.00 0.00 ? 89  TYR A CE1  4  
ATOM 5212  C CE2  . TYR A 1 52 ? 10.228  -9.768  0.644   1.00 0.00 ? 89  TYR A CE2  4  
ATOM 5213  C CZ   . TYR A 1 52 ? 10.244  -10.759 -0.315  1.00 0.00 ? 89  TYR A CZ   4  
ATOM 5214  O OH   . TYR A 1 52 ? 11.217  -11.731 -0.282  1.00 0.00 ? 89  TYR A OH   4  
ATOM 5215  H H    . TYR A 1 52 ? 7.290   -7.659  -2.992  1.00 0.00 ? 89  TYR A H    4  
ATOM 5216  H HA   . TYR A 1 52 ? 5.721   -9.057  -1.137  1.00 0.00 ? 89  TYR A HA   4  
ATOM 5217  H HB2  . TYR A 1 52 ? 7.695   -6.806  -0.832  1.00 0.00 ? 89  TYR A HB2  4  
ATOM 5218  H HB3  . TYR A 1 52 ? 6.877   -7.527  0.542   1.00 0.00 ? 89  TYR A HB3  4  
ATOM 5219  H HD1  . TYR A 1 52 ? 7.583   -9.814  -2.129  1.00 0.00 ? 89  TYR A HD1  4  
ATOM 5220  H HD2  . TYR A 1 52 ? 9.234   -8.012  1.346   1.00 0.00 ? 89  TYR A HD2  4  
ATOM 5221  H HE1  . TYR A 1 52 ? 9.311   -11.553 -2.066  1.00 0.00 ? 89  TYR A HE1  4  
ATOM 5222  H HE2  . TYR A 1 52 ? 10.971  -9.752  1.427   1.00 0.00 ? 89  TYR A HE2  4  
ATOM 5223  H HH   . TYR A 1 52 ? 10.847  -12.544 0.108   1.00 0.00 ? 89  TYR A HH   4  
ATOM 5224  N N    . PHE A 1 53 ? 4.906   -5.911  -1.579  1.00 0.00 ? 90  PHE A N    4  
ATOM 5225  C CA   . PHE A 1 53 ? 3.856   -4.924  -1.371  1.00 0.00 ? 90  PHE A CA   4  
ATOM 5226  C C    . PHE A 1 53 ? 2.507   -5.453  -1.843  1.00 0.00 ? 90  PHE A C    4  
ATOM 5227  O O    . PHE A 1 53 ? 1.506   -5.341  -1.133  1.00 0.00 ? 90  PHE A O    4  
ATOM 5228  C CB   . PHE A 1 53 ? 4.185   -3.633  -2.120  1.00 0.00 ? 90  PHE A CB   4  
ATOM 5229  C CG   . PHE A 1 53 ? 3.102   -2.599  -2.014  1.00 0.00 ? 90  PHE A CG   4  
ATOM 5230  C CD1  . PHE A 1 53 ? 2.992   -1.813  -0.877  1.00 0.00 ? 90  PHE A CD1  4  
ATOM 5231  C CD2  . PHE A 1 53 ? 2.215   -2.394  -3.055  1.00 0.00 ? 90  PHE A CD2  4  
ATOM 5232  C CE1  . PHE A 1 53 ? 2.013   -0.846  -0.781  1.00 0.00 ? 90  PHE A CE1  4  
ATOM 5233  C CE2  . PHE A 1 53 ? 1.236   -1.426  -2.964  1.00 0.00 ? 90  PHE A CE2  4  
ATOM 5234  C CZ   . PHE A 1 53 ? 1.067   -0.727  -1.803  1.00 0.00 ? 90  PHE A CZ   4  
ATOM 5235  H H    . PHE A 1 53 ? 5.673   -5.678  -2.150  1.00 0.00 ? 90  PHE A H    4  
ATOM 5236  H HA   . PHE A 1 53 ? 3.800   -4.714  -0.313  1.00 0.00 ? 90  PHE A HA   4  
ATOM 5237  H HB2  . PHE A 1 53 ? 5.093   -3.210  -1.715  1.00 0.00 ? 90  PHE A HB2  4  
ATOM 5238  H HB3  . PHE A 1 53 ? 4.331   -3.857  -3.167  1.00 0.00 ? 90  PHE A HB3  4  
ATOM 5239  H HD1  . PHE A 1 53 ? 3.678   -1.969  -0.057  1.00 0.00 ? 90  PHE A HD1  4  
ATOM 5240  H HD2  . PHE A 1 53 ? 2.290   -3.002  -3.945  1.00 0.00 ? 90  PHE A HD2  4  
ATOM 5241  H HE1  . PHE A 1 53 ? 1.936   -0.241  0.110   1.00 0.00 ? 90  PHE A HE1  4  
ATOM 5242  H HE2  . PHE A 1 53 ? 0.551   -1.272  -3.784  1.00 0.00 ? 90  PHE A HE2  4  
ATOM 5243  H HZ   . PHE A 1 53 ? 0.275   0.003   -1.720  1.00 0.00 ? 90  PHE A HZ   4  
ATOM 5244  N N    . ASN A 1 54 ? 2.482   -6.024  -3.043  1.00 0.00 ? 91  ASN A N    4  
ATOM 5245  C CA   . ASN A 1 54 ? 1.250   -6.571  -3.603  1.00 0.00 ? 91  ASN A CA   4  
ATOM 5246  C C    . ASN A 1 54 ? 0.690   -7.659  -2.692  1.00 0.00 ? 91  ASN A C    4  
ATOM 5247  O O    . ASN A 1 54 ? -0.500  -7.663  -2.379  1.00 0.00 ? 91  ASN A O    4  
ATOM 5248  C CB   . ASN A 1 54 ? 1.480   -7.128  -5.014  1.00 0.00 ? 91  ASN A CB   4  
ATOM 5249  C CG   . ASN A 1 54 ? 1.670   -6.036  -6.053  1.00 0.00 ? 91  ASN A CG   4  
ATOM 5250  O OD1  . ASN A 1 54 ? 0.816   -5.165  -6.226  1.00 0.00 ? 91  ASN A OD1  4  
ATOM 5251  N ND2  . ASN A 1 54 ? 2.786   -6.085  -6.762  1.00 0.00 ? 91  ASN A ND2  4  
ATOM 5252  H H    . ASN A 1 54 ? 3.312   -6.072  -3.568  1.00 0.00 ? 91  ASN A H    4  
ATOM 5253  H HA   . ASN A 1 54 ? 0.531   -5.767  -3.659  1.00 0.00 ? 91  ASN A HA   4  
ATOM 5254  H HB2  . ASN A 1 54 ? 2.365   -7.746  -5.008  1.00 0.00 ? 91  ASN A HB2  4  
ATOM 5255  H HB3  . ASN A 1 54 ? 0.628   -7.729  -5.302  1.00 0.00 ? 91  ASN A HB3  4  
ATOM 5256  H HD21 . ASN A 1 54 ? 3.417   -6.813  -6.583  1.00 0.00 ? 91  ASN A HD21 4  
ATOM 5257  H HD22 . ASN A 1 54 ? 2.946   -5.382  -7.432  1.00 0.00 ? 91  ASN A HD22 4  
ATOM 5258  N N    . ASN A 1 55 ? 1.577   -8.508  -2.181  1.00 0.00 ? 92  ASN A N    4  
ATOM 5259  C CA   . ASN A 1 55 ? 1.190   -9.540  -1.220  1.00 0.00 ? 92  ASN A CA   4  
ATOM 5260  C C    . ASN A 1 55 ? 0.689   -8.919  0.078   1.00 0.00 ? 92  ASN A C    4  
ATOM 5261  O O    . ASN A 1 55 ? -0.274  -9.401  0.672   1.00 0.00 ? 92  ASN A O    4  
ATOM 5262  C CB   . ASN A 1 55 ? 2.360   -10.480 -0.925  1.00 0.00 ? 92  ASN A CB   4  
ATOM 5263  C CG   . ASN A 1 55 ? 2.531   -11.545 -1.986  1.00 0.00 ? 92  ASN A CG   4  
ATOM 5264  O OD1  . ASN A 1 55 ? 1.638   -12.364 -2.207  1.00 0.00 ? 92  ASN A OD1  4  
ATOM 5265  N ND2  . ASN A 1 55 ? 3.666   -11.535 -2.663  1.00 0.00 ? 92  ASN A ND2  4  
ATOM 5266  H H    . ASN A 1 55 ? 2.527   -8.398  -2.409  1.00 0.00 ? 92  ASN A H    4  
ATOM 5267  H HA   . ASN A 1 55 ? 0.386   -10.110 -1.659  1.00 0.00 ? 92  ASN A HA   4  
ATOM 5268  H HB2  . ASN A 1 55 ? 3.271   -9.903  -0.872  1.00 0.00 ? 92  ASN A HB2  4  
ATOM 5269  H HB3  . ASN A 1 55 ? 2.193   -10.966 0.025   1.00 0.00 ? 92  ASN A HB3  4  
ATOM 5270  H HD21 . ASN A 1 55 ? 4.326   -10.845 -2.451  1.00 0.00 ? 92  ASN A HD21 4  
ATOM 5271  H HD22 . ASN A 1 55 ? 3.804   -12.231 -3.351  1.00 0.00 ? 92  ASN A HD22 4  
ATOM 5272  N N    . ALA A 1 56 ? 1.343   -7.847  0.507   1.00 0.00 ? 93  ALA A N    4  
ATOM 5273  C CA   . ALA A 1 56 ? 0.964   -7.149  1.729   1.00 0.00 ? 93  ALA A CA   4  
ATOM 5274  C C    . ALA A 1 56 ? -0.454  -6.598  1.617   1.00 0.00 ? 93  ALA A C    4  
ATOM 5275  O O    . ALA A 1 56 ? -1.274  -6.788  2.516   1.00 0.00 ? 93  ALA A O    4  
ATOM 5276  C CB   . ALA A 1 56 ? 1.952   -6.032  2.030   1.00 0.00 ? 93  ALA A CB   4  
ATOM 5277  H H    . ALA A 1 56 ? 2.104   -7.513  -0.018  1.00 0.00 ? 93  ALA A H    4  
ATOM 5278  H HA   . ALA A 1 56 ? 0.998   -7.860  2.542   1.00 0.00 ? 93  ALA A HA   4  
ATOM 5279  H HB1  . ALA A 1 56 ? 2.895   -6.241  1.540   1.00 0.00 ? 93  ALA A HB1  4  
ATOM 5280  H HB2  . ALA A 1 56 ? 2.109   -5.967  3.096   1.00 0.00 ? 93  ALA A HB2  4  
ATOM 5281  H HB3  . ALA A 1 56 ? 1.559   -5.094  1.666   1.00 0.00 ? 93  ALA A HB3  4  
ATOM 5282  N N    . ILE A 1 57 ? -0.758  -5.990  0.474   1.00 0.00 ? 94  ILE A N    4  
ATOM 5283  C CA   . ILE A 1 57 ? -2.099  -5.484  0.209   1.00 0.00 ? 94  ILE A CA   4  
ATOM 5284  C C    . ILE A 1 57 ? -3.114  -6.621  0.233   1.00 0.00 ? 94  ILE A C    4  
ATOM 5285  O O    . ILE A 1 57 ? -4.161  -6.517  0.871   1.00 0.00 ? 94  ILE A O    4  
ATOM 5286  C CB   . ILE A 1 57 ? -2.185  -4.764  -1.157  1.00 0.00 ? 94  ILE A CB   4  
ATOM 5287  C CG1  . ILE A 1 57 ? -1.238  -3.560  -1.199  1.00 0.00 ? 94  ILE A CG1  4  
ATOM 5288  C CG2  . ILE A 1 57 ? -3.617  -4.327  -1.444  1.00 0.00 ? 94  ILE A CG2  4  
ATOM 5289  C CD1  . ILE A 1 57 ? -1.552  -2.495  -0.170  1.00 0.00 ? 94  ILE A CD1  4  
ATOM 5290  H H    . ILE A 1 57 ? -0.069  -5.920  -0.226  1.00 0.00 ? 94  ILE A H    4  
ATOM 5291  H HA   . ILE A 1 57 ? -2.348  -4.773  0.985   1.00 0.00 ? 94  ILE A HA   4  
ATOM 5292  H HB   . ILE A 1 57 ? -1.893  -5.467  -1.922  1.00 0.00 ? 94  ILE A HB   4  
ATOM 5293  H HG12 . ILE A 1 57 ? -0.231  -3.898  -1.021  1.00 0.00 ? 94  ILE A HG12 4  
ATOM 5294  H HG13 . ILE A 1 57 ? -1.293  -3.105  -2.176  1.00 0.00 ? 94  ILE A HG13 4  
ATOM 5295  H HG21 . ILE A 1 57 ? -4.176  -4.293  -0.521  1.00 0.00 ? 94  ILE A HG21 4  
ATOM 5296  H HG22 . ILE A 1 57 ? -3.609  -3.346  -1.897  1.00 0.00 ? 94  ILE A HG22 4  
ATOM 5297  H HG23 . ILE A 1 57 ? -4.078  -5.032  -2.121  1.00 0.00 ? 94  ILE A HG23 4  
ATOM 5298  H HD11 . ILE A 1 57 ? -2.617  -2.325  -0.140  1.00 0.00 ? 94  ILE A HD11 4  
ATOM 5299  H HD12 . ILE A 1 57 ? -1.211  -2.820  0.801   1.00 0.00 ? 94  ILE A HD12 4  
ATOM 5300  H HD13 . ILE A 1 57 ? -1.050  -1.576  -0.442  1.00 0.00 ? 94  ILE A HD13 4  
ATOM 5301  N N    . LYS A 1 58 ? -2.776  -7.715  -0.447  1.00 0.00 ? 95  LYS A N    4  
ATOM 5302  C CA   . LYS A 1 58 ? -3.640  -8.888  -0.498  1.00 0.00 ? 95  LYS A CA   4  
ATOM 5303  C C    . LYS A 1 58 ? -3.929  -9.415  0.898   1.00 0.00 ? 95  LYS A C    4  
ATOM 5304  O O    . LYS A 1 58 ? -5.073  -9.724  1.225   1.00 0.00 ? 95  LYS A O    4  
ATOM 5305  C CB   . LYS A 1 58 ? -3.006  -9.999  -1.336  1.00 0.00 ? 95  LYS A CB   4  
ATOM 5306  C CG   . LYS A 1 58 ? -2.965  -9.709  -2.823  1.00 0.00 ? 95  LYS A CG   4  
ATOM 5307  C CD   . LYS A 1 58 ? -2.550  -10.944 -3.602  1.00 0.00 ? 95  LYS A CD   4  
ATOM 5308  C CE   . LYS A 1 58 ? -2.630  -10.716 -5.098  1.00 0.00 ? 95  LYS A CE   4  
ATOM 5309  N NZ   . LYS A 1 58 ? -2.519  -11.988 -5.857  1.00 0.00 ? 95  LYS A NZ   4  
ATOM 5310  H H    . LYS A 1 58 ? -1.916  -7.736  -0.921  1.00 0.00 ? 95  LYS A H    4  
ATOM 5311  H HA   . LYS A 1 58 ? -4.572  -8.591  -0.958  1.00 0.00 ? 95  LYS A HA   4  
ATOM 5312  H HB2  . LYS A 1 58 ? -1.992  -10.154 -0.995  1.00 0.00 ? 95  LYS A HB2  4  
ATOM 5313  H HB3  . LYS A 1 58 ? -3.567  -10.910 -1.185  1.00 0.00 ? 95  LYS A HB3  4  
ATOM 5314  H HG2  . LYS A 1 58 ? -3.947  -9.400  -3.149  1.00 0.00 ? 95  LYS A HG2  4  
ATOM 5315  H HG3  . LYS A 1 58 ? -2.253  -8.919  -3.009  1.00 0.00 ? 95  LYS A HG3  4  
ATOM 5316  H HD2  . LYS A 1 58 ? -1.533  -11.195 -3.341  1.00 0.00 ? 95  LYS A HD2  4  
ATOM 5317  H HD3  . LYS A 1 58 ? -3.205  -11.761 -3.335  1.00 0.00 ? 95  LYS A HD3  4  
ATOM 5318  H HE2  . LYS A 1 58 ? -3.576  -10.250 -5.330  1.00 0.00 ? 95  LYS A HE2  4  
ATOM 5319  H HE3  . LYS A 1 58 ? -1.825  -10.058 -5.393  1.00 0.00 ? 95  LYS A HE3  4  
ATOM 5320  H HZ1  . LYS A 1 58 ? -3.147  -12.710 -5.440  1.00 0.00 ? 95  LYS A HZ1  4  
ATOM 5321  H HZ2  . LYS A 1 58 ? -2.795  -11.838 -6.851  1.00 0.00 ? 95  LYS A HZ2  4  
ATOM 5322  H HZ3  . LYS A 1 58 ? -1.539  -12.341 -5.830  1.00 0.00 ? 95  LYS A HZ3  4  
ATOM 5323  N N    . LYS A 1 59 ? -2.885  -9.516  1.714   1.00 0.00 ? 96  LYS A N    4  
ATOM 5324  C CA   . LYS A 1 59 ? -3.021  -10.015 3.075   1.00 0.00 ? 96  LYS A CA   4  
ATOM 5325  C C    . LYS A 1 59 ? -3.830  -9.044  3.928   1.00 0.00 ? 96  LYS A C    4  
ATOM 5326  O O    . LYS A 1 59 ? -4.632  -9.449  4.765   1.00 0.00 ? 96  LYS A O    4  
ATOM 5327  C CB   . LYS A 1 59 ? -1.644  -10.223 3.710   1.00 0.00 ? 96  LYS A CB   4  
ATOM 5328  C CG   . LYS A 1 59 ? -1.702  -10.855 5.094   1.00 0.00 ? 96  LYS A CG   4  
ATOM 5329  C CD   . LYS A 1 59 ? -1.986  -12.348 5.027   1.00 0.00 ? 96  LYS A CD   4  
ATOM 5330  C CE   . LYS A 1 59 ? -0.897  -13.099 4.279   1.00 0.00 ? 96  LYS A CE   4  
ATOM 5331  N NZ   . LYS A 1 59 ? 0.423   -12.984 4.953   1.00 0.00 ? 96  LYS A NZ   4  
ATOM 5332  H H    . LYS A 1 59 ? -1.997  -9.248  1.387   1.00 0.00 ? 96  LYS A H    4  
ATOM 5333  H HA   . LYS A 1 59 ? -3.538  -10.961 3.033   1.00 0.00 ? 96  LYS A HA   4  
ATOM 5334  H HB2  . LYS A 1 59 ? -1.056  -10.863 3.068   1.00 0.00 ? 96  LYS A HB2  4  
ATOM 5335  H HB3  . LYS A 1 59 ? -1.152  -9.266  3.798   1.00 0.00 ? 96  LYS A HB3  4  
ATOM 5336  H HG2  . LYS A 1 59 ? -0.759  -10.701 5.592   1.00 0.00 ? 96  LYS A HG2  4  
ATOM 5337  H HG3  . LYS A 1 59 ? -2.494  -10.380 5.655   1.00 0.00 ? 96  LYS A HG3  4  
ATOM 5338  H HD2  . LYS A 1 59 ? -2.052  -12.737 6.032   1.00 0.00 ? 96  LYS A HD2  4  
ATOM 5339  H HD3  . LYS A 1 59 ? -2.927  -12.501 4.519   1.00 0.00 ? 96  LYS A HD3  4  
ATOM 5340  H HE2  . LYS A 1 59 ? -1.171  -14.140 4.219   1.00 0.00 ? 96  LYS A HE2  4  
ATOM 5341  H HE3  . LYS A 1 59 ? -0.818  -12.689 3.283   1.00 0.00 ? 96  LYS A HE3  4  
ATOM 5342  H HZ1  . LYS A 1 59 ? 0.323   -12.480 5.863   1.00 0.00 ? 96  LYS A HZ1  4  
ATOM 5343  H HZ2  . LYS A 1 59 ? 0.814   -13.934 5.139   1.00 0.00 ? 96  LYS A HZ2  4  
ATOM 5344  H HZ3  . LYS A 1 59 ? 1.094   -12.459 4.351   1.00 0.00 ? 96  LYS A HZ3  4  
ATOM 5345  N N    . GLY A 1 60 ? -3.567  -7.762  3.755   1.00 0.00 ? 97  GLY A N    4  
ATOM 5346  C CA   . GLY A 1 60 ? -4.223  -6.757  4.562   1.00 0.00 ? 97  GLY A CA   4  
ATOM 5347  C C    . GLY A 1 60 ? -5.720  -6.688  4.327   1.00 0.00 ? 97  GLY A C    4  
ATOM 5348  O O    . GLY A 1 60 ? -6.491  -6.526  5.273   1.00 0.00 ? 97  GLY A O    4  
ATOM 5349  H H    . GLY A 1 60 ? -2.874  -7.494  3.106   1.00 0.00 ? 97  GLY A H    4  
ATOM 5350  H HA2  . GLY A 1 60 ? -4.045  -6.979  5.604   1.00 0.00 ? 97  GLY A HA2  4  
ATOM 5351  H HA3  . GLY A 1 60 ? -3.789  -5.794  4.335   1.00 0.00 ? 97  GLY A HA3  4  
ATOM 5352  N N    . VAL A 1 61 ? -6.138  -6.761  3.069   1.00 0.00 ? 98  VAL A N    4  
ATOM 5353  C CA   . VAL A 1 61 ? -7.556  -6.646  2.739   1.00 0.00 ? 98  VAL A CA   4  
ATOM 5354  C C    . VAL A 1 61 ? -8.359  -7.837  3.271   1.00 0.00 ? 98  VAL A C    4  
ATOM 5355  O O    . VAL A 1 61 ? -9.516  -7.683  3.666   1.00 0.00 ? 98  VAL A O    4  
ATOM 5356  C CB   . VAL A 1 61 ? -7.801  -6.466  1.223   1.00 0.00 ? 98  VAL A CB   4  
ATOM 5357  C CG1  . VAL A 1 61 ? -7.228  -5.142  0.748   1.00 0.00 ? 98  VAL A CG1  4  
ATOM 5358  C CG2  . VAL A 1 61 ? -7.207  -7.607  0.423   1.00 0.00 ? 98  VAL A CG2  4  
ATOM 5359  H H    . VAL A 1 61 ? -5.475  -6.854  2.346   1.00 0.00 ? 98  VAL A H    4  
ATOM 5360  H HA   . VAL A 1 61 ? -7.918  -5.756  3.234   1.00 0.00 ? 98  VAL A HA   4  
ATOM 5361  H HB   . VAL A 1 61 ? -8.869  -6.452  1.052   1.00 0.00 ? 98  VAL A HB   4  
ATOM 5362  H HG11 . VAL A 1 61 ? -6.415  -4.849  1.395   1.00 0.00 ? 98  VAL A HG11 4  
ATOM 5363  H HG12 . VAL A 1 61 ? -6.863  -5.251  -0.262  1.00 0.00 ? 98  VAL A HG12 4  
ATOM 5364  H HG13 . VAL A 1 61 ? -7.998  -4.386  0.773   1.00 0.00 ? 98  VAL A HG13 4  
ATOM 5365  H HG21 . VAL A 1 61 ? -6.320  -7.970  0.921   1.00 0.00 ? 98  VAL A HG21 4  
ATOM 5366  H HG22 . VAL A 1 61 ? -7.928  -8.405  0.342   1.00 0.00 ? 98  VAL A HG22 4  
ATOM 5367  H HG23 . VAL A 1 61 ? -6.946  -7.252  -0.565  1.00 0.00 ? 98  VAL A HG23 4  
ATOM 5368  N N    . GLU A 1 62 ? -7.732  -9.007  3.337   1.00 0.00 ? 99  GLU A N    4  
ATOM 5369  C CA   . GLU A 1 62 ? -8.383  -10.183 3.909   1.00 0.00 ? 99  GLU A CA   4  
ATOM 5370  C C    . GLU A 1 62 ? -8.307  -10.166 5.433   1.00 0.00 ? 99  GLU A C    4  
ATOM 5371  O O    . GLU A 1 62 ? -9.211  -10.644 6.110   1.00 0.00 ? 99  GLU A O    4  
ATOM 5372  C CB   . GLU A 1 62 ? -7.772  -11.475 3.378   1.00 0.00 ? 99  GLU A CB   4  
ATOM 5373  C CG   . GLU A 1 62 ? -6.263  -11.451 3.289   1.00 0.00 ? 99  GLU A CG   4  
ATOM 5374  C CD   . GLU A 1 62 ? -5.654  -12.830 3.412   1.00 0.00 ? 99  GLU A CD   4  
ATOM 5375  O OE1  . GLU A 1 62 ? -6.391  -13.789 3.702   1.00 0.00 ? 99  GLU A OE1  4  
ATOM 5376  O OE2  . GLU A 1 62 ? -4.429  -12.963 3.199   1.00 0.00 ? 99  GLU A OE2  4  
ATOM 5377  H H    . GLU A 1 62 ? -6.796  -9.069  3.048   1.00 0.00 ? 99  GLU A H    4  
ATOM 5378  H HA   . GLU A 1 62 ? -9.425  -10.148 3.619   1.00 0.00 ? 99  GLU A HA   4  
ATOM 5379  H HB2  . GLU A 1 62 ? -8.049  -12.285 4.036   1.00 0.00 ? 99  GLU A HB2  4  
ATOM 5380  H HB3  . GLU A 1 62 ? -8.168  -11.672 2.392   1.00 0.00 ? 99  GLU A HB3  4  
ATOM 5381  H HG2  . GLU A 1 62 ? -5.981  -11.036 2.332   1.00 0.00 ? 99  GLU A HG2  4  
ATOM 5382  H HG3  . GLU A 1 62 ? -5.876  -10.818 4.081   1.00 0.00 ? 99  GLU A HG3  4  
ATOM 5383  N N    . ALA A 1 63 ? -7.189  -9.684  5.965   1.00 0.00 ? 100 ALA A N    4  
ATOM 5384  C CA   . ALA A 1 63 ? -6.980  -9.652  7.407   1.00 0.00 ? 100 ALA A CA   4  
ATOM 5385  C C    . ALA A 1 63 ? -7.919  -8.654  8.069   1.00 0.00 ? 100 ALA A C    4  
ATOM 5386  O O    . ALA A 1 63 ? -8.321  -8.827  9.223   1.00 0.00 ? 100 ALA A O    4  
ATOM 5387  C CB   . ALA A 1 63 ? -5.536  -9.303  7.727   1.00 0.00 ? 100 ALA A CB   4  
ATOM 5388  H H    . ALA A 1 63 ? -6.467  -9.380  5.370   1.00 0.00 ? 100 ALA A H    4  
ATOM 5389  H HA   . ALA A 1 63 ? -7.183  -10.638 7.798   1.00 0.00 ? 100 ALA A HA   4  
ATOM 5390  H HB1  . ALA A 1 63 ? -5.511  -8.442  8.380   1.00 0.00 ? 100 ALA A HB1  4  
ATOM 5391  H HB2  . ALA A 1 63 ? -5.010  -9.076  6.811   1.00 0.00 ? 100 ALA A HB2  4  
ATOM 5392  H HB3  . ALA A 1 63 ? -5.064  -10.140 8.216   1.00 0.00 ? 100 ALA A HB3  4  
ATOM 5393  N N    . GLY A 1 64 ? -8.214  -7.581  7.352   1.00 0.00 ? 101 GLY A N    4  
ATOM 5394  C CA   . GLY A 1 64 ? -9.047  -6.534  7.897   1.00 0.00 ? 101 GLY A CA   4  
ATOM 5395  C C    . GLY A 1 64 ? -8.242  -5.300  8.225   1.00 0.00 ? 101 GLY A C    4  
ATOM 5396  O O    . GLY A 1 64 ? -8.339  -4.760  9.326   1.00 0.00 ? 101 GLY A O    4  
ATOM 5397  H H    . GLY A 1 64 ? -7.824  -7.480  6.457   1.00 0.00 ? 101 GLY A H    4  
ATOM 5398  H HA2  . GLY A 1 64 ? -9.810  -6.279  7.174   1.00 0.00 ? 101 GLY A HA2  4  
ATOM 5399  H HA3  . GLY A 1 64 ? -9.523  -6.894  8.797   1.00 0.00 ? 101 GLY A HA3  4  
ATOM 5400  N N    . ASP A 1 65 ? -7.390  -4.899  7.294   1.00 0.00 ? 102 ASP A N    4  
ATOM 5401  C CA   . ASP A 1 65 ? -6.532  -3.738  7.491   1.00 0.00 ? 102 ASP A CA   4  
ATOM 5402  C C    . ASP A 1 65 ? -6.749  -2.735  6.368   1.00 0.00 ? 102 ASP A C    4  
ATOM 5403  O O    . ASP A 1 65 ? -6.678  -1.521  6.578   1.00 0.00 ? 102 ASP A O    4  
ATOM 5404  C CB   . ASP A 1 65 ? -5.059  -4.151  7.531   1.00 0.00 ? 102 ASP A CB   4  
ATOM 5405  C CG   . ASP A 1 65 ? -4.233  -3.302  8.473   1.00 0.00 ? 102 ASP A CG   4  
ATOM 5406  O OD1  . ASP A 1 65 ? -4.830  -2.503  9.219   1.00 0.00 ? 102 ASP A OD1  4  
ATOM 5407  O OD2  . ASP A 1 65 ? -2.987  -3.395  8.440   1.00 0.00 ? 102 ASP A OD2  4  
ATOM 5408  H H    . ASP A 1 65 ? -7.314  -5.416  6.464   1.00 0.00 ? 102 ASP A H    4  
ATOM 5409  H HA   . ASP A 1 65 ? -6.799  -3.280  8.431   1.00 0.00 ? 102 ASP A HA   4  
ATOM 5410  H HB2  . ASP A 1 65 ? -4.986  -5.181  7.848   1.00 0.00 ? 102 ASP A HB2  4  
ATOM 5411  H HB3  . ASP A 1 65 ? -4.638  -4.054  6.541   1.00 0.00 ? 102 ASP A HB3  4  
ATOM 5412  N N    . PHE A 1 66 ? -7.038  -3.244  5.171   1.00 0.00 ? 103 PHE A N    4  
ATOM 5413  C CA   . PHE A 1 66 ? -7.284  -2.382  4.021   1.00 0.00 ? 103 PHE A CA   4  
ATOM 5414  C C    . PHE A 1 66 ? -8.504  -2.861  3.234   1.00 0.00 ? 103 PHE A C    4  
ATOM 5415  O O    . PHE A 1 66 ? -8.885  -4.028  3.312   1.00 0.00 ? 103 PHE A O    4  
ATOM 5416  C CB   . PHE A 1 66 ? -6.069  -2.337  3.084   1.00 0.00 ? 103 PHE A CB   4  
ATOM 5417  C CG   . PHE A 1 66 ? -4.735  -2.376  3.775   1.00 0.00 ? 103 PHE A CG   4  
ATOM 5418  C CD1  . PHE A 1 66 ? -4.138  -1.216  4.240   1.00 0.00 ? 103 PHE A CD1  4  
ATOM 5419  C CD2  . PHE A 1 66 ? -4.071  -3.577  3.938   1.00 0.00 ? 103 PHE A CD2  4  
ATOM 5420  C CE1  . PHE A 1 66 ? -2.904  -1.261  4.860   1.00 0.00 ? 103 PHE A CE1  4  
ATOM 5421  C CE2  . PHE A 1 66 ? -2.840  -3.628  4.558   1.00 0.00 ? 103 PHE A CE2  4  
ATOM 5422  C CZ   . PHE A 1 66 ? -2.254  -2.469  5.021   1.00 0.00 ? 103 PHE A CZ   4  
ATOM 5423  H H    . PHE A 1 66 ? -7.104  -4.219  5.060   1.00 0.00 ? 103 PHE A H    4  
ATOM 5424  H HA   . PHE A 1 66 ? -7.481  -1.386  4.390   1.00 0.00 ? 103 PHE A HA   4  
ATOM 5425  H HB2  . PHE A 1 66 ? -6.114  -3.179  2.412   1.00 0.00 ? 103 PHE A HB2  4  
ATOM 5426  H HB3  . PHE A 1 66 ? -6.110  -1.425  2.505   1.00 0.00 ? 103 PHE A HB3  4  
ATOM 5427  H HD1  . PHE A 1 66 ? -4.646  -0.269  4.120   1.00 0.00 ? 103 PHE A HD1  4  
ATOM 5428  H HD2  . PHE A 1 66 ? -4.530  -4.484  3.576   1.00 0.00 ? 103 PHE A HD2  4  
ATOM 5429  H HE1  . PHE A 1 66 ? -2.447  -0.350  5.218   1.00 0.00 ? 103 PHE A HE1  4  
ATOM 5430  H HE2  . PHE A 1 66 ? -2.339  -4.578  4.683   1.00 0.00 ? 103 PHE A HE2  4  
ATOM 5431  H HZ   . PHE A 1 66 ? -1.290  -2.503  5.505   1.00 0.00 ? 103 PHE A HZ   4  
ATOM 5432  N N    . GLU A 1 67 ? -9.057  -1.966  2.429   1.00 0.00 ? 104 GLU A N    4  
ATOM 5433  C CA   . GLU A 1 67 ? -10.162 -2.284  1.531   1.00 0.00 ? 104 GLU A CA   4  
ATOM 5434  C C    . GLU A 1 67 ? -9.784  -1.850  0.124   1.00 0.00 ? 104 GLU A C    4  
ATOM 5435  O O    . GLU A 1 67 ? -9.168  -0.803  -0.042  1.00 0.00 ? 104 GLU A O    4  
ATOM 5436  C CB   . GLU A 1 67 ? -11.443 -1.543  1.938   1.00 0.00 ? 104 GLU A CB   4  
ATOM 5437  C CG   . GLU A 1 67 ? -11.881 -1.758  3.377   1.00 0.00 ? 104 GLU A CG   4  
ATOM 5438  C CD   . GLU A 1 67 ? -13.141 -0.981  3.718   1.00 0.00 ? 104 GLU A CD   4  
ATOM 5439  O OE1  . GLU A 1 67 ? -13.749 -0.385  2.806   1.00 0.00 ? 104 GLU A OE1  4  
ATOM 5440  O OE2  . GLU A 1 67 ? -13.534 -0.968  4.905   1.00 0.00 ? 104 GLU A OE2  4  
ATOM 5441  H H    . GLU A 1 67 ? -8.656  -1.074  2.376   1.00 0.00 ? 104 GLU A H    4  
ATOM 5442  H HA   . GLU A 1 67 ? -10.331 -3.351  1.550   1.00 0.00 ? 104 GLU A HA   4  
ATOM 5443  H HB2  . GLU A 1 67 ? -11.288 -0.485  1.792   1.00 0.00 ? 104 GLU A HB2  4  
ATOM 5444  H HB3  . GLU A 1 67 ? -12.247 -1.867  1.291   1.00 0.00 ? 104 GLU A HB3  4  
ATOM 5445  H HG2  . GLU A 1 67 ? -12.071 -2.809  3.530   1.00 0.00 ? 104 GLU A HG2  4  
ATOM 5446  H HG3  . GLU A 1 67 ? -11.088 -1.435  4.034   1.00 0.00 ? 104 GLU A HG3  4  
ATOM 5447  N N    . GLN A 1 68 ? -10.175 -2.599  -0.890  1.00 0.00 ? 105 GLN A N    4  
ATOM 5448  C CA   . GLN A 1 68 ? -9.908  -2.177  -2.258  1.00 0.00 ? 105 GLN A CA   4  
ATOM 5449  C C    . GLN A 1 68 ? -11.193 -1.736  -2.949  1.00 0.00 ? 105 GLN A C    4  
ATOM 5450  O O    . GLN A 1 68 ? -12.093 -2.541  -3.177  1.00 0.00 ? 105 GLN A O    4  
ATOM 5451  C CB   . GLN A 1 68 ? -9.207  -3.279  -3.057  1.00 0.00 ? 105 GLN A CB   4  
ATOM 5452  C CG   . GLN A 1 68 ? -7.758  -3.481  -2.645  1.00 0.00 ? 105 GLN A CG   4  
ATOM 5453  C CD   . GLN A 1 68 ? -6.975  -4.324  -3.631  1.00 0.00 ? 105 GLN A CD   4  
ATOM 5454  O OE1  . GLN A 1 68 ? -7.251  -5.507  -3.819  1.00 0.00 ? 105 GLN A OE1  4  
ATOM 5455  N NE2  . GLN A 1 68 ? -5.989  -3.717  -4.274  1.00 0.00 ? 105 GLN A NE2  4  
ATOM 5456  H H    . GLN A 1 68 ? -10.707 -3.406  -0.725  1.00 0.00 ? 105 GLN A H    4  
ATOM 5457  H HA   . GLN A 1 68 ? -9.248  -1.322  -2.203  1.00 0.00 ? 105 GLN A HA   4  
ATOM 5458  H HB2  . GLN A 1 68 ? -9.738  -4.209  -2.909  1.00 0.00 ? 105 GLN A HB2  4  
ATOM 5459  H HB3  . GLN A 1 68 ? -9.230  -3.021  -4.104  1.00 0.00 ? 105 GLN A HB3  4  
ATOM 5460  H HG2  . GLN A 1 68 ? -7.281  -2.516  -2.570  1.00 0.00 ? 105 GLN A HG2  4  
ATOM 5461  H HG3  . GLN A 1 68 ? -7.737  -3.969  -1.680  1.00 0.00 ? 105 GLN A HG3  4  
ATOM 5462  H HE21 . GLN A 1 68 ? -5.825  -2.768  -4.077  1.00 0.00 ? 105 GLN A HE21 4  
ATOM 5463  H HE22 . GLN A 1 68 ? -5.477  -4.229  -4.928  1.00 0.00 ? 105 GLN A HE22 4  
ATOM 5464  N N    . PRO A 1 69 ? -11.321 -0.423  -3.210  1.00 0.00 ? 106 PRO A N    4  
ATOM 5465  C CA   . PRO A 1 69 ? -12.521 0.158   -3.822  1.00 0.00 ? 106 PRO A CA   4  
ATOM 5466  C C    . PRO A 1 69 ? -12.696 -0.250  -5.279  1.00 0.00 ? 106 PRO A C    4  
ATOM 5467  O O    . PRO A 1 69 ? -13.818 -0.446  -5.741  1.00 0.00 ? 106 PRO A O    4  
ATOM 5468  C CB   . PRO A 1 69 ? -12.287 1.673   -3.725  1.00 0.00 ? 106 PRO A CB   4  
ATOM 5469  C CG   . PRO A 1 69 ? -11.173 1.843   -2.751  1.00 0.00 ? 106 PRO A CG   4  
ATOM 5470  C CD   . PRO A 1 69 ? -10.334 0.608   -2.874  1.00 0.00 ? 106 PRO A CD   4  
ATOM 5471  H HA   . PRO A 1 69 ? -13.411 -0.103  -3.268  1.00 0.00 ? 106 PRO A HA   4  
ATOM 5472  H HB2  . PRO A 1 69 ? -12.020 2.058   -4.699  1.00 0.00 ? 106 PRO A HB2  4  
ATOM 5473  H HB3  . PRO A 1 69 ? -13.188 2.156   -3.379  1.00 0.00 ? 106 PRO A HB3  4  
ATOM 5474  H HG2  . PRO A 1 69 ? -10.592 2.718   -3.004  1.00 0.00 ? 106 PRO A HG2  4  
ATOM 5475  H HG3  . PRO A 1 69 ? -11.567 1.929   -1.749  1.00 0.00 ? 106 PRO A HG3  4  
ATOM 5476  H HD2  . PRO A 1 69 ? -9.607  0.722   -3.666  1.00 0.00 ? 106 PRO A HD2  4  
ATOM 5477  H HD3  . PRO A 1 69 ? -9.845  0.386   -1.938  1.00 0.00 ? 106 PRO A HD3  4  
ATOM 5478  N N    . LYS A 1 70 ? -11.592 -0.297  -6.016  1.00 0.00 ? 107 LYS A N    4  
ATOM 5479  C CA   . LYS A 1 70 ? -11.643 -0.625  -7.437  1.00 0.00 ? 107 LYS A CA   4  
ATOM 5480  C C    . LYS A 1 70 ? -11.659 -2.136  -7.631  1.00 0.00 ? 107 LYS A C    4  
ATOM 5481  O O    . LYS A 1 70 ? -12.492 -2.668  -8.364  1.00 0.00 ? 107 LYS A O    4  
ATOM 5482  C CB   . LYS A 1 70 ? -10.456 -0.005  -8.181  1.00 0.00 ? 107 LYS A CB   4  
ATOM 5483  C CG   . LYS A 1 70 ? -10.385 1.510   -8.066  1.00 0.00 ? 107 LYS A CG   4  
ATOM 5484  C CD   . LYS A 1 70 ? -9.226  2.090   -8.870  1.00 0.00 ? 107 LYS A CD   4  
ATOM 5485  C CE   . LYS A 1 70 ? -9.652  2.506   -10.275 1.00 0.00 ? 107 LYS A CE   4  
ATOM 5486  N NZ   . LYS A 1 70 ? -10.050 1.346   -11.124 1.00 0.00 ? 107 LYS A NZ   4  
ATOM 5487  H H    . LYS A 1 70 ? -10.732 -0.083  -5.601  1.00 0.00 ? 107 LYS A H    4  
ATOM 5488  H HA   . LYS A 1 70 ? -12.559 -0.215  -7.838  1.00 0.00 ? 107 LYS A HA   4  
ATOM 5489  H HB2  . LYS A 1 70 ? -9.542  -0.417  -7.782  1.00 0.00 ? 107 LYS A HB2  4  
ATOM 5490  H HB3  . LYS A 1 70 ? -10.528 -0.261  -9.228  1.00 0.00 ? 107 LYS A HB3  4  
ATOM 5491  H HG2  . LYS A 1 70 ? -11.309 1.931   -8.436  1.00 0.00 ? 107 LYS A HG2  4  
ATOM 5492  H HG3  . LYS A 1 70 ? -10.258 1.775   -7.027  1.00 0.00 ? 107 LYS A HG3  4  
ATOM 5493  H HD2  . LYS A 1 70 ? -8.843  2.957   -8.354  1.00 0.00 ? 107 LYS A HD2  4  
ATOM 5494  H HD3  . LYS A 1 70 ? -8.448  1.343   -8.946  1.00 0.00 ? 107 LYS A HD3  4  
ATOM 5495  H HE2  . LYS A 1 70 ? -10.492 3.180   -10.196 1.00 0.00 ? 107 LYS A HE2  4  
ATOM 5496  H HE3  . LYS A 1 70 ? -8.827  3.019   -10.750 1.00 0.00 ? 107 LYS A HE3  4  
ATOM 5497  H HZ1  . LYS A 1 70 ? -9.474  0.510   -10.890 1.00 0.00 ? 107 LYS A HZ1  4  
ATOM 5498  H HZ2  . LYS A 1 70 ? -11.057 1.120   -10.971 1.00 0.00 ? 107 LYS A HZ2  4  
ATOM 5499  H HZ3  . LYS A 1 70 ? -9.910  1.578   -12.131 1.00 0.00 ? 107 LYS A HZ3  4  
ATOM 5500  N N    . GLY A 1 71 ? -10.769 -2.823  -6.934  1.00 0.00 ? 108 GLY A N    4  
ATOM 5501  C CA   . GLY A 1 71 ? -10.740 -4.265  -7.000  1.00 0.00 ? 108 GLY A CA   4  
ATOM 5502  C C    . GLY A 1 71 ? -9.345  -4.818  -6.818  1.00 0.00 ? 108 GLY A C    4  
ATOM 5503  O O    . GLY A 1 71 ? -8.441  -4.089  -6.400  1.00 0.00 ? 108 GLY A O    4  
ATOM 5504  H H    . GLY A 1 71 ? -10.154 -2.352  -6.338  1.00 0.00 ? 108 GLY A H    4  
ATOM 5505  H HA2  . GLY A 1 71 ? -11.378 -4.666  -6.224  1.00 0.00 ? 108 GLY A HA2  4  
ATOM 5506  H HA3  . GLY A 1 71 ? -11.116 -4.581  -7.962  1.00 0.00 ? 108 GLY A HA3  4  
ATOM 5507  N N    . PRO A 1 72 ? -9.138  -6.103  -7.143  1.00 0.00 ? 109 PRO A N    4  
ATOM 5508  C CA   . PRO A 1 72 ? -7.834  -6.758  -7.025  1.00 0.00 ? 109 PRO A CA   4  
ATOM 5509  C C    . PRO A 1 72 ? -6.750  -6.027  -7.804  1.00 0.00 ? 109 PRO A C    4  
ATOM 5510  O O    . PRO A 1 72 ? -6.939  -5.668  -8.970  1.00 0.00 ? 109 PRO A O    4  
ATOM 5511  C CB   . PRO A 1 72 ? -8.068  -8.145  -7.619  1.00 0.00 ? 109 PRO A CB   4  
ATOM 5512  C CG   . PRO A 1 72 ? -9.530  -8.370  -7.486  1.00 0.00 ? 109 PRO A CG   4  
ATOM 5513  C CD   . PRO A 1 72 ? -10.165 -7.022  -7.657  1.00 0.00 ? 109 PRO A CD   4  
ATOM 5514  H HA   . PRO A 1 72 ? -7.530  -6.851  -5.991  1.00 0.00 ? 109 PRO A HA   4  
ATOM 5515  H HB2  . PRO A 1 72 ? -7.760  -8.153  -8.654  1.00 0.00 ? 109 PRO A HB2  4  
ATOM 5516  H HB3  . PRO A 1 72 ? -7.501  -8.878  -7.063  1.00 0.00 ? 109 PRO A HB3  4  
ATOM 5517  H HG2  . PRO A 1 72 ? -9.871  -9.047  -8.256  1.00 0.00 ? 109 PRO A HG2  4  
ATOM 5518  H HG3  . PRO A 1 72 ? -9.754  -8.771  -6.509  1.00 0.00 ? 109 PRO A HG3  4  
ATOM 5519  H HD2  . PRO A 1 72 ? -10.368 -6.830  -8.699  1.00 0.00 ? 109 PRO A HD2  4  
ATOM 5520  H HD3  . PRO A 1 72 ? -11.071 -6.956  -7.074  1.00 0.00 ? 109 PRO A HD3  4  
ATOM 5521  N N    . ALA A 1 73 ? -5.630  -5.792  -7.129  1.00 0.00 ? 110 ALA A N    4  
ATOM 5522  C CA   . ALA A 1 73 ? -4.490  -5.077  -7.700  1.00 0.00 ? 110 ALA A CA   4  
ATOM 5523  C C    . ALA A 1 73 ? -4.872  -3.661  -8.126  1.00 0.00 ? 110 ALA A C    4  
ATOM 5524  O O    . ALA A 1 73 ? -4.213  -3.056  -8.975  1.00 0.00 ? 110 ALA A O    4  
ATOM 5525  C CB   . ALA A 1 73 ? -3.895  -5.853  -8.869  1.00 0.00 ? 110 ALA A CB   4  
ATOM 5526  H H    . ALA A 1 73 ? -5.566  -6.119  -6.209  1.00 0.00 ? 110 ALA A H    4  
ATOM 5527  H HA   . ALA A 1 73 ? -3.732  -5.009  -6.932  1.00 0.00 ? 110 ALA A HA   4  
ATOM 5528  H HB1  . ALA A 1 73 ? -3.689  -5.175  -9.684  1.00 0.00 ? 110 ALA A HB1  4  
ATOM 5529  H HB2  . ALA A 1 73 ? -2.976  -6.330  -8.556  1.00 0.00 ? 110 ALA A HB2  4  
ATOM 5530  H HB3  . ALA A 1 73 ? -4.599  -6.605  -9.195  1.00 0.00 ? 110 ALA A HB3  4  
ATOM 5531  N N    . GLY A 1 74 ? -5.903  -3.115  -7.493  1.00 0.00 ? 111 GLY A N    4  
ATOM 5532  C CA   . GLY A 1 74 ? -6.315  -1.761  -7.782  1.00 0.00 ? 111 GLY A CA   4  
ATOM 5533  C C    . GLY A 1 74 ? -6.046  -0.828  -6.621  1.00 0.00 ? 111 GLY A C    4  
ATOM 5534  O O    . GLY A 1 74 ? -5.124  -1.057  -5.832  1.00 0.00 ? 111 GLY A O    4  
ATOM 5535  H H    . GLY A 1 74 ? -6.379  -3.635  -6.809  1.00 0.00 ? 111 GLY A H    4  
ATOM 5536  H HA2  . GLY A 1 74 ? -5.776  -1.405  -8.650  1.00 0.00 ? 111 GLY A HA2  4  
ATOM 5537  H HA3  . GLY A 1 74 ? -7.374  -1.753  -7.999  1.00 0.00 ? 111 GLY A HA3  4  
ATOM 5538  N N    . ALA A 1 75 ? -6.875  0.199   -6.495  1.00 0.00 ? 112 ALA A N    4  
ATOM 5539  C CA   . ALA A 1 75 ? -6.742  1.169   -5.417  1.00 0.00 ? 112 ALA A CA   4  
ATOM 5540  C C    . ALA A 1 75 ? -6.973  0.527   -4.059  1.00 0.00 ? 112 ALA A C    4  
ATOM 5541  O O    . ALA A 1 75 ? -7.743  -0.425  -3.934  1.00 0.00 ? 112 ALA A O    4  
ATOM 5542  C CB   . ALA A 1 75 ? -7.710  2.324   -5.618  1.00 0.00 ? 112 ALA A CB   4  
ATOM 5543  H H    . ALA A 1 75 ? -7.603  0.300   -7.136  1.00 0.00 ? 112 ALA A H    4  
ATOM 5544  H HA   . ALA A 1 75 ? -5.738  1.567   -5.446  1.00 0.00 ? 112 ALA A HA   4  
ATOM 5545  H HB1  . ALA A 1 75 ? -7.393  2.916   -6.465  1.00 0.00 ? 112 ALA A HB1  4  
ATOM 5546  H HB2  . ALA A 1 75 ? -7.724  2.940   -4.731  1.00 0.00 ? 112 ALA A HB2  4  
ATOM 5547  H HB3  . ALA A 1 75 ? -8.701  1.934   -5.802  1.00 0.00 ? 112 ALA A HB3  4  
ATOM 5548  N N    . VAL A 1 76 ? -6.325  1.074   -3.045  1.00 0.00 ? 113 VAL A N    4  
ATOM 5549  C CA   . VAL A 1 76 ? -6.497  0.619   -1.676  1.00 0.00 ? 113 VAL A CA   4  
ATOM 5550  C C    . VAL A 1 76 ? -7.069  1.757   -0.839  1.00 0.00 ? 113 VAL A C    4  
ATOM 5551  O O    . VAL A 1 76 ? -6.900  2.920   -1.180  1.00 0.00 ? 113 VAL A O    4  
ATOM 5552  C CB   . VAL A 1 76 ? -5.161  0.138   -1.062  1.00 0.00 ? 113 VAL A CB   4  
ATOM 5553  C CG1  . VAL A 1 76 ? -5.367  -0.428  0.340   1.00 0.00 ? 113 VAL A CG1  4  
ATOM 5554  C CG2  . VAL A 1 76 ? -4.506  -0.898  -1.960  1.00 0.00 ? 113 VAL A CG2  4  
ATOM 5555  H H    . VAL A 1 76 ? -5.748  1.855   -3.214  1.00 0.00 ? 113 VAL A H    4  
ATOM 5556  H HA   . VAL A 1 76 ? -7.196  -0.206  -1.680  1.00 0.00 ? 113 VAL A HA   4  
ATOM 5557  H HB   . VAL A 1 76 ? -4.495  0.984   -0.988  1.00 0.00 ? 113 VAL A HB   4  
ATOM 5558  H HG11 . VAL A 1 76 ? -6.080  -1.238  0.300   1.00 0.00 ? 113 VAL A HG11 4  
ATOM 5559  H HG12 . VAL A 1 76 ? -4.426  -0.797  0.719   1.00 0.00 ? 113 VAL A HG12 4  
ATOM 5560  H HG13 . VAL A 1 76 ? -5.741  0.349   1.000   1.00 0.00 ? 113 VAL A HG13 4  
ATOM 5561  H HG21 . VAL A 1 76 ? -5.170  -1.137  -2.778  1.00 0.00 ? 113 VAL A HG21 4  
ATOM 5562  H HG22 . VAL A 1 76 ? -3.579  -0.507  -2.350  1.00 0.00 ? 113 VAL A HG22 4  
ATOM 5563  H HG23 . VAL A 1 76 ? -4.308  -1.793  -1.389  1.00 0.00 ? 113 VAL A HG23 4  
ATOM 5564  N N    . LYS A 1 77 ? -7.808  1.416   0.197   1.00 0.00 ? 114 LYS A N    4  
ATOM 5565  C CA   . LYS A 1 77 ? -8.439  2.395   1.065   1.00 0.00 ? 114 LYS A CA   4  
ATOM 5566  C C    . LYS A 1 77 ? -8.323  1.904   2.501   1.00 0.00 ? 114 LYS A C    4  
ATOM 5567  O O    . LYS A 1 77 ? -8.423  0.700   2.743   1.00 0.00 ? 114 LYS A O    4  
ATOM 5568  C CB   . LYS A 1 77 ? -9.914  2.562   0.664   1.00 0.00 ? 114 LYS A CB   4  
ATOM 5569  C CG   . LYS A 1 77 ? -10.561 3.857   1.136   1.00 0.00 ? 114 LYS A CG   4  
ATOM 5570  C CD   . LYS A 1 77 ? -10.915 3.832   2.615   1.00 0.00 ? 114 LYS A CD   4  
ATOM 5571  C CE   . LYS A 1 77 ? -12.011 2.823   2.913   1.00 0.00 ? 114 LYS A CE   4  
ATOM 5572  N NZ   . LYS A 1 77 ? -12.464 2.895   4.327   1.00 0.00 ? 114 LYS A NZ   4  
ATOM 5573  H H    . LYS A 1 77 ? -7.966  0.459   0.372   1.00 0.00 ? 114 LYS A H    4  
ATOM 5574  H HA   . LYS A 1 77 ? -7.919  3.336   0.962   1.00 0.00 ? 114 LYS A HA   4  
ATOM 5575  H HB2  . LYS A 1 77 ? -9.981  2.529   -0.414  1.00 0.00 ? 114 LYS A HB2  4  
ATOM 5576  H HB3  . LYS A 1 77 ? -10.476 1.736   1.072   1.00 0.00 ? 114 LYS A HB3  4  
ATOM 5577  H HG2  . LYS A 1 77 ? -9.876  4.671   0.959   1.00 0.00 ? 114 LYS A HG2  4  
ATOM 5578  H HG3  . LYS A 1 77 ? -11.464 4.021   0.565   1.00 0.00 ? 114 LYS A HG3  4  
ATOM 5579  H HD2  . LYS A 1 77 ? -10.033 3.566   3.180   1.00 0.00 ? 114 LYS A HD2  4  
ATOM 5580  H HD3  . LYS A 1 77 ? -11.250 4.814   2.912   1.00 0.00 ? 114 LYS A HD3  4  
ATOM 5581  H HE2  . LYS A 1 77 ? -12.851 3.024   2.263   1.00 0.00 ? 114 LYS A HE2  4  
ATOM 5582  H HE3  . LYS A 1 77 ? -11.633 1.831   2.713   1.00 0.00 ? 114 LYS A HE3  4  
ATOM 5583  H HZ1  . LYS A 1 77 ? -12.492 3.889   4.644   1.00 0.00 ? 114 LYS A HZ1  4  
ATOM 5584  H HZ2  . LYS A 1 77 ? -13.421 2.486   4.418   1.00 0.00 ? 114 LYS A HZ2  4  
ATOM 5585  H HZ3  . LYS A 1 77 ? -11.811 2.364   4.940   1.00 0.00 ? 114 LYS A HZ3  4  
ATOM 5586  N N    . LEU A 1 78 ? -7.998  2.803   3.430   1.00 0.00 ? 115 LEU A N    4  
ATOM 5587  C CA   . LEU A 1 78 ? -7.797  2.403   4.821   1.00 0.00 ? 115 LEU A CA   4  
ATOM 5588  C C    . LEU A 1 78 ? -9.032  1.705   5.367   1.00 0.00 ? 115 LEU A C    4  
ATOM 5589  O O    . LEU A 1 78 ? -10.092 2.322   5.493   1.00 0.00 ? 115 LEU A O    4  
ATOM 5590  C CB   . LEU A 1 78 ? -7.508  3.605   5.737   1.00 0.00 ? 115 LEU A CB   4  
ATOM 5591  C CG   . LEU A 1 78 ? -6.094  4.174   5.708   1.00 0.00 ? 115 LEU A CG   4  
ATOM 5592  C CD1  . LEU A 1 78 ? -5.062  3.057   5.765   1.00 0.00 ? 115 LEU A CD1  4  
ATOM 5593  C CD2  . LEU A 1 78 ? -5.905  5.059   4.496   1.00 0.00 ? 115 LEU A CD2  4  
ATOM 5594  H H    . LEU A 1 78 ? -7.827  3.732   3.164   1.00 0.00 ? 115 LEU A H    4  
ATOM 5595  H HA   . LEU A 1 78 ? -6.956  1.720   4.843   1.00 0.00 ? 115 LEU A HA   4  
ATOM 5596  H HB2  . LEU A 1 78 ? -8.188  4.399   5.468   1.00 0.00 ? 115 LEU A HB2  4  
ATOM 5597  H HB3  . LEU A 1 78 ? -7.721  3.309   6.751   1.00 0.00 ? 115 LEU A HB3  4  
ATOM 5598  H HG   . LEU A 1 78 ? -5.953  4.787   6.583   1.00 0.00 ? 115 LEU A HG   4  
ATOM 5599  H HD11 . LEU A 1 78 ? -5.527  2.159   6.148   1.00 0.00 ? 115 LEU A HD11 4  
ATOM 5600  H HD12 . LEU A 1 78 ? -4.676  2.866   4.771   1.00 0.00 ? 115 LEU A HD12 4  
ATOM 5601  H HD13 . LEU A 1 78 ? -4.252  3.348   6.417   1.00 0.00 ? 115 LEU A HD13 4  
ATOM 5602  H HD21 . LEU A 1 78 ? -6.300  4.563   3.623   1.00 0.00 ? 115 LEU A HD21 4  
ATOM 5603  H HD22 . LEU A 1 78 ? -6.427  5.991   4.648   1.00 0.00 ? 115 LEU A HD22 4  
ATOM 5604  H HD23 . LEU A 1 78 ? -4.852  5.255   4.352   1.00 0.00 ? 115 LEU A HD23 4  
ATOM 5605  N N    . ALA A 1 79 ? -8.869  0.476   5.817   1.00 0.00 ? 116 ALA A N    4  
ATOM 5606  C CA   . ALA A 1 79 ? -9.953  -0.202  6.505   1.00 0.00 ? 116 ALA A CA   4  
ATOM 5607  C C    . ALA A 1 79 ? -9.877  0.070   7.993   1.00 0.00 ? 116 ALA A C    4  
ATOM 5608  O O    . ALA A 1 79 ? -8.881  -0.238  8.646   1.00 0.00 ? 116 ALA A O    4  
ATOM 5609  C CB   . ALA A 1 79 ? -9.941  -1.695  6.250   1.00 0.00 ? 116 ALA A CB   4  
ATOM 5610  H H    . ALA A 1 79 ? -7.976  0.064   5.786   1.00 0.00 ? 116 ALA A H    4  
ATOM 5611  H HA   . ALA A 1 79 ? -10.883 0.196   6.126   1.00 0.00 ? 116 ALA A HA   4  
ATOM 5612  H HB1  . ALA A 1 79 ? -9.763  -1.883  5.201   1.00 0.00 ? 116 ALA A HB1  4  
ATOM 5613  H HB2  . ALA A 1 79 ? -10.899 -2.108  6.533   1.00 0.00 ? 116 ALA A HB2  4  
ATOM 5614  H HB3  . ALA A 1 79 ? -9.163  -2.158  6.838   1.00 0.00 ? 116 ALA A HB3  4  
ATOM 5615  N N    . LYS A 1 80 ? -10.943 0.629   8.521   1.00 0.00 ? 117 LYS A N    4  
ATOM 5616  C CA   . LYS A 1 80 ? -11.035 0.899   9.948   1.00 0.00 ? 117 LYS A CA   4  
ATOM 5617  C C    . LYS A 1 80 ? -11.488 -0.353  10.679  1.00 0.00 ? 117 LYS A C    4  
ATOM 5618  O O    . LYS A 1 80 ? -11.130 -0.582  11.837  1.00 0.00 ? 117 LYS A O    4  
ATOM 5619  C CB   . LYS A 1 80 ? -11.997 2.055   10.220  1.00 0.00 ? 117 LYS A CB   4  
ATOM 5620  C CG   . LYS A 1 80 ? -11.608 3.342   9.509   1.00 0.00 ? 117 LYS A CG   4  
ATOM 5621  C CD   . LYS A 1 80 ? -12.403 4.530   10.021  1.00 0.00 ? 117 LYS A CD   4  
ATOM 5622  C CE   . LYS A 1 80 ? -12.089 4.817   11.482  1.00 0.00 ? 117 LYS A CE   4  
ATOM 5623  N NZ   . LYS A 1 80 ? -12.780 6.035   11.974  1.00 0.00 ? 117 LYS A NZ   4  
ATOM 5624  H H    . LYS A 1 80 ? -11.708 0.830   7.937   1.00 0.00 ? 117 LYS A H    4  
ATOM 5625  H HA   . LYS A 1 80 ? -10.050 1.170   10.298  1.00 0.00 ? 117 LYS A HA   4  
ATOM 5626  H HB2  . LYS A 1 80 ? -12.985 1.770   9.891   1.00 0.00 ? 117 LYS A HB2  4  
ATOM 5627  H HB3  . LYS A 1 80 ? -12.023 2.249   11.282  1.00 0.00 ? 117 LYS A HB3  4  
ATOM 5628  H HG2  . LYS A 1 80 ? -10.558 3.529   9.673   1.00 0.00 ? 117 LYS A HG2  4  
ATOM 5629  H HG3  . LYS A 1 80 ? -11.792 3.227   8.450   1.00 0.00 ? 117 LYS A HG3  4  
ATOM 5630  H HD2  . LYS A 1 80 ? -12.153 5.401   9.431   1.00 0.00 ? 117 LYS A HD2  4  
ATOM 5631  H HD3  . LYS A 1 80 ? -13.458 4.315   9.921   1.00 0.00 ? 117 LYS A HD3  4  
ATOM 5632  H HE2  . LYS A 1 80 ? -12.405 3.973   12.077  1.00 0.00 ? 117 LYS A HE2  4  
ATOM 5633  H HE3  . LYS A 1 80 ? -11.022 4.952   11.586  1.00 0.00 ? 117 LYS A HE3  4  
ATOM 5634  H HZ1  . LYS A 1 80 ? -13.673 6.175   11.457  1.00 0.00 ? 117 LYS A HZ1  4  
ATOM 5635  H HZ2  . LYS A 1 80 ? -12.989 5.940   12.993  1.00 0.00 ? 117 LYS A HZ2  4  
ATOM 5636  H HZ3  . LYS A 1 80 ? -12.171 6.872   11.831  1.00 0.00 ? 117 LYS A HZ3  4  
ATOM 5637  N N    . LYS A 1 81 ? -12.249 -1.171  9.968   1.00 0.00 ? 118 LYS A N    4  
ATOM 5638  C CA   . LYS A 1 81 ? -12.735 -2.439  10.487  1.00 0.00 ? 118 LYS A CA   4  
ATOM 5639  C C    . LYS A 1 81 ? -11.593 -3.449  10.590  1.00 0.00 ? 118 LYS A C    4  
ATOM 5640  O O    . LYS A 1 81 ? -10.793 -3.583  9.668   1.00 0.00 ? 118 LYS A O    4  
ATOM 5641  C CB   . LYS A 1 81 ? -13.840 -2.980  9.569   1.00 0.00 ? 118 LYS A CB   4  
ATOM 5642  C CG   . LYS A 1 81 ? -13.390 -3.180  8.127   1.00 0.00 ? 118 LYS A CG   4  
ATOM 5643  C CD   . LYS A 1 81 ? -14.540 -3.579  7.212   1.00 0.00 ? 118 LYS A CD   4  
ATOM 5644  C CE   . LYS A 1 81 ? -15.533 -2.442  7.028   1.00 0.00 ? 118 LYS A CE   4  
ATOM 5645  N NZ   . LYS A 1 81 ? -16.605 -2.783  6.054   1.00 0.00 ? 118 LYS A NZ   4  
ATOM 5646  H H    . LYS A 1 81 ? -12.458 -0.931  9.042   1.00 0.00 ? 118 LYS A H    4  
ATOM 5647  H HA   . LYS A 1 81 ? -13.145 -2.266  11.471  1.00 0.00 ? 118 LYS A HA   4  
ATOM 5648  H HB2  . LYS A 1 81 ? -14.178 -3.931  9.955   1.00 0.00 ? 118 LYS A HB2  4  
ATOM 5649  H HB3  . LYS A 1 81 ? -14.668 -2.285  9.572   1.00 0.00 ? 118 LYS A HB3  4  
ATOM 5650  H HG2  . LYS A 1 81 ? -12.963 -2.258  7.766   1.00 0.00 ? 118 LYS A HG2  4  
ATOM 5651  H HG3  . LYS A 1 81 ? -12.640 -3.957  8.103   1.00 0.00 ? 118 LYS A HG3  4  
ATOM 5652  H HD2  . LYS A 1 81 ? -14.139 -3.851  6.248   1.00 0.00 ? 118 LYS A HD2  4  
ATOM 5653  H HD3  . LYS A 1 81 ? -15.053 -4.427  7.643   1.00 0.00 ? 118 LYS A HD3  4  
ATOM 5654  H HE2  . LYS A 1 81 ? -15.986 -2.219  7.983   1.00 0.00 ? 118 LYS A HE2  4  
ATOM 5655  H HE3  . LYS A 1 81 ? -15.001 -1.571  6.674   1.00 0.00 ? 118 LYS A HE3  4  
ATOM 5656  H HZ1  . LYS A 1 81 ? -16.233 -3.406  5.309   1.00 0.00 ? 118 LYS A HZ1  4  
ATOM 5657  H HZ2  . LYS A 1 81 ? -17.391 -3.271  6.539   1.00 0.00 ? 118 LYS A HZ2  4  
ATOM 5658  H HZ3  . LYS A 1 81 ? -16.974 -1.914  5.611   1.00 0.00 ? 118 LYS A HZ3  4  
ATOM 5659  N N    . LYS A 1 82 ? -11.521 -4.155  11.712  1.00 0.00 ? 119 LYS A N    4  
ATOM 5660  C CA   . LYS A 1 82 ? -10.474 -5.154  11.926  1.00 0.00 ? 119 LYS A CA   4  
ATOM 5661  C C    . LYS A 1 82 ? -10.938 -6.538  11.476  1.00 0.00 ? 119 LYS A C    4  
ATOM 5662  O O    . LYS A 1 82 ? -10.686 -7.539  12.148  1.00 0.00 ? 119 LYS A O    4  
ATOM 5663  C CB   . LYS A 1 82 ? -10.050 -5.198  13.402  1.00 0.00 ? 119 LYS A CB   4  
ATOM 5664  C CG   . LYS A 1 82 ? -9.048  -4.120  13.796  1.00 0.00 ? 119 LYS A CG   4  
ATOM 5665  C CD   . LYS A 1 82 ? -9.646  -2.726  13.695  1.00 0.00 ? 119 LYS A CD   4  
ATOM 5666  C CE   . LYS A 1 82 ? -8.626  -1.652  14.033  1.00 0.00 ? 119 LYS A CE   4  
ATOM 5667  N NZ   . LYS A 1 82 ? -9.191  -0.285  13.880  1.00 0.00 ? 119 LYS A NZ   4  
ATOM 5668  H H    . LYS A 1 82 ? -12.194 -4.007  12.415  1.00 0.00 ? 119 LYS A H    4  
ATOM 5669  H HA   . LYS A 1 82 ? -9.623  -4.867  11.327  1.00 0.00 ? 119 LYS A HA   4  
ATOM 5670  H HB2  . LYS A 1 82 ? -10.927 -5.085  14.019  1.00 0.00 ? 119 LYS A HB2  4  
ATOM 5671  H HB3  . LYS A 1 82 ? -9.604  -6.161  13.604  1.00 0.00 ? 119 LYS A HB3  4  
ATOM 5672  H HG2  . LYS A 1 82 ? -8.731  -4.291  14.813  1.00 0.00 ? 119 LYS A HG2  4  
ATOM 5673  H HG3  . LYS A 1 82 ? -8.193  -4.183  13.137  1.00 0.00 ? 119 LYS A HG3  4  
ATOM 5674  H HD2  . LYS A 1 82 ? -9.995  -2.569  12.685  1.00 0.00 ? 119 LYS A HD2  4  
ATOM 5675  H HD3  . LYS A 1 82 ? -10.477 -2.650  14.379  1.00 0.00 ? 119 LYS A HD3  4  
ATOM 5676  H HE2  . LYS A 1 82 ? -8.304  -1.787  15.056  1.00 0.00 ? 119 LYS A HE2  4  
ATOM 5677  H HE3  . LYS A 1 82 ? -7.779  -1.758  13.373  1.00 0.00 ? 119 LYS A HE3  4  
ATOM 5678  H HZ1  . LYS A 1 82 ? -9.931  -0.282  13.145  1.00 0.00 ? 119 LYS A HZ1  4  
ATOM 5679  H HZ2  . LYS A 1 82 ? -9.608  0.036   14.783  1.00 0.00 ? 119 LYS A HZ2  4  
ATOM 5680  H HZ3  . LYS A 1 82 ? -8.439  0.386   13.603  1.00 0.00 ? 119 LYS A HZ3  4  
ATOM 5681  N N    . SER A 1 83 ? -11.616 -6.586  10.340  1.00 0.00 ? 120 SER A N    4  
ATOM 5682  C CA   . SER A 1 83 ? -12.131 -7.833  9.791   1.00 0.00 ? 120 SER A CA   4  
ATOM 5683  C C    . SER A 1 83 ? -12.454 -7.656  8.313   1.00 0.00 ? 120 SER A C    4  
ATOM 5684  O O    . SER A 1 83 ? -12.804 -6.554  7.885   1.00 0.00 ? 120 SER A O    4  
ATOM 5685  C CB   . SER A 1 83 ? -13.392 -8.272  10.545  1.00 0.00 ? 120 SER A CB   4  
ATOM 5686  O OG   . SER A 1 83 ? -13.101 -8.576  11.901  1.00 0.00 ? 120 SER A OG   4  
ATOM 5687  H H    . SER A 1 83 ? -11.778 -5.752  9.847   1.00 0.00 ? 120 SER A H    4  
ATOM 5688  H HA   . SER A 1 83 ? -11.367 -8.588  9.899   1.00 0.00 ? 120 SER A HA   4  
ATOM 5689  H HB2  . SER A 1 83 ? -14.120 -7.475  10.516  1.00 0.00 ? 120 SER A HB2  4  
ATOM 5690  H HB3  . SER A 1 83 ? -13.802 -9.151  10.069  1.00 0.00 ? 120 SER A HB3  4  
ATOM 5691  H HG   . SER A 1 83 ? -12.177 -8.341  12.091  1.00 0.00 ? 120 SER A HG   4  
ATOM 5692  N N    . PRO A 1 84 ? -12.328 -8.724  7.511   1.00 0.00 ? 121 PRO A N    4  
ATOM 5693  C CA   . PRO A 1 84 ? -12.647 -8.670  6.087   1.00 0.00 ? 121 PRO A CA   4  
ATOM 5694  C C    . PRO A 1 84 ? -14.110 -8.324  5.864   1.00 0.00 ? 121 PRO A C    4  
ATOM 5695  O O    . PRO A 1 84 ? -14.999 -8.951  6.447   1.00 0.00 ? 121 PRO A O    4  
ATOM 5696  C CB   . PRO A 1 84 ? -12.354 -10.083 5.582   1.00 0.00 ? 121 PRO A CB   4  
ATOM 5697  C CG   . PRO A 1 84 ? -12.385 -10.940 6.802   1.00 0.00 ? 121 PRO A CG   4  
ATOM 5698  C CD   . PRO A 1 84 ? -11.906 -10.069 7.929   1.00 0.00 ? 121 PRO A CD   4  
ATOM 5699  H HA   . PRO A 1 84 ? -12.024 -7.957  5.566   1.00 0.00 ? 121 PRO A HA   4  
ATOM 5700  H HB2  . PRO A 1 84 ? -13.115 -10.372 4.874   1.00 0.00 ? 121 PRO A HB2  4  
ATOM 5701  H HB3  . PRO A 1 84 ? -11.385 -10.108 5.111   1.00 0.00 ? 121 PRO A HB3  4  
ATOM 5702  H HG2  . PRO A 1 84 ? -13.395 -11.277 6.988   1.00 0.00 ? 121 PRO A HG2  4  
ATOM 5703  H HG3  . PRO A 1 84 ? -11.724 -11.781 6.672   1.00 0.00 ? 121 PRO A HG3  4  
ATOM 5704  H HD2  . PRO A 1 84 ? -12.382 -10.352 8.857   1.00 0.00 ? 121 PRO A HD2  4  
ATOM 5705  H HD3  . PRO A 1 84 ? -10.830 -10.124 8.020   1.00 0.00 ? 121 PRO A HD3  4  
ATOM 5706  N N    . GLU A 1 85 ? -14.348 -7.297  5.071   1.00 0.00 ? 122 GLU A N    4  
ATOM 5707  C CA   . GLU A 1 85 ? -15.697 -6.818  4.820   1.00 0.00 ? 122 GLU A CA   4  
ATOM 5708  C C    . GLU A 1 85 ? -15.670 -5.712  3.770   1.00 0.00 ? 122 GLU A C    4  
ATOM 5709  O O    . GLU A 1 85 ? -16.115 -4.588  4.011   1.00 0.00 ? 122 GLU A O    4  
ATOM 5710  C CB   . GLU A 1 85 ? -16.331 -6.302  6.119   1.00 0.00 ? 122 GLU A CB   4  
ATOM 5711  C CG   . GLU A 1 85 ? -17.825 -6.052  6.018   1.00 0.00 ? 122 GLU A CG   4  
ATOM 5712  C CD   . GLU A 1 85 ? -18.367 -5.314  7.221   1.00 0.00 ? 122 GLU A CD   4  
ATOM 5713  O OE1  . GLU A 1 85 ? -18.389 -5.907  8.319   1.00 0.00 ? 122 GLU A OE1  4  
ATOM 5714  O OE2  . GLU A 1 85 ? -18.792 -4.151  7.078   1.00 0.00 ? 122 GLU A OE2  4  
ATOM 5715  H H    . GLU A 1 85 ? -13.592 -6.832  4.661   1.00 0.00 ? 122 GLU A H    4  
ATOM 5716  H HA   . GLU A 1 85 ? -16.279 -7.647  4.445   1.00 0.00 ? 122 GLU A HA   4  
ATOM 5717  H HB2  . GLU A 1 85 ? -16.163 -7.029  6.899   1.00 0.00 ? 122 GLU A HB2  4  
ATOM 5718  H HB3  . GLU A 1 85 ? -15.850 -5.375  6.394   1.00 0.00 ? 122 GLU A HB3  4  
ATOM 5719  H HG2  . GLU A 1 85 ? -18.020 -5.462  5.135   1.00 0.00 ? 122 GLU A HG2  4  
ATOM 5720  H HG3  . GLU A 1 85 ? -18.333 -7.001  5.936   1.00 0.00 ? 122 GLU A HG3  4  
ATOM 5721  N N    . VAL A 1 86 ? -15.140 -6.036  2.604   1.00 0.00 ? 123 VAL A N    4  
ATOM 5722  C CA   . VAL A 1 86 ? -15.096 -5.091  1.505   1.00 0.00 ? 123 VAL A CA   4  
ATOM 5723  C C    . VAL A 1 86 ? -16.330 -5.288  0.641   1.00 0.00 ? 123 VAL A C    4  
ATOM 5724  O O    . VAL A 1 86 ? -16.715 -6.426  0.362   1.00 0.00 ? 123 VAL A O    4  
ATOM 5725  C CB   . VAL A 1 86 ? -13.829 -5.274  0.645   1.00 0.00 ? 123 VAL A CB   4  
ATOM 5726  C CG1  . VAL A 1 86 ? -13.745 -4.201  -0.433  1.00 0.00 ? 123 VAL A CG1  4  
ATOM 5727  C CG2  . VAL A 1 86 ? -12.582 -5.263  1.515   1.00 0.00 ? 123 VAL A CG2  4  
ATOM 5728  H H    . VAL A 1 86 ? -14.801 -6.952  2.465   1.00 0.00 ? 123 VAL A H    4  
ATOM 5729  H HA   . VAL A 1 86 ? -15.101 -4.090  1.914   1.00 0.00 ? 123 VAL A HA   4  
ATOM 5730  H HB   . VAL A 1 86 ? -13.891 -6.234  0.156   1.00 0.00 ? 123 VAL A HB   4  
ATOM 5731  H HG11 . VAL A 1 86 ? -13.793 -3.225  0.027   1.00 0.00 ? 123 VAL A HG11 4  
ATOM 5732  H HG12 . VAL A 1 86 ? -12.812 -4.302  -0.968  1.00 0.00 ? 123 VAL A HG12 4  
ATOM 5733  H HG13 . VAL A 1 86 ? -14.568 -4.317  -1.120  1.00 0.00 ? 123 VAL A HG13 4  
ATOM 5734  H HG21 . VAL A 1 86 ? -12.619 -4.419  2.187   1.00 0.00 ? 123 VAL A HG21 4  
ATOM 5735  H HG22 . VAL A 1 86 ? -12.534 -6.176  2.088   1.00 0.00 ? 123 VAL A HG22 4  
ATOM 5736  H HG23 . VAL A 1 86 ? -11.705 -5.185  0.888   1.00 0.00 ? 123 VAL A HG23 4  
ATOM 5737  N N    . LYS A 1 87 ? -17.032 -4.203  0.355   1.00 0.00 ? 124 LYS A N    4  
ATOM 5738  C CA   . LYS A 1 87 ? -18.304 -4.290  -0.350  1.00 0.00 ? 124 LYS A CA   4  
ATOM 5739  C C    . LYS A 1 87 ? -18.659 -2.965  -1.011  1.00 0.00 ? 124 LYS A C    4  
ATOM 5740  O O    . LYS A 1 87 ? -19.808 -2.519  -0.977  1.00 0.00 ? 124 LYS A O    4  
ATOM 5741  C CB   . LYS A 1 87 ? -19.415 -4.723  0.612   1.00 0.00 ? 124 LYS A CB   4  
ATOM 5742  C CG   . LYS A 1 87 ? -19.534 -3.862  1.866   1.00 0.00 ? 124 LYS A CG   4  
ATOM 5743  C CD   . LYS A 1 87 ? -20.545 -4.428  2.862   1.00 0.00 ? 124 LYS A CD   4  
ATOM 5744  C CE   . LYS A 1 87 ? -21.987 -4.286  2.383   1.00 0.00 ? 124 LYS A CE   4  
ATOM 5745  N NZ   . LYS A 1 87 ? -22.318 -5.217  1.269   1.00 0.00 ? 124 LYS A NZ   4  
ATOM 5746  H H    . LYS A 1 87 ? -16.731 -3.331  0.705   1.00 0.00 ? 124 LYS A H    4  
ATOM 5747  H HA   . LYS A 1 87 ? -18.202 -5.040  -1.119  1.00 0.00 ? 124 LYS A HA   4  
ATOM 5748  H HB2  . LYS A 1 87 ? -20.361 -4.686  0.091   1.00 0.00 ? 124 LYS A HB2  4  
ATOM 5749  H HB3  . LYS A 1 87 ? -19.227 -5.741  0.920   1.00 0.00 ? 124 LYS A HB3  4  
ATOM 5750  H HG2  . LYS A 1 87 ? -18.568 -3.808  2.345   1.00 0.00 ? 124 LYS A HG2  4  
ATOM 5751  H HG3  . LYS A 1 87 ? -19.847 -2.869  1.576   1.00 0.00 ? 124 LYS A HG3  4  
ATOM 5752  H HD2  . LYS A 1 87 ? -20.333 -5.474  3.011   1.00 0.00 ? 124 LYS A HD2  4  
ATOM 5753  H HD3  . LYS A 1 87 ? -20.436 -3.903  3.800   1.00 0.00 ? 124 LYS A HD3  4  
ATOM 5754  H HE2  . LYS A 1 87 ? -22.648 -4.488  3.211   1.00 0.00 ? 124 LYS A HE2  4  
ATOM 5755  H HE3  . LYS A 1 87 ? -22.140 -3.270  2.046   1.00 0.00 ? 124 LYS A HE3  4  
ATOM 5756  H HZ1  . LYS A 1 87 ? -21.685 -6.045  1.287   1.00 0.00 ? 124 LYS A HZ1  4  
ATOM 5757  H HZ2  . LYS A 1 87 ? -23.306 -5.548  1.356   1.00 0.00 ? 124 LYS A HZ2  4  
ATOM 5758  H HZ3  . LYS A 1 87 ? -22.211 -4.732  0.352   1.00 0.00 ? 124 LYS A HZ3  4  
ATOM 5759  N N    . LYS A 1 88 ? -17.680 -2.379  -1.678  1.00 0.00 ? 125 LYS A N    4  
ATOM 5760  C CA   . LYS A 1 88 ? -17.898 -1.153  -2.431  1.00 0.00 ? 125 LYS A CA   4  
ATOM 5761  C C    . LYS A 1 88 ? -18.434 -1.487  -3.816  1.00 0.00 ? 125 LYS A C    4  
ATOM 5762  O O    . LYS A 1 88 ? -18.139 -2.558  -4.351  1.00 0.00 ? 125 LYS A O    4  
ATOM 5763  C CB   . LYS A 1 88 ? -16.607 -0.342  -2.527  1.00 0.00 ? 125 LYS A CB   4  
ATOM 5764  C CG   . LYS A 1 88 ? -15.966 -0.094  -1.174  1.00 0.00 ? 125 LYS A CG   4  
ATOM 5765  C CD   . LYS A 1 88 ? -14.838 0.914   -1.263  1.00 0.00 ? 125 LYS A CD   4  
ATOM 5766  C CE   . LYS A 1 88 ? -14.072 1.010   0.047   1.00 0.00 ? 125 LYS A CE   4  
ATOM 5767  N NZ   . LYS A 1 88 ? -14.947 1.370   1.196   1.00 0.00 ? 125 LYS A NZ   4  
ATOM 5768  H H    . LYS A 1 88 ? -16.807 -2.822  -1.730  1.00 0.00 ? 125 LYS A H    4  
ATOM 5769  H HA   . LYS A 1 88 ? -18.640 -0.572  -1.904  1.00 0.00 ? 125 LYS A HA   4  
ATOM 5770  H HB2  . LYS A 1 88 ? -15.902 -0.876  -3.148  1.00 0.00 ? 125 LYS A HB2  4  
ATOM 5771  H HB3  . LYS A 1 88 ? -16.826 0.612   -2.980  1.00 0.00 ? 125 LYS A HB3  4  
ATOM 5772  H HG2  . LYS A 1 88 ? -16.717 0.282   -0.496  1.00 0.00 ? 125 LYS A HG2  4  
ATOM 5773  H HG3  . LYS A 1 88 ? -15.574 -1.026  -0.796  1.00 0.00 ? 125 LYS A HG3  4  
ATOM 5774  H HD2  . LYS A 1 88 ? -14.158 0.610   -2.045  1.00 0.00 ? 125 LYS A HD2  4  
ATOM 5775  H HD3  . LYS A 1 88 ? -15.254 1.881   -1.499  1.00 0.00 ? 125 LYS A HD3  4  
ATOM 5776  H HE2  . LYS A 1 88 ? -13.611 0.055   0.249   1.00 0.00 ? 125 LYS A HE2  4  
ATOM 5777  H HE3  . LYS A 1 88 ? -13.304 1.762   -0.057  1.00 0.00 ? 125 LYS A HE3  4  
ATOM 5778  H HZ1  . LYS A 1 88 ? -15.947 1.174   0.972   1.00 0.00 ? 125 LYS A HZ1  4  
ATOM 5779  H HZ2  . LYS A 1 88 ? -14.675 0.812   2.037   1.00 0.00 ? 125 LYS A HZ2  4  
ATOM 5780  H HZ3  . LYS A 1 88 ? -14.844 2.384   1.419   1.00 0.00 ? 125 LYS A HZ3  4  
ATOM 5781  N N    . GLU A 1 89 ? -19.339 -0.645  -4.315  1.00 0.00 ? 126 GLU A N    4  
ATOM 5782  C CA   . GLU A 1 89 ? -20.045 -0.918  -5.566  1.00 0.00 ? 126 GLU A CA   4  
ATOM 5783  C C    . GLU A 1 89 ? -20.908 -2.168  -5.414  1.00 0.00 ? 126 GLU A C    4  
ATOM 5784  O O    . GLU A 1 89 ? -21.694 -2.268  -4.471  1.00 0.00 ? 126 GLU A O    4  
ATOM 5785  C CB   . GLU A 1 89 ? -19.063 -1.075  -6.733  1.00 0.00 ? 126 GLU A CB   4  
ATOM 5786  C CG   . GLU A 1 89 ? -18.461 0.230   -7.221  1.00 0.00 ? 126 GLU A CG   4  
ATOM 5787  C CD   . GLU A 1 89 ? -19.486 1.129   -7.884  1.00 0.00 ? 126 GLU A CD   4  
ATOM 5788  O OE1  . GLU A 1 89 ? -20.297 1.754   -7.169  1.00 0.00 ? 126 GLU A OE1  4  
ATOM 5789  O OE2  . GLU A 1 89 ? -19.507 1.187   -9.128  1.00 0.00 ? 126 GLU A OE2  4  
ATOM 5790  H H    . GLU A 1 89 ? -19.623 0.121   -3.768  1.00 0.00 ? 126 GLU A H    4  
ATOM 5791  H HA   . GLU A 1 89 ? -20.692 -0.076  -5.765  1.00 0.00 ? 126 GLU A HA   4  
ATOM 5792  H HB2  . GLU A 1 89 ? -18.255 -1.721  -6.421  1.00 0.00 ? 126 GLU A HB2  4  
ATOM 5793  H HB3  . GLU A 1 89 ? -19.580 -1.540  -7.559  1.00 0.00 ? 126 GLU A HB3  4  
ATOM 5794  H HG2  . GLU A 1 89 ? -18.037 0.755   -6.377  1.00 0.00 ? 126 GLU A HG2  4  
ATOM 5795  H HG3  . GLU A 1 89 ? -17.683 0.009   -7.935  1.00 0.00 ? 126 GLU A HG3  4  
ATOM 5796  N N    . LYS A 1 90 ? -20.740 -3.132  -6.311  1.00 0.00 ? 127 LYS A N    4  
ATOM 5797  C CA   . LYS A 1 90 ? -21.483 -4.376  -6.232  1.00 0.00 ? 127 LYS A CA   4  
ATOM 5798  C C    . LYS A 1 90 ? -20.974 -5.245  -5.087  1.00 0.00 ? 127 LYS A C    4  
ATOM 5799  O O    . LYS A 1 90 ? -21.753 -5.893  -4.384  1.00 0.00 ? 127 LYS A O    4  
ATOM 5800  C CB   . LYS A 1 90 ? -21.395 -5.157  -7.549  1.00 0.00 ? 127 LYS A CB   4  
ATOM 5801  C CG   . LYS A 1 90 ? -22.272 -4.610  -8.668  1.00 0.00 ? 127 LYS A CG   4  
ATOM 5802  C CD   . LYS A 1 90 ? -21.667 -3.383  -9.333  1.00 0.00 ? 127 LYS A CD   4  
ATOM 5803  C CE   . LYS A 1 90 ? -22.524 -2.919  -10.501 1.00 0.00 ? 127 LYS A CE   4  
ATOM 5804  N NZ   . LYS A 1 90 ? -21.914 -1.778  -11.231 1.00 0.00 ? 127 LYS A NZ   4  
ATOM 5805  H H    . LYS A 1 90 ? -20.081 -3.017  -7.025  1.00 0.00 ? 127 LYS A H    4  
ATOM 5806  H HA   . LYS A 1 90 ? -22.510 -4.123  -6.046  1.00 0.00 ? 127 LYS A HA   4  
ATOM 5807  H HB2  . LYS A 1 90 ? -20.370 -5.140  -7.891  1.00 0.00 ? 127 LYS A HB2  4  
ATOM 5808  H HB3  . LYS A 1 90 ? -21.684 -6.181  -7.364  1.00 0.00 ? 127 LYS A HB3  4  
ATOM 5809  H HG2  . LYS A 1 90 ? -22.400 -5.378  -9.416  1.00 0.00 ? 127 LYS A HG2  4  
ATOM 5810  H HG3  . LYS A 1 90 ? -23.235 -4.347  -8.257  1.00 0.00 ? 127 LYS A HG3  4  
ATOM 5811  H HD2  . LYS A 1 90 ? -21.602 -2.587  -8.607  1.00 0.00 ? 127 LYS A HD2  4  
ATOM 5812  H HD3  . LYS A 1 90 ? -20.680 -3.627  -9.694  1.00 0.00 ? 127 LYS A HD3  4  
ATOM 5813  H HE2  . LYS A 1 90 ? -22.651 -3.744  -11.186 1.00 0.00 ? 127 LYS A HE2  4  
ATOM 5814  H HE3  . LYS A 1 90 ? -23.490 -2.617  -10.124 1.00 0.00 ? 127 LYS A HE3  4  
ATOM 5815  H HZ1  . LYS A 1 90 ? -20.874 -1.859  -11.224 1.00 0.00 ? 127 LYS A HZ1  4  
ATOM 5816  H HZ2  . LYS A 1 90 ? -22.245 -1.765  -12.221 1.00 0.00 ? 127 LYS A HZ2  4  
ATOM 5817  H HZ3  . LYS A 1 90 ? -22.177 -0.877  -10.778 1.00 0.00 ? 127 LYS A HZ3  4  
ATOM 5818  N N    . GLU A 1 91 ? -19.657 -5.268  -4.919  1.00 0.00 ? 128 GLU A N    4  
ATOM 5819  C CA   . GLU A 1 91 ? -19.018 -6.081  -3.889  1.00 0.00 ? 128 GLU A CA   4  
ATOM 5820  C C    . GLU A 1 91 ? -17.536 -5.752  -3.787  1.00 0.00 ? 128 GLU A C    4  
ATOM 5821  O O    . GLU A 1 91 ? -16.933 -5.862  -2.720  1.00 0.00 ? 128 GLU A O    4  
ATOM 5822  C CB   . GLU A 1 91 ? -19.215 -7.575  -4.170  1.00 0.00 ? 128 GLU A CB   4  
ATOM 5823  C CG   . GLU A 1 91 ? -18.935 -7.974  -5.610  1.00 0.00 ? 128 GLU A CG   4  
ATOM 5824  C CD   . GLU A 1 91 ? -19.228 -9.434  -5.879  1.00 0.00 ? 128 GLU A CD   4  
ATOM 5825  O OE1  . GLU A 1 91 ? -20.337 -9.894  -5.541  1.00 0.00 ? 128 GLU A OE1  4  
ATOM 5826  O OE2  . GLU A 1 91 ? -18.359 -10.124 -6.450  1.00 0.00 ? 128 GLU A OE2  4  
ATOM 5827  H H    . GLU A 1 91 ? -19.097 -4.714  -5.504  1.00 0.00 ? 128 GLU A H    4  
ATOM 5828  H HA   . GLU A 1 91 ? -19.482 -5.838  -2.952  1.00 0.00 ? 128 GLU A HA   4  
ATOM 5829  H HB2  . GLU A 1 91 ? -18.553 -8.138  -3.529  1.00 0.00 ? 128 GLU A HB2  4  
ATOM 5830  H HB3  . GLU A 1 91 ? -20.236 -7.841  -3.939  1.00 0.00 ? 128 GLU A HB3  4  
ATOM 5831  H HG2  . GLU A 1 91 ? -19.552 -7.376  -6.262  1.00 0.00 ? 128 GLU A HG2  4  
ATOM 5832  H HG3  . GLU A 1 91 ? -17.893 -7.785  -5.827  1.00 0.00 ? 128 GLU A HG3  4  
ATOM 5833  N N    . VAL A 1 92 ? -16.972 -5.314  -4.893  1.00 0.00 ? 129 VAL A N    4  
ATOM 5834  C CA   . VAL A 1 92 ? -15.575 -4.914  -4.941  1.00 0.00 ? 129 VAL A CA   4  
ATOM 5835  C C    . VAL A 1 92 ? -15.301 -4.139  -6.226  1.00 0.00 ? 129 VAL A C    4  
ATOM 5836  O O    . VAL A 1 92 ? -14.509 -3.199  -6.244  1.00 0.00 ? 129 VAL A O    4  
ATOM 5837  C CB   . VAL A 1 92 ? -14.621 -6.131  -4.822  1.00 0.00 ? 129 VAL A CB   4  
ATOM 5838  C CG1  . VAL A 1 92 ? -14.777 -7.081  -6.001  1.00 0.00 ? 129 VAL A CG1  4  
ATOM 5839  C CG2  . VAL A 1 92 ? -13.175 -5.675  -4.685  1.00 0.00 ? 129 VAL A CG2  4  
ATOM 5840  H H    . VAL A 1 92 ? -17.522 -5.214  -5.692  1.00 0.00 ? 129 VAL A H    4  
ATOM 5841  H HA   . VAL A 1 92 ? -15.393 -4.262  -4.101  1.00 0.00 ? 129 VAL A HA   4  
ATOM 5842  H HB   . VAL A 1 92 ? -14.882 -6.673  -3.927  1.00 0.00 ? 129 VAL A HB   4  
ATOM 5843  H HG11 . VAL A 1 92 ? -14.729 -6.523  -6.924  1.00 0.00 ? 129 VAL A HG11 4  
ATOM 5844  H HG12 . VAL A 1 92 ? -13.982 -7.813  -5.982  1.00 0.00 ? 129 VAL A HG12 4  
ATOM 5845  H HG13 . VAL A 1 92 ? -15.729 -7.585  -5.933  1.00 0.00 ? 129 VAL A HG13 4  
ATOM 5846  H HG21 . VAL A 1 92 ? -13.045 -4.729  -5.190  1.00 0.00 ? 129 VAL A HG21 4  
ATOM 5847  H HG22 . VAL A 1 92 ? -12.933 -5.559  -3.639  1.00 0.00 ? 129 VAL A HG22 4  
ATOM 5848  H HG23 . VAL A 1 92 ? -12.521 -6.412  -5.126  1.00 0.00 ? 129 VAL A HG23 4  
ATOM 5849  N N    . SER A 1 93 ? -16.016 -4.492  -7.280  1.00 0.00 ? 130 SER A N    4  
ATOM 5850  C CA   . SER A 1 93 ? -15.904 -3.801  -8.546  1.00 0.00 ? 130 SER A CA   4  
ATOM 5851  C C    . SER A 1 93 ? -17.293 -3.478  -9.087  1.00 0.00 ? 130 SER A C    4  
ATOM 5852  O O    . SER A 1 93 ? -18.284 -3.968  -8.506  1.00 0.00 ? 130 SER A O    4  
ATOM 5853  C CB   . SER A 1 93 ? -15.124 -4.663  -9.543  1.00 0.00 ? 130 SER A CB   4  
ATOM 5854  O OG   . SER A 1 93 ? -13.824 -4.964  -9.053  1.00 0.00 ? 130 SER A OG   4  
ATOM 5855  O OXT  . SER A 1 93 ? -17.389 -2.723  -10.079 1.00 0.00 ? 130 SER A OXT  4  
ATOM 5856  H H    . SER A 1 93 ? -16.667 -5.219  -7.198  1.00 0.00 ? 130 SER A H    4  
ATOM 5857  H HA   . SER A 1 93 ? -15.367 -2.878  -8.377  1.00 0.00 ? 130 SER A HA   4  
ATOM 5858  H HB2  . SER A 1 93 ? -15.653 -5.589  -9.707  1.00 0.00 ? 130 SER A HB2  4  
ATOM 5859  H HB3  . SER A 1 93 ? -15.028 -4.133  -10.480 1.00 0.00 ? 130 SER A HB3  4  
ATOM 5860  H HG   . SER A 1 93 ? -13.494 -4.201  -8.548  1.00 0.00 ? 130 SER A HG   4  
ATOM 5861  N N    . LYS A 1 2  ? 22.244  -1.338  5.853   1.00 0.00 ? 39  LYS A N    5  
ATOM 5862  C CA   . LYS A 1 2  ? 22.054  0.109   5.602   1.00 0.00 ? 39  LYS A CA   5  
ATOM 5863  C C    . LYS A 1 2  ? 20.680  0.551   6.078   1.00 0.00 ? 39  LYS A C    5  
ATOM 5864  O O    . LYS A 1 2  ? 19.688  -0.128  5.809   1.00 0.00 ? 39  LYS A O    5  
ATOM 5865  C CB   . LYS A 1 2  ? 22.195  0.369   4.100   1.00 0.00 ? 39  LYS A CB   5  
ATOM 5866  C CG   . LYS A 1 2  ? 23.538  -0.048  3.525   1.00 0.00 ? 39  LYS A CG   5  
ATOM 5867  C CD   . LYS A 1 2  ? 23.599  0.197   2.027   1.00 0.00 ? 39  LYS A CD   5  
ATOM 5868  C CE   . LYS A 1 2  ? 24.960  -0.165  1.456   1.00 0.00 ? 39  LYS A CE   5  
ATOM 5869  N NZ   . LYS A 1 2  ? 25.259  -1.616  1.584   1.00 0.00 ? 39  LYS A NZ   5  
ATOM 5870  H H1   . LYS A 1 2  ? 21.806  -1.606  6.759   1.00 0.00 ? 39  LYS A H1   5  
ATOM 5871  H H2   . LYS A 1 2  ? 21.801  -1.894  5.091   1.00 0.00 ? 39  LYS A H2   5  
ATOM 5872  H H3   . LYS A 1 2  ? 23.259  -1.569  5.893   1.00 0.00 ? 39  LYS A H3   5  
ATOM 5873  H HA   . LYS A 1 2  ? 22.813  0.659   6.136   1.00 0.00 ? 39  LYS A HA   5  
ATOM 5874  H HB2  . LYS A 1 2  ? 21.423  -0.176  3.578   1.00 0.00 ? 39  LYS A HB2  5  
ATOM 5875  H HB3  . LYS A 1 2  ? 22.063  1.426   3.914   1.00 0.00 ? 39  LYS A HB3  5  
ATOM 5876  H HG2  . LYS A 1 2  ? 24.320  0.523   4.005   1.00 0.00 ? 39  LYS A HG2  5  
ATOM 5877  H HG3  . LYS A 1 2  ? 23.688  -1.100  3.714   1.00 0.00 ? 39  LYS A HG3  5  
ATOM 5878  H HD2  . LYS A 1 2  ? 22.846  -0.408  1.544   1.00 0.00 ? 39  LYS A HD2  5  
ATOM 5879  H HD3  . LYS A 1 2  ? 23.402  1.241   1.833   1.00 0.00 ? 39  LYS A HD3  5  
ATOM 5880  H HE2  . LYS A 1 2  ? 24.982  0.107   0.411   1.00 0.00 ? 39  LYS A HE2  5  
ATOM 5881  H HE3  . LYS A 1 2  ? 25.716  0.397   1.986   1.00 0.00 ? 39  LYS A HE3  5  
ATOM 5882  H HZ1  . LYS A 1 2  ? 24.452  -2.116  2.011   1.00 0.00 ? 39  LYS A HZ1  5  
ATOM 5883  H HZ2  . LYS A 1 2  ? 25.448  -2.029  0.642   1.00 0.00 ? 39  LYS A HZ2  5  
ATOM 5884  H HZ3  . LYS A 1 2  ? 26.100  -1.757  2.186   1.00 0.00 ? 39  LYS A HZ3  5  
ATOM 5885  N N    . GLU A 1 3  ? 20.630  1.692   6.766   1.00 0.00 ? 40  GLU A N    5  
ATOM 5886  C CA   . GLU A 1 3  ? 19.373  2.246   7.264   1.00 0.00 ? 40  GLU A CA   5  
ATOM 5887  C C    . GLU A 1 3  ? 18.654  1.230   8.149   1.00 0.00 ? 40  GLU A C    5  
ATOM 5888  O O    . GLU A 1 3  ? 17.499  0.883   7.898   1.00 0.00 ? 40  GLU A O    5  
ATOM 5889  C CB   . GLU A 1 3  ? 18.487  2.669   6.090   1.00 0.00 ? 40  GLU A CB   5  
ATOM 5890  C CG   . GLU A 1 3  ? 19.127  3.724   5.200   1.00 0.00 ? 40  GLU A CG   5  
ATOM 5891  C CD   . GLU A 1 3  ? 18.395  3.908   3.886   1.00 0.00 ? 40  GLU A CD   5  
ATOM 5892  O OE1  . GLU A 1 3  ? 18.348  2.948   3.086   1.00 0.00 ? 40  GLU A OE1  5  
ATOM 5893  O OE2  . GLU A 1 3  ? 17.856  5.010   3.649   1.00 0.00 ? 40  GLU A OE2  5  
ATOM 5894  H H    . GLU A 1 3  ? 21.467  2.189   6.927   1.00 0.00 ? 40  GLU A H    5  
ATOM 5895  H HA   . GLU A 1 3  ? 19.611  3.117   7.858   1.00 0.00 ? 40  GLU A HA   5  
ATOM 5896  H HB2  . GLU A 1 3  ? 18.270  1.801   5.486   1.00 0.00 ? 40  GLU A HB2  5  
ATOM 5897  H HB3  . GLU A 1 3  ? 17.563  3.070   6.478   1.00 0.00 ? 40  GLU A HB3  5  
ATOM 5898  H HG2  . GLU A 1 3  ? 19.128  4.666   5.726   1.00 0.00 ? 40  GLU A HG2  5  
ATOM 5899  H HG3  . GLU A 1 3  ? 20.145  3.429   4.990   1.00 0.00 ? 40  GLU A HG3  5  
ATOM 5900  N N    . GLU A 1 4  ? 19.413  0.693   9.114   1.00 0.00 ? 41  GLU A N    5  
ATOM 5901  C CA   . GLU A 1 4  ? 18.978  -0.378  10.023  1.00 0.00 ? 41  GLU A CA   5  
ATOM 5902  C C    . GLU A 1 4  ? 18.513  -1.613  9.250   1.00 0.00 ? 41  GLU A C    5  
ATOM 5903  O O    . GLU A 1 4  ? 18.760  -1.735  8.048   1.00 0.00 ? 41  GLU A O    5  
ATOM 5904  C CB   . GLU A 1 4  ? 17.895  0.099   11.017  1.00 0.00 ? 41  GLU A CB   5  
ATOM 5905  C CG   . GLU A 1 4  ? 16.476  0.161   10.462  1.00 0.00 ? 41  GLU A CG   5  
ATOM 5906  C CD   . GLU A 1 4  ? 15.431  0.342   11.541  1.00 0.00 ? 41  GLU A CD   5  
ATOM 5907  O OE1  . GLU A 1 4  ? 15.805  0.464   12.727  1.00 0.00 ? 41  GLU A OE1  5  
ATOM 5908  O OE2  . GLU A 1 4  ? 14.227  0.348   11.214  1.00 0.00 ? 41  GLU A OE2  5  
ATOM 5909  H H    . GLU A 1 4  ? 20.346  0.991   9.177   1.00 0.00 ? 41  GLU A H    5  
ATOM 5910  H HA   . GLU A 1 4  ? 19.849  -0.667  10.596  1.00 0.00 ? 41  GLU A HA   5  
ATOM 5911  H HB2  . GLU A 1 4  ? 17.892  -0.567  11.865  1.00 0.00 ? 41  GLU A HB2  5  
ATOM 5912  H HB3  . GLU A 1 4  ? 18.163  1.089   11.359  1.00 0.00 ? 41  GLU A HB3  5  
ATOM 5913  H HG2  . GLU A 1 4  ? 16.408  0.990   9.773   1.00 0.00 ? 41  GLU A HG2  5  
ATOM 5914  H HG3  . GLU A 1 4  ? 16.270  -0.761  9.935   1.00 0.00 ? 41  GLU A HG3  5  
ATOM 5915  N N    . ALA A 1 5  ? 17.864  -2.539  9.940   1.00 0.00 ? 42  ALA A N    5  
ATOM 5916  C CA   . ALA A 1 5  ? 17.356  -3.739  9.300   1.00 0.00 ? 42  ALA A CA   5  
ATOM 5917  C C    . ALA A 1 5  ? 16.175  -3.390  8.407   1.00 0.00 ? 42  ALA A C    5  
ATOM 5918  O O    . ALA A 1 5  ? 15.404  -2.482  8.718   1.00 0.00 ? 42  ALA A O    5  
ATOM 5919  C CB   . ALA A 1 5  ? 16.953  -4.772  10.339  1.00 0.00 ? 42  ALA A CB   5  
ATOM 5920  H H    . ALA A 1 5  ? 17.685  -2.394  10.895  1.00 0.00 ? 42  ALA A H    5  
ATOM 5921  H HA   . ALA A 1 5  ? 18.148  -4.156  8.693   1.00 0.00 ? 42  ALA A HA   5  
ATOM 5922  H HB1  . ALA A 1 5  ? 17.834  -5.140  10.843  1.00 0.00 ? 42  ALA A HB1  5  
ATOM 5923  H HB2  . ALA A 1 5  ? 16.445  -5.593  9.853   1.00 0.00 ? 42  ALA A HB2  5  
ATOM 5924  H HB3  . ALA A 1 5  ? 16.290  -4.316  11.060  1.00 0.00 ? 42  ALA A HB3  5  
ATOM 5925  N N    . SER A 1 6  ? 16.018  -4.112  7.311   1.00 0.00 ? 43  SER A N    5  
ATOM 5926  C CA   . SER A 1 6  ? 14.907  -3.878  6.399   1.00 0.00 ? 43  SER A CA   5  
ATOM 5927  C C    . SER A 1 6  ? 13.618  -4.492  6.944   1.00 0.00 ? 43  SER A C    5  
ATOM 5928  O O    . SER A 1 6  ? 12.763  -4.952  6.187   1.00 0.00 ? 43  SER A O    5  
ATOM 5929  C CB   . SER A 1 6  ? 15.237  -4.460  5.023   1.00 0.00 ? 43  SER A CB   5  
ATOM 5930  O OG   . SER A 1 6  ? 16.501  -4.003  4.567   1.00 0.00 ? 43  SER A OG   5  
ATOM 5931  H H    . SER A 1 6  ? 16.648  -4.841  7.120   1.00 0.00 ? 43  SER A H    5  
ATOM 5932  H HA   . SER A 1 6  ? 14.775  -2.809  6.305   1.00 0.00 ? 43  SER A HA   5  
ATOM 5933  H HB2  . SER A 1 6  ? 15.261  -5.537  5.083   1.00 0.00 ? 43  SER A HB2  5  
ATOM 5934  H HB3  . SER A 1 6  ? 14.477  -4.157  4.315   1.00 0.00 ? 43  SER A HB3  5  
ATOM 5935  H HG   . SER A 1 6  ? 16.863  -4.632  3.923   1.00 0.00 ? 43  SER A HG   5  
ATOM 5936  N N    . SER A 1 7  ? 13.458  -4.440  8.262   1.00 0.00 ? 44  SER A N    5  
ATOM 5937  C CA   . SER A 1 7  ? 12.277  -4.967  8.921   1.00 0.00 ? 44  SER A CA   5  
ATOM 5938  C C    . SER A 1 7  ? 11.184  -3.907  8.988   1.00 0.00 ? 44  SER A C    5  
ATOM 5939  O O    . SER A 1 7  ? 10.405  -3.853  9.945   1.00 0.00 ? 44  SER A O    5  
ATOM 5940  C CB   . SER A 1 7  ? 12.640  -5.457  10.327  1.00 0.00 ? 44  SER A CB   5  
ATOM 5941  O OG   . SER A 1 7  ? 11.568  -6.176  10.922  1.00 0.00 ? 44  SER A OG   5  
ATOM 5942  H H    . SER A 1 7  ? 14.143  -3.991  8.805   1.00 0.00 ? 44  SER A H    5  
ATOM 5943  H HA   . SER A 1 7  ? 11.915  -5.800  8.340   1.00 0.00 ? 44  SER A HA   5  
ATOM 5944  H HB2  . SER A 1 7  ? 13.500  -6.107  10.268  1.00 0.00 ? 44  SER A HB2  5  
ATOM 5945  H HB3  . SER A 1 7  ? 12.876  -4.607  10.949  1.00 0.00 ? 44  SER A HB3  5  
ATOM 5946  H HG   . SER A 1 7  ? 10.765  -5.638  10.880  1.00 0.00 ? 44  SER A HG   5  
ATOM 5947  N N    . LYS A 1 8  ? 11.065  -3.129  7.923   1.00 0.00 ? 45  LYS A N    5  
ATOM 5948  C CA   . LYS A 1 8  ? 9.989   -2.164  7.814   1.00 0.00 ? 45  LYS A CA   5  
ATOM 5949  C C    . LYS A 1 8  ? 8.706   -2.898  7.487   1.00 0.00 ? 45  LYS A C    5  
ATOM 5950  O O    . LYS A 1 8  ? 8.656   -3.671  6.528   1.00 0.00 ? 45  LYS A O    5  
ATOM 5951  C CB   . LYS A 1 8  ? 10.281  -1.134  6.715   1.00 0.00 ? 45  LYS A CB   5  
ATOM 5952  C CG   . LYS A 1 8  ? 11.666  -0.510  6.782   1.00 0.00 ? 45  LYS A CG   5  
ATOM 5953  C CD   . LYS A 1 8  ? 11.884  0.281   8.064   1.00 0.00 ? 45  LYS A CD   5  
ATOM 5954  C CE   . LYS A 1 8  ? 13.239  0.971   8.052   1.00 0.00 ? 45  LYS A CE   5  
ATOM 5955  N NZ   . LYS A 1 8  ? 13.435  1.858   9.225   1.00 0.00 ? 45  LYS A NZ   5  
ATOM 5956  H H    . LYS A 1 8  ? 11.647  -3.288  7.152   1.00 0.00 ? 45  LYS A H    5  
ATOM 5957  H HA   . LYS A 1 8  ? 9.884   -1.661  8.764   1.00 0.00 ? 45  LYS A HA   5  
ATOM 5958  H HB2  . LYS A 1 8  ? 10.178  -1.618  5.755   1.00 0.00 ? 45  LYS A HB2  5  
ATOM 5959  H HB3  . LYS A 1 8  ? 9.549   -0.342  6.784   1.00 0.00 ? 45  LYS A HB3  5  
ATOM 5960  H HG2  . LYS A 1 8  ? 12.405  -1.294  6.728   1.00 0.00 ? 45  LYS A HG2  5  
ATOM 5961  H HG3  . LYS A 1 8  ? 11.785  0.155   5.938   1.00 0.00 ? 45  LYS A HG3  5  
ATOM 5962  H HD2  . LYS A 1 8  ? 11.110  1.026   8.155   1.00 0.00 ? 45  LYS A HD2  5  
ATOM 5963  H HD3  . LYS A 1 8  ? 11.839  -0.397  8.908   1.00 0.00 ? 45  LYS A HD3  5  
ATOM 5964  H HE2  . LYS A 1 8  ? 14.013  0.219   8.051   1.00 0.00 ? 45  LYS A HE2  5  
ATOM 5965  H HE3  . LYS A 1 8  ? 13.316  1.562   7.149   1.00 0.00 ? 45  LYS A HE3  5  
ATOM 5966  H HZ1  . LYS A 1 8  ? 12.610  2.486   9.349   1.00 0.00 ? 45  LYS A HZ1  5  
ATOM 5967  H HZ2  . LYS A 1 8  ? 13.560  1.288   10.093  1.00 0.00 ? 45  LYS A HZ2  5  
ATOM 5968  H HZ3  . LYS A 1 8  ? 14.286  2.447   9.089   1.00 0.00 ? 45  LYS A HZ3  5  
ATOM 5969  N N    . SER A 1 9  ? 7.672   -2.658  8.263   1.00 0.00 ? 46  SER A N    5  
ATOM 5970  C CA   . SER A 1 9  ? 6.391   -3.264  7.985   1.00 0.00 ? 46  SER A CA   5  
ATOM 5971  C C    . SER A 1 9  ? 5.793   -2.633  6.737   1.00 0.00 ? 46  SER A C    5  
ATOM 5972  O O    . SER A 1 9  ? 5.450   -1.452  6.743   1.00 0.00 ? 46  SER A O    5  
ATOM 5973  C CB   . SER A 1 9  ? 5.442   -3.097  9.176   1.00 0.00 ? 46  SER A CB   5  
ATOM 5974  O OG   . SER A 1 9  ? 4.126   -3.499  8.849   1.00 0.00 ? 46  SER A OG   5  
ATOM 5975  H H    . SER A 1 9  ? 7.754   -2.014  9.007   1.00 0.00 ? 46  SER A H    5  
ATOM 5976  H HA   . SER A 1 9  ? 6.551   -4.318  7.803   1.00 0.00 ? 46  SER A HA   5  
ATOM 5977  H HB2  . SER A 1 9  ? 5.786   -3.705  9.997   1.00 0.00 ? 46  SER A HB2  5  
ATOM 5978  H HB3  . SER A 1 9  ? 5.424   -2.061  9.478   1.00 0.00 ? 46  SER A HB3  5  
ATOM 5979  H HG   . SER A 1 9  ? 3.982   -4.413  9.149   1.00 0.00 ? 46  SER A HG   5  
ATOM 5980  N N    . TYR A 1 10 ? 5.604   -3.436  5.697   1.00 0.00 ? 47  TYR A N    5  
ATOM 5981  C CA   . TYR A 1 10 ? 4.940   -2.961  4.494   1.00 0.00 ? 47  TYR A CA   5  
ATOM 5982  C C    . TYR A 1 10 ? 3.513   -2.587  4.855   1.00 0.00 ? 47  TYR A C    5  
ATOM 5983  O O    . TYR A 1 10 ? 2.999   -1.561  4.419   1.00 0.00 ? 47  TYR A O    5  
ATOM 5984  C CB   . TYR A 1 10 ? 4.953   -4.027  3.391   1.00 0.00 ? 47  TYR A CB   5  
ATOM 5985  C CG   . TYR A 1 10 ? 6.339   -4.382  2.894   1.00 0.00 ? 47  TYR A CG   5  
ATOM 5986  C CD1  . TYR A 1 10 ? 7.229   -5.073  3.703   1.00 0.00 ? 47  TYR A CD1  5  
ATOM 5987  C CD2  . TYR A 1 10 ? 6.761   -4.017  1.622   1.00 0.00 ? 47  TYR A CD2  5  
ATOM 5988  C CE1  . TYR A 1 10 ? 8.498   -5.395  3.257   1.00 0.00 ? 47  TYR A CE1  5  
ATOM 5989  C CE2  . TYR A 1 10 ? 8.025   -4.337  1.169   1.00 0.00 ? 47  TYR A CE2  5  
ATOM 5990  C CZ   . TYR A 1 10 ? 8.878   -5.041  1.967   1.00 0.00 ? 47  TYR A CZ   5  
ATOM 5991  O OH   . TYR A 1 10 ? 10.153  -5.344  1.543   1.00 0.00 ? 47  TYR A OH   5  
ATOM 5992  H H    . TYR A 1 10 ? 5.846   -4.384  5.770   1.00 0.00 ? 47  TYR A H    5  
ATOM 5993  H HA   . TYR A 1 10 ? 5.458   -2.079  4.147   1.00 0.00 ? 47  TYR A HA   5  
ATOM 5994  H HB2  . TYR A 1 10 ? 4.496   -4.930  3.768   1.00 0.00 ? 47  TYR A HB2  5  
ATOM 5995  H HB3  . TYR A 1 10 ? 4.380   -3.667  2.549   1.00 0.00 ? 47  TYR A HB3  5  
ATOM 5996  H HD1  . TYR A 1 10 ? 6.918   -5.364  4.695   1.00 0.00 ? 47  TYR A HD1  5  
ATOM 5997  H HD2  . TYR A 1 10 ? 6.082   -3.477  0.979   1.00 0.00 ? 47  TYR A HD2  5  
ATOM 5998  H HE1  . TYR A 1 10 ? 9.173   -5.935  3.901   1.00 0.00 ? 47  TYR A HE1  5  
ATOM 5999  H HE2  . TYR A 1 10 ? 8.332   -4.045  0.175   1.00 0.00 ? 47  TYR A HE2  5  
ATOM 6000  H HH   . TYR A 1 10 ? 10.142  -5.422  0.576   1.00 0.00 ? 47  TYR A HH   5  
ATOM 6001  N N    . ARG A 1 11 ? 2.969   -3.343  5.799   1.00 0.00 ? 48  ARG A N    5  
ATOM 6002  C CA   . ARG A 1 11 ? 1.670   -3.060  6.390   1.00 0.00 ? 48  ARG A CA   5  
ATOM 6003  C C    . ARG A 1 11 ? 1.630   -1.638  6.960   1.00 0.00 ? 48  ARG A C    5  
ATOM 6004  O O    . ARG A 1 11 ? 0.710   -0.868  6.679   1.00 0.00 ? 48  ARG A O    5  
ATOM 6005  C CB   . ARG A 1 11 ? 1.408   -4.071  7.508   1.00 0.00 ? 48  ARG A CB   5  
ATOM 6006  C CG   . ARG A 1 11 ? 0.046   -3.938  8.162   1.00 0.00 ? 48  ARG A CG   5  
ATOM 6007  C CD   . ARG A 1 11 ? -0.011  -4.710  9.470   1.00 0.00 ? 48  ARG A CD   5  
ATOM 6008  N NE   . ARG A 1 11 ? -1.376  -4.831  9.974   1.00 0.00 ? 48  ARG A NE   5  
ATOM 6009  C CZ   . ARG A 1 11 ? -1.690  -5.185  11.215  1.00 0.00 ? 48  ARG A CZ   5  
ATOM 6010  N NH1  . ARG A 1 11 ? -0.735  -5.398  12.116  1.00 0.00 ? 48  ARG A NH1  5  
ATOM 6011  N NH2  . ARG A 1 11 ? -2.966  -5.311  11.555  1.00 0.00 ? 48  ARG A NH2  5  
ATOM 6012  H H    . ARG A 1 11 ? 3.508   -4.075  6.178   1.00 0.00 ? 48  ARG A H    5  
ATOM 6013  H HA   . ARG A 1 11 ? 0.915   -3.164  5.627   1.00 0.00 ? 48  ARG A HA   5  
ATOM 6014  H HB2  . ARG A 1 11 ? 1.489   -5.068  7.098   1.00 0.00 ? 48  ARG A HB2  5  
ATOM 6015  H HB3  . ARG A 1 11 ? 2.167   -3.945  8.273   1.00 0.00 ? 48  ARG A HB3  5  
ATOM 6016  H HG2  . ARG A 1 11 ? -0.147  -2.893  8.360   1.00 0.00 ? 48  ARG A HG2  5  
ATOM 6017  H HG3  . ARG A 1 11 ? -0.705  -4.326  7.493   1.00 0.00 ? 48  ARG A HG3  5  
ATOM 6018  H HD2  . ARG A 1 11 ? 0.388   -5.699  9.307   1.00 0.00 ? 48  ARG A HD2  5  
ATOM 6019  H HD3  . ARG A 1 11 ? 0.590   -4.196  10.205  1.00 0.00 ? 48  ARG A HD3  5  
ATOM 6020  H HE   . ARG A 1 11 ? -2.110  -4.666  9.328   1.00 0.00 ? 48  ARG A HE   5  
ATOM 6021  H HH11 . ARG A 1 11 ? 0.238   -5.293  11.862  1.00 0.00 ? 48  ARG A HH11 5  
ATOM 6022  H HH12 . ARG A 1 11 ? -0.974  -5.661  13.058  1.00 0.00 ? 48  ARG A HH12 5  
ATOM 6023  H HH21 . ARG A 1 11 ? -3.690  -5.138  10.870  1.00 0.00 ? 48  ARG A HH21 5  
ATOM 6024  H HH22 . ARG A 1 11 ? -3.220  -5.578  12.489  1.00 0.00 ? 48  ARG A HH22 5  
ATOM 6025  N N    . GLU A 1 12 ? 2.654   -1.292  7.731   1.00 0.00 ? 49  GLU A N    5  
ATOM 6026  C CA   . GLU A 1 12 ? 2.768   0.016   8.335   1.00 0.00 ? 49  GLU A CA   5  
ATOM 6027  C C    . GLU A 1 12 ? 3.013   1.091   7.280   1.00 0.00 ? 49  GLU A C    5  
ATOM 6028  O O    . GLU A 1 12 ? 2.356   2.128   7.283   1.00 0.00 ? 49  GLU A O    5  
ATOM 6029  C CB   . GLU A 1 12 ? 3.905   -0.023  9.355   1.00 0.00 ? 49  GLU A CB   5  
ATOM 6030  C CG   . GLU A 1 12 ? 4.392   1.335   9.781   1.00 0.00 ? 49  GLU A CG   5  
ATOM 6031  C CD   . GLU A 1 12 ? 3.417   2.076   10.676  1.00 0.00 ? 49  GLU A CD   5  
ATOM 6032  O OE1  . GLU A 1 12 ? 2.343   1.519   11.000  1.00 0.00 ? 49  GLU A OE1  5  
ATOM 6033  O OE2  . GLU A 1 12 ? 3.728   3.217   11.076  1.00 0.00 ? 49  GLU A OE2  5  
ATOM 6034  H H    . GLU A 1 12 ? 3.379   -1.933  7.881   1.00 0.00 ? 49  GLU A H    5  
ATOM 6035  H HA   . GLU A 1 12 ? 1.843   0.231   8.848   1.00 0.00 ? 49  GLU A HA   5  
ATOM 6036  H HB2  . GLU A 1 12 ? 3.566   -0.551  10.234  1.00 0.00 ? 49  GLU A HB2  5  
ATOM 6037  H HB3  . GLU A 1 12 ? 4.737   -0.560  8.925   1.00 0.00 ? 49  GLU A HB3  5  
ATOM 6038  H HG2  . GLU A 1 12 ? 5.323   1.213   10.308  1.00 0.00 ? 49  GLU A HG2  5  
ATOM 6039  H HG3  . GLU A 1 12 ? 4.555   1.919   8.892   1.00 0.00 ? 49  GLU A HG3  5  
ATOM 6040  N N    . LEU A 1 13 ? 3.945   0.816   6.372   1.00 0.00 ? 50  LEU A N    5  
ATOM 6041  C CA   . LEU A 1 13 ? 4.290   1.740   5.291   1.00 0.00 ? 50  LEU A CA   5  
ATOM 6042  C C    . LEU A 1 13 ? 3.058   2.135   4.488   1.00 0.00 ? 50  LEU A C    5  
ATOM 6043  O O    . LEU A 1 13 ? 2.817   3.319   4.233   1.00 0.00 ? 50  LEU A O    5  
ATOM 6044  C CB   . LEU A 1 13 ? 5.317   1.086   4.360   1.00 0.00 ? 50  LEU A CB   5  
ATOM 6045  C CG   . LEU A 1 13 ? 6.799   1.272   4.724   1.00 0.00 ? 50  LEU A CG   5  
ATOM 6046  C CD1  . LEU A 1 13 ? 7.015   1.320   6.226   1.00 0.00 ? 50  LEU A CD1  5  
ATOM 6047  C CD2  . LEU A 1 13 ? 7.613   0.140   4.134   1.00 0.00 ? 50  LEU A CD2  5  
ATOM 6048  H H    . LEU A 1 13 ? 4.423   -0.044  6.428   1.00 0.00 ? 50  LEU A H    5  
ATOM 6049  H HA   . LEU A 1 13 ? 4.726   2.624   5.732   1.00 0.00 ? 50  LEU A HA   5  
ATOM 6050  H HB2  . LEU A 1 13 ? 5.112   0.024   4.333   1.00 0.00 ? 50  LEU A HB2  5  
ATOM 6051  H HB3  . LEU A 1 13 ? 5.164   1.483   3.365   1.00 0.00 ? 50  LEU A HB3  5  
ATOM 6052  H HG   . LEU A 1 13 ? 7.157   2.199   4.303   1.00 0.00 ? 50  LEU A HG   5  
ATOM 6053  H HD11 . LEU A 1 13 ? 6.095   1.069   6.731   1.00 0.00 ? 50  LEU A HD11 5  
ATOM 6054  H HD12 . LEU A 1 13 ? 7.781   0.608   6.497   1.00 0.00 ? 50  LEU A HD12 5  
ATOM 6055  H HD13 . LEU A 1 13 ? 7.328   2.313   6.511   1.00 0.00 ? 50  LEU A HD13 5  
ATOM 6056  H HD21 . LEU A 1 13 ? 6.981   -0.731  4.014   1.00 0.00 ? 50  LEU A HD21 5  
ATOM 6057  H HD22 . LEU A 1 13 ? 8.003   0.437   3.173   1.00 0.00 ? 50  LEU A HD22 5  
ATOM 6058  H HD23 . LEU A 1 13 ? 8.433   -0.100  4.796   1.00 0.00 ? 50  LEU A HD23 5  
ATOM 6059  N N    . ILE A 1 14 ? 2.280   1.138   4.097   1.00 0.00 ? 51  ILE A N    5  
ATOM 6060  C CA   . ILE A 1 14 ? 1.073   1.365   3.324   1.00 0.00 ? 51  ILE A CA   5  
ATOM 6061  C C    . ILE A 1 14 ? 0.046   2.128   4.137   1.00 0.00 ? 51  ILE A C    5  
ATOM 6062  O O    . ILE A 1 14 ? -0.499  3.104   3.660   1.00 0.00 ? 51  ILE A O    5  
ATOM 6063  C CB   . ILE A 1 14 ? 0.459   0.044   2.828   1.00 0.00 ? 51  ILE A CB   5  
ATOM 6064  C CG1  . ILE A 1 14 ? 1.468   -0.710  1.966   1.00 0.00 ? 51  ILE A CG1  5  
ATOM 6065  C CG2  . ILE A 1 14 ? -0.817  0.307   2.037   1.00 0.00 ? 51  ILE A CG2  5  
ATOM 6066  C CD1  . ILE A 1 14 ? 1.026   -2.108  1.624   1.00 0.00 ? 51  ILE A CD1  5  
ATOM 6067  H H    . ILE A 1 14 ? 2.530   0.216   4.335   1.00 0.00 ? 51  ILE A H    5  
ATOM 6068  H HA   . ILE A 1 14 ? 1.334   1.958   2.460   1.00 0.00 ? 51  ILE A HA   5  
ATOM 6069  H HB   . ILE A 1 14 ? 0.207   -0.561  3.686   1.00 0.00 ? 51  ILE A HB   5  
ATOM 6070  H HG12 . ILE A 1 14 ? 1.615   -0.172  1.040   1.00 0.00 ? 51  ILE A HG12 5  
ATOM 6071  H HG13 . ILE A 1 14 ? 2.408   -0.775  2.493   1.00 0.00 ? 51  ILE A HG13 5  
ATOM 6072  H HG21 . ILE A 1 14 ? -1.379  1.097   2.514   1.00 0.00 ? 51  ILE A HG21 5  
ATOM 6073  H HG22 . ILE A 1 14 ? -0.561  0.604   1.031   1.00 0.00 ? 51  ILE A HG22 5  
ATOM 6074  H HG23 . ILE A 1 14 ? -1.413  -0.592  2.009   1.00 0.00 ? 51  ILE A HG23 5  
ATOM 6075  H HD11 . ILE A 1 14 ? -0.051  -2.155  1.655   1.00 0.00 ? 51  ILE A HD11 5  
ATOM 6076  H HD12 . ILE A 1 14 ? 1.370   -2.363  0.633   1.00 0.00 ? 51  ILE A HD12 5  
ATOM 6077  H HD13 . ILE A 1 14 ? 1.438   -2.799  2.341   1.00 0.00 ? 51  ILE A HD13 5  
ATOM 6078  N N    . ILE A 1 15 ? -0.183  1.717   5.376   1.00 0.00 ? 52  ILE A N    5  
ATOM 6079  C CA   . ILE A 1 15 ? -1.144  2.404   6.230   1.00 0.00 ? 52  ILE A CA   5  
ATOM 6080  C C    . ILE A 1 15 ? -0.742  3.856   6.473   1.00 0.00 ? 52  ILE A C    5  
ATOM 6081  O O    . ILE A 1 15 ? -1.543  4.770   6.256   1.00 0.00 ? 52  ILE A O    5  
ATOM 6082  C CB   . ILE A 1 15 ? -1.329  1.683   7.581   1.00 0.00 ? 52  ILE A CB   5  
ATOM 6083  C CG1  . ILE A 1 15 ? -2.217  0.449   7.387   1.00 0.00 ? 52  ILE A CG1  5  
ATOM 6084  C CG2  . ILE A 1 15 ? -1.927  2.633   8.607   1.00 0.00 ? 52  ILE A CG2  5  
ATOM 6085  C CD1  . ILE A 1 15 ? -2.330  -0.434  8.606   1.00 0.00 ? 52  ILE A CD1  5  
ATOM 6086  H H    . ILE A 1 15 ? 0.316   0.949   5.731   1.00 0.00 ? 52  ILE A H    5  
ATOM 6087  H HA   . ILE A 1 15 ? -2.097  2.395   5.716   1.00 0.00 ? 52  ILE A HA   5  
ATOM 6088  H HB   . ILE A 1 15 ? -0.359  1.371   7.934   1.00 0.00 ? 52  ILE A HB   5  
ATOM 6089  H HG12 . ILE A 1 15 ? -3.211  0.772   7.124   1.00 0.00 ? 52  ILE A HG12 5  
ATOM 6090  H HG13 . ILE A 1 15 ? -1.815  -0.148  6.581   1.00 0.00 ? 52  ILE A HG13 5  
ATOM 6091  H HG21 . ILE A 1 15 ? -1.840  3.649   8.239   1.00 0.00 ? 52  ILE A HG21 5  
ATOM 6092  H HG22 . ILE A 1 15 ? -2.969  2.390   8.759   1.00 0.00 ? 52  ILE A HG22 5  
ATOM 6093  H HG23 . ILE A 1 15 ? -1.392  2.540   9.539   1.00 0.00 ? 52  ILE A HG23 5  
ATOM 6094  H HD11 . ILE A 1 15 ? -1.344  -0.643  8.993   1.00 0.00 ? 52  ILE A HD11 5  
ATOM 6095  H HD12 . ILE A 1 15 ? -2.917  0.067   9.360   1.00 0.00 ? 52  ILE A HD12 5  
ATOM 6096  H HD13 . ILE A 1 15 ? -2.813  -1.362  8.328   1.00 0.00 ? 52  ILE A HD13 5  
ATOM 6097  N N    . GLU A 1 16 ? 0.509   4.063   6.874   1.00 0.00 ? 53  GLU A N    5  
ATOM 6098  C CA   . GLU A 1 16 ? 1.034   5.398   7.130   1.00 0.00 ? 53  GLU A CA   5  
ATOM 6099  C C    . GLU A 1 16 ? 0.848   6.289   5.908   1.00 0.00 ? 53  GLU A C    5  
ATOM 6100  O O    . GLU A 1 16 ? 0.472   7.458   6.021   1.00 0.00 ? 53  GLU A O    5  
ATOM 6101  C CB   . GLU A 1 16 ? 2.519   5.306   7.507   1.00 0.00 ? 53  GLU A CB   5  
ATOM 6102  C CG   . GLU A 1 16 ? 3.217   6.651   7.661   1.00 0.00 ? 53  GLU A CG   5  
ATOM 6103  C CD   . GLU A 1 16 ? 2.720   7.459   8.845   1.00 0.00 ? 53  GLU A CD   5  
ATOM 6104  O OE1  . GLU A 1 16 ? 1.906   6.942   9.640   1.00 0.00 ? 53  GLU A OE1  5  
ATOM 6105  O OE2  . GLU A 1 16 ? 3.158   8.622   8.991   1.00 0.00 ? 53  GLU A OE2  5  
ATOM 6106  H H    . GLU A 1 16 ? 1.107   3.287   6.983   1.00 0.00 ? 53  GLU A H    5  
ATOM 6107  H HA   . GLU A 1 16 ? 0.485   5.821   7.960   1.00 0.00 ? 53  GLU A HA   5  
ATOM 6108  H HB2  . GLU A 1 16 ? 2.603   4.775   8.441   1.00 0.00 ? 53  GLU A HB2  5  
ATOM 6109  H HB3  . GLU A 1 16 ? 3.031   4.745   6.740   1.00 0.00 ? 53  GLU A HB3  5  
ATOM 6110  H HG2  . GLU A 1 16 ? 4.275   6.476   7.789   1.00 0.00 ? 53  GLU A HG2  5  
ATOM 6111  H HG3  . GLU A 1 16 ? 3.058   7.227   6.761   1.00 0.00 ? 53  GLU A HG3  5  
ATOM 6112  N N    . GLY A 1 17 ? 1.074   5.717   4.738   1.00 0.00 ? 54  GLY A N    5  
ATOM 6113  C CA   . GLY A 1 17 ? 0.884   6.456   3.515   1.00 0.00 ? 54  GLY A CA   5  
ATOM 6114  C C    . GLY A 1 17 ? -0.559  6.597   3.139   1.00 0.00 ? 54  GLY A C    5  
ATOM 6115  O O    . GLY A 1 17 ? -1.029  7.694   2.883   1.00 0.00 ? 54  GLY A O    5  
ATOM 6116  H H    . GLY A 1 17 ? 1.349   4.773   4.707   1.00 0.00 ? 54  GLY A H    5  
ATOM 6117  H HA2  . GLY A 1 17 ? 1.317   7.438   3.623   1.00 0.00 ? 54  GLY A HA2  5  
ATOM 6118  H HA3  . GLY A 1 17 ? 1.383   5.937   2.717   1.00 0.00 ? 54  GLY A HA3  5  
ATOM 6119  N N    . LEU A 1 18 ? -1.202  5.461   2.951   1.00 0.00 ? 55  LEU A N    5  
ATOM 6120  C CA   . LEU A 1 18 ? -2.547  5.393   2.407   1.00 0.00 ? 55  LEU A CA   5  
ATOM 6121  C C    . LEU A 1 18 ? -3.530  6.235   3.216   1.00 0.00 ? 55  LEU A C    5  
ATOM 6122  O O    . LEU A 1 18 ? -4.403  6.887   2.648   1.00 0.00 ? 55  LEU A O    5  
ATOM 6123  C CB   . LEU A 1 18 ? -2.970  3.926   2.356   1.00 0.00 ? 55  LEU A CB   5  
ATOM 6124  C CG   . LEU A 1 18 ? -3.839  3.507   1.174   1.00 0.00 ? 55  LEU A CG   5  
ATOM 6125  C CD1  . LEU A 1 18 ? -5.259  3.911   1.409   1.00 0.00 ? 55  LEU A CD1  5  
ATOM 6126  C CD2  . LEU A 1 18 ? -3.340  4.119   -0.121  1.00 0.00 ? 55  LEU A CD2  5  
ATOM 6127  H H    . LEU A 1 18 ? -0.710  4.614   3.080   1.00 0.00 ? 55  LEU A H    5  
ATOM 6128  H HA   . LEU A 1 18 ? -2.516  5.776   1.401   1.00 0.00 ? 55  LEU A HA   5  
ATOM 6129  H HB2  . LEU A 1 18 ? -2.074  3.322   2.343   1.00 0.00 ? 55  LEU A HB2  5  
ATOM 6130  H HB3  . LEU A 1 18 ? -3.511  3.707   3.263   1.00 0.00 ? 55  LEU A HB3  5  
ATOM 6131  H HG   . LEU A 1 18 ? -3.810  2.432   1.077   1.00 0.00 ? 55  LEU A HG   5  
ATOM 6132  H HD11 . LEU A 1 18 ? -5.286  4.915   1.800   1.00 0.00 ? 55  LEU A HD11 5  
ATOM 6133  H HD12 . LEU A 1 18 ? -5.799  3.868   0.476   1.00 0.00 ? 55  LEU A HD12 5  
ATOM 6134  H HD13 . LEU A 1 18 ? -5.708  3.226   2.119   1.00 0.00 ? 55  LEU A HD13 5  
ATOM 6135  H HD21 . LEU A 1 18 ? -2.269  4.246   -0.067  1.00 0.00 ? 55  LEU A HD21 5  
ATOM 6136  H HD22 . LEU A 1 18 ? -3.584  3.465   -0.944  1.00 0.00 ? 55  LEU A HD22 5  
ATOM 6137  H HD23 . LEU A 1 18 ? -3.812  5.079   -0.270  1.00 0.00 ? 55  LEU A HD23 5  
ATOM 6138  N N    . THR A 1 19 ? -3.328  6.302   4.527   1.00 0.00 ? 56  THR A N    5  
ATOM 6139  C CA   . THR A 1 19 ? -4.152  7.156   5.371   1.00 0.00 ? 56  THR A CA   5  
ATOM 6140  C C    . THR A 1 19 ? -3.915  8.631   5.023   1.00 0.00 ? 56  THR A C    5  
ATOM 6141  O O    . THR A 1 19 ? -4.795  9.475   5.193   1.00 0.00 ? 56  THR A O    5  
ATOM 6142  C CB   . THR A 1 19 ? -3.875  6.907   6.877   1.00 0.00 ? 56  THR A CB   5  
ATOM 6143  O OG1  . THR A 1 19 ? -4.956  7.414   7.672   1.00 0.00 ? 56  THR A OG1  5  
ATOM 6144  C CG2  . THR A 1 19 ? -2.574  7.558   7.327   1.00 0.00 ? 56  THR A CG2  5  
ATOM 6145  H H    . THR A 1 19 ? -2.578  5.806   4.926   1.00 0.00 ? 56  THR A H    5  
ATOM 6146  H HA   . THR A 1 19 ? -5.189  6.915   5.175   1.00 0.00 ? 56  THR A HA   5  
ATOM 6147  H HB   . THR A 1 19 ? -3.794  5.841   7.037   1.00 0.00 ? 56  THR A HB   5  
ATOM 6148  H HG1  . THR A 1 19 ? -5.513  6.675   7.960   1.00 0.00 ? 56  THR A HG1  5  
ATOM 6149  H HG21 . THR A 1 19 ? -1.794  7.336   6.612   1.00 0.00 ? 56  THR A HG21 5  
ATOM 6150  H HG22 . THR A 1 19 ? -2.710  8.627   7.394   1.00 0.00 ? 56  THR A HG22 5  
ATOM 6151  H HG23 . THR A 1 19 ? -2.294  7.170   8.295   1.00 0.00 ? 56  THR A HG23 5  
ATOM 6152  N N    . ALA A 1 20 ? -2.710  8.931   4.546   1.00 0.00 ? 57  ALA A N    5  
ATOM 6153  C CA   . ALA A 1 20 ? -2.332  10.286  4.181   1.00 0.00 ? 57  ALA A CA   5  
ATOM 6154  C C    . ALA A 1 20 ? -2.677  10.622  2.724   1.00 0.00 ? 57  ALA A C    5  
ATOM 6155  O O    . ALA A 1 20 ? -3.145  11.724  2.439   1.00 0.00 ? 57  ALA A O    5  
ATOM 6156  C CB   . ALA A 1 20 ? -0.847  10.500  4.430   1.00 0.00 ? 57  ALA A CB   5  
ATOM 6157  H H    . ALA A 1 20 ? -2.051  8.208   4.434   1.00 0.00 ? 57  ALA A H    5  
ATOM 6158  H HA   . ALA A 1 20 ? -2.873  10.964  4.828   1.00 0.00 ? 57  ALA A HA   5  
ATOM 6159  H HB1  . ALA A 1 20 ? -0.624  10.309  5.469   1.00 0.00 ? 57  ALA A HB1  5  
ATOM 6160  H HB2  . ALA A 1 20 ? -0.585  11.519  4.188   1.00 0.00 ? 57  ALA A HB2  5  
ATOM 6161  H HB3  . ALA A 1 20 ? -0.276  9.824   3.810   1.00 0.00 ? 57  ALA A HB3  5  
ATOM 6162  N N    . LEU A 1 21 ? -2.296  9.745   1.790   1.00 0.00 ? 58  LEU A N    5  
ATOM 6163  C CA   . LEU A 1 21 ? -2.396  10.066  0.366   1.00 0.00 ? 58  LEU A CA   5  
ATOM 6164  C C    . LEU A 1 21 ? -3.708  9.579   -0.253  1.00 0.00 ? 58  LEU A C    5  
ATOM 6165  O O    . LEU A 1 21 ? -3.840  9.525   -1.480  1.00 0.00 ? 58  LEU A O    5  
ATOM 6166  C CB   . LEU A 1 21 ? -1.200  9.482   -0.411  1.00 0.00 ? 58  LEU A CB   5  
ATOM 6167  C CG   . LEU A 1 21 ? -1.376  8.057   -0.944  1.00 0.00 ? 58  LEU A CG   5  
ATOM 6168  C CD1  . LEU A 1 21 ? -0.707  7.910   -2.297  1.00 0.00 ? 58  LEU A CD1  5  
ATOM 6169  C CD2  . LEU A 1 21 ? -0.820  7.044   0.013   1.00 0.00 ? 58  LEU A CD2  5  
ATOM 6170  H H    . LEU A 1 21 ? -1.824  8.925   2.066   1.00 0.00 ? 58  LEU A H    5  
ATOM 6171  H HA   . LEU A 1 21 ? -2.357  11.135  0.281   1.00 0.00 ? 58  LEU A HA   5  
ATOM 6172  H HB2  . LEU A 1 21 ? -0.994  10.130  -1.249  1.00 0.00 ? 58  LEU A HB2  5  
ATOM 6173  H HB3  . LEU A 1 21 ? -0.341  9.490   0.243   1.00 0.00 ? 58  LEU A HB3  5  
ATOM 6174  H HG   . LEU A 1 21 ? -2.424  7.849   -1.053  1.00 0.00 ? 58  LEU A HG   5  
ATOM 6175  H HD11 . LEU A 1 21 ? 0.165   8.547   -2.341  1.00 0.00 ? 58  LEU A HD11 5  
ATOM 6176  H HD12 . LEU A 1 21 ? -0.409  6.882   -2.439  1.00 0.00 ? 58  LEU A HD12 5  
ATOM 6177  H HD13 . LEU A 1 21 ? -1.401  8.194   -3.076  1.00 0.00 ? 58  LEU A HD13 5  
ATOM 6178  H HD21 . LEU A 1 21 ? -0.947  7.409   1.024   1.00 0.00 ? 58  LEU A HD21 5  
ATOM 6179  H HD22 . LEU A 1 21 ? -1.360  6.111   -0.104  1.00 0.00 ? 58  LEU A HD22 5  
ATOM 6180  H HD23 . LEU A 1 21 ? 0.227   6.888   -0.190  1.00 0.00 ? 58  LEU A HD23 5  
ATOM 6181  N N    . LYS A 1 22 ? -4.671  9.222   0.591   1.00 0.00 ? 59  LYS A N    5  
ATOM 6182  C CA   . LYS A 1 22 ? -5.951  8.693   0.119   1.00 0.00 ? 59  LYS A CA   5  
ATOM 6183  C C    . LYS A 1 22 ? -6.695  9.700   -0.759  1.00 0.00 ? 59  LYS A C    5  
ATOM 6184  O O    . LYS A 1 22 ? -7.536  9.315   -1.575  1.00 0.00 ? 59  LYS A O    5  
ATOM 6185  C CB   . LYS A 1 22 ? -6.838  8.269   1.300   1.00 0.00 ? 59  LYS A CB   5  
ATOM 6186  C CG   . LYS A 1 22 ? -7.540  9.417   2.020   1.00 0.00 ? 59  LYS A CG   5  
ATOM 6187  C CD   . LYS A 1 22 ? -6.576  10.253  2.843   1.00 0.00 ? 59  LYS A CD   5  
ATOM 6188  C CE   . LYS A 1 22 ? -7.294  11.363  3.596   1.00 0.00 ? 59  LYS A CE   5  
ATOM 6189  N NZ   . LYS A 1 22 ? -8.349  10.836  4.504   1.00 0.00 ? 59  LYS A NZ   5  
ATOM 6190  H H    . LYS A 1 22 ? -4.499  9.255   1.554   1.00 0.00 ? 59  LYS A H    5  
ATOM 6191  H HA   . LYS A 1 22 ? -5.734  7.820   -0.477  1.00 0.00 ? 59  LYS A HA   5  
ATOM 6192  H HB2  . LYS A 1 22 ? -7.591  7.592   0.936   1.00 0.00 ? 59  LYS A HB2  5  
ATOM 6193  H HB3  . LYS A 1 22 ? -6.224  7.750   2.021   1.00 0.00 ? 59  LYS A HB3  5  
ATOM 6194  H HG2  . LYS A 1 22 ? -8.010  10.053  1.286   1.00 0.00 ? 59  LYS A HG2  5  
ATOM 6195  H HG3  . LYS A 1 22 ? -8.294  9.004   2.675   1.00 0.00 ? 59  LYS A HG3  5  
ATOM 6196  H HD2  . LYS A 1 22 ? -6.077  9.613   3.557   1.00 0.00 ? 59  LYS A HD2  5  
ATOM 6197  H HD3  . LYS A 1 22 ? -5.844  10.694  2.182   1.00 0.00 ? 59  LYS A HD3  5  
ATOM 6198  H HE2  . LYS A 1 22 ? -6.570  11.908  4.182   1.00 0.00 ? 59  LYS A HE2  5  
ATOM 6199  H HE3  . LYS A 1 22 ? -7.749  12.029  2.879   1.00 0.00 ? 59  LYS A HE3  5  
ATOM 6200  H HZ1  . LYS A 1 22 ? -8.083  9.894   4.860   1.00 0.00 ? 59  LYS A HZ1  5  
ATOM 6201  H HZ2  . LYS A 1 22 ? -8.480  11.476  5.311   1.00 0.00 ? 59  LYS A HZ2  5  
ATOM 6202  H HZ3  . LYS A 1 22 ? -9.255  10.757  3.990   1.00 0.00 ? 59  LYS A HZ3  5  
ATOM 6203  N N    . GLU A 1 23 ? -6.426  10.987  -0.540  1.00 0.00 ? 60  GLU A N    5  
ATOM 6204  C CA   . GLU A 1 23 ? -7.105  12.063  -1.256  1.00 0.00 ? 60  GLU A CA   5  
ATOM 6205  C C    . GLU A 1 23 ? -8.613  11.969  -1.054  1.00 0.00 ? 60  GLU A C    5  
ATOM 6206  O O    . GLU A 1 23 ? -9.130  12.270  0.023   1.00 0.00 ? 60  GLU A O    5  
ATOM 6207  C CB   . GLU A 1 23 ? -6.775  12.032  -2.754  1.00 0.00 ? 60  GLU A CB   5  
ATOM 6208  C CG   . GLU A 1 23 ? -5.306  12.234  -3.075  1.00 0.00 ? 60  GLU A CG   5  
ATOM 6209  C CD   . GLU A 1 23 ? -5.046  12.299  -4.564  1.00 0.00 ? 60  GLU A CD   5  
ATOM 6210  O OE1  . GLU A 1 23 ? -5.365  11.320  -5.266  1.00 0.00 ? 60  GLU A OE1  5  
ATOM 6211  O OE2  . GLU A 1 23 ? -4.528  13.331  -5.041  1.00 0.00 ? 60  GLU A OE2  5  
ATOM 6212  H H    . GLU A 1 23 ? -5.770  11.220  0.148   1.00 0.00 ? 60  GLU A H    5  
ATOM 6213  H HA   . GLU A 1 23 ? -6.761  12.998  -0.843  1.00 0.00 ? 60  GLU A HA   5  
ATOM 6214  H HB2  . GLU A 1 23 ? -7.079  11.077  -3.157  1.00 0.00 ? 60  GLU A HB2  5  
ATOM 6215  H HB3  . GLU A 1 23 ? -7.337  12.812  -3.247  1.00 0.00 ? 60  GLU A HB3  5  
ATOM 6216  H HG2  . GLU A 1 23 ? -4.975  13.159  -2.625  1.00 0.00 ? 60  GLU A HG2  5  
ATOM 6217  H HG3  . GLU A 1 23 ? -4.743  11.410  -2.659  1.00 0.00 ? 60  GLU A HG3  5  
ATOM 6218  N N    . ARG A 1 24 ? -9.302  11.548  -2.100  1.00 0.00 ? 61  ARG A N    5  
ATOM 6219  C CA   . ARG A 1 24 ? -10.747 11.411  -2.077  1.00 0.00 ? 61  ARG A CA   5  
ATOM 6220  C C    . ARG A 1 24 ? -11.194 10.265  -1.169  1.00 0.00 ? 61  ARG A C    5  
ATOM 6221  O O    . ARG A 1 24 ? -12.225 10.375  -0.504  1.00 0.00 ? 61  ARG A O    5  
ATOM 6222  C CB   . ARG A 1 24 ? -11.267 11.206  -3.502  1.00 0.00 ? 61  ARG A CB   5  
ATOM 6223  C CG   . ARG A 1 24 ? -10.615 10.041  -4.232  1.00 0.00 ? 61  ARG A CG   5  
ATOM 6224  C CD   . ARG A 1 24 ? -10.737 10.187  -5.740  1.00 0.00 ? 61  ARG A CD   5  
ATOM 6225  N NE   . ARG A 1 24 ? -10.070 11.396  -6.228  1.00 0.00 ? 61  ARG A NE   5  
ATOM 6226  C CZ   . ARG A 1 24 ? -8.745  11.584  -6.234  1.00 0.00 ? 61  ARG A CZ   5  
ATOM 6227  N NH1  . ARG A 1 24 ? -7.917  10.595  -5.907  1.00 0.00 ? 61  ARG A NH1  5  
ATOM 6228  N NH2  . ARG A 1 24 ? -8.250  12.756  -6.610  1.00 0.00 ? 61  ARG A NH2  5  
ATOM 6229  H H    . ARG A 1 24 ? -8.821  11.329  -2.921  1.00 0.00 ? 61  ARG A H    5  
ATOM 6230  H HA   . ARG A 1 24 ? -11.155 12.334  -1.692  1.00 0.00 ? 61  ARG A HA   5  
ATOM 6231  H HB2  . ARG A 1 24 ? -12.330 11.027  -3.462  1.00 0.00 ? 61  ARG A HB2  5  
ATOM 6232  H HB3  . ARG A 1 24 ? -11.085 12.107  -4.072  1.00 0.00 ? 61  ARG A HB3  5  
ATOM 6233  H HG2  . ARG A 1 24 ? -9.568  10.004  -3.970  1.00 0.00 ? 61  ARG A HG2  5  
ATOM 6234  H HG3  . ARG A 1 24 ? -11.097 9.123   -3.928  1.00 0.00 ? 61  ARG A HG3  5  
ATOM 6235  H HD2  . ARG A 1 24 ? -10.288 9.324   -6.209  1.00 0.00 ? 61  ARG A HD2  5  
ATOM 6236  H HD3  . ARG A 1 24 ? -11.784 10.234  -6.000  1.00 0.00 ? 61  ARG A HD3  5  
ATOM 6237  H HE   . ARG A 1 24 ? -10.657 12.135  -6.533  1.00 0.00 ? 61  ARG A HE   5  
ATOM 6238  H HH11 . ARG A 1 24 ? -8.281  9.687   -5.662  1.00 0.00 ? 61  ARG A HH11 5  
ATOM 6239  H HH12 . ARG A 1 24 ? -6.918  10.753  -5.886  1.00 0.00 ? 61  ARG A HH12 5  
ATOM 6240  H HH21 . ARG A 1 24 ? -8.873  13.500  -6.896  1.00 0.00 ? 61  ARG A HH21 5  
ATOM 6241  H HH22 . ARG A 1 24 ? -7.255  12.915  -6.610  1.00 0.00 ? 61  ARG A HH22 5  
ATOM 6242  N N    . LYS A 1 25 ? -10.409 9.181   -1.122  1.00 0.00 ? 62  LYS A N    5  
ATOM 6243  C CA   . LYS A 1 25 ? -10.743 8.026   -0.282  1.00 0.00 ? 62  LYS A CA   5  
ATOM 6244  C C    . LYS A 1 25 ? -9.691  6.917   -0.389  1.00 0.00 ? 62  LYS A C    5  
ATOM 6245  O O    . LYS A 1 25 ? -9.354  6.281   0.609   1.00 0.00 ? 62  LYS A O    5  
ATOM 6246  C CB   . LYS A 1 25 ? -12.133 7.473   -0.639  1.00 0.00 ? 62  LYS A CB   5  
ATOM 6247  C CG   . LYS A 1 25 ? -12.303 7.105   -2.107  1.00 0.00 ? 62  LYS A CG   5  
ATOM 6248  C CD   . LYS A 1 25 ? -13.767 6.937   -2.476  1.00 0.00 ? 62  LYS A CD   5  
ATOM 6249  C CE   . LYS A 1 25 ? -14.521 8.255   -2.376  1.00 0.00 ? 62  LYS A CE   5  
ATOM 6250  N NZ   . LYS A 1 25 ? -15.944 8.115   -2.780  1.00 0.00 ? 62  LYS A NZ   5  
ATOM 6251  H H    . LYS A 1 25 ? -9.566  9.177   -1.626  1.00 0.00 ? 62  LYS A H    5  
ATOM 6252  H HA   . LYS A 1 25 ? -10.767 8.372   0.741   1.00 0.00 ? 62  LYS A HA   5  
ATOM 6253  H HB2  . LYS A 1 25 ? -12.316 6.588   -0.050  1.00 0.00 ? 62  LYS A HB2  5  
ATOM 6254  H HB3  . LYS A 1 25 ? -12.876 8.218   -0.392  1.00 0.00 ? 62  LYS A HB3  5  
ATOM 6255  H HG2  . LYS A 1 25 ? -11.877 7.887   -2.716  1.00 0.00 ? 62  LYS A HG2  5  
ATOM 6256  H HG3  . LYS A 1 25 ? -11.785 6.177   -2.296  1.00 0.00 ? 62  LYS A HG3  5  
ATOM 6257  H HD2  . LYS A 1 25 ? -13.832 6.575   -3.492  1.00 0.00 ? 62  LYS A HD2  5  
ATOM 6258  H HD3  . LYS A 1 25 ? -14.219 6.223   -1.806  1.00 0.00 ? 62  LYS A HD3  5  
ATOM 6259  H HE2  . LYS A 1 25 ? -14.476 8.602   -1.354  1.00 0.00 ? 62  LYS A HE2  5  
ATOM 6260  H HE3  . LYS A 1 25 ? -14.041 8.977   -3.020  1.00 0.00 ? 62  LYS A HE3  5  
ATOM 6261  H HZ1  . LYS A 1 25 ? -16.011 7.727   -3.747  1.00 0.00 ? 62  LYS A HZ1  5  
ATOM 6262  H HZ2  . LYS A 1 25 ? -16.446 7.475   -2.126  1.00 0.00 ? 62  LYS A HZ2  5  
ATOM 6263  H HZ3  . LYS A 1 25 ? -16.417 9.045   -2.764  1.00 0.00 ? 62  LYS A HZ3  5  
ATOM 6264  N N    . GLY A 1 26 ? -9.195  6.673   -1.597  1.00 0.00 ? 63  GLY A N    5  
ATOM 6265  C CA   . GLY A 1 26 ? -8.229  5.605   -1.803  1.00 0.00 ? 63  GLY A CA   5  
ATOM 6266  C C    . GLY A 1 26 ? -7.183  5.960   -2.842  1.00 0.00 ? 63  GLY A C    5  
ATOM 6267  O O    . GLY A 1 26 ? -7.309  6.976   -3.531  1.00 0.00 ? 63  GLY A O    5  
ATOM 6268  H H    . GLY A 1 26 ? -9.502  7.199   -2.357  1.00 0.00 ? 63  GLY A H    5  
ATOM 6269  H HA2  . GLY A 1 26 ? -7.734  5.397   -0.865  1.00 0.00 ? 63  GLY A HA2  5  
ATOM 6270  H HA3  . GLY A 1 26 ? -8.754  4.718   -2.124  1.00 0.00 ? 63  GLY A HA3  5  
ATOM 6271  N N    . SER A 1 27 ? -6.117  5.171   -2.907  1.00 0.00 ? 64  SER A N    5  
ATOM 6272  C CA   . SER A 1 27 ? -5.000  5.464   -3.793  1.00 0.00 ? 64  SER A CA   5  
ATOM 6273  C C    . SER A 1 27 ? -4.539  4.212   -4.537  1.00 0.00 ? 64  SER A C    5  
ATOM 6274  O O    . SER A 1 27 ? -4.574  3.105   -4.000  1.00 0.00 ? 64  SER A O    5  
ATOM 6275  C CB   . SER A 1 27 ? -3.844  6.037   -2.979  1.00 0.00 ? 64  SER A CB   5  
ATOM 6276  O OG   . SER A 1 27 ? -4.324  6.916   -1.977  1.00 0.00 ? 64  SER A OG   5  
ATOM 6277  H H    . SER A 1 27 ? -6.049  4.407   -2.289  1.00 0.00 ? 64  SER A H    5  
ATOM 6278  H HA   . SER A 1 27 ? -5.325  6.201   -4.510  1.00 0.00 ? 64  SER A HA   5  
ATOM 6279  H HB2  . SER A 1 27 ? -3.303  5.232   -2.503  1.00 0.00 ? 64  SER A HB2  5  
ATOM 6280  H HB3  . SER A 1 27 ? -3.178  6.583   -3.631  1.00 0.00 ? 64  SER A HB3  5  
ATOM 6281  H HG   . SER A 1 27 ? -4.074  7.821   -2.192  1.00 0.00 ? 64  SER A HG   5  
ATOM 6282  N N    . SER A 1 28 ? -4.118  4.396   -5.782  1.00 0.00 ? 65  SER A N    5  
ATOM 6283  C CA   . SER A 1 28 ? -3.648  3.298   -6.621  1.00 0.00 ? 65  SER A CA   5  
ATOM 6284  C C    . SER A 1 28 ? -2.352  2.697   -6.070  1.00 0.00 ? 65  SER A C    5  
ATOM 6285  O O    . SER A 1 28 ? -1.639  3.346   -5.300  1.00 0.00 ? 65  SER A O    5  
ATOM 6286  C CB   . SER A 1 28 ? -3.426  3.802   -8.046  1.00 0.00 ? 65  SER A CB   5  
ATOM 6287  O OG   . SER A 1 28 ? -4.541  4.555   -8.495  1.00 0.00 ? 65  SER A OG   5  
ATOM 6288  H H    . SER A 1 28 ? -4.118  5.303   -6.151  1.00 0.00 ? 65  SER A H    5  
ATOM 6289  H HA   . SER A 1 28 ? -4.413  2.536   -6.631  1.00 0.00 ? 65  SER A HA   5  
ATOM 6290  H HB2  . SER A 1 28 ? -2.548  4.433   -8.070  1.00 0.00 ? 65  SER A HB2  5  
ATOM 6291  H HB3  . SER A 1 28 ? -3.282  2.960   -8.707  1.00 0.00 ? 65  SER A HB3  5  
ATOM 6292  H HG   . SER A 1 28 ? -5.202  3.950   -8.877  1.00 0.00 ? 65  SER A HG   5  
ATOM 6293  N N    . ARG A 1 29 ? -2.042  1.470   -6.490  1.00 0.00 ? 66  ARG A N    5  
ATOM 6294  C CA   . ARG A 1 29 ? -0.823  0.781   -6.055  1.00 0.00 ? 66  ARG A CA   5  
ATOM 6295  C C    . ARG A 1 29 ? 0.442   1.618   -6.317  1.00 0.00 ? 66  ARG A C    5  
ATOM 6296  O O    . ARG A 1 29 ? 1.247   1.797   -5.405  1.00 0.00 ? 66  ARG A O    5  
ATOM 6297  C CB   . ARG A 1 29 ? -0.677  -0.581  -6.744  1.00 0.00 ? 66  ARG A CB   5  
ATOM 6298  C CG   . ARG A 1 29 ? -1.653  -1.640  -6.260  1.00 0.00 ? 66  ARG A CG   5  
ATOM 6299  C CD   . ARG A 1 29 ? -1.339  -2.991  -6.886  1.00 0.00 ? 66  ARG A CD   5  
ATOM 6300  N NE   . ARG A 1 29 ? -1.289  -2.914  -8.345  1.00 0.00 ? 66  ARG A NE   5  
ATOM 6301  C CZ   . ARG A 1 29 ? -0.649  -3.789  -9.122  1.00 0.00 ? 66  ARG A CZ   5  
ATOM 6302  N NH1  . ARG A 1 29 ? 0.021   -4.806  -8.593  1.00 0.00 ? 66  ARG A NH1  5  
ATOM 6303  N NH2  . ARG A 1 29 ? -0.671  -3.637  -10.436 1.00 0.00 ? 66  ARG A NH2  5  
ATOM 6304  H H    . ARG A 1 29 ? -2.647  1.018   -7.124  1.00 0.00 ? 66  ARG A H    5  
ATOM 6305  H HA   . ARG A 1 29 ? -0.910  0.617   -4.990  1.00 0.00 ? 66  ARG A HA   5  
ATOM 6306  H HB2  . ARG A 1 29 ? -0.827  -0.447  -7.803  1.00 0.00 ? 66  ARG A HB2  5  
ATOM 6307  H HB3  . ARG A 1 29 ? 0.327   -0.944  -6.577  1.00 0.00 ? 66  ARG A HB3  5  
ATOM 6308  H HG2  . ARG A 1 29 ? -1.572  -1.724  -5.186  1.00 0.00 ? 66  ARG A HG2  5  
ATOM 6309  H HG3  . ARG A 1 29 ? -2.656  -1.349  -6.531  1.00 0.00 ? 66  ARG A HG3  5  
ATOM 6310  H HD2  . ARG A 1 29 ? -0.382  -3.334  -6.521  1.00 0.00 ? 66  ARG A HD2  5  
ATOM 6311  H HD3  . ARG A 1 29 ? -2.108  -3.693  -6.599  1.00 0.00 ? 66  ARG A HD3  5  
ATOM 6312  H HE   . ARG A 1 29 ? -1.767  -2.169  -8.773  1.00 0.00 ? 66  ARG A HE   5  
ATOM 6313  H HH11 . ARG A 1 29 ? 0.053   -4.935  -7.596  1.00 0.00 ? 66  ARG A HH11 5  
ATOM 6314  H HH12 . ARG A 1 29 ? 0.512   -5.446  -9.191  1.00 0.00 ? 66  ARG A HH12 5  
ATOM 6315  H HH21 . ARG A 1 29 ? -1.173  -2.868  -10.846 1.00 0.00 ? 66  ARG A HH21 5  
ATOM 6316  H HH22 . ARG A 1 29 ? -0.182  -4.291  -11.033 1.00 0.00 ? 66  ARG A HH22 5  
ATOM 6317  N N    . PRO A 1 30 ? 0.666   2.116   -7.562  1.00 0.00 ? 67  PRO A N    5  
ATOM 6318  C CA   . PRO A 1 30 ? 1.871   2.895   -7.892  1.00 0.00 ? 67  PRO A CA   5  
ATOM 6319  C C    . PRO A 1 30 ? 2.055   4.101   -6.977  1.00 0.00 ? 67  PRO A C    5  
ATOM 6320  O O    . PRO A 1 30 ? 3.176   4.461   -6.622  1.00 0.00 ? 67  PRO A O    5  
ATOM 6321  C CB   . PRO A 1 30 ? 1.639   3.354   -9.340  1.00 0.00 ? 67  PRO A CB   5  
ATOM 6322  C CG   . PRO A 1 30 ? 0.195   3.102   -9.613  1.00 0.00 ? 67  PRO A CG   5  
ATOM 6323  C CD   . PRO A 1 30 ? -0.188  1.936   -8.751  1.00 0.00 ? 67  PRO A CD   5  
ATOM 6324  H HA   . PRO A 1 30 ? 2.757   2.280   -7.848  1.00 0.00 ? 67  PRO A HA   5  
ATOM 6325  H HB2  . PRO A 1 30 ? 1.878   4.404   -9.426  1.00 0.00 ? 67  PRO A HB2  5  
ATOM 6326  H HB3  . PRO A 1 30 ? 2.271   2.782   -10.003 1.00 0.00 ? 67  PRO A HB3  5  
ATOM 6327  H HG2  . PRO A 1 30 ? -0.386  3.973   -9.348  1.00 0.00 ? 67  PRO A HG2  5  
ATOM 6328  H HG3  . PRO A 1 30 ? 0.055   2.859   -10.656 1.00 0.00 ? 67  PRO A HG3  5  
ATOM 6329  H HD2  . PRO A 1 30 ? -1.235  1.985   -8.487  1.00 0.00 ? 67  PRO A HD2  5  
ATOM 6330  H HD3  . PRO A 1 30 ? 0.035   1.006   -9.250  1.00 0.00 ? 67  PRO A HD3  5  
ATOM 6331  N N    . ALA A 1 31 ? 0.942   4.685   -6.549  1.00 0.00 ? 68  ALA A N    5  
ATOM 6332  C CA   . ALA A 1 31 ? 0.970   5.814   -5.630  1.00 0.00 ? 68  ALA A CA   5  
ATOM 6333  C C    . ALA A 1 31 ? 1.586   5.404   -4.294  1.00 0.00 ? 68  ALA A C    5  
ATOM 6334  O O    . ALA A 1 31 ? 2.450   6.101   -3.755  1.00 0.00 ? 68  ALA A O    5  
ATOM 6335  C CB   . ALA A 1 31 ? -0.434  6.357   -5.428  1.00 0.00 ? 68  ALA A CB   5  
ATOM 6336  H H    . ALA A 1 31 ? 0.077   4.313   -6.819  1.00 0.00 ? 68  ALA A H    5  
ATOM 6337  H HA   . ALA A 1 31 ? 1.574   6.594   -6.073  1.00 0.00 ? 68  ALA A HA   5  
ATOM 6338  H HB1  . ALA A 1 31 ? -0.591  7.201   -6.081  1.00 0.00 ? 68  ALA A HB1  5  
ATOM 6339  H HB2  . ALA A 1 31 ? -0.556  6.667   -4.400  1.00 0.00 ? 68  ALA A HB2  5  
ATOM 6340  H HB3  . ALA A 1 31 ? -1.154  5.585   -5.657  1.00 0.00 ? 68  ALA A HB3  5  
ATOM 6341  N N    . LEU A 1 32 ? 1.181   4.241   -3.804  1.00 0.00 ? 69  LEU A N    5  
ATOM 6342  C CA   . LEU A 1 32 ? 1.720   3.690   -2.566  1.00 0.00 ? 69  LEU A CA   5  
ATOM 6343  C C    . LEU A 1 32 ? 3.185   3.311   -2.719  1.00 0.00 ? 69  LEU A C    5  
ATOM 6344  O O    . LEU A 1 32 ? 3.999   3.601   -1.844  1.00 0.00 ? 69  LEU A O    5  
ATOM 6345  C CB   . LEU A 1 32 ? 0.917   2.461   -2.143  1.00 0.00 ? 69  LEU A CB   5  
ATOM 6346  C CG   . LEU A 1 32 ? -0.399  2.758   -1.436  1.00 0.00 ? 69  LEU A CG   5  
ATOM 6347  C CD1  . LEU A 1 32 ? -1.233  1.492   -1.326  1.00 0.00 ? 69  LEU A CD1  5  
ATOM 6348  C CD2  . LEU A 1 32 ? -0.128  3.341   -0.054  1.00 0.00 ? 69  LEU A CD2  5  
ATOM 6349  H H    . LEU A 1 32 ? 0.523   3.716   -4.311  1.00 0.00 ? 69  LEU A H    5  
ATOM 6350  H HA   . LEU A 1 32 ? 1.633   4.446   -1.800  1.00 0.00 ? 69  LEU A HA   5  
ATOM 6351  H HB2  . LEU A 1 32 ? 0.704   1.876   -3.027  1.00 0.00 ? 69  LEU A HB2  5  
ATOM 6352  H HB3  . LEU A 1 32 ? 1.528   1.867   -1.480  1.00 0.00 ? 69  LEU A HB3  5  
ATOM 6353  H HG   . LEU A 1 32 ? -0.956  3.485   -2.007  1.00 0.00 ? 69  LEU A HG   5  
ATOM 6354  H HD11 . LEU A 1 32 ? -0.624  0.692   -0.937  1.00 0.00 ? 69  LEU A HD11 5  
ATOM 6355  H HD12 . LEU A 1 32 ? -2.065  1.667   -0.661  1.00 0.00 ? 69  LEU A HD12 5  
ATOM 6356  H HD13 . LEU A 1 32 ? -1.606  1.219   -2.303  1.00 0.00 ? 69  LEU A HD13 5  
ATOM 6357  H HD21 . LEU A 1 32 ? 0.438   2.631   0.532   1.00 0.00 ? 69  LEU A HD21 5  
ATOM 6358  H HD22 . LEU A 1 32 ? 0.435   4.257   -0.152  1.00 0.00 ? 69  LEU A HD22 5  
ATOM 6359  H HD23 . LEU A 1 32 ? -1.070  3.547   0.440   1.00 0.00 ? 69  LEU A HD23 5  
ATOM 6360  N N    . LYS A 1 33 ? 3.503   2.612   -3.804  1.00 0.00 ? 70  LYS A N    5  
ATOM 6361  C CA   . LYS A 1 33 ? 4.861   2.123   -4.021  1.00 0.00 ? 70  LYS A CA   5  
ATOM 6362  C C    . LYS A 1 33 ? 5.853   3.276   -4.110  1.00 0.00 ? 70  LYS A C    5  
ATOM 6363  O O    . LYS A 1 33 ? 6.945   3.208   -3.545  1.00 0.00 ? 70  LYS A O    5  
ATOM 6364  C CB   . LYS A 1 33 ? 4.943   1.263   -5.286  1.00 0.00 ? 70  LYS A CB   5  
ATOM 6365  C CG   . LYS A 1 33 ? 3.944   0.115   -5.313  1.00 0.00 ? 70  LYS A CG   5  
ATOM 6366  C CD   . LYS A 1 33 ? 4.272   -0.923  -6.383  1.00 0.00 ? 70  LYS A CD   5  
ATOM 6367  C CE   . LYS A 1 33 ? 4.058   -0.395  -7.794  1.00 0.00 ? 70  LYS A CE   5  
ATOM 6368  N NZ   . LYS A 1 33 ? 5.184   0.457   -8.266  1.00 0.00 ? 70  LYS A NZ   5  
ATOM 6369  H H    . LYS A 1 33 ? 2.797   2.374   -4.445  1.00 0.00 ? 70  LYS A H    5  
ATOM 6370  H HA   . LYS A 1 33 ? 5.122   1.514   -3.168  1.00 0.00 ? 70  LYS A HA   5  
ATOM 6371  H HB2  . LYS A 1 33 ? 4.763   1.890   -6.146  1.00 0.00 ? 70  LYS A HB2  5  
ATOM 6372  H HB3  . LYS A 1 33 ? 5.937   0.847   -5.359  1.00 0.00 ? 70  LYS A HB3  5  
ATOM 6373  H HG2  . LYS A 1 33 ? 3.938   -0.374  -4.350  1.00 0.00 ? 70  LYS A HG2  5  
ATOM 6374  H HG3  . LYS A 1 33 ? 2.963   0.519   -5.514  1.00 0.00 ? 70  LYS A HG3  5  
ATOM 6375  H HD2  . LYS A 1 33 ? 5.308   -1.214  -6.277  1.00 0.00 ? 70  LYS A HD2  5  
ATOM 6376  H HD3  . LYS A 1 33 ? 3.640   -1.786  -6.232  1.00 0.00 ? 70  LYS A HD3  5  
ATOM 6377  H HE2  . LYS A 1 33 ? 3.952   -1.237  -8.462  1.00 0.00 ? 70  LYS A HE2  5  
ATOM 6378  H HE3  . LYS A 1 33 ? 3.147   0.187   -7.809  1.00 0.00 ? 70  LYS A HE3  5  
ATOM 6379  H HZ1  . LYS A 1 33 ? 6.097   0.037   -7.987  1.00 0.00 ? 70  LYS A HZ1  5  
ATOM 6380  H HZ2  . LYS A 1 33 ? 5.158   0.538   -9.305  1.00 0.00 ? 70  LYS A HZ2  5  
ATOM 6381  H HZ3  . LYS A 1 33 ? 5.116   1.413   -7.859  1.00 0.00 ? 70  LYS A HZ3  5  
ATOM 6382  N N    . LYS A 1 34 ? 5.445   4.359   -4.760  1.00 0.00 ? 71  LYS A N    5  
ATOM 6383  C CA   . LYS A 1 34 ? 6.285   5.538   -4.868  1.00 0.00 ? 71  LYS A CA   5  
ATOM 6384  C C    . LYS A 1 34 ? 6.460   6.171   -3.504  1.00 0.00 ? 71  LYS A C    5  
ATOM 6385  O O    . LYS A 1 34 ? 7.578   6.450   -3.073  1.00 0.00 ? 71  LYS A O    5  
ATOM 6386  C CB   . LYS A 1 34 ? 5.665   6.555   -5.820  1.00 0.00 ? 71  LYS A CB   5  
ATOM 6387  C CG   . LYS A 1 34 ? 6.479   7.833   -5.940  1.00 0.00 ? 71  LYS A CG   5  
ATOM 6388  C CD   . LYS A 1 34 ? 5.836   8.823   -6.891  1.00 0.00 ? 71  LYS A CD   5  
ATOM 6389  C CE   . LYS A 1 34 ? 6.684   10.078  -7.034  1.00 0.00 ? 71  LYS A CE   5  
ATOM 6390  N NZ   . LYS A 1 34 ? 6.782   10.842  -5.762  1.00 0.00 ? 71  LYS A NZ   5  
ATOM 6391  H H    . LYS A 1 34 ? 4.537   4.385   -5.129  1.00 0.00 ? 71  LYS A H    5  
ATOM 6392  H HA   . LYS A 1 34 ? 7.248   5.234   -5.244  1.00 0.00 ? 71  LYS A HA   5  
ATOM 6393  H HB2  . LYS A 1 34 ? 5.577   6.109   -6.794  1.00 0.00 ? 71  LYS A HB2  5  
ATOM 6394  H HB3  . LYS A 1 34 ? 4.679   6.812   -5.462  1.00 0.00 ? 71  LYS A HB3  5  
ATOM 6395  H HG2  . LYS A 1 34 ? 6.556   8.288   -4.965  1.00 0.00 ? 71  LYS A HG2  5  
ATOM 6396  H HG3  . LYS A 1 34 ? 7.465   7.587   -6.303  1.00 0.00 ? 71  LYS A HG3  5  
ATOM 6397  H HD2  . LYS A 1 34 ? 5.727   8.361   -7.862  1.00 0.00 ? 71  LYS A HD2  5  
ATOM 6398  H HD3  . LYS A 1 34 ? 4.864   9.098   -6.508  1.00 0.00 ? 71  LYS A HD3  5  
ATOM 6399  H HE2  . LYS A 1 34 ? 7.677   9.784   -7.341  1.00 0.00 ? 71  LYS A HE2  5  
ATOM 6400  H HE3  . LYS A 1 34 ? 6.246   10.707  -7.793  1.00 0.00 ? 71  LYS A HE3  5  
ATOM 6401  H HZ1  . LYS A 1 34 ? 6.158   10.423  -5.038  1.00 0.00 ? 71  LYS A HZ1  5  
ATOM 6402  H HZ2  . LYS A 1 34 ? 7.765   10.829  -5.407  1.00 0.00 ? 71  LYS A HZ2  5  
ATOM 6403  H HZ3  . LYS A 1 34 ? 6.497   11.832  -5.916  1.00 0.00 ? 71  LYS A HZ3  5  
ATOM 6404  N N    . PHE A 1 35 ? 5.336   6.364   -2.829  1.00 0.00 ? 72  PHE A N    5  
ATOM 6405  C CA   . PHE A 1 35 ? 5.311   6.951   -1.496  1.00 0.00 ? 72  PHE A CA   5  
ATOM 6406  C C    . PHE A 1 35 ? 6.290   6.233   -0.570  1.00 0.00 ? 72  PHE A C    5  
ATOM 6407  O O    . PHE A 1 35 ? 7.030   6.870   0.187   1.00 0.00 ? 72  PHE A O    5  
ATOM 6408  C CB   . PHE A 1 35 ? 3.897   6.864   -0.917  1.00 0.00 ? 72  PHE A CB   5  
ATOM 6409  C CG   . PHE A 1 35 ? 3.765   7.484   0.441   1.00 0.00 ? 72  PHE A CG   5  
ATOM 6410  C CD1  . PHE A 1 35 ? 3.440   8.821   0.575   1.00 0.00 ? 72  PHE A CD1  5  
ATOM 6411  C CD2  . PHE A 1 35 ? 3.988   6.730   1.578   1.00 0.00 ? 72  PHE A CD2  5  
ATOM 6412  C CE1  . PHE A 1 35 ? 3.330   9.399   1.827   1.00 0.00 ? 72  PHE A CE1  5  
ATOM 6413  C CE2  . PHE A 1 35 ? 3.883   7.300   2.832   1.00 0.00 ? 72  PHE A CE2  5  
ATOM 6414  C CZ   . PHE A 1 35 ? 3.557   8.638   2.957   1.00 0.00 ? 72  PHE A CZ   5  
ATOM 6415  H H    . PHE A 1 35 ? 4.486   6.101   -3.249  1.00 0.00 ? 72  PHE A H    5  
ATOM 6416  H HA   . PHE A 1 35 ? 5.598   7.988   -1.582  1.00 0.00 ? 72  PHE A HA   5  
ATOM 6417  H HB2  . PHE A 1 35 ? 3.212   7.371   -1.579  1.00 0.00 ? 72  PHE A HB2  5  
ATOM 6418  H HB3  . PHE A 1 35 ? 3.610   5.826   -0.838  1.00 0.00 ? 72  PHE A HB3  5  
ATOM 6419  H HD1  . PHE A 1 35 ? 3.265   9.415   -0.311  1.00 0.00 ? 72  PHE A HD1  5  
ATOM 6420  H HD2  . PHE A 1 35 ? 4.243   5.684   1.474   1.00 0.00 ? 72  PHE A HD2  5  
ATOM 6421  H HE1  . PHE A 1 35 ? 3.072   10.445  1.921   1.00 0.00 ? 72  PHE A HE1  5  
ATOM 6422  H HE2  . PHE A 1 35 ? 4.059   6.700   3.714   1.00 0.00 ? 72  PHE A HE2  5  
ATOM 6423  H HZ   . PHE A 1 35 ? 3.471   9.086   3.937   1.00 0.00 ? 72  PHE A HZ   5  
ATOM 6424  N N    . ILE A 1 36 ? 6.276   4.907   -0.625  1.00 0.00 ? 73  ILE A N    5  
ATOM 6425  C CA   . ILE A 1 36 ? 7.148   4.102   0.212   1.00 0.00 ? 73  ILE A CA   5  
ATOM 6426  C C    . ILE A 1 36 ? 8.610   4.339   -0.139  1.00 0.00 ? 73  ILE A C    5  
ATOM 6427  O O    . ILE A 1 36 ? 9.435   4.527   0.742   1.00 0.00 ? 73  ILE A O    5  
ATOM 6428  C CB   . ILE A 1 36 ? 6.822   2.598   0.102   1.00 0.00 ? 73  ILE A CB   5  
ATOM 6429  C CG1  . ILE A 1 36 ? 5.420   2.320   0.652   1.00 0.00 ? 73  ILE A CG1  5  
ATOM 6430  C CG2  . ILE A 1 36 ? 7.860   1.771   0.845   1.00 0.00 ? 73  ILE A CG2  5  
ATOM 6431  C CD1  . ILE A 1 36 ? 5.012   0.865   0.573   1.00 0.00 ? 73  ILE A CD1  5  
ATOM 6432  H H    . ILE A 1 36 ? 5.657   4.459   -1.244  1.00 0.00 ? 73  ILE A H    5  
ATOM 6433  H HA   . ILE A 1 36 ? 6.988   4.404   1.237   1.00 0.00 ? 73  ILE A HA   5  
ATOM 6434  H HB   . ILE A 1 36 ? 6.855   2.322   -0.941  1.00 0.00 ? 73  ILE A HB   5  
ATOM 6435  H HG12 . ILE A 1 36 ? 5.385   2.615   1.688   1.00 0.00 ? 73  ILE A HG12 5  
ATOM 6436  H HG13 . ILE A 1 36 ? 4.700   2.897   0.092   1.00 0.00 ? 73  ILE A HG13 5  
ATOM 6437  H HG21 . ILE A 1 36 ? 8.531   2.430   1.379   1.00 0.00 ? 73  ILE A HG21 5  
ATOM 6438  H HG22 . ILE A 1 36 ? 7.364   1.117   1.545   1.00 0.00 ? 73  ILE A HG22 5  
ATOM 6439  H HG23 . ILE A 1 36 ? 8.423   1.181   0.135   1.00 0.00 ? 73  ILE A HG23 5  
ATOM 6440  H HD11 . ILE A 1 36 ? 5.670   0.343   -0.106  1.00 0.00 ? 73  ILE A HD11 5  
ATOM 6441  H HD12 . ILE A 1 36 ? 5.081   0.419   1.554   1.00 0.00 ? 73  ILE A HD12 5  
ATOM 6442  H HD13 . ILE A 1 36 ? 3.996   0.796   0.215   1.00 0.00 ? 73  ILE A HD13 5  
ATOM 6443  N N    . LYS A 1 37 ? 8.920   4.382   -1.426  1.00 0.00 ? 74  LYS A N    5  
ATOM 6444  C CA   . LYS A 1 37 ? 10.288  4.627   -1.868  1.00 0.00 ? 74  LYS A CA   5  
ATOM 6445  C C    . LYS A 1 37 ? 10.770  6.015   -1.456  1.00 0.00 ? 74  LYS A C    5  
ATOM 6446  O O    . LYS A 1 37 ? 11.954  6.214   -1.193  1.00 0.00 ? 74  LYS A O    5  
ATOM 6447  C CB   . LYS A 1 37 ? 10.407  4.460   -3.380  1.00 0.00 ? 74  LYS A CB   5  
ATOM 6448  C CG   . LYS A 1 37 ? 10.091  3.053   -3.853  1.00 0.00 ? 74  LYS A CG   5  
ATOM 6449  C CD   . LYS A 1 37 ? 10.428  2.872   -5.320  1.00 0.00 ? 74  LYS A CD   5  
ATOM 6450  C CE   . LYS A 1 37 ? 10.147  1.454   -5.782  1.00 0.00 ? 74  LYS A CE   5  
ATOM 6451  N NZ   . LYS A 1 37 ? 10.679  1.194   -7.145  1.00 0.00 ? 74  LYS A NZ   5  
ATOM 6452  H H    . LYS A 1 37 ? 8.210   4.261   -2.097  1.00 0.00 ? 74  LYS A H    5  
ATOM 6453  H HA   . LYS A 1 37 ? 10.919  3.897   -1.390  1.00 0.00 ? 74  LYS A HA   5  
ATOM 6454  H HB2  . LYS A 1 37 ? 9.725   5.142   -3.863  1.00 0.00 ? 74  LYS A HB2  5  
ATOM 6455  H HB3  . LYS A 1 37 ? 11.416  4.699   -3.681  1.00 0.00 ? 74  LYS A HB3  5  
ATOM 6456  H HG2  . LYS A 1 37 ? 10.672  2.351   -3.272  1.00 0.00 ? 74  LYS A HG2  5  
ATOM 6457  H HG3  . LYS A 1 37 ? 9.038   2.861   -3.707  1.00 0.00 ? 74  LYS A HG3  5  
ATOM 6458  H HD2  . LYS A 1 37 ? 9.829   3.555   -5.905  1.00 0.00 ? 74  LYS A HD2  5  
ATOM 6459  H HD3  . LYS A 1 37 ? 11.477  3.090   -5.466  1.00 0.00 ? 74  LYS A HD3  5  
ATOM 6460  H HE2  . LYS A 1 37 ? 10.607  0.766   -5.087  1.00 0.00 ? 74  LYS A HE2  5  
ATOM 6461  H HE3  . LYS A 1 37 ? 9.078   1.295   -5.787  1.00 0.00 ? 74  LYS A HE3  5  
ATOM 6462  H HZ1  . LYS A 1 37 ? 11.633  1.605   -7.244  1.00 0.00 ? 74  LYS A HZ1  5  
ATOM 6463  H HZ2  . LYS A 1 37 ? 10.735  0.167   -7.317  1.00 0.00 ? 74  LYS A HZ2  5  
ATOM 6464  H HZ3  . LYS A 1 37 ? 10.052  1.620   -7.864  1.00 0.00 ? 74  LYS A HZ3  5  
ATOM 6465  N N    . GLU A 1 38 ? 9.862   6.977   -1.450  1.00 0.00 ? 75  GLU A N    5  
ATOM 6466  C CA   . GLU A 1 38 ? 10.204  8.352   -1.105  1.00 0.00 ? 75  GLU A CA   5  
ATOM 6467  C C    . GLU A 1 38 ? 10.536  8.483   0.383   1.00 0.00 ? 75  GLU A C    5  
ATOM 6468  O O    . GLU A 1 38 ? 11.400  9.270   0.772   1.00 0.00 ? 75  GLU A O    5  
ATOM 6469  C CB   . GLU A 1 38 ? 9.043   9.287   -1.459  1.00 0.00 ? 75  GLU A CB   5  
ATOM 6470  C CG   . GLU A 1 38 ? 8.645   9.254   -2.929  1.00 0.00 ? 75  GLU A CG   5  
ATOM 6471  C CD   . GLU A 1 38 ? 9.644   9.932   -3.840  1.00 0.00 ? 75  GLU A CD   5  
ATOM 6472  O OE1  . GLU A 1 38 ? 10.826  9.524   -3.829  1.00 0.00 ? 75  GLU A OE1  5  
ATOM 6473  O OE2  . GLU A 1 38 ? 9.264   10.881  -4.557  1.00 0.00 ? 75  GLU A OE2  5  
ATOM 6474  H H    . GLU A 1 38 ? 8.937   6.764   -1.712  1.00 0.00 ? 75  GLU A H    5  
ATOM 6475  H HA   . GLU A 1 38 ? 11.071  8.634   -1.683  1.00 0.00 ? 75  GLU A HA   5  
ATOM 6476  H HB2  . GLU A 1 38 ? 8.181   9.008   -0.872  1.00 0.00 ? 75  GLU A HB2  5  
ATOM 6477  H HB3  . GLU A 1 38 ? 9.324   10.300  -1.208  1.00 0.00 ? 75  GLU A HB3  5  
ATOM 6478  H HG2  . GLU A 1 38 ? 8.548   8.225   -3.238  1.00 0.00 ? 75  GLU A HG2  5  
ATOM 6479  H HG3  . GLU A 1 38 ? 7.688   9.747   -3.038  1.00 0.00 ? 75  GLU A HG3  5  
ATOM 6480  N N    . ASN A 1 39 ? 9.750   7.816   1.218   1.00 0.00 ? 76  ASN A N    5  
ATOM 6481  C CA   . ASN A 1 39 ? 9.852   7.988   2.667   1.00 0.00 ? 76  ASN A CA   5  
ATOM 6482  C C    . ASN A 1 39 ? 10.638  6.864   3.337   1.00 0.00 ? 76  ASN A C    5  
ATOM 6483  O O    . ASN A 1 39 ? 11.302  7.082   4.350   1.00 0.00 ? 76  ASN A O    5  
ATOM 6484  C CB   . ASN A 1 39 ? 8.455   8.094   3.274   1.00 0.00 ? 76  ASN A CB   5  
ATOM 6485  C CG   . ASN A 1 39 ? 7.750   9.368   2.853   1.00 0.00 ? 76  ASN A CG   5  
ATOM 6486  O OD1  . ASN A 1 39 ? 8.135   10.467  3.252   1.00 0.00 ? 76  ASN A OD1  5  
ATOM 6487  N ND2  . ASN A 1 39 ? 6.739   9.234   2.013   1.00 0.00 ? 76  ASN A ND2  5  
ATOM 6488  H H    . ASN A 1 39 ? 9.014   7.279   0.851   1.00 0.00 ? 76  ASN A H    5  
ATOM 6489  H HA   . ASN A 1 39 ? 10.373  8.916   2.846   1.00 0.00 ? 76  ASN A HA   5  
ATOM 6490  H HB2  . ASN A 1 39 ? 7.863   7.253   2.949   1.00 0.00 ? 76  ASN A HB2  5  
ATOM 6491  H HB3  . ASN A 1 39 ? 8.531   8.081   4.350   1.00 0.00 ? 76  ASN A HB3  5  
ATOM 6492  H HD21 . ASN A 1 39 ? 6.504   8.331   1.709   1.00 0.00 ? 76  ASN A HD21 5  
ATOM 6493  H HD22 . ASN A 1 39 ? 6.262   10.048  1.725   1.00 0.00 ? 76  ASN A HD22 5  
ATOM 6494  N N    . TYR A 1 40 ? 10.534  5.658   2.798   1.00 0.00 ? 77  TYR A N    5  
ATOM 6495  C CA   . TYR A 1 40 ? 11.219  4.499   3.362   1.00 0.00 ? 77  TYR A CA   5  
ATOM 6496  C C    . TYR A 1 40 ? 11.994  3.744   2.278   1.00 0.00 ? 77  TYR A C    5  
ATOM 6497  O O    . TYR A 1 40 ? 11.647  2.613   1.931   1.00 0.00 ? 77  TYR A O    5  
ATOM 6498  C CB   . TYR A 1 40 ? 10.220  3.541   4.029   1.00 0.00 ? 77  TYR A CB   5  
ATOM 6499  C CG   . TYR A 1 40 ? 9.407   4.150   5.152   1.00 0.00 ? 77  TYR A CG   5  
ATOM 6500  C CD1  . TYR A 1 40 ? 8.306   4.954   4.883   1.00 0.00 ? 77  TYR A CD1  5  
ATOM 6501  C CD2  . TYR A 1 40 ? 9.729   3.905   6.481   1.00 0.00 ? 77  TYR A CD2  5  
ATOM 6502  C CE1  . TYR A 1 40 ? 7.554   5.502   5.904   1.00 0.00 ? 77  TYR A CE1  5  
ATOM 6503  C CE2  . TYR A 1 40 ? 8.981   4.447   7.509   1.00 0.00 ? 77  TYR A CE2  5  
ATOM 6504  C CZ   . TYR A 1 40 ? 7.896   5.246   7.216   1.00 0.00 ? 77  TYR A CZ   5  
ATOM 6505  O OH   . TYR A 1 40 ? 7.151   5.794   8.237   1.00 0.00 ? 77  TYR A OH   5  
ATOM 6506  H H    . TYR A 1 40 ? 9.980   5.538   1.995   1.00 0.00 ? 77  TYR A H    5  
ATOM 6507  H HA   . TYR A 1 40 ? 11.917  4.855   4.106   1.00 0.00 ? 77  TYR A HA   5  
ATOM 6508  H HB2  . TYR A 1 40 ? 9.526   3.187   3.282   1.00 0.00 ? 77  TYR A HB2  5  
ATOM 6509  H HB3  . TYR A 1 40 ? 10.760  2.698   4.434   1.00 0.00 ? 77  TYR A HB3  5  
ATOM 6510  H HD1  . TYR A 1 40 ? 8.039   5.152   3.855   1.00 0.00 ? 77  TYR A HD1  5  
ATOM 6511  H HD2  . TYR A 1 40 ? 10.581  3.282   6.708   1.00 0.00 ? 77  TYR A HD2  5  
ATOM 6512  H HE1  . TYR A 1 40 ? 6.705   6.125   5.674   1.00 0.00 ? 77  TYR A HE1  5  
ATOM 6513  H HE2  . TYR A 1 40 ? 9.248   4.244   8.536   1.00 0.00 ? 77  TYR A HE2  5  
ATOM 6514  H HH   . TYR A 1 40 ? 6.799   5.080   8.799   1.00 0.00 ? 77  TYR A HH   5  
ATOM 6515  N N    . PRO A 1 41 ? 13.058  4.359   1.723   1.00 0.00 ? 78  PRO A N    5  
ATOM 6516  C CA   . PRO A 1 41 ? 13.874  3.754   0.654   1.00 0.00 ? 78  PRO A CA   5  
ATOM 6517  C C    . PRO A 1 41 ? 14.479  2.412   1.054   1.00 0.00 ? 78  PRO A C    5  
ATOM 6518  O O    . PRO A 1 41 ? 14.860  1.617   0.194   1.00 0.00 ? 78  PRO A O    5  
ATOM 6519  C CB   . PRO A 1 41 ? 14.981  4.781   0.418   1.00 0.00 ? 78  PRO A CB   5  
ATOM 6520  C CG   . PRO A 1 41 ? 14.421  6.065   0.913   1.00 0.00 ? 78  PRO A CG   5  
ATOM 6521  C CD   . PRO A 1 41 ? 13.543  5.705   2.073   1.00 0.00 ? 78  PRO A CD   5  
ATOM 6522  H HA   . PRO A 1 41 ? 13.301  3.630   -0.253  1.00 0.00 ? 78  PRO A HA   5  
ATOM 6523  H HB2  . PRO A 1 41 ? 15.866  4.493   0.971   1.00 0.00 ? 78  PRO A HB2  5  
ATOM 6524  H HB3  . PRO A 1 41 ? 15.210  4.828   -0.637  1.00 0.00 ? 78  PRO A HB3  5  
ATOM 6525  H HG2  . PRO A 1 41 ? 15.219  6.717   1.234   1.00 0.00 ? 78  PRO A HG2  5  
ATOM 6526  H HG3  . PRO A 1 41 ? 13.839  6.535   0.135   1.00 0.00 ? 78  PRO A HG3  5  
ATOM 6527  H HD2  . PRO A 1 41 ? 14.115  5.683   2.989   1.00 0.00 ? 78  PRO A HD2  5  
ATOM 6528  H HD3  . PRO A 1 41 ? 12.720  6.400   2.156   1.00 0.00 ? 78  PRO A HD3  5  
ATOM 6529  N N    . ILE A 1 42 ? 14.551  2.168   2.359   1.00 0.00 ? 79  ILE A N    5  
ATOM 6530  C CA   . ILE A 1 42 ? 15.048  0.901   2.899   1.00 0.00 ? 79  ILE A CA   5  
ATOM 6531  C C    . ILE A 1 42 ? 14.326  -0.257  2.242   1.00 0.00 ? 79  ILE A C    5  
ATOM 6532  O O    . ILE A 1 42 ? 14.922  -1.128  1.607   1.00 0.00 ? 79  ILE A O    5  
ATOM 6533  C CB   . ILE A 1 42 ? 14.771  0.788   4.417   1.00 0.00 ? 79  ILE A CB   5  
ATOM 6534  C CG1  . ILE A 1 42 ? 15.232  2.043   5.173   1.00 0.00 ? 79  ILE A CG1  5  
ATOM 6535  C CG2  . ILE A 1 42 ? 15.448  -0.450  4.992   1.00 0.00 ? 79  ILE A CG2  5  
ATOM 6536  C CD1  . ILE A 1 42 ? 14.210  3.160   5.215   1.00 0.00 ? 79  ILE A CD1  5  
ATOM 6537  H H    . ILE A 1 42 ? 14.222  2.850   2.979   1.00 0.00 ? 79  ILE A H    5  
ATOM 6538  H HA   . ILE A 1 42 ? 16.110  0.830   2.722   1.00 0.00 ? 79  ILE A HA   5  
ATOM 6539  H HB   . ILE A 1 42 ? 13.695  0.670   4.539   1.00 0.00 ? 79  ILE A HB   5  
ATOM 6540  H HG12 . ILE A 1 42 ? 15.465  1.773   6.191   1.00 0.00 ? 79  ILE A HG12 5  
ATOM 6541  H HG13 . ILE A 1 42 ? 16.123  2.429   4.697   1.00 0.00 ? 79  ILE A HG13 5  
ATOM 6542  H HG21 . ILE A 1 42 ? 15.975  -0.972  4.205   1.00 0.00 ? 79  ILE A HG21 5  
ATOM 6543  H HG22 . ILE A 1 42 ? 16.148  -0.157  5.760   1.00 0.00 ? 79  ILE A HG22 5  
ATOM 6544  H HG23 . ILE A 1 42 ? 14.700  -1.104  5.417   1.00 0.00 ? 79  ILE A HG23 5  
ATOM 6545  H HD11 . ILE A 1 42 ? 13.260  2.795   4.849   1.00 0.00 ? 79  ILE A HD11 5  
ATOM 6546  H HD12 . ILE A 1 42 ? 14.096  3.503   6.234   1.00 0.00 ? 79  ILE A HD12 5  
ATOM 6547  H HD13 . ILE A 1 42 ? 14.544  3.978   4.593   1.00 0.00 ? 79  ILE A HD13 5  
ATOM 6548  N N    . VAL A 1 43 ? 13.020  -0.206  2.380   1.00 0.00 ? 80  VAL A N    5  
ATOM 6549  C CA   . VAL A 1 43 ? 12.130  -1.183  1.805   1.00 0.00 ? 80  VAL A CA   5  
ATOM 6550  C C    . VAL A 1 43 ? 11.813  -0.811  0.366   1.00 0.00 ? 80  VAL A C    5  
ATOM 6551  O O    . VAL A 1 43 ? 11.625  -1.676  -0.485  1.00 0.00 ? 80  VAL A O    5  
ATOM 6552  C CB   . VAL A 1 43 ? 10.847  -1.257  2.646   1.00 0.00 ? 80  VAL A CB   5  
ATOM 6553  C CG1  . VAL A 1 43 ? 9.624   -1.089  1.798   1.00 0.00 ? 80  VAL A CG1  5  
ATOM 6554  C CG2  . VAL A 1 43 ? 10.774  -2.551  3.425   1.00 0.00 ? 80  VAL A CG2  5  
ATOM 6555  H H    . VAL A 1 43 ? 12.631  0.556   2.857   1.00 0.00 ? 80  VAL A H    5  
ATOM 6556  H HA   . VAL A 1 43 ? 12.608  -2.146  1.826   1.00 0.00 ? 80  VAL A HA   5  
ATOM 6557  H HB   . VAL A 1 43 ? 10.872  -0.446  3.343   1.00 0.00 ? 80  VAL A HB   5  
ATOM 6558  H HG11 . VAL A 1 43 ? 9.783   -1.582  0.851   1.00 0.00 ? 80  VAL A HG11 5  
ATOM 6559  H HG12 . VAL A 1 43 ? 8.775   -1.523  2.299   1.00 0.00 ? 80  VAL A HG12 5  
ATOM 6560  H HG13 . VAL A 1 43 ? 9.456   -0.036  1.638   1.00 0.00 ? 80  VAL A HG13 5  
ATOM 6561  H HG21 . VAL A 1 43 ? 11.756  -2.994  3.483   1.00 0.00 ? 80  VAL A HG21 5  
ATOM 6562  H HG22 . VAL A 1 43 ? 10.406  -2.350  4.421   1.00 0.00 ? 80  VAL A HG22 5  
ATOM 6563  H HG23 . VAL A 1 43 ? 10.099  -3.229  2.922   1.00 0.00 ? 80  VAL A HG23 5  
ATOM 6564  N N    . GLY A 1 44 ? 11.707  0.487   0.118   1.00 0.00 ? 81  GLY A N    5  
ATOM 6565  C CA   . GLY A 1 44 ? 11.366  0.961   -1.202  1.00 0.00 ? 81  GLY A CA   5  
ATOM 6566  C C    . GLY A 1 44 ? 12.277  0.395   -2.276  1.00 0.00 ? 81  GLY A C    5  
ATOM 6567  O O    . GLY A 1 44 ? 11.819  -0.008  -3.345  1.00 0.00 ? 81  GLY A O    5  
ATOM 6568  H H    . GLY A 1 44 ? 11.796  1.128   0.862   1.00 0.00 ? 81  GLY A H    5  
ATOM 6569  H HA2  . GLY A 1 44 ? 10.347  0.674   -1.411  1.00 0.00 ? 81  GLY A HA2  5  
ATOM 6570  H HA3  . GLY A 1 44 ? 11.436  2.036   -1.215  1.00 0.00 ? 81  GLY A HA3  5  
ATOM 6571  N N    . SER A 1 45 ? 13.565  0.314   -1.969  1.00 0.00 ? 82  SER A N    5  
ATOM 6572  C CA   . SER A 1 45 ? 14.531  -0.251  -2.893  1.00 0.00 ? 82  SER A CA   5  
ATOM 6573  C C    . SER A 1 45 ? 14.901  -1.679  -2.474  1.00 0.00 ? 82  SER A C    5  
ATOM 6574  O O    . SER A 1 45 ? 15.986  -2.171  -2.793  1.00 0.00 ? 82  SER A O    5  
ATOM 6575  C CB   . SER A 1 45 ? 15.779  0.638   -2.951  1.00 0.00 ? 82  SER A CB   5  
ATOM 6576  O OG   . SER A 1 45 ? 16.497  0.453   -4.162  1.00 0.00 ? 82  SER A OG   5  
ATOM 6577  H H    . SER A 1 45 ? 13.869  0.617   -1.086  1.00 0.00 ? 82  SER A H    5  
ATOM 6578  H HA   . SER A 1 45 ? 14.074  -0.283  -3.872  1.00 0.00 ? 82  SER A HA   5  
ATOM 6579  H HB2  . SER A 1 45 ? 15.482  1.675   -2.881  1.00 0.00 ? 82  SER A HB2  5  
ATOM 6580  H HB3  . SER A 1 45 ? 16.428  0.396   -2.123  1.00 0.00 ? 82  SER A HB3  5  
ATOM 6581  H HG   . SER A 1 45 ? 15.879  0.217   -4.871  1.00 0.00 ? 82  SER A HG   5  
ATOM 6582  N N    . ALA A 1 46 ? 13.959  -2.372  -1.843  1.00 0.00 ? 83  ALA A N    5  
ATOM 6583  C CA   . ALA A 1 46 ? 14.160  -3.765  -1.471  1.00 0.00 ? 83  ALA A CA   5  
ATOM 6584  C C    . ALA A 1 46 ? 14.051  -4.652  -2.704  1.00 0.00 ? 83  ALA A C    5  
ATOM 6585  O O    . ALA A 1 46 ? 13.364  -4.302  -3.667  1.00 0.00 ? 83  ALA A O    5  
ATOM 6586  C CB   . ALA A 1 46 ? 13.165  -4.197  -0.400  1.00 0.00 ? 83  ALA A CB   5  
ATOM 6587  H H    . ALA A 1 46 ? 13.081  -1.957  -1.685  1.00 0.00 ? 83  ALA A H    5  
ATOM 6588  H HA   . ALA A 1 46 ? 15.157  -3.856  -1.063  1.00 0.00 ? 83  ALA A HA   5  
ATOM 6589  H HB1  . ALA A 1 46 ? 12.857  -3.335  0.178   1.00 0.00 ? 83  ALA A HB1  5  
ATOM 6590  H HB2  . ALA A 1 46 ? 12.299  -4.643  -0.869  1.00 0.00 ? 83  ALA A HB2  5  
ATOM 6591  H HB3  . ALA A 1 46 ? 13.629  -4.920  0.254   1.00 0.00 ? 83  ALA A HB3  5  
ATOM 6592  N N    . SER A 1 47 ? 14.835  -5.722  -2.724  1.00 0.00 ? 84  SER A N    5  
ATOM 6593  C CA   . SER A 1 47 ? 14.929  -6.591  -3.890  1.00 0.00 ? 84  SER A CA   5  
ATOM 6594  C C    . SER A 1 47 ? 13.578  -7.198  -4.266  1.00 0.00 ? 84  SER A C    5  
ATOM 6595  O O    . SER A 1 47 ? 13.273  -7.361  -5.445  1.00 0.00 ? 84  SER A O    5  
ATOM 6596  C CB   . SER A 1 47 ? 15.946  -7.701  -3.622  1.00 0.00 ? 84  SER A CB   5  
ATOM 6597  O OG   . SER A 1 47 ? 17.162  -7.164  -3.116  1.00 0.00 ? 84  SER A OG   5  
ATOM 6598  H H    . SER A 1 47 ? 15.446  -5.875  -1.968  1.00 0.00 ? 84  SER A H    5  
ATOM 6599  H HA   . SER A 1 47 ? 15.274  -5.992  -4.716  1.00 0.00 ? 84  SER A HA   5  
ATOM 6600  H HB2  . SER A 1 47 ? 15.542  -8.390  -2.897  1.00 0.00 ? 84  SER A HB2  5  
ATOM 6601  H HB3  . SER A 1 47 ? 16.153  -8.225  -4.544  1.00 0.00 ? 84  SER A HB3  5  
ATOM 6602  H HG   . SER A 1 47 ? 17.446  -6.429  -3.675  1.00 0.00 ? 84  SER A HG   5  
ATOM 6603  N N    . ASN A 1 48 ? 12.775  -7.539  -3.272  1.00 0.00 ? 85  ASN A N    5  
ATOM 6604  C CA   . ASN A 1 48 ? 11.470  -8.123  -3.533  1.00 0.00 ? 85  ASN A CA   5  
ATOM 6605  C C    . ASN A 1 48 ? 10.376  -7.203  -3.029  1.00 0.00 ? 85  ASN A C    5  
ATOM 6606  O O    . ASN A 1 48 ? 9.319   -7.657  -2.595  1.00 0.00 ? 85  ASN A O    5  
ATOM 6607  C CB   . ASN A 1 48 ? 11.342  -9.491  -2.863  1.00 0.00 ? 85  ASN A CB   5  
ATOM 6608  C CG   . ASN A 1 48 ? 12.395  -10.478 -3.327  1.00 0.00 ? 85  ASN A CG   5  
ATOM 6609  O OD1  . ASN A 1 48 ? 12.487  -10.799 -4.514  1.00 0.00 ? 85  ASN A OD1  5  
ATOM 6610  N ND2  . ASN A 1 48 ? 13.192  -10.970 -2.392  1.00 0.00 ? 85  ASN A ND2  5  
ATOM 6611  H H    . ASN A 1 48 ? 13.054  -7.376  -2.343  1.00 0.00 ? 85  ASN A H    5  
ATOM 6612  H HA   . ASN A 1 48 ? 11.363  -8.240  -4.603  1.00 0.00 ? 85  ASN A HA   5  
ATOM 6613  H HB2  . ASN A 1 48 ? 11.437  -9.371  -1.795  1.00 0.00 ? 85  ASN A HB2  5  
ATOM 6614  H HB3  . ASN A 1 48 ? 10.367  -9.899  -3.091  1.00 0.00 ? 85  ASN A HB3  5  
ATOM 6615  H HD21 . ASN A 1 48 ? 13.057  -10.674 -1.466  1.00 0.00 ? 85  ASN A HD21 5  
ATOM 6616  H HD22 . ASN A 1 48 ? 13.895  -11.607 -2.661  1.00 0.00 ? 85  ASN A HD22 5  
ATOM 6617  N N    . PHE A 1 49 ? 10.637  -5.905  -3.096  1.00 0.00 ? 86  PHE A N    5  
ATOM 6618  C CA   . PHE A 1 49 ? 9.694   -4.897  -2.628  1.00 0.00 ? 86  PHE A CA   5  
ATOM 6619  C C    . PHE A 1 49 ? 8.342   -5.042  -3.311  1.00 0.00 ? 86  PHE A C    5  
ATOM 6620  O O    . PHE A 1 49 ? 7.301   -4.999  -2.661  1.00 0.00 ? 86  PHE A O    5  
ATOM 6621  C CB   . PHE A 1 49 ? 10.242  -3.494  -2.897  1.00 0.00 ? 86  PHE A CB   5  
ATOM 6622  C CG   . PHE A 1 49 ? 9.249   -2.407  -2.613  1.00 0.00 ? 86  PHE A CG   5  
ATOM 6623  C CD1  . PHE A 1 49 ? 8.706   -2.273  -1.351  1.00 0.00 ? 86  PHE A CD1  5  
ATOM 6624  C CD2  . PHE A 1 49 ? 8.845   -1.535  -3.611  1.00 0.00 ? 86  PHE A CD2  5  
ATOM 6625  C CE1  . PHE A 1 49 ? 7.779   -1.291  -1.080  1.00 0.00 ? 86  PHE A CE1  5  
ATOM 6626  C CE2  . PHE A 1 49 ? 7.916   -0.547  -3.347  1.00 0.00 ? 86  PHE A CE2  5  
ATOM 6627  C CZ   . PHE A 1 49 ? 7.383   -0.424  -2.079  1.00 0.00 ? 86  PHE A CZ   5  
ATOM 6628  H H    . PHE A 1 49 ? 11.499  -5.613  -3.466  1.00 0.00 ? 86  PHE A H    5  
ATOM 6629  H HA   . PHE A 1 49 ? 9.565   -5.029  -1.563  1.00 0.00 ? 86  PHE A HA   5  
ATOM 6630  H HB2  . PHE A 1 49 ? 11.107  -3.325  -2.271  1.00 0.00 ? 86  PHE A HB2  5  
ATOM 6631  H HB3  . PHE A 1 49 ? 10.532  -3.420  -3.934  1.00 0.00 ? 86  PHE A HB3  5  
ATOM 6632  H HD1  . PHE A 1 49 ? 9.015   -2.948  -0.569  1.00 0.00 ? 86  PHE A HD1  5  
ATOM 6633  H HD2  . PHE A 1 49 ? 9.264   -1.631  -4.602  1.00 0.00 ? 86  PHE A HD2  5  
ATOM 6634  H HE1  . PHE A 1 49 ? 7.367   -1.202  -0.084  1.00 0.00 ? 86  PHE A HE1  5  
ATOM 6635  H HE2  . PHE A 1 49 ? 7.608   0.126   -4.132  1.00 0.00 ? 86  PHE A HE2  5  
ATOM 6636  H HZ   . PHE A 1 49 ? 6.657   0.348   -1.870  1.00 0.00 ? 86  PHE A HZ   5  
ATOM 6637  N N    . ASP A 1 50 ? 8.374   -5.163  -4.627  1.00 0.00 ? 87  ASP A N    5  
ATOM 6638  C CA   . ASP A 1 50 ? 7.148   -5.229  -5.423  1.00 0.00 ? 87  ASP A CA   5  
ATOM 6639  C C    . ASP A 1 50 ? 6.304   -6.439  -5.042  1.00 0.00 ? 87  ASP A C    5  
ATOM 6640  O O    . ASP A 1 50 ? 5.090   -6.334  -4.856  1.00 0.00 ? 87  ASP A O    5  
ATOM 6641  C CB   . ASP A 1 50 ? 7.477   -5.269  -6.917  1.00 0.00 ? 87  ASP A CB   5  
ATOM 6642  C CG   . ASP A 1 50 ? 7.899   -3.917  -7.453  1.00 0.00 ? 87  ASP A CG   5  
ATOM 6643  O OD1  . ASP A 1 50 ? 7.043   -3.007  -7.530  1.00 0.00 ? 87  ASP A OD1  5  
ATOM 6644  O OD2  . ASP A 1 50 ? 9.084   -3.760  -7.806  1.00 0.00 ? 87  ASP A OD2  5  
ATOM 6645  H H    . ASP A 1 50 ? 9.251   -5.170  -5.082  1.00 0.00 ? 87  ASP A H    5  
ATOM 6646  H HA   . ASP A 1 50 ? 6.578   -4.332  -5.216  1.00 0.00 ? 87  ASP A HA   5  
ATOM 6647  H HB2  . ASP A 1 50 ? 8.281   -5.969  -7.086  1.00 0.00 ? 87  ASP A HB2  5  
ATOM 6648  H HB3  . ASP A 1 50 ? 6.602   -5.593  -7.463  1.00 0.00 ? 87  ASP A HB3  5  
ATOM 6649  N N    . LEU A 1 51 ? 6.959   -7.580  -4.886  1.00 0.00 ? 88  LEU A N    5  
ATOM 6650  C CA   . LEU A 1 51 ? 6.282   -8.810  -4.498  1.00 0.00 ? 88  LEU A CA   5  
ATOM 6651  C C    . LEU A 1 51 ? 5.731   -8.680  -3.081  1.00 0.00 ? 88  LEU A C    5  
ATOM 6652  O O    . LEU A 1 51 ? 4.569   -9.005  -2.815  1.00 0.00 ? 88  LEU A O    5  
ATOM 6653  C CB   . LEU A 1 51 ? 7.257   -9.999  -4.614  1.00 0.00 ? 88  LEU A CB   5  
ATOM 6654  C CG   . LEU A 1 51 ? 6.696   -11.395 -4.294  1.00 0.00 ? 88  LEU A CG   5  
ATOM 6655  C CD1  . LEU A 1 51 ? 6.863   -11.727 -2.822  1.00 0.00 ? 88  LEU A CD1  5  
ATOM 6656  C CD2  . LEU A 1 51 ? 5.233   -11.495 -4.692  1.00 0.00 ? 88  LEU A CD2  5  
ATOM 6657  H H    . LEU A 1 51 ? 7.935   -7.592  -5.017  1.00 0.00 ? 88  LEU A H    5  
ATOM 6658  H HA   . LEU A 1 51 ? 5.458   -8.962  -5.178  1.00 0.00 ? 88  LEU A HA   5  
ATOM 6659  H HB2  . LEU A 1 51 ? 7.637   -10.020 -5.624  1.00 0.00 ? 88  LEU A HB2  5  
ATOM 6660  H HB3  . LEU A 1 51 ? 8.087   -9.815  -3.947  1.00 0.00 ? 88  LEU A HB3  5  
ATOM 6661  H HG   . LEU A 1 51 ? 7.247   -12.131 -4.860  1.00 0.00 ? 88  LEU A HG   5  
ATOM 6662  H HD11 . LEU A 1 51 ? 7.903   -11.625 -2.547  1.00 0.00 ? 88  LEU A HD11 5  
ATOM 6663  H HD12 . LEU A 1 51 ? 6.265   -11.049 -2.231  1.00 0.00 ? 88  LEU A HD12 5  
ATOM 6664  H HD13 . LEU A 1 51 ? 6.541   -12.741 -2.643  1.00 0.00 ? 88  LEU A HD13 5  
ATOM 6665  H HD21 . LEU A 1 51 ? 5.089   -11.027 -5.653  1.00 0.00 ? 88  LEU A HD21 5  
ATOM 6666  H HD22 . LEU A 1 51 ? 4.944   -12.535 -4.747  1.00 0.00 ? 88  LEU A HD22 5  
ATOM 6667  H HD23 . LEU A 1 51 ? 4.630   -10.991 -3.949  1.00 0.00 ? 88  LEU A HD23 5  
ATOM 6668  N N    . TYR A 1 52 ? 6.559   -8.176  -2.186  1.00 0.00 ? 89  TYR A N    5  
ATOM 6669  C CA   . TYR A 1 52 ? 6.172   -7.994  -0.799  1.00 0.00 ? 89  TYR A CA   5  
ATOM 6670  C C    . TYR A 1 52 ? 5.010   -7.010  -0.674  1.00 0.00 ? 89  TYR A C    5  
ATOM 6671  O O    . TYR A 1 52 ? 4.086   -7.229  0.109   1.00 0.00 ? 89  TYR A O    5  
ATOM 6672  C CB   . TYR A 1 52 ? 7.366   -7.507  0.016   1.00 0.00 ? 89  TYR A CB   5  
ATOM 6673  C CG   . TYR A 1 52 ? 8.383   -8.578  0.350   1.00 0.00 ? 89  TYR A CG   5  
ATOM 6674  C CD1  . TYR A 1 52 ? 8.514   -9.719  -0.429  1.00 0.00 ? 89  TYR A CD1  5  
ATOM 6675  C CD2  . TYR A 1 52 ? 9.225   -8.437  1.443   1.00 0.00 ? 89  TYR A CD2  5  
ATOM 6676  C CE1  . TYR A 1 52 ? 9.452   -10.685 -0.131  1.00 0.00 ? 89  TYR A CE1  5  
ATOM 6677  C CE2  . TYR A 1 52 ? 10.167  -9.399  1.749   1.00 0.00 ? 89  TYR A CE2  5  
ATOM 6678  C CZ   . TYR A 1 52 ? 10.275  -10.522 0.959   1.00 0.00 ? 89  TYR A CZ   5  
ATOM 6679  O OH   . TYR A 1 52 ? 11.213  -11.482 1.259   1.00 0.00 ? 89  TYR A OH   5  
ATOM 6680  H H    . TYR A 1 52 ? 7.464   -7.912  -2.468  1.00 0.00 ? 89  TYR A H    5  
ATOM 6681  H HA   . TYR A 1 52 ? 5.856   -8.954  -0.417  1.00 0.00 ? 89  TYR A HA   5  
ATOM 6682  H HB2  . TYR A 1 52 ? 7.876   -6.736  -0.541  1.00 0.00 ? 89  TYR A HB2  5  
ATOM 6683  H HB3  . TYR A 1 52 ? 7.005   -7.094  0.938   1.00 0.00 ? 89  TYR A HB3  5  
ATOM 6684  H HD1  . TYR A 1 52 ? 7.867   -9.843  -1.281  1.00 0.00 ? 89  TYR A HD1  5  
ATOM 6685  H HD2  . TYR A 1 52 ? 9.139   -7.556  2.062   1.00 0.00 ? 89  TYR A HD2  5  
ATOM 6686  H HE1  . TYR A 1 52 ? 9.536   -11.564 -0.752  1.00 0.00 ? 89  TYR A HE1  5  
ATOM 6687  H HE2  . TYR A 1 52 ? 10.816  -9.264  2.602   1.00 0.00 ? 89  TYR A HE2  5  
ATOM 6688  H HH   . TYR A 1 52 ? 10.932  -12.332 0.883   1.00 0.00 ? 89  TYR A HH   5  
ATOM 6689  N N    . PHE A 1 53 ? 5.053   -5.945  -1.468  1.00 0.00 ? 90  PHE A N    5  
ATOM 6690  C CA   . PHE A 1 53 ? 4.000   -4.935  -1.470  1.00 0.00 ? 90  PHE A CA   5  
ATOM 6691  C C    . PHE A 1 53 ? 2.654   -5.554  -1.829  1.00 0.00 ? 90  PHE A C    5  
ATOM 6692  O O    . PHE A 1 53 ? 1.656   -5.343  -1.139  1.00 0.00 ? 90  PHE A O    5  
ATOM 6693  C CB   . PHE A 1 53 ? 4.336   -3.825  -2.469  1.00 0.00 ? 90  PHE A CB   5  
ATOM 6694  C CG   . PHE A 1 53 ? 3.230   -2.821  -2.639  1.00 0.00 ? 90  PHE A CG   5  
ATOM 6695  C CD1  . PHE A 1 53 ? 2.909   -1.949  -1.612  1.00 0.00 ? 90  PHE A CD1  5  
ATOM 6696  C CD2  . PHE A 1 53 ? 2.499   -2.762  -3.818  1.00 0.00 ? 90  PHE A CD2  5  
ATOM 6697  C CE1  . PHE A 1 53 ? 1.886   -1.035  -1.756  1.00 0.00 ? 90  PHE A CE1  5  
ATOM 6698  C CE2  . PHE A 1 53 ? 1.471   -1.851  -3.965  1.00 0.00 ? 90  PHE A CE2  5  
ATOM 6699  C CZ   . PHE A 1 53 ? 1.164   -0.988  -2.933  1.00 0.00 ? 90  PHE A CZ   5  
ATOM 6700  H H    . PHE A 1 53 ? 5.820   -5.836  -2.077  1.00 0.00 ? 90  PHE A H    5  
ATOM 6701  H HA   . PHE A 1 53 ? 3.939   -4.512  -0.480  1.00 0.00 ? 90  PHE A HA   5  
ATOM 6702  H HB2  . PHE A 1 53 ? 5.214   -3.297  -2.130  1.00 0.00 ? 90  PHE A HB2  5  
ATOM 6703  H HB3  . PHE A 1 53 ? 4.537   -4.267  -3.434  1.00 0.00 ? 90  PHE A HB3  5  
ATOM 6704  H HD1  . PHE A 1 53 ? 3.473   -1.983  -0.692  1.00 0.00 ? 90  PHE A HD1  5  
ATOM 6705  H HD2  . PHE A 1 53 ? 2.743   -3.434  -4.628  1.00 0.00 ? 90  PHE A HD2  5  
ATOM 6706  H HE1  . PHE A 1 53 ? 1.647   -0.361  -0.949  1.00 0.00 ? 90  PHE A HE1  5  
ATOM 6707  H HE2  . PHE A 1 53 ? 0.910   -1.813  -4.889  1.00 0.00 ? 90  PHE A HE2  5  
ATOM 6708  H HZ   . PHE A 1 53 ? 0.358   -0.277  -3.044  1.00 0.00 ? 90  PHE A HZ   5  
ATOM 6709  N N    . ASN A 1 54 ? 2.630   -6.301  -2.925  1.00 0.00 ? 91  ASN A N    5  
ATOM 6710  C CA   . ASN A 1 54 ? 1.400   -6.920  -3.404  1.00 0.00 ? 91  ASN A CA   5  
ATOM 6711  C C    . ASN A 1 54 ? 0.833   -7.899  -2.385  1.00 0.00 ? 91  ASN A C    5  
ATOM 6712  O O    . ASN A 1 54 ? -0.379  -7.944  -2.165  1.00 0.00 ? 91  ASN A O    5  
ATOM 6713  C CB   . ASN A 1 54 ? 1.637   -7.610  -4.746  1.00 0.00 ? 91  ASN A CB   5  
ATOM 6714  C CG   . ASN A 1 54 ? 1.592   -6.627  -5.900  1.00 0.00 ? 91  ASN A CG   5  
ATOM 6715  O OD1  . ASN A 1 54 ? 0.542   -6.054  -6.198  1.00 0.00 ? 91  ASN A OD1  5  
ATOM 6716  N ND2  . ASN A 1 54 ? 2.732   -6.401  -6.532  1.00 0.00 ? 91  ASN A ND2  5  
ATOM 6717  H H    . ASN A 1 54 ? 3.458   -6.414  -3.443  1.00 0.00 ? 91  ASN A H    5  
ATOM 6718  H HA   . ASN A 1 54 ? 0.680   -6.128  -3.548  1.00 0.00 ? 91  ASN A HA   5  
ATOM 6719  H HB2  . ASN A 1 54 ? 2.608   -8.084  -4.735  1.00 0.00 ? 91  ASN A HB2  5  
ATOM 6720  H HB3  . ASN A 1 54 ? 0.875   -8.359  -4.902  1.00 0.00 ? 91  ASN A HB3  5  
ATOM 6721  H HD21 . ASN A 1 54 ? 3.537   -6.871  -6.223  1.00 0.00 ? 91  ASN A HD21 5  
ATOM 6722  H HD22 . ASN A 1 54 ? 2.729   -5.770  -7.289  1.00 0.00 ? 91  ASN A HD22 5  
ATOM 6723  N N    . ASN A 1 55 ? 1.712   -8.639  -1.721  1.00 0.00 ? 92  ASN A N    5  
ATOM 6724  C CA   . ASN A 1 55 ? 1.287   -9.554  -0.664  1.00 0.00 ? 92  ASN A CA   5  
ATOM 6725  C C    . ASN A 1 55 ? 0.741   -8.792  0.534   1.00 0.00 ? 92  ASN A C    5  
ATOM 6726  O O    . ASN A 1 55 ? -0.221  -9.230  1.170   1.00 0.00 ? 92  ASN A O    5  
ATOM 6727  C CB   . ASN A 1 55 ? 2.430   -10.465 -0.214  1.00 0.00 ? 92  ASN A CB   5  
ATOM 6728  C CG   . ASN A 1 55 ? 2.542   -11.718 -1.060  1.00 0.00 ? 92  ASN A CG   5  
ATOM 6729  O OD1  . ASN A 1 55 ? 1.557   -12.424 -1.275  1.00 0.00 ? 92  ASN A OD1  5  
ATOM 6730  N ND2  . ASN A 1 55 ? 3.743   -12.019 -1.524  1.00 0.00 ? 92  ASN A ND2  5  
ATOM 6731  H H    . ASN A 1 55 ? 2.670   -8.538  -1.920  1.00 0.00 ? 92  ASN A H    5  
ATOM 6732  H HA   . ASN A 1 55 ? 0.494   -10.171 -1.069  1.00 0.00 ? 92  ASN A HA   5  
ATOM 6733  H HB2  . ASN A 1 55 ? 3.360   -9.926  -0.281  1.00 0.00 ? 92  ASN A HB2  5  
ATOM 6734  H HB3  . ASN A 1 55 ? 2.263   -10.757 0.812   1.00 0.00 ? 92  ASN A HB3  5  
ATOM 6735  H HD21 . ASN A 1 55 ? 4.491   -11.423 -1.298  1.00 0.00 ? 92  ASN A HD21 5  
ATOM 6736  H HD22 . ASN A 1 55 ? 3.838   -12.830 -2.077  1.00 0.00 ? 92  ASN A HD22 5  
ATOM 6737  N N    . ALA A 1 56 ? 1.356   -7.654  0.837   1.00 0.00 ? 93  ALA A N    5  
ATOM 6738  C CA   . ALA A 1 56 ? 0.934   -6.827  1.960   1.00 0.00 ? 93  ALA A CA   5  
ATOM 6739  C C    . ALA A 1 56 ? -0.493  -6.328  1.764   1.00 0.00 ? 93  ALA A C    5  
ATOM 6740  O O    . ALA A 1 56 ? -1.310  -6.394  2.684   1.00 0.00 ? 93  ALA A O    5  
ATOM 6741  C CB   . ALA A 1 56 ? 1.885   -5.657  2.147   1.00 0.00 ? 93  ALA A CB   5  
ATOM 6742  H H    . ALA A 1 56 ? 2.114   -7.359  0.286   1.00 0.00 ? 93  ALA A H    5  
ATOM 6743  H HA   . ALA A 1 56 ? 0.970   -7.435  2.852   1.00 0.00 ? 93  ALA A HA   5  
ATOM 6744  H HB1  . ALA A 1 56 ? 2.710   -5.959  2.774   1.00 0.00 ? 93  ALA A HB1  5  
ATOM 6745  H HB2  . ALA A 1 56 ? 2.262   -5.341  1.184   1.00 0.00 ? 93  ALA A HB2  5  
ATOM 6746  H HB3  . ALA A 1 56 ? 1.359   -4.836  2.613   1.00 0.00 ? 93  ALA A HB3  5  
ATOM 6747  N N    . ILE A 1 57 ? -0.798  -5.878  0.548   1.00 0.00 ? 94  ILE A N    5  
ATOM 6748  C CA   . ILE A 1 57 ? -2.143  -5.411  0.223   1.00 0.00 ? 94  ILE A CA   5  
ATOM 6749  C C    . ILE A 1 57 ? -3.155  -6.522  0.455   1.00 0.00 ? 94  ILE A C    5  
ATOM 6750  O O    . ILE A 1 57 ? -4.163  -6.335  1.138   1.00 0.00 ? 94  ILE A O    5  
ATOM 6751  C CB   . ILE A 1 57 ? -2.255  -4.952  -1.249  1.00 0.00 ? 94  ILE A CB   5  
ATOM 6752  C CG1  . ILE A 1 57 ? -1.215  -3.877  -1.569  1.00 0.00 ? 94  ILE A CG1  5  
ATOM 6753  C CG2  . ILE A 1 57 ? -3.658  -4.430  -1.534  1.00 0.00 ? 94  ILE A CG2  5  
ATOM 6754  C CD1  . ILE A 1 57 ? -1.390  -2.611  -0.766  1.00 0.00 ? 94  ILE A CD1  5  
ATOM 6755  H H    . ILE A 1 57 ? -0.107  -5.878  -0.150  1.00 0.00 ? 94  ILE A H    5  
ATOM 6756  H HA   . ILE A 1 57 ? -2.377  -4.575  0.865   1.00 0.00 ? 94  ILE A HA   5  
ATOM 6757  H HB   . ILE A 1 57 ? -2.082  -5.810  -1.884  1.00 0.00 ? 94  ILE A HB   5  
ATOM 6758  H HG12 . ILE A 1 57 ? -0.231  -4.267  -1.363  1.00 0.00 ? 94  ILE A HG12 5  
ATOM 6759  H HG13 . ILE A 1 57 ? -1.286  -3.621  -2.615  1.00 0.00 ? 94  ILE A HG13 5  
ATOM 6760  H HG21 . ILE A 1 57 ? -4.381  -5.029  -1.001  1.00 0.00 ? 94  ILE A HG21 5  
ATOM 6761  H HG22 . ILE A 1 57 ? -3.733  -3.401  -1.212  1.00 0.00 ? 94  ILE A HG22 5  
ATOM 6762  H HG23 . ILE A 1 57 ? -3.854  -4.490  -2.594  1.00 0.00 ? 94  ILE A HG23 5  
ATOM 6763  H HD11 . ILE A 1 57 ? -1.695  -2.869  0.240   1.00 0.00 ? 94  ILE A HD11 5  
ATOM 6764  H HD12 . ILE A 1 57 ? -0.452  -2.074  -0.733  1.00 0.00 ? 94  ILE A HD12 5  
ATOM 6765  H HD13 . ILE A 1 57 ? -2.146  -1.995  -1.228  1.00 0.00 ? 94  ILE A HD13 5  
ATOM 6766  N N    . LYS A 1 58 ? -2.860  -7.680  -0.119  1.00 0.00 ? 95  LYS A N    5  
ATOM 6767  C CA   . LYS A 1 58 ? -3.737  -8.844  -0.027  1.00 0.00 ? 95  LYS A CA   5  
ATOM 6768  C C    . LYS A 1 58 ? -3.979  -9.257  1.423   1.00 0.00 ? 95  LYS A C    5  
ATOM 6769  O O    . LYS A 1 58 ? -5.110  -9.553  1.808   1.00 0.00 ? 95  LYS A O    5  
ATOM 6770  C CB   . LYS A 1 58 ? -3.153  -10.019 -0.811  1.00 0.00 ? 95  LYS A CB   5  
ATOM 6771  C CG   . LYS A 1 58 ? -3.021  -9.762  -2.300  1.00 0.00 ? 95  LYS A CG   5  
ATOM 6772  C CD   . LYS A 1 58 ? -2.554  -11.008 -3.031  1.00 0.00 ? 95  LYS A CD   5  
ATOM 6773  C CE   . LYS A 1 58 ? -2.353  -10.750 -4.515  1.00 0.00 ? 95  LYS A CE   5  
ATOM 6774  N NZ   . LYS A 1 58 ? -1.210  -9.835  -4.770  1.00 0.00 ? 95  LYS A NZ   5  
ATOM 6775  H H    . LYS A 1 58 ? -2.034  -7.742  -0.647  1.00 0.00 ? 95  LYS A H    5  
ATOM 6776  H HA   . LYS A 1 58 ? -4.685  -8.571  -0.468  1.00 0.00 ? 95  LYS A HA   5  
ATOM 6777  H HB2  . LYS A 1 58 ? -2.172  -10.245 -0.418  1.00 0.00 ? 95  LYS A HB2  5  
ATOM 6778  H HB3  . LYS A 1 58 ? -3.790  -10.879 -0.671  1.00 0.00 ? 95  LYS A HB3  5  
ATOM 6779  H HG2  . LYS A 1 58 ? -3.983  -9.465  -2.692  1.00 0.00 ? 95  LYS A HG2  5  
ATOM 6780  H HG3  . LYS A 1 58 ? -2.304  -8.971  -2.458  1.00 0.00 ? 95  LYS A HG3  5  
ATOM 6781  H HD2  . LYS A 1 58 ? -1.617  -11.332 -2.603  1.00 0.00 ? 95  LYS A HD2  5  
ATOM 6782  H HD3  . LYS A 1 58 ? -3.296  -11.784 -2.908  1.00 0.00 ? 95  LYS A HD3  5  
ATOM 6783  H HE2  . LYS A 1 58 ? -2.166  -11.692 -5.011  1.00 0.00 ? 95  LYS A HE2  5  
ATOM 6784  H HE3  . LYS A 1 58 ? -3.253  -10.307 -4.915  1.00 0.00 ? 95  LYS A HE3  5  
ATOM 6785  H HZ1  . LYS A 1 58 ? -0.362  -10.169 -4.259  1.00 0.00 ? 95  LYS A HZ1  5  
ATOM 6786  H HZ2  . LYS A 1 58 ? -0.992  -9.804  -5.793  1.00 0.00 ? 95  LYS A HZ2  5  
ATOM 6787  H HZ3  . LYS A 1 58 ? -1.441  -8.871  -4.452  1.00 0.00 ? 95  LYS A HZ3  5  
ATOM 6788  N N    . LYS A 1 59 ? -2.925  -9.263  2.230   1.00 0.00 ? 96  LYS A N    5  
ATOM 6789  C CA   . LYS A 1 59 ? -3.064  -9.620  3.635   1.00 0.00 ? 96  LYS A CA   5  
ATOM 6790  C C    . LYS A 1 59 ? -3.861  -8.549  4.360   1.00 0.00 ? 96  LYS A C    5  
ATOM 6791  O O    . LYS A 1 59 ? -4.739  -8.845  5.168   1.00 0.00 ? 96  LYS A O    5  
ATOM 6792  C CB   . LYS A 1 59 ? -1.689  -9.792  4.296   1.00 0.00 ? 96  LYS A CB   5  
ATOM 6793  C CG   . LYS A 1 59 ? -1.721  -10.566 5.615   1.00 0.00 ? 96  LYS A CG   5  
ATOM 6794  C CD   . LYS A 1 59 ? -2.249  -9.738  6.786   1.00 0.00 ? 96  LYS A CD   5  
ATOM 6795  C CE   . LYS A 1 59 ? -1.369  -8.533  7.090   1.00 0.00 ? 96  LYS A CE   5  
ATOM 6796  N NZ   . LYS A 1 59 ? -1.828  -7.798  8.303   1.00 0.00 ? 96  LYS A NZ   5  
ATOM 6797  H H    . LYS A 1 59 ? -2.045  -9.008  1.878   1.00 0.00 ? 96  LYS A H    5  
ATOM 6798  H HA   . LYS A 1 59 ? -3.603  -10.555 3.690   1.00 0.00 ? 96  LYS A HA   5  
ATOM 6799  H HB2  . LYS A 1 59 ? -1.038  -10.319 3.612   1.00 0.00 ? 96  LYS A HB2  5  
ATOM 6800  H HB3  . LYS A 1 59 ? -1.274  -8.814  4.488   1.00 0.00 ? 96  LYS A HB3  5  
ATOM 6801  H HG2  . LYS A 1 59 ? -2.366  -11.426 5.490   1.00 0.00 ? 96  LYS A HG2  5  
ATOM 6802  H HG3  . LYS A 1 59 ? -0.720  -10.900 5.846   1.00 0.00 ? 96  LYS A HG3  5  
ATOM 6803  H HD2  . LYS A 1 59 ? -3.242  -9.390  6.547   1.00 0.00 ? 96  LYS A HD2  5  
ATOM 6804  H HD3  . LYS A 1 59 ? -2.292  -10.368 7.663   1.00 0.00 ? 96  LYS A HD3  5  
ATOM 6805  H HE2  . LYS A 1 59 ? -0.357  -8.874  7.249   1.00 0.00 ? 96  LYS A HE2  5  
ATOM 6806  H HE3  . LYS A 1 59 ? -1.394  -7.863  6.242   1.00 0.00 ? 96  LYS A HE3  5  
ATOM 6807  H HZ1  . LYS A 1 59 ? -2.532  -8.364  8.823   1.00 0.00 ? 96  LYS A HZ1  5  
ATOM 6808  H HZ2  . LYS A 1 59 ? -1.020  -7.618  8.939   1.00 0.00 ? 96  LYS A HZ2  5  
ATOM 6809  H HZ3  . LYS A 1 59 ? -2.259  -6.883  8.039   1.00 0.00 ? 96  LYS A HZ3  5  
ATOM 6810  N N    . GLY A 1 60 ? -3.535  -7.301  4.084   1.00 0.00 ? 97  GLY A N    5  
ATOM 6811  C CA   . GLY A 1 60 ? -4.201  -6.205  4.745   1.00 0.00 ? 97  GLY A CA   5  
ATOM 6812  C C    . GLY A 1 60 ? -5.692  -6.176  4.479   1.00 0.00 ? 97  GLY A C    5  
ATOM 6813  O O    . GLY A 1 60 ? -6.483  -5.965  5.395   1.00 0.00 ? 97  GLY A O    5  
ATOM 6814  H H    . GLY A 1 60 ? -2.812  -7.119  3.440   1.00 0.00 ? 97  GLY A H    5  
ATOM 6815  H HA2  . GLY A 1 60 ? -4.040  -6.291  5.809   1.00 0.00 ? 97  GLY A HA2  5  
ATOM 6816  H HA3  . GLY A 1 60 ? -3.769  -5.276  4.401   1.00 0.00 ? 97  GLY A HA3  5  
ATOM 6817  N N    . VAL A 1 61 ? -6.080  -6.350  3.226   1.00 0.00 ? 98  VAL A N    5  
ATOM 6818  C CA   . VAL A 1 61 ? -7.489  -6.280  2.858   1.00 0.00 ? 98  VAL A CA   5  
ATOM 6819  C C    . VAL A 1 61 ? -8.298  -7.418  3.482   1.00 0.00 ? 98  VAL A C    5  
ATOM 6820  O O    . VAL A 1 61 ? -9.460  -7.230  3.840   1.00 0.00 ? 98  VAL A O    5  
ATOM 6821  C CB   . VAL A 1 61 ? -7.696  -6.256  1.326   1.00 0.00 ? 98  VAL A CB   5  
ATOM 6822  C CG1  . VAL A 1 61 ? -7.043  -5.023  0.722   1.00 0.00 ? 98  VAL A CG1  5  
ATOM 6823  C CG2  . VAL A 1 61 ? -7.156  -7.517  0.673   1.00 0.00 ? 98  VAL A CG2  5  
ATOM 6824  H H    . VAL A 1 61 ? -5.402  -6.482  2.523   1.00 0.00 ? 98  VAL A H    5  
ATOM 6825  H HA   . VAL A 1 61 ? -7.871  -5.346  3.250   1.00 0.00 ? 98  VAL A HA   5  
ATOM 6826  H HB   . VAL A 1 61 ? -8.758  -6.202  1.129   1.00 0.00 ? 98  VAL A HB   5  
ATOM 6827  H HG11 . VAL A 1 61 ? -6.250  -4.683  1.370   1.00 0.00 ? 98  VAL A HG11 5  
ATOM 6828  H HG12 . VAL A 1 61 ? -6.635  -5.271  -0.246  1.00 0.00 ? 98  VAL A HG12 5  
ATOM 6829  H HG13 . VAL A 1 61 ? -7.780  -4.242  0.615   1.00 0.00 ? 98  VAL A HG13 5  
ATOM 6830  H HG21 . VAL A 1 61 ? -7.187  -8.330  1.384   1.00 0.00 ? 98  VAL A HG21 5  
ATOM 6831  H HG22 . VAL A 1 61 ? -7.759  -7.764  -0.186  1.00 0.00 ? 98  VAL A HG22 5  
ATOM 6832  H HG23 . VAL A 1 61 ? -6.135  -7.351  0.362   1.00 0.00 ? 98  VAL A HG23 5  
ATOM 6833  N N    . GLU A 1 62 ? -7.683  -8.588  3.634   1.00 0.00 ? 99  GLU A N    5  
ATOM 6834  C CA   . GLU A 1 62 ? -8.369  -9.725  4.239   1.00 0.00 ? 99  GLU A CA   5  
ATOM 6835  C C    . GLU A 1 62 ? -8.424  -9.575  5.759   1.00 0.00 ? 99  GLU A C    5  
ATOM 6836  O O    . GLU A 1 62 ? -9.424  -9.916  6.391   1.00 0.00 ? 99  GLU A O    5  
ATOM 6837  C CB   . GLU A 1 62 ? -7.696  -11.047 3.841   1.00 0.00 ? 99  GLU A CB   5  
ATOM 6838  C CG   . GLU A 1 62 ? -6.288  -11.235 4.373   1.00 0.00 ? 99  GLU A CG   5  
ATOM 6839  C CD   . GLU A 1 62 ? -6.232  -12.135 5.595   1.00 0.00 ? 99  GLU A CD   5  
ATOM 6840  O OE1  . GLU A 1 62 ? -7.305  -12.575 6.066   1.00 0.00 ? 99  GLU A OE1  5  
ATOM 6841  O OE2  . GLU A 1 62 ? -5.119  -12.401 6.099   1.00 0.00 ? 99  GLU A OE2  5  
ATOM 6842  H H    . GLU A 1 62 ? -6.752  -8.687  3.342   1.00 0.00 ? 99  GLU A H    5  
ATOM 6843  H HA   . GLU A 1 62 ? -9.378  -9.729  3.861   1.00 0.00 ? 99  GLU A HA   5  
ATOM 6844  H HB2  . GLU A 1 62 ? -8.295  -11.864 4.212   1.00 0.00 ? 99  GLU A HB2  5  
ATOM 6845  H HB3  . GLU A 1 62 ? -7.659  -11.104 2.763   1.00 0.00 ? 99  GLU A HB3  5  
ATOM 6846  H HG2  . GLU A 1 62 ? -5.684  -11.666 3.597   1.00 0.00 ? 99  GLU A HG2  5  
ATOM 6847  H HG3  . GLU A 1 62 ? -5.887  -10.267 4.639   1.00 0.00 ? 99  GLU A HG3  5  
ATOM 6848  N N    . ALA A 1 63 ? -7.321  -9.120  6.339   1.00 0.00 ? 100 ALA A N    5  
ATOM 6849  C CA   . ALA A 1 63 ? -7.207  -8.984  7.786   1.00 0.00 ? 100 ALA A CA   5  
ATOM 6850  C C    . ALA A 1 63 ? -8.097  -7.867  8.320   1.00 0.00 ? 100 ALA A C    5  
ATOM 6851  O O    . ALA A 1 63 ? -8.722  -8.004  9.371   1.00 0.00 ? 100 ALA A O    5  
ATOM 6852  C CB   . ALA A 1 63 ? -5.762  -8.728  8.171   1.00 0.00 ? 100 ALA A CB   5  
ATOM 6853  H H    . ALA A 1 63 ? -6.532  -8.933  5.779   1.00 0.00 ? 100 ALA A H    5  
ATOM 6854  H HA   . ALA A 1 63 ? -7.512  -9.920  8.233   1.00 0.00 ? 100 ALA A HA   5  
ATOM 6855  H HB1  . ALA A 1 63 ? -5.695  -7.804  8.725   1.00 0.00 ? 100 ALA A HB1  5  
ATOM 6856  H HB2  . ALA A 1 63 ? -5.160  -8.655  7.276   1.00 0.00 ? 100 ALA A HB2  5  
ATOM 6857  H HB3  . ALA A 1 63 ? -5.400  -9.543  8.781   1.00 0.00 ? 100 ALA A HB3  5  
ATOM 6858  N N    . GLY A 1 64 ? -8.106  -6.747  7.614   1.00 0.00 ? 101 GLY A N    5  
ATOM 6859  C CA   . GLY A 1 64 ? -8.856  -5.588  8.057   1.00 0.00 ? 101 GLY A CA   5  
ATOM 6860  C C    . GLY A 1 64 ? -7.955  -4.383  8.226   1.00 0.00 ? 101 GLY A C    5  
ATOM 6861  O O    . GLY A 1 64 ? -8.070  -3.628  9.191   1.00 0.00 ? 101 GLY A O    5  
ATOM 6862  H H    . GLY A 1 64 ? -7.560  -6.692  6.799   1.00 0.00 ? 101 GLY A H    5  
ATOM 6863  H HA2  . GLY A 1 64 ? -9.618  -5.360  7.325   1.00 0.00 ? 101 GLY A HA2  5  
ATOM 6864  H HA3  . GLY A 1 64 ? -9.326  -5.810  9.003   1.00 0.00 ? 101 GLY A HA3  5  
ATOM 6865  N N    . ASP A 1 65 ? -7.025  -4.236  7.298   1.00 0.00 ? 102 ASP A N    5  
ATOM 6866  C CA   . ASP A 1 65 ? -6.041  -3.168  7.334   1.00 0.00 ? 102 ASP A CA   5  
ATOM 6867  C C    . ASP A 1 65 ? -6.286  -2.215  6.179   1.00 0.00 ? 102 ASP A C    5  
ATOM 6868  O O    . ASP A 1 65 ? -6.241  -0.995  6.339   1.00 0.00 ? 102 ASP A O    5  
ATOM 6869  C CB   . ASP A 1 65 ? -4.624  -3.748  7.210   1.00 0.00 ? 102 ASP A CB   5  
ATOM 6870  C CG   . ASP A 1 65 ? -4.208  -4.626  8.378   1.00 0.00 ? 102 ASP A CG   5  
ATOM 6871  O OD1  . ASP A 1 65 ? -4.810  -4.489  9.465   1.00 0.00 ? 102 ASP A OD1  5  
ATOM 6872  O OD2  . ASP A 1 65 ? -3.315  -5.484  8.207   1.00 0.00 ? 102 ASP A OD2  5  
ATOM 6873  H H    . ASP A 1 65 ? -6.967  -4.899  6.579   1.00 0.00 ? 102 ASP A H    5  
ATOM 6874  H HA   . ASP A 1 65 ? -6.138  -2.639  8.271   1.00 0.00 ? 102 ASP A HA   5  
ATOM 6875  H HB2  . ASP A 1 65 ? -4.570  -4.342  6.311   1.00 0.00 ? 102 ASP A HB2  5  
ATOM 6876  H HB3  . ASP A 1 65 ? -3.924  -2.933  7.132   1.00 0.00 ? 102 ASP A HB3  5  
ATOM 6877  N N    . PHE A 1 66 ? -6.586  -2.783  5.017   1.00 0.00 ? 103 PHE A N    5  
ATOM 6878  C CA   . PHE A 1 66 ? -6.866  -1.990  3.829   1.00 0.00 ? 103 PHE A CA   5  
ATOM 6879  C C    . PHE A 1 66 ? -8.131  -2.500  3.144   1.00 0.00 ? 103 PHE A C    5  
ATOM 6880  O O    . PHE A 1 66 ? -8.656  -3.556  3.495   1.00 0.00 ? 103 PHE A O    5  
ATOM 6881  C CB   . PHE A 1 66 ? -5.701  -2.039  2.829   1.00 0.00 ? 103 PHE A CB   5  
ATOM 6882  C CG   . PHE A 1 66 ? -4.332  -2.160  3.441   1.00 0.00 ? 103 PHE A CG   5  
ATOM 6883  C CD1  . PHE A 1 66 ? -3.732  -1.078  4.060   1.00 0.00 ? 103 PHE A CD1  5  
ATOM 6884  C CD2  . PHE A 1 66 ? -3.637  -3.355  3.371   1.00 0.00 ? 103 PHE A CD2  5  
ATOM 6885  C CE1  . PHE A 1 66 ? -2.467  -1.191  4.603   1.00 0.00 ? 103 PHE A CE1  5  
ATOM 6886  C CE2  . PHE A 1 66 ? -2.372  -3.473  3.915   1.00 0.00 ? 103 PHE A CE2  5  
ATOM 6887  C CZ   . PHE A 1 66 ? -1.787  -2.390  4.532   1.00 0.00 ? 103 PHE A CZ   5  
ATOM 6888  H H    . PHE A 1 66 ? -6.656  -3.758  4.966   1.00 0.00 ? 103 PHE A H    5  
ATOM 6889  H HA   . PHE A 1 66 ? -7.023  -0.969  4.140   1.00 0.00 ? 103 PHE A HA   5  
ATOM 6890  H HB2  . PHE A 1 66 ? -5.839  -2.882  2.172   1.00 0.00 ? 103 PHE A HB2  5  
ATOM 6891  H HB3  . PHE A 1 66 ? -5.713  -1.134  2.245   1.00 0.00 ? 103 PHE A HB3  5  
ATOM 6892  H HD1  . PHE A 1 66 ? -4.263  -0.140  4.121   1.00 0.00 ? 103 PHE A HD1  5  
ATOM 6893  H HD2  . PHE A 1 66 ? -4.095  -4.205  2.889   1.00 0.00 ? 103 PHE A HD2  5  
ATOM 6894  H HE1  . PHE A 1 66 ? -2.009  -0.339  5.083   1.00 0.00 ? 103 PHE A HE1  5  
ATOM 6895  H HE2  . PHE A 1 66 ? -1.845  -4.414  3.857   1.00 0.00 ? 103 PHE A HE2  5  
ATOM 6896  H HZ   . PHE A 1 66 ? -0.798  -2.478  4.957   1.00 0.00 ? 103 PHE A HZ   5  
ATOM 6897  N N    . GLU A 1 67 ? -8.612  -1.739  2.173   1.00 0.00 ? 104 GLU A N    5  
ATOM 6898  C CA   . GLU A 1 67 ? -9.803  -2.102  1.416   1.00 0.00 ? 104 GLU A CA   5  
ATOM 6899  C C    . GLU A 1 67 ? -9.547  -1.875  -0.070  1.00 0.00 ? 104 GLU A C    5  
ATOM 6900  O O    . GLU A 1 67 ? -8.811  -0.964  -0.438  1.00 0.00 ? 104 GLU A O    5  
ATOM 6901  C CB   . GLU A 1 67 ? -10.999 -1.255  1.868   1.00 0.00 ? 104 GLU A CB   5  
ATOM 6902  C CG   . GLU A 1 67 ? -11.223 -1.265  3.370   1.00 0.00 ? 104 GLU A CG   5  
ATOM 6903  C CD   . GLU A 1 67 ? -12.356 -0.359  3.804   1.00 0.00 ? 104 GLU A CD   5  
ATOM 6904  O OE1  . GLU A 1 67 ? -13.524 -0.660  3.489   1.00 0.00 ? 104 GLU A OE1  5  
ATOM 6905  O OE2  . GLU A 1 67 ? -12.088 0.662   4.470   1.00 0.00 ? 104 GLU A OE2  5  
ATOM 6906  H H    . GLU A 1 67 ? -8.159  -0.891  1.964   1.00 0.00 ? 104 GLU A H    5  
ATOM 6907  H HA   . GLU A 1 67 ? -10.013 -3.146  1.589   1.00 0.00 ? 104 GLU A HA   5  
ATOM 6908  H HB2  . GLU A 1 67 ? -10.841 -0.234  1.556   1.00 0.00 ? 104 GLU A HB2  5  
ATOM 6909  H HB3  . GLU A 1 67 ? -11.892 -1.633  1.391   1.00 0.00 ? 104 GLU A HB3  5  
ATOM 6910  H HG2  . GLU A 1 67 ? -11.453 -2.273  3.680   1.00 0.00 ? 104 GLU A HG2  5  
ATOM 6911  H HG3  . GLU A 1 67 ? -10.314 -0.939  3.857   1.00 0.00 ? 104 GLU A HG3  5  
ATOM 6912  N N    . GLN A 1 68 ? -10.132 -2.709  -0.919  1.00 0.00 ? 105 GLN A N    5  
ATOM 6913  C CA   . GLN A 1 68 ? -9.966  -2.559  -2.362  1.00 0.00 ? 105 GLN A CA   5  
ATOM 6914  C C    . GLN A 1 68 ? -11.312 -2.350  -3.050  1.00 0.00 ? 105 GLN A C    5  
ATOM 6915  O O    . GLN A 1 68 ? -11.911 -3.295  -3.568  1.00 0.00 ? 105 GLN A O    5  
ATOM 6916  C CB   . GLN A 1 68 ? -9.261  -3.773  -2.968  1.00 0.00 ? 105 GLN A CB   5  
ATOM 6917  C CG   . GLN A 1 68 ? -7.779  -3.847  -2.645  1.00 0.00 ? 105 GLN A CG   5  
ATOM 6918  C CD   . GLN A 1 68 ? -7.110  -5.056  -3.270  1.00 0.00 ? 105 GLN A CD   5  
ATOM 6919  O OE1  . GLN A 1 68 ? -7.548  -6.190  -3.087  1.00 0.00 ? 105 GLN A OE1  5  
ATOM 6920  N NE2  . GLN A 1 68 ? -6.038  -4.822  -4.009  1.00 0.00 ? 105 GLN A NE2  5  
ATOM 6921  H H    . GLN A 1 68 ? -10.700 -3.430  -0.572  1.00 0.00 ? 105 GLN A H    5  
ATOM 6922  H HA   . GLN A 1 68 ? -9.356  -1.682  -2.529  1.00 0.00 ? 105 GLN A HA   5  
ATOM 6923  H HB2  . GLN A 1 68 ? -9.734  -4.670  -2.596  1.00 0.00 ? 105 GLN A HB2  5  
ATOM 6924  H HB3  . GLN A 1 68 ? -9.373  -3.738  -4.042  1.00 0.00 ? 105 GLN A HB3  5  
ATOM 6925  H HG2  . GLN A 1 68 ? -7.300  -2.955  -3.021  1.00 0.00 ? 105 GLN A HG2  5  
ATOM 6926  H HG3  . GLN A 1 68 ? -7.658  -3.897  -1.575  1.00 0.00 ? 105 GLN A HG3  5  
ATOM 6927  H HE21 . GLN A 1 68 ? -5.742  -3.893  -4.113  1.00 0.00 ? 105 GLN A HE21 5  
ATOM 6928  H HE22 . GLN A 1 68 ? -5.585  -5.586  -4.418  1.00 0.00 ? 105 GLN A HE22 5  
ATOM 6929  N N    . PRO A 1 69 ? -11.803 -1.102  -3.076  1.00 0.00 ? 106 PRO A N    5  
ATOM 6930  C CA   . PRO A 1 69 ? -13.084 -0.770  -3.702  1.00 0.00 ? 106 PRO A CA   5  
ATOM 6931  C C    . PRO A 1 69 ? -12.995 -0.676  -5.228  1.00 0.00 ? 106 PRO A C    5  
ATOM 6932  O O    . PRO A 1 69 ? -13.615 0.186   -5.843  1.00 0.00 ? 106 PRO A O    5  
ATOM 6933  C CB   . PRO A 1 69 ? -13.414 0.593   -3.099  1.00 0.00 ? 106 PRO A CB   5  
ATOM 6934  C CG   . PRO A 1 69 ? -12.088 1.217   -2.832  1.00 0.00 ? 106 PRO A CG   5  
ATOM 6935  C CD   . PRO A 1 69 ? -11.149 0.088   -2.497  1.00 0.00 ? 106 PRO A CD   5  
ATOM 6936  H HA   . PRO A 1 69 ? -13.850 -1.479  -3.433  1.00 0.00 ? 106 PRO A HA   5  
ATOM 6937  H HB2  . PRO A 1 69 ? -13.991 1.172   -3.807  1.00 0.00 ? 106 PRO A HB2  5  
ATOM 6938  H HB3  . PRO A 1 69 ? -13.978 0.460   -2.188  1.00 0.00 ? 106 PRO A HB3  5  
ATOM 6939  H HG2  . PRO A 1 69 ? -11.745 1.739   -3.714  1.00 0.00 ? 106 PRO A HG2  5  
ATOM 6940  H HG3  . PRO A 1 69 ? -12.165 1.899   -1.998  1.00 0.00 ? 106 PRO A HG3  5  
ATOM 6941  H HD2  . PRO A 1 69 ? -10.183 0.255   -2.952  1.00 0.00 ? 106 PRO A HD2  5  
ATOM 6942  H HD3  . PRO A 1 69 ? -11.047 -0.013  -1.425  1.00 0.00 ? 106 PRO A HD3  5  
ATOM 6943  N N    . LYS A 1 70 ? -12.276 -1.606  -5.837  1.00 0.00 ? 107 LYS A N    5  
ATOM 6944  C CA   . LYS A 1 70 ? -12.174 -1.680  -7.288  1.00 0.00 ? 107 LYS A CA   5  
ATOM 6945  C C    . LYS A 1 70 ? -12.073 -3.130  -7.733  1.00 0.00 ? 107 LYS A C    5  
ATOM 6946  O O    . LYS A 1 70 ? -12.798 -3.569  -8.622  1.00 0.00 ? 107 LYS A O    5  
ATOM 6947  C CB   . LYS A 1 70 ? -10.960 -0.898  -7.799  1.00 0.00 ? 107 LYS A CB   5  
ATOM 6948  C CG   . LYS A 1 70 ? -11.145 0.606   -7.743  1.00 0.00 ? 107 LYS A CG   5  
ATOM 6949  C CD   . LYS A 1 70 ? -10.086 1.332   -8.557  1.00 0.00 ? 107 LYS A CD   5  
ATOM 6950  C CE   . LYS A 1 70 ? -10.434 2.798   -8.762  1.00 0.00 ? 107 LYS A CE   5  
ATOM 6951  N NZ   . LYS A 1 70 ? -11.550 2.980   -9.728  1.00 0.00 ? 107 LYS A NZ   5  
ATOM 6952  H H    . LYS A 1 70 ? -11.850 -2.299  -5.300  1.00 0.00 ? 107 LYS A H    5  
ATOM 6953  H HA   . LYS A 1 70 ? -13.071 -1.249  -7.708  1.00 0.00 ? 107 LYS A HA   5  
ATOM 6954  H HB2  . LYS A 1 70 ? -10.100 -1.157  -7.199  1.00 0.00 ? 107 LYS A HB2  5  
ATOM 6955  H HB3  . LYS A 1 70 ? -10.770 -1.177  -8.825  1.00 0.00 ? 107 LYS A HB3  5  
ATOM 6956  H HG2  . LYS A 1 70 ? -12.119 0.847   -8.131  1.00 0.00 ? 107 LYS A HG2  5  
ATOM 6957  H HG3  . LYS A 1 70 ? -11.076 0.927   -6.714  1.00 0.00 ? 107 LYS A HG3  5  
ATOM 6958  H HD2  . LYS A 1 70 ? -9.140  1.268   -8.039  1.00 0.00 ? 107 LYS A HD2  5  
ATOM 6959  H HD3  . LYS A 1 70 ? -10.001 0.855   -9.522  1.00 0.00 ? 107 LYS A HD3  5  
ATOM 6960  H HE2  . LYS A 1 70 ? -10.723 3.221   -7.810  1.00 0.00 ? 107 LYS A HE2  5  
ATOM 6961  H HE3  . LYS A 1 70 ? -9.561  3.314   -9.131  1.00 0.00 ? 107 LYS A HE3  5  
ATOM 6962  H HZ1  . LYS A 1 70 ? -11.290 2.581   -10.654 1.00 0.00 ? 107 LYS A HZ1  5  
ATOM 6963  H HZ2  . LYS A 1 70 ? -12.413 2.501   -9.384  1.00 0.00 ? 107 LYS A HZ2  5  
ATOM 6964  H HZ3  . LYS A 1 70 ? -11.755 3.998   -9.851  1.00 0.00 ? 107 LYS A HZ3  5  
ATOM 6965  N N    . GLY A 1 71 ? -11.192 -3.876  -7.093  1.00 0.00 ? 108 GLY A N    5  
ATOM 6966  C CA   . GLY A 1 71 ? -11.043 -5.275  -7.408  1.00 0.00 ? 108 GLY A CA   5  
ATOM 6967  C C    . GLY A 1 71 ? -9.622  -5.745  -7.209  1.00 0.00 ? 108 GLY A C    5  
ATOM 6968  O O    . GLY A 1 71 ? -8.906  -5.215  -6.355  1.00 0.00 ? 108 GLY A O    5  
ATOM 6969  H H    . GLY A 1 71 ? -10.645 -3.481  -6.387  1.00 0.00 ? 108 GLY A H    5  
ATOM 6970  H HA2  . GLY A 1 71 ? -11.699 -5.851  -6.769  1.00 0.00 ? 108 GLY A HA2  5  
ATOM 6971  H HA3  . GLY A 1 71 ? -11.324 -5.436  -8.438  1.00 0.00 ? 108 GLY A HA3  5  
ATOM 6972  N N    . PRO A 1 72 ? -9.157  -6.682  -8.043  1.00 0.00 ? 109 PRO A N    5  
ATOM 6973  C CA   . PRO A 1 72 ? -7.785  -7.184  -7.983  1.00 0.00 ? 109 PRO A CA   5  
ATOM 6974  C C    . PRO A 1 72 ? -6.761  -6.119  -8.351  1.00 0.00 ? 109 PRO A C    5  
ATOM 6975  O O    . PRO A 1 72 ? -6.831  -5.525  -9.432  1.00 0.00 ? 109 PRO A O    5  
ATOM 6976  C CB   . PRO A 1 72 ? -7.772  -8.306  -9.012  1.00 0.00 ? 109 PRO A CB   5  
ATOM 6977  C CG   . PRO A 1 72 ? -8.858  -7.958  -9.968  1.00 0.00 ? 109 PRO A CG   5  
ATOM 6978  C CD   . PRO A 1 72 ? -9.922  -7.291  -9.147  1.00 0.00 ? 109 PRO A CD   5  
ATOM 6979  H HA   . PRO A 1 72 ? -7.548  -7.587  -7.010  1.00 0.00 ? 109 PRO A HA   5  
ATOM 6980  H HB2  . PRO A 1 72 ? -6.810  -8.331  -9.496  1.00 0.00 ? 109 PRO A HB2  5  
ATOM 6981  H HB3  . PRO A 1 72 ? -7.961  -9.251  -8.524  1.00 0.00 ? 109 PRO A HB3  5  
ATOM 6982  H HG2  . PRO A 1 72 ? -8.482  -7.280  -10.719 1.00 0.00 ? 109 PRO A HG2  5  
ATOM 6983  H HG3  . PRO A 1 72 ? -9.246  -8.855  -10.429 1.00 0.00 ? 109 PRO A HG3  5  
ATOM 6984  H HD2  . PRO A 1 72 ? -10.428 -6.535  -9.727  1.00 0.00 ? 109 PRO A HD2  5  
ATOM 6985  H HD3  . PRO A 1 72 ? -10.627 -8.018  -8.773  1.00 0.00 ? 109 PRO A HD3  5  
ATOM 6986  N N    . ALA A 1 73 ? -5.802  -5.902  -7.456  1.00 0.00 ? 110 ALA A N    5  
ATOM 6987  C CA   . ALA A 1 73 ? -4.731  -4.931  -7.672  1.00 0.00 ? 110 ALA A CA   5  
ATOM 6988  C C    . ALA A 1 73 ? -5.298  -3.552  -8.009  1.00 0.00 ? 110 ALA A C    5  
ATOM 6989  O O    . ALA A 1 73 ? -4.742  -2.820  -8.828  1.00 0.00 ? 110 ALA A O    5  
ATOM 6990  C CB   . ALA A 1 73 ? -3.799  -5.416  -8.775  1.00 0.00 ? 110 ALA A CB   5  
ATOM 6991  H H    . ALA A 1 73 ? -5.797  -6.436  -6.633  1.00 0.00 ? 110 ALA A H    5  
ATOM 6992  H HA   . ALA A 1 73 ? -4.160  -4.858  -6.759  1.00 0.00 ? 110 ALA A HA   5  
ATOM 6993  H HB1  . ALA A 1 73 ? -4.376  -5.649  -9.659  1.00 0.00 ? 110 ALA A HB1  5  
ATOM 6994  H HB2  . ALA A 1 73 ? -3.277  -6.303  -8.443  1.00 0.00 ? 110 ALA A HB2  5  
ATOM 6995  H HB3  . ALA A 1 73 ? -3.081  -4.643  -9.007  1.00 0.00 ? 110 ALA A HB3  5  
ATOM 6996  N N    . GLY A 1 74 ? -6.431  -3.222  -7.401  1.00 0.00 ? 111 GLY A N    5  
ATOM 6997  C CA   . GLY A 1 74 ? -7.077  -1.955  -7.679  1.00 0.00 ? 111 GLY A CA   5  
ATOM 6998  C C    . GLY A 1 74 ? -6.532  -0.831  -6.825  1.00 0.00 ? 111 GLY A C    5  
ATOM 6999  O O    . GLY A 1 74 ? -5.380  -0.876  -6.388  1.00 0.00 ? 111 GLY A O    5  
ATOM 7000  H H    . GLY A 1 74 ? -6.844  -3.855  -6.780  1.00 0.00 ? 111 GLY A H    5  
ATOM 7001  H HA2  . GLY A 1 74 ? -6.931  -1.710  -8.720  1.00 0.00 ? 111 GLY A HA2  5  
ATOM 7002  H HA3  . GLY A 1 74 ? -8.135  -2.054  -7.489  1.00 0.00 ? 111 GLY A HA3  5  
ATOM 7003  N N    . ALA A 1 75 ? -7.384  0.129   -6.511  1.00 0.00 ? 112 ALA A N    5  
ATOM 7004  C CA   . ALA A 1 75 ? -7.014  1.208   -5.613  1.00 0.00 ? 112 ALA A CA   5  
ATOM 7005  C C    . ALA A 1 75 ? -7.187  0.765   -4.169  1.00 0.00 ? 112 ALA A C    5  
ATOM 7006  O O    . ALA A 1 75 ? -8.187  0.134   -3.821  1.00 0.00 ? 112 ALA A O    5  
ATOM 7007  C CB   . ALA A 1 75 ? -7.839  2.455   -5.890  1.00 0.00 ? 112 ALA A CB   5  
ATOM 7008  H H    . ALA A 1 75 ? -8.308  0.068   -6.825  1.00 0.00 ? 112 ALA A H    5  
ATOM 7009  H HA   . ALA A 1 75 ? -5.975  1.446   -5.788  1.00 0.00 ? 112 ALA A HA   5  
ATOM 7010  H HB1  . ALA A 1 75 ? -8.035  2.529   -6.950  1.00 0.00 ? 112 ALA A HB1  5  
ATOM 7011  H HB2  . ALA A 1 75 ? -8.773  2.395   -5.354  1.00 0.00 ? 112 ALA A HB2  5  
ATOM 7012  H HB3  . ALA A 1 75 ? -7.291  3.328   -5.564  1.00 0.00 ? 112 ALA A HB3  5  
ATOM 7013  N N    . VAL A 1 76 ? -6.206  1.071   -3.344  1.00 0.00 ? 113 VAL A N    5  
ATOM 7014  C CA   . VAL A 1 76 ? -6.250  0.705   -1.944  1.00 0.00 ? 113 VAL A CA   5  
ATOM 7015  C C    . VAL A 1 76 ? -6.837  1.840   -1.116  1.00 0.00 ? 113 VAL A C    5  
ATOM 7016  O O    . VAL A 1 76 ? -6.477  3.001   -1.290  1.00 0.00 ? 113 VAL A O    5  
ATOM 7017  C CB   . VAL A 1 76 ? -4.845  0.339   -1.423  1.00 0.00 ? 113 VAL A CB   5  
ATOM 7018  C CG1  . VAL A 1 76 ? -4.890  -0.059  0.044   1.00 0.00 ? 113 VAL A CG1  5  
ATOM 7019  C CG2  . VAL A 1 76 ? -4.253  -0.780  -2.265  1.00 0.00 ? 113 VAL A CG2  5  
ATOM 7020  H H    . VAL A 1 76 ? -5.437  1.586   -3.681  1.00 0.00 ? 113 VAL A H    5  
ATOM 7021  H HA   . VAL A 1 76 ? -6.886  -0.165  -1.846  1.00 0.00 ? 113 VAL A HA   5  
ATOM 7022  H HB   . VAL A 1 76 ? -4.207  1.203   -1.518  1.00 0.00 ? 113 VAL A HB   5  
ATOM 7023  H HG11 . VAL A 1 76 ? -5.409  0.702   0.607   1.00 0.00 ? 113 VAL A HG11 5  
ATOM 7024  H HG12 . VAL A 1 76 ? -5.409  -1.002  0.146   1.00 0.00 ? 113 VAL A HG12 5  
ATOM 7025  H HG13 . VAL A 1 76 ? -3.882  -0.160  0.421   1.00 0.00 ? 113 VAL A HG13 5  
ATOM 7026  H HG21 . VAL A 1 76 ? -4.945  -1.037  -3.053  1.00 0.00 ? 113 VAL A HG21 5  
ATOM 7027  H HG22 . VAL A 1 76 ? -3.318  -0.452  -2.697  1.00 0.00 ? 113 VAL A HG22 5  
ATOM 7028  H HG23 . VAL A 1 76 ? -4.080  -1.645  -1.642  1.00 0.00 ? 113 VAL A HG23 5  
ATOM 7029  N N    . LYS A 1 77 ? -7.772  1.494   -0.253  1.00 0.00 ? 114 LYS A N    5  
ATOM 7030  C CA   . LYS A 1 77 ? -8.434  2.454   0.609   1.00 0.00 ? 114 LYS A CA   5  
ATOM 7031  C C    . LYS A 1 77 ? -8.135  2.092   2.058   1.00 0.00 ? 114 LYS A C    5  
ATOM 7032  O O    . LYS A 1 77 ? -8.161  0.915   2.415   1.00 0.00 ? 114 LYS A O    5  
ATOM 7033  C CB   . LYS A 1 77 ? -9.943  2.410   0.332   1.00 0.00 ? 114 LYS A CB   5  
ATOM 7034  C CG   . LYS A 1 77 ? -10.780 3.463   1.055   1.00 0.00 ? 114 LYS A CG   5  
ATOM 7035  C CD   . LYS A 1 77 ? -10.989 3.123   2.522   1.00 0.00 ? 114 LYS A CD   5  
ATOM 7036  C CE   . LYS A 1 77 ? -11.930 4.099   3.204   1.00 0.00 ? 114 LYS A CE   5  
ATOM 7037  N NZ   . LYS A 1 77 ? -13.326 3.962   2.712   1.00 0.00 ? 114 LYS A NZ   5  
ATOM 7038  H H    . LYS A 1 77 ? -8.040  0.548   -0.201  1.00 0.00 ? 114 LYS A H    5  
ATOM 7039  H HA   . LYS A 1 77 ? -8.051  3.439   0.392   1.00 0.00 ? 114 LYS A HA   5  
ATOM 7040  H HB2  . LYS A 1 77 ? -10.097 2.535   -0.729  1.00 0.00 ? 114 LYS A HB2  5  
ATOM 7041  H HB3  . LYS A 1 77 ? -10.304 1.438   0.620   1.00 0.00 ? 114 LYS A HB3  5  
ATOM 7042  H HG2  . LYS A 1 77 ? -10.272 4.414   0.987   1.00 0.00 ? 114 LYS A HG2  5  
ATOM 7043  H HG3  . LYS A 1 77 ? -11.743 3.534   0.571   1.00 0.00 ? 114 LYS A HG3  5  
ATOM 7044  H HD2  . LYS A 1 77 ? -11.403 2.132   2.597   1.00 0.00 ? 114 LYS A HD2  5  
ATOM 7045  H HD3  . LYS A 1 77 ? -10.032 3.153   3.024   1.00 0.00 ? 114 LYS A HD3  5  
ATOM 7046  H HE2  . LYS A 1 77 ? -11.912 3.912   4.267   1.00 0.00 ? 114 LYS A HE2  5  
ATOM 7047  H HE3  . LYS A 1 77 ? -11.587 5.105   3.010   1.00 0.00 ? 114 LYS A HE3  5  
ATOM 7048  H HZ1  . LYS A 1 77 ? -13.508 2.978   2.409   1.00 0.00 ? 114 LYS A HZ1  5  
ATOM 7049  H HZ2  . LYS A 1 77 ? -13.999 4.205   3.471   1.00 0.00 ? 114 LYS A HZ2  5  
ATOM 7050  H HZ3  . LYS A 1 77 ? -13.492 4.599   1.903   1.00 0.00 ? 114 LYS A HZ3  5  
ATOM 7051  N N    . LEU A 1 78 ? -7.684  3.062   2.842   1.00 0.00 ? 115 LEU A N    5  
ATOM 7052  C CA   . LEU A 1 78 ? -7.251  2.779   4.194   1.00 0.00 ? 115 LEU A CA   5  
ATOM 7053  C C    . LEU A 1 78 ? -8.430  2.474   5.100   1.00 0.00 ? 115 LEU A C    5  
ATOM 7054  O O    . LEU A 1 78 ? -9.253  3.344   5.394   1.00 0.00 ? 115 LEU A O    5  
ATOM 7055  C CB   . LEU A 1 78 ? -6.439  3.946   4.734   1.00 0.00 ? 115 LEU A CB   5  
ATOM 7056  C CG   . LEU A 1 78 ? -5.118  3.545   5.376   1.00 0.00 ? 115 LEU A CG   5  
ATOM 7057  C CD1  . LEU A 1 78 ? -5.289  3.346   6.872   1.00 0.00 ? 115 LEU A CD1  5  
ATOM 7058  C CD2  . LEU A 1 78 ? -4.577  2.272   4.732   1.00 0.00 ? 115 LEU A CD2  5  
ATOM 7059  H H    . LEU A 1 78 ? -7.498  3.953   2.460   1.00 0.00 ? 115 LEU A H    5  
ATOM 7060  H HA   . LEU A 1 78 ? -6.615  1.907   4.157   1.00 0.00 ? 115 LEU A HA   5  
ATOM 7061  H HB2  . LEU A 1 78 ? -6.234  4.626   3.918   1.00 0.00 ? 115 LEU A HB2  5  
ATOM 7062  H HB3  . LEU A 1 78 ? -7.033  4.461   5.472   1.00 0.00 ? 115 LEU A HB3  5  
ATOM 7063  H HG   . LEU A 1 78 ? -4.403  4.333   5.213   1.00 0.00 ? 115 LEU A HG   5  
ATOM 7064  H HD11 . LEU A 1 78 ? -6.271  3.681   7.169   1.00 0.00 ? 115 LEU A HD11 5  
ATOM 7065  H HD12 . LEU A 1 78 ? -5.178  2.300   7.111   1.00 0.00 ? 115 LEU A HD12 5  
ATOM 7066  H HD13 . LEU A 1 78 ? -4.538  3.918   7.399   1.00 0.00 ? 115 LEU A HD13 5  
ATOM 7067  H HD21 . LEU A 1 78 ? -4.801  2.279   3.673   1.00 0.00 ? 115 LEU A HD21 5  
ATOM 7068  H HD22 . LEU A 1 78 ? -3.508  2.222   4.873   1.00 0.00 ? 115 LEU A HD22 5  
ATOM 7069  H HD23 . LEU A 1 78 ? -5.043  1.412   5.192   1.00 0.00 ? 115 LEU A HD23 5  
ATOM 7070  N N    . ALA A 1 79 ? -8.496  1.226   5.530   1.00 0.00 ? 116 ALA A N    5  
ATOM 7071  C CA   . ALA A 1 79 ? -9.570  0.757   6.393   1.00 0.00 ? 116 ALA A CA   5  
ATOM 7072  C C    . ALA A 1 79 ? -9.476  1.395   7.769   1.00 0.00 ? 116 ALA A C    5  
ATOM 7073  O O    . ALA A 1 79 ? -8.399  1.455   8.368   1.00 0.00 ? 116 ALA A O    5  
ATOM 7074  C CB   . ALA A 1 79 ? -9.541  -0.759  6.511   1.00 0.00 ? 116 ALA A CB   5  
ATOM 7075  H H    . ALA A 1 79 ? -7.798  0.597   5.246   1.00 0.00 ? 116 ALA A H    5  
ATOM 7076  H HA   . ALA A 1 79 ? -10.510 1.040   5.941   1.00 0.00 ? 116 ALA A HA   5  
ATOM 7077  H HB1  . ALA A 1 79 ? -9.579  -1.196  5.524   1.00 0.00 ? 116 ALA A HB1  5  
ATOM 7078  H HB2  . ALA A 1 79 ? -10.391 -1.094  7.088   1.00 0.00 ? 116 ALA A HB2  5  
ATOM 7079  H HB3  . ALA A 1 79 ? -8.627  -1.065  7.003   1.00 0.00 ? 116 ALA A HB3  5  
ATOM 7080  N N    . LYS A 1 80 ? -10.602 1.901   8.247   1.00 0.00 ? 117 LYS A N    5  
ATOM 7081  C CA   . LYS A 1 80 ? -10.655 2.583   9.527   1.00 0.00 ? 117 LYS A CA   5  
ATOM 7082  C C    . LYS A 1 80 ? -11.999 2.323   10.205  1.00 0.00 ? 117 LYS A C    5  
ATOM 7083  O O    . LYS A 1 80 ? -12.817 3.232   10.359  1.00 0.00 ? 117 LYS A O    5  
ATOM 7084  C CB   . LYS A 1 80 ? -10.432 4.087   9.326   1.00 0.00 ? 117 LYS A CB   5  
ATOM 7085  C CG   . LYS A 1 80 ? -10.206 4.853   10.617  1.00 0.00 ? 117 LYS A CG   5  
ATOM 7086  C CD   . LYS A 1 80 ? -10.157 6.354   10.372  1.00 0.00 ? 117 LYS A CD   5  
ATOM 7087  C CE   . LYS A 1 80 ? -9.941  7.120   11.665  1.00 0.00 ? 117 LYS A CE   5  
ATOM 7088  N NZ   . LYS A 1 80 ? -8.601  6.858   12.250  1.00 0.00 ? 117 LYS A NZ   5  
ATOM 7089  H H    . LYS A 1 80 ? -11.416 1.865   7.692   1.00 0.00 ? 117 LYS A H    5  
ATOM 7090  H HA   . LYS A 1 80 ? -9.866  2.187   10.150  1.00 0.00 ? 117 LYS A HA   5  
ATOM 7091  H HB2  . LYS A 1 80 ? -9.568  4.229   8.695   1.00 0.00 ? 117 LYS A HB2  5  
ATOM 7092  H HB3  . LYS A 1 80 ? -11.298 4.504   8.834   1.00 0.00 ? 117 LYS A HB3  5  
ATOM 7093  H HG2  . LYS A 1 80 ? -11.015 4.637   11.298  1.00 0.00 ? 117 LYS A HG2  5  
ATOM 7094  H HG3  . LYS A 1 80 ? -9.271  4.537   11.053  1.00 0.00 ? 117 LYS A HG3  5  
ATOM 7095  H HD2  . LYS A 1 80 ? -9.344  6.572   9.694   1.00 0.00 ? 117 LYS A HD2  5  
ATOM 7096  H HD3  . LYS A 1 80 ? -11.091 6.666   9.928   1.00 0.00 ? 117 LYS A HD3  5  
ATOM 7097  H HE2  . LYS A 1 80 ? -10.033 8.176   11.461  1.00 0.00 ? 117 LYS A HE2  5  
ATOM 7098  H HE3  . LYS A 1 80 ? -10.699 6.825   12.374  1.00 0.00 ? 117 LYS A HE3  5  
ATOM 7099  H HZ1  . LYS A 1 80 ? -8.369  5.841   12.185  1.00 0.00 ? 117 LYS A HZ1  5  
ATOM 7100  H HZ2  . LYS A 1 80 ? -7.874  7.400   11.736  1.00 0.00 ? 117 LYS A HZ2  5  
ATOM 7101  H HZ3  . LYS A 1 80 ? -8.582  7.142   13.254  1.00 0.00 ? 117 LYS A HZ3  5  
ATOM 7102  N N    . LYS A 1 81 ? -12.237 1.068   10.576  1.00 0.00 ? 118 LYS A N    5  
ATOM 7103  C CA   . LYS A 1 81 ? -13.483 0.677   11.232  1.00 0.00 ? 118 LYS A CA   5  
ATOM 7104  C C    . LYS A 1 81 ? -13.339 -0.710  11.864  1.00 0.00 ? 118 LYS A C    5  
ATOM 7105  O O    . LYS A 1 81 ? -12.244 -1.091  12.274  1.00 0.00 ? 118 LYS A O    5  
ATOM 7106  C CB   . LYS A 1 81 ? -14.678 0.730   10.249  1.00 0.00 ? 118 LYS A CB   5  
ATOM 7107  C CG   . LYS A 1 81 ? -14.656 -0.292  9.112   1.00 0.00 ? 118 LYS A CG   5  
ATOM 7108  C CD   . LYS A 1 81 ? -13.494 -0.079  8.156   1.00 0.00 ? 118 LYS A CD   5  
ATOM 7109  C CE   . LYS A 1 81 ? -13.679 -0.855  6.864   1.00 0.00 ? 118 LYS A CE   5  
ATOM 7110  N NZ   . LYS A 1 81 ? -14.637 -0.187  5.941   1.00 0.00 ? 118 LYS A NZ   5  
ATOM 7111  H H    . LYS A 1 81 ? -11.545 0.382   10.416  1.00 0.00 ? 118 LYS A H    5  
ATOM 7112  H HA   . LYS A 1 81 ? -13.662 1.390   12.025  1.00 0.00 ? 118 LYS A HA   5  
ATOM 7113  H HB2  . LYS A 1 81 ? -15.586 0.575   10.811  1.00 0.00 ? 118 LYS A HB2  5  
ATOM 7114  H HB3  . LYS A 1 81 ? -14.713 1.717   9.809   1.00 0.00 ? 118 LYS A HB3  5  
ATOM 7115  H HG2  . LYS A 1 81 ? -14.576 -1.279  9.537   1.00 0.00 ? 118 LYS A HG2  5  
ATOM 7116  H HG3  . LYS A 1 81 ? -15.583 -0.214  8.558   1.00 0.00 ? 118 LYS A HG3  5  
ATOM 7117  H HD2  . LYS A 1 81 ? -13.419 0.972   7.925   1.00 0.00 ? 118 LYS A HD2  5  
ATOM 7118  H HD3  . LYS A 1 81 ? -12.584 -0.408  8.636   1.00 0.00 ? 118 LYS A HD3  5  
ATOM 7119  H HE2  . LYS A 1 81 ? -12.722 -0.942  6.371   1.00 0.00 ? 118 LYS A HE2  5  
ATOM 7120  H HE3  . LYS A 1 81 ? -14.051 -1.842  7.101   1.00 0.00 ? 118 LYS A HE3  5  
ATOM 7121  H HZ1  . LYS A 1 81 ? -14.754 0.814   6.204   1.00 0.00 ? 118 LYS A HZ1  5  
ATOM 7122  H HZ2  . LYS A 1 81 ? -14.277 -0.233  4.959   1.00 0.00 ? 118 LYS A HZ2  5  
ATOM 7123  H HZ3  . LYS A 1 81 ? -15.571 -0.655  5.978   1.00 0.00 ? 118 LYS A HZ3  5  
ATOM 7124  N N    . LYS A 1 82 ? -14.439 -1.446  11.983  1.00 0.00 ? 119 LYS A N    5  
ATOM 7125  C CA   . LYS A 1 82 ? -14.411 -2.765  12.612  1.00 0.00 ? 119 LYS A CA   5  
ATOM 7126  C C    . LYS A 1 82 ? -14.070 -3.852  11.597  1.00 0.00 ? 119 LYS A C    5  
ATOM 7127  O O    . LYS A 1 82 ? -13.213 -4.703  11.842  1.00 0.00 ? 119 LYS A O    5  
ATOM 7128  C CB   . LYS A 1 82 ? -15.754 -3.072  13.284  1.00 0.00 ? 119 LYS A CB   5  
ATOM 7129  C CG   . LYS A 1 82 ? -15.956 -2.370  14.621  1.00 0.00 ? 119 LYS A CG   5  
ATOM 7130  C CD   . LYS A 1 82 ? -16.073 -0.862  14.464  1.00 0.00 ? 119 LYS A CD   5  
ATOM 7131  C CE   . LYS A 1 82 ? -16.117 -0.167  15.815  1.00 0.00 ? 119 LYS A CE   5  
ATOM 7132  N NZ   . LYS A 1 82 ? -16.209 1.311   15.676  1.00 0.00 ? 119 LYS A NZ   5  
ATOM 7133  H H    . LYS A 1 82 ? -15.294 -1.093  11.651  1.00 0.00 ? 119 LYS A H    5  
ATOM 7134  H HA   . LYS A 1 82 ? -13.641 -2.747  13.369  1.00 0.00 ? 119 LYS A HA   5  
ATOM 7135  H HB2  . LYS A 1 82 ? -16.549 -2.766  12.622  1.00 0.00 ? 119 LYS A HB2  5  
ATOM 7136  H HB3  . LYS A 1 82 ? -15.825 -4.136  13.449  1.00 0.00 ? 119 LYS A HB3  5  
ATOM 7137  H HG2  . LYS A 1 82 ? -16.863 -2.741  15.075  1.00 0.00 ? 119 LYS A HG2  5  
ATOM 7138  H HG3  . LYS A 1 82 ? -15.116 -2.592  15.263  1.00 0.00 ? 119 LYS A HG3  5  
ATOM 7139  H HD2  . LYS A 1 82 ? -15.220 -0.498  13.909  1.00 0.00 ? 119 LYS A HD2  5  
ATOM 7140  H HD3  . LYS A 1 82 ? -16.980 -0.638  13.924  1.00 0.00 ? 119 LYS A HD3  5  
ATOM 7141  H HE2  . LYS A 1 82 ? -16.977 -0.523  16.359  1.00 0.00 ? 119 LYS A HE2  5  
ATOM 7142  H HE3  . LYS A 1 82 ? -15.217 -0.414  16.362  1.00 0.00 ? 119 LYS A HE3  5  
ATOM 7143  H HZ1  . LYS A 1 82 ? -16.974 1.562   15.009  1.00 0.00 ? 119 LYS A HZ1  5  
ATOM 7144  H HZ2  . LYS A 1 82 ? -16.411 1.748   16.600  1.00 0.00 ? 119 LYS A HZ2  5  
ATOM 7145  H HZ3  . LYS A 1 82 ? -15.308 1.697   15.315  1.00 0.00 ? 119 LYS A HZ3  5  
ATOM 7146  N N    . SER A 1 83 ? -14.747 -3.821  10.461  1.00 0.00 ? 120 SER A N    5  
ATOM 7147  C CA   . SER A 1 83 ? -14.523 -4.797  9.402   1.00 0.00 ? 120 SER A CA   5  
ATOM 7148  C C    . SER A 1 83 ? -14.931 -4.201  8.062   1.00 0.00 ? 120 SER A C    5  
ATOM 7149  O O    . SER A 1 83 ? -15.854 -3.389  7.998   1.00 0.00 ? 120 SER A O    5  
ATOM 7150  C CB   . SER A 1 83 ? -15.317 -6.081  9.678   1.00 0.00 ? 120 SER A CB   5  
ATOM 7151  O OG   . SER A 1 83 ? -14.930 -6.667  10.913  1.00 0.00 ? 120 SER A OG   5  
ATOM 7152  H H    . SER A 1 83 ? -15.426 -3.118  10.325  1.00 0.00 ? 120 SER A H    5  
ATOM 7153  H HA   . SER A 1 83 ? -13.468 -5.029  9.379   1.00 0.00 ? 120 SER A HA   5  
ATOM 7154  H HB2  . SER A 1 83 ? -16.371 -5.850  9.720   1.00 0.00 ? 120 SER A HB2  5  
ATOM 7155  H HB3  . SER A 1 83 ? -15.138 -6.790  8.882   1.00 0.00 ? 120 SER A HB3  5  
ATOM 7156  H HG   . SER A 1 83 ? -14.250 -6.110  11.328  1.00 0.00 ? 120 SER A HG   5  
ATOM 7157  N N    . PRO A 1 84 ? -14.208 -4.528  6.983   1.00 0.00 ? 121 PRO A N    5  
ATOM 7158  C CA   . PRO A 1 84 ? -14.494 -3.977  5.666   1.00 0.00 ? 121 PRO A CA   5  
ATOM 7159  C C    . PRO A 1 84 ? -15.791 -4.522  5.090   1.00 0.00 ? 121 PRO A C    5  
ATOM 7160  O O    . PRO A 1 84 ? -16.027 -5.732  5.081   1.00 0.00 ? 121 PRO A O    5  
ATOM 7161  C CB   . PRO A 1 84 ? -13.316 -4.405  4.796   1.00 0.00 ? 121 PRO A CB   5  
ATOM 7162  C CG   . PRO A 1 84 ? -12.307 -5.005  5.726   1.00 0.00 ? 121 PRO A CG   5  
ATOM 7163  C CD   . PRO A 1 84 ? -13.047 -5.425  6.964   1.00 0.00 ? 121 PRO A CD   5  
ATOM 7164  H HA   . PRO A 1 84 ? -14.547 -2.897  5.696   1.00 0.00 ? 121 PRO A HA   5  
ATOM 7165  H HB2  . PRO A 1 84 ? -13.664 -5.120  4.068   1.00 0.00 ? 121 PRO A HB2  5  
ATOM 7166  H HB3  . PRO A 1 84 ? -12.913 -3.541  4.287   1.00 0.00 ? 121 PRO A HB3  5  
ATOM 7167  H HG2  . PRO A 1 84 ? -11.846 -5.863  5.260   1.00 0.00 ? 121 PRO A HG2  5  
ATOM 7168  H HG3  . PRO A 1 84 ? -11.557 -4.268  5.974   1.00 0.00 ? 121 PRO A HG3  5  
ATOM 7169  H HD2  . PRO A 1 84 ? -13.359 -6.456  6.886   1.00 0.00 ? 121 PRO A HD2  5  
ATOM 7170  H HD3  . PRO A 1 84 ? -12.434 -5.280  7.840   1.00 0.00 ? 121 PRO A HD3  5  
ATOM 7171  N N    . GLU A 1 85 ? -16.610 -3.617  4.594   1.00 0.00 ? 122 GLU A N    5  
ATOM 7172  C CA   . GLU A 1 85 ? -17.885 -3.966  3.996   1.00 0.00 ? 122 GLU A CA   5  
ATOM 7173  C C    . GLU A 1 85 ? -17.710 -4.192  2.496   1.00 0.00 ? 122 GLU A C    5  
ATOM 7174  O O    . GLU A 1 85 ? -18.520 -3.762  1.674   1.00 0.00 ? 122 GLU A O    5  
ATOM 7175  C CB   . GLU A 1 85 ? -18.933 -2.872  4.275   1.00 0.00 ? 122 GLU A CB   5  
ATOM 7176  C CG   . GLU A 1 85 ? -18.612 -1.502  3.679   1.00 0.00 ? 122 GLU A CG   5  
ATOM 7177  C CD   . GLU A 1 85 ? -17.579 -0.702  4.458   1.00 0.00 ? 122 GLU A CD   5  
ATOM 7178  O OE1  . GLU A 1 85 ? -17.095 -1.178  5.507   1.00 0.00 ? 122 GLU A OE1  5  
ATOM 7179  O OE2  . GLU A 1 85 ? -17.254 0.422   4.022   1.00 0.00 ? 122 GLU A OE2  5  
ATOM 7180  H H    . GLU A 1 85 ? -16.339 -2.679  4.622   1.00 0.00 ? 122 GLU A H    5  
ATOM 7181  H HA   . GLU A 1 85 ? -18.215 -4.892  4.444   1.00 0.00 ? 122 GLU A HA   5  
ATOM 7182  H HB2  . GLU A 1 85 ? -19.881 -3.194  3.873   1.00 0.00 ? 122 GLU A HB2  5  
ATOM 7183  H HB3  . GLU A 1 85 ? -19.032 -2.756  5.346   1.00 0.00 ? 122 GLU A HB3  5  
ATOM 7184  H HG2  . GLU A 1 85 ? -18.239 -1.646  2.675   1.00 0.00 ? 122 GLU A HG2  5  
ATOM 7185  H HG3  . GLU A 1 85 ? -19.525 -0.927  3.635   1.00 0.00 ? 122 GLU A HG3  5  
ATOM 7186  N N    . VAL A 1 86 ? -16.613 -4.840  2.154   1.00 0.00 ? 123 VAL A N    5  
ATOM 7187  C CA   . VAL A 1 86 ? -16.266 -5.098  0.776   1.00 0.00 ? 123 VAL A CA   5  
ATOM 7188  C C    . VAL A 1 86 ? -15.581 -6.455  0.663   1.00 0.00 ? 123 VAL A C    5  
ATOM 7189  O O    . VAL A 1 86 ? -14.855 -6.870  1.572   1.00 0.00 ? 123 VAL A O    5  
ATOM 7190  C CB   . VAL A 1 86 ? -15.352 -3.979  0.227   1.00 0.00 ? 123 VAL A CB   5  
ATOM 7191  C CG1  . VAL A 1 86 ? -14.008 -3.959  0.942   1.00 0.00 ? 123 VAL A CG1  5  
ATOM 7192  C CG2  . VAL A 1 86 ? -15.164 -4.106  -1.277  1.00 0.00 ? 123 VAL A CG2  5  
ATOM 7193  H H    . VAL A 1 86 ? -15.993 -5.118  2.855   1.00 0.00 ? 123 VAL A H    5  
ATOM 7194  H HA   . VAL A 1 86 ? -17.178 -5.113  0.196   1.00 0.00 ? 123 VAL A HA   5  
ATOM 7195  H HB   . VAL A 1 86 ? -15.840 -3.038  0.424   1.00 0.00 ? 123 VAL A HB   5  
ATOM 7196  H HG11 . VAL A 1 86 ? -14.009 -4.697  1.728   1.00 0.00 ? 123 VAL A HG11 5  
ATOM 7197  H HG12 . VAL A 1 86 ? -13.221 -4.184  0.238   1.00 0.00 ? 123 VAL A HG12 5  
ATOM 7198  H HG13 . VAL A 1 86 ? -13.840 -2.980  1.368   1.00 0.00 ? 123 VAL A HG13 5  
ATOM 7199  H HG21 . VAL A 1 86 ? -15.651 -5.004  -1.628  1.00 0.00 ? 123 VAL A HG21 5  
ATOM 7200  H HG22 . VAL A 1 86 ? -15.599 -3.247  -1.768  1.00 0.00 ? 123 VAL A HG22 5  
ATOM 7201  H HG23 . VAL A 1 86 ? -14.110 -4.153  -1.505  1.00 0.00 ? 123 VAL A HG23 5  
ATOM 7202  N N    . LYS A 1 87 ? -15.900 -7.181  -0.396  1.00 0.00 ? 124 LYS A N    5  
ATOM 7203  C CA   . LYS A 1 87 ? -15.359 -8.515  -0.606  1.00 0.00 ? 124 LYS A CA   5  
ATOM 7204  C C    . LYS A 1 87 ? -15.624 -8.938  -2.040  1.00 0.00 ? 124 LYS A C    5  
ATOM 7205  O O    . LYS A 1 87 ? -14.701 -9.096  -2.837  1.00 0.00 ? 124 LYS A O    5  
ATOM 7206  C CB   . LYS A 1 87 ? -16.010 -9.513  0.357   1.00 0.00 ? 124 LYS A CB   5  
ATOM 7207  C CG   . LYS A 1 87 ? -15.151 -10.731 0.664   1.00 0.00 ? 124 LYS A CG   5  
ATOM 7208  C CD   . LYS A 1 87 ? -13.910 -10.342 1.445   1.00 0.00 ? 124 LYS A CD   5  
ATOM 7209  C CE   . LYS A 1 87 ? -13.161 -11.557 1.966   1.00 0.00 ? 124 LYS A CE   5  
ATOM 7210  N NZ   . LYS A 1 87 ? -11.968 -11.169 2.765   1.00 0.00 ? 124 LYS A NZ   5  
ATOM 7211  H H    . LYS A 1 87 ? -16.547 -6.825  -1.041  1.00 0.00 ? 124 LYS A H    5  
ATOM 7212  H HA   . LYS A 1 87 ? -14.294 -8.484  -0.432  1.00 0.00 ? 124 LYS A HA   5  
ATOM 7213  H HB2  . LYS A 1 87 ? -16.221 -9.008  1.287   1.00 0.00 ? 124 LYS A HB2  5  
ATOM 7214  H HB3  . LYS A 1 87 ? -16.940 -9.855  -0.074  1.00 0.00 ? 124 LYS A HB3  5  
ATOM 7215  H HG2  . LYS A 1 87 ? -15.730 -11.432 1.245   1.00 0.00 ? 124 LYS A HG2  5  
ATOM 7216  H HG3  . LYS A 1 87 ? -14.853 -11.193 -0.267  1.00 0.00 ? 124 LYS A HG3  5  
ATOM 7217  H HD2  . LYS A 1 87 ? -13.253 -9.779  0.797   1.00 0.00 ? 124 LYS A HD2  5  
ATOM 7218  H HD3  . LYS A 1 87 ? -14.203 -9.726  2.283   1.00 0.00 ? 124 LYS A HD3  5  
ATOM 7219  H HE2  . LYS A 1 87 ? -13.828 -12.137 2.587   1.00 0.00 ? 124 LYS A HE2  5  
ATOM 7220  H HE3  . LYS A 1 87 ? -12.842 -12.154 1.125   1.00 0.00 ? 124 LYS A HE3  5  
ATOM 7221  H HZ1  . LYS A 1 87 ? -12.006 -10.153 3.000   1.00 0.00 ? 124 LYS A HZ1  5  
ATOM 7222  H HZ2  . LYS A 1 87 ? -11.933 -11.717 3.652   1.00 0.00 ? 124 LYS A HZ2  5  
ATOM 7223  H HZ3  . LYS A 1 87 ? -11.097 -11.354 2.219   1.00 0.00 ? 124 LYS A HZ3  5  
ATOM 7224  N N    . LYS A 1 88 ? -16.898 -8.975  -2.394  1.00 0.00 ? 125 LYS A N    5  
ATOM 7225  C CA   . LYS A 1 88 ? -17.304 -9.250  -3.761  1.00 0.00 ? 125 LYS A CA   5  
ATOM 7226  C C    . LYS A 1 88 ? -17.907 -8.000  -4.376  1.00 0.00 ? 125 LYS A C    5  
ATOM 7227  O O    . LYS A 1 88 ? -18.741 -7.346  -3.751  1.00 0.00 ? 125 LYS A O    5  
ATOM 7228  C CB   . LYS A 1 88 ? -18.314 -10.396 -3.792  1.00 0.00 ? 125 LYS A CB   5  
ATOM 7229  C CG   . LYS A 1 88 ? -17.713 -11.737 -3.404  1.00 0.00 ? 125 LYS A CG   5  
ATOM 7230  C CD   . LYS A 1 88 ? -18.772 -12.820 -3.278  1.00 0.00 ? 125 LYS A CD   5  
ATOM 7231  C CE   . LYS A 1 88 ? -19.606 -12.954 -4.543  1.00 0.00 ? 125 LYS A CE   5  
ATOM 7232  N NZ   . LYS A 1 88 ? -18.768 -13.153 -5.756  1.00 0.00 ? 125 LYS A NZ   5  
ATOM 7233  H H    . LYS A 1 88 ? -17.586 -8.727  -1.733  1.00 0.00 ? 125 LYS A H    5  
ATOM 7234  H HA   . LYS A 1 88 ? -16.426 -9.532  -4.323  1.00 0.00 ? 125 LYS A HA   5  
ATOM 7235  H HB2  . LYS A 1 88 ? -19.119 -10.174 -3.108  1.00 0.00 ? 125 LYS A HB2  5  
ATOM 7236  H HB3  . LYS A 1 88 ? -18.715 -10.483 -4.792  1.00 0.00 ? 125 LYS A HB3  5  
ATOM 7237  H HG2  . LYS A 1 88 ? -17.002 -12.034 -4.160  1.00 0.00 ? 125 LYS A HG2  5  
ATOM 7238  H HG3  . LYS A 1 88 ? -17.206 -11.631 -2.455  1.00 0.00 ? 125 LYS A HG3  5  
ATOM 7239  H HD2  . LYS A 1 88 ? -18.286 -13.763 -3.081  1.00 0.00 ? 125 LYS A HD2  5  
ATOM 7240  H HD3  . LYS A 1 88 ? -19.427 -12.572 -2.454  1.00 0.00 ? 125 LYS A HD3  5  
ATOM 7241  H HE2  . LYS A 1 88 ? -20.267 -13.801 -4.433  1.00 0.00 ? 125 LYS A HE2  5  
ATOM 7242  H HE3  . LYS A 1 88 ? -20.193 -12.055 -4.666  1.00 0.00 ? 125 LYS A HE3  5  
ATOM 7243  H HZ1  . LYS A 1 88 ? -17.776 -13.333 -5.489  1.00 0.00 ? 125 LYS A HZ1  5  
ATOM 7244  H HZ2  . LYS A 1 88 ? -19.120 -13.965 -6.307  1.00 0.00 ? 125 LYS A HZ2  5  
ATOM 7245  H HZ3  . LYS A 1 88 ? -18.807 -12.301 -6.358  1.00 0.00 ? 125 LYS A HZ3  5  
ATOM 7246  N N    . GLU A 1 89 ? -17.429 -7.634  -5.558  1.00 0.00 ? 126 GLU A N    5  
ATOM 7247  C CA   . GLU A 1 89 ? -17.878 -6.417  -6.231  1.00 0.00 ? 126 GLU A CA   5  
ATOM 7248  C C    . GLU A 1 89 ? -17.610 -5.195  -5.352  1.00 0.00 ? 126 GLU A C    5  
ATOM 7249  O O    . GLU A 1 89 ? -16.499 -5.018  -4.840  1.00 0.00 ? 126 GLU A O    5  
ATOM 7250  C CB   . GLU A 1 89 ? -19.370 -6.498  -6.568  1.00 0.00 ? 126 GLU A CB   5  
ATOM 7251  C CG   . GLU A 1 89 ? -19.738 -7.646  -7.487  1.00 0.00 ? 126 GLU A CG   5  
ATOM 7252  C CD   . GLU A 1 89 ? -21.232 -7.758  -7.689  1.00 0.00 ? 126 GLU A CD   5  
ATOM 7253  O OE1  . GLU A 1 89 ? -21.982 -7.027  -7.008  1.00 0.00 ? 126 GLU A OE1  5  
ATOM 7254  O OE2  . GLU A 1 89 ? -21.666 -8.575  -8.531  1.00 0.00 ? 126 GLU A OE2  5  
ATOM 7255  H H    . GLU A 1 89 ? -16.705 -8.164  -5.964  1.00 0.00 ? 126 GLU A H    5  
ATOM 7256  H HA   . GLU A 1 89 ? -17.315 -6.316  -7.146  1.00 0.00 ? 126 GLU A HA   5  
ATOM 7257  H HB2  . GLU A 1 89 ? -19.926 -6.613  -5.649  1.00 0.00 ? 126 GLU A HB2  5  
ATOM 7258  H HB3  . GLU A 1 89 ? -19.668 -5.578  -7.043  1.00 0.00 ? 126 GLU A HB3  5  
ATOM 7259  H HG2  . GLU A 1 89 ? -19.270 -7.490  -8.448  1.00 0.00 ? 126 GLU A HG2  5  
ATOM 7260  H HG3  . GLU A 1 89 ? -19.376 -8.569  -7.056  1.00 0.00 ? 126 GLU A HG3  5  
ATOM 7261  N N    . LYS A 1 90 ? -18.658 -4.398  -5.134  1.00 0.00 ? 127 LYS A N    5  
ATOM 7262  C CA   . LYS A 1 90 ? -18.594 -3.229  -4.264  1.00 0.00 ? 127 LYS A CA   5  
ATOM 7263  C C    . LYS A 1 90 ? -17.508 -2.260  -4.713  1.00 0.00 ? 127 LYS A C    5  
ATOM 7264  O O    . LYS A 1 90 ? -16.794 -1.678  -3.891  1.00 0.00 ? 127 LYS A O    5  
ATOM 7265  C CB   . LYS A 1 90 ? -18.380 -3.650  -2.808  1.00 0.00 ? 127 LYS A CB   5  
ATOM 7266  C CG   . LYS A 1 90 ? -19.556 -4.408  -2.217  1.00 0.00 ? 127 LYS A CG   5  
ATOM 7267  C CD   . LYS A 1 90 ? -20.816 -3.557  -2.214  1.00 0.00 ? 127 LYS A CD   5  
ATOM 7268  C CE   . LYS A 1 90 ? -22.004 -4.312  -1.643  1.00 0.00 ? 127 LYS A CE   5  
ATOM 7269  N NZ   . LYS A 1 90 ? -22.386 -5.483  -2.476  1.00 0.00 ? 127 LYS A NZ   5  
ATOM 7270  H H    . LYS A 1 90 ? -19.518 -4.632  -5.541  1.00 0.00 ? 127 LYS A H    5  
ATOM 7271  H HA   . LYS A 1 90 ? -19.546 -2.725  -4.337  1.00 0.00 ? 127 LYS A HA   5  
ATOM 7272  H HB2  . LYS A 1 90 ? -17.506 -4.281  -2.750  1.00 0.00 ? 127 LYS A HB2  5  
ATOM 7273  H HB3  . LYS A 1 90 ? -18.213 -2.764  -2.212  1.00 0.00 ? 127 LYS A HB3  5  
ATOM 7274  H HG2  . LYS A 1 90 ? -19.733 -5.295  -2.806  1.00 0.00 ? 127 LYS A HG2  5  
ATOM 7275  H HG3  . LYS A 1 90 ? -19.320 -4.688  -1.201  1.00 0.00 ? 127 LYS A HG3  5  
ATOM 7276  H HD2  . LYS A 1 90 ? -20.641 -2.676  -1.615  1.00 0.00 ? 127 LYS A HD2  5  
ATOM 7277  H HD3  . LYS A 1 90 ? -21.041 -3.264  -3.229  1.00 0.00 ? 127 LYS A HD3  5  
ATOM 7278  H HE2  . LYS A 1 90 ? -21.751 -4.658  -0.652  1.00 0.00 ? 127 LYS A HE2  5  
ATOM 7279  H HE3  . LYS A 1 90 ? -22.846 -3.637  -1.581  1.00 0.00 ? 127 LYS A HE3  5  
ATOM 7280  H HZ1  . LYS A 1 90 ? -22.396 -5.225  -3.485  1.00 0.00 ? 127 LYS A HZ1  5  
ATOM 7281  H HZ2  . LYS A 1 90 ? -21.710 -6.265  -2.337  1.00 0.00 ? 127 LYS A HZ2  5  
ATOM 7282  H HZ3  . LYS A 1 90 ? -23.338 -5.815  -2.209  1.00 0.00 ? 127 LYS A HZ3  5  
ATOM 7283  N N    . GLU A 1 91 ? -17.429 -2.044  -6.015  1.00 0.00 ? 128 GLU A N    5  
ATOM 7284  C CA   . GLU A 1 91 ? -16.491 -1.086  -6.564  1.00 0.00 ? 128 GLU A CA   5  
ATOM 7285  C C    . GLU A 1 91 ? -16.979 0.329   -6.293  1.00 0.00 ? 128 GLU A C    5  
ATOM 7286  O O    . GLU A 1 91 ? -18.153 0.643   -6.510  1.00 0.00 ? 128 GLU A O    5  
ATOM 7287  C CB   . GLU A 1 91 ? -16.301 -1.296  -8.066  1.00 0.00 ? 128 GLU A CB   5  
ATOM 7288  C CG   . GLU A 1 91 ? -15.799 -2.685  -8.434  1.00 0.00 ? 128 GLU A CG   5  
ATOM 7289  C CD   . GLU A 1 91 ? -16.912 -3.710  -8.554  1.00 0.00 ? 128 GLU A CD   5  
ATOM 7290  O OE1  . GLU A 1 91 ? -18.093 -3.314  -8.469  1.00 0.00 ? 128 GLU A OE1  5  
ATOM 7291  O OE2  . GLU A 1 91 ? -16.611 -4.913  -8.706  1.00 0.00 ? 128 GLU A OE2  5  
ATOM 7292  H H    . GLU A 1 91 ? -18.051 -2.506  -6.620  1.00 0.00 ? 128 GLU A H    5  
ATOM 7293  H HA   . GLU A 1 91 ? -15.544 -1.230  -6.064  1.00 0.00 ? 128 GLU A HA   5  
ATOM 7294  H HB2  . GLU A 1 91 ? -17.247 -1.138  -8.560  1.00 0.00 ? 128 GLU A HB2  5  
ATOM 7295  H HB3  . GLU A 1 91 ? -15.590 -0.571  -8.429  1.00 0.00 ? 128 GLU A HB3  5  
ATOM 7296  H HG2  . GLU A 1 91 ? -15.282 -2.627  -9.380  1.00 0.00 ? 128 GLU A HG2  5  
ATOM 7297  H HG3  . GLU A 1 91 ? -15.110 -3.015  -7.670  1.00 0.00 ? 128 GLU A HG3  5  
ATOM 7298  N N    . VAL A 1 92 ? -16.082 1.169   -5.800  1.00 0.00 ? 129 VAL A N    5  
ATOM 7299  C CA   . VAL A 1 92 ? -16.414 2.545   -5.485  1.00 0.00 ? 129 VAL A CA   5  
ATOM 7300  C C    . VAL A 1 92 ? -16.763 3.311   -6.756  1.00 0.00 ? 129 VAL A C    5  
ATOM 7301  O O    . VAL A 1 92 ? -16.126 3.134   -7.798  1.00 0.00 ? 129 VAL A O    5  
ATOM 7302  C CB   . VAL A 1 92 ? -15.260 3.252   -4.735  1.00 0.00 ? 129 VAL A CB   5  
ATOM 7303  C CG1  . VAL A 1 92 ? -14.023 3.391   -5.612  1.00 0.00 ? 129 VAL A CG1  5  
ATOM 7304  C CG2  . VAL A 1 92 ? -15.709 4.608   -4.218  1.00 0.00 ? 129 VAL A CG2  5  
ATOM 7305  H H    . VAL A 1 92 ? -15.163 0.854   -5.657  1.00 0.00 ? 129 VAL A H    5  
ATOM 7306  H HA   . VAL A 1 92 ? -17.280 2.534   -4.839  1.00 0.00 ? 129 VAL A HA   5  
ATOM 7307  H HB   . VAL A 1 92 ? -14.993 2.644   -3.884  1.00 0.00 ? 129 VAL A HB   5  
ATOM 7308  H HG11 . VAL A 1 92 ? -14.038 2.632   -6.379  1.00 0.00 ? 129 VAL A HG11 5  
ATOM 7309  H HG12 . VAL A 1 92 ? -14.015 4.369   -6.072  1.00 0.00 ? 129 VAL A HG12 5  
ATOM 7310  H HG13 . VAL A 1 92 ? -13.136 3.272   -5.005  1.00 0.00 ? 129 VAL A HG13 5  
ATOM 7311  H HG21 . VAL A 1 92 ? -16.151 5.172   -5.025  1.00 0.00 ? 129 VAL A HG21 5  
ATOM 7312  H HG22 . VAL A 1 92 ? -16.438 4.470   -3.434  1.00 0.00 ? 129 VAL A HG22 5  
ATOM 7313  H HG23 . VAL A 1 92 ? -14.858 5.146   -3.827  1.00 0.00 ? 129 VAL A HG23 5  
ATOM 7314  N N    . SER A 1 93 ? -17.832 4.083   -6.692  1.00 0.00 ? 130 SER A N    5  
ATOM 7315  C CA   . SER A 1 93 ? -18.310 4.826   -7.841  1.00 0.00 ? 130 SER A CA   5  
ATOM 7316  C C    . SER A 1 93 ? -18.908 6.147   -7.379  1.00 0.00 ? 130 SER A C    5  
ATOM 7317  O O    . SER A 1 93 ? -19.039 7.070   -8.207  1.00 0.00 ? 130 SER A O    5  
ATOM 7318  C CB   . SER A 1 93 ? -19.356 4.005   -8.601  1.00 0.00 ? 130 SER A CB   5  
ATOM 7319  O OG   . SER A 1 93 ? -18.849 2.723   -8.946  1.00 0.00 ? 130 SER A OG   5  
ATOM 7320  O OXT  . SER A 1 93 ? -19.210 6.264   -6.170  1.00 0.00 ? 130 SER A OXT  5  
ATOM 7321  H H    . SER A 1 93 ? -18.337 4.132   -5.854  1.00 0.00 ? 130 SER A H    5  
ATOM 7322  H HA   . SER A 1 93 ? -17.469 5.026   -8.488  1.00 0.00 ? 130 SER A HA   5  
ATOM 7323  H HB2  . SER A 1 93 ? -20.230 3.877   -7.978  1.00 0.00 ? 130 SER A HB2  5  
ATOM 7324  H HB3  . SER A 1 93 ? -19.633 4.526   -9.506  1.00 0.00 ? 130 SER A HB3  5  
ATOM 7325  H HG   . SER A 1 93 ? -18.558 2.272   -8.143  1.00 0.00 ? 130 SER A HG   5  
ATOM 7326  N N    . LYS A 1 2  ? 24.479  0.963   9.039   1.00 0.00 ? 39  LYS A N    6  
ATOM 7327  C CA   . LYS A 1 2  ? 25.072  0.860   10.395  1.00 0.00 ? 39  LYS A CA   6  
ATOM 7328  C C    . LYS A 1 2  ? 24.354  -0.192  11.238  1.00 0.00 ? 39  LYS A C    6  
ATOM 7329  O O    . LYS A 1 2  ? 24.992  -0.978  11.941  1.00 0.00 ? 39  LYS A O    6  
ATOM 7330  C CB   . LYS A 1 2  ? 25.020  2.238   11.072  1.00 0.00 ? 39  LYS A CB   6  
ATOM 7331  C CG   . LYS A 1 2  ? 23.625  2.840   11.167  1.00 0.00 ? 39  LYS A CG   6  
ATOM 7332  C CD   . LYS A 1 2  ? 23.621  4.152   11.944  1.00 0.00 ? 39  LYS A CD   6  
ATOM 7333  C CE   . LYS A 1 2  ? 24.369  5.262   11.213  1.00 0.00 ? 39  LYS A CE   6  
ATOM 7334  N NZ   . LYS A 1 2  ? 23.744  5.604   9.905   1.00 0.00 ? 39  LYS A NZ   6  
ATOM 7335  H H1   . LYS A 1 2  ? 24.213  0.014   8.695   1.00 0.00 ? 39  LYS A H1   6  
ATOM 7336  H H2   . LYS A 1 2  ? 23.628  1.564   9.055   1.00 0.00 ? 39  LYS A H2   6  
ATOM 7337  H H3   . LYS A 1 2  ? 25.167  1.378   8.377   1.00 0.00 ? 39  LYS A H3   6  
ATOM 7338  H HA   . LYS A 1 2  ? 26.105  0.563   10.286  1.00 0.00 ? 39  LYS A HA   6  
ATOM 7339  H HB2  . LYS A 1 2  ? 25.413  2.147   12.075  1.00 0.00 ? 39  LYS A HB2  6  
ATOM 7340  H HB3  . LYS A 1 2  ? 25.643  2.918   10.514  1.00 0.00 ? 39  LYS A HB3  6  
ATOM 7341  H HG2  . LYS A 1 2  ? 23.257  3.024   10.168  1.00 0.00 ? 39  LYS A HG2  6  
ATOM 7342  H HG3  . LYS A 1 2  ? 22.976  2.136   11.666  1.00 0.00 ? 39  LYS A HG3  6  
ATOM 7343  H HD2  . LYS A 1 2  ? 22.598  4.465   12.093  1.00 0.00 ? 39  LYS A HD2  6  
ATOM 7344  H HD3  . LYS A 1 2  ? 24.090  3.990   12.902  1.00 0.00 ? 39  LYS A HD3  6  
ATOM 7345  H HE2  . LYS A 1 2  ? 24.373  6.144   11.834  1.00 0.00 ? 39  LYS A HE2  6  
ATOM 7346  H HE3  . LYS A 1 2  ? 25.386  4.943   11.042  1.00 0.00 ? 39  LYS A HE3  6  
ATOM 7347  H HZ1  . LYS A 1 2  ? 22.760  5.252   9.868   1.00 0.00 ? 39  LYS A HZ1  6  
ATOM 7348  H HZ2  . LYS A 1 2  ? 23.736  6.638   9.772   1.00 0.00 ? 39  LYS A HZ2  6  
ATOM 7349  H HZ3  . LYS A 1 2  ? 24.285  5.172   9.125   1.00 0.00 ? 39  LYS A HZ3  6  
ATOM 7350  N N    . GLU A 1 3  ? 23.030  -0.232  11.136  1.00 0.00 ? 40  GLU A N    6  
ATOM 7351  C CA   . GLU A 1 3  ? 22.229  -1.202  11.866  1.00 0.00 ? 40  GLU A CA   6  
ATOM 7352  C C    . GLU A 1 3  ? 20.818  -1.237  11.292  1.00 0.00 ? 40  GLU A C    6  
ATOM 7353  O O    . GLU A 1 3  ? 20.223  -0.183  11.047  1.00 0.00 ? 40  GLU A O    6  
ATOM 7354  C CB   . GLU A 1 3  ? 22.179  -0.839  13.354  1.00 0.00 ? 40  GLU A CB   6  
ATOM 7355  C CG   . GLU A 1 3  ? 21.574  -1.926  14.227  1.00 0.00 ? 40  GLU A CG   6  
ATOM 7356  C CD   . GLU A 1 3  ? 21.365  -1.477  15.655  1.00 0.00 ? 40  GLU A CD   6  
ATOM 7357  O OE1  . GLU A 1 3  ? 22.349  -1.083  16.314  1.00 0.00 ? 40  GLU A OE1  6  
ATOM 7358  O OE2  . GLU A 1 3  ? 20.207  -1.504  16.124  1.00 0.00 ? 40  GLU A OE2  6  
ATOM 7359  H H    . GLU A 1 3  ? 22.575  0.402   10.537  1.00 0.00 ? 40  GLU A H    6  
ATOM 7360  H HA   . GLU A 1 3  ? 22.685  -2.174  11.750  1.00 0.00 ? 40  GLU A HA   6  
ATOM 7361  H HB2  . GLU A 1 3  ? 23.185  -0.650  13.698  1.00 0.00 ? 40  GLU A HB2  6  
ATOM 7362  H HB3  . GLU A 1 3  ? 21.591  0.058   13.472  1.00 0.00 ? 40  GLU A HB3  6  
ATOM 7363  H HG2  . GLU A 1 3  ? 20.618  -2.212  13.813  1.00 0.00 ? 40  GLU A HG2  6  
ATOM 7364  H HG3  . GLU A 1 3  ? 22.233  -2.781  14.228  1.00 0.00 ? 40  GLU A HG3  6  
ATOM 7365  N N    . GLU A 1 4  ? 20.322  -2.446  11.034  1.00 0.00 ? 41  GLU A N    6  
ATOM 7366  C CA   . GLU A 1 4  ? 19.008  -2.656  10.424  1.00 0.00 ? 41  GLU A CA   6  
ATOM 7367  C C    . GLU A 1 4  ? 18.964  -2.093  8.998   1.00 0.00 ? 41  GLU A C    6  
ATOM 7368  O O    . GLU A 1 4  ? 18.875  -0.879  8.790   1.00 0.00 ? 41  GLU A O    6  
ATOM 7369  C CB   . GLU A 1 4  ? 17.902  -2.020  11.274  1.00 0.00 ? 41  GLU A CB   6  
ATOM 7370  C CG   . GLU A 1 4  ? 16.525  -2.088  10.634  1.00 0.00 ? 41  GLU A CG   6  
ATOM 7371  C CD   . GLU A 1 4  ? 15.512  -1.209  11.333  1.00 0.00 ? 41  GLU A CD   6  
ATOM 7372  O OE1  . GLU A 1 4  ? 15.119  -1.540  12.473  1.00 0.00 ? 41  GLU A OE1  6  
ATOM 7373  O OE2  . GLU A 1 4  ? 15.081  -0.200  10.744  1.00 0.00 ? 41  GLU A OE2  6  
ATOM 7374  H H    . GLU A 1 4  ? 20.880  -3.232  11.227  1.00 0.00 ? 41  GLU A H    6  
ATOM 7375  H HA   . GLU A 1 4  ? 18.840  -3.722  10.376  1.00 0.00 ? 41  GLU A HA   6  
ATOM 7376  H HB2  . GLU A 1 4  ? 17.856  -2.529  12.224  1.00 0.00 ? 41  GLU A HB2  6  
ATOM 7377  H HB3  . GLU A 1 4  ? 18.145  -0.981  11.443  1.00 0.00 ? 41  GLU A HB3  6  
ATOM 7378  H HG2  . GLU A 1 4  ? 16.606  -1.770  9.605   1.00 0.00 ? 41  GLU A HG2  6  
ATOM 7379  H HG3  . GLU A 1 4  ? 16.178  -3.111  10.667  1.00 0.00 ? 41  GLU A HG3  6  
ATOM 7380  N N    . ALA A 1 5  ? 18.947  -2.983  8.019   1.00 0.00 ? 42  ALA A N    6  
ATOM 7381  C CA   . ALA A 1 5  ? 18.838  -2.581  6.628   1.00 0.00 ? 42  ALA A CA   6  
ATOM 7382  C C    . ALA A 1 5  ? 17.588  -3.188  6.011   1.00 0.00 ? 42  ALA A C    6  
ATOM 7383  O O    . ALA A 1 5  ? 17.477  -3.324  4.793   1.00 0.00 ? 42  ALA A O    6  
ATOM 7384  C CB   . ALA A 1 5  ? 20.082  -2.995  5.860   1.00 0.00 ? 42  ALA A CB   6  
ATOM 7385  H H    . ALA A 1 5  ? 18.961  -3.942  8.237   1.00 0.00 ? 42  ALA A H    6  
ATOM 7386  H HA   . ALA A 1 5  ? 18.760  -1.502  6.596   1.00 0.00 ? 42  ALA A HA   6  
ATOM 7387  H HB1  . ALA A 1 5  ? 20.644  -3.707  6.446   1.00 0.00 ? 42  ALA A HB1  6  
ATOM 7388  H HB2  . ALA A 1 5  ? 19.794  -3.448  4.923   1.00 0.00 ? 42  ALA A HB2  6  
ATOM 7389  H HB3  . ALA A 1 5  ? 20.694  -2.127  5.666   1.00 0.00 ? 42  ALA A HB3  6  
ATOM 7390  N N    . SER A 1 6  ? 16.626  -3.485  6.872   1.00 0.00 ? 43  SER A N    6  
ATOM 7391  C CA   . SER A 1 6  ? 15.334  -4.030  6.473   1.00 0.00 ? 43  SER A CA   6  
ATOM 7392  C C    . SER A 1 6  ? 14.373  -3.951  7.661   1.00 0.00 ? 43  SER A C    6  
ATOM 7393  O O    . SER A 1 6  ? 14.435  -2.998  8.439   1.00 0.00 ? 43  SER A O    6  
ATOM 7394  C CB   . SER A 1 6  ? 15.472  -5.487  5.997   1.00 0.00 ? 43  SER A CB   6  
ATOM 7395  O OG   . SER A 1 6  ? 16.174  -5.572  4.768   1.00 0.00 ? 43  SER A OG   6  
ATOM 7396  H H    . SER A 1 6  ? 16.778  -3.297  7.823   1.00 0.00 ? 43  SER A H    6  
ATOM 7397  H HA   . SER A 1 6  ? 14.950  -3.423  5.665   1.00 0.00 ? 43  SER A HA   6  
ATOM 7398  H HB2  . SER A 1 6  ? 16.008  -6.056  6.741   1.00 0.00 ? 43  SER A HB2  6  
ATOM 7399  H HB3  . SER A 1 6  ? 14.487  -5.909  5.862   1.00 0.00 ? 43  SER A HB3  6  
ATOM 7400  H HG   . SER A 1 6  ? 16.772  -4.812  4.689   1.00 0.00 ? 43  SER A HG   6  
ATOM 7401  N N    . SER A 1 7  ? 13.547  -4.981  7.830   1.00 0.00 ? 44  SER A N    6  
ATOM 7402  C CA   . SER A 1 7  ? 12.637  -5.086  8.969   1.00 0.00 ? 44  SER A CA   6  
ATOM 7403  C C    . SER A 1 7  ? 11.686  -3.895  9.062   1.00 0.00 ? 44  SER A C    6  
ATOM 7404  O O    . SER A 1 7  ? 11.241  -3.527  10.152  1.00 0.00 ? 44  SER A O    6  
ATOM 7405  C CB   . SER A 1 7  ? 13.437  -5.231  10.271  1.00 0.00 ? 44  SER A CB   6  
ATOM 7406  O OG   . SER A 1 7  ? 14.270  -6.384  10.236  1.00 0.00 ? 44  SER A OG   6  
ATOM 7407  H H    . SER A 1 7  ? 13.575  -5.722  7.187   1.00 0.00 ? 44  SER A H    6  
ATOM 7408  H HA   . SER A 1 7  ? 12.045  -5.979  8.827   1.00 0.00 ? 44  SER A HA   6  
ATOM 7409  H HB2  . SER A 1 7  ? 14.057  -4.359  10.408  1.00 0.00 ? 44  SER A HB2  6  
ATOM 7410  H HB3  . SER A 1 7  ? 12.752  -5.321  11.100  1.00 0.00 ? 44  SER A HB3  6  
ATOM 7411  H HG   . SER A 1 7  ? 14.279  -6.793  11.116  1.00 0.00 ? 44  SER A HG   6  
ATOM 7412  N N    . LYS A 1 8  ? 11.266  -3.386  7.912   1.00 0.00 ? 45  LYS A N    6  
ATOM 7413  C CA   . LYS A 1 8  ? 10.249  -2.347  7.880   1.00 0.00 ? 45  LYS A CA   6  
ATOM 7414  C C    . LYS A 1 8  ? 8.884   -2.993  7.695   1.00 0.00 ? 45  LYS A C    6  
ATOM 7415  O O    . LYS A 1 8  ? 8.706   -3.822  6.800   1.00 0.00 ? 45  LYS A O    6  
ATOM 7416  C CB   . LYS A 1 8  ? 10.518  -1.352  6.743   1.00 0.00 ? 45  LYS A CB   6  
ATOM 7417  C CG   . LYS A 1 8  ? 11.895  -0.699  6.787   1.00 0.00 ? 45  LYS A CG   6  
ATOM 7418  C CD   . LYS A 1 8  ? 12.098  0.103   8.061   1.00 0.00 ? 45  LYS A CD   6  
ATOM 7419  C CE   . LYS A 1 8  ? 13.416  0.863   8.033   1.00 0.00 ? 45  LYS A CE   6  
ATOM 7420  N NZ   . LYS A 1 8  ? 13.678  1.571   9.313   1.00 0.00 ? 45  LYS A NZ   6  
ATOM 7421  H H    . LYS A 1 8  ? 11.561  -3.802  7.066   1.00 0.00 ? 45  LYS A H    6  
ATOM 7422  H HA   . LYS A 1 8  ? 10.272  -1.827  8.824   1.00 0.00 ? 45  LYS A HA   6  
ATOM 7423  H HB2  . LYS A 1 8  ? 10.424  -1.871  5.802   1.00 0.00 ? 45  LYS A HB2  6  
ATOM 7424  H HB3  . LYS A 1 8  ? 9.773   -0.570  6.786   1.00 0.00 ? 45  LYS A HB3  6  
ATOM 7425  H HG2  . LYS A 1 8  ? 12.648  -1.470  6.735   1.00 0.00 ? 45  LYS A HG2  6  
ATOM 7426  H HG3  . LYS A 1 8  ? 11.994  -0.038  5.937   1.00 0.00 ? 45  LYS A HG3  6  
ATOM 7427  H HD2  . LYS A 1 8  ? 11.288  0.809   8.162   1.00 0.00 ? 45  LYS A HD2  6  
ATOM 7428  H HD3  . LYS A 1 8  ? 12.099  -0.573  8.906   1.00 0.00 ? 45  LYS A HD3  6  
ATOM 7429  H HE2  . LYS A 1 8  ? 14.216  0.161   7.850   1.00 0.00 ? 45  LYS A HE2  6  
ATOM 7430  H HE3  . LYS A 1 8  ? 13.384  1.587   7.226   1.00 0.00 ? 45  LYS A HE3  6  
ATOM 7431  H HZ1  . LYS A 1 8  ? 12.779  1.876   9.748   1.00 0.00 ? 45  LYS A HZ1  6  
ATOM 7432  H HZ2  . LYS A 1 8  ? 14.174  0.935   9.979   1.00 0.00 ? 45  LYS A HZ2  6  
ATOM 7433  H HZ3  . LYS A 1 8  ? 14.276  2.409   9.146   1.00 0.00 ? 45  LYS A HZ3  6  
ATOM 7434  N N    . SER A 1 9  ? 7.933   -2.662  8.557   1.00 0.00 ? 46  SER A N    6  
ATOM 7435  C CA   . SER A 1 9  ? 6.609   -3.252  8.464   1.00 0.00 ? 46  SER A CA   6  
ATOM 7436  C C    . SER A 1 9  ? 5.845   -2.627  7.305   1.00 0.00 ? 46  SER A C    6  
ATOM 7437  O O    . SER A 1 9  ? 5.517   -1.448  7.338   1.00 0.00 ? 46  SER A O    6  
ATOM 7438  C CB   . SER A 1 9  ? 5.844   -3.040  9.769   1.00 0.00 ? 46  SER A CB   6  
ATOM 7439  O OG   . SER A 1 9  ? 6.731   -2.685  10.824  1.00 0.00 ? 46  SER A OG   6  
ATOM 7440  H H    . SER A 1 9  ? 8.124   -2.019  9.276   1.00 0.00 ? 46  SER A H    6  
ATOM 7441  H HA   . SER A 1 9  ? 6.725   -4.311  8.284   1.00 0.00 ? 46  SER A HA   6  
ATOM 7442  H HB2  . SER A 1 9  ? 5.120   -2.247  9.638   1.00 0.00 ? 46  SER A HB2  6  
ATOM 7443  H HB3  . SER A 1 9  ? 5.334   -3.952  10.037  1.00 0.00 ? 46  SER A HB3  6  
ATOM 7444  H HG   . SER A 1 9  ? 6.835   -1.716  10.842  1.00 0.00 ? 46  SER A HG   6  
ATOM 7445  N N    . TYR A 1 10 ? 5.538   -3.420  6.292   1.00 0.00 ? 47  TYR A N    6  
ATOM 7446  C CA   . TYR A 1 10 ? 4.790   -2.919  5.145   1.00 0.00 ? 47  TYR A CA   6  
ATOM 7447  C C    . TYR A 1 10 ? 3.412   -2.456  5.587   1.00 0.00 ? 47  TYR A C    6  
ATOM 7448  O O    . TYR A 1 10 ? 2.896   -1.454  5.097   1.00 0.00 ? 47  TYR A O    6  
ATOM 7449  C CB   . TYR A 1 10 ? 4.680   -3.984  4.054   1.00 0.00 ? 47  TYR A CB   6  
ATOM 7450  C CG   . TYR A 1 10 ? 5.989   -4.258  3.348   1.00 0.00 ? 47  TYR A CG   6  
ATOM 7451  C CD1  . TYR A 1 10 ? 7.109   -4.683  4.051   1.00 0.00 ? 47  TYR A CD1  6  
ATOM 7452  C CD2  . TYR A 1 10 ? 6.111   -4.073  1.977   1.00 0.00 ? 47  TYR A CD2  6  
ATOM 7453  C CE1  . TYR A 1 10 ? 8.310   -4.914  3.412   1.00 0.00 ? 47  TYR A CE1  6  
ATOM 7454  C CE2  . TYR A 1 10 ? 7.307   -4.305  1.330   1.00 0.00 ? 47  TYR A CE2  6  
ATOM 7455  C CZ   . TYR A 1 10 ? 8.405   -4.724  2.050   1.00 0.00 ? 47  TYR A CZ   6  
ATOM 7456  O OH   . TYR A 1 10 ? 9.603   -4.952  1.406   1.00 0.00 ? 47  TYR A OH   6  
ATOM 7457  H H    . TYR A 1 10 ? 5.804   -4.364  6.320   1.00 0.00 ? 47  TYR A H    6  
ATOM 7458  H HA   . TYR A 1 10 ? 5.328   -2.065  4.753   1.00 0.00 ? 47  TYR A HA   6  
ATOM 7459  H HB2  . TYR A 1 10 ? 4.342   -4.909  4.495   1.00 0.00 ? 47  TYR A HB2  6  
ATOM 7460  H HB3  . TYR A 1 10 ? 3.962   -3.659  3.314   1.00 0.00 ? 47  TYR A HB3  6  
ATOM 7461  H HD1  . TYR A 1 10 ? 7.030   -4.832  5.117   1.00 0.00 ? 47  TYR A HD1  6  
ATOM 7462  H HD2  . TYR A 1 10 ? 5.249   -3.744  1.414   1.00 0.00 ? 47  TYR A HD2  6  
ATOM 7463  H HE1  . TYR A 1 10 ? 9.169   -5.243  3.981   1.00 0.00 ? 47  TYR A HE1  6  
ATOM 7464  H HE2  . TYR A 1 10 ? 7.380   -4.157  0.261   1.00 0.00 ? 47  TYR A HE2  6  
ATOM 7465  H HH   . TYR A 1 10 ? 9.692   -4.335  0.673   1.00 0.00 ? 47  TYR A HH   6  
ATOM 7466  N N    . ARG A 1 11 ? 2.885   -3.137  6.596   1.00 0.00 ? 48  ARG A N    6  
ATOM 7467  C CA   . ARG A 1 11 ? 1.612   -2.774  7.200   1.00 0.00 ? 48  ARG A CA   6  
ATOM 7468  C C    . ARG A 1 11 ? 1.629   -1.322  7.683   1.00 0.00 ? 48  ARG A C    6  
ATOM 7469  O O    . ARG A 1 11 ? 0.705   -0.563  7.403   1.00 0.00 ? 48  ARG A O    6  
ATOM 7470  C CB   . ARG A 1 11 ? 1.307   -3.732  8.361   1.00 0.00 ? 48  ARG A CB   6  
ATOM 7471  C CG   . ARG A 1 11 ? -0.038  -3.499  9.030   1.00 0.00 ? 48  ARG A CG   6  
ATOM 7472  C CD   . ARG A 1 11 ? 0.081   -2.585  10.239  1.00 0.00 ? 48  ARG A CD   6  
ATOM 7473  N NE   . ARG A 1 11 ? -1.218  -2.318  10.855  1.00 0.00 ? 48  ARG A NE   6  
ATOM 7474  C CZ   . ARG A 1 11 ? -1.372  -1.621  11.982  1.00 0.00 ? 48  ARG A CZ   6  
ATOM 7475  N NH1  . ARG A 1 11 ? -0.314  -1.152  12.626  1.00 0.00 ? 48  ARG A NH1  6  
ATOM 7476  N NH2  . ARG A 1 11 ? -2.584  -1.386  12.461  1.00 0.00 ? 48  ARG A NH2  6  
ATOM 7477  H H    . ARG A 1 11 ? 3.392   -3.887  6.973   1.00 0.00 ? 48  ARG A H    6  
ATOM 7478  H HA   . ARG A 1 11 ? 0.845   -2.881  6.447   1.00 0.00 ? 48  ARG A HA   6  
ATOM 7479  H HB2  . ARG A 1 11 ? 1.325   -4.745  7.990   1.00 0.00 ? 48  ARG A HB2  6  
ATOM 7480  H HB3  . ARG A 1 11 ? 2.078   -3.622  9.111   1.00 0.00 ? 48  ARG A HB3  6  
ATOM 7481  H HG2  . ARG A 1 11 ? -0.708  -3.046  8.316   1.00 0.00 ? 48  ARG A HG2  6  
ATOM 7482  H HG3  . ARG A 1 11 ? -0.440  -4.450  9.348   1.00 0.00 ? 48  ARG A HG3  6  
ATOM 7483  H HD2  . ARG A 1 11 ? 0.725   -3.054  10.968  1.00 0.00 ? 48  ARG A HD2  6  
ATOM 7484  H HD3  . ARG A 1 11 ? 0.518   -1.649  9.923   1.00 0.00 ? 48  ARG A HD3  6  
ATOM 7485  H HE   . ARG A 1 11 ? -2.021  -2.668  10.387  1.00 0.00 ? 48  ARG A HE   6  
ATOM 7486  H HH11 . ARG A 1 11 ? 0.613   -1.318  12.267  1.00 0.00 ? 48  ARG A HH11 6  
ATOM 7487  H HH12 . ARG A 1 11 ? -0.427  -0.626  13.480  1.00 0.00 ? 48  ARG A HH12 6  
ATOM 7488  H HH21 . ARG A 1 11 ? -3.397  -1.729  11.978  1.00 0.00 ? 48  ARG A HH21 6  
ATOM 7489  H HH22 . ARG A 1 11 ? -2.699  -0.852  13.307  1.00 0.00 ? 48  ARG A HH22 6  
ATOM 7490  N N    . GLU A 1 12 ? 2.698   -0.926  8.375   1.00 0.00 ? 49  GLU A N    6  
ATOM 7491  C CA   . GLU A 1 12 ? 2.805   0.440   8.870   1.00 0.00 ? 49  GLU A CA   6  
ATOM 7492  C C    . GLU A 1 12 ? 3.074   1.410   7.719   1.00 0.00 ? 49  GLU A C    6  
ATOM 7493  O O    . GLU A 1 12 ? 2.532   2.513   7.695   1.00 0.00 ? 49  GLU A O    6  
ATOM 7494  C CB   . GLU A 1 12 ? 3.894   0.564   9.951   1.00 0.00 ? 49  GLU A CB   6  
ATOM 7495  C CG   . GLU A 1 12 ? 5.318   0.572   9.422   1.00 0.00 ? 49  GLU A CG   6  
ATOM 7496  C CD   . GLU A 1 12 ? 6.339   0.839   10.503  1.00 0.00 ? 49  GLU A CD   6  
ATOM 7497  O OE1  . GLU A 1 12 ? 6.382   1.977   11.018  1.00 0.00 ? 49  GLU A OE1  6  
ATOM 7498  O OE2  . GLU A 1 12 ? 7.116   -0.080  10.832  1.00 0.00 ? 49  GLU A OE2  6  
ATOM 7499  H H    . GLU A 1 12 ? 3.430   -1.554  8.534   1.00 0.00 ? 49  GLU A H    6  
ATOM 7500  H HA   . GLU A 1 12 ? 1.852   0.696   9.314   1.00 0.00 ? 49  GLU A HA   6  
ATOM 7501  H HB2  . GLU A 1 12 ? 3.738   1.479   10.499  1.00 0.00 ? 49  GLU A HB2  6  
ATOM 7502  H HB3  . GLU A 1 12 ? 3.801   -0.270  10.632  1.00 0.00 ? 49  GLU A HB3  6  
ATOM 7503  H HG2  . GLU A 1 12 ? 5.530   -0.388  8.978   1.00 0.00 ? 49  GLU A HG2  6  
ATOM 7504  H HG3  . GLU A 1 12 ? 5.402   1.343   8.669   1.00 0.00 ? 49  GLU A HG3  6  
ATOM 7505  N N    . LEU A 1 13 ? 3.923   0.989   6.781   1.00 0.00 ? 50  LEU A N    6  
ATOM 7506  C CA   . LEU A 1 13 ? 4.319   1.822   5.652   1.00 0.00 ? 50  LEU A CA   6  
ATOM 7507  C C    . LEU A 1 13 ? 3.125   2.218   4.798   1.00 0.00 ? 50  LEU A C    6  
ATOM 7508  O O    . LEU A 1 13 ? 2.929   3.392   4.483   1.00 0.00 ? 50  LEU A O    6  
ATOM 7509  C CB   . LEU A 1 13 ? 5.325   1.062   4.793   1.00 0.00 ? 50  LEU A CB   6  
ATOM 7510  C CG   . LEU A 1 13 ? 6.600   0.656   5.516   1.00 0.00 ? 50  LEU A CG   6  
ATOM 7511  C CD1  . LEU A 1 13 ? 7.414   -0.299  4.666   1.00 0.00 ? 50  LEU A CD1  6  
ATOM 7512  C CD2  . LEU A 1 13 ? 7.415   1.881   5.855   1.00 0.00 ? 50  LEU A CD2  6  
ATOM 7513  H H    . LEU A 1 13 ? 4.333   0.100   6.876   1.00 0.00 ? 50  LEU A H    6  
ATOM 7514  H HA   . LEU A 1 13 ? 4.786   2.714   6.039   1.00 0.00 ? 50  LEU A HA   6  
ATOM 7515  H HB2  . LEU A 1 13 ? 4.848   0.169   4.420   1.00 0.00 ? 50  LEU A HB2  6  
ATOM 7516  H HB3  . LEU A 1 13 ? 5.595   1.682   3.954   1.00 0.00 ? 50  LEU A HB3  6  
ATOM 7517  H HG   . LEU A 1 13 ? 6.344   0.157   6.437   1.00 0.00 ? 50  LEU A HG   6  
ATOM 7518  H HD11 . LEU A 1 13 ? 7.334   -0.011  3.628   1.00 0.00 ? 50  LEU A HD11 6  
ATOM 7519  H HD12 . LEU A 1 13 ? 8.448   -0.259  4.973   1.00 0.00 ? 50  LEU A HD12 6  
ATOM 7520  H HD13 . LEU A 1 13 ? 7.035   -1.302  4.794   1.00 0.00 ? 50  LEU A HD13 6  
ATOM 7521  H HD21 . LEU A 1 13 ? 7.029   2.724   5.305   1.00 0.00 ? 50  LEU A HD21 6  
ATOM 7522  H HD22 . LEU A 1 13 ? 7.347   2.077   6.914   1.00 0.00 ? 50  LEU A HD22 6  
ATOM 7523  H HD23 . LEU A 1 13 ? 8.447   1.712   5.581   1.00 0.00 ? 50  LEU A HD23 6  
ATOM 7524  N N    . ILE A 1 14 ? 2.349   1.223   4.405   1.00 0.00 ? 51  ILE A N    6  
ATOM 7525  C CA   . ILE A 1 14 ? 1.197   1.446   3.553   1.00 0.00 ? 51  ILE A CA   6  
ATOM 7526  C C    . ILE A 1 14 ? 0.154   2.275   4.267   1.00 0.00 ? 51  ILE A C    6  
ATOM 7527  O O    . ILE A 1 14 ? -0.391  3.200   3.695   1.00 0.00 ? 51  ILE A O    6  
ATOM 7528  C CB   . ILE A 1 14 ? 0.578   0.120   3.090   1.00 0.00 ? 51  ILE A CB   6  
ATOM 7529  C CG1  . ILE A 1 14 ? 1.639   -0.721  2.386   1.00 0.00 ? 51  ILE A CG1  6  
ATOM 7530  C CG2  . ILE A 1 14 ? -0.603  0.375   2.163   1.00 0.00 ? 51  ILE A CG2  6  
ATOM 7531  C CD1  . ILE A 1 14 ? 1.215   -2.147  2.163   1.00 0.00 ? 51  ILE A CD1  6  
ATOM 7532  H H    . ILE A 1 14 ? 2.568   0.305   4.684   1.00 0.00 ? 51  ILE A H    6  
ATOM 7533  H HA   . ILE A 1 14 ? 1.527   1.990   2.676   1.00 0.00 ? 51  ILE A HA   6  
ATOM 7534  H HB   . ILE A 1 14 ? 0.221   -0.411  3.958   1.00 0.00 ? 51  ILE A HB   6  
ATOM 7535  H HG12 . ILE A 1 14 ? 1.853   -0.283  1.423   1.00 0.00 ? 51  ILE A HG12 6  
ATOM 7536  H HG13 . ILE A 1 14 ? 2.540   -0.728  2.982   1.00 0.00 ? 51  ILE A HG13 6  
ATOM 7537  H HG21 . ILE A 1 14 ? -0.515  1.362   1.731   1.00 0.00 ? 51  ILE A HG21 6  
ATOM 7538  H HG22 . ILE A 1 14 ? -0.607  -0.363  1.377   1.00 0.00 ? 51  ILE A HG22 6  
ATOM 7539  H HG23 . ILE A 1 14 ? -1.522  0.309   2.725   1.00 0.00 ? 51  ILE A HG23 6  
ATOM 7540  H HD11 . ILE A 1 14 ? 0.168   -2.247  2.407   1.00 0.00 ? 51  ILE A HD11 6  
ATOM 7541  H HD12 . ILE A 1 14 ? 1.375   -2.409  1.129   1.00 0.00 ? 51  ILE A HD12 6  
ATOM 7542  H HD13 . ILE A 1 14 ? 1.800   -2.794  2.796   1.00 0.00 ? 51  ILE A HD13 6  
ATOM 7543  N N    . ILE A 1 15 ? -0.078  1.982   5.537   1.00 0.00 ? 52  ILE A N    6  
ATOM 7544  C CA   . ILE A 1 15 ? -1.033  2.752   6.318   1.00 0.00 ? 52  ILE A CA   6  
ATOM 7545  C C    . ILE A 1 15 ? -0.577  4.199   6.480   1.00 0.00 ? 52  ILE A C    6  
ATOM 7546  O O    . ILE A 1 15 ? -1.349  5.128   6.239   1.00 0.00 ? 52  ILE A O    6  
ATOM 7547  C CB   . ILE A 1 15 ? -1.280  2.127   7.704   1.00 0.00 ? 52  ILE A CB   6  
ATOM 7548  C CG1  . ILE A 1 15 ? -2.169  0.890   7.557   1.00 0.00 ? 52  ILE A CG1  6  
ATOM 7549  C CG2  . ILE A 1 15 ? -1.907  3.149   8.639   1.00 0.00 ? 52  ILE A CG2  6  
ATOM 7550  C CD1  . ILE A 1 15 ? -2.447  0.167   8.854   1.00 0.00 ? 52  ILE A CD1  6  
ATOM 7551  H H    . ILE A 1 15 ? 0.418   1.249   5.963   1.00 0.00 ? 52  ILE A H    6  
ATOM 7552  H HA   . ILE A 1 15 ? -1.969  2.746   5.779   1.00 0.00 ? 52  ILE A HA   6  
ATOM 7553  H HB   . ILE A 1 15 ? -0.326  1.832   8.118   1.00 0.00 ? 52  ILE A HB   6  
ATOM 7554  H HG12 . ILE A 1 15 ? -3.118  1.189   7.138   1.00 0.00 ? 52  ILE A HG12 6  
ATOM 7555  H HG13 . ILE A 1 15 ? -1.690  0.192   6.886   1.00 0.00 ? 52  ILE A HG13 6  
ATOM 7556  H HG21 . ILE A 1 15 ? -1.684  4.144   8.275   1.00 0.00 ? 52  ILE A HG21 6  
ATOM 7557  H HG22 . ILE A 1 15 ? -2.976  3.007   8.665   1.00 0.00 ? 52  ILE A HG22 6  
ATOM 7558  H HG23 . ILE A 1 15 ? -1.501  3.030   9.632   1.00 0.00 ? 52  ILE A HG23 6  
ATOM 7559  H HD11 . ILE A 1 15 ? -1.514  -0.101  9.324   1.00 0.00 ? 52  ILE A HD11 6  
ATOM 7560  H HD12 . ILE A 1 15 ? -3.013  0.808   9.512   1.00 0.00 ? 52  ILE A HD12 6  
ATOM 7561  H HD13 . ILE A 1 15 ? -3.017  -0.729  8.648   1.00 0.00 ? 52  ILE A HD13 6  
ATOM 7562  N N    . GLU A 1 16 ? 0.698   4.377   6.821   1.00 0.00 ? 53  GLU A N    6  
ATOM 7563  C CA   . GLU A 1 16 ? 1.283   5.704   6.969   1.00 0.00 ? 53  GLU A CA   6  
ATOM 7564  C C    . GLU A 1 16 ? 1.123   6.493   5.679   1.00 0.00 ? 53  GLU A C    6  
ATOM 7565  O O    . GLU A 1 16 ? 0.851   7.693   5.692   1.00 0.00 ? 53  GLU A O    6  
ATOM 7566  C CB   . GLU A 1 16 ? 2.761   5.596   7.341   1.00 0.00 ? 53  GLU A CB   6  
ATOM 7567  C CG   . GLU A 1 16 ? 3.457   6.939   7.479   1.00 0.00 ? 53  GLU A CG   6  
ATOM 7568  C CD   . GLU A 1 16 ? 4.874   6.827   8.007   1.00 0.00 ? 53  GLU A CD   6  
ATOM 7569  O OE1  . GLU A 1 16 ? 5.266   5.714   8.413   1.00 0.00 ? 53  GLU A OE1  6  
ATOM 7570  O OE2  . GLU A 1 16 ? 5.611   7.835   7.986   1.00 0.00 ? 53  GLU A OE2  6  
ATOM 7571  H H    . GLU A 1 16 ? 1.275   3.589   6.936   1.00 0.00 ? 53  GLU A H    6  
ATOM 7572  H HA   . GLU A 1 16 ? 0.754   6.216   7.761   1.00 0.00 ? 53  GLU A HA   6  
ATOM 7573  H HB2  . GLU A 1 16 ? 2.846   5.069   8.279   1.00 0.00 ? 53  GLU A HB2  6  
ATOM 7574  H HB3  . GLU A 1 16 ? 3.268   5.029   6.575   1.00 0.00 ? 53  GLU A HB3  6  
ATOM 7575  H HG2  . GLU A 1 16 ? 3.491   7.412   6.509   1.00 0.00 ? 53  GLU A HG2  6  
ATOM 7576  H HG3  . GLU A 1 16 ? 2.887   7.556   8.158   1.00 0.00 ? 53  GLU A HG3  6  
ATOM 7577  N N    . GLY A 1 17 ? 1.244   5.796   4.566   1.00 0.00 ? 54  GLY A N    6  
ATOM 7578  C CA   . GLY A 1 17 ? 1.041   6.425   3.290   1.00 0.00 ? 54  GLY A CA   6  
ATOM 7579  C C    . GLY A 1 17 ? -0.410  6.631   2.973   1.00 0.00 ? 54  GLY A C    6  
ATOM 7580  O O    . GLY A 1 17 ? -0.829  7.738   2.661   1.00 0.00 ? 54  GLY A O    6  
ATOM 7581  H H    . GLY A 1 17 ? 1.441   4.835   4.615   1.00 0.00 ? 54  GLY A H    6  
ATOM 7582  H HA2  . GLY A 1 17 ? 1.542   7.381   3.283   1.00 0.00 ? 54  GLY A HA2  6  
ATOM 7583  H HA3  . GLY A 1 17 ? 1.465   5.801   2.523   1.00 0.00 ? 54  GLY A HA3  6  
ATOM 7584  N N    . LEU A 1 18 ? -1.137  5.530   2.930   1.00 0.00 ? 55  LEU A N    6  
ATOM 7585  C CA   . LEU A 1 18 ? -2.514  5.506   2.465   1.00 0.00 ? 55  LEU A CA   6  
ATOM 7586  C C    . LEU A 1 18 ? -3.398  6.512   3.205   1.00 0.00 ? 55  LEU A C    6  
ATOM 7587  O O    . LEU A 1 18 ? -4.304  7.101   2.617   1.00 0.00 ? 55  LEU A O    6  
ATOM 7588  C CB   . LEU A 1 18 ? -3.048  4.083   2.599   1.00 0.00 ? 55  LEU A CB   6  
ATOM 7589  C CG   . LEU A 1 18 ? -4.336  3.776   1.843   1.00 0.00 ? 55  LEU A CG   6  
ATOM 7590  C CD1  . LEU A 1 18 ? -4.377  4.524   0.517   1.00 0.00 ? 55  LEU A CD1  6  
ATOM 7591  C CD2  . LEU A 1 18 ? -4.439  2.278   1.601   1.00 0.00 ? 55  LEU A CD2  6  
ATOM 7592  H H    . LEU A 1 18 ? -0.692  4.663   3.113   1.00 0.00 ? 55  LEU A H    6  
ATOM 7593  H HA   . LEU A 1 18 ? -2.504  5.765   1.422   1.00 0.00 ? 55  LEU A HA   6  
ATOM 7594  H HB2  . LEU A 1 18 ? -2.285  3.405   2.248   1.00 0.00 ? 55  LEU A HB2  6  
ATOM 7595  H HB3  . LEU A 1 18 ? -3.220  3.885   3.649   1.00 0.00 ? 55  LEU A HB3  6  
ATOM 7596  H HG   . LEU A 1 18 ? -5.183  4.080   2.440   1.00 0.00 ? 55  LEU A HG   6  
ATOM 7597  H HD11 . LEU A 1 18 ? -3.392  4.524   0.075   1.00 0.00 ? 55  LEU A HD11 6  
ATOM 7598  H HD12 . LEU A 1 18 ? -5.073  4.039   -0.150  1.00 0.00 ? 55  LEU A HD12 6  
ATOM 7599  H HD13 . LEU A 1 18 ? -4.695  5.542   0.690   1.00 0.00 ? 55  LEU A HD13 6  
ATOM 7600  H HD21 . LEU A 1 18 ? -3.470  1.824   1.747   1.00 0.00 ? 55  LEU A HD21 6  
ATOM 7601  H HD22 . LEU A 1 18 ? -5.149  1.849   2.296   1.00 0.00 ? 55  LEU A HD22 6  
ATOM 7602  H HD23 . LEU A 1 18 ? -4.773  2.100   0.589   1.00 0.00 ? 55  LEU A HD23 6  
ATOM 7603  N N    . THR A 1 19 ? -3.072  6.784   4.459   1.00 0.00 ? 56  THR A N    6  
ATOM 7604  C CA   . THR A 1 19 ? -3.781  7.799   5.221   1.00 0.00 ? 56  THR A CA   6  
ATOM 7605  C C    . THR A 1 19 ? -3.508  9.186   4.633   1.00 0.00 ? 56  THR A C    6  
ATOM 7606  O O    . THR A 1 19 ? -4.361  10.072  4.670   1.00 0.00 ? 56  THR A O    6  
ATOM 7607  C CB   . THR A 1 19 ? -3.380  7.779   6.715   1.00 0.00 ? 56  THR A CB   6  
ATOM 7608  O OG1  . THR A 1 19 ? -4.243  8.639   7.469   1.00 0.00 ? 56  THR A OG1  6  
ATOM 7609  C CG2  . THR A 1 19 ? -1.941  8.223   6.909   1.00 0.00 ? 56  THR A CG2  6  
ATOM 7610  H H    . THR A 1 19 ? -2.293  6.345   4.854   1.00 0.00 ? 56  THR A H    6  
ATOM 7611  H HA   . THR A 1 19 ? -4.840  7.590   5.149   1.00 0.00 ? 56  THR A HA   6  
ATOM 7612  H HB   . THR A 1 19 ? -3.478  6.769   7.087   1.00 0.00 ? 56  THR A HB   6  
ATOM 7613  H HG1  . THR A 1 19 ? -3.907  9.546   7.430   1.00 0.00 ? 56  THR A HG1  6  
ATOM 7614  H HG21 . THR A 1 19 ? -1.599  8.720   6.013   1.00 0.00 ? 56  THR A HG21 6  
ATOM 7615  H HG22 . THR A 1 19 ? -1.881  8.903   7.745   1.00 0.00 ? 56  THR A HG22 6  
ATOM 7616  H HG23 . THR A 1 19 ? -1.320  7.358   7.098   1.00 0.00 ? 56  THR A HG23 6  
ATOM 7617  N N    . ALA A 1 20 ? -2.306  9.369   4.103   1.00 0.00 ? 57  ALA A N    6  
ATOM 7618  C CA   . ALA A 1 20 ? -1.897  10.641  3.536   1.00 0.00 ? 57  ALA A CA   6  
ATOM 7619  C C    . ALA A 1 20 ? -2.335  10.786  2.079   1.00 0.00 ? 57  ALA A C    6  
ATOM 7620  O O    . ALA A 1 20 ? -2.742  11.871  1.661   1.00 0.00 ? 57  ALA A O    6  
ATOM 7621  C CB   . ALA A 1 20 ? -0.391  10.807  3.649   1.00 0.00 ? 57  ALA A CB   6  
ATOM 7622  H H    . ALA A 1 20 ? -1.665  8.620   4.101   1.00 0.00 ? 57  ALA A H    6  
ATOM 7623  H HA   . ALA A 1 20 ? -2.361  11.424  4.117   1.00 0.00 ? 57  ALA A HA   6  
ATOM 7624  H HB1  . ALA A 1 20 ? -0.041  10.336  4.557   1.00 0.00 ? 57  ALA A HB1  6  
ATOM 7625  H HB2  . ALA A 1 20 ? 0.086   10.345  2.798   1.00 0.00 ? 57  ALA A HB2  6  
ATOM 7626  H HB3  . ALA A 1 20 ? -0.143  11.860  3.672   1.00 0.00 ? 57  ALA A HB3  6  
ATOM 7627  N N    . LEU A 1 21 ? -2.144  9.738   1.276   1.00 0.00 ? 58  LEU A N    6  
ATOM 7628  C CA   . LEU A 1 21 ? -2.401  9.849   -0.153  1.00 0.00 ? 58  LEU A CA   6  
ATOM 7629  C C    . LEU A 1 21 ? -3.653  9.075   -0.578  1.00 0.00 ? 58  LEU A C    6  
ATOM 7630  O O    . LEU A 1 21 ? -3.742  8.594   -1.707  1.00 0.00 ? 58  LEU A O    6  
ATOM 7631  C CB   . LEU A 1 21 ? -1.175  9.395   -0.965  1.00 0.00 ? 58  LEU A CB   6  
ATOM 7632  C CG   . LEU A 1 21 ? -1.080  7.899   -1.277  1.00 0.00 ? 58  LEU A CG   6  
ATOM 7633  C CD1  . LEU A 1 21 ? -0.228  7.675   -2.511  1.00 0.00 ? 58  LEU A CD1  6  
ATOM 7634  C CD2  . LEU A 1 21 ? -0.515  7.126   -0.121  1.00 0.00 ? 58  LEU A CD2  6  
ATOM 7635  H H    . LEU A 1 21 ? -1.732  8.917   1.630   1.00 0.00 ? 58  LEU A H    6  
ATOM 7636  H HA   . LEU A 1 21 ? -2.571  10.893  -0.361  1.00 0.00 ? 58  LEU A HA   6  
ATOM 7637  H HB2  . LEU A 1 21 ? -1.178  9.932   -1.901  1.00 0.00 ? 58  LEU A HB2  6  
ATOM 7638  H HB3  . LEU A 1 21 ? -0.290  9.677   -0.414  1.00 0.00 ? 58  LEU A HB3  6  
ATOM 7639  H HG   . LEU A 1 21 ? -2.067  7.517   -1.465  1.00 0.00 ? 58  LEU A HG   6  
ATOM 7640  H HD11 . LEU A 1 21 ? 0.195   8.614   -2.833  1.00 0.00 ? 58  LEU A HD11 6  
ATOM 7641  H HD12 . LEU A 1 21 ? 0.566   6.982   -2.281  1.00 0.00 ? 58  LEU A HD12 6  
ATOM 7642  H HD13 . LEU A 1 21 ? -0.846  7.267   -3.299  1.00 0.00 ? 58  LEU A HD13 6  
ATOM 7643  H HD21 . LEU A 1 21 ? -0.300  7.802   0.693   1.00 0.00 ? 58  LEU A HD21 6  
ATOM 7644  H HD22 . LEU A 1 21 ? 0.389   6.624   -0.428  1.00 0.00 ? 58  LEU A HD22 6  
ATOM 7645  H HD23 . LEU A 1 21 ? -1.244  6.390   0.207   1.00 0.00 ? 58  LEU A HD23 6  
ATOM 7646  N N    . LYS A 1 22 ? -4.658  9.029   0.296   1.00 0.00 ? 59  LYS A N    6  
ATOM 7647  C CA   . LYS A 1 22 ? -5.923  8.375   -0.039  1.00 0.00 ? 59  LYS A CA   6  
ATOM 7648  C C    . LYS A 1 22 ? -6.572  9.044   -1.257  1.00 0.00 ? 59  LYS A C    6  
ATOM 7649  O O    . LYS A 1 22 ? -7.393  8.428   -1.948  1.00 0.00 ? 59  LYS A O    6  
ATOM 7650  C CB   . LYS A 1 22 ? -6.899  8.380   1.152   1.00 0.00 ? 59  LYS A CB   6  
ATOM 7651  C CG   . LYS A 1 22 ? -7.819  9.593   1.215   1.00 0.00 ? 59  LYS A CG   6  
ATOM 7652  C CD   . LYS A 1 22 ? -7.189  10.755  1.969   1.00 0.00 ? 59  LYS A CD   6  
ATOM 7653  C CE   . LYS A 1 22 ? -7.197  10.514  3.471   1.00 0.00 ? 59  LYS A CE   6  
ATOM 7654  N NZ   . LYS A 1 22 ? -6.791  11.725  4.231   1.00 0.00 ? 59  LYS A NZ   6  
ATOM 7655  H H    . LYS A 1 22 ? -4.545  9.433   1.181   1.00 0.00 ? 59  LYS A H    6  
ATOM 7656  H HA   . LYS A 1 22 ? -5.699  7.351   -0.295  1.00 0.00 ? 59  LYS A HA   6  
ATOM 7657  H HB2  . LYS A 1 22 ? -7.515  7.497   1.094   1.00 0.00 ? 59  LYS A HB2  6  
ATOM 7658  H HB3  . LYS A 1 22 ? -6.327  8.345   2.066   1.00 0.00 ? 59  LYS A HB3  6  
ATOM 7659  H HG2  . LYS A 1 22 ? -8.046  9.912   0.207   1.00 0.00 ? 59  LYS A HG2  6  
ATOM 7660  H HG3  . LYS A 1 22 ? -8.733  9.308   1.714   1.00 0.00 ? 59  LYS A HG3  6  
ATOM 7661  H HD2  . LYS A 1 22 ? -6.167  10.873  1.640   1.00 0.00 ? 59  LYS A HD2  6  
ATOM 7662  H HD3  . LYS A 1 22 ? -7.745  11.656  1.756   1.00 0.00 ? 59  LYS A HD3  6  
ATOM 7663  H HE2  . LYS A 1 22 ? -8.194  10.229  3.773   1.00 0.00 ? 59  LYS A HE2  6  
ATOM 7664  H HE3  . LYS A 1 22 ? -6.510  9.711   3.698   1.00 0.00 ? 59  LYS A HE3  6  
ATOM 7665  H HZ1  . LYS A 1 22 ? -5.894  12.106  3.855   1.00 0.00 ? 59  LYS A HZ1  6  
ATOM 7666  H HZ2  . LYS A 1 22 ? -7.525  12.460  4.152   1.00 0.00 ? 59  LYS A HZ2  6  
ATOM 7667  H HZ3  . LYS A 1 22 ? -6.656  11.493  5.240   1.00 0.00 ? 59  LYS A HZ3  6  
ATOM 7668  N N    . GLU A 1 23 ? -6.204  10.314  -1.488  1.00 0.00 ? 60  GLU A N    6  
ATOM 7669  C CA   . GLU A 1 23 ? -6.687  11.124  -2.616  1.00 0.00 ? 60  GLU A CA   6  
ATOM 7670  C C    . GLU A 1 23 ? -8.164  11.482  -2.487  1.00 0.00 ? 60  GLU A C    6  
ATOM 7671  O O    . GLU A 1 23 ? -8.536  12.650  -2.592  1.00 0.00 ? 60  GLU A O    6  
ATOM 7672  C CB   . GLU A 1 23 ? -6.424  10.428  -3.952  1.00 0.00 ? 60  GLU A CB   6  
ATOM 7673  C CG   . GLU A 1 23 ? -4.949  10.217  -4.239  1.00 0.00 ? 60  GLU A CG   6  
ATOM 7674  C CD   . GLU A 1 23 ? -4.683  9.752   -5.654  1.00 0.00 ? 60  GLU A CD   6  
ATOM 7675  O OE1  . GLU A 1 23 ? -5.641  9.669   -6.450  1.00 0.00 ? 60  GLU A OE1  6  
ATOM 7676  O OE2  . GLU A 1 23 ? -3.505  9.495   -5.984  1.00 0.00 ? 60  GLU A OE2  6  
ATOM 7677  H H    . GLU A 1 23 ? -5.558  10.726  -0.872  1.00 0.00 ? 60  GLU A H    6  
ATOM 7678  H HA   . GLU A 1 23 ? -6.124  12.047  -2.603  1.00 0.00 ? 60  GLU A HA   6  
ATOM 7679  H HB2  . GLU A 1 23 ? -6.910  9.463   -3.945  1.00 0.00 ? 60  GLU A HB2  6  
ATOM 7680  H HB3  . GLU A 1 23 ? -6.844  11.027  -4.748  1.00 0.00 ? 60  GLU A HB3  6  
ATOM 7681  H HG2  . GLU A 1 23 ? -4.430  11.151  -4.083  1.00 0.00 ? 60  GLU A HG2  6  
ATOM 7682  H HG3  . GLU A 1 23 ? -4.565  9.475   -3.554  1.00 0.00 ? 60  GLU A HG3  6  
ATOM 7683  N N    . ARG A 1 24 ? -8.993  10.489  -2.217  1.00 0.00 ? 61  ARG A N    6  
ATOM 7684  C CA   . ARG A 1 24 ? -10.414 10.713  -2.033  1.00 0.00 ? 61  ARG A CA   6  
ATOM 7685  C C    . ARG A 1 24 ? -11.052 9.523   -1.324  1.00 0.00 ? 61  ARG A C    6  
ATOM 7686  O O    . ARG A 1 24 ? -11.905 9.699   -0.456  1.00 0.00 ? 61  ARG A O    6  
ATOM 7687  C CB   . ARG A 1 24 ? -11.116 10.985  -3.377  1.00 0.00 ? 61  ARG A CB   6  
ATOM 7688  C CG   . ARG A 1 24 ? -11.293 9.770   -4.283  1.00 0.00 ? 61  ARG A CG   6  
ATOM 7689  C CD   . ARG A 1 24 ? -9.998  9.346   -4.965  1.00 0.00 ? 61  ARG A CD   6  
ATOM 7690  N NE   . ARG A 1 24 ? -10.199 8.163   -5.803  1.00 0.00 ? 61  ARG A NE   6  
ATOM 7691  C CZ   . ARG A 1 24 ? -9.236  7.537   -6.481  1.00 0.00 ? 61  ARG A CZ   6  
ATOM 7692  N NH1  . ARG A 1 24 ? -8.002  8.027   -6.512  1.00 0.00 ? 61  ARG A NH1  6  
ATOM 7693  N NH2  . ARG A 1 24 ? -9.524  6.432   -7.159  1.00 0.00 ? 61  ARG A NH2  6  
ATOM 7694  H H    . ARG A 1 24 ? -8.629  9.585   -2.094  1.00 0.00 ? 61  ARG A H    6  
ATOM 7695  H HA   . ARG A 1 24 ? -10.526 11.581  -1.403  1.00 0.00 ? 61  ARG A HA   6  
ATOM 7696  H HB2  . ARG A 1 24 ? -12.096 11.393  -3.175  1.00 0.00 ? 61  ARG A HB2  6  
ATOM 7697  H HB3  . ARG A 1 24 ? -10.541 11.723  -3.917  1.00 0.00 ? 61  ARG A HB3  6  
ATOM 7698  H HG2  . ARG A 1 24 ? -11.652 8.945   -3.687  1.00 0.00 ? 61  ARG A HG2  6  
ATOM 7699  H HG3  . ARG A 1 24 ? -12.024 10.007  -5.042  1.00 0.00 ? 61  ARG A HG3  6  
ATOM 7700  H HD2  . ARG A 1 24 ? -9.646  10.159  -5.581  1.00 0.00 ? 61  ARG A HD2  6  
ATOM 7701  H HD3  . ARG A 1 24 ? -9.262  9.120   -4.208  1.00 0.00 ? 61  ARG A HD3  6  
ATOM 7702  H HE   . ARG A 1 24 ? -11.120 7.805   -5.857  1.00 0.00 ? 61  ARG A HE   6  
ATOM 7703  H HH11 . ARG A 1 24 ? -7.775  8.872   -6.026  1.00 0.00 ? 61  ARG A HH11 6  
ATOM 7704  H HH12 . ARG A 1 24 ? -7.280  7.546   -7.027  1.00 0.00 ? 61  ARG A HH12 6  
ATOM 7705  H HH21 . ARG A 1 24 ? -10.464 6.066   -7.160  1.00 0.00 ? 61  ARG A HH21 6  
ATOM 7706  H HH22 . ARG A 1 24 ? -8.803  5.948   -7.674  1.00 0.00 ? 61  ARG A HH22 6  
ATOM 7707  N N    . LYS A 1 25 ? -10.597 8.317   -1.669  1.00 0.00 ? 62  LYS A N    6  
ATOM 7708  C CA   . LYS A 1 25 ? -11.113 7.087   -1.067  1.00 0.00 ? 62  LYS A CA   6  
ATOM 7709  C C    . LYS A 1 25 ? -10.409 5.864   -1.648  1.00 0.00 ? 62  LYS A C    6  
ATOM 7710  O O    . LYS A 1 25 ? -11.009 4.799   -1.808  1.00 0.00 ? 62  LYS A O    6  
ATOM 7711  C CB   . LYS A 1 25 ? -12.620 6.961   -1.291  1.00 0.00 ? 62  LYS A CB   6  
ATOM 7712  C CG   . LYS A 1 25 ? -13.017 6.923   -2.754  1.00 0.00 ? 62  LYS A CG   6  
ATOM 7713  C CD   . LYS A 1 25 ? -14.494 6.606   -2.909  1.00 0.00 ? 62  LYS A CD   6  
ATOM 7714  C CE   . LYS A 1 25 ? -14.919 6.596   -4.366  1.00 0.00 ? 62  LYS A CE   6  
ATOM 7715  N NZ   . LYS A 1 25 ? -16.354 6.237   -4.518  1.00 0.00 ? 62  LYS A NZ   6  
ATOM 7716  H H    . LYS A 1 25 ? -9.880  8.253   -2.332  1.00 0.00 ? 62  LYS A H    6  
ATOM 7717  H HA   . LYS A 1 25 ? -10.917 7.131   -0.005  1.00 0.00 ? 62  LYS A HA   6  
ATOM 7718  H HB2  . LYS A 1 25 ? -12.967 6.054   -0.821  1.00 0.00 ? 62  LYS A HB2  6  
ATOM 7719  H HB3  . LYS A 1 25 ? -13.112 7.805   -0.829  1.00 0.00 ? 62  LYS A HB3  6  
ATOM 7720  H HG2  . LYS A 1 25 ? -12.813 7.886   -3.195  1.00 0.00 ? 62  LYS A HG2  6  
ATOM 7721  H HG3  . LYS A 1 25 ? -12.432 6.164   -3.254  1.00 0.00 ? 62  LYS A HG3  6  
ATOM 7722  H HD2  . LYS A 1 25 ? -14.690 5.632   -2.482  1.00 0.00 ? 62  LYS A HD2  6  
ATOM 7723  H HD3  . LYS A 1 25 ? -15.066 7.354   -2.381  1.00 0.00 ? 62  LYS A HD3  6  
ATOM 7724  H HE2  . LYS A 1 25 ? -14.755 7.579   -4.782  1.00 0.00 ? 62  LYS A HE2  6  
ATOM 7725  H HE3  . LYS A 1 25 ? -14.317 5.876   -4.899  1.00 0.00 ? 62  LYS A HE3  6  
ATOM 7726  H HZ1  . LYS A 1 25 ? -16.546 5.327   -4.048  1.00 0.00 ? 62  LYS A HZ1  6  
ATOM 7727  H HZ2  . LYS A 1 25 ? -16.954 6.970   -4.083  1.00 0.00 ? 62  LYS A HZ2  6  
ATOM 7728  H HZ3  . LYS A 1 25 ? -16.602 6.152   -5.528  1.00 0.00 ? 62  LYS A HZ3  6  
ATOM 7729  N N    . GLY A 1 26 ? -9.144  6.023   -1.971  1.00 0.00 ? 63  GLY A N    6  
ATOM 7730  C CA   . GLY A 1 26 ? -8.380  4.924   -2.519  1.00 0.00 ? 63  GLY A CA   6  
ATOM 7731  C C    . GLY A 1 26 ? -7.219  5.411   -3.348  1.00 0.00 ? 63  GLY A C    6  
ATOM 7732  O O    . GLY A 1 26 ? -7.371  6.327   -4.151  1.00 0.00 ? 63  GLY A O    6  
ATOM 7733  H H    . GLY A 1 26 ? -8.720  6.895   -1.843  1.00 0.00 ? 63  GLY A H    6  
ATOM 7734  H HA2  . GLY A 1 26 ? -8.003  4.321   -1.706  1.00 0.00 ? 63  GLY A HA2  6  
ATOM 7735  H HA3  . GLY A 1 26 ? -9.024  4.318   -3.137  1.00 0.00 ? 63  GLY A HA3  6  
ATOM 7736  N N    . SER A 1 27 ? -6.063  4.807   -3.156  1.00 0.00 ? 64  SER A N    6  
ATOM 7737  C CA   . SER A 1 27 ? -4.885  5.186   -3.909  1.00 0.00 ? 64  SER A CA   6  
ATOM 7738  C C    . SER A 1 27 ? -4.386  4.004   -4.720  1.00 0.00 ? 64  SER A C    6  
ATOM 7739  O O    . SER A 1 27 ? -4.574  2.844   -4.337  1.00 0.00 ? 64  SER A O    6  
ATOM 7740  C CB   . SER A 1 27 ? -3.780  5.683   -2.981  1.00 0.00 ? 64  SER A CB   6  
ATOM 7741  O OG   . SER A 1 27 ? -2.826  6.442   -3.697  1.00 0.00 ? 64  SER A OG   6  
ATOM 7742  H H    . SER A 1 27 ? -5.999  4.076   -2.499  1.00 0.00 ? 64  SER A H    6  
ATOM 7743  H HA   . SER A 1 27 ? -5.163  5.978   -4.584  1.00 0.00 ? 64  SER A HA   6  
ATOM 7744  H HB2  . SER A 1 27 ? -4.208  6.302   -2.207  1.00 0.00 ? 64  SER A HB2  6  
ATOM 7745  H HB3  . SER A 1 27 ? -3.281  4.835   -2.532  1.00 0.00 ? 64  SER A HB3  6  
ATOM 7746  H HG   . SER A 1 27 ? -2.901  7.369   -3.438  1.00 0.00 ? 64  SER A HG   6  
ATOM 7747  N N    . SER A 1 28 ? -3.740  4.303   -5.833  1.00 0.00 ? 65  SER A N    6  
ATOM 7748  C CA   . SER A 1 28 ? -3.164  3.277   -6.676  1.00 0.00 ? 65  SER A CA   6  
ATOM 7749  C C    . SER A 1 28 ? -2.020  2.579   -5.947  1.00 0.00 ? 65  SER A C    6  
ATOM 7750  O O    . SER A 1 28 ? -1.264  3.217   -5.215  1.00 0.00 ? 65  SER A O    6  
ATOM 7751  C CB   . SER A 1 28 ? -2.662  3.898   -7.980  1.00 0.00 ? 65  SER A CB   6  
ATOM 7752  O OG   . SER A 1 28 ? -3.684  4.659   -8.600  1.00 0.00 ? 65  SER A OG   6  
ATOM 7753  H H    . SER A 1 28 ? -3.601  5.249   -6.064  1.00 0.00 ? 65  SER A H    6  
ATOM 7754  H HA   . SER A 1 28 ? -3.933  2.552   -6.901  1.00 0.00 ? 65  SER A HA   6  
ATOM 7755  H HB2  . SER A 1 28 ? -1.824  4.547   -7.769  1.00 0.00 ? 65  SER A HB2  6  
ATOM 7756  H HB3  . SER A 1 28 ? -2.352  3.114   -8.655  1.00 0.00 ? 65  SER A HB3  6  
ATOM 7757  H HG   . SER A 1 28 ? -4.058  5.276   -7.955  1.00 0.00 ? 65  SER A HG   6  
ATOM 7758  N N    . ARG A 1 29 ? -1.895  1.275   -6.157  1.00 0.00 ? 66  ARG A N    6  
ATOM 7759  C CA   . ARG A 1 29 ? -0.824  0.496   -5.542  1.00 0.00 ? 66  ARG A CA   6  
ATOM 7760  C C    . ARG A 1 29 ? 0.557   1.109   -5.824  1.00 0.00 ? 66  ARG A C    6  
ATOM 7761  O O    . ARG A 1 29 ? 1.320   1.341   -4.887  1.00 0.00 ? 66  ARG A O    6  
ATOM 7762  C CB   . ARG A 1 29 ? -0.878  -0.967  -6.003  1.00 0.00 ? 66  ARG A CB   6  
ATOM 7763  C CG   . ARG A 1 29 ? -1.943  -1.778  -5.284  1.00 0.00 ? 66  ARG A CG   6  
ATOM 7764  C CD   . ARG A 1 29 ? -2.024  -3.207  -5.799  1.00 0.00 ? 66  ARG A CD   6  
ATOM 7765  N NE   . ARG A 1 29 ? -2.202  -3.267  -7.252  1.00 0.00 ? 66  ARG A NE   6  
ATOM 7766  C CZ   . ARG A 1 29 ? -2.295  -4.404  -7.946  1.00 0.00 ? 66  ARG A CZ   6  
ATOM 7767  N NH1  . ARG A 1 29 ? -2.231  -5.573  -7.324  1.00 0.00 ? 66  ARG A NH1  6  
ATOM 7768  N NH2  . ARG A 1 29 ? -2.461  -4.361  -9.265  1.00 0.00 ? 66  ARG A NH2  6  
ATOM 7769  H H    . ARG A 1 29 ? -2.532  0.825   -6.761  1.00 0.00 ? 66  ARG A H    6  
ATOM 7770  H HA   . ARG A 1 29 ? -0.990  0.521   -4.474  1.00 0.00 ? 66  ARG A HA   6  
ATOM 7771  H HB2  . ARG A 1 29 ? -1.087  -0.993  -7.061  1.00 0.00 ? 66  ARG A HB2  6  
ATOM 7772  H HB3  . ARG A 1 29 ? 0.081   -1.427  -5.820  1.00 0.00 ? 66  ARG A HB3  6  
ATOM 7773  H HG2  . ARG A 1 29 ? -1.700  -1.803  -4.234  1.00 0.00 ? 66  ARG A HG2  6  
ATOM 7774  H HG3  . ARG A 1 29 ? -2.901  -1.300  -5.423  1.00 0.00 ? 66  ARG A HG3  6  
ATOM 7775  H HD2  . ARG A 1 29 ? -1.116  -3.725  -5.533  1.00 0.00 ? 66  ARG A HD2  6  
ATOM 7776  H HD3  . ARG A 1 29 ? -2.862  -3.696  -5.325  1.00 0.00 ? 66  ARG A HD3  6  
ATOM 7777  H HE   . ARG A 1 29 ? -2.254  -2.412  -7.735  1.00 0.00 ? 66  ARG A HE   6  
ATOM 7778  H HH11 . ARG A 1 29 ? -2.109  -5.613  -6.326  1.00 0.00 ? 66  ARG A HH11 6  
ATOM 7779  H HH12 . ARG A 1 29 ? -2.306  -6.431  -7.846  1.00 0.00 ? 66  ARG A HH12 6  
ATOM 7780  H HH21 . ARG A 1 29 ? -2.518  -3.478  -9.739  1.00 0.00 ? 66  ARG A HH21 6  
ATOM 7781  H HH22 . ARG A 1 29 ? -2.523  -5.218  -9.798  1.00 0.00 ? 66  ARG A HH22 6  
ATOM 7782  N N    . PRO A 1 30 ? 0.895   1.431   -7.098  1.00 0.00 ? 67  PRO A N    6  
ATOM 7783  C CA   . PRO A 1 30 ? 2.181   2.063   -7.432  1.00 0.00 ? 67  PRO A CA   6  
ATOM 7784  C C    . PRO A 1 30 ? 2.398   3.386   -6.691  1.00 0.00 ? 67  PRO A C    6  
ATOM 7785  O O    . PRO A 1 30 ? 3.532   3.740   -6.365  1.00 0.00 ? 67  PRO A O    6  
ATOM 7786  C CB   . PRO A 1 30 ? 2.099   2.304   -8.946  1.00 0.00 ? 67  PRO A CB   6  
ATOM 7787  C CG   . PRO A 1 30 ? 0.651   2.217   -9.279  1.00 0.00 ? 67  PRO A CG   6  
ATOM 7788  C CD   . PRO A 1 30 ? 0.065   1.240   -8.304  1.00 0.00 ? 67  PRO A CD   6  
ATOM 7789  H HA   . PRO A 1 30 ? 3.007   1.400   -7.220  1.00 0.00 ? 67  PRO A HA   6  
ATOM 7790  H HB2  . PRO A 1 30 ? 2.498   3.280   -9.180  1.00 0.00 ? 67  PRO A HB2  6  
ATOM 7791  H HB3  . PRO A 1 30 ? 2.666   1.545   -9.463  1.00 0.00 ? 67  PRO A HB3  6  
ATOM 7792  H HG2  . PRO A 1 30 ? 0.188   3.185   -9.164  1.00 0.00 ? 67  PRO A HG2  6  
ATOM 7793  H HG3  . PRO A 1 30 ? 0.527   1.857   -10.290 1.00 0.00 ? 67  PRO A HG3  6  
ATOM 7794  H HD2  . PRO A 1 30 ? -0.970  1.480   -8.101  1.00 0.00 ? 67  PRO A HD2  6  
ATOM 7795  H HD3  . PRO A 1 30 ? 0.155   0.230   -8.677  1.00 0.00 ? 67  PRO A HD3  6  
ATOM 7796  N N    . ALA A 1 31 ? 1.306   4.086   -6.390  1.00 0.00 ? 68  ALA A N    6  
ATOM 7797  C CA   . ALA A 1 31 ? 1.379   5.340   -5.644  1.00 0.00 ? 68  ALA A CA   6  
ATOM 7798  C C    . ALA A 1 31 ? 1.874   5.092   -4.228  1.00 0.00 ? 68  ALA A C    6  
ATOM 7799  O O    . ALA A 1 31 ? 2.770   5.784   -3.735  1.00 0.00 ? 68  ALA A O    6  
ATOM 7800  C CB   . ALA A 1 31 ? 0.021   6.020   -5.611  1.00 0.00 ? 68  ALA A CB   6  
ATOM 7801  H H    . ALA A 1 31 ? 0.428   3.726   -6.628  1.00 0.00 ? 68  ALA A H    6  
ATOM 7802  H HA   . ALA A 1 31 ? 2.074   5.992   -6.153  1.00 0.00 ? 68  ALA A HA   6  
ATOM 7803  H HB1  . ALA A 1 31 ? 0.061   6.934   -6.181  1.00 0.00 ? 68  ALA A HB1  6  
ATOM 7804  H HB2  . ALA A 1 31 ? -0.240  6.246   -4.584  1.00 0.00 ? 68  ALA A HB2  6  
ATOM 7805  H HB3  . ALA A 1 31 ? -0.722  5.361   -6.034  1.00 0.00 ? 68  ALA A HB3  6  
ATOM 7806  N N    . LEU A 1 32 ? 1.320   4.060   -3.601  1.00 0.00 ? 69  LEU A N    6  
ATOM 7807  C CA   . LEU A 1 32 ? 1.738   3.649   -2.271  1.00 0.00 ? 69  LEU A CA   6  
ATOM 7808  C C    . LEU A 1 32 ? 3.191   3.193   -2.291  1.00 0.00 ? 69  LEU A C    6  
ATOM 7809  O O    . LEU A 1 32 ? 3.977   3.563   -1.422  1.00 0.00 ? 69  LEU A O    6  
ATOM 7810  C CB   . LEU A 1 32 ? 0.847   2.520   -1.757  1.00 0.00 ? 69  LEU A CB   6  
ATOM 7811  C CG   . LEU A 1 32 ? -0.587  2.917   -1.414  1.00 0.00 ? 69  LEU A CG   6  
ATOM 7812  C CD1  . LEU A 1 32 ? -1.455  1.681   -1.251  1.00 0.00 ? 69  LEU A CD1  6  
ATOM 7813  C CD2  . LEU A 1 32 ? -0.610  3.743   -0.141  1.00 0.00 ? 69  LEU A CD2  6  
ATOM 7814  H H    . LEU A 1 32 ? 0.636   3.531   -4.070  1.00 0.00 ? 69  LEU A H    6  
ATOM 7815  H HA   . LEU A 1 32 ? 1.647   4.502   -1.612  1.00 0.00 ? 69  LEU A HA   6  
ATOM 7816  H HB2  . LEU A 1 32 ? 0.811   1.749   -2.514  1.00 0.00 ? 69  LEU A HB2  6  
ATOM 7817  H HB3  . LEU A 1 32 ? 1.303   2.106   -0.870  1.00 0.00 ? 69  LEU A HB3  6  
ATOM 7818  H HG   . LEU A 1 32 ? -0.996  3.516   -2.214  1.00 0.00 ? 69  LEU A HG   6  
ATOM 7819  H HD11 . LEU A 1 32 ? -1.065  0.885   -1.868  1.00 0.00 ? 69  LEU A HD11 6  
ATOM 7820  H HD12 . LEU A 1 32 ? -1.448  1.369   -0.218  1.00 0.00 ? 69  LEU A HD12 6  
ATOM 7821  H HD13 . LEU A 1 32 ? -2.468  1.908   -1.553  1.00 0.00 ? 69  LEU A HD13 6  
ATOM 7822  H HD21 . LEU A 1 32 ? 0.314   3.596   0.400   1.00 0.00 ? 69  LEU A HD21 6  
ATOM 7823  H HD22 . LEU A 1 32 ? -0.715  4.788   -0.393  1.00 0.00 ? 69  LEU A HD22 6  
ATOM 7824  H HD23 . LEU A 1 32 ? -1.441  3.435   0.474   1.00 0.00 ? 69  LEU A HD23 6  
ATOM 7825  N N    . LYS A 1 33 ? 3.548   2.430   -3.323  1.00 0.00 ? 70  LYS A N    6  
ATOM 7826  C CA   . LYS A 1 33 ? 4.917   1.958   -3.486  1.00 0.00 ? 70  LYS A CA   6  
ATOM 7827  C C    . LYS A 1 33 ? 5.879   3.136   -3.542  1.00 0.00 ? 70  LYS A C    6  
ATOM 7828  O O    . LYS A 1 33 ? 6.942   3.115   -2.923  1.00 0.00 ? 70  LYS A O    6  
ATOM 7829  C CB   . LYS A 1 33 ? 5.075   1.144   -4.773  1.00 0.00 ? 70  LYS A CB   6  
ATOM 7830  C CG   . LYS A 1 33 ? 4.077   0.011   -4.958  1.00 0.00 ? 70  LYS A CG   6  
ATOM 7831  C CD   . LYS A 1 33 ? 4.459   -0.828  -6.164  1.00 0.00 ? 70  LYS A CD   6  
ATOM 7832  C CE   . LYS A 1 33 ? 3.456   -1.930  -6.451  1.00 0.00 ? 70  LYS A CE   6  
ATOM 7833  N NZ   . LYS A 1 33 ? 3.761   -2.622  -7.730  1.00 0.00 ? 70  LYS A NZ   6  
ATOM 7834  H H    . LYS A 1 33 ? 2.877   2.197   -4.001  1.00 0.00 ? 70  LYS A H    6  
ATOM 7835  H HA   . LYS A 1 33 ? 5.162   1.339   -2.635  1.00 0.00 ? 70  LYS A HA   6  
ATOM 7836  H HB2  . LYS A 1 33 ? 4.978   1.813   -5.614  1.00 0.00 ? 70  LYS A HB2  6  
ATOM 7837  H HB3  . LYS A 1 33 ? 6.068   0.718   -4.786  1.00 0.00 ? 70  LYS A HB3  6  
ATOM 7838  H HG2  . LYS A 1 33 ? 4.066   -0.613  -4.077  1.00 0.00 ? 70  LYS A HG2  6  
ATOM 7839  H HG3  . LYS A 1 33 ? 3.096   0.431   -5.120  1.00 0.00 ? 70  LYS A HG3  6  
ATOM 7840  H HD2  . LYS A 1 33 ? 4.521   -0.183  -7.031  1.00 0.00 ? 70  LYS A HD2  6  
ATOM 7841  H HD3  . LYS A 1 33 ? 5.427   -1.275  -5.983  1.00 0.00 ? 70  LYS A HD3  6  
ATOM 7842  H HE2  . LYS A 1 33 ? 3.486   -2.647  -5.643  1.00 0.00 ? 70  LYS A HE2  6  
ATOM 7843  H HE3  . LYS A 1 33 ? 2.468   -1.496  -6.510  1.00 0.00 ? 70  LYS A HE3  6  
ATOM 7844  H HZ1  . LYS A 1 33 ? 4.795   -2.657  -7.886  1.00 0.00 ? 70  LYS A HZ1  6  
ATOM 7845  H HZ2  . LYS A 1 33 ? 3.391   -3.594  -7.717  1.00 0.00 ? 70  LYS A HZ2  6  
ATOM 7846  H HZ3  . LYS A 1 33 ? 3.321   -2.107  -8.524  1.00 0.00 ? 70  LYS A HZ3  6  
ATOM 7847  N N    . LYS A 1 34 ? 5.480   4.170   -4.273  1.00 0.00 ? 71  LYS A N    6  
ATOM 7848  C CA   . LYS A 1 34 ? 6.296   5.360   -4.435  1.00 0.00 ? 71  LYS A CA   6  
ATOM 7849  C C    . LYS A 1 34 ? 6.453   6.068   -3.112  1.00 0.00 ? 71  LYS A C    6  
ATOM 7850  O O    . LYS A 1 34 ? 7.562   6.383   -2.693  1.00 0.00 ? 71  LYS A O    6  
ATOM 7851  C CB   . LYS A 1 34 ? 5.663   6.306   -5.451  1.00 0.00 ? 71  LYS A CB   6  
ATOM 7852  C CG   . LYS A 1 34 ? 6.415   7.616   -5.605  1.00 0.00 ? 71  LYS A CG   6  
ATOM 7853  C CD   . LYS A 1 34 ? 5.809   8.493   -6.684  1.00 0.00 ? 71  LYS A CD   6  
ATOM 7854  C CE   . LYS A 1 34 ? 6.490   9.850   -6.734  1.00 0.00 ? 71  LYS A CE   6  
ATOM 7855  N NZ   . LYS A 1 34 ? 7.959   9.734   -6.944  1.00 0.00 ? 71  LYS A NZ   6  
ATOM 7856  H H    . LYS A 1 34 ? 4.593   4.146   -4.686  1.00 0.00 ? 71  LYS A H    6  
ATOM 7857  H HA   . LYS A 1 34 ? 7.268   5.055   -4.788  1.00 0.00 ? 71  LYS A HA   6  
ATOM 7858  H HB2  . LYS A 1 34 ? 5.628   5.816   -6.407  1.00 0.00 ? 71  LYS A HB2  6  
ATOM 7859  H HB3  . LYS A 1 34 ? 4.654   6.531   -5.135  1.00 0.00 ? 71  LYS A HB3  6  
ATOM 7860  H HG2  . LYS A 1 34 ? 6.382   8.148   -4.667  1.00 0.00 ? 71  LYS A HG2  6  
ATOM 7861  H HG3  . LYS A 1 34 ? 7.444   7.403   -5.863  1.00 0.00 ? 71  LYS A HG3  6  
ATOM 7862  H HD2  . LYS A 1 34 ? 5.926   8.003   -7.640  1.00 0.00 ? 71  LYS A HD2  6  
ATOM 7863  H HD3  . LYS A 1 34 ? 4.759   8.632   -6.473  1.00 0.00 ? 71  LYS A HD3  6  
ATOM 7864  H HE2  . LYS A 1 34 ? 6.064   10.422  -7.545  1.00 0.00 ? 71  LYS A HE2  6  
ATOM 7865  H HE3  . LYS A 1 34 ? 6.308   10.362  -5.801  1.00 0.00 ? 71  LYS A HE3  6  
ATOM 7866  H HZ1  . LYS A 1 34 ? 8.209   8.763   -7.231  1.00 0.00 ? 71  LYS A HZ1  6  
ATOM 7867  H HZ2  . LYS A 1 34 ? 8.271   10.393  -7.688  1.00 0.00 ? 71  LYS A HZ2  6  
ATOM 7868  H HZ3  . LYS A 1 34 ? 8.470   9.963   -6.062  1.00 0.00 ? 71  LYS A HZ3  6  
ATOM 7869  N N    . PHE A 1 35 ? 5.329   6.282   -2.453  1.00 0.00 ? 72  PHE A N    6  
ATOM 7870  C CA   . PHE A 1 35 ? 5.310   6.933   -1.151  1.00 0.00 ? 72  PHE A CA   6  
ATOM 7871  C C    . PHE A 1 35 ? 6.287   6.255   -0.195  1.00 0.00 ? 72  PHE A C    6  
ATOM 7872  O O    . PHE A 1 35 ? 7.048   6.920   0.517   1.00 0.00 ? 72  PHE A O    6  
ATOM 7873  C CB   . PHE A 1 35 ? 3.901   6.885   -0.559  1.00 0.00 ? 72  PHE A CB   6  
ATOM 7874  C CG   . PHE A 1 35 ? 3.815   7.531   0.791   1.00 0.00 ? 72  PHE A CG   6  
ATOM 7875  C CD1  . PHE A 1 35 ? 4.086   6.806   1.935   1.00 0.00 ? 72  PHE A CD1  6  
ATOM 7876  C CD2  . PHE A 1 35 ? 3.450   8.860   0.908   1.00 0.00 ? 72  PHE A CD2  6  
ATOM 7877  C CE1  . PHE A 1 35 ? 3.992   7.394   3.182   1.00 0.00 ? 72  PHE A CE1  6  
ATOM 7878  C CE2  . PHE A 1 35 ? 3.348   9.457   2.152   1.00 0.00 ? 72  PHE A CE2  6  
ATOM 7879  C CZ   . PHE A 1 35 ? 3.694   8.732   3.291   1.00 0.00 ? 72  PHE A CZ   6  
ATOM 7880  H H    . PHE A 1 35 ? 4.482   5.982   -2.856  1.00 0.00 ? 72  PHE A H    6  
ATOM 7881  H HA   . PHE A 1 35 ? 5.603   7.963   -1.287  1.00 0.00 ? 72  PHE A HA   6  
ATOM 7882  H HB2  . PHE A 1 35 ? 3.218   7.400   -1.220  1.00 0.00 ? 72  PHE A HB2  6  
ATOM 7883  H HB3  . PHE A 1 35 ? 3.592   5.855   -0.457  1.00 0.00 ? 72  PHE A HB3  6  
ATOM 7884  H HD1  . PHE A 1 35 ? 4.378   5.771   1.846   1.00 0.00 ? 72  PHE A HD1  6  
ATOM 7885  H HD2  . PHE A 1 35 ? 3.237   9.428   0.011   1.00 0.00 ? 72  PHE A HD2  6  
ATOM 7886  H HE1  . PHE A 1 35 ? 4.206   6.817   4.069   1.00 0.00 ? 72  PHE A HE1  6  
ATOM 7887  H HE2  . PHE A 1 35 ? 3.063   10.493  2.233   1.00 0.00 ? 72  PHE A HE2  6  
ATOM 7888  H HZ   . PHE A 1 35 ? 3.651   9.201   4.262   1.00 0.00 ? 72  PHE A HZ   6  
ATOM 7889  N N    . ILE A 1 36 ? 6.250   4.928   -0.178  1.00 0.00 ? 73  ILE A N    6  
ATOM 7890  C CA   . ILE A 1 36 ? 7.119   4.155   0.689   1.00 0.00 ? 73  ILE A CA   6  
ATOM 7891  C C    . ILE A 1 36 ? 8.579   4.340   0.288   1.00 0.00 ? 73  ILE A C    6  
ATOM 7892  O O    . ILE A 1 36 ? 9.434   4.554   1.138   1.00 0.00 ? 73  ILE A O    6  
ATOM 7893  C CB   . ILE A 1 36 ? 6.760   2.656   0.665   1.00 0.00 ? 73  ILE A CB   6  
ATOM 7894  C CG1  . ILE A 1 36 ? 5.313   2.452   1.124   1.00 0.00 ? 73  ILE A CG1  6  
ATOM 7895  C CG2  . ILE A 1 36 ? 7.714   1.873   1.551   1.00 0.00 ? 73  ILE A CG2  6  
ATOM 7896  C CD1  . ILE A 1 36 ? 4.842   1.017   1.036   1.00 0.00 ? 73  ILE A CD1  6  
ATOM 7897  H H    . ILE A 1 36 ? 5.617   4.457   -0.768  1.00 0.00 ? 73  ILE A H    6  
ATOM 7898  H HA   . ILE A 1 36 ? 6.988   4.519   1.697   1.00 0.00 ? 73  ILE A HA   6  
ATOM 7899  H HB   . ILE A 1 36 ? 6.866   2.296   -0.346  1.00 0.00 ? 73  ILE A HB   6  
ATOM 7900  H HG12 . ILE A 1 36 ? 5.220   2.767   2.151   1.00 0.00 ? 73  ILE A HG12 6  
ATOM 7901  H HG13 . ILE A 1 36 ? 4.660   3.054   0.507   1.00 0.00 ? 73  ILE A HG13 6  
ATOM 7902  H HG21 . ILE A 1 36 ? 8.734   2.110   1.278   1.00 0.00 ? 73  ILE A HG21 6  
ATOM 7903  H HG22 . ILE A 1 36 ? 7.547   2.139   2.584   1.00 0.00 ? 73  ILE A HG22 6  
ATOM 7904  H HG23 . ILE A 1 36 ? 7.542   0.816   1.418   1.00 0.00 ? 73  ILE A HG23 6  
ATOM 7905  H HD11 . ILE A 1 36 ? 5.434   0.489   0.302   1.00 0.00 ? 73  ILE A HD11 6  
ATOM 7906  H HD12 . ILE A 1 36 ? 4.955   0.540   1.999   1.00 0.00 ? 73  ILE A HD12 6  
ATOM 7907  H HD13 . ILE A 1 36 ? 3.804   0.995   0.741   1.00 0.00 ? 73  ILE A HD13 6  
ATOM 7908  N N    . LYS A 1 37 ? 8.847   4.313   -1.012  1.00 0.00 ? 74  LYS A N    6  
ATOM 7909  C CA   . LYS A 1 37 ? 10.203  4.505   -1.522  1.00 0.00 ? 74  LYS A CA   6  
ATOM 7910  C C    . LYS A 1 37 ? 10.753  5.881   -1.159  1.00 0.00 ? 74  LYS A C    6  
ATOM 7911  O O    . LYS A 1 37 ? 11.937  6.024   -0.852  1.00 0.00 ? 74  LYS A O    6  
ATOM 7912  C CB   . LYS A 1 37 ? 10.233  4.334   -3.040  1.00 0.00 ? 74  LYS A CB   6  
ATOM 7913  C CG   . LYS A 1 37 ? 9.946   2.919   -3.514  1.00 0.00 ? 74  LYS A CG   6  
ATOM 7914  C CD   . LYS A 1 37 ? 10.040  2.823   -5.023  1.00 0.00 ? 74  LYS A CD   6  
ATOM 7915  C CE   . LYS A 1 37 ? 9.794   1.410   -5.520  1.00 0.00 ? 74  LYS A CE   6  
ATOM 7916  N NZ   . LYS A 1 37 ? 9.846   1.335   -7.003  1.00 0.00 ? 74  LYS A NZ   6  
ATOM 7917  H H    . LYS A 1 37 ? 8.111   4.176   -1.650  1.00 0.00 ? 74  LYS A H    6  
ATOM 7918  H HA   . LYS A 1 37 ? 10.831  3.754   -1.074  1.00 0.00 ? 74  LYS A HA   6  
ATOM 7919  H HB2  . LYS A 1 37 ? 9.494   4.990   -3.475  1.00 0.00 ? 74  LYS A HB2  6  
ATOM 7920  H HB3  . LYS A 1 37 ? 11.209  4.620   -3.402  1.00 0.00 ? 74  LYS A HB3  6  
ATOM 7921  H HG2  . LYS A 1 37 ? 10.664  2.245   -3.072  1.00 0.00 ? 74  LYS A HG2  6  
ATOM 7922  H HG3  . LYS A 1 37 ? 8.948   2.642   -3.206  1.00 0.00 ? 74  LYS A HG3  6  
ATOM 7923  H HD2  . LYS A 1 37 ? 9.301   3.477   -5.460  1.00 0.00 ? 74  LYS A HD2  6  
ATOM 7924  H HD3  . LYS A 1 37 ? 11.029  3.137   -5.330  1.00 0.00 ? 74  LYS A HD3  6  
ATOM 7925  H HE2  . LYS A 1 37 ? 10.550  0.757   -5.107  1.00 0.00 ? 74  LYS A HE2  6  
ATOM 7926  H HE3  . LYS A 1 37 ? 8.818   1.088   -5.185  1.00 0.00 ? 74  LYS A HE3  6  
ATOM 7927  H HZ1  . LYS A 1 37 ? 10.676  1.850   -7.362  1.00 0.00 ? 74  LYS A HZ1  6  
ATOM 7928  H HZ2  . LYS A 1 37 ? 9.908   0.342   -7.314  1.00 0.00 ? 74  LYS A HZ2  6  
ATOM 7929  H HZ3  . LYS A 1 37 ? 8.985   1.761   -7.410  1.00 0.00 ? 74  LYS A HZ3  6  
ATOM 7930  N N    . GLU A 1 38 ? 9.915   6.900   -1.287  1.00 0.00 ? 75  GLU A N    6  
ATOM 7931  C CA   . GLU A 1 38 ? 10.340  8.277   -1.053  1.00 0.00 ? 75  GLU A CA   6  
ATOM 7932  C C    . GLU A 1 38 ? 10.735  8.494   0.405   1.00 0.00 ? 75  GLU A C    6  
ATOM 7933  O O    . GLU A 1 38 ? 11.623  9.293   0.704   1.00 0.00 ? 75  GLU A O    6  
ATOM 7934  C CB   . GLU A 1 38 ? 9.227   9.255   -1.439  1.00 0.00 ? 75  GLU A CB   6  
ATOM 7935  C CG   . GLU A 1 38 ? 8.757   9.115   -2.880  1.00 0.00 ? 75  GLU A CG   6  
ATOM 7936  C CD   . GLU A 1 38 ? 9.803   9.515   -3.899  1.00 0.00 ? 75  GLU A CD   6  
ATOM 7937  O OE1  . GLU A 1 38 ? 10.949  9.030   -3.797  1.00 0.00 ? 75  GLU A OE1  6  
ATOM 7938  O OE2  . GLU A 1 38 ? 9.503   10.338  -4.787  1.00 0.00 ? 75  GLU A OE2  6  
ATOM 7939  H H    . GLU A 1 38 ? 9.001   6.729   -1.612  1.00 0.00 ? 75  GLU A H    6  
ATOM 7940  H HA   . GLU A 1 38 ? 11.202  8.466   -1.675  1.00 0.00 ? 75  GLU A HA   6  
ATOM 7941  H HB2  . GLU A 1 38 ? 8.378   9.090   -0.791  1.00 0.00 ? 75  GLU A HB2  6  
ATOM 7942  H HB3  . GLU A 1 38 ? 9.585   10.265  -1.297  1.00 0.00 ? 75  GLU A HB3  6  
ATOM 7943  H HG2  . GLU A 1 38 ? 8.486   8.086   -3.057  1.00 0.00 ? 75  GLU A HG2  6  
ATOM 7944  H HG3  . GLU A 1 38 ? 7.885   9.740   -3.020  1.00 0.00 ? 75  GLU A HG3  6  
ATOM 7945  N N    . ASN A 1 39 ? 10.012  7.855   1.310   1.00 0.00 ? 76  ASN A N    6  
ATOM 7946  C CA   . ASN A 1 39 ? 10.231  8.051   2.738   1.00 0.00 ? 76  ASN A CA   6  
ATOM 7947  C C    . ASN A 1 39 ? 11.149  6.983   3.329   1.00 0.00 ? 76  ASN A C    6  
ATOM 7948  O O    . ASN A 1 39 ? 12.020  7.284   4.148   1.00 0.00 ? 76  ASN A O    6  
ATOM 7949  C CB   . ASN A 1 39 ? 8.895   8.068   3.473   1.00 0.00 ? 76  ASN A CB   6  
ATOM 7950  C CG   . ASN A 1 39 ? 8.105   9.329   3.196   1.00 0.00 ? 76  ASN A CG   6  
ATOM 7951  O OD1  . ASN A 1 39 ? 8.448   10.410  3.675   1.00 0.00 ? 76  ASN A OD1  6  
ATOM 7952  N ND2  . ASN A 1 39 ? 7.057   9.209   2.397   1.00 0.00 ? 76  ASN A ND2  6  
ATOM 7953  H H    . ASN A 1 39 ? 9.278   7.277   1.011   1.00 0.00 ? 76  ASN A H    6  
ATOM 7954  H HA   . ASN A 1 39 ? 10.704  9.014   2.864   1.00 0.00 ? 76  ASN A HA   6  
ATOM 7955  H HB2  . ASN A 1 39 ? 8.306   7.221   3.157   1.00 0.00 ? 76  ASN A HB2  6  
ATOM 7956  H HB3  . ASN A 1 39 ? 9.072   8.001   4.536   1.00 0.00 ? 76  ASN A HB3  6  
ATOM 7957  H HD21 . ASN A 1 39 ? 6.851   8.321   2.030   1.00 0.00 ? 76  ASN A HD21 6  
ATOM 7958  H HD22 . ASN A 1 39 ? 6.528   10.017  2.200   1.00 0.00 ? 76  ASN A HD22 6  
ATOM 7959  N N    . TYR A 1 40 ? 10.937  5.737   2.927   1.00 0.00 ? 77  TYR A N    6  
ATOM 7960  C CA   . TYR A 1 40 ? 11.728  4.619   3.426   1.00 0.00 ? 77  TYR A CA   6  
ATOM 7961  C C    . TYR A 1 40 ? 12.438  3.909   2.272   1.00 0.00 ? 77  TYR A C    6  
ATOM 7962  O O    . TYR A 1 40 ? 11.996  2.847   1.826   1.00 0.00 ? 77  TYR A O    6  
ATOM 7963  C CB   . TYR A 1 40 ? 10.848  3.596   4.164   1.00 0.00 ? 77  TYR A CB   6  
ATOM 7964  C CG   . TYR A 1 40 ? 10.092  4.124   5.372   1.00 0.00 ? 77  TYR A CG   6  
ATOM 7965  C CD1  . TYR A 1 40 ? 9.095   5.080   5.219   1.00 0.00 ? 77  TYR A CD1  6  
ATOM 7966  C CD2  . TYR A 1 40 ? 10.394  3.697   6.660   1.00 0.00 ? 77  TYR A CD2  6  
ATOM 7967  C CE1  . TYR A 1 40 ? 8.418   5.588   6.313   1.00 0.00 ? 77  TYR A CE1  6  
ATOM 7968  C CE2  . TYR A 1 40 ? 9.727   4.205   7.758   1.00 0.00 ? 77  TYR A CE2  6  
ATOM 7969  C CZ   . TYR A 1 40 ? 8.674   5.032   7.590   1.00 0.00 ? 77  TYR A CZ   6  
ATOM 7970  O OH   . TYR A 1 40 ? 8.076   5.659   8.674   1.00 0.00 ? 77  TYR A OH   6  
ATOM 7971  H H    . TYR A 1 40 ? 10.225  5.559   2.271   1.00 0.00 ? 77  TYR A H    6  
ATOM 7972  H HA   . TYR A 1 40 ? 12.469  5.009   4.108   1.00 0.00 ? 77  TYR A HA   6  
ATOM 7973  H HB2  . TYR A 1 40 ? 10.116  3.209   3.473   1.00 0.00 ? 77  TYR A HB2  6  
ATOM 7974  H HB3  . TYR A 1 40 ? 11.474  2.781   4.500   1.00 0.00 ? 77  TYR A HB3  6  
ATOM 7975  H HD1  . TYR A 1 40 ? 8.844   5.420   4.227   1.00 0.00 ? 77  TYR A HD1  6  
ATOM 7976  H HD2  . TYR A 1 40 ? 11.166  2.955   6.797   1.00 0.00 ? 77  TYR A HD2  6  
ATOM 7977  H HE1  . TYR A 1 40 ? 7.648   6.330   6.171   1.00 0.00 ? 77  TYR A HE1  6  
ATOM 7978  H HE2  . TYR A 1 40 ? 9.980   3.859   8.748   1.00 0.00 ? 77  TYR A HE2  6  
ATOM 7979  H HH   . TYR A 1 40 ? 8.708   5.789   9.406   1.00 0.00 ? 77  TYR A HH   6  
ATOM 7980  N N    . PRO A 1 41 ? 13.566  4.461   1.789   1.00 0.00 ? 78  PRO A N    6  
ATOM 7981  C CA   . PRO A 1 41 ? 14.337  3.861   0.687   1.00 0.00 ? 78  PRO A CA   6  
ATOM 7982  C C    . PRO A 1 41 ? 14.835  2.457   1.026   1.00 0.00 ? 78  PRO A C    6  
ATOM 7983  O O    . PRO A 1 41 ? 15.099  1.649   0.133   1.00 0.00 ? 78  PRO A O    6  
ATOM 7984  C CB   . PRO A 1 41 ? 15.520  4.814   0.504   1.00 0.00 ? 78  PRO A CB   6  
ATOM 7985  C CG   . PRO A 1 41 ? 15.599  5.588   1.774   1.00 0.00 ? 78  PRO A CG   6  
ATOM 7986  C CD   . PRO A 1 41 ? 14.189  5.700   2.278   1.00 0.00 ? 78  PRO A CD   6  
ATOM 7987  H HA   . PRO A 1 41 ? 13.757  3.823   -0.225  1.00 0.00 ? 78  PRO A HA   6  
ATOM 7988  H HB2  . PRO A 1 41 ? 16.419  4.240   0.334   1.00 0.00 ? 78  PRO A HB2  6  
ATOM 7989  H HB3  . PRO A 1 41 ? 15.336  5.461   -0.341  1.00 0.00 ? 78  PRO A HB3  6  
ATOM 7990  H HG2  . PRO A 1 41 ? 16.212  5.059   2.489   1.00 0.00 ? 78  PRO A HG2  6  
ATOM 7991  H HG3  . PRO A 1 41 ? 16.006  6.569   1.581   1.00 0.00 ? 78  PRO A HG3  6  
ATOM 7992  H HD2  . PRO A 1 41 ? 14.175  5.740   3.356   1.00 0.00 ? 78  PRO A HD2  6  
ATOM 7993  H HD3  . PRO A 1 41 ? 13.703  6.568   1.857   1.00 0.00 ? 78  PRO A HD3  6  
ATOM 7994  N N    . ILE A 1 42 ? 14.922  2.177   2.328   1.00 0.00 ? 79  ILE A N    6  
ATOM 7995  C CA   . ILE A 1 42 ? 15.333  0.871   2.829   1.00 0.00 ? 79  ILE A CA   6  
ATOM 7996  C C    . ILE A 1 42 ? 14.531  -0.229  2.158   1.00 0.00 ? 79  ILE A C    6  
ATOM 7997  O O    . ILE A 1 42 ? 15.062  -1.086  1.450   1.00 0.00 ? 79  ILE A O    6  
ATOM 7998  C CB   . ILE A 1 42 ? 15.071  0.751   4.348   1.00 0.00 ? 79  ILE A CB   6  
ATOM 7999  C CG1  . ILE A 1 42 ? 15.747  1.882   5.134   1.00 0.00 ? 79  ILE A CG1  6  
ATOM 8000  C CG2  . ILE A 1 42 ? 15.548  -0.598  4.861   1.00 0.00 ? 79  ILE A CG2  6  
ATOM 8001  C CD1  . ILE A 1 42 ? 14.937  3.161   5.200   1.00 0.00 ? 79  ILE A CD1  6  
ATOM 8002  H H    . ILE A 1 42 ? 14.666  2.866   2.974   1.00 0.00 ? 79  ILE A H    6  
ATOM 8003  H HA   . ILE A 1 42 ? 16.386  0.732   2.637   1.00 0.00 ? 79  ILE A HA   6  
ATOM 8004  H HB   . ILE A 1 42 ? 13.994  0.803   4.495   1.00 0.00 ? 79  ILE A HB   6  
ATOM 8005  H HG12 . ILE A 1 42 ? 15.917  1.552   6.148   1.00 0.00 ? 79  ILE A HG12 6  
ATOM 8006  H HG13 . ILE A 1 42 ? 16.696  2.114   4.674   1.00 0.00 ? 79  ILE A HG13 6  
ATOM 8007  H HG21 . ILE A 1 42 ? 16.046  -1.128  4.061   1.00 0.00 ? 79  ILE A HG21 6  
ATOM 8008  H HG22 . ILE A 1 42 ? 16.237  -0.451  5.678   1.00 0.00 ? 79  ILE A HG22 6  
ATOM 8009  H HG23 . ILE A 1 42 ? 14.701  -1.174  5.201   1.00 0.00 ? 79  ILE A HG23 6  
ATOM 8010  H HD11 . ILE A 1 42 ? 14.090  3.085   4.534   1.00 0.00 ? 79  ILE A HD11 6  
ATOM 8011  H HD12 . ILE A 1 42 ? 14.589  3.316   6.210   1.00 0.00 ? 79  ILE A HD12 6  
ATOM 8012  H HD13 . ILE A 1 42 ? 15.555  3.994   4.901   1.00 0.00 ? 79  ILE A HD13 6  
ATOM 8013  N N    . VAL A 1 43 ? 13.236  -0.159  2.384   1.00 0.00 ? 80  VAL A N    6  
ATOM 8014  C CA   . VAL A 1 43 ? 12.293  -1.096  1.833   1.00 0.00 ? 80  VAL A CA   6  
ATOM 8015  C C    . VAL A 1 43 ? 11.985  -0.740  0.388   1.00 0.00 ? 80  VAL A C    6  
ATOM 8016  O O    . VAL A 1 43 ? 11.692  -1.612  -0.426  1.00 0.00 ? 80  VAL A O    6  
ATOM 8017  C CB   . VAL A 1 43 ? 11.015  -1.098  2.687   1.00 0.00 ? 80  VAL A CB   6  
ATOM 8018  C CG1  . VAL A 1 43 ? 9.793   -0.824  1.862   1.00 0.00 ? 80  VAL A CG1  6  
ATOM 8019  C CG2  . VAL A 1 43 ? 10.870  -2.403  3.439   1.00 0.00 ? 80  VAL A CG2  6  
ATOM 8020  H H    . VAL A 1 43 ? 12.894  0.577   2.929   1.00 0.00 ? 80  VAL A H    6  
ATOM 8021  H HA   . VAL A 1 43 ? 12.724  -2.080  1.868   1.00 0.00 ? 80  VAL A HA   6  
ATOM 8022  H HB   . VAL A 1 43 ? 11.105  -0.305  3.403   1.00 0.00 ? 80  VAL A HB   6  
ATOM 8023  H HG11 . VAL A 1 43 ? 9.877   -1.352  0.928   1.00 0.00 ? 80  VAL A HG11 6  
ATOM 8024  H HG12 . VAL A 1 43 ? 8.916   -1.155  2.393   1.00 0.00 ? 80  VAL A HG12 6  
ATOM 8025  H HG13 . VAL A 1 43 ? 9.730   0.238   1.677   1.00 0.00 ? 80  VAL A HG13 6  
ATOM 8026  H HG21 . VAL A 1 43 ? 11.824  -2.911  3.469   1.00 0.00 ? 80  VAL A HG21 6  
ATOM 8027  H HG22 . VAL A 1 43 ? 10.536  -2.203  4.448   1.00 0.00 ? 80  VAL A HG22 6  
ATOM 8028  H HG23 . VAL A 1 43 ? 10.147  -3.028  2.938   1.00 0.00 ? 80  VAL A HG23 6  
ATOM 8029  N N    . GLY A 1 44 ? 12.019  0.553   0.090   1.00 0.00 ? 81  GLY A N    6  
ATOM 8030  C CA   . GLY A 1 44 ? 11.677  1.011   -1.233  1.00 0.00 ? 81  GLY A CA   6  
ATOM 8031  C C    . GLY A 1 44 ? 12.518  0.360   -2.313  1.00 0.00 ? 81  GLY A C    6  
ATOM 8032  O O    . GLY A 1 44 ? 11.993  -0.118  -3.318  1.00 0.00 ? 81  GLY A O    6  
ATOM 8033  H H    . GLY A 1 44 ? 12.227  1.206   0.793   1.00 0.00 ? 81  GLY A H    6  
ATOM 8034  H HA2  . GLY A 1 44 ? 10.638  0.784   -1.407  1.00 0.00 ? 81  GLY A HA2  6  
ATOM 8035  H HA3  . GLY A 1 44 ? 11.813  2.081   -1.279  1.00 0.00 ? 81  GLY A HA3  6  
ATOM 8036  N N    . SER A 1 45 ? 13.822  0.299   -2.089  1.00 0.00 ? 82  SER A N    6  
ATOM 8037  C CA   . SER A 1 45 ? 14.725  -0.341  -3.026  1.00 0.00 ? 82  SER A CA   6  
ATOM 8038  C C    . SER A 1 45 ? 15.101  -1.743  -2.546  1.00 0.00 ? 82  SER A C    6  
ATOM 8039  O O    . SER A 1 45 ? 16.220  -2.204  -2.764  1.00 0.00 ? 82  SER A O    6  
ATOM 8040  C CB   . SER A 1 45 ? 15.982  0.512   -3.189  1.00 0.00 ? 82  SER A CB   6  
ATOM 8041  O OG   . SER A 1 45 ? 15.660  1.824   -3.631  1.00 0.00 ? 82  SER A OG   6  
ATOM 8042  H H    . SER A 1 45 ? 14.185  0.679   -1.259  1.00 0.00 ? 82  SER A H    6  
ATOM 8043  H HA   . SER A 1 45 ? 14.222  -0.416  -3.979  1.00 0.00 ? 82  SER A HA   6  
ATOM 8044  H HB2  . SER A 1 45 ? 16.492  0.580   -2.239  1.00 0.00 ? 82  SER A HB2  6  
ATOM 8045  H HB3  . SER A 1 45 ? 16.632  0.051   -3.912  1.00 0.00 ? 82  SER A HB3  6  
ATOM 8046  H HG   . SER A 1 45 ? 14.801  2.087   -3.263  1.00 0.00 ? 82  SER A HG   6  
ATOM 8047  N N    . ALA A 1 46 ? 14.169  -2.413  -1.871  1.00 0.00 ? 83  ALA A N    6  
ATOM 8048  C CA   . ALA A 1 46 ? 14.435  -3.740  -1.309  1.00 0.00 ? 83  ALA A CA   6  
ATOM 8049  C C    . ALA A 1 46 ? 14.332  -4.849  -2.361  1.00 0.00 ? 83  ALA A C    6  
ATOM 8050  O O    . ALA A 1 46 ? 14.031  -5.996  -2.024  1.00 0.00 ? 83  ALA A O    6  
ATOM 8051  C CB   . ALA A 1 46 ? 13.489  -4.025  -0.150  1.00 0.00 ? 83  ALA A CB   6  
ATOM 8052  H H    . ALA A 1 46 ? 13.300  -1.985  -1.703  1.00 0.00 ? 83  ALA A H    6  
ATOM 8053  H HA   . ALA A 1 46 ? 15.441  -3.732  -0.917  1.00 0.00 ? 83  ALA A HA   6  
ATOM 8054  H HB1  . ALA A 1 46 ? 13.028  -3.100  0.175   1.00 0.00 ? 83  ALA A HB1  6  
ATOM 8055  H HB2  . ALA A 1 46 ? 12.723  -4.715  -0.471  1.00 0.00 ? 83  ALA A HB2  6  
ATOM 8056  H HB3  . ALA A 1 46 ? 14.043  -4.455  0.670   1.00 0.00 ? 83  ALA A HB3  6  
ATOM 8057  N N    . SER A 1 47 ? 14.696  -4.519  -3.603  1.00 0.00 ? 84  SER A N    6  
ATOM 8058  C CA   . SER A 1 47 ? 14.756  -5.478  -4.713  1.00 0.00 ? 84  SER A CA   6  
ATOM 8059  C C    . SER A 1 47 ? 13.379  -6.055  -5.062  1.00 0.00 ? 84  SER A C    6  
ATOM 8060  O O    . SER A 1 47 ? 12.785  -5.688  -6.075  1.00 0.00 ? 84  SER A O    6  
ATOM 8061  C CB   . SER A 1 47 ? 15.745  -6.606  -4.385  1.00 0.00 ? 84  SER A CB   6  
ATOM 8062  O OG   . SER A 1 47 ? 16.970  -6.084  -3.890  1.00 0.00 ? 84  SER A OG   6  
ATOM 8063  H H    . SER A 1 47 ? 14.995  -3.601  -3.768  1.00 0.00 ? 84  SER A H    6  
ATOM 8064  H HA   . SER A 1 47 ? 15.120  -4.942  -5.576  1.00 0.00 ? 84  SER A HA   6  
ATOM 8065  H HB2  . SER A 1 47 ? 15.316  -7.254  -3.636  1.00 0.00 ? 84  SER A HB2  6  
ATOM 8066  H HB3  . SER A 1 47 ? 15.945  -7.177  -5.280  1.00 0.00 ? 84  SER A HB3  6  
ATOM 8067  H HG   . SER A 1 47 ? 17.178  -5.257  -4.353  1.00 0.00 ? 84  SER A HG   6  
ATOM 8068  N N    . ASN A 1 48 ? 12.864  -6.925  -4.207  1.00 0.00 ? 85  ASN A N    6  
ATOM 8069  C CA   . ASN A 1 48 ? 11.549  -7.524  -4.408  1.00 0.00 ? 85  ASN A CA   6  
ATOM 8070  C C    . ASN A 1 48 ? 10.509  -6.837  -3.532  1.00 0.00 ? 85  ASN A C    6  
ATOM 8071  O O    . ASN A 1 48 ? 9.588   -7.466  -3.015  1.00 0.00 ? 85  ASN A O    6  
ATOM 8072  C CB   . ASN A 1 48 ? 11.585  -9.042  -4.149  1.00 0.00 ? 85  ASN A CB   6  
ATOM 8073  C CG   . ASN A 1 48 ? 12.139  -9.453  -2.784  1.00 0.00 ? 85  ASN A CG   6  
ATOM 8074  O OD1  . ASN A 1 48 ? 12.363  -10.638 -2.538  1.00 0.00 ? 85  ASN A OD1  6  
ATOM 8075  N ND2  . ASN A 1 48 ? 12.346  -8.502  -1.880  1.00 0.00 ? 85  ASN A ND2  6  
ATOM 8076  H H    . ASN A 1 48 ? 13.365  -7.141  -3.393  1.00 0.00 ? 85  ASN A H    6  
ATOM 8077  H HA   . ASN A 1 48 ? 11.280  -7.360  -5.442  1.00 0.00 ? 85  ASN A HA   6  
ATOM 8078  H HB2  . ASN A 1 48 ? 10.580  -9.427  -4.227  1.00 0.00 ? 85  ASN A HB2  6  
ATOM 8079  H HB3  . ASN A 1 48 ? 12.195  -9.507  -4.911  1.00 0.00 ? 85  ASN A HB3  6  
ATOM 8080  H HD21 . ASN A 1 48 ? 12.132  -7.578  -2.118  1.00 0.00 ? 85  ASN A HD21 6  
ATOM 8081  H HD22 . ASN A 1 48 ? 12.703  -8.768  -1.001  1.00 0.00 ? 85  ASN A HD22 6  
ATOM 8082  N N    . PHE A 1 49 ? 10.656  -5.524  -3.415  1.00 0.00 ? 86  PHE A N    6  
ATOM 8083  C CA   . PHE A 1 49 ? 9.732   -4.696  -2.656  1.00 0.00 ? 86  PHE A CA   6  
ATOM 8084  C C    . PHE A 1 49 ? 8.327   -4.778  -3.240  1.00 0.00 ? 86  PHE A C    6  
ATOM 8085  O O    . PHE A 1 49 ? 7.348   -4.883  -2.505  1.00 0.00 ? 86  PHE A O    6  
ATOM 8086  C CB   . PHE A 1 49 ? 10.224  -3.245  -2.666  1.00 0.00 ? 86  PHE A CB   6  
ATOM 8087  C CG   . PHE A 1 49 ? 9.176   -2.236  -2.283  1.00 0.00 ? 86  PHE A CG   6  
ATOM 8088  C CD1  . PHE A 1 49 ? 8.543   -2.295  -1.052  1.00 0.00 ? 86  PHE A CD1  6  
ATOM 8089  C CD2  . PHE A 1 49 ? 8.815   -1.236  -3.167  1.00 0.00 ? 86  PHE A CD2  6  
ATOM 8090  C CE1  . PHE A 1 49 ? 7.571   -1.374  -0.711  1.00 0.00 ? 86  PHE A CE1  6  
ATOM 8091  C CE2  . PHE A 1 49 ? 7.845   -0.312  -2.832  1.00 0.00 ? 86  PHE A CE2  6  
ATOM 8092  C CZ   . PHE A 1 49 ? 7.222   -0.381  -1.602  1.00 0.00 ? 86  PHE A CZ   6  
ATOM 8093  H H    . PHE A 1 49 ? 11.387  -5.089  -3.901  1.00 0.00 ? 86  PHE A H    6  
ATOM 8094  H HA   . PHE A 1 49 ? 9.712   -5.058  -1.638  1.00 0.00 ? 86  PHE A HA   6  
ATOM 8095  H HB2  . PHE A 1 49 ? 11.043  -3.147  -1.970  1.00 0.00 ? 86  PHE A HB2  6  
ATOM 8096  H HB3  . PHE A 1 49 ? 10.574  -3.001  -3.659  1.00 0.00 ? 86  PHE A HB3  6  
ATOM 8097  H HD1  . PHE A 1 49 ? 8.817   -3.071  -0.351  1.00 0.00 ? 86  PHE A HD1  6  
ATOM 8098  H HD2  . PHE A 1 49 ? 9.300   -1.181  -4.132  1.00 0.00 ? 86  PHE A HD2  6  
ATOM 8099  H HE1  . PHE A 1 49 ? 7.085   -1.433  0.251   1.00 0.00 ? 86  PHE A HE1  6  
ATOM 8100  H HE2  . PHE A 1 49 ? 7.574   0.463   -3.531  1.00 0.00 ? 86  PHE A HE2  6  
ATOM 8101  H HZ   . PHE A 1 49 ? 6.463   0.338   -1.339  1.00 0.00 ? 86  PHE A HZ   6  
ATOM 8102  N N    . ASP A 1 50 ? 8.243   -4.710  -4.560  1.00 0.00 ? 87  ASP A N    6  
ATOM 8103  C CA   . ASP A 1 50 ? 6.953   -4.744  -5.248  1.00 0.00 ? 87  ASP A CA   6  
ATOM 8104  C C    . ASP A 1 50 ? 6.194   -6.026  -4.924  1.00 0.00 ? 87  ASP A C    6  
ATOM 8105  O O    . ASP A 1 50 ? 5.008   -5.987  -4.591  1.00 0.00 ? 87  ASP A O    6  
ATOM 8106  C CB   . ASP A 1 50 ? 7.129   -4.624  -6.766  1.00 0.00 ? 87  ASP A CB   6  
ATOM 8107  C CG   . ASP A 1 50 ? 7.318   -3.193  -7.231  1.00 0.00 ? 87  ASP A CG   6  
ATOM 8108  O OD1  . ASP A 1 50 ? 8.354   -2.577  -6.899  1.00 0.00 ? 87  ASP A OD1  6  
ATOM 8109  O OD2  . ASP A 1 50 ? 6.426   -2.676  -7.933  1.00 0.00 ? 87  ASP A OD2  6  
ATOM 8110  H H    . ASP A 1 50 ? 9.074   -4.615  -5.089  1.00 0.00 ? 87  ASP A H    6  
ATOM 8111  H HA   . ASP A 1 50 ? 6.372   -3.903  -4.896  1.00 0.00 ? 87  ASP A HA   6  
ATOM 8112  H HB2  . ASP A 1 50 ? 7.997   -5.193  -7.065  1.00 0.00 ? 87  ASP A HB2  6  
ATOM 8113  H HB3  . ASP A 1 50 ? 6.256   -5.028  -7.257  1.00 0.00 ? 87  ASP A HB3  6  
ATOM 8114  N N    . LEU A 1 51 ? 6.900   -7.149  -4.960  1.00 0.00 ? 88  LEU A N    6  
ATOM 8115  C CA   . LEU A 1 51 ? 6.302   -8.445  -4.653  1.00 0.00 ? 88  LEU A CA   6  
ATOM 8116  C C    . LEU A 1 51 ? 5.787   -8.461  -3.219  1.00 0.00 ? 88  LEU A C    6  
ATOM 8117  O O    . LEU A 1 51 ? 4.635   -8.818  -2.958  1.00 0.00 ? 88  LEU A O    6  
ATOM 8118  C CB   . LEU A 1 51 ? 7.341   -9.564  -4.879  1.00 0.00 ? 88  LEU A CB   6  
ATOM 8119  C CG   . LEU A 1 51 ? 6.858   -11.011 -4.668  1.00 0.00 ? 88  LEU A CG   6  
ATOM 8120  C CD1  . LEU A 1 51 ? 7.074   -11.461 -3.231  1.00 0.00 ? 88  LEU A CD1  6  
ATOM 8121  C CD2  . LEU A 1 51 ? 5.392   -11.150 -5.045  1.00 0.00 ? 88  LEU A CD2  6  
ATOM 8122  H H    . LEU A 1 51 ? 7.858   -7.102  -5.171  1.00 0.00 ? 88  LEU A H    6  
ATOM 8123  H HA   . LEU A 1 51 ? 5.470   -8.595  -5.324  1.00 0.00 ? 88  LEU A HA   6  
ATOM 8124  H HB2  . LEU A 1 51 ? 7.706   -9.479  -5.892  1.00 0.00 ? 88  LEU A HB2  6  
ATOM 8125  H HB3  . LEU A 1 51 ? 8.170   -9.390  -4.207  1.00 0.00 ? 88  LEU A HB3  6  
ATOM 8126  H HG   . LEU A 1 51 ? 7.431   -11.666 -5.306  1.00 0.00 ? 88  LEU A HG   6  
ATOM 8127  H HD11 . LEU A 1 51 ? 8.120   -11.375 -2.979  1.00 0.00 ? 88  LEU A HD11 6  
ATOM 8128  H HD12 . LEU A 1 51 ? 6.491   -10.839 -2.568  1.00 0.00 ? 88  LEU A HD12 6  
ATOM 8129  H HD13 . LEU A 1 51 ? 6.760   -12.491 -3.124  1.00 0.00 ? 88  LEU A HD13 6  
ATOM 8130  H HD21 . LEU A 1 51 ? 5.231   -10.738 -6.031  1.00 0.00 ? 88  LEU A HD21 6  
ATOM 8131  H HD22 . LEU A 1 51 ? 5.115   -12.193 -5.037  1.00 0.00 ? 88  LEU A HD22 6  
ATOM 8132  H HD23 . LEU A 1 51 ? 4.789   -10.611 -4.326  1.00 0.00 ? 88  LEU A HD23 6  
ATOM 8133  N N    . TYR A 1 52 ? 6.631   -8.013  -2.305  1.00 0.00 ? 89  TYR A N    6  
ATOM 8134  C CA   . TYR A 1 52 ? 6.278   -7.942  -0.897  1.00 0.00 ? 89  TYR A CA   6  
ATOM 8135  C C    . TYR A 1 52 ? 5.086   -7.015  -0.674  1.00 0.00 ? 89  TYR A C    6  
ATOM 8136  O O    . TYR A 1 52 ? 4.185   -7.318  0.112   1.00 0.00 ? 89  TYR A O    6  
ATOM 8137  C CB   . TYR A 1 52 ? 7.476   -7.444  -0.096  1.00 0.00 ? 89  TYR A CB   6  
ATOM 8138  C CG   . TYR A 1 52 ? 8.558   -8.480  0.132   1.00 0.00 ? 89  TYR A CG   6  
ATOM 8139  C CD1  . TYR A 1 52 ? 8.703   -9.550  -0.737  1.00 0.00 ? 89  TYR A CD1  6  
ATOM 8140  C CD2  . TYR A 1 52 ? 9.429   -8.388  1.208   1.00 0.00 ? 89  TYR A CD2  6  
ATOM 8141  C CE1  . TYR A 1 52 ? 9.682   -10.502 -0.538  1.00 0.00 ? 89  TYR A CE1  6  
ATOM 8142  C CE2  . TYR A 1 52 ? 10.413  -9.333  1.414   1.00 0.00 ? 89  TYR A CE2  6  
ATOM 8143  C CZ   . TYR A 1 52 ? 10.552  -10.368 0.558   1.00 0.00 ? 89  TYR A CZ   6  
ATOM 8144  O OH   . TYR A 1 52 ? 11.506  -11.346 0.738   1.00 0.00 ? 89  TYR A OH   6  
ATOM 8145  H H    . TYR A 1 52 ? 7.515   -7.701  -2.590  1.00 0.00 ? 89  TYR A H    6  
ATOM 8146  H HA   . TYR A 1 52 ? 6.019   -8.935  -0.564  1.00 0.00 ? 89  TYR A HA   6  
ATOM 8147  H HB2  . TYR A 1 52 ? 7.925   -6.613  -0.617  1.00 0.00 ? 89  TYR A HB2  6  
ATOM 8148  H HB3  . TYR A 1 52 ? 7.129   -7.109  0.862   1.00 0.00 ? 89  TYR A HB3  6  
ATOM 8149  H HD1  . TYR A 1 52 ? 8.034   -9.638  -1.580  1.00 0.00 ? 89  TYR A HD1  6  
ATOM 8150  H HD2  . TYR A 1 52 ? 9.328   -7.560  1.892   1.00 0.00 ? 89  TYR A HD2  6  
ATOM 8151  H HE1  . TYR A 1 52 ? 9.779   -11.330 -1.226  1.00 0.00 ? 89  TYR A HE1  6  
ATOM 8152  H HE2  . TYR A 1 52 ? 11.078  -9.241  2.260   1.00 0.00 ? 89  TYR A HE2  6  
ATOM 8153  H HH   . TYR A 1 52 ? 11.082  -12.185 0.978   1.00 0.00 ? 89  TYR A HH   6  
ATOM 8154  N N    . PHE A 1 53 ? 5.100   -5.885  -1.367  1.00 0.00 ? 90  PHE A N    6  
ATOM 8155  C CA   . PHE A 1 53 ? 4.042   -4.890  -1.260  1.00 0.00 ? 90  PHE A CA   6  
ATOM 8156  C C    . PHE A 1 53 ? 2.697   -5.467  -1.687  1.00 0.00 ? 90  PHE A C    6  
ATOM 8157  O O    . PHE A 1 53 ? 1.695   -5.298  -0.995  1.00 0.00 ? 90  PHE A O    6  
ATOM 8158  C CB   . PHE A 1 53 ? 4.382   -3.676  -2.129  1.00 0.00 ? 90  PHE A CB   6  
ATOM 8159  C CG   . PHE A 1 53 ? 3.310   -2.629  -2.146  1.00 0.00 ? 90  PHE A CG   6  
ATOM 8160  C CD1  . PHE A 1 53 ? 3.193   -1.725  -1.103  1.00 0.00 ? 90  PHE A CD1  6  
ATOM 8161  C CD2  . PHE A 1 53 ? 2.427   -2.540  -3.207  1.00 0.00 ? 90  PHE A CD2  6  
ATOM 8162  C CE1  . PHE A 1 53 ? 2.216   -0.753  -1.118  1.00 0.00 ? 90  PHE A CE1  6  
ATOM 8163  C CE2  . PHE A 1 53 ? 1.447   -1.568  -3.227  1.00 0.00 ? 90  PHE A CE2  6  
ATOM 8164  C CZ   . PHE A 1 53 ? 1.314   -0.704  -2.174  1.00 0.00 ? 90  PHE A CZ   6  
ATOM 8165  H H    . PHE A 1 53 ? 5.861   -5.703  -1.963  1.00 0.00 ? 90  PHE A H    6  
ATOM 8166  H HA   . PHE A 1 53 ? 3.979   -4.577  -0.228  1.00 0.00 ? 90  PHE A HA   6  
ATOM 8167  H HB2  . PHE A 1 53 ? 5.286   -3.220  -1.758  1.00 0.00 ? 90  PHE A HB2  6  
ATOM 8168  H HB3  . PHE A 1 53 ? 4.541   -4.005  -3.146  1.00 0.00 ? 90  PHE A HB3  6  
ATOM 8169  H HD1  . PHE A 1 53 ? 3.877   -1.786  -0.269  1.00 0.00 ? 90  PHE A HD1  6  
ATOM 8170  H HD2  . PHE A 1 53 ? 2.508   -3.240  -4.025  1.00 0.00 ? 90  PHE A HD2  6  
ATOM 8171  H HE1  . PHE A 1 53 ? 2.136   -0.056  -0.298  1.00 0.00 ? 90  PHE A HE1  6  
ATOM 8172  H HE2  . PHE A 1 53 ? 0.764   -1.508  -4.061  1.00 0.00 ? 90  PHE A HE2  6  
ATOM 8173  H HZ   . PHE A 1 53 ? 0.536   0.046   -2.185  1.00 0.00 ? 90  PHE A HZ   6  
ATOM 8174  N N    . ASN A 1 54 ? 2.675   -6.108  -2.852  1.00 0.00 ? 91  ASN A N    6  
ATOM 8175  C CA   . ASN A 1 54 ? 1.436   -6.655  -3.403  1.00 0.00 ? 91  ASN A CA   6  
ATOM 8176  C C    . ASN A 1 54 ? 0.813   -7.664  -2.450  1.00 0.00 ? 91  ASN A C    6  
ATOM 8177  O O    . ASN A 1 54 ? -0.395  -7.626  -2.198  1.00 0.00 ? 91  ASN A O    6  
ATOM 8178  C CB   . ASN A 1 54 ? 1.675   -7.306  -4.769  1.00 0.00 ? 91  ASN A CB   6  
ATOM 8179  C CG   . ASN A 1 54 ? 1.943   -6.291  -5.865  1.00 0.00 ? 91  ASN A CG   6  
ATOM 8180  O OD1  . ASN A 1 54 ? 1.168   -5.354  -6.067  1.00 0.00 ? 91  ASN A OD1  6  
ATOM 8181  N ND2  . ASN A 1 54 ? 3.035   -6.477  -6.590  1.00 0.00 ? 91  ASN A ND2  6  
ATOM 8182  H H    . ASN A 1 54 ? 3.505   -6.174  -3.375  1.00 0.00 ? 91  ASN A H    6  
ATOM 8183  H HA   . ASN A 1 54 ? 0.748   -5.831  -3.528  1.00 0.00 ? 91  ASN A HA   6  
ATOM 8184  H HB2  . ASN A 1 54 ? 2.527   -7.965  -4.702  1.00 0.00 ? 91  ASN A HB2  6  
ATOM 8185  H HB3  . ASN A 1 54 ? 0.802   -7.879  -5.043  1.00 0.00 ? 91  ASN A HB3  6  
ATOM 8186  H HD21 . ASN A 1 54 ? 3.601   -7.251  -6.382  1.00 0.00 ? 91  ASN A HD21 6  
ATOM 8187  H HD22 . ASN A 1 54 ? 3.234   -5.834  -7.307  1.00 0.00 ? 91  ASN A HD22 6  
ATOM 8188  N N    . ASN A 1 55 ? 1.645   -8.523  -1.875  1.00 0.00 ? 92  ASN A N    6  
ATOM 8189  C CA   . ASN A 1 55 ? 1.176   -9.503  -0.897  1.00 0.00 ? 92  ASN A CA   6  
ATOM 8190  C C    . ASN A 1 55 ? 0.675   -8.813  0.364   1.00 0.00 ? 92  ASN A C    6  
ATOM 8191  O O    . ASN A 1 55 ? -0.384  -9.160  0.890   1.00 0.00 ? 92  ASN A O    6  
ATOM 8192  C CB   . ASN A 1 55 ? 2.284   -10.498 -0.539  1.00 0.00 ? 92  ASN A CB   6  
ATOM 8193  C CG   . ASN A 1 55 ? 2.538   -11.511 -1.639  1.00 0.00 ? 92  ASN A CG   6  
ATOM 8194  O OD1  . ASN A 1 55 ? 1.622   -12.200 -2.089  1.00 0.00 ? 92  ASN A OD1  6  
ATOM 8195  N ND2  . ASN A 1 55 ? 3.784   -11.617 -2.068  1.00 0.00 ? 92  ASN A ND2  6  
ATOM 8196  H H    . ASN A 1 55 ? 2.604   -8.473  -2.084  1.00 0.00 ? 92  ASN A H    6  
ATOM 8197  H HA   . ASN A 1 55 ? 0.355   -10.044 -1.343  1.00 0.00 ? 92  ASN A HA   6  
ATOM 8198  H HB2  . ASN A 1 55 ? 3.200   -9.958  -0.357  1.00 0.00 ? 92  ASN A HB2  6  
ATOM 8199  H HB3  . ASN A 1 55 ? 2.002   -11.032 0.357   1.00 0.00 ? 92  ASN A HB3  6  
ATOM 8200  H HD21 . ASN A 1 55 ? 4.467   -11.042 -1.661  1.00 0.00 ? 92  ASN A HD21 6  
ATOM 8201  H HD22 . ASN A 1 55 ? 3.977   -12.272 -2.778  1.00 0.00 ? 92  ASN A HD22 6  
ATOM 8202  N N    . ALA A 1 56 ? 1.413   -7.800  0.812   1.00 0.00 ? 93  ALA A N    6  
ATOM 8203  C CA   . ALA A 1 56 ? 1.028   -7.022  1.987   1.00 0.00 ? 93  ALA A CA   6  
ATOM 8204  C C    . ALA A 1 56 ? -0.342  -6.382  1.789   1.00 0.00 ? 93  ALA A C    6  
ATOM 8205  O O    . ALA A 1 56 ? -1.200  -6.439  2.676   1.00 0.00 ? 93  ALA A O    6  
ATOM 8206  C CB   . ALA A 1 56 ? 2.073   -5.957  2.284   1.00 0.00 ? 93  ALA A CB   6  
ATOM 8207  H H    . ALA A 1 56 ? 2.224   -7.547  0.319   1.00 0.00 ? 93  ALA A H    6  
ATOM 8208  H HA   . ALA A 1 56 ? 0.982   -7.693  2.831   1.00 0.00 ? 93  ALA A HA   6  
ATOM 8209  H HB1  . ALA A 1 56 ? 2.879   -6.030  1.567   1.00 0.00 ? 93  ALA A HB1  6  
ATOM 8210  H HB2  . ALA A 1 56 ? 2.463   -6.101  3.280   1.00 0.00 ? 93  ALA A HB2  6  
ATOM 8211  H HB3  . ALA A 1 56 ? 1.619   -4.979  2.214   1.00 0.00 ? 93  ALA A HB3  6  
ATOM 8212  N N    . ILE A 1 57 ? -0.561  -5.841  0.593   1.00 0.00 ? 94  ILE A N    6  
ATOM 8213  C CA   . ILE A 1 57 ? -1.848  -5.259  0.235   1.00 0.00 ? 94  ILE A CA   6  
ATOM 8214  C C    . ILE A 1 57 ? -2.948  -6.303  0.309   1.00 0.00 ? 94  ILE A C    6  
ATOM 8215  O O    . ILE A 1 57 ? -3.963  -6.099  0.967   1.00 0.00 ? 94  ILE A O    6  
ATOM 8216  C CB   . ILE A 1 57 ? -1.830  -4.662  -1.194  1.00 0.00 ? 94  ILE A CB   6  
ATOM 8217  C CG1  . ILE A 1 57 ? -0.925  -3.435  -1.248  1.00 0.00 ? 94  ILE A CG1  6  
ATOM 8218  C CG2  . ILE A 1 57 ? -3.240  -4.298  -1.650  1.00 0.00 ? 94  ILE A CG2  6  
ATOM 8219  C CD1  . ILE A 1 57 ? -1.370  -2.331  -0.321  1.00 0.00 ? 94  ILE A CD1  6  
ATOM 8220  H H    . ILE A 1 57 ? 0.157   -5.866  -0.080  1.00 0.00 ? 94  ILE A H    6  
ATOM 8221  H HA   . ILE A 1 57 ? -2.067  -4.464  0.936   1.00 0.00 ? 94  ILE A HA   6  
ATOM 8222  H HB   . ILE A 1 57 ? -1.445  -5.412  -1.866  1.00 0.00 ? 94  ILE A HB   6  
ATOM 8223  H HG12 . ILE A 1 57 ? 0.077   -3.721  -0.968  1.00 0.00 ? 94  ILE A HG12 6  
ATOM 8224  H HG13 . ILE A 1 57 ? -0.916  -3.043  -2.255  1.00 0.00 ? 94  ILE A HG13 6  
ATOM 8225  H HG21 . ILE A 1 57 ? -3.893  -5.152  -1.517  1.00 0.00 ? 94  ILE A HG21 6  
ATOM 8226  H HG22 . ILE A 1 57 ? -3.607  -3.470  -1.062  1.00 0.00 ? 94  ILE A HG22 6  
ATOM 8227  H HG23 . ILE A 1 57 ? -3.220  -4.019  -2.692  1.00 0.00 ? 94  ILE A HG23 6  
ATOM 8228  H HD11 . ILE A 1 57 ? -2.040  -2.740  0.422   1.00 0.00 ? 94  ILE A HD11 6  
ATOM 8229  H HD12 . ILE A 1 57 ? -0.509  -1.901  0.166   1.00 0.00 ? 94  ILE A HD12 6  
ATOM 8230  H HD13 . ILE A 1 57 ? -1.884  -1.570  -0.891  1.00 0.00 ? 94  ILE A HD13 6  
ATOM 8231  N N    . LYS A 1 58 ? -2.738  -7.411  -0.387  1.00 0.00 ? 95  LYS A N    6  
ATOM 8232  C CA   . LYS A 1 58 ? -3.727  -8.484  -0.457  1.00 0.00 ? 95  LYS A CA   6  
ATOM 8233  C C    . LYS A 1 58 ? -4.072  -9.018  0.927   1.00 0.00 ? 95  LYS A C    6  
ATOM 8234  O O    . LYS A 1 58 ? -5.242  -9.259  1.234   1.00 0.00 ? 95  LYS A O    6  
ATOM 8235  C CB   . LYS A 1 58 ? -3.211  -9.637  -1.320  1.00 0.00 ? 95  LYS A CB   6  
ATOM 8236  C CG   . LYS A 1 58 ? -2.984  -9.277  -2.777  1.00 0.00 ? 95  LYS A CG   6  
ATOM 8237  C CD   . LYS A 1 58 ? -2.438  -10.467 -3.549  1.00 0.00 ? 95  LYS A CD   6  
ATOM 8238  C CE   . LYS A 1 58 ? -2.255  -10.150 -5.023  1.00 0.00 ? 95  LYS A CE   6  
ATOM 8239  N NZ   . LYS A 1 58 ? -1.759  -11.327 -5.785  1.00 0.00 ? 95  LYS A NZ   6  
ATOM 8240  H H    . LYS A 1 58 ? -1.902  -7.496  -0.895  1.00 0.00 ? 95  LYS A H    6  
ATOM 8241  H HA   . LYS A 1 58 ? -4.622  -8.079  -0.908  1.00 0.00 ? 95  LYS A HA   6  
ATOM 8242  H HB2  . LYS A 1 58 ? -2.273  -9.981  -0.910  1.00 0.00 ? 95  LYS A HB2  6  
ATOM 8243  H HB3  . LYS A 1 58 ? -3.925  -10.446 -1.279  1.00 0.00 ? 95  LYS A HB3  6  
ATOM 8244  H HG2  . LYS A 1 58 ? -3.923  -8.972  -3.216  1.00 0.00 ? 95  LYS A HG2  6  
ATOM 8245  H HG3  . LYS A 1 58 ? -2.274  -8.466  -2.833  1.00 0.00 ? 95  LYS A HG3  6  
ATOM 8246  H HD2  . LYS A 1 58 ? -1.482  -10.743 -3.131  1.00 0.00 ? 95  LYS A HD2  6  
ATOM 8247  H HD3  . LYS A 1 58 ? -3.127  -11.292 -3.452  1.00 0.00 ? 95  LYS A HD3  6  
ATOM 8248  H HE2  . LYS A 1 58 ? -3.206  -9.841  -5.432  1.00 0.00 ? 95  LYS A HE2  6  
ATOM 8249  H HE3  . LYS A 1 58 ? -1.544  -9.343  -5.118  1.00 0.00 ? 95  LYS A HE3  6  
ATOM 8250  H HZ1  . LYS A 1 58 ? -0.976  -11.785 -5.271  1.00 0.00 ? 95  LYS A HZ1  6  
ATOM 8251  H HZ2  . LYS A 1 58 ? -2.527  -12.019 -5.913  1.00 0.00 ? 95  LYS A HZ2  6  
ATOM 8252  H HZ3  . LYS A 1 58 ? -1.415  -11.030 -6.726  1.00 0.00 ? 95  LYS A HZ3  6  
ATOM 8253  N N    . LYS A 1 59 ? -3.049  -9.272  1.730   1.00 0.00 ? 96  LYS A N    6  
ATOM 8254  C CA   . LYS A 1 59 ? -3.240  -9.870  3.042   1.00 0.00 ? 96  LYS A CA   6  
ATOM 8255  C C    . LYS A 1 59 ? -4.004  -8.930  3.967   1.00 0.00 ? 96  LYS A C    6  
ATOM 8256  O O    . LYS A 1 59 ? -4.946  -9.336  4.649   1.00 0.00 ? 96  LYS A O    6  
ATOM 8257  C CB   . LYS A 1 59 ? -1.896  -10.227 3.668   1.00 0.00 ? 96  LYS A CB   6  
ATOM 8258  C CG   . LYS A 1 59 ? -2.023  -11.156 4.861   1.00 0.00 ? 96  LYS A CG   6  
ATOM 8259  C CD   . LYS A 1 59 ? -2.103  -12.612 4.430   1.00 0.00 ? 96  LYS A CD   6  
ATOM 8260  C CE   . LYS A 1 59 ? -2.273  -13.537 5.623   1.00 0.00 ? 96  LYS A CE   6  
ATOM 8261  N NZ   . LYS A 1 59 ? -1.199  -13.348 6.632   1.00 0.00 ? 96  LYS A NZ   6  
ATOM 8262  H H    . LYS A 1 59 ? -2.132  -9.115  1.405   1.00 0.00 ? 96  LYS A H    6  
ATOM 8263  H HA   . LYS A 1 59 ? -3.818  -10.773 2.910   1.00 0.00 ? 96  LYS A HA   6  
ATOM 8264  H HB2  . LYS A 1 59 ? -1.281  -10.710 2.924   1.00 0.00 ? 96  LYS A HB2  6  
ATOM 8265  H HB3  . LYS A 1 59 ? -1.409  -9.321  3.994   1.00 0.00 ? 96  LYS A HB3  6  
ATOM 8266  H HG2  . LYS A 1 59 ? -1.165  -11.026 5.505   1.00 0.00 ? 96  LYS A HG2  6  
ATOM 8267  H HG3  . LYS A 1 59 ? -2.927  -10.902 5.401   1.00 0.00 ? 96  LYS A HG3  6  
ATOM 8268  H HD2  . LYS A 1 59 ? -2.946  -12.735 3.767   1.00 0.00 ? 96  LYS A HD2  6  
ATOM 8269  H HD3  . LYS A 1 59 ? -1.192  -12.874 3.911   1.00 0.00 ? 96  LYS A HD3  6  
ATOM 8270  H HE2  . LYS A 1 59 ? -3.228  -13.335 6.085   1.00 0.00 ? 96  LYS A HE2  6  
ATOM 8271  H HE3  . LYS A 1 59 ? -2.253  -14.560 5.275   1.00 0.00 ? 96  LYS A HE3  6  
ATOM 8272  H HZ1  . LYS A 1 59 ? -0.272  -13.266 6.162   1.00 0.00 ? 96  LYS A HZ1  6  
ATOM 8273  H HZ2  . LYS A 1 59 ? -1.373  -12.476 7.180   1.00 0.00 ? 96  LYS A HZ2  6  
ATOM 8274  H HZ3  . LYS A 1 59 ? -1.174  -14.157 7.289   1.00 0.00 ? 96  LYS A HZ3  6  
ATOM 8275  N N    . GLY A 1 60 ? -3.600  -7.671  3.982   1.00 0.00 ? 97  GLY A N    6  
ATOM 8276  C CA   . GLY A 1 60 ? -4.267  -6.693  4.815   1.00 0.00 ? 97  GLY A CA   6  
ATOM 8277  C C    . GLY A 1 60 ? -5.650  -6.356  4.300   1.00 0.00 ? 97  GLY A C    6  
ATOM 8278  O O    . GLY A 1 60 ? -6.559  -6.065  5.080   1.00 0.00 ? 97  GLY A O    6  
ATOM 8279  H H    . GLY A 1 60 ? -2.847  -7.397  3.411   1.00 0.00 ? 97  GLY A H    6  
ATOM 8280  H HA2  . GLY A 1 60 ? -4.352  -7.088  5.817   1.00 0.00 ? 97  GLY A HA2  6  
ATOM 8281  H HA3  . GLY A 1 60 ? -3.673  -5.793  4.843   1.00 0.00 ? 97  GLY A HA3  6  
ATOM 8282  N N    . VAL A 1 61 ? -5.796  -6.367  2.980   1.00 0.00 ? 98  VAL A N    6  
ATOM 8283  C CA   . VAL A 1 61 ? -7.045  -6.044  2.324   1.00 0.00 ? 98  VAL A CA   6  
ATOM 8284  C C    . VAL A 1 61 ? -8.126  -7.050  2.683   1.00 0.00 ? 98  VAL A C    6  
ATOM 8285  O O    . VAL A 1 61 ? -9.315  -6.732  2.723   1.00 0.00 ? 98  VAL A O    6  
ATOM 8286  C CB   . VAL A 1 61 ? -6.823  -6.002  0.794   1.00 0.00 ? 98  VAL A CB   6  
ATOM 8287  C CG1  . VAL A 1 61 ? -7.445  -7.187  0.075   1.00 0.00 ? 98  VAL A CG1  6  
ATOM 8288  C CG2  . VAL A 1 61 ? -7.332  -4.711  0.234   1.00 0.00 ? 98  VAL A CG2  6  
ATOM 8289  H H    . VAL A 1 61 ? -5.021  -6.572  2.414   1.00 0.00 ? 98  VAL A H    6  
ATOM 8290  H HA   . VAL A 1 61 ? -7.353  -5.061  2.650   1.00 0.00 ? 98  VAL A HA   6  
ATOM 8291  H HB   . VAL A 1 61 ? -5.758  -6.038  0.617   1.00 0.00 ? 98  VAL A HB   6  
ATOM 8292  H HG11 . VAL A 1 61 ? -7.337  -8.071  0.688   1.00 0.00 ? 98  VAL A HG11 6  
ATOM 8293  H HG12 . VAL A 1 61 ? -8.493  -6.995  -0.099  1.00 0.00 ? 98  VAL A HG12 6  
ATOM 8294  H HG13 . VAL A 1 61 ? -6.942  -7.338  -0.870  1.00 0.00 ? 98  VAL A HG13 6  
ATOM 8295  H HG21 . VAL A 1 61 ? -7.937  -4.220  0.977   1.00 0.00 ? 98  VAL A HG21 6  
ATOM 8296  H HG22 . VAL A 1 61 ? -6.490  -4.086  -0.026  1.00 0.00 ? 98  VAL A HG22 6  
ATOM 8297  H HG23 . VAL A 1 61 ? -7.925  -4.915  -0.643  1.00 0.00 ? 98  VAL A HG23 6  
ATOM 8298  N N    . GLU A 1 62 ? -7.705  -8.286  2.849   1.00 0.00 ? 99  GLU A N    6  
ATOM 8299  C CA   . GLU A 1 62 ? -8.619  -9.371  3.099   1.00 0.00 ? 99  GLU A CA   6  
ATOM 8300  C C    . GLU A 1 62 ? -8.910  -9.491  4.592   1.00 0.00 ? 99  GLU A C    6  
ATOM 8301  O O    . GLU A 1 62 ? -10.026 -9.830  4.996   1.00 0.00 ? 99  GLU A O    6  
ATOM 8302  C CB   . GLU A 1 62 ? -8.016  -10.655 2.538   1.00 0.00 ? 99  GLU A CB   6  
ATOM 8303  C CG   . GLU A 1 62 ? -6.871  -11.211 3.366   1.00 0.00 ? 99  GLU A CG   6  
ATOM 8304  C CD   . GLU A 1 62 ? -6.211  -12.427 2.743   1.00 0.00 ? 99  GLU A CD   6  
ATOM 8305  O OE1  . GLU A 1 62 ? -6.704  -12.920 1.705   1.00 0.00 ? 99  GLU A OE1  6  
ATOM 8306  O OE2  . GLU A 1 62 ? -5.200  -12.905 3.299   1.00 0.00 ? 99  GLU A OE2  6  
ATOM 8307  H H    . GLU A 1 62 ? -6.752  -8.485  2.720   1.00 0.00 ? 99  GLU A H    6  
ATOM 8308  H HA   . GLU A 1 62 ? -9.541  -9.158  2.578   1.00 0.00 ? 99  GLU A HA   6  
ATOM 8309  H HB2  . GLU A 1 62 ? -8.784  -11.392 2.467   1.00 0.00 ? 99  GLU A HB2  6  
ATOM 8310  H HB3  . GLU A 1 62 ? -7.636  -10.453 1.551   1.00 0.00 ? 99  GLU A HB3  6  
ATOM 8311  H HG2  . GLU A 1 62 ? -6.123  -10.432 3.487   1.00 0.00 ? 99  GLU A HG2  6  
ATOM 8312  H HG3  . GLU A 1 62 ? -7.254  -11.487 4.337   1.00 0.00 ? 99  GLU A HG3  6  
ATOM 8313  N N    . ALA A 1 63 ? -7.881  -9.238  5.396   1.00 0.00 ? 100 ALA A N    6  
ATOM 8314  C CA   . ALA A 1 63 ? -7.972  -9.345  6.845   1.00 0.00 ? 100 ALA A CA   6  
ATOM 8315  C C    . ALA A 1 63 ? -8.815  -8.222  7.428   1.00 0.00 ? 100 ALA A C    6  
ATOM 8316  O O    . ALA A 1 63 ? -9.580  -8.430  8.369   1.00 0.00 ? 100 ALA A O    6  
ATOM 8317  C CB   . ALA A 1 63 ? -6.579  -9.327  7.450   1.00 0.00 ? 100 ALA A CB   6  
ATOM 8318  H H    . ALA A 1 63 ? -7.017  -9.005  4.995   1.00 0.00 ? 100 ALA A H    6  
ATOM 8319  H HA   . ALA A 1 63 ? -8.432  -10.293 7.082   1.00 0.00 ? 100 ALA A HA   6  
ATOM 8320  H HB1  . ALA A 1 63 ? -6.490  -8.489  8.125   1.00 0.00 ? 100 ALA A HB1  6  
ATOM 8321  H HB2  . ALA A 1 63 ? -6.408  -10.247 7.990   1.00 0.00 ? 100 ALA A HB2  6  
ATOM 8322  H HB3  . ALA A 1 63 ? -5.847  -9.232  6.658   1.00 0.00 ? 100 ALA A HB3  6  
ATOM 8323  N N    . GLY A 1 64 ? -8.645  -7.027  6.888   1.00 0.00 ? 101 GLY A N    6  
ATOM 8324  C CA   . GLY A 1 64 ? -9.387  -5.888  7.378   1.00 0.00 ? 101 GLY A CA   6  
ATOM 8325  C C    . GLY A 1 64 ? -8.488  -4.793  7.903   1.00 0.00 ? 101 GLY A C    6  
ATOM 8326  O O    . GLY A 1 64 ? -8.825  -4.113  8.865   1.00 0.00 ? 101 GLY A O    6  
ATOM 8327  H H    . GLY A 1 64 ? -8.001  -6.916  6.157   1.00 0.00 ? 101 GLY A H    6  
ATOM 8328  H HA2  . GLY A 1 64 ? -9.989  -5.492  6.575   1.00 0.00 ? 101 GLY A HA2  6  
ATOM 8329  H HA3  . GLY A 1 64 ? -10.040 -6.214  8.174   1.00 0.00 ? 101 GLY A HA3  6  
ATOM 8330  N N    . ASP A 1 65 ? -7.367  -4.590  7.234   1.00 0.00 ? 102 ASP A N    6  
ATOM 8331  C CA   . ASP A 1 65 ? -6.458  -3.512  7.590   1.00 0.00 ? 102 ASP A CA   6  
ATOM 8332  C C    . ASP A 1 65 ? -6.420  -2.505  6.453   1.00 0.00 ? 102 ASP A C    6  
ATOM 8333  O O    . ASP A 1 65 ? -6.447  -1.294  6.670   1.00 0.00 ? 102 ASP A O    6  
ATOM 8334  C CB   . ASP A 1 65 ? -5.054  -4.046  7.886   1.00 0.00 ? 102 ASP A CB   6  
ATOM 8335  C CG   . ASP A 1 65 ? -4.308  -3.183  8.889   1.00 0.00 ? 102 ASP A CG   6  
ATOM 8336  O OD1  . ASP A 1 65 ? -4.841  -2.124  9.283   1.00 0.00 ? 102 ASP A OD1  6  
ATOM 8337  O OD2  . ASP A 1 65 ? -3.165  -3.531  9.247   1.00 0.00 ? 102 ASP A OD2  6  
ATOM 8338  H H    . ASP A 1 65 ? -7.173  -5.141  6.444   1.00 0.00 ? 102 ASP A H    6  
ATOM 8339  H HA   . ASP A 1 65 ? -6.848  -3.025  8.472   1.00 0.00 ? 102 ASP A HA   6  
ATOM 8340  H HB2  . ASP A 1 65 ? -5.131  -5.047  8.286   1.00 0.00 ? 102 ASP A HB2  6  
ATOM 8341  H HB3  . ASP A 1 65 ? -4.484  -4.072  6.969   1.00 0.00 ? 102 ASP A HB3  6  
ATOM 8342  N N    . PHE A 1 66 ? -6.544  -3.026  5.238   1.00 0.00 ? 103 PHE A N    6  
ATOM 8343  C CA   . PHE A 1 66 ? -6.702  -2.189  4.058   1.00 0.00 ? 103 PHE A CA   6  
ATOM 8344  C C    . PHE A 1 66 ? -7.930  -2.661  3.295   1.00 0.00 ? 103 PHE A C    6  
ATOM 8345  O O    . PHE A 1 66 ? -8.409  -3.769  3.526   1.00 0.00 ? 103 PHE A O    6  
ATOM 8346  C CB   . PHE A 1 66 ? -5.469  -2.262  3.147   1.00 0.00 ? 103 PHE A CB   6  
ATOM 8347  C CG   . PHE A 1 66 ? -4.157  -2.294  3.877   1.00 0.00 ? 103 PHE A CG   6  
ATOM 8348  C CD1  . PHE A 1 66 ? -3.486  -1.125  4.189   1.00 0.00 ? 103 PHE A CD1  6  
ATOM 8349  C CD2  . PHE A 1 66 ? -3.587  -3.501  4.233   1.00 0.00 ? 103 PHE A CD2  6  
ATOM 8350  C CE1  . PHE A 1 66 ? -2.273  -1.163  4.852   1.00 0.00 ? 103 PHE A CE1  6  
ATOM 8351  C CE2  . PHE A 1 66 ? -2.377  -3.549  4.895   1.00 0.00 ? 103 PHE A CE2  6  
ATOM 8352  C CZ   . PHE A 1 66 ? -1.719  -2.377  5.206   1.00 0.00 ? 103 PHE A CZ   6  
ATOM 8353  H H    . PHE A 1 66 ? -6.657  -3.999  5.143   1.00 0.00 ? 103 PHE A H    6  
ATOM 8354  H HA   . PHE A 1 66 ? -6.853  -1.171  4.383   1.00 0.00 ? 103 PHE A HA   6  
ATOM 8355  H HB2  . PHE A 1 66 ? -5.533  -3.154  2.543   1.00 0.00 ? 103 PHE A HB2  6  
ATOM 8356  H HB3  . PHE A 1 66 ? -5.466  -1.400  2.499   1.00 0.00 ? 103 PHE A HB3  6  
ATOM 8357  H HD1  . PHE A 1 66 ? -3.921  -0.174  3.916   1.00 0.00 ? 103 PHE A HD1  6  
ATOM 8358  H HD2  . PHE A 1 66 ? -4.101  -4.420  3.988   1.00 0.00 ? 103 PHE A HD2  6  
ATOM 8359  H HE1  . PHE A 1 66 ? -1.760  -0.244  5.091   1.00 0.00 ? 103 PHE A HE1  6  
ATOM 8360  H HE2  . PHE A 1 66 ? -1.950  -4.503  5.168   1.00 0.00 ? 103 PHE A HE2  6  
ATOM 8361  H HZ   . PHE A 1 66 ? -0.772  -2.410  5.723   1.00 0.00 ? 103 PHE A HZ   6  
ATOM 8362  N N    . GLU A 1 67 ? -8.464  -1.826  2.421   1.00 0.00 ? 104 GLU A N    6  
ATOM 8363  C CA   . GLU A 1 67 ? -9.646  -2.198  1.656   1.00 0.00 ? 104 GLU A CA   6  
ATOM 8364  C C    . GLU A 1 67 ? -9.590  -1.612  0.250   1.00 0.00 ? 104 GLU A C    6  
ATOM 8365  O O    . GLU A 1 67 ? -9.383  -0.413  0.073   1.00 0.00 ? 104 GLU A O    6  
ATOM 8366  C CB   . GLU A 1 67 ? -10.920 -1.734  2.377   1.00 0.00 ? 104 GLU A CB   6  
ATOM 8367  C CG   . GLU A 1 67 ? -10.915 -0.254  2.735   1.00 0.00 ? 104 GLU A CG   6  
ATOM 8368  C CD   . GLU A 1 67 ? -12.202 0.212   3.381   1.00 0.00 ? 104 GLU A CD   6  
ATOM 8369  O OE1  . GLU A 1 67 ? -12.558 -0.301  4.458   1.00 0.00 ? 104 GLU A OE1  6  
ATOM 8370  O OE2  . GLU A 1 67 ? -12.863 1.107   2.818   1.00 0.00 ? 104 GLU A OE2  6  
ATOM 8371  H H    . GLU A 1 67 ? -8.076  -0.928  2.300   1.00 0.00 ? 104 GLU A H    6  
ATOM 8372  H HA   . GLU A 1 67 ? -9.662  -3.276  1.581   1.00 0.00 ? 104 GLU A HA   6  
ATOM 8373  H HB2  . GLU A 1 67 ? -11.770 -1.925  1.737   1.00 0.00 ? 104 GLU A HB2  6  
ATOM 8374  H HB3  . GLU A 1 67 ? -11.032 -2.303  3.287   1.00 0.00 ? 104 GLU A HB3  6  
ATOM 8375  H HG2  . GLU A 1 67 ? -10.106 -0.071  3.425   1.00 0.00 ? 104 GLU A HG2  6  
ATOM 8376  H HG3  . GLU A 1 67 ? -10.752 0.318   1.834   1.00 0.00 ? 104 GLU A HG3  6  
ATOM 8377  N N    . GLN A 1 68 ? -9.811  -2.455  -0.750  1.00 0.00 ? 105 GLN A N    6  
ATOM 8378  C CA   . GLN A 1 68 ? -9.874  -1.998  -2.129  1.00 0.00 ? 105 GLN A CA   6  
ATOM 8379  C C    . GLN A 1 68 ? -11.334 -1.847  -2.543  1.00 0.00 ? 105 GLN A C    6  
ATOM 8380  O O    . GLN A 1 68 ? -12.041 -2.841  -2.707  1.00 0.00 ? 105 GLN A O    6  
ATOM 8381  C CB   . GLN A 1 68 ? -9.143  -2.976  -3.059  1.00 0.00 ? 105 GLN A CB   6  
ATOM 8382  C CG   . GLN A 1 68 ? -7.627  -2.932  -2.914  1.00 0.00 ? 105 GLN A CG   6  
ATOM 8383  C CD   . GLN A 1 68 ? -6.908  -3.940  -3.793  1.00 0.00 ? 105 GLN A CD   6  
ATOM 8384  O OE1  . GLN A 1 68 ? -7.022  -3.914  -5.015  1.00 0.00 ? 105 GLN A OE1  6  
ATOM 8385  N NE2  . GLN A 1 68 ? -6.139  -4.824  -3.176  1.00 0.00 ? 105 GLN A NE2  6  
ATOM 8386  H H    . GLN A 1 68 ? -10.012 -3.395  -0.549  1.00 0.00 ? 105 GLN A H    6  
ATOM 8387  H HA   . GLN A 1 68 ? -9.395  -1.031  -2.180  1.00 0.00 ? 105 GLN A HA   6  
ATOM 8388  H HB2  . GLN A 1 68 ? -9.475  -3.978  -2.839  1.00 0.00 ? 105 GLN A HB2  6  
ATOM 8389  H HB3  . GLN A 1 68 ? -9.393  -2.738  -4.082  1.00 0.00 ? 105 GLN A HB3  6  
ATOM 8390  H HG2  . GLN A 1 68 ? -7.282  -1.944  -3.177  1.00 0.00 ? 105 GLN A HG2  6  
ATOM 8391  H HG3  . GLN A 1 68 ? -7.373  -3.133  -1.882  1.00 0.00 ? 105 GLN A HG3  6  
ATOM 8392  H HE21 . GLN A 1 68 ? -6.074  -4.778  -2.202  1.00 0.00 ? 105 GLN A HE21 6  
ATOM 8393  H HE22 . GLN A 1 68 ? -5.664  -5.485  -3.721  1.00 0.00 ? 105 GLN A HE22 6  
ATOM 8394  N N    . PRO A 1 69 ? -11.832 -0.601  -2.599  1.00 0.00 ? 106 PRO A N    6  
ATOM 8395  C CA   . PRO A 1 69 ? -13.247 -0.314  -2.865  1.00 0.00 ? 106 PRO A CA   6  
ATOM 8396  C C    . PRO A 1 69 ? -13.719 -0.823  -4.222  1.00 0.00 ? 106 PRO A C    6  
ATOM 8397  O O    . PRO A 1 69 ? -14.888 -1.177  -4.385  1.00 0.00 ? 106 PRO A O    6  
ATOM 8398  C CB   . PRO A 1 69 ? -13.323 1.212   -2.816  1.00 0.00 ? 106 PRO A CB   6  
ATOM 8399  C CG   . PRO A 1 69 ? -12.159 1.625   -1.988  1.00 0.00 ? 106 PRO A CG   6  
ATOM 8400  C CD   . PRO A 1 69 ? -11.079 0.627   -2.287  1.00 0.00 ? 106 PRO A CD   6  
ATOM 8401  H HA   . PRO A 1 69 ? -13.879 -0.728  -2.093  1.00 0.00 ? 106 PRO A HA   6  
ATOM 8402  H HB2  . PRO A 1 69 ? -13.258 1.610   -3.819  1.00 0.00 ? 106 PRO A HB2  6  
ATOM 8403  H HB3  . PRO A 1 69 ? -14.256 1.516   -2.364  1.00 0.00 ? 106 PRO A HB3  6  
ATOM 8404  H HG2  . PRO A 1 69 ? -11.843 2.620   -2.268  1.00 0.00 ? 106 PRO A HG2  6  
ATOM 8405  H HG3  . PRO A 1 69 ? -12.423 1.592   -0.942  1.00 0.00 ? 106 PRO A HG3  6  
ATOM 8406  H HD2  . PRO A 1 69 ? -10.493 0.946   -3.136  1.00 0.00 ? 106 PRO A HD2  6  
ATOM 8407  H HD3  . PRO A 1 69 ? -10.447 0.483   -1.422  1.00 0.00 ? 106 PRO A HD3  6  
ATOM 8408  N N    . LYS A 1 70 ? -12.824 -0.824  -5.201  1.00 0.00 ? 107 LYS A N    6  
ATOM 8409  C CA   . LYS A 1 70 ? -13.182 -1.245  -6.547  1.00 0.00 ? 107 LYS A CA   6  
ATOM 8410  C C    . LYS A 1 70 ? -13.117 -2.759  -6.679  1.00 0.00 ? 107 LYS A C    6  
ATOM 8411  O O    . LYS A 1 70 ? -14.034 -3.384  -7.203  1.00 0.00 ? 107 LYS A O    6  
ATOM 8412  C CB   . LYS A 1 70 ? -12.265 -0.589  -7.581  1.00 0.00 ? 107 LYS A CB   6  
ATOM 8413  C CG   . LYS A 1 70 ? -12.327 0.930   -7.571  1.00 0.00 ? 107 LYS A CG   6  
ATOM 8414  C CD   . LYS A 1 70 ? -11.541 1.534   -8.724  1.00 0.00 ? 107 LYS A CD   6  
ATOM 8415  C CE   . LYS A 1 70 ? -12.138 1.160   -10.073 1.00 0.00 ? 107 LYS A CE   6  
ATOM 8416  N NZ   . LYS A 1 70 ? -13.509 1.711   -10.258 1.00 0.00 ? 107 LYS A NZ   6  
ATOM 8417  H H    . LYS A 1 70 ? -11.910 -0.522  -5.017  1.00 0.00 ? 107 LYS A H    6  
ATOM 8418  H HA   . LYS A 1 70 ? -14.198 -0.926  -6.733  1.00 0.00 ? 107 LYS A HA   6  
ATOM 8419  H HB2  . LYS A 1 70 ? -11.245 -0.887  -7.382  1.00 0.00 ? 107 LYS A HB2  6  
ATOM 8420  H HB3  . LYS A 1 70 ? -12.545 -0.934  -8.566  1.00 0.00 ? 107 LYS A HB3  6  
ATOM 8421  H HG2  . LYS A 1 70 ? -13.360 1.237   -7.655  1.00 0.00 ? 107 LYS A HG2  6  
ATOM 8422  H HG3  . LYS A 1 70 ? -11.917 1.291   -6.640  1.00 0.00 ? 107 LYS A HG3  6  
ATOM 8423  H HD2  . LYS A 1 70 ? -11.550 2.608   -8.627  1.00 0.00 ? 107 LYS A HD2  6  
ATOM 8424  H HD3  . LYS A 1 70 ? -10.524 1.175   -8.680  1.00 0.00 ? 107 LYS A HD3  6  
ATOM 8425  H HE2  . LYS A 1 70 ? -11.499 1.546   -10.854 1.00 0.00 ? 107 LYS A HE2  6  
ATOM 8426  H HE3  . LYS A 1 70 ? -12.180 0.082   -10.147 1.00 0.00 ? 107 LYS A HE3  6  
ATOM 8427  H HZ1  . LYS A 1 70 ? -14.134 1.396   -9.486  1.00 0.00 ? 107 LYS A HZ1  6  
ATOM 8428  H HZ2  . LYS A 1 70 ? -13.480 2.756   -10.263 1.00 0.00 ? 107 LYS A HZ2  6  
ATOM 8429  H HZ3  . LYS A 1 70 ? -13.905 1.383   -11.164 1.00 0.00 ? 107 LYS A HZ3  6  
ATOM 8430  N N    . GLY A 1 71 ? -12.025 -3.341  -6.210  1.00 0.00 ? 108 GLY A N    6  
ATOM 8431  C CA   . GLY A 1 71 ? -11.842 -4.768  -6.306  1.00 0.00 ? 108 GLY A CA   6  
ATOM 8432  C C    . GLY A 1 71 ? -10.380 -5.121  -6.297  1.00 0.00 ? 108 GLY A C    6  
ATOM 8433  O O    . GLY A 1 71 ? -9.538  -4.220  -6.295  1.00 0.00 ? 108 GLY A O    6  
ATOM 8434  H H    . GLY A 1 71 ? -11.315 -2.794  -5.819  1.00 0.00 ? 108 GLY A H    6  
ATOM 8435  H HA2  . GLY A 1 71 ? -12.331 -5.247  -5.470  1.00 0.00 ? 108 GLY A HA2  6  
ATOM 8436  H HA3  . GLY A 1 71 ? -12.281 -5.123  -7.225  1.00 0.00 ? 108 GLY A HA3  6  
ATOM 8437  N N    . PRO A 1 72 ? -10.040 -6.412  -6.314  1.00 0.00 ? 109 PRO A N    6  
ATOM 8438  C CA   . PRO A 1 72 ? -8.649  -6.860  -6.324  1.00 0.00 ? 109 PRO A CA   6  
ATOM 8439  C C    . PRO A 1 72 ? -7.855  -6.272  -7.483  1.00 0.00 ? 109 PRO A C    6  
ATOM 8440  O O    . PRO A 1 72 ? -8.346  -6.200  -8.615  1.00 0.00 ? 109 PRO A O    6  
ATOM 8441  C CB   . PRO A 1 72 ? -8.755  -8.374  -6.473  1.00 0.00 ? 109 PRO A CB   6  
ATOM 8442  C CG   . PRO A 1 72 ? -10.115 -8.713  -5.976  1.00 0.00 ? 109 PRO A CG   6  
ATOM 8443  C CD   . PRO A 1 72 ? -10.984 -7.543  -6.339  1.00 0.00 ? 109 PRO A CD   6  
ATOM 8444  H HA   . PRO A 1 72 ? -8.153  -6.622  -5.394  1.00 0.00 ? 109 PRO A HA   6  
ATOM 8445  H HB2  . PRO A 1 72 ? -8.636  -8.644  -7.513  1.00 0.00 ? 109 PRO A HB2  6  
ATOM 8446  H HB3  . PRO A 1 72 ? -7.988  -8.844  -5.882  1.00 0.00 ? 109 PRO A HB3  6  
ATOM 8447  H HG2  . PRO A 1 72 ? -10.471 -9.610  -6.460  1.00 0.00 ? 109 PRO A HG2  6  
ATOM 8448  H HG3  . PRO A 1 72 ? -10.091 -8.847  -4.905  1.00 0.00 ? 109 PRO A HG3  6  
ATOM 8449  H HD2  . PRO A 1 72 ? -11.404 -7.676  -7.326  1.00 0.00 ? 109 PRO A HD2  6  
ATOM 8450  H HD3  . PRO A 1 72 ? -11.767 -7.410  -5.608  1.00 0.00 ? 109 PRO A HD3  6  
ATOM 8451  N N    . ALA A 1 73 ? -6.642  -5.826  -7.174  1.00 0.00 ? 110 ALA A N    6  
ATOM 8452  C CA   . ALA A 1 73 ? -5.745  -5.217  -8.149  1.00 0.00 ? 110 ALA A CA   6  
ATOM 8453  C C    . ALA A 1 73 ? -6.294  -3.882  -8.646  1.00 0.00 ? 110 ALA A C    6  
ATOM 8454  O O    . ALA A 1 73 ? -6.128  -3.524  -9.815  1.00 0.00 ? 110 ALA A O    6  
ATOM 8455  C CB   . ALA A 1 73 ? -5.476  -6.169  -9.308  1.00 0.00 ? 110 ALA A CB   6  
ATOM 8456  H H    . ALA A 1 73 ? -6.353  -5.879  -6.240  1.00 0.00 ? 110 ALA A H    6  
ATOM 8457  H HA   . ALA A 1 73 ? -4.803  -5.031  -7.650  1.00 0.00 ? 110 ALA A HA   6  
ATOM 8458  H HB1  . ALA A 1 73 ? -5.964  -5.801  -10.198 1.00 0.00 ? 110 ALA A HB1  6  
ATOM 8459  H HB2  . ALA A 1 73 ? -5.863  -7.149  -9.064  1.00 0.00 ? 110 ALA A HB2  6  
ATOM 8460  H HB3  . ALA A 1 73 ? -4.414  -6.235  -9.480  1.00 0.00 ? 110 ALA A HB3  6  
ATOM 8461  N N    . GLY A 1 74 ? -6.863  -3.115  -7.727  1.00 0.00 ? 111 GLY A N    6  
ATOM 8462  C CA   . GLY A 1 74 ? -7.323  -1.784  -8.052  1.00 0.00 ? 111 GLY A CA   6  
ATOM 8463  C C    . GLY A 1 74 ? -6.749  -0.762  -7.098  1.00 0.00 ? 111 GLY A C    6  
ATOM 8464  O O    . GLY A 1 74 ? -5.625  -0.921  -6.620  1.00 0.00 ? 111 GLY A O    6  
ATOM 8465  H H    . GLY A 1 74 ? -6.917  -3.433  -6.796  1.00 0.00 ? 111 GLY A H    6  
ATOM 8466  H HA2  . GLY A 1 74 ? -7.019  -1.539  -9.059  1.00 0.00 ? 111 GLY A HA2  6  
ATOM 8467  H HA3  . GLY A 1 74 ? -8.401  -1.757  -7.990  1.00 0.00 ? 111 GLY A HA3  6  
ATOM 8468  N N    . ALA A 1 75 ? -7.538  0.245   -6.762  1.00 0.00 ? 112 ALA A N    6  
ATOM 8469  C CA   . ALA A 1 75 ? -7.124  1.241   -5.782  1.00 0.00 ? 112 ALA A CA   6  
ATOM 8470  C C    . ALA A 1 75 ? -7.499  0.783   -4.379  1.00 0.00 ? 112 ALA A C    6  
ATOM 8471  O O    . ALA A 1 75 ? -8.608  0.298   -4.161  1.00 0.00 ? 112 ALA A O    6  
ATOM 8472  C CB   . ALA A 1 75 ? -7.753  2.591   -6.091  1.00 0.00 ? 112 ALA A CB   6  
ATOM 8473  H H    . ALA A 1 75 ? -8.445  0.280   -7.124  1.00 0.00 ? 112 ALA A H    6  
ATOM 8474  H HA   . ALA A 1 75 ? -6.051  1.344   -5.842  1.00 0.00 ? 112 ALA A HA   6  
ATOM 8475  H HB1  . ALA A 1 75 ? -6.975  3.310   -6.303  1.00 0.00 ? 112 ALA A HB1  6  
ATOM 8476  H HB2  . ALA A 1 75 ? -8.327  2.925   -5.239  1.00 0.00 ? 112 ALA A HB2  6  
ATOM 8477  H HB3  . ALA A 1 75 ? -8.403  2.500   -6.949  1.00 0.00 ? 112 ALA A HB3  6  
ATOM 8478  N N    . VAL A 1 76 ? -6.580  0.936   -3.439  1.00 0.00 ? 113 VAL A N    6  
ATOM 8479  C CA   . VAL A 1 76 ? -6.835  0.552   -2.057  1.00 0.00 ? 113 VAL A CA   6  
ATOM 8480  C C    . VAL A 1 76 ? -6.849  1.775   -1.149  1.00 0.00 ? 113 VAL A C    6  
ATOM 8481  O O    . VAL A 1 76 ? -6.059  2.700   -1.318  1.00 0.00 ? 113 VAL A O    6  
ATOM 8482  C CB   . VAL A 1 76 ? -5.811  -0.494  -1.540  1.00 0.00 ? 113 VAL A CB   6  
ATOM 8483  C CG1  . VAL A 1 76 ? -4.391  -0.073  -1.848  1.00 0.00 ? 113 VAL A CG1  6  
ATOM 8484  C CG2  . VAL A 1 76 ? -5.978  -0.745  -0.043  1.00 0.00 ? 113 VAL A CG2  6  
ATOM 8485  H H    . VAL A 1 76 ? -5.719  1.351   -3.671  1.00 0.00 ? 113 VAL A H    6  
ATOM 8486  H HA   . VAL A 1 76 ? -7.814  0.099   -2.027  1.00 0.00 ? 113 VAL A HA   6  
ATOM 8487  H HB   . VAL A 1 76 ? -5.994  -1.424  -2.054  1.00 0.00 ? 113 VAL A HB   6  
ATOM 8488  H HG11 . VAL A 1 76 ? -4.284  0.078   -2.912  1.00 0.00 ? 113 VAL A HG11 6  
ATOM 8489  H HG12 . VAL A 1 76 ? -4.169  0.846   -1.328  1.00 0.00 ? 113 VAL A HG12 6  
ATOM 8490  H HG13 . VAL A 1 76 ? -3.710  -0.847  -1.522  1.00 0.00 ? 113 VAL A HG13 6  
ATOM 8491  H HG21 . VAL A 1 76 ? -6.038  0.199   0.482   1.00 0.00 ? 113 VAL A HG21 6  
ATOM 8492  H HG22 . VAL A 1 76 ? -6.883  -1.309  0.130   1.00 0.00 ? 113 VAL A HG22 6  
ATOM 8493  H HG23 . VAL A 1 76 ? -5.131  -1.306  0.327   1.00 0.00 ? 113 VAL A HG23 6  
ATOM 8494  N N    . LYS A 1 77 ? -7.759  1.760   -0.193  1.00 0.00 ? 114 LYS A N    6  
ATOM 8495  C CA   . LYS A 1 77 ? -7.873  2.805   0.803   1.00 0.00 ? 114 LYS A CA   6  
ATOM 8496  C C    . LYS A 1 77 ? -7.740  2.174   2.174   1.00 0.00 ? 114 LYS A C    6  
ATOM 8497  O O    . LYS A 1 77 ? -8.057  0.996   2.335   1.00 0.00 ? 114 LYS A O    6  
ATOM 8498  C CB   . LYS A 1 77 ? -9.237  3.488   0.707   1.00 0.00 ? 114 LYS A CB   6  
ATOM 8499  C CG   . LYS A 1 77 ? -9.456  4.581   1.744   1.00 0.00 ? 114 LYS A CG   6  
ATOM 8500  C CD   . LYS A 1 77 ? -10.876 5.119   1.710   1.00 0.00 ? 114 LYS A CD   6  
ATOM 8501  C CE   . LYS A 1 77 ? -11.902 4.047   2.048   1.00 0.00 ? 114 LYS A CE   6  
ATOM 8502  N NZ   . LYS A 1 77 ? -11.811 3.597   3.463   1.00 0.00 ? 114 LYS A NZ   6  
ATOM 8503  H H    . LYS A 1 77 ? -8.348  0.974   -0.116  1.00 0.00 ? 114 LYS A H    6  
ATOM 8504  H HA   . LYS A 1 77 ? -7.083  3.526   0.649   1.00 0.00 ? 114 LYS A HA   6  
ATOM 8505  H HB2  . LYS A 1 77 ? -9.344  3.923   -0.275  1.00 0.00 ? 114 LYS A HB2  6  
ATOM 8506  H HB3  . LYS A 1 77 ? -9.997  2.738   0.846   1.00 0.00 ? 114 LYS A HB3  6  
ATOM 8507  H HG2  . LYS A 1 77 ? -9.262  4.175   2.725   1.00 0.00 ? 114 LYS A HG2  6  
ATOM 8508  H HG3  . LYS A 1 77 ? -8.769  5.393   1.547   1.00 0.00 ? 114 LYS A HG3  6  
ATOM 8509  H HD2  . LYS A 1 77 ? -10.963 5.920   2.428   1.00 0.00 ? 114 LYS A HD2  6  
ATOM 8510  H HD3  . LYS A 1 77 ? -11.080 5.499   0.719   1.00 0.00 ? 114 LYS A HD3  6  
ATOM 8511  H HE2  . LYS A 1 77 ? -12.889 4.447   1.872   1.00 0.00 ? 114 LYS A HE2  6  
ATOM 8512  H HE3  . LYS A 1 77 ? -11.741 3.199   1.399   1.00 0.00 ? 114 LYS A HE3  6  
ATOM 8513  H HZ1  . LYS A 1 77 ? -10.818 3.454   3.741   1.00 0.00 ? 114 LYS A HZ1  6  
ATOM 8514  H HZ2  . LYS A 1 77 ? -12.239 4.309   4.093   1.00 0.00 ? 114 LYS A HZ2  6  
ATOM 8515  H HZ3  . LYS A 1 77 ? -12.326 2.694   3.583   1.00 0.00 ? 114 LYS A HZ3  6  
ATOM 8516  N N    . LEU A 1 78 ? -7.272  2.928   3.153   1.00 0.00 ? 115 LEU A N    6  
ATOM 8517  C CA   . LEU A 1 78 ? -7.203  2.405   4.505   1.00 0.00 ? 115 LEU A CA   6  
ATOM 8518  C C    . LEU A 1 78 ? -8.571  1.965   4.976   1.00 0.00 ? 115 LEU A C    6  
ATOM 8519  O O    . LEU A 1 78 ? -9.566  2.679   4.818   1.00 0.00 ? 115 LEU A O    6  
ATOM 8520  C CB   . LEU A 1 78 ? -6.630  3.429   5.478   1.00 0.00 ? 115 LEU A CB   6  
ATOM 8521  C CG   . LEU A 1 78 ? -5.141  3.684   5.325   1.00 0.00 ? 115 LEU A CG   6  
ATOM 8522  C CD1  . LEU A 1 78 ? -4.616  4.459   6.515   1.00 0.00 ? 115 LEU A CD1  6  
ATOM 8523  C CD2  . LEU A 1 78 ? -4.403  2.368   5.161   1.00 0.00 ? 115 LEU A CD2  6  
ATOM 8524  H H    . LEU A 1 78 ? -6.971  3.857   2.962   1.00 0.00 ? 115 LEU A H    6  
ATOM 8525  H HA   . LEU A 1 78 ? -6.566  1.533   4.488   1.00 0.00 ? 115 LEU A HA   6  
ATOM 8526  H HB2  . LEU A 1 78 ? -7.153  4.363   5.332   1.00 0.00 ? 115 LEU A HB2  6  
ATOM 8527  H HB3  . LEU A 1 78 ? -6.814  3.085   6.483   1.00 0.00 ? 115 LEU A HB3  6  
ATOM 8528  H HG   . LEU A 1 78 ? -4.970  4.278   4.440   1.00 0.00 ? 115 LEU A HG   6  
ATOM 8529  H HD11 . LEU A 1 78 ? -5.188  5.368   6.632   1.00 0.00 ? 115 LEU A HD11 6  
ATOM 8530  H HD12 . LEU A 1 78 ? -4.710  3.858   7.409   1.00 0.00 ? 115 LEU A HD12 6  
ATOM 8531  H HD13 . LEU A 1 78 ? -3.578  4.704   6.354   1.00 0.00 ? 115 LEU A HD13 6  
ATOM 8532  H HD21 . LEU A 1 78 ? -4.835  1.822   4.333   1.00 0.00 ? 115 LEU A HD21 6  
ATOM 8533  H HD22 . LEU A 1 78 ? -3.362  2.563   4.955   1.00 0.00 ? 115 LEU A HD22 6  
ATOM 8534  H HD23 . LEU A 1 78 ? -4.492  1.786   6.065   1.00 0.00 ? 115 LEU A HD23 6  
ATOM 8535  N N    . ALA A 1 79 ? -8.613  0.757   5.497   1.00 0.00 ? 116 ALA A N    6  
ATOM 8536  C CA   . ALA A 1 79 ? -9.848  0.181   5.971   1.00 0.00 ? 116 ALA A CA   6  
ATOM 8537  C C    . ALA A 1 79 ? -10.280 0.824   7.274   1.00 0.00 ? 116 ALA A C    6  
ATOM 8538  O O    . ALA A 1 79 ? -9.488  1.481   7.958   1.00 0.00 ? 116 ALA A O    6  
ATOM 8539  C CB   . ALA A 1 79 ? -9.714  -1.324  6.129   1.00 0.00 ? 116 ALA A CB   6  
ATOM 8540  H H    . ALA A 1 79 ? -7.784  0.234   5.555   1.00 0.00 ? 116 ALA A H    6  
ATOM 8541  H HA   . ALA A 1 79 ? -10.605 0.371   5.224   1.00 0.00 ? 116 ALA A HA   6  
ATOM 8542  H HB1  . ALA A 1 79 ? -10.075 -1.810  5.232   1.00 0.00 ? 116 ALA A HB1  6  
ATOM 8543  H HB2  . ALA A 1 79 ? -10.295 -1.652  6.977   1.00 0.00 ? 116 ALA A HB2  6  
ATOM 8544  H HB3  . ALA A 1 79 ? -8.676  -1.579  6.282   1.00 0.00 ? 116 ALA A HB3  6  
ATOM 8545  N N    . LYS A 1 80 ? -11.555 0.681   7.570   1.00 0.00 ? 117 LYS A N    6  
ATOM 8546  C CA   . LYS A 1 80 ? -12.151 1.242   8.777   1.00 0.00 ? 117 LYS A CA   6  
ATOM 8547  C C    . LYS A 1 80 ? -11.607 0.539   10.017  1.00 0.00 ? 117 LYS A C    6  
ATOM 8548  O O    . LYS A 1 80 ? -12.211 -0.418  10.513  1.00 0.00 ? 117 LYS A O    6  
ATOM 8549  C CB   . LYS A 1 80 ? -13.673 1.095   8.732   1.00 0.00 ? 117 LYS A CB   6  
ATOM 8550  C CG   . LYS A 1 80 ? -14.406 2.014   9.696   1.00 0.00 ? 117 LYS A CG   6  
ATOM 8551  C CD   . LYS A 1 80 ? -15.856 1.601   9.858   1.00 0.00 ? 117 LYS A CD   6  
ATOM 8552  C CE   . LYS A 1 80 ? -16.722 2.765   10.303  1.00 0.00 ? 117 LYS A CE   6  
ATOM 8553  N NZ   . LYS A 1 80 ? -16.903 3.761   9.214   1.00 0.00 ? 117 LYS A NZ   6  
ATOM 8554  H H    . LYS A 1 80 ? -12.119 0.185   6.945   1.00 0.00 ? 117 LYS A H    6  
ATOM 8555  H HA   . LYS A 1 80 ? -11.897 2.289   8.823   1.00 0.00 ? 117 LYS A HA   6  
ATOM 8556  H HB2  . LYS A 1 80 ? -14.016 1.312   7.731   1.00 0.00 ? 117 LYS A HB2  6  
ATOM 8557  H HB3  . LYS A 1 80 ? -13.932 0.075   8.977   1.00 0.00 ? 117 LYS A HB3  6  
ATOM 8558  H HG2  . LYS A 1 80 ? -13.921 1.970   10.660  1.00 0.00 ? 117 LYS A HG2  6  
ATOM 8559  H HG3  . LYS A 1 80 ? -14.368 3.025   9.317   1.00 0.00 ? 117 LYS A HG3  6  
ATOM 8560  H HD2  . LYS A 1 80 ? -16.223 1.234   8.911   1.00 0.00 ? 117 LYS A HD2  6  
ATOM 8561  H HD3  . LYS A 1 80 ? -15.917 0.816   10.597  1.00 0.00 ? 117 LYS A HD3  6  
ATOM 8562  H HE2  . LYS A 1 80 ? -17.689 2.387   10.599  1.00 0.00 ? 117 LYS A HE2  6  
ATOM 8563  H HE3  . LYS A 1 80 ? -16.250 3.246   11.146  1.00 0.00 ? 117 LYS A HE3  6  
ATOM 8564  H HZ1  . LYS A 1 80 ? -17.122 3.274   8.315   1.00 0.00 ? 117 LYS A HZ1  6  
ATOM 8565  H HZ2  . LYS A 1 80 ? -17.688 4.409   9.445   1.00 0.00 ? 117 LYS A HZ2  6  
ATOM 8566  H HZ3  . LYS A 1 80 ? -16.031 4.323   9.090   1.00 0.00 ? 117 LYS A HZ3  6  
ATOM 8567  N N    . LYS A 1 81 ? -10.416 0.947   10.441  1.00 0.00 ? 118 LYS A N    6  
ATOM 8568  C CA   . LYS A 1 81 ? -9.727  0.321   11.560  1.00 0.00 ? 118 LYS A CA   6  
ATOM 8569  C C    . LYS A 1 81 ? -9.431  -1.145  11.252  1.00 0.00 ? 118 LYS A C    6  
ATOM 8570  O O    . LYS A 1 81 ? -8.646  -1.451  10.356  1.00 0.00 ? 118 LYS A O    6  
ATOM 8571  C CB   . LYS A 1 81 ? -10.530 0.451   12.870  1.00 0.00 ? 118 LYS A CB   6  
ATOM 8572  C CG   . LYS A 1 81 ? -10.532 1.855   13.468  1.00 0.00 ? 118 LYS A CG   6  
ATOM 8573  C CD   . LYS A 1 81 ? -11.369 2.824   12.651  1.00 0.00 ? 118 LYS A CD   6  
ATOM 8574  C CE   . LYS A 1 81 ? -11.290 4.236   13.204  1.00 0.00 ? 118 LYS A CE   6  
ATOM 8575  N NZ   . LYS A 1 81 ? -12.070 5.196   12.381  1.00 0.00 ? 118 LYS A NZ   6  
ATOM 8576  H H    . LYS A 1 81 ? -9.948  1.638   9.923   1.00 0.00 ? 118 LYS A H    6  
ATOM 8577  H HA   . LYS A 1 81 ? -8.785  0.836   11.683  1.00 0.00 ? 118 LYS A HA   6  
ATOM 8578  H HB2  . LYS A 1 81 ? -11.553 0.169   12.676  1.00 0.00 ? 118 LYS A HB2  6  
ATOM 8579  H HB3  . LYS A 1 81 ? -10.114 -0.225  13.601  1.00 0.00 ? 118 LYS A HB3  6  
ATOM 8580  H HG2  . LYS A 1 81 ? -10.932 1.807   14.469  1.00 0.00 ? 118 LYS A HG2  6  
ATOM 8581  H HG3  . LYS A 1 81 ? -9.515  2.218   13.506  1.00 0.00 ? 118 LYS A HG3  6  
ATOM 8582  H HD2  . LYS A 1 81 ? -11.008 2.827   11.634  1.00 0.00 ? 118 LYS A HD2  6  
ATOM 8583  H HD3  . LYS A 1 81 ? -12.399 2.497   12.669  1.00 0.00 ? 118 LYS A HD3  6  
ATOM 8584  H HE2  . LYS A 1 81 ? -11.682 4.237   14.210  1.00 0.00 ? 118 LYS A HE2  6  
ATOM 8585  H HE3  . LYS A 1 81 ? -10.256 4.546   13.221  1.00 0.00 ? 118 LYS A HE3  6  
ATOM 8586  H HZ1  . LYS A 1 81 ? -11.833 5.078   11.370  1.00 0.00 ? 118 LYS A HZ1  6  
ATOM 8587  H HZ2  . LYS A 1 81 ? -13.093 5.027   12.505  1.00 0.00 ? 118 LYS A HZ2  6  
ATOM 8588  H HZ3  . LYS A 1 81 ? -11.855 6.174   12.664  1.00 0.00 ? 118 LYS A HZ3  6  
ATOM 8589  N N    . LYS A 1 82 ? -10.048 -2.046  12.001  1.00 0.00 ? 119 LYS A N    6  
ATOM 8590  C CA   . LYS A 1 82 ? -9.828  -3.470  11.818  1.00 0.00 ? 119 LYS A CA   6  
ATOM 8591  C C    . LYS A 1 82 ? -11.001 -4.116  11.098  1.00 0.00 ? 119 LYS A C    6  
ATOM 8592  O O    . LYS A 1 82 ? -11.433 -5.215  11.454  1.00 0.00 ? 119 LYS A O    6  
ATOM 8593  C CB   . LYS A 1 82 ? -9.596  -4.155  13.168  1.00 0.00 ? 119 LYS A CB   6  
ATOM 8594  C CG   . LYS A 1 82 ? -8.189  -3.968  13.733  1.00 0.00 ? 119 LYS A CG   6  
ATOM 8595  C CD   . LYS A 1 82 ? -7.881  -2.508  14.036  1.00 0.00 ? 119 LYS A CD   6  
ATOM 8596  C CE   . LYS A 1 82 ? -6.414  -2.291  14.373  1.00 0.00 ? 119 LYS A CE   6  
ATOM 8597  N NZ   . LYS A 1 82 ? -6.032  -2.930  15.658  1.00 0.00 ? 119 LYS A NZ   6  
ATOM 8598  H H    . LYS A 1 82 ? -10.672 -1.745  12.698  1.00 0.00 ? 119 LYS A H    6  
ATOM 8599  H HA   . LYS A 1 82 ? -8.943  -3.590  11.212  1.00 0.00 ? 119 LYS A HA   6  
ATOM 8600  H HB2  . LYS A 1 82 ? -10.303 -3.757  13.880  1.00 0.00 ? 119 LYS A HB2  6  
ATOM 8601  H HB3  . LYS A 1 82 ? -9.779  -5.213  13.054  1.00 0.00 ? 119 LYS A HB3  6  
ATOM 8602  H HG2  . LYS A 1 82 ? -8.104  -4.535  14.649  1.00 0.00 ? 119 LYS A HG2  6  
ATOM 8603  H HG3  . LYS A 1 82 ? -7.471  -4.337  13.015  1.00 0.00 ? 119 LYS A HG3  6  
ATOM 8604  H HD2  . LYS A 1 82 ? -8.130  -1.915  13.168  1.00 0.00 ? 119 LYS A HD2  6  
ATOM 8605  H HD3  . LYS A 1 82 ? -8.486  -2.190  14.873  1.00 0.00 ? 119 LYS A HD3  6  
ATOM 8606  H HE2  . LYS A 1 82 ? -5.812  -2.711  13.583  1.00 0.00 ? 119 LYS A HE2  6  
ATOM 8607  H HE3  . LYS A 1 82 ? -6.228  -1.228  14.440  1.00 0.00 ? 119 LYS A HE3  6  
ATOM 8608  H HZ1  . LYS A 1 82 ? -6.748  -2.728  16.388  1.00 0.00 ? 119 LYS A HZ1  6  
ATOM 8609  H HZ2  . LYS A 1 82 ? -5.951  -3.964  15.539  1.00 0.00 ? 119 LYS A HZ2  6  
ATOM 8610  H HZ3  . LYS A 1 82 ? -5.112  -2.558  15.981  1.00 0.00 ? 119 LYS A HZ3  6  
ATOM 8611  N N    . SER A 1 83 ? -11.490 -3.454  10.060  1.00 0.00 ? 120 SER A N    6  
ATOM 8612  C CA   . SER A 1 83 ? -12.592 -3.986  9.284   1.00 0.00 ? 120 SER A CA   6  
ATOM 8613  C C    . SER A 1 83 ? -12.769 -3.232  7.974   1.00 0.00 ? 120 SER A C    6  
ATOM 8614  O O    . SER A 1 83 ? -12.823 -2.004  7.954   1.00 0.00 ? 120 SER A O    6  
ATOM 8615  C CB   . SER A 1 83 ? -13.879 -3.915  10.096  1.00 0.00 ? 120 SER A CB   6  
ATOM 8616  O OG   . SER A 1 83 ? -14.128 -2.588  10.540  1.00 0.00 ? 120 SER A OG   6  
ATOM 8617  H H    . SER A 1 83 ? -11.086 -2.600  9.796   1.00 0.00 ? 120 SER A H    6  
ATOM 8618  H HA   . SER A 1 83 ? -12.376 -5.019  9.063   1.00 0.00 ? 120 SER A HA   6  
ATOM 8619  H HB2  . SER A 1 83 ? -14.703 -4.239  9.477   1.00 0.00 ? 120 SER A HB2  6  
ATOM 8620  H HB3  . SER A 1 83 ? -13.787 -4.560  10.959  1.00 0.00 ? 120 SER A HB3  6  
ATOM 8621  H HG   . SER A 1 83 ? -13.341 -2.042  10.374  1.00 0.00 ? 120 SER A HG   6  
ATOM 8622  N N    . PRO A 1 84 ? -12.866 -3.965  6.863   1.00 0.00 ? 121 PRO A N    6  
ATOM 8623  C CA   . PRO A 1 84 ? -13.075 -3.386  5.540   1.00 0.00 ? 121 PRO A CA   6  
ATOM 8624  C C    . PRO A 1 84 ? -14.523 -2.958  5.317   1.00 0.00 ? 121 PRO A C    6  
ATOM 8625  O O    . PRO A 1 84 ? -15.450 -3.735  5.557   1.00 0.00 ? 121 PRO A O    6  
ATOM 8626  C CB   . PRO A 1 84 ? -12.750 -4.536  4.583   1.00 0.00 ? 121 PRO A CB   6  
ATOM 8627  C CG   . PRO A 1 84 ? -12.233 -5.648  5.433   1.00 0.00 ? 121 PRO A CG   6  
ATOM 8628  C CD   . PRO A 1 84 ? -12.810 -5.424  6.796   1.00 0.00 ? 121 PRO A CD   6  
ATOM 8629  H HA   . PRO A 1 84 ? -12.413 -2.553  5.353   1.00 0.00 ? 121 PRO A HA   6  
ATOM 8630  H HB2  . PRO A 1 84 ? -13.656 -4.824  4.080   1.00 0.00 ? 121 PRO A HB2  6  
ATOM 8631  H HB3  . PRO A 1 84 ? -12.016 -4.212  3.860   1.00 0.00 ? 121 PRO A HB3  6  
ATOM 8632  H HG2  . PRO A 1 84 ? -12.561 -6.599  5.037   1.00 0.00 ? 121 PRO A HG2  6  
ATOM 8633  H HG3  . PRO A 1 84 ? -11.153 -5.612  5.472   1.00 0.00 ? 121 PRO A HG3  6  
ATOM 8634  H HD2  . PRO A 1 84 ? -13.798 -5.857  6.867   1.00 0.00 ? 121 PRO A HD2  6  
ATOM 8635  H HD3  . PRO A 1 84 ? -12.158 -5.822  7.559   1.00 0.00 ? 121 PRO A HD3  6  
ATOM 8636  N N    . GLU A 1 85 ? -14.702 -1.793  4.728   1.00 0.00 ? 122 GLU A N    6  
ATOM 8637  C CA   . GLU A 1 85 ? -16.025 -1.335  4.327   1.00 0.00 ? 122 GLU A CA   6  
ATOM 8638  C C    . GLU A 1 85 ? -16.243 -1.596  2.842   1.00 0.00 ? 122 GLU A C    6  
ATOM 8639  O O    . GLU A 1 85 ? -16.704 -0.720  2.103   1.00 0.00 ? 122 GLU A O    6  
ATOM 8640  C CB   . GLU A 1 85 ? -16.208 0.154   4.626   1.00 0.00 ? 122 GLU A CB   6  
ATOM 8641  C CG   . GLU A 1 85 ? -16.149 0.496   6.101   1.00 0.00 ? 122 GLU A CG   6  
ATOM 8642  C CD   . GLU A 1 85 ? -16.566 1.925   6.375   1.00 0.00 ? 122 GLU A CD   6  
ATOM 8643  O OE1  . GLU A 1 85 ? -15.903 2.851   5.861   1.00 0.00 ? 122 GLU A OE1  6  
ATOM 8644  O OE2  . GLU A 1 85 ? -17.548 2.131   7.115   1.00 0.00 ? 122 GLU A OE2  6  
ATOM 8645  H H    . GLU A 1 85 ? -13.908 -1.266  4.464   1.00 0.00 ? 122 GLU A H    6  
ATOM 8646  H HA   . GLU A 1 85 ? -16.755 -1.900  4.886   1.00 0.00 ? 122 GLU A HA   6  
ATOM 8647  H HB2  . GLU A 1 85 ? -15.430 0.708   4.121   1.00 0.00 ? 122 GLU A HB2  6  
ATOM 8648  H HB3  . GLU A 1 85 ? -17.167 0.471   4.243   1.00 0.00 ? 122 GLU A HB3  6  
ATOM 8649  H HG2  . GLU A 1 85 ? -16.810 -0.167  6.640   1.00 0.00 ? 122 GLU A HG2  6  
ATOM 8650  H HG3  . GLU A 1 85 ? -15.136 0.359   6.452   1.00 0.00 ? 122 GLU A HG3  6  
ATOM 8651  N N    . VAL A 1 86 ? -15.862 -2.789  2.398   1.00 0.00 ? 123 VAL A N    6  
ATOM 8652  C CA   . VAL A 1 86 ? -15.980 -3.158  0.993   1.00 0.00 ? 123 VAL A CA   6  
ATOM 8653  C C    . VAL A 1 86 ? -16.349 -4.633  0.847   1.00 0.00 ? 123 VAL A C    6  
ATOM 8654  O O    . VAL A 1 86 ? -15.532 -5.506  1.138   1.00 0.00 ? 123 VAL A O    6  
ATOM 8655  C CB   . VAL A 1 86 ? -14.664 -2.914  0.212   1.00 0.00 ? 123 VAL A CB   6  
ATOM 8656  C CG1  . VAL A 1 86 ? -14.842 -3.263  -1.258  1.00 0.00 ? 123 VAL A CG1  6  
ATOM 8657  C CG2  . VAL A 1 86 ? -14.181 -1.478  0.357   1.00 0.00 ? 123 VAL A CG2  6  
ATOM 8658  H H    . VAL A 1 86 ? -15.478 -3.432  3.029   1.00 0.00 ? 123 VAL A H    6  
ATOM 8659  H HA   . VAL A 1 86 ? -16.758 -2.553  0.548   1.00 0.00 ? 123 VAL A HA   6  
ATOM 8660  H HB   . VAL A 1 86 ? -13.905 -3.566  0.620   1.00 0.00 ? 123 VAL A HB   6  
ATOM 8661  H HG11 . VAL A 1 86 ? -15.210 -4.274  -1.346  1.00 0.00 ? 123 VAL A HG11 6  
ATOM 8662  H HG12 . VAL A 1 86 ? -15.551 -2.581  -1.705  1.00 0.00 ? 123 VAL A HG12 6  
ATOM 8663  H HG13 . VAL A 1 86 ? -13.891 -3.179  -1.766  1.00 0.00 ? 123 VAL A HG13 6  
ATOM 8664  H HG21 . VAL A 1 86 ? -15.017 -0.841  0.610   1.00 0.00 ? 123 VAL A HG21 6  
ATOM 8665  H HG22 . VAL A 1 86 ? -13.437 -1.425  1.137   1.00 0.00 ? 123 VAL A HG22 6  
ATOM 8666  H HG23 . VAL A 1 86 ? -13.749 -1.148  -0.577  1.00 0.00 ? 123 VAL A HG23 6  
ATOM 8667  N N    . LYS A 1 87 ? -17.527 -4.881  0.264   1.00 0.00 ? 124 LYS A N    6  
ATOM 8668  C CA   . LYS A 1 87 ? -17.990 -6.230  -0.109  1.00 0.00 ? 124 LYS A CA   6  
ATOM 8669  C C    . LYS A 1 87 ? -18.207 -7.182  1.077   1.00 0.00 ? 124 LYS A C    6  
ATOM 8670  O O    . LYS A 1 87 ? -19.206 -7.898  1.108   1.00 0.00 ? 124 LYS A O    6  
ATOM 8671  C CB   . LYS A 1 87 ? -17.030 -6.865  -1.117  1.00 0.00 ? 124 LYS A CB   6  
ATOM 8672  C CG   . LYS A 1 87 ? -17.095 -6.231  -2.498  1.00 0.00 ? 124 LYS A CG   6  
ATOM 8673  C CD   . LYS A 1 87 ? -18.462 -6.433  -3.136  1.00 0.00 ? 124 LYS A CD   6  
ATOM 8674  C CE   . LYS A 1 87 ? -18.573 -5.711  -4.468  1.00 0.00 ? 124 LYS A CE   6  
ATOM 8675  N NZ   . LYS A 1 87 ? -18.500 -4.234  -4.308  1.00 0.00 ? 124 LYS A NZ   6  
ATOM 8676  H H    . LYS A 1 87 ? -18.067 -4.116  -0.026  1.00 0.00 ? 124 LYS A H    6  
ATOM 8677  H HA   . LYS A 1 87 ? -18.944 -6.103  -0.600  1.00 0.00 ? 124 LYS A HA   6  
ATOM 8678  H HB2  . LYS A 1 87 ? -16.020 -6.766  -0.748  1.00 0.00 ? 124 LYS A HB2  6  
ATOM 8679  H HB3  . LYS A 1 87 ? -17.268 -7.914  -1.215  1.00 0.00 ? 124 LYS A HB3  6  
ATOM 8680  H HG2  . LYS A 1 87 ? -16.903 -5.173  -2.408  1.00 0.00 ? 124 LYS A HG2  6  
ATOM 8681  H HG3  . LYS A 1 87 ? -16.344 -6.685  -3.128  1.00 0.00 ? 124 LYS A HG3  6  
ATOM 8682  H HD2  . LYS A 1 87 ? -18.619 -7.490  -3.298  1.00 0.00 ? 124 LYS A HD2  6  
ATOM 8683  H HD3  . LYS A 1 87 ? -19.219 -6.054  -2.465  1.00 0.00 ? 124 LYS A HD3  6  
ATOM 8684  H HE2  . LYS A 1 87 ? -17.765 -6.034  -5.107  1.00 0.00 ? 124 LYS A HE2  6  
ATOM 8685  H HE3  . LYS A 1 87 ? -19.519 -5.967  -4.926  1.00 0.00 ? 124 LYS A HE3  6  
ATOM 8686  H HZ1  . LYS A 1 87 ? -18.641 -3.973  -3.308  1.00 0.00 ? 124 LYS A HZ1  6  
ATOM 8687  H HZ2  . LYS A 1 87 ? -17.564 -3.887  -4.616  1.00 0.00 ? 124 LYS A HZ2  6  
ATOM 8688  H HZ3  . LYS A 1 87 ? -19.237 -3.772  -4.881  1.00 0.00 ? 124 LYS A HZ3  6  
ATOM 8689  N N    . LYS A 1 88 ? -17.218 -7.302  1.953   1.00 0.00 ? 125 LYS A N    6  
ATOM 8690  C CA   . LYS A 1 88 ? -17.260 -8.295  3.024   1.00 0.00 ? 125 LYS A CA   6  
ATOM 8691  C C    . LYS A 1 88 ? -18.472 -8.105  3.929   1.00 0.00 ? 125 LYS A C    6  
ATOM 8692  O O    . LYS A 1 88 ? -18.669 -7.032  4.511   1.00 0.00 ? 125 LYS A O    6  
ATOM 8693  C CB   . LYS A 1 88 ? -15.975 -8.259  3.857   1.00 0.00 ? 125 LYS A CB   6  
ATOM 8694  C CG   . LYS A 1 88 ? -14.718 -8.595  3.065   1.00 0.00 ? 125 LYS A CG   6  
ATOM 8695  C CD   . LYS A 1 88 ? -13.548 -8.945  3.975   1.00 0.00 ? 125 LYS A CD   6  
ATOM 8696  C CE   . LYS A 1 88 ? -13.715 -10.328 4.597   1.00 0.00 ? 125 LYS A CE   6  
ATOM 8697  N NZ   . LYS A 1 88 ? -12.596 -10.676 5.516   1.00 0.00 ? 125 LYS A NZ   6  
ATOM 8698  H H    . LYS A 1 88 ? -16.395 -6.777  1.816   1.00 0.00 ? 125 LYS A H    6  
ATOM 8699  H HA   . LYS A 1 88 ? -17.336 -9.266  2.555   1.00 0.00 ? 125 LYS A HA   6  
ATOM 8700  H HB2  . LYS A 1 88 ? -15.858 -7.269  4.271   1.00 0.00 ? 125 LYS A HB2  6  
ATOM 8701  H HB3  . LYS A 1 88 ? -16.069 -8.968  4.665   1.00 0.00 ? 125 LYS A HB3  6  
ATOM 8702  H HG2  . LYS A 1 88 ? -14.924 -9.438  2.424   1.00 0.00 ? 125 LYS A HG2  6  
ATOM 8703  H HG3  . LYS A 1 88 ? -14.448 -7.741  2.460   1.00 0.00 ? 125 LYS A HG3  6  
ATOM 8704  H HD2  . LYS A 1 88 ? -12.636 -8.930  3.397   1.00 0.00 ? 125 LYS A HD2  6  
ATOM 8705  H HD3  . LYS A 1 88 ? -13.486 -8.210  4.767   1.00 0.00 ? 125 LYS A HD3  6  
ATOM 8706  H HE2  . LYS A 1 88 ? -14.639 -10.352 5.154   1.00 0.00 ? 125 LYS A HE2  6  
ATOM 8707  H HE3  . LYS A 1 88 ? -13.755 -11.060 3.804   1.00 0.00 ? 125 LYS A HE3  6  
ATOM 8708  H HZ1  . LYS A 1 88 ? -11.681 -10.407 5.095   1.00 0.00 ? 125 LYS A HZ1  6  
ATOM 8709  H HZ2  . LYS A 1 88 ? -12.708 -10.174 6.423   1.00 0.00 ? 125 LYS A HZ2  6  
ATOM 8710  H HZ3  . LYS A 1 88 ? -12.590 -11.703 5.703   1.00 0.00 ? 125 LYS A HZ3  6  
ATOM 8711  N N    . GLU A 1 89 ? -19.238 -9.187  4.079   1.00 0.00 ? 126 GLU A N    6  
ATOM 8712  C CA   . GLU A 1 89 ? -20.419 -9.225  4.943   1.00 0.00 ? 126 GLU A CA   6  
ATOM 8713  C C    . GLU A 1 89 ? -21.442 -8.154  4.560   1.00 0.00 ? 126 GLU A C    6  
ATOM 8714  O O    . GLU A 1 89 ? -21.569 -7.790  3.390   1.00 0.00 ? 126 GLU A O    6  
ATOM 8715  C CB   . GLU A 1 89 ? -20.010 -9.083  6.414   1.00 0.00 ? 126 GLU A CB   6  
ATOM 8716  C CG   . GLU A 1 89 ? -19.022 -10.147 6.872   1.00 0.00 ? 126 GLU A CG   6  
ATOM 8717  C CD   . GLU A 1 89 ? -18.661 -10.032 8.337   1.00 0.00 ? 126 GLU A CD   6  
ATOM 8718  O OE1  . GLU A 1 89 ? -19.240 -9.168  9.030   1.00 0.00 ? 126 GLU A OE1  6  
ATOM 8719  O OE2  . GLU A 1 89 ? -17.792 -10.794 8.809   1.00 0.00 ? 126 GLU A OE2  6  
ATOM 8720  H H    . GLU A 1 89 ? -18.978 -10.008 3.610   1.00 0.00 ? 126 GLU A H    6  
ATOM 8721  H HA   . GLU A 1 89 ? -20.880 -10.193 4.810   1.00 0.00 ? 126 GLU A HA   6  
ATOM 8722  H HB2  . GLU A 1 89 ? -19.556 -8.114  6.556   1.00 0.00 ? 126 GLU A HB2  6  
ATOM 8723  H HB3  . GLU A 1 89 ? -20.895 -9.151  7.032   1.00 0.00 ? 126 GLU A HB3  6  
ATOM 8724  H HG2  . GLU A 1 89 ? -19.458 -11.121 6.705   1.00 0.00 ? 126 GLU A HG2  6  
ATOM 8725  H HG3  . GLU A 1 89 ? -18.120 -10.054 6.287   1.00 0.00 ? 126 GLU A HG3  6  
ATOM 8726  N N    . LYS A 1 90 ? -22.205 -7.691  5.547   1.00 0.00 ? 127 LYS A N    6  
ATOM 8727  C CA   . LYS A 1 90 ? -23.242 -6.698  5.323   1.00 0.00 ? 127 LYS A CA   6  
ATOM 8728  C C    . LYS A 1 90 ? -22.650 -5.289  5.315   1.00 0.00 ? 127 LYS A C    6  
ATOM 8729  O O    . LYS A 1 90 ? -21.459 -5.118  5.050   1.00 0.00 ? 127 LYS A O    6  
ATOM 8730  C CB   . LYS A 1 90 ? -24.354 -6.817  6.388   1.00 0.00 ? 127 LYS A CB   6  
ATOM 8731  C CG   . LYS A 1 90 ? -23.898 -6.615  7.834   1.00 0.00 ? 127 LYS A CG   6  
ATOM 8732  C CD   . LYS A 1 90 ? -23.179 -7.836  8.391   1.00 0.00 ? 127 LYS A CD   6  
ATOM 8733  C CE   . LYS A 1 90 ? -22.749 -7.630  9.837   1.00 0.00 ? 127 LYS A CE   6  
ATOM 8734  N NZ   . LYS A 1 90 ? -23.908 -7.541  10.765  1.00 0.00 ? 127 LYS A NZ   6  
ATOM 8735  H H    . LYS A 1 90 ? -22.082 -8.046  6.441   1.00 0.00 ? 127 LYS A H    6  
ATOM 8736  H HA   . LYS A 1 90 ? -23.667 -6.899  4.357   1.00 0.00 ? 127 LYS A HA   6  
ATOM 8737  H HB2  . LYS A 1 90 ? -25.116 -6.081  6.174   1.00 0.00 ? 127 LYS A HB2  6  
ATOM 8738  H HB3  . LYS A 1 90 ? -24.796 -7.801  6.312   1.00 0.00 ? 127 LYS A HB3  6  
ATOM 8739  H HG2  . LYS A 1 90 ? -23.226 -5.770  7.872   1.00 0.00 ? 127 LYS A HG2  6  
ATOM 8740  H HG3  . LYS A 1 90 ? -24.764 -6.411  8.446   1.00 0.00 ? 127 LYS A HG3  6  
ATOM 8741  H HD2  . LYS A 1 90 ? -23.844 -8.686  8.343   1.00 0.00 ? 127 LYS A HD2  6  
ATOM 8742  H HD3  . LYS A 1 90 ? -22.303 -8.028  7.788   1.00 0.00 ? 127 LYS A HD3  6  
ATOM 8743  H HE2  . LYS A 1 90 ? -22.127 -8.460  10.134  1.00 0.00 ? 127 LYS A HE2  6  
ATOM 8744  H HE3  . LYS A 1 90 ? -22.178 -6.714  9.901   1.00 0.00 ? 127 LYS A HE3  6  
ATOM 8745  H HZ1  . LYS A 1 90 ? -24.711 -8.094  10.396  1.00 0.00 ? 127 LYS A HZ1  6  
ATOM 8746  H HZ2  . LYS A 1 90 ? -23.647 -7.918  11.701  1.00 0.00 ? 127 LYS A HZ2  6  
ATOM 8747  H HZ3  . LYS A 1 90 ? -24.205 -6.546  10.877  1.00 0.00 ? 127 LYS A HZ3  6  
ATOM 8748  N N    . GLU A 1 91 ? -23.475 -4.294  5.633   1.00 0.00 ? 128 GLU A N    6  
ATOM 8749  C CA   . GLU A 1 91 ? -23.035 -2.901  5.703   1.00 0.00 ? 128 GLU A CA   6  
ATOM 8750  C C    . GLU A 1 91 ? -22.492 -2.420  4.357   1.00 0.00 ? 128 GLU A C    6  
ATOM 8751  O O    . GLU A 1 91 ? -23.125 -2.625  3.318   1.00 0.00 ? 128 GLU A O    6  
ATOM 8752  C CB   . GLU A 1 91 ? -21.984 -2.728  6.805   1.00 0.00 ? 128 GLU A CB   6  
ATOM 8753  C CG   . GLU A 1 91 ? -22.473 -3.136  8.184   1.00 0.00 ? 128 GLU A CG   6  
ATOM 8754  C CD   . GLU A 1 91 ? -23.595 -2.258  8.701   1.00 0.00 ? 128 GLU A CD   6  
ATOM 8755  O OE1  . GLU A 1 91 ? -23.893 -1.234  8.052   1.00 0.00 ? 128 GLU A OE1  6  
ATOM 8756  O OE2  . GLU A 1 91 ? -24.206 -2.598  9.733   1.00 0.00 ? 128 GLU A OE2  6  
ATOM 8757  H H    . GLU A 1 91 ? -24.416 -4.501  5.836   1.00 0.00 ? 128 GLU A H    6  
ATOM 8758  H HA   . GLU A 1 91 ? -23.898 -2.304  5.956   1.00 0.00 ? 128 GLU A HA   6  
ATOM 8759  H HB2  . GLU A 1 91 ? -21.121 -3.331  6.560   1.00 0.00 ? 128 GLU A HB2  6  
ATOM 8760  H HB3  . GLU A 1 91 ? -21.686 -1.691  6.843   1.00 0.00 ? 128 GLU A HB3  6  
ATOM 8761  H HG2  . GLU A 1 91 ? -22.829 -4.156  8.138   1.00 0.00 ? 128 GLU A HG2  6  
ATOM 8762  H HG3  . GLU A 1 91 ? -21.644 -3.079  8.874   1.00 0.00 ? 128 GLU A HG3  6  
ATOM 8763  N N    . VAL A 1 92 ? -21.339 -1.745  4.392   1.00 0.00 ? 129 VAL A N    6  
ATOM 8764  C CA   . VAL A 1 92 ? -20.725 -1.174  3.192   1.00 0.00 ? 129 VAL A CA   6  
ATOM 8765  C C    . VAL A 1 92 ? -21.667 -0.146  2.559   1.00 0.00 ? 129 VAL A C    6  
ATOM 8766  O O    . VAL A 1 92 ? -22.048 -0.252  1.390   1.00 0.00 ? 129 VAL A O    6  
ATOM 8767  C CB   . VAL A 1 92 ? -20.335 -2.263  2.161   1.00 0.00 ? 129 VAL A CB   6  
ATOM 8768  C CG1  . VAL A 1 92 ? -19.528 -1.673  1.015   1.00 0.00 ? 129 VAL A CG1  6  
ATOM 8769  C CG2  . VAL A 1 92 ? -19.549 -3.379  2.829   1.00 0.00 ? 129 VAL A CG2  6  
ATOM 8770  H H    . VAL A 1 92 ? -20.909 -1.595  5.259   1.00 0.00 ? 129 VAL A H    6  
ATOM 8771  H HA   . VAL A 1 92 ? -19.822 -0.664  3.501   1.00 0.00 ? 129 VAL A HA   6  
ATOM 8772  H HB   . VAL A 1 92 ? -21.242 -2.688  1.754   1.00 0.00 ? 129 VAL A HB   6  
ATOM 8773  H HG11 . VAL A 1 92 ? -20.074 -0.850  0.574   1.00 0.00 ? 129 VAL A HG11 6  
ATOM 8774  H HG12 . VAL A 1 92 ? -18.580 -1.316  1.391   1.00 0.00 ? 129 VAL A HG12 6  
ATOM 8775  H HG13 . VAL A 1 92 ? -19.354 -2.432  0.268   1.00 0.00 ? 129 VAL A HG13 6  
ATOM 8776  H HG21 . VAL A 1 92 ? -19.224 -3.055  3.806   1.00 0.00 ? 129 VAL A HG21 6  
ATOM 8777  H HG22 . VAL A 1 92 ? -20.176 -4.255  2.932   1.00 0.00 ? 129 VAL A HG22 6  
ATOM 8778  H HG23 . VAL A 1 92 ? -18.688 -3.624  2.225   1.00 0.00 ? 129 VAL A HG23 6  
ATOM 8779  N N    . SER A 1 93 ? -22.095 0.813   3.369   1.00 0.00 ? 130 SER A N    6  
ATOM 8780  C CA   . SER A 1 93 ? -23.035 1.833   2.936   1.00 0.00 ? 130 SER A CA   6  
ATOM 8781  C C    . SER A 1 93 ? -23.083 2.969   3.953   1.00 0.00 ? 130 SER A C    6  
ATOM 8782  O O    . SER A 1 93 ? -23.936 3.869   3.814   1.00 0.00 ? 130 SER A O    6  
ATOM 8783  C CB   . SER A 1 93 ? -24.430 1.222   2.738   1.00 0.00 ? 130 SER A CB   6  
ATOM 8784  O OG   . SER A 1 93 ? -24.728 0.267   3.747   1.00 0.00 ? 130 SER A OG   6  
ATOM 8785  O OXT  . SER A 1 93 ? -22.250 2.957   4.886   1.00 0.00 ? 130 SER A OXT  6  
ATOM 8786  H H    . SER A 1 93 ? -21.793 0.819   4.304   1.00 0.00 ? 130 SER A H    6  
ATOM 8787  H HA   . SER A 1 93 ? -22.686 2.226   1.992   1.00 0.00 ? 130 SER A HA   6  
ATOM 8788  H HB2  . SER A 1 93 ? -25.172 2.006   2.774   1.00 0.00 ? 130 SER A HB2  6  
ATOM 8789  H HB3  . SER A 1 93 ? -24.470 0.733   1.776   1.00 0.00 ? 130 SER A HB3  6  
ATOM 8790  H HG   . SER A 1 93 ? -24.076 0.341   4.465   1.00 0.00 ? 130 SER A HG   6  
ATOM 8791  N N    . LYS A 1 2  ? 23.369  -5.161  8.778   1.00 0.00 ? 39  LYS A N    7  
ATOM 8792  C CA   . LYS A 1 2  ? 23.828  -5.867  9.996   1.00 0.00 ? 39  LYS A CA   7  
ATOM 8793  C C    . LYS A 1 2  ? 22.890  -5.598  11.165  1.00 0.00 ? 39  LYS A C    7  
ATOM 8794  O O    . LYS A 1 2  ? 22.441  -6.523  11.840  1.00 0.00 ? 39  LYS A O    7  
ATOM 8795  C CB   . LYS A 1 2  ? 25.243  -5.396  10.337  1.00 0.00 ? 39  LYS A CB   7  
ATOM 8796  C CG   . LYS A 1 2  ? 25.869  -6.138  11.507  1.00 0.00 ? 39  LYS A CG   7  
ATOM 8797  C CD   . LYS A 1 2  ? 27.263  -5.614  11.811  1.00 0.00 ? 39  LYS A CD   7  
ATOM 8798  C CE   . LYS A 1 2  ? 27.921  -6.390  12.940  1.00 0.00 ? 39  LYS A CE   7  
ATOM 8799  N NZ   . LYS A 1 2  ? 28.097  -7.829  12.606  1.00 0.00 ? 39  LYS A NZ   7  
ATOM 8800  H H1   . LYS A 1 2  ? 23.130  -4.172  9.003   1.00 0.00 ? 39  LYS A H1   7  
ATOM 8801  H H2   . LYS A 1 2  ? 24.119  -5.166  8.055   1.00 0.00 ? 39  LYS A H2   7  
ATOM 8802  H H3   . LYS A 1 2  ? 22.521  -5.629  8.391   1.00 0.00 ? 39  LYS A H3   7  
ATOM 8803  H HA   . LYS A 1 2  ? 23.844  -6.928  9.794   1.00 0.00 ? 39  LYS A HA   7  
ATOM 8804  H HB2  . LYS A 1 2  ? 25.875  -5.533  9.472   1.00 0.00 ? 39  LYS A HB2  7  
ATOM 8805  H HB3  . LYS A 1 2  ? 25.207  -4.345  10.583  1.00 0.00 ? 39  LYS A HB3  7  
ATOM 8806  H HG2  . LYS A 1 2  ? 25.247  -6.006  12.381  1.00 0.00 ? 39  LYS A HG2  7  
ATOM 8807  H HG3  . LYS A 1 2  ? 25.934  -7.187  11.263  1.00 0.00 ? 39  LYS A HG3  7  
ATOM 8808  H HD2  . LYS A 1 2  ? 27.872  -5.706  10.923  1.00 0.00 ? 39  LYS A HD2  7  
ATOM 8809  H HD3  . LYS A 1 2  ? 27.192  -4.574  12.094  1.00 0.00 ? 39  LYS A HD3  7  
ATOM 8810  H HE2  . LYS A 1 2  ? 28.892  -5.958  13.141  1.00 0.00 ? 39  LYS A HE2  7  
ATOM 8811  H HE3  . LYS A 1 2  ? 27.304  -6.307  13.822  1.00 0.00 ? 39  LYS A HE3  7  
ATOM 8812  H HZ1  . LYS A 1 2  ? 27.767  -8.021  11.636  1.00 0.00 ? 39  LYS A HZ1  7  
ATOM 8813  H HZ2  . LYS A 1 2  ? 29.105  -8.092  12.673  1.00 0.00 ? 39  LYS A HZ2  7  
ATOM 8814  H HZ3  . LYS A 1 2  ? 27.552  -8.421  13.270  1.00 0.00 ? 39  LYS A HZ3  7  
ATOM 8815  N N    . GLU A 1 3  ? 22.588  -4.326  11.395  1.00 0.00 ? 40  GLU A N    7  
ATOM 8816  C CA   . GLU A 1 3  ? 21.694  -3.938  12.474  1.00 0.00 ? 40  GLU A CA   7  
ATOM 8817  C C    . GLU A 1 3  ? 20.258  -4.300  12.124  1.00 0.00 ? 40  GLU A C    7  
ATOM 8818  O O    . GLU A 1 3  ? 19.607  -5.050  12.849  1.00 0.00 ? 40  GLU A O    7  
ATOM 8819  C CB   . GLU A 1 3  ? 21.827  -2.441  12.748  1.00 0.00 ? 40  GLU A CB   7  
ATOM 8820  C CG   . GLU A 1 3  ? 23.238  -2.046  13.150  1.00 0.00 ? 40  GLU A CG   7  
ATOM 8821  C CD   . GLU A 1 3  ? 23.428  -0.550  13.296  1.00 0.00 ? 40  GLU A CD   7  
ATOM 8822  O OE1  . GLU A 1 3  ? 22.468  0.211   13.058  1.00 0.00 ? 40  GLU A OE1  7  
ATOM 8823  O OE2  . GLU A 1 3  ? 24.549  -0.131  13.645  1.00 0.00 ? 40  GLU A OE2  7  
ATOM 8824  H H    . GLU A 1 3  ? 22.959  -3.628  10.807  1.00 0.00 ? 40  GLU A H    7  
ATOM 8825  H HA   . GLU A 1 3  ? 21.982  -4.486  13.359  1.00 0.00 ? 40  GLU A HA   7  
ATOM 8826  H HB2  . GLU A 1 3  ? 21.561  -1.894  11.854  1.00 0.00 ? 40  GLU A HB2  7  
ATOM 8827  H HB3  . GLU A 1 3  ? 21.156  -2.165  13.546  1.00 0.00 ? 40  GLU A HB3  7  
ATOM 8828  H HG2  . GLU A 1 3  ? 23.468  -2.512  14.097  1.00 0.00 ? 40  GLU A HG2  7  
ATOM 8829  H HG3  . GLU A 1 3  ? 23.924  -2.408  12.400  1.00 0.00 ? 40  GLU A HG3  7  
ATOM 8830  N N    . GLU A 1 4  ? 19.832  -3.886  10.939  1.00 0.00 ? 41  GLU A N    7  
ATOM 8831  C CA   . GLU A 1 4  ? 18.530  -4.268  10.414  1.00 0.00 ? 41  GLU A CA   7  
ATOM 8832  C C    . GLU A 1 4  ? 18.385  -3.800  8.976   1.00 0.00 ? 41  GLU A C    7  
ATOM 8833  O O    . GLU A 1 4  ? 18.637  -2.633  8.664   1.00 0.00 ? 41  GLU A O    7  
ATOM 8834  C CB   . GLU A 1 4  ? 17.396  -3.687  11.259  1.00 0.00 ? 41  GLU A CB   7  
ATOM 8835  C CG   . GLU A 1 4  ? 16.018  -4.143  10.806  1.00 0.00 ? 41  GLU A CG   7  
ATOM 8836  C CD   . GLU A 1 4  ? 14.905  -3.588  11.667  1.00 0.00 ? 41  GLU A CD   7  
ATOM 8837  O OE1  . GLU A 1 4  ? 15.196  -2.830  12.617  1.00 0.00 ? 41  GLU A OE1  7  
ATOM 8838  O OE2  . GLU A 1 4  ? 13.729  -3.907  11.406  1.00 0.00 ? 41  GLU A OE2  7  
ATOM 8839  H H    . GLU A 1 4  ? 20.442  -3.379  10.362  1.00 0.00 ? 41  GLU A H    7  
ATOM 8840  H HA   . GLU A 1 4  ? 18.468  -5.347  10.435  1.00 0.00 ? 41  GLU A HA   7  
ATOM 8841  H HB2  . GLU A 1 4  ? 17.535  -3.987  12.286  1.00 0.00 ? 41  GLU A HB2  7  
ATOM 8842  H HB3  . GLU A 1 4  ? 17.434  -2.608  11.198  1.00 0.00 ? 41  GLU A HB3  7  
ATOM 8843  H HG2  . GLU A 1 4  ? 15.863  -3.817  9.786   1.00 0.00 ? 41  GLU A HG2  7  
ATOM 8844  H HG3  . GLU A 1 4  ? 15.981  -5.222  10.844  1.00 0.00 ? 41  GLU A HG3  7  
ATOM 8845  N N    . ALA A 1 5  ? 17.984  -4.718  8.112   1.00 0.00 ? 42  ALA A N    7  
ATOM 8846  C CA   . ALA A 1 5  ? 17.789  -4.421  6.707   1.00 0.00 ? 42  ALA A CA   7  
ATOM 8847  C C    . ALA A 1 5  ? 16.336  -4.012  6.432   1.00 0.00 ? 42  ALA A C    7  
ATOM 8848  O O    . ALA A 1 5  ? 15.768  -3.197  7.161   1.00 0.00 ? 42  ALA A O    7  
ATOM 8849  C CB   . ALA A 1 5  ? 18.200  -5.621  5.866   1.00 0.00 ? 42  ALA A CB   7  
ATOM 8850  H H    . ALA A 1 5  ? 17.809  -5.632  8.436   1.00 0.00 ? 42  ALA A H    7  
ATOM 8851  H HA   . ALA A 1 5  ? 18.437  -3.594  6.449   1.00 0.00 ? 42  ALA A HA   7  
ATOM 8852  H HB1  . ALA A 1 5  ? 17.464  -6.405  5.973   1.00 0.00 ? 42  ALA A HB1  7  
ATOM 8853  H HB2  . ALA A 1 5  ? 19.160  -5.984  6.204   1.00 0.00 ? 42  ALA A HB2  7  
ATOM 8854  H HB3  . ALA A 1 5  ? 18.271  -5.329  4.828   1.00 0.00 ? 42  ALA A HB3  7  
ATOM 8855  N N    . SER A 1 6  ? 15.737  -4.573  5.390   1.00 0.00 ? 43  SER A N    7  
ATOM 8856  C CA   . SER A 1 6  ? 14.370  -4.232  5.005   1.00 0.00 ? 43  SER A CA   7  
ATOM 8857  C C    . SER A 1 6  ? 13.336  -4.967  5.860   1.00 0.00 ? 43  SER A C    7  
ATOM 8858  O O    . SER A 1 6  ? 12.280  -5.370  5.369   1.00 0.00 ? 43  SER A O    7  
ATOM 8859  C CB   . SER A 1 6  ? 14.163  -4.557  3.525   1.00 0.00 ? 43  SER A CB   7  
ATOM 8860  O OG   . SER A 1 6  ? 15.179  -3.963  2.737   1.00 0.00 ? 43  SER A OG   7  
ATOM 8861  H H    . SER A 1 6  ? 16.232  -5.213  4.843   1.00 0.00 ? 43  SER A H    7  
ATOM 8862  H HA   . SER A 1 6  ? 14.244  -3.169  5.148   1.00 0.00 ? 43  SER A HA   7  
ATOM 8863  H HB2  . SER A 1 6  ? 14.194  -5.627  3.383   1.00 0.00 ? 43  SER A HB2  7  
ATOM 8864  H HB3  . SER A 1 6  ? 13.204  -4.177  3.201   1.00 0.00 ? 43  SER A HB3  7  
ATOM 8865  H HG   . SER A 1 6  ? 15.858  -4.622  2.544   1.00 0.00 ? 43  SER A HG   7  
ATOM 8866  N N    . SER A 1 7  ? 13.589  -5.049  7.158   1.00 0.00 ? 44  SER A N    7  
ATOM 8867  C CA   . SER A 1 7  ? 12.647  -5.666  8.080   1.00 0.00 ? 44  SER A CA   7  
ATOM 8868  C C    . SER A 1 7  ? 11.586  -4.648  8.508   1.00 0.00 ? 44  SER A C    7  
ATOM 8869  O O    . SER A 1 7  ? 11.189  -4.585  9.671   1.00 0.00 ? 44  SER A O    7  
ATOM 8870  C CB   . SER A 1 7  ? 13.394  -6.232  9.293   1.00 0.00 ? 44  SER A CB   7  
ATOM 8871  O OG   . SER A 1 7  ? 12.550  -7.041  10.099  1.00 0.00 ? 44  SER A OG   7  
ATOM 8872  H H    . SER A 1 7  ? 14.405  -4.637  7.512   1.00 0.00 ? 44  SER A H    7  
ATOM 8873  H HA   . SER A 1 7  ? 12.159  -6.474  7.557   1.00 0.00 ? 44  SER A HA   7  
ATOM 8874  H HB2  . SER A 1 7  ? 14.224  -6.834  8.952   1.00 0.00 ? 44  SER A HB2  7  
ATOM 8875  H HB3  . SER A 1 7  ? 13.767  -5.415  9.894   1.00 0.00 ? 44  SER A HB3  7  
ATOM 8876  H HG   . SER A 1 7  ? 12.117  -6.483  10.762  1.00 0.00 ? 44  SER A HG   7  
ATOM 8877  N N    . LYS A 1 8  ? 11.110  -3.874  7.543   1.00 0.00 ? 45  LYS A N    7  
ATOM 8878  C CA   . LYS A 1 8  ? 10.066  -2.892  7.785   1.00 0.00 ? 45  LYS A CA   7  
ATOM 8879  C C    . LYS A 1 8  ? 8.706   -3.526  7.542   1.00 0.00 ? 45  LYS A C    7  
ATOM 8880  O O    . LYS A 1 8  ? 8.485   -4.145  6.500   1.00 0.00 ? 45  LYS A O    7  
ATOM 8881  C CB   . LYS A 1 8  ? 10.241  -1.685  6.855   1.00 0.00 ? 45  LYS A CB   7  
ATOM 8882  C CG   . LYS A 1 8  ? 11.649  -1.106  6.834   1.00 0.00 ? 45  LYS A CG   7  
ATOM 8883  C CD   . LYS A 1 8  ? 12.025  -0.471  8.165   1.00 0.00 ? 45  LYS A CD   7  
ATOM 8884  C CE   . LYS A 1 8  ? 13.414  0.151   8.105   1.00 0.00 ? 45  LYS A CE   7  
ATOM 8885  N NZ   . LYS A 1 8  ? 13.767  0.884   9.353   1.00 0.00 ? 45  LYS A NZ   7  
ATOM 8886  H H    . LYS A 1 8  ? 11.427  -4.015  6.627   1.00 0.00 ? 45  LYS A H    7  
ATOM 8887  H HA   . LYS A 1 8  ? 10.133  -2.569  8.813   1.00 0.00 ? 45  LYS A HA   7  
ATOM 8888  H HB2  . LYS A 1 8  ? 9.986   -1.985  5.848   1.00 0.00 ? 45  LYS A HB2  7  
ATOM 8889  H HB3  . LYS A 1 8  ? 9.560   -0.908  7.168   1.00 0.00 ? 45  LYS A HB3  7  
ATOM 8890  H HG2  . LYS A 1 8  ? 12.348  -1.900  6.618   1.00 0.00 ? 45  LYS A HG2  7  
ATOM 8891  H HG3  . LYS A 1 8  ? 11.705  -0.356  6.058   1.00 0.00 ? 45  LYS A HG3  7  
ATOM 8892  H HD2  . LYS A 1 8  ? 11.307  0.297   8.406   1.00 0.00 ? 45  LYS A HD2  7  
ATOM 8893  H HD3  . LYS A 1 8  ? 12.014  -1.234  8.931   1.00 0.00 ? 45  LYS A HD3  7  
ATOM 8894  H HE2  . LYS A 1 8  ? 14.138  -0.635  7.947   1.00 0.00 ? 45  LYS A HE2  7  
ATOM 8895  H HE3  . LYS A 1 8  ? 13.448  0.839   7.270   1.00 0.00 ? 45  LYS A HE3  7  
ATOM 8896  H HZ1  . LYS A 1 8  ? 13.058  1.627   9.548   1.00 0.00 ? 45  LYS A HZ1  7  
ATOM 8897  H HZ2  . LYS A 1 8  ? 13.796  0.229   10.166  1.00 0.00 ? 45  LYS A HZ2  7  
ATOM 8898  H HZ3  . LYS A 1 8  ? 14.701  1.335   9.251   1.00 0.00 ? 45  LYS A HZ3  7  
ATOM 8899  N N    . SER A 1 9  ? 7.783   -3.345  8.471   1.00 0.00 ? 46  SER A N    7  
ATOM 8900  C CA   . SER A 1 9  ? 6.438   -3.857  8.286   1.00 0.00 ? 46  SER A CA   7  
ATOM 8901  C C    . SER A 1 9  ? 5.703   -3.010  7.253   1.00 0.00 ? 46  SER A C    7  
ATOM 8902  O O    . SER A 1 9  ? 5.683   -1.780  7.344   1.00 0.00 ? 46  SER A O    7  
ATOM 8903  C CB   . SER A 1 9  ? 5.670   -3.874  9.608   1.00 0.00 ? 46  SER A CB   7  
ATOM 8904  O OG   . SER A 1 9  ? 4.330   -4.301  9.415   1.00 0.00 ? 46  SER A OG   7  
ATOM 8905  H H    . SER A 1 9  ? 7.994   -2.808  9.267   1.00 0.00 ? 46  SER A H    7  
ATOM 8906  H HA   . SER A 1 9  ? 6.518   -4.866  7.911   1.00 0.00 ? 46  SER A HA   7  
ATOM 8907  H HB2  . SER A 1 9  ? 6.154   -4.555  10.294  1.00 0.00 ? 46  SER A HB2  7  
ATOM 8908  H HB3  . SER A 1 9  ? 5.663   -2.881  10.031  1.00 0.00 ? 46  SER A HB3  7  
ATOM 8909  H HG   . SER A 1 9  ? 4.154   -5.073  9.978   1.00 0.00 ? 46  SER A HG   7  
ATOM 8910  N N    . TYR A 1 10 ? 5.118   -3.663  6.261   1.00 0.00 ? 47  TYR A N    7  
ATOM 8911  C CA   . TYR A 1 10 ? 4.410   -2.962  5.200   1.00 0.00 ? 47  TYR A CA   7  
ATOM 8912  C C    . TYR A 1 10 ? 3.115   -2.359  5.721   1.00 0.00 ? 47  TYR A C    7  
ATOM 8913  O O    . TYR A 1 10 ? 2.604   -1.394  5.155   1.00 0.00 ? 47  TYR A O    7  
ATOM 8914  C CB   . TYR A 1 10 ? 4.138   -3.892  4.015   1.00 0.00 ? 47  TYR A CB   7  
ATOM 8915  C CG   . TYR A 1 10 ? 5.366   -4.172  3.175   1.00 0.00 ? 47  TYR A CG   7  
ATOM 8916  C CD1  . TYR A 1 10 ? 6.548   -4.597  3.764   1.00 0.00 ? 47  TYR A CD1  7  
ATOM 8917  C CD2  . TYR A 1 10 ? 5.338   -4.028  1.792   1.00 0.00 ? 47  TYR A CD2  7  
ATOM 8918  C CE1  . TYR A 1 10 ? 7.665   -4.870  3.000   1.00 0.00 ? 47  TYR A CE1  7  
ATOM 8919  C CE2  . TYR A 1 10 ? 6.452   -4.296  1.023   1.00 0.00 ? 47  TYR A CE2  7  
ATOM 8920  C CZ   . TYR A 1 10 ? 7.630   -4.653  1.636   1.00 0.00 ? 47  TYR A CZ   7  
ATOM 8921  O OH   . TYR A 1 10 ? 8.719   -4.995  0.865   1.00 0.00 ? 47  TYR A OH   7  
ATOM 8922  H H    . TYR A 1 10 ? 5.172   -4.645  6.233   1.00 0.00 ? 47  TYR A H    7  
ATOM 8923  H HA   . TYR A 1 10 ? 5.049   -2.157  4.865   1.00 0.00 ? 47  TYR A HA   7  
ATOM 8924  H HB2  . TYR A 1 10 ? 3.767   -4.837  4.385   1.00 0.00 ? 47  TYR A HB2  7  
ATOM 8925  H HB3  . TYR A 1 10 ? 3.391   -3.442  3.376   1.00 0.00 ? 47  TYR A HB3  7  
ATOM 8926  H HD1  . TYR A 1 10 ? 6.588   -4.713  4.837   1.00 0.00 ? 47  TYR A HD1  7  
ATOM 8927  H HD2  . TYR A 1 10 ? 4.427   -3.696  1.318   1.00 0.00 ? 47  TYR A HD2  7  
ATOM 8928  H HE1  . TYR A 1 10 ? 8.578   -5.197  3.477   1.00 0.00 ? 47  TYR A HE1  7  
ATOM 8929  H HE2  . TYR A 1 10 ? 6.409   -4.178  -0.049  1.00 0.00 ? 47  TYR A HE2  7  
ATOM 8930  H HH   . TYR A 1 10 ? 9.438   -5.281  1.434   1.00 0.00 ? 47  TYR A HH   7  
ATOM 8931  N N    . ARG A 1 11 ? 2.653   -2.862  6.860   1.00 0.00 ? 48  ARG A N    7  
ATOM 8932  C CA   . ARG A 1 11 ? 1.484   -2.298  7.521   1.00 0.00 ? 48  ARG A CA   7  
ATOM 8933  C C    . ARG A 1 11 ? 1.718   -0.832  7.849   1.00 0.00 ? 48  ARG A C    7  
ATOM 8934  O O    . ARG A 1 11 ? 0.882   0.020   7.560   1.00 0.00 ? 48  ARG A O    7  
ATOM 8935  C CB   . ARG A 1 11 ? 1.162   -3.070  8.800   1.00 0.00 ? 48  ARG A CB   7  
ATOM 8936  C CG   . ARG A 1 11 ? 0.271   -4.276  8.574   1.00 0.00 ? 48  ARG A CG   7  
ATOM 8937  C CD   . ARG A 1 11 ? 0.000   -5.015  9.873   1.00 0.00 ? 48  ARG A CD   7  
ATOM 8938  N NE   . ARG A 1 11 ? -1.231  -5.794  9.804   1.00 0.00 ? 48  ARG A NE   7  
ATOM 8939  C CZ   . ARG A 1 11 ? -1.665  -6.603  10.766  1.00 0.00 ? 48  ARG A CZ   7  
ATOM 8940  N NH1  . ARG A 1 11 ? -0.938  -6.804  11.857  1.00 0.00 ? 48  ARG A NH1  7  
ATOM 8941  N NH2  . ARG A 1 11 ? -2.831  -7.218  10.628  1.00 0.00 ? 48  ARG A NH2  7  
ATOM 8942  H H    . ARG A 1 11 ? 3.162   -3.569  7.311   1.00 0.00 ? 48  ARG A H    7  
ATOM 8943  H HA   . ARG A 1 11 ? 0.648   -2.374  6.842   1.00 0.00 ? 48  ARG A HA   7  
ATOM 8944  H HB2  . ARG A 1 11 ? 2.086   -3.410  9.245   1.00 0.00 ? 48  ARG A HB2  7  
ATOM 8945  H HB3  . ARG A 1 11 ? 0.663   -2.407  9.491   1.00 0.00 ? 48  ARG A HB3  7  
ATOM 8946  H HG2  . ARG A 1 11 ? -0.667  -3.946  8.156   1.00 0.00 ? 48  ARG A HG2  7  
ATOM 8947  H HG3  . ARG A 1 11 ? 0.762   -4.947  7.883   1.00 0.00 ? 48  ARG A HG3  7  
ATOM 8948  H HD2  . ARG A 1 11 ? 0.827   -5.682  10.075  1.00 0.00 ? 48  ARG A HD2  7  
ATOM 8949  H HD3  . ARG A 1 11 ? -0.083  -4.294  10.672  1.00 0.00 ? 48  ARG A HD3  7  
ATOM 8950  H HE   . ARG A 1 11 ? -1.788  -5.686  8.988   1.00 0.00 ? 48  ARG A HE   7  
ATOM 8951  H HH11 . ARG A 1 11 ? -0.045  -6.348  11.967  1.00 0.00 ? 48  ARG A HH11 7  
ATOM 8952  H HH12 . ARG A 1 11 ? -1.276  -7.409  12.589  1.00 0.00 ? 48  ARG A HH12 7  
ATOM 8953  H HH21 . ARG A 1 11 ? -3.381  -7.071  9.800   1.00 0.00 ? 48  ARG A HH21 7  
ATOM 8954  H HH22 . ARG A 1 11 ? -3.170  -7.835  11.348  1.00 0.00 ? 48  ARG A HH22 7  
ATOM 8955  N N    . GLU A 1 12 ? 2.889   -0.538  8.394   1.00 0.00 ? 49  GLU A N    7  
ATOM 8956  C CA   . GLU A 1 12 ? 3.245   0.829   8.727   1.00 0.00 ? 49  GLU A CA   7  
ATOM 8957  C C    . GLU A 1 12 ? 3.426   1.649   7.459   1.00 0.00 ? 49  GLU A C    7  
ATOM 8958  O O    . GLU A 1 12 ? 2.904   2.753   7.341   1.00 0.00 ? 49  GLU A O    7  
ATOM 8959  C CB   . GLU A 1 12 ? 4.551   0.871   9.522   1.00 0.00 ? 49  GLU A CB   7  
ATOM 8960  C CG   . GLU A 1 12 ? 4.855   -0.399  10.291  1.00 0.00 ? 49  GLU A CG   7  
ATOM 8961  C CD   . GLU A 1 12 ? 6.191   -0.339  10.997  1.00 0.00 ? 49  GLU A CD   7  
ATOM 8962  O OE1  . GLU A 1 12 ? 6.871   0.707   10.910  1.00 0.00 ? 49  GLU A OE1  7  
ATOM 8963  O OE2  . GLU A 1 12 ? 6.568   -1.332  11.653  1.00 0.00 ? 49  GLU A OE2  7  
ATOM 8964  H H    . GLU A 1 12 ? 3.537   -1.255  8.547   1.00 0.00 ? 49  GLU A H    7  
ATOM 8965  H HA   . GLU A 1 12 ? 2.447   1.255   9.319   1.00 0.00 ? 49  GLU A HA   7  
ATOM 8966  H HB2  . GLU A 1 12 ? 5.367   1.049   8.835   1.00 0.00 ? 49  GLU A HB2  7  
ATOM 8967  H HB3  . GLU A 1 12 ? 4.504   1.689   10.225  1.00 0.00 ? 49  GLU A HB3  7  
ATOM 8968  H HG2  . GLU A 1 12 ? 4.079   -0.559  11.023  1.00 0.00 ? 49  GLU A HG2  7  
ATOM 8969  H HG3  . GLU A 1 12 ? 4.872   -1.225  9.593   1.00 0.00 ? 49  GLU A HG3  7  
ATOM 8970  N N    . LEU A 1 13 ? 4.229   1.107   6.552   1.00 0.00 ? 50  LEU A N    7  
ATOM 8971  C CA   . LEU A 1 13 ? 4.599   1.790   5.316   1.00 0.00 ? 50  LEU A CA   7  
ATOM 8972  C C    . LEU A 1 13 ? 3.386   2.192   4.493   1.00 0.00 ? 50  LEU A C    7  
ATOM 8973  O O    . LEU A 1 13 ? 3.242   3.354   4.108   1.00 0.00 ? 50  LEU A O    7  
ATOM 8974  C CB   . LEU A 1 13 ? 5.484   0.870   4.482   1.00 0.00 ? 50  LEU A CB   7  
ATOM 8975  C CG   . LEU A 1 13 ? 6.987   0.917   4.777   1.00 0.00 ? 50  LEU A CG   7  
ATOM 8976  C CD1  . LEU A 1 13 ? 7.275   0.974   6.263   1.00 0.00 ? 50  LEU A CD1  7  
ATOM 8977  C CD2  . LEU A 1 13 ? 7.650   -0.306  4.195   1.00 0.00 ? 50  LEU A CD2  7  
ATOM 8978  H H    . LEU A 1 13 ? 4.645   0.239   6.749   1.00 0.00 ? 50  LEU A H    7  
ATOM 8979  H HA   . LEU A 1 13 ? 5.156   2.675   5.575   1.00 0.00 ? 50  LEU A HA   7  
ATOM 8980  H HB2  . LEU A 1 13 ? 5.147   -0.145  4.631   1.00 0.00 ? 50  LEU A HB2  7  
ATOM 8981  H HB3  . LEU A 1 13 ? 5.343   1.124   3.442   1.00 0.00 ? 50  LEU A HB3  7  
ATOM 8982  H HG   . LEU A 1 13 ? 7.415   1.791   4.315   1.00 0.00 ? 50  LEU A HG   7  
ATOM 8983  H HD11 . LEU A 1 13 ? 6.535   0.399   6.796   1.00 0.00 ? 50  LEU A HD11 7  
ATOM 8984  H HD12 . LEU A 1 13 ? 8.256   0.559   6.447   1.00 0.00 ? 50  LEU A HD12 7  
ATOM 8985  H HD13 . LEU A 1 13 ? 7.249   2.000   6.595   1.00 0.00 ? 50  LEU A HD13 7  
ATOM 8986  H HD21 . LEU A 1 13 ? 7.481   -0.335  3.130   1.00 0.00 ? 50  LEU A HD21 7  
ATOM 8987  H HD22 . LEU A 1 13 ? 8.711   -0.271  4.395   1.00 0.00 ? 50  LEU A HD22 7  
ATOM 8988  H HD23 . LEU A 1 13 ? 7.224   -1.186  4.656   1.00 0.00 ? 50  LEU A HD23 7  
ATOM 8989  N N    . ILE A 1 14 ? 2.551   1.216   4.172   1.00 0.00 ? 51  ILE A N    7  
ATOM 8990  C CA   . ILE A 1 14 ? 1.396   1.453   3.327   1.00 0.00 ? 51  ILE A CA   7  
ATOM 8991  C C    . ILE A 1 14 ? 0.410   2.381   4.002   1.00 0.00 ? 51  ILE A C    7  
ATOM 8992  O O    . ILE A 1 14 ? 0.040   3.390   3.431   1.00 0.00 ? 51  ILE A O    7  
ATOM 8993  C CB   . ILE A 1 14 ? 0.682   0.143   2.955   1.00 0.00 ? 51  ILE A CB   7  
ATOM 8994  C CG1  . ILE A 1 14 ? 1.641   -0.784  2.208   1.00 0.00 ? 51  ILE A CG1  7  
ATOM 8995  C CG2  . ILE A 1 14 ? -0.554  0.427   2.114   1.00 0.00 ? 51  ILE A CG2  7  
ATOM 8996  C CD1  . ILE A 1 14 ? 1.025   -2.110  1.841   1.00 0.00 ? 51  ILE A CD1  7  
ATOM 8997  H H    . ILE A 1 14 ? 2.740   0.301   4.481   1.00 0.00 ? 51  ILE A H    7  
ATOM 8998  H HA   . ILE A 1 14 ? 1.737   1.922   2.416   1.00 0.00 ? 51  ILE A HA   7  
ATOM 8999  H HB   . ILE A 1 14 ? 0.365   -0.340  3.868   1.00 0.00 ? 51  ILE A HB   7  
ATOM 9000  H HG12 . ILE A 1 14 ? 1.961   -0.302  1.297   1.00 0.00 ? 51  ILE A HG12 7  
ATOM 9001  H HG13 . ILE A 1 14 ? 2.502   -0.977  2.831   1.00 0.00 ? 51  ILE A HG13 7  
ATOM 9002  H HG21 . ILE A 1 14 ? -0.281  1.038   1.266   1.00 0.00 ? 51  ILE A HG21 7  
ATOM 9003  H HG22 . ILE A 1 14 ? -0.973  -0.505  1.767   1.00 0.00 ? 51  ILE A HG22 7  
ATOM 9004  H HG23 . ILE A 1 14 ? -1.286  0.951   2.713   1.00 0.00 ? 51  ILE A HG23 7  
ATOM 9005  H HD11 . ILE A 1 14 ? 0.047   -1.942  1.413   1.00 0.00 ? 51  ILE A HD11 7  
ATOM 9006  H HD12 . ILE A 1 14 ? 1.653   -2.611  1.121   1.00 0.00 ? 51  ILE A HD12 7  
ATOM 9007  H HD13 . ILE A 1 14 ? 0.931   -2.720  2.727   1.00 0.00 ? 51  ILE A HD13 7  
ATOM 9008  N N    . ILE A 1 15 ? -0.011  2.035   5.210   1.00 0.00 ? 52  ILE A N    7  
ATOM 9009  C CA   . ILE A 1 15 ? -1.014  2.819   5.920   1.00 0.00 ? 52  ILE A CA   7  
ATOM 9010  C C    . ILE A 1 15 ? -0.574  4.269   6.128   1.00 0.00 ? 52  ILE A C    7  
ATOM 9011  O O    . ILE A 1 15 ? -1.372  5.193   5.936   1.00 0.00 ? 52  ILE A O    7  
ATOM 9012  C CB   . ILE A 1 15 ? -1.369  2.186   7.278   1.00 0.00 ? 52  ILE A CB   7  
ATOM 9013  C CG1  . ILE A 1 15 ? -2.117  0.866   7.055   1.00 0.00 ? 52  ILE A CG1  7  
ATOM 9014  C CG2  . ILE A 1 15 ? -2.204  3.154   8.098   1.00 0.00 ? 52  ILE A CG2  7  
ATOM 9015  C CD1  . ILE A 1 15 ? -2.328  0.052   8.312   1.00 0.00 ? 52  ILE A CD1  7  
ATOM 9016  H H    . ILE A 1 15 ? 0.331   1.212   5.619   1.00 0.00 ? 52  ILE A H    7  
ATOM 9017  H HA   . ILE A 1 15 ? -1.908  2.821   5.314   1.00 0.00 ? 52  ILE A HA   7  
ATOM 9018  H HB   . ILE A 1 15 ? -0.454  1.991   7.813   1.00 0.00 ? 52  ILE A HB   7  
ATOM 9019  H HG12 . ILE A 1 15 ? -3.089  1.077   6.634   1.00 0.00 ? 52  ILE A HG12 7  
ATOM 9020  H HG13 . ILE A 1 15 ? -1.555  0.260   6.359   1.00 0.00 ? 52  ILE A HG13 7  
ATOM 9021  H HG21 . ILE A 1 15 ? -2.163  4.135   7.636   1.00 0.00 ? 52  ILE A HG21 7  
ATOM 9022  H HG22 . ILE A 1 15 ? -3.226  2.813   8.128   1.00 0.00 ? 52  ILE A HG22 7  
ATOM 9023  H HG23 . ILE A 1 15 ? -1.811  3.212   9.101   1.00 0.00 ? 52  ILE A HG23 7  
ATOM 9024  H HD11 . ILE A 1 15 ? -1.392  -0.036  8.847   1.00 0.00 ? 52  ILE A HD11 7  
ATOM 9025  H HD12 . ILE A 1 15 ? -3.058  0.542   8.938   1.00 0.00 ? 52  ILE A HD12 7  
ATOM 9026  H HD13 . ILE A 1 15 ? -2.686  -0.936  8.043   1.00 0.00 ? 52  ILE A HD13 7  
ATOM 9027  N N    . GLU A 1 16 ? 0.698   4.464   6.476   1.00 0.00 ? 53  GLU A N    7  
ATOM 9028  C CA   . GLU A 1 16 ? 1.245   5.801   6.696   1.00 0.00 ? 53  GLU A CA   7  
ATOM 9029  C C    . GLU A 1 16 ? 0.965   6.694   5.499   1.00 0.00 ? 53  GLU A C    7  
ATOM 9030  O O    . GLU A 1 16 ? 0.513   7.834   5.648   1.00 0.00 ? 53  GLU A O    7  
ATOM 9031  C CB   . GLU A 1 16 ? 2.750   5.718   6.949   1.00 0.00 ? 53  GLU A CB   7  
ATOM 9032  C CG   . GLU A 1 16 ? 3.398   7.055   7.271   1.00 0.00 ? 53  GLU A CG   7  
ATOM 9033  C CD   . GLU A 1 16 ? 4.853   6.916   7.672   1.00 0.00 ? 53  GLU A CD   7  
ATOM 9034  O OE1  . GLU A 1 16 ? 5.141   6.196   8.647   1.00 0.00 ? 53  GLU A OE1  7  
ATOM 9035  O OE2  . GLU A 1 16 ? 5.719   7.519   7.001   1.00 0.00 ? 53  GLU A OE2  7  
ATOM 9036  H H    . GLU A 1 16 ? 1.290   3.686   6.573   1.00 0.00 ? 53  GLU A H    7  
ATOM 9037  H HA   . GLU A 1 16 ? 0.764   6.221   7.566   1.00 0.00 ? 53  GLU A HA   7  
ATOM 9038  H HB2  . GLU A 1 16 ? 2.918   5.049   7.779   1.00 0.00 ? 53  GLU A HB2  7  
ATOM 9039  H HB3  . GLU A 1 16 ? 3.227   5.311   6.068   1.00 0.00 ? 53  GLU A HB3  7  
ATOM 9040  H HG2  . GLU A 1 16 ? 3.340   7.688   6.397   1.00 0.00 ? 53  GLU A HG2  7  
ATOM 9041  H HG3  . GLU A 1 16 ? 2.856   7.515   8.084   1.00 0.00 ? 53  GLU A HG3  7  
ATOM 9042  N N    . GLY A 1 17 ? 1.134   6.130   4.317   1.00 0.00 ? 54  GLY A N    7  
ATOM 9043  C CA   . GLY A 1 17 ? 0.797   6.842   3.113   1.00 0.00 ? 54  GLY A CA   7  
ATOM 9044  C C    . GLY A 1 17 ? -0.659  6.753   2.796   1.00 0.00 ? 54  GLY A C    7  
ATOM 9045  O O    . GLY A 1 17 ? -1.284  7.754   2.500   1.00 0.00 ? 54  GLY A O    7  
ATOM 9046  H H    . GLY A 1 17 ? 1.424   5.193   4.268   1.00 0.00 ? 54  GLY A H    7  
ATOM 9047  H HA2  . GLY A 1 17 ? 1.073   7.879   3.222   1.00 0.00 ? 54  GLY A HA2  7  
ATOM 9048  H HA3  . GLY A 1 17 ? 1.341   6.418   2.289   1.00 0.00 ? 54  GLY A HA3  7  
ATOM 9049  N N    . LEU A 1 18 ? -1.153  5.527   2.741   1.00 0.00 ? 55  LEU A N    7  
ATOM 9050  C CA   . LEU A 1 18 ? -2.507  5.229   2.304   1.00 0.00 ? 55  LEU A CA   7  
ATOM 9051  C C    . LEU A 1 18 ? -3.537  6.122   2.986   1.00 0.00 ? 55  LEU A C    7  
ATOM 9052  O O    . LEU A 1 18 ? -4.503  6.560   2.362   1.00 0.00 ? 55  LEU A O    7  
ATOM 9053  C CB   . LEU A 1 18 ? -2.800  3.753   2.564   1.00 0.00 ? 55  LEU A CB   7  
ATOM 9054  C CG   . LEU A 1 18 ? -4.131  3.244   2.036   1.00 0.00 ? 55  LEU A CG   7  
ATOM 9055  C CD1  . LEU A 1 18 ? -4.239  3.505   0.546   1.00 0.00 ? 55  LEU A CD1  7  
ATOM 9056  C CD2  . LEU A 1 18 ? -4.275  1.761   2.334   1.00 0.00 ? 55  LEU A CD2  7  
ATOM 9057  H H    . LEU A 1 18 ? -0.545  4.765   2.918   1.00 0.00 ? 55  LEU A H    7  
ATOM 9058  H HA   . LEU A 1 18 ? -2.549  5.402   1.241   1.00 0.00 ? 55  LEU A HA   7  
ATOM 9059  H HB2  . LEU A 1 18 ? -2.014  3.169   2.104   1.00 0.00 ? 55  LEU A HB2  7  
ATOM 9060  H HB3  . LEU A 1 18 ? -2.773  3.587   3.631   1.00 0.00 ? 55  LEU A HB3  7  
ATOM 9061  H HG   . LEU A 1 18 ? -4.935  3.769   2.529   1.00 0.00 ? 55  LEU A HG   7  
ATOM 9062  H HD11 . LEU A 1 18 ? -3.250  3.589   0.122   1.00 0.00 ? 55  LEU A HD11 7  
ATOM 9063  H HD12 . LEU A 1 18 ? -4.765  2.687   0.077   1.00 0.00 ? 55  LEU A HD12 7  
ATOM 9064  H HD13 . LEU A 1 18 ? -4.782  4.425   0.380   1.00 0.00 ? 55  LEU A HD13 7  
ATOM 9065  H HD21 . LEU A 1 18 ? -3.786  1.533   3.271   1.00 0.00 ? 55  LEU A HD21 7  
ATOM 9066  H HD22 . LEU A 1 18 ? -5.322  1.509   2.405   1.00 0.00 ? 55  LEU A HD22 7  
ATOM 9067  H HD23 . LEU A 1 18 ? -3.822  1.187   1.540   1.00 0.00 ? 55  LEU A HD23 7  
ATOM 9068  N N    . THR A 1 19 ? -3.309  6.415   4.255   1.00 0.00 ? 56  THR A N    7  
ATOM 9069  C CA   . THR A 1 19 ? -4.202  7.272   5.008   1.00 0.00 ? 56  THR A CA   7  
ATOM 9070  C C    . THR A 1 19 ? -4.068  8.733   4.548   1.00 0.00 ? 56  THR A C    7  
ATOM 9071  O O    . THR A 1 19 ? -5.030  9.500   4.590   1.00 0.00 ? 56  THR A O    7  
ATOM 9072  C CB   . THR A 1 19 ? -3.935  7.148   6.532   1.00 0.00 ? 56  THR A CB   7  
ATOM 9073  O OG1  . THR A 1 19 ? -5.103  7.539   7.265   1.00 0.00 ? 56  THR A OG1  7  
ATOM 9074  C CG2  . THR A 1 19 ? -2.757  8.000   6.980   1.00 0.00 ? 56  THR A CG2  7  
ATOM 9075  H H    . THR A 1 19 ? -2.511  6.048   4.696   1.00 0.00 ? 56  THR A H    7  
ATOM 9076  H HA   . THR A 1 19 ? -5.212  6.941   4.816   1.00 0.00 ? 56  THR A HA   7  
ATOM 9077  H HB   . THR A 1 19 ? -3.707  6.112   6.757   1.00 0.00 ? 56  THR A HB   7  
ATOM 9078  H HG1  . THR A 1 19 ? -5.892  7.271   6.767   1.00 0.00 ? 56  THR A HG1  7  
ATOM 9079  H HG21 . THR A 1 19 ? -2.922  9.026   6.683   1.00 0.00 ? 56  THR A HG21 7  
ATOM 9080  H HG22 . THR A 1 19 ? -2.661  7.946   8.054   1.00 0.00 ? 56  THR A HG22 7  
ATOM 9081  H HG23 . THR A 1 19 ? -1.852  7.633   6.519   1.00 0.00 ? 56  THR A HG23 7  
ATOM 9082  N N    . ALA A 1 20 ? -2.861  9.109   4.142   1.00 0.00 ? 57  ALA A N    7  
ATOM 9083  C CA   . ALA A 1 20 ? -2.562  10.477  3.744   1.00 0.00 ? 57  ALA A CA   7  
ATOM 9084  C C    . ALA A 1 20 ? -2.833  10.740  2.259   1.00 0.00 ? 57  ALA A C    7  
ATOM 9085  O O    . ALA A 1 20 ? -3.223  11.847  1.891   1.00 0.00 ? 57  ALA A O    7  
ATOM 9086  C CB   . ALA A 1 20 ? -1.111  10.810  4.077   1.00 0.00 ? 57  ALA A CB   7  
ATOM 9087  H H    . ALA A 1 20 ? -2.137  8.447   4.137   1.00 0.00 ? 57  ALA A H    7  
ATOM 9088  H HA   . ALA A 1 20 ? -3.189  11.132  4.329   1.00 0.00 ? 57  ALA A HA   7  
ATOM 9089  H HB1  . ALA A 1 20 ? -0.876  10.451  5.067   1.00 0.00 ? 57  ALA A HB1  7  
ATOM 9090  H HB2  . ALA A 1 20 ? -0.457  10.340  3.358   1.00 0.00 ? 57  ALA A HB2  7  
ATOM 9091  H HB3  . ALA A 1 20 ? -0.972  11.879  4.040   1.00 0.00 ? 57  ALA A HB3  7  
ATOM 9092  N N    . LEU A 1 21 ? -2.455  9.802   1.390   1.00 0.00 ? 58  LEU A N    7  
ATOM 9093  C CA   . LEU A 1 21 ? -2.483  10.059  -0.037  1.00 0.00 ? 58  LEU A CA   7  
ATOM 9094  C C    . LEU A 1 21 ? -3.756  9.521   -0.686  1.00 0.00 ? 58  LEU A C    7  
ATOM 9095  O O    . LEU A 1 21 ? -3.867  9.481   -1.912  1.00 0.00 ? 58  LEU A O    7  
ATOM 9096  C CB   . LEU A 1 21 ? -1.240  9.460   -0.710  1.00 0.00 ? 58  LEU A CB   7  
ATOM 9097  C CG   . LEU A 1 21 ? -1.423  8.073   -1.318  1.00 0.00 ? 58  LEU A CG   7  
ATOM 9098  C CD1  . LEU A 1 21 ? -0.488  7.880   -2.496  1.00 0.00 ? 58  LEU A CD1  7  
ATOM 9099  C CD2  . LEU A 1 21 ? -1.210  6.987   -0.305  1.00 0.00 ? 58  LEU A CD2  7  
ATOM 9100  H H    . LEU A 1 21 ? -2.034  8.973   1.715   1.00 0.00 ? 58  LEU A H    7  
ATOM 9101  H HA   . LEU A 1 21 ? -2.458  11.125  -0.171  1.00 0.00 ? 58  LEU A HA   7  
ATOM 9102  H HB2  . LEU A 1 21 ? -0.923  10.132  -1.494  1.00 0.00 ? 58  LEU A HB2  7  
ATOM 9103  H HB3  . LEU A 1 21 ? -0.454  9.401   0.027   1.00 0.00 ? 58  LEU A HB3  7  
ATOM 9104  H HG   . LEU A 1 21 ? -2.430  7.985   -1.655  1.00 0.00 ? 58  LEU A HG   7  
ATOM 9105  H HD11 . LEU A 1 21 ? -0.390  8.813   -3.034  1.00 0.00 ? 58  LEU A HD11 7  
ATOM 9106  H HD12 . LEU A 1 21 ? 0.482   7.568   -2.139  1.00 0.00 ? 58  LEU A HD12 7  
ATOM 9107  H HD13 . LEU A 1 21 ? -0.889  7.127   -3.158  1.00 0.00 ? 58  LEU A HD13 7  
ATOM 9108  H HD21 . LEU A 1 21 ? -1.167  7.429   0.680   1.00 0.00 ? 58  LEU A HD21 7  
ATOM 9109  H HD22 . LEU A 1 21 ? -2.038  6.288   -0.353  1.00 0.00 ? 58  LEU A HD22 7  
ATOM 9110  H HD23 . LEU A 1 21 ? -0.287  6.471   -0.514  1.00 0.00 ? 58  LEU A HD23 7  
ATOM 9111  N N    . LYS A 1 22 ? -4.730  9.143   0.132   1.00 0.00 ? 59  LYS A N    7  
ATOM 9112  C CA   . LYS A 1 22 ? -5.995  8.636   -0.380  1.00 0.00 ? 59  LYS A CA   7  
ATOM 9113  C C    . LYS A 1 22 ? -6.716  9.713   -1.186  1.00 0.00 ? 59  LYS A C    7  
ATOM 9114  O O    . LYS A 1 22 ? -7.508  9.406   -2.080  1.00 0.00 ? 59  LYS A O    7  
ATOM 9115  C CB   . LYS A 1 22 ? -6.878  8.163   0.775   1.00 0.00 ? 59  LYS A CB   7  
ATOM 9116  C CG   . LYS A 1 22 ? -7.486  9.296   1.581   1.00 0.00 ? 59  LYS A CG   7  
ATOM 9117  C CD   . LYS A 1 22 ? -7.989  8.808   2.926   1.00 0.00 ? 59  LYS A CD   7  
ATOM 9118  C CE   . LYS A 1 22 ? -8.490  9.953   3.792   1.00 0.00 ? 59  LYS A CE   7  
ATOM 9119  N NZ   . LYS A 1 22 ? -9.616  10.684  3.155   1.00 0.00 ? 59  LYS A NZ   7  
ATOM 9120  H H    . LYS A 1 22 ? -4.601  9.210   1.101   1.00 0.00 ? 59  LYS A H    7  
ATOM 9121  H HA   . LYS A 1 22 ? -5.781  7.799   -1.026  1.00 0.00 ? 59  LYS A HA   7  
ATOM 9122  H HB2  . LYS A 1 22 ? -7.679  7.564   0.375   1.00 0.00 ? 59  LYS A HB2  7  
ATOM 9123  H HB3  . LYS A 1 22 ? -6.284  7.554   1.442   1.00 0.00 ? 59  LYS A HB3  7  
ATOM 9124  H HG2  . LYS A 1 22 ? -6.738  10.058  1.738   1.00 0.00 ? 59  LYS A HG2  7  
ATOM 9125  H HG3  . LYS A 1 22 ? -8.319  9.711   1.021   1.00 0.00 ? 59  LYS A HG3  7  
ATOM 9126  H HD2  . LYS A 1 22 ? -8.795  8.109   2.765   1.00 0.00 ? 59  LYS A HD2  7  
ATOM 9127  H HD3  . LYS A 1 22 ? -7.175  8.311   3.437   1.00 0.00 ? 59  LYS A HD3  7  
ATOM 9128  H HE2  . LYS A 1 22 ? -8.824  9.552   4.739   1.00 0.00 ? 59  LYS A HE2  7  
ATOM 9129  H HE3  . LYS A 1 22 ? -7.677  10.642  3.964   1.00 0.00 ? 59  LYS A HE3  7  
ATOM 9130  H HZ1  . LYS A 1 22 ? -10.243 10.015  2.653   1.00 0.00 ? 59  LYS A HZ1  7  
ATOM 9131  H HZ2  . LYS A 1 22 ? -10.175 11.182  3.880   1.00 0.00 ? 59  LYS A HZ2  7  
ATOM 9132  H HZ3  . LYS A 1 22 ? -9.254  11.381  2.473   1.00 0.00 ? 59  LYS A HZ3  7  
ATOM 9133  N N    . GLU A 1 23 ? -6.444  10.972  -0.839  1.00 0.00 ? 60  GLU A N    7  
ATOM 9134  C CA   . GLU A 1 23 ? -7.056  12.118  -1.495  1.00 0.00 ? 60  GLU A CA   7  
ATOM 9135  C C    . GLU A 1 23 ? -8.576  12.070  -1.369  1.00 0.00 ? 60  GLU A C    7  
ATOM 9136  O O    . GLU A 1 23 ? -9.122  12.239  -0.276  1.00 0.00 ? 60  GLU A O    7  
ATOM 9137  C CB   . GLU A 1 23 ? -6.630  12.201  -2.966  1.00 0.00 ? 60  GLU A CB   7  
ATOM 9138  C CG   . GLU A 1 23 ? -5.179  12.609  -3.161  1.00 0.00 ? 60  GLU A CG   7  
ATOM 9139  C CD   . GLU A 1 23 ? -4.823  12.805  -4.619  1.00 0.00 ? 60  GLU A CD   7  
ATOM 9140  O OE1  . GLU A 1 23 ? -5.587  13.480  -5.340  1.00 0.00 ? 60  GLU A OE1  7  
ATOM 9141  O OE2  . GLU A 1 23 ? -3.785  12.269  -5.062  1.00 0.00 ? 60  GLU A OE2  7  
ATOM 9142  H H    . GLU A 1 23 ? -5.817  11.133  -0.102  1.00 0.00 ? 60  GLU A H    7  
ATOM 9143  H HA   . GLU A 1 23 ? -6.704  13.003  -0.986  1.00 0.00 ? 60  GLU A HA   7  
ATOM 9144  H HB2  . GLU A 1 23 ? -6.775  11.235  -3.424  1.00 0.00 ? 60  GLU A HB2  7  
ATOM 9145  H HB3  . GLU A 1 23 ? -7.257  12.924  -3.470  1.00 0.00 ? 60  GLU A HB3  7  
ATOM 9146  H HG2  . GLU A 1 23 ? -5.001  13.534  -2.635  1.00 0.00 ? 60  GLU A HG2  7  
ATOM 9147  H HG3  . GLU A 1 23 ? -4.544  11.836  -2.751  1.00 0.00 ? 60  GLU A HG3  7  
ATOM 9148  N N    . ARG A 1 24 ? -9.244  11.857  -2.490  1.00 0.00 ? 61  ARG A N    7  
ATOM 9149  C CA   . ARG A 1 24 ? -10.697 11.826  -2.540  1.00 0.00 ? 61  ARG A CA   7  
ATOM 9150  C C    . ARG A 1 24 ? -11.268 10.677  -1.711  1.00 0.00 ? 61  ARG A C    7  
ATOM 9151  O O    . ARG A 1 24 ? -12.323 10.824  -1.087  1.00 0.00 ? 61  ARG A O    7  
ATOM 9152  C CB   . ARG A 1 24 ? -11.152 11.705  -3.994  1.00 0.00 ? 61  ARG A CB   7  
ATOM 9153  C CG   . ARG A 1 24 ? -12.657 11.744  -4.176  1.00 0.00 ? 61  ARG A CG   7  
ATOM 9154  C CD   . ARG A 1 24 ? -13.034 11.621  -5.641  1.00 0.00 ? 61  ARG A CD   7  
ATOM 9155  N NE   . ARG A 1 24 ? -12.460 12.697  -6.447  1.00 0.00 ? 61  ARG A NE   7  
ATOM 9156  C CZ   . ARG A 1 24 ? -12.631 12.810  -7.763  1.00 0.00 ? 61  ARG A CZ   7  
ATOM 9157  N NH1  . ARG A 1 24 ? -13.377 11.927  -8.416  1.00 0.00 ? 61  ARG A NH1  7  
ATOM 9158  N NH2  . ARG A 1 24 ? -12.057 13.809  -8.422  1.00 0.00 ? 61  ARG A NH2  7  
ATOM 9159  H H    . ARG A 1 24 ? -8.741  11.740  -3.324  1.00 0.00 ? 61  ARG A H    7  
ATOM 9160  H HA   . ARG A 1 24 ? -11.061 12.759  -2.139  1.00 0.00 ? 61  ARG A HA   7  
ATOM 9161  H HB2  . ARG A 1 24 ? -10.725 12.520  -4.559  1.00 0.00 ? 61  ARG A HB2  7  
ATOM 9162  H HB3  . ARG A 1 24 ? -10.785 10.772  -4.396  1.00 0.00 ? 61  ARG A HB3  7  
ATOM 9163  H HG2  . ARG A 1 24 ? -13.099 10.923  -3.631  1.00 0.00 ? 61  ARG A HG2  7  
ATOM 9164  H HG3  . ARG A 1 24 ? -13.035 12.680  -3.793  1.00 0.00 ? 61  ARG A HG3  7  
ATOM 9165  H HD2  . ARG A 1 24 ? -12.672 10.675  -6.014  1.00 0.00 ? 61  ARG A HD2  7  
ATOM 9166  H HD3  . ARG A 1 24 ? -14.110 11.654  -5.727  1.00 0.00 ? 61  ARG A HD3  7  
ATOM 9167  H HE   . ARG A 1 24 ? -11.915 13.371  -5.976  1.00 0.00 ? 61  ARG A HE   7  
ATOM 9168  H HH11 . ARG A 1 24 ? -13.820 11.168  -7.918  1.00 0.00 ? 61  ARG A HH11 7  
ATOM 9169  H HH12 . ARG A 1 24 ? -13.513 12.011  -9.410  1.00 0.00 ? 61  ARG A HH12 7  
ATOM 9170  H HH21 . ARG A 1 24 ? -11.482 14.480  -7.932  1.00 0.00 ? 61  ARG A HH21 7  
ATOM 9171  H HH22 . ARG A 1 24 ? -12.205 13.913  -9.414  1.00 0.00 ? 61  ARG A HH22 7  
ATOM 9172  N N    . LYS A 1 25 ? -10.575 9.535   -1.708  1.00 0.00 ? 62  LYS A N    7  
ATOM 9173  C CA   . LYS A 1 25 ? -11.038 8.356   -0.978  1.00 0.00 ? 62  LYS A CA   7  
ATOM 9174  C C    . LYS A 1 25 ? -10.021 7.217   -1.036  1.00 0.00 ? 62  LYS A C    7  
ATOM 9175  O O    . LYS A 1 25 ? -9.820  6.513   -0.046  1.00 0.00 ? 62  LYS A O    7  
ATOM 9176  C CB   . LYS A 1 25 ? -12.411 7.887   -1.500  1.00 0.00 ? 62  LYS A CB   7  
ATOM 9177  C CG   . LYS A 1 25 ? -12.519 7.766   -3.020  1.00 0.00 ? 62  LYS A CG   7  
ATOM 9178  C CD   . LYS A 1 25 ? -12.152 6.375   -3.520  1.00 0.00 ? 62  LYS A CD   7  
ATOM 9179  C CE   . LYS A 1 25 ? -13.124 5.318   -3.015  1.00 0.00 ? 62  LYS A CE   7  
ATOM 9180  N NZ   . LYS A 1 25 ? -14.513 5.571   -3.481  1.00 0.00 ? 62  LYS A NZ   7  
ATOM 9181  H H    . LYS A 1 25 ? -9.717  9.496   -2.186  1.00 0.00 ? 62  LYS A H    7  
ATOM 9182  H HA   . LYS A 1 25 ? -11.153 8.648   0.057   1.00 0.00 ? 62  LYS A HA   7  
ATOM 9183  H HB2  . LYS A 1 25 ? -12.628 6.920   -1.074  1.00 0.00 ? 62  LYS A HB2  7  
ATOM 9184  H HB3  . LYS A 1 25 ? -13.162 8.588   -1.166  1.00 0.00 ? 62  LYS A HB3  7  
ATOM 9185  H HG2  . LYS A 1 25 ? -13.535 7.978   -3.311  1.00 0.00 ? 62  LYS A HG2  7  
ATOM 9186  H HG3  . LYS A 1 25 ? -11.855 8.488   -3.473  1.00 0.00 ? 62  LYS A HG3  7  
ATOM 9187  H HD2  . LYS A 1 25 ? -12.169 6.377   -4.599  1.00 0.00 ? 62  LYS A HD2  7  
ATOM 9188  H HD3  . LYS A 1 25 ? -11.158 6.131   -3.175  1.00 0.00 ? 62  LYS A HD3  7  
ATOM 9189  H HE2  . LYS A 1 25 ? -12.803 4.352   -3.378  1.00 0.00 ? 62  LYS A HE2  7  
ATOM 9190  H HE3  . LYS A 1 25 ? -13.109 5.320   -1.936  1.00 0.00 ? 62  LYS A HE3  7  
ATOM 9191  H HZ1  . LYS A 1 25 ? -14.510 6.235   -4.286  1.00 0.00 ? 62  LYS A HZ1  7  
ATOM 9192  H HZ2  . LYS A 1 25 ? -14.956 4.678   -3.790  1.00 0.00 ? 62  LYS A HZ2  7  
ATOM 9193  H HZ3  . LYS A 1 25 ? -15.084 5.983   -2.710  1.00 0.00 ? 62  LYS A HZ3  7  
ATOM 9194  N N    . GLY A 1 26 ? -9.384  7.038   -2.187  1.00 0.00 ? 63  GLY A N    7  
ATOM 9195  C CA   . GLY A 1 26 ? -8.414  5.975   -2.339  1.00 0.00 ? 63  GLY A CA   7  
ATOM 9196  C C    . GLY A 1 26 ? -7.395  6.291   -3.408  1.00 0.00 ? 63  GLY A C    7  
ATOM 9197  O O    . GLY A 1 26 ? -7.694  7.002   -4.368  1.00 0.00 ? 63  GLY A O    7  
ATOM 9198  H H    . GLY A 1 26 ? -9.578  7.626   -2.948  1.00 0.00 ? 63  GLY A H    7  
ATOM 9199  H HA2  . GLY A 1 26 ? -7.900  5.839   -1.400  1.00 0.00 ? 63  GLY A HA2  7  
ATOM 9200  H HA3  . GLY A 1 26 ? -8.927  5.061   -2.598  1.00 0.00 ? 63  GLY A HA3  7  
ATOM 9201  N N    . SER A 1 27 ? -6.170  5.845   -3.189  1.00 0.00 ? 64  SER A N    7  
ATOM 9202  C CA   . SER A 1 27 ? -5.073  6.150   -4.088  1.00 0.00 ? 64  SER A CA   7  
ATOM 9203  C C    . SER A 1 27 ? -4.858  5.036   -5.114  1.00 0.00 ? 64  SER A C    7  
ATOM 9204  O O    . SER A 1 27 ? -5.709  4.803   -5.974  1.00 0.00 ? 64  SER A O    7  
ATOM 9205  C CB   . SER A 1 27 ? -3.806  6.418   -3.278  1.00 0.00 ? 64  SER A CB   7  
ATOM 9206  O OG   . SER A 1 27 ? -3.581  5.394   -2.322  1.00 0.00 ? 64  SER A OG   7  
ATOM 9207  H H    . SER A 1 27 ? -5.987  5.318   -2.381  1.00 0.00 ? 64  SER A H    7  
ATOM 9208  H HA   . SER A 1 27 ? -5.335  7.052   -4.620  1.00 0.00 ? 64  SER A HA   7  
ATOM 9209  H HB2  . SER A 1 27 ? -2.957  6.470   -3.943  1.00 0.00 ? 64  SER A HB2  7  
ATOM 9210  H HB3  . SER A 1 27 ? -3.913  7.358   -2.758  1.00 0.00 ? 64  SER A HB3  7  
ATOM 9211  H HG   . SER A 1 27 ? -3.587  5.775   -1.438  1.00 0.00 ? 64  SER A HG   7  
ATOM 9212  N N    . SER A 1 28 ? -3.692  4.405   -5.070  1.00 0.00 ? 65  SER A N    7  
ATOM 9213  C CA   . SER A 1 28 ? -3.332  3.393   -6.049  1.00 0.00 ? 65  SER A CA   7  
ATOM 9214  C C    . SER A 1 28 ? -2.096  2.634   -5.570  1.00 0.00 ? 65  SER A C    7  
ATOM 9215  O O    . SER A 1 28 ? -1.293  3.171   -4.806  1.00 0.00 ? 65  SER A O    7  
ATOM 9216  C CB   . SER A 1 28 ? -3.062  4.063   -7.405  1.00 0.00 ? 65  SER A CB   7  
ATOM 9217  O OG   . SER A 1 28 ? -3.028  3.123   -8.465  1.00 0.00 ? 65  SER A OG   7  
ATOM 9218  H H    . SER A 1 28 ? -3.037  4.657   -4.387  1.00 0.00 ? 65  SER A H    7  
ATOM 9219  H HA   . SER A 1 28 ? -4.158  2.706   -6.145  1.00 0.00 ? 65  SER A HA   7  
ATOM 9220  H HB2  . SER A 1 28 ? -3.842  4.782   -7.607  1.00 0.00 ? 65  SER A HB2  7  
ATOM 9221  H HB3  . SER A 1 28 ? -2.112  4.575   -7.363  1.00 0.00 ? 65  SER A HB3  7  
ATOM 9222  H HG   . SER A 1 28 ? -3.313  3.558   -9.285  1.00 0.00 ? 65  SER A HG   7  
ATOM 9223  N N    . ARG A 1 29 ? -1.966  1.383   -6.003  1.00 0.00 ? 66  ARG A N    7  
ATOM 9224  C CA   . ARG A 1 29 ? -0.834  0.534   -5.622  1.00 0.00 ? 66  ARG A CA   7  
ATOM 9225  C C    . ARG A 1 29 ? 0.517   1.201   -5.937  1.00 0.00 ? 66  ARG A C    7  
ATOM 9226  O O    . ARG A 1 29 ? 1.350   1.352   -5.042  1.00 0.00 ? 66  ARG A O    7  
ATOM 9227  C CB   . ARG A 1 29 ? -0.935  -0.825  -6.323  1.00 0.00 ? 66  ARG A CB   7  
ATOM 9228  C CG   . ARG A 1 29 ? -2.103  -1.676  -5.852  1.00 0.00 ? 66  ARG A CG   7  
ATOM 9229  C CD   . ARG A 1 29 ? -2.529  -2.664  -6.924  1.00 0.00 ? 66  ARG A CD   7  
ATOM 9230  N NE   . ARG A 1 29 ? -1.438  -3.550  -7.335  1.00 0.00 ? 66  ARG A NE   7  
ATOM 9231  C CZ   . ARG A 1 29 ? -1.380  -4.154  -8.524  1.00 0.00 ? 66  ARG A CZ   7  
ATOM 9232  N NH1  . ARG A 1 29 ? -2.330  -3.942  -9.429  1.00 0.00 ? 66  ARG A NH1  7  
ATOM 9233  N NH2  . ARG A 1 29 ? -0.375  -4.973  -8.805  1.00 0.00 ? 66  ARG A NH2  7  
ATOM 9234  H H    . ARG A 1 29 ? -2.655  1.016   -6.609  1.00 0.00 ? 66  ARG A H    7  
ATOM 9235  H HA   . ARG A 1 29 ? -0.894  0.375   -4.555  1.00 0.00 ? 66  ARG A HA   7  
ATOM 9236  H HB2  . ARG A 1 29 ? -1.045  -0.662  -7.385  1.00 0.00 ? 66  ARG A HB2  7  
ATOM 9237  H HB3  . ARG A 1 29 ? -0.024  -1.375  -6.147  1.00 0.00 ? 66  ARG A HB3  7  
ATOM 9238  H HG2  . ARG A 1 29 ? -1.808  -2.222  -4.966  1.00 0.00 ? 66  ARG A HG2  7  
ATOM 9239  H HG3  . ARG A 1 29 ? -2.938  -1.031  -5.616  1.00 0.00 ? 66  ARG A HG3  7  
ATOM 9240  H HD2  . ARG A 1 29 ? -3.337  -3.266  -6.539  1.00 0.00 ? 66  ARG A HD2  7  
ATOM 9241  H HD3  . ARG A 1 29 ? -2.876  -2.111  -7.783  1.00 0.00 ? 66  ARG A HD3  7  
ATOM 9242  H HE   . ARG A 1 29 ? -0.720  -3.714  -6.683  1.00 0.00 ? 66  ARG A HE   7  
ATOM 9243  H HH11 . ARG A 1 29 ? -3.096  -3.326  -9.226  1.00 0.00 ? 66  ARG A HH11 7  
ATOM 9244  H HH12 . ARG A 1 29 ? -2.286  -4.396  -10.327 1.00 0.00 ? 66  ARG A HH12 7  
ATOM 9245  H HH21 . ARG A 1 29 ? 0.344   -5.146  -8.119  1.00 0.00 ? 66  ARG A HH21 7  
ATOM 9246  H HH22 . ARG A 1 29 ? -0.323  -5.422  -9.704  1.00 0.00 ? 66  ARG A HH22 7  
ATOM 9247  N N    . PRO A 1 30 ? 0.761   1.636   -7.198  1.00 0.00 ? 67  PRO A N    7  
ATOM 9248  C CA   . PRO A 1 30 ? 2.017   2.306   -7.563  1.00 0.00 ? 67  PRO A CA   7  
ATOM 9249  C C    . PRO A 1 30 ? 2.244   3.582   -6.753  1.00 0.00 ? 67  PRO A C    7  
ATOM 9250  O O    . PRO A 1 30 ? 3.375   3.899   -6.379  1.00 0.00 ? 67  PRO A O    7  
ATOM 9251  C CB   . PRO A 1 30 ? 1.846   2.635   -9.052  1.00 0.00 ? 67  PRO A CB   7  
ATOM 9252  C CG   . PRO A 1 30 ? 0.381   2.565   -9.303  1.00 0.00 ? 67  PRO A CG   7  
ATOM 9253  C CD   . PRO A 1 30 ? -0.150  1.532   -8.355  1.00 0.00 ? 67  PRO A CD   7  
ATOM 9254  H HA   . PRO A 1 30 ? 2.864   1.648   -7.433  1.00 0.00 ? 67  PRO A HA   7  
ATOM 9255  H HB2  . PRO A 1 30 ? 2.232   3.624   -9.250  1.00 0.00 ? 67  PRO A HB2  7  
ATOM 9256  H HB3  . PRO A 1 30 ? 2.380   1.910   -9.646  1.00 0.00 ? 67  PRO A HB3  7  
ATOM 9257  H HG2  . PRO A 1 30 ? -0.073  3.524   -9.103  1.00 0.00 ? 67  PRO A HG2  7  
ATOM 9258  H HG3  . PRO A 1 30 ? 0.196   2.267   -10.324 1.00 0.00 ? 67  PRO A HG3  7  
ATOM 9259  H HD2  . PRO A 1 30 ? -1.163  1.766   -8.072  1.00 0.00 ? 67  PRO A HD2  7  
ATOM 9260  H HD3  . PRO A 1 30 ? -0.096  0.550   -8.799  1.00 0.00 ? 67  PRO A HD3  7  
ATOM 9261  N N    . ALA A 1 31 ? 1.154   4.275   -6.437  1.00 0.00 ? 68  ALA A N    7  
ATOM 9262  C CA   . ALA A 1 31 ? 1.213   5.487   -5.629  1.00 0.00 ? 68  ALA A CA   7  
ATOM 9263  C C    . ALA A 1 31 ? 1.692   5.174   -4.213  1.00 0.00 ? 68  ALA A C    7  
ATOM 9264  O O    . ALA A 1 31 ? 2.554   5.864   -3.671  1.00 0.00 ? 68  ALA A O    7  
ATOM 9265  C CB   . ALA A 1 31 ? -0.149  6.165   -5.596  1.00 0.00 ? 68  ALA A CB   7  
ATOM 9266  H H    . ALA A 1 31 ? 0.280   3.938   -6.722  1.00 0.00 ? 68  ALA A H    7  
ATOM 9267  H HA   . ALA A 1 31 ? 1.916   6.165   -6.094  1.00 0.00 ? 68  ALA A HA   7  
ATOM 9268  H HB1  . ALA A 1 31 ? -0.312  6.695   -6.521  1.00 0.00 ? 68  ALA A HB1  7  
ATOM 9269  H HB2  . ALA A 1 31 ? -0.184  6.861   -4.770  1.00 0.00 ? 68  ALA A HB2  7  
ATOM 9270  H HB3  . ALA A 1 31 ? -0.918  5.418   -5.469  1.00 0.00 ? 68  ALA A HB3  7  
ATOM 9271  N N    . LEU A 1 32 ? 1.164   4.093   -3.647  1.00 0.00 ? 69  LEU A N    7  
ATOM 9272  C CA   . LEU A 1 32 ? 1.576   3.636   -2.326  1.00 0.00 ? 69  LEU A CA   7  
ATOM 9273  C C    . LEU A 1 32 ? 3.056   3.286   -2.319  1.00 0.00 ? 69  LEU A C    7  
ATOM 9274  O O    . LEU A 1 32 ? 3.804   3.724   -1.448  1.00 0.00 ? 69  LEU A O    7  
ATOM 9275  C CB   . LEU A 1 32 ? 0.748   2.420   -1.904  1.00 0.00 ? 69  LEU A CB   7  
ATOM 9276  C CG   . LEU A 1 32 ? -0.668  2.734   -1.427  1.00 0.00 ? 69  LEU A CG   7  
ATOM 9277  C CD1  . LEU A 1 32 ? -1.478  1.457   -1.275  1.00 0.00 ? 69  LEU A CD1  7  
ATOM 9278  C CD2  . LEU A 1 32 ? -0.614  3.492   -0.115  1.00 0.00 ? 69  LEU A CD2  7  
ATOM 9279  H H    . LEU A 1 32 ? 0.508   3.564   -4.151  1.00 0.00 ? 69  LEU A H    7  
ATOM 9280  H HA   . LEU A 1 32 ? 1.405   4.441   -1.626  1.00 0.00 ? 69  LEU A HA   7  
ATOM 9281  H HB2  . LEU A 1 32 ? 0.682   1.749   -2.748  1.00 0.00 ? 69  LEU A HB2  7  
ATOM 9282  H HB3  . LEU A 1 32 ? 1.270   1.915   -1.105  1.00 0.00 ? 69  LEU A HB3  7  
ATOM 9283  H HG   . LEU A 1 32 ? -1.163  3.357   -2.154  1.00 0.00 ? 69  LEU A HG   7  
ATOM 9284  H HD11 . LEU A 1 32 ? -0.809  0.622   -1.124  1.00 0.00 ? 69  LEU A HD11 7  
ATOM 9285  H HD12 . LEU A 1 32 ? -2.137  1.547   -0.425  1.00 0.00 ? 69  LEU A HD12 7  
ATOM 9286  H HD13 . LEU A 1 32 ? -2.063  1.291   -2.168  1.00 0.00 ? 69  LEU A HD13 7  
ATOM 9287  H HD21 . LEU A 1 32 ? 0.401   3.498   0.255   1.00 0.00 ? 69  LEU A HD21 7  
ATOM 9288  H HD22 . LEU A 1 32 ? -0.947  4.507   -0.272  1.00 0.00 ? 69  LEU A HD22 7  
ATOM 9289  H HD23 . LEU A 1 32 ? -1.256  3.009   0.607   1.00 0.00 ? 69  LEU A HD23 7  
ATOM 9290  N N    . LYS A 1 33 ? 3.483   2.551   -3.340  1.00 0.00 ? 70  LYS A N    7  
ATOM 9291  C CA   . LYS A 1 33 ? 4.883   2.184   -3.487  1.00 0.00 ? 70  LYS A CA   7  
ATOM 9292  C C    . LYS A 1 33 ? 5.770   3.419   -3.592  1.00 0.00 ? 70  LYS A C    7  
ATOM 9293  O O    . LYS A 1 33 ? 6.886   3.433   -3.078  1.00 0.00 ? 70  LYS A O    7  
ATOM 9294  C CB   . LYS A 1 33 ? 5.085   1.310   -4.724  1.00 0.00 ? 70  LYS A CB   7  
ATOM 9295  C CG   . LYS A 1 33 ? 4.458   -0.069  -4.619  1.00 0.00 ? 70  LYS A CG   7  
ATOM 9296  C CD   . LYS A 1 33 ? 4.994   -1.001  -5.692  1.00 0.00 ? 70  LYS A CD   7  
ATOM 9297  C CE   . LYS A 1 33 ? 4.709   -0.470  -7.086  1.00 0.00 ? 70  LYS A CE   7  
ATOM 9298  N NZ   . LYS A 1 33 ? 5.427   -1.240  -8.133  1.00 0.00 ? 70  LYS A NZ   7  
ATOM 9299  H H    . LYS A 1 33 ? 2.839   2.272   -4.028  1.00 0.00 ? 70  LYS A H    7  
ATOM 9300  H HA   . LYS A 1 33 ? 5.170   1.623   -2.611  1.00 0.00 ? 70  LYS A HA   7  
ATOM 9301  H HB2  . LYS A 1 33 ? 4.653   1.811   -5.577  1.00 0.00 ? 70  LYS A HB2  7  
ATOM 9302  H HB3  . LYS A 1 33 ? 6.145   1.187   -4.892  1.00 0.00 ? 70  LYS A HB3  7  
ATOM 9303  H HG2  . LYS A 1 33 ? 4.680   -0.483  -3.648  1.00 0.00 ? 70  LYS A HG2  7  
ATOM 9304  H HG3  . LYS A 1 33 ? 3.387   0.020   -4.738  1.00 0.00 ? 70  LYS A HG3  7  
ATOM 9305  H HD2  . LYS A 1 33 ? 6.062   -1.099  -5.568  1.00 0.00 ? 70  LYS A HD2  7  
ATOM 9306  H HD3  . LYS A 1 33 ? 4.528   -1.969  -5.582  1.00 0.00 ? 70  LYS A HD3  7  
ATOM 9307  H HE2  . LYS A 1 33 ? 3.647   -0.533  -7.270  1.00 0.00 ? 70  LYS A HE2  7  
ATOM 9308  H HE3  . LYS A 1 33 ? 5.021   0.563   -7.132  1.00 0.00 ? 70  LYS A HE3  7  
ATOM 9309  H HZ1  . LYS A 1 33 ? 6.122   -1.888  -7.694  1.00 0.00 ? 70  LYS A HZ1  7  
ATOM 9310  H HZ2  . LYS A 1 33 ? 4.752   -1.800  -8.695  1.00 0.00 ? 70  LYS A HZ2  7  
ATOM 9311  H HZ3  . LYS A 1 33 ? 5.936   -0.588  -8.770  1.00 0.00 ? 70  LYS A HZ3  7  
ATOM 9312  N N    . LYS A 1 34 ? 5.250   4.461   -4.225  1.00 0.00 ? 71  LYS A N    7  
ATOM 9313  C CA   . LYS A 1 34 ? 5.979   5.709   -4.380  1.00 0.00 ? 71  LYS A CA   7  
ATOM 9314  C C    . LYS A 1 34 ? 6.232   6.328   -3.026  1.00 0.00 ? 71  LYS A C    7  
ATOM 9315  O O    . LYS A 1 34 ? 7.375   6.583   -2.650  1.00 0.00 ? 71  LYS A O    7  
ATOM 9316  C CB   . LYS A 1 34 ? 5.180   6.678   -5.251  1.00 0.00 ? 71  LYS A CB   7  
ATOM 9317  C CG   . LYS A 1 34 ? 5.777   8.074   -5.342  1.00 0.00 ? 71  LYS A CG   7  
ATOM 9318  C CD   . LYS A 1 34 ? 4.943   8.965   -6.247  1.00 0.00 ? 71  LYS A CD   7  
ATOM 9319  C CE   . LYS A 1 34 ? 5.485   10.383  -6.295  1.00 0.00 ? 71  LYS A CE   7  
ATOM 9320  N NZ   . LYS A 1 34 ? 4.678   11.258  -7.187  1.00 0.00 ? 71  LYS A NZ   7  
ATOM 9321  H H    . LYS A 1 34 ? 4.325   4.408   -4.543  1.00 0.00 ? 71  LYS A H    7  
ATOM 9322  H HA   . LYS A 1 34 ? 6.924   5.493   -4.853  1.00 0.00 ? 71  LYS A HA   7  
ATOM 9323  H HB2  . LYS A 1 34 ? 5.112   6.272   -6.246  1.00 0.00 ? 71  LYS A HB2  7  
ATOM 9324  H HB3  . LYS A 1 34 ? 4.183   6.765   -4.844  1.00 0.00 ? 71  LYS A HB3  7  
ATOM 9325  H HG2  . LYS A 1 34 ? 5.807   8.506   -4.353  1.00 0.00 ? 71  LYS A HG2  7  
ATOM 9326  H HG3  . LYS A 1 34 ? 6.777   8.005   -5.738  1.00 0.00 ? 71  LYS A HG3  7  
ATOM 9327  H HD2  . LYS A 1 34 ? 4.951   8.556   -7.247  1.00 0.00 ? 71  LYS A HD2  7  
ATOM 9328  H HD3  . LYS A 1 34 ? 3.929   8.991   -5.875  1.00 0.00 ? 71  LYS A HD3  7  
ATOM 9329  H HE2  . LYS A 1 34 ? 5.473   10.794  -5.296  1.00 0.00 ? 71  LYS A HE2  7  
ATOM 9330  H HE3  . LYS A 1 34 ? 6.501   10.354  -6.659  1.00 0.00 ? 71  LYS A HE3  7  
ATOM 9331  H HZ1  . LYS A 1 34 ? 4.398   10.739  -8.046  1.00 0.00 ? 71  LYS A HZ1  7  
ATOM 9332  H HZ2  . LYS A 1 34 ? 3.814   11.580  -6.696  1.00 0.00 ? 71  LYS A HZ2  7  
ATOM 9333  H HZ3  . LYS A 1 34 ? 5.231   12.096  -7.467  1.00 0.00 ? 71  LYS A HZ3  7  
ATOM 9334  N N    . PHE A 1 35 ? 5.156   6.491   -2.278  1.00 0.00 ? 72  PHE A N    7  
ATOM 9335  C CA   . PHE A 1 35 ? 5.213   7.033   -0.931  1.00 0.00 ? 72  PHE A CA   7  
ATOM 9336  C C    . PHE A 1 35 ? 6.182   6.235   -0.061  1.00 0.00 ? 72  PHE A C    7  
ATOM 9337  O O    . PHE A 1 35 ? 6.951   6.806   0.719   1.00 0.00 ? 72  PHE A O    7  
ATOM 9338  C CB   . PHE A 1 35 ? 3.815   7.007   -0.308  1.00 0.00 ? 72  PHE A CB   7  
ATOM 9339  C CG   . PHE A 1 35 ? 3.759   7.592   1.071   1.00 0.00 ? 72  PHE A CG   7  
ATOM 9340  C CD1  . PHE A 1 35 ? 4.068   6.820   2.174   1.00 0.00 ? 72  PHE A CD1  7  
ATOM 9341  C CD2  . PHE A 1 35 ? 3.402   8.915   1.256   1.00 0.00 ? 72  PHE A CD2  7  
ATOM 9342  C CE1  . PHE A 1 35 ? 4.020   7.356   3.446   1.00 0.00 ? 72  PHE A CE1  7  
ATOM 9343  C CE2  . PHE A 1 35 ? 3.349   9.461   2.526   1.00 0.00 ? 72  PHE A CE2  7  
ATOM 9344  C CZ   . PHE A 1 35 ? 3.652   8.673   3.626   1.00 0.00 ? 72  PHE A CZ   7  
ATOM 9345  H H    . PHE A 1 35 ? 4.284   6.217   -2.645  1.00 0.00 ? 72  PHE A H    7  
ATOM 9346  H HA   . PHE A 1 35 ? 5.555   8.054   -0.995  1.00 0.00 ? 72  PHE A HA   7  
ATOM 9347  H HB2  . PHE A 1 35 ? 3.140   7.572   -0.932  1.00 0.00 ? 72  PHE A HB2  7  
ATOM 9348  H HB3  . PHE A 1 35 ? 3.476   5.984   -0.249  1.00 0.00 ? 72  PHE A HB3  7  
ATOM 9349  H HD1  . PHE A 1 35 ? 4.350   5.786   2.033   1.00 0.00 ? 72  PHE A HD1  7  
ATOM 9350  H HD2  . PHE A 1 35 ? 3.161   9.519   0.392   1.00 0.00 ? 72  PHE A HD2  7  
ATOM 9351  H HE1  . PHE A 1 35 ? 4.267   6.743   4.301   1.00 0.00 ? 72  PHE A HE1  7  
ATOM 9352  H HE2  . PHE A 1 35 ? 3.069   10.495  2.660   1.00 0.00 ? 72  PHE A HE2  7  
ATOM 9353  H HZ   . PHE A 1 35 ? 3.609   9.095   4.618   1.00 0.00 ? 72  PHE A HZ   7  
ATOM 9354  N N    . ILE A 1 36 ? 6.116   4.913   -0.180  1.00 0.00 ? 73  ILE A N    7  
ATOM 9355  C CA   . ILE A 1 36 ? 6.958   4.033   0.614   1.00 0.00 ? 73  ILE A CA   7  
ATOM 9356  C C    . ILE A 1 36 ? 8.433   4.256   0.307   1.00 0.00 ? 73  ILE A C    7  
ATOM 9357  O O    . ILE A 1 36 ? 9.242   4.380   1.218   1.00 0.00 ? 73  ILE A O    7  
ATOM 9358  C CB   . ILE A 1 36 ? 6.601   2.545   0.396   1.00 0.00 ? 73  ILE A CB   7  
ATOM 9359  C CG1  . ILE A 1 36 ? 5.189   2.255   0.919   1.00 0.00 ? 73  ILE A CG1  7  
ATOM 9360  C CG2  . ILE A 1 36 ? 7.619   1.645   1.081   1.00 0.00 ? 73  ILE A CG2  7  
ATOM 9361  C CD1  . ILE A 1 36 ? 4.768   0.809   0.776   1.00 0.00 ? 73  ILE A CD1  7  
ATOM 9362  H H    . ILE A 1 36 ? 5.473   4.520   -0.812  1.00 0.00 ? 73  ILE A H    7  
ATOM 9363  H HA   . ILE A 1 36 ? 6.783   4.268   1.655   1.00 0.00 ? 73  ILE A HA   7  
ATOM 9364  H HB   . ILE A 1 36 ? 6.633   2.342   -0.665  1.00 0.00 ? 73  ILE A HB   7  
ATOM 9365  H HG12 . ILE A 1 36 ? 5.143   2.511   1.966   1.00 0.00 ? 73  ILE A HG12 7  
ATOM 9366  H HG13 . ILE A 1 36 ? 4.479   2.862   0.374   1.00 0.00 ? 73  ILE A HG13 7  
ATOM 9367  H HG21 . ILE A 1 36 ? 8.568   2.156   1.138   1.00 0.00 ? 73  ILE A HG21 7  
ATOM 9368  H HG22 . ILE A 1 36 ? 7.277   1.408   2.078   1.00 0.00 ? 73  ILE A HG22 7  
ATOM 9369  H HG23 . ILE A 1 36 ? 7.733   0.734   0.512   1.00 0.00 ? 73  ILE A HG23 7  
ATOM 9370  H HD11 . ILE A 1 36 ? 5.294   0.360   -0.054  1.00 0.00 ? 73  ILE A HD11 7  
ATOM 9371  H HD12 . ILE A 1 36 ? 5.005   0.274   1.686   1.00 0.00 ? 73  ILE A HD12 7  
ATOM 9372  H HD13 . ILE A 1 36 ? 3.706   0.760   0.597   1.00 0.00 ? 73  ILE A HD13 7  
ATOM 9373  N N    . LYS A 1 37 ? 8.777   4.325   -0.971  1.00 0.00 ? 74  LYS A N    7  
ATOM 9374  C CA   . LYS A 1 37 ? 10.165  4.526   -1.370  1.00 0.00 ? 74  LYS A CA   7  
ATOM 9375  C C    . LYS A 1 37 ? 10.674  5.902   -0.949  1.00 0.00 ? 74  LYS A C    7  
ATOM 9376  O O    . LYS A 1 37 ? 11.843  6.059   -0.594  1.00 0.00 ? 74  LYS A O    7  
ATOM 9377  C CB   . LYS A 1 37 ? 10.331  4.326   -2.878  1.00 0.00 ? 74  LYS A CB   7  
ATOM 9378  C CG   . LYS A 1 37 ? 9.907   2.943   -3.339  1.00 0.00 ? 74  LYS A CG   7  
ATOM 9379  C CD   . LYS A 1 37 ? 10.349  2.642   -4.758  1.00 0.00 ? 74  LYS A CD   7  
ATOM 9380  C CE   . LYS A 1 37 ? 9.921   1.238   -5.163  1.00 0.00 ? 74  LYS A CE   7  
ATOM 9381  N NZ   . LYS A 1 37 ? 10.514  0.808   -6.456  1.00 0.00 ? 74  LYS A NZ   7  
ATOM 9382  H H    . LYS A 1 37 ? 8.085   4.230   -1.663  1.00 0.00 ? 74  LYS A H    7  
ATOM 9383  H HA   . LYS A 1 37 ? 10.755  3.779   -0.860  1.00 0.00 ? 74  LYS A HA   7  
ATOM 9384  H HB2  . LYS A 1 37 ? 9.729   5.059   -3.399  1.00 0.00 ? 74  LYS A HB2  7  
ATOM 9385  H HB3  . LYS A 1 37 ? 11.368  4.470   -3.140  1.00 0.00 ? 74  LYS A HB3  7  
ATOM 9386  H HG2  . LYS A 1 37 ? 10.344  2.210   -2.678  1.00 0.00 ? 74  LYS A HG2  7  
ATOM 9387  H HG3  . LYS A 1 37 ? 8.830   2.875   -3.285  1.00 0.00 ? 74  LYS A HG3  7  
ATOM 9388  H HD2  . LYS A 1 37 ? 9.893   3.358   -5.428  1.00 0.00 ? 74  LYS A HD2  7  
ATOM 9389  H HD3  . LYS A 1 37 ? 11.425  2.716   -4.819  1.00 0.00 ? 74  LYS A HD3  7  
ATOM 9390  H HE2  . LYS A 1 37 ? 10.234  0.547   -4.393  1.00 0.00 ? 74  LYS A HE2  7  
ATOM 9391  H HE3  . LYS A 1 37 ? 8.846   1.215   -5.245  1.00 0.00 ? 74  LYS A HE3  7  
ATOM 9392  H HZ1  . LYS A 1 37 ? 10.288  1.493   -7.207  1.00 0.00 ? 74  LYS A HZ1  7  
ATOM 9393  H HZ2  . LYS A 1 37 ? 11.551  0.730   -6.368  1.00 0.00 ? 74  LYS A HZ2  7  
ATOM 9394  H HZ3  . LYS A 1 37 ? 10.134  -0.128  -6.725  1.00 0.00 ? 74  LYS A HZ3  7  
ATOM 9395  N N    . GLU A 1 38 ? 9.790   6.895   -0.971  1.00 0.00 ? 75  GLU A N    7  
ATOM 9396  C CA   . GLU A 1 38 ? 10.154  8.252   -0.578  1.00 0.00 ? 75  GLU A CA   7  
ATOM 9397  C C    . GLU A 1 38 ? 10.501  8.321   0.912   1.00 0.00 ? 75  GLU A C    7  
ATOM 9398  O O    . GLU A 1 38 ? 11.410  9.052   1.312   1.00 0.00 ? 75  GLU A O    7  
ATOM 9399  C CB   . GLU A 1 38 ? 9.013   9.232   -0.879  1.00 0.00 ? 75  GLU A CB   7  
ATOM 9400  C CG   . GLU A 1 38 ? 8.583   9.271   -2.340  1.00 0.00 ? 75  GLU A CG   7  
ATOM 9401  C CD   . GLU A 1 38 ? 9.671   9.760   -3.275  1.00 0.00 ? 75  GLU A CD   7  
ATOM 9402  O OE1  . GLU A 1 38 ? 10.627  8.999   -3.528  1.00 0.00 ? 75  GLU A OE1  7  
ATOM 9403  O OE2  . GLU A 1 38 ? 9.581   10.908  -3.756  1.00 0.00 ? 75  GLU A OE2  7  
ATOM 9404  H H    . GLU A 1 38 ? 8.868   6.711   -1.259  1.00 0.00 ? 75  GLU A H    7  
ATOM 9405  H HA   . GLU A 1 38 ? 11.023  8.539   -1.149  1.00 0.00 ? 75  GLU A HA   7  
ATOM 9406  H HB2  . GLU A 1 38 ? 8.155   8.958   -0.284  1.00 0.00 ? 75  GLU A HB2  7  
ATOM 9407  H HB3  . GLU A 1 38 ? 9.329   10.225  -0.597  1.00 0.00 ? 75  GLU A HB3  7  
ATOM 9408  H HG2  . GLU A 1 38 ? 8.301   8.273   -2.641  1.00 0.00 ? 75  GLU A HG2  7  
ATOM 9409  H HG3  . GLU A 1 38 ? 7.728   9.924   -2.435  1.00 0.00 ? 75  GLU A HG3  7  
ATOM 9410  N N    . ASN A 1 39 ? 9.708   7.641   1.734   1.00 0.00 ? 76  ASN A N    7  
ATOM 9411  C CA   . ASN A 1 39 ? 9.854   7.723   3.188   1.00 0.00 ? 76  ASN A CA   7  
ATOM 9412  C C    . ASN A 1 39 ? 10.724  6.603   3.753   1.00 0.00 ? 76  ASN A C    7  
ATOM 9413  O O    . ASN A 1 39 ? 11.575  6.841   4.611   1.00 0.00 ? 76  ASN A O    7  
ATOM 9414  C CB   . ASN A 1 39 ? 8.476   7.694   3.850   1.00 0.00 ? 76  ASN A CB   7  
ATOM 9415  C CG   . ASN A 1 39 ? 7.770   9.031   3.760   1.00 0.00 ? 76  ASN A CG   7  
ATOM 9416  O OD1  . ASN A 1 39 ? 8.117   9.978   4.462   1.00 0.00 ? 76  ASN A OD1  7  
ATOM 9417  N ND2  . ASN A 1 39 ? 6.799   9.128   2.871   1.00 0.00 ? 76  ASN A ND2  7  
ATOM 9418  H H    . ASN A 1 39 ? 8.951   7.141   1.355   1.00 0.00 ? 76  ASN A H    7  
ATOM 9419  H HA   . ASN A 1 39 ? 10.322  8.667   3.415   1.00 0.00 ? 76  ASN A HA   7  
ATOM 9420  H HB2  . ASN A 1 39 ? 7.863   6.951   3.363   1.00 0.00 ? 76  ASN A HB2  7  
ATOM 9421  H HB3  . ASN A 1 39 ? 8.588   7.436   4.894   1.00 0.00 ? 76  ASN A HB3  7  
ATOM 9422  H HD21 . ASN A 1 39 ? 6.588   8.341   2.321   1.00 0.00 ? 76  ASN A HD21 7  
ATOM 9423  H HD22 . ASN A 1 39 ? 6.329   9.987   2.791   1.00 0.00 ? 76  ASN A HD22 7  
ATOM 9424  N N    . TYR A 1 40 ? 10.497  5.382   3.288   1.00 0.00 ? 77  TYR A N    7  
ATOM 9425  C CA   . TYR A 1 40 ? 11.252  4.224   3.757   1.00 0.00 ? 77  TYR A CA   7  
ATOM 9426  C C    . TYR A 1 40 ? 11.999  3.560   2.598   1.00 0.00 ? 77  TYR A C    7  
ATOM 9427  O O    . TYR A 1 40 ? 11.623  2.473   2.156   1.00 0.00 ? 77  TYR A O    7  
ATOM 9428  C CB   . TYR A 1 40 ? 10.323  3.185   4.405   1.00 0.00 ? 77  TYR A CB   7  
ATOM 9429  C CG   . TYR A 1 40 ? 9.563   3.664   5.625   1.00 0.00 ? 77  TYR A CG   7  
ATOM 9430  C CD1  . TYR A 1 40 ? 8.469   4.514   5.504   1.00 0.00 ? 77  TYR A CD1  7  
ATOM 9431  C CD2  . TYR A 1 40 ? 9.912   3.229   6.895   1.00 0.00 ? 77  TYR A CD2  7  
ATOM 9432  C CE1  . TYR A 1 40 ? 7.755   4.922   6.615   1.00 0.00 ? 77  TYR A CE1  7  
ATOM 9433  C CE2  . TYR A 1 40 ? 9.202   3.627   8.010   1.00 0.00 ? 77  TYR A CE2  7  
ATOM 9434  C CZ   . TYR A 1 40 ? 8.125   4.475   7.866   1.00 0.00 ? 77  TYR A CZ   7  
ATOM 9435  O OH   . TYR A 1 40 ? 7.413   4.869   8.978   1.00 0.00 ? 77  TYR A OH   7  
ATOM 9436  H H    . TYR A 1 40 ? 9.805   5.252   2.601   1.00 0.00 ? 77  TYR A H    7  
ATOM 9437  H HA   . TYR A 1 40 ? 11.968  4.563   4.489   1.00 0.00 ? 77  TYR A HA   7  
ATOM 9438  H HB2  . TYR A 1 40 ? 9.596   2.866   3.674   1.00 0.00 ? 77  TYR A HB2  7  
ATOM 9439  H HB3  . TYR A 1 40 ? 10.915  2.329   4.702   1.00 0.00 ? 77  TYR A HB3  7  
ATOM 9440  H HD1  . TYR A 1 40 ? 8.182   4.862   4.522   1.00 0.00 ? 77  TYR A HD1  7  
ATOM 9441  H HD2  . TYR A 1 40 ? 10.758  2.566   7.006   1.00 0.00 ? 77  TYR A HD2  7  
ATOM 9442  H HE1  . TYR A 1 40 ? 6.913   5.586   6.499   1.00 0.00 ? 77  TYR A HE1  7  
ATOM 9443  H HE2  . TYR A 1 40 ? 9.491   3.275   8.988   1.00 0.00 ? 77  TYR A HE2  7  
ATOM 9444  H HH   . TYR A 1 40 ? 6.599   5.325   8.696   1.00 0.00 ? 77  TYR A HH   7  
ATOM 9445  N N    . PRO A 1 41 ? 13.061  4.199   2.074   1.00 0.00 ? 78  PRO A N    7  
ATOM 9446  C CA   . PRO A 1 41 ? 13.818  3.671   0.930   1.00 0.00 ? 78  PRO A CA   7  
ATOM 9447  C C    . PRO A 1 41 ? 14.571  2.386   1.247   1.00 0.00 ? 78  PRO A C    7  
ATOM 9448  O O    . PRO A 1 41 ? 15.036  1.699   0.343   1.00 0.00 ? 78  PRO A O    7  
ATOM 9449  C CB   . PRO A 1 41 ? 14.792  4.787   0.587   1.00 0.00 ? 78  PRO A CB   7  
ATOM 9450  C CG   . PRO A 1 41 ? 14.925  5.582   1.838   1.00 0.00 ? 78  PRO A CG   7  
ATOM 9451  C CD   . PRO A 1 41 ? 13.589  5.500   2.519   1.00 0.00 ? 78  PRO A CD   7  
ATOM 9452  H HA   . PRO A 1 41 ? 13.167  3.495   0.087   1.00 0.00 ? 78  PRO A HA   7  
ATOM 9453  H HB2  . PRO A 1 41 ? 15.736  4.360   0.283   1.00 0.00 ? 78  PRO A HB2  7  
ATOM 9454  H HB3  . PRO A 1 41 ? 14.381  5.377   -0.214  1.00 0.00 ? 78  PRO A HB3  7  
ATOM 9455  H HG2  . PRO A 1 41 ? 15.694  5.155   2.463   1.00 0.00 ? 78  PRO A HG2  7  
ATOM 9456  H HG3  . PRO A 1 41 ? 15.160  6.608   1.599   1.00 0.00 ? 78  PRO A HG3  7  
ATOM 9457  H HD2  . PRO A 1 41 ? 13.708  5.523   3.592   1.00 0.00 ? 78  PRO A HD2  7  
ATOM 9458  H HD3  . PRO A 1 41 ? 12.950  6.306   2.192   1.00 0.00 ? 78  PRO A HD3  7  
ATOM 9459  N N    . ILE A 1 42 ? 14.609  2.028   2.526   1.00 0.00 ? 79  ILE A N    7  
ATOM 9460  C CA   . ILE A 1 42 ? 15.193  0.764   2.957   1.00 0.00 ? 79  ILE A CA   7  
ATOM 9461  C C    . ILE A 1 42 ? 14.501  -0.376  2.236   1.00 0.00 ? 79  ILE A C    7  
ATOM 9462  O O    . ILE A 1 42 ? 15.091  -1.091  1.428   1.00 0.00 ? 79  ILE A O    7  
ATOM 9463  C CB   . ILE A 1 42 ? 14.985  0.533   4.468   1.00 0.00 ? 79  ILE A CB   7  
ATOM 9464  C CG1  . ILE A 1 42 ? 15.443  1.743   5.295   1.00 0.00 ? 79  ILE A CG1  7  
ATOM 9465  C CG2  . ILE A 1 42 ? 15.728  -0.718  4.916   1.00 0.00 ? 79  ILE A CG2  7  
ATOM 9466  C CD1  . ILE A 1 42 ? 14.390  2.820   5.449   1.00 0.00 ? 79  ILE A CD1  7  
ATOM 9467  H H    . ILE A 1 42 ? 14.168  2.598   3.189   1.00 0.00 ? 79  ILE A H    7  
ATOM 9468  H HA   . ILE A 1 42 ? 16.251  0.761   2.732   1.00 0.00 ? 79  ILE A HA   7  
ATOM 9469  H HB   . ILE A 1 42 ? 13.920  0.370   4.625   1.00 0.00 ? 79  ILE A HB   7  
ATOM 9470  H HG12 . ILE A 1 42 ? 15.719  1.409   6.283   1.00 0.00 ? 79  ILE A HG12 7  
ATOM 9471  H HG13 . ILE A 1 42 ? 16.304  2.188   4.817   1.00 0.00 ? 79  ILE A HG13 7  
ATOM 9472  H HG21 . ILE A 1 42 ? 15.993  -1.306  4.051   1.00 0.00 ? 79  ILE A HG21 7  
ATOM 9473  H HG22 . ILE A 1 42 ? 16.625  -0.433  5.446   1.00 0.00 ? 79  ILE A HG22 7  
ATOM 9474  H HG23 . ILE A 1 42 ? 15.094  -1.301  5.567   1.00 0.00 ? 79  ILE A HG23 7  
ATOM 9475  H HD11 . ILE A 1 42 ? 13.411  2.364   5.491   1.00 0.00 ? 79  ILE A HD11 7  
ATOM 9476  H HD12 . ILE A 1 42 ? 14.570  3.370   6.361   1.00 0.00 ? 79  ILE A HD12 7  
ATOM 9477  H HD13 . ILE A 1 42 ? 14.438  3.493   4.606   1.00 0.00 ? 79  ILE A HD13 7  
ATOM 9478  N N    . VAL A 1 43 ? 13.201  -0.416  2.445   1.00 0.00 ? 80  VAL A N    7  
ATOM 9479  C CA   . VAL A 1 43 ? 12.324  -1.333  1.764   1.00 0.00 ? 80  VAL A CA   7  
ATOM 9480  C C    . VAL A 1 43 ? 12.052  -0.832  0.353   1.00 0.00 ? 80  VAL A C    7  
ATOM 9481  O O    . VAL A 1 43 ? 11.793  -1.617  -0.555  1.00 0.00 ? 80  VAL A O    7  
ATOM 9482  C CB   . VAL A 1 43 ? 11.016  -1.474  2.559   1.00 0.00 ? 80  VAL A CB   7  
ATOM 9483  C CG1  . VAL A 1 43 ? 9.816   -1.158  1.713   1.00 0.00 ? 80  VAL A CG1  7  
ATOM 9484  C CG2  . VAL A 1 43 ? 10.891  -2.851  3.183   1.00 0.00 ? 80  VAL A CG2  7  
ATOM 9485  H H    . VAL A 1 43 ? 12.802  0.267   3.023   1.00 0.00 ? 80  VAL A H    7  
ATOM 9486  H HA   . VAL A 1 43 ? 12.798  -2.296  1.713   1.00 0.00 ? 80  VAL A HA   7  
ATOM 9487  H HB   . VAL A 1 43 ? 11.049  -0.754  3.344   1.00 0.00 ? 80  VAL A HB   7  
ATOM 9488  H HG11 . VAL A 1 43 ? 9.999   -1.498  0.708   1.00 0.00 ? 80  VAL A HG11 7  
ATOM 9489  H HG12 . VAL A 1 43 ? 8.950   -1.654  2.118   1.00 0.00 ? 80  VAL A HG12 7  
ATOM 9490  H HG13 . VAL A 1 43 ? 9.663   -0.089  1.715   1.00 0.00 ? 80  VAL A HG13 7  
ATOM 9491  H HG21 . VAL A 1 43 ? 11.865  -3.193  3.504   1.00 0.00 ? 80  VAL A HG21 7  
ATOM 9492  H HG22 . VAL A 1 43 ? 10.226  -2.796  4.035   1.00 0.00 ? 80  VAL A HG22 7  
ATOM 9493  H HG23 . VAL A 1 43 ? 10.486  -3.540  2.455   1.00 0.00 ? 80  VAL A HG23 7  
ATOM 9494  N N    . GLY A 1 44 ? 12.061  0.487   0.184   1.00 0.00 ? 81  GLY A N    7  
ATOM 9495  C CA   . GLY A 1 44 ? 11.768  1.048   -1.111  1.00 0.00 ? 81  GLY A CA   7  
ATOM 9496  C C    . GLY A 1 44 ? 12.701  0.523   -2.184  1.00 0.00 ? 81  GLY A C    7  
ATOM 9497  O O    . GLY A 1 44 ? 12.265  0.158   -3.277  1.00 0.00 ? 81  GLY A O    7  
ATOM 9498  H H    . GLY A 1 44 ? 12.212  1.081   0.958   1.00 0.00 ? 81  GLY A H    7  
ATOM 9499  H HA2  . GLY A 1 44 ? 10.753  0.786   -1.364  1.00 0.00 ? 81  GLY A HA2  7  
ATOM 9500  H HA3  . GLY A 1 44 ? 11.853  2.123   -1.063  1.00 0.00 ? 81  GLY A HA3  7  
ATOM 9501  N N    . SER A 1 45 ? 13.979  0.422   -1.852  1.00 0.00 ? 82  SER A N    7  
ATOM 9502  C CA   . SER A 1 45 ? 14.967  -0.122  -2.764  1.00 0.00 ? 82  SER A CA   7  
ATOM 9503  C C    . SER A 1 45 ? 15.157  -1.624  -2.543  1.00 0.00 ? 82  SER A C    7  
ATOM 9504  O O    . SER A 1 45 ? 16.207  -2.181  -2.877  1.00 0.00 ? 82  SER A O    7  
ATOM 9505  C CB   . SER A 1 45 ? 16.296  0.613   -2.587  1.00 0.00 ? 82  SER A CB   7  
ATOM 9506  O OG   . SER A 1 45 ? 16.156  1.995   -2.886  1.00 0.00 ? 82  SER A OG   7  
ATOM 9507  H H    . SER A 1 45 ? 14.265  0.695   -0.950  1.00 0.00 ? 82  SER A H    7  
ATOM 9508  H HA   . SER A 1 45 ? 14.609  0.039   -3.771  1.00 0.00 ? 82  SER A HA   7  
ATOM 9509  H HB2  . SER A 1 45 ? 16.627  0.510   -1.566  1.00 0.00 ? 82  SER A HB2  7  
ATOM 9510  H HB3  . SER A 1 45 ? 17.032  0.186   -3.249  1.00 0.00 ? 82  SER A HB3  7  
ATOM 9511  H HG   . SER A 1 45 ? 16.085  2.109   -3.848  1.00 0.00 ? 82  SER A HG   7  
ATOM 9512  N N    . ALA A 1 46 ? 14.111  -2.296  -2.076  1.00 0.00 ? 83  ALA A N    7  
ATOM 9513  C CA   . ALA A 1 46 ? 14.149  -3.743  -1.938  1.00 0.00 ? 83  ALA A CA   7  
ATOM 9514  C C    . ALA A 1 46 ? 13.896  -4.383  -3.297  1.00 0.00 ? 83  ALA A C    7  
ATOM 9515  O O    . ALA A 1 46 ? 13.000  -3.959  -4.033  1.00 0.00 ? 83  ALA A O    7  
ATOM 9516  C CB   . ALA A 1 46 ? 13.131  -4.221  -0.901  1.00 0.00 ? 83  ALA A CB   7  
ATOM 9517  H H    . ALA A 1 46 ? 13.265  -1.821  -1.906  1.00 0.00 ? 83  ALA A H    7  
ATOM 9518  H HA   . ALA A 1 46 ? 15.136  -4.019  -1.598  1.00 0.00 ? 83  ALA A HA   7  
ATOM 9519  H HB1  . ALA A 1 46 ? 12.224  -4.524  -1.403  1.00 0.00 ? 83  ALA A HB1  7  
ATOM 9520  H HB2  . ALA A 1 46 ? 12.908  -3.415  -0.209  1.00 0.00 ? 83  ALA A HB2  7  
ATOM 9521  H HB3  . ALA A 1 46 ? 13.538  -5.060  -0.355  1.00 0.00 ? 83  ALA A HB3  7  
ATOM 9522  N N    . SER A 1 47 ? 14.735  -5.338  -3.665  1.00 0.00 ? 84  SER A N    7  
ATOM 9523  C CA   . SER A 1 47 ? 14.645  -5.975  -4.968  1.00 0.00 ? 84  SER A CA   7  
ATOM 9524  C C    . SER A 1 47 ? 13.301  -6.674  -5.140  1.00 0.00 ? 84  SER A C    7  
ATOM 9525  O O    . SER A 1 47 ? 12.669  -6.582  -6.193  1.00 0.00 ? 84  SER A O    7  
ATOM 9526  C CB   . SER A 1 47 ? 15.796  -6.968  -5.137  1.00 0.00 ? 84  SER A CB   7  
ATOM 9527  O OG   . SER A 1 47 ? 17.036  -6.349  -4.845  1.00 0.00 ? 84  SER A OG   7  
ATOM 9528  H H    . SER A 1 47 ? 15.460  -5.599  -3.057  1.00 0.00 ? 84  SER A H    7  
ATOM 9529  H HA   . SER A 1 47 ? 14.734  -5.204  -5.720  1.00 0.00 ? 84  SER A HA   7  
ATOM 9530  H HB2  . SER A 1 47 ? 15.654  -7.801  -4.464  1.00 0.00 ? 84  SER A HB2  7  
ATOM 9531  H HB3  . SER A 1 47 ? 15.815  -7.326  -6.156  1.00 0.00 ? 84  SER A HB3  7  
ATOM 9532  H HG   . SER A 1 47 ? 16.974  -5.396  -5.033  1.00 0.00 ? 84  SER A HG   7  
ATOM 9533  N N    . ASN A 1 48 ? 12.836  -7.313  -4.077  1.00 0.00 ? 85  ASN A N    7  
ATOM 9534  C CA   . ASN A 1 48 ? 11.539  -7.977  -4.092  1.00 0.00 ? 85  ASN A CA   7  
ATOM 9535  C C    . ASN A 1 48 ? 10.481  -7.151  -3.369  1.00 0.00 ? 85  ASN A C    7  
ATOM 9536  O O    . ASN A 1 48 ? 9.471   -7.690  -2.912  1.00 0.00 ? 85  ASN A O    7  
ATOM 9537  C CB   . ASN A 1 48 ? 11.629  -9.368  -3.461  1.00 0.00 ? 85  ASN A CB   7  
ATOM 9538  C CG   . ASN A 1 48 ? 12.403  -9.378  -2.151  1.00 0.00 ? 85  ASN A CG   7  
ATOM 9539  O OD1  . ASN A 1 48 ? 12.157  -8.566  -1.260  1.00 0.00 ? 85  ASN A OD1  7  
ATOM 9540  N ND2  . ASN A 1 48 ? 13.330  -10.313 -2.024  1.00 0.00 ? 85  ASN A ND2  7  
ATOM 9541  H H    . ASN A 1 48 ? 13.362  -7.306  -3.245  1.00 0.00 ? 85  ASN A H    7  
ATOM 9542  H HA   . ASN A 1 48 ? 11.241  -8.086  -5.124  1.00 0.00 ? 85  ASN A HA   7  
ATOM 9543  H HB2  . ASN A 1 48 ? 10.629  -9.726  -3.267  1.00 0.00 ? 85  ASN A HB2  7  
ATOM 9544  H HB3  . ASN A 1 48 ? 12.119  -10.038 -4.153  1.00 0.00 ? 85  ASN A HB3  7  
ATOM 9545  H HD21 . ASN A 1 48 ? 13.461  -10.943 -2.773  1.00 0.00 ? 85  ASN A HD21 7  
ATOM 9546  H HD22 . ASN A 1 48 ? 13.850  -10.342 -1.191  1.00 0.00 ? 85  ASN A HD22 7  
ATOM 9547  N N    . PHE A 1 49 ? 10.675  -5.836  -3.340  1.00 0.00 ? 86  PHE A N    7  
ATOM 9548  C CA   . PHE A 1 49 ? 9.708   -4.932  -2.729  1.00 0.00 ? 86  PHE A CA   7  
ATOM 9549  C C    . PHE A 1 49 ? 8.353   -5.059  -3.407  1.00 0.00 ? 86  PHE A C    7  
ATOM 9550  O O    . PHE A 1 49 ? 7.320   -5.120  -2.742  1.00 0.00 ? 86  PHE A O    7  
ATOM 9551  C CB   . PHE A 1 49 ? 10.186  -3.481  -2.823  1.00 0.00 ? 86  PHE A CB   7  
ATOM 9552  C CG   . PHE A 1 49 ? 9.126   -2.479  -2.466  1.00 0.00 ? 86  PHE A CG   7  
ATOM 9553  C CD1  . PHE A 1 49 ? 8.570   -2.463  -1.200  1.00 0.00 ? 86  PHE A CD1  7  
ATOM 9554  C CD2  . PHE A 1 49 ? 8.696   -1.545  -3.392  1.00 0.00 ? 86  PHE A CD2  7  
ATOM 9555  C CE1  . PHE A 1 49 ? 7.606   -1.534  -0.864  1.00 0.00 ? 86  PHE A CE1  7  
ATOM 9556  C CE2  . PHE A 1 49 ? 7.731   -0.616  -3.062  1.00 0.00 ? 86  PHE A CE2  7  
ATOM 9557  C CZ   . PHE A 1 49 ? 7.149   -0.639  -1.817  1.00 0.00 ? 86  PHE A CZ   7  
ATOM 9558  H H    . PHE A 1 49 ? 11.469  -5.461  -3.775  1.00 0.00 ? 86  PHE A H    7  
ATOM 9559  H HA   . PHE A 1 49 ? 9.606   -5.203  -1.689  1.00 0.00 ? 86  PHE A HA   7  
ATOM 9560  H HB2  . PHE A 1 49 ? 11.020  -3.339  -2.152  1.00 0.00 ? 86  PHE A HB2  7  
ATOM 9561  H HB3  . PHE A 1 49 ? 10.506  -3.281  -3.835  1.00 0.00 ? 86  PHE A HB3  7  
ATOM 9562  H HD1  . PHE A 1 49 ? 8.898   -3.187  -0.468  1.00 0.00 ? 86  PHE A HD1  7  
ATOM 9563  H HD2  . PHE A 1 49 ? 9.124   -1.547  -4.383  1.00 0.00 ? 86  PHE A HD2  7  
ATOM 9564  H HE1  . PHE A 1 49 ? 7.184   -1.531  0.128   1.00 0.00 ? 86  PHE A HE1  7  
ATOM 9565  H HE2  . PHE A 1 49 ? 7.405   0.104   -3.798  1.00 0.00 ? 86  PHE A HE2  7  
ATOM 9566  H HZ   . PHE A 1 49 ? 6.378   0.074   -1.565  1.00 0.00 ? 86  PHE A HZ   7  
ATOM 9567  N N    . ASP A 1 50 ? 8.373   -5.088  -4.732  1.00 0.00 ? 87  ASP A N    7  
ATOM 9568  C CA   . ASP A 1 50 ? 7.145   -5.197  -5.524  1.00 0.00 ? 87  ASP A CA   7  
ATOM 9569  C C    . ASP A 1 50 ? 6.353   -6.438  -5.136  1.00 0.00 ? 87  ASP A C    7  
ATOM 9570  O O    . ASP A 1 50 ? 5.143   -6.375  -4.912  1.00 0.00 ? 87  ASP A O    7  
ATOM 9571  C CB   . ASP A 1 50 ? 7.462   -5.262  -7.020  1.00 0.00 ? 87  ASP A CB   7  
ATOM 9572  C CG   . ASP A 1 50 ? 7.532   -3.902  -7.683  1.00 0.00 ? 87  ASP A CG   7  
ATOM 9573  O OD1  . ASP A 1 50 ? 7.298   -2.883  -7.009  1.00 0.00 ? 87  ASP A OD1  7  
ATOM 9574  O OD2  . ASP A 1 50 ? 7.808   -3.848  -8.903  1.00 0.00 ? 87  ASP A OD2  7  
ATOM 9575  H H    . ASP A 1 50 ? 9.240   -5.024  -5.193  1.00 0.00 ? 87  ASP A H    7  
ATOM 9576  H HA   . ASP A 1 50 ? 6.544   -4.320  -5.328  1.00 0.00 ? 87  ASP A HA   7  
ATOM 9577  H HB2  . ASP A 1 50 ? 8.416   -5.748  -7.153  1.00 0.00 ? 87  ASP A HB2  7  
ATOM 9578  H HB3  . ASP A 1 50 ? 6.699   -5.843  -7.516  1.00 0.00 ? 87  ASP A HB3  7  
ATOM 9579  N N    . LEU A 1 51 ? 7.051   -7.563  -5.053  1.00 0.00 ? 88  LEU A N    7  
ATOM 9580  C CA   . LEU A 1 51 ? 6.433   -8.833  -4.705  1.00 0.00 ? 88  LEU A CA   7  
ATOM 9581  C C    . LEU A 1 51 ? 5.849   -8.764  -3.299  1.00 0.00 ? 88  LEU A C    7  
ATOM 9582  O O    . LEU A 1 51 ? 4.691   -9.117  -3.069  1.00 0.00 ? 88  LEU A O    7  
ATOM 9583  C CB   . LEU A 1 51 ? 7.480   -9.956  -4.817  1.00 0.00 ? 88  LEU A CB   7  
ATOM 9584  C CG   . LEU A 1 51 ? 6.980   -11.388 -4.581  1.00 0.00 ? 88  LEU A CG   7  
ATOM 9585  C CD1  . LEU A 1 51 ? 7.113   -11.780 -3.119  1.00 0.00 ? 88  LEU A CD1  7  
ATOM 9586  C CD2  . LEU A 1 51 ? 5.538   -11.528 -5.035  1.00 0.00 ? 88  LEU A CD2  7  
ATOM 9587  H H    . LEU A 1 51 ? 8.019   -7.537  -5.223  1.00 0.00 ? 88  LEU A H    7  
ATOM 9588  H HA   . LEU A 1 51 ? 5.635   -9.023  -5.406  1.00 0.00 ? 88  LEU A HA   7  
ATOM 9589  H HB2  . LEU A 1 51 ? 7.910   -9.914  -5.806  1.00 0.00 ? 88  LEU A HB2  7  
ATOM 9590  H HB3  . LEU A 1 51 ? 8.263   -9.755  -4.100  1.00 0.00 ? 88  LEU A HB3  7  
ATOM 9591  H HG   . LEU A 1 51 ? 7.583   -12.071 -5.159  1.00 0.00 ? 88  LEU A HG   7  
ATOM 9592  H HD11 . LEU A 1 51 ? 8.145   -11.692 -2.814  1.00 0.00 ? 88  LEU A HD11 7  
ATOM 9593  H HD12 . LEU A 1 51 ? 6.502   -11.129 -2.514  1.00 0.00 ? 88  LEU A HD12 7  
ATOM 9594  H HD13 . LEU A 1 51 ? 6.786   -12.801 -2.988  1.00 0.00 ? 88  LEU A HD13 7  
ATOM 9595  H HD21 . LEU A 1 51 ? 4.942   -10.756 -4.564  1.00 0.00 ? 88  LEU A HD21 7  
ATOM 9596  H HD22 . LEU A 1 51 ? 5.484   -11.417 -6.108  1.00 0.00 ? 88  LEU A HD22 7  
ATOM 9597  H HD23 . LEU A 1 51 ? 5.162   -12.499 -4.749  1.00 0.00 ? 88  LEU A HD23 7  
ATOM 9598  N N    . TYR A 1 52 ? 6.648   -8.263  -2.380  1.00 0.00 ? 89  TYR A N    7  
ATOM 9599  C CA   . TYR A 1 52 ? 6.234   -8.123  -0.998  1.00 0.00 ? 89  TYR A CA   7  
ATOM 9600  C C    . TYR A 1 52 ? 5.028   -7.198  -0.867  1.00 0.00 ? 89  TYR A C    7  
ATOM 9601  O O    . TYR A 1 52 ? 4.105   -7.473  -0.100  1.00 0.00 ? 89  TYR A O    7  
ATOM 9602  C CB   . TYR A 1 52 ? 7.388   -7.583  -0.166  1.00 0.00 ? 89  TYR A CB   7  
ATOM 9603  C CG   . TYR A 1 52 ? 8.459   -8.600  0.169   1.00 0.00 ? 89  TYR A CG   7  
ATOM 9604  C CD1  . TYR A 1 52 ? 8.652   -9.729  -0.616  1.00 0.00 ? 89  TYR A CD1  7  
ATOM 9605  C CD2  . TYR A 1 52 ? 9.279   -8.422  1.272   1.00 0.00 ? 89  TYR A CD2  7  
ATOM 9606  C CE1  . TYR A 1 52 ? 9.631   -10.653 -0.307  1.00 0.00 ? 89  TYR A CE1  7  
ATOM 9607  C CE2  . TYR A 1 52 ? 10.261  -9.337  1.587   1.00 0.00 ? 89  TYR A CE2  7  
ATOM 9608  C CZ   . TYR A 1 52 ? 10.434  -10.454 0.797   1.00 0.00 ? 89  TYR A CZ   7  
ATOM 9609  O OH   . TYR A 1 52 ? 11.405  -11.376 1.119   1.00 0.00 ? 89  TYR A OH   7  
ATOM 9610  H H    . TYR A 1 52 ? 7.552   -7.972  -2.640  1.00 0.00 ? 89  TYR A H    7  
ATOM 9611  H HA   . TYR A 1 52 ? 5.965   -9.101  -0.629  1.00 0.00 ? 89  TYR A HA   7  
ATOM 9612  H HB2  . TYR A 1 52 ? 7.860   -6.773  -0.704  1.00 0.00 ? 89  TYR A HB2  7  
ATOM 9613  H HB3  . TYR A 1 52 ? 6.992   -7.205  0.756   1.00 0.00 ? 89  TYR A HB3  7  
ATOM 9614  H HD1  . TYR A 1 52 ? 8.019   -9.883  -1.478  1.00 0.00 ? 89  TYR A HD1  7  
ATOM 9615  H HD2  . TYR A 1 52 ? 9.142   -7.547  1.890   1.00 0.00 ? 89  TYR A HD2  7  
ATOM 9616  H HE1  . TYR A 1 52 ? 9.764   -11.524 -0.936  1.00 0.00 ? 89  TYR A HE1  7  
ATOM 9617  H HE2  . TYR A 1 52 ? 10.892  -9.176  2.449   1.00 0.00 ? 89  TYR A HE2  7  
ATOM 9618  H HH   . TYR A 1 52 ? 11.357  -11.572 2.069   1.00 0.00 ? 89  TYR A HH   7  
ATOM 9619  N N    . PHE A 1 53 ? 5.065   -6.088  -1.592  1.00 0.00 ? 90  PHE A N    7  
ATOM 9620  C CA   . PHE A 1 53 ? 4.001   -5.092  -1.542  1.00 0.00 ? 90  PHE A CA   7  
ATOM 9621  C C    . PHE A 1 53 ? 2.667   -5.685  -1.972  1.00 0.00 ? 90  PHE A C    7  
ATOM 9622  O O    . PHE A 1 53 ? 1.656   -5.519  -1.290  1.00 0.00 ? 90  PHE A O    7  
ATOM 9623  C CB   . PHE A 1 53 ? 4.349   -3.904  -2.442  1.00 0.00 ? 90  PHE A CB   7  
ATOM 9624  C CG   . PHE A 1 53 ? 3.284   -2.847  -2.484  1.00 0.00 ? 90  PHE A CG   7  
ATOM 9625  C CD1  . PHE A 1 53 ? 3.113   -1.982  -1.416  1.00 0.00 ? 90  PHE A CD1  7  
ATOM 9626  C CD2  . PHE A 1 53 ? 2.466   -2.711  -3.594  1.00 0.00 ? 90  PHE A CD2  7  
ATOM 9627  C CE1  . PHE A 1 53 ? 2.141   -1.001  -1.452  1.00 0.00 ? 90  PHE A CE1  7  
ATOM 9628  C CE2  . PHE A 1 53 ? 1.493   -1.731  -3.634  1.00 0.00 ? 90  PHE A CE2  7  
ATOM 9629  C CZ   . PHE A 1 53 ? 1.300   -0.908  -2.559  1.00 0.00 ? 90  PHE A CZ   7  
ATOM 9630  H H    . PHE A 1 53 ? 5.851   -5.914  -2.160  1.00 0.00 ? 90  PHE A H    7  
ATOM 9631  H HA   . PHE A 1 53 ? 3.916   -4.746  -0.523  1.00 0.00 ? 90  PHE A HA   7  
ATOM 9632  H HB2  . PHE A 1 53 ? 5.257   -3.444  -2.083  1.00 0.00 ? 90  PHE A HB2  7  
ATOM 9633  H HB3  . PHE A 1 53 ? 4.506   -4.257  -3.452  1.00 0.00 ? 90  PHE A HB3  7  
ATOM 9634  H HD1  . PHE A 1 53 ? 3.747   -2.077  -0.548  1.00 0.00 ? 90  PHE A HD1  7  
ATOM 9635  H HD2  . PHE A 1 53 ? 2.590   -3.381  -4.430  1.00 0.00 ? 90  PHE A HD2  7  
ATOM 9636  H HE1  . PHE A 1 53 ? 2.017   -0.334  -0.614  1.00 0.00 ? 90  PHE A HE1  7  
ATOM 9637  H HE2  . PHE A 1 53 ? 0.862   -1.632  -4.504  1.00 0.00 ? 90  PHE A HE2  7  
ATOM 9638  H HZ   . PHE A 1 53 ? 0.527   -0.153  -2.587  1.00 0.00 ? 90  PHE A HZ   7  
ATOM 9639  N N    . ASN A 1 54 ? 2.664   -6.353  -3.117  1.00 0.00 ? 91  ASN A N    7  
ATOM 9640  C CA   . ASN A 1 54 ? 1.442   -6.933  -3.660  1.00 0.00 ? 91  ASN A CA   7  
ATOM 9641  C C    . ASN A 1 54 ? 0.876   -7.998  -2.726  1.00 0.00 ? 91  ASN A C    7  
ATOM 9642  O O    . ASN A 1 54 ? -0.336  -8.077  -2.527  1.00 0.00 ? 91  ASN A O    7  
ATOM 9643  C CB   . ASN A 1 54 ? 1.685   -7.505  -5.060  1.00 0.00 ? 91  ASN A CB   7  
ATOM 9644  C CG   . ASN A 1 54 ? 1.819   -6.413  -6.108  1.00 0.00 ? 91  ASN A CG   7  
ATOM 9645  O OD1  . ASN A 1 54 ? 0.880   -5.660  -6.367  1.00 0.00 ? 91  ASN A OD1  7  
ATOM 9646  N ND2  . ASN A 1 54 ? 2.990   -6.313  -6.719  1.00 0.00 ? 91  ASN A ND2  7  
ATOM 9647  H H    . ASN A 1 54 ? 3.500   -6.434  -3.626  1.00 0.00 ? 91  ASN A H    7  
ATOM 9648  H HA   . ASN A 1 54 ? 0.716   -6.136  -3.737  1.00 0.00 ? 91  ASN A HA   7  
ATOM 9649  H HB2  . ASN A 1 54 ? 2.594   -8.089  -5.051  1.00 0.00 ? 91  ASN A HB2  7  
ATOM 9650  H HB3  . ASN A 1 54 ? 0.854   -8.142  -5.332  1.00 0.00 ? 91  ASN A HB3  7  
ATOM 9651  H HD21 . ASN A 1 54 ? 3.702   -6.946  -6.468  1.00 0.00 ? 91  ASN A HD21 7  
ATOM 9652  H HD22 . ASN A 1 54 ? 3.108   -5.600  -7.387  1.00 0.00 ? 91  ASN A HD22 7  
ATOM 9653  N N    . ASN A 1 55 ? 1.757   -8.757  -2.080  1.00 0.00 ? 92  ASN A N    7  
ATOM 9654  C CA   . ASN A 1 55 ? 1.322   -9.733  -1.084  1.00 0.00 ? 92  ASN A CA   7  
ATOM 9655  C C    . ASN A 1 55 ? 0.729   -9.026  0.129   1.00 0.00 ? 92  ASN A C    7  
ATOM 9656  O O    . ASN A 1 55 ? -0.297  -9.451  0.666   1.00 0.00 ? 92  ASN A O    7  
ATOM 9657  C CB   . ASN A 1 55 ? 2.478   -10.631 -0.640  1.00 0.00 ? 92  ASN A CB   7  
ATOM 9658  C CG   . ASN A 1 55 ? 2.784   -11.732 -1.632  1.00 0.00 ? 92  ASN A CG   7  
ATOM 9659  O OD1  . ASN A 1 55 ? 1.891   -12.470 -2.060  1.00 0.00 ? 92  ASN A OD1  7  
ATOM 9660  N ND2  . ASN A 1 55 ? 4.048   -11.869 -1.993  1.00 0.00 ? 92  ASN A ND2  7  
ATOM 9661  H H    . ASN A 1 55 ? 2.717   -8.611  -2.228  1.00 0.00 ? 92  ASN A H    7  
ATOM 9662  H HA   . ASN A 1 55 ? 0.556   -10.344 -1.536  1.00 0.00 ? 92  ASN A HA   7  
ATOM 9663  H HB2  . ASN A 1 55 ? 3.366   -10.027 -0.518  1.00 0.00 ? 92  ASN A HB2  7  
ATOM 9664  H HB3  . ASN A 1 55 ? 2.225   -11.089 0.307   1.00 0.00 ? 92  ASN A HB3  7  
ATOM 9665  H HD21 . ASN A 1 55 ? 4.710   -11.255 -1.608  1.00 0.00 ? 92  ASN A HD21 7  
ATOM 9666  H HD22 . ASN A 1 55 ? 4.277   -12.588 -2.623  1.00 0.00 ? 92  ASN A HD22 7  
ATOM 9667  N N    . ALA A 1 56 ? 1.381   -7.946  0.548   1.00 0.00 ? 93  ALA A N    7  
ATOM 9668  C CA   . ALA A 1 56 ? 0.936   -7.164  1.694   1.00 0.00 ? 93  ALA A CA   7  
ATOM 9669  C C    . ALA A 1 56 ? -0.458  -6.588  1.463   1.00 0.00 ? 93  ALA A C    7  
ATOM 9670  O O    . ALA A 1 56 ? -1.297  -6.605  2.361   1.00 0.00 ? 93  ALA A O    7  
ATOM 9671  C CB   . ALA A 1 56 ? 1.929   -6.050  1.995   1.00 0.00 ? 93  ALA A CB   7  
ATOM 9672  H H    . ALA A 1 56 ? 2.195   -7.667  0.070   1.00 0.00 ? 93  ALA A H    7  
ATOM 9673  H HA   . ALA A 1 56 ? 0.902   -7.823  2.550   1.00 0.00 ? 93  ALA A HA   7  
ATOM 9674  H HB1  . ALA A 1 56 ? 2.753   -6.105  1.297   1.00 0.00 ? 93  ALA A HB1  7  
ATOM 9675  H HB2  . ALA A 1 56 ? 2.303   -6.164  3.002   1.00 0.00 ? 93  ALA A HB2  7  
ATOM 9676  H HB3  . ALA A 1 56 ? 1.437   -5.093  1.897   1.00 0.00 ? 93  ALA A HB3  7  
ATOM 9677  N N    . ILE A 1 57 ? -0.705  -6.107  0.247   1.00 0.00 ? 94  ILE A N    7  
ATOM 9678  C CA   . ILE A 1 57 ? -2.011  -5.565  -0.114  1.00 0.00 ? 94  ILE A CA   7  
ATOM 9679  C C    . ILE A 1 57 ? -3.093  -6.631  0.039   1.00 0.00 ? 94  ILE A C    7  
ATOM 9680  O O    . ILE A 1 57 ? -4.126  -6.395  0.670   1.00 0.00 ? 94  ILE A O    7  
ATOM 9681  C CB   . ILE A 1 57 ? -2.025  -5.035  -1.569  1.00 0.00 ? 94  ILE A CB   7  
ATOM 9682  C CG1  . ILE A 1 57 ? -1.083  -3.835  -1.713  1.00 0.00 ? 94  ILE A CG1  7  
ATOM 9683  C CG2  . ILE A 1 57 ? -3.439  -4.659  -1.999  1.00 0.00 ? 94  ILE A CG2  7  
ATOM 9684  C CD1  . ILE A 1 57 ? -1.497  -2.627  -0.897  1.00 0.00 ? 94  ILE A CD1  7  
ATOM 9685  H H    . ILE A 1 57 ? 0.008   -6.129  -0.428  1.00 0.00 ? 94  ILE A H    7  
ATOM 9686  H HA   . ILE A 1 57 ? -2.230  -4.743  0.552   1.00 0.00 ? 94  ILE A HA   7  
ATOM 9687  H HB   . ILE A 1 57 ? -1.681  -5.828  -2.216  1.00 0.00 ? 94  ILE A HB   7  
ATOM 9688  H HG12 . ILE A 1 57 ? -0.091  -4.123  -1.394  1.00 0.00 ? 94  ILE A HG12 7  
ATOM 9689  H HG13 . ILE A 1 57 ? -1.047  -3.538  -2.751  1.00 0.00 ? 94  ILE A HG13 7  
ATOM 9690  H HG21 . ILE A 1 57 ? -4.154  -5.124  -1.335  1.00 0.00 ? 94  ILE A HG21 7  
ATOM 9691  H HG22 . ILE A 1 57 ? -3.556  -3.586  -1.958  1.00 0.00 ? 94  ILE A HG22 7  
ATOM 9692  H HG23 . ILE A 1 57 ? -3.609  -5.002  -3.007  1.00 0.00 ? 94  ILE A HG23 7  
ATOM 9693  H HD11 . ILE A 1 57 ? -2.355  -2.879  -0.291  1.00 0.00 ? 94  ILE A HD11 7  
ATOM 9694  H HD12 . ILE A 1 57 ? -0.681  -2.326  -0.256  1.00 0.00 ? 94  ILE A HD12 7  
ATOM 9695  H HD13 . ILE A 1 57 ? -1.752  -1.815  -1.563  1.00 0.00 ? 94  ILE A HD13 7  
ATOM 9696  N N    . LYS A 1 58 ? -2.830  -7.808  -0.521  1.00 0.00 ? 95  LYS A N    7  
ATOM 9697  C CA   . LYS A 1 58 ? -3.773  -8.917  -0.462  1.00 0.00 ? 95  LYS A CA   7  
ATOM 9698  C C    . LYS A 1 58 ? -4.030  -9.348  0.978   1.00 0.00 ? 95  LYS A C    7  
ATOM 9699  O O    . LYS A 1 58 ? -5.170  -9.594  1.362   1.00 0.00 ? 95  LYS A O    7  
ATOM 9700  C CB   . LYS A 1 58 ? -3.256  -10.104 -1.275  1.00 0.00 ? 95  LYS A CB   7  
ATOM 9701  C CG   . LYS A 1 58 ? -3.091  -9.799  -2.754  1.00 0.00 ? 95  LYS A CG   7  
ATOM 9702  C CD   . LYS A 1 58 ? -2.582  -11.009 -3.517  1.00 0.00 ? 95  LYS A CD   7  
ATOM 9703  C CE   . LYS A 1 58 ? -2.441  -10.712 -5.000  1.00 0.00 ? 95  LYS A CE   7  
ATOM 9704  N NZ   . LYS A 1 58 ? -1.429  -9.655  -5.265  1.00 0.00 ? 95  LYS A NZ   7  
ATOM 9705  H H    . LYS A 1 58 ? -1.981  -7.928  -0.999  1.00 0.00 ? 95  LYS A H    7  
ATOM 9706  H HA   . LYS A 1 58 ? -4.704  -8.581  -0.892  1.00 0.00 ? 95  LYS A HA   7  
ATOM 9707  H HB2  . LYS A 1 58 ? -2.295  -10.405 -0.884  1.00 0.00 ? 95  LYS A HB2  7  
ATOM 9708  H HB3  . LYS A 1 58 ? -3.950  -10.923 -1.174  1.00 0.00 ? 95  LYS A HB3  7  
ATOM 9709  H HG2  . LYS A 1 58 ? -4.049  -9.507  -3.159  1.00 0.00 ? 95  LYS A HG2  7  
ATOM 9710  H HG3  . LYS A 1 58 ? -2.386  -8.989  -2.869  1.00 0.00 ? 95  LYS A HG3  7  
ATOM 9711  H HD2  . LYS A 1 58 ? -1.617  -11.291 -3.122  1.00 0.00 ? 95  LYS A HD2  7  
ATOM 9712  H HD3  . LYS A 1 58 ? -3.280  -11.823 -3.387  1.00 0.00 ? 95  LYS A HD3  7  
ATOM 9713  H HE2  . LYS A 1 58 ? -2.145  -11.617 -5.508  1.00 0.00 ? 95  LYS A HE2  7  
ATOM 9714  H HE3  . LYS A 1 58 ? -3.398  -10.385 -5.381  1.00 0.00 ? 95  LYS A HE3  7  
ATOM 9715  H HZ1  . LYS A 1 58 ? -0.497  -9.951  -4.901  1.00 0.00 ? 95  LYS A HZ1  7  
ATOM 9716  H HZ2  . LYS A 1 58 ? -1.349  -9.492  -6.292  1.00 0.00 ? 95  LYS A HZ2  7  
ATOM 9717  H HZ3  . LYS A 1 58 ? -1.706  -8.759  -4.805  1.00 0.00 ? 95  LYS A HZ3  7  
ATOM 9718  N N    . LYS A 1 59 ? -2.970  -9.428  1.772   1.00 0.00 ? 96  LYS A N    7  
ATOM 9719  C CA   . LYS A 1 59 ? -3.100  -9.807  3.172   1.00 0.00 ? 96  LYS A CA   7  
ATOM 9720  C C    . LYS A 1 59 ? -3.823  -8.719  3.956   1.00 0.00 ? 96  LYS A C    7  
ATOM 9721  O O    . LYS A 1 59 ? -4.585  -9.002  4.876   1.00 0.00 ? 96  LYS A O    7  
ATOM 9722  C CB   . LYS A 1 59 ? -1.725  -10.061 3.793   1.00 0.00 ? 96  LYS A CB   7  
ATOM 9723  C CG   . LYS A 1 59 ? -1.786  -10.406 5.274   1.00 0.00 ? 96  LYS A CG   7  
ATOM 9724  C CD   . LYS A 1 59 ? -2.343  -11.801 5.506   1.00 0.00 ? 96  LYS A CD   7  
ATOM 9725  C CE   . LYS A 1 59 ? -2.405  -12.135 6.989   1.00 0.00 ? 96  LYS A CE   7  
ATOM 9726  N NZ   . LYS A 1 59 ? -1.077  -12.004 7.642   1.00 0.00 ? 96  LYS A NZ   7  
ATOM 9727  H H    . LYS A 1 59 ? -2.083  -9.215  1.411   1.00 0.00 ? 96  LYS A H    7  
ATOM 9728  H HA   . LYS A 1 59 ? -3.681  -10.716 3.218   1.00 0.00 ? 96  LYS A HA   7  
ATOM 9729  H HB2  . LYS A 1 59 ? -1.254  -10.883 3.276   1.00 0.00 ? 96  LYS A HB2  7  
ATOM 9730  H HB3  . LYS A 1 59 ? -1.119  -9.176  3.677   1.00 0.00 ? 96  LYS A HB3  7  
ATOM 9731  H HG2  . LYS A 1 59 ? -0.792  -10.353 5.689   1.00 0.00 ? 96  LYS A HG2  7  
ATOM 9732  H HG3  . LYS A 1 59 ? -2.425  -9.689  5.770   1.00 0.00 ? 96  LYS A HG3  7  
ATOM 9733  H HD2  . LYS A 1 59 ? -3.341  -11.852 5.093   1.00 0.00 ? 96  LYS A HD2  7  
ATOM 9734  H HD3  . LYS A 1 59 ? -1.710  -12.520 5.009   1.00 0.00 ? 96  LYS A HD3  7  
ATOM 9735  H HE2  . LYS A 1 59 ? -3.100  -11.462 7.468   1.00 0.00 ? 96  LYS A HE2  7  
ATOM 9736  H HE3  . LYS A 1 59 ? -2.754  -13.152 7.101   1.00 0.00 ? 96  LYS A HE3  7  
ATOM 9737  H HZ1  . LYS A 1 59 ? -0.326  -11.917 6.924   1.00 0.00 ? 96  LYS A HZ1  7  
ATOM 9738  H HZ2  . LYS A 1 59 ? -1.063  -11.157 8.254   1.00 0.00 ? 96  LYS A HZ2  7  
ATOM 9739  H HZ3  . LYS A 1 59 ? -0.882  -12.842 8.232   1.00 0.00 ? 96  LYS A HZ3  7  
ATOM 9740  N N    . GLY A 1 60 ? -3.524  -7.478  3.628   1.00 0.00 ? 97  GLY A N    7  
ATOM 9741  C CA   . GLY A 1 60 ? -4.089  -6.364  4.352   1.00 0.00 ? 97  GLY A CA   7  
ATOM 9742  C C    . GLY A 1 60 ? -5.594  -6.271  4.223   1.00 0.00 ? 97  GLY A C    7  
ATOM 9743  O O    . GLY A 1 60 ? -6.280  -5.972  5.197   1.00 0.00 ? 97  GLY A O    7  
ATOM 9744  H H    . GLY A 1 60 ? -2.865  -7.313  2.915   1.00 0.00 ? 97  GLY A H    7  
ATOM 9745  H HA2  . GLY A 1 60 ? -3.837  -6.468  5.397   1.00 0.00 ? 97  GLY A HA2  7  
ATOM 9746  H HA3  . GLY A 1 60 ? -3.650  -5.450  3.979   1.00 0.00 ? 97  GLY A HA3  7  
ATOM 9747  N N    . VAL A 1 61 ? -6.110  -6.464  3.018   1.00 0.00 ? 98  VAL A N    7  
ATOM 9748  C CA   . VAL A 1 61 ? -7.545  -6.335  2.792   1.00 0.00 ? 98  VAL A CA   7  
ATOM 9749  C C    . VAL A 1 61 ? -8.328  -7.403  3.558   1.00 0.00 ? 98  VAL A C    7  
ATOM 9750  O O    . VAL A 1 61 ? -9.381  -7.115  4.130   1.00 0.00 ? 98  VAL A O    7  
ATOM 9751  C CB   . VAL A 1 61 ? -7.916  -6.368  1.288   1.00 0.00 ? 98  VAL A CB   7  
ATOM 9752  C CG1  . VAL A 1 61 ? -7.313  -5.173  0.568   1.00 0.00 ? 98  VAL A CG1  7  
ATOM 9753  C CG2  . VAL A 1 61 ? -7.466  -7.660  0.632   1.00 0.00 ? 98  VAL A CG2  7  
ATOM 9754  H H    . VAL A 1 61 ? -5.513  -6.653  2.259   1.00 0.00 ? 98  VAL A H    7  
ATOM 9755  H HA   . VAL A 1 61 ? -7.839  -5.367  3.178   1.00 0.00 ? 98  VAL A HA   7  
ATOM 9756  H HB   . VAL A 1 61 ? -8.990  -6.301  1.202   1.00 0.00 ? 98  VAL A HB   7  
ATOM 9757  H HG11 . VAL A 1 61 ? -6.290  -5.039  0.886   1.00 0.00 ? 98  VAL A HG11 7  
ATOM 9758  H HG12 . VAL A 1 61 ? -7.339  -5.346  -0.497  1.00 0.00 ? 98  VAL A HG12 7  
ATOM 9759  H HG13 . VAL A 1 61 ? -7.882  -4.287  0.801   1.00 0.00 ? 98  VAL A HG13 7  
ATOM 9760  H HG21 . VAL A 1 61 ? -6.927  -8.258  1.351   1.00 0.00 ? 98  VAL A HG21 7  
ATOM 9761  H HG22 . VAL A 1 61 ? -8.328  -8.204  0.281   1.00 0.00 ? 98  VAL A HG22 7  
ATOM 9762  H HG23 . VAL A 1 61 ? -6.820  -7.432  -0.202  1.00 0.00 ? 98  VAL A HG23 7  
ATOM 9763  N N    . GLU A 1 62 ? -7.770  -8.607  3.644   1.00 0.00 ? 99  GLU A N    7  
ATOM 9764  C CA   . GLU A 1 62 ? -8.396  -9.690  4.402   1.00 0.00 ? 99  GLU A CA   7  
ATOM 9765  C C    . GLU A 1 62 ? -8.210  -9.505  5.907   1.00 0.00 ? 99  GLU A C    7  
ATOM 9766  O O    . GLU A 1 62 ? -9.114  -9.801  6.687   1.00 0.00 ? 99  GLU A O    7  
ATOM 9767  C CB   . GLU A 1 62 ? -7.840  -11.051 3.977   1.00 0.00 ? 99  GLU A CB   7  
ATOM 9768  C CG   . GLU A 1 62 ? -6.348  -11.053 3.720   1.00 0.00 ? 99  GLU A CG   7  
ATOM 9769  C CD   . GLU A 1 62 ? -5.760  -12.449 3.707   1.00 0.00 ? 99  GLU A CD   7  
ATOM 9770  O OE1  . GLU A 1 62 ? -5.944  -13.179 4.701   1.00 0.00 ? 99  GLU A OE1  7  
ATOM 9771  O OE2  . GLU A 1 62 ? -5.107  -12.822 2.710   1.00 0.00 ? 99  GLU A OE2  7  
ATOM 9772  H H    . GLU A 1 62 ? -6.896  -8.760  3.226   1.00 0.00 ? 99  GLU A H    7  
ATOM 9773  H HA   . GLU A 1 62 ? -9.453  -9.667  4.185   1.00 0.00 ? 99  GLU A HA   7  
ATOM 9774  H HB2  . GLU A 1 62 ? -8.043  -11.766 4.759   1.00 0.00 ? 99  GLU A HB2  7  
ATOM 9775  H HB3  . GLU A 1 62 ? -8.341  -11.365 3.073   1.00 0.00 ? 99  GLU A HB3  7  
ATOM 9776  H HG2  . GLU A 1 62 ? -6.164  -10.597 2.757   1.00 0.00 ? 99  GLU A HG2  7  
ATOM 9777  H HG3  . GLU A 1 62 ? -5.857  -10.470 4.490   1.00 0.00 ? 99  GLU A HG3  7  
ATOM 9778  N N    . ALA A 1 63 ? -7.013  -9.100  6.314   1.00 0.00 ? 100 ALA A N    7  
ATOM 9779  C CA   . ALA A 1 63 ? -6.694  -8.948  7.731   1.00 0.00 ? 100 ALA A CA   7  
ATOM 9780  C C    . ALA A 1 63 ? -7.490  -7.810  8.357   1.00 0.00 ? 100 ALA A C    7  
ATOM 9781  O O    . ALA A 1 63 ? -7.732  -7.799  9.565   1.00 0.00 ? 100 ALA A O    7  
ATOM 9782  C CB   . ALA A 1 63 ? -5.204  -8.712  7.919   1.00 0.00 ? 100 ALA A CB   7  
ATOM 9783  H H    . ALA A 1 63 ? -6.306  -8.949  5.646   1.00 0.00 ? 100 ALA A H    7  
ATOM 9784  H HA   . ALA A 1 63 ? -6.953  -9.870  8.230   1.00 0.00 ? 100 ALA A HA   7  
ATOM 9785  H HB1  . ALA A 1 63 ? -5.044  -7.731  8.343   1.00 0.00 ? 100 ALA A HB1  7  
ATOM 9786  H HB2  . ALA A 1 63 ? -4.803  -9.461  8.588   1.00 0.00 ? 100 ALA A HB2  7  
ATOM 9787  H HB3  . ALA A 1 63 ? -4.704  -8.778  6.965   1.00 0.00 ? 100 ALA A HB3  7  
ATOM 9788  N N    . GLY A 1 64 ? -7.828  -6.824  7.544   1.00 0.00 ? 101 GLY A N    7  
ATOM 9789  C CA   . GLY A 1 64 ? -8.525  -5.656  8.043   1.00 0.00 ? 101 GLY A CA   7  
ATOM 9790  C C    . GLY A 1 64 ? -7.587  -4.483  8.205   1.00 0.00 ? 101 GLY A C    7  
ATOM 9791  O O    . GLY A 1 64 ? -7.665  -3.729  9.177   1.00 0.00 ? 101 GLY A O    7  
ATOM 9792  H H    . GLY A 1 64 ? -7.560  -6.864  6.601   1.00 0.00 ? 101 GLY A H    7  
ATOM 9793  H HA2  . GLY A 1 64 ? -9.307  -5.389  7.348   1.00 0.00 ? 101 GLY A HA2  7  
ATOM 9794  H HA3  . GLY A 1 64 ? -8.966  -5.889  9.000   1.00 0.00 ? 101 GLY A HA3  7  
ATOM 9795  N N    . ASP A 1 65 ? -6.697  -4.333  7.240   1.00 0.00 ? 102 ASP A N    7  
ATOM 9796  C CA   . ASP A 1 65 ? -5.724  -3.260  7.240   1.00 0.00 ? 102 ASP A CA   7  
ATOM 9797  C C    . ASP A 1 65 ? -6.031  -2.316  6.094   1.00 0.00 ? 102 ASP A C    7  
ATOM 9798  O O    . ASP A 1 65 ? -6.010  -1.096  6.252   1.00 0.00 ? 102 ASP A O    7  
ATOM 9799  C CB   . ASP A 1 65 ? -4.307  -3.806  7.043   1.00 0.00 ? 102 ASP A CB   7  
ATOM 9800  C CG   . ASP A 1 65 ? -3.897  -4.863  8.048   1.00 0.00 ? 102 ASP A CG   7  
ATOM 9801  O OD1  . ASP A 1 65 ? -4.568  -4.970  9.097   1.00 0.00 ? 102 ASP A OD1  7  
ATOM 9802  O OD2  . ASP A 1 65 ? -2.933  -5.615  7.787   1.00 0.00 ? 102 ASP A OD2  7  
ATOM 9803  H H    . ASP A 1 65 ? -6.680  -4.982  6.505   1.00 0.00 ? 102 ASP A H    7  
ATOM 9804  H HA   . ASP A 1 65 ? -5.788  -2.730  8.178   1.00 0.00 ? 102 ASP A HA   7  
ATOM 9805  H HB2  . ASP A 1 65 ? -4.231  -4.232  6.057   1.00 0.00 ? 102 ASP A HB2  7  
ATOM 9806  H HB3  . ASP A 1 65 ? -3.613  -2.986  7.118   1.00 0.00 ? 102 ASP A HB3  7  
ATOM 9807  N N    . PHE A 1 66 ? -6.335  -2.896  4.937   1.00 0.00 ? 103 PHE A N    7  
ATOM 9808  C CA   . PHE A 1 66 ? -6.618  -2.114  3.741   1.00 0.00 ? 103 PHE A CA   7  
ATOM 9809  C C    . PHE A 1 66 ? -7.938  -2.550  3.113   1.00 0.00 ? 103 PHE A C    7  
ATOM 9810  O O    . PHE A 1 66 ? -8.471  -3.605  3.445   1.00 0.00 ? 103 PHE A O    7  
ATOM 9811  C CB   . PHE A 1 66 ? -5.488  -2.263  2.712   1.00 0.00 ? 103 PHE A CB   7  
ATOM 9812  C CG   . PHE A 1 66 ? -4.109  -2.346  3.308   1.00 0.00 ? 103 PHE A CG   7  
ATOM 9813  C CD1  . PHE A 1 66 ? -3.553  -1.268  3.976   1.00 0.00 ? 103 PHE A CD1  7  
ATOM 9814  C CD2  . PHE A 1 66 ? -3.367  -3.508  3.192   1.00 0.00 ? 103 PHE A CD2  7  
ATOM 9815  C CE1  . PHE A 1 66 ? -2.289  -1.351  4.522   1.00 0.00 ? 103 PHE A CE1  7  
ATOM 9816  C CE2  . PHE A 1 66 ? -2.101  -3.599  3.736   1.00 0.00 ? 103 PHE A CE2  7  
ATOM 9817  C CZ   . PHE A 1 66 ? -1.560  -2.518  4.403   1.00 0.00 ? 103 PHE A CZ   7  
ATOM 9818  H H    . PHE A 1 66 ? -6.372  -3.879  4.885   1.00 0.00 ? 103 PHE A H    7  
ATOM 9819  H HA   . PHE A 1 66 ? -6.695  -1.077  4.033   1.00 0.00 ? 103 PHE A HA   7  
ATOM 9820  H HB2  . PHE A 1 66 ? -5.652  -3.162  2.138   1.00 0.00 ? 103 PHE A HB2  7  
ATOM 9821  H HB3  . PHE A 1 66 ? -5.507  -1.412  2.048   1.00 0.00 ? 103 PHE A HB3  7  
ATOM 9822  H HD1  . PHE A 1 66 ? -4.122  -0.356  4.072   1.00 0.00 ? 103 PHE A HD1  7  
ATOM 9823  H HD2  . PHE A 1 66 ? -3.790  -4.354  2.671   1.00 0.00 ? 103 PHE A HD2  7  
ATOM 9824  H HE1  . PHE A 1 66 ? -1.866  -0.502  5.039   1.00 0.00 ? 103 PHE A HE1  7  
ATOM 9825  H HE2  . PHE A 1 66 ? -1.536  -4.515  3.641   1.00 0.00 ? 103 PHE A HE2  7  
ATOM 9826  H HZ   . PHE A 1 66 ? -0.570  -2.584  4.828   1.00 0.00 ? 103 PHE A HZ   7  
ATOM 9827  N N    . GLU A 1 67 ? -8.449  -1.735  2.208   1.00 0.00 ? 104 GLU A N    7  
ATOM 9828  C CA   . GLU A 1 67 ? -9.688  -2.016  1.497   1.00 0.00 ? 104 GLU A CA   7  
ATOM 9829  C C    . GLU A 1 67 ? -9.564  -1.563  0.053   1.00 0.00 ? 104 GLU A C    7  
ATOM 9830  O O    . GLU A 1 67 ? -8.928  -0.547  -0.231  1.00 0.00 ? 104 GLU A O    7  
ATOM 9831  C CB   . GLU A 1 67 ? -10.871 -1.306  2.154   1.00 0.00 ? 104 GLU A CB   7  
ATOM 9832  C CG   . GLU A 1 67 ? -11.585 -2.145  3.193   1.00 0.00 ? 104 GLU A CG   7  
ATOM 9833  C CD   . GLU A 1 67 ? -12.814 -1.463  3.749   1.00 0.00 ? 104 GLU A CD   7  
ATOM 9834  O OE1  . GLU A 1 67 ? -13.701 -1.084  2.955   1.00 0.00 ? 104 GLU A OE1  7  
ATOM 9835  O OE2  . GLU A 1 67 ? -12.910 -1.319  4.984   1.00 0.00 ? 104 GLU A OE2  7  
ATOM 9836  H H    . GLU A 1 67 ? -7.970  -0.906  1.995   1.00 0.00 ? 104 GLU A H    7  
ATOM 9837  H HA   . GLU A 1 67 ? -9.853  -3.083  1.522   1.00 0.00 ? 104 GLU A HA   7  
ATOM 9838  H HB2  . GLU A 1 67 ? -10.513 -0.405  2.633   1.00 0.00 ? 104 GLU A HB2  7  
ATOM 9839  H HB3  . GLU A 1 67 ? -11.582 -1.036  1.389   1.00 0.00 ? 104 GLU A HB3  7  
ATOM 9840  H HG2  . GLU A 1 67 ? -11.887 -3.075  2.736   1.00 0.00 ? 104 GLU A HG2  7  
ATOM 9841  H HG3  . GLU A 1 67 ? -10.904 -2.349  4.006   1.00 0.00 ? 104 GLU A HG3  7  
ATOM 9842  N N    . GLN A 1 68 ? -10.137 -2.335  -0.856  1.00 0.00 ? 105 GLN A N    7  
ATOM 9843  C CA   . GLN A 1 68 ? -10.076 -2.010  -2.273  1.00 0.00 ? 105 GLN A CA   7  
ATOM 9844  C C    . GLN A 1 68 ? -11.472 -1.707  -2.813  1.00 0.00 ? 105 GLN A C    7  
ATOM 9845  O O    . GLN A 1 68 ? -12.369 -2.546  -2.746  1.00 0.00 ? 105 GLN A O    7  
ATOM 9846  C CB   . GLN A 1 68 ? -9.443  -3.167  -3.049  1.00 0.00 ? 105 GLN A CB   7  
ATOM 9847  C CG   . GLN A 1 68 ? -8.007  -3.454  -2.639  1.00 0.00 ? 105 GLN A CG   7  
ATOM 9848  C CD   . GLN A 1 68 ? -7.453  -4.716  -3.270  1.00 0.00 ? 105 GLN A CD   7  
ATOM 9849  O OE1  . GLN A 1 68 ? -7.990  -5.808  -3.085  1.00 0.00 ? 105 GLN A OE1  7  
ATOM 9850  N NE2  . GLN A 1 68 ? -6.366  -4.576  -4.013  1.00 0.00 ? 105 GLN A NE2  7  
ATOM 9851  H H    . GLN A 1 68 ? -10.612 -3.142  -0.569  1.00 0.00 ? 105 GLN A H    7  
ATOM 9852  H HA   . GLN A 1 68 ? -9.460  -1.131  -2.384  1.00 0.00 ? 105 GLN A HA   7  
ATOM 9853  H HB2  . GLN A 1 68 ? -10.029 -4.060  -2.886  1.00 0.00 ? 105 GLN A HB2  7  
ATOM 9854  H HB3  . GLN A 1 68 ? -9.454  -2.928  -4.101  1.00 0.00 ? 105 GLN A HB3  7  
ATOM 9855  H HG2  . GLN A 1 68 ? -7.388  -2.621  -2.939  1.00 0.00 ? 105 GLN A HG2  7  
ATOM 9856  H HG3  . GLN A 1 68 ? -7.968  -3.560  -1.563  1.00 0.00 ? 105 GLN A HG3  7  
ATOM 9857  H HE21 . GLN A 1 68 ? -5.987  -3.677  -4.112  1.00 0.00 ? 105 GLN A HE21 7  
ATOM 9858  H HE22 . GLN A 1 68 ? -5.976  -5.378  -4.419  1.00 0.00 ? 105 GLN A HE22 7  
ATOM 9859  N N    . PRO A 1 69 ? -11.690 -0.473  -3.294  1.00 0.00 ? 106 PRO A N    7  
ATOM 9860  C CA   . PRO A 1 69 ? -12.997 -0.031  -3.794  1.00 0.00 ? 106 PRO A CA   7  
ATOM 9861  C C    . PRO A 1 69 ? -13.454 -0.817  -5.021  1.00 0.00 ? 106 PRO A C    7  
ATOM 9862  O O    . PRO A 1 69 ? -14.629 -1.157  -5.148  1.00 0.00 ? 106 PRO A O    7  
ATOM 9863  C CB   . PRO A 1 69 ? -12.771 1.441   -4.160  1.00 0.00 ? 106 PRO A CB   7  
ATOM 9864  C CG   . PRO A 1 69 ? -11.546 1.841   -3.412  1.00 0.00 ? 106 PRO A CG   7  
ATOM 9865  C CD   . PRO A 1 69 ? -10.697 0.608   -3.335  1.00 0.00 ? 106 PRO A CD   7  
ATOM 9866  H HA   . PRO A 1 69 ? -13.754 -0.100  -3.027  1.00 0.00 ? 106 PRO A HA   7  
ATOM 9867  H HB2  . PRO A 1 69 ? -12.629 1.531   -5.228  1.00 0.00 ? 106 PRO A HB2  7  
ATOM 9868  H HB3  . PRO A 1 69 ? -13.626 2.026   -3.856  1.00 0.00 ? 106 PRO A HB3  7  
ATOM 9869  H HG2  . PRO A 1 69 ? -11.028 2.622   -3.946  1.00 0.00 ? 106 PRO A HG2  7  
ATOM 9870  H HG3  . PRO A 1 69 ? -11.813 2.175   -2.422  1.00 0.00 ? 106 PRO A HG3  7  
ATOM 9871  H HD2  . PRO A 1 69 ? -10.068 0.525   -4.211  1.00 0.00 ? 106 PRO A HD2  7  
ATOM 9872  H HD3  . PRO A 1 69 ? -10.099 0.618   -2.437  1.00 0.00 ? 106 PRO A HD3  7  
ATOM 9873  N N    . LYS A 1 70 ? -12.530 -1.080  -5.936  1.00 0.00 ? 107 LYS A N    7  
ATOM 9874  C CA   . LYS A 1 70 ? -12.868 -1.785  -7.164  1.00 0.00 ? 107 LYS A CA   7  
ATOM 9875  C C    . LYS A 1 70 ? -12.868 -3.290  -6.939  1.00 0.00 ? 107 LYS A C    7  
ATOM 9876  O O    . LYS A 1 70 ? -13.889 -3.959  -7.113  1.00 0.00 ? 107 LYS A O    7  
ATOM 9877  C CB   . LYS A 1 70 ? -11.877 -1.439  -8.280  1.00 0.00 ? 107 LYS A CB   7  
ATOM 9878  C CG   . LYS A 1 70 ? -11.781 0.046   -8.593  1.00 0.00 ? 107 LYS A CG   7  
ATOM 9879  C CD   . LYS A 1 70 ? -10.945 0.299   -9.840  1.00 0.00 ? 107 LYS A CD   7  
ATOM 9880  C CE   . LYS A 1 70 ? -9.538  -0.260  -9.699  1.00 0.00 ? 107 LYS A CE   7  
ATOM 9881  N NZ   . LYS A 1 70 ? -8.727  -0.065  -10.931 1.00 0.00 ? 107 LYS A NZ   7  
ATOM 9882  H H    . LYS A 1 70 ? -11.613 -0.777  -5.791  1.00 0.00 ? 107 LYS A H    7  
ATOM 9883  H HA   . LYS A 1 70 ? -13.859 -1.475  -7.464  1.00 0.00 ? 107 LYS A HA   7  
ATOM 9884  H HB2  . LYS A 1 70 ? -10.896 -1.787  -7.991  1.00 0.00 ? 107 LYS A HB2  7  
ATOM 9885  H HB3  . LYS A 1 70 ? -12.177 -1.955  -9.180  1.00 0.00 ? 107 LYS A HB3  7  
ATOM 9886  H HG2  . LYS A 1 70 ? -12.776 0.436   -8.753  1.00 0.00 ? 107 LYS A HG2  7  
ATOM 9887  H HG3  . LYS A 1 70 ? -11.326 0.553   -7.754  1.00 0.00 ? 107 LYS A HG3  7  
ATOM 9888  H HD2  . LYS A 1 70 ? -11.424 -0.173  -10.684 1.00 0.00 ? 107 LYS A HD2  7  
ATOM 9889  H HD3  . LYS A 1 70 ? -10.884 1.365   -10.010 1.00 0.00 ? 107 LYS A HD3  7  
ATOM 9890  H HE2  . LYS A 1 70 ? -9.047  0.240   -8.876  1.00 0.00 ? 107 LYS A HE2  7  
ATOM 9891  H HE3  . LYS A 1 70 ? -9.604  -1.317  -9.486  1.00 0.00 ? 107 LYS A HE3  7  
ATOM 9892  H HZ1  . LYS A 1 70 ? -9.169  0.648   -11.548 1.00 0.00 ? 107 LYS A HZ1  7  
ATOM 9893  H HZ2  . LYS A 1 70 ? -7.764  0.256   -10.681 1.00 0.00 ? 107 LYS A HZ2  7  
ATOM 9894  H HZ3  . LYS A 1 70 ? -8.653  -0.961  -11.457 1.00 0.00 ? 107 LYS A HZ3  7  
ATOM 9895  N N    . GLY A 1 71 ? -11.717 -3.812  -6.546  1.00 0.00 ? 108 GLY A N    7  
ATOM 9896  C CA   . GLY A 1 71 ? -11.577 -5.227  -6.306  1.00 0.00 ? 108 GLY A CA   7  
ATOM 9897  C C    . GLY A 1 71 ? -10.123 -5.627  -6.252  1.00 0.00 ? 108 GLY A C    7  
ATOM 9898  O O    . GLY A 1 71 ? -9.268  -4.792  -5.949  1.00 0.00 ? 108 GLY A O    7  
ATOM 9899  H H    . GLY A 1 71 ? -10.942 -3.228  -6.426  1.00 0.00 ? 108 GLY A H    7  
ATOM 9900  H HA2  . GLY A 1 71 ? -12.047 -5.475  -5.366  1.00 0.00 ? 108 GLY A HA2  7  
ATOM 9901  H HA3  . GLY A 1 71 ? -12.064 -5.772  -7.100  1.00 0.00 ? 108 GLY A HA3  7  
ATOM 9902  N N    . PRO A 1 72 ? -9.804  -6.885  -6.582  1.00 0.00 ? 109 PRO A N    7  
ATOM 9903  C CA   . PRO A 1 72 ? -8.425  -7.383  -6.577  1.00 0.00 ? 109 PRO A CA   7  
ATOM 9904  C C    . PRO A 1 72 ? -7.503  -6.577  -7.483  1.00 0.00 ? 109 PRO A C    7  
ATOM 9905  O O    . PRO A 1 72 ? -7.828  -6.314  -8.646  1.00 0.00 ? 109 PRO A O    7  
ATOM 9906  C CB   . PRO A 1 72 ? -8.554  -8.817  -7.094  1.00 0.00 ? 109 PRO A CB   7  
ATOM 9907  C CG   . PRO A 1 72 ? -9.969  -9.192  -6.835  1.00 0.00 ? 109 PRO A CG   7  
ATOM 9908  C CD   . PRO A 1 72 ? -10.761 -7.925  -6.991  1.00 0.00 ? 109 PRO A CD   7  
ATOM 9909  H HA   . PRO A 1 72 ? -8.018  -7.399  -5.576  1.00 0.00 ? 109 PRO A HA   7  
ATOM 9910  H HB2  . PRO A 1 72 ? -8.326  -8.841  -8.150  1.00 0.00 ? 109 PRO A HB2  7  
ATOM 9911  H HB3  . PRO A 1 72 ? -7.871  -9.455  -6.557  1.00 0.00 ? 109 PRO A HB3  7  
ATOM 9912  H HG2  . PRO A 1 72 ? -10.294 -9.929  -7.555  1.00 0.00 ? 109 PRO A HG2  7  
ATOM 9913  H HG3  . PRO A 1 72 ? -10.071 -9.576  -5.831  1.00 0.00 ? 109 PRO A HG3  7  
ATOM 9914  H HD2  . PRO A 1 72 ? -11.061 -7.791  -8.020  1.00 0.00 ? 109 PRO A HD2  7  
ATOM 9915  H HD3  . PRO A 1 72 ? -11.622 -7.936  -6.341  1.00 0.00 ? 109 PRO A HD3  7  
ATOM 9916  N N    . ALA A 1 73 ? -6.336  -6.239  -6.945  1.00 0.00 ? 110 ALA A N    7  
ATOM 9917  C CA   . ALA A 1 73 ? -5.292  -5.521  -7.673  1.00 0.00 ? 110 ALA A CA   7  
ATOM 9918  C C    . ALA A 1 73 ? -5.763  -4.151  -8.160  1.00 0.00 ? 110 ALA A C    7  
ATOM 9919  O O    . ALA A 1 73 ? -5.223  -3.607  -9.123  1.00 0.00 ? 110 ALA A O    7  
ATOM 9920  C CB   . ALA A 1 73 ? -4.786  -6.361  -8.838  1.00 0.00 ? 110 ALA A CB   7  
ATOM 9921  H H    . ALA A 1 73 ? -6.146  -6.533  -6.026  1.00 0.00 ? 110 ALA A H    7  
ATOM 9922  H HA   . ALA A 1 73 ? -4.466  -5.374  -6.993  1.00 0.00 ? 110 ALA A HA   7  
ATOM 9923  H HB1  . ALA A 1 73 ? -4.791  -5.765  -9.739  1.00 0.00 ? 110 ALA A HB1  7  
ATOM 9924  H HB2  . ALA A 1 73 ? -3.781  -6.695  -8.632  1.00 0.00 ? 110 ALA A HB2  7  
ATOM 9925  H HB3  . ALA A 1 73 ? -5.430  -7.217  -8.969  1.00 0.00 ? 110 ALA A HB3  7  
ATOM 9926  N N    . GLY A 1 74 ? -6.698  -3.556  -7.435  1.00 0.00 ? 111 GLY A N    7  
ATOM 9927  C CA   . GLY A 1 74 ? -7.146  -2.222  -7.774  1.00 0.00 ? 111 GLY A CA   7  
ATOM 9928  C C    . GLY A 1 74 ? -6.601  -1.179  -6.822  1.00 0.00 ? 111 GLY A C    7  
ATOM 9929  O O    . GLY A 1 74 ? -5.645  -1.445  -6.090  1.00 0.00 ? 111 GLY A O    7  
ATOM 9930  H H    . GLY A 1 74 ? -7.042  -4.003  -6.631  1.00 0.00 ? 111 GLY A H    7  
ATOM 9931  H HA2  . GLY A 1 74 ? -6.821  -1.988  -8.778  1.00 0.00 ? 111 GLY A HA2  7  
ATOM 9932  H HA3  . GLY A 1 74 ? -8.225  -2.195  -7.740  1.00 0.00 ? 111 GLY A HA3  7  
ATOM 9933  N N    . ALA A 1 75 ? -7.268  -0.029  -6.763  1.00 0.00 ? 112 ALA A N    7  
ATOM 9934  C CA   . ALA A 1 75 ? -6.897  1.029   -5.829  1.00 0.00 ? 112 ALA A CA   7  
ATOM 9935  C C    . ALA A 1 75 ? -7.069  0.558   -4.396  1.00 0.00 ? 112 ALA A C    7  
ATOM 9936  O O    . ALA A 1 75 ? -7.948  -0.254  -4.104  1.00 0.00 ? 112 ALA A O    7  
ATOM 9937  C CB   . ALA A 1 75 ? -7.733  2.280   -6.067  1.00 0.00 ? 112 ALA A CB   7  
ATOM 9938  H H    . ALA A 1 75 ? -8.056  0.091   -7.325  1.00 0.00 ? 112 ALA A H    7  
ATOM 9939  H HA   . ALA A 1 75 ? -5.859  1.278   -5.995  1.00 0.00 ? 112 ALA A HA   7  
ATOM 9940  H HB1  . ALA A 1 75 ? -7.921  2.394   -7.125  1.00 0.00 ? 112 ALA A HB1  7  
ATOM 9941  H HB2  . ALA A 1 75 ? -8.670  2.193   -5.540  1.00 0.00 ? 112 ALA A HB2  7  
ATOM 9942  H HB3  . ALA A 1 75 ? -7.197  3.148   -5.702  1.00 0.00 ? 112 ALA A HB3  7  
ATOM 9943  N N    . VAL A 1 76 ? -6.240  1.071   -3.506  1.00 0.00 ? 113 VAL A N    7  
ATOM 9944  C CA   . VAL A 1 76 ? -6.328  0.721   -2.100  1.00 0.00 ? 113 VAL A CA   7  
ATOM 9945  C C    . VAL A 1 76 ? -6.643  1.954   -1.269  1.00 0.00 ? 113 VAL A C    7  
ATOM 9946  O O    . VAL A 1 76 ? -6.282  3.073   -1.636  1.00 0.00 ? 113 VAL A O    7  
ATOM 9947  C CB   . VAL A 1 76 ? -5.018  0.081   -1.577  1.00 0.00 ? 113 VAL A CB   7  
ATOM 9948  C CG1  . VAL A 1 76 ? -5.178  -0.410  -0.140  1.00 0.00 ? 113 VAL A CG1  7  
ATOM 9949  C CG2  . VAL A 1 76 ? -4.577  -1.059  -2.482  1.00 0.00 ? 113 VAL A CG2  7  
ATOM 9950  H H    . VAL A 1 76 ? -5.576  1.731   -3.794  1.00 0.00 ? 113 VAL A H    7  
ATOM 9951  H HA   . VAL A 1 76 ? -7.128  0.004   -1.984  1.00 0.00 ? 113 VAL A HA   7  
ATOM 9952  H HB   . VAL A 1 76 ? -4.247  0.835   -1.588  1.00 0.00 ? 113 VAL A HB   7  
ATOM 9953  H HG11 . VAL A 1 76 ? -5.548  0.398   0.487   1.00 0.00 ? 113 VAL A HG11 7  
ATOM 9954  H HG12 . VAL A 1 76 ? -5.880  -1.229  -0.115  1.00 0.00 ? 113 VAL A HG12 7  
ATOM 9955  H HG13 . VAL A 1 76 ? -4.224  -0.743  0.234   1.00 0.00 ? 113 VAL A HG13 7  
ATOM 9956  H HG21 . VAL A 1 76 ? -5.318  -1.213  -3.251  1.00 0.00 ? 113 VAL A HG21 7  
ATOM 9957  H HG22 . VAL A 1 76 ? -3.630  -0.812  -2.936  1.00 0.00 ? 113 VAL A HG22 7  
ATOM 9958  H HG23 . VAL A 1 76 ? -4.471  -1.962  -1.897  1.00 0.00 ? 113 VAL A HG23 7  
ATOM 9959  N N    . LYS A 1 77 ? -7.276  1.725   -0.138  1.00 0.00 ? 114 LYS A N    7  
ATOM 9960  C CA   . LYS A 1 77 ? -7.554  2.760   0.832   1.00 0.00 ? 114 LYS A CA   7  
ATOM 9961  C C    . LYS A 1 77 ? -7.765  2.102   2.178   1.00 0.00 ? 114 LYS A C    7  
ATOM 9962  O O    . LYS A 1 77 ? -7.964  0.889   2.231   1.00 0.00 ? 114 LYS A O    7  
ATOM 9963  C CB   . LYS A 1 77 ? -8.751  3.611   0.410   1.00 0.00 ? 114 LYS A CB   7  
ATOM 9964  C CG   . LYS A 1 77 ? -9.995  2.822   0.008   1.00 0.00 ? 114 LYS A CG   7  
ATOM 9965  C CD   . LYS A 1 77 ? -10.804 2.348   1.210   1.00 0.00 ? 114 LYS A CD   7  
ATOM 9966  C CE   . LYS A 1 77 ? -11.360 3.514   2.015   1.00 0.00 ? 114 LYS A CE   7  
ATOM 9967  N NZ   . LYS A 1 77 ? -12.288 3.058   3.080   1.00 0.00 ? 114 LYS A NZ   7  
ATOM 9968  H H    . LYS A 1 77 ? -7.520  0.799   0.087   1.00 0.00 ? 114 LYS A H    7  
ATOM 9969  H HA   . LYS A 1 77 ? -6.679  3.390   0.895   1.00 0.00 ? 114 LYS A HA   7  
ATOM 9970  H HB2  . LYS A 1 77 ? -9.016  4.263   1.229   1.00 0.00 ? 114 LYS A HB2  7  
ATOM 9971  H HB3  . LYS A 1 77 ? -8.446  4.217   -0.430  1.00 0.00 ? 114 LYS A HB3  7  
ATOM 9972  H HG2  . LYS A 1 77 ? -10.624 3.450   -0.604  1.00 0.00 ? 114 LYS A HG2  7  
ATOM 9973  H HG3  . LYS A 1 77 ? -9.688  1.957   -0.565  1.00 0.00 ? 114 LYS A HG3  7  
ATOM 9974  H HD2  . LYS A 1 77 ? -11.625 1.741   0.862   1.00 0.00 ? 114 LYS A HD2  7  
ATOM 9975  H HD3  . LYS A 1 77 ? -10.163 1.759   1.849   1.00 0.00 ? 114 LYS A HD3  7  
ATOM 9976  H HE2  . LYS A 1 77 ? -10.540 4.046   2.474   1.00 0.00 ? 114 LYS A HE2  7  
ATOM 9977  H HE3  . LYS A 1 77 ? -11.889 4.178   1.347   1.00 0.00 ? 114 LYS A HE3  7  
ATOM 9978  H HZ1  . LYS A 1 77 ? -12.819 2.219   2.757   1.00 0.00 ? 114 LYS A HZ1  7  
ATOM 9979  H HZ2  . LYS A 1 77 ? -11.757 2.813   3.942   1.00 0.00 ? 114 LYS A HZ2  7  
ATOM 9980  H HZ3  . LYS A 1 77 ? -12.971 3.814   3.309   1.00 0.00 ? 114 LYS A HZ3  7  
ATOM 9981  N N    . LEU A 1 78 ? -7.491  2.829   3.247   1.00 0.00 ? 115 LEU A N    7  
ATOM 9982  C CA   . LEU A 1 78 ? -7.484  2.234   4.571   1.00 0.00 ? 115 LEU A CA   7  
ATOM 9983  C C    . LEU A 1 78 ? -8.781  1.495   4.867   1.00 0.00 ? 115 LEU A C    7  
ATOM 9984  O O    . LEU A 1 78 ? -9.875  2.026   4.665   1.00 0.00 ? 115 LEU A O    7  
ATOM 9985  C CB   . LEU A 1 78 ? -7.264  3.306   5.639   1.00 0.00 ? 115 LEU A CB   7  
ATOM 9986  C CG   . LEU A 1 78 ? -5.880  3.341   6.282   1.00 0.00 ? 115 LEU A CG   7  
ATOM 9987  C CD1  . LEU A 1 78 ? -5.580  2.028   6.983   1.00 0.00 ? 115 LEU A CD1  7  
ATOM 9988  C CD2  . LEU A 1 78 ? -4.812  3.649   5.256   1.00 0.00 ? 115 LEU A CD2  7  
ATOM 9989  H H    . LEU A 1 78 ? -7.161  3.749   3.136   1.00 0.00 ? 115 LEU A H    7  
ATOM 9990  H HA   . LEU A 1 78 ? -6.671  1.525   4.600   1.00 0.00 ? 115 LEU A HA   7  
ATOM 9991  H HB2  . LEU A 1 78 ? -7.450  4.271   5.188   1.00 0.00 ? 115 LEU A HB2  7  
ATOM 9992  H HB3  . LEU A 1 78 ? -7.992  3.152   6.422   1.00 0.00 ? 115 LEU A HB3  7  
ATOM 9993  H HG   . LEU A 1 78 ? -5.864  4.124   7.020   1.00 0.00 ? 115 LEU A HG   7  
ATOM 9994  H HD11 . LEU A 1 78 ? -6.486  1.442   7.056   1.00 0.00 ? 115 LEU A HD11 7  
ATOM 9995  H HD12 . LEU A 1 78 ? -4.841  1.480   6.418   1.00 0.00 ? 115 LEU A HD12 7  
ATOM 9996  H HD13 . LEU A 1 78 ? -5.199  2.228   7.974   1.00 0.00 ? 115 LEU A HD13 7  
ATOM 9997  H HD21 . LEU A 1 78 ? -5.264  4.105   4.388   1.00 0.00 ? 115 LEU A HD21 7  
ATOM 9998  H HD22 . LEU A 1 78 ? -4.088  4.329   5.683   1.00 0.00 ? 115 LEU A HD22 7  
ATOM 9999  H HD23 . LEU A 1 78 ? -4.316  2.735   4.963   1.00 0.00 ? 115 LEU A HD23 7  
ATOM 10000 N N    . ALA A 1 79 ? -8.643  0.297   5.414   1.00 0.00 ? 116 ALA A N    7  
ATOM 10001 C CA   . ALA A 1 79 ? -9.799  -0.470  5.846   1.00 0.00 ? 116 ALA A CA   7  
ATOM 10002 C C    . ALA A 1 79 ? -10.462 0.213   7.025   1.00 0.00 ? 116 ALA A C    7  
ATOM 10003 O O    . ALA A 1 79 ? -9.791  0.825   7.857   1.00 0.00 ? 116 ALA A O    7  
ATOM 10004 C CB   . ALA A 1 79 ? -9.418  -1.893  6.218   1.00 0.00 ? 116 ALA A CB   7  
ATOM 10005 H H    . ALA A 1 79 ? -7.741  -0.047  5.593   1.00 0.00 ? 116 ALA A H    7  
ATOM 10006 H HA   . ALA A 1 79 ? -10.499 -0.512  5.024   1.00 0.00 ? 116 ALA A HA   7  
ATOM 10007 H HB1  . ALA A 1 79 ? -9.832  -2.577  5.490   1.00 0.00 ? 116 ALA A HB1  7  
ATOM 10008 H HB2  . ALA A 1 79 ? -9.814  -2.128  7.197   1.00 0.00 ? 116 ALA A HB2  7  
ATOM 10009 H HB3  . ALA A 1 79 ? -8.341  -1.988  6.232   1.00 0.00 ? 116 ALA A HB3  7  
ATOM 10010 N N    . LYS A 1 80 ? -11.778 0.163   7.048   1.00 0.00 ? 117 LYS A N    7  
ATOM 10011 C CA   . LYS A 1 80 ? -12.559 0.816   8.089   1.00 0.00 ? 117 LYS A CA   7  
ATOM 10012 C C    . LYS A 1 80 ? -12.200 0.263   9.468   1.00 0.00 ? 117 LYS A C    7  
ATOM 10013 O O    . LYS A 1 80 ? -12.186 0.995   10.460  1.00 0.00 ? 117 LYS A O    7  
ATOM 10014 C CB   . LYS A 1 80 ? -14.053 0.623   7.829   1.00 0.00 ? 117 LYS A CB   7  
ATOM 10015 C CG   . LYS A 1 80 ? -14.481 0.976   6.413   1.00 0.00 ? 117 LYS A CG   7  
ATOM 10016 C CD   . LYS A 1 80 ? -15.988 0.863   6.242   1.00 0.00 ? 117 LYS A CD   7  
ATOM 10017 C CE   . LYS A 1 80 ? -16.381 0.783   4.777   1.00 0.00 ? 117 LYS A CE   7  
ATOM 10018 N NZ   . LYS A 1 80 ? -15.998 -0.521  4.171   1.00 0.00 ? 117 LYS A NZ   7  
ATOM 10019 H H    . LYS A 1 80 ? -12.247 -0.300  6.311   1.00 0.00 ? 117 LYS A H    7  
ATOM 10020 H HA   . LYS A 1 80 ? -12.331 1.871   8.065   1.00 0.00 ? 117 LYS A HA   7  
ATOM 10021 H HB2  . LYS A 1 80 ? -14.304 -0.411  8.008   1.00 0.00 ? 117 LYS A HB2  7  
ATOM 10022 H HB3  . LYS A 1 80 ? -14.610 1.244   8.517   1.00 0.00 ? 117 LYS A HB3  7  
ATOM 10023 H HG2  . LYS A 1 80 ? -14.183 1.990   6.200   1.00 0.00 ? 117 LYS A HG2  7  
ATOM 10024 H HG3  . LYS A 1 80 ? -13.998 0.301   5.723   1.00 0.00 ? 117 LYS A HG3  7  
ATOM 10025 H HD2  . LYS A 1 80 ? -16.331 -0.030  6.746   1.00 0.00 ? 117 LYS A HD2  7  
ATOM 10026 H HD3  . LYS A 1 80 ? -16.455 1.730   6.684   1.00 0.00 ? 117 LYS A HD3  7  
ATOM 10027 H HE2  . LYS A 1 80 ? -17.449 0.910   4.695   1.00 0.00 ? 117 LYS A HE2  7  
ATOM 10028 H HE3  . LYS A 1 80 ? -15.881 1.578   4.241   1.00 0.00 ? 117 LYS A HE3  7  
ATOM 10029 H HZ1  . LYS A 1 80 ? -16.196 -1.300  4.839   1.00 0.00 ? 117 LYS A HZ1  7  
ATOM 10030 H HZ2  . LYS A 1 80 ? -16.542 -0.686  3.295   1.00 0.00 ? 117 LYS A HZ2  7  
ATOM 10031 H HZ3  . LYS A 1 80 ? -14.978 -0.533  3.939   1.00 0.00 ? 117 LYS A HZ3  7  
ATOM 10032 N N    . LYS A 1 81 ? -11.937 -1.036  9.521   1.00 0.00 ? 118 LYS A N    7  
ATOM 10033 C CA   . LYS A 1 81 ? -11.637 -1.715  10.774  1.00 0.00 ? 118 LYS A CA   7  
ATOM 10034 C C    . LYS A 1 81 ? -11.028 -3.079  10.479  1.00 0.00 ? 118 LYS A C    7  
ATOM 10035 O O    . LYS A 1 81 ? -11.206 -3.603  9.379   1.00 0.00 ? 118 LYS A O    7  
ATOM 10036 C CB   . LYS A 1 81 ? -12.924 -1.893  11.581  1.00 0.00 ? 118 LYS A CB   7  
ATOM 10037 C CG   . LYS A 1 81 ? -12.704 -2.233  13.046  1.00 0.00 ? 118 LYS A CG   7  
ATOM 10038 C CD   . LYS A 1 81 ? -14.026 -2.325  13.788  1.00 0.00 ? 118 LYS A CD   7  
ATOM 10039 C CE   . LYS A 1 81 ? -14.789 -1.013  13.719  1.00 0.00 ? 118 LYS A CE   7  
ATOM 10040 N NZ   . LYS A 1 81 ? -16.186 -1.151  14.202  1.00 0.00 ? 118 LYS A NZ   7  
ATOM 10041 H H    . LYS A 1 81 ? -11.976 -1.564  8.694   1.00 0.00 ? 118 LYS A H    7  
ATOM 10042 H HA   . LYS A 1 81 ? -10.935 -1.114  11.333  1.00 0.00 ? 118 LYS A HA   7  
ATOM 10043 H HB2  . LYS A 1 81 ? -13.496 -0.980  11.529  1.00 0.00 ? 118 LYS A HB2  7  
ATOM 10044 H HB3  . LYS A 1 81 ? -13.498 -2.695  11.133  1.00 0.00 ? 118 LYS A HB3  7  
ATOM 10045 H HG2  . LYS A 1 81 ? -12.194 -3.183  13.115  1.00 0.00 ? 118 LYS A HG2  7  
ATOM 10046 H HG3  . LYS A 1 81 ? -12.098 -1.461  13.499  1.00 0.00 ? 118 LYS A HG3  7  
ATOM 10047 H HD2  . LYS A 1 81 ? -14.627 -3.103  13.343  1.00 0.00 ? 118 LYS A HD2  7  
ATOM 10048 H HD3  . LYS A 1 81 ? -13.833 -2.562  14.824  1.00 0.00 ? 118 LYS A HD3  7  
ATOM 10049 H HE2  . LYS A 1 81 ? -14.277 -0.284  14.330  1.00 0.00 ? 118 LYS A HE2  7  
ATOM 10050 H HE3  . LYS A 1 81 ? -14.802 -0.673  12.693  1.00 0.00 ? 118 LYS A HE3  7  
ATOM 10051 H HZ1  . LYS A 1 81 ? -16.463 -2.156  14.210  1.00 0.00 ? 118 LYS A HZ1  7  
ATOM 10052 H HZ2  . LYS A 1 81 ? -16.276 -0.764  15.168  1.00 0.00 ? 118 LYS A HZ2  7  
ATOM 10053 H HZ3  . LYS A 1 81 ? -16.833 -0.631  13.569  1.00 0.00 ? 118 LYS A HZ3  7  
ATOM 10054 N N    . LYS A 1 82 ? -10.327 -3.659  11.451  1.00 0.00 ? 119 LYS A N    7  
ATOM 10055 C CA   . LYS A 1 82 ? -9.772  -4.993  11.268  1.00 0.00 ? 119 LYS A CA   7  
ATOM 10056 C C    . LYS A 1 82 ? -10.905 -6.001  11.091  1.00 0.00 ? 119 LYS A C    7  
ATOM 10057 O O    . LYS A 1 82 ? -10.957 -6.706  10.079  1.00 0.00 ? 119 LYS A O    7  
ATOM 10058 C CB   . LYS A 1 82 ? -8.854  -5.398  12.436  1.00 0.00 ? 119 LYS A CB   7  
ATOM 10059 C CG   . LYS A 1 82 ? -9.532  -5.467  13.797  1.00 0.00 ? 119 LYS A CG   7  
ATOM 10060 C CD   . LYS A 1 82 ? -9.275  -4.225  14.636  1.00 0.00 ? 119 LYS A CD   7  
ATOM 10061 C CE   . LYS A 1 82 ? -7.800  -4.075  14.976  1.00 0.00 ? 119 LYS A CE   7  
ATOM 10062 N NZ   . LYS A 1 82 ? -7.565  -3.020  15.997  1.00 0.00 ? 119 LYS A NZ   7  
ATOM 10063 H H    . LYS A 1 82 ? -10.207 -3.192  12.308  1.00 0.00 ? 119 LYS A H    7  
ATOM 10064 H HA   . LYS A 1 82 ? -9.188  -4.976  10.359  1.00 0.00 ? 119 LYS A HA   7  
ATOM 10065 H HB2  . LYS A 1 82 ? -8.440  -6.372  12.221  1.00 0.00 ? 119 LYS A HB2  7  
ATOM 10066 H HB3  . LYS A 1 82 ? -8.045  -4.686  12.499  1.00 0.00 ? 119 LYS A HB3  7  
ATOM 10067 H HG2  . LYS A 1 82 ? -10.597 -5.570  13.651  1.00 0.00 ? 119 LYS A HG2  7  
ATOM 10068 H HG3  . LYS A 1 82 ? -9.157  -6.330  14.327  1.00 0.00 ? 119 LYS A HG3  7  
ATOM 10069 H HD2  . LYS A 1 82 ? -9.596  -3.356  14.081  1.00 0.00 ? 119 LYS A HD2  7  
ATOM 10070 H HD3  . LYS A 1 82 ? -9.842  -4.298  15.553  1.00 0.00 ? 119 LYS A HD3  7  
ATOM 10071 H HE2  . LYS A 1 82 ? -7.435  -5.018  15.354  1.00 0.00 ? 119 LYS A HE2  7  
ATOM 10072 H HE3  . LYS A 1 82 ? -7.262  -3.817  14.074  1.00 0.00 ? 119 LYS A HE3  7  
ATOM 10073 H HZ1  . LYS A 1 82 ? -8.391  -2.941  16.632  1.00 0.00 ? 119 LYS A HZ1  7  
ATOM 10074 H HZ2  . LYS A 1 82 ? -6.727  -3.261  16.572  1.00 0.00 ? 119 LYS A HZ2  7  
ATOM 10075 H HZ3  . LYS A 1 82 ? -7.400  -2.099  15.536  1.00 0.00 ? 119 LYS A HZ3  7  
ATOM 10076 N N    . SER A 1 83 ? -11.888 -5.938  11.998  1.00 0.00 ? 120 SER A N    7  
ATOM 10077 C CA   . SER A 1 83 ? -13.113 -6.730  11.899  1.00 0.00 ? 120 SER A CA   7  
ATOM 10078 C C    . SER A 1 83 ? -12.836 -8.241  11.922  1.00 0.00 ? 120 SER A C    7  
ATOM 10079 O O    . SER A 1 83 ? -11.720 -8.691  11.658  1.00 0.00 ? 120 SER A O    7  
ATOM 10080 C CB   . SER A 1 83 ? -13.880 -6.335  10.630  1.00 0.00 ? 120 SER A CB   7  
ATOM 10081 O OG   . SER A 1 83 ? -14.294 -4.980  10.682  1.00 0.00 ? 120 SER A OG   7  
ATOM 10082 H H    . SER A 1 83 ? -11.824 -5.270  12.709  1.00 0.00 ? 120 SER A H    7  
ATOM 10083 H HA   . SER A 1 83 ? -13.723 -6.488  12.754  1.00 0.00 ? 120 SER A HA   7  
ATOM 10084 H HB2  . SER A 1 83 ? -13.237 -6.461  9.773   1.00 0.00 ? 120 SER A HB2  7  
ATOM 10085 H HB3  . SER A 1 83 ? -14.753 -6.964  10.524  1.00 0.00 ? 120 SER A HB3  7  
ATOM 10086 H HG   . SER A 1 83 ? -14.091 -4.556  9.834   1.00 0.00 ? 120 SER A HG   7  
ATOM 10087 N N    . PRO A 1 84 ? -13.831 -9.049  12.322  1.00 0.00 ? 121 PRO A N    7  
ATOM 10088 C CA   . PRO A 1 84 ? -13.690 -10.507 12.374  1.00 0.00 ? 121 PRO A CA   7  
ATOM 10089 C C    . PRO A 1 84 ? -13.454 -11.098 10.987  1.00 0.00 ? 121 PRO A C    7  
ATOM 10090 O O    . PRO A 1 84 ? -13.568 -10.395 9.982   1.00 0.00 ? 121 PRO A O    7  
ATOM 10091 C CB   . PRO A 1 84 ? -15.035 -10.992 12.920  1.00 0.00 ? 121 PRO A CB   7  
ATOM 10092 C CG   . PRO A 1 84 ? -15.664 -9.791  13.541  1.00 0.00 ? 121 PRO A CG   7  
ATOM 10093 C CD   . PRO A 1 84 ? -15.171 -8.615  12.750  1.00 0.00 ? 121 PRO A CD   7  
ATOM 10094 H HA   . PRO A 1 84 ? -12.893 -10.809 13.038  1.00 0.00 ? 121 PRO A HA   7  
ATOM 10095 H HB2  . PRO A 1 84 ? -15.633 -11.373 12.102  1.00 0.00 ? 121 PRO A HB2  7  
ATOM 10096 H HB3  . PRO A 1 84 ? -14.873 -11.772 13.647  1.00 0.00 ? 121 PRO A HB3  7  
ATOM 10097 H HG2  . PRO A 1 84 ? -16.740 -9.862  13.473  1.00 0.00 ? 121 PRO A HG2  7  
ATOM 10098 H HG3  . PRO A 1 84 ? -15.357 -9.703  14.574  1.00 0.00 ? 121 PRO A HG3  7  
ATOM 10099 H HD2  . PRO A 1 84 ? -15.812 -8.439  11.899  1.00 0.00 ? 121 PRO A HD2  7  
ATOM 10100 H HD3  . PRO A 1 84 ? -15.112 -7.737  13.373  1.00 0.00 ? 121 PRO A HD3  7  
ATOM 10101 N N    . GLU A 1 85 ? -13.113 -12.380 10.937  1.00 0.00 ? 122 GLU A N    7  
ATOM 10102 C CA   . GLU A 1 85 ? -12.861 -13.053 9.669   1.00 0.00 ? 122 GLU A CA   7  
ATOM 10103 C C    . GLU A 1 85 ? -14.100 -13.023 8.775   1.00 0.00 ? 122 GLU A C    7  
ATOM 10104 O O    . GLU A 1 85 ? -15.170 -13.517 9.141   1.00 0.00 ? 122 GLU A O    7  
ATOM 10105 C CB   . GLU A 1 85 ? -12.399 -14.492 9.907   1.00 0.00 ? 122 GLU A CB   7  
ATOM 10106 C CG   . GLU A 1 85 ? -13.246 -15.263 10.909  1.00 0.00 ? 122 GLU A CG   7  
ATOM 10107 C CD   . GLU A 1 85 ? -12.777 -16.691 11.089  1.00 0.00 ? 122 GLU A CD   7  
ATOM 10108 O OE1  . GLU A 1 85 ? -11.590 -16.891 11.421  1.00 0.00 ? 122 GLU A OE1  7  
ATOM 10109 O OE2  . GLU A 1 85 ? -13.592 -17.620 10.895  1.00 0.00 ? 122 GLU A OE2  7  
ATOM 10110 H H    . GLU A 1 85 ? -13.020 -12.883 11.775  1.00 0.00 ? 122 GLU A H    7  
ATOM 10111 H HA   . GLU A 1 85 ? -12.068 -12.515 9.171   1.00 0.00 ? 122 GLU A HA   7  
ATOM 10112 H HB2  . GLU A 1 85 ? -12.425 -15.024 8.969   1.00 0.00 ? 122 GLU A HB2  7  
ATOM 10113 H HB3  . GLU A 1 85 ? -11.381 -14.474 10.271  1.00 0.00 ? 122 GLU A HB3  7  
ATOM 10114 H HG2  . GLU A 1 85 ? -13.197 -14.764 11.864  1.00 0.00 ? 122 GLU A HG2  7  
ATOM 10115 H HG3  . GLU A 1 85 ? -14.269 -15.276 10.562  1.00 0.00 ? 122 GLU A HG3  7  
ATOM 10116 N N    . VAL A 1 86 ? -13.963 -12.354 7.645   1.00 0.00 ? 123 VAL A N    7  
ATOM 10117 C CA   . VAL A 1 86 ? -15.058 -12.178 6.706   1.00 0.00 ? 123 VAL A CA   7  
ATOM 10118 C C    . VAL A 1 86 ? -14.975 -13.202 5.578   1.00 0.00 ? 123 VAL A C    7  
ATOM 10119 O O    . VAL A 1 86 ? -13.927 -13.341 4.940   1.00 0.00 ? 123 VAL A O    7  
ATOM 10120 C CB   . VAL A 1 86 ? -15.047 -10.751 6.102   1.00 0.00 ? 123 VAL A CB   7  
ATOM 10121 C CG1  . VAL A 1 86 ? -16.183 -10.562 5.105   1.00 0.00 ? 123 VAL A CG1  7  
ATOM 10122 C CG2  . VAL A 1 86 ? -15.122 -9.702  7.202   1.00 0.00 ? 123 VAL A CG2  7  
ATOM 10123 H H    . VAL A 1 86 ? -13.102 -11.922 7.453   1.00 0.00 ? 123 VAL A H    7  
ATOM 10124 H HA   . VAL A 1 86 ? -15.985 -12.315 7.242   1.00 0.00 ? 123 VAL A HA   7  
ATOM 10125 H HB   . VAL A 1 86 ? -14.114 -10.616 5.574   1.00 0.00 ? 123 VAL A HB   7  
ATOM 10126 H HG11 . VAL A 1 86 ? -16.402 -11.505 4.626   1.00 0.00 ? 123 VAL A HG11 7  
ATOM 10127 H HG12 . VAL A 1 86 ? -17.063 -10.208 5.623   1.00 0.00 ? 123 VAL A HG12 7  
ATOM 10128 H HG13 . VAL A 1 86 ? -15.889 -9.839  4.359   1.00 0.00 ? 123 VAL A HG13 7  
ATOM 10129 H HG21 . VAL A 1 86 ? -15.976 -9.902  7.832   1.00 0.00 ? 123 VAL A HG21 7  
ATOM 10130 H HG22 . VAL A 1 86 ? -14.222 -9.736  7.793   1.00 0.00 ? 123 VAL A HG22 7  
ATOM 10131 H HG23 . VAL A 1 86 ? -15.226 -8.722  6.757   1.00 0.00 ? 123 VAL A HG23 7  
ATOM 10132 N N    . LYS A 1 87 ? -16.108 -13.848 5.298   1.00 0.00 ? 124 LYS A N    7  
ATOM 10133 C CA   . LYS A 1 87 ? -16.237 -14.770 4.166   1.00 0.00 ? 124 LYS A CA   7  
ATOM 10134 C C    . LYS A 1 87 ? -15.074 -15.764 4.092   1.00 0.00 ? 124 LYS A C    7  
ATOM 10135 O O    . LYS A 1 87 ? -14.676 -16.339 5.107   1.00 0.00 ? 124 LYS A O    7  
ATOM 10136 C CB   . LYS A 1 87 ? -16.357 -13.967 2.867   1.00 0.00 ? 124 LYS A CB   7  
ATOM 10137 C CG   . LYS A 1 87 ? -17.664 -13.193 2.766   1.00 0.00 ? 124 LYS A CG   7  
ATOM 10138 C CD   . LYS A 1 87 ? -17.639 -12.134 1.669   1.00 0.00 ? 124 LYS A CD   7  
ATOM 10139 C CE   . LYS A 1 87 ? -17.362 -12.727 0.294   1.00 0.00 ? 124 LYS A CE   7  
ATOM 10140 N NZ   . LYS A 1 87 ? -15.905 -12.812 -0.001  1.00 0.00 ? 124 LYS A NZ   7  
ATOM 10141 H H    . LYS A 1 87 ? -16.914 -13.631 5.819   1.00 0.00 ? 124 LYS A H    7  
ATOM 10142 H HA   . LYS A 1 87 ? -17.150 -15.328 4.306   1.00 0.00 ? 124 LYS A HA   7  
ATOM 10143 H HB2  . LYS A 1 87 ? -15.538 -13.264 2.813   1.00 0.00 ? 124 LYS A HB2  7  
ATOM 10144 H HB3  . LYS A 1 87 ? -16.296 -14.645 2.028   1.00 0.00 ? 124 LYS A HB3  7  
ATOM 10145 H HG2  . LYS A 1 87 ? -18.463 -13.888 2.556   1.00 0.00 ? 124 LYS A HG2  7  
ATOM 10146 H HG3  . LYS A 1 87 ? -17.851 -12.708 3.714   1.00 0.00 ? 124 LYS A HG3  7  
ATOM 10147 H HD2  . LYS A 1 87 ? -18.596 -11.634 1.644   1.00 0.00 ? 124 LYS A HD2  7  
ATOM 10148 H HD3  . LYS A 1 87 ? -16.867 -11.413 1.900   1.00 0.00 ? 124 LYS A HD3  7  
ATOM 10149 H HE2  . LYS A 1 87 ? -17.787 -13.719 0.251   1.00 0.00 ? 124 LYS A HE2  7  
ATOM 10150 H HE3  . LYS A 1 87 ? -17.833 -12.105 -0.454  1.00 0.00 ? 124 LYS A HE3  7  
ATOM 10151 H HZ1  . LYS A 1 87 ? -15.423 -11.941 0.322   1.00 0.00 ? 124 LYS A HZ1  7  
ATOM 10152 H HZ2  . LYS A 1 87 ? -15.482 -13.625 0.488   1.00 0.00 ? 124 LYS A HZ2  7  
ATOM 10153 H HZ3  . LYS A 1 87 ? -15.752 -12.921 -1.027  1.00 0.00 ? 124 LYS A HZ3  7  
ATOM 10154 N N    . LYS A 1 88 ? -14.543 -15.975 2.891   1.00 0.00 ? 125 LYS A N    7  
ATOM 10155 C CA   . LYS A 1 88 ? -13.448 -16.914 2.690   1.00 0.00 ? 125 LYS A CA   7  
ATOM 10156 C C    . LYS A 1 88 ? -12.535 -16.444 1.559   1.00 0.00 ? 125 LYS A C    7  
ATOM 10157 O O    . LYS A 1 88 ? -11.331 -16.274 1.757   1.00 0.00 ? 125 LYS A O    7  
ATOM 10158 C CB   . LYS A 1 88 ? -14.005 -18.309 2.387   1.00 0.00 ? 125 LYS A CB   7  
ATOM 10159 C CG   . LYS A 1 88 ? -12.939 -19.367 2.138   1.00 0.00 ? 125 LYS A CG   7  
ATOM 10160 C CD   . LYS A 1 88 ? -11.995 -19.507 3.319   1.00 0.00 ? 125 LYS A CD   7  
ATOM 10161 C CE   . LYS A 1 88 ? -11.038 -20.676 3.133   1.00 0.00 ? 125 LYS A CE   7  
ATOM 10162 N NZ   . LYS A 1 88 ? -11.730 -21.989 3.253   1.00 0.00 ? 125 LYS A NZ   7  
ATOM 10163 H H    . LYS A 1 88 ? -14.911 -15.503 2.117   1.00 0.00 ? 125 LYS A H    7  
ATOM 10164 H HA   . LYS A 1 88 ? -12.875 -16.956 3.605   1.00 0.00 ? 125 LYS A HA   7  
ATOM 10165 H HB2  . LYS A 1 88 ? -14.607 -18.631 3.223   1.00 0.00 ? 125 LYS A HB2  7  
ATOM 10166 H HB3  . LYS A 1 88 ? -14.632 -18.251 1.508   1.00 0.00 ? 125 LYS A HB3  7  
ATOM 10167 H HG2  . LYS A 1 88 ? -13.424 -20.317 1.965   1.00 0.00 ? 125 LYS A HG2  7  
ATOM 10168 H HG3  . LYS A 1 88 ? -12.368 -19.091 1.263   1.00 0.00 ? 125 LYS A HG3  7  
ATOM 10169 H HD2  . LYS A 1 88 ? -11.421 -18.598 3.420   1.00 0.00 ? 125 LYS A HD2  7  
ATOM 10170 H HD3  . LYS A 1 88 ? -12.577 -19.669 4.213   1.00 0.00 ? 125 LYS A HD3  7  
ATOM 10171 H HE2  . LYS A 1 88 ? -10.592 -20.605 2.153   1.00 0.00 ? 125 LYS A HE2  7  
ATOM 10172 H HE3  . LYS A 1 88 ? -10.266 -20.617 3.885   1.00 0.00 ? 125 LYS A HE3  7  
ATOM 10173 H HZ1  . LYS A 1 88 ? -12.259 -22.034 4.154   1.00 0.00 ? 125 LYS A HZ1  7  
ATOM 10174 H HZ2  . LYS A 1 88 ? -12.404 -22.117 2.466   1.00 0.00 ? 125 LYS A HZ2  7  
ATOM 10175 H HZ3  . LYS A 1 88 ? -11.034 -22.766 3.232   1.00 0.00 ? 125 LYS A HZ3  7  
ATOM 10176 N N    . GLU A 1 89 ? -13.124 -16.150 0.406   1.00 0.00 ? 126 GLU A N    7  
ATOM 10177 C CA   . GLU A 1 89 ? -12.368 -15.608 -0.715  1.00 0.00 ? 126 GLU A CA   7  
ATOM 10178 C C    . GLU A 1 89 ? -12.126 -14.123 -0.510  1.00 0.00 ? 126 GLU A C    7  
ATOM 10179 O O    . GLU A 1 89 ? -13.035 -13.386 -0.125  1.00 0.00 ? 126 GLU A O    7  
ATOM 10180 C CB   . GLU A 1 89 ? -13.098 -15.845 -2.036  1.00 0.00 ? 126 GLU A CB   7  
ATOM 10181 C CG   . GLU A 1 89 ? -13.204 -17.311 -2.417  1.00 0.00 ? 126 GLU A CG   7  
ATOM 10182 C CD   . GLU A 1 89 ? -11.858 -18.006 -2.419  1.00 0.00 ? 126 GLU A CD   7  
ATOM 10183 O OE1  . GLU A 1 89 ? -10.927 -17.518 -3.095  1.00 0.00 ? 126 GLU A OE1  7  
ATOM 10184 O OE2  . GLU A 1 89 ? -11.725 -19.052 -1.747  1.00 0.00 ? 126 GLU A OE2  7  
ATOM 10185 H H    . GLU A 1 89 ? -14.101 -16.224 0.335   1.00 0.00 ? 126 GLU A H    7  
ATOM 10186 H HA   . GLU A 1 89 ? -11.414 -16.115 -0.743  1.00 0.00 ? 126 GLU A HA   7  
ATOM 10187 H HB2  . GLU A 1 89 ? -14.098 -15.443 -1.961  1.00 0.00 ? 126 GLU A HB2  7  
ATOM 10188 H HB3  . GLU A 1 89 ? -12.570 -15.329 -2.824  1.00 0.00 ? 126 GLU A HB3  7  
ATOM 10189 H HG2  . GLU A 1 89 ? -13.848 -17.809 -1.707  1.00 0.00 ? 126 GLU A HG2  7  
ATOM 10190 H HG3  . GLU A 1 89 ? -13.633 -17.385 -3.406  1.00 0.00 ? 126 GLU A HG3  7  
ATOM 10191 N N    . LYS A 1 90 ? -10.888 -13.698 -0.713  1.00 0.00 ? 127 LYS A N    7  
ATOM 10192 C CA   . LYS A 1 90 ? -10.500 -12.322 -0.476  1.00 0.00 ? 127 LYS A CA   7  
ATOM 10193 C C    . LYS A 1 90 ? -10.887 -11.419 -1.642  1.00 0.00 ? 127 LYS A C    7  
ATOM 10194 O O    . LYS A 1 90 ? -10.056 -10.683 -2.180  1.00 0.00 ? 127 LYS A O    7  
ATOM 10195 C CB   . LYS A 1 90 ? -8.999  -12.218 -0.187  1.00 0.00 ? 127 LYS A CB   7  
ATOM 10196 C CG   . LYS A 1 90 ? -8.601  -12.792 1.163   1.00 0.00 ? 127 LYS A CG   7  
ATOM 10197 C CD   . LYS A 1 90 ? -8.643  -14.312 1.176   1.00 0.00 ? 127 LYS A CD   7  
ATOM 10198 C CE   . LYS A 1 90 ? -8.542  -14.857 2.589   1.00 0.00 ? 127 LYS A CE   7  
ATOM 10199 N NZ   . LYS A 1 90 ? -9.717  -14.476 3.423   1.00 0.00 ? 127 LYS A NZ   7  
ATOM 10200 H H    . LYS A 1 90 ? -10.204 -14.339 -0.984  1.00 0.00 ? 127 LYS A H    7  
ATOM 10201 H HA   . LYS A 1 90 ? -11.035 -11.995 0.396   1.00 0.00 ? 127 LYS A HA   7  
ATOM 10202 H HB2  . LYS A 1 90 ? -8.457  -12.750 -0.955  1.00 0.00 ? 127 LYS A HB2  7  
ATOM 10203 H HB3  . LYS A 1 90 ? -8.710  -11.178 -0.211  1.00 0.00 ? 127 LYS A HB3  7  
ATOM 10204 H HG2  . LYS A 1 90 ? -7.598  -12.470 1.397   1.00 0.00 ? 127 LYS A HG2  7  
ATOM 10205 H HG3  . LYS A 1 90 ? -9.283  -12.418 1.913   1.00 0.00 ? 127 LYS A HG3  7  
ATOM 10206 H HD2  . LYS A 1 90 ? -9.573  -14.641 0.738   1.00 0.00 ? 127 LYS A HD2  7  
ATOM 10207 H HD3  . LYS A 1 90 ? -7.815  -14.688 0.594   1.00 0.00 ? 127 LYS A HD3  7  
ATOM 10208 H HE2  . LYS A 1 90 ? -8.482  -15.935 2.541   1.00 0.00 ? 127 LYS A HE2  7  
ATOM 10209 H HE3  . LYS A 1 90 ? -7.644  -14.468 3.048   1.00 0.00 ? 127 LYS A HE3  7  
ATOM 10210 H HZ1  . LYS A 1 90 ? -10.201 -13.647 3.016   1.00 0.00 ? 127 LYS A HZ1  7  
ATOM 10211 H HZ2  . LYS A 1 90 ? -10.395 -15.267 3.470   1.00 0.00 ? 127 LYS A HZ2  7  
ATOM 10212 H HZ3  . LYS A 1 90 ? -9.408  -14.245 4.390   1.00 0.00 ? 127 LYS A HZ3  7  
ATOM 10213 N N    . GLU A 1 91 ? -12.171 -11.411 -1.954  1.00 0.00 ? 128 GLU A N    7  
ATOM 10214 C CA   . GLU A 1 91 ? -12.729 -10.513 -2.956  1.00 0.00 ? 128 GLU A CA   7  
ATOM 10215 C C    . GLU A 1 91 ? -12.903 -9.127  -2.337  1.00 0.00 ? 128 GLU A C    7  
ATOM 10216 O O    . GLU A 1 91 ? -14.024 -8.729  -2.012  1.00 0.00 ? 128 GLU A O    7  
ATOM 10217 C CB   . GLU A 1 91 ? -14.073 -11.060 -3.433  1.00 0.00 ? 128 GLU A CB   7  
ATOM 10218 C CG   . GLU A 1 91 ? -14.012 -12.521 -3.851  1.00 0.00 ? 128 GLU A CG   7  
ATOM 10219 C CD   . GLU A 1 91 ? -15.359 -13.199 -3.772  1.00 0.00 ? 128 GLU A CD   7  
ATOM 10220 O OE1  . GLU A 1 91 ? -15.970 -13.205 -2.683  1.00 0.00 ? 128 GLU A OE1  7  
ATOM 10221 O OE2  . GLU A 1 91 ? -15.813 -13.737 -4.805  1.00 0.00 ? 128 GLU A OE2  7  
ATOM 10222 H H    . GLU A 1 91 ? -12.785 -11.971 -1.430  1.00 0.00 ? 128 GLU A H    7  
ATOM 10223 H HA   . GLU A 1 91 ? -12.041 -10.453 -3.787  1.00 0.00 ? 128 GLU A HA   7  
ATOM 10224 H HB2  . GLU A 1 91 ? -14.794 -10.964 -2.634  1.00 0.00 ? 128 GLU A HB2  7  
ATOM 10225 H HB3  . GLU A 1 91 ? -14.408 -10.478 -4.281  1.00 0.00 ? 128 GLU A HB3  7  
ATOM 10226 H HG2  . GLU A 1 91 ? -13.656 -12.578 -4.869  1.00 0.00 ? 128 GLU A HG2  7  
ATOM 10227 H HG3  . GLU A 1 91 ? -13.324 -13.041 -3.200  1.00 0.00 ? 128 GLU A HG3  7  
ATOM 10228 N N    . VAL A 1 92 ? -11.769 -8.554  -1.915  1.00 0.00 ? 129 VAL A N    7  
ATOM 10229 C CA   . VAL A 1 92 ? -11.733 -7.379  -1.038  1.00 0.00 ? 129 VAL A CA   7  
ATOM 10230 C C    . VAL A 1 92 ? -11.986 -7.816  0.406   1.00 0.00 ? 129 VAL A C    7  
ATOM 10231 O O    . VAL A 1 92 ? -11.215 -7.499  1.310   1.00 0.00 ? 129 VAL A O    7  
ATOM 10232 C CB   . VAL A 1 92 ? -12.746 -6.284  -1.441  1.00 0.00 ? 129 VAL A CB   7  
ATOM 10233 C CG1  . VAL A 1 92 ? -12.663 -5.099  -0.491  1.00 0.00 ? 129 VAL A CG1  7  
ATOM 10234 C CG2  . VAL A 1 92 ? -12.510 -5.831  -2.876  1.00 0.00 ? 129 VAL A CG2  7  
ATOM 10235 H H    . VAL A 1 92 ? -10.930 -9.054  -2.045  1.00 0.00 ? 129 VAL A H    7  
ATOM 10236 H HA   . VAL A 1 92 ? -10.738 -6.960  -1.097  1.00 0.00 ? 129 VAL A HA   7  
ATOM 10237 H HB   . VAL A 1 92 ? -13.741 -6.701  -1.375  1.00 0.00 ? 129 VAL A HB   7  
ATOM 10238 H HG11 . VAL A 1 92 ? -11.837 -5.242  0.192   1.00 0.00 ? 129 VAL A HG11 7  
ATOM 10239 H HG12 . VAL A 1 92 ? -12.506 -4.193  -1.057  1.00 0.00 ? 129 VAL A HG12 7  
ATOM 10240 H HG13 . VAL A 1 92 ? -13.583 -5.020  0.069   1.00 0.00 ? 129 VAL A HG13 7  
ATOM 10241 H HG21 . VAL A 1 92 ? -12.580 -6.680  -3.539  1.00 0.00 ? 129 VAL A HG21 7  
ATOM 10242 H HG22 . VAL A 1 92 ? -13.258 -5.100  -3.148  1.00 0.00 ? 129 VAL A HG22 7  
ATOM 10243 H HG23 . VAL A 1 92 ? -11.529 -5.387  -2.958  1.00 0.00 ? 129 VAL A HG23 7  
ATOM 10244 N N    . SER A 1 93 ? -12.980 -8.671  0.569   1.00 0.00 ? 130 SER A N    7  
ATOM 10245 C CA   . SER A 1 93 ? -13.270 -9.312  1.836   1.00 0.00 ? 130 SER A CA   7  
ATOM 10246 C C    . SER A 1 93 ? -14.217 -10.477 1.586   1.00 0.00 ? 130 SER A C    7  
ATOM 10247 O O    . SER A 1 93 ? -14.088 -11.513 2.257   1.00 0.00 ? 130 SER A O    7  
ATOM 10248 C CB   . SER A 1 93 ? -13.876 -8.310  2.828   1.00 0.00 ? 130 SER A CB   7  
ATOM 10249 O OG   . SER A 1 93 ? -14.848 -7.486  2.201   1.00 0.00 ? 130 SER A OG   7  
ATOM 10250 O OXT  . SER A 1 93 ? -15.057 -10.361 0.669   1.00 0.00 ? 130 SER A OXT  7  
ATOM 10251 H H    . SER A 1 93 ? -13.491 -8.954  -0.222  1.00 0.00 ? 130 SER A H    7  
ATOM 10252 H HA   . SER A 1 93 ? -12.343 -9.695  2.237   1.00 0.00 ? 130 SER A HA   7  
ATOM 10253 H HB2  . SER A 1 93 ? -14.349 -8.848  3.636   1.00 0.00 ? 130 SER A HB2  7  
ATOM 10254 H HB3  . SER A 1 93 ? -13.093 -7.683  3.225   1.00 0.00 ? 130 SER A HB3  7  
ATOM 10255 H HG   . SER A 1 93 ? -15.056 -7.849  1.325   1.00 0.00 ? 130 SER A HG   7  
ATOM 10256 N N    . LYS A 1 2  ? 20.231  -10.988 9.822   1.00 0.00 ? 39  LYS A N    8  
ATOM 10257 C CA   . LYS A 1 2  ? 18.882  -10.407 10.006  1.00 0.00 ? 39  LYS A CA   8  
ATOM 10258 C C    . LYS A 1 2  ? 18.864  -8.928  9.627   1.00 0.00 ? 39  LYS A C    8  
ATOM 10259 O O    . LYS A 1 2  ? 18.189  -8.121  10.269  1.00 0.00 ? 39  LYS A O    8  
ATOM 10260 C CB   . LYS A 1 2  ? 18.432  -10.602 11.467  1.00 0.00 ? 39  LYS A CB   8  
ATOM 10261 C CG   . LYS A 1 2  ? 19.287  -9.888  12.513  1.00 0.00 ? 39  LYS A CG   8  
ATOM 10262 C CD   . LYS A 1 2  ? 20.604  -10.606 12.772  1.00 0.00 ? 39  LYS A CD   8  
ATOM 10263 C CE   . LYS A 1 2  ? 21.420  -9.908  13.848  1.00 0.00 ? 39  LYS A CE   8  
ATOM 10264 N NZ   . LYS A 1 2  ? 20.719  -9.901  15.157  1.00 0.00 ? 39  LYS A NZ   8  
ATOM 10265 H H1   . LYS A 1 2  ? 20.949  -10.377 10.270  1.00 0.00 ? 39  LYS A H1   8  
ATOM 10266 H H2   . LYS A 1 2  ? 20.278  -11.936 10.252  1.00 0.00 ? 39  LYS A H2   8  
ATOM 10267 H H3   . LYS A 1 2  ? 20.451  -11.070 8.805   1.00 0.00 ? 39  LYS A H3   8  
ATOM 10268 H HA   . LYS A 1 2  ? 18.198  -10.936 9.359   1.00 0.00 ? 39  LYS A HA   8  
ATOM 10269 H HB2  . LYS A 1 2  ? 17.419  -10.241 11.565  1.00 0.00 ? 39  LYS A HB2  8  
ATOM 10270 H HB3  . LYS A 1 2  ? 18.444  -11.660 11.691  1.00 0.00 ? 39  LYS A HB3  8  
ATOM 10271 H HG2  . LYS A 1 2  ? 19.502  -8.889  12.163  1.00 0.00 ? 39  LYS A HG2  8  
ATOM 10272 H HG3  . LYS A 1 2  ? 18.731  -9.832  13.437  1.00 0.00 ? 39  LYS A HG3  8  
ATOM 10273 H HD2  . LYS A 1 2  ? 20.394  -11.614 13.095  1.00 0.00 ? 39  LYS A HD2  8  
ATOM 10274 H HD3  . LYS A 1 2  ? 21.176  -10.630 11.857  1.00 0.00 ? 39  LYS A HD3  8  
ATOM 10275 H HE2  . LYS A 1 2  ? 22.364  -10.425 13.957  1.00 0.00 ? 39  LYS A HE2  8  
ATOM 10276 H HE3  . LYS A 1 2  ? 21.603  -8.888  13.539  1.00 0.00 ? 39  LYS A HE3  8  
ATOM 10277 H HZ1  . LYS A 1 2  ? 19.988  -10.645 15.175  1.00 0.00 ? 39  LYS A HZ1  8  
ATOM 10278 H HZ2  . LYS A 1 2  ? 21.398  -10.078 15.928  1.00 0.00 ? 39  LYS A HZ2  8  
ATOM 10279 H HZ3  . LYS A 1 2  ? 20.260  -8.977  15.316  1.00 0.00 ? 39  LYS A HZ3  8  
ATOM 10280 N N    . GLU A 1 3  ? 19.565  -8.588  8.545   1.00 0.00 ? 40  GLU A N    8  
ATOM 10281 C CA   . GLU A 1 3  ? 19.598  -7.214  8.057   1.00 0.00 ? 40  GLU A CA   8  
ATOM 10282 C C    . GLU A 1 3  ? 18.190  -6.740  7.712   1.00 0.00 ? 40  GLU A C    8  
ATOM 10283 O O    . GLU A 1 3  ? 17.418  -7.470  7.088   1.00 0.00 ? 40  GLU A O    8  
ATOM 10284 C CB   . GLU A 1 3  ? 20.500  -7.108  6.824   1.00 0.00 ? 40  GLU A CB   8  
ATOM 10285 C CG   . GLU A 1 3  ? 21.931  -7.560  7.071   1.00 0.00 ? 40  GLU A CG   8  
ATOM 10286 C CD   . GLU A 1 3  ? 22.803  -7.440  5.836   1.00 0.00 ? 40  GLU A CD   8  
ATOM 10287 O OE1  . GLU A 1 3  ? 22.318  -6.946  4.802   1.00 0.00 ? 40  GLU A OE1  8  
ATOM 10288 O OE2  . GLU A 1 3  ? 23.988  -7.841  5.895   1.00 0.00 ? 40  GLU A OE2  8  
ATOM 10289 H H    . GLU A 1 3  ? 20.048  -9.284  8.044   1.00 0.00 ? 40  GLU A H    8  
ATOM 10290 H HA   . GLU A 1 3  ? 19.998  -6.589  8.843   1.00 0.00 ? 40  GLU A HA   8  
ATOM 10291 H HB2  . GLU A 1 3  ? 20.085  -7.719  6.037   1.00 0.00 ? 40  GLU A HB2  8  
ATOM 10292 H HB3  . GLU A 1 3  ? 20.521  -6.079  6.496   1.00 0.00 ? 40  GLU A HB3  8  
ATOM 10293 H HG2  . GLU A 1 3  ? 22.357  -6.950  7.854   1.00 0.00 ? 40  GLU A HG2  8  
ATOM 10294 H HG3  . GLU A 1 3  ? 21.920  -8.592  7.387   1.00 0.00 ? 40  GLU A HG3  8  
ATOM 10295 N N    . GLU A 1 4  ? 17.860  -5.529  8.134   1.00 0.00 ? 41  GLU A N    8  
ATOM 10296 C CA   . GLU A 1 4  ? 16.545  -4.954  7.884   1.00 0.00 ? 41  GLU A CA   8  
ATOM 10297 C C    . GLU A 1 4  ? 16.472  -4.398  6.457   1.00 0.00 ? 41  GLU A C    8  
ATOM 10298 O O    . GLU A 1 4  ? 16.186  -3.220  6.248   1.00 0.00 ? 41  GLU A O    8  
ATOM 10299 C CB   . GLU A 1 4  ? 16.257  -3.856  8.918   1.00 0.00 ? 41  GLU A CB   8  
ATOM 10300 C CG   . GLU A 1 4  ? 14.791  -3.465  9.016   1.00 0.00 ? 41  GLU A CG   8  
ATOM 10301 C CD   . GLU A 1 4  ? 14.533  -2.423  10.081  1.00 0.00 ? 41  GLU A CD   8  
ATOM 10302 O OE1  . GLU A 1 4  ? 15.024  -1.282  9.939   1.00 0.00 ? 41  GLU A OE1  8  
ATOM 10303 O OE2  . GLU A 1 4  ? 13.834  -2.736  11.067  1.00 0.00 ? 41  GLU A OE2  8  
ATOM 10304 H H    . GLU A 1 4  ? 18.526  -4.995  8.623   1.00 0.00 ? 41  GLU A H    8  
ATOM 10305 H HA   . GLU A 1 4  ? 15.812  -5.741  7.991   1.00 0.00 ? 41  GLU A HA   8  
ATOM 10306 H HB2  . GLU A 1 4  ? 16.579  -4.199  9.888   1.00 0.00 ? 41  GLU A HB2  8  
ATOM 10307 H HB3  . GLU A 1 4  ? 16.822  -2.974  8.653   1.00 0.00 ? 41  GLU A HB3  8  
ATOM 10308 H HG2  . GLU A 1 4  ? 14.470  -3.071  8.063   1.00 0.00 ? 41  GLU A HG2  8  
ATOM 10309 H HG3  . GLU A 1 4  ? 14.213  -4.344  9.253   1.00 0.00 ? 41  GLU A HG3  8  
ATOM 10310 N N    . ALA A 1 5  ? 16.792  -5.246  5.482   1.00 0.00 ? 42  ALA A N    8  
ATOM 10311 C CA   . ALA A 1 5  ? 16.813  -4.843  4.078   1.00 0.00 ? 42  ALA A CA   8  
ATOM 10312 C C    . ALA A 1 5  ? 15.405  -4.570  3.563   1.00 0.00 ? 42  ALA A C    8  
ATOM 10313 O O    . ALA A 1 5  ? 15.149  -3.546  2.930   1.00 0.00 ? 42  ALA A O    8  
ATOM 10314 C CB   . ALA A 1 5  ? 17.483  -5.916  3.233   1.00 0.00 ? 42  ALA A CB   8  
ATOM 10315 H H    . ALA A 1 5  ? 17.037  -6.169  5.716   1.00 0.00 ? 42  ALA A H    8  
ATOM 10316 H HA   . ALA A 1 5  ? 17.397  -3.938  3.999   1.00 0.00 ? 42  ALA A HA   8  
ATOM 10317 H HB1  . ALA A 1 5  ? 17.918  -6.663  3.879   1.00 0.00 ? 42  ALA A HB1  8  
ATOM 10318 H HB2  . ALA A 1 5  ? 16.748  -6.378  2.591   1.00 0.00 ? 42  ALA A HB2  8  
ATOM 10319 H HB3  . ALA A 1 5  ? 18.258  -5.467  2.628   1.00 0.00 ? 42  ALA A HB3  8  
ATOM 10320 N N    . SER A 1 6  ? 14.493  -5.479  3.868   1.00 0.00 ? 43  SER A N    8  
ATOM 10321 C CA   . SER A 1 6  ? 13.105  -5.338  3.469   1.00 0.00 ? 43  SER A CA   8  
ATOM 10322 C C    . SER A 1 6  ? 12.210  -5.717  4.647   1.00 0.00 ? 43  SER A C    8  
ATOM 10323 O O    . SER A 1 6  ? 11.045  -6.079  4.484   1.00 0.00 ? 43  SER A O    8  
ATOM 10324 C CB   . SER A 1 6  ? 12.814  -6.226  2.250   1.00 0.00 ? 43  SER A CB   8  
ATOM 10325 O OG   . SER A 1 6  ? 11.580  -5.885  1.633   1.00 0.00 ? 43  SER A OG   8  
ATOM 10326 H H    . SER A 1 6  ? 14.767  -6.277  4.382   1.00 0.00 ? 43  SER A H    8  
ATOM 10327 H HA   . SER A 1 6  ? 12.930  -4.304  3.211   1.00 0.00 ? 43  SER A HA   8  
ATOM 10328 H HB2  . SER A 1 6  ? 13.605  -6.106  1.524   1.00 0.00 ? 43  SER A HB2  8  
ATOM 10329 H HB3  . SER A 1 6  ? 12.770  -7.258  2.564   1.00 0.00 ? 43  SER A HB3  8  
ATOM 10330 H HG   . SER A 1 6  ? 11.443  -6.450  0.861   1.00 0.00 ? 43  SER A HG   8  
ATOM 10331 N N    . SER A 1 7  ? 12.769  -5.604  5.845   1.00 0.00 ? 44  SER A N    8  
ATOM 10332 C CA   . SER A 1 7  ? 12.051  -5.936  7.067   1.00 0.00 ? 44  SER A CA   8  
ATOM 10333 C C    . SER A 1 7  ? 11.357  -4.713  7.657   1.00 0.00 ? 44  SER A C    8  
ATOM 10334 O O    . SER A 1 7  ? 11.121  -4.640  8.861   1.00 0.00 ? 44  SER A O    8  
ATOM 10335 C CB   . SER A 1 7  ? 13.013  -6.555  8.082   1.00 0.00 ? 44  SER A CB   8  
ATOM 10336 O OG   . SER A 1 7  ? 13.537  -7.782  7.604   1.00 0.00 ? 44  SER A OG   8  
ATOM 10337 H H    . SER A 1 7  ? 13.698  -5.302  5.908   1.00 0.00 ? 44  SER A H    8  
ATOM 10338 H HA   . SER A 1 7  ? 11.298  -6.662  6.815   1.00 0.00 ? 44  SER A HA   8  
ATOM 10339 H HB2  . SER A 1 7  ? 13.833  -5.878  8.257   1.00 0.00 ? 44  SER A HB2  8  
ATOM 10340 H HB3  . SER A 1 7  ? 12.491  -6.736  9.010   1.00 0.00 ? 44  SER A HB3  8  
ATOM 10341 H HG   . SER A 1 7  ? 12.948  -8.504  7.871   1.00 0.00 ? 44  SER A HG   8  
ATOM 10342 N N    . LYS A 1 8  ? 10.893  -3.832  6.784   1.00 0.00 ? 45  LYS A N    8  
ATOM 10343 C CA   . LYS A 1 8  ? 10.060  -2.720  7.205   1.00 0.00 ? 45  LYS A CA   8  
ATOM 10344 C C    . LYS A 1 8  ? 8.605   -3.156  7.185   1.00 0.00 ? 45  LYS A C    8  
ATOM 10345 O O    . LYS A 1 8  ? 8.199   -3.905  6.297   1.00 0.00 ? 45  LYS A O    8  
ATOM 10346 C CB   . LYS A 1 8  ? 10.251  -1.508  6.289   1.00 0.00 ? 45  LYS A CB   8  
ATOM 10347 C CG   . LYS A 1 8  ? 11.669  -0.956  6.269   1.00 0.00 ? 45  LYS A CG   8  
ATOM 10348 C CD   . LYS A 1 8  ? 12.115  -0.528  7.656   1.00 0.00 ? 45  LYS A CD   8  
ATOM 10349 C CE   . LYS A 1 8  ? 13.392  0.296   7.598   1.00 0.00 ? 45  LYS A CE   8  
ATOM 10350 N NZ   . LYS A 1 8  ? 13.763  0.848   8.928   1.00 0.00 ? 45  LYS A NZ   8  
ATOM 10351 H H    . LYS A 1 8  ? 10.997  -4.013  5.826   1.00 0.00 ? 45  LYS A H    8  
ATOM 10352 H HA   . LYS A 1 8  ? 10.337  -2.454  8.214   1.00 0.00 ? 45  LYS A HA   8  
ATOM 10353 H HB2  . LYS A 1 8  ? 9.987   -1.793  5.280   1.00 0.00 ? 45  LYS A HB2  8  
ATOM 10354 H HB3  . LYS A 1 8  ? 9.587   -0.721  6.612   1.00 0.00 ? 45  LYS A HB3  8  
ATOM 10355 H HG2  . LYS A 1 8  ? 12.337  -1.722  5.905   1.00 0.00 ? 45  LYS A HG2  8  
ATOM 10356 H HG3  . LYS A 1 8  ? 11.700  -0.101  5.610   1.00 0.00 ? 45  LYS A HG3  8  
ATOM 10357 H HD2  . LYS A 1 8  ? 11.333  0.063   8.109   1.00 0.00 ? 45  LYS A HD2  8  
ATOM 10358 H HD3  . LYS A 1 8  ? 12.293  -1.415  8.251   1.00 0.00 ? 45  LYS A HD3  8  
ATOM 10359 H HE2  . LYS A 1 8  ? 14.194  -0.333  7.243   1.00 0.00 ? 45  LYS A HE2  8  
ATOM 10360 H HE3  . LYS A 1 8  ? 13.245  1.115   6.905   1.00 0.00 ? 45  LYS A HE3  8  
ATOM 10361 H HZ1  . LYS A 1 8  ? 12.933  1.295   9.379   1.00 0.00 ? 45  LYS A HZ1  8  
ATOM 10362 H HZ2  . LYS A 1 8  ? 14.114  0.084   9.548   1.00 0.00 ? 45  LYS A HZ2  8  
ATOM 10363 H HZ3  . LYS A 1 8  ? 14.512  1.566   8.822   1.00 0.00 ? 45  LYS A HZ3  8  
ATOM 10364 N N    . SER A 1 9  ? 7.833   -2.728  8.169   1.00 0.00 ? 46  SER A N    8  
ATOM 10365 C CA   . SER A 1 9  ? 6.430   -3.094  8.228   1.00 0.00 ? 46  SER A CA   8  
ATOM 10366 C C    . SER A 1 9  ? 5.663   -2.427  7.096   1.00 0.00 ? 46  SER A C    8  
ATOM 10367 O O    . SER A 1 9  ? 5.443   -1.216  7.107   1.00 0.00 ? 46  SER A O    8  
ATOM 10368 C CB   . SER A 1 9  ? 5.835   -2.703  9.579   1.00 0.00 ? 46  SER A CB   8  
ATOM 10369 O OG   . SER A 1 9  ? 6.528   -3.339  10.641  1.00 0.00 ? 46  SER A OG   8  
ATOM 10370 H H    . SER A 1 9  ? 8.213   -2.148  8.873   1.00 0.00 ? 46  SER A H    8  
ATOM 10371 H HA   . SER A 1 9  ? 6.362   -4.166  8.112   1.00 0.00 ? 46  SER A HA   8  
ATOM 10372 H HB2  . SER A 1 9  ? 5.906   -1.632  9.706   1.00 0.00 ? 46  SER A HB2  8  
ATOM 10373 H HB3  . SER A 1 9  ? 4.798   -3.002  9.611   1.00 0.00 ? 46  SER A HB3  8  
ATOM 10374 H HG   . SER A 1 9  ? 6.812   -4.220  10.350  1.00 0.00 ? 46  SER A HG   8  
ATOM 10375 N N    . TYR A 1 10 ? 5.279   -3.227  6.113   1.00 0.00 ? 47  TYR A N    8  
ATOM 10376 C CA   . TYR A 1 10 ? 4.555   -2.723  4.955   1.00 0.00 ? 47  TYR A CA   8  
ATOM 10377 C C    . TYR A 1 10 ? 3.216   -2.138  5.369   1.00 0.00 ? 47  TYR A C    8  
ATOM 10378 O O    . TYR A 1 10 ? 2.810   -1.104  4.857   1.00 0.00 ? 47  TYR A O    8  
ATOM 10379 C CB   . TYR A 1 10 ? 4.359   -3.817  3.906   1.00 0.00 ? 47  TYR A CB   8  
ATOM 10380 C CG   . TYR A 1 10 ? 5.601   -4.098  3.089   1.00 0.00 ? 47  TYR A CG   8  
ATOM 10381 C CD1  . TYR A 1 10 ? 6.734   -4.660  3.669   1.00 0.00 ? 47  TYR A CD1  8  
ATOM 10382 C CD2  . TYR A 1 10 ? 5.647   -3.783  1.738   1.00 0.00 ? 47  TYR A CD2  8  
ATOM 10383 C CE1  . TYR A 1 10 ? 7.874   -4.900  2.925   1.00 0.00 ? 47  TYR A CE1  8  
ATOM 10384 C CE2  . TYR A 1 10 ? 6.780   -4.024  0.987   1.00 0.00 ? 47  TYR A CE2  8  
ATOM 10385 C CZ   . TYR A 1 10 ? 7.892   -4.581  1.584   1.00 0.00 ? 47  TYR A CZ   8  
ATOM 10386 O OH   . TYR A 1 10 ? 9.026   -4.817  0.838   1.00 0.00 ? 47  TYR A OH   8  
ATOM 10387 H H    . TYR A 1 10 ? 5.509   -4.178  6.157   1.00 0.00 ? 47  TYR A H    8  
ATOM 10388 H HA   . TYR A 1 10 ? 5.150   -1.932  4.522   1.00 0.00 ? 47  TYR A HA   8  
ATOM 10389 H HB2  . TYR A 1 10 ? 4.070   -4.732  4.399   1.00 0.00 ? 47  TYR A HB2  8  
ATOM 10390 H HB3  . TYR A 1 10 ? 3.574   -3.518  3.227   1.00 0.00 ? 47  TYR A HB3  8  
ATOM 10391 H HD1  . TYR A 1 10 ? 6.714   -4.909  4.720   1.00 0.00 ? 47  TYR A HD1  8  
ATOM 10392 H HD2  . TYR A 1 10 ? 4.776   -3.345  1.271   1.00 0.00 ? 47  TYR A HD2  8  
ATOM 10393 H HE1  . TYR A 1 10 ? 8.744   -5.336  3.395   1.00 0.00 ? 47  TYR A HE1  8  
ATOM 10394 H HE2  . TYR A 1 10 ? 6.794   -3.773  -0.063  1.00 0.00 ? 47  TYR A HE2  8  
ATOM 10395 H HH   . TYR A 1 10 ? 9.752   -5.076  1.421   1.00 0.00 ? 47  TYR A HH   8  
ATOM 10396 N N    . ARG A 1 11 ? 2.583   -2.755  6.360   1.00 0.00 ? 48  ARG A N    8  
ATOM 10397 C CA   . ARG A 1 11 ? 1.336   -2.238  6.916   1.00 0.00 ? 48  ARG A CA   8  
ATOM 10398 C C    . ARG A 1 11 ? 1.503   -0.789  7.373   1.00 0.00 ? 48  ARG A C    8  
ATOM 10399 O O    . ARG A 1 11 ? 0.686   0.067   7.050   1.00 0.00 ? 48  ARG A O    8  
ATOM 10400 C CB   . ARG A 1 11 ? 0.874   -3.111  8.090   1.00 0.00 ? 48  ARG A CB   8  
ATOM 10401 C CG   . ARG A 1 11 ? -0.129  -2.416  8.994   1.00 0.00 ? 48  ARG A CG   8  
ATOM 10402 C CD   . ARG A 1 11 ? -0.612  -3.312  10.126  1.00 0.00 ? 48  ARG A CD   8  
ATOM 10403 N NE   . ARG A 1 11 ? -1.594  -4.295  9.676   1.00 0.00 ? 48  ARG A NE   8  
ATOM 10404 C CZ   . ARG A 1 11 ? -1.313  -5.552  9.332   1.00 0.00 ? 48  ARG A CZ   8  
ATOM 10405 N NH1  . ARG A 1 11 ? -0.067  -6.011  9.420   1.00 0.00 ? 48  ARG A NH1  8  
ATOM 10406 N NH2  . ARG A 1 11 ? -2.286  -6.355  8.919   1.00 0.00 ? 48  ARG A NH2  8  
ATOM 10407 H H    . ARG A 1 11 ? 2.993   -3.555  6.764   1.00 0.00 ? 48  ARG A H    8  
ATOM 10408 H HA   . ARG A 1 11 ? 0.589   -2.273  6.138   1.00 0.00 ? 48  ARG A HA   8  
ATOM 10409 H HB2  . ARG A 1 11 ? 0.416   -4.009  7.700   1.00 0.00 ? 48  ARG A HB2  8  
ATOM 10410 H HB3  . ARG A 1 11 ? 1.735   -3.385  8.683   1.00 0.00 ? 48  ARG A HB3  8  
ATOM 10411 H HG2  . ARG A 1 11 ? 0.340   -1.543  9.422   1.00 0.00 ? 48  ARG A HG2  8  
ATOM 10412 H HG3  . ARG A 1 11 ? -0.980  -2.112  8.401   1.00 0.00 ? 48  ARG A HG3  8  
ATOM 10413 H HD2  . ARG A 1 11 ? 0.239   -3.832  10.540  1.00 0.00 ? 48  ARG A HD2  8  
ATOM 10414 H HD3  . ARG A 1 11 ? -1.059  -2.692  10.890  1.00 0.00 ? 48  ARG A HD3  8  
ATOM 10415 H HE   . ARG A 1 11 ? -2.539  -3.990  9.624   1.00 0.00 ? 48  ARG A HE   8  
ATOM 10416 H HH11 . ARG A 1 11 ? 0.673   -5.410  9.751   1.00 0.00 ? 48  ARG A HH11 8  
ATOM 10417 H HH12 . ARG A 1 11 ? 0.141   -6.967  9.179   1.00 0.00 ? 48  ARG A HH12 8  
ATOM 10418 H HH21 . ARG A 1 11 ? -3.228  -6.018  8.871   1.00 0.00 ? 48  ARG A HH21 8  
ATOM 10419 H HH22 . ARG A 1 11 ? -2.089  -7.311  8.670   1.00 0.00 ? 48  ARG A HH22 8  
ATOM 10420 N N    . GLU A 1 12 ? 2.616   -0.510  8.038   1.00 0.00 ? 49  GLU A N    8  
ATOM 10421 C CA   . GLU A 1 12 ? 2.940   0.818   8.486   1.00 0.00 ? 49  GLU A CA   8  
ATOM 10422 C C    . GLU A 1 12 ? 3.174   1.738   7.293   1.00 0.00 ? 49  GLU A C    8  
ATOM 10423 O O    . GLU A 1 12 ? 2.566   2.796   7.191   1.00 0.00 ? 49  GLU A O    8  
ATOM 10424 C CB   . GLU A 1 12 ? 4.185   0.728   9.363   1.00 0.00 ? 49  GLU A CB   8  
ATOM 10425 C CG   . GLU A 1 12 ? 4.888   2.042   9.576   1.00 0.00 ? 49  GLU A CG   8  
ATOM 10426 C CD   . GLU A 1 12 ? 4.280   2.880   10.684  1.00 0.00 ? 49  GLU A CD   8  
ATOM 10427 O OE1  . GLU A 1 12 ? 3.238   2.476   11.245  1.00 0.00 ? 49  GLU A OE1  8  
ATOM 10428 O OE2  . GLU A 1 12 ? 4.848   3.946   11.005  1.00 0.00 ? 49  GLU A OE2  8  
ATOM 10429 H H    . GLU A 1 12 ? 3.280   -1.204  8.169   1.00 0.00 ? 49  GLU A H    8  
ATOM 10430 H HA   . GLU A 1 12 ? 2.115   1.192   9.070   1.00 0.00 ? 49  GLU A HA   8  
ATOM 10431 H HB2  . GLU A 1 12 ? 3.903   0.340   10.328  1.00 0.00 ? 49  GLU A HB2  8  
ATOM 10432 H HB3  . GLU A 1 12 ? 4.883   0.043   8.901   1.00 0.00 ? 49  GLU A HB3  8  
ATOM 10433 H HG2  . GLU A 1 12 ? 5.917   1.840   9.816   1.00 0.00 ? 49  GLU A HG2  8  
ATOM 10434 H HG3  . GLU A 1 12 ? 4.835   2.596   8.652   1.00 0.00 ? 49  GLU A HG3  8  
ATOM 10435 N N    . LEU A 1 13 ? 4.006   1.279   6.364   1.00 0.00 ? 50  LEU A N    8  
ATOM 10436 C CA   . LEU A 1 13 ? 4.315   2.028   5.149   1.00 0.00 ? 50  LEU A CA   8  
ATOM 10437 C C    . LEU A 1 13 ? 3.044   2.395   4.376   1.00 0.00 ? 50  LEU A C    8  
ATOM 10438 O O    . LEU A 1 13 ? 2.847   3.551   3.994   1.00 0.00 ? 50  LEU A O    8  
ATOM 10439 C CB   . LEU A 1 13 ? 5.235   1.191   4.256   1.00 0.00 ? 50  LEU A CB   8  
ATOM 10440 C CG   . LEU A 1 13 ? 6.745   1.277   4.537   1.00 0.00 ? 50  LEU A CG   8  
ATOM 10441 C CD1  . LEU A 1 13 ? 7.055   1.378   6.022   1.00 0.00 ? 50  LEU A CD1  8  
ATOM 10442 C CD2  . LEU A 1 13 ? 7.435   0.057   3.964   1.00 0.00 ? 50  LEU A CD2  8  
ATOM 10443 H H    . LEU A 1 13 ? 4.422   0.398   6.493   1.00 0.00 ? 50  LEU A H    8  
ATOM 10444 H HA   . LEU A 1 13 ? 4.828   2.935   5.433   1.00 0.00 ? 50  LEU A HA   8  
ATOM 10445 H HB2  . LEU A 1 13 ? 4.939   0.156   4.351   1.00 0.00 ? 50  LEU A HB2  8  
ATOM 10446 H HB3  . LEU A 1 13 ? 5.069   1.495   3.232   1.00 0.00 ? 50  LEU A HB3  8  
ATOM 10447 H HG   . LEU A 1 13 ? 7.149   2.149   4.048   1.00 0.00 ? 50  LEU A HG   8  
ATOM 10448 H HD11 . LEU A 1 13 ? 6.139   1.533   6.574   1.00 0.00 ? 50  LEU A HD11 8  
ATOM 10449 H HD12 . LEU A 1 13 ? 7.527   0.462   6.350   1.00 0.00 ? 50  LEU A HD12 8  
ATOM 10450 H HD13 . LEU A 1 13 ? 7.726   2.209   6.191   1.00 0.00 ? 50  LEU A HD13 8  
ATOM 10451 H HD21 . LEU A 1 13 ? 6.765   -0.786  4.009   1.00 0.00 ? 50  LEU A HD21 8  
ATOM 10452 H HD22 . LEU A 1 13 ? 7.709   0.246   2.936   1.00 0.00 ? 50  LEU A HD22 8  
ATOM 10453 H HD23 . LEU A 1 13 ? 8.325   -0.159  4.538   1.00 0.00 ? 50  LEU A HD23 8  
ATOM 10454 N N    . ILE A 1 14 ? 2.192   1.403   4.156   1.00 0.00 ? 51  ILE A N    8  
ATOM 10455 C CA   . ILE A 1 14 ? 0.947   1.596   3.426   1.00 0.00 ? 51  ILE A CA   8  
ATOM 10456 C C    . ILE A 1 14 ? -0.003  2.492   4.190   1.00 0.00 ? 51  ILE A C    8  
ATOM 10457 O O    . ILE A 1 14 ? -0.537  3.432   3.629   1.00 0.00 ? 51  ILE A O    8  
ATOM 10458 C CB   . ILE A 1 14 ? 0.245   0.256   3.155   1.00 0.00 ? 51  ILE A CB   8  
ATOM 10459 C CG1  . ILE A 1 14 ? 1.166   -0.675  2.375   1.00 0.00 ? 51  ILE A CG1  8  
ATOM 10460 C CG2  . ILE A 1 14 ? -1.058  0.475   2.396   1.00 0.00 ? 51  ILE A CG2  8  
ATOM 10461 C CD1  . ILE A 1 14 ? 0.599   -2.060  2.213   1.00 0.00 ? 51  ILE A CD1  8  
ATOM 10462 H H    . ILE A 1 14 ? 2.413   0.505   4.491   1.00 0.00 ? 51  ILE A H    8  
ATOM 10463 H HA   . ILE A 1 14 ? 1.172   2.062   2.475   1.00 0.00 ? 51  ILE A HA   8  
ATOM 10464 H HB   . ILE A 1 14 ? 0.007   -0.198  4.105   1.00 0.00 ? 51  ILE A HB   8  
ATOM 10465 H HG12 . ILE A 1 14 ? 1.338   -0.267  1.390   1.00 0.00 ? 51  ILE A HG12 8  
ATOM 10466 H HG13 . ILE A 1 14 ? 2.110   -0.756  2.898   1.00 0.00 ? 51  ILE A HG13 8  
ATOM 10467 H HG21 . ILE A 1 14 ? -1.429  1.469   2.597   1.00 0.00 ? 51  ILE A HG21 8  
ATOM 10468 H HG22 . ILE A 1 14 ? -0.878  0.362   1.338   1.00 0.00 ? 51  ILE A HG22 8  
ATOM 10469 H HG23 . ILE A 1 14 ? -1.789  -0.255  2.717   1.00 0.00 ? 51  ILE A HG23 8  
ATOM 10470 H HD11 . ILE A 1 14 ? -0.479  -1.999  2.201   1.00 0.00 ? 51  ILE A HD11 8  
ATOM 10471 H HD12 . ILE A 1 14 ? 0.948   -2.487  1.285   1.00 0.00 ? 51  ILE A HD12 8  
ATOM 10472 H HD13 . ILE A 1 14 ? 0.917   -2.677  3.040   1.00 0.00 ? 51  ILE A HD13 8  
ATOM 10473 N N    . ILE A 1 15 ? -0.233  2.184   5.454   1.00 0.00 ? 52  ILE A N    8  
ATOM 10474 C CA   . ILE A 1 15 ? -1.159  2.961   6.262   1.00 0.00 ? 52  ILE A CA   8  
ATOM 10475 C C    . ILE A 1 15 ? -0.704  4.408   6.387   1.00 0.00 ? 52  ILE A C    8  
ATOM 10476 O O    . ILE A 1 15 ? -1.486  5.333   6.154   1.00 0.00 ? 52  ILE A O    8  
ATOM 10477 C CB   . ILE A 1 15 ? -1.340  2.352   7.665   1.00 0.00 ? 52  ILE A CB   8  
ATOM 10478 C CG1  . ILE A 1 15 ? -2.251  1.125   7.582   1.00 0.00 ? 52  ILE A CG1  8  
ATOM 10479 C CG2  . ILE A 1 15 ? -1.901  3.390   8.625   1.00 0.00 ? 52  ILE A CG2  8  
ATOM 10480 C CD1  . ILE A 1 15 ? -2.362  0.351   8.873   1.00 0.00 ? 52  ILE A CD1  8  
ATOM 10481 H H    . ILE A 1 15 ? 0.211   1.399   5.850   1.00 0.00 ? 52  ILE A H    8  
ATOM 10482 H HA   . ILE A 1 15 ? -2.119  2.946   5.764   1.00 0.00 ? 52  ILE A HA   8  
ATOM 10483 H HB   . ILE A 1 15 ? -0.371  2.048   8.029   1.00 0.00 ? 52  ILE A HB   8  
ATOM 10484 H HG12 . ILE A 1 15 ? -3.245  1.441   7.301   1.00 0.00 ? 52  ILE A HG12 8  
ATOM 10485 H HG13 . ILE A 1 15 ? -1.868  0.456   6.826   1.00 0.00 ? 52  ILE A HG13 8  
ATOM 10486 H HG21 . ILE A 1 15 ? -1.730  4.377   8.215   1.00 0.00 ? 52  ILE A HG21 8  
ATOM 10487 H HG22 . ILE A 1 15 ? -2.960  3.229   8.751   1.00 0.00 ? 52  ILE A HG22 8  
ATOM 10488 H HG23 . ILE A 1 15 ? -1.405  3.306   9.578   1.00 0.00 ? 52  ILE A HG23 8  
ATOM 10489 H HD11 . ILE A 1 15 ? -1.380  0.237   9.311   1.00 0.00 ? 52  ILE A HD11 8  
ATOM 10490 H HD12 . ILE A 1 15 ? -3.005  0.885   9.557   1.00 0.00 ? 52  ILE A HD12 8  
ATOM 10491 H HD13 . ILE A 1 15 ? -2.782  -0.626  8.667   1.00 0.00 ? 52  ILE A HD13 8  
ATOM 10492 N N    . GLU A 1 16 ? 0.572   4.595   6.696   1.00 0.00 ? 53  GLU A N    8  
ATOM 10493 C CA   . GLU A 1 16 ? 1.147   5.925   6.806   1.00 0.00 ? 53  GLU A CA   8  
ATOM 10494 C C    . GLU A 1 16 ? 0.898   6.723   5.539   1.00 0.00 ? 53  GLU A C    8  
ATOM 10495 O O    . GLU A 1 16 ? 0.495   7.885   5.594   1.00 0.00 ? 53  GLU A O    8  
ATOM 10496 C CB   . GLU A 1 16 ? 2.643   5.840   7.082   1.00 0.00 ? 53  GLU A CB   8  
ATOM 10497 C CG   . GLU A 1 16 ? 2.974   5.611   8.542   1.00 0.00 ? 53  GLU A CG   8  
ATOM 10498 C CD   . GLU A 1 16 ? 2.184   6.512   9.469   1.00 0.00 ? 53  GLU A CD   8  
ATOM 10499 O OE1  . GLU A 1 16 ? 2.290   7.751   9.341   1.00 0.00 ? 53  GLU A OE1  8  
ATOM 10500 O OE2  . GLU A 1 16 ? 1.458   5.986   10.336  1.00 0.00 ? 53  GLU A OE2  8  
ATOM 10501 H H    . GLU A 1 16 ? 1.154   3.812   6.829   1.00 0.00 ? 53  GLU A H    8  
ATOM 10502 H HA   . GLU A 1 16 ? 0.663   6.427   7.631   1.00 0.00 ? 53  GLU A HA   8  
ATOM 10503 H HB2  . GLU A 1 16 ? 3.049   5.009   6.517   1.00 0.00 ? 53  GLU A HB2  8  
ATOM 10504 H HB3  . GLU A 1 16 ? 3.114   6.754   6.761   1.00 0.00 ? 53  GLU A HB3  8  
ATOM 10505 H HG2  . GLU A 1 16 ? 2.759   4.583   8.788   1.00 0.00 ? 53  GLU A HG2  8  
ATOM 10506 H HG3  . GLU A 1 16 ? 4.028   5.803   8.687   1.00 0.00 ? 53  GLU A HG3  8  
ATOM 10507 N N    . GLY A 1 17 ? 1.067   6.068   4.404   1.00 0.00 ? 54  GLY A N    8  
ATOM 10508 C CA   . GLY A 1 17 ? 0.777   6.709   3.150   1.00 0.00 ? 54  GLY A CA   8  
ATOM 10509 C C    . GLY A 1 17 ? -0.694  6.852   2.911   1.00 0.00 ? 54  GLY A C    8  
ATOM 10510 O O    . GLY A 1 17 ? -1.166  7.932   2.595   1.00 0.00 ? 54  GLY A O    8  
ATOM 10511 H H    . GLY A 1 17 ? 1.340   5.125   4.423   1.00 0.00 ? 54  GLY A H    8  
ATOM 10512 H HA2  . GLY A 1 17 ? 1.233   7.687   3.136   1.00 0.00 ? 54  GLY A HA2  8  
ATOM 10513 H HA3  . GLY A 1 17 ? 1.184   6.120   2.350   1.00 0.00 ? 54  GLY A HA3  8  
ATOM 10514 N N    . LEU A 1 18 ? -1.388  5.730   2.937   1.00 0.00 ? 55  LEU A N    8  
ATOM 10515 C CA   . LEU A 1 18 ? -2.779  5.678   2.544   1.00 0.00 ? 55  LEU A CA   8  
ATOM 10516 C C    . LEU A 1 18 ? -3.645  6.623   3.378   1.00 0.00 ? 55  LEU A C    8  
ATOM 10517 O O    . LEU A 1 18 ? -4.616  7.180   2.874   1.00 0.00 ? 55  LEU A O    8  
ATOM 10518 C CB   . LEU A 1 18 ? -3.284  4.236   2.619   1.00 0.00 ? 55  LEU A CB   8  
ATOM 10519 C CG   . LEU A 1 18 ? -4.604  3.958   1.905   1.00 0.00 ? 55  LEU A CG   8  
ATOM 10520 C CD1  . LEU A 1 18 ? -4.693  4.753   0.610   1.00 0.00 ? 55  LEU A CD1  8  
ATOM 10521 C CD2  . LEU A 1 18 ? -4.735  2.474   1.613   1.00 0.00 ? 55  LEU A CD2  8  
ATOM 10522 H H    . LEU A 1 18 ? -0.912  4.876   3.112   1.00 0.00 ? 55  LEU A H    8  
ATOM 10523 H HA   . LEU A 1 18 ? -2.825  5.993   1.516   1.00 0.00 ? 55  LEU A HA   8  
ATOM 10524 H HB2  . LEU A 1 18 ? -2.530  3.593   2.193   1.00 0.00 ? 55  LEU A HB2  8  
ATOM 10525 H HB3  . LEU A 1 18 ? -3.406  3.976   3.659   1.00 0.00 ? 55  LEU A HB3  8  
ATOM 10526 H HG   . LEU A 1 18 ? -5.424  4.250   2.543   1.00 0.00 ? 55  LEU A HG   8  
ATOM 10527 H HD11 . LEU A 1 18 ? -3.822  4.553   0.005   1.00 0.00 ? 55  LEU A HD11 8  
ATOM 10528 H HD12 . LEU A 1 18 ? -5.580  4.459   0.070   1.00 0.00 ? 55  LEU A HD12 8  
ATOM 10529 H HD13 . LEU A 1 18 ? -4.740  5.806   0.838   1.00 0.00 ? 55  LEU A HD13 8  
ATOM 10530 H HD21 . LEU A 1 18 ? -3.769  2.001   1.709   1.00 0.00 ? 55  LEU A HD21 8  
ATOM 10531 H HD22 . LEU A 1 18 ? -5.428  2.028   2.316   1.00 0.00 ? 55  LEU A HD22 8  
ATOM 10532 H HD23 . LEU A 1 18 ? -5.107  2.338   0.607   1.00 0.00 ? 55  LEU A HD23 8  
ATOM 10533 N N    . THR A 1 19 ? -3.261  6.857   4.626   1.00 0.00 ? 56  THR A N    8  
ATOM 10534 C CA   . THR A 1 19 ? -3.976  7.810   5.464   1.00 0.00 ? 56  THR A CA   8  
ATOM 10535 C C    . THR A 1 19 ? -3.619  9.246   5.056   1.00 0.00 ? 56  THR A C    8  
ATOM 10536 O O    . THR A 1 19 ? -4.417  10.170  5.218   1.00 0.00 ? 56  THR A O    8  
ATOM 10537 C CB   . THR A 1 19 ? -3.673  7.596   6.974   1.00 0.00 ? 56  THR A CB   8  
ATOM 10538 O OG1  . THR A 1 19 ? -4.729  8.151   7.774   1.00 0.00 ? 56  THR A OG1  8  
ATOM 10539 C CG2  . THR A 1 19 ? -2.355  8.236   7.381   1.00 0.00 ? 56  THR A CG2  8  
ATOM 10540 H H    . THR A 1 19 ? -2.457  6.411   4.978   1.00 0.00 ? 56  THR A H    8  
ATOM 10541 H HA   . THR A 1 19 ? -5.035  7.655   5.306   1.00 0.00 ? 56  THR A HA   8  
ATOM 10542 H HB   . THR A 1 19 ? -3.607  6.536   7.168   1.00 0.00 ? 56  THR A HB   8  
ATOM 10543 H HG1  . THR A 1 19 ? -4.396  8.923   8.256   1.00 0.00 ? 56  THR A HG1  8  
ATOM 10544 H HG21 . THR A 1 19 ? -2.323  9.252   7.014   1.00 0.00 ? 56  THR A HG21 8  
ATOM 10545 H HG22 . THR A 1 19 ? -2.274  8.238   8.457   1.00 0.00 ? 56  THR A HG22 8  
ATOM 10546 H HG23 . THR A 1 19 ? -1.535  7.674   6.959   1.00 0.00 ? 56  THR A HG23 8  
ATOM 10547 N N    . ALA A 1 20 ? -2.377  9.430   4.609   1.00 0.00 ? 57  ALA A N    8  
ATOM 10548 C CA   . ALA A 1 20 ? -1.855  10.752  4.293   1.00 0.00 ? 57  ALA A CA   8  
ATOM 10549 C C    . ALA A 1 20 ? -2.173  11.175  2.864   1.00 0.00 ? 57  ALA A C    8  
ATOM 10550 O O    . ALA A 1 20 ? -2.631  12.297  2.635   1.00 0.00 ? 57  ALA A O    8  
ATOM 10551 C CB   . ALA A 1 20 ? -0.352  10.782  4.529   1.00 0.00 ? 57  ALA A CB   8  
ATOM 10552 H H    . ALA A 1 20 ? -1.776  8.660   4.552   1.00 0.00 ? 57  ALA A H    8  
ATOM 10553 H HA   . ALA A 1 20 ? -2.309  11.456  4.974   1.00 0.00 ? 57  ALA A HA   8  
ATOM 10554 H HB1  . ALA A 1 20 ? -0.054  9.887   5.057   1.00 0.00 ? 57  ALA A HB1  8  
ATOM 10555 H HB2  . ALA A 1 20 ? 0.160   10.829  3.579   1.00 0.00 ? 57  ALA A HB2  8  
ATOM 10556 H HB3  . ALA A 1 20 ? -0.097  11.650  5.118   1.00 0.00 ? 57  ALA A HB3  8  
ATOM 10557 N N    . LEU A 1 21 ? -1.867  10.321  1.892   1.00 0.00 ? 58  LEU A N    8  
ATOM 10558 C CA   . LEU A 1 21 ? -2.070  10.690  0.506   1.00 0.00 ? 58  LEU A CA   8  
ATOM 10559 C C    . LEU A 1 21 ? -3.550  10.594  0.152   1.00 0.00 ? 58  LEU A C    8  
ATOM 10560 O O    . LEU A 1 21 ? -4.145  11.617  -0.158  1.00 0.00 ? 58  LEU A O    8  
ATOM 10561 C CB   . LEU A 1 21 ? -1.181  9.867   -0.453  1.00 0.00 ? 58  LEU A CB   8  
ATOM 10562 C CG   . LEU A 1 21 ? -1.763  8.563   -1.006  1.00 0.00 ? 58  LEU A CG   8  
ATOM 10563 C CD1  . LEU A 1 21 ? -1.487  8.448   -2.495  1.00 0.00 ? 58  LEU A CD1  8  
ATOM 10564 C CD2  . LEU A 1 21 ? -1.199  7.371   -0.279  1.00 0.00 ? 58  LEU A CD2  8  
ATOM 10565 H H    . LEU A 1 21 ? -1.472  9.448   2.114   1.00 0.00 ? 58  LEU A H    8  
ATOM 10566 H HA   . LEU A 1 21 ? -1.778  11.718  0.420   1.00 0.00 ? 58  LEU A HA   8  
ATOM 10567 H HB2  . LEU A 1 21 ? -0.929  10.498  -1.292  1.00 0.00 ? 58  LEU A HB2  8  
ATOM 10568 H HB3  . LEU A 1 21 ? -0.268  9.627   0.070   1.00 0.00 ? 58  LEU A HB3  8  
ATOM 10569 H HG   . LEU A 1 21 ? -2.821  8.558   -0.855  1.00 0.00 ? 58  LEU A HG   8  
ATOM 10570 H HD11 . LEU A 1 21 ? -1.928  9.289   -3.008  1.00 0.00 ? 58  LEU A HD11 8  
ATOM 10571 H HD12 . LEU A 1 21 ? -0.419  8.445   -2.665  1.00 0.00 ? 58  LEU A HD12 8  
ATOM 10572 H HD13 . LEU A 1 21 ? -1.914  7.530   -2.870  1.00 0.00 ? 58  LEU A HD13 8  
ATOM 10573 H HD21 . LEU A 1 21 ? -0.759  7.706   0.649   1.00 0.00 ? 58  LEU A HD21 8  
ATOM 10574 H HD22 . LEU A 1 21 ? -1.997  6.669   -0.067  1.00 0.00 ? 58  LEU A HD22 8  
ATOM 10575 H HD23 . LEU A 1 21 ? -0.450  6.894   -0.890  1.00 0.00 ? 58  LEU A HD23 8  
ATOM 10576 N N    . LYS A 1 22 ? -4.136  9.406   0.424   1.00 0.00 ? 59  LYS A N    8  
ATOM 10577 C CA   . LYS A 1 22 ? -5.570  9.045   0.280   1.00 0.00 ? 59  LYS A CA   8  
ATOM 10578 C C    . LYS A 1 22 ? -6.308  9.578   -0.972  1.00 0.00 ? 59  LYS A C    8  
ATOM 10579 O O    . LYS A 1 22 ? -7.115  8.851   -1.553  1.00 0.00 ? 59  LYS A O    8  
ATOM 10580 C CB   . LYS A 1 22 ? -6.356  9.345   1.567   1.00 0.00 ? 59  LYS A CB   8  
ATOM 10581 C CG   . LYS A 1 22 ? -6.987  10.723  1.670   1.00 0.00 ? 59  LYS A CG   8  
ATOM 10582 C CD   . LYS A 1 22 ? -5.997  11.756  2.181   1.00 0.00 ? 59  LYS A CD   8  
ATOM 10583 C CE   . LYS A 1 22 ? -6.702  13.010  2.658   1.00 0.00 ? 59  LYS A CE   8  
ATOM 10584 N NZ   . LYS A 1 22 ? -5.746  14.106  2.966   1.00 0.00 ? 59  LYS A NZ   8  
ATOM 10585 H H    . LYS A 1 22 ? -3.578  8.742   0.865   1.00 0.00 ? 59  LYS A H    8  
ATOM 10586 H HA   . LYS A 1 22 ? -5.566  7.969   0.176   1.00 0.00 ? 59  LYS A HA   8  
ATOM 10587 H HB2  . LYS A 1 22 ? -7.138  8.614   1.658   1.00 0.00 ? 59  LYS A HB2  8  
ATOM 10588 H HB3  . LYS A 1 22 ? -5.685  9.228   2.406   1.00 0.00 ? 59  LYS A HB3  8  
ATOM 10589 H HG2  . LYS A 1 22 ? -7.334  11.019  0.687   1.00 0.00 ? 59  LYS A HG2  8  
ATOM 10590 H HG3  . LYS A 1 22 ? -7.828  10.674  2.347   1.00 0.00 ? 59  LYS A HG3  8  
ATOM 10591 H HD2  . LYS A 1 22 ? -5.442  11.333  3.004   1.00 0.00 ? 59  LYS A HD2  8  
ATOM 10592 H HD3  . LYS A 1 22 ? -5.320  12.016  1.381   1.00 0.00 ? 59  LYS A HD3  8  
ATOM 10593 H HE2  . LYS A 1 22 ? -7.380  13.341  1.885   1.00 0.00 ? 59  LYS A HE2  8  
ATOM 10594 H HE3  . LYS A 1 22 ? -7.260  12.771  3.550   1.00 0.00 ? 59  LYS A HE3  8  
ATOM 10595 H HZ1  . LYS A 1 22 ? -5.017  13.776  3.637   1.00 0.00 ? 59  LYS A HZ1  8  
ATOM 10596 H HZ2  . LYS A 1 22 ? -5.277  14.431  2.094   1.00 0.00 ? 59  LYS A HZ2  8  
ATOM 10597 H HZ3  . LYS A 1 22 ? -6.253  14.910  3.396   1.00 0.00 ? 59  LYS A HZ3  8  
ATOM 10598 N N    . GLU A 1 23 ? -6.102  10.833  -1.335  1.00 0.00 ? 60  GLU A N    8  
ATOM 10599 C CA   . GLU A 1 23 ? -6.809  11.472  -2.433  1.00 0.00 ? 60  GLU A CA   8  
ATOM 10600 C C    . GLU A 1 23 ? -8.296  11.553  -2.100  1.00 0.00 ? 60  GLU A C    8  
ATOM 10601 O O    . GLU A 1 23 ? -8.689  12.317  -1.219  1.00 0.00 ? 60  GLU A O    8  
ATOM 10602 C CB   . GLU A 1 23 ? -6.554  10.740  -3.757  1.00 0.00 ? 60  GLU A CB   8  
ATOM 10603 C CG   . GLU A 1 23 ? -5.081  10.686  -4.129  1.00 0.00 ? 60  GLU A CG   8  
ATOM 10604 C CD   . GLU A 1 23 ? -4.831  10.056  -5.480  1.00 0.00 ? 60  GLU A CD   8  
ATOM 10605 O OE1  . GLU A 1 23 ? -5.173  8.868   -5.657  1.00 0.00 ? 60  GLU A OE1  8  
ATOM 10606 O OE2  . GLU A 1 23 ? -4.298  10.739  -6.376  1.00 0.00 ? 60  GLU A OE2  8  
ATOM 10607 H H    . GLU A 1 23 ? -5.479  11.371  -0.802  1.00 0.00 ? 60  GLU A H    8  
ATOM 10608 H HA   . GLU A 1 23 ? -6.428  12.480  -2.516  1.00 0.00 ? 60  GLU A HA   8  
ATOM 10609 H HB2  . GLU A 1 23 ? -6.923  9.728   -3.676  1.00 0.00 ? 60  GLU A HB2  8  
ATOM 10610 H HB3  . GLU A 1 23 ? -7.087  11.247  -4.548  1.00 0.00 ? 60  GLU A HB3  8  
ATOM 10611 H HG2  . GLU A 1 23 ? -4.692  11.694  -4.145  1.00 0.00 ? 60  GLU A HG2  8  
ATOM 10612 H HG3  . GLU A 1 23 ? -4.558  10.114  -3.378  1.00 0.00 ? 60  GLU A HG3  8  
ATOM 10613 N N    . ARG A 1 24 ? -9.103  10.718  -2.730  1.00 0.00 ? 61  ARG A N    8  
ATOM 10614 C CA   . ARG A 1 24 ? -10.523 10.667  -2.411  1.00 0.00 ? 61  ARG A CA   8  
ATOM 10615 C C    . ARG A 1 24 ? -10.759 9.887   -1.116  1.00 0.00 ? 61  ARG A C    8  
ATOM 10616 O O    . ARG A 1 24 ? -11.673 10.199  -0.353  1.00 0.00 ? 61  ARG A O    8  
ATOM 10617 C CB   . ARG A 1 24 ? -11.314 10.044  -3.563  1.00 0.00 ? 61  ARG A CB   8  
ATOM 10618 C CG   . ARG A 1 24 ? -11.034 8.568   -3.802  1.00 0.00 ? 61  ARG A CG   8  
ATOM 10619 C CD   . ARG A 1 24 ? -11.864 8.042   -4.959  1.00 0.00 ? 61  ARG A CD   8  
ATOM 10620 N NE   . ARG A 1 24 ? -11.487 8.666   -6.220  1.00 0.00 ? 61  ARG A NE   8  
ATOM 10621 C CZ   . ARG A 1 24 ? -12.284 8.743   -7.282  1.00 0.00 ? 61  ARG A CZ   8  
ATOM 10622 N NH1  . ARG A 1 24 ? -13.536 8.299   -7.217  1.00 0.00 ? 61  ARG A NH1  8  
ATOM 10623 N NH2  . ARG A 1 24 ? -11.834 9.275   -8.407  1.00 0.00 ? 61  ARG A NH2  8  
ATOM 10624 H H    . ARG A 1 24 ? -8.733  10.089  -3.388  1.00 0.00 ? 61  ARG A H    8  
ATOM 10625 H HA   . ARG A 1 24 ? -10.862 11.682  -2.267  1.00 0.00 ? 61  ARG A HA   8  
ATOM 10626 H HB2  . ARG A 1 24 ? -12.369 10.156  -3.357  1.00 0.00 ? 61  ARG A HB2  8  
ATOM 10627 H HB3  . ARG A 1 24 ? -11.080 10.581  -4.472  1.00 0.00 ? 61  ARG A HB3  8  
ATOM 10628 H HG2  . ARG A 1 24 ? -9.987  8.441   -4.032  1.00 0.00 ? 61  ARG A HG2  8  
ATOM 10629 H HG3  . ARG A 1 24 ? -11.279 8.012   -2.908  1.00 0.00 ? 61  ARG A HG3  8  
ATOM 10630 H HD2  . ARG A 1 24 ? -11.715 6.974   -5.036  1.00 0.00 ? 61  ARG A HD2  8  
ATOM 10631 H HD3  . ARG A 1 24 ? -12.905 8.247   -4.761  1.00 0.00 ? 61  ARG A HD3  8  
ATOM 10632 H HE   . ARG A 1 24 ? -10.571 9.036   -6.283  1.00 0.00 ? 61  ARG A HE   8  
ATOM 10633 H HH11 . ARG A 1 24 ? -13.893 7.905   -6.362  1.00 0.00 ? 61  ARG A HH11 8  
ATOM 10634 H HH12 . ARG A 1 24 ? -14.138 8.374   -8.016  1.00 0.00 ? 61  ARG A HH12 8  
ATOM 10635 H HH21 . ARG A 1 24 ? -10.889 9.621   -8.467  1.00 0.00 ? 61  ARG A HH21 8  
ATOM 10636 H HH22 . ARG A 1 24 ? -12.444 9.359   -9.203  1.00 0.00 ? 61  ARG A HH22 8  
ATOM 10637 N N    . LYS A 1 25 ? -9.877  8.918   -0.859  1.00 0.00 ? 62  LYS A N    8  
ATOM 10638 C CA   . LYS A 1 25 ? -9.907  8.086   0.351   1.00 0.00 ? 62  LYS A CA   8  
ATOM 10639 C C    . LYS A 1 25 ? -8.963  6.907   0.169   1.00 0.00 ? 62  LYS A C    8  
ATOM 10640 O O    . LYS A 1 25 ? -8.377  6.410   1.125   1.00 0.00 ? 62  LYS A O    8  
ATOM 10641 C CB   . LYS A 1 25 ? -11.318 7.572   0.704   1.00 0.00 ? 62  LYS A CB   8  
ATOM 10642 C CG   . LYS A 1 25 ? -11.961 6.673   -0.346  1.00 0.00 ? 62  LYS A CG   8  
ATOM 10643 C CD   . LYS A 1 25 ? -13.077 7.380   -1.112  1.00 0.00 ? 62  LYS A CD   8  
ATOM 10644 C CE   . LYS A 1 25 ? -14.343 7.574   -0.275  1.00 0.00 ? 62  LYS A CE   8  
ATOM 10645 N NZ   . LYS A 1 25 ? -14.208 8.652   0.744   1.00 0.00 ? 62  LYS A NZ   8  
ATOM 10646 H H    . LYS A 1 25 ? -9.109  8.819   -1.464  1.00 0.00 ? 62  LYS A H    8  
ATOM 10647 H HA   . LYS A 1 25 ? -9.543  8.694   1.168   1.00 0.00 ? 62  LYS A HA   8  
ATOM 10648 H HB2  . LYS A 1 25 ? -11.261 7.015   1.625   1.00 0.00 ? 62  LYS A HB2  8  
ATOM 10649 H HB3  . LYS A 1 25 ? -11.967 8.423   0.855   1.00 0.00 ? 62  LYS A HB3  8  
ATOM 10650 H HG2  . LYS A 1 25 ? -11.201 6.360   -1.048  1.00 0.00 ? 62  LYS A HG2  8  
ATOM 10651 H HG3  . LYS A 1 25 ? -12.371 5.804   0.147   1.00 0.00 ? 62  LYS A HG3  8  
ATOM 10652 H HD2  . LYS A 1 25 ? -12.721 8.349   -1.425  1.00 0.00 ? 62  LYS A HD2  8  
ATOM 10653 H HD3  . LYS A 1 25 ? -13.322 6.791   -1.983  1.00 0.00 ? 62  LYS A HD3  8  
ATOM 10654 H HE2  . LYS A 1 25 ? -15.157 7.825   -0.937  1.00 0.00 ? 62  LYS A HE2  8  
ATOM 10655 H HE3  . LYS A 1 25 ? -14.568 6.644   0.227   1.00 0.00 ? 62  LYS A HE3  8  
ATOM 10656 H HZ1  . LYS A 1 25 ? -13.400 8.462   1.371   1.00 0.00 ? 62  LYS A HZ1  8  
ATOM 10657 H HZ2  . LYS A 1 25 ? -14.068 9.580   0.282   1.00 0.00 ? 62  LYS A HZ2  8  
ATOM 10658 H HZ3  . LYS A 1 25 ? -15.073 8.701   1.328   1.00 0.00 ? 62  LYS A HZ3  8  
ATOM 10659 N N    . GLY A 1 26 ? -8.794  6.498   -1.079  1.00 0.00 ? 63  GLY A N    8  
ATOM 10660 C CA   . GLY A 1 26 ? -7.895  5.415   -1.401  1.00 0.00 ? 63  GLY A CA   8  
ATOM 10661 C C    . GLY A 1 26 ? -7.165  5.677   -2.695  1.00 0.00 ? 63  GLY A C    8  
ATOM 10662 O O    . GLY A 1 26 ? -7.683  6.377   -3.570  1.00 0.00 ? 63  GLY A O    8  
ATOM 10663 H H    . GLY A 1 26 ? -9.260  6.960   -1.801  1.00 0.00 ? 63  GLY A H    8  
ATOM 10664 H HA2  . GLY A 1 26 ? -7.175  5.305   -0.605  1.00 0.00 ? 63  GLY A HA2  8  
ATOM 10665 H HA3  . GLY A 1 26 ? -8.460  4.501   -1.497  1.00 0.00 ? 63  GLY A HA3  8  
ATOM 10666 N N    . SER A 1 27 ? -5.966  5.143   -2.812  1.00 0.00 ? 64  SER A N    8  
ATOM 10667 C CA   . SER A 1 27 ? -5.157  5.355   -3.994  1.00 0.00 ? 64  SER A CA   8  
ATOM 10668 C C    . SER A 1 27 ? -4.567  4.035   -4.470  1.00 0.00 ? 64  SER A C    8  
ATOM 10669 O O    . SER A 1 27 ? -4.517  3.059   -3.716  1.00 0.00 ? 64  SER A O    8  
ATOM 10670 C CB   . SER A 1 27 ? -4.047  6.363   -3.697  1.00 0.00 ? 64  SER A CB   8  
ATOM 10671 O OG   . SER A 1 27 ? -3.525  6.914   -4.894  1.00 0.00 ? 64  SER A OG   8  
ATOM 10672 H H    . SER A 1 27 ? -5.614  4.583   -2.083  1.00 0.00 ? 64  SER A H    8  
ATOM 10673 H HA   . SER A 1 27 ? -5.795  5.751   -4.767  1.00 0.00 ? 64  SER A HA   8  
ATOM 10674 H HB2  . SER A 1 27 ? -4.444  7.165   -3.092  1.00 0.00 ? 64  SER A HB2  8  
ATOM 10675 H HB3  . SER A 1 27 ? -3.250  5.871   -3.159  1.00 0.00 ? 64  SER A HB3  8  
ATOM 10676 H HG   . SER A 1 27 ? -4.085  7.657   -5.173  1.00 0.00 ? 64  SER A HG   8  
ATOM 10677 N N    . SER A 1 28 ? -4.235  3.982   -5.748  1.00 0.00 ? 65  SER A N    8  
ATOM 10678 C CA   . SER A 1 28 ? -3.733  2.768   -6.373  1.00 0.00 ? 65  SER A CA   8  
ATOM 10679 C C    . SER A 1 28 ? -2.408  2.335   -5.741  1.00 0.00 ? 65  SER A C    8  
ATOM 10680 O O    . SER A 1 28 ? -1.694  3.150   -5.149  1.00 0.00 ? 65  SER A O    8  
ATOM 10681 C CB   . SER A 1 28 ? -3.564  2.994   -7.879  1.00 0.00 ? 65  SER A CB   8  
ATOM 10682 O OG   . SER A 1 28 ? -3.337  1.772   -8.563  1.00 0.00 ? 65  SER A OG   8  
ATOM 10683 H H    . SER A 1 28 ? -4.364  4.781   -6.303  1.00 0.00 ? 65  SER A H    8  
ATOM 10684 H HA   . SER A 1 28 ? -4.463  1.989   -6.216  1.00 0.00 ? 65  SER A HA   8  
ATOM 10685 H HB2  . SER A 1 28 ? -4.460  3.451   -8.273  1.00 0.00 ? 65  SER A HB2  8  
ATOM 10686 H HB3  . SER A 1 28 ? -2.722  3.649   -8.049  1.00 0.00 ? 65  SER A HB3  8  
ATOM 10687 H HG   . SER A 1 28 ? -3.627  1.860   -9.483  1.00 0.00 ? 65  SER A HG   8  
ATOM 10688 N N    . ARG A 1 29 ? -2.093  1.045   -5.872  1.00 0.00 ? 66  ARG A N    8  
ATOM 10689 C CA   . ARG A 1 29 ? -0.861  0.472   -5.325  1.00 0.00 ? 66  ARG A CA   8  
ATOM 10690 C C    . ARG A 1 29 ? 0.376   1.304   -5.694  1.00 0.00 ? 66  ARG A C    8  
ATOM 10691 O O    . ARG A 1 29 ? 1.161   1.648   -4.813  1.00 0.00 ? 66  ARG A O    8  
ATOM 10692 C CB   . ARG A 1 29 ? -0.667  -0.968  -5.811  1.00 0.00 ? 66  ARG A CB   8  
ATOM 10693 C CG   . ARG A 1 29 ? -1.619  -1.974  -5.192  1.00 0.00 ? 66  ARG A CG   8  
ATOM 10694 C CD   . ARG A 1 29 ? -1.527  -3.313  -5.910  1.00 0.00 ? 66  ARG A CD   8  
ATOM 10695 N NE   . ARG A 1 29 ? -1.831  -3.177  -7.336  1.00 0.00 ? 66  ARG A NE   8  
ATOM 10696 C CZ   . ARG A 1 29 ? -1.579  -4.106  -8.257  1.00 0.00 ? 66  ARG A CZ   8  
ATOM 10697 N NH1  . ARG A 1 29 ? -0.980  -5.239  -7.927  1.00 0.00 ? 66  ARG A NH1  8  
ATOM 10698 N NH2  . ARG A 1 29 ? -1.905  -3.887  -9.524  1.00 0.00 ? 66  ARG A NH2  8  
ATOM 10699 H H    . ARG A 1 29 ? -2.705  0.461   -6.368  1.00 0.00 ? 66  ARG A H    8  
ATOM 10700 H HA   . ARG A 1 29 ? -0.960  0.460   -4.247  1.00 0.00 ? 66  ARG A HA   8  
ATOM 10701 H HB2  . ARG A 1 29 ? -0.804  -0.991  -6.881  1.00 0.00 ? 66  ARG A HB2  8  
ATOM 10702 H HB3  . ARG A 1 29 ? 0.343   -1.276  -5.582  1.00 0.00 ? 66  ARG A HB3  8  
ATOM 10703 H HG2  . ARG A 1 29 ? -1.356  -2.111  -4.152  1.00 0.00 ? 66  ARG A HG2  8  
ATOM 10704 H HG3  . ARG A 1 29 ? -2.631  -1.600  -5.268  1.00 0.00 ? 66  ARG A HG3  8  
ATOM 10705 H HD2  . ARG A 1 29 ? -0.525  -3.702  -5.798  1.00 0.00 ? 66  ARG A HD2  8  
ATOM 10706 H HD3  . ARG A 1 29 ? -2.232  -3.998  -5.462  1.00 0.00 ? 66  ARG A HD3  8  
ATOM 10707 H HE   . ARG A 1 29 ? -2.264  -2.336  -7.622  1.00 0.00 ? 66  ARG A HE   8  
ATOM 10708 H HH11 . ARG A 1 29 ? -0.709  -5.416  -6.973  1.00 0.00 ? 66  ARG A HH11 8  
ATOM 10709 H HH12 . ARG A 1 29 ? -0.792  -5.934  -8.635  1.00 0.00 ? 66  ARG A HH12 8  
ATOM 10710 H HH21 . ARG A 1 29 ? -2.346  -3.028  -9.793  1.00 0.00 ? 66  ARG A HH21 8  
ATOM 10711 H HH22 . ARG A 1 29 ? -1.706  -4.583  -10.223 1.00 0.00 ? 66  ARG A HH22 8  
ATOM 10712 N N    . PRO A 1 30 ? 0.596   1.616   -7.002  1.00 0.00 ? 67  PRO A N    8  
ATOM 10713 C CA   . PRO A 1 30 ? 1.761   2.389   -7.455  1.00 0.00 ? 67  PRO A CA   8  
ATOM 10714 C C    . PRO A 1 30 ? 1.972   3.672   -6.656  1.00 0.00 ? 67  PRO A C    8  
ATOM 10715 O O    . PRO A 1 30 ? 3.108   4.031   -6.347  1.00 0.00 ? 67  PRO A O    8  
ATOM 10716 C CB   . PRO A 1 30 ? 1.440   2.731   -8.918  1.00 0.00 ? 67  PRO A CB   8  
ATOM 10717 C CG   . PRO A 1 30 ? 0.026   2.311   -9.135  1.00 0.00 ? 67  PRO A CG   8  
ATOM 10718 C CD   . PRO A 1 30 ? -0.238  1.221   -8.146  1.00 0.00 ? 67  PRO A CD   8  
ATOM 10719 H HA   . PRO A 1 30 ? 2.663   1.796   -7.414  1.00 0.00 ? 67  PRO A HA   8  
ATOM 10720 H HB2  . PRO A 1 30 ? 1.557   3.792   -9.071  1.00 0.00 ? 67  PRO A HB2  8  
ATOM 10721 H HB3  . PRO A 1 30 ? 2.114   2.194   -9.570  1.00 0.00 ? 67  PRO A HB3  8  
ATOM 10722 H HG2  . PRO A 1 30 ? -0.637  3.145   -8.957  1.00 0.00 ? 67  PRO A HG2  8  
ATOM 10723 H HG3  . PRO A 1 30 ? -0.099  1.942   -10.143 1.00 0.00 ? 67  PRO A HG3  8  
ATOM 10724 H HD2  . PRO A 1 30 ? -1.283  1.199   -7.875  1.00 0.00 ? 67  PRO A HD2  8  
ATOM 10725 H HD3  . PRO A 1 30 ? 0.075   0.265   -8.541  1.00 0.00 ? 67  PRO A HD3  8  
ATOM 10726 N N    . ALA A 1 31 ? 0.879   4.339   -6.299  1.00 0.00 ? 68  ALA A N    8  
ATOM 10727 C CA   . ALA A 1 31 ? 0.950   5.569   -5.520  1.00 0.00 ? 68  ALA A CA   8  
ATOM 10728 C C    . ALA A 1 31 ? 1.529   5.305   -4.134  1.00 0.00 ? 68  ALA A C    8  
ATOM 10729 O O    . ALA A 1 31 ? 2.432   6.013   -3.685  1.00 0.00 ? 68  ALA A O    8  
ATOM 10730 C CB   . ALA A 1 31 ? -0.424  6.208   -5.414  1.00 0.00 ? 68  ALA A CB   8  
ATOM 10731 H H    . ALA A 1 31 ? 0.000   3.976   -6.543  1.00 0.00 ? 68  ALA A H    8  
ATOM 10732 H HA   . ALA A 1 31 ? 1.599   6.256   -6.044  1.00 0.00 ? 68  ALA A HA   8  
ATOM 10733 H HB1  . ALA A 1 31 ? -0.876  6.256   -6.393  1.00 0.00 ? 68  ALA A HB1  8  
ATOM 10734 H HB2  . ALA A 1 31 ? -1.047  5.614   -4.758  1.00 0.00 ? 68  ALA A HB2  8  
ATOM 10735 H HB3  . ALA A 1 31 ? -0.326  7.205   -5.012  1.00 0.00 ? 68  ALA A HB3  8  
ATOM 10736 N N    . LEU A 1 32 ? 1.059   4.242   -3.492  1.00 0.00 ? 69  LEU A N    8  
ATOM 10737 C CA   . LEU A 1 32 ? 1.582   3.838   -2.190  1.00 0.00 ? 69  LEU A CA   8  
ATOM 10738 C C    . LEU A 1 32 ? 3.027   3.384   -2.304  1.00 0.00 ? 69  LEU A C    8  
ATOM 10739 O O    . LEU A 1 32 ? 3.876   3.775   -1.507  1.00 0.00 ? 69  LEU A O    8  
ATOM 10740 C CB   . LEU A 1 32 ? 0.731   2.717   -1.595  1.00 0.00 ? 69  LEU A CB   8  
ATOM 10741 C CG   . LEU A 1 32 ? -0.617  3.162   -1.043  1.00 0.00 ? 69  LEU A CG   8  
ATOM 10742 C CD1  . LEU A 1 32 ? -1.489  1.957   -0.750  1.00 0.00 ? 69  LEU A CD1  8  
ATOM 10743 C CD2  . LEU A 1 32 ? -0.417  3.994   0.212   1.00 0.00 ? 69  LEU A CD2  8  
ATOM 10744 H H    . LEU A 1 32 ? 0.378   3.685   -3.927  1.00 0.00 ? 69  LEU A H    8  
ATOM 10745 H HA   . LEU A 1 32 ? 1.538   4.697   -1.536  1.00 0.00 ? 69  LEU A HA   8  
ATOM 10746 H HB2  . LEU A 1 32 ? 0.558   1.972   -2.358  1.00 0.00 ? 69  LEU A HB2  8  
ATOM 10747 H HB3  . LEU A 1 32 ? 1.288   2.260   -0.790  1.00 0.00 ? 69  LEU A HB3  8  
ATOM 10748 H HG   . LEU A 1 32 ? -1.122  3.772   -1.778  1.00 0.00 ? 69  LEU A HG   8  
ATOM 10749 H HD11 . LEU A 1 32 ? -1.115  1.101   -1.293  1.00 0.00 ? 69  LEU A HD11 8  
ATOM 10750 H HD12 . LEU A 1 32 ? -1.472  1.749   0.309   1.00 0.00 ? 69  LEU A HD12 8  
ATOM 10751 H HD13 . LEU A 1 32 ? -2.503  2.164   -1.059  1.00 0.00 ? 69  LEU A HD13 8  
ATOM 10752 H HD21 . LEU A 1 32 ? 0.292   3.500   0.864   1.00 0.00 ? 69  LEU A HD21 8  
ATOM 10753 H HD22 . LEU A 1 32 ? -0.037  4.969   -0.060  1.00 0.00 ? 69  LEU A HD22 8  
ATOM 10754 H HD23 . LEU A 1 32 ? -1.361  4.105   0.724   1.00 0.00 ? 69  LEU A HD23 8  
ATOM 10755 N N    . LYS A 1 33 ? 3.303   2.587   -3.327  1.00 0.00 ? 70  LYS A N    8  
ATOM 10756 C CA   . LYS A 1 33 ? 4.650   2.094   -3.585  1.00 0.00 ? 70  LYS A CA   8  
ATOM 10757 C C    . LYS A 1 33 ? 5.622   3.254   -3.796  1.00 0.00 ? 70  LYS A C    8  
ATOM 10758 O O    . LYS A 1 33 ? 6.763   3.212   -3.337  1.00 0.00 ? 70  LYS A O    8  
ATOM 10759 C CB   . LYS A 1 33 ? 4.645   1.174   -4.810  1.00 0.00 ? 70  LYS A CB   8  
ATOM 10760 C CG   . LYS A 1 33 ? 3.764   -0.053  -4.642  1.00 0.00 ? 70  LYS A CG   8  
ATOM 10761 C CD   . LYS A 1 33 ? 3.589   -0.816  -5.946  1.00 0.00 ? 70  LYS A CD   8  
ATOM 10762 C CE   . LYS A 1 33 ? 4.904   -1.368  -6.470  1.00 0.00 ? 70  LYS A CE   8  
ATOM 10763 N NZ   . LYS A 1 33 ? 4.720   -2.065  -7.769  1.00 0.00 ? 70  LYS A NZ   8  
ATOM 10764 H H    . LYS A 1 33 ? 2.574   2.333   -3.940  1.00 0.00 ? 70  LYS A H    8  
ATOM 10765 H HA   . LYS A 1 33 ? 4.968   1.530   -2.721  1.00 0.00 ? 70  LYS A HA   8  
ATOM 10766 H HB2  . LYS A 1 33 ? 4.291   1.733   -5.665  1.00 0.00 ? 70  LYS A HB2  8  
ATOM 10767 H HB3  . LYS A 1 33 ? 5.654   0.843   -5.003  1.00 0.00 ? 70  LYS A HB3  8  
ATOM 10768 H HG2  . LYS A 1 33 ? 4.209   -0.711  -3.913  1.00 0.00 ? 70  LYS A HG2  8  
ATOM 10769 H HG3  . LYS A 1 33 ? 2.792   0.264   -4.292  1.00 0.00 ? 70  LYS A HG3  8  
ATOM 10770 H HD2  . LYS A 1 33 ? 2.913   -1.639  -5.776  1.00 0.00 ? 70  LYS A HD2  8  
ATOM 10771 H HD3  . LYS A 1 33 ? 3.170   -0.151  -6.686  1.00 0.00 ? 70  LYS A HD3  8  
ATOM 10772 H HE2  . LYS A 1 33 ? 5.598   -0.551  -6.602  1.00 0.00 ? 70  LYS A HE2  8  
ATOM 10773 H HE3  . LYS A 1 33 ? 5.303   -2.066  -5.749  1.00 0.00 ? 70  LYS A HE3  8  
ATOM 10774 H HZ1  . LYS A 1 33 ? 4.017   -2.832  -7.675  1.00 0.00 ? 70  LYS A HZ1  8  
ATOM 10775 H HZ2  . LYS A 1 33 ? 4.384   -1.393  -8.493  1.00 0.00 ? 70  LYS A HZ2  8  
ATOM 10776 H HZ3  . LYS A 1 33 ? 5.624   -2.477  -8.091  1.00 0.00 ? 70  LYS A HZ3  8  
ATOM 10777 N N    . LYS A 1 34 ? 5.132   4.316   -4.420  1.00 0.00 ? 71  LYS A N    8  
ATOM 10778 C CA   . LYS A 1 34 ? 5.917   5.518   -4.641  1.00 0.00 ? 71  LYS A CA   8  
ATOM 10779 C C    . LYS A 1 34 ? 6.183   6.223   -3.325  1.00 0.00 ? 71  LYS A C    8  
ATOM 10780 O O    . LYS A 1 34 ? 7.329   6.540   -2.995  1.00 0.00 ? 71  LYS A O    8  
ATOM 10781 C CB   . LYS A 1 34 ? 5.164   6.450   -5.582  1.00 0.00 ? 71  LYS A CB   8  
ATOM 10782 C CG   . LYS A 1 34 ? 5.846   7.786   -5.792  1.00 0.00 ? 71  LYS A CG   8  
ATOM 10783 C CD   . LYS A 1 34 ? 5.064   8.663   -6.747  1.00 0.00 ? 71  LYS A CD   8  
ATOM 10784 C CE   . LYS A 1 34 ? 5.508   10.108  -6.647  1.00 0.00 ? 71  LYS A CE   8  
ATOM 10785 N NZ   . LYS A 1 34 ? 5.200   10.692  -5.313  1.00 0.00 ? 71  LYS A NZ   8  
ATOM 10786 H H    . LYS A 1 34 ? 4.186   4.318   -4.683  1.00 0.00 ? 71  LYS A H    8  
ATOM 10787 H HA   . LYS A 1 34 ? 6.856   5.235   -5.090  1.00 0.00 ? 71  LYS A HA   8  
ATOM 10788 H HB2  . LYS A 1 34 ? 5.056   5.966   -6.535  1.00 0.00 ? 71  LYS A HB2  8  
ATOM 10789 H HB3  . LYS A 1 34 ? 4.183   6.634   -5.172  1.00 0.00 ? 71  LYS A HB3  8  
ATOM 10790 H HG2  . LYS A 1 34 ? 5.928   8.291   -4.841  1.00 0.00 ? 71  LYS A HG2  8  
ATOM 10791 H HG3  . LYS A 1 34 ? 6.833   7.616   -6.197  1.00 0.00 ? 71  LYS A HG3  8  
ATOM 10792 H HD2  . LYS A 1 34 ? 5.225   8.317   -7.756  1.00 0.00 ? 71  LYS A HD2  8  
ATOM 10793 H HD3  . LYS A 1 34 ? 4.013   8.601   -6.503  1.00 0.00 ? 71  LYS A HD3  8  
ATOM 10794 H HE2  . LYS A 1 34 ? 6.574   10.153  -6.811  1.00 0.00 ? 71  LYS A HE2  8  
ATOM 10795 H HE3  . LYS A 1 34 ? 5.001   10.680  -7.409  1.00 0.00 ? 71  LYS A HE3  8  
ATOM 10796 H HZ1  . LYS A 1 34 ? 4.649   10.016  -4.739  1.00 0.00 ? 71  LYS A HZ1  8  
ATOM 10797 H HZ2  . LYS A 1 34 ? 6.085   10.921  -4.807  1.00 0.00 ? 71  LYS A HZ2  8  
ATOM 10798 H HZ3  . LYS A 1 34 ? 4.642   11.565  -5.428  1.00 0.00 ? 71  LYS A HZ3  8  
ATOM 10799 N N    . PHE A 1 35 ? 5.111   6.426   -2.571  1.00 0.00 ? 72  PHE A N    8  
ATOM 10800 C CA   . PHE A 1 35 ? 5.186   7.052   -1.255  1.00 0.00 ? 72  PHE A CA   8  
ATOM 10801 C C    . PHE A 1 35 ? 6.223   6.350   -0.387  1.00 0.00 ? 72  PHE A C    8  
ATOM 10802 O O    . PHE A 1 35 ? 7.006   6.990   0.324   1.00 0.00 ? 72  PHE A O    8  
ATOM 10803 C CB   . PHE A 1 35 ? 3.821   6.989   -0.563  1.00 0.00 ? 72  PHE A CB   8  
ATOM 10804 C CG   . PHE A 1 35 ? 3.809   7.604   0.808   1.00 0.00 ? 72  PHE A CG   8  
ATOM 10805 C CD1  . PHE A 1 35 ? 3.639   8.971   0.973   1.00 0.00 ? 72  PHE A CD1  8  
ATOM 10806 C CD2  . PHE A 1 35 ? 3.970   6.814   1.934   1.00 0.00 ? 72  PHE A CD2  8  
ATOM 10807 C CE1  . PHE A 1 35 ? 3.625   9.535   2.235   1.00 0.00 ? 72  PHE A CE1  8  
ATOM 10808 C CE2  . PHE A 1 35 ? 3.960   7.372   3.197   1.00 0.00 ? 72  PHE A CE2  8  
ATOM 10809 C CZ   . PHE A 1 35 ? 3.792   8.748   3.343   1.00 0.00 ? 72  PHE A CZ   8  
ATOM 10810 H H    . PHE A 1 35 ? 4.234   6.136   -2.913  1.00 0.00 ? 72  PHE A H    8  
ATOM 10811 H HA   . PHE A 1 35 ? 5.472   8.086   -1.387  1.00 0.00 ? 72  PHE A HA   8  
ATOM 10812 H HB2  . PHE A 1 35 ? 3.096   7.513   -1.166  1.00 0.00 ? 72  PHE A HB2  8  
ATOM 10813 H HB3  . PHE A 1 35 ? 3.522   5.954   -0.468  1.00 0.00 ? 72  PHE A HB3  8  
ATOM 10814 H HD1  . PHE A 1 35 ? 3.514   9.599   0.101   1.00 0.00 ? 72  PHE A HD1  8  
ATOM 10815 H HD2  . PHE A 1 35 ? 4.107   5.750   1.816   1.00 0.00 ? 72  PHE A HD2  8  
ATOM 10816 H HE1  . PHE A 1 35 ? 3.492   10.599  2.350   1.00 0.00 ? 72  PHE A HE1  8  
ATOM 10817 H HE2  . PHE A 1 35 ? 4.085   6.743   4.068   1.00 0.00 ? 72  PHE A HE2  8  
ATOM 10818 H HZ   . PHE A 1 35 ? 3.788   9.193   4.327   1.00 0.00 ? 72  PHE A HZ   8  
ATOM 10819 N N    . ILE A 1 36 ? 6.196   5.027   -0.432  1.00 0.00 ? 73  ILE A N    8  
ATOM 10820 C CA   . ILE A 1 36 ? 7.109   4.214   0.347   1.00 0.00 ? 73  ILE A CA   8  
ATOM 10821 C C    . ILE A 1 36 ? 8.553   4.461   -0.073  1.00 0.00 ? 73  ILE A C    8  
ATOM 10822 O O    . ILE A 1 36 ? 9.421   4.642   0.771   1.00 0.00 ? 73  ILE A O    8  
ATOM 10823 C CB   . ILE A 1 36 ? 6.781   2.714   0.219   1.00 0.00 ? 73  ILE A CB   8  
ATOM 10824 C CG1  . ILE A 1 36 ? 5.401   2.421   0.813   1.00 0.00 ? 73  ILE A CG1  8  
ATOM 10825 C CG2  . ILE A 1 36 ? 7.848   1.878   0.906   1.00 0.00 ? 73  ILE A CG2  8  
ATOM 10826 C CD1  . ILE A 1 36 ? 4.962   0.980   0.651   1.00 0.00 ? 73  ILE A CD1  8  
ATOM 10827 H H    . ILE A 1 36 ? 5.522   4.585   -0.998  1.00 0.00 ? 73  ILE A H    8  
ATOM 10828 H HA   . ILE A 1 36 ? 6.998   4.496   1.385   1.00 0.00 ? 73  ILE A HA   8  
ATOM 10829 H HB   . ILE A 1 36 ? 6.777   2.458   -0.829  1.00 0.00 ? 73  ILE A HB   8  
ATOM 10830 H HG12 . ILE A 1 36 ? 5.417   2.643   1.870   1.00 0.00 ? 73  ILE A HG12 8  
ATOM 10831 H HG13 . ILE A 1 36 ? 4.667   3.049   0.329   1.00 0.00 ? 73  ILE A HG13 8  
ATOM 10832 H HG21 . ILE A 1 36 ? 8.016   2.255   1.905   1.00 0.00 ? 73  ILE A HG21 8  
ATOM 10833 H HG22 . ILE A 1 36 ? 7.520   0.851   0.960   1.00 0.00 ? 73  ILE A HG22 8  
ATOM 10834 H HG23 . ILE A 1 36 ? 8.767   1.933   0.342   1.00 0.00 ? 73  ILE A HG23 8  
ATOM 10835 H HD11 . ILE A 1 36 ? 5.089   0.678   -0.379  1.00 0.00 ? 73  ILE A HD11 8  
ATOM 10836 H HD12 . ILE A 1 36 ? 5.560   0.346   1.288   1.00 0.00 ? 73  ILE A HD12 8  
ATOM 10837 H HD13 . ILE A 1 36 ? 3.922   0.888   0.927   1.00 0.00 ? 73  ILE A HD13 8  
ATOM 10838 N N    . LYS A 1 37 ? 8.806   4.482   -1.374  1.00 0.00 ? 74  LYS A N    8  
ATOM 10839 C CA   . LYS A 1 37 ? 10.158  4.700   -1.885  1.00 0.00 ? 74  LYS A CA   8  
ATOM 10840 C C    . LYS A 1 37 ? 10.710  6.057   -1.464  1.00 0.00 ? 74  LYS A C    8  
ATOM 10841 O O    . LYS A 1 37 ? 11.908  6.197   -1.212  1.00 0.00 ? 74  LYS A O    8  
ATOM 10842 C CB   . LYS A 1 37 ? 10.184  4.569   -3.406  1.00 0.00 ? 74  LYS A CB   8  
ATOM 10843 C CG   . LYS A 1 37 ? 9.774   3.193   -3.893  1.00 0.00 ? 74  LYS A CG   8  
ATOM 10844 C CD   . LYS A 1 37 ? 9.891   3.064   -5.400  1.00 0.00 ? 74  LYS A CD   8  
ATOM 10845 C CE   . LYS A 1 37 ? 9.438   1.690   -5.866  1.00 0.00 ? 74  LYS A CE   8  
ATOM 10846 N NZ   . LYS A 1 37 ? 9.514   1.544   -7.343  1.00 0.00 ? 74  LYS A NZ   8  
ATOM 10847 H H    . LYS A 1 37 ? 8.070   4.337   -2.009  1.00 0.00 ? 74  LYS A H    8  
ATOM 10848 H HA   . LYS A 1 37 ? 10.789  3.937   -1.463  1.00 0.00 ? 74  LYS A HA   8  
ATOM 10849 H HB2  . LYS A 1 37 ? 9.509   5.299   -3.832  1.00 0.00 ? 74  LYS A HB2  8  
ATOM 10850 H HB3  . LYS A 1 37 ? 11.185  4.770   -3.756  1.00 0.00 ? 74  LYS A HB3  8  
ATOM 10851 H HG2  . LYS A 1 37 ? 10.413  2.455   -3.429  1.00 0.00 ? 74  LYS A HG2  8  
ATOM 10852 H HG3  . LYS A 1 37 ? 8.749   3.010   -3.605  1.00 0.00 ? 74  LYS A HG3  8  
ATOM 10853 H HD2  . LYS A 1 37 ? 9.274   3.817   -5.867  1.00 0.00 ? 74  LYS A HD2  8  
ATOM 10854 H HD3  . LYS A 1 37 ? 10.922  3.209   -5.684  1.00 0.00 ? 74  LYS A HD3  8  
ATOM 10855 H HE2  . LYS A 1 37 ? 10.072  0.944   -5.409  1.00 0.00 ? 74  LYS A HE2  8  
ATOM 10856 H HE3  . LYS A 1 37 ? 8.417   1.537   -5.549  1.00 0.00 ? 74  LYS A HE3  8  
ATOM 10857 H HZ1  . LYS A 1 37 ? 9.323   2.459   -7.809  1.00 0.00 ? 74  LYS A HZ1  8  
ATOM 10858 H HZ2  . LYS A 1 37 ? 10.460  1.217   -7.624  1.00 0.00 ? 74  LYS A HZ2  8  
ATOM 10859 H HZ3  . LYS A 1 37 ? 8.804   0.853   -7.672  1.00 0.00 ? 74  LYS A HZ3  8  
ATOM 10860 N N    . GLU A 1 38 ? 9.847   7.060   -1.440  1.00 0.00 ? 75  GLU A N    8  
ATOM 10861 C CA   . GLU A 1 38 ? 10.259  8.412   -1.087  1.00 0.00 ? 75  GLU A CA   8  
ATOM 10862 C C    . GLU A 1 38 ? 10.660  8.501   0.386   1.00 0.00 ? 75  GLU A C    8  
ATOM 10863 O O    . GLU A 1 38 ? 11.603  9.206   0.744   1.00 0.00 ? 75  GLU A O    8  
ATOM 10864 C CB   . GLU A 1 38 ? 9.127   9.399   -1.376  1.00 0.00 ? 75  GLU A CB   8  
ATOM 10865 C CG   . GLU A 1 38 ? 8.626   9.353   -2.811  1.00 0.00 ? 75  GLU A CG   8  
ATOM 10866 C CD   . GLU A 1 38 ? 7.474   10.304  -3.056  1.00 0.00 ? 75  GLU A CD   8  
ATOM 10867 O OE1  . GLU A 1 38 ? 6.488   10.258  -2.299  1.00 0.00 ? 75  GLU A OE1  8  
ATOM 10868 O OE2  . GLU A 1 38 ? 7.541   11.094  -4.022  1.00 0.00 ? 75  GLU A OE2  8  
ATOM 10869 H H    . GLU A 1 38 ? 8.912   6.894   -1.691  1.00 0.00 ? 75  GLU A H    8  
ATOM 10870 H HA   . GLU A 1 38 ? 11.113  8.670   -1.697  1.00 0.00 ? 75  GLU A HA   8  
ATOM 10871 H HB2  . GLU A 1 38 ? 8.295   9.174   -0.724  1.00 0.00 ? 75  GLU A HB2  8  
ATOM 10872 H HB3  . GLU A 1 38 ? 9.473   10.400  -1.171  1.00 0.00 ? 75  GLU A HB3  8  
ATOM 10873 H HG2  . GLU A 1 38 ? 9.436   9.617   -3.474  1.00 0.00 ? 75  GLU A HG2  8  
ATOM 10874 H HG3  . GLU A 1 38 ? 8.296   8.347   -3.031  1.00 0.00 ? 75  GLU A HG3  8  
ATOM 10875 N N    . ASN A 1 39 ? 9.879   7.860   1.245   1.00 0.00 ? 76  ASN A N    8  
ATOM 10876 C CA   . ASN A 1 39 ? 10.077  7.973   2.692   1.00 0.00 ? 76  ASN A CA   8  
ATOM 10877 C C    . ASN A 1 39 ? 10.948  6.850   3.247   1.00 0.00 ? 76  ASN A C    8  
ATOM 10878 O O    . ASN A 1 39 ? 11.784  7.076   4.127   1.00 0.00 ? 76  ASN A O    8  
ATOM 10879 C CB   . ASN A 1 39 ? 8.722   7.982   3.400   1.00 0.00 ? 76  ASN A CB   8  
ATOM 10880 C CG   . ASN A 1 39 ? 7.953   9.260   3.155   1.00 0.00 ? 76  ASN A CG   8  
ATOM 10881 O OD1  . ASN A 1 39 ? 8.239   10.301  3.750   1.00 0.00 ? 76  ASN A OD1  8  
ATOM 10882 N ND2  . ASN A 1 39 ? 6.991   9.202   2.249   1.00 0.00 ? 76  ASN A ND2  8  
ATOM 10883 H H    . ASN A 1 39 ? 9.099   7.368   0.905   1.00 0.00 ? 76  ASN A H    8  
ATOM 10884 H HA   . ASN A 1 39 ? 10.571  8.913   2.879   1.00 0.00 ? 76  ASN A HA   8  
ATOM 10885 H HB2  . ASN A 1 39 ? 8.129   7.155   3.040   1.00 0.00 ? 76  ASN A HB2  8  
ATOM 10886 H HB3  . ASN A 1 39 ? 8.876   7.873   4.461   1.00 0.00 ? 76  ASN A HB3  8  
ATOM 10887 H HD21 . ASN A 1 39 ? 6.833   8.345   1.795   1.00 0.00 ? 76  ASN A HD21 8  
ATOM 10888 H HD22 . ASN A 1 39 ? 6.483   10.016  2.057   1.00 0.00 ? 76  ASN A HD22 8  
ATOM 10889 N N    . TYR A 1 40 ? 10.737  5.642   2.756   1.00 0.00 ? 77  TYR A N    8  
ATOM 10890 C CA   . TYR A 1 40 ? 11.477  4.475   3.220   1.00 0.00 ? 77  TYR A CA   8  
ATOM 10891 C C    . TYR A 1 40 ? 12.170  3.777   2.049   1.00 0.00 ? 77  TYR A C    8  
ATOM 10892 O O    . TYR A 1 40 ? 11.722  2.718   1.603   1.00 0.00 ? 77  TYR A O    8  
ATOM 10893 C CB   . TYR A 1 40 ? 10.541  3.470   3.912   1.00 0.00 ? 77  TYR A CB   8  
ATOM 10894 C CG   . TYR A 1 40 ? 9.838   3.993   5.148   1.00 0.00 ? 77  TYR A CG   8  
ATOM 10895 C CD1  . TYR A 1 40 ? 8.763   4.868   5.049   1.00 0.00 ? 77  TYR A CD1  8  
ATOM 10896 C CD2  . TYR A 1 40 ? 10.234  3.583   6.415   1.00 0.00 ? 77  TYR A CD2  8  
ATOM 10897 C CE1  . TYR A 1 40 ? 8.108   5.326   6.176   1.00 0.00 ? 77  TYR A CE1  8  
ATOM 10898 C CE2  . TYR A 1 40 ? 9.581   4.035   7.547   1.00 0.00 ? 77  TYR A CE2  8  
ATOM 10899 C CZ   . TYR A 1 40 ? 8.520   4.907   7.422   1.00 0.00 ? 77  TYR A CZ   8  
ATOM 10900 O OH   . TYR A 1 40 ? 7.866   5.363   8.546   1.00 0.00 ? 77  TYR A OH   8  
ATOM 10901 H H    . TYR A 1 40 ? 10.062  5.523   2.050   1.00 0.00 ? 77  TYR A H    8  
ATOM 10902 H HA   . TYR A 1 40 ? 12.225  4.807   3.924   1.00 0.00 ? 77  TYR A HA   8  
ATOM 10903 H HB2  . TYR A 1 40 ? 9.780   3.166   3.210   1.00 0.00 ? 77  TYR A HB2  8  
ATOM 10904 H HB3  . TYR A 1 40 ? 11.116  2.603   4.200   1.00 0.00 ? 77  TYR A HB3  8  
ATOM 10905 H HD1  . TYR A 1 40 ? 8.441   5.197   4.072   1.00 0.00 ? 77  TYR A HD1  8  
ATOM 10906 H HD2  . TYR A 1 40 ? 11.067  2.901   6.509   1.00 0.00 ? 77  TYR A HD2  8  
ATOM 10907 H HE1  . TYR A 1 40 ? 7.276   6.009   6.078   1.00 0.00 ? 77  TYR A HE1  8  
ATOM 10908 H HE2  . TYR A 1 40 ? 9.904   3.701   8.523   1.00 0.00 ? 77  TYR A HE2  8  
ATOM 10909 H HH   . TYR A 1 40 ? 7.905   4.681   9.239   1.00 0.00 ? 77  TYR A HH   8  
ATOM 10910 N N    . PRO A 1 41 ? 13.285  4.339   1.549   1.00 0.00 ? 78  PRO A N    8  
ATOM 10911 C CA   . PRO A 1 41 ? 14.035  3.755   0.429   1.00 0.00 ? 78  PRO A CA   8  
ATOM 10912 C C    . PRO A 1 41 ? 14.542  2.348   0.738   1.00 0.00 ? 78  PRO A C    8  
ATOM 10913 O O    . PRO A 1 41 ? 14.845  1.575   -0.172  1.00 0.00 ? 78  PRO A O    8  
ATOM 10914 C CB   . PRO A 1 41 ? 15.211  4.713   0.227   1.00 0.00 ? 78  PRO A CB   8  
ATOM 10915 C CG   . PRO A 1 41 ? 15.310  5.485   1.497   1.00 0.00 ? 78  PRO A CG   8  
ATOM 10916 C CD   . PRO A 1 41 ? 13.910  5.581   2.031   1.00 0.00 ? 78  PRO A CD   8  
ATOM 10917 H HA   . PRO A 1 41 ? 13.436  3.725   -0.472  1.00 0.00 ? 78  PRO A HA   8  
ATOM 10918 H HB2  . PRO A 1 41 ? 16.110  4.143   0.039   1.00 0.00 ? 78  PRO A HB2  8  
ATOM 10919 H HB3  . PRO A 1 41 ? 15.007  5.359   -0.611  1.00 0.00 ? 78  PRO A HB3  8  
ATOM 10920 H HG2  . PRO A 1 41 ? 15.944  4.962   2.198   1.00 0.00 ? 78  PRO A HG2  8  
ATOM 10921 H HG3  . PRO A 1 41 ? 15.703  6.470   1.298   1.00 0.00 ? 78  PRO A HG3  8  
ATOM 10922 H HD2  . PRO A 1 41 ? 13.918  5.615   3.111   1.00 0.00 ? 78  PRO A HD2  8  
ATOM 10923 H HD3  . PRO A 1 41 ? 13.409  6.448   1.627   1.00 0.00 ? 78  PRO A HD3  8  
ATOM 10924 N N    . ILE A 1 42 ? 14.594  2.021   2.029   1.00 0.00 ? 79  ILE A N    8  
ATOM 10925 C CA   . ILE A 1 42 ? 15.004  0.700   2.490   1.00 0.00 ? 79  ILE A CA   8  
ATOM 10926 C C    . ILE A 1 42 ? 14.204  -0.377  1.780   1.00 0.00 ? 79  ILE A C    8  
ATOM 10927 O O    . ILE A 1 42 ? 14.708  -1.099  0.918   1.00 0.00 ? 79  ILE A O    8  
ATOM 10928 C CB   . ILE A 1 42 ? 14.741  0.532   4.001   1.00 0.00 ? 79  ILE A CB   8  
ATOM 10929 C CG1  . ILE A 1 42 ? 15.257  1.735   4.798   1.00 0.00 ? 79  ILE A CG1  8  
ATOM 10930 C CG2  . ILE A 1 42 ? 15.390  -0.744  4.508   1.00 0.00 ? 79  ILE A CG2  8  
ATOM 10931 C CD1  . ILE A 1 42 ? 14.241  2.844   4.967   1.00 0.00 ? 79  ILE A CD1  8  
ATOM 10932 H H    . ILE A 1 42 ? 14.313  2.684   2.694   1.00 0.00 ? 79  ILE A H    8  
ATOM 10933 H HA   . ILE A 1 42 ? 16.059  0.570   2.297   1.00 0.00 ? 79  ILE A HA   8  
ATOM 10934 H HB   . ILE A 1 42 ? 13.663  0.443   4.137   1.00 0.00 ? 79  ILE A HB   8  
ATOM 10935 H HG12 . ILE A 1 42 ? 15.549  1.405   5.785   1.00 0.00 ? 79  ILE A HG12 8  
ATOM 10936 H HG13 . ILE A 1 42 ? 16.117  2.148   4.293   1.00 0.00 ? 79  ILE A HG13 8  
ATOM 10937 H HG21 . ILE A 1 42 ? 15.970  -1.193  3.716   1.00 0.00 ? 79  ILE A HG21 8  
ATOM 10938 H HG22 . ILE A 1 42 ? 16.036  -0.514  5.340   1.00 0.00 ? 79  ILE A HG22 8  
ATOM 10939 H HG23 . ILE A 1 42 ? 14.624  -1.434  4.829   1.00 0.00 ? 79  ILE A HG23 8  
ATOM 10940 H HD11 . ILE A 1 42 ? 13.245  2.436   4.886   1.00 0.00 ? 79  ILE A HD11 8  
ATOM 10941 H HD12 . ILE A 1 42 ? 14.365  3.302   5.938   1.00 0.00 ? 79  ILE A HD12 8  
ATOM 10942 H HD13 . ILE A 1 42 ? 14.390  3.588   4.196   1.00 0.00 ? 79  ILE A HD13 8  
ATOM 10943 N N    . VAL A 1 43 ? 12.928  -0.396  2.099   1.00 0.00 ? 80  VAL A N    8  
ATOM 10944 C CA   . VAL A 1 43 ? 11.981  -1.289  1.475   1.00 0.00 ? 80  VAL A CA   8  
ATOM 10945 C C    . VAL A 1 43 ? 11.668  -0.813  0.063   1.00 0.00 ? 80  VAL A C    8  
ATOM 10946 O O    . VAL A 1 43 ? 11.442  -1.614  -0.836  1.00 0.00 ? 80  VAL A O    8  
ATOM 10947 C CB   . VAL A 1 43 ? 10.701  -1.350  2.328   1.00 0.00 ? 80  VAL A CB   8  
ATOM 10948 C CG1  . VAL A 1 43 ? 9.468   -1.121  1.502   1.00 0.00 ? 80  VAL A CG1  8  
ATOM 10949 C CG2  . VAL A 1 43 ? 10.592  -2.666  3.069   1.00 0.00 ? 80  VAL A CG2  8  
ATOM 10950 H H    . VAL A 1 43 ? 12.597  0.264   2.742   1.00 0.00 ? 80  VAL A H    8  
ATOM 10951 H HA   . VAL A 1 43 ? 12.410  -2.276  1.432   1.00 0.00 ? 80  VAL A HA   8  
ATOM 10952 H HB   . VAL A 1 43 ? 10.758  -0.564  3.050   1.00 0.00 ? 80  VAL A HB   8  
ATOM 10953 H HG11 . VAL A 1 43 ? 9.520   -1.733  0.616   1.00 0.00 ? 80  VAL A HG11 8  
ATOM 10954 H HG12 . VAL A 1 43 ? 8.595   -1.380  2.079   1.00 0.00 ? 80  VAL A HG12 8  
ATOM 10955 H HG13 . VAL A 1 43 ? 9.425   -0.080  1.225   1.00 0.00 ? 80  VAL A HG13 8  
ATOM 10956 H HG21 . VAL A 1 43 ? 11.576  -3.094  3.197   1.00 0.00 ? 80  VAL A HG21 8  
ATOM 10957 H HG22 . VAL A 1 43 ? 10.143  -2.491  4.038   1.00 0.00 ? 80  VAL A HG22 8  
ATOM 10958 H HG23 . VAL A 1 43 ? 9.972   -3.345  2.500   1.00 0.00 ? 80  VAL A HG23 8  
ATOM 10959 N N    . GLY A 1 44 ? 11.626  0.503   -0.109  1.00 0.00 ? 81  GLY A N    8  
ATOM 10960 C CA   . GLY A 1 44 ? 11.280  1.073   -1.390  1.00 0.00 ? 81  GLY A CA   8  
ATOM 10961 C C    . GLY A 1 44 ? 12.135  0.542   -2.523  1.00 0.00 ? 81  GLY A C    8  
ATOM 10962 O O    . GLY A 1 44 ? 11.628  0.226   -3.600  1.00 0.00 ? 81  GLY A O    8  
ATOM 10963 H H    . GLY A 1 44 ? 11.769  1.095   0.665   1.00 0.00 ? 81  GLY A H    8  
ATOM 10964 H HA2  . GLY A 1 44 ? 10.245  0.847   -1.594  1.00 0.00 ? 81  GLY A HA2  8  
ATOM 10965 H HA3  . GLY A 1 44 ? 11.400  2.141   -1.338  1.00 0.00 ? 81  GLY A HA3  8  
ATOM 10966 N N    . SER A 1 45 ? 13.429  0.418   -2.277  1.00 0.00 ? 82  SER A N    8  
ATOM 10967 C CA   . SER A 1 45 ? 14.337  -0.107  -3.278  1.00 0.00 ? 82  SER A CA   8  
ATOM 10968 C C    . SER A 1 45 ? 14.694  -1.560  -2.962  1.00 0.00 ? 82  SER A C    8  
ATOM 10969 O O    . SER A 1 45 ? 15.733  -2.063  -3.387  1.00 0.00 ? 82  SER A O    8  
ATOM 10970 C CB   . SER A 1 45 ? 15.600  0.756   -3.347  1.00 0.00 ? 82  SER A CB   8  
ATOM 10971 O OG   . SER A 1 45 ? 16.219  0.655   -4.622  1.00 0.00 ? 82  SER A OG   8  
ATOM 10972 H H    . SER A 1 45 ? 13.781  0.670   -1.394  1.00 0.00 ? 82  SER A H    8  
ATOM 10973 H HA   . SER A 1 45 ? 13.832  -0.073  -4.232  1.00 0.00 ? 82  SER A HA   8  
ATOM 10974 H HB2  . SER A 1 45 ? 15.339  1.789   -3.172  1.00 0.00 ? 82  SER A HB2  8  
ATOM 10975 H HB3  . SER A 1 45 ? 16.300  0.429   -2.593  1.00 0.00 ? 82  SER A HB3  8  
ATOM 10976 H HG   . SER A 1 45 ? 15.573  0.885   -5.308  1.00 0.00 ? 82  SER A HG   8  
ATOM 10977 N N    . ALA A 1 46 ? 13.788  -2.256  -2.286  1.00 0.00 ? 83  ALA A N    8  
ATOM 10978 C CA   . ALA A 1 46 ? 13.969  -3.675  -2.018  1.00 0.00 ? 83  ALA A CA   8  
ATOM 10979 C C    . ALA A 1 46 ? 13.758  -4.471  -3.301  1.00 0.00 ? 83  ALA A C    8  
ATOM 10980 O O    . ALA A 1 46 ? 12.907  -4.121  -4.122  1.00 0.00 ? 83  ALA A O    8  
ATOM 10981 C CB   . ALA A 1 46 ? 13.020  -4.149  -0.917  1.00 0.00 ? 83  ALA A CB   8  
ATOM 10982 H H    . ALA A 1 46 ? 12.944  -1.821  -2.027  1.00 0.00 ? 83  ALA A H    8  
ATOM 10983 H HA   . ALA A 1 46 ? 14.983  -3.823  -1.677  1.00 0.00 ? 83  ALA A HA   8  
ATOM 10984 H HB1  . ALA A 1 46 ? 12.730  -3.307  -0.297  1.00 0.00 ? 83  ALA A HB1  8  
ATOM 10985 H HB2  . ALA A 1 46 ? 12.140  -4.587  -1.362  1.00 0.00 ? 83  ALA A HB2  8  
ATOM 10986 H HB3  . ALA A 1 46 ? 13.517  -4.888  -0.305  1.00 0.00 ? 83  ALA A HB3  8  
ATOM 10987 N N    . SER A 1 47 ? 14.577  -5.489  -3.510  1.00 0.00 ? 84  SER A N    8  
ATOM 10988 C CA   . SER A 1 47 ? 14.504  -6.291  -4.726  1.00 0.00 ? 84  SER A CA   8  
ATOM 10989 C C    . SER A 1 47 ? 13.145  -6.977  -4.832  1.00 0.00 ? 84  SER A C    8  
ATOM 10990 O O    . SER A 1 47 ? 12.556  -7.072  -5.908  1.00 0.00 ? 84  SER A O    8  
ATOM 10991 C CB   . SER A 1 47 ? 15.621  -7.333  -4.723  1.00 0.00 ? 84  SER A CB   8  
ATOM 10992 O OG   . SER A 1 47 ? 16.868  -6.731  -4.413  1.00 0.00 ? 84  SER A OG   8  
ATOM 10993 H H    . SER A 1 47 ? 15.274  -5.693  -2.842  1.00 0.00 ? 84  SER A H    8  
ATOM 10994 H HA   . SER A 1 47 ? 14.632  -5.632  -5.571  1.00 0.00 ? 84  SER A HA   8  
ATOM 10995 H HB2  . SER A 1 47 ? 15.407  -8.090  -3.981  1.00 0.00 ? 84  SER A HB2  8  
ATOM 10996 H HB3  . SER A 1 47 ? 15.687  -7.792  -5.698  1.00 0.00 ? 84  SER A HB3  8  
ATOM 10997 H HG   . SER A 1 47 ? 16.961  -5.906  -4.918  1.00 0.00 ? 84  SER A HG   8  
ATOM 10998 N N    . ASN A 1 48 ? 12.644  -7.433  -3.696  1.00 0.00 ? 85  ASN A N    8  
ATOM 10999 C CA   . ASN A 1 48 ? 11.358  -8.107  -3.639  1.00 0.00 ? 85  ASN A CA   8  
ATOM 11000 C C    . ASN A 1 48 ? 10.273  -7.189  -3.095  1.00 0.00 ? 85  ASN A C    8  
ATOM 11001 O O    . ASN A 1 48 ? 9.238   -7.660  -2.621  1.00 0.00 ? 85  ASN A O    8  
ATOM 11002 C CB   . ASN A 1 48 ? 11.452  -9.349  -2.761  1.00 0.00 ? 85  ASN A CB   8  
ATOM 11003 C CG   . ASN A 1 48 ? 12.193  -9.081  -1.460  1.00 0.00 ? 85  ASN A CG   8  
ATOM 11004 O OD1  . ASN A 1 48 ? 11.865  -8.156  -0.717  1.00 0.00 ? 85  ASN A OD1  8  
ATOM 11005 N ND2  . ASN A 1 48 ? 13.200  -9.890  -1.176  1.00 0.00 ? 85  ASN A ND2  8  
ATOM 11006 H H    . ASN A 1 48 ? 13.150  -7.299  -2.865  1.00 0.00 ? 85  ASN A H    8  
ATOM 11007 H HA   . ASN A 1 48 ? 11.093  -8.405  -4.642  1.00 0.00 ? 85  ASN A HA   8  
ATOM 11008 H HB2  . ASN A 1 48 ? 10.449  -9.683  -2.527  1.00 0.00 ? 85  ASN A HB2  8  
ATOM 11009 H HB3  . ASN A 1 48 ? 11.972  -10.127 -3.298  1.00 0.00 ? 85  ASN A HB3  8  
ATOM 11010 H HD21 . ASN A 1 48 ? 13.410  -10.613 -1.811  1.00 0.00 ? 85  ASN A HD21 8  
ATOM 11011 H HD22 . ASN A 1 48 ? 13.702  -9.734  -0.345  1.00 0.00 ? 85  ASN A HD22 8  
ATOM 11012 N N    . PHE A 1 49 ? 10.494  -5.887  -3.196  1.00 0.00 ? 86  PHE A N    8  
ATOM 11013 C CA   . PHE A 1 49 ? 9.524   -4.906  -2.722  1.00 0.00 ? 86  PHE A CA   8  
ATOM 11014 C C    . PHE A 1 49 ? 8.184   -5.088  -3.419  1.00 0.00 ? 86  PHE A C    8  
ATOM 11015 O O    . PHE A 1 49 ? 7.126   -5.021  -2.794  1.00 0.00 ? 86  PHE A O    8  
ATOM 11016 C CB   . PHE A 1 49 ? 10.030  -3.484  -2.976  1.00 0.00 ? 86  PHE A CB   8  
ATOM 11017 C CG   . PHE A 1 49 ? 8.995   -2.427  -2.721  1.00 0.00 ? 86  PHE A CG   8  
ATOM 11018 C CD1  . PHE A 1 49 ? 8.412   -2.299  -1.476  1.00 0.00 ? 86  PHE A CD1  8  
ATOM 11019 C CD2  . PHE A 1 49 ? 8.591   -1.578  -3.737  1.00 0.00 ? 86  PHE A CD2  8  
ATOM 11020 C CE1  . PHE A 1 49 ? 7.446   -1.344  -1.242  1.00 0.00 ? 86  PHE A CE1  8  
ATOM 11021 C CE2  . PHE A 1 49 ? 7.628   -0.619  -3.511  1.00 0.00 ? 86  PHE A CE2  8  
ATOM 11022 C CZ   . PHE A 1 49 ? 7.051   -0.501  -2.262  1.00 0.00 ? 86  PHE A CZ   8  
ATOM 11023 H H    . PHE A 1 49 ? 11.327  -5.575  -3.608  1.00 0.00 ? 86  PHE A H    8  
ATOM 11024 H HA   . PHE A 1 49 ? 9.391   -5.052  -1.659  1.00 0.00 ? 86  PHE A HA   8  
ATOM 11025 H HB2  . PHE A 1 49 ? 10.873  -3.287  -2.329  1.00 0.00 ? 86  PHE A HB2  8  
ATOM 11026 H HB3  . PHE A 1 49 ? 10.346  -3.401  -4.006  1.00 0.00 ? 86  PHE A HB3  8  
ATOM 11027 H HD1  . PHE A 1 49 ? 8.721   -2.956  -0.678  1.00 0.00 ? 86  PHE A HD1  8  
ATOM 11028 H HD2  . PHE A 1 49 ? 9.041   -1.669  -4.716  1.00 0.00 ? 86  PHE A HD2  8  
ATOM 11029 H HE1  . PHE A 1 49 ? 7.005   -1.257  -0.260  1.00 0.00 ? 86  PHE A HE1  8  
ATOM 11030 H HE2  . PHE A 1 49 ? 7.321   0.037   -4.312  1.00 0.00 ? 86  PHE A HE2  8  
ATOM 11031 H HZ   . PHE A 1 49 ? 6.293   0.249   -2.085  1.00 0.00 ? 86  PHE A HZ   8  
ATOM 11032 N N    . ASP A 1 50 ? 8.246   -5.258  -4.729  1.00 0.00 ? 87  ASP A N    8  
ATOM 11033 C CA   . ASP A 1 50 ? 7.048   -5.361  -5.550  1.00 0.00 ? 87  ASP A CA   8  
ATOM 11034 C C    . ASP A 1 50 ? 6.223   -6.571  -5.128  1.00 0.00 ? 87  ASP A C    8  
ATOM 11035 O O    . ASP A 1 50 ? 5.004   -6.493  -4.974  1.00 0.00 ? 87  ASP A O    8  
ATOM 11036 C CB   . ASP A 1 50 ? 7.435   -5.475  -7.027  1.00 0.00 ? 87  ASP A CB   8  
ATOM 11037 C CG   . ASP A 1 50 ? 6.330   -5.029  -7.960  1.00 0.00 ? 87  ASP A CG   8  
ATOM 11038 O OD1  . ASP A 1 50 ? 5.312   -5.751  -8.054  1.00 0.00 ? 87  ASP A OD1  8  
ATOM 11039 O OD2  . ASP A 1 50 ? 6.471   -3.972  -8.613  1.00 0.00 ? 87  ASP A OD2  8  
ATOM 11040 H H    . ASP A 1 50 ? 9.129   -5.268  -5.163  1.00 0.00 ? 87  ASP A H    8  
ATOM 11041 H HA   . ASP A 1 50 ? 6.462   -4.464  -5.402  1.00 0.00 ? 87  ASP A HA   8  
ATOM 11042 H HB2  . ASP A 1 50 ? 8.304   -4.860  -7.213  1.00 0.00 ? 87  ASP A HB2  8  
ATOM 11043 H HB3  . ASP A 1 50 ? 7.677   -6.505  -7.253  1.00 0.00 ? 87  ASP A HB3  8  
ATOM 11044 N N    . LEU A 1 51 ? 6.920   -7.670  -4.883  1.00 0.00 ? 88  LEU A N    8  
ATOM 11045 C CA   . LEU A 1 51 ? 6.293   -8.906  -4.439  1.00 0.00 ? 88  LEU A CA   8  
ATOM 11046 C C    . LEU A 1 51 ? 5.736   -8.749  -3.023  1.00 0.00 ? 88  LEU A C    8  
ATOM 11047 O O    . LEU A 1 51 ? 4.584   -9.093  -2.751  1.00 0.00 ? 88  LEU A O    8  
ATOM 11048 C CB   . LEU A 1 51 ? 7.325   -10.047 -4.507  1.00 0.00 ? 88  LEU A CB   8  
ATOM 11049 C CG   . LEU A 1 51 ? 6.804   -11.465 -4.231  1.00 0.00 ? 88  LEU A CG   8  
ATOM 11050 C CD1  . LEU A 1 51 ? 6.970   -11.833 -2.767  1.00 0.00 ? 88  LEU A CD1  8  
ATOM 11051 C CD2  . LEU A 1 51 ? 5.347   -11.581 -4.642  1.00 0.00 ? 88  LEU A CD2  8  
ATOM 11052 H H    . LEU A 1 51 ? 7.895   -7.641  -4.976  1.00 0.00 ? 88  LEU A H    8  
ATOM 11053 H HA   . LEU A 1 51 ? 5.478   -9.126  -5.112  1.00 0.00 ? 88  LEU A HA   8  
ATOM 11054 H HB2  . LEU A 1 51 ? 7.763   -10.041 -5.494  1.00 0.00 ? 88  LEU A HB2  8  
ATOM 11055 H HB3  . LEU A 1 51 ? 8.105   -9.833  -3.791  1.00 0.00 ? 88  LEU A HB3  8  
ATOM 11056 H HG   . LEU A 1 51 ? 7.377   -12.170 -4.815  1.00 0.00 ? 88  LEU A HG   8  
ATOM 11057 H HD11 . LEU A 1 51 ? 7.998   -11.681 -2.472  1.00 0.00 ? 88  LEU A HD11 8  
ATOM 11058 H HD12 . LEU A 1 51 ? 6.326   -11.213 -2.164  1.00 0.00 ? 88  LEU A HD12 8  
ATOM 11059 H HD13 . LEU A 1 51 ? 6.707   -12.871 -2.628  1.00 0.00 ? 88  LEU A HD13 8  
ATOM 11060 H HD21 . LEU A 1 51 ? 4.792   -10.757 -4.213  1.00 0.00 ? 88  LEU A HD21 8  
ATOM 11061 H HD22 . LEU A 1 51 ? 5.271   -11.544 -5.717  1.00 0.00 ? 88  LEU A HD22 8  
ATOM 11062 H HD23 . LEU A 1 51 ? 4.944   -12.515 -4.280  1.00 0.00 ? 88  LEU A HD23 8  
ATOM 11063 N N    . TYR A 1 52 ? 6.566   -8.235  -2.131  1.00 0.00 ? 89  TYR A N    8  
ATOM 11064 C CA   . TYR A 1 52 ? 6.197   -8.074  -0.731  1.00 0.00 ? 89  TYR A CA   8  
ATOM 11065 C C    . TYR A 1 52 ? 5.013   -7.130  -0.556  1.00 0.00 ? 89  TYR A C    8  
ATOM 11066 O O    . TYR A 1 52 ? 4.123   -7.389  0.256   1.00 0.00 ? 89  TYR A O    8  
ATOM 11067 C CB   . TYR A 1 52 ? 7.388   -7.552  0.063   1.00 0.00 ? 89  TYR A CB   8  
ATOM 11068 C CG   . TYR A 1 52 ? 8.421   -8.601  0.401   1.00 0.00 ? 89  TYR A CG   8  
ATOM 11069 C CD1  . TYR A 1 52 ? 8.477   -9.801  -0.291  1.00 0.00 ? 89  TYR A CD1  8  
ATOM 11070 C CD2  . TYR A 1 52 ? 9.347   -8.387  1.412   1.00 0.00 ? 89  TYR A CD2  8  
ATOM 11071 C CE1  . TYR A 1 52 ? 9.419   -10.761 0.013   1.00 0.00 ? 89  TYR A CE1  8  
ATOM 11072 C CE2  . TYR A 1 52 ? 10.298  -9.338  1.723   1.00 0.00 ? 89  TYR A CE2  8  
ATOM 11073 C CZ   . TYR A 1 52 ? 10.329  -10.526 1.021   1.00 0.00 ? 89  TYR A CZ   8  
ATOM 11074 O OH   . TYR A 1 52 ? 11.273  -11.481 1.330   1.00 0.00 ? 89  TYR A OH   8  
ATOM 11075 H H    . TYR A 1 52 ? 7.475   -7.980  -2.416  1.00 0.00 ? 89  TYR A H    8  
ATOM 11076 H HA   . TYR A 1 52 ? 5.922   -9.045  -0.349  1.00 0.00 ? 89  TYR A HA   8  
ATOM 11077 H HB2  . TYR A 1 52 ? 7.879   -6.780  -0.508  1.00 0.00 ? 89  TYR A HB2  8  
ATOM 11078 H HB3  . TYR A 1 52 ? 7.026   -7.132  0.983   1.00 0.00 ? 89  TYR A HB3  8  
ATOM 11079 H HD1  . TYR A 1 52 ? 7.765   -9.981  -1.081  1.00 0.00 ? 89  TYR A HD1  8  
ATOM 11080 H HD2  . TYR A 1 52 ? 9.320   -7.458  1.960   1.00 0.00 ? 89  TYR A HD2  8  
ATOM 11081 H HE1  . TYR A 1 52 ? 9.444   -11.688 -0.544  1.00 0.00 ? 89  TYR A HE1  8  
ATOM 11082 H HE2  . TYR A 1 52 ? 11.015  -9.147  2.509   1.00 0.00 ? 89  TYR A HE2  8  
ATOM 11083 H HH   . TYR A 1 52 ? 10.825  -12.303 1.588   1.00 0.00 ? 89  TYR A HH   8  
ATOM 11084 N N    . PHE A 1 53 ? 5.033   -6.017  -1.282  1.00 0.00 ? 90  PHE A N    8  
ATOM 11085 C CA   . PHE A 1 53 ? 3.978   -5.014  -1.179  1.00 0.00 ? 90  PHE A CA   8  
ATOM 11086 C C    . PHE A 1 53 ? 2.625   -5.628  -1.510  1.00 0.00 ? 90  PHE A C    8  
ATOM 11087 O O    . PHE A 1 53 ? 1.650   -5.435  -0.785  1.00 0.00 ? 90  PHE A O    8  
ATOM 11088 C CB   . PHE A 1 53 ? 4.249   -3.844  -2.128  1.00 0.00 ? 90  PHE A CB   8  
ATOM 11089 C CG   . PHE A 1 53 ? 3.222   -2.750  -2.036  1.00 0.00 ? 90  PHE A CG   8  
ATOM 11090 C CD1  . PHE A 1 53 ? 3.253   -1.837  -0.994  1.00 0.00 ? 90  PHE A CD1  8  
ATOM 11091 C CD2  . PHE A 1 53 ? 2.238   -2.626  -3.003  1.00 0.00 ? 90  PHE A CD2  8  
ATOM 11092 C CE1  . PHE A 1 53 ? 2.315   -0.825  -0.914  1.00 0.00 ? 90  PHE A CE1  8  
ATOM 11093 C CE2  . PHE A 1 53 ? 1.300   -1.614  -2.927  1.00 0.00 ? 90  PHE A CE2  8  
ATOM 11094 C CZ   . PHE A 1 53 ? 1.310   -0.743  -1.853  1.00 0.00 ? 90  PHE A CZ   8  
ATOM 11095 H H    . PHE A 1 53 ? 5.799   -5.847  -1.879  1.00 0.00 ? 90  PHE A H    8  
ATOM 11096 H HA   . PHE A 1 53 ? 3.958   -4.650  -0.164  1.00 0.00 ? 90  PHE A HA   8  
ATOM 11097 H HB2  . PHE A 1 53 ? 5.213   -3.414  -1.894  1.00 0.00 ? 90  PHE A HB2  8  
ATOM 11098 H HB3  . PHE A 1 53 ? 4.261   -4.207  -3.146  1.00 0.00 ? 90  PHE A HB3  8  
ATOM 11099 H HD1  . PHE A 1 53 ? 4.017   -1.920  -0.237  1.00 0.00 ? 90  PHE A HD1  8  
ATOM 11100 H HD2  . PHE A 1 53 ? 2.205   -3.330  -3.819  1.00 0.00 ? 90  PHE A HD2  8  
ATOM 11101 H HE1  . PHE A 1 53 ? 2.345   -0.122  -0.094  1.00 0.00 ? 90  PHE A HE1  8  
ATOM 11102 H HE2  . PHE A 1 53 ? 0.538   -1.526  -3.688  1.00 0.00 ? 90  PHE A HE2  8  
ATOM 11103 H HZ   . PHE A 1 53 ? 0.568   0.037   -1.782  1.00 0.00 ? 90  PHE A HZ   8  
ATOM 11104 N N    . ASN A 1 54 ? 2.580   -6.369  -2.605  1.00 0.00 ? 91  ASN A N    8  
ATOM 11105 C CA   . ASN A 1 54 ? 1.346   -7.001  -3.054  1.00 0.00 ? 91  ASN A CA   8  
ATOM 11106 C C    . ASN A 1 54 ? 0.830   -7.999  -2.034  1.00 0.00 ? 91  ASN A C    8  
ATOM 11107 O O    . ASN A 1 54 ? -0.358  -8.002  -1.717  1.00 0.00 ? 91  ASN A O    8  
ATOM 11108 C CB   . ASN A 1 54 ? 1.551   -7.677  -4.406  1.00 0.00 ? 91  ASN A CB   8  
ATOM 11109 C CG   . ASN A 1 54 ? 1.445   -6.694  -5.549  1.00 0.00 ? 91  ASN A CG   8  
ATOM 11110 O OD1  . ASN A 1 54 ? 0.378   -6.138  -5.805  1.00 0.00 ? 91  ASN A OD1  8  
ATOM 11111 N ND2  . ASN A 1 54 ? 2.553   -6.448  -6.227  1.00 0.00 ? 91  ASN A ND2  8  
ATOM 11112 H H    . ASN A 1 54 ? 3.398   -6.488  -3.135  1.00 0.00 ? 91  ASN A H    8  
ATOM 11113 H HA   . ASN A 1 54 ? 0.610   -6.221  -3.168  1.00 0.00 ? 91  ASN A HA   8  
ATOM 11114 H HB2  . ASN A 1 54 ? 2.532   -8.128  -4.433  1.00 0.00 ? 91  ASN A HB2  8  
ATOM 11115 H HB3  . ASN A 1 54 ? 0.800   -8.444  -4.539  1.00 0.00 ? 91  ASN A HB3  8  
ATOM 11116 H HD21 . ASN A 1 54 ? 3.377   -6.911  -5.952  1.00 0.00 ? 91  ASN A HD21 8  
ATOM 11117 H HD22 . ASN A 1 54 ? 2.516   -5.809  -6.969  1.00 0.00 ? 91  ASN A HD22 8  
ATOM 11118 N N    . ASN A 1 55 ? 1.726   -8.803  -1.472  1.00 0.00 ? 92  ASN A N    8  
ATOM 11119 C CA   . ASN A 1 55 ? 1.336   -9.761  -0.440  1.00 0.00 ? 92  ASN A CA   8  
ATOM 11120 C C    . ASN A 1 55 ? 0.826   -9.043  0.802   1.00 0.00 ? 92  ASN A C    8  
ATOM 11121 O O    . ASN A 1 55 ? -0.162  -9.462  1.404   1.00 0.00 ? 92  ASN A O    8  
ATOM 11122 C CB   . ASN A 1 55 ? 2.489   -10.694 -0.071  1.00 0.00 ? 92  ASN A CB   8  
ATOM 11123 C CG   . ASN A 1 55 ? 2.697   -11.786 -1.100  1.00 0.00 ? 92  ASN A CG   8  
ATOM 11124 O OD1  . ASN A 1 55 ? 1.742   -12.399 -1.574  1.00 0.00 ? 92  ASN A OD1  8  
ATOM 11125 N ND2  . ASN A 1 55 ? 3.945   -12.072 -1.416  1.00 0.00 ? 92  ASN A ND2  8  
ATOM 11126 H H    . ASN A 1 55 ? 2.669   -8.731  -1.733  1.00 0.00 ? 92  ASN A H    8  
ATOM 11127 H HA   . ASN A 1 55 ? 0.527   -10.354 -0.842  1.00 0.00 ? 92  ASN A HA   8  
ATOM 11128 H HB2  . ASN A 1 55 ? 3.401   -10.121 0.003   1.00 0.00 ? 92  ASN A HB2  8  
ATOM 11129 H HB3  . ASN A 1 55 ? 2.281   -11.158 0.882   1.00 0.00 ? 92  ASN A HB3  8  
ATOM 11130 H HD21 . ASN A 1 55 ? 4.666   -11.566 -0.968  1.00 0.00 ? 92  ASN A HD21 8  
ATOM 11131 H HD22 . ASN A 1 55 ? 4.108   -12.785 -2.073  1.00 0.00 ? 92  ASN A HD22 8  
ATOM 11132 N N    . ALA A 1 56 ? 1.464   -7.929  1.146   1.00 0.00 ? 93  ALA A N    8  
ATOM 11133 C CA   . ALA A 1 56 ? 1.031   -7.116  2.276   1.00 0.00 ? 93  ALA A CA   8  
ATOM 11134 C C    . ALA A 1 56 ? -0.376  -6.578  2.043   1.00 0.00 ? 93  ALA A C    8  
ATOM 11135 O O    . ALA A 1 56 ? -1.236  -6.661  2.925   1.00 0.00 ? 93  ALA A O    8  
ATOM 11136 C CB   . ALA A 1 56 ? 2.001   -5.971  2.511   1.00 0.00 ? 93  ALA A CB   8  
ATOM 11137 H H    . ALA A 1 56 ? 2.222   -7.623  0.599   1.00 0.00 ? 93  ALA A H    8  
ATOM 11138 H HA   . ALA A 1 56 ? 1.028   -7.741  3.157   1.00 0.00 ? 93  ALA A HA   8  
ATOM 11139 H HB1  . ALA A 1 56 ? 2.838   -6.323  3.095   1.00 0.00 ? 93  ALA A HB1  8  
ATOM 11140 H HB2  . ALA A 1 56 ? 2.354   -5.601  1.563   1.00 0.00 ? 93  ALA A HB2  8  
ATOM 11141 H HB3  . ALA A 1 56 ? 1.497   -5.178  3.043   1.00 0.00 ? 93  ALA A HB3  8  
ATOM 11142 N N    . ILE A 1 57 ? -0.624  -6.102  0.825   1.00 0.00 ? 94  ILE A N    8  
ATOM 11143 C CA   . ILE A 1 57 ? -1.950  -5.641  0.430   1.00 0.00 ? 94  ILE A CA   8  
ATOM 11144 C C    . ILE A 1 57 ? -2.949  -6.786  0.523   1.00 0.00 ? 94  ILE A C    8  
ATOM 11145 O O    . ILE A 1 57 ? -3.979  -6.673  1.180   1.00 0.00 ? 94  ILE A O    8  
ATOM 11146 C CB   . ILE A 1 57 ? -1.957  -5.097  -1.019  1.00 0.00 ? 94  ILE A CB   8  
ATOM 11147 C CG1  . ILE A 1 57 ? -1.046  -3.874  -1.148  1.00 0.00 ? 94  ILE A CG1  8  
ATOM 11148 C CG2  . ILE A 1 57 ? -3.375  -4.751  -1.454  1.00 0.00 ? 94  ILE A CG2  8  
ATOM 11149 C CD1  . ILE A 1 57 ? -1.557  -2.656  -0.414  1.00 0.00 ? 94  ILE A CD1  8  
ATOM 11150 H H    . ILE A 1 57 ? 0.096   -6.113  0.154   1.00 0.00 ? 94  ILE A H    8  
ATOM 11151 H HA   . ILE A 1 57 ? -2.251  -4.848  1.101   1.00 0.00 ? 94  ILE A HA   8  
ATOM 11152 H HB   . ILE A 1 57 ? -1.591  -5.877  -1.670  1.00 0.00 ? 94  ILE A HB   8  
ATOM 11153 H HG12 . ILE A 1 57 ? -0.072  -4.114  -0.749  1.00 0.00 ? 94  ILE A HG12 8  
ATOM 11154 H HG13 . ILE A 1 57 ? -0.948  -3.615  -2.193  1.00 0.00 ? 94  ILE A HG13 8  
ATOM 11155 H HG21 . ILE A 1 57 ? -3.859  -4.176  -0.680  1.00 0.00 ? 94  ILE A HG21 8  
ATOM 11156 H HG22 . ILE A 1 57 ? -3.342  -4.172  -2.366  1.00 0.00 ? 94  ILE A HG22 8  
ATOM 11157 H HG23 . ILE A 1 57 ? -3.929  -5.660  -1.628  1.00 0.00 ? 94  ILE A HG23 8  
ATOM 11158 H HD11 . ILE A 1 57 ? -2.533  -2.873  -0.002  1.00 0.00 ? 94  ILE A HD11 8  
ATOM 11159 H HD12 . ILE A 1 57 ? -0.876  -2.404  0.383   1.00 0.00 ? 94  ILE A HD12 8  
ATOM 11160 H HD13 . ILE A 1 57 ? -1.632  -1.825  -1.101  1.00 0.00 ? 94  ILE A HD13 8  
ATOM 11161 N N    . LYS A 1 58 ? -2.610  -7.889  -0.130  1.00 0.00 ? 95  LYS A N    8  
ATOM 11162 C CA   . LYS A 1 58 ? -3.453  -9.084  -0.164  1.00 0.00 ? 95  LYS A CA   8  
ATOM 11163 C C    . LYS A 1 58 ? -3.828  -9.560  1.233   1.00 0.00 ? 95  LYS A C    8  
ATOM 11164 O O    . LYS A 1 58 ? -4.993  -9.848  1.508   1.00 0.00 ? 95  LYS A O    8  
ATOM 11165 C CB   . LYS A 1 58 ? -2.734  -10.213 -0.898  1.00 0.00 ? 95  LYS A CB   8  
ATOM 11166 C CG   . LYS A 1 58 ? -2.647  -10.018 -2.399  1.00 0.00 ? 95  LYS A CG   8  
ATOM 11167 C CD   . LYS A 1 58 ? -1.791  -11.095 -3.045  1.00 0.00 ? 95  LYS A CD   8  
ATOM 11168 C CE   . LYS A 1 58 ? -1.977  -11.128 -4.551  1.00 0.00 ? 95  LYS A CE   8  
ATOM 11169 N NZ   . LYS A 1 58 ? -3.353  -11.554 -4.927  1.00 0.00 ? 95  LYS A NZ   8  
ATOM 11170 H H    . LYS A 1 58 ? -1.761  -7.893  -0.633  1.00 0.00 ? 95  LYS A H    8  
ATOM 11171 H HA   . LYS A 1 58 ? -4.356  -8.836  -0.701  1.00 0.00 ? 95  LYS A HA   8  
ATOM 11172 H HB2  . LYS A 1 58 ? -1.729  -10.295 -0.512  1.00 0.00 ? 95  LYS A HB2  8  
ATOM 11173 H HB3  . LYS A 1 58 ? -3.258  -11.140 -0.709  1.00 0.00 ? 95  LYS A HB3  8  
ATOM 11174 H HG2  . LYS A 1 58 ? -3.642  -10.063 -2.817  1.00 0.00 ? 95  LYS A HG2  8  
ATOM 11175 H HG3  . LYS A 1 58 ? -2.211  -9.051  -2.600  1.00 0.00 ? 95  LYS A HG3  8  
ATOM 11176 H HD2  . LYS A 1 58 ? -0.753  -10.895 -2.824  1.00 0.00 ? 95  LYS A HD2  8  
ATOM 11177 H HD3  . LYS A 1 58 ? -2.069  -12.053 -2.634  1.00 0.00 ? 95  LYS A HD3  8  
ATOM 11178 H HE2  . LYS A 1 58 ? -1.793  -10.141 -4.947  1.00 0.00 ? 95  LYS A HE2  8  
ATOM 11179 H HE3  . LYS A 1 58 ? -1.266  -11.824 -4.973  1.00 0.00 ? 95  LYS A HE3  8  
ATOM 11180 H HZ1  . LYS A 1 58 ? -3.879  -11.869 -4.083  1.00 0.00 ? 95  LYS A HZ1  8  
ATOM 11181 H HZ2  . LYS A 1 58 ? -3.868  -10.758 -5.362  1.00 0.00 ? 95  LYS A HZ2  8  
ATOM 11182 H HZ3  . LYS A 1 58 ? -3.311  -12.342 -5.612  1.00 0.00 ? 95  LYS A HZ3  8  
ATOM 11183 N N    . LYS A 1 59 ? -2.836  -9.687  2.098   1.00 0.00 ? 96  LYS A N    8  
ATOM 11184 C CA   . LYS A 1 59 ? -3.061  -10.196 3.440   1.00 0.00 ? 96  LYS A CA   8  
ATOM 11185 C C    . LYS A 1 59 ? -3.791  -9.163  4.286   1.00 0.00 ? 96  LYS A C    8  
ATOM 11186 O O    . LYS A 1 59 ? -4.547  -9.503  5.194   1.00 0.00 ? 96  LYS A O    8  
ATOM 11187 C CB   . LYS A 1 59 ? -1.735  -10.578 4.097   1.00 0.00 ? 96  LYS A CB   8  
ATOM 11188 C CG   . LYS A 1 59 ? -1.801  -11.889 4.862   1.00 0.00 ? 96  LYS A CG   8  
ATOM 11189 C CD   . LYS A 1 59 ? -2.090  -13.059 3.932   1.00 0.00 ? 96  LYS A CD   8  
ATOM 11190 C CE   . LYS A 1 59 ? -1.020  -13.209 2.858   1.00 0.00 ? 96  LYS A CE   8  
ATOM 11191 N NZ   . LYS A 1 59 ? -1.312  -14.343 1.939   1.00 0.00 ? 96  LYS A NZ   8  
ATOM 11192 H H    . LYS A 1 59 ? -1.921  -9.456  1.818   1.00 0.00 ? 96  LYS A H    8  
ATOM 11193 H HA   . LYS A 1 59 ? -3.680  -11.079 3.360   1.00 0.00 ? 96  LYS A HA   8  
ATOM 11194 H HB2  . LYS A 1 59 ? -0.978  -10.668 3.331   1.00 0.00 ? 96  LYS A HB2  8  
ATOM 11195 H HB3  . LYS A 1 59 ? -1.447  -9.798  4.786   1.00 0.00 ? 96  LYS A HB3  8  
ATOM 11196 H HG2  . LYS A 1 59 ? -0.858  -12.058 5.356   1.00 0.00 ? 96  LYS A HG2  8  
ATOM 11197 H HG3  . LYS A 1 59 ? -2.593  -11.823 5.596   1.00 0.00 ? 96  LYS A HG3  8  
ATOM 11198 H HD2  . LYS A 1 59 ? -2.128  -13.966 4.516   1.00 0.00 ? 96  LYS A HD2  8  
ATOM 11199 H HD3  . LYS A 1 59 ? -3.045  -12.898 3.454   1.00 0.00 ? 96  LYS A HD3  8  
ATOM 11200 H HE2  . LYS A 1 59 ? -0.975  -12.297 2.283   1.00 0.00 ? 96  LYS A HE2  8  
ATOM 11201 H HE3  . LYS A 1 59 ? -0.069  -13.382 3.337   1.00 0.00 ? 96  LYS A HE3  8  
ATOM 11202 H HZ1  . LYS A 1 59 ? -2.342  -14.502 1.879   1.00 0.00 ? 96  LYS A HZ1  8  
ATOM 11203 H HZ2  . LYS A 1 59 ? -0.952  -14.138 0.984   1.00 0.00 ? 96  LYS A HZ2  8  
ATOM 11204 H HZ3  . LYS A 1 59 ? -0.856  -15.215 2.290   1.00 0.00 ? 96  LYS A HZ3  8  
ATOM 11205 N N    . GLY A 1 60 ? -3.547  -7.900  3.991   1.00 0.00 ? 97  GLY A N    8  
ATOM 11206 C CA   . GLY A 1 60 ? -4.173  -6.833  4.735   1.00 0.00 ? 97  GLY A CA   8  
ATOM 11207 C C    . GLY A 1 60 ? -5.631  -6.633  4.365   1.00 0.00 ? 97  GLY A C    8  
ATOM 11208 O O    . GLY A 1 60 ? -6.455  -6.318  5.228   1.00 0.00 ? 97  GLY A O    8  
ATOM 11209 H H    . GLY A 1 60 ? -2.922  -7.686  3.262   1.00 0.00 ? 97  GLY A H    8  
ATOM 11210 H HA2  . GLY A 1 60 ? -4.110  -7.061  5.789   1.00 0.00 ? 97  GLY A HA2  8  
ATOM 11211 H HA3  . GLY A 1 60 ? -3.634  -5.919  4.543   1.00 0.00 ? 97  GLY A HA3  8  
ATOM 11212 N N    . VAL A 1 61 ? -5.947  -6.749  3.077   1.00 0.00 ? 98  VAL A N    8  
ATOM 11213 C CA   . VAL A 1 61 ? -7.312  -6.522  2.614   1.00 0.00 ? 98  VAL A CA   8  
ATOM 11214 C C    . VAL A 1 61 ? -8.252  -7.622  3.098   1.00 0.00 ? 98  VAL A C    8  
ATOM 11215 O O    . VAL A 1 61 ? -9.373  -7.345  3.518   1.00 0.00 ? 98  VAL A O    8  
ATOM 11216 C CB   . VAL A 1 61 ? -7.414  -6.360  1.073   1.00 0.00 ? 98  VAL A CB   8  
ATOM 11217 C CG1  . VAL A 1 61 ? -6.700  -5.094  0.614   1.00 0.00 ? 98  VAL A CG1  8  
ATOM 11218 C CG2  . VAL A 1 61 ? -6.861  -7.574  0.348   1.00 0.00 ? 98  VAL A CG2  8  
ATOM 11219 H H    . VAL A 1 61 ? -5.238  -6.946  2.420   1.00 0.00 ? 98  VAL A H    8  
ATOM 11220 H HA   . VAL A 1 61 ? -7.640  -5.592  3.058   1.00 0.00 ? 98  VAL A HA   8  
ATOM 11221 H HB   . VAL A 1 61 ? -8.458  -6.264  0.816   1.00 0.00 ? 98  VAL A HB   8  
ATOM 11222 H HG11 . VAL A 1 61 ? -5.738  -5.025  1.100   1.00 0.00 ? 98  VAL A HG11 8  
ATOM 11223 H HG12 . VAL A 1 61 ? -6.561  -5.127  -0.457  1.00 0.00 ? 98  VAL A HG12 8  
ATOM 11224 H HG13 . VAL A 1 61 ? -7.294  -4.229  0.874   1.00 0.00 ? 98  VAL A HG13 8  
ATOM 11225 H HG21 . VAL A 1 61 ? -6.510  -8.294  1.071   1.00 0.00 ? 98  VAL A HG21 8  
ATOM 11226 H HG22 . VAL A 1 61 ? -6.039  -7.270  -0.284  1.00 0.00 ? 98  VAL A HG22 8  
ATOM 11227 H HG23 . VAL A 1 61 ? -7.636  -8.018  -0.258  1.00 0.00 ? 98  VAL A HG23 8  
ATOM 11228 N N    . GLU A 1 62 ? -7.769  -8.859  3.126   1.00 0.00 ? 99  GLU A N    8  
ATOM 11229 C CA   . GLU A 1 62 ? -8.562  -9.965  3.651   1.00 0.00 ? 99  GLU A CA   8  
ATOM 11230 C C    . GLU A 1 62 ? -8.787  -9.802  5.152   1.00 0.00 ? 99  GLU A C    8  
ATOM 11231 O O    . GLU A 1 62 ? -9.869  -10.091 5.665   1.00 0.00 ? 99  GLU A O    8  
ATOM 11232 C CB   . GLU A 1 62 ? -7.886  -11.306 3.369   1.00 0.00 ? 99  GLU A CB   8  
ATOM 11233 C CG   . GLU A 1 62 ? -6.421  -11.340 3.755   1.00 0.00 ? 99  GLU A CG   8  
ATOM 11234 C CD   . GLU A 1 62 ? -5.913  -12.751 3.953   1.00 0.00 ? 99  GLU A CD   8  
ATOM 11235 O OE1  . GLU A 1 62 ? -5.844  -13.506 2.961   1.00 0.00 ? 99  GLU A OE1  8  
ATOM 11236 O OE2  . GLU A 1 62 ? -5.564  -13.108 5.098   1.00 0.00 ? 99  GLU A OE2  8  
ATOM 11237 H H    . GLU A 1 62 ? -6.848  -9.023  2.826   1.00 0.00 ? 99  GLU A H    8  
ATOM 11238 H HA   . GLU A 1 62 ? -9.521  -9.946  3.154   1.00 0.00 ? 99  GLU A HA   8  
ATOM 11239 H HB2  . GLU A 1 62 ? -8.397  -12.076 3.924   1.00 0.00 ? 99  GLU A HB2  8  
ATOM 11240 H HB3  . GLU A 1 62 ? -7.964  -11.521 2.313   1.00 0.00 ? 99  GLU A HB3  8  
ATOM 11241 H HG2  . GLU A 1 62 ? -5.849  -10.878 2.965   1.00 0.00 ? 99  GLU A HG2  8  
ATOM 11242 H HG3  . GLU A 1 62 ? -6.283  -10.777 4.673   1.00 0.00 ? 99  GLU A HG3  8  
ATOM 11243 N N    . ALA A 1 63 ? -7.750  -9.340  5.844   1.00 0.00 ? 100 ALA A N    8  
ATOM 11244 C CA   . ALA A 1 63 ? -7.809  -9.130  7.286   1.00 0.00 ? 100 ALA A CA   8  
ATOM 11245 C C    . ALA A 1 63 ? -8.781  -8.011  7.631   1.00 0.00 ? 100 ALA A C    8  
ATOM 11246 O O    . ALA A 1 63 ? -9.389  -8.009  8.702   1.00 0.00 ? 100 ALA A O    8  
ATOM 11247 C CB   . ALA A 1 63 ? -6.422  -8.812  7.828   1.00 0.00 ? 100 ALA A CB   8  
ATOM 11248 H H    . ALA A 1 63 ? -6.919  -9.135  5.371   1.00 0.00 ? 100 ALA A H    8  
ATOM 11249 H HA   . ALA A 1 63 ? -8.150  -10.046 7.743   1.00 0.00 ? 100 ALA A HA   8  
ATOM 11250 H HB1  . ALA A 1 63 ? -6.506  -8.101  8.639   1.00 0.00 ? 100 ALA A HB1  8  
ATOM 11251 H HB2  . ALA A 1 63 ? -5.815  -8.390  7.041   1.00 0.00 ? 100 ALA A HB2  8  
ATOM 11252 H HB3  . ALA A 1 63 ? -5.962  -9.720  8.191   1.00 0.00 ? 100 ALA A HB3  8  
ATOM 11253 N N    . GLY A 1 64 ? -8.910  -7.056  6.726   1.00 0.00 ? 101 GLY A N    8  
ATOM 11254 C CA   . GLY A 1 64 ? -9.783  -5.929  6.960   1.00 0.00 ? 101 GLY A CA   8  
ATOM 11255 C C    . GLY A 1 64 ? -9.039  -4.760  7.567   1.00 0.00 ? 101 GLY A C    8  
ATOM 11256 O O    . GLY A 1 64 ? -9.593  -4.003  8.362   1.00 0.00 ? 101 GLY A O    8  
ATOM 11257 H H    . GLY A 1 64 ? -8.391  -7.109  5.895   1.00 0.00 ? 101 GLY A H    8  
ATOM 11258 H HA2  . GLY A 1 64 ? -10.219 -5.620  6.021   1.00 0.00 ? 101 GLY A HA2  8  
ATOM 11259 H HA3  . GLY A 1 64 ? -10.571 -6.230  7.633   1.00 0.00 ? 101 GLY A HA3  8  
ATOM 11260 N N    . ASP A 1 65 ? -7.800  -4.577  7.134   1.00 0.00 ? 102 ASP A N    8  
ATOM 11261 C CA   . ASP A 1 65 ? -6.990  -3.451  7.584   1.00 0.00 ? 102 ASP A CA   8  
ATOM 11262 C C    . ASP A 1 65 ? -6.762  -2.518  6.408   1.00 0.00 ? 102 ASP A C    8  
ATOM 11263 O O    . ASP A 1 65 ? -6.669  -1.301  6.564   1.00 0.00 ? 102 ASP A O    8  
ATOM 11264 C CB   . ASP A 1 65 ? -5.654  -3.927  8.158   1.00 0.00 ? 102 ASP A CB   8  
ATOM 11265 C CG   . ASP A 1 65 ? -5.129  -3.014  9.254   1.00 0.00 ? 102 ASP A CG   8  
ATOM 11266 O OD1  . ASP A 1 65 ? -5.842  -2.060  9.627   1.00 0.00 ? 102 ASP A OD1  8  
ATOM 11267 O OD2  . ASP A 1 65 ? -3.986  -3.222  9.719   1.00 0.00 ? 102 ASP A OD2  8  
ATOM 11268 H H    . ASP A 1 65 ? -7.430  -5.198  6.470   1.00 0.00 ? 102 ASP A H    8  
ATOM 11269 H HA   . ASP A 1 65 ? -7.544  -2.923  8.348   1.00 0.00 ? 102 ASP A HA   8  
ATOM 11270 H HB2  . ASP A 1 65 ? -5.780  -4.919  8.569   1.00 0.00 ? 102 ASP A HB2  8  
ATOM 11271 H HB3  . ASP A 1 65 ? -4.924  -3.964  7.364   1.00 0.00 ? 102 ASP A HB3  8  
ATOM 11272 N N    . PHE A 1 66 ? -6.878  -3.085  5.214   1.00 0.00 ? 103 PHE A N    8  
ATOM 11273 C CA   . PHE A 1 66 ? -6.912  -2.305  3.989   1.00 0.00 ? 103 PHE A CA   8  
ATOM 11274 C C    . PHE A 1 66 ? -8.031  -2.859  3.115   1.00 0.00 ? 103 PHE A C    8  
ATOM 11275 O O    . PHE A 1 66 ? -8.419  -4.009  3.278   1.00 0.00 ? 103 PHE A O    8  
ATOM 11276 C CB   . PHE A 1 66 ? -5.582  -2.365  3.224   1.00 0.00 ? 103 PHE A CB   8  
ATOM 11277 C CG   . PHE A 1 66 ? -4.358  -2.430  4.094   1.00 0.00 ? 103 PHE A CG   8  
ATOM 11278 C CD1  . PHE A 1 66 ? -3.929  -3.639  4.609   1.00 0.00 ? 103 PHE A CD1  8  
ATOM 11279 C CD2  . PHE A 1 66 ? -3.630  -1.288  4.378   1.00 0.00 ? 103 PHE A CD2  8  
ATOM 11280 C CE1  . PHE A 1 66 ? -2.800  -3.714  5.397   1.00 0.00 ? 103 PHE A CE1  8  
ATOM 11281 C CE2  . PHE A 1 66 ? -2.494  -1.354  5.166   1.00 0.00 ? 103 PHE A CE2  8  
ATOM 11282 C CZ   . PHE A 1 66 ? -2.080  -2.568  5.677   1.00 0.00 ? 103 PHE A CZ   8  
ATOM 11283 H H    . PHE A 1 66 ? -7.095  -4.045  5.164   1.00 0.00 ? 103 PHE A H    8  
ATOM 11284 H HA   . PHE A 1 66 ? -7.137  -1.279  4.245   1.00 0.00 ? 103 PHE A HA   8  
ATOM 11285 H HB2  . PHE A 1 66 ? -5.580  -3.240  2.588   1.00 0.00 ? 103 PHE A HB2  8  
ATOM 11286 H HB3  . PHE A 1 66 ? -5.498  -1.483  2.608   1.00 0.00 ? 103 PHE A HB3  8  
ATOM 11287 H HD1  . PHE A 1 66 ? -4.492  -4.534  4.389   1.00 0.00 ? 103 PHE A HD1  8  
ATOM 11288 H HD2  . PHE A 1 66 ? -3.958  -0.338  3.981   1.00 0.00 ? 103 PHE A HD2  8  
ATOM 11289 H HE1  . PHE A 1 66 ? -2.482  -4.669  5.794   1.00 0.00 ? 103 PHE A HE1  8  
ATOM 11290 H HE2  . PHE A 1 66 ? -1.932  -0.458  5.381   1.00 0.00 ? 103 PHE A HE2  8  
ATOM 11291 H HZ   . PHE A 1 66 ? -1.193  -2.621  6.293   1.00 0.00 ? 103 PHE A HZ   8  
ATOM 11292 N N    . GLU A 1 67 ? -8.592  -2.034  2.245   1.00 0.00 ? 104 GLU A N    8  
ATOM 11293 C CA   . GLU A 1 67 ? -9.687  -2.467  1.381   1.00 0.00 ? 104 GLU A CA   8  
ATOM 11294 C C    . GLU A 1 67 ? -9.545  -1.841  0.002   1.00 0.00 ? 104 GLU A C    8  
ATOM 11295 O O    . GLU A 1 67 ? -9.526  -0.620  -0.128  1.00 0.00 ? 104 GLU A O    8  
ATOM 11296 C CB   . GLU A 1 67 ? -11.043 -2.069  1.983   1.00 0.00 ? 104 GLU A CB   8  
ATOM 11297 C CG   . GLU A 1 67 ? -11.499 -2.937  3.149   1.00 0.00 ? 104 GLU A CG   8  
ATOM 11298 C CD   . GLU A 1 67 ? -12.114 -4.249  2.703   1.00 0.00 ? 104 GLU A CD   8  
ATOM 11299 O OE1  . GLU A 1 67 ? -13.065 -4.229  1.894   1.00 0.00 ? 104 GLU A OE1  8  
ATOM 11300 O OE2  . GLU A 1 67 ? -11.624 -5.310  3.139   1.00 0.00 ? 104 GLU A OE2  8  
ATOM 11301 H H    . GLU A 1 67 ? -8.277  -1.106  2.188   1.00 0.00 ? 104 GLU A H    8  
ATOM 11302 H HA   . GLU A 1 67 ? -9.641  -3.543  1.289   1.00 0.00 ? 104 GLU A HA   8  
ATOM 11303 H HB2  . GLU A 1 67 ? -10.978 -1.050  2.331   1.00 0.00 ? 104 GLU A HB2  8  
ATOM 11304 H HB3  . GLU A 1 67 ? -11.794 -2.124  1.208   1.00 0.00 ? 104 GLU A HB3  8  
ATOM 11305 H HG2  . GLU A 1 67 ? -10.647 -3.152  3.774   1.00 0.00 ? 104 GLU A HG2  8  
ATOM 11306 H HG3  . GLU A 1 67 ? -12.235 -2.390  3.719   1.00 0.00 ? 104 GLU A HG3  8  
ATOM 11307 N N    . GLN A 1 68 ? -9.489  -2.673  -1.026  1.00 0.00 ? 105 GLN A N    8  
ATOM 11308 C CA   . GLN A 1 68 ? -9.431  -2.184  -2.396  1.00 0.00 ? 105 GLN A CA   8  
ATOM 11309 C C    . GLN A 1 68 ? -10.818 -2.163  -3.023  1.00 0.00 ? 105 GLN A C    8  
ATOM 11310 O O    . GLN A 1 68 ? -11.353 -3.210  -3.395  1.00 0.00 ? 105 GLN A O    8  
ATOM 11311 C CB   . GLN A 1 68 ? -8.535  -3.061  -3.268  1.00 0.00 ? 105 GLN A CB   8  
ATOM 11312 C CG   . GLN A 1 68 ? -7.046  -2.881  -3.061  1.00 0.00 ? 105 GLN A CG   8  
ATOM 11313 C CD   . GLN A 1 68 ? -6.249  -3.614  -4.124  1.00 0.00 ? 105 GLN A CD   8  
ATOM 11314 O OE1  . GLN A 1 68 ? -6.283  -3.252  -5.300  1.00 0.00 ? 105 GLN A OE1  8  
ATOM 11315 N NE2  . GLN A 1 68 ? -5.551  -4.666  -3.732  1.00 0.00 ? 105 GLN A NE2  8  
ATOM 11316 H H    . GLN A 1 68 ? -9.556  -3.642  -0.864  1.00 0.00 ? 105 GLN A H    8  
ATOM 11317 H HA   . GLN A 1 68 ? -9.036  -1.180  -2.379  1.00 0.00 ? 105 GLN A HA   8  
ATOM 11318 H HB2  . GLN A 1 68 ? -8.773  -4.095  -3.071  1.00 0.00 ? 105 GLN A HB2  8  
ATOM 11319 H HB3  . GLN A 1 68 ? -8.757  -2.848  -4.304  1.00 0.00 ? 105 GLN A HB3  8  
ATOM 11320 H HG2  . GLN A 1 68 ? -6.811  -1.828  -3.114  1.00 0.00 ? 105 GLN A HG2  8  
ATOM 11321 H HG3  . GLN A 1 68 ? -6.771  -3.265  -2.091  1.00 0.00 ? 105 GLN A HG3  8  
ATOM 11322 H HE21 . GLN A 1 68 ? -5.578  -4.915  -2.786  1.00 0.00 ? 105 GLN A HE21 8  
ATOM 11323 H HE22 . GLN A 1 68 ? -5.047  -5.165  -4.411  1.00 0.00 ? 105 GLN A HE22 8  
ATOM 11324 N N    . PRO A 1 69 ? -11.395 -0.974  -3.217  1.00 0.00 ? 106 PRO A N    8  
ATOM 11325 C CA   . PRO A 1 69 ? -12.679 -0.833  -3.900  1.00 0.00 ? 106 PRO A CA   8  
ATOM 11326 C C    . PRO A 1 69 ? -12.598 -1.309  -5.350  1.00 0.00 ? 106 PRO A C    8  
ATOM 11327 O O    . PRO A 1 69 ? -13.556 -1.860  -5.893  1.00 0.00 ? 106 PRO A O    8  
ATOM 11328 C CB   . PRO A 1 69 ? -12.965 0.670   -3.837  1.00 0.00 ? 106 PRO A CB   8  
ATOM 11329 C CG   . PRO A 1 69 ? -11.634 1.312   -3.648  1.00 0.00 ? 106 PRO A CG   8  
ATOM 11330 C CD   . PRO A 1 69 ? -10.809 0.332   -2.861  1.00 0.00 ? 106 PRO A CD   8  
ATOM 11331 H HA   . PRO A 1 69 ? -13.459 -1.376  -3.387  1.00 0.00 ? 106 PRO A HA   8  
ATOM 11332 H HB2  . PRO A 1 69 ? -13.431 0.988   -4.759  1.00 0.00 ? 106 PRO A HB2  8  
ATOM 11333 H HB3  . PRO A 1 69 ? -13.625 0.877   -3.006  1.00 0.00 ? 106 PRO A HB3  8  
ATOM 11334 H HG2  . PRO A 1 69 ? -11.177 1.500   -4.607  1.00 0.00 ? 106 PRO A HG2  8  
ATOM 11335 H HG3  . PRO A 1 69 ? -11.744 2.235   -3.096  1.00 0.00 ? 106 PRO A HG3  8  
ATOM 11336 H HD2  . PRO A 1 69 ? -9.773  0.384   -3.161  1.00 0.00 ? 106 PRO A HD2  8  
ATOM 11337 H HD3  . PRO A 1 69 ? -10.907 0.521   -1.802  1.00 0.00 ? 106 PRO A HD3  8  
ATOM 11338 N N    . LYS A 1 70 ? -11.441 -1.093  -5.971  1.00 0.00 ? 107 LYS A N    8  
ATOM 11339 C CA   . LYS A 1 70 ? -11.225 -1.472  -7.361  1.00 0.00 ? 107 LYS A CA   8  
ATOM 11340 C C    . LYS A 1 70 ? -10.757 -2.926  -7.507  1.00 0.00 ? 107 LYS A C    8  
ATOM 11341 O O    . LYS A 1 70 ? -10.066 -3.267  -8.469  1.00 0.00 ? 107 LYS A O    8  
ATOM 11342 C CB   . LYS A 1 70 ? -10.207 -0.526  -8.003  1.00 0.00 ? 107 LYS A CB   8  
ATOM 11343 C CG   . LYS A 1 70 ? -10.746 0.877   -8.241  1.00 0.00 ? 107 LYS A CG   8  
ATOM 11344 C CD   . LYS A 1 70 ? -9.670  1.798   -8.800  1.00 0.00 ? 107 LYS A CD   8  
ATOM 11345 C CE   . LYS A 1 70 ? -10.263 2.999   -9.523  1.00 0.00 ? 107 LYS A CE   8  
ATOM 11346 N NZ   . LYS A 1 70 ? -11.237 3.752   -8.685  1.00 0.00 ? 107 LYS A NZ   8  
ATOM 11347 H H    . LYS A 1 70 ? -10.716 -0.652  -5.481  1.00 0.00 ? 107 LYS A H    8  
ATOM 11348 H HA   . LYS A 1 70 ? -12.166 -1.363  -7.877  1.00 0.00 ? 107 LYS A HA   8  
ATOM 11349 H HB2  . LYS A 1 70 ? -9.345  -0.453  -7.357  1.00 0.00 ? 107 LYS A HB2  8  
ATOM 11350 H HB3  . LYS A 1 70 ? -9.901  -0.937  -8.954  1.00 0.00 ? 107 LYS A HB3  8  
ATOM 11351 H HG2  . LYS A 1 70 ? -11.562 0.823   -8.941  1.00 0.00 ? 107 LYS A HG2  8  
ATOM 11352 H HG3  . LYS A 1 70 ? -11.099 1.280   -7.302  1.00 0.00 ? 107 LYS A HG3  8  
ATOM 11353 H HD2  . LYS A 1 70 ? -9.056  2.151   -7.985  1.00 0.00 ? 107 LYS A HD2  8  
ATOM 11354 H HD3  . LYS A 1 70 ? -9.059  1.238   -9.494  1.00 0.00 ? 107 LYS A HD3  8  
ATOM 11355 H HE2  . LYS A 1 70 ? -9.461  3.665   -9.802  1.00 0.00 ? 107 LYS A HE2  8  
ATOM 11356 H HE3  . LYS A 1 70 ? -10.764 2.652   -10.414 1.00 0.00 ? 107 LYS A HE3  8  
ATOM 11357 H HZ1  . LYS A 1 70 ? -11.070 3.568   -7.673  1.00 0.00 ? 107 LYS A HZ1  8  
ATOM 11358 H HZ2  . LYS A 1 70 ? -11.146 4.774   -8.860  1.00 0.00 ? 107 LYS A HZ2  8  
ATOM 11359 H HZ3  . LYS A 1 70 ? -12.211 3.460   -8.925  1.00 0.00 ? 107 LYS A HZ3  8  
ATOM 11360 N N    . GLY A 1 71 ? -11.227 -3.797  -6.624  1.00 0.00 ? 108 GLY A N    8  
ATOM 11361 C CA   . GLY A 1 71 ? -10.928 -5.211  -6.743  1.00 0.00 ? 108 GLY A CA   8  
ATOM 11362 C C    . GLY A 1 71 ? -9.555  -5.577  -6.212  1.00 0.00 ? 108 GLY A C    8  
ATOM 11363 O O    . GLY A 1 71 ? -9.201  -5.201  -5.101  1.00 0.00 ? 108 GLY A O    8  
ATOM 11364 H H    . GLY A 1 71 ? -11.817 -3.484  -5.908  1.00 0.00 ? 108 GLY A H    8  
ATOM 11365 H HA2  . GLY A 1 71 ? -11.668 -5.775  -6.197  1.00 0.00 ? 108 GLY A HA2  8  
ATOM 11366 H HA3  . GLY A 1 71 ? -10.980 -5.489  -7.785  1.00 0.00 ? 108 GLY A HA3  8  
ATOM 11367 N N    . PRO A 1 72 ? -8.827  -6.445  -6.920  1.00 0.00 ? 109 PRO A N    8  
ATOM 11368 C CA   . PRO A 1 72 ? -7.546  -6.971  -6.456  1.00 0.00 ? 109 PRO A CA   8  
ATOM 11369 C C    . PRO A 1 72 ? -6.336  -6.146  -6.902  1.00 0.00 ? 109 PRO A C    8  
ATOM 11370 O O    . PRO A 1 72 ? -5.265  -6.230  -6.297  1.00 0.00 ? 109 PRO A O    8  
ATOM 11371 C CB   . PRO A 1 72 ? -7.509  -8.349  -7.096  1.00 0.00 ? 109 PRO A CB   8  
ATOM 11372 C CG   . PRO A 1 72 ? -8.273  -8.205  -8.371  1.00 0.00 ? 109 PRO A CG   8  
ATOM 11373 C CD   . PRO A 1 72 ? -9.258  -7.085  -8.172  1.00 0.00 ? 109 PRO A CD   8  
ATOM 11374 H HA   . PRO A 1 72 ? -7.527  -7.078  -5.384  1.00 0.00 ? 109 PRO A HA   8  
ATOM 11375 H HB2  . PRO A 1 72 ? -6.487  -8.627  -7.277  1.00 0.00 ? 109 PRO A HB2  8  
ATOM 11376 H HB3  . PRO A 1 72 ? -7.974  -9.068  -6.439  1.00 0.00 ? 109 PRO A HB3  8  
ATOM 11377 H HG2  . PRO A 1 72 ? -7.595  -7.965  -9.176  1.00 0.00 ? 109 PRO A HG2  8  
ATOM 11378 H HG3  . PRO A 1 72 ? -8.797  -9.125  -8.587  1.00 0.00 ? 109 PRO A HG3  8  
ATOM 11379 H HD2  . PRO A 1 72 ? -9.205  -6.388  -8.995  1.00 0.00 ? 109 PRO A HD2  8  
ATOM 11380 H HD3  . PRO A 1 72 ? -10.260 -7.479  -8.078  1.00 0.00 ? 109 PRO A HD3  8  
ATOM 11381 N N    . ALA A 1 73 ? -6.457  -5.478  -8.042  1.00 0.00 ? 110 ALA A N    8  
ATOM 11382 C CA   . ALA A 1 73 ? -5.320  -4.787  -8.634  1.00 0.00 ? 110 ALA A CA   8  
ATOM 11383 C C    . ALA A 1 73 ? -5.669  -3.350  -8.997  1.00 0.00 ? 110 ALA A C    8  
ATOM 11384 O O    . ALA A 1 73 ? -5.393  -2.895  -10.108 1.00 0.00 ? 110 ALA A O    8  
ATOM 11385 C CB   . ALA A 1 73 ? -4.833  -5.548  -9.857  1.00 0.00 ? 110 ALA A CB   8  
ATOM 11386 H H    . ALA A 1 73 ? -7.301  -5.528  -8.539  1.00 0.00 ? 110 ALA A H    8  
ATOM 11387 H HA   . ALA A 1 73 ? -4.521  -4.778  -7.905  1.00 0.00 ? 110 ALA A HA   8  
ATOM 11388 H HB1  . ALA A 1 73 ? -5.345  -5.185  -10.737 1.00 0.00 ? 110 ALA A HB1  8  
ATOM 11389 H HB2  . ALA A 1 73 ? -5.040  -6.600  -9.732  1.00 0.00 ? 110 ALA A HB2  8  
ATOM 11390 H HB3  . ALA A 1 73 ? -3.769  -5.403  -9.973  1.00 0.00 ? 110 ALA A HB3  8  
ATOM 11391 N N    . GLY A 1 74 ? -6.207  -2.617  -8.038  1.00 0.00 ? 111 GLY A N    8  
ATOM 11392 C CA   . GLY A 1 74 ? -6.531  -1.229  -8.274  1.00 0.00 ? 111 GLY A CA   8  
ATOM 11393 C C    . GLY A 1 74 ? -6.176  -0.351  -7.097  1.00 0.00 ? 111 GLY A C    8  
ATOM 11394 O O    . GLY A 1 74 ? -5.137  -0.542  -6.463  1.00 0.00 ? 111 GLY A O    8  
ATOM 11395 H H    . GLY A 1 74 ? -6.344  -3.010  -7.144  1.00 0.00 ? 111 GLY A H    8  
ATOM 11396 H HA2  . GLY A 1 74 ? -5.991  -0.886  -9.142  1.00 0.00 ? 111 GLY A HA2  8  
ATOM 11397 H HA3  . GLY A 1 74 ? -7.592  -1.145  -8.464  1.00 0.00 ? 111 GLY A HA3  8  
ATOM 11398 N N    . ALA A 1 75 ? -7.033  0.612   -6.809  1.00 0.00 ? 112 ALA A N    8  
ATOM 11399 C CA   . ALA A 1 75 ? -6.829  1.514   -5.685  1.00 0.00 ? 112 ALA A CA   8  
ATOM 11400 C C    . ALA A 1 75 ? -7.253  0.852   -4.384  1.00 0.00 ? 112 ALA A C    8  
ATOM 11401 O O    . ALA A 1 75 ? -8.263  0.155   -4.343  1.00 0.00 ? 112 ALA A O    8  
ATOM 11402 C CB   . ALA A 1 75 ? -7.597  2.809   -5.893  1.00 0.00 ? 112 ALA A CB   8  
ATOM 11403 H H    . ALA A 1 75 ? -7.840  0.705   -7.351  1.00 0.00 ? 112 ALA A H    8  
ATOM 11404 H HA   . ALA A 1 75 ? -5.774  1.747   -5.634  1.00 0.00 ? 112 ALA A HA   8  
ATOM 11405 H HB1  . ALA A 1 75 ? -7.431  3.171   -6.898  1.00 0.00 ? 112 ALA A HB1  8  
ATOM 11406 H HB2  . ALA A 1 75 ? -8.652  2.632   -5.744  1.00 0.00 ? 112 ALA A HB2  8  
ATOM 11407 H HB3  . ALA A 1 75 ? -7.251  3.548   -5.184  1.00 0.00 ? 112 ALA A HB3  8  
ATOM 11408 N N    . VAL A 1 76 ? -6.512  1.119   -3.319  1.00 0.00 ? 113 VAL A N    8  
ATOM 11409 C CA   . VAL A 1 76 ? -6.857  0.620   -1.996  1.00 0.00 ? 113 VAL A CA   8  
ATOM 11410 C C    . VAL A 1 76 ? -7.063  1.785   -1.036  1.00 0.00 ? 113 VAL A C    8  
ATOM 11411 O O    . VAL A 1 76 ? -6.360  2.790   -1.111  1.00 0.00 ? 113 VAL A O    8  
ATOM 11412 C CB   . VAL A 1 76 ? -5.775  -0.343  -1.439  1.00 0.00 ? 113 VAL A CB   8  
ATOM 11413 C CG1  . VAL A 1 76 ? -4.415  0.315   -1.437  1.00 0.00 ? 113 VAL A CG1  8  
ATOM 11414 C CG2  . VAL A 1 76 ? -6.128  -0.825  -0.038  1.00 0.00 ? 113 VAL A CG2  8  
ATOM 11415 H H    . VAL A 1 76 ? -5.742  1.727   -3.412  1.00 0.00 ? 113 VAL A H    8  
ATOM 11416 H HA   . VAL A 1 76 ? -7.782  0.073   -2.079  1.00 0.00 ? 113 VAL A HA   8  
ATOM 11417 H HB   . VAL A 1 76 ? -5.727  -1.206  -2.088  1.00 0.00 ? 113 VAL A HB   8  
ATOM 11418 H HG11 . VAL A 1 76 ? -4.509  1.332   -1.790  1.00 0.00 ? 113 VAL A HG11 8  
ATOM 11419 H HG12 . VAL A 1 76 ? -4.023  0.319   -0.428  1.00 0.00 ? 113 VAL A HG12 8  
ATOM 11420 H HG13 . VAL A 1 76 ? -3.746  -0.236  -2.083  1.00 0.00 ? 113 VAL A HG13 8  
ATOM 11421 H HG21 . VAL A 1 76 ? -7.149  -1.177  -0.023  1.00 0.00 ? 113 VAL A HG21 8  
ATOM 11422 H HG22 . VAL A 1 76 ? -5.466  -1.630  0.242   1.00 0.00 ? 113 VAL A HG22 8  
ATOM 11423 H HG23 . VAL A 1 76 ? -6.018  -0.010  0.664   1.00 0.00 ? 113 VAL A HG23 8  
ATOM 11424 N N    . LYS A 1 77 ? -8.023  1.646   -0.138  1.00 0.00 ? 114 LYS A N    8  
ATOM 11425 C CA   . LYS A 1 77 ? -8.289  2.658   0.872   1.00 0.00 ? 114 LYS A CA   8  
ATOM 11426 C C    . LYS A 1 77 ? -8.101  2.055   2.252   1.00 0.00 ? 114 LYS A C    8  
ATOM 11427 O O    . LYS A 1 77 ? -8.356  0.863   2.442   1.00 0.00 ? 114 LYS A O    8  
ATOM 11428 C CB   . LYS A 1 77 ? -9.709  3.232   0.718   1.00 0.00 ? 114 LYS A CB   8  
ATOM 11429 C CG   . LYS A 1 77 ? -10.827 2.188   0.663   1.00 0.00 ? 114 LYS A CG   8  
ATOM 11430 C CD   . LYS A 1 77 ? -11.296 1.757   2.051   1.00 0.00 ? 114 LYS A CD   8  
ATOM 11431 C CE   . LYS A 1 77 ? -11.962 2.898   2.801   1.00 0.00 ? 114 LYS A CE   8  
ATOM 11432 N NZ   . LYS A 1 77 ? -12.369 2.498   4.175   1.00 0.00 ? 114 LYS A NZ   8  
ATOM 11433 H H    . LYS A 1 77 ? -8.534  0.805   -0.112  1.00 0.00 ? 114 LYS A H    8  
ATOM 11434 H HA   . LYS A 1 77 ? -7.570  3.454   0.741   1.00 0.00 ? 114 LYS A HA   8  
ATOM 11435 H HB2  . LYS A 1 77 ? -9.904  3.882   1.554   1.00 0.00 ? 114 LYS A HB2  8  
ATOM 11436 H HB3  . LYS A 1 77 ? -9.753  3.812   -0.188  1.00 0.00 ? 114 LYS A HB3  8  
ATOM 11437 H HG2  . LYS A 1 77 ? -11.669 2.606   0.131   1.00 0.00 ? 114 LYS A HG2  8  
ATOM 11438 H HG3  . LYS A 1 77 ? -10.464 1.319   0.133   1.00 0.00 ? 114 LYS A HG3  8  
ATOM 11439 H HD2  . LYS A 1 77 ? -12.003 0.949   1.945   1.00 0.00 ? 114 LYS A HD2  8  
ATOM 11440 H HD3  . LYS A 1 77 ? -10.441 1.415   2.618   1.00 0.00 ? 114 LYS A HD3  8  
ATOM 11441 H HE2  . LYS A 1 77 ? -11.271 3.725   2.864   1.00 0.00 ? 114 LYS A HE2  8  
ATOM 11442 H HE3  . LYS A 1 77 ? -12.839 3.205   2.252   1.00 0.00 ? 114 LYS A HE3  8  
ATOM 11443 H HZ1  . LYS A 1 77 ? -12.728 1.518   4.177   1.00 0.00 ? 114 LYS A HZ1  8  
ATOM 11444 H HZ2  . LYS A 1 77 ? -11.554 2.554   4.821   1.00 0.00 ? 114 LYS A HZ2  8  
ATOM 11445 H HZ3  . LYS A 1 77 ? -13.119 3.133   4.526   1.00 0.00 ? 114 LYS A HZ3  8  
ATOM 11446 N N    . LEU A 1 78 ? -7.570  2.832   3.186   1.00 0.00 ? 115 LEU A N    8  
ATOM 11447 C CA   . LEU A 1 78 ? -7.346  2.318   4.529   1.00 0.00 ? 115 LEU A CA   8  
ATOM 11448 C C    . LEU A 1 78 ? -8.645  1.831   5.137   1.00 0.00 ? 115 LEU A C    8  
ATOM 11449 O O    . LEU A 1 78 ? -9.669  2.520   5.085   1.00 0.00 ? 115 LEU A O    8  
ATOM 11450 C CB   . LEU A 1 78 ? -6.723  3.366   5.440   1.00 0.00 ? 115 LEU A CB   8  
ATOM 11451 C CG   . LEU A 1 78 ? -5.227  3.557   5.269   1.00 0.00 ? 115 LEU A CG   8  
ATOM 11452 C CD1  . LEU A 1 78 ? -4.667  4.332   6.440   1.00 0.00 ? 115 LEU A CD1  8  
ATOM 11453 C CD2  . LEU A 1 78 ? -4.529  2.214   5.120   1.00 0.00 ? 115 LEU A CD2  8  
ATOM 11454 H H    . LEU A 1 78 ? -7.277  3.749   2.957   1.00 0.00 ? 115 LEU A H    8  
ATOM 11455 H HA   . LEU A 1 78 ? -6.669  1.479   4.444   1.00 0.00 ? 115 LEU A HA   8  
ATOM 11456 H HB2  . LEU A 1 78 ? -7.208  4.314   5.248   1.00 0.00 ? 115 LEU A HB2  8  
ATOM 11457 H HB3  . LEU A 1 78 ? -6.913  3.088   6.464   1.00 0.00 ? 115 LEU A HB3  8  
ATOM 11458 H HG   . LEU A 1 78 ? -5.045  4.130   4.369   1.00 0.00 ? 115 LEU A HG   8  
ATOM 11459 H HD11 . LEU A 1 78 ? -5.204  5.264   6.538   1.00 0.00 ? 115 LEU A HD11 8  
ATOM 11460 H HD12 . LEU A 1 78 ? -4.785  3.750   7.342   1.00 0.00 ? 115 LEU A HD12 8  
ATOM 11461 H HD13 . LEU A 1 78 ? -3.621  4.532   6.270   1.00 0.00 ? 115 LEU A HD13 8  
ATOM 11462 H HD21 . LEU A 1 78 ? -5.206  1.424   5.410   1.00 0.00 ? 115 LEU A HD21 8  
ATOM 11463 H HD22 . LEU A 1 78 ? -4.237  2.076   4.087   1.00 0.00 ? 115 LEU A HD22 8  
ATOM 11464 H HD23 . LEU A 1 78 ? -3.652  2.193   5.749   1.00 0.00 ? 115 LEU A HD23 8  
ATOM 11465 N N    . ALA A 1 79 ? -8.618  0.618   5.652   1.00 0.00 ? 116 ALA A N    8  
ATOM 11466 C CA   . ALA A 1 79 ? -9.816  0.022   6.200   1.00 0.00 ? 116 ALA A CA   8  
ATOM 11467 C C    . ALA A 1 79 ? -9.840  0.071   7.713   1.00 0.00 ? 116 ALA A C    8  
ATOM 11468 O O    . ALA A 1 79 ? -9.063  -0.602  8.390   1.00 0.00 ? 116 ALA A O    8  
ATOM 11469 C CB   . ALA A 1 79 ? -9.978  -1.407  5.728   1.00 0.00 ? 116 ALA A CB   8  
ATOM 11470 H H    . ALA A 1 79 ? -7.780  0.101   5.630   1.00 0.00 ? 116 ALA A H    8  
ATOM 11471 H HA   . ALA A 1 79 ? -10.658 0.587   5.826   1.00 0.00 ? 116 ALA A HA   8  
ATOM 11472 H HB1  . ALA A 1 79 ? -10.102 -1.423  4.655   1.00 0.00 ? 116 ALA A HB1  8  
ATOM 11473 H HB2  . ALA A 1 79 ? -9.103  -1.979  6.000   1.00 0.00 ? 116 ALA A HB2  8  
ATOM 11474 H HB3  . ALA A 1 79 ? -10.849 -1.838  6.200   1.00 0.00 ? 116 ALA A HB3  8  
ATOM 11475 N N    . LYS A 1 80 ? -10.874 0.706   8.208   1.00 0.00 ? 117 LYS A N    8  
ATOM 11476 C CA   . LYS A 1 80 ? -11.222 0.681   9.615   1.00 0.00 ? 117 LYS A CA   8  
ATOM 11477 C C    . LYS A 1 80 ? -12.726 0.510   9.695   1.00 0.00 ? 117 LYS A C    8  
ATOM 11478 O O    . LYS A 1 80 ? -13.415 1.111   10.523  1.00 0.00 ? 117 LYS A O    8  
ATOM 11479 C CB   . LYS A 1 80 ? -10.758 1.956   10.323  1.00 0.00 ? 117 LYS A CB   8  
ATOM 11480 C CG   . LYS A 1 80 ? -9.249  2.023   10.495  1.00 0.00 ? 117 LYS A CG   8  
ATOM 11481 C CD   . LYS A 1 80 ? -8.811  3.305   11.173  1.00 0.00 ? 117 LYS A CD   8  
ATOM 11482 C CE   . LYS A 1 80 ? -7.313  3.318   11.422  1.00 0.00 ? 117 LYS A CE   8  
ATOM 11483 N NZ   . LYS A 1 80 ? -6.535  3.187   10.160  1.00 0.00 ? 117 LYS A NZ   8  
ATOM 11484 H H    . LYS A 1 80 ? -11.513 1.107   7.580   1.00 0.00 ? 117 LYS A H    8  
ATOM 11485 H HA   . LYS A 1 80 ? -10.745 -0.179  10.065  1.00 0.00 ? 117 LYS A HA   8  
ATOM 11486 H HB2  . LYS A 1 80 ? -11.072 2.811   9.746   1.00 0.00 ? 117 LYS A HB2  8  
ATOM 11487 H HB3  . LYS A 1 80 ? -11.215 2.002   11.301  1.00 0.00 ? 117 LYS A HB3  8  
ATOM 11488 H HG2  . LYS A 1 80 ? -8.927  1.186   11.096  1.00 0.00 ? 117 LYS A HG2  8  
ATOM 11489 H HG3  . LYS A 1 80 ? -8.783  1.966   9.522   1.00 0.00 ? 117 LYS A HG3  8  
ATOM 11490 H HD2  . LYS A 1 80 ? -9.069  4.142   10.539  1.00 0.00 ? 117 LYS A HD2  8  
ATOM 11491 H HD3  . LYS A 1 80 ? -9.326  3.395   12.118  1.00 0.00 ? 117 LYS A HD3  8  
ATOM 11492 H HE2  . LYS A 1 80 ? -7.050  4.249   11.902  1.00 0.00 ? 117 LYS A HE2  8  
ATOM 11493 H HE3  . LYS A 1 80 ? -7.062  2.495   12.076  1.00 0.00 ? 117 LYS A HE3  8  
ATOM 11494 H HZ1  . LYS A 1 80 ? -7.017  3.701   9.389   1.00 0.00 ? 117 LYS A HZ1  8  
ATOM 11495 H HZ2  . LYS A 1 80 ? -5.580  3.591   10.282  1.00 0.00 ? 117 LYS A HZ2  8  
ATOM 11496 H HZ3  . LYS A 1 80 ? -6.447  2.181   9.889   1.00 0.00 ? 117 LYS A HZ3  8  
ATOM 11497 N N    . LYS A 1 81 ? -13.213 -0.292  8.757   1.00 0.00 ? 118 LYS A N    8  
ATOM 11498 C CA   . LYS A 1 81 ? -14.622 -0.569  8.588   1.00 0.00 ? 118 LYS A CA   8  
ATOM 11499 C C    . LYS A 1 81 ? -14.754 -1.821  7.734   1.00 0.00 ? 118 LYS A C    8  
ATOM 11500 O O    . LYS A 1 81 ? -14.224 -1.866  6.621   1.00 0.00 ? 118 LYS A O    8  
ATOM 11501 C CB   . LYS A 1 81 ? -15.308 0.615   7.895   1.00 0.00 ? 118 LYS A CB   8  
ATOM 11502 C CG   . LYS A 1 81 ? -16.809 0.467   7.727   1.00 0.00 ? 118 LYS A CG   8  
ATOM 11503 C CD   . LYS A 1 81 ? -17.524 0.457   9.065   1.00 0.00 ? 118 LYS A CD   8  
ATOM 11504 C CE   . LYS A 1 81 ? -19.031 0.426   8.884   1.00 0.00 ? 118 LYS A CE   8  
ATOM 11505 N NZ   . LYS A 1 81 ? -19.544 1.675   8.256   1.00 0.00 ? 118 LYS A NZ   8  
ATOM 11506 H H    . LYS A 1 81 ? -12.584 -0.700  8.128   1.00 0.00 ? 118 LYS A H    8  
ATOM 11507 H HA   . LYS A 1 81 ? -15.066 -0.739  9.558   1.00 0.00 ? 118 LYS A HA   8  
ATOM 11508 H HB2  . LYS A 1 81 ? -15.122 1.507   8.473   1.00 0.00 ? 118 LYS A HB2  8  
ATOM 11509 H HB3  . LYS A 1 81 ? -14.872 0.738   6.915   1.00 0.00 ? 118 LYS A HB3  8  
ATOM 11510 H HG2  . LYS A 1 81 ? -17.178 1.297   7.142   1.00 0.00 ? 118 LYS A HG2  8  
ATOM 11511 H HG3  . LYS A 1 81 ? -17.014 -0.460  7.211   1.00 0.00 ? 118 LYS A HG3  8  
ATOM 11512 H HD2  . LYS A 1 81 ? -17.218 -0.417  9.621   1.00 0.00 ? 118 LYS A HD2  8  
ATOM 11513 H HD3  . LYS A 1 81 ? -17.254 1.348   9.611   1.00 0.00 ? 118 LYS A HD3  8  
ATOM 11514 H HE2  . LYS A 1 81 ? -19.288 -0.413  8.255   1.00 0.00 ? 118 LYS A HE2  8  
ATOM 11515 H HE3  . LYS A 1 81 ? -19.495 0.304   9.852   1.00 0.00 ? 118 LYS A HE3  8  
ATOM 11516 H HZ1  . LYS A 1 81 ? -18.828 2.087   7.616   1.00 0.00 ? 118 LYS A HZ1  8  
ATOM 11517 H HZ2  . LYS A 1 81 ? -20.407 1.477   7.707   1.00 0.00 ? 118 LYS A HZ2  8  
ATOM 11518 H HZ3  . LYS A 1 81 ? -19.774 2.374   8.993   1.00 0.00 ? 118 LYS A HZ3  8  
ATOM 11519 N N    . LYS A 1 82 ? -15.350 -2.860  8.300   1.00 0.00 ? 119 LYS A N    8  
ATOM 11520 C CA   . LYS A 1 82 ? -15.452 -4.153  7.622   1.00 0.00 ? 119 LYS A CA   8  
ATOM 11521 C C    . LYS A 1 82 ? -16.321 -4.043  6.389   1.00 0.00 ? 119 LYS A C    8  
ATOM 11522 O O    . LYS A 1 82 ? -15.891 -4.350  5.276   1.00 0.00 ? 119 LYS A O    8  
ATOM 11523 C CB   . LYS A 1 82 ? -16.040 -5.213  8.555   1.00 0.00 ? 119 LYS A CB   8  
ATOM 11524 C CG   . LYS A 1 82 ? -15.055 -5.766  9.577   1.00 0.00 ? 119 LYS A CG   8  
ATOM 11525 C CD   . LYS A 1 82 ? -14.576 -4.694  10.543  1.00 0.00 ? 119 LYS A CD   8  
ATOM 11526 C CE   . LYS A 1 82 ? -13.576 -5.245  11.542  1.00 0.00 ? 119 LYS A CE   8  
ATOM 11527 N NZ   . LYS A 1 82 ? -14.174 -6.279  12.425  1.00 0.00 ? 119 LYS A NZ   8  
ATOM 11528 H H    . LYS A 1 82 ? -15.684 -2.772  9.225   1.00 0.00 ? 119 LYS A H    8  
ATOM 11529 H HA   . LYS A 1 82 ? -14.459 -4.456  7.325   1.00 0.00 ? 119 LYS A HA   8  
ATOM 11530 H HB2  . LYS A 1 82 ? -16.876 -4.777  9.086   1.00 0.00 ? 119 LYS A HB2  8  
ATOM 11531 H HB3  . LYS A 1 82 ? -16.403 -6.034  7.955   1.00 0.00 ? 119 LYS A HB3  8  
ATOM 11532 H HG2  . LYS A 1 82 ? -15.535 -6.551  10.138  1.00 0.00 ? 119 LYS A HG2  8  
ATOM 11533 H HG3  . LYS A 1 82 ? -14.201 -6.168  9.052   1.00 0.00 ? 119 LYS A HG3  8  
ATOM 11534 H HD2  . LYS A 1 82 ? -14.105 -3.902  9.980   1.00 0.00 ? 119 LYS A HD2  8  
ATOM 11535 H HD3  . LYS A 1 82 ? -15.428 -4.300  11.078  1.00 0.00 ? 119 LYS A HD3  8  
ATOM 11536 H HE2  . LYS A 1 82 ? -12.752 -5.682  11.001  1.00 0.00 ? 119 LYS A HE2  8  
ATOM 11537 H HE3  . LYS A 1 82 ? -13.212 -4.431  12.152  1.00 0.00 ? 119 LYS A HE3  8  
ATOM 11538 H HZ1  . LYS A 1 82 ? -15.115 -5.973  12.755  1.00 0.00 ? 119 LYS A HZ1  8  
ATOM 11539 H HZ2  . LYS A 1 82 ? -14.275 -7.180  11.905  1.00 0.00 ? 119 LYS A HZ2  8  
ATOM 11540 H HZ3  . LYS A 1 82 ? -13.559 -6.436  13.253  1.00 0.00 ? 119 LYS A HZ3  8  
ATOM 11541 N N    . SER A 1 83 ? -17.531 -3.563  6.601   1.00 0.00 ? 120 SER A N    8  
ATOM 11542 C CA   . SER A 1 83 ? -18.466 -3.338  5.523   1.00 0.00 ? 120 SER A CA   8  
ATOM 11543 C C    . SER A 1 83 ? -17.927 -2.274  4.573   1.00 0.00 ? 120 SER A C    8  
ATOM 11544 O O    . SER A 1 83 ? -17.484 -1.211  5.014   1.00 0.00 ? 120 SER A O    8  
ATOM 11545 C CB   . SER A 1 83 ? -19.796 -2.891  6.114   1.00 0.00 ? 120 SER A CB   8  
ATOM 11546 O OG   . SER A 1 83 ? -20.379 -3.920  6.899   1.00 0.00 ? 120 SER A OG   8  
ATOM 11547 H H    . SER A 1 83 ? -17.794 -3.322  7.517   1.00 0.00 ? 120 SER A H    8  
ATOM 11548 H HA   . SER A 1 83 ? -18.601 -4.265  4.988   1.00 0.00 ? 120 SER A HA   8  
ATOM 11549 H HB2  . SER A 1 83 ? -19.626 -2.034  6.748   1.00 0.00 ? 120 SER A HB2  8  
ATOM 11550 H HB3  . SER A 1 83 ? -20.476 -2.627  5.317   1.00 0.00 ? 120 SER A HB3  8  
ATOM 11551 H HG   . SER A 1 83 ? -19.862 -4.737  6.795   1.00 0.00 ? 120 SER A HG   8  
ATOM 11552 N N    . PRO A 1 84 ? -17.951 -2.541  3.257   1.00 0.00 ? 121 PRO A N    8  
ATOM 11553 C CA   . PRO A 1 84 ? -17.477 -1.584  2.266   1.00 0.00 ? 121 PRO A CA   8  
ATOM 11554 C C    . PRO A 1 84 ? -18.278 -0.296  2.321   1.00 0.00 ? 121 PRO A C    8  
ATOM 11555 O O    . PRO A 1 84 ? -19.494 -0.308  2.539   1.00 0.00 ? 121 PRO A O    8  
ATOM 11556 C CB   . PRO A 1 84 ? -17.680 -2.284  0.924   1.00 0.00 ? 121 PRO A CB   8  
ATOM 11557 C CG   . PRO A 1 84 ? -17.891 -3.725  1.249   1.00 0.00 ? 121 PRO A CG   8  
ATOM 11558 C CD   . PRO A 1 84 ? -18.463 -3.773  2.637   1.00 0.00 ? 121 PRO A CD   8  
ATOM 11559 H HA   . PRO A 1 84 ? -16.429 -1.359  2.406   1.00 0.00 ? 121 PRO A HA   8  
ATOM 11560 H HB2  . PRO A 1 84 ? -18.537 -1.853  0.431   1.00 0.00 ? 121 PRO A HB2  8  
ATOM 11561 H HB3  . PRO A 1 84 ? -16.802 -2.142  0.310   1.00 0.00 ? 121 PRO A HB3  8  
ATOM 11562 H HG2  . PRO A 1 84 ? -18.586 -4.160  0.545   1.00 0.00 ? 121 PRO A HG2  8  
ATOM 11563 H HG3  . PRO A 1 84 ? -16.947 -4.251  1.215   1.00 0.00 ? 121 PRO A HG3  8  
ATOM 11564 H HD2  . PRO A 1 84 ? -19.541 -3.766  2.604   1.00 0.00 ? 121 PRO A HD2  8  
ATOM 11565 H HD3  . PRO A 1 84 ? -18.105 -4.646  3.163   1.00 0.00 ? 121 PRO A HD3  8  
ATOM 11566 N N    . GLU A 1 85 ? -17.579 0.812   2.212   1.00 0.00 ? 122 GLU A N    8  
ATOM 11567 C CA   . GLU A 1 85 ? -18.200 2.112   2.358   1.00 0.00 ? 122 GLU A CA   8  
ATOM 11568 C C    . GLU A 1 85 ? -17.495 3.130   1.472   1.00 0.00 ? 122 GLU A C    8  
ATOM 11569 O O    . GLU A 1 85 ? -17.365 4.307   1.812   1.00 0.00 ? 122 GLU A O    8  
ATOM 11570 C CB   . GLU A 1 85 ? -18.161 2.536   3.829   1.00 0.00 ? 122 GLU A CB   8  
ATOM 11571 C CG   . GLU A 1 85 ? -19.118 3.661   4.177   1.00 0.00 ? 122 GLU A CG   8  
ATOM 11572 C CD   . GLU A 1 85 ? -19.174 3.940   5.663   1.00 0.00 ? 122 GLU A CD   8  
ATOM 11573 O OE1  . GLU A 1 85 ? -18.461 3.263   6.434   1.00 0.00 ? 122 GLU A OE1  8  
ATOM 11574 O OE2  . GLU A 1 85 ? -19.954 4.828   6.073   1.00 0.00 ? 122 GLU A OE2  8  
ATOM 11575 H H    . GLU A 1 85 ? -16.613 0.751   2.089   1.00 0.00 ? 122 GLU A H    8  
ATOM 11576 H HA   . GLU A 1 85 ? -19.228 2.028   2.042   1.00 0.00 ? 122 GLU A HA   8  
ATOM 11577 H HB2  . GLU A 1 85 ? -18.411 1.683   4.440   1.00 0.00 ? 122 GLU A HB2  8  
ATOM 11578 H HB3  . GLU A 1 85 ? -17.157 2.858   4.073   1.00 0.00 ? 122 GLU A HB3  8  
ATOM 11579 H HG2  . GLU A 1 85 ? -18.797 4.557   3.669   1.00 0.00 ? 122 GLU A HG2  8  
ATOM 11580 H HG3  . GLU A 1 85 ? -20.108 3.391   3.837   1.00 0.00 ? 122 GLU A HG3  8  
ATOM 11581 N N    . VAL A 1 86 ? -17.168 2.695   0.267   1.00 0.00 ? 123 VAL A N    8  
ATOM 11582 C CA   . VAL A 1 86 ? -16.616 3.585   -0.740  1.00 0.00 ? 123 VAL A CA   8  
ATOM 11583 C C    . VAL A 1 86 ? -17.750 4.079   -1.629  1.00 0.00 ? 123 VAL A C    8  
ATOM 11584 O O    . VAL A 1 86 ? -17.761 3.874   -2.844  1.00 0.00 ? 123 VAL A O    8  
ATOM 11585 C CB   . VAL A 1 86 ? -15.527 2.897   -1.590  1.00 0.00 ? 123 VAL A CB   8  
ATOM 11586 C CG1  . VAL A 1 86 ? -14.716 3.930   -2.363  1.00 0.00 ? 123 VAL A CG1  8  
ATOM 11587 C CG2  . VAL A 1 86 ? -14.617 2.043   -0.717  1.00 0.00 ? 123 VAL A CG2  8  
ATOM 11588 H H    . VAL A 1 86 ? -17.427 1.782   0.007   1.00 0.00 ? 123 VAL A H    8  
ATOM 11589 H HA   . VAL A 1 86 ? -16.179 4.431   -0.232  1.00 0.00 ? 123 VAL A HA   8  
ATOM 11590 H HB   . VAL A 1 86 ? -16.014 2.249   -2.303  1.00 0.00 ? 123 VAL A HB   8  
ATOM 11591 H HG11 . VAL A 1 86 ? -15.322 4.808   -2.531  1.00 0.00 ? 123 VAL A HG11 8  
ATOM 11592 H HG12 . VAL A 1 86 ? -13.839 4.199   -1.793  1.00 0.00 ? 123 VAL A HG12 8  
ATOM 11593 H HG13 . VAL A 1 86 ? -14.413 3.514   -3.312  1.00 0.00 ? 123 VAL A HG13 8  
ATOM 11594 H HG21 . VAL A 1 86 ? -14.805 2.259   0.324   1.00 0.00 ? 123 VAL A HG21 8  
ATOM 11595 H HG22 . VAL A 1 86 ? -14.813 0.998   -0.908  1.00 0.00 ? 123 VAL A HG22 8  
ATOM 11596 H HG23 . VAL A 1 86 ? -13.585 2.262   -0.951  1.00 0.00 ? 123 VAL A HG23 8  
ATOM 11597 N N    . LYS A 1 87 ? -18.776 4.576   -0.969  1.00 0.00 ? 124 LYS A N    8  
ATOM 11598 C CA   . LYS A 1 87 ? -19.998 4.999   -1.628  1.00 0.00 ? 124 LYS A CA   8  
ATOM 11599 C C    . LYS A 1 87 ? -20.214 6.489   -1.403  1.00 0.00 ? 124 LYS A C    8  
ATOM 11600 O O    . LYS A 1 87 ? -20.643 7.210   -2.303  1.00 0.00 ? 124 LYS A O    8  
ATOM 11601 C CB   . LYS A 1 87 ? -21.179 4.190   -1.089  1.00 0.00 ? 124 LYS A CB   8  
ATOM 11602 C CG   . LYS A 1 87 ? -22.516 4.535   -1.720  1.00 0.00 ? 124 LYS A CG   8  
ATOM 11603 C CD   . LYS A 1 87 ? -23.625 3.596   -1.256  1.00 0.00 ? 124 LYS A CD   8  
ATOM 11604 C CE   . LYS A 1 87 ? -23.908 3.719   0.238   1.00 0.00 ? 124 LYS A CE   8  
ATOM 11605 N NZ   . LYS A 1 87 ? -22.921 2.984   1.077   1.00 0.00 ? 124 LYS A NZ   8  
ATOM 11606 H H    . LYS A 1 87 ? -18.731 4.601   0.008   1.00 0.00 ? 124 LYS A H    8  
ATOM 11607 H HA   . LYS A 1 87 ? -19.892 4.813   -2.686  1.00 0.00 ? 124 LYS A HA   8  
ATOM 11608 H HB2  . LYS A 1 87 ? -20.987 3.141   -1.262  1.00 0.00 ? 124 LYS A HB2  8  
ATOM 11609 H HB3  . LYS A 1 87 ? -21.255 4.360   -0.025  1.00 0.00 ? 124 LYS A HB3  8  
ATOM 11610 H HG2  . LYS A 1 87 ? -22.779 5.545   -1.445  1.00 0.00 ? 124 LYS A HG2  8  
ATOM 11611 H HG3  . LYS A 1 87 ? -22.423 4.466   -2.795  1.00 0.00 ? 124 LYS A HG3  8  
ATOM 11612 H HD2  . LYS A 1 87 ? -24.528 3.829   -1.799  1.00 0.00 ? 124 LYS A HD2  8  
ATOM 11613 H HD3  . LYS A 1 87 ? -23.330 2.577   -1.474  1.00 0.00 ? 124 LYS A HD3  8  
ATOM 11614 H HE2  . LYS A 1 87 ? -23.881 4.763   0.509   1.00 0.00 ? 124 LYS A HE2  8  
ATOM 11615 H HE3  . LYS A 1 87 ? -24.894 3.325   0.435   1.00 0.00 ? 124 LYS A HE3  8  
ATOM 11616 H HZ1  . LYS A 1 87 ? -22.243 2.467   0.478   1.00 0.00 ? 124 LYS A HZ1  8  
ATOM 11617 H HZ2  . LYS A 1 87 ? -22.394 3.652   1.680   1.00 0.00 ? 124 LYS A HZ2  8  
ATOM 11618 H HZ3  . LYS A 1 87 ? -23.411 2.297   1.692   1.00 0.00 ? 124 LYS A HZ3  8  
ATOM 11619 N N    . LYS A 1 88 ? -19.809 6.954   -0.226  1.00 0.00 ? 125 LYS A N    8  
ATOM 11620 C CA   . LYS A 1 88 ? -19.811 8.376   0.075   1.00 0.00 ? 125 LYS A CA   8  
ATOM 11621 C C    . LYS A 1 88 ? -18.712 9.060   -0.727  1.00 0.00 ? 125 LYS A C    8  
ATOM 11622 O O    . LYS A 1 88 ? -17.646 8.474   -0.933  1.00 0.00 ? 125 LYS A O    8  
ATOM 11623 C CB   . LYS A 1 88 ? -19.598 8.604   1.576   1.00 0.00 ? 125 LYS A CB   8  
ATOM 11624 C CG   . LYS A 1 88 ? -19.511 10.073  1.965   1.00 0.00 ? 125 LYS A CG   8  
ATOM 11625 C CD   . LYS A 1 88 ? -19.225 10.250  3.449   1.00 0.00 ? 125 LYS A CD   8  
ATOM 11626 C CE   . LYS A 1 88 ? -20.490 10.200  4.294   1.00 0.00 ? 125 LYS A CE   8  
ATOM 11627 N NZ   . LYS A 1 88 ? -21.122 8.854   4.301   1.00 0.00 ? 125 LYS A NZ   8  
ATOM 11628 H H    . LYS A 1 88 ? -19.397 6.338   0.411   1.00 0.00 ? 125 LYS A H    8  
ATOM 11629 H HA   . LYS A 1 88 ? -20.769 8.781   -0.218  1.00 0.00 ? 125 LYS A HA   8  
ATOM 11630 H HB2  . LYS A 1 88 ? -20.421 8.160   2.118   1.00 0.00 ? 125 LYS A HB2  8  
ATOM 11631 H HB3  . LYS A 1 88 ? -18.682 8.120   1.874   1.00 0.00 ? 125 LYS A HB3  8  
ATOM 11632 H HG2  . LYS A 1 88 ? -18.716 10.537  1.401   1.00 0.00 ? 125 LYS A HG2  8  
ATOM 11633 H HG3  . LYS A 1 88 ? -20.449 10.552  1.729   1.00 0.00 ? 125 LYS A HG3  8  
ATOM 11634 H HD2  . LYS A 1 88 ? -18.564 9.460   3.771   1.00 0.00 ? 125 LYS A HD2  8  
ATOM 11635 H HD3  . LYS A 1 88 ? -18.743 11.206  3.598   1.00 0.00 ? 125 LYS A HD3  8  
ATOM 11636 H HE2  . LYS A 1 88 ? -20.238 10.470  5.307   1.00 0.00 ? 125 LYS A HE2  8  
ATOM 11637 H HE3  . LYS A 1 88 ? -21.197 10.916  3.899   1.00 0.00 ? 125 LYS A HE3  8  
ATOM 11638 H HZ1  . LYS A 1 88 ? -20.388 8.110   4.321   1.00 0.00 ? 125 LYS A HZ1  8  
ATOM 11639 H HZ2  . LYS A 1 88 ? -21.728 8.750   5.142   1.00 0.00 ? 125 LYS A HZ2  8  
ATOM 11640 H HZ3  . LYS A 1 88 ? -21.709 8.729   3.449   1.00 0.00 ? 125 LYS A HZ3  8  
ATOM 11641 N N    . GLU A 1 89 ? -19.005 10.258  -1.231  1.00 0.00 ? 126 GLU A N    8  
ATOM 11642 C CA   . GLU A 1 89 ? -18.081 10.997  -2.088  1.00 0.00 ? 126 GLU A CA   8  
ATOM 11643 C C    . GLU A 1 89 ? -17.910 10.270  -3.415  1.00 0.00 ? 126 GLU A C    8  
ATOM 11644 O O    . GLU A 1 89 ? -16.787 9.960   -3.826  1.00 0.00 ? 126 GLU A O    8  
ATOM 11645 C CB   . GLU A 1 89 ? -16.721 11.182  -1.412  1.00 0.00 ? 126 GLU A CB   8  
ATOM 11646 C CG   . GLU A 1 89 ? -16.783 11.886  -0.069  1.00 0.00 ? 126 GLU A CG   8  
ATOM 11647 C CD   . GLU A 1 89 ? -15.461 11.822  0.665   1.00 0.00 ? 126 GLU A CD   8  
ATOM 11648 O OE1  . GLU A 1 89 ? -14.506 11.217  0.130   1.00 0.00 ? 126 GLU A OE1  8  
ATOM 11649 O OE2  . GLU A 1 89 ? -15.369 12.372  1.783   1.00 0.00 ? 126 GLU A OE2  8  
ATOM 11650 H H    . GLU A 1 89 ? -19.891 10.638  -1.060  1.00 0.00 ? 126 GLU A H    8  
ATOM 11651 H HA   . GLU A 1 89 ? -18.514 11.967  -2.278  1.00 0.00 ? 126 GLU A HA   8  
ATOM 11652 H HB2  . GLU A 1 89 ? -16.274 10.209  -1.260  1.00 0.00 ? 126 GLU A HB2  8  
ATOM 11653 H HB3  . GLU A 1 89 ? -16.086 11.759  -2.067  1.00 0.00 ? 126 GLU A HB3  8  
ATOM 11654 H HG2  . GLU A 1 89 ? -17.039 12.923  -0.230  1.00 0.00 ? 126 GLU A HG2  8  
ATOM 11655 H HG3  . GLU A 1 89 ? -17.541 11.417  0.540   1.00 0.00 ? 126 GLU A HG3  8  
ATOM 11656 N N    . LYS A 1 90 ? -19.048 9.957   -4.040  1.00 0.00 ? 127 LYS A N    8  
ATOM 11657 C CA   . LYS A 1 90 ? -19.098 9.218   -5.304  1.00 0.00 ? 127 LYS A CA   8  
ATOM 11658 C C    . LYS A 1 90 ? -18.772 7.738   -5.097  1.00 0.00 ? 127 LYS A C    8  
ATOM 11659 O O    . LYS A 1 90 ? -17.807 7.380   -4.421  1.00 0.00 ? 127 LYS A O    8  
ATOM 11660 C CB   . LYS A 1 90 ? -18.160 9.833   -6.349  1.00 0.00 ? 127 LYS A CB   8  
ATOM 11661 C CG   . LYS A 1 90 ? -18.524 11.262  -6.719  1.00 0.00 ? 127 LYS A CG   8  
ATOM 11662 C CD   . LYS A 1 90 ? -17.497 11.870  -7.658  1.00 0.00 ? 127 LYS A CD   8  
ATOM 11663 C CE   . LYS A 1 90 ? -17.858 13.296  -8.033  1.00 0.00 ? 127 LYS A CE   8  
ATOM 11664 N NZ   . LYS A 1 90 ? -17.899 14.198  -6.851  1.00 0.00 ? 127 LYS A NZ   8  
ATOM 11665 H H    . LYS A 1 90 ? -19.897 10.203  -3.610  1.00 0.00 ? 127 LYS A H    8  
ATOM 11666 H HA   . LYS A 1 90 ? -20.112 9.289   -5.673  1.00 0.00 ? 127 LYS A HA   8  
ATOM 11667 H HB2  . LYS A 1 90 ? -17.152 9.827   -5.960  1.00 0.00 ? 127 LYS A HB2  8  
ATOM 11668 H HB3  . LYS A 1 90 ? -18.193 9.231   -7.246  1.00 0.00 ? 127 LYS A HB3  8  
ATOM 11669 H HG2  . LYS A 1 90 ? -19.487 11.263  -7.207  1.00 0.00 ? 127 LYS A HG2  8  
ATOM 11670 H HG3  . LYS A 1 90 ? -18.573 11.856  -5.818  1.00 0.00 ? 127 LYS A HG3  8  
ATOM 11671 H HD2  . LYS A 1 90 ? -16.534 11.873  -7.170  1.00 0.00 ? 127 LYS A HD2  8  
ATOM 11672 H HD3  . LYS A 1 90 ? -17.447 11.272  -8.555  1.00 0.00 ? 127 LYS A HD3  8  
ATOM 11673 H HE2  . LYS A 1 90 ? -17.121 13.666  -8.728  1.00 0.00 ? 127 LYS A HE2  8  
ATOM 11674 H HE3  . LYS A 1 90 ? -18.830 13.294  -8.507  1.00 0.00 ? 127 LYS A HE3  8  
ATOM 11675 H HZ1  . LYS A 1 90 ? -18.507 13.795  -6.106  1.00 0.00 ? 127 LYS A HZ1  8  
ATOM 11676 H HZ2  . LYS A 1 90 ? -16.939 14.330  -6.462  1.00 0.00 ? 127 LYS A HZ2  8  
ATOM 11677 H HZ3  . LYS A 1 90 ? -18.282 15.128  -7.128  1.00 0.00 ? 127 LYS A HZ3  8  
ATOM 11678 N N    . GLU A 1 91 ? -19.606 6.887   -5.675  1.00 0.00 ? 128 GLU A N    8  
ATOM 11679 C CA   . GLU A 1 91 ? -19.453 5.442   -5.555  1.00 0.00 ? 128 GLU A CA   8  
ATOM 11680 C C    . GLU A 1 91 ? -18.267 4.947   -6.372  1.00 0.00 ? 128 GLU A C    8  
ATOM 11681 O O    . GLU A 1 91 ? -17.768 5.655   -7.248  1.00 0.00 ? 128 GLU A O    8  
ATOM 11682 C CB   . GLU A 1 91 ? -20.723 4.738   -6.036  1.00 0.00 ? 128 GLU A CB   8  
ATOM 11683 C CG   . GLU A 1 91 ? -21.988 5.214   -5.343  1.00 0.00 ? 128 GLU A CG   8  
ATOM 11684 C CD   . GLU A 1 91 ? -23.230 4.527   -5.864  1.00 0.00 ? 128 GLU A CD   8  
ATOM 11685 O OE1  . GLU A 1 91 ? -23.114 3.666   -6.758  1.00 0.00 ? 128 GLU A OE1  8  
ATOM 11686 O OE2  . GLU A 1 91 ? -24.334 4.831   -5.369  1.00 0.00 ? 128 GLU A OE2  8  
ATOM 11687 H H    . GLU A 1 91 ? -20.353 7.240   -6.207  1.00 0.00 ? 128 GLU A H    8  
ATOM 11688 H HA   . GLU A 1 91 ? -19.290 5.205   -4.514  1.00 0.00 ? 128 GLU A HA   8  
ATOM 11689 H HB2  . GLU A 1 91 ? -20.834 4.908   -7.096  1.00 0.00 ? 128 GLU A HB2  8  
ATOM 11690 H HB3  . GLU A 1 91 ? -20.620 3.677   -5.860  1.00 0.00 ? 128 GLU A HB3  8  
ATOM 11691 H HG2  . GLU A 1 91 ? -21.899 5.013   -4.285  1.00 0.00 ? 128 GLU A HG2  8  
ATOM 11692 H HG3  . GLU A 1 91 ? -22.088 6.279   -5.498  1.00 0.00 ? 128 GLU A HG3  8  
ATOM 11693 N N    . VAL A 1 92 ? -17.881 3.699   -6.141  1.00 0.00 ? 129 VAL A N    8  
ATOM 11694 C CA   . VAL A 1 92 ? -16.837 3.067   -6.932  1.00 0.00 ? 129 VAL A CA   8  
ATOM 11695 C C    . VAL A 1 92 ? -17.316 2.901   -8.368  1.00 0.00 ? 129 VAL A C    8  
ATOM 11696 O O    . VAL A 1 92 ? -18.306 2.208   -8.623  1.00 0.00 ? 129 VAL A O    8  
ATOM 11697 C CB   . VAL A 1 92 ? -16.453 1.683   -6.367  1.00 0.00 ? 129 VAL A CB   8  
ATOM 11698 C CG1  . VAL A 1 92 ? -15.259 1.106   -7.112  1.00 0.00 ? 129 VAL A CG1  8  
ATOM 11699 C CG2  . VAL A 1 92 ? -16.162 1.765   -4.879  1.00 0.00 ? 129 VAL A CG2  8  
ATOM 11700 H H    . VAL A 1 92 ? -18.358 3.169   -5.469  1.00 0.00 ? 129 VAL A H    8  
ATOM 11701 H HA   . VAL A 1 92 ? -15.964 3.703   -6.919  1.00 0.00 ? 129 VAL A HA   8  
ATOM 11702 H HB   . VAL A 1 92 ? -17.291 1.016   -6.509  1.00 0.00 ? 129 VAL A HB   8  
ATOM 11703 H HG11 . VAL A 1 92 ? -14.652 1.913   -7.496  1.00 0.00 ? 129 VAL A HG11 8  
ATOM 11704 H HG12 . VAL A 1 92 ? -14.670 0.502   -6.436  1.00 0.00 ? 129 VAL A HG12 8  
ATOM 11705 H HG13 . VAL A 1 92 ? -15.607 0.495   -7.931  1.00 0.00 ? 129 VAL A HG13 8  
ATOM 11706 H HG21 . VAL A 1 92 ? -17.023 2.160   -4.363  1.00 0.00 ? 129 VAL A HG21 8  
ATOM 11707 H HG22 . VAL A 1 92 ? -15.939 0.777   -4.503  1.00 0.00 ? 129 VAL A HG22 8  
ATOM 11708 H HG23 . VAL A 1 92 ? -15.313 2.412   -4.714  1.00 0.00 ? 129 VAL A HG23 8  
ATOM 11709 N N    . SER A 1 93 ? -16.671 3.600   -9.284  1.00 0.00 ? 130 SER A N    8  
ATOM 11710 C CA   . SER A 1 93 ? -17.062 3.587   -10.685 1.00 0.00 ? 130 SER A CA   8  
ATOM 11711 C C    . SER A 1 93 ? -15.877 3.984   -11.553 1.00 0.00 ? 130 SER A C    8  
ATOM 11712 O O    . SER A 1 93 ? -15