data_1UU1
# 
_entry.id   1UU1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.312 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1UU1         
PDBE  EBI-13777    
WWPDB D_1290013777 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1H1C unspecified 'HISTIDINOL-PHOSPHATE AMINOTRANSFERASE (HISC) FROM THERMOTOGA MARITIMA (APO-FORM)'            
PDB 1UU0 unspecified 'COMPLEX OF HISTIDINOL-PHOSPHATE AMINOTRANSFERASE (HISC) FROM THERMOTOGA MARITIMA (APO-FORM)' 
PDB 1UU2 unspecified 'COMPLEX OF HISTIDINOL-PHOSPHATE AMINOTRANSFERASE (HISC) FROM THERMOTOGA MARITIMA (APO-FORM)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1UU1 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2003-12-12 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vega, M.C.'      1 
'Fernandez, F.J.' 2 
'Lehman, F.'      3 
'Wilmanns, M.'    4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural Studies of the Catalytic Reaction Pathway of a Hyperthermophilic Histidinol-Phosphate Aminotransferase' 
J.Biol.Chem. 279 21478 ? 2004 JBCHA3 US 0021-9258 0071 ? 15007066 10.1074/JBC.M400291200 
1       
;Crystal Structure of Histidinol Phosphate Aminotransferase (Hisc) from Escherichia Coli, and its Covalent Complex with Pyridoxal-5'-Phosphate and L-Histidinol Phosphate
;
J.Mol.Biol.  311 761   ? 2001 JMOBAK UK 0022-2836 0070 ? 11518529 10.1006/JMBI.2001.4882 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Fernandez, F.J.' 1  ? 
primary 'Vega, M.C.'      2  ? 
primary 'Lehmann, F.'     3  ? 
primary 'Sandmeier, E.'   4  ? 
primary 'Gehring, H.'     5  ? 
primary 'Christen, P.'    6  ? 
primary 'Wilmanns, M.'    7  ? 
1       'Sivaraman, J.'   8  ? 
1       'Li, Y.'          9  ? 
1       'Larocque, R.'    10 ? 
1       'Schrag, J.D.'    11 ? 
1       'Cygler, M.'      12 ? 
1       'Matte, A.'       13 ? 
# 
_cell.entry_id           1UU1 
_cell.length_a           53.610 
_cell.length_b           136.519 
_cell.length_c           92.815 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.19 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1UU1 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HISTIDINOL-PHOSPHATE AMINOTRANSFERASE'                           39350.945 4   2.6.1.9 ? ? 
'PHOSPHATE ANION ATTACHED PER CHAIN' 
2 non-polymer syn "4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE"                         248.173   4   ?       ? ? ? 
3 non-polymer syn 'PHOSPHORIC ACID MONO-[2-AMINO-3-(3H-IMIDAZOL-4-YL)-PROPYL]ESTER' 221.151   4   ?       ? ? ? 
4 water       nat water                                                             18.015    369 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'IMIDAZOLE ACETOL-PHOSPHATE TRANAMINASE, HISC' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNPLDLIAKRAYPYETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPDEELIEKILSYLDTDFLSKNNVS
VGNGADEIIYVMMLMFDRSVFFPPTYSCYRIFAKAVGAKFLEVPLTKDLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEI
ERILKTGAFVALDEAYYEFHGESYVDFLKKYENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVRLPFNVSYVSQMF
AKVALDHREIFEERTKFIVEERERMKSALREMGYRITDSRGNFVFVFMEKEEKERLLEHLRTKNVAVRSFREGVRITIGK
REENDMILRELEVFK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNPLDLIAKRAYPYETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPDEELIEKILSYLDTDFLSKNNVS
VGNGADEIIYVMMLMFDRSVFFPPTYSCYRIFAKAVGAKFLEVPLTKDLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEI
ERILKTGAFVALDEAYYEFHGESYVDFLKKYENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVRLPFNVSYVSQMF
AKVALDHREIFEERTKFIVEERERMKSALREMGYRITDSRGNFVFVFMEKEEKERLLEHLRTKNVAVRSFREGVRITIGK
REENDMILRELEVFK
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   PRO n 
1 4   LEU n 
1 5   ASP n 
1 6   LEU n 
1 7   ILE n 
1 8   ALA n 
1 9   LYS n 
1 10  ARG n 
1 11  ALA n 
1 12  TYR n 
1 13  PRO n 
1 14  TYR n 
1 15  GLU n 
1 16  THR n 
1 17  GLU n 
1 18  LYS n 
1 19  ARG n 
1 20  ASP n 
1 21  LYS n 
1 22  THR n 
1 23  TYR n 
1 24  LEU n 
1 25  ALA n 
1 26  LEU n 
1 27  ASN n 
1 28  GLU n 
1 29  ASN n 
1 30  PRO n 
1 31  PHE n 
1 32  PRO n 
1 33  PHE n 
1 34  PRO n 
1 35  GLU n 
1 36  ASP n 
1 37  LEU n 
1 38  VAL n 
1 39  ASP n 
1 40  GLU n 
1 41  VAL n 
1 42  PHE n 
1 43  ARG n 
1 44  ARG n 
1 45  LEU n 
1 46  ASN n 
1 47  SER n 
1 48  ASP n 
1 49  ALA n 
1 50  LEU n 
1 51  ARG n 
1 52  ILE n 
1 53  TYR n 
1 54  TYR n 
1 55  ASP n 
1 56  SER n 
1 57  PRO n 
1 58  ASP n 
1 59  GLU n 
1 60  GLU n 
1 61  LEU n 
1 62  ILE n 
1 63  GLU n 
1 64  LYS n 
1 65  ILE n 
1 66  LEU n 
1 67  SER n 
1 68  TYR n 
1 69  LEU n 
1 70  ASP n 
1 71  THR n 
1 72  ASP n 
1 73  PHE n 
1 74  LEU n 
1 75  SER n 
1 76  LYS n 
1 77  ASN n 
1 78  ASN n 
1 79  VAL n 
1 80  SER n 
1 81  VAL n 
1 82  GLY n 
1 83  ASN n 
1 84  GLY n 
1 85  ALA n 
1 86  ASP n 
1 87  GLU n 
1 88  ILE n 
1 89  ILE n 
1 90  TYR n 
1 91  VAL n 
1 92  MET n 
1 93  MET n 
1 94  LEU n 
1 95  MET n 
1 96  PHE n 
1 97  ASP n 
1 98  ARG n 
1 99  SER n 
1 100 VAL n 
1 101 PHE n 
1 102 PHE n 
1 103 PRO n 
1 104 PRO n 
1 105 THR n 
1 106 TYR n 
1 107 SER n 
1 108 CYS n 
1 109 TYR n 
1 110 ARG n 
1 111 ILE n 
1 112 PHE n 
1 113 ALA n 
1 114 LYS n 
1 115 ALA n 
1 116 VAL n 
1 117 GLY n 
1 118 ALA n 
1 119 LYS n 
1 120 PHE n 
1 121 LEU n 
1 122 GLU n 
1 123 VAL n 
1 124 PRO n 
1 125 LEU n 
1 126 THR n 
1 127 LYS n 
1 128 ASP n 
1 129 LEU n 
1 130 ARG n 
1 131 ILE n 
1 132 PRO n 
1 133 GLU n 
1 134 VAL n 
1 135 ASN n 
1 136 VAL n 
1 137 GLY n 
1 138 GLU n 
1 139 GLY n 
1 140 ASP n 
1 141 VAL n 
1 142 VAL n 
1 143 PHE n 
1 144 ILE n 
1 145 PRO n 
1 146 ASN n 
1 147 PRO n 
1 148 ASN n 
1 149 ASN n 
1 150 PRO n 
1 151 THR n 
1 152 GLY n 
1 153 HIS n 
1 154 VAL n 
1 155 PHE n 
1 156 GLU n 
1 157 ARG n 
1 158 GLU n 
1 159 GLU n 
1 160 ILE n 
1 161 GLU n 
1 162 ARG n 
1 163 ILE n 
1 164 LEU n 
1 165 LYS n 
1 166 THR n 
1 167 GLY n 
1 168 ALA n 
1 169 PHE n 
1 170 VAL n 
1 171 ALA n 
1 172 LEU n 
1 173 ASP n 
1 174 GLU n 
1 175 ALA n 
1 176 TYR n 
1 177 TYR n 
1 178 GLU n 
1 179 PHE n 
1 180 HIS n 
1 181 GLY n 
1 182 GLU n 
1 183 SER n 
1 184 TYR n 
1 185 VAL n 
1 186 ASP n 
1 187 PHE n 
1 188 LEU n 
1 189 LYS n 
1 190 LYS n 
1 191 TYR n 
1 192 GLU n 
1 193 ASN n 
1 194 LEU n 
1 195 ALA n 
1 196 VAL n 
1 197 ILE n 
1 198 ARG n 
1 199 THR n 
1 200 PHE n 
1 201 SER n 
1 202 LYS n 
1 203 ALA n 
1 204 PHE n 
1 205 SER n 
1 206 LEU n 
1 207 ALA n 
1 208 ALA n 
1 209 GLN n 
1 210 ARG n 
1 211 VAL n 
1 212 GLY n 
1 213 TYR n 
1 214 VAL n 
1 215 VAL n 
1 216 ALA n 
1 217 SER n 
1 218 GLU n 
1 219 LYS n 
1 220 PHE n 
1 221 ILE n 
1 222 ASP n 
1 223 ALA n 
1 224 TYR n 
1 225 ASN n 
1 226 ARG n 
1 227 VAL n 
1 228 ARG n 
1 229 LEU n 
1 230 PRO n 
1 231 PHE n 
1 232 ASN n 
1 233 VAL n 
1 234 SER n 
1 235 TYR n 
1 236 VAL n 
1 237 SER n 
1 238 GLN n 
1 239 MET n 
1 240 PHE n 
1 241 ALA n 
1 242 LYS n 
1 243 VAL n 
1 244 ALA n 
1 245 LEU n 
1 246 ASP n 
1 247 HIS n 
1 248 ARG n 
1 249 GLU n 
1 250 ILE n 
1 251 PHE n 
1 252 GLU n 
1 253 GLU n 
1 254 ARG n 
1 255 THR n 
1 256 LYS n 
1 257 PHE n 
1 258 ILE n 
1 259 VAL n 
1 260 GLU n 
1 261 GLU n 
1 262 ARG n 
1 263 GLU n 
1 264 ARG n 
1 265 MET n 
1 266 LYS n 
1 267 SER n 
1 268 ALA n 
1 269 LEU n 
1 270 ARG n 
1 271 GLU n 
1 272 MET n 
1 273 GLY n 
1 274 TYR n 
1 275 ARG n 
1 276 ILE n 
1 277 THR n 
1 278 ASP n 
1 279 SER n 
1 280 ARG n 
1 281 GLY n 
1 282 ASN n 
1 283 PHE n 
1 284 VAL n 
1 285 PHE n 
1 286 VAL n 
1 287 PHE n 
1 288 MET n 
1 289 GLU n 
1 290 LYS n 
1 291 GLU n 
1 292 GLU n 
1 293 LYS n 
1 294 GLU n 
1 295 ARG n 
1 296 LEU n 
1 297 LEU n 
1 298 GLU n 
1 299 HIS n 
1 300 LEU n 
1 301 ARG n 
1 302 THR n 
1 303 LYS n 
1 304 ASN n 
1 305 VAL n 
1 306 ALA n 
1 307 VAL n 
1 308 ARG n 
1 309 SER n 
1 310 PHE n 
1 311 ARG n 
1 312 GLU n 
1 313 GLY n 
1 314 VAL n 
1 315 ARG n 
1 316 ILE n 
1 317 THR n 
1 318 ILE n 
1 319 GLY n 
1 320 LYS n 
1 321 ARG n 
1 322 GLU n 
1 323 GLU n 
1 324 ASN n 
1 325 ASP n 
1 326 MET n 
1 327 ILE n 
1 328 LEU n 
1 329 ARG n 
1 330 GLU n 
1 331 LEU n 
1 332 GLU n 
1 333 VAL n 
1 334 PHE n 
1 335 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'THERMOTOGA MARITIMA' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2336 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               'T7 PROMOTER' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PETM11 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    HIS8_THEMA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q9X0D0 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1UU1 A 1 ? 335 ? Q9X0D0 1 ? 335 ? 1 335 
2 1 1UU1 B 1 ? 335 ? Q9X0D0 1 ? 335 ? 1 335 
3 1 1UU1 C 1 ? 335 ? Q9X0D0 1 ? 335 ? 1 335 
4 1 1UU1 D 1 ? 335 ? Q9X0D0 1 ? 335 ? 1 335 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                           ?                           
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                          ?                           
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                        ?                           
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                   ?                           
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                          ?                           
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                         ?                           
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                   ?                           
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                           ?                           
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                         ?                           
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                             ?                           'H2 O' 
18.015  
HSA non-polymer         . 'PHOSPHORIC ACID MONO-[2-AMINO-3-(3H-IMIDAZOL-4-YL)-PROPYL]ESTER' ?                           
'C6 H12 N3 O4 P' 221.151 
ILE 'L-peptide linking' y ISOLEUCINE                                                        ?                           
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                           ?                           
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                            ?                           
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                        ?                           
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                     ?                           
'C9 H11 N O2'    165.189 
PMP non-polymer         . "4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE"                         "PYRIDOXAMINE-5'-PHOSPHATE" 
'C8 H13 N2 O5 P' 248.173 
PRO 'L-peptide linking' y PROLINE                                                           ?                           
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                            ?                           
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                         ?                           
'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                                                          ?                           
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                            ?                           
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1UU1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.4 
_exptl_crystal.density_percent_sol   44.7 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.00' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2003-08-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.8042 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X13' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   X13 
_diffrn_source.pdbx_wavelength             0.8042 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1UU1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.350 
_reflns.number_obs                   49556 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         90.6 
_reflns.pdbx_Rmerge_I_obs            0.08850 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.7000 
_reflns.B_iso_Wilson_estimate        26.9 
_reflns.pdbx_redundancy              1.250 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.35 
_reflns_shell.d_res_low              2.45 
_reflns_shell.percent_possible_all   91.3 
_reflns_shell.Rmerge_I_obs           0.47400 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.220 
_reflns_shell.pdbx_redundancy        1.00 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1UU1 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     48181 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.67 
_refine.ls_d_res_high                            2.38 
_refine.ls_percent_reflns_obs                    90.7 
_refine.ls_R_factor_obs                          0.206 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.206 
_refine.ls_R_factor_R_free                       0.268 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2427 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               33.3 
_refine.aniso_B[1][1]                            7.03 
_refine.aniso_B[2][2]                            1.76 
_refine.aniso_B[3][3]                            -8.78 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.05 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.36114 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1H1C' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1UU1 
_refine_analyze.Luzzati_coordinate_error_obs    0.27 
_refine_analyze.Luzzati_sigma_a_obs             0.32 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.38 
_refine_analyze.Luzzati_sigma_a_free            0.38 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11031 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         116 
_refine_hist.number_atoms_solvent             369 
_refine_hist.number_atoms_total               11516 
_refine_hist.d_res_high                       2.38 
_refine_hist.d_res_low                        19.67 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.5  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.04  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.38 
_refine_ls_shell.d_res_low                        2.53 
_refine_ls_shell.number_reflns_R_work             7614 
_refine_ls_shell.R_factor_R_work                  0.256 
_refine_ls_shell.percent_reflns_obs               90.9 
_refine_ls_shell.R_factor_R_free                  0.337 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            5.0 
_refine_ls_shell.number_reflns_R_free             400 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 
'X-RAY DIFFRACTION' 2 WATER_REP.PARAM   WATER.TOP   
'X-RAY DIFFRACTION' 3 ION.PARAM         ION.TOP     
'X-RAY DIFFRACTION' 4 HSP.PAR           HSP.TOP     
# 
_struct.entry_id                  1UU1 
_struct.title                     'Complex of Histidinol-phosphate aminotransferase (HisC) from Thermotoga maritima (Apo-form)' 
_struct.pdbx_descriptor           'HISTIDINOL-PHOSPHATE AMINOTRANSFERASE (E.C.2.6.1.9)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UU1 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'HISTIDINE BIOSYNTHESIS, TRANSFERASE, AMINOTRANSFERASE, PYRIDOXAL PHOSPHATE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 3 ? 
K N N 2 ? 
L N N 3 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 34  ? ARG A 44  ? PRO A 34  ARG A 44  1 ? 11 
HELX_P HELX_P2  2  ASN A 46  ? ILE A 52  ? ASN A 46  ILE A 52  5 ? 7  
HELX_P HELX_P3  3  ASP A 58  ? ASP A 70  ? ASP A 58  ASP A 70  1 ? 13 
HELX_P HELX_P4  4  SER A 75  ? ASN A 77  ? SER A 75  ASN A 77  5 ? 3  
HELX_P HELX_P5  5  GLY A 84  ? PHE A 96  ? GLY A 84  PHE A 96  1 ? 13 
HELX_P HELX_P6  6  SER A 107 ? GLY A 117 ? SER A 107 GLY A 117 1 ? 11 
HELX_P HELX_P7  7  GLU A 156 ? THR A 166 ? GLU A 156 THR A 166 1 ? 11 
HELX_P HELX_P8  8  TYR A 176 ? GLY A 181 ? TYR A 176 GLY A 181 1 ? 6  
HELX_P HELX_P9  9  TYR A 184 ? LYS A 190 ? TYR A 184 LYS A 190 5 ? 7  
HELX_P HELX_P10 10 LEU A 206 ? ARG A 210 ? LEU A 206 ARG A 210 5 ? 5  
HELX_P HELX_P11 11 SER A 217 ? ARG A 228 ? SER A 217 ARG A 228 1 ? 12 
HELX_P HELX_P12 12 SER A 234 ? HIS A 247 ? SER A 234 HIS A 247 1 ? 14 
HELX_P HELX_P13 13 HIS A 247 ? GLY A 273 ? HIS A 247 GLY A 273 1 ? 27 
HELX_P HELX_P14 14 LYS A 290 ? LYS A 303 ? LYS A 290 LYS A 303 1 ? 14 
HELX_P HELX_P15 15 LYS A 320 ? VAL A 333 ? LYS A 320 VAL A 333 1 ? 14 
HELX_P HELX_P16 16 MET B 1   ? ALA B 8   ? MET B 1   ALA B 8   1 ? 8  
HELX_P HELX_P17 17 PRO B 34  ? LEU B 45  ? PRO B 34  LEU B 45  1 ? 12 
HELX_P HELX_P18 18 ASN B 46  ? ILE B 52  ? ASN B 46  ILE B 52  5 ? 7  
HELX_P HELX_P19 19 ASP B 58  ? ASP B 70  ? ASP B 58  ASP B 70  1 ? 13 
HELX_P HELX_P20 20 SER B 75  ? ASN B 77  ? SER B 75  ASN B 77  5 ? 3  
HELX_P HELX_P21 21 GLY B 84  ? PHE B 96  ? GLY B 84  PHE B 96  1 ? 13 
HELX_P HELX_P22 22 SER B 107 ? VAL B 116 ? SER B 107 VAL B 116 1 ? 10 
HELX_P HELX_P23 23 GLU B 156 ? THR B 166 ? GLU B 156 THR B 166 1 ? 11 
HELX_P HELX_P24 24 TYR B 176 ? HIS B 180 ? TYR B 176 HIS B 180 5 ? 5  
HELX_P HELX_P25 25 SER B 183 ? LYS B 190 ? SER B 183 LYS B 190 5 ? 8  
HELX_P HELX_P26 26 SER B 217 ? ARG B 228 ? SER B 217 ARG B 228 1 ? 12 
HELX_P HELX_P27 27 SER B 234 ? HIS B 247 ? SER B 234 HIS B 247 1 ? 14 
HELX_P HELX_P28 28 HIS B 247 ? GLY B 273 ? HIS B 247 GLY B 273 1 ? 27 
HELX_P HELX_P29 29 GLU B 289 ? LYS B 303 ? GLU B 289 LYS B 303 1 ? 15 
HELX_P HELX_P30 30 LYS B 320 ? VAL B 333 ? LYS B 320 VAL B 333 1 ? 14 
HELX_P HELX_P31 31 PRO C 34  ? LEU C 45  ? PRO C 34  LEU C 45  1 ? 12 
HELX_P HELX_P32 32 ASP C 48  ? ILE C 52  ? ASP C 48  ILE C 52  5 ? 5  
HELX_P HELX_P33 33 ASP C 58  ? ASP C 70  ? ASP C 58  ASP C 70  1 ? 13 
HELX_P HELX_P34 34 SER C 75  ? ASN C 77  ? SER C 75  ASN C 77  5 ? 3  
HELX_P HELX_P35 35 ASN C 83  ? PHE C 96  ? ASN C 83  PHE C 96  1 ? 14 
HELX_P HELX_P36 36 SER C 107 ? GLY C 117 ? SER C 107 GLY C 117 1 ? 11 
HELX_P HELX_P37 37 GLU C 156 ? THR C 166 ? GLU C 156 THR C 166 1 ? 11 
HELX_P HELX_P38 38 TYR C 176 ? GLY C 181 ? TYR C 176 GLY C 181 1 ? 6  
HELX_P HELX_P39 39 TYR C 184 ? LYS C 190 ? TYR C 184 LYS C 190 5 ? 7  
HELX_P HELX_P40 40 LEU C 206 ? ARG C 210 ? LEU C 206 ARG C 210 5 ? 5  
HELX_P HELX_P41 41 SER C 217 ? ARG C 228 ? SER C 217 ARG C 228 1 ? 12 
HELX_P HELX_P42 42 SER C 234 ? HIS C 247 ? SER C 234 HIS C 247 1 ? 14 
HELX_P HELX_P43 43 HIS C 247 ? MET C 272 ? HIS C 247 MET C 272 1 ? 26 
HELX_P HELX_P44 44 GLU C 289 ? THR C 302 ? GLU C 289 THR C 302 1 ? 14 
HELX_P HELX_P45 45 LYS C 320 ? VAL C 333 ? LYS C 320 VAL C 333 1 ? 14 
HELX_P HELX_P46 46 PRO D 34  ? LEU D 45  ? PRO D 34  LEU D 45  1 ? 12 
HELX_P HELX_P47 47 ASN D 46  ? ILE D 52  ? ASN D 46  ILE D 52  5 ? 7  
HELX_P HELX_P48 48 ASP D 58  ? ASP D 70  ? ASP D 58  ASP D 70  1 ? 13 
HELX_P HELX_P49 49 SER D 75  ? ASN D 77  ? SER D 75  ASN D 77  5 ? 3  
HELX_P HELX_P50 50 GLY D 84  ? LEU D 94  ? GLY D 84  LEU D 94  1 ? 11 
HELX_P HELX_P51 51 TYR D 106 ? GLY D 117 ? TYR D 106 GLY D 117 1 ? 12 
HELX_P HELX_P52 52 GLU D 156 ? THR D 166 ? GLU D 156 THR D 166 1 ? 11 
HELX_P HELX_P53 53 TYR D 176 ? GLY D 181 ? TYR D 176 GLY D 181 1 ? 6  
HELX_P HELX_P54 54 TYR D 184 ? LYS D 190 ? TYR D 184 LYS D 190 5 ? 7  
HELX_P HELX_P55 55 SER D 217 ? ARG D 228 ? SER D 217 ARG D 228 1 ? 12 
HELX_P HELX_P56 56 SER D 234 ? HIS D 247 ? SER D 234 HIS D 247 1 ? 14 
HELX_P HELX_P57 57 ARG D 248 ? MET D 272 ? ARG D 248 MET D 272 1 ? 25 
HELX_P HELX_P58 58 GLU D 289 ? LYS D 303 ? GLU D 289 LYS D 303 1 ? 15 
HELX_P HELX_P59 59 LYS D 320 ? VAL D 333 ? LYS D 320 VAL D 333 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale one ? E PMP . N4A ? ? ? 1_555 F HSA . CA ? ? A PMP 1335 A HSA 1336 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale2 covale one ? G PMP . N4A ? ? ? 1_555 H HSA . CA ? ? B PMP 1335 B HSA 1336 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale3 covale one ? I PMP . N4A ? ? ? 1_555 J HSA . CA ? ? C PMP 1335 C HSA 1336 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale4 covale one ? K PMP . N4A ? ? ? 1_555 L HSA . CA ? ? D PMP 1335 D HSA 1336 1_555 ? ? ? ? ? ? ? 1.331 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  PRO 103 A . ? PRO 103 A PRO 104 A ? PRO 104 A 1 0.22  
2  ASN 146 A . ? ASN 146 A PRO 147 A ? PRO 147 A 1 0.69  
3  ASN 149 A . ? ASN 149 A PRO 150 A ? PRO 150 A 1 0.63  
4  PRO 103 B . ? PRO 103 B PRO 104 B ? PRO 104 B 1 -0.24 
5  ASN 146 B . ? ASN 146 B PRO 147 B ? PRO 147 B 1 0.02  
6  ASN 149 B . ? ASN 149 B PRO 150 B ? PRO 150 B 1 0.65  
7  PRO 103 C . ? PRO 103 C PRO 104 C ? PRO 104 C 1 0.44  
8  ASN 146 C . ? ASN 146 C PRO 147 C ? PRO 147 C 1 -0.12 
9  ASN 149 C . ? ASN 149 C PRO 150 C ? PRO 150 C 1 0.75  
10 PRO 103 D . ? PRO 103 D PRO 104 D ? PRO 104 D 1 0.09  
11 ASN 146 D . ? ASN 146 D PRO 147 D ? PRO 147 D 1 -0.15 
12 ASN 149 D . ? ASN 149 D PRO 150 D ? PRO 150 D 1 0.47  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 7 ? 
BA ? 5 ? 
BB ? 7 ? 
CA ? 4 ? 
CB ? 7 ? 
DA ? 2 ? 
DB ? 7 ? 
DC ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? parallel      
AB 4 5 ? parallel      
AB 5 6 ? parallel      
AB 6 7 ? parallel      
BA 1 2 ? parallel      
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BA 4 5 ? anti-parallel 
BB 1 2 ? anti-parallel 
BB 2 3 ? anti-parallel 
BB 3 4 ? parallel      
BB 4 5 ? parallel      
BB 5 6 ? parallel      
BB 6 7 ? parallel      
CA 1 2 ? parallel      
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? parallel      
CB 4 5 ? parallel      
CB 5 6 ? parallel      
CB 6 7 ? parallel      
DA 1 2 ? parallel      
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
DB 3 4 ? parallel      
DB 4 5 ? parallel      
DB 5 6 ? parallel      
DB 6 7 ? parallel      
DC 1 2 ? anti-parallel 
DC 2 3 ? anti-parallel 
DC 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 THR A 22  ? LEU A 24  ? THR A 22  LEU A 24  
AA 2 VAL A 305 ? PHE A 310 ? VAL A 305 PHE A 310 
AA 3 GLY A 313 ? THR A 317 ? GLY A 313 THR A 317 
AA 4 PHE A 283 ? PHE A 287 ? PHE A 283 PHE A 287 
AB 1 VAL A 79  ? GLY A 82  ? VAL A 79  GLY A 82  
AB 2 GLY A 212 ? ALA A 216 ? GLY A 212 ALA A 216 
AB 3 LEU A 194 ? THR A 199 ? LEU A 194 THR A 199 
AB 4 PHE A 169 ? ASP A 173 ? PHE A 169 ASP A 173 
AB 5 ASP A 140 ? PRO A 145 ? ASP A 140 PRO A 145 
AB 6 ARG A 98  ? PHE A 101 ? ARG A 98  PHE A 101 
AB 7 LYS A 119 ? GLU A 122 ? LYS A 119 GLU A 122 
BA 1 THR B 22  ? LEU B 24  ? THR B 22  LEU B 24  
BA 2 VAL B 305 ? SER B 309 ? VAL B 305 SER B 309 
BA 3 GLY B 313 ? THR B 317 ? GLY B 313 THR B 317 
BA 4 PHE B 283 ? PHE B 287 ? PHE B 283 PHE B 287 
BA 5 ARG B 275 ? ILE B 276 ? ARG B 275 ILE B 276 
BB 1 VAL B 79  ? GLY B 82  ? VAL B 79  GLY B 82  
BB 2 GLY B 212 ? ALA B 216 ? GLY B 212 ALA B 216 
BB 3 LEU B 194 ? THR B 199 ? LEU B 194 THR B 199 
BB 4 PHE B 169 ? ASP B 173 ? PHE B 169 ASP B 173 
BB 5 ASP B 140 ? PRO B 145 ? ASP B 140 PRO B 145 
BB 6 ARG B 98  ? PHE B 101 ? ARG B 98  PHE B 101 
BB 7 PHE B 120 ? GLU B 122 ? PHE B 120 GLU B 122 
CA 1 THR C 22  ? LEU C 24  ? THR C 22  LEU C 24  
CA 2 VAL C 305 ? PHE C 310 ? VAL C 305 PHE C 310 
CA 3 GLY C 313 ? THR C 317 ? GLY C 313 THR C 317 
CA 4 PHE C 283 ? PHE C 287 ? PHE C 283 PHE C 287 
CB 1 VAL C 79  ? GLY C 82  ? VAL C 79  GLY C 82  
CB 2 GLY C 212 ? ALA C 216 ? GLY C 212 ALA C 216 
CB 3 LEU C 194 ? THR C 199 ? LEU C 194 THR C 199 
CB 4 PHE C 169 ? ASP C 173 ? PHE C 169 ASP C 173 
CB 5 ASP C 140 ? PRO C 145 ? ASP C 140 PRO C 145 
CB 6 ARG C 98  ? PHE C 101 ? ARG C 98  PHE C 101 
CB 7 PHE C 120 ? GLU C 122 ? PHE C 120 GLU C 122 
DA 1 THR D 22  ? TYR D 23  ? THR D 22  TYR D 23  
DA 2 VAL D 305 ? ALA D 306 ? VAL D 305 ALA D 306 
DB 1 VAL D 79  ? GLY D 82  ? VAL D 79  GLY D 82  
DB 2 GLY D 212 ? ALA D 216 ? GLY D 212 ALA D 216 
DB 3 LEU D 194 ? THR D 199 ? LEU D 194 THR D 199 
DB 4 PHE D 169 ? ASP D 173 ? PHE D 169 ASP D 173 
DB 5 ASP D 140 ? PRO D 145 ? ASP D 140 PRO D 145 
DB 6 ARG D 98  ? PHE D 101 ? ARG D 98  PHE D 101 
DB 7 LYS D 119 ? GLU D 122 ? LYS D 119 GLU D 122 
DC 1 ARG D 275 ? ILE D 276 ? ARG D 275 ILE D 276 
DC 2 PHE D 283 ? PHE D 287 ? PHE D 283 PHE D 287 
DC 3 GLY D 313 ? THR D 317 ? GLY D 313 THR D 317 
DC 4 ARG D 308 ? PHE D 310 ? ARG D 308 PHE D 310 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 24  ? N LEU A 24  O ALA A 306 ? O ALA A 306 
AA 2 3 N PHE A 310 ? N PHE A 310 O GLY A 313 ? O GLY A 313 
AA 3 4 N ILE A 316 ? N ILE A 316 O VAL A 284 ? O VAL A 284 
AB 1 2 N GLY A 82  ? N GLY A 82  O GLY A 212 ? O GLY A 212 
AB 2 3 N VAL A 215 ? N VAL A 215 O VAL A 196 ? O VAL A 196 
AB 3 4 N ALA A 195 ? N ALA A 195 O VAL A 170 ? O VAL A 170 
AB 4 5 N PHE A 169 ? N PHE A 169 O ASP A 140 ? O ASP A 140 
AB 5 6 N VAL A 141 ? N VAL A 141 O ARG A 98  ? O ARG A 98  
AB 6 7 N SER A 99  ? N SER A 99  O LYS A 119 ? O LYS A 119 
BA 1 2 N LEU B 24  ? N LEU B 24  O ALA B 306 ? O ALA B 306 
BA 2 3 N ARG B 308 ? N ARG B 308 O ARG B 315 ? O ARG B 315 
BA 3 4 N ILE B 316 ? N ILE B 316 O VAL B 284 ? O VAL B 284 
BA 4 5 N PHE B 287 ? N PHE B 287 O ARG B 275 ? O ARG B 275 
BB 1 2 N GLY B 82  ? N GLY B 82  O GLY B 212 ? O GLY B 212 
BB 2 3 N VAL B 215 ? N VAL B 215 O VAL B 196 ? O VAL B 196 
BB 3 4 N ALA B 195 ? N ALA B 195 O VAL B 170 ? O VAL B 170 
BB 4 5 N PHE B 169 ? N PHE B 169 O ASP B 140 ? O ASP B 140 
BB 5 6 N VAL B 141 ? N VAL B 141 O ARG B 98  ? O ARG B 98  
BB 6 7 N PHE B 101 ? N PHE B 101 O LEU B 121 ? O LEU B 121 
CA 1 2 N LEU C 24  ? N LEU C 24  O ALA C 306 ? O ALA C 306 
CA 2 3 N PHE C 310 ? N PHE C 310 O GLY C 313 ? O GLY C 313 
CA 3 4 N ILE C 316 ? N ILE C 316 O VAL C 284 ? O VAL C 284 
CB 1 2 N GLY C 82  ? N GLY C 82  O GLY C 212 ? O GLY C 212 
CB 2 3 N VAL C 215 ? N VAL C 215 O VAL C 196 ? O VAL C 196 
CB 3 4 N ALA C 195 ? N ALA C 195 O VAL C 170 ? O VAL C 170 
CB 4 5 N PHE C 169 ? N PHE C 169 O ASP C 140 ? O ASP C 140 
CB 5 6 N VAL C 141 ? N VAL C 141 O ARG C 98  ? O ARG C 98  
CB 6 7 N PHE C 101 ? N PHE C 101 O LEU C 121 ? O LEU C 121 
DA 1 2 O THR D 22  ? O THR D 22  N ALA D 306 ? N ALA D 306 
DB 1 2 N GLY D 82  ? N GLY D 82  O GLY D 212 ? O GLY D 212 
DB 2 3 N VAL D 215 ? N VAL D 215 O VAL D 196 ? O VAL D 196 
DB 3 4 N ALA D 195 ? N ALA D 195 O VAL D 170 ? O VAL D 170 
DB 4 5 N PHE D 169 ? N PHE D 169 O ASP D 140 ? O ASP D 140 
DB 5 6 N VAL D 141 ? N VAL D 141 O ARG D 98  ? O ARG D 98  
DB 6 7 N SER D 99  ? N SER D 99  O LYS D 119 ? O LYS D 119 
DC 1 2 N ARG D 275 ? N ARG D 275 O PHE D 287 ? O PHE D 287 
DC 2 3 N VAL D 286 ? N VAL D 286 O VAL D 314 ? O VAL D 314 
DC 3 4 N ARG D 315 ? N ARG D 315 O ARG D 308 ? O ARG D 308 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE PMP A1335' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE HSA A1336' 
AC3 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE PMP B1335' 
AC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE HSA B1336' 
AC5 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE PMP C1335' 
AC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE HSA C1336' 
AC7 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE PMP D1335' 
AC8 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE HSA D1336' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 GLY A 84  ? GLY A 84   . ? 1_555 ? 
2  AC1 14 ALA A 85  ? ALA A 85   . ? 1_555 ? 
3  AC1 14 ASP A 86  ? ASP A 86   . ? 1_555 ? 
4  AC1 14 TYR A 106 ? TYR A 106  . ? 1_555 ? 
5  AC1 14 ASN A 149 ? ASN A 149  . ? 1_555 ? 
6  AC1 14 ASP A 173 ? ASP A 173  . ? 1_555 ? 
7  AC1 14 ALA A 175 ? ALA A 175  . ? 1_555 ? 
8  AC1 14 TYR A 176 ? TYR A 176  . ? 1_555 ? 
9  AC1 14 THR A 199 ? THR A 199  . ? 1_555 ? 
10 AC1 14 SER A 201 ? SER A 201  . ? 1_555 ? 
11 AC1 14 LYS A 202 ? LYS A 202  . ? 1_555 ? 
12 AC1 14 ARG A 210 ? ARG A 210  . ? 1_555 ? 
13 AC1 14 HSA F .   ? HSA A 1336 . ? 1_555 ? 
14 AC1 14 TYR B 53  ? TYR B 53   . ? 1_555 ? 
15 AC2 11 ASP A 86  ? ASP A 86   . ? 1_555 ? 
16 AC2 11 TYR A 106 ? TYR A 106  . ? 1_555 ? 
17 AC2 11 SER A 107 ? SER A 107  . ? 1_555 ? 
18 AC2 11 ASN A 149 ? ASN A 149  . ? 1_555 ? 
19 AC2 11 PHE A 310 ? PHE A 310  . ? 1_555 ? 
20 AC2 11 ARG A 315 ? ARG A 315  . ? 1_555 ? 
21 AC2 11 PMP E .   ? PMP A 1335 . ? 1_555 ? 
22 AC2 11 HOH M .   ? HOH A 2101 . ? 1_555 ? 
23 AC2 11 HOH M .   ? HOH A 2102 . ? 1_555 ? 
24 AC2 11 TYR B 53  ? TYR B 53   . ? 1_555 ? 
25 AC2 11 PHE B 231 ? PHE B 231  . ? 1_555 ? 
26 AC3 14 TYR A 53  ? TYR A 53   . ? 1_555 ? 
27 AC3 14 GLY B 84  ? GLY B 84   . ? 1_555 ? 
28 AC3 14 ALA B 85  ? ALA B 85   . ? 1_555 ? 
29 AC3 14 ASP B 86  ? ASP B 86   . ? 1_555 ? 
30 AC3 14 TYR B 106 ? TYR B 106  . ? 1_555 ? 
31 AC3 14 ASN B 149 ? ASN B 149  . ? 1_555 ? 
32 AC3 14 ASP B 173 ? ASP B 173  . ? 1_555 ? 
33 AC3 14 ALA B 175 ? ALA B 175  . ? 1_555 ? 
34 AC3 14 TYR B 176 ? TYR B 176  . ? 1_555 ? 
35 AC3 14 THR B 199 ? THR B 199  . ? 1_555 ? 
36 AC3 14 SER B 201 ? SER B 201  . ? 1_555 ? 
37 AC3 14 LYS B 202 ? LYS B 202  . ? 1_555 ? 
38 AC3 14 ARG B 210 ? ARG B 210  . ? 1_555 ? 
39 AC3 14 HSA H .   ? HSA B 1336 . ? 1_555 ? 
40 AC4 10 TYR A 53  ? TYR A 53   . ? 1_555 ? 
41 AC4 10 PHE A 231 ? PHE A 231  . ? 1_555 ? 
42 AC4 10 ASP B 86  ? ASP B 86   . ? 1_555 ? 
43 AC4 10 TYR B 106 ? TYR B 106  . ? 1_555 ? 
44 AC4 10 SER B 107 ? SER B 107  . ? 1_555 ? 
45 AC4 10 CYS B 108 ? CYS B 108  . ? 1_555 ? 
46 AC4 10 ARG B 315 ? ARG B 315  . ? 1_555 ? 
47 AC4 10 PMP G .   ? PMP B 1335 . ? 1_555 ? 
48 AC4 10 HOH N .   ? HOH B 2081 . ? 1_555 ? 
49 AC4 10 HOH N .   ? HOH B 2082 . ? 1_555 ? 
50 AC5 15 GLY C 84  ? GLY C 84   . ? 1_555 ? 
51 AC5 15 ALA C 85  ? ALA C 85   . ? 1_555 ? 
52 AC5 15 ASP C 86  ? ASP C 86   . ? 1_555 ? 
53 AC5 15 ILE C 89  ? ILE C 89   . ? 1_555 ? 
54 AC5 15 TYR C 106 ? TYR C 106  . ? 1_555 ? 
55 AC5 15 ASN C 149 ? ASN C 149  . ? 1_555 ? 
56 AC5 15 ASP C 173 ? ASP C 173  . ? 1_555 ? 
57 AC5 15 ALA C 175 ? ALA C 175  . ? 1_555 ? 
58 AC5 15 TYR C 176 ? TYR C 176  . ? 1_555 ? 
59 AC5 15 THR C 199 ? THR C 199  . ? 1_555 ? 
60 AC5 15 SER C 201 ? SER C 201  . ? 1_555 ? 
61 AC5 15 LYS C 202 ? LYS C 202  . ? 1_555 ? 
62 AC5 15 ARG C 210 ? ARG C 210  . ? 1_555 ? 
63 AC5 15 HSA J .   ? HSA C 1336 . ? 1_555 ? 
64 AC5 15 TYR D 53  ? TYR D 53   . ? 1_555 ? 
65 AC6 10 ASP C 86  ? ASP C 86   . ? 1_555 ? 
66 AC6 10 TYR C 106 ? TYR C 106  . ? 1_555 ? 
67 AC6 10 SER C 107 ? SER C 107  . ? 1_555 ? 
68 AC6 10 ASN C 149 ? ASN C 149  . ? 1_555 ? 
69 AC6 10 ARG C 308 ? ARG C 308  . ? 1_555 ? 
70 AC6 10 ARG C 315 ? ARG C 315  . ? 1_555 ? 
71 AC6 10 PMP I .   ? PMP C 1335 . ? 1_555 ? 
72 AC6 10 HOH O .   ? HOH C 2054 . ? 1_555 ? 
73 AC6 10 TYR D 53  ? TYR D 53   . ? 1_555 ? 
74 AC6 10 PHE D 231 ? PHE D 231  . ? 1_555 ? 
75 AC7 14 TYR C 53  ? TYR C 53   . ? 1_555 ? 
76 AC7 14 GLY D 84  ? GLY D 84   . ? 1_555 ? 
77 AC7 14 ALA D 85  ? ALA D 85   . ? 1_555 ? 
78 AC7 14 ASP D 86  ? ASP D 86   . ? 1_555 ? 
79 AC7 14 TYR D 106 ? TYR D 106  . ? 1_555 ? 
80 AC7 14 ASN D 149 ? ASN D 149  . ? 1_555 ? 
81 AC7 14 ASP D 173 ? ASP D 173  . ? 1_555 ? 
82 AC7 14 ALA D 175 ? ALA D 175  . ? 1_555 ? 
83 AC7 14 TYR D 176 ? TYR D 176  . ? 1_555 ? 
84 AC7 14 THR D 199 ? THR D 199  . ? 1_555 ? 
85 AC7 14 SER D 201 ? SER D 201  . ? 1_555 ? 
86 AC7 14 LYS D 202 ? LYS D 202  . ? 1_555 ? 
87 AC7 14 ARG D 210 ? ARG D 210  . ? 1_555 ? 
88 AC7 14 HSA L .   ? HSA D 1336 . ? 1_555 ? 
89 AC8 10 TYR C 53  ? TYR C 53   . ? 1_555 ? 
90 AC8 10 PHE C 231 ? PHE C 231  . ? 1_555 ? 
91 AC8 10 ASP D 86  ? ASP D 86   . ? 1_555 ? 
92 AC8 10 TYR D 106 ? TYR D 106  . ? 1_555 ? 
93 AC8 10 SER D 107 ? SER D 107  . ? 1_555 ? 
94 AC8 10 LYS D 202 ? LYS D 202  . ? 1_555 ? 
95 AC8 10 ARG D 308 ? ARG D 308  . ? 1_555 ? 
96 AC8 10 ARG D 315 ? ARG D 315  . ? 1_555 ? 
97 AC8 10 PMP K .   ? PMP D 1335 . ? 1_555 ? 
98 AC8 10 HOH P .   ? HOH D 2088 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1UU1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1UU1 
_atom_sites.fract_transf_matrix[1][1]   0.018653 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001694 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007325 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010818 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . LEU A 1 6   ? -14.169 103.892 79.645  1.00   92.64 ? 6    LEU A N   1 
ATOM   2     C CA  . LEU A 1 6   ? -14.182 102.836 80.691  1.00   93.25 ? 6    LEU A CA  1 
ATOM   3     C C   . LEU A 1 6   ? -13.590 101.531 80.158  1.00   93.58 ? 6    LEU A C   1 
ATOM   4     O O   . LEU A 1 6   ? -13.668 101.237 78.964  1.00   92.68 ? 6    LEU A O   1 
ATOM   5     C CB  . LEU A 1 6   ? -15.615 102.594 81.166  1.00   93.54 ? 6    LEU A CB  1 
ATOM   6     C CG  . LEU A 1 6   ? -15.819 101.467 82.185  1.00   95.25 ? 6    LEU A CG  1 
ATOM   7     C CD1 . LEU A 1 6   ? -15.115 101.807 83.489  1.00   94.92 ? 6    LEU A CD1 1 
ATOM   8     C CD2 . LEU A 1 6   ? -17.308 101.264 82.423  1.00   95.89 ? 6    LEU A CD2 1 
ATOM   9     N N   . ILE A 1 7   ? -12.998 100.749 81.052  1.00   93.93 ? 7    ILE A N   1 
ATOM   10    C CA  . ILE A 1 7   ? -12.402 99.480  80.667  1.00   93.72 ? 7    ILE A CA  1 
ATOM   11    C C   . ILE A 1 7   ? -13.296 98.342  81.138  1.00   94.57 ? 7    ILE A C   1 
ATOM   12    O O   . ILE A 1 7   ? -12.897 97.550  81.987  1.00   95.11 ? 7    ILE A O   1 
ATOM   13    C CB  . ILE A 1 7   ? -11.016 99.290  81.309  1.00   92.57 ? 7    ILE A CB  1 
ATOM   14    C CG1 . ILE A 1 7   ? -10.419 100.643 81.695  1.00   91.89 ? 7    ILE A CG1 1 
ATOM   15    C CG2 . ILE A 1 7   ? -10.094 98.585  80.334  1.00   92.92 ? 7    ILE A CG2 1 
ATOM   16    C CD1 . ILE A 1 7   ? -9.123  100.537 82.469  1.00   89.44 ? 7    ILE A CD1 1 
ATOM   17    N N   . ALA A 1 8   ? -14.508 98.267  80.601  1.00   95.24 ? 8    ALA A N   1 
ATOM   18    C CA  . ALA A 1 8   ? -15.433 97.205  80.984  1.00   95.98 ? 8    ALA A CA  1 
ATOM   19    C C   . ALA A 1 8   ? -14.812 95.848  80.639  1.00   96.66 ? 8    ALA A C   1 
ATOM   20    O O   . ALA A 1 8   ? -13.854 95.774  79.864  1.00   96.87 ? 8    ALA A O   1 
ATOM   21    C CB  . ALA A 1 8   ? -16.763 97.383  80.259  1.00   95.13 ? 8    ALA A CB  1 
ATOM   22    N N   . LYS A 1 9   ? -15.354 94.779  81.216  1.00   97.05 ? 9    LYS A N   1 
ATOM   23    C CA  . LYS A 1 9   ? -14.837 93.436  80.967  1.00   97.07 ? 9    LYS A CA  1 
ATOM   24    C C   . LYS A 1 9   ? -15.905 92.354  80.798  1.00   97.60 ? 9    LYS A C   1 
ATOM   25    O O   . LYS A 1 9   ? -15.582 91.166  80.703  1.00   97.43 ? 9    LYS A O   1 
ATOM   26    C CB  . LYS A 1 9   ? -13.884 93.031  82.088  1.00   96.24 ? 9    LYS A CB  1 
ATOM   27    C CG  . LYS A 1 9   ? -14.140 93.726  83.418  1.00   97.28 ? 9    LYS A CG  1 
ATOM   28    C CD  . LYS A 1 9   ? -13.142 94.858  83.646  1.00   96.23 ? 9    LYS A CD  1 
ATOM   29    C CE  . LYS A 1 9   ? -13.246 95.428  85.053  1.00   95.36 ? 9    LYS A CE  1 
ATOM   30    N NZ  . LYS A 1 9   ? -12.105 96.334  85.380  1.00   94.27 ? 9    LYS A NZ  1 
ATOM   31    N N   . ARG A 1 10  ? -17.170 92.761  80.747  1.00   97.74 ? 10   ARG A N   1 
ATOM   32    C CA  . ARG A 1 10  ? -18.273 91.816  80.594  1.00   98.32 ? 10   ARG A CA  1 
ATOM   33    C C   . ARG A 1 10  ? -18.378 90.879  81.799  1.00   99.00 ? 10   ARG A C   1 
ATOM   34    O O   . ARG A 1 10  ? -18.821 89.735  81.676  1.00   98.91 ? 10   ARG A O   1 
ATOM   35    C CB  . ARG A 1 10  ? -18.101 91.003  79.307  1.00   98.45 ? 10   ARG A CB  1 
ATOM   36    C CG  . ARG A 1 10  ? -19.013 91.442  78.169  1.00   98.73 ? 10   ARG A CG  1 
ATOM   37    C CD  . ARG A 1 10  ? -20.467 91.052  78.433  1.00   98.18 ? 10   ARG A CD  1 
ATOM   38    N NE  . ARG A 1 10  ? -21.353 91.409  77.324  1.00   98.64 ? 10   ARG A NE  1 
ATOM   39    C CZ  . ARG A 1 10  ? -21.460 90.727  76.185  1.00   99.00 ? 10   ARG A CZ  1 
ATOM   40    N NH1 . ARG A 1 10  ? -20.742 89.631  75.987  1.00   99.00 ? 10   ARG A NH1 1 
ATOM   41    N NH2 . ARG A 1 10  ? -22.285 91.147  75.233  1.00   99.00 ? 10   ARG A NH2 1 
ATOM   42    N N   . ALA A 1 11  ? -17.957 91.392  82.956  1.00   99.00 ? 11   ALA A N   1 
ATOM   43    C CA  . ALA A 1 11  ? -17.976 90.692  84.242  1.00   99.00 ? 11   ALA A CA  1 
ATOM   44    C C   . ALA A 1 11  ? -17.597 89.207  84.262  1.00   99.00 ? 11   ALA A C   1 
ATOM   45    O O   . ALA A 1 11  ? -18.470 88.335  84.261  1.00   99.00 ? 11   ALA A O   1 
ATOM   46    C CB  . ALA A 1 11  ? -19.337 90.883  84.906  1.00   98.68 ? 11   ALA A CB  1 
ATOM   47    N N   . TYR A 1 12  ? -16.295 88.928  84.287  1.00   98.94 ? 12   TYR A N   1 
ATOM   48    C CA  . TYR A 1 12  ? -15.797 87.557  84.358  1.00   98.69 ? 12   TYR A CA  1 
ATOM   49    C C   . TYR A 1 12  ? -14.342 87.548  84.833  1.00   98.93 ? 12   TYR A C   1 
ATOM   50    O O   . TYR A 1 12  ? -13.413 87.354  84.041  1.00   99.00 ? 12   TYR A O   1 
ATOM   51    C CB  . TYR A 1 12  ? -15.925 86.852  83.006  1.00   98.06 ? 12   TYR A CB  1 
ATOM   52    C CG  . TYR A 1 12  ? -16.206 85.374  83.157  1.00   98.02 ? 12   TYR A CG  1 
ATOM   53    C CD1 . TYR A 1 12  ? -16.921 84.677  82.183  1.00   98.08 ? 12   TYR A CD1 1 
ATOM   54    C CD2 . TYR A 1 12  ? -15.790 84.679  84.296  1.00   98.19 ? 12   TYR A CD2 1 
ATOM   55    C CE1 . TYR A 1 12  ? -17.221 83.326  82.341  1.00   98.31 ? 12   TYR A CE1 1 
ATOM   56    C CE2 . TYR A 1 12  ? -16.080 83.330  84.466  1.00   99.00 ? 12   TYR A CE2 1 
ATOM   57    C CZ  . TYR A 1 12  ? -16.797 82.659  83.487  1.00   99.00 ? 12   TYR A CZ  1 
ATOM   58    O OH  . TYR A 1 12  ? -17.090 81.323  83.664  1.00   99.00 ? 12   TYR A OH  1 
ATOM   59    N N   . PRO A 1 13  ? -14.137 87.757  86.150  1.00   98.11 ? 13   PRO A N   1 
ATOM   60    C CA  . PRO A 1 13  ? -12.850 87.804  86.852  1.00   97.39 ? 13   PRO A CA  1 
ATOM   61    C C   . PRO A 1 13  ? -11.924 86.605  86.665  1.00   96.91 ? 13   PRO A C   1 
ATOM   62    O O   . PRO A 1 13  ? -12.280 85.602  86.042  1.00   96.67 ? 13   PRO A O   1 
ATOM   63    C CB  . PRO A 1 13  ? -13.264 87.972  88.312  1.00   97.72 ? 13   PRO A CB  1 
ATOM   64    C CG  . PRO A 1 13  ? -14.549 88.724  88.209  1.00   97.60 ? 13   PRO A CG  1 
ATOM   65    C CD  . PRO A 1 13  ? -15.239 87.986  87.102  1.00   96.98 ? 13   PRO A CD  1 
ATOM   66    N N   . TYR A 1 14  ? -10.726 86.739  87.225  1.00   96.21 ? 14   TYR A N   1 
ATOM   67    C CA  . TYR A 1 14  ? -9.701  85.708  87.177  1.00   95.53 ? 14   TYR A CA  1 
ATOM   68    C C   . TYR A 1 14  ? -9.115  85.529  88.573  1.00   95.66 ? 14   TYR A C   1 
ATOM   69    O O   . TYR A 1 14  ? -8.823  86.511  89.258  1.00   95.54 ? 14   TYR A O   1 
ATOM   70    C CB  . TYR A 1 14  ? -8.595  86.105  86.188  1.00   93.92 ? 14   TYR A CB  1 
ATOM   71    C CG  . TYR A 1 14  ? -7.186  85.761  86.645  1.00   92.04 ? 14   TYR A CG  1 
ATOM   72    C CD1 . TYR A 1 14  ? -6.428  86.679  87.377  1.00   91.39 ? 14   TYR A CD1 1 
ATOM   73    C CD2 . TYR A 1 14  ? -6.624  84.510  86.373  1.00   90.35 ? 14   TYR A CD2 1 
ATOM   74    C CE1 . TYR A 1 14  ? -5.144  86.359  87.831  1.00   91.32 ? 14   TYR A CE1 1 
ATOM   75    C CE2 . TYR A 1 14  ? -5.341  84.178  86.822  1.00   90.27 ? 14   TYR A CE2 1 
ATOM   76    C CZ  . TYR A 1 14  ? -4.609  85.108  87.551  1.00   91.33 ? 14   TYR A CZ  1 
ATOM   77    O OH  . TYR A 1 14  ? -3.350  84.787  88.012  1.00   91.52 ? 14   TYR A OH  1 
ATOM   78    N N   . GLU A 1 15  ? -8.947  84.275  88.988  1.00   95.80 ? 15   GLU A N   1 
ATOM   79    C CA  . GLU A 1 15  ? -8.389  83.962  90.300  1.00   95.99 ? 15   GLU A CA  1 
ATOM   80    C C   . GLU A 1 15  ? -8.386  82.457  90.554  1.00   96.17 ? 15   GLU A C   1 
ATOM   81    O O   . GLU A 1 15  ? -9.167  81.713  89.956  1.00   96.08 ? 15   GLU A O   1 
ATOM   82    C CB  . GLU A 1 15  ? -9.189  84.679  91.397  1.00   96.50 ? 15   GLU A CB  1 
ATOM   83    C CG  . GLU A 1 15  ? -10.687 84.396  91.370  1.00   96.30 ? 15   GLU A CG  1 
ATOM   84    C CD  . GLU A 1 15  ? -11.472 85.313  92.291  1.00   95.85 ? 15   GLU A CD  1 
ATOM   85    O OE1 . GLU A 1 15  ? -12.711 85.167  92.370  1.00   96.06 ? 15   GLU A OE1 1 
ATOM   86    O OE2 . GLU A 1 15  ? -10.848 86.181  92.932  1.00   95.22 ? 15   GLU A OE2 1 
ATOM   87    N N   . THR A 1 16  ? -7.496  82.013  91.437  1.00   95.84 ? 16   THR A N   1 
ATOM   88    C CA  . THR A 1 16  ? -7.389  80.598  91.783  1.00   95.01 ? 16   THR A CA  1 
ATOM   89    C C   . THR A 1 16  ? -7.314  80.421  93.297  1.00   93.86 ? 16   THR A C   1 
ATOM   90    O O   . THR A 1 16  ? -6.221  80.421  93.870  1.00   94.29 ? 16   THR A O   1 
ATOM   91    C CB  . THR A 1 16  ? -6.129  79.951  91.144  1.00   95.85 ? 16   THR A CB  1 
ATOM   92    O OG1 . THR A 1 16  ? -6.254  79.960  89.715  1.00   95.29 ? 16   THR A OG1 1 
ATOM   93    C CG2 . THR A 1 16  ? -5.961  78.506  91.623  1.00   96.10 ? 16   THR A CG2 1 
ATOM   94    N N   . GLU A 1 17  ? -8.476  80.277  93.939  1.00   91.78 ? 17   GLU A N   1 
ATOM   95    C CA  . GLU A 1 17  ? -8.536  80.089  95.391  1.00   88.67 ? 17   GLU A CA  1 
ATOM   96    C C   . GLU A 1 17  ? -7.542  79.020  95.823  1.00   85.34 ? 17   GLU A C   1 
ATOM   97    O O   . GLU A 1 17  ? -7.123  78.188  95.014  1.00   85.55 ? 17   GLU A O   1 
ATOM   98    C CB  . GLU A 1 17  ? -9.951  79.686  95.838  1.00   89.31 ? 17   GLU A CB  1 
ATOM   99    C CG  . GLU A 1 17  ? -10.834 80.845  96.305  1.00   91.34 ? 17   GLU A CG  1 
ATOM   100   C CD  . GLU A 1 17  ? -11.236 81.794  95.183  1.00   92.89 ? 17   GLU A CD  1 
ATOM   101   O OE1 . GLU A 1 17  ? -11.926 82.796  95.469  1.00   91.51 ? 17   GLU A OE1 1 
ATOM   102   O OE2 . GLU A 1 17  ? -10.866 81.540  94.016  1.00   94.49 ? 17   GLU A OE2 1 
ATOM   103   N N   . LYS A 1 18  ? -7.167  79.045  97.098  1.00   81.31 ? 18   LYS A N   1 
ATOM   104   C CA  . LYS A 1 18  ? -6.207  78.081  97.627  1.00   76.99 ? 18   LYS A CA  1 
ATOM   105   C C   . LYS A 1 18  ? -6.612  76.634  97.370  1.00   73.01 ? 18   LYS A C   1 
ATOM   106   O O   . LYS A 1 18  ? -7.608  76.146  97.905  1.00   73.79 ? 18   LYS A O   1 
ATOM   107   C CB  . LYS A 1 18  ? -6.003  78.293  99.131  1.00   77.15 ? 18   LYS A CB  1 
ATOM   108   C CG  . LYS A 1 18  ? -4.558  78.553  99.500  1.00   77.09 ? 18   LYS A CG  1 
ATOM   109   C CD  . LYS A 1 18  ? -3.675  77.402  99.049  1.00   76.47 ? 18   LYS A CD  1 
ATOM   110   C CE  . LYS A 1 18  ? -2.316  77.900  98.583  1.00   77.89 ? 18   LYS A CE  1 
ATOM   111   N NZ  . LYS A 1 18  ? -1.445  76.783  98.118  1.00   76.35 ? 18   LYS A NZ  1 
ATOM   112   N N   . ARG A 1 19  ? -5.827  75.952  96.544  1.00   67.89 ? 19   ARG A N   1 
ATOM   113   C CA  . ARG A 1 19  ? -6.091  74.561  96.222  1.00   60.92 ? 19   ARG A CA  1 
ATOM   114   C C   . ARG A 1 19  ? -6.071  73.756  97.509  1.00   57.45 ? 19   ARG A C   1 
ATOM   115   O O   . ARG A 1 19  ? -5.188  73.925  98.342  1.00   57.30 ? 19   ARG A O   1 
ATOM   116   C CB  . ARG A 1 19  ? -5.015  74.028  95.280  1.00   59.00 ? 19   ARG A CB  1 
ATOM   117   C CG  . ARG A 1 19  ? -4.912  74.770  93.968  1.00   56.45 ? 19   ARG A CG  1 
ATOM   118   C CD  . ARG A 1 19  ? -3.591  74.456  93.297  1.00   53.67 ? 19   ARG A CD  1 
ATOM   119   N NE  . ARG A 1 19  ? -3.447  73.044  92.955  1.00   47.94 ? 19   ARG A NE  1 
ATOM   120   C CZ  . ARG A 1 19  ? -3.460  72.571  91.709  1.00   47.52 ? 19   ARG A CZ  1 
ATOM   121   N NH1 . ARG A 1 19  ? -3.614  73.398  90.672  1.00   45.02 ? 19   ARG A NH1 1 
ATOM   122   N NH2 . ARG A 1 19  ? -3.325  71.267  91.496  1.00   42.37 ? 19   ARG A NH2 1 
ATOM   123   N N   . ASP A 1 20  ? -7.061  72.895  97.677  1.00   54.01 ? 20   ASP A N   1 
ATOM   124   C CA  . ASP A 1 20  ? -7.128  72.050  98.848  1.00   50.43 ? 20   ASP A CA  1 
ATOM   125   C C   . ASP A 1 20  ? -5.967  71.076  98.768  1.00   48.85 ? 20   ASP A C   1 
ATOM   126   O O   . ASP A 1 20  ? -5.377  70.883  97.705  1.00   47.22 ? 20   ASP A O   1 
ATOM   127   C CB  . ASP A 1 20  ? -8.440  71.283  98.866  1.00   51.54 ? 20   ASP A CB  1 
ATOM   128   C CG  . ASP A 1 20  ? -9.449  71.892  99.794  1.00   52.14 ? 20   ASP A CG  1 
ATOM   129   O OD1 . ASP A 1 20  ? -9.101  72.069  100.974 1.00   53.94 ? 20   ASP A OD1 1 
ATOM   130   O OD2 . ASP A 1 20  ? -10.582 72.183  99.352  1.00   52.69 ? 20   ASP A OD2 1 
ATOM   131   N N   . LYS A 1 21  ? -5.659  70.450  99.896  1.00   47.28 ? 21   LYS A N   1 
ATOM   132   C CA  . LYS A 1 21  ? -4.561  69.503  99.972  1.00   45.58 ? 21   LYS A CA  1 
ATOM   133   C C   . LYS A 1 21  ? -4.661  68.439  98.884  1.00   43.52 ? 21   LYS A C   1 
ATOM   134   O O   . LYS A 1 21  ? -3.751  68.288  98.078  1.00   45.22 ? 21   LYS A O   1 
ATOM   135   C CB  . LYS A 1 21  ? -4.523  68.852  101.356 1.00   46.66 ? 21   LYS A CB  1 
ATOM   136   C CG  . LYS A 1 21  ? -4.802  69.812  102.528 1.00   46.83 ? 21   LYS A CG  1 
ATOM   137   C CD  . LYS A 1 21  ? -4.122  71.190  102.387 1.00   47.81 ? 21   LYS A CD  1 
ATOM   138   C CE  . LYS A 1 21  ? -2.596  71.118  102.339 1.00   45.28 ? 21   LYS A CE  1 
ATOM   139   N NZ  . LYS A 1 21  ? -1.991  72.472  102.521 1.00   38.36 ? 21   LYS A NZ  1 
ATOM   140   N N   . THR A 1 22  ? -5.749  67.686  98.876  1.00   40.44 ? 22   THR A N   1 
ATOM   141   C CA  . THR A 1 22  ? -5.943  66.680  97.843  1.00   37.15 ? 22   THR A CA  1 
ATOM   142   C C   . THR A 1 22  ? -6.777  67.358  96.742  1.00   35.62 ? 22   THR A C   1 
ATOM   143   O O   . THR A 1 22  ? -7.990  67.514  96.875  1.00   35.80 ? 22   THR A O   1 
ATOM   144   C CB  . THR A 1 22  ? -6.665  65.435  98.402  1.00   35.77 ? 22   THR A CB  1 
ATOM   145   O OG1 . THR A 1 22  ? -7.918  65.819  98.973  1.00   47.20 ? 22   THR A OG1 1 
ATOM   146   C CG2 . THR A 1 22  ? -5.827  64.794  99.494  1.00   38.29 ? 22   THR A CG2 1 
ATOM   147   N N   . TYR A 1 23  ? -6.094  67.782  95.677  1.00   32.44 ? 23   TYR A N   1 
ATOM   148   C CA  . TYR A 1 23  ? -6.697  68.479  94.551  1.00   29.14 ? 23   TYR A CA  1 
ATOM   149   C C   . TYR A 1 23  ? -7.011  67.540  93.383  1.00   27.94 ? 23   TYR A C   1 
ATOM   150   O O   . TYR A 1 23  ? -6.104  67.051  92.719  1.00   25.57 ? 23   TYR A O   1 
ATOM   151   C CB  . TYR A 1 23  ? -5.727  69.573  94.082  1.00   30.42 ? 23   TYR A CB  1 
ATOM   152   C CG  . TYR A 1 23  ? -6.376  70.706  93.330  1.00   29.48 ? 23   TYR A CG  1 
ATOM   153   C CD1 . TYR A 1 23  ? -7.113  71.689  94.008  1.00   31.24 ? 23   TYR A CD1 1 
ATOM   154   C CD2 . TYR A 1 23  ? -6.310  70.761  91.940  1.00   24.27 ? 23   TYR A CD2 1 
ATOM   155   C CE1 . TYR A 1 23  ? -7.783  72.696  93.319  1.00   27.76 ? 23   TYR A CE1 1 
ATOM   156   C CE2 . TYR A 1 23  ? -6.971  71.758  91.242  1.00   26.76 ? 23   TYR A CE2 1 
ATOM   157   C CZ  . TYR A 1 23  ? -7.713  72.723  91.935  1.00   30.25 ? 23   TYR A CZ  1 
ATOM   158   O OH  . TYR A 1 23  ? -8.413  73.687  91.234  1.00   31.61 ? 23   TYR A OH  1 
ATOM   159   N N   . LEU A 1 24  ? -8.296  67.291  93.137  1.00   26.34 ? 24   LEU A N   1 
ATOM   160   C CA  . LEU A 1 24  ? -8.732  66.415  92.042  1.00   23.45 ? 24   LEU A CA  1 
ATOM   161   C C   . LEU A 1 24  ? -9.728  67.151  91.128  1.00   23.54 ? 24   LEU A C   1 
ATOM   162   O O   . LEU A 1 24  ? -10.661 66.533  90.600  1.00   20.70 ? 24   LEU A O   1 
ATOM   163   C CB  . LEU A 1 24  ? -9.404  65.153  92.612  1.00   19.34 ? 24   LEU A CB  1 
ATOM   164   C CG  . LEU A 1 24  ? -8.536  64.283  93.549  1.00   22.75 ? 24   LEU A CG  1 
ATOM   165   C CD1 . LEU A 1 24  ? -9.403  63.419  94.474  1.00   16.08 ? 24   LEU A CD1 1 
ATOM   166   C CD2 . LEU A 1 24  ? -7.590  63.401  92.703  1.00   18.66 ? 24   LEU A CD2 1 
ATOM   167   N N   . ALA A 1 25  ? -9.507  68.455  90.920  1.00   24.17 ? 25   ALA A N   1 
ATOM   168   C CA  . ALA A 1 25  ? -10.421 69.269  90.123  1.00   23.01 ? 25   ALA A CA  1 
ATOM   169   C C   . ALA A 1 25  ? -9.962  69.825  88.786  1.00   21.26 ? 25   ALA A C   1 
ATOM   170   O O   . ALA A 1 25  ? -10.762 70.400  88.076  1.00   22.62 ? 25   ALA A O   1 
ATOM   171   C CB  . ALA A 1 25  ? -10.962 70.406  90.986  1.00   22.52 ? 25   ALA A CB  1 
ATOM   172   N N   . LEU A 1 26  ? -8.696  69.657  88.427  1.00   23.72 ? 26   LEU A N   1 
ATOM   173   C CA  . LEU A 1 26  ? -8.206  70.202  87.160  1.00   20.13 ? 26   LEU A CA  1 
ATOM   174   C C   . LEU A 1 26  ? -7.691  69.161  86.179  1.00   20.11 ? 26   LEU A C   1 
ATOM   175   O O   . LEU A 1 26  ? -6.871  69.476  85.313  1.00   18.40 ? 26   LEU A O   1 
ATOM   176   C CB  . LEU A 1 26  ? -7.109  71.248  87.401  1.00   19.65 ? 26   LEU A CB  1 
ATOM   177   C CG  . LEU A 1 26  ? -7.598  72.634  87.806  1.00   20.85 ? 26   LEU A CG  1 
ATOM   178   C CD1 . LEU A 1 26  ? -6.438  73.488  88.219  1.00   17.85 ? 26   LEU A CD1 1 
ATOM   179   C CD2 . LEU A 1 26  ? -8.370  73.277  86.650  1.00   24.85 ? 26   LEU A CD2 1 
ATOM   180   N N   . ASN A 1 27  ? -8.164  67.924  86.296  1.00   20.94 ? 27   ASN A N   1 
ATOM   181   C CA  . ASN A 1 27  ? -7.741  66.897  85.353  1.00   17.22 ? 27   ASN A CA  1 
ATOM   182   C C   . ASN A 1 27  ? -6.221  66.852  85.182  1.00   17.23 ? 27   ASN A C   1 
ATOM   183   O O   . ASN A 1 27  ? -5.709  66.529  84.128  1.00   15.22 ? 27   ASN A O   1 
ATOM   184   C CB  . ASN A 1 27  ? -8.430  67.133  84.014  1.00   18.88 ? 27   ASN A CB  1 
ATOM   185   C CG  . ASN A 1 27  ? -9.908  66.753  84.057  1.00   20.29 ? 27   ASN A CG  1 
ATOM   186   O OD1 . ASN A 1 27  ? -10.711 67.157  83.207  1.00   20.73 ? 27   ASN A OD1 1 
ATOM   187   N ND2 . ASN A 1 27  ? -10.266 65.962  85.058  1.00   19.74 ? 27   ASN A ND2 1 
ATOM   188   N N   . GLU A 1 28  ? -5.507  67.199  86.240  1.00   17.46 ? 28   GLU A N   1 
ATOM   189   C CA  . GLU A 1 28  ? -4.052  67.164  86.237  1.00   17.18 ? 28   GLU A CA  1 
ATOM   190   C C   . GLU A 1 28  ? -3.519  65.698  86.414  1.00   19.03 ? 28   GLU A C   1 
ATOM   191   O O   . GLU A 1 28  ? -4.107  64.868  87.132  1.00   17.01 ? 28   GLU A O   1 
ATOM   192   C CB  . GLU A 1 28  ? -3.534  68.046  87.381  1.00   16.97 ? 28   GLU A CB  1 
ATOM   193   C CG  . GLU A 1 28  ? -3.813  69.544  87.224  1.00   18.67 ? 28   GLU A CG  1 
ATOM   194   C CD  . GLU A 1 28  ? -3.831  70.294  88.548  1.00   20.33 ? 28   GLU A CD  1 
ATOM   195   O OE1 . GLU A 1 28  ? -3.482  71.490  88.527  1.00   26.24 ? 28   GLU A OE1 1 
ATOM   196   O OE2 . GLU A 1 28  ? -4.200  69.706  89.603  1.00   17.42 ? 28   GLU A OE2 1 
ATOM   197   N N   . ASN A 1 29  ? -2.415  65.371  85.745  1.00   18.80 ? 29   ASN A N   1 
ATOM   198   C CA  . ASN A 1 29  ? -1.822  64.053  85.922  1.00   18.03 ? 29   ASN A CA  1 
ATOM   199   C C   . ASN A 1 29  ? -1.531  63.925  87.419  1.00   16.82 ? 29   ASN A C   1 
ATOM   200   O O   . ASN A 1 29  ? -1.215  64.899  88.096  1.00   17.20 ? 29   ASN A O   1 
ATOM   201   C CB  . ASN A 1 29  ? -0.505  63.907  85.139  1.00   15.81 ? 29   ASN A CB  1 
ATOM   202   C CG  . ASN A 1 29  ? -0.129  62.466  84.949  1.00   16.01 ? 29   ASN A CG  1 
ATOM   203   O OD1 . ASN A 1 29  ? 0.417   61.831  85.866  1.00   14.82 ? 29   ASN A OD1 1 
ATOM   204   N ND2 . ASN A 1 29  ? -0.473  61.904  83.769  1.00   7.72  ? 29   ASN A ND2 1 
ATOM   205   N N   . PRO A 1 30  ? -1.659  62.723  87.965  1.00   19.43 ? 30   PRO A N   1 
ATOM   206   C CA  . PRO A 1 30  ? -1.391  62.565  89.389  1.00   20.32 ? 30   PRO A CA  1 
ATOM   207   C C   . PRO A 1 30  ? 0.111   62.438  89.726  1.00   22.73 ? 30   PRO A C   1 
ATOM   208   O O   . PRO A 1 30  ? 0.527   62.695  90.856  1.00   22.83 ? 30   PRO A O   1 
ATOM   209   C CB  . PRO A 1 30  ? -2.192  61.322  89.743  1.00   21.79 ? 30   PRO A CB  1 
ATOM   210   C CG  . PRO A 1 30  ? -2.191  60.552  88.481  1.00   19.86 ? 30   PRO A CG  1 
ATOM   211   C CD  . PRO A 1 30  ? -2.194  61.494  87.353  1.00   17.71 ? 30   PRO A CD  1 
ATOM   212   N N   . PHE A 1 31  ? 0.908   62.067  88.728  1.00   21.80 ? 31   PHE A N   1 
ATOM   213   C CA  . PHE A 1 31  ? 2.345   61.880  88.898  1.00   22.83 ? 31   PHE A CA  1 
ATOM   214   C C   . PHE A 1 31  ? 3.247   63.037  88.445  1.00   25.03 ? 31   PHE A C   1 
ATOM   215   O O   . PHE A 1 31  ? 3.009   63.678  87.422  1.00   24.68 ? 31   PHE A O   1 
ATOM   216   C CB  . PHE A 1 31  ? 2.760   60.622  88.164  1.00   24.43 ? 31   PHE A CB  1 
ATOM   217   C CG  . PHE A 1 31  ? 1.923   59.428  88.508  1.00   21.41 ? 31   PHE A CG  1 
ATOM   218   C CD1 . PHE A 1 31  ? 1.229   58.741  87.524  1.00   22.67 ? 31   PHE A CD1 1 
ATOM   219   C CD2 . PHE A 1 31  ? 1.810   59.008  89.831  1.00   23.82 ? 31   PHE A CD2 1 
ATOM   220   C CE1 . PHE A 1 31  ? 0.428   57.647  87.850  1.00   30.08 ? 31   PHE A CE1 1 
ATOM   221   C CE2 . PHE A 1 31  ? 1.013   57.914  90.180  1.00   29.39 ? 31   PHE A CE2 1 
ATOM   222   C CZ  . PHE A 1 31  ? 0.319   57.231  89.193  1.00   30.40 ? 31   PHE A CZ  1 
ATOM   223   N N   . PRO A 1 32  ? 4.315   63.297  89.203  1.00   24.87 ? 32   PRO A N   1 
ATOM   224   C CA  . PRO A 1 32  ? 5.241   64.378  88.859  1.00   23.94 ? 32   PRO A CA  1 
ATOM   225   C C   . PRO A 1 32  ? 5.990   64.061  87.602  1.00   20.76 ? 32   PRO A C   1 
ATOM   226   O O   . PRO A 1 32  ? 6.053   62.912  87.177  1.00   20.66 ? 32   PRO A O   1 
ATOM   227   C CB  . PRO A 1 32  ? 6.154   64.450  90.069  1.00   23.68 ? 32   PRO A CB  1 
ATOM   228   C CG  . PRO A 1 32  ? 6.181   63.036  90.540  1.00   25.38 ? 32   PRO A CG  1 
ATOM   229   C CD  . PRO A 1 32  ? 4.749   62.615  90.437  1.00   25.91 ? 32   PRO A CD  1 
ATOM   230   N N   . PHE A 1 33  ? 6.545   65.085  86.982  1.00   18.83 ? 33   PHE A N   1 
ATOM   231   C CA  . PHE A 1 33  ? 7.314   64.850  85.767  1.00   17.82 ? 33   PHE A CA  1 
ATOM   232   C C   . PHE A 1 33  ? 8.520   64.047  86.248  1.00   18.32 ? 33   PHE A C   1 
ATOM   233   O O   . PHE A 1 33  ? 9.073   64.355  87.303  1.00   18.78 ? 33   PHE A O   1 
ATOM   234   C CB  . PHE A 1 33  ? 7.766   66.170  85.152  1.00   14.45 ? 33   PHE A CB  1 
ATOM   235   C CG  . PHE A 1 33  ? 8.205   66.040  83.731  1.00   12.27 ? 33   PHE A CG  1 
ATOM   236   C CD1 . PHE A 1 33  ? 7.286   65.705  82.766  1.00   7.42  ? 33   PHE A CD1 1 
ATOM   237   C CD2 . PHE A 1 33  ? 9.569   66.129  83.385  1.00   11.47 ? 33   PHE A CD2 1 
ATOM   238   C CE1 . PHE A 1 33  ? 7.681   65.442  81.472  1.00   5.63  ? 33   PHE A CE1 1 
ATOM   239   C CE2 . PHE A 1 33  ? 9.988   65.867  82.110  1.00   3.17  ? 33   PHE A CE2 1 
ATOM   240   C CZ  . PHE A 1 33  ? 9.027   65.515  81.138  1.00   10.75 ? 33   PHE A CZ  1 
ATOM   241   N N   . PRO A 1 34  ? 8.951   63.034  85.490  1.00   16.11 ? 34   PRO A N   1 
ATOM   242   C CA  . PRO A 1 34  ? 10.108  62.257  85.965  1.00   19.72 ? 34   PRO A CA  1 
ATOM   243   C C   . PRO A 1 34  ? 11.387  63.052  86.260  1.00   21.91 ? 34   PRO A C   1 
ATOM   244   O O   . PRO A 1 34  ? 11.853  63.865  85.455  1.00   17.61 ? 34   PRO A O   1 
ATOM   245   C CB  . PRO A 1 34  ? 10.283  61.202  84.874  1.00   17.14 ? 34   PRO A CB  1 
ATOM   246   C CG  . PRO A 1 34  ? 8.858   61.008  84.369  1.00   17.03 ? 34   PRO A CG  1 
ATOM   247   C CD  . PRO A 1 34  ? 8.408   62.458  84.249  1.00   18.25 ? 34   PRO A CD  1 
ATOM   248   N N   . GLU A 1 35  ? 11.946  62.812  87.441  1.00   26.04 ? 35   GLU A N   1 
ATOM   249   C CA  . GLU A 1 35  ? 13.162  63.503  87.881  1.00   30.12 ? 35   GLU A CA  1 
ATOM   250   C C   . GLU A 1 35  ? 14.301  63.397  86.886  1.00   29.06 ? 35   GLU A C   1 
ATOM   251   O O   . GLU A 1 35  ? 15.068  64.324  86.700  1.00   29.93 ? 35   GLU A O   1 
ATOM   252   C CB  . GLU A 1 35  ? 13.637  62.944  89.218  1.00   34.20 ? 35   GLU A CB  1 
ATOM   253   C CG  . GLU A 1 35  ? 14.192  63.998  90.169  1.00   47.05 ? 35   GLU A CG  1 
ATOM   254   C CD  . GLU A 1 35  ? 15.047  63.398  91.291  1.00   52.23 ? 35   GLU A CD  1 
ATOM   255   O OE1 . GLU A 1 35  ? 15.550  64.160  92.156  1.00   52.26 ? 35   GLU A OE1 1 
ATOM   256   O OE2 . GLU A 1 35  ? 15.220  62.158  91.299  1.00   57.37 ? 35   GLU A OE2 1 
ATOM   257   N N   . ASP A 1 36  ? 14.420  62.241  86.259  1.00   30.48 ? 36   ASP A N   1 
ATOM   258   C CA  . ASP A 1 36  ? 15.482  62.025  85.286  1.00   31.15 ? 36   ASP A CA  1 
ATOM   259   C C   . ASP A 1 36  ? 15.215  62.725  83.946  1.00   27.93 ? 36   ASP A C   1 
ATOM   260   O O   . ASP A 1 36  ? 16.137  63.142  83.258  1.00   28.89 ? 36   ASP A O   1 
ATOM   261   C CB  . ASP A 1 36  ? 15.644  60.531  85.083  1.00   32.40 ? 36   ASP A CB  1 
ATOM   262   C CG  . ASP A 1 36  ? 14.322  59.809  85.175  1.00   41.01 ? 36   ASP A CG  1 
ATOM   263   O OD1 . ASP A 1 36  ? 13.861  59.590  86.328  1.00   46.40 ? 36   ASP A OD1 1 
ATOM   264   O OD2 . ASP A 1 36  ? 13.735  59.496  84.110  1.00   36.39 ? 36   ASP A OD2 1 
ATOM   265   N N   . LEU A 1 37  ? 13.956  62.843  83.551  1.00   27.72 ? 37   LEU A N   1 
ATOM   266   C CA  . LEU A 1 37  ? 13.682  63.527  82.294  1.00   23.98 ? 37   LEU A CA  1 
ATOM   267   C C   . LEU A 1 37  ? 13.905  65.012  82.570  1.00   22.05 ? 37   LEU A C   1 
ATOM   268   O O   . LEU A 1 37  ? 14.375  65.762  81.720  1.00   21.35 ? 37   LEU A O   1 
ATOM   269   C CB  . LEU A 1 37  ? 12.262  63.223  81.809  1.00   21.74 ? 37   LEU A CB  1 
ATOM   270   C CG  . LEU A 1 37  ? 12.033  61.706  81.644  1.00   20.70 ? 37   LEU A CG  1 
ATOM   271   C CD1 . LEU A 1 37  ? 10.692  61.426  80.960  1.00   17.17 ? 37   LEU A CD1 1 
ATOM   272   C CD2 . LEU A 1 37  ? 13.171  61.119  80.815  1.00   16.55 ? 37   LEU A CD2 1 
ATOM   273   N N   . VAL A 1 38  ? 13.598  65.428  83.787  1.00   23.18 ? 38   VAL A N   1 
ATOM   274   C CA  . VAL A 1 38  ? 13.840  66.808  84.147  1.00   24.16 ? 38   VAL A CA  1 
ATOM   275   C C   . VAL A 1 38  ? 15.340  67.016  84.034  1.00   26.59 ? 38   VAL A C   1 
ATOM   276   O O   . VAL A 1 38  ? 15.807  68.058  83.560  1.00   26.05 ? 38   VAL A O   1 
ATOM   277   C CB  . VAL A 1 38  ? 13.426  67.120  85.588  1.00   23.34 ? 38   VAL A CB  1 
ATOM   278   C CG1 . VAL A 1 38  ? 13.843  68.580  85.948  1.00   24.18 ? 38   VAL A CG1 1 
ATOM   279   C CG2 . VAL A 1 38  ? 11.921  66.954  85.736  1.00   23.03 ? 38   VAL A CG2 1 
ATOM   280   N N   . ASP A 1 39  ? 16.104  66.009  84.457  1.00   28.00 ? 39   ASP A N   1 
ATOM   281   C CA  . ASP A 1 39  ? 17.544  66.128  84.399  1.00   26.56 ? 39   ASP A CA  1 
ATOM   282   C C   . ASP A 1 39  ? 17.972  66.208  82.953  1.00   25.08 ? 39   ASP A C   1 
ATOM   283   O O   . ASP A 1 39  ? 18.783  67.050  82.573  1.00   22.54 ? 39   ASP A O   1 
ATOM   284   C CB  . ASP A 1 39  ? 18.218  64.942  85.082  1.00   31.55 ? 39   ASP A CB  1 
ATOM   285   C CG  . ASP A 1 39  ? 19.703  65.179  85.293  1.00   37.53 ? 39   ASP A CG  1 
ATOM   286   O OD1 . ASP A 1 39  ? 20.455  65.218  84.290  1.00   36.97 ? 39   ASP A OD1 1 
ATOM   287   O OD2 . ASP A 1 39  ? 20.104  65.346  86.469  1.00   41.56 ? 39   ASP A OD2 1 
ATOM   288   N N   . GLU A 1 40  ? 17.422  65.324  82.138  1.00   24.05 ? 40   GLU A N   1 
ATOM   289   C CA  . GLU A 1 40  ? 17.747  65.327  80.712  1.00   24.62 ? 40   GLU A CA  1 
ATOM   290   C C   . GLU A 1 40  ? 17.455  66.673  80.029  1.00   23.17 ? 40   GLU A C   1 
ATOM   291   O O   . GLU A 1 40  ? 18.235  67.126  79.170  1.00   23.34 ? 40   GLU A O   1 
ATOM   292   C CB  . GLU A 1 40  ? 16.971  64.233  79.991  1.00   23.84 ? 40   GLU A CB  1 
ATOM   293   C CG  . GLU A 1 40  ? 17.321  64.104  78.519  1.00   24.21 ? 40   GLU A CG  1 
ATOM   294   C CD  . GLU A 1 40  ? 16.628  62.921  77.897  1.00   27.53 ? 40   GLU A CD  1 
ATOM   295   O OE1 . GLU A 1 40  ? 16.463  61.917  78.619  1.00   31.01 ? 40   GLU A OE1 1 
ATOM   296   O OE2 . GLU A 1 40  ? 16.258  62.976  76.706  1.00   28.17 ? 40   GLU A OE2 1 
ATOM   297   N N   . VAL A 1 41  ? 16.342  67.305  80.396  1.00   20.29 ? 41   VAL A N   1 
ATOM   298   C CA  . VAL A 1 41  ? 15.987  68.592  79.803  1.00   21.15 ? 41   VAL A CA  1 
ATOM   299   C C   . VAL A 1 41  ? 17.057  69.634  80.069  1.00   23.48 ? 41   VAL A C   1 
ATOM   300   O O   . VAL A 1 41  ? 17.513  70.295  79.144  1.00   23.73 ? 41   VAL A O   1 
ATOM   301   C CB  . VAL A 1 41  ? 14.649  69.164  80.346  1.00   20.14 ? 41   VAL A CB  1 
ATOM   302   C CG1 . VAL A 1 41  ? 14.490  70.597  79.852  1.00   21.35 ? 41   VAL A CG1 1 
ATOM   303   C CG2 . VAL A 1 41  ? 13.458  68.318  79.857  1.00   12.53 ? 41   VAL A CG2 1 
ATOM   304   N N   . PHE A 1 42  ? 17.460  69.777  81.332  1.00   26.18 ? 42   PHE A N   1 
ATOM   305   C CA  . PHE A 1 42  ? 18.473  70.762  81.675  1.00   28.22 ? 42   PHE A CA  1 
ATOM   306   C C   . PHE A 1 42  ? 19.823  70.361  81.137  1.00   27.43 ? 42   PHE A C   1 
ATOM   307   O O   . PHE A 1 42  ? 20.690  71.193  80.921  1.00   30.73 ? 42   PHE A O   1 
ATOM   308   C CB  . PHE A 1 42  ? 18.515  70.991  83.192  1.00   30.00 ? 42   PHE A CB  1 
ATOM   309   C CG  . PHE A 1 42  ? 17.485  71.983  83.662  1.00   30.58 ? 42   PHE A CG  1 
ATOM   310   C CD1 . PHE A 1 42  ? 16.138  71.633  83.743  1.00   30.81 ? 42   PHE A CD1 1 
ATOM   311   C CD2 . PHE A 1 42  ? 17.844  73.308  83.903  1.00   28.51 ? 42   PHE A CD2 1 
ATOM   312   C CE1 . PHE A 1 42  ? 15.173  72.604  84.050  1.00   30.70 ? 42   PHE A CE1 1 
ATOM   313   C CE2 . PHE A 1 42  ? 16.885  74.282  84.209  1.00   26.09 ? 42   PHE A CE2 1 
ATOM   314   C CZ  . PHE A 1 42  ? 15.554  73.929  84.279  1.00   25.31 ? 42   PHE A CZ  1 
ATOM   315   N N   . ARG A 1 43  ? 19.986  69.075  80.900  1.00   25.19 ? 43   ARG A N   1 
ATOM   316   C CA  . ARG A 1 43  ? 21.209  68.570  80.338  1.00   27.18 ? 43   ARG A CA  1 
ATOM   317   C C   . ARG A 1 43  ? 21.334  69.122  78.919  1.00   25.45 ? 43   ARG A C   1 
ATOM   318   O O   . ARG A 1 43  ? 22.367  69.618  78.531  1.00   27.75 ? 43   ARG A O   1 
ATOM   319   C CB  . ARG A 1 43  ? 21.147  67.043  80.310  1.00   30.92 ? 43   ARG A CB  1 
ATOM   320   C CG  . ARG A 1 43  ? 22.479  66.356  80.493  1.00   37.77 ? 43   ARG A CG  1 
ATOM   321   C CD  . ARG A 1 43  ? 22.307  65.030  81.237  1.00   44.86 ? 43   ARG A CD  1 
ATOM   322   N NE  . ARG A 1 43  ? 23.250  64.929  82.344  1.00   47.39 ? 43   ARG A NE  1 
ATOM   323   C CZ  . ARG A 1 43  ? 23.319  65.807  83.335  1.00   49.29 ? 43   ARG A CZ  1 
ATOM   324   N NH1 . ARG A 1 43  ? 22.497  66.844  83.360  1.00   55.19 ? 43   ARG A NH1 1 
ATOM   325   N NH2 . ARG A 1 43  ? 24.213  65.651  84.298  1.00   49.74 ? 43   ARG A NH2 1 
ATOM   326   N N   . ARG A 1 44  ? 20.260  69.020  78.148  1.00   24.71 ? 44   ARG A N   1 
ATOM   327   C CA  . ARG A 1 44  ? 20.241  69.520  76.777  1.00   20.50 ? 44   ARG A CA  1 
ATOM   328   C C   . ARG A 1 44  ? 19.976  71.031  76.708  1.00   20.70 ? 44   ARG A C   1 
ATOM   329   O O   . ARG A 1 44  ? 19.812  71.583  75.642  1.00   19.99 ? 44   ARG A O   1 
ATOM   330   C CB  . ARG A 1 44  ? 19.148  68.804  76.001  1.00   21.41 ? 44   ARG A CB  1 
ATOM   331   C CG  . ARG A 1 44  ? 19.184  67.286  76.140  1.00   28.27 ? 44   ARG A CG  1 
ATOM   332   C CD  . ARG A 1 44  ? 18.044  66.696  75.352  1.00   28.42 ? 44   ARG A CD  1 
ATOM   333   N NE  . ARG A 1 44  ? 17.864  67.473  74.131  1.00   33.57 ? 44   ARG A NE  1 
ATOM   334   C CZ  . ARG A 1 44  ? 16.960  67.207  73.194  1.00   34.67 ? 44   ARG A CZ  1 
ATOM   335   N NH1 . ARG A 1 44  ? 16.879  67.986  72.124  1.00   33.47 ? 44   ARG A NH1 1 
ATOM   336   N NH2 . ARG A 1 44  ? 16.150  66.165  73.324  1.00   36.87 ? 44   ARG A NH2 1 
ATOM   337   N N   . LEU A 1 45  ? 19.900  71.695  77.847  1.00   19.59 ? 45   LEU A N   1 
ATOM   338   C CA  . LEU A 1 45  ? 19.618  73.112  77.840  1.00   20.81 ? 45   LEU A CA  1 
ATOM   339   C C   . LEU A 1 45  ? 20.832  73.931  77.465  1.00   23.72 ? 45   LEU A C   1 
ATOM   340   O O   . LEU A 1 45  ? 21.866  73.851  78.128  1.00   25.88 ? 45   LEU A O   1 
ATOM   341   C CB  . LEU A 1 45  ? 19.126  73.544  79.208  1.00   20.97 ? 45   LEU A CB  1 
ATOM   342   C CG  . LEU A 1 45  ? 17.689  74.067  79.237  1.00   24.23 ? 45   LEU A CG  1 
ATOM   343   C CD1 . LEU A 1 45  ? 16.727  73.056  78.605  1.00   26.02 ? 45   LEU A CD1 1 
ATOM   344   C CD2 . LEU A 1 45  ? 17.296  74.366  80.675  1.00   20.25 ? 45   LEU A CD2 1 
ATOM   345   N N   . ASN A 1 46  ? 20.717  74.683  76.377  1.00   20.43 ? 46   ASN A N   1 
ATOM   346   C CA  . ASN A 1 46  ? 21.790  75.544  75.956  1.00   15.84 ? 46   ASN A CA  1 
ATOM   347   C C   . ASN A 1 46  ? 21.529  76.967  76.473  1.00   19.06 ? 46   ASN A C   1 
ATOM   348   O O   . ASN A 1 46  ? 20.601  77.657  75.998  1.00   18.43 ? 46   ASN A O   1 
ATOM   349   C CB  . ASN A 1 46  ? 21.911  75.584  74.439  1.00   16.41 ? 46   ASN A CB  1 
ATOM   350   C CG  . ASN A 1 46  ? 23.049  76.471  74.000  1.00   13.13 ? 46   ASN A CG  1 
ATOM   351   O OD1 . ASN A 1 46  ? 23.640  77.194  74.821  1.00   17.14 ? 46   ASN A OD1 1 
ATOM   352   N ND2 . ASN A 1 46  ? 23.356  76.458  72.717  1.00   21.15 ? 46   ASN A ND2 1 
ATOM   353   N N   . SER A 1 47  ? 22.363  77.383  77.425  1.00   16.46 ? 47   SER A N   1 
ATOM   354   C CA  . SER A 1 47  ? 22.293  78.698  78.070  1.00   18.76 ? 47   SER A CA  1 
ATOM   355   C C   . SER A 1 47  ? 22.338  79.891  77.111  1.00   16.86 ? 47   SER A C   1 
ATOM   356   O O   . SER A 1 47  ? 21.745  80.928  77.395  1.00   15.92 ? 47   SER A O   1 
ATOM   357   C CB  . SER A 1 47  ? 23.436  78.839  79.090  1.00   15.45 ? 47   SER A CB  1 
ATOM   358   O OG  . SER A 1 47  ? 23.096  78.259  80.339  1.00   22.73 ? 47   SER A OG  1 
ATOM   359   N N   . ASP A 1 48  ? 23.041  79.732  75.993  1.00   18.44 ? 48   ASP A N   1 
ATOM   360   C CA  . ASP A 1 48  ? 23.205  80.770  74.972  1.00   18.31 ? 48   ASP A CA  1 
ATOM   361   C C   . ASP A 1 48  ? 21.889  80.952  74.218  1.00   19.95 ? 48   ASP A C   1 
ATOM   362   O O   . ASP A 1 48  ? 21.609  82.035  73.702  1.00   20.55 ? 48   ASP A O   1 
ATOM   363   C CB  . ASP A 1 48  ? 24.301  80.338  73.987  1.00   20.02 ? 48   ASP A CB  1 
ATOM   364   C CG  . ASP A 1 48  ? 24.798  81.481  73.098  1.00   26.47 ? 48   ASP A CG  1 
ATOM   365   O OD1 . ASP A 1 48  ? 25.313  81.160  72.000  1.00   20.02 ? 48   ASP A OD1 1 
ATOM   366   O OD2 . ASP A 1 48  ? 24.699  82.680  73.502  1.00   30.21 ? 48   ASP A OD2 1 
ATOM   367   N N   . ALA A 1 49  ? 21.071  79.897  74.180  1.00   18.76 ? 49   ALA A N   1 
ATOM   368   C CA  . ALA A 1 49  ? 19.804  79.965  73.468  1.00   18.00 ? 49   ALA A CA  1 
ATOM   369   C C   . ALA A 1 49  ? 18.720  80.663  74.269  1.00   19.08 ? 49   ALA A C   1 
ATOM   370   O O   . ALA A 1 49  ? 17.730  81.095  73.697  1.00   19.15 ? 49   ALA A O   1 
ATOM   371   C CB  . ALA A 1 49  ? 19.338  78.571  73.043  1.00   14.33 ? 49   ALA A CB  1 
ATOM   372   N N   . LEU A 1 50  ? 18.904  80.806  75.582  1.00   21.13 ? 50   LEU A N   1 
ATOM   373   C CA  . LEU A 1 50  ? 17.884  81.503  76.378  1.00   18.16 ? 50   LEU A CA  1 
ATOM   374   C C   . LEU A 1 50  ? 17.804  82.987  76.024  1.00   16.58 ? 50   LEU A C   1 
ATOM   375   O O   . LEU A 1 50  ? 16.756  83.596  76.203  1.00   17.59 ? 50   LEU A O   1 
ATOM   376   C CB  . LEU A 1 50  ? 18.151  81.361  77.883  1.00   13.26 ? 50   LEU A CB  1 
ATOM   377   C CG  . LEU A 1 50  ? 17.996  79.970  78.524  1.00   16.04 ? 50   LEU A CG  1 
ATOM   378   C CD1 . LEU A 1 50  ? 18.389  80.043  80.005  1.00   13.63 ? 50   LEU A CD1 1 
ATOM   379   C CD2 . LEU A 1 50  ? 16.522  79.430  78.372  1.00   5.96  ? 50   LEU A CD2 1 
ATOM   380   N N   . ARG A 1 51  ? 18.895  83.577  75.537  1.00   18.12 ? 51   ARG A N   1 
ATOM   381   C CA  . ARG A 1 51  ? 18.886  85.033  75.230  1.00   18.60 ? 51   ARG A CA  1 
ATOM   382   C C   . ARG A 1 51  ? 18.292  85.403  73.858  1.00   19.08 ? 51   ARG A C   1 
ATOM   383   O O   . ARG A 1 51  ? 18.002  86.574  73.590  1.00   21.03 ? 51   ARG A O   1 
ATOM   384   C CB  . ARG A 1 51  ? 20.308  85.597  75.302  1.00   17.58 ? 51   ARG A CB  1 
ATOM   385   C CG  . ARG A 1 51  ? 21.134  85.126  74.132  1.00   17.23 ? 51   ARG A CG  1 
ATOM   386   C CD  . ARG A 1 51  ? 22.589  85.551  74.177  1.00   19.73 ? 51   ARG A CD  1 
ATOM   387   N NE  . ARG A 1 51  ? 23.264  84.996  73.002  1.00   23.55 ? 51   ARG A NE  1 
ATOM   388   C CZ  . ARG A 1 51  ? 23.263  85.580  71.807  1.00   20.79 ? 51   ARG A CZ  1 
ATOM   389   N NH1 . ARG A 1 51  ? 22.652  86.742  71.651  1.00   23.12 ? 51   ARG A NH1 1 
ATOM   390   N NH2 . ARG A 1 51  ? 23.827  84.989  70.764  1.00   18.86 ? 51   ARG A NH2 1 
ATOM   391   N N   . ILE A 1 52  ? 18.103  84.410  72.996  1.00   17.19 ? 52   ILE A N   1 
ATOM   392   C CA  . ILE A 1 52  ? 17.576  84.675  71.664  1.00   17.28 ? 52   ILE A CA  1 
ATOM   393   C C   . ILE A 1 52  ? 16.132  84.293  71.503  1.00   15.33 ? 52   ILE A C   1 
ATOM   394   O O   . ILE A 1 52  ? 15.601  83.533  72.290  1.00   10.91 ? 52   ILE A O   1 
ATOM   395   C CB  . ILE A 1 52  ? 18.301  83.855  70.560  1.00   18.93 ? 52   ILE A CB  1 
ATOM   396   C CG1 . ILE A 1 52  ? 17.910  82.385  70.698  1.00   19.15 ? 52   ILE A CG1 1 
ATOM   397   C CG2 . ILE A 1 52  ? 19.809  84.045  70.649  1.00   14.16 ? 52   ILE A CG2 1 
ATOM   398   C CD1 . ILE A 1 52  ? 17.945  81.583  69.399  1.00   19.41 ? 52   ILE A CD1 1 
ATOM   399   N N   . TYR A 1 53  ? 15.529  84.818  70.439  1.00   14.47 ? 53   TYR A N   1 
ATOM   400   C CA  . TYR A 1 53  ? 14.153  84.513  70.078  1.00   13.78 ? 53   TYR A CA  1 
ATOM   401   C C   . TYR A 1 53  ? 14.208  83.193  69.321  1.00   13.53 ? 53   TYR A C   1 
ATOM   402   O O   . TYR A 1 53  ? 14.725  83.112  68.225  1.00   14.44 ? 53   TYR A O   1 
ATOM   403   C CB  . TYR A 1 53  ? 13.608  85.626  69.228  1.00   11.45 ? 53   TYR A CB  1 
ATOM   404   C CG  . TYR A 1 53  ? 13.279  86.823  70.083  1.00   16.67 ? 53   TYR A CG  1 
ATOM   405   C CD1 . TYR A 1 53  ? 12.062  86.898  70.752  1.00   11.48 ? 53   TYR A CD1 1 
ATOM   406   C CD2 . TYR A 1 53  ? 14.196  87.862  70.254  1.00   13.35 ? 53   TYR A CD2 1 
ATOM   407   C CE1 . TYR A 1 53  ? 11.752  87.970  71.564  1.00   14.69 ? 53   TYR A CE1 1 
ATOM   408   C CE2 . TYR A 1 53  ? 13.908  88.945  71.067  1.00   17.53 ? 53   TYR A CE2 1 
ATOM   409   C CZ  . TYR A 1 53  ? 12.678  88.995  71.717  1.00   19.86 ? 53   TYR A CZ  1 
ATOM   410   O OH  . TYR A 1 53  ? 12.370  90.070  72.497  1.00   17.89 ? 53   TYR A OH  1 
ATOM   411   N N   . TYR A 1 54  ? 13.661  82.172  69.962  1.00   15.73 ? 54   TYR A N   1 
ATOM   412   C CA  . TYR A 1 54  ? 13.666  80.808  69.496  1.00   16.21 ? 54   TYR A CA  1 
ATOM   413   C C   . TYR A 1 54  ? 12.407  80.364  68.731  1.00   17.29 ? 54   TYR A C   1 
ATOM   414   O O   . TYR A 1 54  ? 11.302  80.384  69.274  1.00   18.08 ? 54   TYR A O   1 
ATOM   415   C CB  . TYR A 1 54  ? 13.872  79.927  70.722  1.00   13.33 ? 54   TYR A CB  1 
ATOM   416   C CG  . TYR A 1 54  ? 14.301  78.529  70.410  1.00   22.05 ? 54   TYR A CG  1 
ATOM   417   C CD1 . TYR A 1 54  ? 15.638  78.242  70.167  1.00   24.54 ? 54   TYR A CD1 1 
ATOM   418   C CD2 . TYR A 1 54  ? 13.370  77.494  70.322  1.00   21.68 ? 54   TYR A CD2 1 
ATOM   419   C CE1 . TYR A 1 54  ? 16.047  76.962  69.844  1.00   27.56 ? 54   TYR A CE1 1 
ATOM   420   C CE2 . TYR A 1 54  ? 13.766  76.200  69.986  1.00   23.48 ? 54   TYR A CE2 1 
ATOM   421   C CZ  . TYR A 1 54  ? 15.103  75.944  69.749  1.00   24.81 ? 54   TYR A CZ  1 
ATOM   422   O OH  . TYR A 1 54  ? 15.488  74.682  69.392  1.00   28.14 ? 54   TYR A OH  1 
ATOM   423   N N   . ASP A 1 55  ? 12.576  79.967  67.472  1.00   15.31 ? 55   ASP A N   1 
ATOM   424   C CA  . ASP A 1 55  ? 11.454  79.504  66.653  1.00   20.83 ? 55   ASP A CA  1 
ATOM   425   C C   . ASP A 1 55  ? 10.544  78.673  67.546  1.00   18.75 ? 55   ASP A C   1 
ATOM   426   O O   . ASP A 1 55  ? 10.990  77.675  68.077  1.00   17.26 ? 55   ASP A O   1 
ATOM   427   C CB  . ASP A 1 55  ? 11.986  78.664  65.498  1.00   22.50 ? 55   ASP A CB  1 
ATOM   428   C CG  . ASP A 1 55  ? 12.977  79.426  64.640  1.00   26.63 ? 55   ASP A CG  1 
ATOM   429   O OD1 . ASP A 1 55  ? 13.684  78.829  63.806  1.00   26.92 ? 55   ASP A OD1 1 
ATOM   430   O OD2 . ASP A 1 55  ? 13.031  80.661  64.799  1.00   29.85 ? 55   ASP A OD2 1 
ATOM   431   N N   . SER A 1 56  ? 9.289   79.083  67.745  1.00   22.74 ? 56   SER A N   1 
ATOM   432   C CA  . SER A 1 56  ? 8.436   78.330  68.657  1.00   22.11 ? 56   SER A CA  1 
ATOM   433   C C   . SER A 1 56  ? 8.093   77.072  67.943  1.00   27.26 ? 56   SER A C   1 
ATOM   434   O O   . SER A 1 56  ? 8.214   75.973  68.495  1.00   36.64 ? 56   SER A O   1 
ATOM   435   C CB  . SER A 1 56  ? 7.180   79.072  69.047  1.00   19.26 ? 56   SER A CB  1 
ATOM   436   O OG  . SER A 1 56  ? 6.380   78.195  69.816  1.00   22.29 ? 56   SER A OG  1 
ATOM   437   N N   . PRO A 1 57  ? 7.580   77.182  66.729  1.00   21.84 ? 57   PRO A N   1 
ATOM   438   C CA  . PRO A 1 57  ? 7.440   75.762  66.408  1.00   18.35 ? 57   PRO A CA  1 
ATOM   439   C C   . PRO A 1 57  ? 8.871   75.369  65.959  1.00   18.41 ? 57   PRO A C   1 
ATOM   440   O O   . PRO A 1 57  ? 9.285   75.624  64.833  1.00   17.68 ? 57   PRO A O   1 
ATOM   441   C CB  . PRO A 1 57  ? 6.406   75.756  65.281  1.00   16.95 ? 57   PRO A CB  1 
ATOM   442   C CG  . PRO A 1 57  ? 5.554   76.914  65.626  1.00   24.40 ? 57   PRO A CG  1 
ATOM   443   C CD  . PRO A 1 57  ? 6.543   77.997  66.083  1.00   18.05 ? 57   PRO A CD  1 
ATOM   444   N N   . ASP A 1 58  ? 9.656   74.822  66.864  1.00   18.31 ? 58   ASP A N   1 
ATOM   445   C CA  . ASP A 1 58  ? 11.008  74.383  66.527  1.00   20.45 ? 58   ASP A CA  1 
ATOM   446   C C   . ASP A 1 58  ? 10.961  73.171  65.561  1.00   22.32 ? 58   ASP A C   1 
ATOM   447   O O   . ASP A 1 58  ? 9.992   72.405  65.544  1.00   20.42 ? 58   ASP A O   1 
ATOM   448   C CB  . ASP A 1 58  ? 11.712  74.025  67.840  1.00   32.08 ? 58   ASP A CB  1 
ATOM   449   C CG  . ASP A 1 58  ? 13.156  73.720  67.669  1.00   31.41 ? 58   ASP A CG  1 
ATOM   450   O OD1 . ASP A 1 58  ? 13.747  74.164  66.668  1.00   43.02 ? 58   ASP A OD1 1 
ATOM   451   O OD2 . ASP A 1 58  ? 13.710  73.050  68.554  1.00   33.74 ? 58   ASP A OD2 1 
ATOM   452   N N   . GLU A 1 59  ? 12.010  72.992  64.764  1.00   22.61 ? 59   GLU A N   1 
ATOM   453   C CA  . GLU A 1 59  ? 12.012  71.914  63.775  1.00   24.04 ? 59   GLU A CA  1 
ATOM   454   C C   . GLU A 1 59  ? 12.074  70.484  64.316  1.00   24.65 ? 59   GLU A C   1 
ATOM   455   O O   . GLU A 1 59  ? 11.429  69.586  63.778  1.00   27.46 ? 59   GLU A O   1 
ATOM   456   C CB  . GLU A 1 59  ? 13.115  72.167  62.732  1.00   26.20 ? 59   GLU A CB  1 
ATOM   457   C CG  . GLU A 1 59  ? 13.557  70.959  61.917  1.00   36.38 ? 59   GLU A CG  1 
ATOM   458   C CD  . GLU A 1 59  ? 14.436  71.338  60.733  1.00   47.58 ? 59   GLU A CD  1 
ATOM   459   O OE1 . GLU A 1 59  ? 14.981  70.407  60.086  1.00   51.88 ? 59   GLU A OE1 1 
ATOM   460   O OE2 . GLU A 1 59  ? 14.563  72.561  60.450  1.00   47.72 ? 59   GLU A OE2 1 
ATOM   461   N N   . GLU A 1 60  ? 12.827  70.270  65.379  1.00   24.83 ? 60   GLU A N   1 
ATOM   462   C CA  . GLU A 1 60  ? 12.942  68.951  65.959  1.00   23.99 ? 60   GLU A CA  1 
ATOM   463   C C   . GLU A 1 60  ? 11.630  68.610  66.678  1.00   23.28 ? 60   GLU A C   1 
ATOM   464   O O   . GLU A 1 60  ? 11.221  67.439  66.735  1.00   25.21 ? 60   GLU A O   1 
ATOM   465   C CB  . GLU A 1 60  ? 14.112  68.929  66.951  1.00   26.69 ? 60   GLU A CB  1 
ATOM   466   C CG  . GLU A 1 60  ? 14.224  67.664  67.825  1.00   33.94 ? 60   GLU A CG  1 
ATOM   467   C CD  . GLU A 1 60  ? 15.072  67.888  69.083  1.00   34.20 ? 60   GLU A CD  1 
ATOM   468   O OE1 . GLU A 1 60  ? 15.127  66.989  69.950  1.00   37.68 ? 60   GLU A OE1 1 
ATOM   469   O OE2 . GLU A 1 60  ? 15.680  68.976  69.207  1.00   39.91 ? 60   GLU A OE2 1 
ATOM   470   N N   . LEU A 1 61  ? 10.975  69.620  67.239  1.00   19.57 ? 61   LEU A N   1 
ATOM   471   C CA  . LEU A 1 61  ? 9.721   69.377  67.930  1.00   19.09 ? 61   LEU A CA  1 
ATOM   472   C C   . LEU A 1 61  ? 8.675   68.894  66.910  1.00   20.09 ? 61   LEU A C   1 
ATOM   473   O O   . LEU A 1 61  ? 7.859   67.997  67.198  1.00   19.07 ? 61   LEU A O   1 
ATOM   474   C CB  . LEU A 1 61  ? 9.202   70.649  68.630  1.00   18.11 ? 61   LEU A CB  1 
ATOM   475   C CG  . LEU A 1 61  ? 7.883   70.487  69.428  1.00   13.17 ? 61   LEU A CG  1 
ATOM   476   C CD1 . LEU A 1 61  ? 8.010   69.370  70.475  1.00   14.54 ? 61   LEU A CD1 1 
ATOM   477   C CD2 . LEU A 1 61  ? 7.538   71.788  70.155  1.00   16.13 ? 61   LEU A CD2 1 
ATOM   478   N N   . ILE A 1 62  ? 8.692   69.476  65.716  1.00   16.15 ? 62   ILE A N   1 
ATOM   479   C CA  . ILE A 1 62  ? 7.725   69.050  64.726  1.00   19.80 ? 62   ILE A CA  1 
ATOM   480   C C   . ILE A 1 62  ? 8.026   67.612  64.307  1.00   23.94 ? 62   ILE A C   1 
ATOM   481   O O   . ILE A 1 62  ? 7.113   66.776  64.207  1.00   24.64 ? 62   ILE A O   1 
ATOM   482   C CB  . ILE A 1 62  ? 7.731   69.989  63.512  1.00   20.54 ? 62   ILE A CB  1 
ATOM   483   C CG1 . ILE A 1 62  ? 7.251   71.372  63.956  1.00   17.36 ? 62   ILE A CG1 1 
ATOM   484   C CG2 . ILE A 1 62  ? 6.832   69.452  62.406  1.00   15.47 ? 62   ILE A CG2 1 
ATOM   485   C CD1 . ILE A 1 62  ? 6.037   71.307  64.809  1.00   19.36 ? 62   ILE A CD1 1 
ATOM   486   N N   . GLU A 1 63  ? 9.296   67.307  64.078  1.00   22.08 ? 63   GLU A N   1 
ATOM   487   C CA  . GLU A 1 63  ? 9.643   65.942  63.702  1.00   25.82 ? 63   GLU A CA  1 
ATOM   488   C C   . GLU A 1 63  ? 9.141   64.960  64.775  1.00   24.96 ? 63   GLU A C   1 
ATOM   489   O O   . GLU A 1 63  ? 8.468   63.986  64.446  1.00   21.45 ? 63   GLU A O   1 
ATOM   490   C CB  . GLU A 1 63  ? 11.156  65.804  63.502  1.00   27.09 ? 63   GLU A CB  1 
ATOM   491   C CG  . GLU A 1 63  ? 11.677  66.659  62.348  1.00   34.26 ? 63   GLU A CG  1 
ATOM   492   C CD  . GLU A 1 63  ? 13.193  66.800  62.330  1.00   40.38 ? 63   GLU A CD  1 
ATOM   493   O OE1 . GLU A 1 63  ? 13.706  67.551  61.455  1.00   42.83 ? 63   GLU A OE1 1 
ATOM   494   O OE2 . GLU A 1 63  ? 13.860  66.172  63.185  1.00   37.87 ? 63   GLU A OE2 1 
ATOM   495   N N   . LYS A 1 64  ? 9.450   65.220  66.049  1.00   25.21 ? 64   LYS A N   1 
ATOM   496   C CA  . LYS A 1 64  ? 8.993   64.339  67.126  1.00   24.18 ? 64   LYS A CA  1 
ATOM   497   C C   . LYS A 1 64  ? 7.467   64.149  67.129  1.00   22.60 ? 64   LYS A C   1 
ATOM   498   O O   . LYS A 1 64  ? 6.988   63.024  67.132  1.00   20.85 ? 64   LYS A O   1 
ATOM   499   C CB  . LYS A 1 64  ? 9.451   64.875  68.477  1.00   27.31 ? 64   LYS A CB  1 
ATOM   500   C CG  . LYS A 1 64  ? 10.747  64.242  68.989  1.00   31.08 ? 64   LYS A CG  1 
ATOM   501   C CD  . LYS A 1 64  ? 11.971  64.743  68.233  1.00   34.91 ? 64   LYS A CD  1 
ATOM   502   C CE  . LYS A 1 64  ? 13.269  64.124  68.778  1.00   34.53 ? 64   LYS A CE  1 
ATOM   503   N NZ  . LYS A 1 64  ? 13.535  64.502  70.197  1.00   27.26 ? 64   LYS A NZ  1 
ATOM   504   N N   . ILE A 1 65  ? 6.719   65.252  67.102  1.00   22.43 ? 65   ILE A N   1 
ATOM   505   C CA  . ILE A 1 65  ? 5.252   65.241  67.092  1.00   22.23 ? 65   ILE A CA  1 
ATOM   506   C C   . ILE A 1 65  ? 4.789   64.310  65.967  1.00   21.24 ? 65   ILE A C   1 
ATOM   507   O O   . ILE A 1 65  ? 4.065   63.343  66.194  1.00   21.57 ? 65   ILE A O   1 
ATOM   508   C CB  . ILE A 1 65  ? 4.698   66.665  66.817  1.00   23.78 ? 65   ILE A CB  1 
ATOM   509   C CG1 . ILE A 1 65  ? 5.139   67.622  67.923  1.00   22.88 ? 65   ILE A CG1 1 
ATOM   510   C CG2 . ILE A 1 65  ? 3.217   66.624  66.653  1.00   17.94 ? 65   ILE A CG2 1 
ATOM   511   C CD1 . ILE A 1 65  ? 4.548   67.333  69.231  1.00   33.24 ? 65   ILE A CD1 1 
ATOM   512   N N   . LEU A 1 66  ? 5.222   64.625  64.749  1.00   18.79 ? 66   LEU A N   1 
ATOM   513   C CA  . LEU A 1 66  ? 4.904   63.842  63.566  1.00   17.12 ? 66   LEU A CA  1 
ATOM   514   C C   . LEU A 1 66  ? 5.114   62.369  63.877  1.00   20.46 ? 66   LEU A C   1 
ATOM   515   O O   . LEU A 1 66  ? 4.233   61.539  63.631  1.00   22.52 ? 66   LEU A O   1 
ATOM   516   C CB  . LEU A 1 66  ? 5.834   64.248  62.443  1.00   16.92 ? 66   LEU A CB  1 
ATOM   517   C CG  . LEU A 1 66  ? 5.270   64.679  61.089  1.00   17.91 ? 66   LEU A CG  1 
ATOM   518   C CD1 . LEU A 1 66  ? 3.923   65.382  61.218  1.00   18.98 ? 66   LEU A CD1 1 
ATOM   519   C CD2 . LEU A 1 66  ? 6.289   65.589  60.443  1.00   14.55 ? 66   LEU A CD2 1 
ATOM   520   N N   . SER A 1 67  ? 6.283   62.055  64.430  1.00   19.68 ? 67   SER A N   1 
ATOM   521   C CA  . SER A 1 67  ? 6.607   60.686  64.780  1.00   20.79 ? 67   SER A CA  1 
ATOM   522   C C   . SER A 1 67  ? 5.627   60.085  65.795  1.00   22.12 ? 67   SER A C   1 
ATOM   523   O O   . SER A 1 67  ? 5.268   58.919  65.716  1.00   25.29 ? 67   SER A O   1 
ATOM   524   C CB  . SER A 1 67  ? 8.034   60.612  65.323  1.00   17.85 ? 67   SER A CB  1 
ATOM   525   O OG  . SER A 1 67  ? 8.280   59.331  65.849  1.00   26.20 ? 67   SER A OG  1 
ATOM   526   N N   . TYR A 1 68  ? 5.198   60.892  66.753  1.00   22.31 ? 68   TYR A N   1 
ATOM   527   C CA  . TYR A 1 68  ? 4.268   60.449  67.766  1.00   19.09 ? 68   TYR A CA  1 
ATOM   528   C C   . TYR A 1 68  ? 2.888   60.247  67.171  1.00   20.72 ? 68   TYR A C   1 
ATOM   529   O O   . TYR A 1 68  ? 2.162   59.367  67.582  1.00   20.45 ? 68   TYR A O   1 
ATOM   530   C CB  . TYR A 1 68  ? 4.200   61.499  68.861  1.00   17.36 ? 68   TYR A CB  1 
ATOM   531   C CG  . TYR A 1 68  ? 3.192   61.229  69.958  1.00   20.66 ? 68   TYR A CG  1 
ATOM   532   C CD1 . TYR A 1 68  ? 3.242   60.063  70.722  1.00   18.93 ? 68   TYR A CD1 1 
ATOM   533   C CD2 . TYR A 1 68  ? 2.205   62.166  70.260  1.00   17.44 ? 68   TYR A CD2 1 
ATOM   534   C CE1 . TYR A 1 68  ? 2.340   59.840  71.765  1.00   16.69 ? 68   TYR A CE1 1 
ATOM   535   C CE2 . TYR A 1 68  ? 1.294   61.951  71.295  1.00   15.00 ? 68   TYR A CE2 1 
ATOM   536   C CZ  . TYR A 1 68  ? 1.370   60.790  72.047  1.00   18.83 ? 68   TYR A CZ  1 
ATOM   537   O OH  . TYR A 1 68  ? 0.514   60.600  73.117  1.00   20.29 ? 68   TYR A OH  1 
ATOM   538   N N   . LEU A 1 69  ? 2.522   61.083  66.217  1.00   23.73 ? 69   LEU A N   1 
ATOM   539   C CA  . LEU A 1 69  ? 1.217   61.007  65.573  1.00   25.26 ? 69   LEU A CA  1 
ATOM   540   C C   . LEU A 1 69  ? 1.208   59.741  64.742  1.00   28.78 ? 69   LEU A C   1 
ATOM   541   O O   . LEU A 1 69  ? 0.150   59.163  64.476  1.00   30.71 ? 69   LEU A O   1 
ATOM   542   C CB  . LEU A 1 69  ? 1.008   62.223  64.683  1.00   24.32 ? 69   LEU A CB  1 
ATOM   543   C CG  . LEU A 1 69  ? 0.535   63.463  65.402  1.00   22.42 ? 69   LEU A CG  1 
ATOM   544   C CD1 . LEU A 1 69  ? 1.258   63.556  66.724  1.00   31.28 ? 69   LEU A CD1 1 
ATOM   545   C CD2 . LEU A 1 69  ? 0.797   64.692  64.540  1.00   24.83 ? 69   LEU A CD2 1 
ATOM   546   N N   . ASP A 1 70  ? 2.401   59.340  64.308  1.00   30.15 ? 70   ASP A N   1 
ATOM   547   C CA  . ASP A 1 70  ? 2.593   58.101  63.559  1.00   31.09 ? 70   ASP A CA  1 
ATOM   548   C C   . ASP A 1 70  ? 1.577   57.850  62.428  1.00   31.60 ? 70   ASP A C   1 
ATOM   549   O O   . ASP A 1 70  ? 0.942   56.789  62.391  1.00   30.56 ? 70   ASP A O   1 
ATOM   550   C CB  . ASP A 1 70  ? 2.558   56.955  64.588  1.00   33.57 ? 70   ASP A CB  1 
ATOM   551   C CG  . ASP A 1 70  ? 2.979   55.615  64.026  1.00   36.47 ? 70   ASP A CG  1 
ATOM   552   O OD1 . ASP A 1 70  ? 2.192   54.639  64.180  1.00   31.81 ? 70   ASP A OD1 1 
ATOM   553   O OD2 . ASP A 1 70  ? 4.097   55.547  63.463  1.00   37.16 ? 70   ASP A OD2 1 
ATOM   554   N N   . THR A 1 71  ? 1.404   58.811  61.517  1.00   30.80 ? 71   THR A N   1 
ATOM   555   C CA  . THR A 1 71  ? 0.463   58.606  60.409  1.00   29.74 ? 71   THR A CA  1 
ATOM   556   C C   . THR A 1 71  ? 1.219   58.388  59.095  1.00   32.84 ? 71   THR A C   1 
ATOM   557   O O   . THR A 1 71  ? 2.449   58.484  59.049  1.00   33.70 ? 71   THR A O   1 
ATOM   558   C CB  . THR A 1 71  ? -0.499  59.806  60.224  1.00   25.88 ? 71   THR A CB  1 
ATOM   559   O OG1 . THR A 1 71  ? 0.185   60.888  59.588  1.00   23.89 ? 71   THR A OG1 1 
ATOM   560   C CG2 . THR A 1 71  ? -0.995  60.279  61.547  1.00   24.31 ? 71   THR A CG2 1 
ATOM   561   N N   . ASP A 1 72  ? 0.494   58.106  58.021  1.00   32.99 ? 72   ASP A N   1 
ATOM   562   C CA  . ASP A 1 72  ? 1.151   57.890  56.738  1.00   33.36 ? 72   ASP A CA  1 
ATOM   563   C C   . ASP A 1 72  ? 1.016   59.059  55.751  1.00   32.14 ? 72   ASP A C   1 
ATOM   564   O O   . ASP A 1 72  ? 1.369   58.913  54.577  1.00   36.17 ? 72   ASP A O   1 
ATOM   565   C CB  . ASP A 1 72  ? 0.614   56.592  56.098  1.00   33.81 ? 72   ASP A CB  1 
ATOM   566   C CG  . ASP A 1 72  ? -0.793  56.750  55.505  1.00   34.82 ? 72   ASP A CG  1 
ATOM   567   O OD1 . ASP A 1 72  ? -1.559  57.612  55.973  1.00   34.72 ? 72   ASP A OD1 1 
ATOM   568   O OD2 . ASP A 1 72  ? -1.145  56.011  54.565  1.00   36.71 ? 72   ASP A OD2 1 
ATOM   569   N N   . PHE A 1 73  ? 0.527   60.210  56.208  1.00   29.10 ? 73   PHE A N   1 
ATOM   570   C CA  . PHE A 1 73  ? 0.362   61.362  55.304  1.00   28.36 ? 73   PHE A CA  1 
ATOM   571   C C   . PHE A 1 73  ? 0.871   62.731  55.794  1.00   28.06 ? 73   PHE A C   1 
ATOM   572   O O   . PHE A 1 73  ? 1.561   63.429  55.065  1.00   30.33 ? 73   PHE A O   1 
ATOM   573   C CB  . PHE A 1 73  ? -1.111  61.498  54.887  1.00   25.86 ? 73   PHE A CB  1 
ATOM   574   C CG  . PHE A 1 73  ? -2.061  61.632  56.040  1.00   23.74 ? 73   PHE A CG  1 
ATOM   575   C CD1 . PHE A 1 73  ? -2.300  60.548  56.890  1.00   24.33 ? 73   PHE A CD1 1 
ATOM   576   C CD2 . PHE A 1 73  ? -2.720  62.843  56.276  1.00   25.30 ? 73   PHE A CD2 1 
ATOM   577   C CE1 . PHE A 1 73  ? -3.183  60.654  57.961  1.00   26.61 ? 73   PHE A CE1 1 
ATOM   578   C CE2 . PHE A 1 73  ? -3.616  62.979  57.350  1.00   20.91 ? 73   PHE A CE2 1 
ATOM   579   C CZ  . PHE A 1 73  ? -3.851  61.876  58.199  1.00   27.90 ? 73   PHE A CZ  1 
ATOM   580   N N   . LEU A 1 74  ? 0.531   63.120  57.018  1.00   27.65 ? 74   LEU A N   1 
ATOM   581   C CA  . LEU A 1 74  ? 0.963   64.407  57.598  1.00   25.71 ? 74   LEU A CA  1 
ATOM   582   C C   . LEU A 1 74  ? 2.436   64.752  57.364  1.00   20.63 ? 74   LEU A C   1 
ATOM   583   O O   . LEU A 1 74  ? 3.275   63.886  57.423  1.00   18.25 ? 74   LEU A O   1 
ATOM   584   C CB  . LEU A 1 74  ? 0.715   64.374  59.108  1.00   29.38 ? 74   LEU A CB  1 
ATOM   585   C CG  . LEU A 1 74  ? -0.739  64.195  59.527  1.00   30.60 ? 74   LEU A CG  1 
ATOM   586   C CD1 . LEU A 1 74  ? -0.832  63.857  61.012  1.00   36.07 ? 74   LEU A CD1 1 
ATOM   587   C CD2 . LEU A 1 74  ? -1.480  65.465  59.203  1.00   32.88 ? 74   LEU A CD2 1 
ATOM   588   N N   . SER A 1 75  ? 2.754   66.014  57.102  1.00   22.38 ? 75   SER A N   1 
ATOM   589   C CA  . SER A 1 75  ? 4.158   66.411  56.928  1.00   22.07 ? 75   SER A CA  1 
ATOM   590   C C   . SER A 1 75  ? 4.411   67.578  57.873  1.00   21.17 ? 75   SER A C   1 
ATOM   591   O O   . SER A 1 75  ? 3.513   67.979  58.578  1.00   18.89 ? 75   SER A O   1 
ATOM   592   C CB  . SER A 1 75  ? 4.443   66.834  55.484  1.00   27.60 ? 75   SER A CB  1 
ATOM   593   O OG  . SER A 1 75  ? 3.899   68.112  55.193  1.00   38.38 ? 75   SER A OG  1 
ATOM   594   N N   . LYS A 1 76  ? 5.621   68.127  57.914  1.00   23.79 ? 76   LYS A N   1 
ATOM   595   C CA  . LYS A 1 76  ? 5.880   69.241  58.836  1.00   24.58 ? 76   LYS A CA  1 
ATOM   596   C C   . LYS A 1 76  ? 4.859   70.363  58.651  1.00   24.40 ? 76   LYS A C   1 
ATOM   597   O O   . LYS A 1 76  ? 4.493   71.039  59.606  1.00   22.46 ? 76   LYS A O   1 
ATOM   598   C CB  . LYS A 1 76  ? 7.295   69.781  58.655  1.00   27.60 ? 76   LYS A CB  1 
ATOM   599   C CG  . LYS A 1 76  ? 7.650   70.202  57.230  1.00   36.00 ? 76   LYS A CG  1 
ATOM   600   C CD  . LYS A 1 76  ? 9.032   70.845  57.186  1.00   38.42 ? 76   LYS A CD  1 
ATOM   601   C CE  . LYS A 1 76  ? 9.033   72.171  57.963  1.00   46.31 ? 76   LYS A CE  1 
ATOM   602   N NZ  . LYS A 1 76  ? 10.401  72.742  58.237  1.00   45.67 ? 76   LYS A NZ  1 
ATOM   603   N N   . ASN A 1 77  ? 4.377   70.525  57.423  1.00   24.20 ? 77   ASN A N   1 
ATOM   604   C CA  . ASN A 1 77  ? 3.387   71.546  57.083  1.00   24.32 ? 77   ASN A CA  1 
ATOM   605   C C   . ASN A 1 77  ? 2.014   71.389  57.722  1.00   21.94 ? 77   ASN A C   1 
ATOM   606   O O   . ASN A 1 77  ? 1.216   72.316  57.676  1.00   24.97 ? 77   ASN A O   1 
ATOM   607   C CB  . ASN A 1 77  ? 3.160   71.579  55.573  1.00   28.31 ? 77   ASN A CB  1 
ATOM   608   C CG  . ASN A 1 77  ? 4.300   72.197  54.822  1.00   33.13 ? 77   ASN A CG  1 
ATOM   609   O OD1 . ASN A 1 77  ? 4.284   72.219  53.595  1.00   39.67 ? 77   ASN A OD1 1 
ATOM   610   N ND2 . ASN A 1 77  ? 5.295   72.713  55.543  1.00   35.31 ? 77   ASN A ND2 1 
ATOM   611   N N   . ASN A 1 78  ? 1.738   70.231  58.305  1.00   16.24 ? 78   ASN A N   1 
ATOM   612   C CA  . ASN A 1 78  ? 0.430   69.961  58.887  1.00   17.85 ? 78   ASN A CA  1 
ATOM   613   C C   . ASN A 1 78  ? 0.344   70.204  60.386  1.00   20.06 ? 78   ASN A C   1 
ATOM   614   O O   . ASN A 1 78  ? -0.740  70.178  60.956  1.00   19.54 ? 78   ASN A O   1 
ATOM   615   C CB  . ASN A 1 78  ? 0.020   68.502  58.571  1.00   15.55 ? 78   ASN A CB  1 
ATOM   616   C CG  . ASN A 1 78  ? -0.133  68.232  57.055  1.00   19.70 ? 78   ASN A CG  1 
ATOM   617   O OD1 . ASN A 1 78  ? 0.471   67.303  56.495  1.00   23.49 ? 78   ASN A OD1 1 
ATOM   618   N ND2 . ASN A 1 78  ? -0.937  69.058  56.393  1.00   15.86 ? 78   ASN A ND2 1 
ATOM   619   N N   . VAL A 1 79  ? 1.490   70.477  61.003  1.00   19.27 ? 79   VAL A N   1 
ATOM   620   C CA  . VAL A 1 79  ? 1.604   70.657  62.439  1.00   17.05 ? 79   VAL A CA  1 
ATOM   621   C C   . VAL A 1 79  ? 2.046   72.039  62.887  1.00   18.88 ? 79   VAL A C   1 
ATOM   622   O O   . VAL A 1 79  ? 2.772   72.725  62.176  1.00   19.21 ? 79   VAL A O   1 
ATOM   623   C CB  . VAL A 1 79  ? 2.655   69.664  62.995  1.00   18.32 ? 79   VAL A CB  1 
ATOM   624   C CG1 . VAL A 1 79  ? 2.730   69.761  64.484  1.00   14.44 ? 79   VAL A CG1 1 
ATOM   625   C CG2 . VAL A 1 79  ? 2.342   68.249  62.533  1.00   14.49 ? 79   VAL A CG2 1 
ATOM   626   N N   . SER A 1 80  ? 1.582   72.467  64.055  1.00   18.43 ? 80   SER A N   1 
ATOM   627   C CA  . SER A 1 80  ? 2.054   73.730  64.625  1.00   18.13 ? 80   SER A CA  1 
ATOM   628   C C   . SER A 1 80  ? 1.894   73.600  66.130  1.00   19.91 ? 80   SER A C   1 
ATOM   629   O O   . SER A 1 80  ? 1.468   72.560  66.630  1.00   18.39 ? 80   SER A O   1 
ATOM   630   C CB  . SER A 1 80  ? 1.290   74.963  64.124  1.00   19.84 ? 80   SER A CB  1 
ATOM   631   O OG  . SER A 1 80  ? 1.889   76.170  64.614  1.00   14.27 ? 80   SER A OG  1 
ATOM   632   N N   . VAL A 1 81  ? 2.208   74.665  66.855  1.00   19.12 ? 81   VAL A N   1 
ATOM   633   C CA  . VAL A 1 81  ? 2.151   74.593  68.295  1.00   18.77 ? 81   VAL A CA  1 
ATOM   634   C C   . VAL A 1 81  ? 1.534   75.827  68.959  1.00   18.31 ? 81   VAL A C   1 
ATOM   635   O O   . VAL A 1 81  ? 1.454   76.910  68.363  1.00   19.30 ? 81   VAL A O   1 
ATOM   636   C CB  . VAL A 1 81  ? 3.583   74.366  68.808  1.00   19.58 ? 81   VAL A CB  1 
ATOM   637   C CG1 . VAL A 1 81  ? 4.362   75.673  68.750  1.00   21.02 ? 81   VAL A CG1 1 
ATOM   638   C CG2 . VAL A 1 81  ? 3.559   73.806  70.181  1.00   28.90 ? 81   VAL A CG2 1 
ATOM   639   N N   . GLY A 1 82  ? 1.086   75.655  70.200  1.00   18.47 ? 82   GLY A N   1 
ATOM   640   C CA  . GLY A 1 82  ? 0.517   76.765  70.935  1.00   16.83 ? 82   GLY A CA  1 
ATOM   641   C C   . GLY A 1 82  ? 0.962   76.746  72.388  1.00   15.57 ? 82   GLY A C   1 
ATOM   642   O O   . GLY A 1 82  ? 1.374   75.718  72.936  1.00   16.22 ? 82   GLY A O   1 
ATOM   643   N N   . ASN A 1 83  ? 0.860   77.914  73.000  1.00   15.26 ? 83   ASN A N   1 
ATOM   644   C CA  . ASN A 1 83  ? 1.216   78.096  74.393  1.00   12.94 ? 83   ASN A CA  1 
ATOM   645   C C   . ASN A 1 83  ? 0.072   77.476  75.177  1.00   12.46 ? 83   ASN A C   1 
ATOM   646   O O   . ASN A 1 83  ? -0.749  78.168  75.771  1.00   11.84 ? 83   ASN A O   1 
ATOM   647   C CB  . ASN A 1 83  ? 1.371   79.599  74.699  1.00   9.79  ? 83   ASN A CB  1 
ATOM   648   C CG  . ASN A 1 83  ? 1.673   79.866  76.170  1.00   15.96 ? 83   ASN A CG  1 
ATOM   649   O OD1 . ASN A 1 83  ? 2.333   79.058  76.815  1.00   21.14 ? 83   ASN A OD1 1 
ATOM   650   N ND2 . ASN A 1 83  ? 1.191   80.991  76.706  1.00   14.89 ? 83   ASN A ND2 1 
ATOM   651   N N   . GLY A 1 84  ? 0.053   76.148  75.181  1.00   15.02 ? 84   GLY A N   1 
ATOM   652   C CA  . GLY A 1 84  ? -1.000  75.387  75.825  1.00   14.17 ? 84   GLY A CA  1 
ATOM   653   C C   . GLY A 1 84  ? -1.998  75.095  74.703  1.00   16.54 ? 84   GLY A C   1 
ATOM   654   O O   . GLY A 1 84  ? -1.936  75.737  73.662  1.00   17.52 ? 84   GLY A O   1 
ATOM   655   N N   . ALA A 1 85  ? -2.874  74.111  74.863  1.00   18.34 ? 85   ALA A N   1 
ATOM   656   C CA  . ALA A 1 85  ? -3.882  73.848  73.838  1.00   16.52 ? 85   ALA A CA  1 
ATOM   657   C C   . ALA A 1 85  ? -4.784  75.088  73.868  1.00   15.85 ? 85   ALA A C   1 
ATOM   658   O O   . ALA A 1 85  ? -5.377  75.469  72.863  1.00   18.78 ? 85   ALA A O   1 
ATOM   659   C CB  . ALA A 1 85  ? -4.690  72.602  74.187  1.00   10.41 ? 85   ALA A CB  1 
ATOM   660   N N   . ASP A 1 86  ? -4.874  75.694  75.050  1.00   19.29 ? 86   ASP A N   1 
ATOM   661   C CA  . ASP A 1 86  ? -5.629  76.924  75.282  1.00   18.28 ? 86   ASP A CA  1 
ATOM   662   C C   . ASP A 1 86  ? -5.295  77.988  74.246  1.00   18.95 ? 86   ASP A C   1 
ATOM   663   O O   . ASP A 1 86  ? -6.199  78.592  73.688  1.00   24.58 ? 86   ASP A O   1 
ATOM   664   C CB  . ASP A 1 86  ? -5.305  77.506  76.655  1.00   18.53 ? 86   ASP A CB  1 
ATOM   665   C CG  . ASP A 1 86  ? -6.164  76.934  77.771  1.00   22.70 ? 86   ASP A CG  1 
ATOM   666   O OD1 . ASP A 1 86  ? -5.924  77.346  78.926  1.00   22.48 ? 86   ASP A OD1 1 
ATOM   667   O OD2 . ASP A 1 86  ? -7.067  76.102  77.524  1.00   20.47 ? 86   ASP A OD2 1 
ATOM   668   N N   . GLU A 1 87  ? -4.008  78.224  73.975  1.00   19.11 ? 87   GLU A N   1 
ATOM   669   C CA  . GLU A 1 87  ? -3.664  79.257  72.992  1.00   19.50 ? 87   GLU A CA  1 
ATOM   670   C C   . GLU A 1 87  ? -4.173  78.933  71.604  1.00   18.12 ? 87   GLU A C   1 
ATOM   671   O O   . GLU A 1 87  ? -4.591  79.815  70.851  1.00   19.22 ? 87   GLU A O   1 
ATOM   672   C CB  . GLU A 1 87  ? -2.159  79.506  72.915  1.00   18.83 ? 87   GLU A CB  1 
ATOM   673   C CG  . GLU A 1 87  ? -1.841  80.871  72.234  1.00   20.56 ? 87   GLU A CG  1 
ATOM   674   C CD  . GLU A 1 87  ? -0.387  81.021  71.810  1.00   25.05 ? 87   GLU A CD  1 
ATOM   675   O OE1 . GLU A 1 87  ? 0.197   80.005  71.407  1.00   27.28 ? 87   GLU A OE1 1 
ATOM   676   O OE2 . GLU A 1 87  ? 0.173   82.146  71.862  1.00   24.73 ? 87   GLU A OE2 1 
ATOM   677   N N   . ILE A 1 88  ? -4.177  77.654  71.269  1.00   21.36 ? 88   ILE A N   1 
ATOM   678   C CA  . ILE A 1 88  ? -4.624  77.252  69.957  1.00   20.92 ? 88   ILE A CA  1 
ATOM   679   C C   . ILE A 1 88  ? -6.098  77.534  69.849  1.00   20.94 ? 88   ILE A C   1 
ATOM   680   O O   . ILE A 1 88  ? -6.586  77.890  68.793  1.00   23.38 ? 88   ILE A O   1 
ATOM   681   C CB  . ILE A 1 88  ? -4.350  75.762  69.722  1.00   21.13 ? 88   ILE A CB  1 
ATOM   682   C CG1 . ILE A 1 88  ? -2.852  75.495  69.909  1.00   20.67 ? 88   ILE A CG1 1 
ATOM   683   C CG2 . ILE A 1 88  ? -4.833  75.350  68.326  1.00   16.06 ? 88   ILE A CG2 1 
ATOM   684   C CD1 . ILE A 1 88  ? -2.450  74.006  69.882  1.00   20.26 ? 88   ILE A CD1 1 
ATOM   685   N N   . ILE A 1 89  ? -6.804  77.407  70.960  1.00   19.94 ? 89   ILE A N   1 
ATOM   686   C CA  . ILE A 1 89  ? -8.237  77.638  70.954  1.00   21.19 ? 89   ILE A CA  1 
ATOM   687   C C   . ILE A 1 89  ? -8.474  79.132  70.820  1.00   21.73 ? 89   ILE A C   1 
ATOM   688   O O   . ILE A 1 89  ? -9.287  79.591  70.011  1.00   23.30 ? 89   ILE A O   1 
ATOM   689   C CB  . ILE A 1 89  ? -8.837  77.111  72.245  1.00   19.18 ? 89   ILE A CB  1 
ATOM   690   C CG1 . ILE A 1 89  ? -8.766  75.580  72.237  1.00   21.47 ? 89   ILE A CG1 1 
ATOM   691   C CG2 . ILE A 1 89  ? -10.249 77.620  72.424  1.00   16.93 ? 89   ILE A CG2 1 
ATOM   692   C CD1 . ILE A 1 89  ? -9.086  74.932  73.591  1.00   18.74 ? 89   ILE A CD1 1 
ATOM   693   N N   . TYR A 1 90  ? -7.722  79.876  71.620  1.00   18.11 ? 90   TYR A N   1 
ATOM   694   C CA  . TYR A 1 90  ? -7.792  81.325  71.667  1.00   19.24 ? 90   TYR A CA  1 
ATOM   695   C C   . TYR A 1 90  ? -7.561  81.987  70.297  1.00   18.97 ? 90   TYR A C   1 
ATOM   696   O O   . TYR A 1 90  ? -8.316  82.864  69.878  1.00   17.87 ? 90   TYR A O   1 
ATOM   697   C CB  . TYR A 1 90  ? -6.746  81.799  72.677  1.00   18.64 ? 90   TYR A CB  1 
ATOM   698   C CG  . TYR A 1 90  ? -6.867  83.224  73.152  1.00   12.38 ? 90   TYR A CG  1 
ATOM   699   C CD1 . TYR A 1 90  ? -6.306  84.277  72.426  1.00   14.94 ? 90   TYR A CD1 1 
ATOM   700   C CD2 . TYR A 1 90  ? -7.369  83.497  74.423  1.00   11.73 ? 90   TYR A CD2 1 
ATOM   701   C CE1 . TYR A 1 90  ? -6.227  85.568  72.979  1.00   15.08 ? 90   TYR A CE1 1 
ATOM   702   C CE2 . TYR A 1 90  ? -7.287  84.763  74.981  1.00   11.89 ? 90   TYR A CE2 1 
ATOM   703   C CZ  . TYR A 1 90  ? -6.718  85.786  74.263  1.00   11.90 ? 90   TYR A CZ  1 
ATOM   704   O OH  . TYR A 1 90  ? -6.640  87.017  74.858  1.00   18.23 ? 90   TYR A OH  1 
ATOM   705   N N   . VAL A 1 91  ? -6.512  81.557  69.598  1.00   19.30 ? 91   VAL A N   1 
ATOM   706   C CA  . VAL A 1 91  ? -6.199  82.127  68.307  1.00   17.40 ? 91   VAL A CA  1 
ATOM   707   C C   . VAL A 1 91  ? -7.230  81.727  67.263  1.00   16.04 ? 91   VAL A C   1 
ATOM   708   O O   . VAL A 1 91  ? -7.642  82.545  66.452  1.00   14.33 ? 91   VAL A O   1 
ATOM   709   C CB  . VAL A 1 91  ? -4.799  81.716  67.851  1.00   19.48 ? 91   VAL A CB  1 
ATOM   710   C CG1 . VAL A 1 91  ? -3.743  82.376  68.750  1.00   16.16 ? 91   VAL A CG1 1 
ATOM   711   C CG2 . VAL A 1 91  ? -4.676  80.227  67.931  1.00   29.23 ? 91   VAL A CG2 1 
ATOM   712   N N   . MET A 1 92  ? -7.663  80.473  67.296  1.00   17.55 ? 92   MET A N   1 
ATOM   713   C CA  . MET A 1 92  ? -8.657  80.012  66.343  1.00   16.51 ? 92   MET A CA  1 
ATOM   714   C C   . MET A 1 92  ? -9.886  80.905  66.425  1.00   18.58 ? 92   MET A C   1 
ATOM   715   O O   . MET A 1 92  ? -10.480 81.271  65.398  1.00   21.35 ? 92   MET A O   1 
ATOM   716   C CB  . MET A 1 92  ? -9.018  78.547  66.602  1.00   15.24 ? 92   MET A CB  1 
ATOM   717   C CG  . MET A 1 92  ? -7.868  77.635  66.236  1.00   17.25 ? 92   MET A CG  1 
ATOM   718   S SD  . MET A 1 92  ? -8.158  75.871  66.299  1.00   24.39 ? 92   MET A SD  1 
ATOM   719   C CE  . MET A 1 92  ? -9.075  75.623  64.798  1.00   23.72 ? 92   MET A CE  1 
ATOM   720   N N   . MET A 1 93  ? -10.257 81.288  67.639  1.00   19.51 ? 93   MET A N   1 
ATOM   721   C CA  . MET A 1 93  ? -11.417 82.145  67.781  1.00   18.38 ? 93   MET A CA  1 
ATOM   722   C C   . MET A 1 93  ? -11.194 83.515  67.159  1.00   20.07 ? 93   MET A C   1 
ATOM   723   O O   . MET A 1 93  ? -12.158 84.247  66.909  1.00   22.35 ? 93   MET A O   1 
ATOM   724   C CB  . MET A 1 93  ? -11.800 82.281  69.246  1.00   17.39 ? 93   MET A CB  1 
ATOM   725   C CG  . MET A 1 93  ? -12.396 81.004  69.798  1.00   16.94 ? 93   MET A CG  1 
ATOM   726   S SD  . MET A 1 93  ? -12.956 81.098  71.496  1.00   23.29 ? 93   MET A SD  1 
ATOM   727   C CE  . MET A 1 93  ? -13.557 79.405  71.700  1.00   13.37 ? 93   MET A CE  1 
ATOM   728   N N   . LEU A 1 94  ? -9.936  83.868  66.902  1.00   17.21 ? 94   LEU A N   1 
ATOM   729   C CA  . LEU A 1 94  ? -9.656  85.149  66.267  1.00   19.29 ? 94   LEU A CA  1 
ATOM   730   C C   . LEU A 1 94  ? -9.673  84.967  64.752  1.00   19.42 ? 94   LEU A C   1 
ATOM   731   O O   . LEU A 1 94  ? -9.801  85.932  64.011  1.00   15.84 ? 94   LEU A O   1 
ATOM   732   C CB  . LEU A 1 94  ? -8.290  85.714  66.704  1.00   23.54 ? 94   LEU A CB  1 
ATOM   733   C CG  . LEU A 1 94  ? -8.132  86.194  68.157  1.00   19.96 ? 94   LEU A CG  1 
ATOM   734   C CD1 . LEU A 1 94  ? -6.716  86.661  68.377  1.00   22.31 ? 94   LEU A CD1 1 
ATOM   735   C CD2 . LEU A 1 94  ? -9.097  87.309  68.451  1.00   24.95 ? 94   LEU A CD2 1 
ATOM   736   N N   . MET A 1 95  ? -9.601  83.712  64.310  1.00   21.05 ? 95   MET A N   1 
ATOM   737   C CA  . MET A 1 95  ? -9.560  83.361  62.896  1.00   21.88 ? 95   MET A CA  1 
ATOM   738   C C   . MET A 1 95  ? -10.878 83.144  62.164  1.00   23.71 ? 95   MET A C   1 
ATOM   739   O O   . MET A 1 95  ? -10.918 83.209  60.943  1.00   24.50 ? 95   MET A O   1 
ATOM   740   C CB  . MET A 1 95  ? -8.716  82.096  62.712  1.00   20.10 ? 95   MET A CB  1 
ATOM   741   C CG  . MET A 1 95  ? -7.235  82.296  63.012  1.00   22.81 ? 95   MET A CG  1 
ATOM   742   S SD  . MET A 1 95  ? -6.390  80.682  63.004  1.00   24.21 ? 95   MET A SD  1 
ATOM   743   C CE  . MET A 1 95  ? -6.033  80.414  61.291  1.00   25.95 ? 95   MET A CE  1 
ATOM   744   N N   . PHE A 1 96  ? -11.952 82.879  62.891  1.00   22.68 ? 96   PHE A N   1 
ATOM   745   C CA  . PHE A 1 96  ? -13.208 82.596  62.225  1.00   20.10 ? 96   PHE A CA  1 
ATOM   746   C C   . PHE A 1 96  ? -14.273 83.599  62.548  1.00   21.31 ? 96   PHE A C   1 
ATOM   747   O O   . PHE A 1 96  ? -14.125 84.381  63.475  1.00   18.13 ? 96   PHE A O   1 
ATOM   748   C CB  . PHE A 1 96  ? -13.679 81.200  62.620  1.00   22.19 ? 96   PHE A CB  1 
ATOM   749   C CG  . PHE A 1 96  ? -12.787 80.107  62.136  1.00   18.17 ? 96   PHE A CG  1 
ATOM   750   C CD1 . PHE A 1 96  ? -12.990 79.529  60.889  1.00   16.29 ? 96   PHE A CD1 1 
ATOM   751   C CD2 . PHE A 1 96  ? -11.705 79.690  62.907  1.00   15.17 ? 96   PHE A CD2 1 
ATOM   752   C CE1 . PHE A 1 96  ? -12.121 78.546  60.408  1.00   13.72 ? 96   PHE A CE1 1 
ATOM   753   C CE2 . PHE A 1 96  ? -10.837 78.720  62.441  1.00   13.29 ? 96   PHE A CE2 1 
ATOM   754   C CZ  . PHE A 1 96  ? -11.036 78.145  61.197  1.00   14.24 ? 96   PHE A CZ  1 
ATOM   755   N N   . ASP A 1 97  ? -15.367 83.552  61.795  1.00   22.20 ? 97   ASP A N   1 
ATOM   756   C CA  . ASP A 1 97  ? -16.451 84.496  62.004  1.00   25.11 ? 97   ASP A CA  1 
ATOM   757   C C   . ASP A 1 97  ? -17.272 84.154  63.225  1.00   24.04 ? 97   ASP A C   1 
ATOM   758   O O   . ASP A 1 97  ? -17.733 85.035  63.941  1.00   23.15 ? 97   ASP A O   1 
ATOM   759   C CB  . ASP A 1 97  ? -17.334 84.556  60.762  1.00   28.55 ? 97   ASP A CB  1 
ATOM   760   C CG  . ASP A 1 97  ? -16.598 85.129  59.577  1.00   32.75 ? 97   ASP A CG  1 
ATOM   761   O OD1 . ASP A 1 97  ? -16.415 86.368  59.538  1.00   34.86 ? 97   ASP A OD1 1 
ATOM   762   O OD2 . ASP A 1 97  ? -16.174 84.345  58.700  1.00   37.24 ? 97   ASP A OD2 1 
ATOM   763   N N   . ARG A 1 98  ? -17.433 82.866  63.482  1.00   23.21 ? 98   ARG A N   1 
ATOM   764   C CA  . ARG A 1 98  ? -18.218 82.479  64.635  1.00   21.34 ? 98   ARG A CA  1 
ATOM   765   C C   . ARG A 1 98  ? -17.779 81.140  65.192  1.00   21.35 ? 98   ARG A C   1 
ATOM   766   O O   . ARG A 1 98  ? -17.455 80.220  64.443  1.00   22.15 ? 98   ARG A O   1 
ATOM   767   C CB  . ARG A 1 98  ? -19.702 82.445  64.257  1.00   24.65 ? 98   ARG A CB  1 
ATOM   768   C CG  . ARG A 1 98  ? -20.625 82.008  65.375  1.00   21.87 ? 98   ARG A CG  1 
ATOM   769   C CD  . ARG A 1 98  ? -22.044 81.922  64.901  1.00   18.46 ? 98   ARG A CD  1 
ATOM   770   N NE  . ARG A 1 98  ? -22.211 80.914  63.866  1.00   21.53 ? 98   ARG A NE  1 
ATOM   771   C CZ  . ARG A 1 98  ? -23.396 80.398  63.552  1.00   24.59 ? 98   ARG A CZ  1 
ATOM   772   N NH1 . ARG A 1 98  ? -24.483 80.812  64.206  1.00   24.26 ? 98   ARG A NH1 1 
ATOM   773   N NH2 . ARG A 1 98  ? -23.495 79.469  62.605  1.00   13.62 ? 98   ARG A NH2 1 
ATOM   774   N N   . SER A 1 99  ? -17.770 81.057  66.517  1.00   20.07 ? 99   SER A N   1 
ATOM   775   C CA  . SER A 1 99  ? -17.363 79.871  67.231  1.00   19.88 ? 99   SER A CA  1 
ATOM   776   C C   . SER A 1 99  ? -18.588 79.196  67.831  1.00   21.12 ? 99   SER A C   1 
ATOM   777   O O   . SER A 1 99  ? -19.377 79.827  68.520  1.00   23.40 ? 99   SER A O   1 
ATOM   778   C CB  . SER A 1 99  ? -16.379 80.249  68.347  1.00   20.54 ? 99   SER A CB  1 
ATOM   779   O OG  . SER A 1 99  ? -15.171 80.710  67.794  1.00   21.36 ? 99   SER A OG  1 
ATOM   780   N N   . VAL A 1 100 ? -18.718 77.901  67.573  1.00   21.67 ? 100  VAL A N   1 
ATOM   781   C CA  . VAL A 1 100 ? -19.851 77.121  68.019  1.00   17.17 ? 100  VAL A CA  1 
ATOM   782   C C   . VAL A 1 100 ? -19.363 75.967  68.848  1.00   16.69 ? 100  VAL A C   1 
ATOM   783   O O   . VAL A 1 100 ? -18.404 75.306  68.482  1.00   20.06 ? 100  VAL A O   1 
ATOM   784   C CB  . VAL A 1 100 ? -20.641 76.567  66.794  1.00   18.39 ? 100  VAL A CB  1 
ATOM   785   C CG1 . VAL A 1 100 ? -21.940 75.942  67.249  1.00   10.49 ? 100  VAL A CG1 1 
ATOM   786   C CG2 . VAL A 1 100 ? -20.901 77.695  65.770  1.00   10.40 ? 100  VAL A CG2 1 
ATOM   787   N N   . PHE A 1 101 ? -19.986 75.766  70.002  1.00   14.75 ? 101  PHE A N   1 
ATOM   788   C CA  . PHE A 1 101 ? -19.653 74.646  70.863  1.00   17.83 ? 101  PHE A CA  1 
ATOM   789   C C   . PHE A 1 101 ? -20.903 74.204  71.603  1.00   17.24 ? 101  PHE A C   1 
ATOM   790   O O   . PHE A 1 101 ? -21.871 74.959  71.695  1.00   18.18 ? 101  PHE A O   1 
ATOM   791   C CB  . PHE A 1 101 ? -18.498 74.971  71.826  1.00   18.54 ? 101  PHE A CB  1 
ATOM   792   C CG  . PHE A 1 101 ? -18.388 76.414  72.191  1.00   15.10 ? 101  PHE A CG  1 
ATOM   793   C CD1 . PHE A 1 101 ? -19.053 76.925  73.287  1.00   16.79 ? 101  PHE A CD1 1 
ATOM   794   C CD2 . PHE A 1 101 ? -17.598 77.266  71.432  1.00   16.06 ? 101  PHE A CD2 1 
ATOM   795   C CE1 . PHE A 1 101 ? -18.930 78.277  73.623  1.00   8.96  ? 101  PHE A CE1 1 
ATOM   796   C CE2 . PHE A 1 101 ? -17.468 78.624  71.764  1.00   14.54 ? 101  PHE A CE2 1 
ATOM   797   C CZ  . PHE A 1 101 ? -18.136 79.122  72.856  1.00   12.83 ? 101  PHE A CZ  1 
ATOM   798   N N   . PHE A 1 102 ? -20.875 72.998  72.148  1.00   17.16 ? 102  PHE A N   1 
ATOM   799   C CA  . PHE A 1 102 ? -22.055 72.439  72.763  1.00   19.98 ? 102  PHE A CA  1 
ATOM   800   C C   . PHE A 1 102 ? -21.977 72.023  74.211  1.00   19.57 ? 102  PHE A C   1 
ATOM   801   O O   . PHE A 1 102 ? -21.386 70.987  74.530  1.00   20.34 ? 102  PHE A O   1 
ATOM   802   C CB  . PHE A 1 102 ? -22.493 71.258  71.891  1.00   19.54 ? 102  PHE A CB  1 
ATOM   803   C CG  . PHE A 1 102 ? -22.225 71.482  70.421  1.00   17.80 ? 102  PHE A CG  1 
ATOM   804   C CD1 . PHE A 1 102 ? -21.127 70.898  69.812  1.00   16.63 ? 102  PHE A CD1 1 
ATOM   805   C CD2 . PHE A 1 102 ? -23.060 72.307  69.652  1.00   16.27 ? 102  PHE A CD2 1 
ATOM   806   C CE1 . PHE A 1 102 ? -20.844 71.113  68.447  1.00   20.55 ? 102  PHE A CE1 1 
ATOM   807   C CE2 . PHE A 1 102 ? -22.794 72.535  68.289  1.00   21.16 ? 102  PHE A CE2 1 
ATOM   808   C CZ  . PHE A 1 102 ? -21.675 71.930  67.683  1.00   21.36 ? 102  PHE A CZ  1 
ATOM   809   N N   . PRO A 1 103 ? -22.566 72.826  75.110  1.00   21.09 ? 103  PRO A N   1 
ATOM   810   C CA  . PRO A 1 103 ? -22.542 72.510  76.550  1.00   21.97 ? 103  PRO A CA  1 
ATOM   811   C C   . PRO A 1 103 ? -23.365 71.294  76.868  1.00   22.56 ? 103  PRO A C   1 
ATOM   812   O O   . PRO A 1 103 ? -24.407 71.059  76.236  1.00   26.45 ? 103  PRO A O   1 
ATOM   813   C CB  . PRO A 1 103 ? -23.075 73.790  77.208  1.00   20.52 ? 103  PRO A CB  1 
ATOM   814   C CG  . PRO A 1 103 ? -23.742 74.565  76.089  1.00   22.30 ? 103  PRO A CG  1 
ATOM   815   C CD  . PRO A 1 103 ? -22.908 74.248  74.892  1.00   20.40 ? 103  PRO A CD  1 
ATOM   816   N N   . PRO A 1 104 ? -22.900 70.469  77.859  1.00   20.59 ? 104  PRO A N   1 
ATOM   817   C CA  . PRO A 1 104 ? -21.680 70.664  78.639  1.00   19.17 ? 104  PRO A CA  1 
ATOM   818   C C   . PRO A 1 104 ? -20.421 70.489  77.812  1.00   18.34 ? 104  PRO A C   1 
ATOM   819   O O   . PRO A 1 104 ? -20.233 69.452  77.178  1.00   19.19 ? 104  PRO A O   1 
ATOM   820   C CB  . PRO A 1 104 ? -21.791 69.585  79.725  1.00   18.73 ? 104  PRO A CB  1 
ATOM   821   C CG  . PRO A 1 104 ? -22.413 68.422  78.957  1.00   22.43 ? 104  PRO A CG  1 
ATOM   822   C CD  . PRO A 1 104 ? -23.475 69.128  78.104  1.00   20.90 ? 104  PRO A CD  1 
ATOM   823   N N   . THR A 1 105 ? -19.568 71.512  77.809  1.00   16.07 ? 105  THR A N   1 
ATOM   824   C CA  . THR A 1 105 ? -18.317 71.469  77.067  1.00   14.69 ? 105  THR A CA  1 
ATOM   825   C C   . THR A 1 105 ? -17.200 72.198  77.846  1.00   15.86 ? 105  THR A C   1 
ATOM   826   O O   . THR A 1 105 ? -17.412 72.654  78.965  1.00   12.23 ? 105  THR A O   1 
ATOM   827   C CB  . THR A 1 105 ? -18.507 72.071  75.638  1.00   18.31 ? 105  THR A CB  1 
ATOM   828   O OG1 . THR A 1 105 ? -17.271 71.983  74.926  1.00   10.31 ? 105  THR A OG1 1 
ATOM   829   C CG2 . THR A 1 105 ? -18.991 73.530  75.703  1.00   10.87 ? 105  THR A CG2 1 
ATOM   830   N N   . TYR A 1 106 ? -16.005 72.278  77.284  1.00   14.91 ? 106  TYR A N   1 
ATOM   831   C CA  . TYR A 1 106 ? -14.901 72.938  77.973  1.00   18.35 ? 106  TYR A CA  1 
ATOM   832   C C   . TYR A 1 106 ? -15.358 74.349  78.388  1.00   18.97 ? 106  TYR A C   1 
ATOM   833   O O   . TYR A 1 106 ? -15.847 75.130  77.567  1.00   17.37 ? 106  TYR A O   1 
ATOM   834   C CB  . TYR A 1 106 ? -13.695 73.019  77.036  1.00   19.50 ? 106  TYR A CB  1 
ATOM   835   C CG  . TYR A 1 106 ? -12.440 73.628  77.627  1.00   26.49 ? 106  TYR A CG  1 
ATOM   836   C CD1 . TYR A 1 106 ? -11.413 74.105  76.800  1.00   23.04 ? 106  TYR A CD1 1 
ATOM   837   C CD2 . TYR A 1 106 ? -12.227 73.640  79.009  1.00   23.54 ? 106  TYR A CD2 1 
ATOM   838   C CE1 . TYR A 1 106 ? -10.207 74.572  77.339  1.00   24.23 ? 106  TYR A CE1 1 
ATOM   839   C CE2 . TYR A 1 106 ? -11.025 74.101  79.550  1.00   24.71 ? 106  TYR A CE2 1 
ATOM   840   C CZ  . TYR A 1 106 ? -10.021 74.570  78.715  1.00   22.93 ? 106  TYR A CZ  1 
ATOM   841   O OH  . TYR A 1 106 ? -8.849  75.091  79.250  1.00   13.90 ? 106  TYR A OH  1 
ATOM   842   N N   . SER A 1 107 ? -15.211 74.665  79.668  1.00   18.46 ? 107  SER A N   1 
ATOM   843   C CA  . SER A 1 107 ? -15.633 75.956  80.174  1.00   22.32 ? 107  SER A CA  1 
ATOM   844   C C   . SER A 1 107 ? -14.880 77.108  79.531  1.00   20.63 ? 107  SER A C   1 
ATOM   845   O O   . SER A 1 107 ? -15.430 78.188  79.378  1.00   23.61 ? 107  SER A O   1 
ATOM   846   C CB  . SER A 1 107 ? -15.486 76.020  81.700  1.00   21.19 ? 107  SER A CB  1 
ATOM   847   O OG  . SER A 1 107 ? -14.134 75.823  82.090  1.00   28.07 ? 107  SER A OG  1 
ATOM   848   N N   . CYS A 1 108 ? -13.637 76.880  79.127  1.00   22.23 ? 108  CYS A N   1 
ATOM   849   C CA  . CYS A 1 108 ? -12.882 77.962  78.516  1.00   22.95 ? 108  CYS A CA  1 
ATOM   850   C C   . CYS A 1 108 ? -13.307 78.419  77.116  1.00   21.28 ? 108  CYS A C   1 
ATOM   851   O O   . CYS A 1 108 ? -12.880 79.491  76.661  1.00   22.15 ? 108  CYS A O   1 
ATOM   852   C CB  . CYS A 1 108 ? -11.386 77.655  78.571  1.00   25.28 ? 108  CYS A CB  1 
ATOM   853   S SG  . CYS A 1 108 ? -10.716 77.851  80.253  1.00   33.42 ? 108  CYS A SG  1 
ATOM   854   N N   . TYR A 1 109 ? -14.139 77.647  76.417  1.00   19.71 ? 109  TYR A N   1 
ATOM   855   C CA  . TYR A 1 109 ? -14.581 78.126  75.103  1.00   21.27 ? 109  TYR A CA  1 
ATOM   856   C C   . TYR A 1 109 ? -15.359 79.431  75.295  1.00   20.63 ? 109  TYR A C   1 
ATOM   857   O O   . TYR A 1 109 ? -15.131 80.388  74.582  1.00   21.64 ? 109  TYR A O   1 
ATOM   858   C CB  . TYR A 1 109 ? -15.494 77.134  74.383  1.00   22.49 ? 109  TYR A CB  1 
ATOM   859   C CG  . TYR A 1 109 ? -14.848 75.829  74.010  1.00   21.11 ? 109  TYR A CG  1 
ATOM   860   C CD1 . TYR A 1 109 ? -13.517 75.779  73.577  1.00   19.25 ? 109  TYR A CD1 1 
ATOM   861   C CD2 . TYR A 1 109 ? -15.577 74.636  74.069  1.00   18.92 ? 109  TYR A CD2 1 
ATOM   862   C CE1 . TYR A 1 109 ? -12.933 74.568  73.209  1.00   14.42 ? 109  TYR A CE1 1 
ATOM   863   C CE2 . TYR A 1 109 ? -15.003 73.423  73.713  1.00   13.52 ? 109  TYR A CE2 1 
ATOM   864   C CZ  . TYR A 1 109 ? -13.693 73.393  73.284  1.00   13.29 ? 109  TYR A CZ  1 
ATOM   865   O OH  . TYR A 1 109 ? -13.178 72.189  72.929  1.00   13.05 ? 109  TYR A OH  1 
ATOM   866   N N   . ARG A 1 110 ? -16.286 79.445  76.243  1.00   20.04 ? 110  ARG A N   1 
ATOM   867   C CA  . ARG A 1 110 ? -17.093 80.616  76.534  1.00   23.08 ? 110  ARG A CA  1 
ATOM   868   C C   . ARG A 1 110 ? -16.181 81.748  76.988  1.00   23.37 ? 110  ARG A C   1 
ATOM   869   O O   . ARG A 1 110 ? -16.275 82.877  76.503  1.00   23.61 ? 110  ARG A O   1 
ATOM   870   C CB  . ARG A 1 110 ? -18.075 80.316  77.674  1.00   24.91 ? 110  ARG A CB  1 
ATOM   871   C CG  . ARG A 1 110 ? -19.535 80.434  77.313  1.00   32.95 ? 110  ARG A CG  1 
ATOM   872   C CD  . ARG A 1 110 ? -20.410 80.347  78.563  1.00   32.64 ? 110  ARG A CD  1 
ATOM   873   N NE  . ARG A 1 110 ? -20.556 81.644  79.218  1.00   43.96 ? 110  ARG A NE  1 
ATOM   874   C CZ  . ARG A 1 110 ? -21.521 82.519  78.929  1.00   49.34 ? 110  ARG A CZ  1 
ATOM   875   N NH1 . ARG A 1 110 ? -22.430 82.228  77.998  1.00   45.67 ? 110  ARG A NH1 1 
ATOM   876   N NH2 . ARG A 1 110 ? -21.578 83.689  79.567  1.00   48.99 ? 110  ARG A NH2 1 
ATOM   877   N N   . ILE A 1 111 ? -15.290 81.429  77.919  1.00   22.11 ? 111  ILE A N   1 
ATOM   878   C CA  . ILE A 1 111 ? -14.378 82.425  78.463  1.00   22.99 ? 111  ILE A CA  1 
ATOM   879   C C   . ILE A 1 111 ? -13.469 83.078  77.415  1.00   23.89 ? 111  ILE A C   1 
ATOM   880   O O   . ILE A 1 111 ? -13.403 84.303  77.315  1.00   25.48 ? 111  ILE A O   1 
ATOM   881   C CB  . ILE A 1 111 ? -13.548 81.800  79.602  1.00   23.16 ? 111  ILE A CB  1 
ATOM   882   C CG1 . ILE A 1 111 ? -14.505 81.358  80.724  1.00   22.08 ? 111  ILE A CG1 1 
ATOM   883   C CG2 . ILE A 1 111 ? -12.510 82.790  80.129  1.00   15.76 ? 111  ILE A CG2 1 
ATOM   884   C CD1 . ILE A 1 111 ? -13.972 80.224  81.626  1.00   15.21 ? 111  ILE A CD1 1 
ATOM   885   N N   . PHE A 1 112 ? -12.785 82.268  76.620  1.00   23.05 ? 112  PHE A N   1 
ATOM   886   C CA  . PHE A 1 112 ? -11.900 82.826  75.607  1.00   20.75 ? 112  PHE A CA  1 
ATOM   887   C C   . PHE A 1 112 ? -12.661 83.591  74.517  1.00   21.81 ? 112  PHE A C   1 
ATOM   888   O O   . PHE A 1 112 ? -12.141 84.561  73.960  1.00   19.85 ? 112  PHE A O   1 
ATOM   889   C CB  . PHE A 1 112 ? -11.046 81.719  74.955  1.00   19.43 ? 112  PHE A CB  1 
ATOM   890   C CG  . PHE A 1 112 ? -10.134 80.983  75.920  1.00   16.99 ? 112  PHE A CG  1 
ATOM   891   C CD1 . PHE A 1 112 ? -9.948  81.437  77.243  1.00   15.16 ? 112  PHE A CD1 1 
ATOM   892   C CD2 . PHE A 1 112 ? -9.481  79.807  75.508  1.00   19.91 ? 112  PHE A CD2 1 
ATOM   893   C CE1 . PHE A 1 112 ? -9.122  80.722  78.152  1.00   16.29 ? 112  PHE A CE1 1 
ATOM   894   C CE2 . PHE A 1 112 ? -8.635  79.057  76.407  1.00   16.64 ? 112  PHE A CE2 1 
ATOM   895   C CZ  . PHE A 1 112 ? -8.459  79.517  77.725  1.00   12.53 ? 112  PHE A CZ  1 
ATOM   896   N N   . ALA A 1 113 ? -13.869 83.134  74.180  1.00   21.73 ? 113  ALA A N   1 
ATOM   897   C CA  . ALA A 1 113 ? -14.671 83.797  73.151  1.00   21.99 ? 113  ALA A CA  1 
ATOM   898   C C   . ALA A 1 113 ? -15.054 85.191  73.635  1.00   22.53 ? 113  ALA A C   1 
ATOM   899   O O   . ALA A 1 113 ? -14.800 86.173  72.951  1.00   23.44 ? 113  ALA A O   1 
ATOM   900   C CB  . ALA A 1 113 ? -15.915 83.000  72.853  1.00   24.31 ? 113  ALA A CB  1 
ATOM   901   N N   . LYS A 1 114 ? -15.662 85.268  74.816  1.00   22.42 ? 114  LYS A N   1 
ATOM   902   C CA  . LYS A 1 114 ? -16.041 86.549  75.374  1.00   25.84 ? 114  LYS A CA  1 
ATOM   903   C C   . LYS A 1 114 ? -14.784 87.404  75.431  1.00   28.83 ? 114  LYS A C   1 
ATOM   904   O O   . LYS A 1 114 ? -14.766 88.529  74.940  1.00   31.58 ? 114  LYS A O   1 
ATOM   905   C CB  . LYS A 1 114 ? -16.583 86.394  76.787  1.00   27.94 ? 114  LYS A CB  1 
ATOM   906   C CG  . LYS A 1 114 ? -17.986 85.817  76.913  1.00   32.49 ? 114  LYS A CG  1 
ATOM   907   C CD  . LYS A 1 114 ? -18.674 86.459  78.112  1.00   35.68 ? 114  LYS A CD  1 
ATOM   908   C CE  . LYS A 1 114 ? -19.418 85.451  78.965  1.00   43.85 ? 114  LYS A CE  1 
ATOM   909   N NZ  . LYS A 1 114 ? -19.790 86.027  80.295  1.00   44.96 ? 114  LYS A NZ  1 
ATOM   910   N N   . ALA A 1 115 ? -13.733 86.847  76.023  1.00   28.95 ? 115  ALA A N   1 
ATOM   911   C CA  . ALA A 1 115 ? -12.455 87.525  76.181  1.00   28.38 ? 115  ALA A CA  1 
ATOM   912   C C   . ALA A 1 115 ? -11.853 88.027  74.884  1.00   25.83 ? 115  ALA A C   1 
ATOM   913   O O   . ALA A 1 115 ? -11.304 89.116  74.833  1.00   26.70 ? 115  ALA A O   1 
ATOM   914   C CB  . ALA A 1 115 ? -11.457 86.597  76.887  1.00   29.24 ? 115  ALA A CB  1 
ATOM   915   N N   . VAL A 1 116 ? -11.957 87.229  73.835  1.00   28.92 ? 116  VAL A N   1 
ATOM   916   C CA  . VAL A 1 116 ? -11.395 87.598  72.546  1.00   29.40 ? 116  VAL A CA  1 
ATOM   917   C C   . VAL A 1 116 ? -12.385 88.360  71.664  1.00   30.78 ? 116  VAL A C   1 
ATOM   918   O O   . VAL A 1 116 ? -12.065 88.724  70.534  1.00   30.11 ? 116  VAL A O   1 
ATOM   919   C CB  . VAL A 1 116 ? -10.873 86.336  71.823  1.00   32.98 ? 116  VAL A CB  1 
ATOM   920   C CG1 . VAL A 1 116 ? -11.674 86.042  70.553  1.00   29.07 ? 116  VAL A CG1 1 
ATOM   921   C CG2 . VAL A 1 116 ? -9.404  86.502  71.537  1.00   30.53 ? 116  VAL A CG2 1 
ATOM   922   N N   . GLY A 1 117 ? -13.577 88.618  72.196  1.00   30.25 ? 117  GLY A N   1 
ATOM   923   C CA  . GLY A 1 117 ? -14.580 89.346  71.442  1.00   30.18 ? 117  GLY A CA  1 
ATOM   924   C C   . GLY A 1 117 ? -15.065 88.602  70.205  1.00   31.45 ? 117  GLY A C   1 
ATOM   925   O O   . GLY A 1 117 ? -15.532 89.221  69.243  1.00   32.96 ? 117  GLY A O   1 
ATOM   926   N N   . ALA A 1 118 ? -14.953 87.278  70.205  1.00   27.84 ? 118  ALA A N   1 
ATOM   927   C CA  . ALA A 1 118 ? -15.408 86.499  69.067  1.00   25.00 ? 118  ALA A CA  1 
ATOM   928   C C   . ALA A 1 118 ? -16.889 86.165  69.213  1.00   25.53 ? 118  ALA A C   1 
ATOM   929   O O   . ALA A 1 118 ? -17.387 85.939  70.312  1.00   27.05 ? 118  ALA A O   1 
ATOM   930   C CB  . ALA A 1 118 ? -14.612 85.228  68.957  1.00   25.20 ? 118  ALA A CB  1 
ATOM   931   N N   . LYS A 1 119 ? -17.588 86.149  68.091  1.00   24.46 ? 119  LYS A N   1 
ATOM   932   C CA  . LYS A 1 119 ? -19.001 85.824  68.074  1.00   24.97 ? 119  LYS A CA  1 
ATOM   933   C C   . LYS A 1 119 ? -19.099 84.336  68.304  1.00   23.58 ? 119  LYS A C   1 
ATOM   934   O O   . LYS A 1 119 ? -18.342 83.559  67.692  1.00   21.70 ? 119  LYS A O   1 
ATOM   935   C CB  . LYS A 1 119 ? -19.588 86.162  66.709  1.00   25.39 ? 119  LYS A CB  1 
ATOM   936   C CG  . LYS A 1 119 ? -21.026 85.762  66.528  1.00   34.12 ? 119  LYS A CG  1 
ATOM   937   C CD  . LYS A 1 119 ? -21.448 85.877  65.057  1.00   39.66 ? 119  LYS A CD  1 
ATOM   938   C CE  . LYS A 1 119 ? -22.642 86.817  64.894  1.00   38.03 ? 119  LYS A CE  1 
ATOM   939   N NZ  . LYS A 1 119 ? -23.769 86.396  65.791  1.00   34.92 ? 119  LYS A NZ  1 
ATOM   940   N N   . PHE A 1 120 ? -20.017 83.926  69.179  1.00   21.22 ? 120  PHE A N   1 
ATOM   941   C CA  . PHE A 1 120 ? -20.168 82.498  69.443  1.00   20.59 ? 120  PHE A CA  1 
ATOM   942   C C   . PHE A 1 120 ? -21.609 82.064  69.703  1.00   20.56 ? 120  PHE A C   1 
ATOM   943   O O   . PHE A 1 120 ? -22.463 82.862  70.080  1.00   21.01 ? 120  PHE A O   1 
ATOM   944   C CB  . PHE A 1 120 ? -19.302 82.079  70.635  1.00   15.46 ? 120  PHE A CB  1 
ATOM   945   C CG  . PHE A 1 120 ? -19.756 82.660  71.936  1.00   15.06 ? 120  PHE A CG  1 
ATOM   946   C CD1 . PHE A 1 120 ? -19.462 83.978  72.261  1.00   13.34 ? 120  PHE A CD1 1 
ATOM   947   C CD2 . PHE A 1 120 ? -20.523 81.908  72.819  1.00   15.51 ? 120  PHE A CD2 1 
ATOM   948   C CE1 . PHE A 1 120 ? -19.923 84.548  73.444  1.00   7.72  ? 120  PHE A CE1 1 
ATOM   949   C CE2 . PHE A 1 120 ? -20.998 82.467  74.021  1.00   12.26 ? 120  PHE A CE2 1 
ATOM   950   C CZ  . PHE A 1 120 ? -20.696 83.793  74.330  1.00   12.95 ? 120  PHE A CZ  1 
ATOM   951   N N   . LEU A 1 121 ? -21.858 80.781  69.493  1.00   19.66 ? 121  LEU A N   1 
ATOM   952   C CA  . LEU A 1 121 ? -23.162 80.182  69.717  1.00   19.96 ? 121  LEU A CA  1 
ATOM   953   C C   . LEU A 1 121 ? -23.027 78.898  70.536  1.00   19.65 ? 121  LEU A C   1 
ATOM   954   O O   . LEU A 1 121 ? -22.324 77.967  70.139  1.00   18.51 ? 121  LEU A O   1 
ATOM   955   C CB  . LEU A 1 121 ? -23.847 79.849  68.385  1.00   19.66 ? 121  LEU A CB  1 
ATOM   956   C CG  . LEU A 1 121 ? -25.233 79.222  68.553  1.00   20.13 ? 121  LEU A CG  1 
ATOM   957   C CD1 . LEU A 1 121 ? -26.223 80.317  69.019  1.00   18.63 ? 121  LEU A CD1 1 
ATOM   958   C CD2 . LEU A 1 121 ? -25.708 78.613  67.242  1.00   17.04 ? 121  LEU A CD2 1 
ATOM   959   N N   . GLU A 1 122 ? -23.680 78.882  71.694  1.00   19.85 ? 122  GLU A N   1 
ATOM   960   C CA  . GLU A 1 122 ? -23.720 77.711  72.573  1.00   21.46 ? 122  GLU A CA  1 
ATOM   961   C C   . GLU A 1 122 ? -25.027 76.972  72.294  1.00   19.95 ? 122  GLU A C   1 
ATOM   962   O O   . GLU A 1 122 ? -26.105 77.545  72.491  1.00   21.54 ? 122  GLU A O   1 
ATOM   963   C CB  . GLU A 1 122 ? -23.707 78.116  74.052  1.00   20.37 ? 122  GLU A CB  1 
ATOM   964   C CG  . GLU A 1 122 ? -22.371 78.606  74.512  1.00   27.36 ? 122  GLU A CG  1 
ATOM   965   C CD  . GLU A 1 122 ? -22.367 79.063  75.952  1.00   31.67 ? 122  GLU A CD  1 
ATOM   966   O OE1 . GLU A 1 122 ? -22.937 80.145  76.246  1.00   33.60 ? 122  GLU A OE1 1 
ATOM   967   O OE2 . GLU A 1 122 ? -21.779 78.336  76.787  1.00   27.92 ? 122  GLU A OE2 1 
ATOM   968   N N   . VAL A 1 123 ? -24.942 75.746  71.781  1.00   16.34 ? 123  VAL A N   1 
ATOM   969   C CA  . VAL A 1 123 ? -26.147 74.972  71.534  1.00   16.69 ? 123  VAL A CA  1 
ATOM   970   C C   . VAL A 1 123 ? -25.867 73.759  72.369  1.00   19.18 ? 123  VAL A C   1 
ATOM   971   O O   . VAL A 1 123 ? -24.844 73.100  72.192  1.00   20.47 ? 123  VAL A O   1 
ATOM   972   C CB  . VAL A 1 123 ? -26.355 74.631  70.055  1.00   15.17 ? 123  VAL A CB  1 
ATOM   973   C CG1 . VAL A 1 123 ? -27.718 73.905  69.872  1.00   14.64 ? 123  VAL A CG1 1 
ATOM   974   C CG2 . VAL A 1 123 ? -26.398 75.924  69.248  1.00   15.81 ? 123  VAL A CG2 1 
ATOM   975   N N   . PRO A 1 124 ? -26.776 73.456  73.310  1.00   19.67 ? 124  PRO A N   1 
ATOM   976   C CA  . PRO A 1 124 ? -26.566 72.308  74.194  1.00   18.87 ? 124  PRO A CA  1 
ATOM   977   C C   . PRO A 1 124 ? -26.658 70.974  73.512  1.00   21.14 ? 124  PRO A C   1 
ATOM   978   O O   . PRO A 1 124 ? -27.455 70.807  72.601  1.00   23.28 ? 124  PRO A O   1 
ATOM   979   C CB  . PRO A 1 124 ? -27.639 72.482  75.298  1.00   17.28 ? 124  PRO A CB  1 
ATOM   980   C CG  . PRO A 1 124 ? -28.423 73.861  74.943  1.00   16.67 ? 124  PRO A CG  1 
ATOM   981   C CD  . PRO A 1 124 ? -28.149 73.992  73.433  1.00   15.19 ? 124  PRO A CD  1 
ATOM   982   N N   . LEU A 1 125 ? -25.778 70.058  73.918  1.00   21.78 ? 125  LEU A N   1 
ATOM   983   C CA  . LEU A 1 125 ? -25.795 68.689  73.437  1.00   21.37 ? 125  LEU A CA  1 
ATOM   984   C C   . LEU A 1 125 ? -27.200 68.125  73.748  1.00   23.38 ? 125  LEU A C   1 
ATOM   985   O O   . LEU A 1 125 ? -27.917 68.625  74.641  1.00   19.08 ? 125  LEU A O   1 
ATOM   986   C CB  . LEU A 1 125 ? -24.756 67.866  74.201  1.00   20.49 ? 125  LEU A CB  1 
ATOM   987   C CG  . LEU A 1 125 ? -23.268 68.023  73.877  1.00   21.86 ? 125  LEU A CG  1 
ATOM   988   C CD1 . LEU A 1 125 ? -22.451 67.076  74.770  1.00   21.05 ? 125  LEU A CD1 1 
ATOM   989   C CD2 . LEU A 1 125 ? -23.022 67.687  72.401  1.00   13.78 ? 125  LEU A CD2 1 
ATOM   990   N N   . THR A 1 126 ? -27.590 67.075  73.038  1.00   23.08 ? 126  THR A N   1 
ATOM   991   C CA  . THR A 1 126 ? -28.907 66.496  73.269  1.00   24.38 ? 126  THR A CA  1 
ATOM   992   C C   . THR A 1 126 ? -28.918 65.838  74.642  1.00   24.80 ? 126  THR A C   1 
ATOM   993   O O   . THR A 1 126 ? -27.887 65.798  75.297  1.00   22.73 ? 126  THR A O   1 
ATOM   994   C CB  . THR A 1 126 ? -29.249 65.437  72.218  1.00   23.51 ? 126  THR A CB  1 
ATOM   995   O OG1 . THR A 1 126 ? -28.418 64.284  72.406  1.00   23.70 ? 126  THR A OG1 1 
ATOM   996   C CG2 . THR A 1 126 ? -29.034 65.972  70.830  1.00   20.60 ? 126  THR A CG2 1 
ATOM   997   N N   . LYS A 1 127 ? -30.070 65.326  75.070  1.00   23.91 ? 127  LYS A N   1 
ATOM   998   C CA  . LYS A 1 127 ? -30.189 64.653  76.368  1.00   25.27 ? 127  LYS A CA  1 
ATOM   999   C C   . LYS A 1 127 ? -29.393 63.353  76.363  1.00   25.16 ? 127  LYS A C   1 
ATOM   1000  O O   . LYS A 1 127 ? -29.291 62.669  77.371  1.00   23.06 ? 127  LYS A O   1 
ATOM   1001  C CB  . LYS A 1 127 ? -31.656 64.304  76.669  1.00   29.95 ? 127  LYS A CB  1 
ATOM   1002  C CG  . LYS A 1 127 ? -32.214 63.173  75.791  1.00   32.32 ? 127  LYS A CG  1 
ATOM   1003  C CD  . LYS A 1 127 ? -33.663 62.838  76.140  1.00   39.62 ? 127  LYS A CD  1 
ATOM   1004  C CE  . LYS A 1 127 ? -34.257 61.820  75.160  1.00   40.33 ? 127  LYS A CE  1 
ATOM   1005  N NZ  . LYS A 1 127 ? -33.625 60.468  75.300  1.00   44.78 ? 127  LYS A NZ  1 
ATOM   1006  N N   . ASP A 1 128 ? -28.858 62.993  75.209  1.00   27.71 ? 128  ASP A N   1 
ATOM   1007  C CA  . ASP A 1 128 ? -28.064 61.777  75.117  1.00   27.80 ? 128  ASP A CA  1 
ATOM   1008  C C   . ASP A 1 128 ? -26.645 62.153  74.810  1.00   25.82 ? 128  ASP A C   1 
ATOM   1009  O O   . ASP A 1 128 ? -25.856 61.342  74.352  1.00   25.47 ? 128  ASP A O   1 
ATOM   1010  C CB  . ASP A 1 128 ? -28.642 60.841  74.063  1.00   30.10 ? 128  ASP A CB  1 
ATOM   1011  C CG  . ASP A 1 128 ? -30.060 60.418  74.413  1.00   34.37 ? 128  ASP A CG  1 
ATOM   1012  O OD1 . ASP A 1 128 ? -30.225 59.873  75.531  1.00   28.57 ? 128  ASP A OD1 1 
ATOM   1013  O OD2 . ASP A 1 128 ? -30.993 60.654  73.597  1.00   28.68 ? 128  ASP A OD2 1 
ATOM   1014  N N   . LEU A 1 129 ? -26.346 63.422  75.073  1.00   26.25 ? 129  LEU A N   1 
ATOM   1015  C CA  . LEU A 1 129 ? -25.021 63.968  74.884  1.00   23.98 ? 129  LEU A CA  1 
ATOM   1016  C C   . LEU A 1 129 ? -24.566 63.900  73.439  1.00   22.42 ? 129  LEU A C   1 
ATOM   1017  O O   . LEU A 1 129 ? -23.380 63.701  73.181  1.00   21.16 ? 129  LEU A O   1 
ATOM   1018  C CB  . LEU A 1 129 ? -24.027 63.205  75.771  1.00   25.23 ? 129  LEU A CB  1 
ATOM   1019  C CG  . LEU A 1 129 ? -24.423 63.027  77.226  1.00   25.80 ? 129  LEU A CG  1 
ATOM   1020  C CD1 . LEU A 1 129 ? -23.330 62.272  77.954  1.00   23.77 ? 129  LEU A CD1 1 
ATOM   1021  C CD2 . LEU A 1 129 ? -24.672 64.386  77.851  1.00   25.34 ? 129  LEU A CD2 1 
ATOM   1022  N N   . ARG A 1 130 ? -25.493 64.050  72.501  1.00   21.03 ? 130  ARG A N   1 
ATOM   1023  C CA  . ARG A 1 130 ? -25.137 64.019  71.090  1.00   23.18 ? 130  ARG A CA  1 
ATOM   1024  C C   . ARG A 1 130 ? -25.087 65.425  70.467  1.00   25.32 ? 130  ARG A C   1 
ATOM   1025  O O   . ARG A 1 130 ? -25.789 66.348  70.895  1.00   22.28 ? 130  ARG A O   1 
ATOM   1026  C CB  . ARG A 1 130 ? -26.115 63.143  70.299  1.00   27.06 ? 130  ARG A CB  1 
ATOM   1027  C CG  . ARG A 1 130 ? -25.925 61.649  70.498  1.00   30.38 ? 130  ARG A CG  1 
ATOM   1028  C CD  . ARG A 1 130 ? -26.608 60.872  69.379  1.00   40.87 ? 130  ARG A CD  1 
ATOM   1029  N NE  . ARG A 1 130 ? -25.669 60.323  68.387  1.00   49.26 ? 130  ARG A NE  1 
ATOM   1030  C CZ  . ARG A 1 130 ? -25.756 60.511  67.065  1.00   50.26 ? 130  ARG A CZ  1 
ATOM   1031  N NH1 . ARG A 1 130 ? -26.733 61.245  66.553  1.00   47.68 ? 130  ARG A NH1 1 
ATOM   1032  N NH2 . ARG A 1 130 ? -24.875 59.949  66.242  1.00   53.02 ? 130  ARG A NH2 1 
ATOM   1033  N N   . ILE A 1 131 ? -24.233 65.590  69.463  1.00   25.83 ? 131  ILE A N   1 
ATOM   1034  C CA  . ILE A 1 131 ? -24.121 66.879  68.805  1.00   28.72 ? 131  ILE A CA  1 
ATOM   1035  C C   . ILE A 1 131 ? -25.523 67.267  68.339  1.00   29.20 ? 131  ILE A C   1 
ATOM   1036  O O   . ILE A 1 131 ? -26.201 66.500  67.663  1.00   30.63 ? 131  ILE A O   1 
ATOM   1037  C CB  . ILE A 1 131 ? -23.187 66.837  67.554  1.00   28.30 ? 131  ILE A CB  1 
ATOM   1038  C CG1 . ILE A 1 131 ? -21.788 66.306  67.912  1.00   28.52 ? 131  ILE A CG1 1 
ATOM   1039  C CG2 . ILE A 1 131 ? -23.099 68.232  66.942  1.00   23.42 ? 131  ILE A CG2 1 
ATOM   1040  C CD1 . ILE A 1 131 ? -20.960 67.208  68.779  1.00   29.73 ? 131  ILE A CD1 1 
ATOM   1041  N N   . PRO A 1 132 ? -25.972 68.470  68.695  1.00   29.60 ? 132  PRO A N   1 
ATOM   1042  C CA  . PRO A 1 132 ? -27.300 68.921  68.293  1.00   27.68 ? 132  PRO A CA  1 
ATOM   1043  C C   . PRO A 1 132 ? -27.313 69.347  66.840  1.00   29.70 ? 132  PRO A C   1 
ATOM   1044  O O   . PRO A 1 132 ? -26.259 69.507  66.223  1.00   33.95 ? 132  PRO A O   1 
ATOM   1045  C CB  . PRO A 1 132 ? -27.559 70.072  69.243  1.00   26.05 ? 132  PRO A CB  1 
ATOM   1046  C CG  . PRO A 1 132 ? -26.193 70.672  69.393  1.00   27.68 ? 132  PRO A CG  1 
ATOM   1047  C CD  . PRO A 1 132 ? -25.327 69.451  69.583  1.00   27.10 ? 132  PRO A CD  1 
ATOM   1048  N N   . GLU A 1 133 ? -28.510 69.494  66.286  1.00   30.39 ? 133  GLU A N   1 
ATOM   1049  C CA  . GLU A 1 133 ? -28.670 69.931  64.902  1.00   32.13 ? 133  GLU A CA  1 
ATOM   1050  C C   . GLU A 1 133 ? -28.366 71.421  64.935  1.00   31.35 ? 133  GLU A C   1 
ATOM   1051  O O   . GLU A 1 133 ? -28.720 72.102  65.888  1.00   28.89 ? 133  GLU A O   1 
ATOM   1052  C CB  . GLU A 1 133 ? -30.113 69.711  64.436  1.00   35.04 ? 133  GLU A CB  1 
ATOM   1053  C CG  . GLU A 1 133 ? -31.149 70.512  65.238  1.00   42.88 ? 133  GLU A CG  1 
ATOM   1054  C CD  . GLU A 1 133 ? -31.108 70.231  66.750  1.00   48.65 ? 133  GLU A CD  1 
ATOM   1055  O OE1 . GLU A 1 133 ? -31.365 71.168  67.544  1.00   54.70 ? 133  GLU A OE1 1 
ATOM   1056  O OE2 . GLU A 1 133 ? -30.833 69.074  67.149  1.00   50.81 ? 133  GLU A OE2 1 
ATOM   1057  N N   . VAL A 1 134 ? -27.719 71.951  63.911  1.00   32.28 ? 134  VAL A N   1 
ATOM   1058  C CA  . VAL A 1 134 ? -27.425 73.375  63.962  1.00   32.07 ? 134  VAL A CA  1 
ATOM   1059  C C   . VAL A 1 134 ? -27.026 73.958  62.611  1.00   30.63 ? 134  VAL A C   1 
ATOM   1060  O O   . VAL A 1 134 ? -26.580 73.246  61.720  1.00   31.69 ? 134  VAL A O   1 
ATOM   1061  C CB  . VAL A 1 134 ? -26.314 73.642  65.035  1.00   32.73 ? 134  VAL A CB  1 
ATOM   1062  C CG1 . VAL A 1 134 ? -24.995 73.014  64.591  1.00   31.83 ? 134  VAL A CG1 1 
ATOM   1063  C CG2 . VAL A 1 134 ? -26.164 75.141  65.281  1.00   30.67 ? 134  VAL A CG2 1 
ATOM   1064  N N   . ASN A 1 135 ? -27.192 75.261  62.457  1.00   31.93 ? 135  ASN A N   1 
ATOM   1065  C CA  . ASN A 1 135 ? -26.849 75.888  61.200  1.00   31.17 ? 135  ASN A CA  1 
ATOM   1066  C C   . ASN A 1 135 ? -25.482 76.490  61.259  1.00   30.02 ? 135  ASN A C   1 
ATOM   1067  O O   . ASN A 1 135 ? -25.289 77.602  61.779  1.00   29.09 ? 135  ASN A O   1 
ATOM   1068  C CB  . ASN A 1 135 ? -27.871 76.950  60.835  1.00   39.45 ? 135  ASN A CB  1 
ATOM   1069  C CG  . ASN A 1 135 ? -29.228 76.359  60.589  1.00   46.33 ? 135  ASN A CG  1 
ATOM   1070  O OD1 . ASN A 1 135 ? -29.371 75.455  59.763  1.00   52.74 ? 135  ASN A OD1 1 
ATOM   1071  N ND2 . ASN A 1 135 ? -30.236 76.847  61.306  1.00   51.99 ? 135  ASN A ND2 1 
ATOM   1072  N N   . VAL A 1 136 ? -24.543 75.722  60.722  1.00   26.61 ? 136  VAL A N   1 
ATOM   1073  C CA  . VAL A 1 136 ? -23.144 76.087  60.663  1.00   24.96 ? 136  VAL A CA  1 
ATOM   1074  C C   . VAL A 1 136 ? -22.570 75.740  59.295  1.00   27.15 ? 136  VAL A C   1 
ATOM   1075  O O   . VAL A 1 136 ? -22.964 74.767  58.658  1.00   28.88 ? 136  VAL A O   1 
ATOM   1076  C CB  . VAL A 1 136 ? -22.348 75.332  61.717  1.00   22.59 ? 136  VAL A CB  1 
ATOM   1077  C CG1 . VAL A 1 136 ? -22.939 75.618  63.097  1.00   22.53 ? 136  VAL A CG1 1 
ATOM   1078  C CG2 . VAL A 1 136 ? -22.386 73.820  61.414  1.00   19.17 ? 136  VAL A CG2 1 
ATOM   1079  N N   . GLY A 1 137 ? -21.617 76.552  58.867  1.00   28.24 ? 137  GLY A N   1 
ATOM   1080  C CA  . GLY A 1 137 ? -20.958 76.350  57.600  1.00   24.52 ? 137  GLY A CA  1 
ATOM   1081  C C   . GLY A 1 137 ? -19.754 77.265  57.536  1.00   24.39 ? 137  GLY A C   1 
ATOM   1082  O O   . GLY A 1 137 ? -19.372 77.864  58.548  1.00   22.75 ? 137  GLY A O   1 
ATOM   1083  N N   . GLU A 1 138 ? -19.160 77.373  56.351  1.00   23.99 ? 138  GLU A N   1 
ATOM   1084  C CA  . GLU A 1 138 ? -17.974 78.189  56.152  1.00   27.33 ? 138  GLU A CA  1 
ATOM   1085  C C   . GLU A 1 138 ? -18.061 79.484  56.954  1.00   28.69 ? 138  GLU A C   1 
ATOM   1086  O O   . GLU A 1 138 ? -19.104 80.137  57.030  1.00   30.30 ? 138  GLU A O   1 
ATOM   1087  C CB  . GLU A 1 138 ? -17.781 78.476  54.676  1.00   27.54 ? 138  GLU A CB  1 
ATOM   1088  C CG  . GLU A 1 138 ? -16.333 78.658  54.290  1.00   38.30 ? 138  GLU A CG  1 
ATOM   1089  C CD  . GLU A 1 138 ? -16.138 78.650  52.797  1.00   45.61 ? 138  GLU A CD  1 
ATOM   1090  O OE1 . GLU A 1 138 ? -14.970 78.661  52.363  1.00   50.89 ? 138  GLU A OE1 1 
ATOM   1091  O OE2 . GLU A 1 138 ? -17.147 78.627  52.054  1.00   49.57 ? 138  GLU A OE2 1 
ATOM   1092  N N   . GLY A 1 139 ? -16.958 79.855  57.570  1.00   28.44 ? 139  GLY A N   1 
ATOM   1093  C CA  . GLY A 1 139 ? -16.979 81.048  58.398  1.00   27.33 ? 139  GLY A CA  1 
ATOM   1094  C C   . GLY A 1 139 ? -17.053 80.609  59.857  1.00   26.39 ? 139  GLY A C   1 
ATOM   1095  O O   . GLY A 1 139 ? -16.409 81.183  60.748  1.00   28.08 ? 139  GLY A O   1 
ATOM   1096  N N   . ASP A 1 140 ? -17.847 79.571  60.098  1.00   23.49 ? 140  ASP A N   1 
ATOM   1097  C CA  . ASP A 1 140 ? -18.017 79.023  61.436  1.00   22.07 ? 140  ASP A CA  1 
ATOM   1098  C C   . ASP A 1 140 ? -16.864 78.101  61.831  1.00   19.85 ? 140  ASP A C   1 
ATOM   1099  O O   . ASP A 1 140 ? -16.228 77.488  60.993  1.00   17.95 ? 140  ASP A O   1 
ATOM   1100  C CB  . ASP A 1 140 ? -19.302 78.185  61.507  1.00   23.18 ? 140  ASP A CB  1 
ATOM   1101  C CG  . ASP A 1 140 ? -20.555 79.014  61.469  1.00   26.36 ? 140  ASP A CG  1 
ATOM   1102  O OD1 . ASP A 1 140 ? -21.578 78.486  60.964  1.00   26.46 ? 140  ASP A OD1 1 
ATOM   1103  O OD2 . ASP A 1 140 ? -20.507 80.173  61.956  1.00   27.14 ? 140  ASP A OD2 1 
ATOM   1104  N N   . VAL A 1 141 ? -16.583 78.019  63.121  1.00   18.60 ? 141  VAL A N   1 
ATOM   1105  C CA  . VAL A 1 141 ? -15.595 77.067  63.602  1.00   16.37 ? 141  VAL A CA  1 
ATOM   1106  C C   . VAL A 1 141 ? -16.324 76.371  64.731  1.00   16.46 ? 141  VAL A C   1 
ATOM   1107  O O   . VAL A 1 141 ? -16.944 77.007  65.594  1.00   11.82 ? 141  VAL A O   1 
ATOM   1108  C CB  . VAL A 1 141 ? -14.249 77.707  64.099  1.00   18.38 ? 141  VAL A CB  1 
ATOM   1109  C CG1 . VAL A 1 141 ? -14.488 78.899  65.012  1.00   18.72 ? 141  VAL A CG1 1 
ATOM   1110  C CG2 . VAL A 1 141 ? -13.445 76.651  64.833  1.00   13.85 ? 141  VAL A CG2 1 
ATOM   1111  N N   . VAL A 1 142 ? -16.293 75.047  64.691  1.00   16.72 ? 142  VAL A N   1 
ATOM   1112  C CA  . VAL A 1 142 ? -16.968 74.247  65.690  1.00   17.18 ? 142  VAL A CA  1 
ATOM   1113  C C   . VAL A 1 142 ? -16.015 73.480  66.598  1.00   14.92 ? 142  VAL A C   1 
ATOM   1114  O O   . VAL A 1 142 ? -15.318 72.556  66.171  1.00   13.19 ? 142  VAL A O   1 
ATOM   1115  C CB  . VAL A 1 142 ? -17.920 73.283  65.009  1.00   19.52 ? 142  VAL A CB  1 
ATOM   1116  C CG1 . VAL A 1 142 ? -18.604 72.419  66.050  1.00   19.26 ? 142  VAL A CG1 1 
ATOM   1117  C CG2 . VAL A 1 142 ? -18.922 74.078  64.163  1.00   16.93 ? 142  VAL A CG2 1 
ATOM   1118  N N   . PHE A 1 143 ? -15.994 73.881  67.862  1.00   16.47 ? 143  PHE A N   1 
ATOM   1119  C CA  . PHE A 1 143 ? -15.134 73.249  68.847  1.00   18.63 ? 143  PHE A CA  1 
ATOM   1120  C C   . PHE A 1 143 ? -15.791 72.033  69.477  1.00   19.29 ? 143  PHE A C   1 
ATOM   1121  O O   . PHE A 1 143 ? -16.819 72.154  70.152  1.00   24.68 ? 143  PHE A O   1 
ATOM   1122  C CB  . PHE A 1 143 ? -14.755 74.258  69.926  1.00   14.51 ? 143  PHE A CB  1 
ATOM   1123  C CG  . PHE A 1 143 ? -13.722 75.243  69.485  1.00   20.56 ? 143  PHE A CG  1 
ATOM   1124  C CD1 . PHE A 1 143 ? -12.378 74.873  69.402  1.00   19.46 ? 143  PHE A CD1 1 
ATOM   1125  C CD2 . PHE A 1 143 ? -14.093 76.540  69.145  1.00   21.49 ? 143  PHE A CD2 1 
ATOM   1126  C CE1 . PHE A 1 143 ? -11.418 75.786  68.989  1.00   18.05 ? 143  PHE A CE1 1 
ATOM   1127  C CE2 . PHE A 1 143 ? -13.147 77.459  68.732  1.00   22.72 ? 143  PHE A CE2 1 
ATOM   1128  C CZ  . PHE A 1 143 ? -11.804 77.086  68.653  1.00   21.56 ? 143  PHE A CZ  1 
ATOM   1129  N N   . ILE A 1 144 ? -15.202 70.863  69.243  1.00   18.78 ? 144  ILE A N   1 
ATOM   1130  C CA  . ILE A 1 144 ? -15.723 69.638  69.826  1.00   16.84 ? 144  ILE A CA  1 
ATOM   1131  C C   . ILE A 1 144 ? -14.629 68.857  70.572  1.00   19.21 ? 144  ILE A C   1 
ATOM   1132  O O   . ILE A 1 144 ? -13.728 68.284  69.956  1.00   14.33 ? 144  ILE A O   1 
ATOM   1133  C CB  . ILE A 1 144 ? -16.271 68.704  68.770  1.00   17.79 ? 144  ILE A CB  1 
ATOM   1134  C CG1 . ILE A 1 144 ? -17.188 69.447  67.811  1.00   19.20 ? 144  ILE A CG1 1 
ATOM   1135  C CG2 . ILE A 1 144 ? -17.015 67.575  69.439  1.00   22.65 ? 144  ILE A CG2 1 
ATOM   1136  C CD1 . ILE A 1 144 ? -17.745 68.546  66.673  1.00   16.63 ? 144  ILE A CD1 1 
ATOM   1137  N N   . PRO A 1 145 ? -14.680 68.850  71.913  1.00   17.51 ? 145  PRO A N   1 
ATOM   1138  C CA  . PRO A 1 145 ? -13.651 68.096  72.623  1.00   22.10 ? 145  PRO A CA  1 
ATOM   1139  C C   . PRO A 1 145 ? -14.070 66.631  72.558  1.00   22.31 ? 145  PRO A C   1 
ATOM   1140  O O   . PRO A 1 145 ? -15.221 66.286  72.832  1.00   23.86 ? 145  PRO A O   1 
ATOM   1141  C CB  . PRO A 1 145 ? -13.698 68.672  74.037  1.00   21.81 ? 145  PRO A CB  1 
ATOM   1142  C CG  . PRO A 1 145 ? -15.180 69.064  74.176  1.00   22.85 ? 145  PRO A CG  1 
ATOM   1143  C CD  . PRO A 1 145 ? -15.445 69.703  72.829  1.00   19.52 ? 145  PRO A CD  1 
ATOM   1144  N N   . ASN A 1 146 ? -13.143 65.767  72.183  1.00   21.44 ? 146  ASN A N   1 
ATOM   1145  C CA  . ASN A 1 146 ? -13.482 64.368  72.079  1.00   22.37 ? 146  ASN A CA  1 
ATOM   1146  C C   . ASN A 1 146 ? -12.251 63.558  72.428  1.00   21.07 ? 146  ASN A C   1 
ATOM   1147  O O   . ASN A 1 146 ? -11.360 63.389  71.597  1.00   19.74 ? 146  ASN A O   1 
ATOM   1148  C CB  . ASN A 1 146 ? -13.991 64.076  70.655  1.00   22.77 ? 146  ASN A CB  1 
ATOM   1149  C CG  . ASN A 1 146 ? -14.455 62.640  70.465  1.00   22.05 ? 146  ASN A CG  1 
ATOM   1150  O OD1 . ASN A 1 146 ? -14.913 61.980  71.395  1.00   26.13 ? 146  ASN A OD1 1 
ATOM   1151  N ND2 . ASN A 1 146 ? -14.358 62.159  69.238  1.00   22.26 ? 146  ASN A ND2 1 
ATOM   1152  N N   . PRO A 1 147 ? -12.237 62.964  73.636  1.00   21.23 ? 147  PRO A N   1 
ATOM   1153  C CA  . PRO A 1 147 ? -13.278 62.981  74.681  1.00   21.55 ? 147  PRO A CA  1 
ATOM   1154  C C   . PRO A 1 147 ? -13.802 64.328  75.212  1.00   22.75 ? 147  PRO A C   1 
ATOM   1155  O O   . PRO A 1 147 ? -13.048 65.264  75.452  1.00   23.36 ? 147  PRO A O   1 
ATOM   1156  C CB  . PRO A 1 147 ? -12.669 62.116  75.786  1.00   21.71 ? 147  PRO A CB  1 
ATOM   1157  C CG  . PRO A 1 147 ? -11.798 61.186  75.047  1.00   21.90 ? 147  PRO A CG  1 
ATOM   1158  C CD  . PRO A 1 147 ? -11.115 62.111  74.056  1.00   17.94 ? 147  PRO A CD  1 
ATOM   1159  N N   . ASN A 1 148 ? -15.118 64.403  75.416  1.00   22.13 ? 148  ASN A N   1 
ATOM   1160  C CA  . ASN A 1 148 ? -15.757 65.630  75.906  1.00   20.51 ? 148  ASN A CA  1 
ATOM   1161  C C   . ASN A 1 148 ? -15.284 66.013  77.307  1.00   19.72 ? 148  ASN A C   1 
ATOM   1162  O O   . ASN A 1 148 ? -14.887 65.162  78.098  1.00   18.11 ? 148  ASN A O   1 
ATOM   1163  C CB  . ASN A 1 148 ? -17.270 65.456  75.951  1.00   18.61 ? 148  ASN A CB  1 
ATOM   1164  C CG  . ASN A 1 148 ? -18.024 66.764  76.192  1.00   17.05 ? 148  ASN A CG  1 
ATOM   1165  O OD1 . ASN A 1 148 ? -17.733 67.767  75.568  1.00   13.22 ? 148  ASN A OD1 1 
ATOM   1166  N ND2 . ASN A 1 148 ? -19.030 66.736  77.077  1.00   17.26 ? 148  ASN A ND2 1 
ATOM   1167  N N   . ASN A 1 149 ? -15.333 67.307  77.587  1.00   19.98 ? 149  ASN A N   1 
ATOM   1168  C CA  . ASN A 1 149 ? -15.013 67.854  78.908  1.00   22.29 ? 149  ASN A CA  1 
ATOM   1169  C C   . ASN A 1 149 ? -16.341 68.547  79.224  1.00   20.86 ? 149  ASN A C   1 
ATOM   1170  O O   . ASN A 1 149 ? -16.835 69.311  78.408  1.00   23.88 ? 149  ASN A O   1 
ATOM   1171  C CB  . ASN A 1 149 ? -13.885 68.897  78.795  1.00   20.40 ? 149  ASN A CB  1 
ATOM   1172  C CG  . ASN A 1 149 ? -13.608 69.605  80.112  1.00   27.10 ? 149  ASN A CG  1 
ATOM   1173  O OD1 . ASN A 1 149 ? -14.515 69.865  80.905  1.00   25.70 ? 149  ASN A OD1 1 
ATOM   1174  N ND2 . ASN A 1 149 ? -12.336 69.953  80.340  1.00   24.21 ? 149  ASN A ND2 1 
ATOM   1175  N N   . PRO A 1 150 ? -16.939 68.310  80.421  1.00   20.69 ? 150  PRO A N   1 
ATOM   1176  C CA  . PRO A 1 150 ? -16.497 67.464  81.529  1.00   19.94 ? 150  PRO A CA  1 
ATOM   1177  C C   . PRO A 1 150 ? -17.057 66.049  81.670  1.00   18.53 ? 150  PRO A C   1 
ATOM   1178  O O   . PRO A 1 150 ? -16.915 65.454  82.735  1.00   20.83 ? 150  PRO A O   1 
ATOM   1179  C CB  . PRO A 1 150 ? -16.926 68.283  82.717  1.00   18.52 ? 150  PRO A CB  1 
ATOM   1180  C CG  . PRO A 1 150 ? -18.362 68.638  82.275  1.00   16.08 ? 150  PRO A CG  1 
ATOM   1181  C CD  . PRO A 1 150 ? -18.155 69.050  80.801  1.00   16.50 ? 150  PRO A CD  1 
ATOM   1182  N N   . THR A 1 151 ? -17.677 65.501  80.621  1.00   17.60 ? 151  THR A N   1 
ATOM   1183  C CA  . THR A 1 151 ? -18.308 64.175  80.735  1.00   15.34 ? 151  THR A CA  1 
ATOM   1184  C C   . THR A 1 151 ? -17.366 63.054  80.423  1.00   15.29 ? 151  THR A C   1 
ATOM   1185  O O   . THR A 1 151 ? -17.456 61.973  80.992  1.00   18.27 ? 151  THR A O   1 
ATOM   1186  C CB  . THR A 1 151 ? -19.537 64.063  79.800  1.00   13.07 ? 151  THR A CB  1 
ATOM   1187  O OG1 . THR A 1 151 ? -19.141 64.364  78.461  1.00   19.87 ? 151  THR A OG1 1 
ATOM   1188  C CG2 . THR A 1 151 ? -20.584 65.054  80.199  1.00   16.20 ? 151  THR A CG2 1 
ATOM   1189  N N   . GLY A 1 152 ? -16.460 63.319  79.497  1.00   17.80 ? 152  GLY A N   1 
ATOM   1190  C CA  . GLY A 1 152 ? -15.498 62.314  79.101  1.00   16.77 ? 152  GLY A CA  1 
ATOM   1191  C C   . GLY A 1 152 ? -16.101 61.405  78.053  1.00   20.16 ? 152  GLY A C   1 
ATOM   1192  O O   . GLY A 1 152 ? -15.400 60.551  77.513  1.00   19.97 ? 152  GLY A O   1 
ATOM   1193  N N   . HIS A 1 153 ? -17.386 61.553  77.743  1.00   19.57 ? 153  HIS A N   1 
ATOM   1194  C CA  . HIS A 1 153 ? -17.931 60.652  76.730  1.00   22.37 ? 153  HIS A CA  1 
ATOM   1195  C C   . HIS A 1 153 ? -17.323 60.998  75.366  1.00   23.03 ? 153  HIS A C   1 
ATOM   1196  O O   . HIS A 1 153 ? -16.828 62.117  75.135  1.00   21.90 ? 153  HIS A O   1 
ATOM   1197  C CB  . HIS A 1 153 ? -19.451 60.739  76.658  1.00   22.97 ? 153  HIS A CB  1 
ATOM   1198  C CG  . HIS A 1 153 ? -19.939 61.908  75.863  1.00   28.85 ? 153  HIS A CG  1 
ATOM   1199  N ND1 . HIS A 1 153 ? -19.743 63.212  76.266  1.00   27.96 ? 153  HIS A ND1 1 
ATOM   1200  C CD2 . HIS A 1 153 ? -20.574 61.976  74.668  1.00   26.16 ? 153  HIS A CD2 1 
ATOM   1201  C CE1 . HIS A 1 153 ? -20.236 64.032  75.354  1.00   25.36 ? 153  HIS A CE1 1 
ATOM   1202  N NE2 . HIS A 1 153 ? -20.747 63.308  74.374  1.00   28.43 ? 153  HIS A NE2 1 
ATOM   1203  N N   . VAL A 1 154 ? -17.361 60.012  74.480  1.00   25.29 ? 154  VAL A N   1 
ATOM   1204  C CA  . VAL A 1 154 ? -16.822 60.102  73.128  1.00   26.83 ? 154  VAL A CA  1 
ATOM   1205  C C   . VAL A 1 154 ? -17.930 60.281  72.087  1.00   29.15 ? 154  VAL A C   1 
ATOM   1206  O O   . VAL A 1 154 ? -18.939 59.582  72.139  1.00   26.50 ? 154  VAL A O   1 
ATOM   1207  C CB  . VAL A 1 154 ? -16.058 58.782  72.759  1.00   28.65 ? 154  VAL A CB  1 
ATOM   1208  C CG1 . VAL A 1 154 ? -15.638 58.807  71.275  1.00   25.25 ? 154  VAL A CG1 1 
ATOM   1209  C CG2 . VAL A 1 154 ? -14.847 58.594  73.673  1.00   29.32 ? 154  VAL A CG2 1 
ATOM   1210  N N   . PHE A 1 155 ? -17.730 61.194  71.136  1.00   31.13 ? 155  PHE A N   1 
ATOM   1211  C CA  . PHE A 1 155 ? -18.701 61.408  70.074  1.00   33.31 ? 155  PHE A CA  1 
ATOM   1212  C C   . PHE A 1 155 ? -18.393 60.435  68.941  1.00   37.80 ? 155  PHE A C   1 
ATOM   1213  O O   . PHE A 1 155 ? -17.230 60.089  68.703  1.00   39.57 ? 155  PHE A O   1 
ATOM   1214  C CB  . PHE A 1 155 ? -18.634 62.838  69.542  1.00   30.95 ? 155  PHE A CB  1 
ATOM   1215  C CG  . PHE A 1 155 ? -19.115 63.872  70.519  1.00   33.29 ? 155  PHE A CG  1 
ATOM   1216  C CD1 . PHE A 1 155 ? -18.206 64.689  71.192  1.00   33.07 ? 155  PHE A CD1 1 
ATOM   1217  C CD2 . PHE A 1 155 ? -20.471 64.020  70.779  1.00   33.84 ? 155  PHE A CD2 1 
ATOM   1218  C CE1 . PHE A 1 155 ? -18.631 65.641  72.109  1.00   28.03 ? 155  PHE A CE1 1 
ATOM   1219  C CE2 . PHE A 1 155 ? -20.919 64.962  71.693  1.00   32.40 ? 155  PHE A CE2 1 
ATOM   1220  C CZ  . PHE A 1 155 ? -19.992 65.780  72.363  1.00   35.56 ? 155  PHE A CZ  1 
ATOM   1221  N N   . GLU A 1 156 ? -19.438 59.993  68.251  1.00   40.26 ? 156  GLU A N   1 
ATOM   1222  C CA  . GLU A 1 156 ? -19.294 59.063  67.142  1.00   42.45 ? 156  GLU A CA  1 
ATOM   1223  C C   . GLU A 1 156 ? -18.732 59.766  65.895  1.00   42.76 ? 156  GLU A C   1 
ATOM   1224  O O   . GLU A 1 156 ? -19.005 60.952  65.657  1.00   43.99 ? 156  GLU A O   1 
ATOM   1225  C CB  . GLU A 1 156 ? -20.654 58.433  66.821  1.00   47.24 ? 156  GLU A CB  1 
ATOM   1226  C CG  . GLU A 1 156 ? -21.339 57.727  68.005  1.00   53.08 ? 156  GLU A CG  1 
ATOM   1227  C CD  . GLU A 1 156 ? -22.408 56.712  67.565  1.00   58.85 ? 156  GLU A CD  1 
ATOM   1228  O OE1 . GLU A 1 156 ? -23.058 56.095  68.435  1.00   58.89 ? 156  GLU A OE1 1 
ATOM   1229  O OE2 . GLU A 1 156 ? -22.597 56.522  66.341  1.00   63.36 ? 156  GLU A OE2 1 
ATOM   1230  N N   . ARG A 1 157 ? -17.943 59.033  65.107  1.00   42.47 ? 157  ARG A N   1 
ATOM   1231  C CA  . ARG A 1 157 ? -17.331 59.573  63.895  1.00   38.55 ? 157  ARG A CA  1 
ATOM   1232  C C   . ARG A 1 157 ? -18.375 60.205  62.989  1.00   37.87 ? 157  ARG A C   1 
ATOM   1233  O O   . ARG A 1 157 ? -18.123 61.215  62.336  1.00   39.82 ? 157  ARG A O   1 
ATOM   1234  C CB  . ARG A 1 157 ? -16.619 58.472  63.121  1.00   38.45 ? 157  ARG A CB  1 
ATOM   1235  C CG  . ARG A 1 157 ? -15.426 57.857  63.811  1.00   38.92 ? 157  ARG A CG  1 
ATOM   1236  C CD  . ARG A 1 157 ? -14.284 57.708  62.817  1.00   39.73 ? 157  ARG A CD  1 
ATOM   1237  N NE  . ARG A 1 157 ? -13.079 57.113  63.394  1.00   38.75 ? 157  ARG A NE  1 
ATOM   1238  C CZ  . ARG A 1 157 ? -11.855 57.295  62.899  1.00   42.16 ? 157  ARG A CZ  1 
ATOM   1239  N NH1 . ARG A 1 157 ? -11.682 58.063  61.827  1.00   41.50 ? 157  ARG A NH1 1 
ATOM   1240  N NH2 . ARG A 1 157 ? -10.806 56.712  63.468  1.00   40.90 ? 157  ARG A NH2 1 
ATOM   1241  N N   . GLU A 1 158 ? -19.535 59.574  62.921  1.00   36.85 ? 158  GLU A N   1 
ATOM   1242  C CA  . GLU A 1 158 ? -20.626 60.079  62.126  1.00   37.58 ? 158  GLU A CA  1 
ATOM   1243  C C   . GLU A 1 158 ? -20.941 61.512  62.578  1.00   36.13 ? 158  GLU A C   1 
ATOM   1244  O O   . GLU A 1 158 ? -21.036 62.420  61.759  1.00   35.38 ? 158  GLU A O   1 
ATOM   1245  C CB  . GLU A 1 158 ? -21.845 59.170  62.323  1.00   41.76 ? 158  GLU A CB  1 
ATOM   1246  C CG  . GLU A 1 158 ? -23.208 59.869  62.230  1.00   53.66 ? 158  GLU A CG  1 
ATOM   1247  C CD  . GLU A 1 158 ? -23.558 60.377  60.828  1.00   61.78 ? 158  GLU A CD  1 
ATOM   1248  O OE1 . GLU A 1 158 ? -24.663 60.951  60.661  1.00   65.65 ? 158  GLU A OE1 1 
ATOM   1249  O OE2 . GLU A 1 158 ? -22.734 60.203  59.899  1.00   65.44 ? 158  GLU A OE2 1 
ATOM   1250  N N   . GLU A 1 159 ? -21.090 61.700  63.889  1.00   34.92 ? 159  GLU A N   1 
ATOM   1251  C CA  . GLU A 1 159 ? -21.383 63.003  64.474  1.00   31.41 ? 159  GLU A CA  1 
ATOM   1252  C C   . GLU A 1 159 ? -20.417 64.063  63.985  1.00   30.90 ? 159  GLU A C   1 
ATOM   1253  O O   . GLU A 1 159 ? -20.816 65.153  63.545  1.00   28.32 ? 159  GLU A O   1 
ATOM   1254  C CB  . GLU A 1 159 ? -21.287 62.935  65.998  1.00   33.54 ? 159  GLU A CB  1 
ATOM   1255  C CG  . GLU A 1 159 ? -22.262 61.975  66.621  1.00   34.14 ? 159  GLU A CG  1 
ATOM   1256  C CD  . GLU A 1 159 ? -22.518 62.260  68.081  1.00   34.96 ? 159  GLU A CD  1 
ATOM   1257  O OE1 . GLU A 1 159 ? -22.020 61.491  68.946  1.00   31.70 ? 159  GLU A OE1 1 
ATOM   1258  O OE2 . GLU A 1 159 ? -23.223 63.256  68.349  1.00   33.67 ? 159  GLU A OE2 1 
ATOM   1259  N N   . ILE A 1 160 ? -19.134 63.754  64.077  1.00   28.15 ? 160  ILE A N   1 
ATOM   1260  C CA  . ILE A 1 160 ? -18.137 64.708  63.635  1.00   26.59 ? 160  ILE A CA  1 
ATOM   1261  C C   . ILE A 1 160 ? -18.245 64.963  62.149  1.00   25.82 ? 160  ILE A C   1 
ATOM   1262  O O   . ILE A 1 160 ? -18.208 66.110  61.701  1.00   27.20 ? 160  ILE A O   1 
ATOM   1263  C CB  . ILE A 1 160 ? -16.721 64.218  63.942  1.00   26.05 ? 160  ILE A CB  1 
ATOM   1264  C CG1 . ILE A 1 160 ? -16.566 64.048  65.453  1.00   29.72 ? 160  ILE A CG1 1 
ATOM   1265  C CG2 . ILE A 1 160 ? -15.698 65.190  63.371  1.00   14.89 ? 160  ILE A CG2 1 
ATOM   1266  C CD1 . ILE A 1 160 ? -17.079 65.216  66.239  1.00   23.66 ? 160  ILE A CD1 1 
ATOM   1267  N N   . GLU A 1 161 ? -18.390 63.885  61.391  1.00   24.73 ? 161  GLU A N   1 
ATOM   1268  C CA  . GLU A 1 161 ? -18.476 63.995  59.942  1.00   27.53 ? 161  GLU A CA  1 
ATOM   1269  C C   . GLU A 1 161 ? -19.645 64.867  59.466  1.00   27.56 ? 161  GLU A C   1 
ATOM   1270  O O   . GLU A 1 161 ? -19.490 65.651  58.530  1.00   26.98 ? 161  GLU A O   1 
ATOM   1271  C CB  . GLU A 1 161 ? -18.540 62.592  59.330  1.00   26.40 ? 161  GLU A CB  1 
ATOM   1272  C CG  . GLU A 1 161 ? -18.299 62.516  57.821  1.00   31.47 ? 161  GLU A CG  1 
ATOM   1273  C CD  . GLU A 1 161 ? -17.607 61.216  57.398  1.00   36.12 ? 161  GLU A CD  1 
ATOM   1274  O OE1 . GLU A 1 161 ? -17.789 60.186  58.101  1.00   34.23 ? 161  GLU A OE1 1 
ATOM   1275  O OE2 . GLU A 1 161 ? -16.890 61.226  56.364  1.00   34.60 ? 161  GLU A OE2 1 
ATOM   1276  N N   . ARG A 1 162 ? -20.807 64.747  60.097  1.00   26.45 ? 162  ARG A N   1 
ATOM   1277  C CA  . ARG A 1 162 ? -21.945 65.562  59.679  1.00   27.79 ? 162  ARG A CA  1 
ATOM   1278  C C   . ARG A 1 162 ? -21.651 67.058  59.747  1.00   25.34 ? 162  ARG A C   1 
ATOM   1279  O O   . ARG A 1 162 ? -22.099 67.823  58.911  1.00   23.95 ? 162  ARG A O   1 
ATOM   1280  C CB  . ARG A 1 162 ? -23.188 65.248  60.524  1.00   30.38 ? 162  ARG A CB  1 
ATOM   1281  C CG  . ARG A 1 162 ? -24.052 64.148  59.950  1.00   34.95 ? 162  ARG A CG  1 
ATOM   1282  C CD  . ARG A 1 162 ? -25.292 63.915  60.810  1.00   40.86 ? 162  ARG A CD  1 
ATOM   1283  N NE  . ARG A 1 162 ? -26.446 63.462  60.032  1.00   41.76 ? 162  ARG A NE  1 
ATOM   1284  C CZ  . ARG A 1 162 ? -27.192 64.254  59.259  1.00   42.53 ? 162  ARG A CZ  1 
ATOM   1285  N NH1 . ARG A 1 162 ? -26.911 65.550  59.146  1.00   40.72 ? 162  ARG A NH1 1 
ATOM   1286  N NH2 . ARG A 1 162 ? -28.246 63.760  58.618  1.00   42.08 ? 162  ARG A NH2 1 
ATOM   1287  N N   . ILE A 1 163 ? -20.909 67.477  60.760  1.00   26.40 ? 163  ILE A N   1 
ATOM   1288  C CA  . ILE A 1 163 ? -20.579 68.877  60.884  1.00   27.53 ? 163  ILE A CA  1 
ATOM   1289  C C   . ILE A 1 163 ? -19.543 69.172  59.826  1.00   29.78 ? 163  ILE A C   1 
ATOM   1290  O O   . ILE A 1 163 ? -19.493 70.271  59.260  1.00   32.42 ? 163  ILE A O   1 
ATOM   1291  C CB  . ILE A 1 163 ? -19.988 69.160  62.231  1.00   30.90 ? 163  ILE A CB  1 
ATOM   1292  C CG1 . ILE A 1 163 ? -21.013 68.834  63.302  1.00   30.65 ? 163  ILE A CG1 1 
ATOM   1293  C CG2 . ILE A 1 163 ? -19.540 70.604  62.314  1.00   29.93 ? 163  ILE A CG2 1 
ATOM   1294  C CD1 . ILE A 1 163 ? -20.491 69.103  64.710  1.00   41.56 ? 163  ILE A CD1 1 
ATOM   1295  N N   . LEU A 1 164 ? -18.717 68.172  59.549  1.00   28.37 ? 164  LEU A N   1 
ATOM   1296  C CA  . LEU A 1 164 ? -17.661 68.321  58.570  1.00   25.62 ? 164  LEU A CA  1 
ATOM   1297  C C   . LEU A 1 164 ? -18.236 68.538  57.153  1.00   28.40 ? 164  LEU A C   1 
ATOM   1298  O O   . LEU A 1 164 ? -17.769 69.429  56.402  1.00   23.48 ? 164  LEU A O   1 
ATOM   1299  C CB  . LEU A 1 164 ? -16.773 67.078  58.638  1.00   27.15 ? 164  LEU A CB  1 
ATOM   1300  C CG  . LEU A 1 164 ? -15.261 67.230  58.822  1.00   28.61 ? 164  LEU A CG  1 
ATOM   1301  C CD1 . LEU A 1 164 ? -14.858 68.517  59.533  1.00   23.79 ? 164  LEU A CD1 1 
ATOM   1302  C CD2 . LEU A 1 164 ? -14.795 66.012  59.573  1.00   29.96 ? 164  LEU A CD2 1 
ATOM   1303  N N   . LYS A 1 165 ? -19.261 67.752  56.796  1.00   26.58 ? 165  LYS A N   1 
ATOM   1304  C CA  . LYS A 1 165 ? -19.889 67.857  55.479  1.00   28.57 ? 165  LYS A CA  1 
ATOM   1305  C C   . LYS A 1 165 ? -20.529 69.225  55.271  1.00   27.92 ? 165  LYS A C   1 
ATOM   1306  O O   . LYS A 1 165 ? -20.630 69.722  54.152  1.00   28.37 ? 165  LYS A O   1 
ATOM   1307  C CB  . LYS A 1 165 ? -20.923 66.744  55.289  1.00   29.79 ? 165  LYS A CB  1 
ATOM   1308  C CG  . LYS A 1 165 ? -20.255 65.420  54.899  1.00   38.55 ? 165  LYS A CG  1 
ATOM   1309  C CD  . LYS A 1 165 ? -21.194 64.237  54.919  1.00   38.91 ? 165  LYS A CD  1 
ATOM   1310  C CE  . LYS A 1 165 ? -20.444 62.975  54.572  1.00   44.10 ? 165  LYS A CE  1 
ATOM   1311  N NZ  . LYS A 1 165 ? -21.307 61.761  54.692  1.00   51.86 ? 165  LYS A NZ  1 
ATOM   1312  N N   . THR A 1 166 ? -20.949 69.817  56.380  1.00   27.58 ? 166  THR A N   1 
ATOM   1313  C CA  . THR A 1 166 ? -21.558 71.140  56.425  1.00   24.06 ? 166  THR A CA  1 
ATOM   1314  C C   . THR A 1 166 ? -20.627 72.209  55.826  1.00   24.01 ? 166  THR A C   1 
ATOM   1315  O O   . THR A 1 166 ? -21.075 73.272  55.407  1.00   26.58 ? 166  THR A O   1 
ATOM   1316  C CB  . THR A 1 166 ? -21.829 71.508  57.883  1.00   24.87 ? 166  THR A CB  1 
ATOM   1317  O OG1 . THR A 1 166 ? -23.183 71.928  58.032  1.00   29.81 ? 166  THR A OG1 1 
ATOM   1318  C CG2 . THR A 1 166 ? -20.888 72.602  58.355  1.00   19.38 ? 166  THR A CG2 1 
ATOM   1319  N N   . GLY A 1 167 ? -19.327 71.935  55.823  1.00   22.29 ? 167  GLY A N   1 
ATOM   1320  C CA  . GLY A 1 167 ? -18.379 72.902  55.296  1.00   21.58 ? 167  GLY A CA  1 
ATOM   1321  C C   . GLY A 1 167 ? -17.841 73.852  56.351  1.00   23.05 ? 167  GLY A C   1 
ATOM   1322  O O   . GLY A 1 167 ? -16.994 74.710  56.081  1.00   26.03 ? 167  GLY A O   1 
ATOM   1323  N N   . ALA A 1 168 ? -18.358 73.707  57.563  1.00   24.35 ? 168  ALA A N   1 
ATOM   1324  C CA  . ALA A 1 168 ? -17.935 74.527  58.683  1.00   22.04 ? 168  ALA A CA  1 
ATOM   1325  C C   . ALA A 1 168 ? -16.612 73.908  59.096  1.00   22.93 ? 168  ALA A C   1 
ATOM   1326  O O   . ALA A 1 168 ? -16.332 72.763  58.732  1.00   19.23 ? 168  ALA A O   1 
ATOM   1327  C CB  . ALA A 1 168 ? -18.950 74.421  59.821  1.00   21.30 ? 168  ALA A CB  1 
ATOM   1328  N N   . PHE A 1 169 ? -15.789 74.659  59.819  1.00   22.42 ? 169  PHE A N   1 
ATOM   1329  C CA  . PHE A 1 169 ? -14.491 74.160  60.250  1.00   22.36 ? 169  PHE A CA  1 
ATOM   1330  C C   . PHE A 1 169 ? -14.636 73.473  61.607  1.00   20.73 ? 169  PHE A C   1 
ATOM   1331  O O   . PHE A 1 169 ? -15.197 74.032  62.542  1.00   21.26 ? 169  PHE A O   1 
ATOM   1332  C CB  . PHE A 1 169 ? -13.483 75.316  60.349  1.00   21.47 ? 169  PHE A CB  1 
ATOM   1333  C CG  . PHE A 1 169 ? -12.045 74.864  60.368  1.00   28.87 ? 169  PHE A CG  1 
ATOM   1334  C CD1 . PHE A 1 169 ? -11.396 74.608  61.574  1.00   29.59 ? 169  PHE A CD1 1 
ATOM   1335  C CD2 . PHE A 1 169 ? -11.340 74.654  59.169  1.00   27.96 ? 169  PHE A CD2 1 
ATOM   1336  C CE1 . PHE A 1 169 ? -10.072 74.154  61.607  1.00   28.11 ? 169  PHE A CE1 1 
ATOM   1337  C CE2 . PHE A 1 169 ? -10.007 74.196  59.187  1.00   26.10 ? 169  PHE A CE2 1 
ATOM   1338  C CZ  . PHE A 1 169 ? -9.371  73.946  60.418  1.00   27.00 ? 169  PHE A CZ  1 
ATOM   1339  N N   . VAL A 1 170 ? -14.169 72.243  61.712  1.00   22.51 ? 170  VAL A N   1 
ATOM   1340  C CA  . VAL A 1 170 ? -14.240 71.550  62.990  1.00   23.58 ? 170  VAL A CA  1 
ATOM   1341  C C   . VAL A 1 170 ? -12.917 71.637  63.730  1.00   21.87 ? 170  VAL A C   1 
ATOM   1342  O O   . VAL A 1 170 ? -11.857 71.272  63.207  1.00   19.72 ? 170  VAL A O   1 
ATOM   1343  C CB  . VAL A 1 170 ? -14.560 70.035  62.863  1.00   23.89 ? 170  VAL A CB  1 
ATOM   1344  C CG1 . VAL A 1 170 ? -14.340 69.356  64.216  1.00   17.58 ? 170  VAL A CG1 1 
ATOM   1345  C CG2 . VAL A 1 170 ? -15.998 69.839  62.408  1.00   27.39 ? 170  VAL A CG2 1 
ATOM   1346  N N   . ALA A 1 171 ? -13.010 72.115  64.959  1.00   22.71 ? 171  ALA A N   1 
ATOM   1347  C CA  . ALA A 1 171 ? -11.879 72.229  65.848  1.00   22.00 ? 171  ALA A CA  1 
ATOM   1348  C C   . ALA A 1 171 ? -12.023 71.012  66.737  1.00   23.19 ? 171  ALA A C   1 
ATOM   1349  O O   . ALA A 1 171 ? -12.742 71.066  67.733  1.00   26.60 ? 171  ALA A O   1 
ATOM   1350  C CB  . ALA A 1 171 ? -11.999 73.483  66.662  1.00   24.76 ? 171  ALA A CB  1 
ATOM   1351  N N   . LEU A 1 172 ? -11.403 69.905  66.337  1.00   20.67 ? 172  LEU A N   1 
ATOM   1352  C CA  . LEU A 1 172 ? -11.480 68.682  67.126  1.00   20.55 ? 172  LEU A CA  1 
ATOM   1353  C C   . LEU A 1 172 ? -10.515 68.765  68.322  1.00   21.25 ? 172  LEU A C   1 
ATOM   1354  O O   . LEU A 1 172 ? -9.291  68.646  68.179  1.00   21.40 ? 172  LEU A O   1 
ATOM   1355  C CB  . LEU A 1 172 ? -11.119 67.470  66.279  1.00   21.59 ? 172  LEU A CB  1 
ATOM   1356  C CG  . LEU A 1 172 ? -11.522 66.155  66.928  1.00   24.69 ? 172  LEU A CG  1 
ATOM   1357  C CD1 . LEU A 1 172 ? -13.057 66.072  66.991  1.00   25.82 ? 172  LEU A CD1 1 
ATOM   1358  C CD2 . LEU A 1 172 ? -10.955 64.991  66.127  1.00   28.26 ? 172  LEU A CD2 1 
ATOM   1359  N N   . ASP A 1 173 ? -11.084 68.952  69.504  1.00   20.18 ? 173  ASP A N   1 
ATOM   1360  C CA  . ASP A 1 173 ? -10.281 69.075  70.697  1.00   21.57 ? 173  ASP A CA  1 
ATOM   1361  C C   . ASP A 1 173 ? -9.995  67.732  71.377  1.00   22.67 ? 173  ASP A C   1 
ATOM   1362  O O   . ASP A 1 173 ? -10.785 67.257  72.197  1.00   21.00 ? 173  ASP A O   1 
ATOM   1363  C CB  . ASP A 1 173 ? -10.963 70.015  71.671  1.00   19.13 ? 173  ASP A CB  1 
ATOM   1364  C CG  . ASP A 1 173 ? -10.035 70.452  72.746  1.00   23.33 ? 173  ASP A CG  1 
ATOM   1365  O OD1 . ASP A 1 173 ? -9.148  69.635  73.108  1.00   23.94 ? 173  ASP A OD1 1 
ATOM   1366  O OD2 . ASP A 1 173 ? -10.196 71.605  73.229  1.00   24.82 ? 173  ASP A OD2 1 
ATOM   1367  N N   . GLU A 1 174 ? -8.849  67.141  71.050  1.00   22.25 ? 174  GLU A N   1 
ATOM   1368  C CA  . GLU A 1 174 ? -8.452  65.848  71.596  1.00   23.06 ? 174  GLU A CA  1 
ATOM   1369  C C   . GLU A 1 174 ? -7.523  65.969  72.790  1.00   21.61 ? 174  GLU A C   1 
ATOM   1370  O O   . GLU A 1 174 ? -6.521  65.265  72.890  1.00   21.69 ? 174  GLU A O   1 
ATOM   1371  C CB  . GLU A 1 174 ? -7.806  64.983  70.494  1.00   25.39 ? 174  GLU A CB  1 
ATOM   1372  C CG  . GLU A 1 174 ? -8.817  64.424  69.494  1.00   24.34 ? 174  GLU A CG  1 
ATOM   1373  C CD  . GLU A 1 174 ? -8.201  63.482  68.462  1.00   27.97 ? 174  GLU A CD  1 
ATOM   1374  O OE1 . GLU A 1 174 ? -7.031  63.083  68.640  1.00   29.39 ? 174  GLU A OE1 1 
ATOM   1375  O OE2 . GLU A 1 174 ? -8.892  63.134  67.474  1.00   21.81 ? 174  GLU A OE2 1 
ATOM   1376  N N   . ALA A 1 175 ? -7.874  66.877  73.688  1.00   21.15 ? 175  ALA A N   1 
ATOM   1377  C CA  . ALA A 1 175 ? -7.105  67.126  74.898  1.00   18.66 ? 175  ALA A CA  1 
ATOM   1378  C C   . ALA A 1 175 ? -6.933  65.874  75.740  1.00   20.85 ? 175  ALA A C   1 
ATOM   1379  O O   . ALA A 1 175 ? -5.906  65.741  76.412  1.00   23.12 ? 175  ALA A O   1 
ATOM   1380  C CB  . ALA A 1 175 ? -7.778  68.185  75.732  1.00   15.96 ? 175  ALA A CB  1 
ATOM   1381  N N   . TYR A 1 176 ? -7.927  64.978  75.721  1.00   18.26 ? 176  TYR A N   1 
ATOM   1382  C CA  . TYR A 1 176 ? -7.895  63.749  76.519  1.00   19.66 ? 176  TYR A CA  1 
ATOM   1383  C C   . TYR A 1 176 ? -7.637  62.465  75.743  1.00   21.02 ? 176  TYR A C   1 
ATOM   1384  O O   . TYR A 1 176 ? -7.757  61.371  76.289  1.00   19.96 ? 176  TYR A O   1 
ATOM   1385  C CB  . TYR A 1 176 ? -9.193  63.619  77.326  1.00   17.88 ? 176  TYR A CB  1 
ATOM   1386  C CG  . TYR A 1 176 ? -9.342  64.759  78.307  1.00   16.75 ? 176  TYR A CG  1 
ATOM   1387  C CD1 . TYR A 1 176 ? -8.489  64.867  79.409  1.00   17.86 ? 176  TYR A CD1 1 
ATOM   1388  C CD2 . TYR A 1 176 ? -10.247 65.791  78.070  1.00   19.04 ? 176  TYR A CD2 1 
ATOM   1389  C CE1 . TYR A 1 176 ? -8.518  65.981  80.241  1.00   22.19 ? 176  TYR A CE1 1 
ATOM   1390  C CE2 . TYR A 1 176 ? -10.290 66.904  78.899  1.00   20.38 ? 176  TYR A CE2 1 
ATOM   1391  C CZ  . TYR A 1 176 ? -9.419  66.996  79.979  1.00   22.31 ? 176  TYR A CZ  1 
ATOM   1392  O OH  . TYR A 1 176 ? -9.421  68.098  80.786  1.00   20.87 ? 176  TYR A OH  1 
ATOM   1393  N N   . TYR A 1 177 ? -7.248  62.617  74.479  1.00   22.26 ? 177  TYR A N   1 
ATOM   1394  C CA  . TYR A 1 177 ? -6.942  61.495  73.591  1.00   21.60 ? 177  TYR A CA  1 
ATOM   1395  C C   . TYR A 1 177 ? -6.103  60.355  74.210  1.00   24.56 ? 177  TYR A C   1 
ATOM   1396  O O   . TYR A 1 177 ? -6.495  59.187  74.142  1.00   26.45 ? 177  TYR A O   1 
ATOM   1397  C CB  . TYR A 1 177 ? -6.258  62.040  72.320  1.00   22.05 ? 177  TYR A CB  1 
ATOM   1398  C CG  . TYR A 1 177 ? -5.458  61.017  71.535  1.00   25.22 ? 177  TYR A CG  1 
ATOM   1399  C CD1 . TYR A 1 177 ? -4.059  61.053  71.539  1.00   21.89 ? 177  TYR A CD1 1 
ATOM   1400  C CD2 . TYR A 1 177 ? -6.093  59.924  70.911  1.00   22.24 ? 177  TYR A CD2 1 
ATOM   1401  C CE1 . TYR A 1 177 ? -3.317  60.022  70.968  1.00   27.42 ? 177  TYR A CE1 1 
ATOM   1402  C CE2 . TYR A 1 177 ? -5.370  58.897  70.340  1.00   20.12 ? 177  TYR A CE2 1 
ATOM   1403  C CZ  . TYR A 1 177 ? -3.984  58.942  70.378  1.00   23.55 ? 177  TYR A CZ  1 
ATOM   1404  O OH  . TYR A 1 177 ? -3.279  57.891  69.887  1.00   29.80 ? 177  TYR A OH  1 
ATOM   1405  N N   . GLU A 1 178 ? -4.957  60.676  74.814  1.00   22.99 ? 178  GLU A N   1 
ATOM   1406  C CA  . GLU A 1 178 ? -4.119  59.628  75.398  1.00   22.06 ? 178  GLU A CA  1 
ATOM   1407  C C   . GLU A 1 178 ? -4.902  58.640  76.297  1.00   24.18 ? 178  GLU A C   1 
ATOM   1408  O O   . GLU A 1 178 ? -4.550  57.454  76.433  1.00   19.15 ? 178  GLU A O   1 
ATOM   1409  C CB  . GLU A 1 178 ? -2.979  60.254  76.192  1.00   17.28 ? 178  GLU A CB  1 
ATOM   1410  C CG  . GLU A 1 178 ? -1.796  60.781  75.374  1.00   19.89 ? 178  GLU A CG  1 
ATOM   1411  C CD  . GLU A 1 178 ? -2.121  62.040  74.594  1.00   18.25 ? 178  GLU A CD  1 
ATOM   1412  O OE1 . GLU A 1 178 ? -2.823  62.922  75.128  1.00   24.35 ? 178  GLU A OE1 1 
ATOM   1413  O OE2 . GLU A 1 178 ? -1.658  62.161  73.447  1.00   23.17 ? 178  GLU A OE2 1 
ATOM   1414  N N   . PHE A 1 179 ? -5.978  59.117  76.911  1.00   25.11 ? 179  PHE A N   1 
ATOM   1415  C CA  . PHE A 1 179 ? -6.751  58.241  77.782  1.00   25.81 ? 179  PHE A CA  1 
ATOM   1416  C C   . PHE A 1 179 ? -7.855  57.485  77.031  1.00   25.26 ? 179  PHE A C   1 
ATOM   1417  O O   . PHE A 1 179 ? -8.446  56.543  77.554  1.00   26.40 ? 179  PHE A O   1 
ATOM   1418  C CB  . PHE A 1 179 ? -7.305  59.062  78.931  1.00   24.10 ? 179  PHE A CB  1 
ATOM   1419  C CG  . PHE A 1 179 ? -6.253  59.869  79.622  1.00   26.03 ? 179  PHE A CG  1 
ATOM   1420  C CD1 . PHE A 1 179 ? -5.400  59.273  80.548  1.00   31.06 ? 179  PHE A CD1 1 
ATOM   1421  C CD2 . PHE A 1 179 ? -6.045  61.213  79.284  1.00   26.40 ? 179  PHE A CD2 1 
ATOM   1422  C CE1 . PHE A 1 179 ? -4.342  60.004  81.130  1.00   28.38 ? 179  PHE A CE1 1 
ATOM   1423  C CE2 . PHE A 1 179 ? -4.988  61.955  79.859  1.00   22.68 ? 179  PHE A CE2 1 
ATOM   1424  C CZ  . PHE A 1 179 ? -4.140  61.353  80.777  1.00   24.99 ? 179  PHE A CZ  1 
ATOM   1425  N N   . HIS A 1 180 ? -8.102  57.885  75.791  1.00   22.31 ? 180  HIS A N   1 
ATOM   1426  C CA  . HIS A 1 180 ? -9.115  57.239  75.011  1.00   23.26 ? 180  HIS A CA  1 
ATOM   1427  C C   . HIS A 1 180 ? -8.486  56.233  74.056  1.00   25.06 ? 180  HIS A C   1 
ATOM   1428  O O   . HIS A 1 180 ? -8.860  55.063  74.039  1.00   28.41 ? 180  HIS A O   1 
ATOM   1429  C CB  . HIS A 1 180 ? -9.913  58.260  74.208  1.00   21.42 ? 180  HIS A CB  1 
ATOM   1430  C CG  . HIS A 1 180 ? -11.005 57.640  73.401  1.00   22.57 ? 180  HIS A CG  1 
ATOM   1431  N ND1 . HIS A 1 180 ? -11.398 58.129  72.174  1.00   22.87 ? 180  HIS A ND1 1 
ATOM   1432  C CD2 . HIS A 1 180 ? -11.799 56.571  73.661  1.00   23.60 ? 180  HIS A CD2 1 
ATOM   1433  C CE1 . HIS A 1 180 ? -12.389 57.386  71.715  1.00   23.54 ? 180  HIS A CE1 1 
ATOM   1434  N NE2 . HIS A 1 180 ? -12.649 56.435  72.595  1.00   18.07 ? 180  HIS A NE2 1 
ATOM   1435  N N   . GLY A 1 181 ? -7.540  56.695  73.251  1.00   23.81 ? 181  GLY A N   1 
ATOM   1436  C CA  . GLY A 1 181 ? -6.880  55.803  72.317  1.00   27.07 ? 181  GLY A CA  1 
ATOM   1437  C C   . GLY A 1 181 ? -7.253  55.928  70.840  1.00   28.06 ? 181  GLY A C   1 
ATOM   1438  O O   . GLY A 1 181 ? -6.639  55.281  69.999  1.00   28.45 ? 181  GLY A O   1 
ATOM   1439  N N   . GLU A 1 182 ? -8.236  56.749  70.494  1.00   28.24 ? 182  GLU A N   1 
ATOM   1440  C CA  . GLU A 1 182 ? -8.587  56.875  69.100  1.00   30.11 ? 182  GLU A CA  1 
ATOM   1441  C C   . GLU A 1 182 ? -8.714  58.329  68.664  1.00   29.84 ? 182  GLU A C   1 
ATOM   1442  O O   . GLU A 1 182 ? -9.469  59.105  69.246  1.00   31.90 ? 182  GLU A O   1 
ATOM   1443  C CB  . GLU A 1 182 ? -9.886  56.123  68.806  1.00   34.92 ? 182  GLU A CB  1 
ATOM   1444  C CG  . GLU A 1 182 ? -10.028 55.717  67.342  1.00   42.03 ? 182  GLU A CG  1 
ATOM   1445  C CD  . GLU A 1 182 ? -11.412 55.192  67.018  1.00   46.88 ? 182  GLU A CD  1 
ATOM   1446  O OE1 . GLU A 1 182 ? -11.958 54.436  67.863  1.00   48.69 ? 182  GLU A OE1 1 
ATOM   1447  O OE2 . GLU A 1 182 ? -11.941 55.532  65.928  1.00   43.01 ? 182  GLU A OE2 1 
ATOM   1448  N N   . SER A 1 183 ? -7.979  58.677  67.612  1.00   27.91 ? 183  SER A N   1 
ATOM   1449  C CA  . SER A 1 183 ? -7.953  60.030  67.087  1.00   24.80 ? 183  SER A CA  1 
ATOM   1450  C C   . SER A 1 183 ? -8.624  60.106  65.722  1.00   23.06 ? 183  SER A C   1 
ATOM   1451  O O   . SER A 1 183 ? -8.679  59.117  65.014  1.00   25.94 ? 183  SER A O   1 
ATOM   1452  C CB  . SER A 1 183 ? -6.496  60.498  66.980  1.00   23.08 ? 183  SER A CB  1 
ATOM   1453  O OG  . SER A 1 183 ? -6.399  61.676  66.203  1.00   28.21 ? 183  SER A OG  1 
ATOM   1454  N N   . TYR A 1 184 ? -9.146  61.267  65.347  1.00   21.25 ? 184  TYR A N   1 
ATOM   1455  C CA  . TYR A 1 184 ? -9.765  61.365  64.039  1.00   24.58 ? 184  TYR A CA  1 
ATOM   1456  C C   . TYR A 1 184 ? -8.853  62.132  63.112  1.00   26.49 ? 184  TYR A C   1 
ATOM   1457  O O   . TYR A 1 184 ? -9.291  62.669  62.105  1.00   27.33 ? 184  TYR A O   1 
ATOM   1458  C CB  . TYR A 1 184 ? -11.145 62.019  64.113  1.00   22.30 ? 184  TYR A CB  1 
ATOM   1459  C CG  . TYR A 1 184 ? -12.149 61.232  64.944  1.00   26.75 ? 184  TYR A CG  1 
ATOM   1460  C CD1 . TYR A 1 184 ? -11.880 59.930  65.363  1.00   30.87 ? 184  TYR A CD1 1 
ATOM   1461  C CD2 . TYR A 1 184 ? -13.351 61.809  65.340  1.00   29.46 ? 184  TYR A CD2 1 
ATOM   1462  C CE1 . TYR A 1 184 ? -12.781 59.227  66.161  1.00   32.76 ? 184  TYR A CE1 1 
ATOM   1463  C CE2 . TYR A 1 184 ? -14.252 61.122  66.132  1.00   28.50 ? 184  TYR A CE2 1 
ATOM   1464  C CZ  . TYR A 1 184 ? -13.966 59.839  66.542  1.00   34.78 ? 184  TYR A CZ  1 
ATOM   1465  O OH  . TYR A 1 184 ? -14.862 59.168  67.351  1.00   38.82 ? 184  TYR A OH  1 
ATOM   1466  N N   . VAL A 1 185 ? -7.569  62.170  63.458  1.00   28.09 ? 185  VAL A N   1 
ATOM   1467  C CA  . VAL A 1 185 ? -6.578  62.854  62.644  1.00   30.56 ? 185  VAL A CA  1 
ATOM   1468  C C   . VAL A 1 185 ? -6.550  62.253  61.218  1.00   31.11 ? 185  VAL A C   1 
ATOM   1469  O O   . VAL A 1 185 ? -6.164  62.924  60.250  1.00   31.38 ? 185  VAL A O   1 
ATOM   1470  C CB  . VAL A 1 185 ? -5.169  62.746  63.299  1.00   34.23 ? 185  VAL A CB  1 
ATOM   1471  C CG1 . VAL A 1 185 ? -4.718  61.291  63.343  1.00   32.56 ? 185  VAL A CG1 1 
ATOM   1472  C CG2 . VAL A 1 185 ? -4.169  63.592  62.533  1.00   37.89 ? 185  VAL A CG2 1 
ATOM   1473  N N   . ASP A 1 186 ? -6.961  60.989  61.085  1.00   31.78 ? 186  ASP A N   1 
ATOM   1474  C CA  . ASP A 1 186 ? -6.993  60.332  59.776  1.00   30.00 ? 186  ASP A CA  1 
ATOM   1475  C C   . ASP A 1 186 ? -7.984  61.019  58.857  1.00   28.04 ? 186  ASP A C   1 
ATOM   1476  O O   . ASP A 1 186 ? -7.933  60.847  57.642  1.00   27.34 ? 186  ASP A O   1 
ATOM   1477  C CB  . ASP A 1 186 ? -7.390  58.875  59.917  1.00   34.87 ? 186  ASP A CB  1 
ATOM   1478  C CG  . ASP A 1 186 ? -8.825  58.713  60.322  1.00   39.69 ? 186  ASP A CG  1 
ATOM   1479  O OD1 . ASP A 1 186 ? -9.276  59.451  61.226  1.00   44.27 ? 186  ASP A OD1 1 
ATOM   1480  O OD2 . ASP A 1 186 ? -9.493  57.837  59.737  1.00   44.56 ? 186  ASP A OD2 1 
ATOM   1481  N N   . PHE A 1 187 ? -8.887  61.792  59.444  1.00   24.52 ? 187  PHE A N   1 
ATOM   1482  C CA  . PHE A 1 187 ? -9.878  62.511  58.678  1.00   26.65 ? 187  PHE A CA  1 
ATOM   1483  C C   . PHE A 1 187 ? -9.266  63.576  57.794  1.00   28.75 ? 187  PHE A C   1 
ATOM   1484  O O   . PHE A 1 187 ? -9.916  64.052  56.863  1.00   29.17 ? 187  PHE A O   1 
ATOM   1485  C CB  . PHE A 1 187 ? -10.892 63.178  59.608  1.00   33.56 ? 187  PHE A CB  1 
ATOM   1486  C CG  . PHE A 1 187 ? -12.075 62.324  59.932  1.00   38.34 ? 187  PHE A CG  1 
ATOM   1487  C CD1 . PHE A 1 187 ? -13.239 62.910  60.423  1.00   41.94 ? 187  PHE A CD1 1 
ATOM   1488  C CD2 . PHE A 1 187 ? -12.043 60.939  59.729  1.00   43.05 ? 187  PHE A CD2 1 
ATOM   1489  C CE1 . PHE A 1 187 ? -14.366 62.145  60.708  1.00   40.54 ? 187  PHE A CE1 1 
ATOM   1490  C CE2 . PHE A 1 187 ? -13.162 60.159  60.009  1.00   44.71 ? 187  PHE A CE2 1 
ATOM   1491  C CZ  . PHE A 1 187 ? -14.330 60.769  60.500  1.00   44.26 ? 187  PHE A CZ  1 
ATOM   1492  N N   . LEU A 1 188 ? -8.024  63.963  58.069  1.00   30.56 ? 188  LEU A N   1 
ATOM   1493  C CA  . LEU A 1 188 ? -7.369  64.983  57.249  1.00   30.00 ? 188  LEU A CA  1 
ATOM   1494  C C   . LEU A 1 188 ? -7.076  64.461  55.852  1.00   28.72 ? 188  LEU A C   1 
ATOM   1495  O O   . LEU A 1 188 ? -6.503  65.168  55.032  1.00   25.18 ? 188  LEU A O   1 
ATOM   1496  C CB  . LEU A 1 188 ? -6.063  65.459  57.886  1.00   32.50 ? 188  LEU A CB  1 
ATOM   1497  C CG  . LEU A 1 188 ? -6.116  66.519  58.989  1.00   32.10 ? 188  LEU A CG  1 
ATOM   1498  C CD1 . LEU A 1 188 ? -6.692  67.833  58.451  1.00   35.36 ? 188  LEU A CD1 1 
ATOM   1499  C CD2 . LEU A 1 188 ? -6.924  65.997  60.122  1.00   27.80 ? 188  LEU A CD2 1 
ATOM   1500  N N   . LYS A 1 189 ? -7.454  63.218  55.582  1.00   28.85 ? 189  LYS A N   1 
ATOM   1501  C CA  . LYS A 1 189 ? -7.242  62.652  54.254  1.00   29.57 ? 189  LYS A CA  1 
ATOM   1502  C C   . LYS A 1 189 ? -8.432  63.047  53.384  1.00   30.70 ? 189  LYS A C   1 
ATOM   1503  O O   . LYS A 1 189 ? -8.345  63.027  52.158  1.00   31.99 ? 189  LYS A O   1 
ATOM   1504  C CB  . LYS A 1 189 ? -7.151  61.120  54.308  1.00   27.70 ? 189  LYS A CB  1 
ATOM   1505  C CG  . LYS A 1 189 ? -5.846  60.527  54.829  1.00   30.27 ? 189  LYS A CG  1 
ATOM   1506  C CD  . LYS A 1 189 ? -6.116  59.096  55.346  1.00   31.97 ? 189  LYS A CD  1 
ATOM   1507  C CE  . LYS A 1 189 ? -4.842  58.284  55.642  1.00   33.22 ? 189  LYS A CE  1 
ATOM   1508  N NZ  . LYS A 1 189 ? -4.022  58.049  54.406  1.00   31.59 ? 189  LYS A NZ  1 
ATOM   1509  N N   . LYS A 1 190 ? -9.548  63.401  54.018  1.00   30.93 ? 190  LYS A N   1 
ATOM   1510  C CA  . LYS A 1 190 ? -10.749 63.768  53.264  1.00   34.35 ? 190  LYS A CA  1 
ATOM   1511  C C   . LYS A 1 190 ? -11.136 65.214  53.397  1.00   33.88 ? 190  LYS A C   1 
ATOM   1512  O O   . LYS A 1 190 ? -11.381 65.889  52.401  1.00   34.98 ? 190  LYS A O   1 
ATOM   1513  C CB  . LYS A 1 190 ? -11.956 62.920  53.683  1.00   35.47 ? 190  LYS A CB  1 
ATOM   1514  C CG  . LYS A 1 190 ? -12.166 61.669  52.856  1.00   39.00 ? 190  LYS A CG  1 
ATOM   1515  C CD  . LYS A 1 190 ? -13.589 61.151  53.048  1.00   40.79 ? 190  LYS A CD  1 
ATOM   1516  C CE  . LYS A 1 190 ? -14.620 62.151  52.500  1.00   43.55 ? 190  LYS A CE  1 
ATOM   1517  N NZ  . LYS A 1 190 ? -16.032 61.686  52.687  1.00   44.29 ? 190  LYS A NZ  1 
ATOM   1518  N N   . TYR A 1 191 ? -11.179 65.696  54.631  1.00   34.45 ? 191  TYR A N   1 
ATOM   1519  C CA  . TYR A 1 191 ? -11.595 67.064  54.845  1.00   35.02 ? 191  TYR A CA  1 
ATOM   1520  C C   . TYR A 1 191 ? -10.455 67.980  55.157  1.00   34.34 ? 191  TYR A C   1 
ATOM   1521  O O   . TYR A 1 191 ? -9.563  67.644  55.938  1.00   35.65 ? 191  TYR A O   1 
ATOM   1522  C CB  . TYR A 1 191 ? -12.652 67.139  55.957  1.00   33.98 ? 191  TYR A CB  1 
ATOM   1523  C CG  . TYR A 1 191 ? -13.831 66.208  55.744  1.00   32.88 ? 191  TYR A CG  1 
ATOM   1524  C CD1 . TYR A 1 191 ? -13.816 64.908  56.248  1.00   26.08 ? 191  TYR A CD1 1 
ATOM   1525  C CD2 . TYR A 1 191 ? -14.974 66.633  55.060  1.00   32.87 ? 191  TYR A CD2 1 
ATOM   1526  C CE1 . TYR A 1 191 ? -14.894 64.064  56.090  1.00   31.61 ? 191  TYR A CE1 1 
ATOM   1527  C CE2 . TYR A 1 191 ? -16.074 65.789  54.898  1.00   34.47 ? 191  TYR A CE2 1 
ATOM   1528  C CZ  . TYR A 1 191 ? -16.024 64.511  55.422  1.00   32.62 ? 191  TYR A CZ  1 
ATOM   1529  O OH  . TYR A 1 191 ? -17.125 63.699  55.336  1.00   38.74 ? 191  TYR A OH  1 
ATOM   1530  N N   . GLU A 1 192 ? -10.505 69.143  54.528  1.00   29.55 ? 192  GLU A N   1 
ATOM   1531  C CA  . GLU A 1 192 ? -9.498  70.147  54.713  1.00   31.54 ? 192  GLU A CA  1 
ATOM   1532  C C   . GLU A 1 192 ? -9.990  71.099  55.795  1.00   28.97 ? 192  GLU A C   1 
ATOM   1533  O O   . GLU A 1 192 ? -9.218  71.860  56.371  1.00   24.14 ? 192  GLU A O   1 
ATOM   1534  C CB  . GLU A 1 192 ? -9.296  70.910  53.397  1.00   38.40 ? 192  GLU A CB  1 
ATOM   1535  C CG  . GLU A 1 192 ? -7.932  71.567  53.274  1.00   46.52 ? 192  GLU A CG  1 
ATOM   1536  C CD  . GLU A 1 192 ? -6.805  70.546  53.094  1.00   54.42 ? 192  GLU A CD  1 
ATOM   1537  O OE1 . GLU A 1 192 ? -7.002  69.351  53.424  1.00   57.86 ? 192  GLU A OE1 1 
ATOM   1538  O OE2 . GLU A 1 192 ? -5.712  70.947  52.633  1.00   59.05 ? 192  GLU A OE2 1 
ATOM   1539  N N   . ASN A 1 193 ? -11.289 71.047  56.074  1.00   28.86 ? 193  ASN A N   1 
ATOM   1540  C CA  . ASN A 1 193 ? -11.875 71.947  57.068  1.00   25.42 ? 193  ASN A CA  1 
ATOM   1541  C C   . ASN A 1 193 ? -11.887 71.326  58.464  1.00   24.33 ? 193  ASN A C   1 
ATOM   1542  O O   . ASN A 1 193 ? -12.911 71.299  59.155  1.00   24.64 ? 193  ASN A O   1 
ATOM   1543  C CB  . ASN A 1 193 ? -13.285 72.373  56.630  1.00   18.92 ? 193  ASN A CB  1 
ATOM   1544  C CG  . ASN A 1 193 ? -14.220 71.185  56.387  1.00   18.54 ? 193  ASN A CG  1 
ATOM   1545  O OD1 . ASN A 1 193 ? -15.367 71.185  56.837  1.00   17.45 ? 193  ASN A OD1 1 
ATOM   1546  N ND2 . ASN A 1 193 ? -13.730 70.177  55.673  1.00   16.09 ? 193  ASN A ND2 1 
ATOM   1547  N N   . LEU A 1 194 ? -10.713 70.878  58.894  1.00   23.61 ? 194  LEU A N   1 
ATOM   1548  C CA  . LEU A 1 194 ? -10.571 70.231  60.185  1.00   23.23 ? 194  LEU A CA  1 
ATOM   1549  C C   . LEU A 1 194 ? -9.212  70.461  60.831  1.00   26.46 ? 194  LEU A C   1 
ATOM   1550  O O   . LEU A 1 194 ? -8.183  70.560  60.156  1.00   27.35 ? 194  LEU A O   1 
ATOM   1551  C CB  . LEU A 1 194 ? -10.759 68.733  60.000  1.00   19.55 ? 194  LEU A CB  1 
ATOM   1552  C CG  . LEU A 1 194 ? -10.327 67.752  61.083  1.00   20.75 ? 194  LEU A CG  1 
ATOM   1553  C CD1 . LEU A 1 194 ? -11.333 67.776  62.208  1.00   23.17 ? 194  LEU A CD1 1 
ATOM   1554  C CD2 . LEU A 1 194 ? -10.237 66.356  60.494  1.00   20.52 ? 194  LEU A CD2 1 
ATOM   1555  N N   . ALA A 1 195 ? -9.215  70.531  62.150  1.00   24.17 ? 195  ALA A N   1 
ATOM   1556  C CA  . ALA A 1 195 ? -7.979  70.677  62.876  1.00   24.32 ? 195  ALA A CA  1 
ATOM   1557  C C   . ALA A 1 195 ? -8.096  69.854  64.147  1.00   22.08 ? 195  ALA A C   1 
ATOM   1558  O O   . ALA A 1 195 ? -9.086  69.952  64.855  1.00   22.57 ? 195  ALA A O   1 
ATOM   1559  C CB  . ALA A 1 195 ? -7.704  72.150  63.211  1.00   20.39 ? 195  ALA A CB  1 
ATOM   1560  N N   . VAL A 1 196 ? -7.109  69.007  64.404  1.00   18.18 ? 196  VAL A N   1 
ATOM   1561  C CA  . VAL A 1 196 ? -7.125  68.248  65.630  1.00   18.49 ? 196  VAL A CA  1 
ATOM   1562  C C   . VAL A 1 196 ? -6.177  68.983  66.598  1.00   21.96 ? 196  VAL A C   1 
ATOM   1563  O O   . VAL A 1 196 ? -5.077  69.428  66.213  1.00   24.33 ? 196  VAL A O   1 
ATOM   1564  C CB  . VAL A 1 196 ? -6.672  66.780  65.397  1.00   17.64 ? 196  VAL A CB  1 
ATOM   1565  C CG1 . VAL A 1 196 ? -6.653  66.008  66.709  1.00   6.79  ? 196  VAL A CG1 1 
ATOM   1566  C CG2 . VAL A 1 196 ? -7.630  66.079  64.404  1.00   12.63 ? 196  VAL A CG2 1 
ATOM   1567  N N   . ILE A 1 197 ? -6.617  69.141  67.843  1.00   22.15 ? 197  ILE A N   1 
ATOM   1568  C CA  . ILE A 1 197 ? -5.830  69.822  68.869  1.00   19.32 ? 197  ILE A CA  1 
ATOM   1569  C C   . ILE A 1 197 ? -5.483  68.842  69.971  1.00   20.44 ? 197  ILE A C   1 
ATOM   1570  O O   . ILE A 1 197 ? -6.362  68.127  70.460  1.00   17.79 ? 197  ILE A O   1 
ATOM   1571  C CB  . ILE A 1 197 ? -6.616  70.988  69.526  1.00   19.38 ? 197  ILE A CB  1 
ATOM   1572  C CG1 . ILE A 1 197 ? -7.169  71.920  68.446  1.00   16.25 ? 197  ILE A CG1 1 
ATOM   1573  C CG2 . ILE A 1 197 ? -5.680  71.784  70.468  1.00   12.61 ? 197  ILE A CG2 1 
ATOM   1574  C CD1 . ILE A 1 197 ? -7.937  73.080  69.007  1.00   10.18 ? 197  ILE A CD1 1 
ATOM   1575  N N   . ARG A 1 198 ? -4.213  68.842  70.375  1.00   20.32 ? 198  ARG A N   1 
ATOM   1576  C CA  . ARG A 1 198 ? -3.694  67.944  71.420  1.00   20.14 ? 198  ARG A CA  1 
ATOM   1577  C C   . ARG A 1 198 ? -2.872  68.763  72.401  1.00   21.50 ? 198  ARG A C   1 
ATOM   1578  O O   . ARG A 1 198 ? -2.558  69.934  72.135  1.00   21.13 ? 198  ARG A O   1 
ATOM   1579  C CB  . ARG A 1 198 ? -2.780  66.898  70.795  1.00   17.67 ? 198  ARG A CB  1 
ATOM   1580  C CG  . ARG A 1 198 ? -3.451  65.933  69.813  1.00   22.44 ? 198  ARG A CG  1 
ATOM   1581  C CD  . ARG A 1 198 ? -3.830  64.648  70.535  1.00   27.48 ? 198  ARG A CD  1 
ATOM   1582  N NE  . ARG A 1 198 ? -4.205  63.561  69.640  1.00   31.97 ? 198  ARG A NE  1 
ATOM   1583  C CZ  . ARG A 1 198 ? -3.340  62.784  68.991  1.00   32.47 ? 198  ARG A CZ  1 
ATOM   1584  N NH1 . ARG A 1 198 ? -2.024  62.967  69.130  1.00   25.13 ? 198  ARG A NH1 1 
ATOM   1585  N NH2 . ARG A 1 198 ? -3.803  61.824  68.188  1.00   25.16 ? 198  ARG A NH2 1 
ATOM   1586  N N   . THR A 1 199 ? -2.517  68.165  73.535  1.00   21.07 ? 199  THR A N   1 
ATOM   1587  C CA  . THR A 1 199 ? -1.683  68.869  74.524  1.00   20.86 ? 199  THR A CA  1 
ATOM   1588  C C   . THR A 1 199 ? -0.717  67.899  75.220  1.00   21.95 ? 199  THR A C   1 
ATOM   1589  O O   . THR A 1 199 ? -0.798  66.677  75.013  1.00   20.32 ? 199  THR A O   1 
ATOM   1590  C CB  . THR A 1 199 ? -2.545  69.607  75.602  1.00   16.35 ? 199  THR A CB  1 
ATOM   1591  O OG1 . THR A 1 199 ? -1.684  70.192  76.578  1.00   19.06 ? 199  THR A OG1 1 
ATOM   1592  C CG2 . THR A 1 199 ? -3.462  68.664  76.310  1.00   13.33 ? 199  THR A CG2 1 
ATOM   1593  N N   . PHE A 1 200 ? 0.209   68.452  76.008  1.00   20.36 ? 200  PHE A N   1 
ATOM   1594  C CA  . PHE A 1 200 ? 1.170   67.660  76.778  1.00   20.45 ? 200  PHE A CA  1 
ATOM   1595  C C   . PHE A 1 200 ? 0.826   67.773  78.265  1.00   22.15 ? 200  PHE A C   1 
ATOM   1596  O O   . PHE A 1 200 ? 1.428   67.071  79.114  1.00   19.62 ? 200  PHE A O   1 
ATOM   1597  C CB  . PHE A 1 200 ? 2.605   68.176  76.604  1.00   19.68 ? 200  PHE A CB  1 
ATOM   1598  C CG  . PHE A 1 200 ? 3.259   67.775  75.312  1.00   20.32 ? 200  PHE A CG  1 
ATOM   1599  C CD1 . PHE A 1 200 ? 2.974   68.440  74.142  1.00   20.30 ? 200  PHE A CD1 1 
ATOM   1600  C CD2 . PHE A 1 200 ? 4.178   66.732  75.279  1.00   18.75 ? 200  PHE A CD2 1 
ATOM   1601  C CE1 . PHE A 1 200 ? 3.596   68.077  72.945  1.00   24.52 ? 200  PHE A CE1 1 
ATOM   1602  C CE2 . PHE A 1 200 ? 4.795   66.366  74.102  1.00   17.89 ? 200  PHE A CE2 1 
ATOM   1603  C CZ  . PHE A 1 200 ? 4.501   67.045  72.924  1.00   17.54 ? 200  PHE A CZ  1 
ATOM   1604  N N   . SER A 1 201 ? -0.139  68.651  78.570  1.00   19.58 ? 201  SER A N   1 
ATOM   1605  C CA  . SER A 1 201 ? -0.533  68.909  79.958  1.00   21.58 ? 201  SER A CA  1 
ATOM   1606  C C   . SER A 1 201 ? -1.055  67.736  80.777  1.00   23.21 ? 201  SER A C   1 
ATOM   1607  O O   . SER A 1 201 ? -0.756  67.656  81.975  1.00   23.33 ? 201  SER A O   1 
ATOM   1608  C CB  . SER A 1 201 ? -1.581  70.023  80.031  1.00   23.45 ? 201  SER A CB  1 
ATOM   1609  O OG  . SER A 1 201 ? -1.178  71.162  79.292  1.00   24.93 ? 201  SER A OG  1 
ATOM   1610  N N   . LYS A 1 202 ? -1.821  66.836  80.159  1.00   21.14 ? 202  LYS A N   1 
ATOM   1611  C CA  . LYS A 1 202 ? -2.400  65.739  80.922  1.00   24.04 ? 202  LYS A CA  1 
ATOM   1612  C C   . LYS A 1 202 ? -1.601  64.439  80.948  1.00   22.18 ? 202  LYS A C   1 
ATOM   1613  O O   . LYS A 1 202 ? -1.169  64.023  82.003  1.00   21.63 ? 202  LYS A O   1 
ATOM   1614  C CB  . LYS A 1 202 ? -3.855  65.460  80.470  1.00   24.03 ? 202  LYS A CB  1 
ATOM   1615  C CG  . LYS A 1 202 ? -4.829  66.638  80.681  1.00   31.78 ? 202  LYS A CG  1 
ATOM   1616  C CD  . LYS A 1 202 ? -4.847  67.579  79.491  1.00   37.59 ? 202  LYS A CD  1 
ATOM   1617  C CE  . LYS A 1 202 ? -5.307  68.985  79.881  1.00   41.80 ? 202  LYS A CE  1 
ATOM   1618  N NZ  . LYS A 1 202 ? -6.637  69.026  80.541  1.00   38.19 ? 202  LYS A NZ  1 
ATOM   1619  N N   . ALA A 1 203 ? -1.392  63.812  79.799  1.00   21.31 ? 203  ALA A N   1 
ATOM   1620  C CA  . ALA A 1 203 ? -0.668  62.552  79.729  1.00   19.61 ? 203  ALA A CA  1 
ATOM   1621  C C   . ALA A 1 203 ? 0.817   62.629  80.050  1.00   22.50 ? 203  ALA A C   1 
ATOM   1622  O O   . ALA A 1 203 ? 1.433   61.606  80.378  1.00   23.44 ? 203  ALA A O   1 
ATOM   1623  C CB  . ALA A 1 203 ? -0.857  61.950  78.365  1.00   15.99 ? 203  ALA A CB  1 
ATOM   1624  N N   . PHE A 1 204 ? 1.392   63.827  79.962  1.00   23.98 ? 204  PHE A N   1 
ATOM   1625  C CA  . PHE A 1 204 ? 2.819   63.994  80.181  1.00   22.07 ? 204  PHE A CA  1 
ATOM   1626  C C   . PHE A 1 204 ? 3.189   64.808  81.399  1.00   23.35 ? 204  PHE A C   1 
ATOM   1627  O O   . PHE A 1 204 ? 4.342   65.225  81.541  1.00   24.09 ? 204  PHE A O   1 
ATOM   1628  C CB  . PHE A 1 204 ? 3.446   64.609  78.935  1.00   22.43 ? 204  PHE A CB  1 
ATOM   1629  C CG  . PHE A 1 204 ? 3.197   63.819  77.691  1.00   21.38 ? 204  PHE A CG  1 
ATOM   1630  C CD1 . PHE A 1 204 ? 4.106   62.843  77.274  1.00   22.67 ? 204  PHE A CD1 1 
ATOM   1631  C CD2 . PHE A 1 204 ? 2.056   64.048  76.928  1.00   25.01 ? 204  PHE A CD2 1 
ATOM   1632  C CE1 . PHE A 1 204 ? 3.879   62.104  76.099  1.00   20.62 ? 204  PHE A CE1 1 
ATOM   1633  C CE2 . PHE A 1 204 ? 1.817   63.314  75.754  1.00   22.58 ? 204  PHE A CE2 1 
ATOM   1634  C CZ  . PHE A 1 204 ? 2.734   62.340  75.338  1.00   21.58 ? 204  PHE A CZ  1 
ATOM   1635  N N   . SER A 1 205 ? 2.222   65.039  82.281  1.00   22.44 ? 205  SER A N   1 
ATOM   1636  C CA  . SER A 1 205 ? 2.493   65.781  83.509  1.00   23.31 ? 205  SER A CA  1 
ATOM   1637  C C   . SER A 1 205 ? 3.280   67.029  83.164  1.00   25.10 ? 205  SER A C   1 
ATOM   1638  O O   . SER A 1 205 ? 4.371   67.265  83.714  1.00   29.19 ? 205  SER A O   1 
ATOM   1639  C CB  . SER A 1 205 ? 3.306   64.921  84.481  1.00   22.77 ? 205  SER A CB  1 
ATOM   1640  O OG  . SER A 1 205 ? 2.588   63.760  84.891  1.00   22.09 ? 205  SER A OG  1 
ATOM   1641  N N   . LEU A 1 206 ? 2.714   67.846  82.274  1.00   21.45 ? 206  LEU A N   1 
ATOM   1642  C CA  . LEU A 1 206 ? 3.416   69.036  81.835  1.00   19.55 ? 206  LEU A CA  1 
ATOM   1643  C C   . LEU A 1 206 ? 2.505   70.262  81.760  1.00   18.84 ? 206  LEU A C   1 
ATOM   1644  O O   . LEU A 1 206 ? 2.769   71.199  81.010  1.00   18.19 ? 206  LEU A O   1 
ATOM   1645  C CB  . LEU A 1 206 ? 4.031   68.747  80.463  1.00   15.60 ? 206  LEU A CB  1 
ATOM   1646  C CG  . LEU A 1 206 ? 5.538   68.860  80.260  1.00   22.05 ? 206  LEU A CG  1 
ATOM   1647  C CD1 . LEU A 1 206 ? 6.240   68.901  81.595  1.00   21.10 ? 206  LEU A CD1 1 
ATOM   1648  C CD2 . LEU A 1 206 ? 6.042   67.718  79.381  1.00   11.97 ? 206  LEU A CD2 1 
ATOM   1649  N N   . ALA A 1 207 ? 1.455   70.259  82.565  1.00   16.66 ? 207  ALA A N   1 
ATOM   1650  C CA  . ALA A 1 207 ? 0.472   71.329  82.568  1.00   16.13 ? 207  ALA A CA  1 
ATOM   1651  C C   . ALA A 1 207 ? 1.074   72.704  82.827  1.00   18.55 ? 207  ALA A C   1 
ATOM   1652  O O   . ALA A 1 207 ? 0.649   73.704  82.236  1.00   17.23 ? 207  ALA A O   1 
ATOM   1653  C CB  . ALA A 1 207 ? -0.592  71.010  83.577  1.00   11.67 ? 207  ALA A CB  1 
ATOM   1654  N N   . ALA A 1 208 ? 2.087   72.728  83.694  1.00   17.61 ? 208  ALA A N   1 
ATOM   1655  C CA  . ALA A 1 208 ? 2.789   73.934  84.083  1.00   16.12 ? 208  ALA A CA  1 
ATOM   1656  C C   . ALA A 1 208 ? 3.669   74.568  83.012  1.00   16.45 ? 208  ALA A C   1 
ATOM   1657  O O   . ALA A 1 208 ? 3.960   75.744  83.132  1.00   17.78 ? 208  ALA A O   1 
ATOM   1658  C CB  . ALA A 1 208 ? 3.636   73.660  85.330  1.00   13.07 ? 208  ALA A CB  1 
ATOM   1659  N N   . GLN A 1 209 ? 4.101   73.797  82.005  1.00   14.10 ? 209  GLN A N   1 
ATOM   1660  C CA  . GLN A 1 209 ? 4.968   74.252  80.913  1.00   16.31 ? 209  GLN A CA  1 
ATOM   1661  C C   . GLN A 1 209 ? 4.260   74.704  79.629  1.00   18.39 ? 209  GLN A C   1 
ATOM   1662  O O   . GLN A 1 209 ? 4.912   75.089  78.647  1.00   16.83 ? 209  GLN A O   1 
ATOM   1663  C CB  . GLN A 1 209 ? 5.992   73.164  80.531  1.00   18.25 ? 209  GLN A CB  1 
ATOM   1664  C CG  . GLN A 1 209 ? 7.086   73.051  81.521  1.00   14.19 ? 209  GLN A CG  1 
ATOM   1665  C CD  . GLN A 1 209 ? 7.565   74.413  81.927  1.00   14.73 ? 209  GLN A CD  1 
ATOM   1666  O OE1 . GLN A 1 209 ? 8.200   75.121  81.139  1.00   22.49 ? 209  GLN A OE1 1 
ATOM   1667  N NE2 . GLN A 1 209 ? 7.261   74.798  83.150  1.00   6.36  ? 209  GLN A NE2 1 
ATOM   1668  N N   . ARG A 1 210 ? 2.934   74.599  79.612  1.00   18.32 ? 210  ARG A N   1 
ATOM   1669  C CA  . ARG A 1 210 ? 2.129   75.091  78.490  1.00   15.14 ? 210  ARG A CA  1 
ATOM   1670  C C   . ARG A 1 210 ? 2.561   74.737  77.067  1.00   13.60 ? 210  ARG A C   1 
ATOM   1671  O O   . ARG A 1 210 ? 3.143   75.555  76.359  1.00   11.05 ? 210  ARG A O   1 
ATOM   1672  C CB  . ARG A 1 210 ? 2.018   76.624  78.616  1.00   12.69 ? 210  ARG A CB  1 
ATOM   1673  C CG  . ARG A 1 210 ? 2.071   77.104  80.067  1.00   8.65  ? 210  ARG A CG  1 
ATOM   1674  C CD  . ARG A 1 210 ? 0.889   76.510  80.805  1.00   15.66 ? 210  ARG A CD  1 
ATOM   1675  N NE  . ARG A 1 210 ? -0.353  76.839  80.104  1.00   16.16 ? 210  ARG A NE  1 
ATOM   1676  C CZ  . ARG A 1 210 ? -1.281  75.950  79.744  1.00   20.82 ? 210  ARG A CZ  1 
ATOM   1677  N NH1 . ARG A 1 210 ? -1.108  74.662  80.026  1.00   21.63 ? 210  ARG A NH1 1 
ATOM   1678  N NH2 . ARG A 1 210 ? -2.373  76.335  79.087  1.00   22.32 ? 210  ARG A NH2 1 
ATOM   1679  N N   . VAL A 1 211 ? 2.269   73.514  76.650  1.00   17.52 ? 211  VAL A N   1 
ATOM   1680  C CA  . VAL A 1 211 ? 2.567   73.096  75.280  1.00   16.49 ? 211  VAL A CA  1 
ATOM   1681  C C   . VAL A 1 211 ? 1.396   72.318  74.659  1.00   16.46 ? 211  VAL A C   1 
ATOM   1682  O O   . VAL A 1 211 ? 1.029   71.220  75.107  1.00   15.05 ? 211  VAL A O   1 
ATOM   1683  C CB  . VAL A 1 211 ? 3.851   72.211  75.188  1.00   16.72 ? 211  VAL A CB  1 
ATOM   1684  C CG1 . VAL A 1 211 ? 4.100   71.777  73.742  1.00   6.36  ? 211  VAL A CG1 1 
ATOM   1685  C CG2 . VAL A 1 211 ? 5.057   72.979  75.694  1.00   16.21 ? 211  VAL A CG2 1 
ATOM   1686  N N   . GLY A 1 212 ? 0.813   72.906  73.626  1.00   16.58 ? 212  GLY A N   1 
ATOM   1687  C CA  . GLY A 1 212 ? -0.261  72.239  72.901  1.00   16.05 ? 212  GLY A CA  1 
ATOM   1688  C C   . GLY A 1 212 ? 0.143   72.174  71.436  1.00   16.91 ? 212  GLY A C   1 
ATOM   1689  O O   . GLY A 1 212 ? 1.126   72.798  71.045  1.00   18.33 ? 212  GLY A O   1 
ATOM   1690  N N   . TYR A 1 213 ? -0.557  71.399  70.614  1.00   19.69 ? 213  TYR A N   1 
ATOM   1691  C CA  . TYR A 1 213 ? -0.200  71.362  69.195  1.00   19.45 ? 213  TYR A CA  1 
ATOM   1692  C C   . TYR A 1 213 ? -1.402  71.090  68.308  1.00   17.37 ? 213  TYR A C   1 
ATOM   1693  O O   . TYR A 1 213 ? -2.421  70.584  68.784  1.00   18.50 ? 213  TYR A O   1 
ATOM   1694  C CB  . TYR A 1 213 ? 0.941   70.376  68.931  1.00   18.11 ? 213  TYR A CB  1 
ATOM   1695  C CG  . TYR A 1 213 ? 0.683   68.935  69.308  1.00   22.10 ? 213  TYR A CG  1 
ATOM   1696  C CD1 . TYR A 1 213 ? 0.280   67.997  68.348  1.00   18.69 ? 213  TYR A CD1 1 
ATOM   1697  C CD2 . TYR A 1 213 ? 0.896   68.490  70.610  1.00   25.44 ? 213  TYR A CD2 1 
ATOM   1698  C CE1 . TYR A 1 213 ? 0.100   66.655  68.675  1.00   23.76 ? 213  TYR A CE1 1 
ATOM   1699  C CE2 . TYR A 1 213 ? 0.721   67.145  70.950  1.00   24.97 ? 213  TYR A CE2 1 
ATOM   1700  C CZ  . TYR A 1 213 ? 0.320   66.236  69.978  1.00   20.86 ? 213  TYR A CZ  1 
ATOM   1701  O OH  . TYR A 1 213 ? 0.115   64.949  70.321  1.00   19.62 ? 213  TYR A OH  1 
ATOM   1702  N N   . VAL A 1 214 ? -1.270  71.431  67.030  1.00   16.61 ? 214  VAL A N   1 
ATOM   1703  C CA  . VAL A 1 214 ? -2.359  71.313  66.073  1.00   18.43 ? 214  VAL A CA  1 
ATOM   1704  C C   . VAL A 1 214 ? -1.941  70.594  64.819  1.00   20.13 ? 214  VAL A C   1 
ATOM   1705  O O   . VAL A 1 214 ? -0.832  70.783  64.335  1.00   22.46 ? 214  VAL A O   1 
ATOM   1706  C CB  . VAL A 1 214 ? -2.867  72.690  65.614  1.00   21.15 ? 214  VAL A CB  1 
ATOM   1707  C CG1 . VAL A 1 214 ? -4.363  72.600  65.244  1.00   14.60 ? 214  VAL A CG1 1 
ATOM   1708  C CG2 . VAL A 1 214 ? -2.592  73.726  66.683  1.00   20.95 ? 214  VAL A CG2 1 
ATOM   1709  N N   . VAL A 1 215 ? -2.858  69.783  64.306  1.00   22.32 ? 215  VAL A N   1 
ATOM   1710  C CA  . VAL A 1 215 ? -2.644  68.997  63.112  1.00   22.47 ? 215  VAL A CA  1 
ATOM   1711  C C   . VAL A 1 215 ? -3.784  69.344  62.188  1.00   23.70 ? 215  VAL A C   1 
ATOM   1712  O O   . VAL A 1 215 ? -4.948  69.092  62.488  1.00   23.26 ? 215  VAL A O   1 
ATOM   1713  C CB  . VAL A 1 215 ? -2.713  67.503  63.422  1.00   25.13 ? 215  VAL A CB  1 
ATOM   1714  C CG1 . VAL A 1 215 ? -2.142  66.704  62.258  1.00   23.56 ? 215  VAL A CG1 1 
ATOM   1715  C CG2 . VAL A 1 215 ? -1.979  67.219  64.711  1.00   21.12 ? 215  VAL A CG2 1 
ATOM   1716  N N   . ALA A 1 216 ? -3.454  69.943  61.058  1.00   24.87 ? 216  ALA A N   1 
ATOM   1717  C CA  . ALA A 1 216 ? -4.491  70.322  60.134  1.00   21.79 ? 216  ALA A CA  1 
ATOM   1718  C C   . ALA A 1 216 ? -3.924  70.466  58.758  1.00   22.99 ? 216  ALA A C   1 
ATOM   1719  O O   . ALA A 1 216 ? -2.753  70.180  58.524  1.00   23.67 ? 216  ALA A O   1 
ATOM   1720  C CB  . ALA A 1 216 ? -5.120  71.633  60.576  1.00   18.34 ? 216  ALA A CB  1 
ATOM   1721  N N   . SER A 1 217 ? -4.786  70.898  57.846  1.00   24.03 ? 217  SER A N   1 
ATOM   1722  C CA  . SER A 1 217 ? -4.405  71.154  56.474  1.00   26.87 ? 217  SER A CA  1 
ATOM   1723  C C   . SER A 1 217 ? -3.338  72.255  56.442  1.00   28.28 ? 217  SER A C   1 
ATOM   1724  O O   . SER A 1 217 ? -3.262  73.125  57.335  1.00   27.32 ? 217  SER A O   1 
ATOM   1725  C CB  . SER A 1 217 ? -5.617  71.634  55.696  1.00   27.36 ? 217  SER A CB  1 
ATOM   1726  O OG  . SER A 1 217 ? -6.165  72.795  56.313  1.00   37.94 ? 217  SER A OG  1 
ATOM   1727  N N   . GLU A 1 218 ? -2.533  72.217  55.398  1.00   27.79 ? 218  GLU A N   1 
ATOM   1728  C CA  . GLU A 1 218 ? -1.476  73.179  55.214  1.00   29.85 ? 218  GLU A CA  1 
ATOM   1729  C C   . GLU A 1 218 ? -2.040  74.586  55.150  1.00   29.05 ? 218  GLU A C   1 
ATOM   1730  O O   . GLU A 1 218 ? -1.420  75.516  55.661  1.00   29.22 ? 218  GLU A O   1 
ATOM   1731  C CB  . GLU A 1 218 ? -0.719  72.891  53.914  1.00   37.11 ? 218  GLU A CB  1 
ATOM   1732  C CG  . GLU A 1 218 ? -0.216  71.469  53.750  1.00   45.56 ? 218  GLU A CG  1 
ATOM   1733  C CD  . GLU A 1 218 ? 0.347   71.228  52.358  1.00   54.11 ? 218  GLU A CD  1 
ATOM   1734  O OE1 . GLU A 1 218 ? -0.435  71.329  51.382  1.00   55.17 ? 218  GLU A OE1 1 
ATOM   1735  O OE2 . GLU A 1 218 ? 1.567   70.943  52.239  1.00   60.17 ? 218  GLU A OE2 1 
ATOM   1736  N N   . LYS A 1 219 ? -3.196  74.759  54.515  1.00   27.08 ? 219  LYS A N   1 
ATOM   1737  C CA  . LYS A 1 219 ? -3.766  76.102  54.425  1.00   25.01 ? 219  LYS A CA  1 
ATOM   1738  C C   . LYS A 1 219 ? -4.117  76.571  55.812  1.00   21.07 ? 219  LYS A C   1 
ATOM   1739  O O   . LYS A 1 219 ? -3.827  77.716  56.174  1.00   23.40 ? 219  LYS A O   1 
ATOM   1740  C CB  . LYS A 1 219 ? -5.012  76.155  53.522  1.00   28.76 ? 219  LYS A CB  1 
ATOM   1741  C CG  . LYS A 1 219 ? -4.713  75.946  52.048  1.00   35.20 ? 219  LYS A CG  1 
ATOM   1742  C CD  . LYS A 1 219 ? -5.990  75.849  51.235  1.00   41.17 ? 219  LYS A CD  1 
ATOM   1743  C CE  . LYS A 1 219 ? -5.728  75.306  49.832  1.00   45.18 ? 219  LYS A CE  1 
ATOM   1744  N NZ  . LYS A 1 219 ? -6.986  75.148  49.028  1.00   48.75 ? 219  LYS A NZ  1 
ATOM   1745  N N   . PHE A 1 220 ? -4.727  75.708  56.608  1.00   18.56 ? 220  PHE A N   1 
ATOM   1746  C CA  . PHE A 1 220 ? -5.053  76.160  57.951  1.00   21.41 ? 220  PHE A CA  1 
ATOM   1747  C C   . PHE A 1 220 ? -3.783  76.452  58.770  1.00   22.33 ? 220  PHE A C   1 
ATOM   1748  O O   . PHE A 1 220 ? -3.667  77.522  59.380  1.00   21.32 ? 220  PHE A O   1 
ATOM   1749  C CB  . PHE A 1 220 ? -5.888  75.158  58.729  1.00   17.75 ? 220  PHE A CB  1 
ATOM   1750  C CG  . PHE A 1 220 ? -6.171  75.615  60.142  1.00   20.97 ? 220  PHE A CG  1 
ATOM   1751  C CD1 . PHE A 1 220 ? -7.155  76.568  60.398  1.00   21.64 ? 220  PHE A CD1 1 
ATOM   1752  C CD2 . PHE A 1 220 ? -5.406  75.158  61.199  1.00   20.97 ? 220  PHE A CD2 1 
ATOM   1753  C CE1 . PHE A 1 220 ? -7.371  77.058  61.675  1.00   20.34 ? 220  PHE A CE1 1 
ATOM   1754  C CE2 . PHE A 1 220 ? -5.612  75.642  62.485  1.00   21.84 ? 220  PHE A CE2 1 
ATOM   1755  C CZ  . PHE A 1 220 ? -6.606  76.601  62.718  1.00   24.67 ? 220  PHE A CZ  1 
ATOM   1756  N N   . ILE A 1 221 ? -2.837  75.507  58.788  1.00   22.06 ? 221  ILE A N   1 
ATOM   1757  C CA  . ILE A 1 221 ? -1.617  75.723  59.546  1.00   23.21 ? 221  ILE A CA  1 
ATOM   1758  C C   . ILE A 1 221 ? -0.985  77.069  59.175  1.00   23.15 ? 221  ILE A C   1 
ATOM   1759  O O   . ILE A 1 221 ? -0.570  77.829  60.055  1.00   24.05 ? 221  ILE A O   1 
ATOM   1760  C CB  . ILE A 1 221 ? -0.565  74.598  59.321  1.00   23.39 ? 221  ILE A CB  1 
ATOM   1761  C CG1 . ILE A 1 221 ? -1.120  73.246  59.815  1.00   25.18 ? 221  ILE A CG1 1 
ATOM   1762  C CG2 . ILE A 1 221 ? 0.730   74.932  60.095  1.00   16.69 ? 221  ILE A CG2 1 
ATOM   1763  C CD1 . ILE A 1 221 ? -1.478  73.221  61.294  1.00   21.58 ? 221  ILE A CD1 1 
ATOM   1764  N N   . ASP A 1 222 ? -0.933  77.362  57.878  1.00   23.11 ? 222  ASP A N   1 
ATOM   1765  C CA  . ASP A 1 222 ? -0.351  78.614  57.410  1.00   26.64 ? 222  ASP A CA  1 
ATOM   1766  C C   . ASP A 1 222 ? -1.104  79.848  57.970  1.00   28.41 ? 222  ASP A C   1 
ATOM   1767  O O   . ASP A 1 222 ? -0.472  80.796  58.459  1.00   31.05 ? 222  ASP A O   1 
ATOM   1768  C CB  . ASP A 1 222 ? -0.314  78.645  55.864  1.00   29.68 ? 222  ASP A CB  1 
ATOM   1769  C CG  . ASP A 1 222 ? 0.226   79.989  55.298  1.00   35.98 ? 222  ASP A CG  1 
ATOM   1770  O OD1 . ASP A 1 222 ? 1.452   80.123  55.123  1.00   40.11 ? 222  ASP A OD1 1 
ATOM   1771  O OD2 . ASP A 1 222 ? -0.570  80.921  55.029  1.00   34.49 ? 222  ASP A OD2 1 
ATOM   1772  N N   . ALA A 1 223 ? -2.436  79.849  57.926  1.00   26.43 ? 223  ALA A N   1 
ATOM   1773  C CA  . ALA A 1 223 ? -3.181  81.000  58.444  1.00   24.62 ? 223  ALA A CA  1 
ATOM   1774  C C   . ALA A 1 223 ? -3.041  81.142  59.966  1.00   23.45 ? 223  ALA A C   1 
ATOM   1775  O O   . ALA A 1 223 ? -2.966  82.251  60.501  1.00   22.95 ? 223  ALA A O   1 
ATOM   1776  C CB  . ALA A 1 223 ? -4.651  80.893  58.056  1.00   24.44 ? 223  ALA A CB  1 
ATOM   1777  N N   . TYR A 1 224 ? -2.987  80.009  60.647  1.00   20.68 ? 224  TYR A N   1 
ATOM   1778  C CA  . TYR A 1 224 ? -2.861  79.971  62.093  1.00   21.05 ? 224  TYR A CA  1 
ATOM   1779  C C   . TYR A 1 224 ? -1.519  80.572  62.500  1.00   20.33 ? 224  TYR A C   1 
ATOM   1780  O O   . TYR A 1 224 ? -1.444  81.380  63.431  1.00   21.94 ? 224  TYR A O   1 
ATOM   1781  C CB  . TYR A 1 224 ? -2.972  78.525  62.570  1.00   19.08 ? 224  TYR A CB  1 
ATOM   1782  C CG  . TYR A 1 224 ? -2.473  78.338  63.961  1.00   19.50 ? 224  TYR A CG  1 
ATOM   1783  C CD1 . TYR A 1 224 ? -3.268  78.668  65.050  1.00   15.64 ? 224  TYR A CD1 1 
ATOM   1784  C CD2 . TYR A 1 224 ? -1.174  77.873  64.193  1.00   17.09 ? 224  TYR A CD2 1 
ATOM   1785  C CE1 . TYR A 1 224 ? -2.778  78.545  66.338  1.00   15.26 ? 224  TYR A CE1 1 
ATOM   1786  C CE2 . TYR A 1 224 ? -0.682  77.740  65.483  1.00   17.78 ? 224  TYR A CE2 1 
ATOM   1787  C CZ  . TYR A 1 224 ? -1.487  78.083  66.556  1.00   15.07 ? 224  TYR A CZ  1 
ATOM   1788  O OH  . TYR A 1 224 ? -1.003  78.006  67.846  1.00   18.70 ? 224  TYR A OH  1 
ATOM   1789  N N   . ASN A 1 225 ? -0.476  80.169  61.780  1.00   19.26 ? 225  ASN A N   1 
ATOM   1790  C CA  . ASN A 1 225 ? 0.872   80.651  62.009  1.00   17.31 ? 225  ASN A CA  1 
ATOM   1791  C C   . ASN A 1 225 ? 1.023   82.160  61.782  1.00   18.34 ? 225  ASN A C   1 
ATOM   1792  O O   . ASN A 1 225 ? 1.990   82.762  62.260  1.00   17.45 ? 225  ASN A O   1 
ATOM   1793  C CB  . ASN A 1 225 ? 1.839   79.891  61.105  1.00   12.99 ? 225  ASN A CB  1 
ATOM   1794  C CG  . ASN A 1 225 ? 2.309   78.577  61.719  1.00   16.39 ? 225  ASN A CG  1 
ATOM   1795  O OD1 . ASN A 1 225 ? 2.976   77.793  61.062  1.00   17.05 ? 225  ASN A OD1 1 
ATOM   1796  N ND2 . ASN A 1 225 ? 1.959   78.335  62.985  1.00   17.54 ? 225  ASN A ND2 1 
ATOM   1797  N N   . ARG A 1 226 ? 0.099   82.776  61.040  1.00   17.67 ? 226  ARG A N   1 
ATOM   1798  C CA  . ARG A 1 226 ? 0.172   84.232  60.817  1.00   17.38 ? 226  ARG A CA  1 
ATOM   1799  C C   . ARG A 1 226 ? -0.586  85.013  61.889  1.00   17.61 ? 226  ARG A C   1 
ATOM   1800  O O   . ARG A 1 226 ? -0.311  86.186  62.098  1.00   18.57 ? 226  ARG A O   1 
ATOM   1801  C CB  . ARG A 1 226 ? -0.451  84.638  59.491  1.00   18.61 ? 226  ARG A CB  1 
ATOM   1802  C CG  . ARG A 1 226 ? 0.308   84.354  58.206  1.00   18.84 ? 226  ARG A CG  1 
ATOM   1803  C CD  . ARG A 1 226 ? -0.738  83.991  57.181  1.00   19.88 ? 226  ARG A CD  1 
ATOM   1804  N NE  . ARG A 1 226 ? -0.418  84.290  55.794  1.00   31.27 ? 226  ARG A NE  1 
ATOM   1805  C CZ  . ARG A 1 226 ? 0.577   83.730  55.134  1.00   33.23 ? 226  ARG A CZ  1 
ATOM   1806  N NH1 . ARG A 1 226 ? 0.781   84.059  53.872  1.00   31.11 ? 226  ARG A NH1 1 
ATOM   1807  N NH2 . ARG A 1 226 ? 1.370   82.859  55.744  1.00   40.01 ? 226  ARG A NH2 1 
ATOM   1808  N N   . VAL A 1 227 ? -1.545  84.369  62.549  1.00   17.28 ? 227  VAL A N   1 
ATOM   1809  C CA  . VAL A 1 227 ? -2.378  85.029  63.556  1.00   16.99 ? 227  VAL A CA  1 
ATOM   1810  C C   . VAL A 1 227 ? -1.884  84.906  64.985  1.00   16.57 ? 227  VAL A C   1 
ATOM   1811  O O   . VAL A 1 227 ? -2.111  85.787  65.800  1.00   16.39 ? 227  VAL A O   1 
ATOM   1812  C CB  . VAL A 1 227 ? -3.843  84.499  63.479  1.00   17.30 ? 227  VAL A CB  1 
ATOM   1813  C CG1 . VAL A 1 227 ? -4.700  85.074  64.643  1.00   13.58 ? 227  VAL A CG1 1 
ATOM   1814  C CG2 . VAL A 1 227 ? -4.440  84.906  62.145  1.00   18.46 ? 227  VAL A CG2 1 
ATOM   1815  N N   . ARG A 1 228 ? -1.229  83.794  65.280  1.00   15.88 ? 228  ARG A N   1 
ATOM   1816  C CA  . ARG A 1 228 ? -0.651  83.588  66.603  1.00   17.57 ? 228  ARG A CA  1 
ATOM   1817  C C   . ARG A 1 228 ? 0.605   84.453  66.832  1.00   16.10 ? 228  ARG A C   1 
ATOM   1818  O O   . ARG A 1 228 ? 1.176   85.032  65.918  1.00   15.09 ? 228  ARG A O   1 
ATOM   1819  C CB  . ARG A 1 228 ? -0.234  82.133  66.770  1.00   13.71 ? 228  ARG A CB  1 
ATOM   1820  C CG  . ARG A 1 228 ? 0.992   81.762  65.931  1.00   12.07 ? 228  ARG A CG  1 
ATOM   1821  C CD  . ARG A 1 228 ? 1.291   80.296  66.146  1.00   12.84 ? 228  ARG A CD  1 
ATOM   1822  N NE  . ARG A 1 228 ? 2.349   79.769  65.284  1.00   13.86 ? 228  ARG A NE  1 
ATOM   1823  C CZ  . ARG A 1 228 ? 3.652   79.957  65.480  1.00   14.16 ? 228  ARG A CZ  1 
ATOM   1824  N NH1 . ARG A 1 228 ? 4.096   80.678  66.504  1.00   16.82 ? 228  ARG A NH1 1 
ATOM   1825  N NH2 . ARG A 1 228 ? 4.515   79.384  64.668  1.00   16.91 ? 228  ARG A NH2 1 
ATOM   1826  N N   . LEU A 1 229 ? 1.025   84.502  68.088  1.00   18.04 ? 229  LEU A N   1 
ATOM   1827  C CA  . LEU A 1 229 ? 2.240   85.192  68.484  1.00   18.97 ? 229  LEU A CA  1 
ATOM   1828  C C   . LEU A 1 229 ? 3.384   84.374  67.843  1.00   20.28 ? 229  LEU A C   1 
ATOM   1829  O O   . LEU A 1 229 ? 3.325   83.144  67.806  1.00   18.64 ? 229  LEU A O   1 
ATOM   1830  C CB  . LEU A 1 229 ? 2.355   85.161  70.016  1.00   18.91 ? 229  LEU A CB  1 
ATOM   1831  C CG  . LEU A 1 229 ? 1.523   86.219  70.744  1.00   17.79 ? 229  LEU A CG  1 
ATOM   1832  C CD1 . LEU A 1 229 ? 1.289   85.874  72.201  1.00   14.65 ? 229  LEU A CD1 1 
ATOM   1833  C CD2 . LEU A 1 229 ? 2.271   87.527  70.608  1.00   19.74 ? 229  LEU A CD2 1 
ATOM   1834  N N   . PRO A 1 230 ? 4.411   85.058  67.299  1.00   19.21 ? 230  PRO A N   1 
ATOM   1835  C CA  . PRO A 1 230 ? 5.554   84.388  66.662  1.00   17.14 ? 230  PRO A CA  1 
ATOM   1836  C C   . PRO A 1 230 ? 6.258   83.438  67.620  1.00   19.52 ? 230  PRO A C   1 
ATOM   1837  O O   . PRO A 1 230 ? 6.505   82.282  67.310  1.00   21.55 ? 230  PRO A O   1 
ATOM   1838  C CB  . PRO A 1 230 ? 6.494   85.537  66.266  1.00   20.15 ? 230  PRO A CB  1 
ATOM   1839  C CG  . PRO A 1 230 ? 5.693   86.773  66.350  1.00   11.31 ? 230  PRO A CG  1 
ATOM   1840  C CD  . PRO A 1 230 ? 4.573   86.527  67.310  1.00   16.98 ? 230  PRO A CD  1 
ATOM   1841  N N   . PHE A 1 231 ? 6.600   83.935  68.796  1.00   21.35 ? 231  PHE A N   1 
ATOM   1842  C CA  . PHE A 1 231 ? 7.310   83.081  69.744  1.00   20.64 ? 231  PHE A CA  1 
ATOM   1843  C C   . PHE A 1 231 ? 6.444   82.784  70.951  1.00   21.34 ? 231  PHE A C   1 
ATOM   1844  O O   . PHE A 1 231 ? 6.732   83.229  72.057  1.00   23.24 ? 231  PHE A O   1 
ATOM   1845  C CB  . PHE A 1 231 ? 8.619   83.754  70.156  1.00   17.83 ? 231  PHE A CB  1 
ATOM   1846  C CG  . PHE A 1 231 ? 9.387   84.339  69.001  1.00   12.56 ? 231  PHE A CG  1 
ATOM   1847  C CD1 . PHE A 1 231 ? 9.248   85.695  68.688  1.00   20.51 ? 231  PHE A CD1 1 
ATOM   1848  C CD2 . PHE A 1 231 ? 10.223  83.548  68.208  1.00   12.77 ? 231  PHE A CD2 1 
ATOM   1849  C CE1 . PHE A 1 231 ? 9.929   86.264  67.606  1.00   12.84 ? 231  PHE A CE1 1 
ATOM   1850  C CE2 . PHE A 1 231 ? 10.914  84.107  67.109  1.00   2.02  ? 231  PHE A CE2 1 
ATOM   1851  C CZ  . PHE A 1 231 ? 10.766  85.456  66.813  1.00   12.16 ? 231  PHE A CZ  1 
ATOM   1852  N N   . ASN A 1 232 ? 5.384   82.014  70.706  1.00   20.70 ? 232  ASN A N   1 
ATOM   1853  C CA  . ASN A 1 232 ? 4.428   81.645  71.735  1.00   17.34 ? 232  ASN A CA  1 
ATOM   1854  C C   . ASN A 1 232 ? 4.857   80.479  72.633  1.00   16.92 ? 232  ASN A C   1 
ATOM   1855  O O   . ASN A 1 232 ? 4.248   80.280  73.677  1.00   14.36 ? 232  ASN A O   1 
ATOM   1856  C CB  . ASN A 1 232 ? 3.085   81.301  71.085  1.00   20.34 ? 232  ASN A CB  1 
ATOM   1857  C CG  . ASN A 1 232 ? 3.184   80.114  70.136  1.00   21.40 ? 232  ASN A CG  1 
ATOM   1858  O OD1 . ASN A 1 232 ? 2.174   79.546  69.688  1.00   25.48 ? 232  ASN A OD1 1 
ATOM   1859  N ND2 . ASN A 1 232 ? 4.405   79.747  69.802  1.00   20.14 ? 232  ASN A ND2 1 
ATOM   1860  N N   . VAL A 1 233 ? 5.836   79.665  72.231  1.00   15.51 ? 233  VAL A N   1 
ATOM   1861  C CA  . VAL A 1 233 ? 6.259   78.569  73.117  1.00   16.48 ? 233  VAL A CA  1 
ATOM   1862  C C   . VAL A 1 233 ? 7.759   78.652  73.461  1.00   15.72 ? 233  VAL A C   1 
ATOM   1863  O O   . VAL A 1 233 ? 8.632   78.577  72.594  1.00   14.86 ? 233  VAL A O   1 
ATOM   1864  C CB  . VAL A 1 233 ? 5.891   77.175  72.540  1.00   16.28 ? 233  VAL A CB  1 
ATOM   1865  C CG1 . VAL A 1 233 ? 6.317   76.061  73.505  1.00   17.64 ? 233  VAL A CG1 1 
ATOM   1866  C CG2 . VAL A 1 233 ? 4.391   77.102  72.323  1.00   16.22 ? 233  VAL A CG2 1 
ATOM   1867  N N   . SER A 1 234 ? 8.032   78.839  74.746  1.00   16.07 ? 234  SER A N   1 
ATOM   1868  C CA  . SER A 1 234 ? 9.389   78.985  75.249  1.00   17.73 ? 234  SER A CA  1 
ATOM   1869  C C   . SER A 1 234 ? 10.297  77.840  74.892  1.00   16.79 ? 234  SER A C   1 
ATOM   1870  O O   . SER A 1 234 ? 9.864   76.697  74.688  1.00   17.44 ? 234  SER A O   1 
ATOM   1871  C CB  . SER A 1 234 ? 9.419   79.157  76.776  1.00   19.78 ? 234  SER A CB  1 
ATOM   1872  O OG  . SER A 1 234 ? 9.494   77.894  77.426  1.00   14.91 ? 234  SER A OG  1 
ATOM   1873  N N   . TYR A 1 235 ? 11.571  78.192  74.830  1.00   15.98 ? 235  TYR A N   1 
ATOM   1874  C CA  . TYR A 1 235 ? 12.639  77.284  74.510  1.00   15.05 ? 235  TYR A CA  1 
ATOM   1875  C C   . TYR A 1 235 ? 12.624  76.068  75.421  1.00   14.90 ? 235  TYR A C   1 
ATOM   1876  O O   . TYR A 1 235 ? 12.568  74.924  74.972  1.00   16.61 ? 235  TYR A O   1 
ATOM   1877  C CB  . TYR A 1 235 ? 13.968  78.031  74.633  1.00   19.22 ? 235  TYR A CB  1 
ATOM   1878  C CG  . TYR A 1 235 ? 15.185  77.147  74.560  1.00   20.46 ? 235  TYR A CG  1 
ATOM   1879  C CD1 . TYR A 1 235 ? 15.584  76.554  73.348  1.00   21.47 ? 235  TYR A CD1 1 
ATOM   1880  C CD2 . TYR A 1 235 ? 15.943  76.899  75.707  1.00   18.42 ? 235  TYR A CD2 1 
ATOM   1881  C CE1 . TYR A 1 235 ? 16.712  75.732  73.286  1.00   22.82 ? 235  TYR A CE1 1 
ATOM   1882  C CE2 . TYR A 1 235 ? 17.066  76.089  75.658  1.00   21.86 ? 235  TYR A CE2 1 
ATOM   1883  C CZ  . TYR A 1 235 ? 17.447  75.507  74.453  1.00   24.76 ? 235  TYR A CZ  1 
ATOM   1884  O OH  . TYR A 1 235 ? 18.560  74.709  74.431  1.00   20.22 ? 235  TYR A OH  1 
ATOM   1885  N N   . VAL A 1 236 ? 12.649  76.323  76.716  1.00   17.27 ? 236  VAL A N   1 
ATOM   1886  C CA  . VAL A 1 236 ? 12.638  75.224  77.658  1.00   19.56 ? 236  VAL A CA  1 
ATOM   1887  C C   . VAL A 1 236 ? 11.354  74.402  77.588  1.00   20.88 ? 236  VAL A C   1 
ATOM   1888  O O   . VAL A 1 236 ? 11.397  73.185  77.748  1.00   22.26 ? 236  VAL A O   1 
ATOM   1889  C CB  . VAL A 1 236 ? 12.852  75.735  79.091  1.00   22.18 ? 236  VAL A CB  1 
ATOM   1890  C CG1 . VAL A 1 236 ? 12.842  74.552  80.084  1.00   19.16 ? 236  VAL A CG1 1 
ATOM   1891  C CG2 . VAL A 1 236 ? 14.187  76.492  79.153  1.00   20.42 ? 236  VAL A CG2 1 
ATOM   1892  N N   . SER A 1 237 ? 10.214  75.047  77.351  1.00   19.70 ? 237  SER A N   1 
ATOM   1893  C CA  . SER A 1 237 ? 8.964   74.307  77.260  1.00   18.39 ? 237  SER A CA  1 
ATOM   1894  C C   . SER A 1 237 ? 9.060   73.326  76.107  1.00   17.63 ? 237  SER A C   1 
ATOM   1895  O O   . SER A 1 237 ? 8.676   72.165  76.233  1.00   16.87 ? 237  SER A O   1 
ATOM   1896  C CB  . SER A 1 237 ? 7.784   75.252  77.056  1.00   16.34 ? 237  SER A CB  1 
ATOM   1897  O OG  . SER A 1 237 ? 7.410   75.796  78.310  1.00   18.95 ? 237  SER A OG  1 
ATOM   1898  N N   . GLN A 1 238 ? 9.586   73.788  74.981  1.00   16.44 ? 238  GLN A N   1 
ATOM   1899  C CA  . GLN A 1 238 ? 9.763   72.902  73.840  1.00   19.00 ? 238  GLN A CA  1 
ATOM   1900  C C   . GLN A 1 238 ? 10.724  71.731  74.151  1.00   19.45 ? 238  GLN A C   1 
ATOM   1901  O O   . GLN A 1 238 ? 10.535  70.624  73.634  1.00   18.92 ? 238  GLN A O   1 
ATOM   1902  C CB  . GLN A 1 238 ? 10.269  73.686  72.625  1.00   18.14 ? 238  GLN A CB  1 
ATOM   1903  C CG  . GLN A 1 238 ? 9.243   74.680  72.066  1.00   18.27 ? 238  GLN A CG  1 
ATOM   1904  C CD  . GLN A 1 238 ? 9.741   75.336  70.814  1.00   25.56 ? 238  GLN A CD  1 
ATOM   1905  O OE1 . GLN A 1 238 ? 10.071  76.534  70.789  1.00   29.61 ? 238  GLN A OE1 1 
ATOM   1906  N NE2 . GLN A 1 238 ? 9.825   74.552  69.757  1.00   19.64 ? 238  GLN A NE2 1 
ATOM   1907  N N   . MET A 1 239 ? 11.746  71.975  74.977  1.00   15.97 ? 239  MET A N   1 
ATOM   1908  C CA  . MET A 1 239 ? 12.682  70.941  75.360  1.00   15.13 ? 239  MET A CA  1 
ATOM   1909  C C   . MET A 1 239 ? 11.930  69.904  76.192  1.00   13.43 ? 239  MET A C   1 
ATOM   1910  O O   . MET A 1 239 ? 12.049  68.716  75.972  1.00   11.36 ? 239  MET A O   1 
ATOM   1911  C CB  . MET A 1 239 ? 13.824  71.520  76.207  1.00   15.15 ? 239  MET A CB  1 
ATOM   1912  C CG  . MET A 1 239 ? 15.048  70.649  76.190  1.00   18.48 ? 239  MET A CG  1 
ATOM   1913  S SD  . MET A 1 239 ? 15.574  70.141  74.497  1.00   21.47 ? 239  MET A SD  1 
ATOM   1914  C CE  . MET A 1 239 ? 16.319  71.799  73.957  1.00   23.02 ? 239  MET A CE  1 
ATOM   1915  N N   . PHE A 1 240 ? 11.146  70.369  77.152  1.00   16.09 ? 240  PHE A N   1 
ATOM   1916  C CA  . PHE A 1 240 ? 10.365  69.457  77.995  1.00   15.66 ? 240  PHE A CA  1 
ATOM   1917  C C   . PHE A 1 240 ? 9.442   68.549  77.136  1.00   14.39 ? 240  PHE A C   1 
ATOM   1918  O O   . PHE A 1 240 ? 9.340   67.340  77.365  1.00   12.37 ? 240  PHE A O   1 
ATOM   1919  C CB  . PHE A 1 240 ? 9.519   70.269  78.993  1.00   16.91 ? 240  PHE A CB  1 
ATOM   1920  C CG  . PHE A 1 240 ? 10.145  70.419  80.347  1.00   21.28 ? 240  PHE A CG  1 
ATOM   1921  C CD1 . PHE A 1 240 ? 10.295  69.322  81.202  1.00   18.55 ? 240  PHE A CD1 1 
ATOM   1922  C CD2 . PHE A 1 240 ? 10.562  71.660  80.783  1.00   25.38 ? 240  PHE A CD2 1 
ATOM   1923  C CE1 . PHE A 1 240 ? 10.846  69.480  82.455  1.00   18.52 ? 240  PHE A CE1 1 
ATOM   1924  C CE2 . PHE A 1 240 ? 11.114  71.820  82.039  1.00   24.68 ? 240  PHE A CE2 1 
ATOM   1925  C CZ  . PHE A 1 240 ? 11.256  70.736  82.874  1.00   21.49 ? 240  PHE A CZ  1 
ATOM   1926  N N   . ALA A 1 241 ? 8.757   69.132  76.162  1.00   13.45 ? 241  ALA A N   1 
ATOM   1927  C CA  . ALA A 1 241 ? 7.885   68.329  75.296  1.00   18.52 ? 241  ALA A CA  1 
ATOM   1928  C C   . ALA A 1 241 ? 8.731   67.304  74.494  1.00   18.72 ? 241  ALA A C   1 
ATOM   1929  O O   . ALA A 1 241 ? 8.360   66.140  74.336  1.00   15.23 ? 241  ALA A O   1 
ATOM   1930  C CB  . ALA A 1 241 ? 7.111   69.250  74.317  1.00   16.56 ? 241  ALA A CB  1 
ATOM   1931  N N   . LYS A 1 242 ? 9.881   67.756  73.995  1.00   18.67 ? 242  LYS A N   1 
ATOM   1932  C CA  . LYS A 1 242 ? 10.742  66.872  73.236  1.00   21.46 ? 242  LYS A CA  1 
ATOM   1933  C C   . LYS A 1 242 ? 11.247  65.669  74.036  1.00   23.62 ? 242  LYS A C   1 
ATOM   1934  O O   . LYS A 1 242 ? 11.157  64.512  73.586  1.00   26.07 ? 242  LYS A O   1 
ATOM   1935  C CB  . LYS A 1 242 ? 11.910  67.662  72.655  1.00   24.12 ? 242  LYS A CB  1 
ATOM   1936  C CG  . LYS A 1 242 ? 11.519  68.394  71.382  1.00   23.50 ? 242  LYS A CG  1 
ATOM   1937  C CD  . LYS A 1 242 ? 12.686  69.108  70.741  1.00   25.83 ? 242  LYS A CD  1 
ATOM   1938  C CE  . LYS A 1 242 ? 13.049  70.373  71.491  1.00   22.94 ? 242  LYS A CE  1 
ATOM   1939  N NZ  . LYS A 1 242 ? 14.100  71.095  70.750  1.00   28.65 ? 242  LYS A NZ  1 
ATOM   1940  N N   . VAL A 1 243 ? 11.749  65.911  75.233  1.00   22.36 ? 243  VAL A N   1 
ATOM   1941  C CA  . VAL A 1 243 ? 12.238  64.779  75.986  1.00   23.36 ? 243  VAL A CA  1 
ATOM   1942  C C   . VAL A 1 243 ? 11.077  63.875  76.364  1.00   21.92 ? 243  VAL A C   1 
ATOM   1943  O O   . VAL A 1 243 ? 11.223  62.658  76.352  1.00   21.89 ? 243  VAL A O   1 
ATOM   1944  C CB  . VAL A 1 243 ? 13.035  65.220  77.244  1.00   21.47 ? 243  VAL A CB  1 
ATOM   1945  C CG1 . VAL A 1 243 ? 14.120  66.238  76.832  1.00   16.16 ? 243  VAL A CG1 1 
ATOM   1946  C CG2 . VAL A 1 243 ? 12.103  65.805  78.276  1.00   27.26 ? 243  VAL A CG2 1 
ATOM   1947  N N   . ALA A 1 244 ? 9.925   64.453  76.697  1.00   22.65 ? 244  ALA A N   1 
ATOM   1948  C CA  . ALA A 1 244 ? 8.765   63.633  77.046  1.00   23.71 ? 244  ALA A CA  1 
ATOM   1949  C C   . ALA A 1 244 ? 8.479   62.694  75.877  1.00   23.49 ? 244  ALA A C   1 
ATOM   1950  O O   . ALA A 1 244 ? 8.305   61.497  76.072  1.00   24.93 ? 244  ALA A O   1 
ATOM   1951  C CB  . ALA A 1 244 ? 7.525   64.510  77.330  1.00   24.38 ? 244  ALA A CB  1 
ATOM   1952  N N   . LEU A 1 245 ? 8.434   63.232  74.659  1.00   22.06 ? 245  LEU A N   1 
ATOM   1953  C CA  . LEU A 1 245 ? 8.199   62.373  73.496  1.00   23.64 ? 245  LEU A CA  1 
ATOM   1954  C C   . LEU A 1 245 ? 9.312   61.344  73.281  1.00   24.31 ? 245  LEU A C   1 
ATOM   1955  O O   . LEU A 1 245 ? 9.044   60.243  72.788  1.00   26.16 ? 245  LEU A O   1 
ATOM   1956  C CB  . LEU A 1 245 ? 8.014   63.191  72.214  1.00   21.08 ? 245  LEU A CB  1 
ATOM   1957  C CG  . LEU A 1 245 ? 6.739   64.048  72.115  1.00   23.56 ? 245  LEU A CG  1 
ATOM   1958  C CD1 . LEU A 1 245 ? 6.561   64.538  70.671  1.00   20.02 ? 245  LEU A CD1 1 
ATOM   1959  C CD2 . LEU A 1 245 ? 5.512   63.242  72.537  1.00   24.08 ? 245  LEU A CD2 1 
ATOM   1960  N N   . ASP A 1 246 ? 10.556  61.685  73.618  1.00   23.59 ? 246  ASP A N   1 
ATOM   1961  C CA  . ASP A 1 246 ? 11.638  60.712  73.457  1.00   22.32 ? 246  ASP A CA  1 
ATOM   1962  C C   . ASP A 1 246 ? 11.543  59.598  74.490  1.00   21.31 ? 246  ASP A C   1 
ATOM   1963  O O   . ASP A 1 246 ? 12.215  58.589  74.391  1.00   21.21 ? 246  ASP A O   1 
ATOM   1964  C CB  . ASP A 1 246 ? 13.010  61.367  73.552  1.00   22.22 ? 246  ASP A CB  1 
ATOM   1965  C CG  . ASP A 1 246 ? 13.315  62.246  72.371  1.00   28.04 ? 246  ASP A CG  1 
ATOM   1966  O OD1 . ASP A 1 246 ? 12.796  61.952  71.266  1.00   27.74 ? 246  ASP A OD1 1 
ATOM   1967  O OD2 . ASP A 1 246 ? 14.078  63.220  72.549  1.00   30.53 ? 246  ASP A OD2 1 
ATOM   1968  N N   . HIS A 1 247 ? 10.707  59.781  75.489  1.00   19.65 ? 247  HIS A N   1 
ATOM   1969  C CA  . HIS A 1 247 ? 10.529  58.761  76.499  1.00   21.05 ? 247  HIS A CA  1 
ATOM   1970  C C   . HIS A 1 247 ? 9.052   58.499  76.652  1.00   21.52 ? 247  HIS A C   1 
ATOM   1971  O O   . HIS A 1 247 ? 8.582   58.242  77.754  1.00   22.82 ? 247  HIS A O   1 
ATOM   1972  C CB  . HIS A 1 247 ? 11.100  59.226  77.824  1.00   16.66 ? 247  HIS A CB  1 
ATOM   1973  C CG  . HIS A 1 247 ? 12.582  59.381  77.817  1.00   20.95 ? 247  HIS A CG  1 
ATOM   1974  N ND1 . HIS A 1 247 ? 13.213  60.552  77.450  1.00   23.48 ? 247  HIS A ND1 1 
ATOM   1975  C CD2 . HIS A 1 247 ? 13.568  58.496  78.092  1.00   19.44 ? 247  HIS A CD2 1 
ATOM   1976  C CE1 . HIS A 1 247 ? 14.524  60.382  77.499  1.00   17.11 ? 247  HIS A CE1 1 
ATOM   1977  N NE2 . HIS A 1 247 ? 14.768  59.141  77.886  1.00   21.39 ? 247  HIS A NE2 1 
ATOM   1978  N N   . ARG A 1 248 ? 8.322   58.585  75.543  1.00   25.08 ? 248  ARG A N   1 
ATOM   1979  C CA  . ARG A 1 248 ? 6.878   58.386  75.549  1.00   27.91 ? 248  ARG A CA  1 
ATOM   1980  C C   . ARG A 1 248 ? 6.380   57.102  76.237  1.00   29.43 ? 248  ARG A C   1 
ATOM   1981  O O   . ARG A 1 248 ? 5.245   57.049  76.676  1.00   28.13 ? 248  ARG A O   1 
ATOM   1982  C CB  . ARG A 1 248 ? 6.330   58.487  74.122  1.00   30.66 ? 248  ARG A CB  1 
ATOM   1983  C CG  . ARG A 1 248 ? 6.850   57.432  73.168  1.00   35.78 ? 248  ARG A CG  1 
ATOM   1984  C CD  . ARG A 1 248 ? 6.341   57.649  71.729  1.00   37.70 ? 248  ARG A CD  1 
ATOM   1985  N NE  . ARG A 1 248 ? 6.911   58.845  71.106  1.00   43.51 ? 248  ARG A NE  1 
ATOM   1986  C CZ  . ARG A 1 248 ? 7.252   58.938  69.818  1.00   45.68 ? 248  ARG A CZ  1 
ATOM   1987  N NH1 . ARG A 1 248 ? 7.770   60.067  69.327  1.00   45.04 ? 248  ARG A NH1 1 
ATOM   1988  N NH2 . ARG A 1 248 ? 7.078   57.899  69.012  1.00   45.91 ? 248  ARG A NH2 1 
ATOM   1989  N N   . GLU A 1 249 ? 7.215   56.075  76.373  1.00   31.62 ? 249  GLU A N   1 
ATOM   1990  C CA  . GLU A 1 249 ? 6.755   54.858  77.047  1.00   31.99 ? 249  GLU A CA  1 
ATOM   1991  C C   . GLU A 1 249 ? 6.564   55.003  78.557  1.00   30.27 ? 249  GLU A C   1 
ATOM   1992  O O   . GLU A 1 249 ? 5.756   54.294  79.168  1.00   29.24 ? 249  GLU A O   1 
ATOM   1993  C CB  . GLU A 1 249 ? 7.698   53.675  76.782  1.00   38.91 ? 249  GLU A CB  1 
ATOM   1994  C CG  . GLU A 1 249 ? 7.553   53.071  75.383  1.00   51.82 ? 249  GLU A CG  1 
ATOM   1995  C CD  . GLU A 1 249 ? 8.300   51.743  75.222  1.00   62.37 ? 249  GLU A CD  1 
ATOM   1996  O OE1 . GLU A 1 249 ? 8.269   51.155  74.109  1.00   65.20 ? 249  GLU A OE1 1 
ATOM   1997  O OE2 . GLU A 1 249 ? 8.914   51.287  76.215  1.00   66.11 ? 249  GLU A OE2 1 
ATOM   1998  N N   . ILE A 1 250 ? 7.307   55.896  79.185  1.00   27.45 ? 250  ILE A N   1 
ATOM   1999  C CA  . ILE A 1 250 ? 7.110   56.038  80.624  1.00   26.39 ? 250  ILE A CA  1 
ATOM   2000  C C   . ILE A 1 250 ? 5.722   56.636  80.917  1.00   27.19 ? 250  ILE A C   1 
ATOM   2001  O O   . ILE A 1 250 ? 5.114   56.363  81.968  1.00   25.23 ? 250  ILE A O   1 
ATOM   2002  C CB  . ILE A 1 250 ? 8.202   56.938  81.286  1.00   23.59 ? 250  ILE A CB  1 
ATOM   2003  C CG1 . ILE A 1 250 ? 9.573   56.257  81.199  1.00   25.69 ? 250  ILE A CG1 1 
ATOM   2004  C CG2 . ILE A 1 250 ? 7.873   57.207  82.733  1.00   19.52 ? 250  ILE A CG2 1 
ATOM   2005  C CD1 . ILE A 1 250 ? 10.224  56.407  79.836  1.00   23.00 ? 250  ILE A CD1 1 
ATOM   2006  N N   . PHE A 1 251 ? 5.204   57.428  79.985  1.00   25.59 ? 251  PHE A N   1 
ATOM   2007  C CA  . PHE A 1 251 ? 3.910   58.055  80.206  1.00   26.30 ? 251  PHE A CA  1 
ATOM   2008  C C   . PHE A 1 251 ? 2.757   57.170  79.834  1.00   29.42 ? 251  PHE A C   1 
ATOM   2009  O O   . PHE A 1 251 ? 1.661   57.320  80.365  1.00   28.65 ? 251  PHE A O   1 
ATOM   2010  C CB  . PHE A 1 251 ? 3.829   59.362  79.449  1.00   23.08 ? 251  PHE A CB  1 
ATOM   2011  C CG  . PHE A 1 251 ? 4.954   60.262  79.744  1.00   21.40 ? 251  PHE A CG  1 
ATOM   2012  C CD1 . PHE A 1 251 ? 6.072   60.275  78.922  1.00   21.27 ? 251  PHE A CD1 1 
ATOM   2013  C CD2 . PHE A 1 251 ? 4.936   61.061  80.886  1.00   22.18 ? 251  PHE A CD2 1 
ATOM   2014  C CE1 . PHE A 1 251 ? 7.162   61.071  79.230  1.00   19.50 ? 251  PHE A CE1 1 
ATOM   2015  C CE2 . PHE A 1 251 ? 6.014   61.855  81.203  1.00   23.61 ? 251  PHE A CE2 1 
ATOM   2016  C CZ  . PHE A 1 251 ? 7.134   61.863  80.371  1.00   20.14 ? 251  PHE A CZ  1 
ATOM   2017  N N   . GLU A 1 252 ? 2.998   56.240  78.919  1.00   31.43 ? 252  GLU A N   1 
ATOM   2018  C CA  . GLU A 1 252 ? 1.943   55.318  78.519  1.00   33.79 ? 252  GLU A CA  1 
ATOM   2019  C C   . GLU A 1 252 ? 1.676   54.378  79.680  1.00   32.03 ? 252  GLU A C   1 
ATOM   2020  O O   . GLU A 1 252 ? 0.562   53.882  79.855  1.00   32.08 ? 252  GLU A O   1 
ATOM   2021  C CB  . GLU A 1 252 ? 2.372   54.523  77.295  1.00   36.18 ? 252  GLU A CB  1 
ATOM   2022  C CG  . GLU A 1 252 ? 2.849   55.417  76.177  1.00   44.59 ? 252  GLU A CG  1 
ATOM   2023  C CD  . GLU A 1 252 ? 2.976   54.679  74.875  1.00   48.24 ? 252  GLU A CD  1 
ATOM   2024  O OE1 . GLU A 1 252 ? 3.362   55.307  73.860  1.00   52.51 ? 252  GLU A OE1 1 
ATOM   2025  O OE2 . GLU A 1 252 ? 2.683   53.469  74.872  1.00   49.34 ? 252  GLU A OE2 1 
ATOM   2026  N N   . GLU A 1 253 ? 2.707   54.140  80.472  1.00   29.72 ? 253  GLU A N   1 
ATOM   2027  C CA  . GLU A 1 253 ? 2.584   53.270  81.629  1.00   33.38 ? 253  GLU A CA  1 
ATOM   2028  C C   . GLU A 1 253 ? 1.713   53.968  82.667  1.00   31.57 ? 253  GLU A C   1 
ATOM   2029  O O   . GLU A 1 253 ? 0.809   53.370  83.245  1.00   31.53 ? 253  GLU A O   1 
ATOM   2030  C CB  . GLU A 1 253 ? 3.974   52.971  82.209  1.00   36.78 ? 253  GLU A CB  1 
ATOM   2031  C CG  . GLU A 1 253 ? 3.966   52.512  83.666  1.00   45.97 ? 253  GLU A CG  1 
ATOM   2032  C CD  . GLU A 1 253 ? 5.306   52.723  84.355  1.00   54.76 ? 253  GLU A CD  1 
ATOM   2033  O OE1 . GLU A 1 253 ? 5.723   53.904  84.462  1.00   54.70 ? 253  GLU A OE1 1 
ATOM   2034  O OE2 . GLU A 1 253 ? 5.930   51.711  84.781  1.00   56.42 ? 253  GLU A OE2 1 
ATOM   2035  N N   . ARG A 1 254 ? 1.988   55.249  82.889  1.00   30.80 ? 254  ARG A N   1 
ATOM   2036  C CA  . ARG A 1 254 ? 1.229   56.020  83.863  1.00   29.01 ? 254  ARG A CA  1 
ATOM   2037  C C   . ARG A 1 254 ? -0.207  56.135  83.387  1.00   26.36 ? 254  ARG A C   1 
ATOM   2038  O O   . ARG A 1 254 ? -1.155  56.035  84.164  1.00   23.79 ? 254  ARG A O   1 
ATOM   2039  C CB  . ARG A 1 254 ? 1.837   57.410  84.013  1.00   27.41 ? 254  ARG A CB  1 
ATOM   2040  C CG  . ARG A 1 254 ? 3.284   57.395  84.511  1.00   26.02 ? 254  ARG A CG  1 
ATOM   2041  C CD  . ARG A 1 254 ? 3.941   58.768  84.387  1.00   19.98 ? 254  ARG A CD  1 
ATOM   2042  N NE  . ARG A 1 254 ? 4.916   58.922  85.443  1.00   24.03 ? 254  ARG A NE  1 
ATOM   2043  C CZ  . ARG A 1 254 ? 5.356   60.087  85.897  1.00   28.83 ? 254  ARG A CZ  1 
ATOM   2044  N NH1 . ARG A 1 254 ? 4.911   61.235  85.390  1.00   28.09 ? 254  ARG A NH1 1 
ATOM   2045  N NH2 . ARG A 1 254 ? 6.241   60.095  86.885  1.00   29.46 ? 254  ARG A NH2 1 
ATOM   2046  N N   . THR A 1 255 ? -0.357  56.340  82.094  1.00   25.62 ? 255  THR A N   1 
ATOM   2047  C CA  . THR A 1 255 ? -1.687  56.474  81.533  1.00   29.91 ? 255  THR A CA  1 
ATOM   2048  C C   . THR A 1 255 ? -2.445  55.150  81.627  1.00   30.91 ? 255  THR A C   1 
ATOM   2049  O O   . THR A 1 255 ? -3.658  55.127  81.824  1.00   31.48 ? 255  THR A O   1 
ATOM   2050  C CB  . THR A 1 255 ? -1.628  56.931  80.057  1.00   28.53 ? 255  THR A CB  1 
ATOM   2051  O OG1 . THR A 1 255 ? -1.125  58.267  79.991  1.00   26.53 ? 255  THR A OG1 1 
ATOM   2052  C CG2 . THR A 1 255 ? -3.010  56.875  79.425  1.00   26.89 ? 255  THR A CG2 1 
ATOM   2053  N N   . LYS A 1 256 ? -1.738  54.040  81.491  1.00   28.98 ? 256  LYS A N   1 
ATOM   2054  C CA  . LYS A 1 256 ? -2.413  52.759  81.576  1.00   30.12 ? 256  LYS A CA  1 
ATOM   2055  C C   . LYS A 1 256 ? -2.973  52.641  83.001  1.00   29.47 ? 256  LYS A C   1 
ATOM   2056  O O   . LYS A 1 256 ? -4.105  52.208  83.221  1.00   27.18 ? 256  LYS A O   1 
ATOM   2057  C CB  . LYS A 1 256 ? -1.426  51.644  81.254  1.00   29.86 ? 256  LYS A CB  1 
ATOM   2058  C CG  . LYS A 1 256 ? -2.076  50.390  80.802  1.00   33.68 ? 256  LYS A CG  1 
ATOM   2059  C CD  . LYS A 1 256 ? -2.261  49.434  81.949  1.00   42.01 ? 256  LYS A CD  1 
ATOM   2060  C CE  . LYS A 1 256 ? -0.936  48.808  82.312  1.00   40.62 ? 256  LYS A CE  1 
ATOM   2061  N NZ  . LYS A 1 256 ? -1.078  47.829  83.414  1.00   39.95 ? 256  LYS A NZ  1 
ATOM   2062  N N   . PHE A 1 257 ? -2.166  53.048  83.965  1.00   27.55 ? 257  PHE A N   1 
ATOM   2063  C CA  . PHE A 1 257 ? -2.574  53.036  85.358  1.00   29.22 ? 257  PHE A CA  1 
ATOM   2064  C C   . PHE A 1 257 ? -3.773  53.975  85.563  1.00   31.08 ? 257  PHE A C   1 
ATOM   2065  O O   . PHE A 1 257 ? -4.727  53.652  86.292  1.00   29.54 ? 257  PHE A O   1 
ATOM   2066  C CB  . PHE A 1 257 ? -1.418  53.508  86.251  1.00   27.09 ? 257  PHE A CB  1 
ATOM   2067  C CG  . PHE A 1 257 ? -1.843  53.890  87.640  1.00   25.34 ? 257  PHE A CG  1 
ATOM   2068  C CD1 . PHE A 1 257 ? -2.225  55.207  87.927  1.00   28.18 ? 257  PHE A CD1 1 
ATOM   2069  C CD2 . PHE A 1 257 ? -1.903  52.935  88.645  1.00   23.23 ? 257  PHE A CD2 1 
ATOM   2070  C CE1 . PHE A 1 257 ? -2.668  55.572  89.208  1.00   28.01 ? 257  PHE A CE1 1 
ATOM   2071  C CE2 . PHE A 1 257 ? -2.339  53.265  89.924  1.00   27.47 ? 257  PHE A CE2 1 
ATOM   2072  C CZ  . PHE A 1 257 ? -2.728  54.604  90.213  1.00   31.17 ? 257  PHE A CZ  1 
ATOM   2073  N N   . ILE A 1 258 ? -3.713  55.147  84.929  1.00   29.96 ? 258  ILE A N   1 
ATOM   2074  C CA  . ILE A 1 258 ? -4.795  56.102  85.080  1.00   26.09 ? 258  ILE A CA  1 
ATOM   2075  C C   . ILE A 1 258 ? -6.112  55.520  84.593  1.00   24.03 ? 258  ILE A C   1 
ATOM   2076  O O   . ILE A 1 258 ? -7.130  55.676  85.284  1.00   19.61 ? 258  ILE A O   1 
ATOM   2077  C CB  . ILE A 1 258 ? -4.539  57.418  84.318  1.00   28.70 ? 258  ILE A CB  1 
ATOM   2078  C CG1 . ILE A 1 258 ? -3.341  58.172  84.903  1.00   26.33 ? 258  ILE A CG1 1 
ATOM   2079  C CG2 . ILE A 1 258 ? -5.768  58.301  84.385  1.00   26.59 ? 258  ILE A CG2 1 
ATOM   2080  C CD1 . ILE A 1 258 ? -3.469  58.467  86.316  1.00   28.58 ? 258  ILE A CD1 1 
ATOM   2081  N N   . VAL A 1 259 ? -6.109  54.872  83.426  1.00   21.96 ? 259  VAL A N   1 
ATOM   2082  C CA  . VAL A 1 259 ? -7.351  54.318  82.901  1.00   26.05 ? 259  VAL A CA  1 
ATOM   2083  C C   . VAL A 1 259 ? -7.865  53.161  83.752  1.00   28.32 ? 259  VAL A C   1 
ATOM   2084  O O   . VAL A 1 259 ? -9.074  53.028  83.930  1.00   28.85 ? 259  VAL A O   1 
ATOM   2085  C CB  . VAL A 1 259 ? -7.230  53.856  81.437  1.00   26.79 ? 259  VAL A CB  1 
ATOM   2086  C CG1 . VAL A 1 259 ? -6.744  55.015  80.561  1.00   26.95 ? 259  VAL A CG1 1 
ATOM   2087  C CG2 . VAL A 1 259 ? -6.333  52.660  81.343  1.00   33.49 ? 259  VAL A CG2 1 
ATOM   2088  N N   . GLU A 1 260 ? -6.959  52.363  84.317  1.00   28.12 ? 260  GLU A N   1 
ATOM   2089  C CA  . GLU A 1 260 ? -7.368  51.225  85.139  1.00   29.69 ? 260  GLU A CA  1 
ATOM   2090  C C   . GLU A 1 260 ? -8.153  51.750  86.302  1.00   27.87 ? 260  GLU A C   1 
ATOM   2091  O O   . GLU A 1 260 ? -9.273  51.308  86.600  1.00   27.48 ? 260  GLU A O   1 
ATOM   2092  C CB  . GLU A 1 260 ? -6.147  50.442  85.631  1.00   32.15 ? 260  GLU A CB  1 
ATOM   2093  C CG  . GLU A 1 260 ? -5.546  49.583  84.541  1.00   41.66 ? 260  GLU A CG  1 
ATOM   2094  C CD  . GLU A 1 260 ? -4.204  48.961  84.907  1.00   50.26 ? 260  GLU A CD  1 
ATOM   2095  O OE1 . GLU A 1 260 ? -3.251  49.723  85.207  1.00   53.56 ? 260  GLU A OE1 1 
ATOM   2096  O OE2 . GLU A 1 260 ? -4.103  47.710  84.878  1.00   49.59 ? 260  GLU A OE2 1 
ATOM   2097  N N   . GLU A 1 261 ? -7.532  52.722  86.947  1.00   27.95 ? 261  GLU A N   1 
ATOM   2098  C CA  . GLU A 1 261 ? -8.109  53.416  88.089  1.00   24.47 ? 261  GLU A CA  1 
ATOM   2099  C C   . GLU A 1 261 ? -9.480  54.004  87.682  1.00   25.85 ? 261  GLU A C   1 
ATOM   2100  O O   . GLU A 1 261 ? -10.447 53.901  88.428  1.00   24.36 ? 261  GLU A O   1 
ATOM   2101  C CB  . GLU A 1 261 ? -7.144  54.516  88.510  1.00   26.11 ? 261  GLU A CB  1 
ATOM   2102  C CG  . GLU A 1 261 ? -7.098  54.846  89.996  1.00   34.61 ? 261  GLU A CG  1 
ATOM   2103  C CD  . GLU A 1 261 ? -6.642  53.694  90.895  1.00   35.93 ? 261  GLU A CD  1 
ATOM   2104  O OE1 . GLU A 1 261 ? -6.197  53.991  92.012  1.00   40.24 ? 261  GLU A OE1 1 
ATOM   2105  O OE2 . GLU A 1 261 ? -6.743  52.497  90.523  1.00   37.90 ? 261  GLU A OE2 1 
ATOM   2106  N N   . ARG A 1 262 ? -9.571  54.613  86.499  1.00   26.14 ? 262  ARG A N   1 
ATOM   2107  C CA  . ARG A 1 262 ? -10.842 55.202  86.058  1.00   27.17 ? 262  ARG A CA  1 
ATOM   2108  C C   . ARG A 1 262 ? -11.948 54.150  85.941  1.00   28.24 ? 262  ARG A C   1 
ATOM   2109  O O   . ARG A 1 262 ? -13.056 54.329  86.460  1.00   27.42 ? 262  ARG A O   1 
ATOM   2110  C CB  . ARG A 1 262 ? -10.697 55.882  84.693  1.00   24.29 ? 262  ARG A CB  1 
ATOM   2111  C CG  . ARG A 1 262 ? -11.992 56.523  84.204  1.00   21.02 ? 262  ARG A CG  1 
ATOM   2112  C CD  . ARG A 1 262 ? -11.883 56.913  82.765  1.00   17.99 ? 262  ARG A CD  1 
ATOM   2113  N NE  . ARG A 1 262 ? -11.765 55.723  81.932  1.00   18.14 ? 262  ARG A NE  1 
ATOM   2114  C CZ  . ARG A 1 262 ? -11.136 55.677  80.772  1.00   18.96 ? 262  ARG A CZ  1 
ATOM   2115  N NH1 . ARG A 1 262 ? -10.539 56.757  80.299  1.00   20.81 ? 262  ARG A NH1 1 
ATOM   2116  N NH2 . ARG A 1 262 ? -11.137 54.546  80.076  1.00   20.75 ? 262  ARG A NH2 1 
ATOM   2117  N N   . GLU A 1 263 ? -11.645 53.055  85.250  1.00   28.66 ? 263  GLU A N   1 
ATOM   2118  C CA  . GLU A 1 263 ? -12.624 52.002  85.067  1.00   29.64 ? 263  GLU A CA  1 
ATOM   2119  C C   . GLU A 1 263 ? -12.978 51.366  86.408  1.00   30.38 ? 263  GLU A C   1 
ATOM   2120  O O   . GLU A 1 263 ? -14.124 51.008  86.670  1.00   31.44 ? 263  GLU A O   1 
ATOM   2121  C CB  . GLU A 1 263 ? -12.076 50.996  84.075  1.00   27.98 ? 263  GLU A CB  1 
ATOM   2122  C CG  . GLU A 1 263 ? -11.862 51.614  82.703  1.00   28.53 ? 263  GLU A CG  1 
ATOM   2123  C CD  . GLU A 1 263 ? -13.101 52.371  82.224  1.00   28.50 ? 263  GLU A CD  1 
ATOM   2124  O OE1 . GLU A 1 263 ? -14.208 52.011  82.658  1.00   26.77 ? 263  GLU A OE1 1 
ATOM   2125  O OE2 . GLU A 1 263 ? -12.976 53.315  81.410  1.00   30.82 ? 263  GLU A OE2 1 
ATOM   2126  N N   . ARG A 1 264 ? -11.987 51.253  87.275  1.00   30.91 ? 264  ARG A N   1 
ATOM   2127  C CA  . ARG A 1 264 ? -12.216 50.684  88.590  1.00   30.09 ? 264  ARG A CA  1 
ATOM   2128  C C   . ARG A 1 264 ? -13.198 51.579  89.383  1.00   30.90 ? 264  ARG A C   1 
ATOM   2129  O O   . ARG A 1 264 ? -14.164 51.082  89.979  1.00   31.45 ? 264  ARG A O   1 
ATOM   2130  C CB  . ARG A 1 264 ? -10.877 50.542  89.316  1.00   29.55 ? 264  ARG A CB  1 
ATOM   2131  C CG  . ARG A 1 264 ? -10.980 50.111  90.740  1.00   26.89 ? 264  ARG A CG  1 
ATOM   2132  C CD  . ARG A 1 264 ? -9.718  50.454  91.490  1.00   30.55 ? 264  ARG A CD  1 
ATOM   2133  N NE  . ARG A 1 264 ? -10.023 50.455  92.905  1.00   31.19 ? 264  ARG A NE  1 
ATOM   2134  C CZ  . ARG A 1 264 ? -9.459  51.242  93.808  1.00   30.81 ? 264  ARG A CZ  1 
ATOM   2135  N NH1 . ARG A 1 264 ? -8.529  52.123  93.460  1.00   27.19 ? 264  ARG A NH1 1 
ATOM   2136  N NH2 . ARG A 1 264 ? -9.844  51.144  95.072  1.00   35.78 ? 264  ARG A NH2 1 
ATOM   2137  N N   . MET A 1 265 ? -12.967 52.892  89.388  1.00   29.10 ? 265  MET A N   1 
ATOM   2138  C CA  . MET A 1 265 ? -13.866 53.797  90.096  1.00   29.14 ? 265  MET A CA  1 
ATOM   2139  C C   . MET A 1 265 ? -15.246 53.798  89.444  1.00   30.24 ? 265  MET A C   1 
ATOM   2140  O O   . MET A 1 265 ? -16.269 53.877  90.129  1.00   31.72 ? 265  MET A O   1 
ATOM   2141  C CB  . MET A 1 265 ? -13.304 55.217  90.116  1.00   29.40 ? 265  MET A CB  1 
ATOM   2142  C CG  . MET A 1 265 ? -12.218 55.409  91.156  1.00   29.27 ? 265  MET A CG  1 
ATOM   2143  S SD  . MET A 1 265 ? -11.401 57.018  91.114  1.00   27.34 ? 265  MET A SD  1 
ATOM   2144  C CE  . MET A 1 265 ? -12.082 57.745  92.595  1.00   27.40 ? 265  MET A CE  1 
ATOM   2145  N N   . LYS A 1 266 ? -15.276 53.710  88.121  1.00   29.15 ? 266  LYS A N   1 
ATOM   2146  C CA  . LYS A 1 266 ? -16.539 53.687  87.418  1.00   29.83 ? 266  LYS A CA  1 
ATOM   2147  C C   . LYS A 1 266 ? -17.398 52.493  87.838  1.00   32.45 ? 266  LYS A C   1 
ATOM   2148  O O   . LYS A 1 266 ? -18.609 52.636  88.013  1.00   33.60 ? 266  LYS A O   1 
ATOM   2149  C CB  . LYS A 1 266 ? -16.294 53.664  85.907  1.00   28.97 ? 266  LYS A CB  1 
ATOM   2150  C CG  . LYS A 1 266 ? -15.751 55.002  85.377  1.00   25.33 ? 266  LYS A CG  1 
ATOM   2151  C CD  . LYS A 1 266 ? -16.217 55.324  83.955  1.00   13.86 ? 266  LYS A CD  1 
ATOM   2152  C CE  . LYS A 1 266 ? -15.722 54.339  82.958  1.00   20.96 ? 266  LYS A CE  1 
ATOM   2153  N NZ  . LYS A 1 266 ? -15.699 54.916  81.588  1.00   17.25 ? 266  LYS A NZ  1 
ATOM   2154  N N   . SER A 1 267 ? -16.792 51.317  88.011  1.00   31.26 ? 267  SER A N   1 
ATOM   2155  C CA  . SER A 1 267 ? -17.570 50.141  88.421  1.00   32.62 ? 267  SER A CA  1 
ATOM   2156  C C   . SER A 1 267 ? -18.094 50.310  89.834  1.00   33.34 ? 267  SER A C   1 
ATOM   2157  O O   . SER A 1 267 ? -19.253 49.996  90.122  1.00   33.97 ? 267  SER A O   1 
ATOM   2158  C CB  . SER A 1 267 ? -16.727 48.868  88.373  1.00   27.71 ? 267  SER A CB  1 
ATOM   2159  O OG  . SER A 1 267 ? -16.219 48.666  87.073  1.00   35.99 ? 267  SER A OG  1 
ATOM   2160  N N   . ALA A 1 268 ? -17.238 50.810  90.720  1.00   32.24 ? 268  ALA A N   1 
ATOM   2161  C CA  . ALA A 1 268 ? -17.630 50.988  92.115  1.00   32.61 ? 268  ALA A CA  1 
ATOM   2162  C C   . ALA A 1 268 ? -18.749 51.997  92.260  1.00   33.95 ? 268  ALA A C   1 
ATOM   2163  O O   . ALA A 1 268 ? -19.668 51.805  93.060  1.00   34.88 ? 268  ALA A O   1 
ATOM   2164  C CB  . ALA A 1 268 ? -16.432 51.418  92.954  1.00   32.70 ? 268  ALA A CB  1 
ATOM   2165  N N   . LEU A 1 269 ? -18.677 53.085  91.498  1.00   34.67 ? 269  LEU A N   1 
ATOM   2166  C CA  . LEU A 1 269 ? -19.714 54.101  91.603  1.00   33.96 ? 269  LEU A CA  1 
ATOM   2167  C C   . LEU A 1 269 ? -21.045 53.539  91.098  1.00   34.92 ? 269  LEU A C   1 
ATOM   2168  O O   . LEU A 1 269 ? -22.070 53.714  91.756  1.00   34.50 ? 269  LEU A O   1 
ATOM   2169  C CB  . LEU A 1 269 ? -19.294 55.351  90.844  1.00   31.09 ? 269  LEU A CB  1 
ATOM   2170  C CG  . LEU A 1 269 ? -17.990 55.939  91.396  1.00   30.16 ? 269  LEU A CG  1 
ATOM   2171  C CD1 . LEU A 1 269 ? -17.452 56.980  90.463  1.00   31.07 ? 269  LEU A CD1 1 
ATOM   2172  C CD2 . LEU A 1 269 ? -18.214 56.523  92.775  1.00   27.51 ? 269  LEU A CD2 1 
ATOM   2173  N N   . ARG A 1 270 ? -21.025 52.851  89.957  1.00   36.25 ? 270  ARG A N   1 
ATOM   2174  C CA  . ARG A 1 270 ? -22.236 52.258  89.404  1.00   38.37 ? 270  ARG A CA  1 
ATOM   2175  C C   . ARG A 1 270 ? -22.824 51.356  90.473  1.00   42.24 ? 270  ARG A C   1 
ATOM   2176  O O   . ARG A 1 270 ? -24.018 51.445  90.805  1.00   40.07 ? 270  ARG A O   1 
ATOM   2177  C CB  . ARG A 1 270 ? -21.919 51.399  88.179  1.00   40.44 ? 270  ARG A CB  1 
ATOM   2178  C CG  . ARG A 1 270 ? -21.269 52.133  87.016  1.00   44.93 ? 270  ARG A CG  1 
ATOM   2179  C CD  . ARG A 1 270 ? -21.394 51.329  85.716  1.00   47.33 ? 270  ARG A CD  1 
ATOM   2180  N NE  . ARG A 1 270 ? -20.458 51.761  84.680  1.00   51.30 ? 270  ARG A NE  1 
ATOM   2181  C CZ  . ARG A 1 270 ? -19.188 51.368  84.610  1.00   54.31 ? 270  ARG A CZ  1 
ATOM   2182  N NH1 . ARG A 1 270 ? -18.701 50.528  85.518  1.00   53.38 ? 270  ARG A NH1 1 
ATOM   2183  N NH2 . ARG A 1 270 ? -18.405 51.814  83.634  1.00   56.75 ? 270  ARG A NH2 1 
ATOM   2184  N N   . GLU A 1 271 ? -21.958 50.486  90.999  1.00   43.35 ? 271  GLU A N   1 
ATOM   2185  C CA  . GLU A 1 271 ? -22.316 49.542  92.043  1.00   45.34 ? 271  GLU A CA  1 
ATOM   2186  C C   . GLU A 1 271 ? -22.983 50.242  93.204  1.00   45.39 ? 271  GLU A C   1 
ATOM   2187  O O   . GLU A 1 271 ? -24.002 49.785  93.702  1.00   47.52 ? 271  GLU A O   1 
ATOM   2188  C CB  . GLU A 1 271 ? -21.071 48.811  92.544  1.00   48.64 ? 271  GLU A CB  1 
ATOM   2189  C CG  . GLU A 1 271 ? -20.853 47.455  91.904  1.00   53.01 ? 271  GLU A CG  1 
ATOM   2190  C CD  . GLU A 1 271 ? -21.968 46.491  92.235  1.00   58.00 ? 271  GLU A CD  1 
ATOM   2191  O OE1 . GLU A 1 271 ? -22.116 46.131  93.429  1.00   60.59 ? 271  GLU A OE1 1 
ATOM   2192  O OE2 . GLU A 1 271 ? -22.701 46.103  91.304  1.00   60.00 ? 271  GLU A OE2 1 
ATOM   2193  N N   . MET A 1 272 ? -22.409 51.356  93.632  1.00   44.06 ? 272  MET A N   1 
ATOM   2194  C CA  . MET A 1 272 ? -22.961 52.096  94.748  1.00   42.16 ? 272  MET A CA  1 
ATOM   2195  C C   . MET A 1 272 ? -24.310 52.698  94.432  1.00   41.05 ? 272  MET A C   1 
ATOM   2196  O O   . MET A 1 272 ? -25.038 53.090  95.341  1.00   43.72 ? 272  MET A O   1 
ATOM   2197  C CB  . MET A 1 272 ? -21.990 53.199  95.175  1.00   42.95 ? 272  MET A CB  1 
ATOM   2198  C CG  . MET A 1 272 ? -20.741 52.663  95.839  1.00   45.79 ? 272  MET A CG  1 
ATOM   2199  S SD  . MET A 1 272 ? -19.551 53.944  96.164  1.00   47.45 ? 272  MET A SD  1 
ATOM   2200  C CE  . MET A 1 272 ? -20.519 55.040  97.080  1.00   44.75 ? 272  MET A CE  1 
ATOM   2201  N N   . GLY A 1 273 ? -24.659 52.762  93.153  1.00   38.75 ? 273  GLY A N   1 
ATOM   2202  C CA  . GLY A 1 273 ? -25.936 53.355  92.786  1.00   36.84 ? 273  GLY A CA  1 
ATOM   2203  C C   . GLY A 1 273 ? -25.858 54.729  92.134  1.00   35.03 ? 273  GLY A C   1 
ATOM   2204  O O   . GLY A 1 273 ? -26.879 55.297  91.777  1.00   37.07 ? 273  GLY A O   1 
ATOM   2205  N N   . TYR A 1 274 ? -24.664 55.289  91.988  1.00   33.49 ? 274  TYR A N   1 
ATOM   2206  C CA  . TYR A 1 274 ? -24.538 56.586  91.341  1.00   32.71 ? 274  TYR A CA  1 
ATOM   2207  C C   . TYR A 1 274 ? -24.639 56.482  89.833  1.00   33.48 ? 274  TYR A C   1 
ATOM   2208  O O   . TYR A 1 274 ? -24.180 55.499  89.218  1.00   32.85 ? 274  TYR A O   1 
ATOM   2209  C CB  . TYR A 1 274 ? -23.200 57.245  91.648  1.00   31.34 ? 274  TYR A CB  1 
ATOM   2210  C CG  . TYR A 1 274 ? -23.048 57.717  93.057  1.00   29.53 ? 274  TYR A CG  1 
ATOM   2211  C CD1 . TYR A 1 274 ? -22.385 56.936  94.016  1.00   28.60 ? 274  TYR A CD1 1 
ATOM   2212  C CD2 . TYR A 1 274 ? -23.522 58.970  93.428  1.00   25.31 ? 274  TYR A CD2 1 
ATOM   2213  C CE1 . TYR A 1 274 ? -22.192 57.408  95.310  1.00   29.07 ? 274  TYR A CE1 1 
ATOM   2214  C CE2 . TYR A 1 274 ? -23.336 59.449  94.711  1.00   31.05 ? 274  TYR A CE2 1 
ATOM   2215  C CZ  . TYR A 1 274 ? -22.667 58.669  95.654  1.00   31.79 ? 274  TYR A CZ  1 
ATOM   2216  O OH  . TYR A 1 274 ? -22.464 59.155  96.928  1.00   30.69 ? 274  TYR A OH  1 
ATOM   2217  N N   . ARG A 1 275 ? -25.230 57.523  89.251  1.00   34.40 ? 275  ARG A N   1 
ATOM   2218  C CA  . ARG A 1 275 ? -25.397 57.643  87.801  1.00   35.43 ? 275  ARG A CA  1 
ATOM   2219  C C   . ARG A 1 275 ? -24.163 58.383  87.254  1.00   33.37 ? 275  ARG A C   1 
ATOM   2220  O O   . ARG A 1 275 ? -23.916 59.540  87.628  1.00   32.53 ? 275  ARG A O   1 
ATOM   2221  C CB  . ARG A 1 275 ? -26.669 58.442  87.493  1.00   40.29 ? 275  ARG A CB  1 
ATOM   2222  C CG  . ARG A 1 275 ? -26.874 58.773  86.014  1.00   48.71 ? 275  ARG A CG  1 
ATOM   2223  C CD  . ARG A 1 275 ? -27.896 59.899  85.842  1.00   55.13 ? 275  ARG A CD  1 
ATOM   2224  N NE  . ARG A 1 275 ? -27.904 60.459  84.487  1.00   61.98 ? 275  ARG A NE  1 
ATOM   2225  C CZ  . ARG A 1 275 ? -28.591 61.543  84.128  1.00   62.71 ? 275  ARG A CZ  1 
ATOM   2226  N NH1 . ARG A 1 275 ? -28.549 61.984  82.876  1.00   63.00 ? 275  ARG A NH1 1 
ATOM   2227  N NH2 . ARG A 1 275 ? -29.318 62.191  85.030  1.00   63.46 ? 275  ARG A NH2 1 
ATOM   2228  N N   . ILE A 1 276 ? -23.385 57.723  86.394  1.00   29.45 ? 276  ILE A N   1 
ATOM   2229  C CA  . ILE A 1 276 ? -22.184 58.347  85.814  1.00   26.55 ? 276  ILE A CA  1 
ATOM   2230  C C   . ILE A 1 276 ? -22.138 58.303  84.272  1.00   27.39 ? 276  ILE A C   1 
ATOM   2231  O O   . ILE A 1 276 ? -22.920 57.599  83.628  1.00   25.80 ? 276  ILE A O   1 
ATOM   2232  C CB  . ILE A 1 276 ? -20.897 57.652  86.318  1.00   23.51 ? 276  ILE A CB  1 
ATOM   2233  C CG1 . ILE A 1 276 ? -20.930 56.166  85.948  1.00   22.64 ? 276  ILE A CG1 1 
ATOM   2234  C CG2 . ILE A 1 276 ? -20.758 57.823  87.823  1.00   23.63 ? 276  ILE A CG2 1 
ATOM   2235  C CD1 . ILE A 1 276 ? -19.599 55.450  86.159  1.00   25.93 ? 276  ILE A CD1 1 
ATOM   2236  N N   . THR A 1 277 ? -21.220 59.069  83.686  1.00   24.13 ? 277  THR A N   1 
ATOM   2237  C CA  . THR A 1 277 ? -21.045 59.054  82.241  1.00   21.87 ? 277  THR A CA  1 
ATOM   2238  C C   . THR A 1 277 ? -20.009 57.975  81.956  1.00   22.34 ? 277  THR A C   1 
ATOM   2239  O O   . THR A 1 277 ? -19.332 57.477  82.864  1.00   20.54 ? 277  THR A O   1 
ATOM   2240  C CB  . THR A 1 277 ? -20.462 60.357  81.700  1.00   20.37 ? 277  THR A CB  1 
ATOM   2241  O OG1 . THR A 1 277 ? -19.169 60.544  82.283  1.00   15.48 ? 277  THR A OG1 1 
ATOM   2242  C CG2 . THR A 1 277 ? -21.395 61.545  81.991  1.00   15.68 ? 277  THR A CG2 1 
ATOM   2243  N N   . ASP A 1 278 ? -19.892 57.608  80.693  1.00   20.77 ? 278  ASP A N   1 
ATOM   2244  C CA  . ASP A 1 278 ? -18.915 56.611  80.301  1.00   22.55 ? 278  ASP A CA  1 
ATOM   2245  C C   . ASP A 1 278 ? -17.650 57.397  79.907  1.00   19.73 ? 278  ASP A C   1 
ATOM   2246  O O   . ASP A 1 278 ? -17.270 57.458  78.740  1.00   18.80 ? 278  ASP A O   1 
ATOM   2247  C CB  . ASP A 1 278 ? -19.478 55.779  79.132  1.00   23.00 ? 278  ASP A CB  1 
ATOM   2248  C CG  . ASP A 1 278 ? -18.499 54.731  78.618  1.00   30.27 ? 278  ASP A CG  1 
ATOM   2249  O OD1 . ASP A 1 278 ? -17.546 54.364  79.351  1.00   27.55 ? 278  ASP A OD1 1 
ATOM   2250  O OD2 . ASP A 1 278 ? -18.704 54.259  77.475  1.00   30.72 ? 278  ASP A OD2 1 
ATOM   2251  N N   . SER A 1 279 ? -16.994 57.994  80.893  1.00   21.67 ? 279  SER A N   1 
ATOM   2252  C CA  . SER A 1 279 ? -15.799 58.801  80.645  1.00   22.10 ? 279  SER A CA  1 
ATOM   2253  C C   . SER A 1 279 ? -14.596 58.025  80.116  1.00   21.50 ? 279  SER A C   1 
ATOM   2254  O O   . SER A 1 279 ? -14.267 56.946  80.610  1.00   23.96 ? 279  SER A O   1 
ATOM   2255  C CB  . SER A 1 279 ? -15.385 59.539  81.916  1.00   22.65 ? 279  SER A CB  1 
ATOM   2256  O OG  . SER A 1 279 ? -14.189 60.292  81.713  1.00   25.23 ? 279  SER A OG  1 
ATOM   2257  N N   . ARG A 1 280 ? -13.936 58.604  79.122  1.00   19.39 ? 280  ARG A N   1 
ATOM   2258  C CA  . ARG A 1 280 ? -12.760 58.011  78.510  1.00   17.46 ? 280  ARG A CA  1 
ATOM   2259  C C   . ARG A 1 280 ? -11.612 58.986  78.691  1.00   17.35 ? 280  ARG A C   1 
ATOM   2260  O O   . ARG A 1 280 ? -10.665 58.983  77.921  1.00   19.45 ? 280  ARG A O   1 
ATOM   2261  C CB  . ARG A 1 280 ? -13.007 57.746  77.020  1.00   19.12 ? 280  ARG A CB  1 
ATOM   2262  C CG  . ARG A 1 280 ? -14.232 56.860  76.721  1.00   25.13 ? 280  ARG A CG  1 
ATOM   2263  C CD  . ARG A 1 280 ? -14.144 55.485  77.414  1.00   25.89 ? 280  ARG A CD  1 
ATOM   2264  N NE  . ARG A 1 280 ? -15.327 54.665  77.136  1.00   31.96 ? 280  ARG A NE  1 
ATOM   2265  C CZ  . ARG A 1 280 ? -15.455 53.836  76.100  1.00   32.21 ? 280  ARG A CZ  1 
ATOM   2266  N NH1 . ARG A 1 280 ? -14.461 53.689  75.230  1.00   27.85 ? 280  ARG A NH1 1 
ATOM   2267  N NH2 . ARG A 1 280 ? -16.595 53.180  75.908  1.00   33.13 ? 280  ARG A NH2 1 
ATOM   2268  N N   . GLY A 1 281 ? -11.725 59.844  79.696  1.00   16.95 ? 281  GLY A N   1 
ATOM   2269  C CA  . GLY A 1 281 ? -10.673 60.795  79.995  1.00   17.27 ? 281  GLY A CA  1 
ATOM   2270  C C   . GLY A 1 281 ? -9.901  60.346  81.234  1.00   16.71 ? 281  GLY A C   1 
ATOM   2271  O O   . GLY A 1 281 ? -9.895  59.167  81.588  1.00   16.90 ? 281  GLY A O   1 
ATOM   2272  N N   . ASN A 1 282 ? -9.231  61.285  81.891  1.00   17.39 ? 282  ASN A N   1 
ATOM   2273  C CA  . ASN A 1 282 ? -8.465  60.968  83.089  1.00   19.76 ? 282  ASN A CA  1 
ATOM   2274  C C   . ASN A 1 282 ? -9.243  61.447  84.312  1.00   20.49 ? 282  ASN A C   1 
ATOM   2275  O O   . ASN A 1 282 ? -8.672  62.030  85.239  1.00   20.79 ? 282  ASN A O   1 
ATOM   2276  C CB  . ASN A 1 282 ? -7.093  61.632  83.042  1.00   20.47 ? 282  ASN A CB  1 
ATOM   2277  C CG  . ASN A 1 282 ? -7.183  63.160  82.982  1.00   25.09 ? 282  ASN A CG  1 
ATOM   2278  O OD1 . ASN A 1 282 ? -8.064  63.709  82.331  1.00   20.62 ? 282  ASN A OD1 1 
ATOM   2279  N ND2 . ASN A 1 282 ? -6.249  63.846  83.655  1.00   22.69 ? 282  ASN A ND2 1 
ATOM   2280  N N   . PHE A 1 283 ? -10.549 61.189  84.305  1.00   17.66 ? 283  PHE A N   1 
ATOM   2281  C CA  . PHE A 1 283 ? -11.412 61.595  85.406  1.00   18.33 ? 283  PHE A CA  1 
ATOM   2282  C C   . PHE A 1 283 ? -12.784 60.928  85.229  1.00   15.54 ? 283  PHE A C   1 
ATOM   2283  O O   . PHE A 1 283 ? -13.082 60.372  84.176  1.00   11.97 ? 283  PHE A O   1 
ATOM   2284  C CB  . PHE A 1 283 ? -11.630 63.108  85.329  1.00   20.43 ? 283  PHE A CB  1 
ATOM   2285  C CG  . PHE A 1 283 ? -12.194 63.534  84.009  1.00   17.28 ? 283  PHE A CG  1 
ATOM   2286  C CD1 . PHE A 1 283 ? -11.349 63.979  82.991  1.00   19.27 ? 283  PHE A CD1 1 
ATOM   2287  C CD2 . PHE A 1 283 ? -13.562 63.400  83.746  1.00   18.41 ? 283  PHE A CD2 1 
ATOM   2288  C CE1 . PHE A 1 283 ? -11.844 64.283  81.733  1.00   14.36 ? 283  PHE A CE1 1 
ATOM   2289  C CE2 . PHE A 1 283 ? -14.088 63.700  82.483  1.00   14.33 ? 283  PHE A CE2 1 
ATOM   2290  C CZ  . PHE A 1 283 ? -13.227 64.144  81.473  1.00   18.40 ? 283  PHE A CZ  1 
ATOM   2291  N N   . VAL A 1 284 ? -13.620 61.001  86.253  1.00   15.24 ? 284  VAL A N   1 
ATOM   2292  C CA  . VAL A 1 284 ? -14.967 60.490  86.121  1.00   18.10 ? 284  VAL A CA  1 
ATOM   2293  C C   . VAL A 1 284 ? -15.934 61.658  86.334  1.00   22.06 ? 284  VAL A C   1 
ATOM   2294  O O   . VAL A 1 284 ? -15.566 62.726  86.853  1.00   22.75 ? 284  VAL A O   1 
ATOM   2295  C CB  . VAL A 1 284 ? -15.296 59.376  87.154  1.00   17.29 ? 284  VAL A CB  1 
ATOM   2296  C CG1 . VAL A 1 284 ? -14.606 58.059  86.746  1.00   22.50 ? 284  VAL A CG1 1 
ATOM   2297  C CG2 . VAL A 1 284 ? -14.875 59.800  88.535  1.00   15.26 ? 284  VAL A CG2 1 
ATOM   2298  N N   . PHE A 1 285 ? -17.167 61.462  85.898  1.00   22.30 ? 285  PHE A N   1 
ATOM   2299  C CA  . PHE A 1 285 ? -18.181 62.466  86.110  1.00   22.93 ? 285  PHE A CA  1 
ATOM   2300  C C   . PHE A 1 285 ? -19.346 61.839  86.875  1.00   24.42 ? 285  PHE A C   1 
ATOM   2301  O O   . PHE A 1 285 ? -19.914 60.839  86.427  1.00   21.64 ? 285  PHE A O   1 
ATOM   2302  C CB  . PHE A 1 285 ? -18.690 63.041  84.792  1.00   19.85 ? 285  PHE A CB  1 
ATOM   2303  C CG  . PHE A 1 285 ? -19.560 64.240  84.993  1.00   18.38 ? 285  PHE A CG  1 
ATOM   2304  C CD1 . PHE A 1 285 ? -18.993 65.505  85.078  1.00   13.88 ? 285  PHE A CD1 1 
ATOM   2305  C CD2 . PHE A 1 285 ? -20.946 64.097  85.204  1.00   21.03 ? 285  PHE A CD2 1 
ATOM   2306  C CE1 . PHE A 1 285 ? -19.791 66.645  85.377  1.00   20.77 ? 285  PHE A CE1 1 
ATOM   2307  C CE2 . PHE A 1 285 ? -21.770 65.227  85.509  1.00   20.20 ? 285  PHE A CE2 1 
ATOM   2308  C CZ  . PHE A 1 285 ? -21.178 66.507  85.594  1.00   20.92 ? 285  PHE A CZ  1 
ATOM   2309  N N   . VAL A 1 286 ? -19.684 62.435  88.021  1.00   24.93 ? 286  VAL A N   1 
ATOM   2310  C CA  . VAL A 1 286 ? -20.769 61.949  88.865  1.00   28.41 ? 286  VAL A CA  1 
ATOM   2311  C C   . VAL A 1 286 ? -21.945 62.910  88.838  1.00   28.87 ? 286  VAL A C   1 
ATOM   2312  O O   . VAL A 1 286 ? -21.794 64.069  89.197  1.00   30.35 ? 286  VAL A O   1 
ATOM   2313  C CB  . VAL A 1 286 ? -20.329 61.808  90.320  1.00   28.16 ? 286  VAL A CB  1 
ATOM   2314  C CG1 . VAL A 1 286 ? -21.460 61.196  91.136  1.00   26.98 ? 286  VAL A CG1 1 
ATOM   2315  C CG2 . VAL A 1 286 ? -19.079 60.936  90.399  1.00   28.64 ? 286  VAL A CG2 1 
ATOM   2316  N N   . PHE A 1 287 ? -23.109 62.442  88.395  1.00   30.13 ? 287  PHE A N   1 
ATOM   2317  C CA  . PHE A 1 287 ? -24.286 63.303  88.360  1.00   34.86 ? 287  PHE A CA  1 
ATOM   2318  C C   . PHE A 1 287 ? -24.835 63.428  89.787  1.00   36.50 ? 287  PHE A C   1 
ATOM   2319  O O   . PHE A 1 287 ? -24.905 62.446  90.515  1.00   37.30 ? 287  PHE A O   1 
ATOM   2320  C CB  . PHE A 1 287 ? -25.391 62.729  87.450  1.00   35.80 ? 287  PHE A CB  1 
ATOM   2321  C CG  . PHE A 1 287 ? -25.055 62.722  85.977  1.00   36.70 ? 287  PHE A CG  1 
ATOM   2322  C CD1 . PHE A 1 287 ? -24.557 61.579  85.363  1.00   36.82 ? 287  PHE A CD1 1 
ATOM   2323  C CD2 . PHE A 1 287 ? -25.278 63.854  85.202  1.00   37.15 ? 287  PHE A CD2 1 
ATOM   2324  C CE1 . PHE A 1 287 ? -24.294 61.574  83.996  1.00   41.02 ? 287  PHE A CE1 1 
ATOM   2325  C CE2 . PHE A 1 287 ? -25.019 63.861  83.839  1.00   36.62 ? 287  PHE A CE2 1 
ATOM   2326  C CZ  . PHE A 1 287 ? -24.529 62.728  83.229  1.00   36.83 ? 287  PHE A CZ  1 
ATOM   2327  N N   . MET A 1 288 ? -25.214 64.636  90.186  1.00   40.59 ? 288  MET A N   1 
ATOM   2328  C CA  . MET A 1 288 ? -25.758 64.869  91.517  1.00   44.35 ? 288  MET A CA  1 
ATOM   2329  C C   . MET A 1 288 ? -26.746 66.026  91.470  1.00   47.16 ? 288  MET A C   1 
ATOM   2330  O O   . MET A 1 288 ? -26.482 67.058  90.847  1.00   44.96 ? 288  MET A O   1 
ATOM   2331  C CB  . MET A 1 288 ? -24.643 65.181  92.520  1.00   43.69 ? 288  MET A CB  1 
ATOM   2332  C CG  . MET A 1 288 ? -23.662 64.053  92.723  1.00   45.14 ? 288  MET A CG  1 
ATOM   2333  S SD  . MET A 1 288 ? -22.535 64.378  94.086  1.00   48.04 ? 288  MET A SD  1 
ATOM   2334  C CE  . MET A 1 288 ? -23.425 63.611  95.430  1.00   45.94 ? 288  MET A CE  1 
ATOM   2335  N N   . GLU A 1 289 ? -27.884 65.835  92.132  1.00   50.56 ? 289  GLU A N   1 
ATOM   2336  C CA  . GLU A 1 289 ? -28.942 66.827  92.177  1.00   55.30 ? 289  GLU A CA  1 
ATOM   2337  C C   . GLU A 1 289 ? -28.548 68.015  93.047  1.00   56.91 ? 289  GLU A C   1 
ATOM   2338  O O   . GLU A 1 289 ? -28.864 68.080  94.232  1.00   58.79 ? 289  GLU A O   1 
ATOM   2339  C CB  . GLU A 1 289 ? -30.241 66.190  92.696  1.00   58.06 ? 289  GLU A CB  1 
ATOM   2340  C CG  . GLU A 1 289 ? -30.715 64.964  91.886  1.00   62.87 ? 289  GLU A CG  1 
ATOM   2341  C CD  . GLU A 1 289 ? -31.919 64.243  92.505  1.00   65.78 ? 289  GLU A CD  1 
ATOM   2342  O OE1 . GLU A 1 289 ? -31.904 64.001  93.736  1.00   66.78 ? 289  GLU A OE1 1 
ATOM   2343  O OE2 . GLU A 1 289 ? -32.869 63.904  91.758  1.00   62.98 ? 289  GLU A OE2 1 
ATOM   2344  N N   . LYS A 1 290 ? -27.837 68.940  92.420  1.00   58.09 ? 290  LYS A N   1 
ATOM   2345  C CA  . LYS A 1 290 ? -27.358 70.180  93.005  1.00   58.88 ? 290  LYS A CA  1 
ATOM   2346  C C   . LYS A 1 290 ? -27.329 70.345  94.526  1.00   61.22 ? 290  LYS A C   1 
ATOM   2347  O O   . LYS A 1 290 ? -26.253 70.517  95.109  1.00   60.89 ? 290  LYS A O   1 
ATOM   2348  C CB  . LYS A 1 290 ? -28.113 71.331  92.330  1.00   58.83 ? 290  LYS A CB  1 
ATOM   2349  C CG  . LYS A 1 290 ? -27.803 71.396  90.800  1.00   53.88 ? 290  LYS A CG  1 
ATOM   2350  C CD  . LYS A 1 290 ? -28.694 72.332  89.982  1.00   43.78 ? 290  LYS A CD  1 
ATOM   2351  C CE  . LYS A 1 290 ? -29.888 71.614  89.439  1.00   37.64 ? 290  LYS A CE  1 
ATOM   2352  N NZ  . LYS A 1 290 ? -30.785 71.201  90.513  1.00   38.56 ? 290  LYS A NZ  1 
ATOM   2353  N N   . GLU A 1 291 ? -28.488 70.308  95.176  1.00   62.90 ? 291  GLU A N   1 
ATOM   2354  C CA  . GLU A 1 291 ? -28.525 70.454  96.632  1.00   63.51 ? 291  GLU A CA  1 
ATOM   2355  C C   . GLU A 1 291 ? -27.586 69.472  97.328  1.00   62.61 ? 291  GLU A C   1 
ATOM   2356  O O   . GLU A 1 291 ? -26.709 69.881  98.092  1.00   63.07 ? 291  GLU A O   1 
ATOM   2357  C CB  . GLU A 1 291 ? -29.938 70.246  97.178  1.00   66.20 ? 291  GLU A CB  1 
ATOM   2358  C CG  . GLU A 1 291 ? -29.998 70.308  98.705  1.00   71.33 ? 291  GLU A CG  1 
ATOM   2359  C CD  . GLU A 1 291 ? -31.344 69.885  99.275  1.00   76.75 ? 291  GLU A CD  1 
ATOM   2360  O OE1 . GLU A 1 291 ? -31.813 68.776  98.926  1.00   79.47 ? 291  GLU A OE1 1 
ATOM   2361  O OE2 . GLU A 1 291 ? -31.923 70.654  100.078 1.00   75.37 ? 291  GLU A OE2 1 
ATOM   2362  N N   . GLU A 1 292 ? -27.767 68.179  97.077  1.00   58.87 ? 292  GLU A N   1 
ATOM   2363  C CA  . GLU A 1 292 ? -26.906 67.193  97.708  1.00   56.55 ? 292  GLU A CA  1 
ATOM   2364  C C   . GLU A 1 292 ? -25.455 67.390  97.313  1.00   53.48 ? 292  GLU A C   1 
ATOM   2365  O O   . GLU A 1 292 ? -24.559 67.120  98.096  1.00   53.63 ? 292  GLU A O   1 
ATOM   2366  C CB  . GLU A 1 292 ? -27.359 65.773  97.366  1.00   58.89 ? 292  GLU A CB  1 
ATOM   2367  C CG  . GLU A 1 292 ? -28.661 65.343  98.070  1.00   66.31 ? 292  GLU A CG  1 
ATOM   2368  C CD  . GLU A 1 292 ? -28.658 65.587  99.591  1.00   69.19 ? 292  GLU A CD  1 
ATOM   2369  O OE1 . GLU A 1 292 ? -27.745 65.084  100.289 1.00   69.06 ? 292  GLU A OE1 1 
ATOM   2370  O OE2 . GLU A 1 292 ? -29.577 66.280  100.088 1.00   69.17 ? 292  GLU A OE2 1 
ATOM   2371  N N   . LYS A 1 293 ? -25.225 67.868  96.096  1.00   51.56 ? 293  LYS A N   1 
ATOM   2372  C CA  . LYS A 1 293 ? -23.867 68.119  95.622  1.00   48.56 ? 293  LYS A CA  1 
ATOM   2373  C C   . LYS A 1 293 ? -23.190 69.106  96.584  1.00   48.09 ? 293  LYS A C   1 
ATOM   2374  O O   . LYS A 1 293 ? -22.040 68.908  97.003  1.00   46.73 ? 293  LYS A O   1 
ATOM   2375  C CB  . LYS A 1 293 ? -23.901 68.709  94.210  1.00   46.94 ? 293  LYS A CB  1 
ATOM   2376  C CG  . LYS A 1 293 ? -22.534 68.990  93.623  1.00   47.54 ? 293  LYS A CG  1 
ATOM   2377  C CD  . LYS A 1 293 ? -22.634 69.671  92.274  1.00   46.70 ? 293  LYS A CD  1 
ATOM   2378  C CE  . LYS A 1 293 ? -23.148 71.097  92.406  1.00   46.22 ? 293  LYS A CE  1 
ATOM   2379  N NZ  . LYS A 1 293 ? -23.355 71.705  91.069  1.00   43.96 ? 293  LYS A NZ  1 
ATOM   2380  N N   . GLU A 1 294 ? -23.926 70.161  96.937  1.00   46.85 ? 294  GLU A N   1 
ATOM   2381  C CA  . GLU A 1 294 ? -23.448 71.195  97.854  1.00   44.74 ? 294  GLU A CA  1 
ATOM   2382  C C   . GLU A 1 294 ? -22.975 70.580  99.161  1.00   43.08 ? 294  GLU A C   1 
ATOM   2383  O O   . GLU A 1 294 ? -22.016 71.063  99.776  1.00   40.07 ? 294  GLU A O   1 
ATOM   2384  C CB  . GLU A 1 294 ? -24.566 72.190  98.161  1.00   45.82 ? 294  GLU A CB  1 
ATOM   2385  C CG  . GLU A 1 294 ? -25.097 72.905  96.951  1.00   49.29 ? 294  GLU A CG  1 
ATOM   2386  C CD  . GLU A 1 294 ? -24.047 73.768  96.301  1.00   52.87 ? 294  GLU A CD  1 
ATOM   2387  O OE1 . GLU A 1 294 ? -23.731 74.837  96.862  1.00   55.05 ? 294  GLU A OE1 1 
ATOM   2388  O OE2 . GLU A 1 294 ? -23.534 73.372  95.234  1.00   55.08 ? 294  GLU A OE2 1 
ATOM   2389  N N   . ARG A 1 295 ? -23.678 69.526  99.580  1.00   42.82 ? 295  ARG A N   1 
ATOM   2390  C CA  . ARG A 1 295 ? -23.370 68.818  100.812 1.00   42.90 ? 295  ARG A CA  1 
ATOM   2391  C C   . ARG A 1 295 ? -21.979 68.217  100.678 1.00   42.71 ? 295  ARG A C   1 
ATOM   2392  O O   . ARG A 1 295 ? -21.094 68.481  101.490 1.00   43.89 ? 295  ARG A O   1 
ATOM   2393  C CB  . ARG A 1 295 ? -24.391 67.704  101.051 1.00   44.70 ? 295  ARG A CB  1 
ATOM   2394  C CG  . ARG A 1 295 ? -25.129 67.779  102.390 1.00   49.64 ? 295  ARG A CG  1 
ATOM   2395  C CD  . ARG A 1 295 ? -25.853 66.466  102.732 1.00   53.46 ? 295  ARG A CD  1 
ATOM   2396  N NE  . ARG A 1 295 ? -26.562 66.550  104.015 1.00   61.18 ? 295  ARG A NE  1 
ATOM   2397  C CZ  . ARG A 1 295 ? -27.109 65.514  104.654 1.00   62.24 ? 295  ARG A CZ  1 
ATOM   2398  N NH1 . ARG A 1 295 ? -27.033 64.295  104.141 1.00   65.23 ? 295  ARG A NH1 1 
ATOM   2399  N NH2 . ARG A 1 295 ? -27.742 65.692  105.808 1.00   61.93 ? 295  ARG A NH2 1 
ATOM   2400  N N   . LEU A 1 296 ? -21.787 67.423  99.635  1.00   40.37 ? 296  LEU A N   1 
ATOM   2401  C CA  . LEU A 1 296 ? -20.508 66.787  99.401  1.00   39.09 ? 296  LEU A CA  1 
ATOM   2402  C C   . LEU A 1 296 ? -19.380 67.812  99.384  1.00   38.40 ? 296  LEU A C   1 
ATOM   2403  O O   . LEU A 1 296 ? -18.384 67.679  100.094 1.00   36.64 ? 296  LEU A O   1 
ATOM   2404  C CB  . LEU A 1 296 ? -20.549 66.056  98.071  1.00   39.60 ? 296  LEU A CB  1 
ATOM   2405  C CG  . LEU A 1 296 ? -20.027 64.627  98.096  1.00   40.40 ? 296  LEU A CG  1 
ATOM   2406  C CD1 . LEU A 1 296 ? -20.073 64.109  96.672  1.00   46.71 ? 296  LEU A CD1 1 
ATOM   2407  C CD2 . LEU A 1 296 ? -18.615 64.548  98.646  1.00   38.93 ? 296  LEU A CD2 1 
ATOM   2408  N N   . LEU A 1 297 ? -19.533 68.830  98.553  1.00   37.28 ? 297  LEU A N   1 
ATOM   2409  C CA  . LEU A 1 297 ? -18.526 69.875  98.446  1.00   38.32 ? 297  LEU A CA  1 
ATOM   2410  C C   . LEU A 1 297 ? -18.094 70.410  99.816  1.00   37.57 ? 297  LEU A C   1 
ATOM   2411  O O   . LEU A 1 297 ? -16.899 70.555  100.079 1.00   36.59 ? 297  LEU A O   1 
ATOM   2412  C CB  . LEU A 1 297 ? -19.064 71.002  97.563  1.00   36.95 ? 297  LEU A CB  1 
ATOM   2413  C CG  . LEU A 1 297 ? -18.779 70.832  96.062  1.00   38.45 ? 297  LEU A CG  1 
ATOM   2414  C CD1 . LEU A 1 297 ? -18.789 69.360  95.655  1.00   31.68 ? 297  LEU A CD1 1 
ATOM   2415  C CD2 . LEU A 1 297 ? -19.799 71.639  95.265  1.00   35.75 ? 297  LEU A CD2 1 
ATOM   2416  N N   . GLU A 1 298 ? -19.067 70.709  100.675 1.00   36.99 ? 298  GLU A N   1 
ATOM   2417  C CA  . GLU A 1 298 ? -18.787 71.186  102.033 1.00   37.37 ? 298  GLU A CA  1 
ATOM   2418  C C   . GLU A 1 298 ? -18.045 70.091  102.803 1.00   34.90 ? 298  GLU A C   1 
ATOM   2419  O O   . GLU A 1 298 ? -17.007 70.334  103.416 1.00   34.14 ? 298  GLU A O   1 
ATOM   2420  C CB  . GLU A 1 298 ? -20.089 71.496  102.785 1.00   39.02 ? 298  GLU A CB  1 
ATOM   2421  C CG  . GLU A 1 298 ? -20.812 72.744  102.338 1.00   43.06 ? 298  GLU A CG  1 
ATOM   2422  C CD  . GLU A 1 298 ? -19.999 74.010  102.556 1.00   47.68 ? 298  GLU A CD  1 
ATOM   2423  O OE1 . GLU A 1 298 ? -20.541 75.114  102.334 1.00   50.39 ? 298  GLU A OE1 1 
ATOM   2424  O OE2 . GLU A 1 298 ? -18.817 73.914  102.939 1.00   53.70 ? 298  GLU A OE2 1 
ATOM   2425  N N   . HIS A 1 299 ? -18.602 68.887  102.783 1.00   31.01 ? 299  HIS A N   1 
ATOM   2426  C CA  . HIS A 1 299 ? -17.969 67.772  103.458 1.00   32.17 ? 299  HIS A CA  1 
ATOM   2427  C C   . HIS A 1 299 ? -16.510 67.688  103.068 1.00   30.30 ? 299  HIS A C   1 
ATOM   2428  O O   . HIS A 1 299 ? -15.636 67.769  103.914 1.00   32.06 ? 299  HIS A O   1 
ATOM   2429  C CB  . HIS A 1 299 ? -18.642 66.466  103.091 1.00   34.58 ? 299  HIS A CB  1 
ATOM   2430  C CG  . HIS A 1 299 ? -18.083 65.291  103.822 1.00   39.45 ? 299  HIS A CG  1 
ATOM   2431  N ND1 . HIS A 1 299 ? -17.952 65.270  105.194 1.00   42.99 ? 299  HIS A ND1 1 
ATOM   2432  C CD2 . HIS A 1 299 ? -17.628 64.096  103.380 1.00   40.24 ? 299  HIS A CD2 1 
ATOM   2433  C CE1 . HIS A 1 299 ? -17.444 64.108  105.565 1.00   43.26 ? 299  HIS A CE1 1 
ATOM   2434  N NE2 . HIS A 1 299 ? -17.239 63.378  104.483 1.00   40.63 ? 299  HIS A NE2 1 
ATOM   2435  N N   . LEU A 1 300 ? -16.270 67.522  101.773 1.00   33.15 ? 300  LEU A N   1 
ATOM   2436  C CA  . LEU A 1 300 ? -14.918 67.447  101.224 1.00   35.39 ? 300  LEU A CA  1 
ATOM   2437  C C   . LEU A 1 300 ? -14.103 68.664  101.655 1.00   36.89 ? 300  LEU A C   1 
ATOM   2438  O O   . LEU A 1 300 ? -12.928 68.558  101.968 1.00   35.78 ? 300  LEU A O   1 
ATOM   2439  C CB  . LEU A 1 300 ? -14.987 67.378  99.702  1.00   32.14 ? 300  LEU A CB  1 
ATOM   2440  C CG  . LEU A 1 300 ? -15.805 66.190  99.200  1.00   33.39 ? 300  LEU A CG  1 
ATOM   2441  C CD1 . LEU A 1 300 ? -15.888 66.209  97.686  1.00   33.91 ? 300  LEU A CD1 1 
ATOM   2442  C CD2 . LEU A 1 300 ? -15.166 64.908  99.690  1.00   31.18 ? 300  LEU A CD2 1 
ATOM   2443  N N   . ARG A 1 301 ? -14.754 69.817  101.690 1.00   38.81 ? 301  ARG A N   1 
ATOM   2444  C CA  . ARG A 1 301 ? -14.116 71.056  102.085 1.00   42.44 ? 301  ARG A CA  1 
ATOM   2445  C C   . ARG A 1 301 ? -13.616 70.853  103.509 1.00   45.01 ? 301  ARG A C   1 
ATOM   2446  O O   . ARG A 1 301 ? -12.673 71.514  103.962 1.00   46.48 ? 301  ARG A O   1 
ATOM   2447  C CB  . ARG A 1 301 ? -15.136 72.190  102.028 1.00   44.31 ? 301  ARG A CB  1 
ATOM   2448  C CG  . ARG A 1 301 ? -14.611 73.469  101.450 1.00   50.04 ? 301  ARG A CG  1 
ATOM   2449  C CD  . ARG A 1 301 ? -15.663 74.136  100.556 1.00   57.51 ? 301  ARG A CD  1 
ATOM   2450  N NE  . ARG A 1 301 ? -15.920 73.368  99.333  1.00   61.62 ? 301  ARG A NE  1 
ATOM   2451  C CZ  . ARG A 1 301 ? -16.568 73.837  98.265  1.00   60.82 ? 301  ARG A CZ  1 
ATOM   2452  N NH1 . ARG A 1 301 ? -17.034 75.078  98.263  1.00   61.87 ? 301  ARG A NH1 1 
ATOM   2453  N NH2 . ARG A 1 301 ? -16.740 73.073  97.191  1.00   57.36 ? 301  ARG A NH2 1 
ATOM   2454  N N   . THR A 1 302 ? -14.253 69.917  104.203 1.00   44.33 ? 302  THR A N   1 
ATOM   2455  C CA  . THR A 1 302 ? -13.899 69.604  105.576 1.00   43.11 ? 302  THR A CA  1 
ATOM   2456  C C   . THR A 1 302 ? -12.735 68.632  105.635 1.00   42.51 ? 302  THR A C   1 
ATOM   2457  O O   . THR A 1 302 ? -12.005 68.580  106.617 1.00   42.37 ? 302  THR A O   1 
ATOM   2458  C CB  . THR A 1 302 ? -15.113 68.998  106.332 1.00   43.91 ? 302  THR A CB  1 
ATOM   2459  O OG1 . THR A 1 302 ? -16.036 70.043  106.670 1.00   37.60 ? 302  THR A OG1 1 
ATOM   2460  C CG2 . THR A 1 302 ? -14.667 68.283  107.601 1.00   44.05 ? 302  THR A CG2 1 
ATOM   2461  N N   . LYS A 1 303 ? -12.563 67.854  104.582 1.00   42.20 ? 303  LYS A N   1 
ATOM   2462  C CA  . LYS A 1 303 ? -11.477 66.888  104.552 1.00   42.32 ? 303  LYS A CA  1 
ATOM   2463  C C   . LYS A 1 303 ? -10.310 67.383  103.690 1.00   42.24 ? 303  LYS A C   1 
ATOM   2464  O O   . LYS A 1 303 ? -9.373  66.632  103.396 1.00   40.08 ? 303  LYS A O   1 
ATOM   2465  C CB  . LYS A 1 303 ? -12.001 65.564  104.021 1.00   41.98 ? 303  LYS A CB  1 
ATOM   2466  C CG  . LYS A 1 303 ? -13.065 64.940  104.899 1.00   48.65 ? 303  LYS A CG  1 
ATOM   2467  C CD  . LYS A 1 303 ? -12.454 64.027  105.955 1.00   51.91 ? 303  LYS A CD  1 
ATOM   2468  C CE  . LYS A 1 303 ? -11.760 62.841  105.297 1.00   51.04 ? 303  LYS A CE  1 
ATOM   2469  N NZ  . LYS A 1 303 ? -11.113 61.927  106.287 1.00   53.90 ? 303  LYS A NZ  1 
ATOM   2470  N N   . ASN A 1 304 ? -10.373 68.655  103.303 1.00   42.60 ? 304  ASN A N   1 
ATOM   2471  C CA  . ASN A 1 304 ? -9.343  69.262  102.464 1.00   42.73 ? 304  ASN A CA  1 
ATOM   2472  C C   . ASN A 1 304 ? -9.284  68.576  101.104 1.00   40.89 ? 304  ASN A C   1 
ATOM   2473  O O   . ASN A 1 304 ? -8.201  68.314  100.567 1.00   39.23 ? 304  ASN A O   1 
ATOM   2474  C CB  . ASN A 1 304 ? -7.979  69.170  103.148 1.00   47.83 ? 304  ASN A CB  1 
ATOM   2475  C CG  . ASN A 1 304 ? -7.708  70.341  104.060 1.00   50.60 ? 304  ASN A CG  1 
ATOM   2476  O OD1 . ASN A 1 304 ? -7.655  71.483  103.608 1.00   54.28 ? 304  ASN A OD1 1 
ATOM   2477  N ND2 . ASN A 1 304 ? -7.531  70.069  105.347 1.00   52.57 ? 304  ASN A ND2 1 
ATOM   2478  N N   . VAL A 1 305 ? -10.458 68.294  100.555 1.00   37.19 ? 305  VAL A N   1 
ATOM   2479  C CA  . VAL A 1 305 ? -10.559 67.633  99.271  1.00   36.45 ? 305  VAL A CA  1 
ATOM   2480  C C   . VAL A 1 305 ? -11.317 68.487  98.249  1.00   34.62 ? 305  VAL A C   1 
ATOM   2481  O O   . VAL A 1 305 ? -12.441 68.919  98.507  1.00   35.23 ? 305  VAL A O   1 
ATOM   2482  C CB  . VAL A 1 305 ? -11.272 66.282  99.433  1.00   36.26 ? 305  VAL A CB  1 
ATOM   2483  C CG1 . VAL A 1 305 ? -11.437 65.613  98.088  1.00   35.93 ? 305  VAL A CG1 1 
ATOM   2484  C CG2 . VAL A 1 305 ? -10.483 65.401  100.393 1.00   35.38 ? 305  VAL A CG2 1 
ATOM   2485  N N   . ALA A 1 306 ? -10.703 68.716  97.092  1.00   32.44 ? 306  ALA A N   1 
ATOM   2486  C CA  . ALA A 1 306 ? -11.337 69.514  96.043  1.00   31.49 ? 306  ALA A CA  1 
ATOM   2487  C C   . ALA A 1 306 ? -11.593 68.776  94.718  1.00   29.88 ? 306  ALA A C   1 
ATOM   2488  O O   . ALA A 1 306 ? -10.664 68.226  94.103  1.00   28.61 ? 306  ALA A O   1 
ATOM   2489  C CB  . ALA A 1 306 ? -10.495 70.790  95.757  1.00   32.17 ? 306  ALA A CB  1 
ATOM   2490  N N   . VAL A 1 307 ? -12.857 68.774  94.296  1.00   24.85 ? 307  VAL A N   1 
ATOM   2491  C CA  . VAL A 1 307 ? -13.270 68.184  93.034  1.00   21.35 ? 307  VAL A CA  1 
ATOM   2492  C C   . VAL A 1 307 ? -13.826 69.359  92.192  1.00   21.89 ? 307  VAL A C   1 
ATOM   2493  O O   . VAL A 1 307 ? -13.916 70.483  92.667  1.00   20.75 ? 307  VAL A O   1 
ATOM   2494  C CB  . VAL A 1 307 ? -14.344 67.104  93.257  1.00   22.17 ? 307  VAL A CB  1 
ATOM   2495  C CG1 . VAL A 1 307 ? -13.758 65.968  94.096  1.00   24.55 ? 307  VAL A CG1 1 
ATOM   2496  C CG2 . VAL A 1 307 ? -15.570 67.694  93.959  1.00   20.89 ? 307  VAL A CG2 1 
ATOM   2497  N N   . ARG A 1 308 ? -14.155 69.125  90.935  1.00   20.94 ? 308  ARG A N   1 
ATOM   2498  C CA  . ARG A 1 308 ? -14.708 70.184  90.127  1.00   19.95 ? 308  ARG A CA  1 
ATOM   2499  C C   . ARG A 1 308 ? -16.237 70.085  90.085  1.00   19.02 ? 308  ARG A C   1 
ATOM   2500  O O   . ARG A 1 308 ? -16.805 69.044  89.808  1.00   17.61 ? 308  ARG A O   1 
ATOM   2501  C CB  . ARG A 1 308 ? -14.137 70.120  88.706  1.00   23.15 ? 308  ARG A CB  1 
ATOM   2502  C CG  . ARG A 1 308 ? -14.420 71.345  87.877  1.00   25.42 ? 308  ARG A CG  1 
ATOM   2503  C CD  . ARG A 1 308 ? -13.974 72.585  88.616  1.00   32.36 ? 308  ARG A CD  1 
ATOM   2504  N NE  . ARG A 1 308 ? -12.629 72.996  88.234  1.00   45.04 ? 308  ARG A NE  1 
ATOM   2505  C CZ  . ARG A 1 308 ? -11.887 73.880  88.903  1.00   48.52 ? 308  ARG A CZ  1 
ATOM   2506  N NH1 . ARG A 1 308 ? -12.357 74.448  90.008  1.00   48.57 ? 308  ARG A NH1 1 
ATOM   2507  N NH2 . ARG A 1 308 ? -10.676 74.210  88.457  1.00   45.81 ? 308  ARG A NH2 1 
ATOM   2508  N N   . SER A 1 309 ? -16.909 71.189  90.364  1.00   21.42 ? 309  SER A N   1 
ATOM   2509  C CA  . SER A 1 309 ? -18.363 71.203  90.319  1.00   22.45 ? 309  SER A CA  1 
ATOM   2510  C C   . SER A 1 309 ? -18.887 71.775  89.002  1.00   22.00 ? 309  SER A C   1 
ATOM   2511  O O   . SER A 1 309 ? -18.403 72.788  88.539  1.00   20.56 ? 309  SER A O   1 
ATOM   2512  C CB  . SER A 1 309 ? -18.912 72.042  91.482  1.00   23.17 ? 309  SER A CB  1 
ATOM   2513  O OG  . SER A 1 309 ? -20.322 72.197  91.399  1.00   28.78 ? 309  SER A OG  1 
ATOM   2514  N N   . PHE A 1 310 ? -19.870 71.111  88.402  1.00   23.93 ? 310  PHE A N   1 
ATOM   2515  C CA  . PHE A 1 310 ? -20.506 71.607  87.176  1.00   26.40 ? 310  PHE A CA  1 
ATOM   2516  C C   . PHE A 1 310 ? -21.998 71.592  87.433  1.00   27.27 ? 310  PHE A C   1 
ATOM   2517  O O   . PHE A 1 310 ? -22.430 71.091  88.477  1.00   29.02 ? 310  PHE A O   1 
ATOM   2518  C CB  . PHE A 1 310 ? -20.161 70.727  85.980  1.00   24.48 ? 310  PHE A CB  1 
ATOM   2519  C CG  . PHE A 1 310 ? -18.743 70.878  85.526  1.00   24.04 ? 310  PHE A CG  1 
ATOM   2520  C CD1 . PHE A 1 310 ? -18.384 71.907  84.664  1.00   23.98 ? 310  PHE A CD1 1 
ATOM   2521  C CD2 . PHE A 1 310 ? -17.745 70.018  85.997  1.00   21.89 ? 310  PHE A CD2 1 
ATOM   2522  C CE1 . PHE A 1 310 ? -17.039 72.093  84.264  1.00   23.88 ? 310  PHE A CE1 1 
ATOM   2523  C CE2 . PHE A 1 310 ? -16.404 70.192  85.606  1.00   20.24 ? 310  PHE A CE2 1 
ATOM   2524  C CZ  . PHE A 1 310 ? -16.048 71.232  84.737  1.00   18.63 ? 310  PHE A CZ  1 
ATOM   2525  N N   . ARG A 1 311 ? -22.784 72.126  86.500  1.00   29.72 ? 311  ARG A N   1 
ATOM   2526  C CA  . ARG A 1 311 ? -24.236 72.176  86.686  1.00   31.49 ? 311  ARG A CA  1 
ATOM   2527  C C   . ARG A 1 311 ? -24.902 70.825  86.965  1.00   32.06 ? 311  ARG A C   1 
ATOM   2528  O O   . ARG A 1 311 ? -25.799 70.754  87.795  1.00   31.93 ? 311  ARG A O   1 
ATOM   2529  C CB  . ARG A 1 311 ? -24.921 72.859  85.487  1.00   33.26 ? 311  ARG A CB  1 
ATOM   2530  C CG  . ARG A 1 311 ? -26.440 72.634  85.448  1.00   33.91 ? 311  ARG A CG  1 
ATOM   2531  C CD  . ARG A 1 311 ? -27.219 73.722  84.708  1.00   33.57 ? 311  ARG A CD  1 
ATOM   2532  N NE  . ARG A 1 311 ? -27.608 73.328  83.354  1.00   34.47 ? 311  ARG A NE  1 
ATOM   2533  C CZ  . ARG A 1 311 ? -28.754 73.673  82.758  1.00   34.49 ? 311  ARG A CZ  1 
ATOM   2534  N NH1 . ARG A 1 311 ? -29.654 74.420  83.388  1.00   32.24 ? 311  ARG A NH1 1 
ATOM   2535  N NH2 . ARG A 1 311 ? -29.007 73.280  81.514  1.00   37.82 ? 311  ARG A NH2 1 
ATOM   2536  N N   . GLU A 1 312 ? -24.474 69.754  86.297  1.00   32.02 ? 312  GLU A N   1 
ATOM   2537  C CA  . GLU A 1 312 ? -25.095 68.452  86.546  1.00   32.48 ? 312  GLU A CA  1 
ATOM   2538  C C   . GLU A 1 312 ? -24.396 67.535  87.533  1.00   30.61 ? 312  GLU A C   1 
ATOM   2539  O O   . GLU A 1 312 ? -24.885 66.437  87.795  1.00   30.15 ? 312  GLU A O   1 
ATOM   2540  C CB  . GLU A 1 312 ? -25.321 67.689  85.237  1.00   36.02 ? 312  GLU A CB  1 
ATOM   2541  C CG  . GLU A 1 312 ? -26.397 68.293  84.365  1.00   42.08 ? 312  GLU A CG  1 
ATOM   2542  C CD  . GLU A 1 312 ? -27.608 68.729  85.174  1.00   46.20 ? 312  GLU A CD  1 
ATOM   2543  O OE1 . GLU A 1 312 ? -28.100 67.932  85.998  1.00   47.36 ? 312  GLU A OE1 1 
ATOM   2544  O OE2 . GLU A 1 312 ? -28.072 69.875  84.984  1.00   49.25 ? 312  GLU A OE2 1 
ATOM   2545  N N   . GLY A 1 313 ? -23.272 67.959  88.103  1.00   27.85 ? 313  GLY A N   1 
ATOM   2546  C CA  . GLY A 1 313 ? -22.603 67.087  89.047  1.00   22.98 ? 313  GLY A CA  1 
ATOM   2547  C C   . GLY A 1 313 ? -21.156 67.428  89.271  1.00   21.03 ? 313  GLY A C   1 
ATOM   2548  O O   . GLY A 1 313 ? -20.744 68.583  89.153  1.00   16.66 ? 313  GLY A O   1 
ATOM   2549  N N   . VAL A 1 314 ? -20.371 66.413  89.604  1.00   18.63 ? 314  VAL A N   1 
ATOM   2550  C CA  . VAL A 1 314 ? -18.957 66.636  89.858  1.00   18.81 ? 314  VAL A CA  1 
ATOM   2551  C C   . VAL A 1 314 ? -18.056 65.811  88.965  1.00   18.48 ? 314  VAL A C   1 
ATOM   2552  O O   . VAL A 1 314 ? -18.348 64.665  88.630  1.00   18.97 ? 314  VAL A O   1 
ATOM   2553  C CB  . VAL A 1 314 ? -18.585 66.332  91.315  1.00   19.31 ? 314  VAL A CB  1 
ATOM   2554  C CG1 . VAL A 1 314 ? -19.238 67.348  92.238  1.00   21.71 ? 314  VAL A CG1 1 
ATOM   2555  C CG2 . VAL A 1 314 ? -19.001 64.915  91.680  1.00   17.25 ? 314  VAL A CG2 1 
ATOM   2556  N N   . ARG A 1 315 ? -16.963 66.430  88.563  1.00   16.79 ? 315  ARG A N   1 
ATOM   2557  C CA  . ARG A 1 315 ? -15.975 65.762  87.737  1.00   17.92 ? 315  ARG A CA  1 
ATOM   2558  C C   . ARG A 1 315 ? -14.799 65.545  88.688  1.00   18.57 ? 315  ARG A C   1 
ATOM   2559  O O   . ARG A 1 315 ? -14.253 66.483  89.266  1.00   17.49 ? 315  ARG A O   1 
ATOM   2560  C CB  . ARG A 1 315 ? -15.596 66.644  86.561  1.00   13.05 ? 315  ARG A CB  1 
ATOM   2561  C CG  . ARG A 1 315 ? -14.628 66.011  85.612  1.00   18.30 ? 315  ARG A CG  1 
ATOM   2562  C CD  . ARG A 1 315 ? -13.366 66.849  85.567  1.00   23.95 ? 315  ARG A CD  1 
ATOM   2563  N NE  . ARG A 1 315 ? -13.465 67.895  84.569  1.00   20.38 ? 315  ARG A NE  1 
ATOM   2564  C CZ  . ARG A 1 315 ? -12.891 69.090  84.635  1.00   15.18 ? 315  ARG A CZ  1 
ATOM   2565  N NH1 . ARG A 1 315 ? -12.167 69.451  85.680  1.00   13.31 ? 315  ARG A NH1 1 
ATOM   2566  N NH2 . ARG A 1 315 ? -12.994 69.905  83.603  1.00   16.94 ? 315  ARG A NH2 1 
ATOM   2567  N N   . ILE A 1 316 ? -14.470 64.289  88.906  1.00   18.40 ? 316  ILE A N   1 
ATOM   2568  C CA  . ILE A 1 316 ? -13.387 63.936  89.794  1.00   21.00 ? 316  ILE A CA  1 
ATOM   2569  C C   . ILE A 1 316 ? -12.242 63.398  88.951  1.00   23.74 ? 316  ILE A C   1 
ATOM   2570  O O   . ILE A 1 316 ? -12.412 62.442  88.169  1.00   23.16 ? 316  ILE A O   1 
ATOM   2571  C CB  . ILE A 1 316 ? -13.823 62.852  90.829  1.00   22.21 ? 316  ILE A CB  1 
ATOM   2572  C CG1 . ILE A 1 316 ? -15.036 63.358  91.589  1.00   22.42 ? 316  ILE A CG1 1 
ATOM   2573  C CG2 . ILE A 1 316 ? -12.700 62.565  91.825  1.00   18.17 ? 316  ILE A CG2 1 
ATOM   2574  C CD1 . ILE A 1 316 ? -15.783 62.278  92.328  1.00   28.91 ? 316  ILE A CD1 1 
ATOM   2575  N N   . THR A 1 317 ? -11.094 64.050  89.105  1.00   22.79 ? 317  THR A N   1 
ATOM   2576  C CA  . THR A 1 317 ? -9.878  63.682  88.420  1.00   23.70 ? 317  THR A CA  1 
ATOM   2577  C C   . THR A 1 317 ? -9.246  62.459  89.114  1.00   23.49 ? 317  THR A C   1 
ATOM   2578  O O   . THR A 1 317 ? -9.342  62.285  90.324  1.00   25.71 ? 317  THR A O   1 
ATOM   2579  C CB  . THR A 1 317 ? -8.893  64.851  88.457  1.00   23.92 ? 317  THR A CB  1 
ATOM   2580  O OG1 . THR A 1 317 ? -9.423  65.939  87.686  1.00   30.64 ? 317  THR A OG1 1 
ATOM   2581  C CG2 . THR A 1 317 ? -7.529  64.421  87.921  1.00   22.38 ? 317  THR A CG2 1 
ATOM   2582  N N   . ILE A 1 318 ? -8.603  61.605  88.346  1.00   24.24 ? 318  ILE A N   1 
ATOM   2583  C CA  . ILE A 1 318 ? -7.955  60.442  88.904  1.00   22.07 ? 318  ILE A CA  1 
ATOM   2584  C C   . ILE A 1 318 ? -6.597  60.824  89.461  1.00   22.57 ? 318  ILE A C   1 
ATOM   2585  O O   . ILE A 1 318 ? -5.755  61.395  88.780  1.00   27.59 ? 318  ILE A O   1 
ATOM   2586  C CB  . ILE A 1 318 ? -7.789  59.363  87.817  1.00   23.95 ? 318  ILE A CB  1 
ATOM   2587  C CG1 . ILE A 1 318 ? -9.175  58.918  87.358  1.00   17.15 ? 318  ILE A CG1 1 
ATOM   2588  C CG2 . ILE A 1 318 ? -7.011  58.160  88.352  1.00   26.13 ? 318  ILE A CG2 1 
ATOM   2589  C CD1 . ILE A 1 318 ? -9.200  58.449  85.967  1.00   23.22 ? 318  ILE A CD1 1 
ATOM   2590  N N   . GLY A 1 319 ? -6.404  60.522  90.729  1.00   26.11 ? 319  GLY A N   1 
ATOM   2591  C CA  . GLY A 1 319 ? -5.136  60.801  91.365  1.00   25.63 ? 319  GLY A CA  1 
ATOM   2592  C C   . GLY A 1 319 ? -4.500  59.476  91.730  1.00   28.79 ? 319  GLY A C   1 
ATOM   2593  O O   . GLY A 1 319 ? -4.755  58.443  91.093  1.00   23.85 ? 319  GLY A O   1 
ATOM   2594  N N   . LYS A 1 320 ? -3.682  59.491  92.774  1.00   30.52 ? 320  LYS A N   1 
ATOM   2595  C CA  . LYS A 1 320 ? -3.011  58.275  93.198  1.00   34.42 ? 320  LYS A CA  1 
ATOM   2596  C C   . LYS A 1 320 ? -4.043  57.338  93.789  1.00   34.50 ? 320  LYS A C   1 
ATOM   2597  O O   . LYS A 1 320 ? -5.128  57.783  94.183  1.00   35.26 ? 320  LYS A O   1 
ATOM   2598  C CB  . LYS A 1 320 ? -1.925  58.603  94.221  1.00   36.61 ? 320  LYS A CB  1 
ATOM   2599  C CG  . LYS A 1 320 ? -0.786  59.475  93.687  1.00   39.35 ? 320  LYS A CG  1 
ATOM   2600  C CD  . LYS A 1 320 ? 0.204   59.788  94.803  1.00   45.19 ? 320  LYS A CD  1 
ATOM   2601  C CE  . LYS A 1 320 ? 1.249   60.818  94.396  1.00   46.68 ? 320  LYS A CE  1 
ATOM   2602  N NZ  . LYS A 1 320 ? 2.016   60.397  93.194  1.00   51.69 ? 320  LYS A NZ  1 
ATOM   2603  N N   . ARG A 1 321 ? -3.700  56.052  93.842  1.00   32.95 ? 321  ARG A N   1 
ATOM   2604  C CA  . ARG A 1 321 ? -4.574  55.005  94.375  1.00   35.59 ? 321  ARG A CA  1 
ATOM   2605  C C   . ARG A 1 321 ? -5.252  55.390  95.689  1.00   35.93 ? 321  ARG A C   1 
ATOM   2606  O O   . ARG A 1 321 ? -6.447  55.159  95.878  1.00   35.71 ? 321  ARG A O   1 
ATOM   2607  C CB  . ARG A 1 321 ? -3.767  53.708  94.574  1.00   39.50 ? 321  ARG A CB  1 
ATOM   2608  C CG  . ARG A 1 321 ? -4.602  52.459  94.880  1.00   44.02 ? 321  ARG A CG  1 
ATOM   2609  C CD  . ARG A 1 321 ? -3.757  51.203  94.662  1.00   53.62 ? 321  ARG A CD  1 
ATOM   2610  N NE  . ARG A 1 321 ? -2.829  51.390  93.541  1.00   62.05 ? 321  ARG A NE  1 
ATOM   2611  C CZ  . ARG A 1 321 ? -2.119  50.424  92.955  1.00   63.73 ? 321  ARG A CZ  1 
ATOM   2612  N NH1 . ARG A 1 321 ? -1.304  50.719  91.947  1.00   63.29 ? 321  ARG A NH1 1 
ATOM   2613  N NH2 . ARG A 1 321 ? -2.228  49.163  93.362  1.00   64.75 ? 321  ARG A NH2 1 
ATOM   2614  N N   . GLU A 1 322 ? -4.480  55.962  96.603  1.00   36.33 ? 322  GLU A N   1 
ATOM   2615  C CA  . GLU A 1 322 ? -5.023  56.390  97.886  1.00   37.66 ? 322  GLU A CA  1 
ATOM   2616  C C   . GLU A 1 322 ? -6.152  57.412  97.700  1.00   38.02 ? 322  GLU A C   1 
ATOM   2617  O O   . GLU A 1 322 ? -7.264  57.201  98.178  1.00   37.67 ? 322  GLU A O   1 
ATOM   2618  C CB  . GLU A 1 322 ? -3.914  57.002  98.761  1.00   39.19 ? 322  GLU A CB  1 
ATOM   2619  C CG  . GLU A 1 322 ? -2.589  57.268  98.039  1.00   44.65 ? 322  GLU A CG  1 
ATOM   2620  C CD  . GLU A 1 322 ? -1.914  55.983  97.553  1.00   48.96 ? 322  GLU A CD  1 
ATOM   2621  O OE1 . GLU A 1 322 ? -1.621  55.104  98.394  1.00   52.14 ? 322  GLU A OE1 1 
ATOM   2622  O OE2 . GLU A 1 322 ? -1.678  55.840  96.331  1.00   48.60 ? 322  GLU A OE2 1 
ATOM   2623  N N   . GLU A 1 323 ? -5.860  58.510  97.000  1.00   37.21 ? 323  GLU A N   1 
ATOM   2624  C CA  . GLU A 1 323 ? -6.839  59.571  96.765  1.00   34.96 ? 323  GLU A CA  1 
ATOM   2625  C C   . GLU A 1 323 ? -8.121  58.980  96.208  1.00   34.03 ? 323  GLU A C   1 
ATOM   2626  O O   . GLU A 1 323 ? -9.222  59.324  96.633  1.00   32.02 ? 323  GLU A O   1 
ATOM   2627  C CB  . GLU A 1 323 ? -6.253  60.606  95.801  1.00   31.85 ? 323  GLU A CB  1 
ATOM   2628  C CG  . GLU A 1 323 ? -5.020  61.282  96.379  1.00   32.57 ? 323  GLU A CG  1 
ATOM   2629  C CD  . GLU A 1 323 ? -4.215  62.083  95.370  1.00   31.29 ? 323  GLU A CD  1 
ATOM   2630  O OE1 . GLU A 1 323 ? -3.987  61.611  94.233  1.00   34.43 ? 323  GLU A OE1 1 
ATOM   2631  O OE2 . GLU A 1 323 ? -3.782  63.191  95.728  1.00   38.52 ? 323  GLU A OE2 1 
ATOM   2632  N N   . ASN A 1 324 ? -7.963  58.055  95.273  1.00   34.52 ? 324  ASN A N   1 
ATOM   2633  C CA  . ASN A 1 324 ? -9.109  57.423  94.664  1.00   35.00 ? 324  ASN A CA  1 
ATOM   2634  C C   . ASN A 1 324 ? -9.874  56.611  95.696  1.00   34.88 ? 324  ASN A C   1 
ATOM   2635  O O   . ASN A 1 324 ? -11.103 56.669  95.764  1.00   35.74 ? 324  ASN A O   1 
ATOM   2636  C CB  . ASN A 1 324 ? -8.640  56.577  93.487  1.00   33.93 ? 324  ASN A CB  1 
ATOM   2637  C CG  . ASN A 1 324 ? -7.904  57.421  92.450  1.00   35.54 ? 324  ASN A CG  1 
ATOM   2638  O OD1 . ASN A 1 324 ? -8.284  58.559  92.174  1.00   28.92 ? 324  ASN A OD1 1 
ATOM   2639  N ND2 . ASN A 1 324 ? -6.851  56.863  91.874  1.00   34.29 ? 324  ASN A ND2 1 
ATOM   2640  N N   . ASP A 1 325 ? -9.144  55.890  96.534  1.00   34.86 ? 325  ASP A N   1 
ATOM   2641  C CA  . ASP A 1 325 ? -9.782  55.091  97.570  1.00   35.81 ? 325  ASP A CA  1 
ATOM   2642  C C   . ASP A 1 325 ? -10.641 55.940  98.502  1.00   35.24 ? 325  ASP A C   1 
ATOM   2643  O O   . ASP A 1 325 ? -11.804 55.608  98.752  1.00   36.39 ? 325  ASP A O   1 
ATOM   2644  C CB  . ASP A 1 325 ? -8.738  54.345  98.402  1.00   36.21 ? 325  ASP A CB  1 
ATOM   2645  C CG  . ASP A 1 325 ? -8.183  53.118  97.696  1.00   37.22 ? 325  ASP A CG  1 
ATOM   2646  O OD1 . ASP A 1 325 ? -8.725  52.747  96.635  1.00   33.62 ? 325  ASP A OD1 1 
ATOM   2647  O OD2 . ASP A 1 325 ? -7.213  52.525  98.215  1.00   40.35 ? 325  ASP A OD2 1 
ATOM   2648  N N   . MET A 1 326 ? -10.069 57.020  99.018  1.00   32.62 ? 326  MET A N   1 
ATOM   2649  C CA  . MET A 1 326 ? -10.791 57.887  99.927  1.00   35.32 ? 326  MET A CA  1 
ATOM   2650  C C   . MET A 1 326 ? -12.012 58.468  99.231  1.00   37.13 ? 326  MET A C   1 
ATOM   2651  O O   . MET A 1 326 ? -13.052 58.675  99.864  1.00   35.45 ? 326  MET A O   1 
ATOM   2652  C CB  . MET A 1 326 ? -9.880  59.008  100.416 1.00   36.45 ? 326  MET A CB  1 
ATOM   2653  C CG  . MET A 1 326 ? -9.655  60.114  99.420  1.00   43.20 ? 326  MET A CG  1 
ATOM   2654  S SD  . MET A 1 326 ? -10.838 61.455  99.626  1.00   44.88 ? 326  MET A SD  1 
ATOM   2655  C CE  . MET A 1 326 ? -10.219 62.079  101.172 1.00   44.66 ? 326  MET A CE  1 
ATOM   2656  N N   . ILE A 1 327 ? -11.888 58.719  97.928  1.00   39.13 ? 327  ILE A N   1 
ATOM   2657  C CA  . ILE A 1 327 ? -13.003 59.249  97.149  1.00   40.58 ? 327  ILE A CA  1 
ATOM   2658  C C   . ILE A 1 327 ? -14.154 58.256  97.073  1.00   41.08 ? 327  ILE A C   1 
ATOM   2659  O O   . ILE A 1 327 ? -15.310 58.634  97.210  1.00   40.33 ? 327  ILE A O   1 
ATOM   2660  C CB  . ILE A 1 327 ? -12.590 59.589  95.719  1.00   39.59 ? 327  ILE A CB  1 
ATOM   2661  C CG1 . ILE A 1 327 ? -11.924 60.966  95.688  1.00   37.97 ? 327  ILE A CG1 1 
ATOM   2662  C CG2 . ILE A 1 327 ? -13.820 59.568  94.814  1.00   41.53 ? 327  ILE A CG2 1 
ATOM   2663  C CD1 . ILE A 1 327 ? -12.897 62.130  95.939  1.00   26.17 ? 327  ILE A CD1 1 
ATOM   2664  N N   . LEU A 1 328 ? -13.840 56.985  96.849  1.00   40.98 ? 328  LEU A N   1 
ATOM   2665  C CA  . LEU A 1 328 ? -14.891 55.991  96.764  1.00   41.38 ? 328  LEU A CA  1 
ATOM   2666  C C   . LEU A 1 328 ? -15.533 55.827  98.136  1.00   44.67 ? 328  LEU A C   1 
ATOM   2667  O O   . LEU A 1 328 ? -16.758 55.676  98.255  1.00   43.29 ? 328  LEU A O   1 
ATOM   2668  C CB  . LEU A 1 328 ? -14.319 54.666  96.283  1.00   37.16 ? 328  LEU A CB  1 
ATOM   2669  C CG  . LEU A 1 328 ? -13.952 54.603  94.797  1.00   34.71 ? 328  LEU A CG  1 
ATOM   2670  C CD1 . LEU A 1 328 ? -13.475 53.198  94.469  1.00   28.08 ? 328  LEU A CD1 1 
ATOM   2671  C CD2 . LEU A 1 328 ? -15.160 54.975  93.920  1.00   27.15 ? 328  LEU A CD2 1 
ATOM   2672  N N   . ARG A 1 329 ? -14.684 55.857  99.166  1.00   47.22 ? 329  ARG A N   1 
ATOM   2673  C CA  . ARG A 1 329 ? -15.121 55.736  100.556 1.00   47.68 ? 329  ARG A CA  1 
ATOM   2674  C C   . ARG A 1 329 ? -16.022 56.912  100.910 1.00   47.44 ? 329  ARG A C   1 
ATOM   2675  O O   . ARG A 1 329 ? -17.089 56.739  101.507 1.00   45.52 ? 329  ARG A O   1 
ATOM   2676  C CB  . ARG A 1 329 ? -13.908 55.720  101.484 1.00   49.74 ? 329  ARG A CB  1 
ATOM   2677  C CG  . ARG A 1 329 ? -13.468 54.335  101.930 1.00   55.11 ? 329  ARG A CG  1 
ATOM   2678  C CD  . ARG A 1 329 ? -12.015 54.364  102.416 1.00   58.59 ? 329  ARG A CD  1 
ATOM   2679  N NE  . ARG A 1 329 ? -11.695 55.605  103.127 1.00   60.53 ? 329  ARG A NE  1 
ATOM   2680  C CZ  . ARG A 1 329 ? -10.538 56.258  103.004 1.00   60.28 ? 329  ARG A CZ  1 
ATOM   2681  N NH1 . ARG A 1 329 ? -9.591  55.785  102.197 1.00   58.88 ? 329  ARG A NH1 1 
ATOM   2682  N NH2 . ARG A 1 329 ? -10.327 57.392  103.668 1.00   58.88 ? 329  ARG A NH2 1 
ATOM   2683  N N   . GLU A 1 330 ? -15.586 58.109  100.535 1.00   46.92 ? 330  GLU A N   1 
ATOM   2684  C CA  . GLU A 1 330 ? -16.367 59.296  100.818 1.00   48.18 ? 330  GLU A CA  1 
ATOM   2685  C C   . GLU A 1 330 ? -17.728 59.194  100.156 1.00   47.55 ? 330  GLU A C   1 
ATOM   2686  O O   . GLU A 1 330 ? -18.747 59.372  100.807 1.00   48.61 ? 330  GLU A O   1 
ATOM   2687  C CB  . GLU A 1 330 ? -15.629 60.543  100.349 1.00   50.93 ? 330  GLU A CB  1 
ATOM   2688  C CG  . GLU A 1 330 ? -14.523 60.977  101.302 1.00   54.43 ? 330  GLU A CG  1 
ATOM   2689  C CD  . GLU A 1 330 ? -15.070 61.358  102.663 1.00   58.42 ? 330  GLU A CD  1 
ATOM   2690  O OE1 . GLU A 1 330 ? -14.274 61.593  103.601 1.00   59.55 ? 330  GLU A OE1 1 
ATOM   2691  O OE2 . GLU A 1 330 ? -16.310 61.428  102.787 1.00   62.09 ? 330  GLU A OE2 1 
ATOM   2692  N N   . LEU A 1 331 ? -17.756 58.892  98.867  1.00   46.71 ? 331  LEU A N   1 
ATOM   2693  C CA  . LEU A 1 331 ? -19.036 58.758  98.183  1.00   47.74 ? 331  LEU A CA  1 
ATOM   2694  C C   . LEU A 1 331 ? -19.853 57.608  98.777  1.00   48.20 ? 331  LEU A C   1 
ATOM   2695  O O   . LEU A 1 331 ? -21.083 57.585  98.688  1.00   46.46 ? 331  LEU A O   1 
ATOM   2696  C CB  . LEU A 1 331 ? -18.819 58.531  96.684  1.00   46.55 ? 331  LEU A CB  1 
ATOM   2697  C CG  . LEU A 1 331 ? -18.274 59.779  95.978  1.00   48.10 ? 331  LEU A CG  1 
ATOM   2698  C CD1 . LEU A 1 331 ? -17.748 59.459  94.588  1.00   48.36 ? 331  LEU A CD1 1 
ATOM   2699  C CD2 . LEU A 1 331 ? -19.377 60.805  95.906  1.00   51.14 ? 331  LEU A CD2 1 
ATOM   2700  N N   . GLU A 1 332 ? -19.166 56.650  99.386  1.00   50.02 ? 332  GLU A N   1 
ATOM   2701  C CA  . GLU A 1 332 ? -19.849 55.517  99.983  1.00   52.57 ? 332  GLU A CA  1 
ATOM   2702  C C   . GLU A 1 332 ? -20.620 55.977  101.206 1.00   53.52 ? 332  GLU A C   1 
ATOM   2703  O O   . GLU A 1 332 ? -21.834 55.798  101.285 1.00   50.87 ? 332  GLU A O   1 
ATOM   2704  C CB  . GLU A 1 332 ? -18.842 54.440  100.377 1.00   54.49 ? 332  GLU A CB  1 
ATOM   2705  C CG  . GLU A 1 332 ? -19.444 53.054  100.572 1.00   57.70 ? 332  GLU A CG  1 
ATOM   2706  C CD  . GLU A 1 332 ? -18.408 52.023  101.008 1.00   63.41 ? 332  GLU A CD  1 
ATOM   2707  O OE1 . GLU A 1 332 ? -17.783 52.225  102.082 1.00   64.45 ? 332  GLU A OE1 1 
ATOM   2708  O OE2 . GLU A 1 332 ? -18.223 51.020  100.279 1.00   58.73 ? 332  GLU A OE2 1 
ATOM   2709  N N   . VAL A 1 333 ? -19.913 56.583  102.155 1.00   55.45 ? 333  VAL A N   1 
ATOM   2710  C CA  . VAL A 1 333 ? -20.551 57.051  103.375 1.00   57.23 ? 333  VAL A CA  1 
ATOM   2711  C C   . VAL A 1 333 ? -21.521 58.180  103.088 1.00   59.35 ? 333  VAL A C   1 
ATOM   2712  O O   . VAL A 1 333 ? -22.083 58.773  104.009 1.00   60.21 ? 333  VAL A O   1 
ATOM   2713  C CB  . VAL A 1 333 ? -19.512 57.528  104.407 1.00   55.48 ? 333  VAL A CB  1 
ATOM   2714  C CG1 . VAL A 1 333 ? -18.638 56.366  104.818 1.00   53.23 ? 333  VAL A CG1 1 
ATOM   2715  C CG2 . VAL A 1 333 ? -18.669 58.648  103.828 1.00   58.56 ? 333  VAL A CG2 1 
ATOM   2716  N N   . PHE A 1 334 ? -21.730 58.458  101.805 1.00   61.05 ? 334  PHE A N   1 
ATOM   2717  C CA  . PHE A 1 334 ? -22.630 59.525  101.391 1.00   61.68 ? 334  PHE A CA  1 
ATOM   2718  C C   . PHE A 1 334 ? -23.699 58.994  100.437 1.00   62.29 ? 334  PHE A C   1 
ATOM   2719  O O   . PHE A 1 334 ? -23.774 57.759  100.252 1.00   61.49 ? 334  PHE A O   1 
ATOM   2720  C CB  . PHE A 1 334 ? -21.835 60.623  100.701 1.00   61.22 ? 334  PHE A CB  1 
ATOM   2721  C CG  . PHE A 1 334 ? -22.513 61.952  100.703 1.00   63.06 ? 334  PHE A CG  1 
ATOM   2722  C CD1 . PHE A 1 334 ? -22.460 62.768  101.833 1.00   64.06 ? 334  PHE A CD1 1 
ATOM   2723  C CD2 . PHE A 1 334 ? -23.182 62.409  99.572  1.00   62.25 ? 334  PHE A CD2 1 
ATOM   2724  C CE1 . PHE A 1 334 ? -23.055 64.028  101.841 1.00   61.82 ? 334  PHE A CE1 1 
ATOM   2725  C CE2 . PHE A 1 334 ? -23.785 63.671  99.568  1.00   62.68 ? 334  PHE A CE2 1 
ATOM   2726  C CZ  . PHE A 1 334 ? -23.717 64.482  100.710 1.00   63.26 ? 334  PHE A CZ  1 
ATOM   2727  N N   . LYS A 1 335 ? -24.454 59.828  99.892  1.00   62.37 ? 335  LYS A N   1 
ATOM   2728  N N   . MET B 1 1   ? -13.195 77.354  53.847  1.00   62.56 ? 1    MET B N   1 
ATOM   2729  C CA  . MET B 1 1   ? -12.009 77.142  52.960  1.00   61.29 ? 1    MET B CA  1 
ATOM   2730  C C   . MET B 1 1   ? -11.546 78.445  52.312  1.00   59.78 ? 1    MET B C   1 
ATOM   2731  O O   . MET B 1 1   ? -10.409 78.875  52.499  1.00   58.68 ? 1    MET B O   1 
ATOM   2732  C CB  . MET B 1 1   ? -12.354 76.115  51.882  1.00   63.45 ? 1    MET B CB  1 
ATOM   2733  C CG  . MET B 1 1   ? -12.801 74.767  52.448  1.00   68.08 ? 1    MET B CG  1 
ATOM   2734  S SD  . MET B 1 1   ? -13.442 73.622  51.191  1.00   74.49 ? 1    MET B SD  1 
ATOM   2735  C CE  . MET B 1 1   ? -12.516 72.090  51.596  1.00   68.65 ? 1    MET B CE  1 
ATOM   2736  N N   . ASN B 1 2   ? -12.432 79.081  51.557  1.00   59.25 ? 2    ASN B N   1 
ATOM   2737  C CA  . ASN B 1 2   ? -12.088 80.325  50.886  1.00   56.27 ? 2    ASN B CA  1 
ATOM   2738  C C   . ASN B 1 2   ? -11.874 81.494  51.853  1.00   53.41 ? 2    ASN B C   1 
ATOM   2739  O O   . ASN B 1 2   ? -10.956 82.285  51.671  1.00   53.49 ? 2    ASN B O   1 
ATOM   2740  C CB  . ASN B 1 2   ? -13.171 80.692  49.863  1.00   60.91 ? 2    ASN B CB  1 
ATOM   2741  C CG  . ASN B 1 2   ? -12.688 81.708  48.821  1.00   64.63 ? 2    ASN B CG  1 
ATOM   2742  O OD1 . ASN B 1 2   ? -11.870 81.384  47.948  1.00   66.35 ? 2    ASN B OD1 1 
ATOM   2743  N ND2 . ASN B 1 2   ? -13.192 82.941  48.912  1.00   64.05 ? 2    ASN B ND2 1 
ATOM   2744  N N   . PRO B 1 3   ? -12.715 81.623  52.893  1.00   50.63 ? 3    PRO B N   1 
ATOM   2745  C CA  . PRO B 1 3   ? -12.535 82.733  53.831  1.00   49.12 ? 3    PRO B CA  1 
ATOM   2746  C C   . PRO B 1 3   ? -11.259 82.656  54.654  1.00   47.57 ? 3    PRO B C   1 
ATOM   2747  O O   . PRO B 1 3   ? -10.790 83.668  55.167  1.00   44.43 ? 3    PRO B O   1 
ATOM   2748  C CB  . PRO B 1 3   ? -13.795 82.664  54.697  1.00   48.62 ? 3    PRO B CB  1 
ATOM   2749  C CG  . PRO B 1 3   ? -14.803 82.108  53.775  1.00   50.55 ? 3    PRO B CG  1 
ATOM   2750  C CD  . PRO B 1 3   ? -14.023 80.989  53.114  1.00   51.55 ? 3    PRO B CD  1 
ATOM   2751  N N   . LEU B 1 4   ? -10.700 81.456  54.781  1.00   47.92 ? 4    LEU B N   1 
ATOM   2752  C CA  . LEU B 1 4   ? -9.474  81.281  55.553  1.00   48.56 ? 4    LEU B CA  1 
ATOM   2753  C C   . LEU B 1 4   ? -8.295  81.843  54.781  1.00   47.51 ? 4    LEU B C   1 
ATOM   2754  O O   . LEU B 1 4   ? -7.324  82.331  55.363  1.00   45.49 ? 4    LEU B O   1 
ATOM   2755  C CB  . LEU B 1 4   ? -9.228  79.810  55.857  1.00   51.29 ? 4    LEU B CB  1 
ATOM   2756  C CG  . LEU B 1 4   ? -10.246 79.137  56.768  1.00   54.45 ? 4    LEU B CG  1 
ATOM   2757  C CD1 . LEU B 1 4   ? -11.575 78.923  56.022  1.00   56.95 ? 4    LEU B CD1 1 
ATOM   2758  C CD2 . LEU B 1 4   ? -9.667  77.812  57.228  1.00   56.03 ? 4    LEU B CD2 1 
ATOM   2759  N N   . ASP B 1 5   ? -8.377  81.762  53.462  1.00   47.74 ? 5    ASP B N   1 
ATOM   2760  C CA  . ASP B 1 5   ? -7.321  82.309  52.640  1.00   49.66 ? 5    ASP B CA  1 
ATOM   2761  C C   . ASP B 1 5   ? -7.464  83.822  52.778  1.00   50.12 ? 5    ASP B C   1 
ATOM   2762  O O   . ASP B 1 5   ? -6.504  84.572  52.621  1.00   50.47 ? 5    ASP B O   1 
ATOM   2763  C CB  . ASP B 1 5   ? -7.497  81.910  51.178  1.00   51.19 ? 5    ASP B CB  1 
ATOM   2764  C CG  . ASP B 1 5   ? -6.271  82.226  50.346  1.00   55.18 ? 5    ASP B CG  1 
ATOM   2765  O OD1 . ASP B 1 5   ? -6.432  82.539  49.144  1.00   55.15 ? 5    ASP B OD1 1 
ATOM   2766  O OD2 . ASP B 1 5   ? -5.145  82.152  50.901  1.00   56.77 ? 5    ASP B OD2 1 
ATOM   2767  N N   . LEU B 1 6   ? -8.681  84.259  53.074  1.00   48.76 ? 6    LEU B N   1 
ATOM   2768  C CA  . LEU B 1 6   ? -8.967  85.667  53.262  1.00   49.96 ? 6    LEU B CA  1 
ATOM   2769  C C   . LEU B 1 6   ? -8.335  86.123  54.572  1.00   50.07 ? 6    LEU B C   1 
ATOM   2770  O O   . LEU B 1 6   ? -7.977  87.291  54.721  1.00   51.11 ? 6    LEU B O   1 
ATOM   2771  C CB  . LEU B 1 6   ? -10.484 85.884  53.296  1.00   52.17 ? 6    LEU B CB  1 
ATOM   2772  C CG  . LEU B 1 6   ? -11.113 86.605  54.493  1.00   52.66 ? 6    LEU B CG  1 
ATOM   2773  C CD1 . LEU B 1 6   ? -10.793 88.107  54.453  1.00   50.10 ? 6    LEU B CD1 1 
ATOM   2774  C CD2 . LEU B 1 6   ? -12.630 86.384  54.456  1.00   53.66 ? 6    LEU B CD2 1 
ATOM   2775  N N   . ILE B 1 7   ? -8.216  85.194  55.521  1.00   50.09 ? 7    ILE B N   1 
ATOM   2776  C CA  . ILE B 1 7   ? -7.606  85.479  56.819  1.00   48.29 ? 7    ILE B CA  1 
ATOM   2777  C C   . ILE B 1 7   ? -6.147  85.717  56.503  1.00   48.04 ? 7    ILE B C   1 
ATOM   2778  O O   . ILE B 1 7   ? -5.542  86.687  56.961  1.00   47.93 ? 7    ILE B O   1 
ATOM   2779  C CB  . ILE B 1 7   ? -7.755  84.284  57.774  1.00   48.05 ? 7    ILE B CB  1 
ATOM   2780  C CG1 . ILE B 1 7   ? -9.244  83.989  57.996  1.00   46.80 ? 7    ILE B CG1 1 
ATOM   2781  C CG2 . ILE B 1 7   ? -7.058  84.573  59.087  1.00   47.59 ? 7    ILE B CG2 1 
ATOM   2782  C CD1 . ILE B 1 7   ? -10.054 85.185  58.493  1.00   46.36 ? 7    ILE B CD1 1 
ATOM   2783  N N   . ALA B 1 8   ? -5.586  84.819  55.702  1.00   48.00 ? 8    ALA B N   1 
ATOM   2784  C CA  . ALA B 1 8   ? -4.214  84.967  55.256  1.00   46.91 ? 8    ALA B CA  1 
ATOM   2785  C C   . ALA B 1 8   ? -4.411  86.136  54.301  1.00   47.20 ? 8    ALA B C   1 
ATOM   2786  O O   . ALA B 1 8   ? -5.529  86.623  54.167  1.00   49.58 ? 8    ALA B O   1 
ATOM   2787  C CB  . ALA B 1 8   ? -3.774  83.725  54.504  1.00   47.60 ? 8    ALA B CB  1 
ATOM   2788  N N   . LYS B 1 9   ? -3.364  86.600  53.636  1.00   46.44 ? 9    LYS B N   1 
ATOM   2789  C CA  . LYS B 1 9   ? -3.539  87.732  52.729  1.00   45.09 ? 9    LYS B CA  1 
ATOM   2790  C C   . LYS B 1 9   ? -3.949  89.016  53.471  1.00   42.43 ? 9    LYS B C   1 
ATOM   2791  O O   . LYS B 1 9   ? -3.852  90.111  52.924  1.00   44.33 ? 9    LYS B O   1 
ATOM   2792  C CB  . LYS B 1 9   ? -4.575  87.388  51.654  1.00   45.91 ? 9    LYS B CB  1 
ATOM   2793  C CG  . LYS B 1 9   ? -4.136  86.250  50.753  1.00   49.03 ? 9    LYS B CG  1 
ATOM   2794  C CD  . LYS B 1 9   ? -5.130  85.998  49.643  1.00   51.73 ? 9    LYS B CD  1 
ATOM   2795  C CE  . LYS B 1 9   ? -4.718  84.801  48.805  1.00   51.50 ? 9    LYS B CE  1 
ATOM   2796  N NZ  . LYS B 1 9   ? -5.711  84.548  47.718  1.00   56.43 ? 9    LYS B NZ  1 
ATOM   2797  N N   . ARG B 1 10  ? -4.426  88.877  54.706  1.00   39.78 ? 10   ARG B N   1 
ATOM   2798  C CA  . ARG B 1 10  ? -4.796  90.031  55.529  1.00   36.48 ? 10   ARG B CA  1 
ATOM   2799  C C   . ARG B 1 10  ? -3.644  90.257  56.530  1.00   35.35 ? 10   ARG B C   1 
ATOM   2800  O O   . ARG B 1 10  ? -3.443  91.354  57.058  1.00   34.22 ? 10   ARG B O   1 
ATOM   2801  C CB  . ARG B 1 10  ? -6.071  89.750  56.334  1.00   35.02 ? 10   ARG B CB  1 
ATOM   2802  C CG  . ARG B 1 10  ? -5.795  89.426  57.814  1.00   34.50 ? 10   ARG B CG  1 
ATOM   2803  C CD  . ARG B 1 10  ? -7.061  89.226  58.613  1.00   38.08 ? 10   ARG B CD  1 
ATOM   2804  N NE  . ARG B 1 10  ? -6.781  88.686  59.939  1.00   45.91 ? 10   ARG B NE  1 
ATOM   2805  C CZ  . ARG B 1 10  ? -7.709  88.470  60.871  1.00   51.16 ? 10   ARG B CZ  1 
ATOM   2806  N NH1 . ARG B 1 10  ? -7.371  87.968  62.056  1.00   47.98 ? 10   ARG B NH1 1 
ATOM   2807  N NH2 . ARG B 1 10  ? -8.983  88.763  60.622  1.00   50.38 ? 10   ARG B NH2 1 
ATOM   2808  N N   . ALA B 1 11  ? -2.910  89.188  56.814  1.00   31.47 ? 11   ALA B N   1 
ATOM   2809  C CA  . ALA B 1 11  ? -1.809  89.265  57.758  1.00   29.94 ? 11   ALA B CA  1 
ATOM   2810  C C   . ALA B 1 11  ? -0.536  88.926  57.052  1.00   26.35 ? 11   ALA B C   1 
ATOM   2811  O O   . ALA B 1 11  ? -0.558  88.259  56.031  1.00   30.31 ? 11   ALA B O   1 
ATOM   2812  C CB  . ALA B 1 11  ? -2.025  88.281  58.916  1.00   29.04 ? 11   ALA B CB  1 
ATOM   2813  N N   . TYR B 1 12  ? 0.582   89.376  57.591  1.00   23.31 ? 12   TYR B N   1 
ATOM   2814  C CA  . TYR B 1 12  ? 1.848   89.043  56.983  1.00   22.35 ? 12   TYR B CA  1 
ATOM   2815  C C   . TYR B 1 12  ? 2.110   87.570  57.146  1.00   23.36 ? 12   TYR B C   1 
ATOM   2816  O O   . TYR B 1 12  ? 1.731   86.953  58.144  1.00   23.97 ? 12   TYR B O   1 
ATOM   2817  C CB  . TYR B 1 12  ? 2.987   89.803  57.624  1.00   18.03 ? 12   TYR B CB  1 
ATOM   2818  C CG  . TYR B 1 12  ? 3.016   91.258  57.247  1.00   17.91 ? 12   TYR B CG  1 
ATOM   2819  C CD1 . TYR B 1 12  ? 2.114   92.157  57.818  1.00   18.79 ? 12   TYR B CD1 1 
ATOM   2820  C CD2 . TYR B 1 12  ? 4.013   91.763  56.402  1.00   16.87 ? 12   TYR B CD2 1 
ATOM   2821  C CE1 . TYR B 1 12  ? 2.206   93.528  57.579  1.00   22.54 ? 12   TYR B CE1 1 
ATOM   2822  C CE2 . TYR B 1 12  ? 4.120   93.140  56.153  1.00   23.87 ? 12   TYR B CE2 1 
ATOM   2823  C CZ  . TYR B 1 12  ? 3.213   94.013  56.756  1.00   21.43 ? 12   TYR B CZ  1 
ATOM   2824  O OH  . TYR B 1 12  ? 3.350   95.363  56.591  1.00   27.76 ? 12   TYR B OH  1 
ATOM   2825  N N   . PRO B 1 13  ? 2.748   86.977  56.139  1.00   25.13 ? 13   PRO B N   1 
ATOM   2826  C CA  . PRO B 1 13  ? 3.072   85.553  56.184  1.00   25.03 ? 13   PRO B CA  1 
ATOM   2827  C C   . PRO B 1 13  ? 4.047   85.265  57.321  1.00   27.41 ? 13   PRO B C   1 
ATOM   2828  O O   . PRO B 1 13  ? 4.922   86.085  57.652  1.00   28.34 ? 13   PRO B O   1 
ATOM   2829  C CB  . PRO B 1 13  ? 3.679   85.295  54.810  1.00   28.06 ? 13   PRO B CB  1 
ATOM   2830  C CG  . PRO B 1 13  ? 4.235   86.688  54.392  1.00   21.73 ? 13   PRO B CG  1 
ATOM   2831  C CD  . PRO B 1 13  ? 3.144   87.592  54.851  1.00   21.23 ? 13   PRO B CD  1 
ATOM   2832  N N   . TYR B 1 14  ? 3.863   84.108  57.935  1.00   28.52 ? 14   TYR B N   1 
ATOM   2833  C CA  . TYR B 1 14  ? 4.710   83.675  59.030  1.00   28.68 ? 14   TYR B CA  1 
ATOM   2834  C C   . TYR B 1 14  ? 6.045   83.195  58.480  1.00   30.65 ? 14   TYR B C   1 
ATOM   2835  O O   . TYR B 1 14  ? 6.110   82.372  57.570  1.00   29.85 ? 14   TYR B O   1 
ATOM   2836  C CB  . TYR B 1 14  ? 4.055   82.517  59.784  1.00   27.02 ? 14   TYR B CB  1 
ATOM   2837  C CG  . TYR B 1 14  ? 5.012   81.825  60.734  1.00   22.20 ? 14   TYR B CG  1 
ATOM   2838  C CD1 . TYR B 1 14  ? 5.405   82.444  61.915  1.00   23.65 ? 14   TYR B CD1 1 
ATOM   2839  C CD2 . TYR B 1 14  ? 5.531   80.564  60.442  1.00   16.57 ? 14   TYR B CD2 1 
ATOM   2840  C CE1 . TYR B 1 14  ? 6.283   81.840  62.794  1.00   18.59 ? 14   TYR B CE1 1 
ATOM   2841  C CE2 . TYR B 1 14  ? 6.421   79.937  61.320  1.00   20.96 ? 14   TYR B CE2 1 
ATOM   2842  C CZ  . TYR B 1 14  ? 6.789   80.586  62.502  1.00   20.80 ? 14   TYR B CZ  1 
ATOM   2843  O OH  . TYR B 1 14  ? 7.637   79.997  63.408  1.00   18.55 ? 14   TYR B OH  1 
ATOM   2844  N N   . GLU B 1 15  ? 7.118   83.707  59.049  1.00   33.44 ? 15   GLU B N   1 
ATOM   2845  C CA  . GLU B 1 15  ? 8.445   83.321  58.616  1.00   36.11 ? 15   GLU B CA  1 
ATOM   2846  C C   . GLU B 1 15  ? 9.368   83.257  59.826  1.00   36.30 ? 15   GLU B C   1 
ATOM   2847  O O   . GLU B 1 15  ? 9.102   83.872  60.853  1.00   36.27 ? 15   GLU B O   1 
ATOM   2848  C CB  . GLU B 1 15  ? 8.972   84.350  57.615  1.00   40.77 ? 15   GLU B CB  1 
ATOM   2849  C CG  . GLU B 1 15  ? 8.226   84.415  56.273  1.00   45.89 ? 15   GLU B CG  1 
ATOM   2850  C CD  . GLU B 1 15  ? 8.658   85.621  55.425  1.00   51.77 ? 15   GLU B CD  1 
ATOM   2851  O OE1 . GLU B 1 15  ? 9.874   85.922  55.389  1.00   54.49 ? 15   GLU B OE1 1 
ATOM   2852  O OE2 . GLU B 1 15  ? 7.789   86.269  54.793  1.00   51.89 ? 15   GLU B OE2 1 
ATOM   2853  N N   . THR B 1 16  ? 10.445  82.494  59.705  1.00   36.34 ? 16   THR B N   1 
ATOM   2854  C CA  . THR B 1 16  ? 11.421  82.396  60.773  1.00   37.07 ? 16   THR B CA  1 
ATOM   2855  C C   . THR B 1 16  ? 12.740  82.997  60.274  1.00   37.54 ? 16   THR B C   1 
ATOM   2856  O O   . THR B 1 16  ? 13.007  83.013  59.075  1.00   36.70 ? 16   THR B O   1 
ATOM   2857  C CB  . THR B 1 16  ? 11.612  80.932  61.228  1.00   40.46 ? 16   THR B CB  1 
ATOM   2858  O OG1 . THR B 1 16  ? 11.872  80.099  60.096  1.00   40.96 ? 16   THR B OG1 1 
ATOM   2859  C CG2 . THR B 1 16  ? 10.357  80.432  61.940  1.00   40.52 ? 16   THR B CG2 1 
ATOM   2860  N N   . GLU B 1 17  ? 13.551  83.505  61.195  1.00   39.30 ? 17   GLU B N   1 
ATOM   2861  C CA  . GLU B 1 17  ? 14.818  84.144  60.846  1.00   40.52 ? 17   GLU B CA  1 
ATOM   2862  C C   . GLU B 1 17  ? 15.902  83.105  60.629  1.00   40.93 ? 17   GLU B C   1 
ATOM   2863  O O   . GLU B 1 17  ? 15.880  82.043  61.232  1.00   39.84 ? 17   GLU B O   1 
ATOM   2864  C CB  . GLU B 1 17  ? 15.278  85.077  61.983  1.00   45.26 ? 17   GLU B CB  1 
ATOM   2865  C CG  . GLU B 1 17  ? 14.199  85.961  62.642  1.00   50.49 ? 17   GLU B CG  1 
ATOM   2866  C CD  . GLU B 1 17  ? 13.828  87.175  61.817  1.00   53.82 ? 17   GLU B CD  1 
ATOM   2867  O OE1 . GLU B 1 17  ? 13.114  88.060  62.345  1.00   49.51 ? 17   GLU B OE1 1 
ATOM   2868  O OE2 . GLU B 1 17  ? 14.252  87.234  60.641  1.00   58.68 ? 17   GLU B OE2 1 
ATOM   2869  N N   . LYS B 1 18  ? 16.860  83.423  59.771  1.00   43.42 ? 18   LYS B N   1 
ATOM   2870  C CA  . LYS B 1 18  ? 17.992  82.539  59.504  1.00   44.48 ? 18   LYS B CA  1 
ATOM   2871  C C   . LYS B 1 18  ? 19.207  83.318  59.986  1.00   42.75 ? 18   LYS B C   1 
ATOM   2872  O O   . LYS B 1 18  ? 19.788  84.100  59.246  1.00   46.36 ? 18   LYS B O   1 
ATOM   2873  C CB  . LYS B 1 18  ? 18.097  82.243  58.012  1.00   45.28 ? 18   LYS B CB  1 
ATOM   2874  C CG  . LYS B 1 18  ? 16.880  81.523  57.452  1.00   50.07 ? 18   LYS B CG  1 
ATOM   2875  C CD  . LYS B 1 18  ? 17.080  81.119  55.994  1.00   51.85 ? 18   LYS B CD  1 
ATOM   2876  C CE  . LYS B 1 18  ? 15.919  80.275  55.496  1.00   52.75 ? 18   LYS B CE  1 
ATOM   2877  N NZ  . LYS B 1 18  ? 16.164  79.737  54.132  1.00   53.62 ? 18   LYS B NZ  1 
ATOM   2878  N N   . ARG B 1 19  ? 19.576  83.088  61.238  1.00   41.08 ? 19   ARG B N   1 
ATOM   2879  C CA  . ARG B 1 19  ? 20.679  83.798  61.886  1.00   39.43 ? 19   ARG B CA  1 
ATOM   2880  C C   . ARG B 1 19  ? 22.064  83.636  61.272  1.00   38.74 ? 19   ARG B C   1 
ATOM   2881  O O   . ARG B 1 19  ? 22.515  82.527  61.004  1.00   40.56 ? 19   ARG B O   1 
ATOM   2882  C CB  . ARG B 1 19  ? 20.728  83.401  63.358  1.00   35.63 ? 19   ARG B CB  1 
ATOM   2883  C CG  . ARG B 1 19  ? 19.368  83.459  64.026  1.00   35.77 ? 19   ARG B CG  1 
ATOM   2884  C CD  . ARG B 1 19  ? 19.400  82.786  65.371  1.00   34.74 ? 19   ARG B CD  1 
ATOM   2885  N NE  . ARG B 1 19  ? 20.193  83.557  66.318  1.00   41.29 ? 19   ARG B NE  1 
ATOM   2886  C CZ  . ARG B 1 19  ? 19.784  84.691  66.873  1.00   36.80 ? 19   ARG B CZ  1 
ATOM   2887  N NH1 . ARG B 1 19  ? 18.580  85.173  66.570  1.00   27.37 ? 19   ARG B NH1 1 
ATOM   2888  N NH2 . ARG B 1 19  ? 20.580  85.329  67.728  1.00   33.84 ? 19   ARG B NH2 1 
ATOM   2889  N N   . ASP B 1 20  ? 22.753  84.749  61.066  1.00   37.58 ? 20   ASP B N   1 
ATOM   2890  C CA  . ASP B 1 20  ? 24.092  84.673  60.519  1.00   34.25 ? 20   ASP B CA  1 
ATOM   2891  C C   . ASP B 1 20  ? 25.068  84.414  61.660  1.00   30.79 ? 20   ASP B C   1 
ATOM   2892  O O   . ASP B 1 20  ? 24.668  84.276  62.804  1.00   30.83 ? 20   ASP B O   1 
ATOM   2893  C CB  . ASP B 1 20  ? 24.460  85.970  59.812  1.00   37.95 ? 20   ASP B CB  1 
ATOM   2894  C CG  . ASP B 1 20  ? 25.360  85.731  58.618  1.00   42.21 ? 20   ASP B CG  1 
ATOM   2895  O OD1 . ASP B 1 20  ? 26.145  84.733  58.659  1.00   39.22 ? 20   ASP B OD1 1 
ATOM   2896  O OD2 . ASP B 1 20  ? 25.276  86.540  57.659  1.00   41.00 ? 20   ASP B OD2 1 
ATOM   2897  N N   . LYS B 1 21  ? 26.351  84.349  61.342  1.00   27.91 ? 21   LYS B N   1 
ATOM   2898  C CA  . LYS B 1 21  ? 27.369  84.097  62.345  1.00   26.08 ? 21   LYS B CA  1 
ATOM   2899  C C   . LYS B 1 21  ? 27.423  85.186  63.387  1.00   23.81 ? 21   LYS B C   1 
ATOM   2900  O O   . LYS B 1 21  ? 27.632  84.905  64.554  1.00   22.93 ? 21   LYS B O   1 
ATOM   2901  C CB  . LYS B 1 21  ? 28.724  83.919  61.672  1.00   29.91 ? 21   LYS B CB  1 
ATOM   2902  C CG  . LYS B 1 21  ? 28.885  82.506  61.153  1.00   32.12 ? 21   LYS B CG  1 
ATOM   2903  C CD  . LYS B 1 21  ? 30.055  82.329  60.205  1.00   33.95 ? 21   LYS B CD  1 
ATOM   2904  C CE  . LYS B 1 21  ? 30.157  80.857  59.813  1.00   33.81 ? 21   LYS B CE  1 
ATOM   2905  N NZ  . LYS B 1 21  ? 31.194  80.610  58.798  1.00   34.23 ? 21   LYS B NZ  1 
ATOM   2906  N N   . THR B 1 22  ? 27.262  86.431  62.959  1.00   22.09 ? 22   THR B N   1 
ATOM   2907  C CA  . THR B 1 22  ? 27.237  87.538  63.887  1.00   22.52 ? 22   THR B CA  1 
ATOM   2908  C C   . THR B 1 22  ? 25.859  88.193  63.658  1.00   19.47 ? 22   THR B C   1 
ATOM   2909  O O   . THR B 1 22  ? 25.618  88.899  62.679  1.00   22.50 ? 22   THR B O   1 
ATOM   2910  C CB  . THR B 1 22  ? 28.452  88.476  63.660  1.00   24.77 ? 22   THR B CB  1 
ATOM   2911  O OG1 . THR B 1 22  ? 28.205  89.764  64.226  1.00   28.66 ? 22   THR B OG1 1 
ATOM   2912  C CG2 . THR B 1 22  ? 28.725  88.638  62.226  1.00   33.49 ? 22   THR B CG2 1 
ATOM   2913  N N   . TYR B 1 23  ? 24.946  87.878  64.564  1.00   18.90 ? 23   TYR B N   1 
ATOM   2914  C CA  . TYR B 1 23  ? 23.567  88.360  64.518  1.00   19.10 ? 23   TYR B CA  1 
ATOM   2915  C C   . TYR B 1 23  ? 23.361  89.552  65.420  1.00   17.54 ? 23   TYR B C   1 
ATOM   2916  O O   . TYR B 1 23  ? 23.494  89.454  66.624  1.00   18.82 ? 23   TYR B O   1 
ATOM   2917  C CB  . TYR B 1 23  ? 22.600  87.256  64.946  1.00   16.30 ? 23   TYR B CB  1 
ATOM   2918  C CG  . TYR B 1 23  ? 21.230  87.404  64.333  1.00   20.05 ? 23   TYR B CG  1 
ATOM   2919  C CD1 . TYR B 1 23  ? 21.051  87.221  62.972  1.00   20.94 ? 23   TYR B CD1 1 
ATOM   2920  C CD2 . TYR B 1 23  ? 20.118  87.774  65.109  1.00   19.67 ? 23   TYR B CD2 1 
ATOM   2921  C CE1 . TYR B 1 23  ? 19.807  87.402  62.382  1.00   23.23 ? 23   TYR B CE1 1 
ATOM   2922  C CE2 . TYR B 1 23  ? 18.843  87.969  64.521  1.00   19.46 ? 23   TYR B CE2 1 
ATOM   2923  C CZ  . TYR B 1 23  ? 18.715  87.781  63.153  1.00   22.17 ? 23   TYR B CZ  1 
ATOM   2924  O OH  . TYR B 1 23  ? 17.513  88.011  62.518  1.00   30.63 ? 23   TYR B OH  1 
ATOM   2925  N N   . LEU B 1 24  ? 23.000  90.677  64.827  1.00   20.32 ? 24   LEU B N   1 
ATOM   2926  C CA  . LEU B 1 24  ? 22.770  91.910  65.574  1.00   19.76 ? 24   LEU B CA  1 
ATOM   2927  C C   . LEU B 1 24  ? 21.515  92.570  65.008  1.00   19.34 ? 24   LEU B C   1 
ATOM   2928  O O   . LEU B 1 24  ? 21.464  93.798  64.871  1.00   16.39 ? 24   LEU B O   1 
ATOM   2929  C CB  . LEU B 1 24  ? 23.973  92.839  65.384  1.00   21.68 ? 24   LEU B CB  1 
ATOM   2930  C CG  . LEU B 1 24  ? 25.331  92.283  65.815  1.00   21.19 ? 24   LEU B CG  1 
ATOM   2931  C CD1 . LEU B 1 24  ? 26.412  93.044  65.099  1.00   24.21 ? 24   LEU B CD1 1 
ATOM   2932  C CD2 . LEU B 1 24  ? 25.496  92.393  67.323  1.00   23.94 ? 24   LEU B CD2 1 
ATOM   2933  N N   . ALA B 1 25  ? 20.502  91.763  64.685  1.00   20.14 ? 25   ALA B N   1 
ATOM   2934  C CA  . ALA B 1 25  ? 19.288  92.310  64.084  1.00   22.51 ? 25   ALA B CA  1 
ATOM   2935  C C   . ALA B 1 25  ? 17.982  92.208  64.868  1.00   22.08 ? 25   ALA B C   1 
ATOM   2936  O O   . ALA B 1 25  ? 16.944  92.646  64.365  1.00   25.81 ? 25   ALA B O   1 
ATOM   2937  C CB  . ALA B 1 25  ? 19.081  91.703  62.671  1.00   18.89 ? 25   ALA B CB  1 
ATOM   2938  N N   . LEU B 1 26  ? 18.038  91.673  66.085  1.00   23.24 ? 26   LEU B N   1 
ATOM   2939  C CA  . LEU B 1 26  ? 16.843  91.486  66.921  1.00   21.91 ? 26   LEU B CA  1 
ATOM   2940  C C   . LEU B 1 26  ? 16.932  91.988  68.355  1.00   23.17 ? 26   LEU B C   1 
ATOM   2941  O O   . LEU B 1 26  ? 16.205  91.486  69.221  1.00   23.78 ? 26   LEU B O   1 
ATOM   2942  C CB  . LEU B 1 26  ? 16.468  90.008  66.990  1.00   21.23 ? 26   LEU B CB  1 
ATOM   2943  C CG  . LEU B 1 26  ? 15.575  89.396  65.900  1.00   26.52 ? 26   LEU B CG  1 
ATOM   2944  C CD1 . LEU B 1 26  ? 15.394  87.893  66.190  1.00   21.98 ? 26   LEU B CD1 1 
ATOM   2945  C CD2 . LEU B 1 26  ? 14.224  90.111  65.862  1.00   17.79 ? 26   LEU B CD2 1 
ATOM   2946  N N   . ASN B 1 27  ? 17.809  92.942  68.617  1.00   19.91 ? 27   ASN B N   1 
ATOM   2947  C CA  . ASN B 1 27  ? 17.963  93.491  69.962  1.00   21.96 ? 27   ASN B CA  1 
ATOM   2948  C C   . ASN B 1 27  ? 18.058  92.479  71.108  1.00   22.80 ? 27   ASN B C   1 
ATOM   2949  O O   . ASN B 1 27  ? 17.569  92.744  72.208  1.00   23.25 ? 27   ASN B O   1 
ATOM   2950  C CB  . ASN B 1 27  ? 16.834  94.483  70.277  1.00   20.26 ? 27   ASN B CB  1 
ATOM   2951  C CG  . ASN B 1 27  ? 16.886  95.715  69.401  1.00   21.73 ? 27   ASN B CG  1 
ATOM   2952  O OD1 . ASN B 1 27  ? 15.880  96.396  69.213  1.00   23.36 ? 27   ASN B OD1 1 
ATOM   2953  N ND2 . ASN B 1 27  ? 18.062  96.007  68.859  1.00   16.21 ? 27   ASN B ND2 1 
ATOM   2954  N N   . GLU B 1 28  ? 18.676  91.328  70.857  1.00   22.58 ? 28   GLU B N   1 
ATOM   2955  C CA  . GLU B 1 28  ? 18.854  90.330  71.897  1.00   23.88 ? 28   GLU B CA  1 
ATOM   2956  C C   . GLU B 1 28  ? 20.103  90.698  72.720  1.00   23.60 ? 28   GLU B C   1 
ATOM   2957  O O   . GLU B 1 28  ? 21.010  91.357  72.213  1.00   23.78 ? 28   GLU B O   1 
ATOM   2958  C CB  . GLU B 1 28  ? 19.049  88.952  71.255  1.00   27.92 ? 28   GLU B CB  1 
ATOM   2959  C CG  . GLU B 1 28  ? 17.907  88.548  70.327  1.00   26.26 ? 28   GLU B CG  1 
ATOM   2960  C CD  . GLU B 1 28  ? 18.302  87.488  69.310  1.00   24.20 ? 28   GLU B CD  1 
ATOM   2961  O OE1 . GLU B 1 28  ? 19.374  87.615  68.669  1.00   20.59 ? 28   GLU B OE1 1 
ATOM   2962  O OE2 . GLU B 1 28  ? 17.520  86.536  69.133  1.00   25.22 ? 28   GLU B OE2 1 
ATOM   2963  N N   . ASN B 1 29  ? 20.117  90.297  73.992  1.00   24.27 ? 29   ASN B N   1 
ATOM   2964  C CA  . ASN B 1 29  ? 21.255  90.514  74.890  1.00   22.81 ? 29   ASN B CA  1 
ATOM   2965  C C   . ASN B 1 29  ? 22.384  89.642  74.328  1.00   23.88 ? 29   ASN B C   1 
ATOM   2966  O O   . ASN B 1 29  ? 22.148  88.506  73.873  1.00   24.81 ? 29   ASN B O   1 
ATOM   2967  C CB  . ASN B 1 29  ? 20.897  90.065  76.308  1.00   24.70 ? 29   ASN B CB  1 
ATOM   2968  C CG  . ASN B 1 29  ? 21.881  90.559  77.350  1.00   23.96 ? 29   ASN B CG  1 
ATOM   2969  O OD1 . ASN B 1 29  ? 23.051  90.166  77.374  1.00   24.75 ? 29   ASN B OD1 1 
ATOM   2970  N ND2 . ASN B 1 29  ? 21.403  91.426  78.231  1.00   18.93 ? 29   ASN B ND2 1 
ATOM   2971  N N   . PRO B 1 30  ? 23.629  90.158  74.349  1.00   23.88 ? 30   PRO B N   1 
ATOM   2972  C CA  . PRO B 1 30  ? 24.786  89.408  73.822  1.00   22.74 ? 30   PRO B CA  1 
ATOM   2973  C C   . PRO B 1 30  ? 25.270  88.212  74.624  1.00   23.47 ? 30   PRO B C   1 
ATOM   2974  O O   . PRO B 1 30  ? 25.857  87.288  74.062  1.00   20.27 ? 30   PRO B O   1 
ATOM   2975  C CB  . PRO B 1 30  ? 25.868  90.481  73.682  1.00   23.80 ? 30   PRO B CB  1 
ATOM   2976  C CG  . PRO B 1 30  ? 25.534  91.462  74.788  1.00   23.33 ? 30   PRO B CG  1 
ATOM   2977  C CD  . PRO B 1 30  ? 24.014  91.504  74.815  1.00   20.63 ? 30   PRO B CD  1 
ATOM   2978  N N   . PHE B 1 31  ? 25.000  88.219  75.926  1.00   25.85 ? 31   PHE B N   1 
ATOM   2979  C CA  . PHE B 1 31  ? 25.467  87.168  76.829  1.00   27.26 ? 31   PHE B CA  1 
ATOM   2980  C C   . PHE B 1 31  ? 24.400  86.144  77.129  1.00   27.04 ? 31   PHE B C   1 
ATOM   2981  O O   . PHE B 1 31  ? 23.230  86.478  77.253  1.00   30.69 ? 31   PHE B O   1 
ATOM   2982  C CB  . PHE B 1 31  ? 25.946  87.799  78.142  1.00   25.22 ? 31   PHE B CB  1 
ATOM   2983  C CG  . PHE B 1 31  ? 26.828  89.003  77.942  1.00   25.91 ? 31   PHE B CG  1 
ATOM   2984  C CD1 . PHE B 1 31  ? 26.443  90.246  78.435  1.00   24.06 ? 31   PHE B CD1 1 
ATOM   2985  C CD2 . PHE B 1 31  ? 28.026  88.901  77.229  1.00   26.45 ? 31   PHE B CD2 1 
ATOM   2986  C CE1 . PHE B 1 31  ? 27.235  91.386  78.218  1.00   22.86 ? 31   PHE B CE1 1 
ATOM   2987  C CE2 . PHE B 1 31  ? 28.823  90.033  77.007  1.00   26.02 ? 31   PHE B CE2 1 
ATOM   2988  C CZ  . PHE B 1 31  ? 28.422  91.280  77.503  1.00   20.39 ? 31   PHE B CZ  1 
ATOM   2989  N N   . PRO B 1 32  ? 24.793  84.872  77.256  1.00   25.33 ? 32   PRO B N   1 
ATOM   2990  C CA  . PRO B 1 32  ? 23.789  83.850  77.549  1.00   24.00 ? 32   PRO B CA  1 
ATOM   2991  C C   . PRO B 1 32  ? 23.292  84.042  78.970  1.00   25.06 ? 32   PRO B C   1 
ATOM   2992  O O   . PRO B 1 32  ? 23.882  84.788  79.771  1.00   25.04 ? 32   PRO B O   1 
ATOM   2993  C CB  . PRO B 1 32  ? 24.570  82.548  77.389  1.00   24.52 ? 32   PRO B CB  1 
ATOM   2994  C CG  . PRO B 1 32  ? 25.936  82.902  77.795  1.00   19.22 ? 32   PRO B CG  1 
ATOM   2995  C CD  . PRO B 1 32  ? 26.145  84.294  77.207  1.00   23.55 ? 32   PRO B CD  1 
ATOM   2996  N N   . PHE B 1 33  ? 22.175  83.408  79.280  1.00   20.28 ? 33   PHE B N   1 
ATOM   2997  C CA  . PHE B 1 33  ? 21.707  83.500  80.641  1.00   19.93 ? 33   PHE B CA  1 
ATOM   2998  C C   . PHE B 1 33  ? 22.836  82.876  81.480  1.00   20.50 ? 33   PHE B C   1 
ATOM   2999  O O   . PHE B 1 33  ? 23.426  81.844  81.109  1.00   18.53 ? 33   PHE B O   1 
ATOM   3000  C CB  . PHE B 1 33  ? 20.425  82.694  80.840  1.00   15.30 ? 33   PHE B CB  1 
ATOM   3001  C CG  . PHE B 1 33  ? 19.759  82.965  82.148  1.00   15.24 ? 33   PHE B CG  1 
ATOM   3002  C CD1 . PHE B 1 33  ? 19.171  84.198  82.399  1.00   10.66 ? 33   PHE B CD1 1 
ATOM   3003  C CD2 . PHE B 1 33  ? 19.755  82.001  83.138  1.00   12.63 ? 33   PHE B CD2 1 
ATOM   3004  C CE1 . PHE B 1 33  ? 18.591  84.462  83.610  1.00   12.29 ? 33   PHE B CE1 1 
ATOM   3005  C CE2 . PHE B 1 33  ? 19.176  82.254  84.356  1.00   13.75 ? 33   PHE B CE2 1 
ATOM   3006  C CZ  . PHE B 1 33  ? 18.593  83.481  84.597  1.00   16.33 ? 33   PHE B CZ  1 
ATOM   3007  N N   . PRO B 1 34  ? 23.147  83.496  82.625  1.00   20.80 ? 34   PRO B N   1 
ATOM   3008  C CA  . PRO B 1 34  ? 24.212  82.971  83.492  1.00   22.74 ? 34   PRO B CA  1 
ATOM   3009  C C   . PRO B 1 34  ? 24.038  81.476  83.786  1.00   24.08 ? 34   PRO B C   1 
ATOM   3010  O O   . PRO B 1 34  ? 23.012  81.027  84.311  1.00   24.86 ? 34   PRO B O   1 
ATOM   3011  C CB  . PRO B 1 34  ? 24.092  83.834  84.747  1.00   22.67 ? 34   PRO B CB  1 
ATOM   3012  C CG  . PRO B 1 34  ? 23.566  85.130  84.229  1.00   20.08 ? 34   PRO B CG  1 
ATOM   3013  C CD  . PRO B 1 34  ? 22.505  84.674  83.229  1.00   15.71 ? 34   PRO B CD  1 
ATOM   3014  N N   . GLU B 1 35  ? 25.055  80.692  83.463  1.00   28.01 ? 35   GLU B N   1 
ATOM   3015  C CA  . GLU B 1 35  ? 24.963  79.249  83.676  1.00   27.74 ? 35   GLU B CA  1 
ATOM   3016  C C   . GLU B 1 35  ? 24.699  78.808  85.116  1.00   25.75 ? 35   GLU B C   1 
ATOM   3017  O O   . GLU B 1 35  ? 23.986  77.835  85.336  1.00   26.06 ? 35   GLU B O   1 
ATOM   3018  C CB  . GLU B 1 35  ? 26.213  78.561  83.139  1.00   30.53 ? 35   GLU B CB  1 
ATOM   3019  C CG  . GLU B 1 35  ? 26.226  77.061  83.369  1.00   35.17 ? 35   GLU B CG  1 
ATOM   3020  C CD  . GLU B 1 35  ? 27.592  76.474  83.185  1.00   37.99 ? 35   GLU B CD  1 
ATOM   3021  O OE1 . GLU B 1 35  ? 27.886  76.020  82.059  1.00   38.88 ? 35   GLU B OE1 1 
ATOM   3022  O OE2 . GLU B 1 35  ? 28.371  76.491  84.170  1.00   43.53 ? 35   GLU B OE2 1 
ATOM   3023  N N   . ASP B 1 36  ? 25.266  79.485  86.100  1.00   24.49 ? 36   ASP B N   1 
ATOM   3024  C CA  . ASP B 1 36  ? 25.007  79.083  87.484  1.00   28.69 ? 36   ASP B CA  1 
ATOM   3025  C C   . ASP B 1 36  ? 23.572  79.423  87.896  1.00   26.60 ? 36   ASP B C   1 
ATOM   3026  O O   . ASP B 1 36  ? 23.047  78.859  88.854  1.00   26.97 ? 36   ASP B O   1 
ATOM   3027  C CB  . ASP B 1 36  ? 25.999  79.745  88.459  1.00   30.64 ? 36   ASP B CB  1 
ATOM   3028  C CG  . ASP B 1 36  ? 25.875  81.252  88.484  1.00   37.12 ? 36   ASP B CG  1 
ATOM   3029  O OD1 . ASP B 1 36  ? 25.994  81.880  87.413  1.00   41.23 ? 36   ASP B OD1 1 
ATOM   3030  O OD2 . ASP B 1 36  ? 25.652  81.825  89.571  1.00   45.54 ? 36   ASP B OD2 1 
ATOM   3031  N N   . LEU B 1 37  ? 22.940  80.348  87.177  1.00   25.33 ? 37   LEU B N   1 
ATOM   3032  C CA  . LEU B 1 37  ? 21.563  80.712  87.484  1.00   22.30 ? 37   LEU B CA  1 
ATOM   3033  C C   . LEU B 1 37  ? 20.603  79.697  86.851  1.00   21.90 ? 37   LEU B C   1 
ATOM   3034  O O   . LEU B 1 37  ? 19.516  79.466  87.361  1.00   19.70 ? 37   LEU B O   1 
ATOM   3035  C CB  . LEU B 1 37  ? 21.263  82.143  87.025  1.00   19.21 ? 37   LEU B CB  1 
ATOM   3036  C CG  . LEU B 1 37  ? 21.995  83.237  87.826  1.00   22.18 ? 37   LEU B CG  1 
ATOM   3037  C CD1 . LEU B 1 37  ? 21.219  84.557  87.751  1.00   17.80 ? 37   LEU B CD1 1 
ATOM   3038  C CD2 . LEU B 1 37  ? 22.113  82.829  89.291  1.00   20.54 ? 37   LEU B CD2 1 
ATOM   3039  N N   . VAL B 1 38  ? 21.020  79.081  85.752  1.00   21.67 ? 38   VAL B N   1 
ATOM   3040  C CA  . VAL B 1 38  ? 20.220  78.054  85.093  1.00   21.53 ? 38   VAL B CA  1 
ATOM   3041  C C   . VAL B 1 38  ? 20.201  76.908  86.112  1.00   24.36 ? 38   VAL B C   1 
ATOM   3042  O O   . VAL B 1 38  ? 19.144  76.314  86.383  1.00   23.16 ? 38   VAL B O   1 
ATOM   3043  C CB  . VAL B 1 38  ? 20.884  77.571  83.752  1.00   18.06 ? 38   VAL B CB  1 
ATOM   3044  C CG1 . VAL B 1 38  ? 20.114  76.421  83.180  1.00   17.56 ? 38   VAL B CG1 1 
ATOM   3045  C CG2 . VAL B 1 38  ? 20.934  78.714  82.740  1.00   14.38 ? 38   VAL B CG2 1 
ATOM   3046  N N   . ASP B 1 39  ? 21.375  76.620  86.688  1.00   22.27 ? 39   ASP B N   1 
ATOM   3047  C CA  . ASP B 1 39  ? 21.509  75.573  87.714  1.00   22.29 ? 39   ASP B CA  1 
ATOM   3048  C C   . ASP B 1 39  ? 20.683  75.924  88.963  1.00   19.16 ? 39   ASP B C   1 
ATOM   3049  O O   . ASP B 1 39  ? 20.108  75.052  89.603  1.00   18.62 ? 39   ASP B O   1 
ATOM   3050  C CB  . ASP B 1 39  ? 22.980  75.398  88.121  1.00   21.20 ? 39   ASP B CB  1 
ATOM   3051  C CG  . ASP B 1 39  ? 23.843  74.929  86.976  1.00   30.03 ? 39   ASP B CG  1 
ATOM   3052  O OD1 . ASP B 1 39  ? 25.071  75.125  87.044  1.00   35.42 ? 39   ASP B OD1 1 
ATOM   3053  O OD2 . ASP B 1 39  ? 23.298  74.360  86.002  1.00   31.06 ? 39   ASP B OD2 1 
ATOM   3054  N N   . GLU B 1 40  ? 20.656  77.197  89.325  1.00   18.14 ? 40   GLU B N   1 
ATOM   3055  C CA  . GLU B 1 40  ? 19.833  77.603  90.462  1.00   19.90 ? 40   GLU B CA  1 
ATOM   3056  C C   . GLU B 1 40  ? 18.389  77.215  90.109  1.00   20.86 ? 40   GLU B C   1 
ATOM   3057  O O   . GLU B 1 40  ? 17.717  76.544  90.881  1.00   20.44 ? 40   GLU B O   1 
ATOM   3058  C CB  . GLU B 1 40  ? 19.908  79.112  90.676  1.00   19.61 ? 40   GLU B CB  1 
ATOM   3059  C CG  . GLU B 1 40  ? 18.902  79.680  91.702  1.00   23.82 ? 40   GLU B CG  1 
ATOM   3060  C CD  . GLU B 1 40  ? 19.111  79.185  93.133  1.00   30.50 ? 40   GLU B CD  1 
ATOM   3061  O OE1 . GLU B 1 40  ? 18.247  79.469  94.001  1.00   32.17 ? 40   GLU B OE1 1 
ATOM   3062  O OE2 . GLU B 1 40  ? 20.142  78.518  93.394  1.00   38.00 ? 40   GLU B OE2 1 
ATOM   3063  N N   . VAL B 1 41  ? 17.925  77.625  88.930  1.00   20.37 ? 41   VAL B N   1 
ATOM   3064  C CA  . VAL B 1 41  ? 16.574  77.313  88.509  1.00   20.88 ? 41   VAL B CA  1 
ATOM   3065  C C   . VAL B 1 41  ? 16.336  75.812  88.535  1.00   20.58 ? 41   VAL B C   1 
ATOM   3066  O O   . VAL B 1 41  ? 15.316  75.371  89.060  1.00   20.13 ? 41   VAL B O   1 
ATOM   3067  C CB  . VAL B 1 41  ? 16.285  77.871  87.123  1.00   16.92 ? 41   VAL B CB  1 
ATOM   3068  C CG1 . VAL B 1 41  ? 14.918  77.418  86.667  1.00   18.69 ? 41   VAL B CG1 1 
ATOM   3069  C CG2 . VAL B 1 41  ? 16.362  79.396  87.171  1.00   12.23 ? 41   VAL B CG2 1 
ATOM   3070  N N   . PHE B 1 42  ? 17.265  75.035  87.977  1.00   20.02 ? 42   PHE B N   1 
ATOM   3071  C CA  . PHE B 1 42  ? 17.149  73.575  87.984  1.00   19.67 ? 42   PHE B CA  1 
ATOM   3072  C C   . PHE B 1 42  ? 16.955  73.081  89.412  1.00   21.63 ? 42   PHE B C   1 
ATOM   3073  O O   . PHE B 1 42  ? 16.115  72.222  89.655  1.00   25.14 ? 42   PHE B O   1 
ATOM   3074  C CB  . PHE B 1 42  ? 18.407  72.929  87.407  1.00   22.89 ? 42   PHE B CB  1 
ATOM   3075  C CG  . PHE B 1 42  ? 18.510  71.433  87.645  1.00   17.69 ? 42   PHE B CG  1 
ATOM   3076  C CD1 . PHE B 1 42  ? 17.706  70.532  86.930  1.00   18.43 ? 42   PHE B CD1 1 
ATOM   3077  C CD2 . PHE B 1 42  ? 19.446  70.937  88.559  1.00   19.74 ? 42   PHE B CD2 1 
ATOM   3078  C CE1 . PHE B 1 42  ? 17.824  69.168  87.108  1.00   18.53 ? 42   PHE B CE1 1 
ATOM   3079  C CE2 . PHE B 1 42  ? 19.592  69.571  88.765  1.00   22.10 ? 42   PHE B CE2 1 
ATOM   3080  C CZ  . PHE B 1 42  ? 18.775  68.667  88.034  1.00   23.78 ? 42   PHE B CZ  1 
ATOM   3081  N N   . ARG B 1 43  ? 17.719  73.631  90.354  1.00   22.03 ? 43   ARG B N   1 
ATOM   3082  C CA  . ARG B 1 43  ? 17.612  73.218  91.762  1.00   25.38 ? 43   ARG B CA  1 
ATOM   3083  C C   . ARG B 1 43  ? 16.369  73.665  92.517  1.00   24.74 ? 43   ARG B C   1 
ATOM   3084  O O   . ARG B 1 43  ? 15.975  73.013  93.468  1.00   28.13 ? 43   ARG B O   1 
ATOM   3085  C CB  . ARG B 1 43  ? 18.846  73.636  92.558  1.00   22.44 ? 43   ARG B CB  1 
ATOM   3086  C CG  . ARG B 1 43  ? 19.999  72.693  92.416  1.00   26.35 ? 43   ARG B CG  1 
ATOM   3087  C CD  . ARG B 1 43  ? 21.177  73.159  93.255  1.00   28.37 ? 43   ARG B CD  1 
ATOM   3088  N NE  . ARG B 1 43  ? 22.208  73.785  92.440  1.00   34.60 ? 43   ARG B NE  1 
ATOM   3089  C CZ  . ARG B 1 43  ? 22.398  75.094  92.326  1.00   34.01 ? 43   ARG B CZ  1 
ATOM   3090  N NH1 . ARG B 1 43  ? 21.629  75.946  92.987  1.00   38.94 ? 43   ARG B NH1 1 
ATOM   3091  N NH2 . ARG B 1 43  ? 23.359  75.546  91.530  1.00   30.32 ? 43   ARG B NH2 1 
ATOM   3092  N N   . ARG B 1 44  ? 15.760  74.774  92.125  1.00   26.27 ? 44   ARG B N   1 
ATOM   3093  C CA  . ARG B 1 44  ? 14.538  75.228  92.804  1.00   27.80 ? 44   ARG B CA  1 
ATOM   3094  C C   . ARG B 1 44  ? 13.292  74.548  92.188  1.00   26.34 ? 44   ARG B C   1 
ATOM   3095  O O   . ARG B 1 44  ? 12.183  74.629  92.705  1.00   26.55 ? 44   ARG B O   1 
ATOM   3096  C CB  . ARG B 1 44  ? 14.412  76.756  92.694  1.00   27.13 ? 44   ARG B CB  1 
ATOM   3097  C CG  . ARG B 1 44  ? 15.591  77.521  93.312  1.00   30.79 ? 44   ARG B CG  1 
ATOM   3098  C CD  . ARG B 1 44  ? 15.454  79.052  93.217  1.00   31.35 ? 44   ARG B CD  1 
ATOM   3099  N NE  . ARG B 1 44  ? 14.152  79.528  93.676  1.00   38.17 ? 44   ARG B NE  1 
ATOM   3100  C CZ  . ARG B 1 44  ? 13.855  80.805  93.917  1.00   36.60 ? 44   ARG B CZ  1 
ATOM   3101  N NH1 . ARG B 1 44  ? 14.776  81.759  93.755  1.00   24.47 ? 44   ARG B NH1 1 
ATOM   3102  N NH2 . ARG B 1 44  ? 12.620  81.128  94.296  1.00   34.84 ? 44   ARG B NH2 1 
ATOM   3103  N N   . LEU B 1 45  ? 13.504  73.860  91.085  1.00   25.91 ? 45   LEU B N   1 
ATOM   3104  C CA  . LEU B 1 45  ? 12.429  73.202  90.373  1.00   28.51 ? 45   LEU B CA  1 
ATOM   3105  C C   . LEU B 1 45  ? 11.795  71.986  91.073  1.00   27.28 ? 45   LEU B C   1 
ATOM   3106  O O   . LEU B 1 45  ? 12.449  70.985  91.316  1.00   26.71 ? 45   LEU B O   1 
ATOM   3107  C CB  . LEU B 1 45  ? 12.964  72.814  89.011  1.00   33.53 ? 45   LEU B CB  1 
ATOM   3108  C CG  . LEU B 1 45  ? 12.306  73.539  87.839  1.00   42.49 ? 45   LEU B CG  1 
ATOM   3109  C CD1 . LEU B 1 45  ? 11.096  72.717  87.431  1.00   45.89 ? 45   LEU B CD1 1 
ATOM   3110  C CD2 . LEU B 1 45  ? 11.895  74.990  88.189  1.00   40.57 ? 45   LEU B CD2 1 
ATOM   3111  N N   . ASN B 1 46  ? 10.513  72.085  91.376  1.00   23.75 ? 46   ASN B N   1 
ATOM   3112  C CA  . ASN B 1 46  ? 9.799   71.019  92.040  1.00   25.03 ? 46   ASN B CA  1 
ATOM   3113  C C   . ASN B 1 46  ? 9.149   70.171  90.958  1.00   24.88 ? 46   ASN B C   1 
ATOM   3114  O O   . ASN B 1 46  ? 8.109   70.571  90.415  1.00   25.08 ? 46   ASN B O   1 
ATOM   3115  C CB  . ASN B 1 46  ? 8.708   71.620  92.956  1.00   26.38 ? 46   ASN B CB  1 
ATOM   3116  C CG  . ASN B 1 46  ? 7.906   70.554  93.703  1.00   28.26 ? 46   ASN B CG  1 
ATOM   3117  O OD1 . ASN B 1 46  ? 7.852   69.388  93.295  1.00   25.61 ? 46   ASN B OD1 1 
ATOM   3118  N ND2 . ASN B 1 46  ? 7.259   70.964  94.793  1.00   28.76 ? 46   ASN B ND2 1 
ATOM   3119  N N   . SER B 1 47  ? 9.726   69.005  90.657  1.00   21.92 ? 47   SER B N   1 
ATOM   3120  C CA  . SER B 1 47  ? 9.184   68.169  89.594  1.00   22.15 ? 47   SER B CA  1 
ATOM   3121  C C   . SER B 1 47  ? 7.686   67.905  89.747  1.00   20.66 ? 47   SER B C   1 
ATOM   3122  O O   . SER B 1 47  ? 6.983   67.697  88.780  1.00   17.99 ? 47   SER B O   1 
ATOM   3123  C CB  . SER B 1 47  ? 9.949   66.838  89.489  1.00   25.23 ? 47   SER B CB  1 
ATOM   3124  O OG  . SER B 1 47  ? 9.755   66.027  90.628  1.00   28.18 ? 47   SER B OG  1 
ATOM   3125  N N   . ASP B 1 48  ? 7.183   67.937  90.964  1.00   20.82 ? 48   ASP B N   1 
ATOM   3126  C CA  . ASP B 1 48  ? 5.773   67.700  91.149  1.00   23.02 ? 48   ASP B CA  1 
ATOM   3127  C C   . ASP B 1 48  ? 4.944   68.909  90.708  1.00   24.02 ? 48   ASP B C   1 
ATOM   3128  O O   . ASP B 1 48  ? 3.764   68.776  90.393  1.00   28.24 ? 48   ASP B O   1 
ATOM   3129  C CB  . ASP B 1 48  ? 5.476   67.377  92.611  1.00   19.76 ? 48   ASP B CB  1 
ATOM   3130  C CG  . ASP B 1 48  ? 4.109   66.770  92.798  1.00   21.24 ? 48   ASP B CG  1 
ATOM   3131  O OD1 . ASP B 1 48  ? 3.215   67.423  93.390  1.00   23.73 ? 48   ASP B OD1 1 
ATOM   3132  O OD2 . ASP B 1 48  ? 3.934   65.636  92.329  1.00   25.64 ? 48   ASP B OD2 1 
ATOM   3133  N N   . ALA B 1 49  ? 5.559   70.086  90.688  1.00   23.52 ? 49   ALA B N   1 
ATOM   3134  C CA  . ALA B 1 49  ? 4.868   71.304  90.288  1.00   20.60 ? 49   ALA B CA  1 
ATOM   3135  C C   . ALA B 1 49  ? 4.641   71.329  88.767  1.00   20.90 ? 49   ALA B C   1 
ATOM   3136  O O   . ALA B 1 49  ? 3.773   72.073  88.266  1.00   21.20 ? 49   ALA B O   1 
ATOM   3137  C CB  . ALA B 1 49  ? 5.681   72.523  90.705  1.00   20.04 ? 49   ALA B CB  1 
ATOM   3138  N N   . LEU B 1 50  ? 5.407   70.529  88.031  1.00   16.73 ? 50   LEU B N   1 
ATOM   3139  C CA  . LEU B 1 50  ? 5.263   70.493  86.576  1.00   17.88 ? 50   LEU B CA  1 
ATOM   3140  C C   . LEU B 1 50  ? 3.911   69.952  86.078  1.00   17.68 ? 50   LEU B C   1 
ATOM   3141  O O   . LEU B 1 50  ? 3.450   70.342  85.007  1.00   15.50 ? 50   LEU B O   1 
ATOM   3142  C CB  . LEU B 1 50  ? 6.405   69.668  85.935  1.00   15.80 ? 50   LEU B CB  1 
ATOM   3143  C CG  . LEU B 1 50  ? 7.782   70.332  85.966  1.00   20.44 ? 50   LEU B CG  1 
ATOM   3144  C CD1 . LEU B 1 50  ? 8.835   69.386  85.426  1.00   22.20 ? 50   LEU B CD1 1 
ATOM   3145  C CD2 . LEU B 1 50  ? 7.757   71.627  85.170  1.00   15.57 ? 50   LEU B CD2 1 
ATOM   3146  N N   . ARG B 1 51  ? 3.313   69.044  86.849  1.00   17.25 ? 51   ARG B N   1 
ATOM   3147  C CA  . ARG B 1 51  ? 2.034   68.409  86.507  1.00   19.73 ? 51   ARG B CA  1 
ATOM   3148  C C   . ARG B 1 51  ? 0.793   69.273  86.802  1.00   19.26 ? 51   ARG B C   1 
ATOM   3149  O O   . ARG B 1 51  ? -0.335  68.890  86.462  1.00   19.66 ? 51   ARG B O   1 
ATOM   3150  C CB  . ARG B 1 51  ? 1.855   67.110  87.308  1.00   18.39 ? 51   ARG B CB  1 
ATOM   3151  C CG  . ARG B 1 51  ? 1.629   67.373  88.798  1.00   20.39 ? 51   ARG B CG  1 
ATOM   3152  C CD  . ARG B 1 51  ? 1.454   66.104  89.609  1.00   25.91 ? 51   ARG B CD  1 
ATOM   3153  N NE  . ARG B 1 51  ? 0.065   65.902  90.013  1.00   31.50 ? 51   ARG B NE  1 
ATOM   3154  C CZ  . ARG B 1 51  ? -0.493  66.415  91.106  1.00   31.72 ? 51   ARG B CZ  1 
ATOM   3155  N NH1 . ARG B 1 51  ? -1.764  66.162  91.365  1.00   36.39 ? 51   ARG B NH1 1 
ATOM   3156  N NH2 . ARG B 1 51  ? 0.212   67.161  91.952  1.00   31.39 ? 51   ARG B NH2 1 
ATOM   3157  N N   . ILE B 1 52  ? 0.989   70.424  87.426  1.00   17.82 ? 52   ILE B N   1 
ATOM   3158  C CA  . ILE B 1 52  ? -0.175  71.212  87.784  1.00   20.15 ? 52   ILE B CA  1 
ATOM   3159  C C   . ILE B 1 52  ? -0.269  72.472  86.975  1.00   19.14 ? 52   ILE B C   1 
ATOM   3160  O O   . ILE B 1 52  ? 0.676   72.856  86.308  1.00   18.98 ? 52   ILE B O   1 
ATOM   3161  C CB  . ILE B 1 52  ? -0.159  71.609  89.281  1.00   19.75 ? 52   ILE B CB  1 
ATOM   3162  C CG1 . ILE B 1 52  ? 1.011   72.569  89.549  1.00   20.61 ? 52   ILE B CG1 1 
ATOM   3163  C CG2 . ILE B 1 52  ? 0.015   70.365  90.144  1.00   11.73 ? 52   ILE B CG2 1 
ATOM   3164  C CD1 . ILE B 1 52  ? 0.916   73.268  90.882  1.00   25.38 ? 52   ILE B CD1 1 
ATOM   3165  N N   . TYR B 1 53  ? -1.437  73.094  87.028  1.00   19.21 ? 53   TYR B N   1 
ATOM   3166  C CA  . TYR B 1 53  ? -1.667  74.334  86.342  1.00   20.44 ? 53   TYR B CA  1 
ATOM   3167  C C   . TYR B 1 53  ? -1.094  75.317  87.336  1.00   19.35 ? 53   TYR B C   1 
ATOM   3168  O O   . TYR B 1 53  ? -1.527  75.361  88.490  1.00   22.04 ? 53   TYR B O   1 
ATOM   3169  C CB  . TYR B 1 53  ? -3.168  74.480  86.082  1.00   18.73 ? 53   TYR B CB  1 
ATOM   3170  C CG  . TYR B 1 53  ? -3.556  73.694  84.845  1.00   18.45 ? 53   TYR B CG  1 
ATOM   3171  C CD1 . TYR B 1 53  ? -3.348  74.225  83.564  1.00   18.44 ? 53   TYR B CD1 1 
ATOM   3172  C CD2 . TYR B 1 53  ? -4.046  72.385  84.946  1.00   19.04 ? 53   TYR B CD2 1 
ATOM   3173  C CE1 . TYR B 1 53  ? -3.614  73.464  82.409  1.00   21.79 ? 53   TYR B CE1 1 
ATOM   3174  C CE2 . TYR B 1 53  ? -4.316  71.616  83.804  1.00   20.36 ? 53   TYR B CE2 1 
ATOM   3175  C CZ  . TYR B 1 53  ? -4.098  72.158  82.540  1.00   20.68 ? 53   TYR B CZ  1 
ATOM   3176  O OH  . TYR B 1 53  ? -4.370  71.407  81.423  1.00   19.78 ? 53   TYR B OH  1 
ATOM   3177  N N   . TYR B 1 54  ? -0.060  76.033  86.890  1.00   17.52 ? 54   TYR B N   1 
ATOM   3178  C CA  . TYR B 1 54  ? 0.668   76.956  87.743  1.00   18.57 ? 54   TYR B CA  1 
ATOM   3179  C C   . TYR B 1 54  ? 0.282   78.429  87.540  1.00   16.42 ? 54   TYR B C   1 
ATOM   3180  O O   . TYR B 1 54  ? 0.382   78.971  86.444  1.00   17.70 ? 54   TYR B O   1 
ATOM   3181  C CB  . TYR B 1 54  ? 2.189   76.740  87.525  1.00   17.84 ? 54   TYR B CB  1 
ATOM   3182  C CG  . TYR B 1 54  ? 3.076   77.249  88.650  1.00   21.29 ? 54   TYR B CG  1 
ATOM   3183  C CD1 . TYR B 1 54  ? 3.262   76.511  89.823  1.00   23.11 ? 54   TYR B CD1 1 
ATOM   3184  C CD2 . TYR B 1 54  ? 3.659   78.505  88.577  1.00   21.70 ? 54   TYR B CD2 1 
ATOM   3185  C CE1 . TYR B 1 54  ? 3.992   77.036  90.901  1.00   21.25 ? 54   TYR B CE1 1 
ATOM   3186  C CE2 . TYR B 1 54  ? 4.390   79.026  89.640  1.00   15.39 ? 54   TYR B CE2 1 
ATOM   3187  C CZ  . TYR B 1 54  ? 4.537   78.301  90.789  1.00   16.24 ? 54   TYR B CZ  1 
ATOM   3188  O OH  . TYR B 1 54  ? 5.157   78.894  91.858  1.00   22.16 ? 54   TYR B OH  1 
ATOM   3189  N N   . ASP B 1 55  ? -0.194  79.058  88.613  1.00   17.39 ? 55   ASP B N   1 
ATOM   3190  C CA  . ASP B 1 55  ? -0.608  80.461  88.604  1.00   20.36 ? 55   ASP B CA  1 
ATOM   3191  C C   . ASP B 1 55  ? 0.395   81.213  87.781  1.00   19.39 ? 55   ASP B C   1 
ATOM   3192  O O   . ASP B 1 55  ? 1.574   81.248  88.115  1.00   14.25 ? 55   ASP B O   1 
ATOM   3193  C CB  . ASP B 1 55  ? -0.692  80.980  90.043  1.00   21.31 ? 55   ASP B CB  1 
ATOM   3194  C CG  . ASP B 1 55  ? -1.827  80.296  90.835  1.00   25.22 ? 55   ASP B CG  1 
ATOM   3195  O OD1 . ASP B 1 55  ? -2.044  80.560  92.035  1.00   24.17 ? 55   ASP B OD1 1 
ATOM   3196  O OD2 . ASP B 1 55  ? -2.531  79.465  90.221  1.00   24.89 ? 55   ASP B OD2 1 
ATOM   3197  N N   . SER B 1 56  ? -0.051  81.797  86.677  1.00   22.14 ? 56   SER B N   1 
ATOM   3198  C CA  . SER B 1 56  ? 0.929   82.426  85.820  1.00   26.29 ? 56   SER B CA  1 
ATOM   3199  C C   . SER B 1 56  ? 1.398   83.617  86.558  1.00   28.87 ? 56   SER B C   1 
ATOM   3200  O O   . SER B 1 56  ? 2.597   83.806  86.766  1.00   36.09 ? 56   SER B O   1 
ATOM   3201  C CB  . SER B 1 56  ? 0.372   82.795  84.465  1.00   23.70 ? 56   SER B CB  1 
ATOM   3202  O OG  . SER B 1 56  ? 1.472   82.953  83.596  1.00   28.12 ? 56   SER B OG  1 
ATOM   3203  N N   . PRO B 1 57  ? 0.484   84.485  86.940  1.00   26.11 ? 57   PRO B N   1 
ATOM   3204  C CA  . PRO B 1 57  ? 1.266   85.490  87.653  1.00   25.69 ? 57   PRO B CA  1 
ATOM   3205  C C   . PRO B 1 57  ? 1.573   84.782  89.000  1.00   27.45 ? 57   PRO B C   1 
ATOM   3206  O O   . PRO B 1 57  ? 0.667   84.530  89.786  1.00   24.53 ? 57   PRO B O   1 
ATOM   3207  C CB  . PRO B 1 57  ? 0.281   86.644  87.802  1.00   25.73 ? 57   PRO B CB  1 
ATOM   3208  C CG  . PRO B 1 57  ? -0.605  86.495  86.608  1.00   25.07 ? 57   PRO B CG  1 
ATOM   3209  C CD  . PRO B 1 57  ? -0.805  84.995  86.469  1.00   19.49 ? 57   PRO B CD  1 
ATOM   3210  N N   . ASP B 1 58  ? 2.822   84.397  89.245  1.00   29.12 ? 58   ASP B N   1 
ATOM   3211  C CA  . ASP B 1 58  ? 3.157   83.769  90.526  1.00   29.16 ? 58   ASP B CA  1 
ATOM   3212  C C   . ASP B 1 58  ? 3.113   84.850  91.603  1.00   26.46 ? 58   ASP B C   1 
ATOM   3213  O O   . ASP B 1 58  ? 3.507   85.999  91.369  1.00   21.99 ? 58   ASP B O   1 
ATOM   3214  C CB  . ASP B 1 58  ? 4.572   83.161  90.533  1.00   34.74 ? 58   ASP B CB  1 
ATOM   3215  C CG  . ASP B 1 58  ? 4.651   81.892  91.349  1.00   38.63 ? 58   ASP B CG  1 
ATOM   3216  O OD1 . ASP B 1 58  ? 5.772   81.435  91.677  1.00   36.38 ? 58   ASP B OD1 1 
ATOM   3217  O OD2 . ASP B 1 58  ? 3.563   81.345  91.645  1.00   42.76 ? 58   ASP B OD2 1 
ATOM   3218  N N   . GLU B 1 59  ? 2.650   84.469  92.783  1.00   23.05 ? 59   GLU B N   1 
ATOM   3219  C CA  . GLU B 1 59  ? 2.530   85.380  93.895  1.00   25.14 ? 59   GLU B CA  1 
ATOM   3220  C C   . GLU B 1 59  ? 3.897   85.959  94.232  1.00   24.80 ? 59   GLU B C   1 
ATOM   3221  O O   . GLU B 1 59  ? 4.061   87.175  94.342  1.00   29.77 ? 59   GLU B O   1 
ATOM   3222  C CB  . GLU B 1 59  ? 1.950   84.638  95.100  1.00   26.66 ? 59   GLU B CB  1 
ATOM   3223  C CG  . GLU B 1 59  ? 1.144   85.498  96.027  1.00   33.68 ? 59   GLU B CG  1 
ATOM   3224  C CD  . GLU B 1 59  ? -0.102  86.042  95.365  1.00   37.32 ? 59   GLU B CD  1 
ATOM   3225  O OE1 . GLU B 1 59  ? -0.802  85.280  94.669  1.00   48.61 ? 59   GLU B OE1 1 
ATOM   3226  O OE2 . GLU B 1 59  ? -0.400  87.229  95.543  1.00   41.32 ? 59   GLU B OE2 1 
ATOM   3227  N N   . GLU B 1 60  ? 4.894   85.100  94.373  1.00   23.39 ? 60   GLU B N   1 
ATOM   3228  C CA  . GLU B 1 60  ? 6.198   85.606  94.705  1.00   22.23 ? 60   GLU B CA  1 
ATOM   3229  C C   . GLU B 1 60  ? 6.858   86.339  93.538  1.00   17.93 ? 60   GLU B C   1 
ATOM   3230  O O   . GLU B 1 60  ? 7.701   87.213  93.753  1.00   17.68 ? 60   GLU B O   1 
ATOM   3231  C CB  . GLU B 1 60  ? 7.105   84.477  95.209  1.00   23.88 ? 60   GLU B CB  1 
ATOM   3232  C CG  . GLU B 1 60  ? 7.565   83.531  94.140  1.00   38.97 ? 60   GLU B CG  1 
ATOM   3233  C CD  . GLU B 1 60  ? 8.546   82.501  94.670  1.00   48.55 ? 60   GLU B CD  1 
ATOM   3234  O OE1 . GLU B 1 60  ? 9.650   82.909  95.118  1.00   51.64 ? 60   GLU B OE1 1 
ATOM   3235  O OE2 . GLU B 1 60  ? 8.209   81.296  94.642  1.00   45.18 ? 60   GLU B OE2 1 
ATOM   3236  N N   . LEU B 1 61  ? 6.497   85.999  92.309  1.00   16.80 ? 61   LEU B N   1 
ATOM   3237  C CA  . LEU B 1 61  ? 7.096   86.720  91.191  1.00   17.40 ? 61   LEU B CA  1 
ATOM   3238  C C   . LEU B 1 61  ? 6.612   88.179  91.186  1.00   18.71 ? 61   LEU B C   1 
ATOM   3239  O O   . LEU B 1 61  ? 7.393   89.084  90.887  1.00   15.49 ? 61   LEU B O   1 
ATOM   3240  C CB  . LEU B 1 61  ? 6.791   86.062  89.844  1.00   17.19 ? 61   LEU B CB  1 
ATOM   3241  C CG  . LEU B 1 61  ? 7.224   86.837  88.595  1.00   22.20 ? 61   LEU B CG  1 
ATOM   3242  C CD1 . LEU B 1 61  ? 8.710   87.250  88.688  1.00   15.15 ? 61   LEU B CD1 1 
ATOM   3243  C CD2 . LEU B 1 61  ? 6.993   85.955  87.360  1.00   24.18 ? 61   LEU B CD2 1 
ATOM   3244  N N   . ILE B 1 62  ? 5.340   88.411  91.507  1.00   18.74 ? 62   ILE B N   1 
ATOM   3245  C CA  . ILE B 1 62  ? 4.822   89.762  91.580  1.00   22.04 ? 62   ILE B CA  1 
ATOM   3246  C C   . ILE B 1 62  ? 5.604   90.517  92.654  1.00   22.00 ? 62   ILE B C   1 
ATOM   3247  O O   . ILE B 1 62  ? 6.027   91.638  92.446  1.00   22.65 ? 62   ILE B O   1 
ATOM   3248  C CB  . ILE B 1 62  ? 3.342   89.787  91.974  1.00   23.13 ? 62   ILE B CB  1 
ATOM   3249  C CG1 . ILE B 1 62  ? 2.553   88.912  91.014  1.00   28.76 ? 62   ILE B CG1 1 
ATOM   3250  C CG2 . ILE B 1 62  ? 2.811   91.182  91.903  1.00   19.76 ? 62   ILE B CG2 1 
ATOM   3251  C CD1 . ILE B 1 62  ? 2.896   89.180  89.545  1.00   41.06 ? 62   ILE B CD1 1 
ATOM   3252  N N   . GLU B 1 63  ? 5.797   89.873  93.796  1.00   23.66 ? 63   GLU B N   1 
ATOM   3253  C CA  . GLU B 1 63  ? 6.529   90.462  94.896  1.00   23.77 ? 63   GLU B CA  1 
ATOM   3254  C C   . GLU B 1 63  ? 7.888   90.905  94.408  1.00   24.77 ? 63   GLU B C   1 
ATOM   3255  O O   . GLU B 1 63  ? 8.275   92.043  94.635  1.00   26.08 ? 63   GLU B O   1 
ATOM   3256  C CB  . GLU B 1 63  ? 6.670   89.450  96.031  1.00   27.93 ? 63   GLU B CB  1 
ATOM   3257  C CG  . GLU B 1 63  ? 5.361   89.166  96.799  1.00   33.72 ? 63   GLU B CG  1 
ATOM   3258  C CD  . GLU B 1 63  ? 5.417   87.863  97.626  1.00   38.34 ? 63   GLU B CD  1 
ATOM   3259  O OE1 . GLU B 1 63  ? 6.544   87.439  97.994  1.00   41.05 ? 63   GLU B OE1 1 
ATOM   3260  O OE2 . GLU B 1 63  ? 4.346   87.271  97.920  1.00   29.39 ? 63   GLU B OE2 1 
ATOM   3261  N N   . LYS B 1 64  ? 8.616   90.017  93.733  1.00   24.64 ? 64   LYS B N   1 
ATOM   3262  C CA  . LYS B 1 64  ? 9.933   90.396  93.224  1.00   25.52 ? 64   LYS B CA  1 
ATOM   3263  C C   . LYS B 1 64  ? 9.835   91.579  92.243  1.00   24.70 ? 64   LYS B C   1 
ATOM   3264  O O   . LYS B 1 64  ? 10.676  92.496  92.248  1.00   22.47 ? 64   LYS B O   1 
ATOM   3265  C CB  . LYS B 1 64  ? 10.599  89.209  92.540  1.00   28.55 ? 64   LYS B CB  1 
ATOM   3266  C CG  . LYS B 1 64  ? 11.310  88.263  93.505  1.00   25.90 ? 64   LYS B CG  1 
ATOM   3267  C CD  . LYS B 1 64  ? 10.934  86.805  93.245  1.00   23.38 ? 64   LYS B CD  1 
ATOM   3268  C CE  . LYS B 1 64  ? 11.896  85.849  93.929  1.00   23.46 ? 64   LYS B CE  1 
ATOM   3269  N NZ  . LYS B 1 64  ? 12.360  86.363  95.247  1.00   16.91 ? 64   LYS B NZ  1 
ATOM   3270  N N   . ILE B 1 65  ? 8.810   91.556  91.402  1.00   22.92 ? 65   ILE B N   1 
ATOM   3271  C CA  . ILE B 1 65  ? 8.627   92.646  90.461  1.00   23.86 ? 65   ILE B CA  1 
ATOM   3272  C C   . ILE B 1 65  ? 8.409   93.933  91.269  1.00   23.24 ? 65   ILE B C   1 
ATOM   3273  O O   . ILE B 1 65  ? 9.070   94.936  91.015  1.00   19.42 ? 65   ILE B O   1 
ATOM   3274  C CB  . ILE B 1 65  ? 7.398   92.425  89.537  1.00   27.58 ? 65   ILE B CB  1 
ATOM   3275  C CG1 . ILE B 1 65  ? 7.600   91.176  88.662  1.00   25.22 ? 65   ILE B CG1 1 
ATOM   3276  C CG2 . ILE B 1 65  ? 7.169   93.662  88.657  1.00   19.11 ? 65   ILE B CG2 1 
ATOM   3277  C CD1 . ILE B 1 65  ? 8.776   91.243  87.780  1.00   28.18 ? 65   ILE B CD1 1 
ATOM   3278  N N   . LEU B 1 66  ? 7.488   93.907  92.235  1.00   19.87 ? 66   LEU B N   1 
ATOM   3279  C CA  . LEU B 1 66  ? 7.228   95.088  93.044  1.00   23.19 ? 66   LEU B CA  1 
ATOM   3280  C C   . LEU B 1 66  ? 8.564   95.597  93.595  1.00   23.67 ? 66   LEU B C   1 
ATOM   3281  O O   . LEU B 1 66  ? 8.941   96.776  93.441  1.00   21.22 ? 66   LEU B O   1 
ATOM   3282  C CB  . LEU B 1 66  ? 6.296   94.768  94.213  1.00   19.51 ? 66   LEU B CB  1 
ATOM   3283  C CG  . LEU B 1 66  ? 4.788   95.012  94.044  1.00   27.10 ? 66   LEU B CG  1 
ATOM   3284  C CD1 . LEU B 1 66  ? 4.534   96.200  93.084  1.00   22.38 ? 66   LEU B CD1 1 
ATOM   3285  C CD2 . LEU B 1 66  ? 4.130   93.758  93.519  1.00   20.94 ? 66   LEU B CD2 1 
ATOM   3286  N N   . SER B 1 67  ? 9.265   94.670  94.229  1.00   22.74 ? 67   SER B N   1 
ATOM   3287  C CA  . SER B 1 67  ? 10.540  94.938  94.835  1.00   24.32 ? 67   SER B CA  1 
ATOM   3288  C C   . SER B 1 67  ? 11.397  95.691  93.836  1.00   25.97 ? 67   SER B C   1 
ATOM   3289  O O   . SER B 1 67  ? 11.903  96.773  94.153  1.00   25.23 ? 67   SER B O   1 
ATOM   3290  C CB  . SER B 1 67  ? 11.178  93.613  95.239  1.00   25.51 ? 67   SER B CB  1 
ATOM   3291  O OG  . SER B 1 67  ? 12.551  93.752  95.481  1.00   33.51 ? 67   SER B OG  1 
ATOM   3292  N N   . TYR B 1 68  ? 11.526  95.120  92.634  1.00   24.55 ? 68   TYR B N   1 
ATOM   3293  C CA  . TYR B 1 68  ? 12.299  95.702  91.541  1.00   21.60 ? 68   TYR B CA  1 
ATOM   3294  C C   . TYR B 1 68  ? 11.824  97.103  91.167  1.00   21.81 ? 68   TYR B C   1 
ATOM   3295  O O   . TYR B 1 68  ? 12.647  97.982  90.933  1.00   25.88 ? 68   TYR B O   1 
ATOM   3296  C CB  . TYR B 1 68  ? 12.223  94.778  90.318  1.00   21.75 ? 68   TYR B CB  1 
ATOM   3297  C CG  . TYR B 1 68  ? 13.129  95.128  89.141  1.00   20.01 ? 68   TYR B CG  1 
ATOM   3298  C CD1 . TYR B 1 68  ? 14.493  95.358  89.304  1.00   23.50 ? 68   TYR B CD1 1 
ATOM   3299  C CD2 . TYR B 1 68  ? 12.602  95.250  87.866  1.00   19.09 ? 68   TYR B CD2 1 
ATOM   3300  C CE1 . TYR B 1 68  ? 15.306  95.710  88.211  1.00   21.31 ? 68   TYR B CE1 1 
ATOM   3301  C CE2 . TYR B 1 68  ? 13.391  95.595  86.782  1.00   15.94 ? 68   TYR B CE2 1 
ATOM   3302  C CZ  . TYR B 1 68  ? 14.740  95.822  86.957  1.00   21.08 ? 68   TYR B CZ  1 
ATOM   3303  O OH  . TYR B 1 68  ? 15.528  96.130  85.862  1.00   11.68 ? 68   TYR B OH  1 
ATOM   3304  N N   . LEU B 1 69  ? 10.513  97.317  91.093  1.00   21.80 ? 69   LEU B N   1 
ATOM   3305  C CA  . LEU B 1 69  ? 9.985   98.643  90.756  1.00   22.56 ? 69   LEU B CA  1 
ATOM   3306  C C   . LEU B 1 69  ? 10.305  99.612  91.888  1.00   24.12 ? 69   LEU B C   1 
ATOM   3307  O O   . LEU B 1 69  ? 10.396  100.813 91.676  1.00   28.74 ? 69   LEU B O   1 
ATOM   3308  C CB  . LEU B 1 69  ? 8.479   98.588  90.526  1.00   20.14 ? 69   LEU B CB  1 
ATOM   3309  C CG  . LEU B 1 69  ? 7.937   98.297  89.120  1.00   24.78 ? 69   LEU B CG  1 
ATOM   3310  C CD1 . LEU B 1 69  ? 9.038   97.786  88.211  1.00   26.77 ? 69   LEU B CD1 1 
ATOM   3311  C CD2 . LEU B 1 69  ? 6.786   97.301  89.215  1.00   15.06 ? 69   LEU B CD2 1 
ATOM   3312  N N   . ASP B 1 70  ? 10.441  99.094  93.100  1.00   24.77 ? 70   ASP B N   1 
ATOM   3313  C CA  . ASP B 1 70  ? 10.830  99.916  94.239  1.00   25.88 ? 70   ASP B CA  1 
ATOM   3314  C C   . ASP B 1 70  ? 10.084  101.225 94.401  1.00   24.85 ? 70   ASP B C   1 
ATOM   3315  O O   . ASP B 1 70  ? 10.704  102.263 94.570  1.00   26.26 ? 70   ASP B O   1 
ATOM   3316  C CB  . ASP B 1 70  ? 12.334  100.237 94.145  1.00   28.25 ? 70   ASP B CB  1 
ATOM   3317  C CG  . ASP B 1 70  ? 12.939  100.628 95.483  1.00   31.04 ? 70   ASP B CG  1 
ATOM   3318  O OD1 . ASP B 1 70  ? 13.964  101.344 95.478  1.00   31.48 ? 70   ASP B OD1 1 
ATOM   3319  O OD2 . ASP B 1 70  ? 12.397  100.212 96.535  1.00   31.18 ? 70   ASP B OD2 1 
ATOM   3320  N N   . THR B 1 71  ? 8.761   101.173 94.353  1.00   25.99 ? 71   THR B N   1 
ATOM   3321  C CA  . THR B 1 71  ? 7.957   102.367 94.521  1.00   24.27 ? 71   THR B CA  1 
ATOM   3322  C C   . THR B 1 71  ? 7.373   102.262 95.897  1.00   27.27 ? 71   THR B C   1 
ATOM   3323  O O   . THR B 1 71  ? 7.595   101.271 96.597  1.00   26.37 ? 71   THR B O   1 
ATOM   3324  C CB  . THR B 1 71  ? 6.763   102.431 93.553  1.00   23.49 ? 71   THR B CB  1 
ATOM   3325  O OG1 . THR B 1 71  ? 5.894   101.314 93.785  1.00   20.78 ? 71   THR B OG1 1 
ATOM   3326  C CG2 . THR B 1 71  ? 7.240   102.430 92.104  1.00   18.85 ? 71   THR B CG2 1 
ATOM   3327  N N   . ASP B 1 72  ? 6.613   103.282 96.269  1.00   26.81 ? 72   ASP B N   1 
ATOM   3328  C CA  . ASP B 1 72  ? 5.953   103.328 97.558  1.00   28.44 ? 72   ASP B CA  1 
ATOM   3329  C C   . ASP B 1 72  ? 4.441   103.386 97.365  1.00   26.14 ? 72   ASP B C   1 
ATOM   3330  O O   . ASP B 1 72  ? 3.702   103.659 98.307  1.00   27.25 ? 72   ASP B O   1 
ATOM   3331  C CB  . ASP B 1 72  ? 6.397   104.566 98.338  1.00   35.63 ? 72   ASP B CB  1 
ATOM   3332  C CG  . ASP B 1 72  ? 7.819   104.460 98.866  1.00   45.65 ? 72   ASP B CG  1 
ATOM   3333  O OD1 . ASP B 1 72  ? 8.110   103.522 99.652  1.00   49.11 ? 72   ASP B OD1 1 
ATOM   3334  O OD2 . ASP B 1 72  ? 8.647   105.330 98.503  1.00   51.52 ? 72   ASP B OD2 1 
ATOM   3335  N N   . PHE B 1 73  ? 3.966   103.173 96.147  1.00   23.78 ? 73   PHE B N   1 
ATOM   3336  C CA  . PHE B 1 73  ? 2.532   103.224 95.943  1.00   22.03 ? 73   PHE B CA  1 
ATOM   3337  C C   . PHE B 1 73  ? 1.957   101.998 95.298  1.00   20.02 ? 73   PHE B C   1 
ATOM   3338  O O   . PHE B 1 73  ? 0.758   101.768 95.392  1.00   20.90 ? 73   PHE B O   1 
ATOM   3339  C CB  . PHE B 1 73  ? 2.107   104.475 95.149  1.00   20.17 ? 73   PHE B CB  1 
ATOM   3340  C CG  . PHE B 1 73  ? 2.685   104.550 93.787  1.00   22.53 ? 73   PHE B CG  1 
ATOM   3341  C CD1 . PHE B 1 73  ? 4.026   104.930 93.606  1.00   23.93 ? 73   PHE B CD1 1 
ATOM   3342  C CD2 . PHE B 1 73  ? 1.925   104.175 92.683  1.00   18.49 ? 73   PHE B CD2 1 
ATOM   3343  C CE1 . PHE B 1 73  ? 4.613   104.928 92.332  1.00   19.61 ? 73   PHE B CE1 1 
ATOM   3344  C CE2 . PHE B 1 73  ? 2.500   104.166 91.400  1.00   23.00 ? 73   PHE B CE2 1 
ATOM   3345  C CZ  . PHE B 1 73  ? 3.846   104.543 91.229  1.00   23.94 ? 73   PHE B CZ  1 
ATOM   3346  N N   . LEU B 1 74  ? 2.796   101.182 94.677  1.00   18.97 ? 74   LEU B N   1 
ATOM   3347  C CA  . LEU B 1 74  ? 2.291   99.985  94.011  1.00   19.46 ? 74   LEU B CA  1 
ATOM   3348  C C   . LEU B 1 74  ? 2.011   98.776  94.902  1.00   18.38 ? 74   LEU B C   1 
ATOM   3349  O O   . LEU B 1 74  ? 2.666   98.571  95.916  1.00   18.56 ? 74   LEU B O   1 
ATOM   3350  C CB  . LEU B 1 74  ? 3.258   99.535  92.917  1.00   21.35 ? 74   LEU B CB  1 
ATOM   3351  C CG  . LEU B 1 74  ? 3.568   100.450 91.742  1.00   20.28 ? 74   LEU B CG  1 
ATOM   3352  C CD1 . LEU B 1 74  ? 4.656   99.795  90.922  1.00   19.57 ? 74   LEU B CD1 1 
ATOM   3353  C CD2 . LEU B 1 74  ? 2.322   100.698 90.920  1.00   17.03 ? 74   LEU B CD2 1 
ATOM   3354  N N   . SER B 1 75  ? 1.042   97.964  94.487  1.00   21.32 ? 75   SER B N   1 
ATOM   3355  C CA  . SER B 1 75  ? 0.688   96.742  95.201  1.00   19.81 ? 75   SER B CA  1 
ATOM   3356  C C   . SER B 1 75  ? 0.550   95.641  94.144  1.00   22.29 ? 75   SER B C   1 
ATOM   3357  O O   . SER B 1 75  ? 0.566   95.926  92.941  1.00   23.34 ? 75   SER B O   1 
ATOM   3358  C CB  . SER B 1 75  ? -0.635  96.922  95.949  1.00   17.08 ? 75   SER B CB  1 
ATOM   3359  O OG  . SER B 1 75  ? -1.739  96.765  95.080  1.00   17.70 ? 75   SER B OG  1 
ATOM   3360  N N   . LYS B 1 76  ? 0.400   94.397  94.586  1.00   21.40 ? 76   LYS B N   1 
ATOM   3361  C CA  . LYS B 1 76  ? 0.278   93.286  93.657  1.00   25.72 ? 76   LYS B CA  1 
ATOM   3362  C C   . LYS B 1 76  ? -0.832  93.514  92.645  1.00   28.36 ? 76   LYS B C   1 
ATOM   3363  O O   . LYS B 1 76  ? -0.765  93.012  91.522  1.00   32.12 ? 76   LYS B O   1 
ATOM   3364  C CB  . LYS B 1 76  ? 0.052   91.972  94.420  1.00   24.65 ? 76   LYS B CB  1 
ATOM   3365  C CG  . LYS B 1 76  ? 1.276   91.544  95.231  1.00   26.85 ? 76   LYS B CG  1 
ATOM   3366  C CD  . LYS B 1 76  ? 1.038   90.287  96.042  1.00   28.51 ? 76   LYS B CD  1 
ATOM   3367  C CE  . LYS B 1 76  ? 2.195   90.057  96.996  1.00   33.17 ? 76   LYS B CE  1 
ATOM   3368  N NZ  . LYS B 1 76  ? 1.857   89.102  98.081  1.00   28.34 ? 76   LYS B NZ  1 
ATOM   3369  N N   . ASN B 1 77  ? -1.845  94.278  93.040  1.00   26.34 ? 77   ASN B N   1 
ATOM   3370  C CA  . ASN B 1 77  ? -2.964  94.583  92.150  1.00   26.29 ? 77   ASN B CA  1 
ATOM   3371  C C   . ASN B 1 77  ? -2.602  95.441  90.930  1.00   25.55 ? 77   ASN B C   1 
ATOM   3372  O O   . ASN B 1 77  ? -3.410  95.595  90.009  1.00   24.80 ? 77   ASN B O   1 
ATOM   3373  C CB  . ASN B 1 77  ? -4.073  95.284  92.924  1.00   23.35 ? 77   ASN B CB  1 
ATOM   3374  C CG  . ASN B 1 77  ? -4.749  94.374  93.911  1.00   26.29 ? 77   ASN B CG  1 
ATOM   3375  O OD1 . ASN B 1 77  ? -4.681  93.158  93.787  1.00   18.33 ? 77   ASN B OD1 1 
ATOM   3376  N ND2 . ASN B 1 77  ? -5.429  94.963  94.892  1.00   33.59 ? 77   ASN B ND2 1 
ATOM   3377  N N   . ASN B 1 78  ? -1.398  96.004  90.918  1.00   23.23 ? 78   ASN B N   1 
ATOM   3378  C CA  . ASN B 1 78  ? -0.973  96.863  89.817  1.00   20.63 ? 78   ASN B CA  1 
ATOM   3379  C C   . ASN B 1 78  ? -0.030  96.168  88.864  1.00   20.99 ? 78   ASN B C   1 
ATOM   3380  O O   . ASN B 1 78  ? 0.516   96.792  87.973  1.00   22.03 ? 78   ASN B O   1 
ATOM   3381  C CB  . ASN B 1 78  ? -0.282  98.110  90.370  1.00   19.14 ? 78   ASN B CB  1 
ATOM   3382  C CG  . ASN B 1 78  ? -1.205  98.950  91.242  1.00   25.19 ? 78   ASN B CG  1 
ATOM   3383  O OD1 . ASN B 1 78  ? -0.941  99.149  92.440  1.00   23.21 ? 78   ASN B OD1 1 
ATOM   3384  N ND2 . ASN B 1 78  ? -2.301  99.451  90.643  1.00   13.89 ? 78   ASN B ND2 1 
ATOM   3385  N N   . VAL B 1 79  ? 0.160   94.867  89.045  1.00   22.31 ? 79   VAL B N   1 
ATOM   3386  C CA  . VAL B 1 79  ? 1.073   94.140  88.187  1.00   21.52 ? 79   VAL B CA  1 
ATOM   3387  C C   . VAL B 1 79  ? 0.536   92.815  87.627  1.00   22.50 ? 79   VAL B C   1 
ATOM   3388  O O   . VAL B 1 79  ? -0.204  92.090  88.308  1.00   19.55 ? 79   VAL B O   1 
ATOM   3389  C CB  . VAL B 1 79  ? 2.393   93.826  88.961  1.00   21.54 ? 79   VAL B CB  1 
ATOM   3390  C CG1 . VAL B 1 79  ? 3.377   93.054  88.065  1.00   19.17 ? 79   VAL B CG1 1 
ATOM   3391  C CG2 . VAL B 1 79  ? 3.015   95.108  89.475  1.00   21.92 ? 79   VAL B CG2 1 
ATOM   3392  N N   . SER B 1 80  ? 0.923   92.508  86.386  1.00   20.53 ? 80   SER B N   1 
ATOM   3393  C CA  . SER B 1 80  ? 0.568   91.235  85.777  1.00   20.24 ? 80   SER B CA  1 
ATOM   3394  C C   . SER B 1 80  ? 1.659   90.896  84.763  1.00   19.44 ? 80   SER B C   1 
ATOM   3395  O O   . SER B 1 80  ? 2.482   91.752  84.409  1.00   18.22 ? 80   SER B O   1 
ATOM   3396  C CB  . SER B 1 80  ? -0.813  91.274  85.096  1.00   22.05 ? 80   SER B CB  1 
ATOM   3397  O OG  . SER B 1 80  ? -1.252  89.944  84.786  1.00   17.96 ? 80   SER B OG  1 
ATOM   3398  N N   . VAL B 1 81  ? 1.672   89.640  84.328  1.00   14.41 ? 81   VAL B N   1 
ATOM   3399  C CA  . VAL B 1 81  ? 2.664   89.171  83.380  1.00   15.53 ? 81   VAL B CA  1 
ATOM   3400  C C   . VAL B 1 81  ? 2.115   88.800  81.991  1.00   17.56 ? 81   VAL B C   1 
ATOM   3401  O O   . VAL B 1 81  ? 0.906   88.677  81.762  1.00   15.73 ? 81   VAL B O   1 
ATOM   3402  C CB  . VAL B 1 81  ? 3.436   87.940  83.947  1.00   17.46 ? 81   VAL B CB  1 
ATOM   3403  C CG1 . VAL B 1 81  ? 4.067   88.303  85.302  1.00   15.26 ? 81   VAL B CG1 1 
ATOM   3404  C CG2 . VAL B 1 81  ? 2.487   86.746  84.105  1.00   11.70 ? 81   VAL B CG2 1 
ATOM   3405  N N   . GLY B 1 82  ? 3.056   88.631  81.071  1.00   16.96 ? 82   GLY B N   1 
ATOM   3406  C CA  . GLY B 1 82  ? 2.722   88.275  79.721  1.00   17.59 ? 82   GLY B CA  1 
ATOM   3407  C C   . GLY B 1 82  ? 3.736   87.262  79.210  1.00   20.07 ? 82   GLY B C   1 
ATOM   3408  O O   . GLY B 1 82  ? 4.881   87.188  79.683  1.00   20.33 ? 82   GLY B O   1 
ATOM   3409  N N   . ASN B 1 83  ? 3.297   86.479  78.234  1.00   18.97 ? 83   ASN B N   1 
ATOM   3410  C CA  . ASN B 1 83  ? 4.094   85.453  77.596  1.00   17.81 ? 83   ASN B CA  1 
ATOM   3411  C C   . ASN B 1 83  ? 4.928   86.293  76.675  1.00   15.70 ? 83   ASN B C   1 
ATOM   3412  O O   . ASN B 1 83  ? 4.776   86.235  75.472  1.00   15.84 ? 83   ASN B O   1 
ATOM   3413  C CB  . ASN B 1 83  ? 3.142   84.519  76.825  1.00   22.39 ? 83   ASN B CB  1 
ATOM   3414  C CG  . ASN B 1 83  ? 3.878   83.454  76.037  1.00   21.13 ? 83   ASN B CG  1 
ATOM   3415  O OD1 . ASN B 1 83  ? 4.972   83.071  76.397  1.00   26.44 ? 83   ASN B OD1 1 
ATOM   3416  N ND2 . ASN B 1 83  ? 3.264   82.959  74.972  1.00   19.02 ? 83   ASN B ND2 1 
ATOM   3417  N N   . GLY B 1 84  ? 5.817   87.091  77.264  1.00   18.68 ? 84   GLY B N   1 
ATOM   3418  C CA  . GLY B 1 84  ? 6.612   88.044  76.503  1.00   14.77 ? 84   GLY B CA  1 
ATOM   3419  C C   . GLY B 1 84  ? 5.812   89.364  76.540  1.00   15.31 ? 84   GLY B C   1 
ATOM   3420  O O   . GLY B 1 84  ? 4.577   89.347  76.707  1.00   14.33 ? 84   GLY B O   1 
ATOM   3421  N N   . ALA B 1 85  ? 6.471   90.516  76.438  1.00   14.34 ? 85   ALA B N   1 
ATOM   3422  C CA  . ALA B 1 85  ? 5.743   91.789  76.424  1.00   13.34 ? 85   ALA B CA  1 
ATOM   3423  C C   . ALA B 1 85  ? 4.874   91.739  75.151  1.00   15.45 ? 85   ALA B C   1 
ATOM   3424  O O   . ALA B 1 85  ? 3.870   92.433  75.038  1.00   14.98 ? 85   ALA B O   1 
ATOM   3425  C CB  . ALA B 1 85  ? 6.702   92.949  76.356  1.00   10.00 ? 85   ALA B CB  1 
ATOM   3426  N N   . ASP B 1 86  ? 5.302   90.902  74.207  1.00   15.71 ? 86   ASP B N   1 
ATOM   3427  C CA  . ASP B 1 86  ? 4.589   90.680  72.964  1.00   18.18 ? 86   ASP B CA  1 
ATOM   3428  C C   . ASP B 1 86  ? 3.104   90.333  73.193  1.00   17.45 ? 86   ASP B C   1 
ATOM   3429  O O   . ASP B 1 86  ? 2.220   90.862  72.524  1.00   14.92 ? 86   ASP B O   1 
ATOM   3430  C CB  . ASP B 1 86  ? 5.263   89.534  72.162  1.00   14.71 ? 86   ASP B CB  1 
ATOM   3431  C CG  . ASP B 1 86  ? 6.121   90.054  71.006  1.00   19.44 ? 86   ASP B CG  1 
ATOM   3432  O OD1 . ASP B 1 86  ? 6.397   91.275  70.998  1.00   13.37 ? 86   ASP B OD1 1 
ATOM   3433  O OD2 . ASP B 1 86  ? 6.519   89.267  70.113  1.00   18.99 ? 86   ASP B OD2 1 
ATOM   3434  N N   . GLU B 1 87  ? 2.833   89.435  74.131  1.00   17.92 ? 87   GLU B N   1 
ATOM   3435  C CA  . GLU B 1 87  ? 1.454   89.030  74.398  1.00   17.76 ? 87   GLU B CA  1 
ATOM   3436  C C   . GLU B 1 87  ? 0.652   90.147  75.025  1.00   18.22 ? 87   GLU B C   1 
ATOM   3437  O O   . GLU B 1 87  ? -0.536  90.274  74.802  1.00   20.88 ? 87   GLU B O   1 
ATOM   3438  C CB  . GLU B 1 87  ? 1.410   87.828  75.322  1.00   21.03 ? 87   GLU B CB  1 
ATOM   3439  C CG  . GLU B 1 87  ? -0.008  87.343  75.605  1.00   18.44 ? 87   GLU B CG  1 
ATOM   3440  C CD  . GLU B 1 87  ? -0.053  86.132  76.544  1.00   26.28 ? 87   GLU B CD  1 
ATOM   3441  O OE1 . GLU B 1 87  ? 0.445   86.249  77.683  1.00   25.49 ? 87   GLU B OE1 1 
ATOM   3442  O OE2 . GLU B 1 87  ? -0.594  85.062  76.153  1.00   24.26 ? 87   GLU B OE2 1 
ATOM   3443  N N   . ILE B 1 88  ? 1.309   90.929  75.859  1.00   18.32 ? 88   ILE B N   1 
ATOM   3444  C CA  . ILE B 1 88  ? 0.665   92.041  76.516  1.00   17.85 ? 88   ILE B CA  1 
ATOM   3445  C C   . ILE B 1 88  ? 0.142   93.039  75.482  1.00   17.54 ? 88   ILE B C   1 
ATOM   3446  O O   . ILE B 1 88  ? -0.974  93.554  75.589  1.00   18.32 ? 88   ILE B O   1 
ATOM   3447  C CB  . ILE B 1 88  ? 1.660   92.755  77.436  1.00   21.07 ? 88   ILE B CB  1 
ATOM   3448  C CG1 . ILE B 1 88  ? 2.229   91.741  78.438  1.00   17.40 ? 88   ILE B CG1 1 
ATOM   3449  C CG2 . ILE B 1 88  ? 0.978   93.920  78.145  1.00   19.68 ? 88   ILE B CG2 1 
ATOM   3450  C CD1 . ILE B 1 88  ? 3.159   92.361  79.461  1.00   13.97 ? 88   ILE B CD1 1 
ATOM   3451  N N   . ILE B 1 89  ? 0.976   93.313  74.486  1.00   17.94 ? 89   ILE B N   1 
ATOM   3452  C CA  . ILE B 1 89  ? 0.641   94.225  73.397  1.00   19.12 ? 89   ILE B CA  1 
ATOM   3453  C C   . ILE B 1 89  ? -0.490  93.577  72.586  1.00   20.31 ? 89   ILE B C   1 
ATOM   3454  O O   . ILE B 1 89  ? -1.517  94.205  72.277  1.00   20.62 ? 89   ILE B O   1 
ATOM   3455  C CB  . ILE B 1 89  ? 1.883   94.447  72.466  1.00   20.66 ? 89   ILE B CB  1 
ATOM   3456  C CG1 . ILE B 1 89  ? 2.903   95.353  73.154  1.00   18.05 ? 89   ILE B CG1 1 
ATOM   3457  C CG2 . ILE B 1 89  ? 1.461   95.049  71.145  1.00   20.57 ? 89   ILE B CG2 1 
ATOM   3458  C CD1 . ILE B 1 89  ? 4.190   95.377  72.423  1.00   21.67 ? 89   ILE B CD1 1 
ATOM   3459  N N   . TYR B 1 90  ? -0.284  92.310  72.257  1.00   17.70 ? 90   TYR B N   1 
ATOM   3460  C CA  . TYR B 1 90  ? -1.238  91.546  71.491  1.00   20.17 ? 90   TYR B CA  1 
ATOM   3461  C C   . TYR B 1 90  ? -2.596  91.541  72.173  1.00   20.90 ? 90   TYR B C   1 
ATOM   3462  O O   . TYR B 1 90  ? -3.591  91.899  71.554  1.00   24.28 ? 90   TYR B O   1 
ATOM   3463  C CB  . TYR B 1 90  ? -0.713  90.109  71.296  1.00   19.72 ? 90   TYR B CB  1 
ATOM   3464  C CG  . TYR B 1 90  ? -1.508  89.239  70.340  1.00   15.49 ? 90   TYR B CG  1 
ATOM   3465  C CD1 . TYR B 1 90  ? -2.607  88.523  70.794  1.00   16.17 ? 90   TYR B CD1 1 
ATOM   3466  C CD2 . TYR B 1 90  ? -1.051  88.995  69.044  1.00   14.16 ? 90   TYR B CD2 1 
ATOM   3467  C CE1 . TYR B 1 90  ? -3.224  87.560  70.005  1.00   12.49 ? 90   TYR B CE1 1 
ATOM   3468  C CE2 . TYR B 1 90  ? -1.658  88.035  68.245  1.00   15.61 ? 90   TYR B CE2 1 
ATOM   3469  C CZ  . TYR B 1 90  ? -2.747  87.315  68.733  1.00   15.91 ? 90   TYR B CZ  1 
ATOM   3470  O OH  . TYR B 1 90  ? -3.355  86.342  67.946  1.00   15.48 ? 90   TYR B OH  1 
ATOM   3471  N N   . VAL B 1 91  ? -2.658  91.171  73.446  1.00   22.12 ? 91   VAL B N   1 
ATOM   3472  C CA  . VAL B 1 91  ? -3.968  91.155  74.075  1.00   23.14 ? 91   VAL B CA  1 
ATOM   3473  C C   . VAL B 1 91  ? -4.496  92.571  74.222  1.00   21.85 ? 91   VAL B C   1 
ATOM   3474  O O   . VAL B 1 91  ? -5.679  92.808  74.046  1.00   22.66 ? 91   VAL B O   1 
ATOM   3475  C CB  . VAL B 1 91  ? -3.986  90.402  75.454  1.00   27.55 ? 91   VAL B CB  1 
ATOM   3476  C CG1 . VAL B 1 91  ? -3.310  89.023  75.316  1.00   20.12 ? 91   VAL B CG1 1 
ATOM   3477  C CG2 . VAL B 1 91  ? -3.375  91.238  76.523  1.00   26.98 ? 91   VAL B CG2 1 
ATOM   3478  N N   . MET B 1 92  ? -3.617  93.527  74.499  1.00   22.95 ? 92   MET B N   1 
ATOM   3479  C CA  . MET B 1 92  ? -4.061  94.907  74.606  1.00   20.45 ? 92   MET B CA  1 
ATOM   3480  C C   . MET B 1 92  ? -4.791  95.352  73.350  1.00   21.47 ? 92   MET B C   1 
ATOM   3481  O O   . MET B 1 92  ? -5.693  96.199  73.413  1.00   18.30 ? 92   MET B O   1 
ATOM   3482  C CB  . MET B 1 92  ? -2.877  95.840  74.844  1.00   24.84 ? 92   MET B CB  1 
ATOM   3483  C CG  . MET B 1 92  ? -2.633  96.116  76.302  1.00   23.93 ? 92   MET B CG  1 
ATOM   3484  S SD  . MET B 1 92  ? -1.198  97.116  76.674  1.00   27.10 ? 92   MET B SD  1 
ATOM   3485  C CE  . MET B 1 92  ? -1.938  98.679  77.039  1.00   33.39 ? 92   MET B CE  1 
ATOM   3486  N N   . MET B 1 93  ? -4.384  94.813  72.197  1.00   21.38 ? 93   MET B N   1 
ATOM   3487  C CA  . MET B 1 93  ? -5.074  95.181  70.954  1.00   22.70 ? 93   MET B CA  1 
ATOM   3488  C C   . MET B 1 93  ? -6.469  94.548  70.851  1.00   22.10 ? 93   MET B C   1 
ATOM   3489  O O   . MET B 1 93  ? -7.301  94.954  70.034  1.00   18.61 ? 93   MET B O   1 
ATOM   3490  C CB  . MET B 1 93  ? -4.255  94.782  69.747  1.00   20.56 ? 93   MET B CB  1 
ATOM   3491  C CG  . MET B 1 93  ? -2.916  95.462  69.690  1.00   25.64 ? 93   MET B CG  1 
ATOM   3492  S SD  . MET B 1 93  ? -2.063  95.055  68.188  1.00   20.96 ? 93   MET B SD  1 
ATOM   3493  C CE  . MET B 1 93  ? -1.354  96.599  67.746  1.00   23.11 ? 93   MET B CE  1 
ATOM   3494  N N   . LEU B 1 94  ? -6.719  93.544  71.677  1.00   21.34 ? 94   LEU B N   1 
ATOM   3495  C CA  . LEU B 1 94  ? -8.010  92.875  71.683  1.00   24.04 ? 94   LEU B CA  1 
ATOM   3496  C C   . LEU B 1 94  ? -8.958  93.663  72.586  1.00   24.90 ? 94   LEU B C   1 
ATOM   3497  O O   . LEU B 1 94  ? -10.176 93.612  72.439  1.00   27.36 ? 94   LEU B O   1 
ATOM   3498  C CB  . LEU B 1 94  ? -7.849  91.453  72.218  1.00   17.91 ? 94   LEU B CB  1 
ATOM   3499  C CG  . LEU B 1 94  ? -6.995  90.519  71.352  1.00   14.80 ? 94   LEU B CG  1 
ATOM   3500  C CD1 . LEU B 1 94  ? -6.935  89.123  71.965  1.00   19.55 ? 94   LEU B CD1 1 
ATOM   3501  C CD2 . LEU B 1 94  ? -7.602  90.448  69.973  1.00   14.10 ? 94   LEU B CD2 1 
ATOM   3502  N N   . MET B 1 95  ? -8.364  94.396  73.516  1.00   25.10 ? 95   MET B N   1 
ATOM   3503  C CA  . MET B 1 95  ? -9.111  95.159  74.485  1.00   25.16 ? 95   MET B CA  1 
ATOM   3504  C C   . MET B 1 95  ? -9.651  96.505  74.005  1.00   28.63 ? 95   MET B C   1 
ATOM   3505  O O   . MET B 1 95  ? -10.754 96.877  74.378  1.00   31.73 ? 95   MET B O   1 
ATOM   3506  C CB  . MET B 1 95  ? -8.245  95.403  75.710  1.00   20.37 ? 95   MET B CB  1 
ATOM   3507  C CG  . MET B 1 95  ? -7.691  94.157  76.336  1.00   22.83 ? 95   MET B CG  1 
ATOM   3508  S SD  . MET B 1 95  ? -6.813  94.567  77.851  1.00   28.29 ? 95   MET B SD  1 
ATOM   3509  C CE  . MET B 1 95  ? -5.213  94.562  77.295  1.00   24.62 ? 95   MET B CE  1 
ATOM   3510  N N   . PHE B 1 96  ? -8.896  97.245  73.201  1.00   27.75 ? 96   PHE B N   1 
ATOM   3511  C CA  . PHE B 1 96  ? -9.383  98.546  72.783  1.00   28.41 ? 96   PHE B CA  1 
ATOM   3512  C C   . PHE B 1 96  ? -9.993  98.623  71.388  1.00   30.20 ? 96   PHE B C   1 
ATOM   3513  O O   . PHE B 1 96  ? -9.784  97.742  70.547  1.00   28.11 ? 96   PHE B O   1 
ATOM   3514  C CB  . PHE B 1 96  ? -8.271  99.564  72.939  1.00   25.63 ? 96   PHE B CB  1 
ATOM   3515  C CG  . PHE B 1 96  ? -7.743  99.676  74.348  1.00   30.12 ? 96   PHE B CG  1 
ATOM   3516  C CD1 . PHE B 1 96  ? -8.228  100.643 75.221  1.00   24.52 ? 96   PHE B CD1 1 
ATOM   3517  C CD2 . PHE B 1 96  ? -6.730  98.822  74.793  1.00   29.74 ? 96   PHE B CD2 1 
ATOM   3518  C CE1 . PHE B 1 96  ? -7.708  100.761 76.511  1.00   26.39 ? 96   PHE B CE1 1 
ATOM   3519  C CE2 . PHE B 1 96  ? -6.202  98.932  76.081  1.00   26.76 ? 96   PHE B CE2 1 
ATOM   3520  C CZ  . PHE B 1 96  ? -6.687  99.900  76.941  1.00   27.47 ? 96   PHE B CZ  1 
ATOM   3521  N N   . ASP B 1 97  ? -10.772 99.683  71.158  1.00   31.38 ? 97   ASP B N   1 
ATOM   3522  C CA  . ASP B 1 97  ? -11.452 99.890  69.889  1.00   31.52 ? 97   ASP B CA  1 
ATOM   3523  C C   . ASP B 1 97  ? -10.497 100.101 68.739  1.00   28.10 ? 97   ASP B C   1 
ATOM   3524  O O   . ASP B 1 97  ? -10.738 99.598  67.643  1.00   26.30 ? 97   ASP B O   1 
ATOM   3525  C CB  . ASP B 1 97  ? -12.422 101.074 69.981  1.00   36.19 ? 97   ASP B CB  1 
ATOM   3526  C CG  . ASP B 1 97  ? -13.568 100.818 70.944  1.00   40.67 ? 97   ASP B CG  1 
ATOM   3527  O OD1 . ASP B 1 97  ? -14.289 99.807  70.774  1.00   40.81 ? 97   ASP B OD1 1 
ATOM   3528  O OD2 . ASP B 1 97  ? -13.749 101.628 71.876  1.00   49.31 ? 97   ASP B OD2 1 
ATOM   3529  N N   . ARG B 1 98  ? -9.398  100.806 68.991  1.00   26.10 ? 98   ARG B N   1 
ATOM   3530  C CA  . ARG B 1 98  ? -8.429  101.074 67.926  1.00   23.57 ? 98   ARG B CA  1 
ATOM   3531  C C   . ARG B 1 98  ? -7.016  101.259 68.441  1.00   22.79 ? 98   ARG B C   1 
ATOM   3532  O O   . ARG B 1 98  ? -6.807  101.899 69.474  1.00   21.77 ? 98   ARG B O   1 
ATOM   3533  C CB  . ARG B 1 98  ? -8.844  102.331 67.157  1.00   25.33 ? 98   ARG B CB  1 
ATOM   3534  C CG  . ARG B 1 98  ? -7.952  102.657 65.989  1.00   24.27 ? 98   ARG B CG  1 
ATOM   3535  C CD  . ARG B 1 98  ? -8.371  103.960 65.340  1.00   26.92 ? 98   ARG B CD  1 
ATOM   3536  N NE  . ARG B 1 98  ? -8.214  105.089 66.256  1.00   35.50 ? 98   ARG B NE  1 
ATOM   3537  C CZ  . ARG B 1 98  ? -8.207  106.363 65.871  1.00   35.77 ? 98   ARG B CZ  1 
ATOM   3538  N NH1 . ARG B 1 98  ? -8.352  106.667 64.587  1.00   31.59 ? 98   ARG B NH1 1 
ATOM   3539  N NH2 . ARG B 1 98  ? -8.045  107.335 66.760  1.00   35.33 ? 98   ARG B NH2 1 
ATOM   3540  N N   . SER B 1 99  ? -6.039  100.711 67.710  1.00   22.03 ? 99   SER B N   1 
ATOM   3541  C CA  . SER B 1 99  ? -4.647  100.849 68.123  1.00   16.42 ? 99   SER B CA  1 
ATOM   3542  C C   . SER B 1 99  ? -3.967  101.910 67.298  1.00   17.82 ? 99   SER B C   1 
ATOM   3543  O O   . SER B 1 99  ? -4.145  101.981 66.088  1.00   21.43 ? 99   SER B O   1 
ATOM   3544  C CB  . SER B 1 99  ? -3.895  99.528  68.007  1.00   17.97 ? 99   SER B CB  1 
ATOM   3545  O OG  . SER B 1 99  ? -4.437  98.567  68.897  1.00   18.55 ? 99   SER B OG  1 
ATOM   3546  N N   . VAL B 1 100 ? -3.175  102.736 67.968  1.00   17.45 ? 100  VAL B N   1 
ATOM   3547  C CA  . VAL B 1 100 ? -2.491  103.833 67.306  1.00   18.27 ? 100  VAL B CA  1 
ATOM   3548  C C   . VAL B 1 100 ? -0.984  103.851 67.589  1.00   20.06 ? 100  VAL B C   1 
ATOM   3549  O O   . VAL B 1 100 ? -0.558  103.797 68.739  1.00   23.77 ? 100  VAL B O   1 
ATOM   3550  C CB  . VAL B 1 100 ? -3.127  105.178 67.763  1.00   18.81 ? 100  VAL B CB  1 
ATOM   3551  C CG1 . VAL B 1 100 ? -2.462  106.373 67.056  1.00   14.87 ? 100  VAL B CG1 1 
ATOM   3552  C CG2 . VAL B 1 100 ? -4.638  105.143 67.491  1.00   16.72 ? 100  VAL B CG2 1 
ATOM   3553  N N   . PHE B 1 101 ? -0.173  103.916 66.545  1.00   16.11 ? 101  PHE B N   1 
ATOM   3554  C CA  . PHE B 1 101 ? 1.272   103.992 66.751  1.00   18.51 ? 101  PHE B CA  1 
ATOM   3555  C C   . PHE B 1 101 ? 1.885   104.876 65.711  1.00   17.80 ? 101  PHE B C   1 
ATOM   3556  O O   . PHE B 1 101 ? 1.208   105.278 64.780  1.00   21.86 ? 101  PHE B O   1 
ATOM   3557  C CB  . PHE B 1 101 ? 1.934   102.620 66.732  1.00   18.59 ? 101  PHE B CB  1 
ATOM   3558  C CG  . PHE B 1 101 ? 1.223   101.615 65.880  1.00   20.32 ? 101  PHE B CG  1 
ATOM   3559  C CD1 . PHE B 1 101 ? 1.636   101.369 64.575  1.00   20.90 ? 101  PHE B CD1 1 
ATOM   3560  C CD2 . PHE B 1 101 ? 0.147   100.887 66.402  1.00   18.01 ? 101  PHE B CD2 1 
ATOM   3561  C CE1 . PHE B 1 101 ? 0.984   100.385 63.781  1.00   24.08 ? 101  PHE B CE1 1 
ATOM   3562  C CE2 . PHE B 1 101 ? -0.513  99.908  65.632  1.00   20.08 ? 101  PHE B CE2 1 
ATOM   3563  C CZ  . PHE B 1 101 ? -0.091  99.652  64.314  1.00   19.26 ? 101  PHE B CZ  1 
ATOM   3564  N N   . PHE B 1 102 ? 3.176   105.149 65.845  1.00   19.32 ? 102  PHE B N   1 
ATOM   3565  C CA  . PHE B 1 102 ? 3.806   106.076 64.926  1.00   20.23 ? 102  PHE B CA  1 
ATOM   3566  C C   . PHE B 1 102 ? 5.120   105.621 64.331  1.00   20.98 ? 102  PHE B C   1 
ATOM   3567  O O   . PHE B 1 102 ? 6.138   105.534 65.012  1.00   19.67 ? 102  PHE B O   1 
ATOM   3568  C CB  . PHE B 1 102 ? 4.030   107.404 65.638  1.00   21.13 ? 102  PHE B CB  1 
ATOM   3569  C CG  . PHE B 1 102 ? 2.993   107.724 66.678  1.00   22.84 ? 102  PHE B CG  1 
ATOM   3570  C CD1 . PHE B 1 102 ? 3.254   107.482 68.016  1.00   21.28 ? 102  PHE B CD1 1 
ATOM   3571  C CD2 . PHE B 1 102 ? 1.780   108.307 66.323  1.00   27.52 ? 102  PHE B CD2 1 
ATOM   3572  C CE1 . PHE B 1 102 ? 2.337   107.812 68.984  1.00   27.52 ? 102  PHE B CE1 1 
ATOM   3573  C CE2 . PHE B 1 102 ? 0.843   108.646 67.295  1.00   27.16 ? 102  PHE B CE2 1 
ATOM   3574  C CZ  . PHE B 1 102 ? 1.120   108.399 68.624  1.00   28.98 ? 102  PHE B CZ  1 
ATOM   3575  N N   . PRO B 1 103 ? 5.129   105.358 63.030  1.00   21.38 ? 103  PRO B N   1 
ATOM   3576  C CA  . PRO B 1 103 ? 6.393   104.912 62.454  1.00   24.22 ? 103  PRO B CA  1 
ATOM   3577  C C   . PRO B 1 103 ? 7.415   106.017 62.247  1.00   23.87 ? 103  PRO B C   1 
ATOM   3578  O O   . PRO B 1 103 ? 7.048   107.185 62.094  1.00   24.17 ? 103  PRO B O   1 
ATOM   3579  C CB  . PRO B 1 103 ? 5.963   104.213 61.170  1.00   21.52 ? 103  PRO B CB  1 
ATOM   3580  C CG  . PRO B 1 103 ? 4.680   104.763 60.880  1.00   27.68 ? 103  PRO B CG  1 
ATOM   3581  C CD  . PRO B 1 103 ? 4.003   105.000 62.172  1.00   24.85 ? 103  PRO B CD  1 
ATOM   3582  N N   . PRO B 1 104 ? 8.714   105.668 62.319  1.00   23.19 ? 104  PRO B N   1 
ATOM   3583  C CA  . PRO B 1 104 ? 9.210   104.303 62.587  1.00   22.25 ? 104  PRO B CA  1 
ATOM   3584  C C   . PRO B 1 104 ? 8.932   103.854 64.035  1.00   22.55 ? 104  PRO B C   1 
ATOM   3585  O O   . PRO B 1 104 ? 9.160   104.592 64.993  1.00   24.09 ? 104  PRO B O   1 
ATOM   3586  C CB  . PRO B 1 104 ? 10.700  104.401 62.272  1.00   22.18 ? 104  PRO B CB  1 
ATOM   3587  C CG  . PRO B 1 104 ? 11.032  105.851 62.679  1.00   26.82 ? 104  PRO B CG  1 
ATOM   3588  C CD  . PRO B 1 104 ? 9.823   106.637 62.186  1.00   21.53 ? 104  PRO B CD  1 
ATOM   3589  N N   . THR B 1 105 ? 8.417   102.640 64.179  1.00   20.50 ? 105  THR B N   1 
ATOM   3590  C CA  . THR B 1 105 ? 8.083   102.095 65.487  1.00   20.43 ? 105  THR B CA  1 
ATOM   3591  C C   . THR B 1 105 ? 8.269   100.559 65.478  1.00   21.04 ? 105  THR B C   1 
ATOM   3592  O O   . THR B 1 105 ? 8.639   99.960  64.451  1.00   21.17 ? 105  THR B O   1 
ATOM   3593  C CB  . THR B 1 105 ? 6.609   102.456 65.845  1.00   21.19 ? 105  THR B CB  1 
ATOM   3594  O OG1 . THR B 1 105 ? 6.343   102.186 67.231  1.00   17.80 ? 105  THR B OG1 1 
ATOM   3595  C CG2 . THR B 1 105 ? 5.645   101.672 64.948  1.00   18.31 ? 105  THR B CG2 1 
ATOM   3596  N N   . TYR B 1 106 ? 8.052   99.936  66.625  1.00   21.03 ? 106  TYR B N   1 
ATOM   3597  C CA  . TYR B 1 106 ? 8.169   98.481  66.754  1.00   23.99 ? 106  TYR B CA  1 
ATOM   3598  C C   . TYR B 1 106 ? 7.321   97.842  65.640  1.00   23.18 ? 106  TYR B C   1 
ATOM   3599  O O   . TYR B 1 106 ? 6.099   97.988  65.632  1.00   24.34 ? 106  TYR B O   1 
ATOM   3600  C CB  . TYR B 1 106 ? 7.676   98.064  68.151  1.00   22.89 ? 106  TYR B CB  1 
ATOM   3601  C CG  . TYR B 1 106 ? 7.643   96.580  68.436  1.00   22.71 ? 106  TYR B CG  1 
ATOM   3602  C CD1 . TYR B 1 106 ? 8.625   95.712  67.911  1.00   21.42 ? 106  TYR B CD1 1 
ATOM   3603  C CD2 . TYR B 1 106 ? 6.704   96.060  69.330  1.00   14.11 ? 106  TYR B CD2 1 
ATOM   3604  C CE1 . TYR B 1 106 ? 8.668   94.387  68.284  1.00   19.98 ? 106  TYR B CE1 1 
ATOM   3605  C CE2 . TYR B 1 106 ? 6.738   94.735  69.706  1.00   17.48 ? 106  TYR B CE2 1 
ATOM   3606  C CZ  . TYR B 1 106 ? 7.719   93.902  69.184  1.00   19.92 ? 106  TYR B CZ  1 
ATOM   3607  O OH  . TYR B 1 106 ? 7.732   92.590  69.548  1.00   18.78 ? 106  TYR B OH  1 
ATOM   3608  N N   . SER B 1 107 ? 7.979   97.153  64.706  1.00   22.66 ? 107  SER B N   1 
ATOM   3609  C CA  . SER B 1 107 ? 7.300   96.545  63.548  1.00   23.10 ? 107  SER B CA  1 
ATOM   3610  C C   . SER B 1 107 ? 6.191   95.567  63.876  1.00   22.77 ? 107  SER B C   1 
ATOM   3611  O O   . SER B 1 107 ? 5.311   95.334  63.063  1.00   26.10 ? 107  SER B O   1 
ATOM   3612  C CB  . SER B 1 107 ? 8.297   95.832  62.648  1.00   23.14 ? 107  SER B CB  1 
ATOM   3613  O OG  . SER B 1 107 ? 8.759   94.677  63.318  1.00   33.84 ? 107  SER B OG  1 
ATOM   3614  N N   . CYS B 1 108 ? 6.218   94.989  65.058  1.00   22.61 ? 108  CYS B N   1 
ATOM   3615  C CA  . CYS B 1 108 ? 5.180   94.050  65.388  1.00   23.95 ? 108  CYS B CA  1 
ATOM   3616  C C   . CYS B 1 108 ? 3.842   94.703  65.660  1.00   24.24 ? 108  CYS B C   1 
ATOM   3617  O O   . CYS B 1 108 ? 2.811   94.027  65.601  1.00   23.97 ? 108  CYS B O   1 
ATOM   3618  C CB  . CYS B 1 108 ? 5.614   93.162  66.570  1.00   25.55 ? 108  CYS B CB  1 
ATOM   3619  S SG  . CYS B 1 108 ? 6.834   91.837  66.069  1.00   28.25 ? 108  CYS B SG  1 
ATOM   3620  N N   . TYR B 1 109 ? 3.834   95.999  65.958  1.00   23.72 ? 109  TYR B N   1 
ATOM   3621  C CA  . TYR B 1 109 ? 2.556   96.660  66.203  1.00   22.10 ? 109  TYR B CA  1 
ATOM   3622  C C   . TYR B 1 109 ? 1.635   96.446  65.014  1.00   23.59 ? 109  TYR B C   1 
ATOM   3623  O O   . TYR B 1 109 ? 0.495   96.000  65.191  1.00   25.75 ? 109  TYR B O   1 
ATOM   3624  C CB  . TYR B 1 109 ? 2.715   98.158  66.435  1.00   17.25 ? 109  TYR B CB  1 
ATOM   3625  C CG  . TYR B 1 109 ? 3.366   98.501  67.750  1.00   15.14 ? 109  TYR B CG  1 
ATOM   3626  C CD1 . TYR B 1 109 ? 3.101   97.751  68.904  1.00   17.27 ? 109  TYR B CD1 1 
ATOM   3627  C CD2 . TYR B 1 109 ? 4.231   99.588  67.851  1.00   14.72 ? 109  TYR B CD2 1 
ATOM   3628  C CE1 . TYR B 1 109 ? 3.689   98.097  70.141  1.00   22.62 ? 109  TYR B CE1 1 
ATOM   3629  C CE2 . TYR B 1 109 ? 4.820   99.927  69.048  1.00   18.94 ? 109  TYR B CE2 1 
ATOM   3630  C CZ  . TYR B 1 109 ? 4.547   99.191  70.194  1.00   20.06 ? 109  TYR B CZ  1 
ATOM   3631  O OH  . TYR B 1 109 ? 5.116   99.591  71.376  1.00   25.90 ? 109  TYR B OH  1 
ATOM   3632  N N   . ARG B 1 110 ? 2.135   96.769  63.816  1.00   23.48 ? 110  ARG B N   1 
ATOM   3633  C CA  . ARG B 1 110 ? 1.376   96.614  62.579  1.00   23.57 ? 110  ARG B CA  1 
ATOM   3634  C C   . ARG B 1 110 ? 1.027   95.153  62.346  1.00   25.76 ? 110  ARG B C   1 
ATOM   3635  O O   . ARG B 1 110 ? -0.139  94.838  62.084  1.00   24.11 ? 110  ARG B O   1 
ATOM   3636  C CB  . ARG B 1 110 ? 2.167   97.134  61.379  1.00   20.64 ? 110  ARG B CB  1 
ATOM   3637  C CG  . ARG B 1 110 ? 1.433   96.930  60.071  1.00   24.74 ? 110  ARG B CG  1 
ATOM   3638  C CD  . ARG B 1 110 ? 2.304   97.182  58.859  1.00   27.45 ? 110  ARG B CD  1 
ATOM   3639  N NE  . ARG B 1 110 ? 2.643   98.590  58.650  1.00   28.19 ? 110  ARG B NE  1 
ATOM   3640  C CZ  . ARG B 1 110 ? 2.521   99.208  57.472  1.00   36.99 ? 110  ARG B CZ  1 
ATOM   3641  N NH1 . ARG B 1 110 ? 2.058   98.545  56.411  1.00   40.68 ? 110  ARG B NH1 1 
ATOM   3642  N NH2 . ARG B 1 110 ? 2.878   100.487 57.333  1.00   30.45 ? 110  ARG B NH2 1 
ATOM   3643  N N   . ILE B 1 111 ? 2.024   94.262  62.469  1.00   24.96 ? 111  ILE B N   1 
ATOM   3644  C CA  . ILE B 1 111 ? 1.826   92.824  62.270  1.00   21.26 ? 111  ILE B CA  1 
ATOM   3645  C C   . ILE B 1 111 ? 0.764   92.269  63.181  1.00   21.30 ? 111  ILE B C   1 
ATOM   3646  O O   . ILE B 1 111 ? -0.130  91.567  62.734  1.00   22.87 ? 111  ILE B O   1 
ATOM   3647  C CB  . ILE B 1 111 ? 3.110   91.998  62.532  1.00   25.28 ? 111  ILE B CB  1 
ATOM   3648  C CG1 . ILE B 1 111 ? 4.136   92.221  61.424  1.00   23.75 ? 111  ILE B CG1 1 
ATOM   3649  C CG2 . ILE B 1 111 ? 2.758   90.473  62.608  1.00   17.98 ? 111  ILE B CG2 1 
ATOM   3650  C CD1 . ILE B 1 111 ? 4.310   93.665  61.012  1.00   34.03 ? 111  ILE B CD1 1 
ATOM   3651  N N   . PHE B 1 112 ? 0.857   92.568  64.466  1.00   20.29 ? 112  PHE B N   1 
ATOM   3652  C CA  . PHE B 1 112 ? -0.140  92.016  65.377  1.00   22.78 ? 112  PHE B CA  1 
ATOM   3653  C C   . PHE B 1 112 ? -1.505  92.620  65.134  1.00   22.53 ? 112  PHE B C   1 
ATOM   3654  O O   . PHE B 1 112 ? -2.510  91.931  65.229  1.00   25.91 ? 112  PHE B O   1 
ATOM   3655  C CB  . PHE B 1 112 ? 0.263   92.229  66.836  1.00   23.70 ? 112  PHE B CB  1 
ATOM   3656  C CG  . PHE B 1 112 ? 1.521   91.508  67.232  1.00   25.49 ? 112  PHE B CG  1 
ATOM   3657  C CD1 . PHE B 1 112 ? 2.206   90.701  66.330  1.00   27.63 ? 112  PHE B CD1 1 
ATOM   3658  C CD2 . PHE B 1 112 ? 2.028   91.646  68.509  1.00   27.15 ? 112  PHE B CD2 1 
ATOM   3659  C CE1 . PHE B 1 112 ? 3.381   90.050  66.704  1.00   31.66 ? 112  PHE B CE1 1 
ATOM   3660  C CE2 . PHE B 1 112 ? 3.192   91.001  68.887  1.00   26.83 ? 112  PHE B CE2 1 
ATOM   3661  C CZ  . PHE B 1 112 ? 3.873   90.207  67.995  1.00   24.36 ? 112  PHE B CZ  1 
ATOM   3662  N N   . ALA B 1 113 ? -1.550  93.903  64.810  1.00   22.57 ? 113  ALA B N   1 
ATOM   3663  C CA  . ALA B 1 113 ? -2.832  94.534  64.553  1.00   22.32 ? 113  ALA B CA  1 
ATOM   3664  C C   . ALA B 1 113 ? -3.535  93.859  63.363  1.00   24.29 ? 113  ALA B C   1 
ATOM   3665  O O   . ALA B 1 113 ? -4.736  93.569  63.421  1.00   22.49 ? 113  ALA B O   1 
ATOM   3666  C CB  . ALA B 1 113 ? -2.639  96.030  64.281  1.00   17.84 ? 113  ALA B CB  1 
ATOM   3667  N N   . LYS B 1 114 ? -2.796  93.599  62.289  1.00   23.91 ? 114  LYS B N   1 
ATOM   3668  C CA  . LYS B 1 114 ? -3.388  92.964  61.122  1.00   26.06 ? 114  LYS B CA  1 
ATOM   3669  C C   . LYS B 1 114 ? -3.678  91.512  61.460  1.00   26.33 ? 114  LYS B C   1 
ATOM   3670  O O   . LYS B 1 114 ? -4.669  90.953  61.011  1.00   30.46 ? 114  LYS B O   1 
ATOM   3671  C CB  . LYS B 1 114 ? -2.446  93.011  59.915  1.00   26.15 ? 114  LYS B CB  1 
ATOM   3672  C CG  . LYS B 1 114 ? -1.908  94.378  59.534  1.00   31.71 ? 114  LYS B CG  1 
ATOM   3673  C CD  . LYS B 1 114 ? -1.175  94.320  58.182  1.00   35.20 ? 114  LYS B CD  1 
ATOM   3674  C CE  . LYS B 1 114 ? -2.159  94.367  57.011  1.00   39.04 ? 114  LYS B CE  1 
ATOM   3675  N NZ  . LYS B 1 114 ? -1.530  94.059  55.687  1.00   39.75 ? 114  LYS B NZ  1 
ATOM   3676  N N   . ALA B 1 115 ? -2.808  90.895  62.248  1.00   25.13 ? 115  ALA B N   1 
ATOM   3677  C CA  . ALA B 1 115 ? -3.006  89.496  62.608  1.00   27.79 ? 115  ALA B CA  1 
ATOM   3678  C C   . ALA B 1 115 ? -4.332  89.287  63.313  1.00   27.19 ? 115  ALA B C   1 
ATOM   3679  O O   . ALA B 1 115 ? -5.080  88.374  63.003  1.00   30.15 ? 115  ALA B O   1 
ATOM   3680  C CB  . ALA B 1 115 ? -1.876  89.015  63.500  1.00   27.35 ? 115  ALA B CB  1 
ATOM   3681  N N   . VAL B 1 116 ? -4.622  90.138  64.276  1.00   27.49 ? 116  VAL B N   1 
ATOM   3682  C CA  . VAL B 1 116 ? -5.859  90.003  65.022  1.00   26.04 ? 116  VAL B CA  1 
ATOM   3683  C C   . VAL B 1 116 ? -7.019  90.689  64.296  1.00   27.34 ? 116  VAL B C   1 
ATOM   3684  O O   . VAL B 1 116 ? -8.157  90.632  64.745  1.00   26.11 ? 116  VAL B O   1 
ATOM   3685  C CB  . VAL B 1 116 ? -5.685  90.610  66.421  1.00   27.70 ? 116  VAL B CB  1 
ATOM   3686  C CG1 . VAL B 1 116 ? -6.993  90.618  67.135  1.00   33.57 ? 116  VAL B CG1 1 
ATOM   3687  C CG2 . VAL B 1 116 ? -4.666  89.791  67.226  1.00   27.15 ? 116  VAL B CG2 1 
ATOM   3688  N N   . GLY B 1 117 ? -6.732  91.331  63.167  1.00   28.14 ? 117  GLY B N   1 
ATOM   3689  C CA  . GLY B 1 117 ? -7.781  92.022  62.423  1.00   29.41 ? 117  GLY B CA  1 
ATOM   3690  C C   . GLY B 1 117 ? -8.306  93.271  63.134  1.00   28.55 ? 117  GLY B C   1 
ATOM   3691  O O   . GLY B 1 117 ? -9.425  93.730  62.906  1.00   28.44 ? 117  GLY B O   1 
ATOM   3692  N N   . ALA B 1 118 ? -7.472  93.835  63.994  1.00   27.36 ? 118  ALA B N   1 
ATOM   3693  C CA  . ALA B 1 118 ? -7.813  95.022  64.762  1.00   26.78 ? 118  ALA B CA  1 
ATOM   3694  C C   . ALA B 1 118 ? -7.752  96.314  63.945  1.00   25.92 ? 118  ALA B C   1 
ATOM   3695  O O   . ALA B 1 118 ? -6.938  96.437  63.038  1.00   30.56 ? 118  ALA B O   1 
ATOM   3696  C CB  . ALA B 1 118 ? -6.862  95.129  65.989  1.00   19.83 ? 118  ALA B CB  1 
ATOM   3697  N N   . LYS B 1 119 ? -8.596  97.283  64.284  1.00   26.54 ? 119  LYS B N   1 
ATOM   3698  C CA  . LYS B 1 119 ? -8.578  98.561  63.584  1.00   23.09 ? 119  LYS B CA  1 
ATOM   3699  C C   . LYS B 1 119 ? -7.387  99.314  64.145  1.00   22.29 ? 119  LYS B C   1 
ATOM   3700  O O   . LYS B 1 119 ? -7.220  99.396  65.354  1.00   22.30 ? 119  LYS B O   1 
ATOM   3701  C CB  . LYS B 1 119 ? -9.846  99.382  63.849  1.00   23.81 ? 119  LYS B CB  1 
ATOM   3702  C CG  . LYS B 1 119 ? -9.827  100.713 63.100  1.00   28.07 ? 119  LYS B CG  1 
ATOM   3703  C CD  . LYS B 1 119 ? -10.717 101.766 63.728  1.00   36.71 ? 119  LYS B CD  1 
ATOM   3704  C CE  . LYS B 1 119 ? -12.191 101.403 63.688  1.00   38.08 ? 119  LYS B CE  1 
ATOM   3705  N NZ  . LYS B 1 119 ? -12.995 102.413 64.457  1.00   41.44 ? 119  LYS B NZ  1 
ATOM   3706  N N   . PHE B 1 120 ? -6.549  99.860  63.280  1.00   22.26 ? 120  PHE B N   1 
ATOM   3707  C CA  . PHE B 1 120 ? -5.398  100.595 63.764  1.00   24.13 ? 120  PHE B CA  1 
ATOM   3708  C C   . PHE B 1 120 ? -5.122  101.811 62.881  1.00   24.34 ? 120  PHE B C   1 
ATOM   3709  O O   . PHE B 1 120 ? -5.698  101.950 61.799  1.00   26.50 ? 120  PHE B O   1 
ATOM   3710  C CB  . PHE B 1 120 ? -4.168  99.666  63.823  1.00   19.15 ? 120  PHE B CB  1 
ATOM   3711  C CG  . PHE B 1 120 ? -3.681  99.211  62.475  1.00   19.26 ? 120  PHE B CG  1 
ATOM   3712  C CD1 . PHE B 1 120 ? -4.224  98.087  61.871  1.00   21.27 ? 120  PHE B CD1 1 
ATOM   3713  C CD2 . PHE B 1 120 ? -2.662  99.894  61.814  1.00   21.12 ? 120  PHE B CD2 1 
ATOM   3714  C CE1 . PHE B 1 120 ? -3.758  97.634  60.624  1.00   18.49 ? 120  PHE B CE1 1 
ATOM   3715  C CE2 . PHE B 1 120 ? -2.194  99.447  60.569  1.00   21.02 ? 120  PHE B CE2 1 
ATOM   3716  C CZ  . PHE B 1 120 ? -2.751  98.307  59.978  1.00   22.54 ? 120  PHE B CZ  1 
ATOM   3717  N N   . LEU B 1 121 ? -4.254  102.701 63.343  1.00   24.11 ? 121  LEU B N   1 
ATOM   3718  C CA  . LEU B 1 121 ? -3.913  103.872 62.541  1.00   23.44 ? 121  LEU B CA  1 
ATOM   3719  C C   . LEU B 1 121 ? -2.456  104.184 62.755  1.00   21.94 ? 121  LEU B C   1 
ATOM   3720  O O   . LEU B 1 121 ? -1.970  104.114 63.886  1.00   21.53 ? 121  LEU B O   1 
ATOM   3721  C CB  . LEU B 1 121 ? -4.786  105.056 62.951  1.00   24.53 ? 121  LEU B CB  1 
ATOM   3722  C CG  . LEU B 1 121 ? -4.906  106.229 61.975  1.00   32.06 ? 121  LEU B CG  1 
ATOM   3723  C CD1 . LEU B 1 121 ? -3.693  107.099 62.105  1.00   37.09 ? 121  LEU B CD1 1 
ATOM   3724  C CD2 . LEU B 1 121 ? -5.073  105.721 60.531  1.00   27.65 ? 121  LEU B CD2 1 
ATOM   3725  N N   . GLU B 1 122 ? -1.750  104.504 61.677  1.00   22.91 ? 122  GLU B N   1 
ATOM   3726  C CA  . GLU B 1 122 ? -0.331  104.830 61.789  1.00   27.26 ? 122  GLU B CA  1 
ATOM   3727  C C   . GLU B 1 122 ? -0.090  106.255 61.402  1.00   29.92 ? 122  GLU B C   1 
ATOM   3728  O O   . GLU B 1 122 ? -0.263  106.613 60.245  1.00   34.44 ? 122  GLU B O   1 
ATOM   3729  C CB  . GLU B 1 122 ? 0.535   103.941 60.882  1.00   24.37 ? 122  GLU B CB  1 
ATOM   3730  C CG  . GLU B 1 122 ? 0.595   102.483 61.329  1.00   25.28 ? 122  GLU B CG  1 
ATOM   3731  C CD  . GLU B 1 122 ? 1.404   101.606 60.399  1.00   30.42 ? 122  GLU B CD  1 
ATOM   3732  O OE1 . GLU B 1 122 ? 1.307   101.824 59.176  1.00   32.63 ? 122  GLU B OE1 1 
ATOM   3733  O OE2 . GLU B 1 122 ? 2.116   100.687 60.885  1.00   33.48 ? 122  GLU B OE2 1 
ATOM   3734  N N   . VAL B 1 123 ? 0.291   107.087 62.354  1.00   30.60 ? 123  VAL B N   1 
ATOM   3735  C CA  . VAL B 1 123 ? 0.587   108.465 61.998  1.00   31.30 ? 123  VAL B CA  1 
ATOM   3736  C C   . VAL B 1 123 ? 2.108   108.582 62.156  1.00   33.54 ? 123  VAL B C   1 
ATOM   3737  O O   . VAL B 1 123 ? 2.651   108.325 63.227  1.00   33.11 ? 123  VAL B O   1 
ATOM   3738  C CB  . VAL B 1 123 ? -0.143  109.456 62.918  1.00   32.90 ? 123  VAL B CB  1 
ATOM   3739  C CG1 . VAL B 1 123 ? 0.022   110.866 62.371  1.00   31.96 ? 123  VAL B CG1 1 
ATOM   3740  C CG2 . VAL B 1 123 ? -1.619  109.099 63.020  1.00   28.01 ? 123  VAL B CG2 1 
ATOM   3741  N N   . PRO B 1 124 ? 2.815   108.940 61.077  1.00   34.54 ? 124  PRO B N   1 
ATOM   3742  C CA  . PRO B 1 124 ? 4.274   109.069 61.114  1.00   35.73 ? 124  PRO B CA  1 
ATOM   3743  C C   . PRO B 1 124 ? 4.809   110.170 62.003  1.00   36.34 ? 124  PRO B C   1 
ATOM   3744  O O   . PRO B 1 124 ? 4.208   111.234 62.122  1.00   37.17 ? 124  PRO B O   1 
ATOM   3745  C CB  . PRO B 1 124 ? 4.640   109.298 59.651  1.00   35.06 ? 124  PRO B CB  1 
ATOM   3746  C CG  . PRO B 1 124 ? 3.587   108.546 58.924  1.00   35.59 ? 124  PRO B CG  1 
ATOM   3747  C CD  . PRO B 1 124 ? 2.334   108.934 59.686  1.00   35.94 ? 124  PRO B CD  1 
ATOM   3748  N N   . LEU B 1 125 ? 5.936   109.906 62.644  1.00   34.25 ? 125  LEU B N   1 
ATOM   3749  C CA  . LEU B 1 125 ? 6.551   110.913 63.488  1.00   35.34 ? 125  LEU B CA  1 
ATOM   3750  C C   . LEU B 1 125 ? 7.121   112.011 62.577  1.00   35.50 ? 125  LEU B C   1 
ATOM   3751  O O   . LEU B 1 125 ? 7.341   111.797 61.383  1.00   35.32 ? 125  LEU B O   1 
ATOM   3752  C CB  . LEU B 1 125 ? 7.692   110.298 64.299  1.00   30.59 ? 125  LEU B CB  1 
ATOM   3753  C CG  . LEU B 1 125 ? 7.370   109.061 65.131  1.00   26.61 ? 125  LEU B CG  1 
ATOM   3754  C CD1 . LEU B 1 125 ? 8.668   108.382 65.539  1.00   13.06 ? 125  LEU B CD1 1 
ATOM   3755  C CD2 . LEU B 1 125 ? 6.527   109.457 66.336  1.00   23.38 ? 125  LEU B CD2 1 
ATOM   3756  N N   . THR B 1 126 ? 7.361   113.181 63.156  1.00   37.98 ? 126  THR B N   1 
ATOM   3757  C CA  . THR B 1 126 ? 7.922   114.314 62.429  1.00   38.56 ? 126  THR B CA  1 
ATOM   3758  C C   . THR B 1 126 ? 9.307   113.902 61.983  1.00   41.33 ? 126  THR B C   1 
ATOM   3759  O O   . THR B 1 126 ? 9.806   112.851 62.388  1.00   38.91 ? 126  THR B O   1 
ATOM   3760  C CB  . THR B 1 126 ? 8.080   115.548 63.334  1.00   37.70 ? 126  THR B CB  1 
ATOM   3761  O OG1 . THR B 1 126 ? 6.833   115.834 63.975  1.00   36.32 ? 126  THR B OG1 1 
ATOM   3762  C CG2 . THR B 1 126 ? 8.494   116.771 62.512  1.00   45.75 ? 126  THR B CG2 1 
ATOM   3763  N N   . LYS B 1 127 ? 9.928   114.728 61.149  1.00   43.41 ? 127  LYS B N   1 
ATOM   3764  C CA  . LYS B 1 127 ? 11.272  114.452 60.671  1.00   48.27 ? 127  LYS B CA  1 
ATOM   3765  C C   . LYS B 1 127 ? 12.226  114.583 61.866  1.00   48.00 ? 127  LYS B C   1 
ATOM   3766  O O   . LYS B 1 127 ? 13.402  114.241 61.794  1.00   49.40 ? 127  LYS B O   1 
ATOM   3767  C CB  . LYS B 1 127 ? 11.642  115.459 59.579  1.00   53.75 ? 127  LYS B CB  1 
ATOM   3768  C CG  . LYS B 1 127 ? 12.513  114.896 58.454  1.00   61.54 ? 127  LYS B CG  1 
ATOM   3769  C CD  . LYS B 1 127 ? 11.834  113.739 57.718  1.00   64.50 ? 127  LYS B CD  1 
ATOM   3770  C CE  . LYS B 1 127 ? 12.637  113.302 56.491  1.00   67.78 ? 127  LYS B CE  1 
ATOM   3771  N NZ  . LYS B 1 127 ? 12.636  114.334 55.406  1.00   68.04 ? 127  LYS B NZ  1 
ATOM   3772  N N   . ASP B 1 128 ? 11.697  115.079 62.975  1.00   47.46 ? 128  ASP B N   1 
ATOM   3773  C CA  . ASP B 1 128 ? 12.478  115.263 64.186  1.00   47.79 ? 128  ASP B CA  1 
ATOM   3774  C C   . ASP B 1 128 ? 12.221  114.123 65.178  1.00   47.00 ? 128  ASP B C   1 
ATOM   3775  O O   . ASP B 1 128 ? 12.667  114.165 66.326  1.00   46.60 ? 128  ASP B O   1 
ATOM   3776  C CB  . ASP B 1 128 ? 12.107  116.603 64.808  1.00   51.13 ? 128  ASP B CB  1 
ATOM   3777  C CG  . ASP B 1 128 ? 12.347  117.760 63.865  1.00   55.14 ? 128  ASP B CG  1 
ATOM   3778  O OD1 . ASP B 1 128 ? 13.529  118.031 63.567  1.00   60.32 ? 128  ASP B OD1 1 
ATOM   3779  O OD2 . ASP B 1 128 ? 11.362  118.387 63.410  1.00   56.08 ? 128  ASP B OD2 1 
ATOM   3780  N N   . LEU B 1 129 ? 11.489  113.108 64.734  1.00   44.88 ? 129  LEU B N   1 
ATOM   3781  C CA  . LEU B 1 129 ? 11.186  111.964 65.576  1.00   40.79 ? 129  LEU B CA  1 
ATOM   3782  C C   . LEU B 1 129 ? 10.299  112.364 66.739  1.00   40.65 ? 129  LEU B C   1 
ATOM   3783  O O   . LEU B 1 129 ? 10.434  111.843 67.838  1.00   40.71 ? 129  LEU B O   1 
ATOM   3784  C CB  . LEU B 1 129 ? 12.483  111.335 66.091  1.00   38.42 ? 129  LEU B CB  1 
ATOM   3785  C CG  . LEU B 1 129 ? 13.347  110.687 64.994  1.00   42.36 ? 129  LEU B CG  1 
ATOM   3786  C CD1 . LEU B 1 129 ? 14.619  110.057 65.589  1.00   41.17 ? 129  LEU B CD1 1 
ATOM   3787  C CD2 . LEU B 1 129 ? 12.517  109.619 64.268  1.00   39.56 ? 129  LEU B CD2 1 
ATOM   3788  N N   . ARG B 1 130 ? 9.398   113.309 66.498  1.00   39.51 ? 130  ARG B N   1 
ATOM   3789  C CA  . ARG B 1 130 ? 8.490   113.744 67.541  1.00   37.05 ? 130  ARG B CA  1 
ATOM   3790  C C   . ARG B 1 130 ? 7.097   113.223 67.239  1.00   34.40 ? 130  ARG B C   1 
ATOM   3791  O O   . ARG B 1 130 ? 6.750   112.975 66.084  1.00   33.00 ? 130  ARG B O   1 
ATOM   3792  C CB  . ARG B 1 130 ? 8.478   115.270 67.664  1.00   35.83 ? 130  ARG B CB  1 
ATOM   3793  C CG  . ARG B 1 130 ? 9.727   115.853 68.334  1.00   43.49 ? 130  ARG B CG  1 
ATOM   3794  C CD  . ARG B 1 130 ? 9.507   117.310 68.810  1.00   50.39 ? 130  ARG B CD  1 
ATOM   3795  N NE  . ARG B 1 130 ? 8.814   117.405 70.101  1.00   51.30 ? 130  ARG B NE  1 
ATOM   3796  C CZ  . ARG B 1 130 ? 8.103   118.460 70.496  1.00   53.32 ? 130  ARG B CZ  1 
ATOM   3797  N NH1 . ARG B 1 130 ? 7.986   119.516 69.699  1.00   57.13 ? 130  ARG B NH1 1 
ATOM   3798  N NH2 . ARG B 1 130 ? 7.495   118.456 71.678  1.00   54.18 ? 130  ARG B NH2 1 
ATOM   3799  N N   . ILE B 1 131 ? 6.312   113.045 68.291  1.00   32.25 ? 131  ILE B N   1 
ATOM   3800  C CA  . ILE B 1 131 ? 4.961   112.555 68.151  1.00   32.55 ? 131  ILE B CA  1 
ATOM   3801  C C   . ILE B 1 131 ? 4.125   113.552 67.387  1.00   33.26 ? 131  ILE B C   1 
ATOM   3802  O O   . ILE B 1 131 ? 3.958   114.681 67.799  1.00   35.13 ? 131  ILE B O   1 
ATOM   3803  C CB  . ILE B 1 131 ? 4.318   112.301 69.514  1.00   30.69 ? 131  ILE B CB  1 
ATOM   3804  C CG1 . ILE B 1 131 ? 5.189   111.304 70.289  1.00   30.19 ? 131  ILE B CG1 1 
ATOM   3805  C CG2 . ILE B 1 131 ? 2.870   111.822 69.321  1.00   29.22 ? 131  ILE B CG2 1 
ATOM   3806  C CD1 . ILE B 1 131 ? 4.548   110.745 71.530  1.00   33.41 ? 131  ILE B CD1 1 
ATOM   3807  N N   . PRO B 1 132 ? 3.581   113.132 66.249  1.00   35.76 ? 132  PRO B N   1 
ATOM   3808  C CA  . PRO B 1 132 ? 2.746   113.975 65.392  1.00   36.88 ? 132  PRO B CA  1 
ATOM   3809  C C   . PRO B 1 132 ? 1.443   114.433 66.028  1.00   37.54 ? 132  PRO B C   1 
ATOM   3810  O O   . PRO B 1 132 ? 1.109   114.061 67.148  1.00   38.47 ? 132  PRO B O   1 
ATOM   3811  C CB  . PRO B 1 132 ? 2.498   113.087 64.177  1.00   35.33 ? 132  PRO B CB  1 
ATOM   3812  C CG  . PRO B 1 132 ? 2.458   111.714 64.789  1.00   36.78 ? 132  PRO B CG  1 
ATOM   3813  C CD  . PRO B 1 132 ? 3.628   111.745 65.744  1.00   36.82 ? 132  PRO B CD  1 
ATOM   3814  N N   . GLU B 1 133 ? 0.718   115.267 65.301  1.00   37.85 ? 133  GLU B N   1 
ATOM   3815  C CA  . GLU B 1 133 ? -0.562  115.748 65.775  1.00   37.84 ? 133  GLU B CA  1 
ATOM   3816  C C   . GLU B 1 133 ? -1.464  114.606 65.401  1.00   34.97 ? 133  GLU B C   1 
ATOM   3817  O O   . GLU B 1 133 ? -1.318  114.039 64.325  1.00   33.70 ? 133  GLU B O   1 
ATOM   3818  C CB  . GLU B 1 133 ? -0.972  117.019 65.026  1.00   41.38 ? 133  GLU B CB  1 
ATOM   3819  C CG  . GLU B 1 133 ? 0.048   118.154 65.110  1.00   48.19 ? 133  GLU B CG  1 
ATOM   3820  C CD  . GLU B 1 133 ? 0.249   118.688 66.527  1.00   55.07 ? 133  GLU B CD  1 
ATOM   3821  O OE1 . GLU B 1 133 ? 0.825   117.948 67.362  1.00   58.19 ? 133  GLU B OE1 1 
ATOM   3822  O OE2 . GLU B 1 133 ? -0.169  119.844 66.800  1.00   54.78 ? 133  GLU B OE2 1 
ATOM   3823  N N   . VAL B 1 134 ? -2.398  114.267 66.278  1.00   33.34 ? 134  VAL B N   1 
ATOM   3824  C CA  . VAL B 1 134 ? -3.293  113.148 66.021  1.00   31.00 ? 134  VAL B CA  1 
ATOM   3825  C C   . VAL B 1 134 ? -4.597  113.349 66.760  1.00   29.67 ? 134  VAL B C   1 
ATOM   3826  O O   . VAL B 1 134 ? -4.648  114.112 67.705  1.00   29.81 ? 134  VAL B O   1 
ATOM   3827  C CB  . VAL B 1 134 ? -2.636  111.829 66.496  1.00   30.58 ? 134  VAL B CB  1 
ATOM   3828  C CG1 . VAL B 1 134 ? -1.411  111.541 65.680  1.00   35.70 ? 134  VAL B CG1 1 
ATOM   3829  C CG2 . VAL B 1 134 ? -2.246  111.941 67.966  1.00   27.45 ? 134  VAL B CG2 1 
ATOM   3830  N N   . ASN B 1 135 ? -5.649  112.666 66.324  1.00   31.83 ? 135  ASN B N   1 
ATOM   3831  C CA  . ASN B 1 135 ? -6.953  112.778 66.976  1.00   34.48 ? 135  ASN B CA  1 
ATOM   3832  C C   . ASN B 1 135 ? -7.308  111.456 67.631  1.00   34.43 ? 135  ASN B C   1 
ATOM   3833  O O   . ASN B 1 135 ? -7.842  110.549 66.989  1.00   31.19 ? 135  ASN B O   1 
ATOM   3834  C CB  . ASN B 1 135 ? -8.042  113.146 65.971  1.00   36.50 ? 135  ASN B CB  1 
ATOM   3835  C CG  . ASN B 1 135 ? -7.519  114.001 64.840  1.00   41.57 ? 135  ASN B CG  1 
ATOM   3836  O OD1 . ASN B 1 135 ? -7.105  113.485 63.799  1.00   42.76 ? 135  ASN B OD1 1 
ATOM   3837  N ND2 . ASN B 1 135 ? -7.521  115.315 65.040  1.00   42.18 ? 135  ASN B ND2 1 
ATOM   3838  N N   . VAL B 1 136 ? -6.997  111.351 68.916  1.00   35.40 ? 136  VAL B N   1 
ATOM   3839  C CA  . VAL B 1 136 ? -7.268  110.145 69.674  1.00   36.14 ? 136  VAL B CA  1 
ATOM   3840  C C   . VAL B 1 136 ? -8.026  110.491 70.927  1.00   35.91 ? 136  VAL B C   1 
ATOM   3841  O O   . VAL B 1 136 ? -7.999  111.632 71.384  1.00   36.97 ? 136  VAL B O   1 
ATOM   3842  C CB  . VAL B 1 136 ? -5.970  109.440 70.087  1.00   36.69 ? 136  VAL B CB  1 
ATOM   3843  C CG1 . VAL B 1 136 ? -5.214  108.964 68.848  1.00   37.29 ? 136  VAL B CG1 1 
ATOM   3844  C CG2 . VAL B 1 136 ? -5.120  110.386 70.919  1.00   35.43 ? 136  VAL B CG2 1 
ATOM   3845  N N   . GLY B 1 137 ? -8.698  109.487 71.485  1.00   37.37 ? 137  GLY B N   1 
ATOM   3846  C CA  . GLY B 1 137 ? -9.456  109.683 72.705  1.00   35.42 ? 137  GLY B CA  1 
ATOM   3847  C C   . GLY B 1 137 ? -9.807  108.357 73.342  1.00   35.22 ? 137  GLY B C   1 
ATOM   3848  O O   . GLY B 1 137 ? -9.444  107.304 72.830  1.00   33.55 ? 137  GLY B O   1 
ATOM   3849  N N   . GLU B 1 138 ? -10.500 108.407 74.473  1.00   36.08 ? 138  GLU B N   1 
ATOM   3850  C CA  . GLU B 1 138 ? -10.913 107.187 75.150  1.00   36.66 ? 138  GLU B CA  1 
ATOM   3851  C C   . GLU B 1 138 ? -11.494 106.247 74.103  1.00   34.31 ? 138  GLU B C   1 
ATOM   3852  O O   . GLU B 1 138 ? -12.488 106.576 73.446  1.00   31.26 ? 138  GLU B O   1 
ATOM   3853  C CB  . GLU B 1 138 ? -11.971 107.495 76.202  1.00   39.17 ? 138  GLU B CB  1 
ATOM   3854  C CG  . GLU B 1 138 ? -12.469 106.262 76.922  1.00   46.37 ? 138  GLU B CG  1 
ATOM   3855  C CD  . GLU B 1 138 ? -13.474 106.593 78.001  1.00   51.90 ? 138  GLU B CD  1 
ATOM   3856  O OE1 . GLU B 1 138 ? -14.596 107.053 77.669  1.00   53.33 ? 138  GLU B OE1 1 
ATOM   3857  O OE2 . GLU B 1 138 ? -13.126 106.392 79.186  1.00   53.82 ? 138  GLU B OE2 1 
ATOM   3858  N N   . GLY B 1 139 ? -10.877 105.080 73.957  1.00   31.10 ? 139  GLY B N   1 
ATOM   3859  C CA  . GLY B 1 139 ? -11.348 104.120 72.981  1.00   29.78 ? 139  GLY B CA  1 
ATOM   3860  C C   . GLY B 1 139 ? -10.134 103.586 72.259  1.00   31.97 ? 139  GLY B C   1 
ATOM   3861  O O   . GLY B 1 139 ? -10.081 102.413 71.850  1.00   35.05 ? 139  GLY B O   1 
ATOM   3862  N N   . ASP B 1 140 ? -9.145  104.459 72.113  1.00   29.46 ? 140  ASP B N   1 
ATOM   3863  C CA  . ASP B 1 140 ? -7.902  104.101 71.459  1.00   30.21 ? 140  ASP B CA  1 
ATOM   3864  C C   . ASP B 1 140 ? -6.820  103.718 72.471  1.00   27.69 ? 140  ASP B C   1 
ATOM   3865  O O   . ASP B 1 140 ? -6.882  104.115 73.633  1.00   29.46 ? 140  ASP B O   1 
ATOM   3866  C CB  . ASP B 1 140 ? -7.353  105.296 70.650  1.00   30.53 ? 140  ASP B CB  1 
ATOM   3867  C CG  . ASP B 1 140 ? -8.358  105.886 69.692  1.00   32.94 ? 140  ASP B CG  1 
ATOM   3868  O OD1 . ASP B 1 140 ? -8.637  107.085 69.843  1.00   33.02 ? 140  ASP B OD1 1 
ATOM   3869  O OD2 . ASP B 1 140 ? -8.859  105.175 68.784  1.00   37.52 ? 140  ASP B OD2 1 
ATOM   3870  N N   . VAL B 1 141 ? -5.861  102.914 72.025  1.00   25.03 ? 141  VAL B N   1 
ATOM   3871  C CA  . VAL B 1 141 ? -4.689  102.592 72.836  1.00   24.15 ? 141  VAL B CA  1 
ATOM   3872  C C   . VAL B 1 141 ? -3.600  103.212 71.974  1.00   22.52 ? 141  VAL B C   1 
ATOM   3873  O O   . VAL B 1 141 ? -3.563  102.997 70.758  1.00   19.32 ? 141  VAL B O   1 
ATOM   3874  C CB  . VAL B 1 141 ? -4.292  101.090 72.902  1.00   24.29 ? 141  VAL B CB  1 
ATOM   3875  C CG1 . VAL B 1 141 ? -3.861  100.747 74.320  1.00   25.05 ? 141  VAL B CG1 1 
ATOM   3876  C CG2 . VAL B 1 141 ? -5.375  100.214 72.373  1.00   26.86 ? 141  VAL B CG2 1 
ATOM   3877  N N   . VAL B 1 142 ? -2.713  103.970 72.585  1.00   21.01 ? 142  VAL B N   1 
ATOM   3878  C CA  . VAL B 1 142 ? -1.635  104.571 71.832  1.00   21.27 ? 142  VAL B CA  1 
ATOM   3879  C C   . VAL B 1 142 ? -0.360  103.882 72.281  1.00   20.65 ? 142  VAL B C   1 
ATOM   3880  O O   . VAL B 1 142 ? 0.034   103.979 73.430  1.00   21.27 ? 142  VAL B O   1 
ATOM   3881  C CB  . VAL B 1 142 ? -1.590  106.104 72.082  1.00   21.70 ? 142  VAL B CB  1 
ATOM   3882  C CG1 . VAL B 1 142 ? -0.276  106.714 71.554  1.00   20.62 ? 142  VAL B CG1 1 
ATOM   3883  C CG2 . VAL B 1 142 ? -2.776  106.748 71.398  1.00   18.05 ? 142  VAL B CG2 1 
ATOM   3884  N N   . PHE B 1 143 ? 0.261   103.154 71.361  1.00   22.05 ? 143  PHE B N   1 
ATOM   3885  C CA  . PHE B 1 143 ? 1.469   102.406 71.649  1.00   20.69 ? 143  PHE B CA  1 
ATOM   3886  C C   . PHE B 1 143 ? 2.703   103.240 71.452  1.00   21.63 ? 143  PHE B C   1 
ATOM   3887  O O   . PHE B 1 143 ? 3.023   103.639 70.336  1.00   21.06 ? 143  PHE B O   1 
ATOM   3888  C CB  . PHE B 1 143 ? 1.539   101.178 70.763  1.00   17.86 ? 143  PHE B CB  1 
ATOM   3889  C CG  . PHE B 1 143 ? 0.611   100.096 71.179  1.00   13.13 ? 143  PHE B CG  1 
ATOM   3890  C CD1 . PHE B 1 143 ? 0.899   99.313  72.292  1.00   16.28 ? 143  PHE B CD1 1 
ATOM   3891  C CD2 . PHE B 1 143 ? -0.557  99.861  70.477  1.00   10.02 ? 143  PHE B CD2 1 
ATOM   3892  C CE1 . PHE B 1 143 ? 0.026   98.301  72.700  1.00   16.74 ? 143  PHE B CE1 1 
ATOM   3893  C CE2 . PHE B 1 143 ? -1.443  98.854  70.869  1.00   16.98 ? 143  PHE B CE2 1 
ATOM   3894  C CZ  . PHE B 1 143 ? -1.159  98.071  71.977  1.00   15.10 ? 143  PHE B CZ  1 
ATOM   3895  N N   . ILE B 1 144 ? 3.410   103.492 72.544  1.00   22.29 ? 144  ILE B N   1 
ATOM   3896  C CA  . ILE B 1 144 ? 4.617   104.306 72.456  1.00   24.36 ? 144  ILE B CA  1 
ATOM   3897  C C   . ILE B 1 144 ? 5.839   103.667 73.092  1.00   23.76 ? 144  ILE B C   1 
ATOM   3898  O O   . ILE B 1 144 ? 6.032   103.725 74.312  1.00   25.31 ? 144  ILE B O   1 
ATOM   3899  C CB  . ILE B 1 144 ? 4.422   105.692 73.123  1.00   23.53 ? 144  ILE B CB  1 
ATOM   3900  C CG1 . ILE B 1 144 ? 3.119   106.329 72.660  1.00   23.34 ? 144  ILE B CG1 1 
ATOM   3901  C CG2 . ILE B 1 144 ? 5.585   106.597 72.774  1.00   22.34 ? 144  ILE B CG2 1 
ATOM   3902  C CD1 . ILE B 1 144 ? 2.747   107.592 73.461  1.00   25.74 ? 144  ILE B CD1 1 
ATOM   3903  N N   . PRO B 1 145 ? 6.678   103.035 72.279  1.00   23.90 ? 145  PRO B N   1 
ATOM   3904  C CA  . PRO B 1 145 ? 7.864   102.432 72.888  1.00   23.98 ? 145  PRO B CA  1 
ATOM   3905  C C   . PRO B 1 145 ? 8.762   103.590 73.275  1.00   25.01 ? 145  PRO B C   1 
ATOM   3906  O O   . PRO B 1 145 ? 8.896   104.548 72.507  1.00   22.93 ? 145  PRO B O   1 
ATOM   3907  C CB  . PRO B 1 145 ? 8.444   101.624 71.751  1.00   21.10 ? 145  PRO B CB  1 
ATOM   3908  C CG  . PRO B 1 145 ? 8.031   102.393 70.556  1.00   22.29 ? 145  PRO B CG  1 
ATOM   3909  C CD  . PRO B 1 145 ? 6.618   102.750 70.845  1.00   23.60 ? 145  PRO B CD  1 
ATOM   3910  N N   . ASN B 1 146 ? 9.356   103.533 74.461  1.00   26.07 ? 146  ASN B N   1 
ATOM   3911  C CA  . ASN B 1 146 ? 10.235  104.619 74.877  1.00   26.88 ? 146  ASN B CA  1 
ATOM   3912  C C   . ASN B 1 146 ? 11.281  104.212 75.898  1.00   25.34 ? 146  ASN B C   1 
ATOM   3913  O O   . ASN B 1 146 ? 10.949  104.009 77.051  1.00   28.26 ? 146  ASN B O   1 
ATOM   3914  C CB  . ASN B 1 146 ? 9.422   105.767 75.446  1.00   25.13 ? 146  ASN B CB  1 
ATOM   3915  C CG  . ASN B 1 146 ? 10.274  106.968 75.768  1.00   27.32 ? 146  ASN B CG  1 
ATOM   3916  O OD1 . ASN B 1 146 ? 11.223  107.266 75.046  1.00   26.07 ? 146  ASN B OD1 1 
ATOM   3917  N ND2 . ASN B 1 146 ? 9.935   107.673 76.847  1.00   28.09 ? 146  ASN B ND2 1 
ATOM   3918  N N   . PRO B 1 147 ? 12.552  104.110 75.498  1.00   25.13 ? 147  PRO B N   1 
ATOM   3919  C CA  . PRO B 1 147 ? 13.159  104.332 74.177  1.00   23.96 ? 147  PRO B CA  1 
ATOM   3920  C C   . PRO B 1 147 ? 12.408  103.726 72.974  1.00   25.93 ? 147  PRO B C   1 
ATOM   3921  O O   . PRO B 1 147 ? 11.899  102.594 73.039  1.00   27.35 ? 147  PRO B O   1 
ATOM   3922  C CB  . PRO B 1 147 ? 14.553  103.737 74.348  1.00   21.87 ? 147  PRO B CB  1 
ATOM   3923  C CG  . PRO B 1 147 ? 14.891  104.105 75.720  1.00   25.38 ? 147  PRO B CG  1 
ATOM   3924  C CD  . PRO B 1 147 ? 13.598  103.781 76.485  1.00   24.41 ? 147  PRO B CD  1 
ATOM   3925  N N   . ASN B 1 148 ? 12.359  104.485 71.883  1.00   21.99 ? 148  ASN B N   1 
ATOM   3926  C CA  . ASN B 1 148 ? 11.706  104.046 70.669  1.00   22.68 ? 148  ASN B CA  1 
ATOM   3927  C C   . ASN B 1 148 ? 12.453  102.951 69.928  1.00   23.39 ? 148  ASN B C   1 
ATOM   3928  O O   . ASN B 1 148 ? 13.677  102.814 70.005  1.00   23.66 ? 148  ASN B O   1 
ATOM   3929  C CB  . ASN B 1 148 ? 11.529  105.212 69.684  1.00   22.77 ? 148  ASN B CB  1 
ATOM   3930  C CG  . ASN B 1 148 ? 10.488  104.906 68.606  1.00   19.61 ? 148  ASN B CG  1 
ATOM   3931  O OD1 . ASN B 1 148 ? 9.358   104.575 68.936  1.00   20.57 ? 148  ASN B OD1 1 
ATOM   3932  N ND2 . ASN B 1 148 ? 10.869  105.009 67.325  1.00   12.48 ? 148  ASN B ND2 1 
ATOM   3933  N N   . ASN B 1 149 ? 11.673  102.161 69.210  1.00   22.75 ? 149  ASN B N   1 
ATOM   3934  C CA  . ASN B 1 149 ? 12.217  101.107 68.383  1.00   22.95 ? 149  ASN B CA  1 
ATOM   3935  C C   . ASN B 1 149 ? 11.827  101.565 66.978  1.00   22.41 ? 149  ASN B C   1 
ATOM   3936  O O   . ASN B 1 149 ? 10.661  101.852 66.723  1.00   25.25 ? 149  ASN B O   1 
ATOM   3937  C CB  . ASN B 1 149 ? 11.567  99.765  68.727  1.00   22.36 ? 149  ASN B CB  1 
ATOM   3938  C CG  . ASN B 1 149 ? 11.846  98.685  67.671  1.00   30.28 ? 149  ASN B CG  1 
ATOM   3939  O OD1 . ASN B 1 149 ? 11.762  98.931  66.457  1.00   30.41 ? 149  ASN B OD1 1 
ATOM   3940  N ND2 . ASN B 1 149 ? 12.147  97.481  68.130  1.00   27.10 ? 149  ASN B ND2 1 
ATOM   3941  N N   . PRO B 1 150 ? 12.775  101.583 66.032  1.00   20.22 ? 150  PRO B N   1 
ATOM   3942  C CA  . PRO B 1 150 ? 14.178  101.197 66.169  1.00   19.56 ? 150  PRO B CA  1 
ATOM   3943  C C   . PRO B 1 150 ? 15.160  102.351 66.367  1.00   19.46 ? 150  PRO B C   1 
ATOM   3944  O O   . PRO B 1 150 ? 16.366  102.147 66.332  1.00   18.99 ? 150  PRO B O   1 
ATOM   3945  C CB  . PRO B 1 150 ? 14.425  100.459 64.863  1.00   19.64 ? 150  PRO B CB  1 
ATOM   3946  C CG  . PRO B 1 150 ? 13.712  101.379 63.878  1.00   18.09 ? 150  PRO B CG  1 
ATOM   3947  C CD  . PRO B 1 150 ? 12.447  101.845 64.621  1.00   17.38 ? 150  PRO B CD  1 
ATOM   3948  N N   . THR B 1 151 ? 14.635  103.551 66.553  1.00   19.69 ? 151  THR B N   1 
ATOM   3949  C CA  . THR B 1 151 ? 15.444  104.739 66.752  1.00   22.67 ? 151  THR B CA  1 
ATOM   3950  C C   . THR B 1 151 ? 16.131  104.742 68.109  1.00   23.14 ? 151  THR B C   1 
ATOM   3951  O O   . THR B 1 151 ? 17.230  105.254 68.254  1.00   26.06 ? 151  THR B O   1 
ATOM   3952  C CB  . THR B 1 151 ? 14.567  105.973 66.708  1.00   20.55 ? 151  THR B CB  1 
ATOM   3953  O OG1 . THR B 1 151 ? 13.543  105.816 67.693  1.00   32.39 ? 151  THR B OG1 1 
ATOM   3954  C CG2 . THR B 1 151 ? 13.924  106.135 65.345  1.00   23.39 ? 151  THR B CG2 1 
ATOM   3955  N N   . GLY B 1 152 ? 15.449  104.183 69.107  1.00   26.62 ? 152  GLY B N   1 
ATOM   3956  C CA  . GLY B 1 152 ? 15.971  104.140 70.459  1.00   23.74 ? 152  GLY B CA  1 
ATOM   3957  C C   . GLY B 1 152 ? 15.970  105.528 71.077  1.00   25.10 ? 152  GLY B C   1 
ATOM   3958  O O   . GLY B 1 152 ? 16.465  105.716 72.196  1.00   22.80 ? 152  GLY B O   1 
ATOM   3959  N N   . HIS B 1 153 ? 15.439  106.512 70.351  1.00   24.31 ? 153  HIS B N   1 
ATOM   3960  C CA  . HIS B 1 153 ? 15.384  107.870 70.876  1.00   26.44 ? 153  HIS B CA  1 
ATOM   3961  C C   . HIS B 1 153 ? 14.318  107.959 71.962  1.00   27.94 ? 153  HIS B C   1 
ATOM   3962  O O   . HIS B 1 153 ? 13.274  107.293 71.916  1.00   26.51 ? 153  HIS B O   1 
ATOM   3963  C CB  . HIS B 1 153 ? 15.087  108.910 69.772  1.00   26.94 ? 153  HIS B CB  1 
ATOM   3964  C CG  . HIS B 1 153 ? 13.638  109.046 69.436  1.00   29.33 ? 153  HIS B CG  1 
ATOM   3965  N ND1 . HIS B 1 153 ? 12.977  108.155 68.619  1.00   28.28 ? 153  HIS B ND1 1 
ATOM   3966  C CD2 . HIS B 1 153 ? 12.703  109.927 69.867  1.00   31.80 ? 153  HIS B CD2 1 
ATOM   3967  C CE1 . HIS B 1 153 ? 11.696  108.476 68.568  1.00   33.61 ? 153  HIS B CE1 1 
ATOM   3968  N NE2 . HIS B 1 153 ? 11.503  109.547 69.319  1.00   32.15 ? 153  HIS B NE2 1 
ATOM   3969  N N   . VAL B 1 154 ? 14.610  108.796 72.945  1.00   30.44 ? 154  VAL B N   1 
ATOM   3970  C CA  . VAL B 1 154 ? 13.727  109.021 74.067  1.00   29.31 ? 154  VAL B CA  1 
ATOM   3971  C C   . VAL B 1 154 ? 12.781  110.178 73.783  1.00   31.51 ? 154  VAL B C   1 
ATOM   3972  O O   . VAL B 1 154 ? 13.211  111.279 73.432  1.00   31.26 ? 154  VAL B O   1 
ATOM   3973  C CB  . VAL B 1 154 ? 14.549  109.348 75.311  1.00   28.88 ? 154  VAL B CB  1 
ATOM   3974  C CG1 . VAL B 1 154 ? 13.643  109.595 76.482  1.00   27.69 ? 154  VAL B CG1 1 
ATOM   3975  C CG2 . VAL B 1 154 ? 15.507  108.203 75.588  1.00   28.25 ? 154  VAL B CG2 1 
ATOM   3976  N N   . PHE B 1 155 ? 11.487  109.920 73.910  1.00   31.60 ? 155  PHE B N   1 
ATOM   3977  C CA  . PHE B 1 155 ? 10.507  110.968 73.698  1.00   35.13 ? 155  PHE B CA  1 
ATOM   3978  C C   . PHE B 1 155 ? 10.560  111.945 74.878  1.00   37.37 ? 155  PHE B C   1 
ATOM   3979  O O   . PHE B 1 155 ? 11.005  111.595 75.978  1.00   38.58 ? 155  PHE B O   1 
ATOM   3980  C CB  . PHE B 1 155 ? 9.092   110.394 73.610  1.00   33.61 ? 155  PHE B CB  1 
ATOM   3981  C CG  . PHE B 1 155 ? 8.821   109.624 72.359  1.00   34.78 ? 155  PHE B CG  1 
ATOM   3982  C CD1 . PHE B 1 155 ? 9.049   108.245 72.312  1.00   33.79 ? 155  PHE B CD1 1 
ATOM   3983  C CD2 . PHE B 1 155 ? 8.316   110.266 71.230  1.00   35.43 ? 155  PHE B CD2 1 
ATOM   3984  C CE1 . PHE B 1 155 ? 8.776   107.511 71.162  1.00   31.83 ? 155  PHE B CE1 1 
ATOM   3985  C CE2 . PHE B 1 155 ? 8.037   109.540 70.068  1.00   38.16 ? 155  PHE B CE2 1 
ATOM   3986  C CZ  . PHE B 1 155 ? 8.269   108.154 70.036  1.00   34.04 ? 155  PHE B CZ  1 
ATOM   3987  N N   . GLU B 1 156 ? 10.082  113.160 74.637  1.00   39.39 ? 156  GLU B N   1 
ATOM   3988  C CA  . GLU B 1 156 ? 10.044  114.192 75.660  1.00   42.42 ? 156  GLU B CA  1 
ATOM   3989  C C   . GLU B 1 156 ? 8.808   113.969 76.522  1.00   40.72 ? 156  GLU B C   1 
ATOM   3990  O O   . GLU B 1 156 ? 7.796   113.479 76.032  1.00   39.44 ? 156  GLU B O   1 
ATOM   3991  C CB  . GLU B 1 156 ? 10.004  115.582 75.012  1.00   45.28 ? 156  GLU B CB  1 
ATOM   3992  C CG  . GLU B 1 156 ? 11.179  115.869 74.083  1.00   48.47 ? 156  GLU B CG  1 
ATOM   3993  C CD  . GLU B 1 156 ? 11.594  117.342 74.072  1.00   54.57 ? 156  GLU B CD  1 
ATOM   3994  O OE1 . GLU B 1 156 ? 12.494  117.712 73.283  1.00   55.90 ? 156  GLU B OE1 1 
ATOM   3995  O OE2 . GLU B 1 156 ? 11.029  118.133 74.857  1.00   57.33 ? 156  GLU B OE2 1 
ATOM   3996  N N   . ARG B 1 157 ? 8.897   114.336 77.799  1.00   40.63 ? 157  ARG B N   1 
ATOM   3997  C CA  . ARG B 1 157 ? 7.797   114.153 78.739  1.00   40.76 ? 157  ARG B CA  1 
ATOM   3998  C C   . ARG B 1 157 ? 6.449   114.764 78.315  1.00   40.26 ? 157  ARG B C   1 
ATOM   3999  O O   . ARG B 1 157 ? 5.408   114.101 78.421  1.00   37.01 ? 157  ARG B O   1 
ATOM   4000  C CB  . ARG B 1 157 ? 8.212   114.690 80.112  1.00   45.41 ? 157  ARG B CB  1 
ATOM   4001  C CG  . ARG B 1 157 ? 7.186   114.486 81.225  1.00   52.46 ? 157  ARG B CG  1 
ATOM   4002  C CD  . ARG B 1 157 ? 7.677   115.059 82.557  1.00   59.35 ? 157  ARG B CD  1 
ATOM   4003  N NE  . ARG B 1 157 ? 8.926   114.442 83.009  1.00   67.33 ? 157  ARG B NE  1 
ATOM   4004  C CZ  . ARG B 1 157 ? 9.048   113.164 83.362  1.00   72.45 ? 157  ARG B CZ  1 
ATOM   4005  N NH1 . ARG B 1 157 ? 7.994   112.358 83.320  1.00   76.60 ? 157  ARG B NH1 1 
ATOM   4006  N NH2 . ARG B 1 157 ? 10.226  112.683 83.751  1.00   73.52 ? 157  ARG B NH2 1 
ATOM   4007  N N   . GLU B 1 158 ? 6.447   116.010 77.839  1.00   36.93 ? 158  GLU B N   1 
ATOM   4008  C CA  . GLU B 1 158 ? 5.188   116.631 77.439  1.00   39.74 ? 158  GLU B CA  1 
ATOM   4009  C C   . GLU B 1 158 ? 4.563   115.930 76.240  1.00   38.63 ? 158  GLU B C   1 
ATOM   4010  O O   . GLU B 1 158 ? 3.357   116.046 76.004  1.00   38.39 ? 158  GLU B O   1 
ATOM   4011  C CB  . GLU B 1 158 ? 5.361   118.120 77.119  1.00   43.08 ? 158  GLU B CB  1 
ATOM   4012  C CG  . GLU B 1 158 ? 6.470   118.454 76.134  1.00   51.62 ? 158  GLU B CG  1 
ATOM   4013  C CD  . GLU B 1 158 ? 7.832   118.535 76.808  1.00   59.96 ? 158  GLU B CD  1 
ATOM   4014  O OE1 . GLU B 1 158 ? 8.780   119.070 76.175  1.00   61.91 ? 158  GLU B OE1 1 
ATOM   4015  O OE2 . GLU B 1 158 ? 7.950   118.061 77.966  1.00   59.80 ? 158  GLU B OE2 1 
ATOM   4016  N N   . GLU B 1 159 ? 5.382   115.211 75.482  1.00   36.78 ? 159  GLU B N   1 
ATOM   4017  C CA  . GLU B 1 159 ? 4.889   114.466 74.324  1.00   36.10 ? 159  GLU B CA  1 
ATOM   4018  C C   . GLU B 1 159 ? 3.928   113.352 74.747  1.00   33.30 ? 159  GLU B C   1 
ATOM   4019  O O   . GLU B 1 159 ? 2.828   113.235 74.216  1.00   31.77 ? 159  GLU B O   1 
ATOM   4020  C CB  . GLU B 1 159 ? 6.052   113.841 73.551  1.00   36.69 ? 159  GLU B CB  1 
ATOM   4021  C CG  . GLU B 1 159 ? 6.950   114.835 72.875  1.00   35.75 ? 159  GLU B CG  1 
ATOM   4022  C CD  . GLU B 1 159 ? 7.783   114.191 71.798  1.00   36.48 ? 159  GLU B CD  1 
ATOM   4023  O OE1 . GLU B 1 159 ? 8.888   113.688 72.117  1.00   34.60 ? 159  GLU B OE1 1 
ATOM   4024  O OE2 . GLU B 1 159 ? 7.311   114.175 70.635  1.00   31.26 ? 159  GLU B OE2 1 
ATOM   4025  N N   . ILE B 1 160 ? 4.353   112.526 75.694  1.00   32.84 ? 160  ILE B N   1 
ATOM   4026  C CA  . ILE B 1 160 ? 3.506   111.439 76.162  1.00   34.84 ? 160  ILE B CA  1 
ATOM   4027  C C   . ILE B 1 160 ? 2.331   112.043 76.925  1.00   36.77 ? 160  ILE B C   1 
ATOM   4028  O O   . ILE B 1 160 ? 1.187   111.600 76.808  1.00   36.72 ? 160  ILE B O   1 
ATOM   4029  C CB  . ILE B 1 160 ? 4.268   110.487 77.116  1.00   33.89 ? 160  ILE B CB  1 
ATOM   4030  C CG1 . ILE B 1 160 ? 5.444   109.836 76.389  1.00   32.70 ? 160  ILE B CG1 1 
ATOM   4031  C CG2 . ILE B 1 160 ? 3.342   109.397 77.622  1.00   36.52 ? 160  ILE B CG2 1 
ATOM   4032  C CD1 . ILE B 1 160 ? 6.735   110.545 76.570  1.00   33.15 ? 160  ILE B CD1 1 
ATOM   4033  N N   . GLU B 1 161 ? 2.657   113.063 77.710  1.00   38.12 ? 161  GLU B N   1 
ATOM   4034  C CA  . GLU B 1 161 ? 1.715   113.784 78.545  1.00   37.01 ? 161  GLU B CA  1 
ATOM   4035  C C   . GLU B 1 161 ? 0.563   114.325 77.698  1.00   36.84 ? 161  GLU B C   1 
ATOM   4036  O O   . GLU B 1 161 ? -0.592  114.275 78.115  1.00   37.40 ? 161  GLU B O   1 
ATOM   4037  C CB  . GLU B 1 161 ? 2.485   114.901 79.255  1.00   39.93 ? 161  GLU B CB  1 
ATOM   4038  C CG  . GLU B 1 161 ? 1.869   115.466 80.529  1.00   41.23 ? 161  GLU B CG  1 
ATOM   4039  C CD  . GLU B 1 161 ? 2.841   115.481 81.723  1.00   37.50 ? 161  GLU B CD  1 
ATOM   4040  O OE1 . GLU B 1 161 ? 4.059   115.726 81.539  1.00   34.27 ? 161  GLU B OE1 1 
ATOM   4041  O OE2 . GLU B 1 161 ? 2.370   115.261 82.861  1.00   36.22 ? 161  GLU B OE2 1 
ATOM   4042  N N   . ARG B 1 162 ? 0.872   114.816 76.501  1.00   36.55 ? 162  ARG B N   1 
ATOM   4043  C CA  . ARG B 1 162 ? -0.151  115.355 75.595  1.00   35.16 ? 162  ARG B CA  1 
ATOM   4044  C C   . ARG B 1 162 ? -1.161  114.278 75.193  1.00   34.14 ? 162  ARG B C   1 
ATOM   4045  O O   . ARG B 1 162 ? -2.381  114.465 75.264  1.00   31.44 ? 162  ARG B O   1 
ATOM   4046  C CB  . ARG B 1 162 ? 0.505   115.928 74.327  1.00   36.18 ? 162  ARG B CB  1 
ATOM   4047  C CG  . ARG B 1 162 ? -0.480  116.630 73.399  1.00   39.12 ? 162  ARG B CG  1 
ATOM   4048  C CD  . ARG B 1 162 ? 0.082   116.837 71.990  1.00   45.56 ? 162  ARG B CD  1 
ATOM   4049  N NE  . ARG B 1 162 ? 1.325   117.610 71.973  1.00   54.07 ? 162  ARG B NE  1 
ATOM   4050  C CZ  . ARG B 1 162 ? 2.549   117.078 71.990  1.00   59.45 ? 162  ARG B CZ  1 
ATOM   4051  N NH1 . ARG B 1 162 ? 2.711   115.755 72.021  1.00   62.74 ? 162  ARG B NH1 1 
ATOM   4052  N NH2 . ARG B 1 162 ? 3.619   117.871 71.976  1.00   55.95 ? 162  ARG B NH2 1 
ATOM   4053  N N   . ILE B 1 163 ? -0.643  113.136 74.760  1.00   34.32 ? 163  ILE B N   1 
ATOM   4054  C CA  . ILE B 1 163 ? -1.489  112.027 74.340  1.00   31.76 ? 163  ILE B CA  1 
ATOM   4055  C C   . ILE B 1 163 ? -2.269  111.589 75.554  1.00   30.18 ? 163  ILE B C   1 
ATOM   4056  O O   . ILE B 1 163 ? -3.466  111.308 75.497  1.00   29.45 ? 163  ILE B O   1 
ATOM   4057  C CB  . ILE B 1 163 ? -0.622  110.874 73.829  1.00   33.35 ? 163  ILE B CB  1 
ATOM   4058  C CG1 . ILE B 1 163 ? 0.240   111.392 72.686  1.00   32.55 ? 163  ILE B CG1 1 
ATOM   4059  C CG2 . ILE B 1 163 ? -1.496  109.703 73.373  1.00   29.44 ? 163  ILE B CG2 1 
ATOM   4060  C CD1 . ILE B 1 163 ? 1.190   110.372 72.153  1.00   44.72 ? 163  ILE B CD1 1 
ATOM   4061  N N   . LEU B 1 164 ? -1.554  111.541 76.661  1.00   27.77 ? 164  LEU B N   1 
ATOM   4062  C CA  . LEU B 1 164 ? -2.128  111.165 77.927  1.00   31.10 ? 164  LEU B CA  1 
ATOM   4063  C C   . LEU B 1 164 ? -3.335  112.052 78.258  1.00   33.47 ? 164  LEU B C   1 
ATOM   4064  O O   . LEU B 1 164 ? -4.384  111.555 78.647  1.00   32.91 ? 164  LEU B O   1 
ATOM   4065  C CB  . LEU B 1 164 ? -1.054  111.304 79.001  1.00   29.03 ? 164  LEU B CB  1 
ATOM   4066  C CG  . LEU B 1 164 ? -0.937  110.204 80.038  1.00   29.33 ? 164  LEU B CG  1 
ATOM   4067  C CD1 . LEU B 1 164 ? -1.340  108.866 79.456  1.00   27.93 ? 164  LEU B CD1 1 
ATOM   4068  C CD2 . LEU B 1 164 ? 0.499   110.200 80.538  1.00   28.14 ? 164  LEU B CD2 1 
ATOM   4069  N N   . LYS B 1 165 ? -3.192  113.365 78.084  1.00   33.72 ? 165  LYS B N   1 
ATOM   4070  C CA  . LYS B 1 165 ? -4.285  114.266 78.387  1.00   35.12 ? 165  LYS B CA  1 
ATOM   4071  C C   . LYS B 1 165 ? -5.517  114.131 77.488  1.00   35.34 ? 165  LYS B C   1 
ATOM   4072  O O   . LYS B 1 165 ? -6.595  114.568 77.857  1.00   35.57 ? 165  LYS B O   1 
ATOM   4073  C CB  . LYS B 1 165 ? -3.784  115.713 78.400  1.00   36.75 ? 165  LYS B CB  1 
ATOM   4074  C CG  . LYS B 1 165 ? -3.043  116.078 79.692  1.00   38.02 ? 165  LYS B CG  1 
ATOM   4075  C CD  . LYS B 1 165 ? -2.652  117.549 79.711  1.00   43.78 ? 165  LYS B CD  1 
ATOM   4076  C CE  . LYS B 1 165 ? -1.646  117.873 78.601  1.00   50.50 ? 165  LYS B CE  1 
ATOM   4077  N NZ  . LYS B 1 165 ? -1.868  119.209 77.949  1.00   51.10 ? 165  LYS B NZ  1 
ATOM   4078  N N   . THR B 1 166 ? -5.377  113.500 76.331  1.00   35.28 ? 166  THR B N   1 
ATOM   4079  C CA  . THR B 1 166 ? -6.510  113.321 75.413  1.00   33.17 ? 166  THR B CA  1 
ATOM   4080  C C   . THR B 1 166 ? -7.507  112.244 75.881  1.00   32.61 ? 166  THR B C   1 
ATOM   4081  O O   . THR B 1 166 ? -8.490  111.945 75.201  1.00   31.43 ? 166  THR B O   1 
ATOM   4082  C CB  . THR B 1 166 ? -6.033  112.899 74.032  1.00   31.49 ? 166  THR B CB  1 
ATOM   4083  O OG1 . THR B 1 166 ? -5.625  111.526 74.089  1.00   29.15 ? 166  THR B OG1 1 
ATOM   4084  C CG2 . THR B 1 166 ? -4.864  113.771 73.595  1.00   27.67 ? 166  THR B CG2 1 
ATOM   4085  N N   . GLY B 1 167 ? -7.237  111.644 77.027  1.00   31.05 ? 167  GLY B N   1 
ATOM   4086  C CA  . GLY B 1 167 ? -8.140  110.631 77.522  1.00   30.74 ? 167  GLY B CA  1 
ATOM   4087  C C   . GLY B 1 167 ? -7.942  109.303 76.832  1.00   30.31 ? 167  GLY B C   1 
ATOM   4088  O O   . GLY B 1 167 ? -8.681  108.341 77.084  1.00   30.60 ? 167  GLY B O   1 
ATOM   4089  N N   . ALA B 1 168 ? -6.949  109.252 75.948  1.00   29.21 ? 168  ALA B N   1 
ATOM   4090  C CA  . ALA B 1 168 ? -6.640  108.025 75.210  1.00   27.30 ? 168  ALA B CA  1 
ATOM   4091  C C   . ALA B 1 168 ? -5.758  107.185 76.111  1.00   26.44 ? 168  ALA B C   1 
ATOM   4092  O O   . ALA B 1 168 ? -4.980  107.724 76.890  1.00   26.56 ? 168  ALA B O   1 
ATOM   4093  C CB  . ALA B 1 168 ? -5.908  108.341 73.911  1.00   23.08 ? 168  ALA B CB  1 
ATOM   4094  N N   . PHE B 1 169 ? -5.871  105.870 76.024  1.00   24.59 ? 169  PHE B N   1 
ATOM   4095  C CA  . PHE B 1 169 ? -5.049  105.033 76.881  1.00   25.31 ? 169  PHE B CA  1 
ATOM   4096  C C   . PHE B 1 169 ? -3.677  104.861 76.270  1.00   22.13 ? 169  PHE B C   1 
ATOM   4097  O O   . PHE B 1 169 ? -3.520  104.453 75.121  1.00   21.00 ? 169  PHE B O   1 
ATOM   4098  C CB  . PHE B 1 169 ? -5.703  103.667 77.109  1.00   25.34 ? 169  PHE B CB  1 
ATOM   4099  C CG  . PHE B 1 169 ? -5.061  102.863 78.198  1.00   27.98 ? 169  PHE B CG  1 
ATOM   4100  C CD1 . PHE B 1 169 ? -3.904  102.125 77.956  1.00   28.28 ? 169  PHE B CD1 1 
ATOM   4101  C CD2 . PHE B 1 169 ? -5.589  102.871 79.482  1.00   24.66 ? 169  PHE B CD2 1 
ATOM   4102  C CE1 . PHE B 1 169 ? -3.282  101.407 78.987  1.00   25.81 ? 169  PHE B CE1 1 
ATOM   4103  C CE2 . PHE B 1 169 ? -4.977  102.162 80.511  1.00   23.33 ? 169  PHE B CE2 1 
ATOM   4104  C CZ  . PHE B 1 169 ? -3.817  101.429 80.260  1.00   20.94 ? 169  PHE B CZ  1 
ATOM   4105  N N   . VAL B 1 170 ? -2.680  105.191 77.067  1.00   22.24 ? 170  VAL B N   1 
ATOM   4106  C CA  . VAL B 1 170 ? -1.316  105.082 76.616  1.00   21.42 ? 170  VAL B CA  1 
ATOM   4107  C C   . VAL B 1 170 ? -0.685  103.807 77.142  1.00   22.58 ? 170  VAL B C   1 
ATOM   4108  O O   . VAL B 1 170 ? -0.863  103.424 78.303  1.00   21.64 ? 170  VAL B O   1 
ATOM   4109  C CB  . VAL B 1 170 ? -0.514  106.303 77.056  1.00   21.67 ? 170  VAL B CB  1 
ATOM   4110  C CG1 . VAL B 1 170 ? 0.952   106.139 76.704  1.00   27.63 ? 170  VAL B CG1 1 
ATOM   4111  C CG2 . VAL B 1 170 ? -1.093  107.554 76.374  1.00   25.44 ? 170  VAL B CG2 1 
ATOM   4112  N N   . ALA B 1 171 ? 0.019   103.139 76.246  1.00   20.31 ? 171  ALA B N   1 
ATOM   4113  C CA  . ALA B 1 171 ? 0.716   101.919 76.577  1.00   21.21 ? 171  ALA B CA  1 
ATOM   4114  C C   . ALA B 1 171 ? 2.157   102.305 76.324  1.00   21.74 ? 171  ALA B C   1 
ATOM   4115  O O   . ALA B 1 171 ? 2.630   102.353 75.192  1.00   21.32 ? 171  ALA B O   1 
ATOM   4116  C CB  . ALA B 1 171 ? 0.288   100.768 75.664  1.00   20.17 ? 171  ALA B CB  1 
ATOM   4117  N N   . LEU B 1 172 ? 2.828   102.645 77.405  1.00   21.39 ? 172  LEU B N   1 
ATOM   4118  C CA  . LEU B 1 172 ? 4.197   103.043 77.341  1.00   19.45 ? 172  LEU B CA  1 
ATOM   4119  C C   . LEU B 1 172 ? 5.027   101.761 77.312  1.00   21.20 ? 172  LEU B C   1 
ATOM   4120  O O   . LEU B 1 172 ? 5.259   101.114 78.347  1.00   22.21 ? 172  LEU B O   1 
ATOM   4121  C CB  . LEU B 1 172 ? 4.539   103.853 78.574  1.00   17.67 ? 172  LEU B CB  1 
ATOM   4122  C CG  . LEU B 1 172 ? 5.828   104.624 78.344  1.00   26.96 ? 172  LEU B CG  1 
ATOM   4123  C CD1 . LEU B 1 172 ? 5.562   105.773 77.351  1.00   24.18 ? 172  LEU B CD1 1 
ATOM   4124  C CD2 . LEU B 1 172 ? 6.338   105.172 79.666  1.00   26.69 ? 172  LEU B CD2 1 
ATOM   4125  N N   . ASP B 1 173 ? 5.499   101.407 76.137  1.00   18.42 ? 173  ASP B N   1 
ATOM   4126  C CA  . ASP B 1 173 ? 6.276   100.201 75.988  1.00   20.89 ? 173  ASP B CA  1 
ATOM   4127  C C   . ASP B 1 173 ? 7.700   100.425 76.412  1.00   20.84 ? 173  ASP B C   1 
ATOM   4128  O O   . ASP B 1 173 ? 8.513   100.878 75.613  1.00   22.44 ? 173  ASP B O   1 
ATOM   4129  C CB  . ASP B 1 173 ? 6.251   99.734  74.534  1.00   22.94 ? 173  ASP B CB  1 
ATOM   4130  C CG  . ASP B 1 173 ? 6.872   98.377  74.352  1.00   28.63 ? 173  ASP B CG  1 
ATOM   4131  O OD1 . ASP B 1 173 ? 7.883   98.101  75.063  1.00   26.94 ? 173  ASP B OD1 1 
ATOM   4132  O OD2 . ASP B 1 173 ? 6.355   97.605  73.496  1.00   30.62 ? 173  ASP B OD2 1 
ATOM   4133  N N   . GLU B 1 174 ? 8.005   100.107 77.664  1.00   20.82 ? 174  GLU B N   1 
ATOM   4134  C CA  . GLU B 1 174 ? 9.357   100.286 78.168  1.00   22.48 ? 174  GLU B CA  1 
ATOM   4135  C C   . GLU B 1 174 ? 10.218  99.052  77.995  1.00   19.83 ? 174  GLU B C   1 
ATOM   4136  O O   . GLU B 1 174 ? 10.939  98.659  78.897  1.00   22.84 ? 174  GLU B O   1 
ATOM   4137  C CB  . GLU B 1 174 ? 9.341   100.733 79.635  1.00   19.90 ? 174  GLU B CB  1 
ATOM   4138  C CG  . GLU B 1 174 ? 8.761   102.147 79.782  1.00   21.75 ? 174  GLU B CG  1 
ATOM   4139  C CD  . GLU B 1 174 ? 8.880   102.748 81.193  1.00   25.37 ? 174  GLU B CD  1 
ATOM   4140  O OE1 . GLU B 1 174 ? 9.218   102.030 82.162  1.00   25.49 ? 174  GLU B OE1 1 
ATOM   4141  O OE2 . GLU B 1 174 ? 8.614   103.953 81.337  1.00   18.62 ? 174  GLU B OE2 1 
ATOM   4142  N N   . ALA B 1 175 ? 10.140  98.457  76.810  1.00   19.49 ? 175  ALA B N   1 
ATOM   4143  C CA  . ALA B 1 175 ? 10.930  97.282  76.471  1.00   19.83 ? 175  ALA B CA  1 
ATOM   4144  C C   . ALA B 1 175 ? 12.433  97.540  76.666  1.00   21.38 ? 175  ALA B C   1 
ATOM   4145  O O   . ALA B 1 175 ? 13.195  96.609  76.982  1.00   21.97 ? 175  ALA B O   1 
ATOM   4146  C CB  . ALA B 1 175 ? 10.665  96.873  75.017  1.00   15.93 ? 175  ALA B CB  1 
ATOM   4147  N N   . TYR B 1 176 ? 12.859  98.789  76.476  1.00   17.94 ? 176  TYR B N   1 
ATOM   4148  C CA  . TYR B 1 176 ? 14.267  99.137  76.613  1.00   20.14 ? 176  TYR B CA  1 
ATOM   4149  C C   . TYR B 1 176 ? 14.579  99.912  77.881  1.00   20.56 ? 176  TYR B C   1 
ATOM   4150  O O   . TYR B 1 176 ? 15.676  100.461 78.026  1.00   21.18 ? 176  TYR B O   1 
ATOM   4151  C CB  . TYR B 1 176 ? 14.749  99.926  75.370  1.00   21.24 ? 176  TYR B CB  1 
ATOM   4152  C CG  . TYR B 1 176 ? 14.569  99.108  74.115  1.00   21.99 ? 176  TYR B CG  1 
ATOM   4153  C CD1 . TYR B 1 176 ? 15.367  97.978  73.894  1.00   19.35 ? 176  TYR B CD1 1 
ATOM   4154  C CD2 . TYR B 1 176 ? 13.475  99.326  73.266  1.00   22.24 ? 176  TYR B CD2 1 
ATOM   4155  C CE1 . TYR B 1 176 ? 15.064  97.080  72.880  1.00   23.38 ? 176  TYR B CE1 1 
ATOM   4156  C CE2 . TYR B 1 176 ? 13.169  98.437  72.251  1.00   22.11 ? 176  TYR B CE2 1 
ATOM   4157  C CZ  . TYR B 1 176 ? 13.964  97.311  72.065  1.00   24.15 ? 176  TYR B CZ  1 
ATOM   4158  O OH  . TYR B 1 176 ? 13.654  96.402  71.085  1.00   25.25 ? 176  TYR B OH  1 
ATOM   4159  N N   . TYR B 1 177 ? 13.624  99.957  78.801  1.00   20.44 ? 177  TYR B N   1 
ATOM   4160  C CA  . TYR B 1 177 ? 13.841  100.680 80.041  1.00   19.74 ? 177  TYR B CA  1 
ATOM   4161  C C   . TYR B 1 177 ? 15.230  100.504 80.674  1.00   19.34 ? 177  TYR B C   1 
ATOM   4162  O O   . TYR B 1 177 ? 15.892  101.486 81.001  1.00   18.78 ? 177  TYR B O   1 
ATOM   4163  C CB  . TYR B 1 177 ? 12.809  100.291 81.098  1.00   21.21 ? 177  TYR B CB  1 
ATOM   4164  C CG  . TYR B 1 177 ? 13.262  100.709 82.494  1.00   24.52 ? 177  TYR B CG  1 
ATOM   4165  C CD1 . TYR B 1 177 ? 13.634  99.744  83.447  1.00   19.28 ? 177  TYR B CD1 1 
ATOM   4166  C CD2 . TYR B 1 177 ? 13.393  102.068 82.838  1.00   20.94 ? 177  TYR B CD2 1 
ATOM   4167  C CE1 . TYR B 1 177 ? 14.123  100.119 84.686  1.00   21.64 ? 177  TYR B CE1 1 
ATOM   4168  C CE2 . TYR B 1 177 ? 13.876  102.452 84.080  1.00   18.49 ? 177  TYR B CE2 1 
ATOM   4169  C CZ  . TYR B 1 177 ? 14.242  101.479 85.003  1.00   22.90 ? 177  TYR B CZ  1 
ATOM   4170  O OH  . TYR B 1 177 ? 14.707  101.872 86.240  1.00   19.38 ? 177  TYR B OH  1 
ATOM   4171  N N   . GLU B 1 178 ? 15.633  99.252  80.871  1.00   18.36 ? 178  GLU B N   1 
ATOM   4172  C CA  . GLU B 1 178 ? 16.907  98.910  81.482  1.00   19.68 ? 178  GLU B CA  1 
ATOM   4173  C C   . GLU B 1 178 ? 18.159  99.613  80.937  1.00   19.92 ? 178  GLU B C   1 
ATOM   4174  O O   . GLU B 1 178 ? 19.093  99.870  81.678  1.00   19.92 ? 178  GLU B O   1 
ATOM   4175  C CB  . GLU B 1 178 ? 17.137  97.394  81.388  1.00   18.88 ? 178  GLU B CB  1 
ATOM   4176  C CG  . GLU B 1 178 ? 16.433  96.499  82.424  1.00   21.81 ? 178  GLU B CG  1 
ATOM   4177  C CD  . GLU B 1 178 ? 14.906  96.513  82.355  1.00   21.35 ? 178  GLU B CD  1 
ATOM   4178  O OE1 . GLU B 1 178 ? 14.343  96.850  81.297  1.00   19.43 ? 178  GLU B OE1 1 
ATOM   4179  O OE2 . GLU B 1 178 ? 14.265  96.178  83.375  1.00   21.72 ? 178  GLU B OE2 1 
ATOM   4180  N N   . PHE B 1 179 ? 18.176  99.905  79.643  1.00   20.40 ? 179  PHE B N   1 
ATOM   4181  C CA  . PHE B 1 179 ? 19.324  100.527 78.985  1.00   21.60 ? 179  PHE B CA  1 
ATOM   4182  C C   . PHE B 1 179 ? 19.294  102.037 78.986  1.00   21.45 ? 179  PHE B C   1 
ATOM   4183  O O   . PHE B 1 179 ? 20.170  102.683 78.429  1.00   19.12 ? 179  PHE B O   1 
ATOM   4184  C CB  . PHE B 1 179 ? 19.410  100.005 77.561  1.00   18.00 ? 179  PHE B CB  1 
ATOM   4185  C CG  . PHE B 1 179 ? 19.469  98.520  77.499  1.00   22.43 ? 179  PHE B CG  1 
ATOM   4186  C CD1 . PHE B 1 179 ? 20.669  97.849  77.791  1.00   19.26 ? 179  PHE B CD1 1 
ATOM   4187  C CD2 . PHE B 1 179 ? 18.303  97.773  77.252  1.00   19.40 ? 179  PHE B CD2 1 
ATOM   4188  C CE1 . PHE B 1 179 ? 20.724  96.447  77.846  1.00   20.57 ? 179  PHE B CE1 1 
ATOM   4189  C CE2 . PHE B 1 179 ? 18.336  96.370  77.304  1.00   21.86 ? 179  PHE B CE2 1 
ATOM   4190  C CZ  . PHE B 1 179 ? 19.540  95.700  77.600  1.00   21.85 ? 179  PHE B CZ  1 
ATOM   4191  N N   . HIS B 1 180 ? 18.270  102.573 79.628  1.00   24.93 ? 180  HIS B N   1 
ATOM   4192  C CA  . HIS B 1 180 ? 18.050  103.998 79.751  1.00   29.46 ? 180  HIS B CA  1 
ATOM   4193  C C   . HIS B 1 180 ? 17.718  104.156 81.207  1.00   34.73 ? 180  HIS B C   1 
ATOM   4194  O O   . HIS B 1 180 ? 17.381  103.186 81.869  1.00   38.31 ? 180  HIS B O   1 
ATOM   4195  C CB  . HIS B 1 180 ? 16.845  104.408 78.930  1.00   29.12 ? 180  HIS B CB  1 
ATOM   4196  C CG  . HIS B 1 180 ? 16.520  105.864 79.019  1.00   31.49 ? 180  HIS B CG  1 
ATOM   4197  N ND1 . HIS B 1 180 ? 15.229  106.333 79.147  1.00   33.67 ? 180  HIS B ND1 1 
ATOM   4198  C CD2 . HIS B 1 180 ? 17.308  106.958 78.934  1.00   32.25 ? 180  HIS B CD2 1 
ATOM   4199  C CE1 . HIS B 1 180 ? 15.236  107.652 79.134  1.00   33.03 ? 180  HIS B CE1 1 
ATOM   4200  N NE2 . HIS B 1 180 ? 16.484  108.056 79.006  1.00   33.78 ? 180  HIS B NE2 1 
ATOM   4201  N N   . GLY B 1 181 ? 17.785  105.365 81.723  1.00   37.98 ? 181  GLY B N   1 
ATOM   4202  C CA  . GLY B 1 181 ? 17.474  105.516 83.131  1.00   41.57 ? 181  GLY B CA  1 
ATOM   4203  C C   . GLY B 1 181 ? 16.034  105.724 83.567  1.00   42.10 ? 181  GLY B C   1 
ATOM   4204  O O   . GLY B 1 181 ? 15.534  104.986 84.397  1.00   41.60 ? 181  GLY B O   1 
ATOM   4205  N N   . GLU B 1 182 ? 15.381  106.750 83.036  1.00   44.63 ? 182  GLU B N   1 
ATOM   4206  C CA  . GLU B 1 182 ? 14.015  107.075 83.412  1.00   42.97 ? 182  GLU B CA  1 
ATOM   4207  C C   . GLU B 1 182 ? 12.980  105.969 83.195  1.00   42.03 ? 182  GLU B C   1 
ATOM   4208  O O   . GLU B 1 182 ? 13.246  104.954 82.564  1.00   45.27 ? 182  GLU B O   1 
ATOM   4209  C CB  . GLU B 1 182 ? 13.568  108.345 82.680  1.00   46.01 ? 182  GLU B CB  1 
ATOM   4210  C CG  . GLU B 1 182 ? 14.107  109.660 83.266  1.00   54.06 ? 182  GLU B CG  1 
ATOM   4211  C CD  . GLU B 1 182 ? 15.382  110.144 82.602  1.00   57.21 ? 182  GLU B CD  1 
ATOM   4212  O OE1 . GLU B 1 182 ? 16.366  110.440 83.320  1.00   60.21 ? 182  GLU B OE1 1 
ATOM   4213  O OE2 . GLU B 1 182 ? 15.391  110.241 81.356  1.00   60.74 ? 182  GLU B OE2 1 
ATOM   4214  N N   . SER B 1 183 ? 11.788  106.206 83.723  1.00   39.04 ? 183  SER B N   1 
ATOM   4215  C CA  . SER B 1 183 ? 10.662  105.296 83.607  1.00   34.37 ? 183  SER B CA  1 
ATOM   4216  C C   . SER B 1 183 ? 9.438   106.113 83.983  1.00   32.73 ? 183  SER B C   1 
ATOM   4217  O O   . SER B 1 183 ? 9.496   106.897 84.931  1.00   31.07 ? 183  SER B O   1 
ATOM   4218  C CB  . SER B 1 183 ? 10.805  104.127 84.588  1.00   34.03 ? 183  SER B CB  1 
ATOM   4219  O OG  . SER B 1 183 ? 9.585   103.407 84.707  1.00   26.43 ? 183  SER B OG  1 
ATOM   4220  N N   . TYR B 1 184 ? 8.342   105.948 83.248  1.00   28.98 ? 184  TYR B N   1 
ATOM   4221  C CA  . TYR B 1 184 ? 7.124   106.678 83.565  1.00   29.98 ? 184  TYR B CA  1 
ATOM   4222  C C   . TYR B 1 184 ? 6.234   105.922 84.537  1.00   27.81 ? 184  TYR B C   1 
ATOM   4223  O O   . TYR B 1 184 ? 5.064   106.237 84.665  1.00   27.11 ? 184  TYR B O   1 
ATOM   4224  C CB  . TYR B 1 184 ? 6.326   107.003 82.293  1.00   32.83 ? 184  TYR B CB  1 
ATOM   4225  C CG  . TYR B 1 184 ? 6.906   108.141 81.486  1.00   34.85 ? 184  TYR B CG  1 
ATOM   4226  C CD1 . TYR B 1 184 ? 8.188   108.050 80.945  1.00   38.86 ? 184  TYR B CD1 1 
ATOM   4227  C CD2 . TYR B 1 184 ? 6.177   109.301 81.267  1.00   35.51 ? 184  TYR B CD2 1 
ATOM   4228  C CE1 . TYR B 1 184 ? 8.740   109.087 80.205  1.00   37.71 ? 184  TYR B CE1 1 
ATOM   4229  C CE2 . TYR B 1 184 ? 6.713   110.357 80.515  1.00   40.70 ? 184  TYR B CE2 1 
ATOM   4230  C CZ  . TYR B 1 184 ? 7.998   110.241 79.989  1.00   42.27 ? 184  TYR B CZ  1 
ATOM   4231  O OH  . TYR B 1 184 ? 8.540   111.280 79.249  1.00   41.46 ? 184  TYR B OH  1 
ATOM   4232  N N   . VAL B 1 185 ? 6.775   104.922 85.226  1.00   29.15 ? 185  VAL B N   1 
ATOM   4233  C CA  . VAL B 1 185 ? 5.959   104.174 86.176  1.00   29.61 ? 185  VAL B CA  1 
ATOM   4234  C C   . VAL B 1 185 ? 5.306   105.121 87.193  1.00   31.17 ? 185  VAL B C   1 
ATOM   4235  O O   . VAL B 1 185 ? 4.134   104.964 87.534  1.00   30.83 ? 185  VAL B O   1 
ATOM   4236  C CB  . VAL B 1 185 ? 6.790   103.084 86.931  1.00   28.00 ? 185  VAL B CB  1 
ATOM   4237  C CG1 . VAL B 1 185 ? 6.043   102.633 88.190  1.00   31.96 ? 185  VAL B CG1 1 
ATOM   4238  C CG2 . VAL B 1 185 ? 6.992   101.875 86.040  1.00   23.11 ? 185  VAL B CG2 1 
ATOM   4239  N N   . ASP B 1 186 ? 6.062   106.101 87.679  1.00   32.67 ? 186  ASP B N   1 
ATOM   4240  C CA  . ASP B 1 186 ? 5.525   107.065 88.650  1.00   34.12 ? 186  ASP B CA  1 
ATOM   4241  C C   . ASP B 1 186 ? 4.288   107.792 88.128  1.00   33.19 ? 186  ASP B C   1 
ATOM   4242  O O   . ASP B 1 186 ? 3.428   108.211 88.909  1.00   32.04 ? 186  ASP B O   1 
ATOM   4243  C CB  . ASP B 1 186 ? 6.567   108.124 89.010  1.00   36.73 ? 186  ASP B CB  1 
ATOM   4244  C CG  . ASP B 1 186 ? 7.024   108.033 90.453  1.00   42.84 ? 186  ASP B CG  1 
ATOM   4245  O OD1 . ASP B 1 186 ? 6.931   109.059 91.172  1.00   45.41 ? 186  ASP B OD1 1 
ATOM   4246  O OD2 . ASP B 1 186 ? 7.482   106.940 90.862  1.00   43.57 ? 186  ASP B OD2 1 
ATOM   4247  N N   . PHE B 1 187 ? 4.215   107.966 86.811  1.00   31.16 ? 187  PHE B N   1 
ATOM   4248  C CA  . PHE B 1 187 ? 3.084   108.652 86.209  1.00   31.88 ? 187  PHE B CA  1 
ATOM   4249  C C   . PHE B 1 187 ? 1.800   107.932 86.536  1.00   30.98 ? 187  PHE B C   1 
ATOM   4250  O O   . PHE B 1 187 ? 0.713   108.468 86.376  1.00   30.62 ? 187  PHE B O   1 
ATOM   4251  C CB  . PHE B 1 187 ? 3.248   108.742 84.690  1.00   31.71 ? 187  PHE B CB  1 
ATOM   4252  C CG  . PHE B 1 187 ? 3.669   110.094 84.209  1.00   37.44 ? 187  PHE B CG  1 
ATOM   4253  C CD1 . PHE B 1 187 ? 3.276   110.546 82.951  1.00   42.43 ? 187  PHE B CD1 1 
ATOM   4254  C CD2 . PHE B 1 187 ? 4.482   110.912 84.992  1.00   41.60 ? 187  PHE B CD2 1 
ATOM   4255  C CE1 . PHE B 1 187 ? 3.688   111.794 82.477  1.00   41.04 ? 187  PHE B CE1 1 
ATOM   4256  C CE2 . PHE B 1 187 ? 4.902   112.166 84.526  1.00   40.94 ? 187  PHE B CE2 1 
ATOM   4257  C CZ  . PHE B 1 187 ? 4.507   112.604 83.272  1.00   40.58 ? 187  PHE B CZ  1 
ATOM   4258  N N   . LEU B 1 188 ? 1.930   106.699 86.990  1.00   32.67 ? 188  LEU B N   1 
ATOM   4259  C CA  . LEU B 1 188 ? 0.770   105.918 87.332  1.00   34.91 ? 188  LEU B CA  1 
ATOM   4260  C C   . LEU B 1 188 ? 0.049   106.550 88.514  1.00   37.16 ? 188  LEU B C   1 
ATOM   4261  O O   . LEU B 1 188 ? -1.083  106.183 88.829  1.00   40.00 ? 188  LEU B O   1 
ATOM   4262  C CB  . LEU B 1 188 ? 1.199   104.491 87.653  1.00   31.91 ? 188  LEU B CB  1 
ATOM   4263  C CG  . LEU B 1 188 ? 0.543   103.412 86.800  1.00   33.40 ? 188  LEU B CG  1 
ATOM   4264  C CD1 . LEU B 1 188 ? -0.173  104.024 85.618  1.00   30.68 ? 188  LEU B CD1 1 
ATOM   4265  C CD2 . LEU B 1 188 ? 1.602   102.440 86.364  1.00   29.92 ? 188  LEU B CD2 1 
ATOM   4266  N N   . LYS B 1 189 ? 0.697   107.513 89.159  1.00   39.28 ? 189  LYS B N   1 
ATOM   4267  C CA  . LYS B 1 189 ? 0.095   108.182 90.304  1.00   39.24 ? 189  LYS B CA  1 
ATOM   4268  C C   . LYS B 1 189 ? -0.898  109.231 89.883  1.00   39.54 ? 189  LYS B C   1 
ATOM   4269  O O   . LYS B 1 189 ? -1.863  109.485 90.601  1.00   40.13 ? 189  LYS B O   1 
ATOM   4270  C CB  . LYS B 1 189 ? 1.172   108.799 91.203  1.00   38.58 ? 189  LYS B CB  1 
ATOM   4271  C CG  . LYS B 1 189 ? 1.759   107.766 92.165  1.00   40.04 ? 189  LYS B CG  1 
ATOM   4272  C CD  . LYS B 1 189 ? 2.794   108.334 93.110  1.00   39.13 ? 189  LYS B CD  1 
ATOM   4273  C CE  . LYS B 1 189 ? 4.038   108.780 92.366  1.00   36.12 ? 189  LYS B CE  1 
ATOM   4274  N NZ  . LYS B 1 189 ? 5.064   109.260 93.323  1.00   41.19 ? 189  LYS B NZ  1 
ATOM   4275  N N   . LYS B 1 190 ? -0.675  109.830 88.715  1.00   40.50 ? 190  LYS B N   1 
ATOM   4276  C CA  . LYS B 1 190 ? -1.581  110.864 88.210  1.00   42.27 ? 190  LYS B CA  1 
ATOM   4277  C C   . LYS B 1 190 ? -2.571  110.313 87.187  1.00   41.85 ? 190  LYS B C   1 
ATOM   4278  O O   . LYS B 1 190 ? -3.784  110.544 87.276  1.00   42.16 ? 190  LYS B O   1 
ATOM   4279  C CB  . LYS B 1 190 ? -0.803  112.010 87.549  1.00   44.01 ? 190  LYS B CB  1 
ATOM   4280  C CG  . LYS B 1 190 ? 0.498   112.396 88.225  1.00   48.10 ? 190  LYS B CG  1 
ATOM   4281  C CD  . LYS B 1 190 ? 1.629   111.457 87.804  1.00   53.29 ? 190  LYS B CD  1 
ATOM   4282  C CE  . LYS B 1 190 ? 3.015   112.003 88.190  1.00   54.40 ? 190  LYS B CE  1 
ATOM   4283  N NZ  . LYS B 1 190 ? 3.267   111.988 89.660  1.00   54.10 ? 190  LYS B NZ  1 
ATOM   4284  N N   . TYR B 1 191 ? -2.055  109.581 86.214  1.00   40.55 ? 191  TYR B N   1 
ATOM   4285  C CA  . TYR B 1 191 ? -2.904  109.028 85.169  1.00   41.30 ? 191  TYR B CA  1 
ATOM   4286  C C   . TYR B 1 191 ? -3.301  107.575 85.375  1.00   39.69 ? 191  TYR B C   1 
ATOM   4287  O O   . TYR B 1 191 ? -2.509  106.747 85.813  1.00   38.38 ? 191  TYR B O   1 
ATOM   4288  C CB  . TYR B 1 191 ? -2.217  109.181 83.812  1.00   41.17 ? 191  TYR B CB  1 
ATOM   4289  C CG  . TYR B 1 191 ? -1.711  110.576 83.561  1.00   41.35 ? 191  TYR B CG  1 
ATOM   4290  C CD1 . TYR B 1 191 ? -0.470  110.981 84.039  1.00   42.10 ? 191  TYR B CD1 1 
ATOM   4291  C CD2 . TYR B 1 191 ? -2.492  111.506 82.888  1.00   42.89 ? 191  TYR B CD2 1 
ATOM   4292  C CE1 . TYR B 1 191 ? -0.016  112.275 83.851  1.00   46.01 ? 191  TYR B CE1 1 
ATOM   4293  C CE2 . TYR B 1 191 ? -2.048  112.813 82.694  1.00   47.35 ? 191  TYR B CE2 1 
ATOM   4294  C CZ  . TYR B 1 191 ? -0.805  113.189 83.175  1.00   47.92 ? 191  TYR B CZ  1 
ATOM   4295  O OH  . TYR B 1 191 ? -0.329  114.464 82.950  1.00   50.54 ? 191  TYR B OH  1 
ATOM   4296  N N   . GLU B 1 192 ? -4.544  107.280 85.035  1.00   38.89 ? 192  GLU B N   1 
ATOM   4297  C CA  . GLU B 1 192 ? -5.082  105.941 85.162  1.00   40.27 ? 192  GLU B CA  1 
ATOM   4298  C C   . GLU B 1 192 ? -5.095  105.280 83.788  1.00   36.43 ? 192  GLU B C   1 
ATOM   4299  O O   . GLU B 1 192 ? -5.029  104.067 83.671  1.00   36.14 ? 192  GLU B O   1 
ATOM   4300  C CB  . GLU B 1 192 ? -6.501  106.018 85.721  1.00   45.97 ? 192  GLU B CB  1 
ATOM   4301  C CG  . GLU B 1 192 ? -7.027  104.692 86.202  1.00   58.35 ? 192  GLU B CG  1 
ATOM   4302  C CD  . GLU B 1 192 ? -8.480  104.743 86.625  1.00   63.55 ? 192  GLU B CD  1 
ATOM   4303  O OE1 . GLU B 1 192 ? -8.995  103.676 87.040  1.00   65.42 ? 192  GLU B OE1 1 
ATOM   4304  O OE2 . GLU B 1 192 ? -9.094  105.839 86.537  1.00   64.22 ? 192  GLU B OE2 1 
ATOM   4305  N N   . ASN B 1 193 ? -5.186  106.102 82.751  1.00   34.95 ? 193  ASN B N   1 
ATOM   4306  C CA  . ASN B 1 193 ? -5.220  105.632 81.371  1.00   30.17 ? 193  ASN B CA  1 
ATOM   4307  C C   . ASN B 1 193 ? -3.791  105.393 80.865  1.00   28.91 ? 193  ASN B C   1 
ATOM   4308  O O   . ASN B 1 193 ? -3.409  105.857 79.787  1.00   31.84 ? 193  ASN B O   1 
ATOM   4309  C CB  . ASN B 1 193 ? -5.954  106.668 80.475  1.00   22.52 ? 193  ASN B CB  1 
ATOM   4310  C CG  . ASN B 1 193 ? -5.281  108.039 80.467  1.00   25.72 ? 193  ASN B CG  1 
ATOM   4311  O OD1 . ASN B 1 193 ? -4.963  108.597 79.411  1.00   30.85 ? 193  ASN B OD1 1 
ATOM   4312  N ND2 . ASN B 1 193 ? -5.061  108.589 81.653  1.00   27.20 ? 193  ASN B ND2 1 
ATOM   4313  N N   . LEU B 1 194 ? -2.996  104.685 81.655  1.00   26.39 ? 194  LEU B N   1 
ATOM   4314  C CA  . LEU B 1 194 ? -1.609  104.386 81.279  1.00   24.08 ? 194  LEU B CA  1 
ATOM   4315  C C   . LEU B 1 194 ? -1.158  103.003 81.732  1.00   23.64 ? 194  LEU B C   1 
ATOM   4316  O O   . LEU B 1 194 ? -1.621  102.476 82.753  1.00   24.31 ? 194  LEU B O   1 
ATOM   4317  C CB  . LEU B 1 194 ? -0.656  105.412 81.884  1.00   21.99 ? 194  LEU B CB  1 
ATOM   4318  C CG  . LEU B 1 194 ? 0.864   105.129 81.958  1.00   16.91 ? 194  LEU B CG  1 
ATOM   4319  C CD1 . LEU B 1 194 ? 1.532   105.315 80.602  1.00   15.42 ? 194  LEU B CD1 1 
ATOM   4320  C CD2 . LEU B 1 194 ? 1.494   106.098 82.976  1.00   14.49 ? 194  LEU B CD2 1 
ATOM   4321  N N   . ALA B 1 195 ? -0.246  102.423 80.963  1.00   22.61 ? 195  ALA B N   1 
ATOM   4322  C CA  . ALA B 1 195 ? 0.314   101.125 81.300  1.00   20.21 ? 195  ALA B CA  1 
ATOM   4323  C C   . ALA B 1 195 ? 1.743   101.067 80.806  1.00   22.45 ? 195  ALA B C   1 
ATOM   4324  O O   . ALA B 1 195 ? 2.060   101.431 79.663  1.00   23.27 ? 195  ALA B O   1 
ATOM   4325  C CB  . ALA B 1 195 ? -0.489  100.017 80.707  1.00   18.24 ? 195  ALA B CB  1 
ATOM   4326  N N   . VAL B 1 196 ? 2.596   100.602 81.697  1.00   20.28 ? 196  VAL B N   1 
ATOM   4327  C CA  . VAL B 1 196 ? 4.010   100.462 81.438  1.00   19.86 ? 196  VAL B CA  1 
ATOM   4328  C C   . VAL B 1 196 ? 4.276   99.001  81.180  1.00   20.76 ? 196  VAL B C   1 
ATOM   4329  O O   . VAL B 1 196 ? 3.993   98.158  82.029  1.00   24.07 ? 196  VAL B O   1 
ATOM   4330  C CB  . VAL B 1 196 ? 4.835   100.929 82.678  1.00   16.97 ? 196  VAL B CB  1 
ATOM   4331  C CG1 . VAL B 1 196 ? 6.318   100.613 82.486  1.00   13.45 ? 196  VAL B CG1 1 
ATOM   4332  C CG2 . VAL B 1 196 ? 4.614   102.431 82.900  1.00   19.42 ? 196  VAL B CG2 1 
ATOM   4333  N N   . ILE B 1 197 ? 4.804   98.712  79.999  1.00   22.07 ? 197  ILE B N   1 
ATOM   4334  C CA  . ILE B 1 197 ? 5.117   97.344  79.594  1.00   20.27 ? 197  ILE B CA  1 
ATOM   4335  C C   . ILE B 1 197 ? 6.631   97.109  79.680  1.00   20.66 ? 197  ILE B C   1 
ATOM   4336  O O   . ILE B 1 197 ? 7.414   97.860  79.107  1.00   19.10 ? 197  ILE B O   1 
ATOM   4337  C CB  . ILE B 1 197 ? 4.652   97.103  78.135  1.00   18.92 ? 197  ILE B CB  1 
ATOM   4338  C CG1 . ILE B 1 197 ? 3.155   97.301  78.046  1.00   17.72 ? 197  ILE B CG1 1 
ATOM   4339  C CG2 . ILE B 1 197 ? 4.992   95.662  77.653  1.00   12.96 ? 197  ILE B CG2 1 
ATOM   4340  C CD1 . ILE B 1 197 ? 2.663   97.411  76.582  1.00   22.40 ? 197  ILE B CD1 1 
ATOM   4341  N N   . ARG B 1 198 ? 7.024   96.054  80.384  1.00   20.90 ? 198  ARG B N   1 
ATOM   4342  C CA  . ARG B 1 198 ? 8.428   95.689  80.541  1.00   20.49 ? 198  ARG B CA  1 
ATOM   4343  C C   . ARG B 1 198 ? 8.653   94.256  80.060  1.00   21.15 ? 198  ARG B C   1 
ATOM   4344  O O   . ARG B 1 198 ? 7.707   93.518  79.807  1.00   19.01 ? 198  ARG B O   1 
ATOM   4345  C CB  . ARG B 1 198 ? 8.832   95.749  82.013  1.00   21.73 ? 198  ARG B CB  1 
ATOM   4346  C CG  . ARG B 1 198 ? 8.726   97.100  82.679  1.00   18.70 ? 198  ARG B CG  1 
ATOM   4347  C CD  . ARG B 1 198 ? 9.767   98.062  82.173  1.00   15.25 ? 198  ARG B CD  1 
ATOM   4348  N NE  . ARG B 1 198 ? 9.782   99.254  83.031  1.00   20.65 ? 198  ARG B NE  1 
ATOM   4349  C CZ  . ARG B 1 198 ? 10.188  99.259  84.294  1.00   16.94 ? 198  ARG B CZ  1 
ATOM   4350  N NH1 . ARG B 1 198 ? 10.641  98.149  84.847  1.00   20.46 ? 198  ARG B NH1 1 
ATOM   4351  N NH2 . ARG B 1 198 ? 10.091  100.366 85.016  1.00   15.70 ? 198  ARG B NH2 1 
ATOM   4352  N N   . THR B 1 199 ? 9.913   93.855  79.967  1.00   21.07 ? 199  THR B N   1 
ATOM   4353  C CA  . THR B 1 199 ? 10.229  92.494  79.553  1.00   20.13 ? 199  THR B CA  1 
ATOM   4354  C C   . THR B 1 199 ? 11.494  92.020  80.247  1.00   17.49 ? 199  THR B C   1 
ATOM   4355  O O   . THR B 1 199 ? 12.218  92.831  80.821  1.00   18.80 ? 199  THR B O   1 
ATOM   4356  C CB  . THR B 1 199 ? 10.443  92.403  78.003  1.00   19.85 ? 199  THR B CB  1 
ATOM   4357  O OG1 . THR B 1 199 ? 10.713  91.047  77.624  1.00   22.90 ? 199  THR B OG1 1 
ATOM   4358  C CG2 . THR B 1 199 ? 11.600  93.256  77.576  1.00   11.39 ? 199  THR B CG2 1 
ATOM   4359  N N   . PHE B 1 200 ? 11.724  90.700  80.222  1.00   17.06 ? 200  PHE B N   1 
ATOM   4360  C CA  . PHE B 1 200 ? 12.941  90.105  80.781  1.00   17.52 ? 200  PHE B CA  1 
ATOM   4361  C C   . PHE B 1 200 ? 13.837  89.742  79.607  1.00   17.96 ? 200  PHE B C   1 
ATOM   4362  O O   . PHE B 1 200 ? 14.999  89.356  79.775  1.00   18.82 ? 200  PHE B O   1 
ATOM   4363  C CB  . PHE B 1 200 ? 12.646  88.843  81.606  1.00   15.99 ? 200  PHE B CB  1 
ATOM   4364  C CG  . PHE B 1 200 ? 12.101  89.139  82.967  1.00   16.28 ? 200  PHE B CG  1 
ATOM   4365  C CD1 . PHE B 1 200 ? 10.730  89.312  83.169  1.00   14.66 ? 200  PHE B CD1 1 
ATOM   4366  C CD2 . PHE B 1 200 ? 12.964  89.326  84.038  1.00   17.21 ? 200  PHE B CD2 1 
ATOM   4367  C CE1 . PHE B 1 200 ? 10.245  89.673  84.422  1.00   14.18 ? 200  PHE B CE1 1 
ATOM   4368  C CE2 . PHE B 1 200 ? 12.495  89.685  85.286  1.00   10.91 ? 200  PHE B CE2 1 
ATOM   4369  C CZ  . PHE B 1 200 ? 11.138  89.862  85.484  1.00   15.24 ? 200  PHE B CZ  1 
ATOM   4370  N N   . SER B 1 201 ? 13.274  89.936  78.419  1.00   17.04 ? 201  SER B N   1 
ATOM   4371  C CA  . SER B 1 201 ? 13.914  89.600  77.161  1.00   18.65 ? 201  SER B CA  1 
ATOM   4372  C C   . SER B 1 201 ? 15.221  90.295  76.810  1.00   19.47 ? 201  SER B C   1 
ATOM   4373  O O   . SER B 1 201 ? 16.129  89.623  76.332  1.00   18.09 ? 201  SER B O   1 
ATOM   4374  C CB  . SER B 1 201 ? 12.917  89.781  76.009  1.00   17.55 ? 201  SER B CB  1 
ATOM   4375  O OG  . SER B 1 201 ? 11.879  88.820  76.068  1.00   17.14 ? 201  SER B OG  1 
ATOM   4376  N N   . LYS B 1 202 ? 15.337  91.606  77.044  1.00   21.34 ? 202  LYS B N   1 
ATOM   4377  C CA  . LYS B 1 202 ? 16.557  92.325  76.679  1.00   23.35 ? 202  LYS B CA  1 
ATOM   4378  C C   . LYS B 1 202 ? 17.694  92.305  77.678  1.00   21.93 ? 202  LYS B C   1 
ATOM   4379  O O   . LYS B 1 202 ? 18.773  91.847  77.362  1.00   26.08 ? 202  LYS B O   1 
ATOM   4380  C CB  . LYS B 1 202 ? 16.257  93.791  76.337  1.00   27.13 ? 202  LYS B CB  1 
ATOM   4381  C CG  . LYS B 1 202 ? 15.596  94.000  74.979  1.00   30.43 ? 202  LYS B CG  1 
ATOM   4382  C CD  . LYS B 1 202 ? 14.201  93.409  74.938  1.00   33.44 ? 202  LYS B CD  1 
ATOM   4383  C CE  . LYS B 1 202 ? 13.548  93.624  73.572  1.00   38.92 ? 202  LYS B CE  1 
ATOM   4384  N NZ  . LYS B 1 202 ? 14.301  92.958  72.452  1.00   42.79 ? 202  LYS B NZ  1 
ATOM   4385  N N   . ALA B 1 203 ? 17.447  92.789  78.884  1.00   20.38 ? 203  ALA B N   1 
ATOM   4386  C CA  . ALA B 1 203 ? 18.498  92.867  79.885  1.00   18.82 ? 203  ALA B CA  1 
ATOM   4387  C C   . ALA B 1 203 ? 18.746  91.597  80.694  1.00   20.72 ? 203  ALA B C   1 
ATOM   4388  O O   . ALA B 1 203 ? 19.778  91.478  81.353  1.00   22.43 ? 203  ALA B O   1 
ATOM   4389  C CB  . ALA B 1 203 ? 18.208  94.027  80.815  1.00   9.49  ? 203  ALA B CB  1 
ATOM   4390  N N   . PHE B 1 204 ? 17.814  90.649  80.655  1.00   22.84 ? 204  PHE B N   1 
ATOM   4391  C CA  . PHE B 1 204 ? 17.993  89.431  81.432  1.00   21.10 ? 204  PHE B CA  1 
ATOM   4392  C C   . PHE B 1 204 ? 18.352  88.195  80.610  1.00   22.08 ? 204  PHE B C   1 
ATOM   4393  O O   . PHE B 1 204 ? 18.477  87.080  81.150  1.00   22.19 ? 204  PHE B O   1 
ATOM   4394  C CB  . PHE B 1 204 ? 16.745  89.188  82.279  1.00   24.41 ? 204  PHE B CB  1 
ATOM   4395  C CG  . PHE B 1 204 ? 16.549  90.229  83.361  1.00   28.03 ? 204  PHE B CG  1 
ATOM   4396  C CD1 . PHE B 1 204 ? 17.268  90.153  84.557  1.00   25.58 ? 204  PHE B CD1 1 
ATOM   4397  C CD2 . PHE B 1 204 ? 15.665  91.296  83.180  1.00   28.19 ? 204  PHE B CD2 1 
ATOM   4398  C CE1 . PHE B 1 204 ? 17.106  91.117  85.558  1.00   20.43 ? 204  PHE B CE1 1 
ATOM   4399  C CE2 . PHE B 1 204 ? 15.496  92.273  84.180  1.00   22.70 ? 204  PHE B CE2 1 
ATOM   4400  C CZ  . PHE B 1 204 ? 16.218  92.178  85.369  1.00   21.87 ? 204  PHE B CZ  1 
ATOM   4401  N N   . SER B 1 205 ? 18.549  88.410  79.308  1.00   20.18 ? 205  SER B N   1 
ATOM   4402  C CA  . SER B 1 205 ? 18.904  87.322  78.404  1.00   21.00 ? 205  SER B CA  1 
ATOM   4403  C C   . SER B 1 205 ? 17.931  86.161  78.521  1.00   18.02 ? 205  SER B C   1 
ATOM   4404  O O   . SER B 1 205 ? 18.338  84.999  78.614  1.00   19.44 ? 205  SER B O   1 
ATOM   4405  C CB  . SER B 1 205 ? 20.327  86.843  78.707  1.00   20.98 ? 205  SER B CB  1 
ATOM   4406  O OG  . SER B 1 205 ? 21.250  87.863  78.379  1.00   25.43 ? 205  SER B OG  1 
ATOM   4407  N N   . LEU B 1 206 ? 16.651  86.479  78.530  1.00   17.44 ? 206  LEU B N   1 
ATOM   4408  C CA  . LEU B 1 206 ? 15.591  85.478  78.669  1.00   18.25 ? 206  LEU B CA  1 
ATOM   4409  C C   . LEU B 1 206 ? 14.497  85.596  77.562  1.00   19.46 ? 206  LEU B C   1 
ATOM   4410  O O   . LEU B 1 206 ? 13.322  85.244  77.788  1.00   16.26 ? 206  LEU B O   1 
ATOM   4411  C CB  . LEU B 1 206 ? 14.941  85.673  80.032  1.00   15.16 ? 206  LEU B CB  1 
ATOM   4412  C CG  . LEU B 1 206 ? 15.165  84.780  81.250  1.00   17.69 ? 206  LEU B CG  1 
ATOM   4413  C CD1 . LEU B 1 206 ? 16.301  83.854  81.042  1.00   17.31 ? 206  LEU B CD1 1 
ATOM   4414  C CD2 . LEU B 1 206 ? 15.325  85.652  82.465  1.00   17.25 ? 206  LEU B CD2 1 
ATOM   4415  N N   . ALA B 1 207 ? 14.886  86.099  76.390  1.00   16.15 ? 207  ALA B N   1 
ATOM   4416  C CA  . ALA B 1 207 ? 13.963  86.302  75.290  1.00   17.60 ? 207  ALA B CA  1 
ATOM   4417  C C   . ALA B 1 207 ? 13.317  84.988  74.883  1.00   20.27 ? 207  ALA B C   1 
ATOM   4418  O O   . ALA B 1 207 ? 12.157  84.975  74.417  1.00   19.25 ? 207  ALA B O   1 
ATOM   4419  C CB  . ALA B 1 207 ? 14.696  86.915  74.118  1.00   15.47 ? 207  ALA B CB  1 
ATOM   4420  N N   . ALA B 1 208 ? 14.059  83.889  75.060  1.00   17.32 ? 208  ALA B N   1 
ATOM   4421  C CA  . ALA B 1 208 ? 13.577  82.558  74.692  1.00   14.34 ? 208  ALA B CA  1 
ATOM   4422  C C   . ALA B 1 208 ? 12.540  81.993  75.653  1.00   16.47 ? 208  ALA B C   1 
ATOM   4423  O O   . ALA B 1 208 ? 11.818  81.061  75.299  1.00   15.14 ? 208  ALA B O   1 
ATOM   4424  C CB  . ALA B 1 208 ? 14.749  81.569  74.570  1.00   12.06 ? 208  ALA B CB  1 
ATOM   4425  N N   . GLN B 1 209 ? 12.496  82.532  76.874  1.00   17.14 ? 209  GLN B N   1 
ATOM   4426  C CA  . GLN B 1 209 ? 11.543  82.066  77.877  1.00   17.64 ? 209  GLN B CA  1 
ATOM   4427  C C   . GLN B 1 209 ? 10.219  82.847  77.932  1.00   18.17 ? 209  GLN B C   1 
ATOM   4428  O O   . GLN B 1 209 ? 9.235   82.427  78.571  1.00   19.03 ? 209  GLN B O   1 
ATOM   4429  C CB  . GLN B 1 209 ? 12.240  82.037  79.241  1.00   17.08 ? 209  GLN B CB  1 
ATOM   4430  C CG  . GLN B 1 209 ? 13.255  80.899  79.324  1.00   20.51 ? 209  GLN B CG  1 
ATOM   4431  C CD  . GLN B 1 209 ? 12.619  79.560  78.994  1.00   18.34 ? 209  GLN B CD  1 
ATOM   4432  O OE1 . GLN B 1 209 ? 11.771  79.066  79.733  1.00   26.19 ? 209  GLN B OE1 1 
ATOM   4433  N NE2 . GLN B 1 209 ? 13.005  78.980  77.865  1.00   13.46 ? 209  GLN B NE2 1 
ATOM   4434  N N   . ARG B 1 210 ? 10.203  83.999  77.270  1.00   18.25 ? 210  ARG B N   1 
ATOM   4435  C CA  . ARG B 1 210 ? 8.992   84.813  77.155  1.00   14.92 ? 210  ARG B CA  1 
ATOM   4436  C C   . ARG B 1 210 ? 8.337   85.299  78.433  1.00   16.12 ? 210  ARG B C   1 
ATOM   4437  O O   . ARG B 1 210 ? 7.307   84.773  78.853  1.00   16.63 ? 210  ARG B O   1 
ATOM   4438  C CB  . ARG B 1 210 ? 7.916   84.057  76.345  1.00   6.82  ? 210  ARG B CB  1 
ATOM   4439  C CG  . ARG B 1 210 ? 8.430   83.170  75.200  1.00   9.11  ? 210  ARG B CG  1 
ATOM   4440  C CD  . ARG B 1 210 ? 9.194   83.976  74.186  1.00   12.66 ? 210  ARG B CD  1 
ATOM   4441  N NE  . ARG B 1 210 ? 8.377   85.118  73.760  1.00   12.67 ? 210  ARG B NE  1 
ATOM   4442  C CZ  . ARG B 1 210 ? 8.800   86.381  73.694  1.00   15.00 ? 210  ARG B CZ  1 
ATOM   4443  N NH1 . ARG B 1 210 ? 10.043  86.678  74.033  1.00   18.29 ? 210  ARG B NH1 1 
ATOM   4444  N NH2 . ARG B 1 210 ? 7.972   87.353  73.291  1.00   14.29 ? 210  ARG B NH2 1 
ATOM   4445  N N   . VAL B 1 211 ? 8.909   86.326  79.036  1.00   17.95 ? 211  VAL B N   1 
ATOM   4446  C CA  . VAL B 1 211 ? 8.316   86.873  80.242  1.00   15.67 ? 211  VAL B CA  1 
ATOM   4447  C C   . VAL B 1 211 ? 8.220   88.399  80.147  1.00   16.06 ? 211  VAL B C   1 
ATOM   4448  O O   . VAL B 1 211 ? 9.228   89.073  80.064  1.00   17.51 ? 211  VAL B O   1 
ATOM   4449  C CB  . VAL B 1 211 ? 9.151   86.500  81.491  1.00   16.30 ? 211  VAL B CB  1 
ATOM   4450  C CG1 . VAL B 1 211 ? 8.384   86.866  82.776  1.00   13.68 ? 211  VAL B CG1 1 
ATOM   4451  C CG2 . VAL B 1 211 ? 9.498   85.025  81.450  1.00   18.81 ? 211  VAL B CG2 1 
ATOM   4452  N N   . GLY B 1 212 ? 6.999   88.935  80.137  1.00   16.32 ? 212  GLY B N   1 
ATOM   4453  C CA  . GLY B 1 212 ? 6.813   90.371  80.102  1.00   11.28 ? 212  GLY B CA  1 
ATOM   4454  C C   . GLY B 1 212 ? 5.938   90.733  81.290  1.00   15.25 ? 212  GLY B C   1 
ATOM   4455  O O   . GLY B 1 212 ? 5.335   89.863  81.918  1.00   15.70 ? 212  GLY B O   1 
ATOM   4456  N N   . TYR B 1 213 ? 5.870   92.005  81.641  1.00   15.58 ? 213  TYR B N   1 
ATOM   4457  C CA  . TYR B 1 213 ? 5.003   92.359  82.737  1.00   15.23 ? 213  TYR B CA  1 
ATOM   4458  C C   . TYR B 1 213 ? 4.429   93.746  82.546  1.00   16.17 ? 213  TYR B C   1 
ATOM   4459  O O   . TYR B 1 213 ? 4.981   94.578  81.844  1.00   16.89 ? 213  TYR B O   1 
ATOM   4460  C CB  . TYR B 1 213 ? 5.713   92.197  84.088  1.00   17.00 ? 213  TYR B CB  1 
ATOM   4461  C CG  . TYR B 1 213 ? 6.974   92.987  84.285  1.00   10.35 ? 213  TYR B CG  1 
ATOM   4462  C CD1 . TYR B 1 213 ? 6.939   94.231  84.879  1.00   15.62 ? 213  TYR B CD1 1 
ATOM   4463  C CD2 . TYR B 1 213 ? 8.211   92.461  83.913  1.00   12.78 ? 213  TYR B CD2 1 
ATOM   4464  C CE1 . TYR B 1 213 ? 8.118   94.945  85.112  1.00   19.16 ? 213  TYR B CE1 1 
ATOM   4465  C CE2 . TYR B 1 213 ? 9.386   93.159  84.122  1.00   12.29 ? 213  TYR B CE2 1 
ATOM   4466  C CZ  . TYR B 1 213 ? 9.338   94.408  84.721  1.00   19.64 ? 213  TYR B CZ  1 
ATOM   4467  O OH  . TYR B 1 213 ? 10.479  95.168  84.868  1.00   22.71 ? 213  TYR B OH  1 
ATOM   4468  N N   . VAL B 1 214 ? 3.276   93.959  83.151  1.00   18.15 ? 214  VAL B N   1 
ATOM   4469  C CA  . VAL B 1 214 ? 2.594   95.217  83.005  1.00   19.15 ? 214  VAL B CA  1 
ATOM   4470  C C   . VAL B 1 214 ? 2.344   95.793  84.362  1.00   20.50 ? 214  VAL B C   1 
ATOM   4471  O O   . VAL B 1 214 ? 1.967   95.074  85.290  1.00   21.82 ? 214  VAL B O   1 
ATOM   4472  C CB  . VAL B 1 214 ? 1.199   95.074  82.355  1.00   18.63 ? 214  VAL B CB  1 
ATOM   4473  C CG1 . VAL B 1 214 ? 0.896   96.283  81.496  1.00   12.68 ? 214  VAL B CG1 1 
ATOM   4474  C CG2 . VAL B 1 214 ? 1.079   93.801  81.620  1.00   21.24 ? 214  VAL B CG2 1 
ATOM   4475  N N   . VAL B 1 215 ? 2.552   97.102  84.451  1.00   20.58 ? 215  VAL B N   1 
ATOM   4476  C CA  . VAL B 1 215 ? 2.337   97.856  85.661  1.00   19.86 ? 215  VAL B CA  1 
ATOM   4477  C C   . VAL B 1 215 ? 1.276   98.874  85.250  1.00   20.75 ? 215  VAL B C   1 
ATOM   4478  O O   . VAL B 1 215 ? 1.462   99.632  84.291  1.00   19.66 ? 215  VAL B O   1 
ATOM   4479  C CB  . VAL B 1 215 ? 3.622   98.592  86.085  1.00   20.50 ? 215  VAL B CB  1 
ATOM   4480  C CG1 . VAL B 1 215 ? 3.509   99.043  87.526  1.00   18.93 ? 215  VAL B CG1 1 
ATOM   4481  C CG2 . VAL B 1 215 ? 4.833   97.698  85.870  1.00   15.80 ? 215  VAL B CG2 1 
ATOM   4482  N N   . ALA B 1 216 ? 0.147   98.871  85.947  1.00   22.46 ? 216  ALA B N   1 
ATOM   4483  C CA  . ALA B 1 216 ? -0.917  99.802  85.619  1.00   22.61 ? 216  ALA B CA  1 
ATOM   4484  C C   . ALA B 1 216 ? -1.932  99.864  86.756  1.00   25.97 ? 216  ALA B C   1 
ATOM   4485  O O   . ALA B 1 216 ? -1.698  99.323  87.847  1.00   25.58 ? 216  ALA B O   1 
ATOM   4486  C CB  . ALA B 1 216 ? -1.597  99.371  84.340  1.00   18.45 ? 216  ALA B CB  1 
ATOM   4487  N N   . SER B 1 217 ? -3.065  100.513 86.488  1.00   25.59 ? 217  SER B N   1 
ATOM   4488  C CA  . SER B 1 217 ? -4.105  100.642 87.487  1.00   27.82 ? 217  SER B CA  1 
ATOM   4489  C C   . SER B 1 217 ? -4.793  99.306  87.697  1.00   28.69 ? 217  SER B C   1 
ATOM   4490  O O   . SER B 1 217 ? -4.860  98.479  86.794  1.00   30.72 ? 217  SER B O   1 
ATOM   4491  C CB  . SER B 1 217 ? -5.144  101.675 87.059  1.00   23.97 ? 217  SER B CB  1 
ATOM   4492  O OG  . SER B 1 217 ? -6.210  101.045 86.377  1.00   32.79 ? 217  SER B OG  1 
ATOM   4493  N N   . GLU B 1 218 ? -5.310  99.124  88.903  1.00   29.86 ? 218  GLU B N   1 
ATOM   4494  C CA  . GLU B 1 218 ? -6.008  97.930  89.290  1.00   30.13 ? 218  GLU B CA  1 
ATOM   4495  C C   . GLU B 1 218 ? -7.117  97.614  88.320  1.00   28.88 ? 218  GLU B C   1 
ATOM   4496  O O   . GLU B 1 218 ? -7.332  96.457  87.979  1.00   29.72 ? 218  GLU B O   1 
ATOM   4497  C CB  . GLU B 1 218 ? -6.609  98.116  90.677  1.00   32.83 ? 218  GLU B CB  1 
ATOM   4498  C CG  . GLU B 1 218 ? -5.602  98.432  91.754  1.00   38.57 ? 218  GLU B CG  1 
ATOM   4499  C CD  . GLU B 1 218 ? -6.120  98.062  93.124  1.00   43.12 ? 218  GLU B CD  1 
ATOM   4500  O OE1 . GLU B 1 218 ? -5.671  98.682  94.117  1.00   43.67 ? 218  GLU B OE1 1 
ATOM   4501  O OE2 . GLU B 1 218 ? -6.977  97.140  93.192  1.00   42.39 ? 218  GLU B OE2 1 
ATOM   4502  N N   . LYS B 1 219 ? -7.828  98.654  87.893  1.00   29.38 ? 219  LYS B N   1 
ATOM   4503  C CA  . LYS B 1 219 ? -8.939  98.494  86.968  1.00   28.65 ? 219  LYS B CA  1 
ATOM   4504  C C   . LYS B 1 219 ? -8.448  97.931  85.637  1.00   25.93 ? 219  LYS B C   1 
ATOM   4505  O O   . LYS B 1 219 ? -9.084  97.079  85.036  1.00   24.63 ? 219  LYS B O   1 
ATOM   4506  C CB  . LYS B 1 219 ? -9.643  99.841  86.750  1.00   32.26 ? 219  LYS B CB  1 
ATOM   4507  C CG  . LYS B 1 219 ? -10.993 99.738  85.997  1.00   38.27 ? 219  LYS B CG  1 
ATOM   4508  C CD  . LYS B 1 219 ? -11.493 101.109 85.485  1.00   40.26 ? 219  LYS B CD  1 
ATOM   4509  C CE  . LYS B 1 219 ? -11.878 102.046 86.633  1.00   43.68 ? 219  LYS B CE  1 
ATOM   4510  N NZ  . LYS B 1 219 ? -13.328 102.454 86.581  1.00   45.84 ? 219  LYS B NZ  1 
ATOM   4511  N N   . PHE B 1 220 ? -7.309  98.419  85.170  1.00   24.55 ? 220  PHE B N   1 
ATOM   4512  C CA  . PHE B 1 220 ? -6.768  97.921  83.924  1.00   23.25 ? 220  PHE B CA  1 
ATOM   4513  C C   . PHE B 1 220 ? -6.259  96.484  84.118  1.00   25.39 ? 220  PHE B C   1 
ATOM   4514  O O   . PHE B 1 220 ? -6.682  95.548  83.381  1.00   24.23 ? 220  PHE B O   1 
ATOM   4515  C CB  . PHE B 1 220 ? -5.609  98.782  83.433  1.00   20.44 ? 220  PHE B CB  1 
ATOM   4516  C CG  . PHE B 1 220 ? -4.927  98.209  82.233  1.00   18.92 ? 220  PHE B CG  1 
ATOM   4517  C CD1 . PHE B 1 220 ? -5.528  98.273  80.965  1.00   18.94 ? 220  PHE B CD1 1 
ATOM   4518  C CD2 . PHE B 1 220 ? -3.730  97.517  82.378  1.00   17.57 ? 220  PHE B CD2 1 
ATOM   4519  C CE1 . PHE B 1 220 ? -4.937  97.640  79.858  1.00   13.42 ? 220  PHE B CE1 1 
ATOM   4520  C CE2 . PHE B 1 220 ? -3.129  96.884  81.285  1.00   19.35 ? 220  PHE B CE2 1 
ATOM   4521  C CZ  . PHE B 1 220 ? -3.728  96.943  80.031  1.00   15.82 ? 220  PHE B CZ  1 
ATOM   4522  N N   . ILE B 1 221 ? -5.339  96.317  85.083  1.00   18.62 ? 221  ILE B N   1 
ATOM   4523  C CA  . ILE B 1 221 ? -4.781  94.998  85.362  1.00   19.61 ? 221  ILE B CA  1 
ATOM   4524  C C   . ILE B 1 221 ? -5.924  93.982  85.458  1.00   21.44 ? 221  ILE B C   1 
ATOM   4525  O O   . ILE B 1 221 ? -5.864  92.912  84.857  1.00   21.86 ? 221  ILE B O   1 
ATOM   4526  C CB  . ILE B 1 221 ? -3.959  95.011  86.677  1.00   15.03 ? 221  ILE B CB  1 
ATOM   4527  C CG1 . ILE B 1 221 ? -2.698  95.868  86.501  1.00   13.69 ? 221  ILE B CG1 1 
ATOM   4528  C CG2 . ILE B 1 221 ? -3.527  93.589  87.066  1.00   16.76 ? 221  ILE B CG2 1 
ATOM   4529  C CD1 . ILE B 1 221 ? -1.573  95.231  85.615  1.00   5.70  ? 221  ILE B CD1 1 
ATOM   4530  N N   . ASP B 1 222 ? -6.973  94.321  86.199  1.00   23.25 ? 222  ASP B N   1 
ATOM   4531  C CA  . ASP B 1 222 ? -8.106  93.407  86.303  1.00   26.25 ? 222  ASP B CA  1 
ATOM   4532  C C   . ASP B 1 222 ? -8.691  93.120  84.910  1.00   25.65 ? 222  ASP B C   1 
ATOM   4533  O O   . ASP B 1 222 ? -8.995  91.971  84.571  1.00   25.67 ? 222  ASP B O   1 
ATOM   4534  C CB  . ASP B 1 222 ? -9.210  93.985  87.174  1.00   32.68 ? 222  ASP B CB  1 
ATOM   4535  C CG  . ASP B 1 222 ? -10.526 93.229  87.003  1.00   41.41 ? 222  ASP B CG  1 
ATOM   4536  O OD1 . ASP B 1 222 ? -10.710 92.199  87.683  1.00   43.56 ? 222  ASP B OD1 1 
ATOM   4537  O OD2 . ASP B 1 222 ? -11.365 93.646  86.164  1.00   44.08 ? 222  ASP B OD2 1 
ATOM   4538  N N   . ALA B 1 223 ? -8.866  94.159  84.102  1.00   23.68 ? 223  ALA B N   1 
ATOM   4539  C CA  . ALA B 1 223 ? -9.423  93.959  82.770  1.00   23.60 ? 223  ALA B CA  1 
ATOM   4540  C C   . ALA B 1 223 ? -8.509  93.024  81.978  1.00   23.87 ? 223  ALA B C   1 
ATOM   4541  O O   . ALA B 1 223 ? -8.944  92.009  81.434  1.00   24.81 ? 223  ALA B O   1 
ATOM   4542  C CB  . ALA B 1 223 ? -9.568  95.289  82.064  1.00   21.26 ? 223  ALA B CB  1 
ATOM   4543  N N   . TYR B 1 224 ? -7.235  93.388  81.926  1.00   22.19 ? 224  TYR B N   1 
ATOM   4544  C CA  . TYR B 1 224 ? -6.217  92.612  81.236  1.00   19.79 ? 224  TYR B CA  1 
ATOM   4545  C C   . TYR B 1 224 ? -6.302  91.139  81.653  1.00   21.25 ? 224  TYR B C   1 
ATOM   4546  O O   . TYR B 1 224 ? -6.326  90.229  80.814  1.00   22.03 ? 224  TYR B O   1 
ATOM   4547  C CB  . TYR B 1 224 ? -4.847  93.209  81.582  1.00   17.48 ? 224  TYR B CB  1 
ATOM   4548  C CG  . TYR B 1 224 ? -3.673  92.397  81.139  1.00   16.24 ? 224  TYR B CG  1 
ATOM   4549  C CD1 . TYR B 1 224 ? -3.287  92.373  79.807  1.00   18.08 ? 224  TYR B CD1 1 
ATOM   4550  C CD2 . TYR B 1 224 ? -2.983  91.587  82.047  1.00   18.51 ? 224  TYR B CD2 1 
ATOM   4551  C CE1 . TYR B 1 224 ? -2.251  91.553  79.383  1.00   19.57 ? 224  TYR B CE1 1 
ATOM   4552  C CE2 . TYR B 1 224 ? -1.948  90.762  81.628  1.00   16.84 ? 224  TYR B CE2 1 
ATOM   4553  C CZ  . TYR B 1 224 ? -1.592  90.749  80.296  1.00   18.38 ? 224  TYR B CZ  1 
ATOM   4554  O OH  . TYR B 1 224 ? -0.582  89.937  79.849  1.00   22.53 ? 224  TYR B OH  1 
ATOM   4555  N N   . ASN B 1 225 ? -6.366  90.912  82.960  1.00   19.49 ? 225  ASN B N   1 
ATOM   4556  C CA  . ASN B 1 225 ? -6.431  89.567  83.513  1.00   23.04 ? 225  ASN B CA  1 
ATOM   4557  C C   . ASN B 1 225 ? -7.624  88.733  83.089  1.00   23.93 ? 225  ASN B C   1 
ATOM   4558  O O   . ASN B 1 225 ? -7.582  87.509  83.184  1.00   22.18 ? 225  ASN B O   1 
ATOM   4559  C CB  . ASN B 1 225 ? -6.381  89.631  85.034  1.00   23.98 ? 225  ASN B CB  1 
ATOM   4560  C CG  . ASN B 1 225 ? -4.985  89.814  85.553  1.00   24.75 ? 225  ASN B CG  1 
ATOM   4561  O OD1 . ASN B 1 225 ? -4.768  90.059  86.745  1.00   30.22 ? 225  ASN B OD1 1 
ATOM   4562  N ND2 . ASN B 1 225 ? -4.013  89.688  84.655  1.00   14.99 ? 225  ASN B ND2 1 
ATOM   4563  N N   . ARG B 1 226 ? -8.687  89.392  82.643  1.00   25.98 ? 226  ARG B N   1 
ATOM   4564  C CA  . ARG B 1 226 ? -9.881  88.684  82.211  1.00   26.49 ? 226  ARG B CA  1 
ATOM   4565  C C   . ARG B 1 226 ? -9.774  88.390  80.724  1.00   24.85 ? 226  ARG B C   1 
ATOM   4566  O O   . ARG B 1 226 ? -10.461 87.525  80.189  1.00   23.29 ? 226  ARG B O   1 
ATOM   4567  C CB  . ARG B 1 226 ? -11.135 89.536  82.445  1.00   33.57 ? 226  ARG B CB  1 
ATOM   4568  C CG  . ARG B 1 226 ? -11.286 90.109  83.851  1.00   41.15 ? 226  ARG B CG  1 
ATOM   4569  C CD  . ARG B 1 226 ? -12.694 90.634  84.078  1.00   43.72 ? 226  ARG B CD  1 
ATOM   4570  N NE  . ARG B 1 226 ? -12.836 91.326  85.353  1.00   49.12 ? 226  ARG B NE  1 
ATOM   4571  C CZ  . ARG B 1 226 ? -14.005 91.701  85.867  1.00   52.29 ? 226  ARG B CZ  1 
ATOM   4572  N NH1 . ARG B 1 226 ? -14.048 92.328  87.035  1.00   55.68 ? 226  ARG B NH1 1 
ATOM   4573  N NH2 . ARG B 1 226 ? -15.137 91.441  85.221  1.00   50.16 ? 226  ARG B NH2 1 
ATOM   4574  N N   . VAL B 1 227 ? -8.894  89.104  80.054  1.00   22.94 ? 227  VAL B N   1 
ATOM   4575  C CA  . VAL B 1 227 ? -8.763  88.931  78.618  1.00   21.68 ? 227  VAL B CA  1 
ATOM   4576  C C   . VAL B 1 227 ? -7.602  88.056  78.162  1.00   22.25 ? 227  VAL B C   1 
ATOM   4577  O O   . VAL B 1 227 ? -7.634  87.445  77.083  1.00   22.16 ? 227  VAL B O   1 
ATOM   4578  C CB  . VAL B 1 227 ? -8.677  90.315  77.959  1.00   16.46 ? 227  VAL B CB  1 
ATOM   4579  C CG1 . VAL B 1 227 ? -8.276  90.190  76.491  1.00   15.86 ? 227  VAL B CG1 1 
ATOM   4580  C CG2 . VAL B 1 227 ? -10.011 90.998  78.098  1.00   15.35 ? 227  VAL B CG2 1 
ATOM   4581  N N   . ARG B 1 228 ? -6.571  88.011  78.989  1.00   20.85 ? 228  ARG B N   1 
ATOM   4582  C CA  . ARG B 1 228 ? -5.402  87.202  78.691  1.00   19.57 ? 228  ARG B CA  1 
ATOM   4583  C C   . ARG B 1 228 ? -5.613  85.724  79.014  1.00   18.56 ? 228  ARG B C   1 
ATOM   4584  O O   . ARG B 1 228 ? -6.483  85.354  79.802  1.00   14.62 ? 228  ARG B O   1 
ATOM   4585  C CB  . ARG B 1 228 ? -4.222  87.681  79.513  1.00   15.74 ? 228  ARG B CB  1 
ATOM   4586  C CG  . ARG B 1 228 ? -4.274  87.241  80.973  1.00   11.57 ? 228  ARG B CG  1 
ATOM   4587  C CD  . ARG B 1 228 ? -3.014  87.719  81.726  1.00   16.37 ? 228  ARG B CD  1 
ATOM   4588  N NE  . ARG B 1 228 ? -3.116  87.596  83.177  1.00   10.33 ? 228  ARG B NE  1 
ATOM   4589  C CZ  . ARG B 1 228 ? -2.985  86.450  83.828  1.00   18.85 ? 228  ARG B CZ  1 
ATOM   4590  N NH1 . ARG B 1 228 ? -2.733  85.326  83.155  1.00   19.66 ? 228  ARG B NH1 1 
ATOM   4591  N NH2 . ARG B 1 228 ? -3.125  86.424  85.148  1.00   15.67 ? 228  ARG B NH2 1 
ATOM   4592  N N   . LEU B 1 229 ? -4.784  84.880  78.418  1.00   20.10 ? 229  LEU B N   1 
ATOM   4593  C CA  . LEU B 1 229 ? -4.845  83.453  78.712  1.00   22.90 ? 229  LEU B CA  1 
ATOM   4594  C C   . LEU B 1 229 ? -4.521  83.311  80.216  1.00   22.65 ? 229  LEU B C   1 
ATOM   4595  O O   . LEU B 1 229 ? -3.570  83.920  80.722  1.00   22.91 ? 229  LEU B O   1 
ATOM   4596  C CB  . LEU B 1 229 ? -3.834  82.691  77.840  1.00   23.66 ? 229  LEU B CB  1 
ATOM   4597  C CG  . LEU B 1 229 ? -4.281  82.428  76.389  1.00   22.36 ? 229  LEU B CG  1 
ATOM   4598  C CD1 . LEU B 1 229 ? -3.096  82.342  75.463  1.00   23.15 ? 229  LEU B CD1 1 
ATOM   4599  C CD2 . LEU B 1 229 ? -5.072  81.140  76.351  1.00   23.36 ? 229  LEU B CD2 1 
ATOM   4600  N N   . PRO B 1 230 ? -5.328  82.532  80.944  1.00   23.33 ? 230  PRO B N   1 
ATOM   4601  C CA  . PRO B 1 230 ? -5.149  82.306  82.389  1.00   22.93 ? 230  PRO B CA  1 
ATOM   4602  C C   . PRO B 1 230 ? -3.740  81.838  82.753  1.00   23.36 ? 230  PRO B C   1 
ATOM   4603  O O   . PRO B 1 230 ? -3.112  82.353  83.687  1.00   23.19 ? 230  PRO B O   1 
ATOM   4604  C CB  . PRO B 1 230 ? -6.184  81.225  82.706  1.00   23.37 ? 230  PRO B CB  1 
ATOM   4605  C CG  . PRO B 1 230 ? -7.186  81.355  81.616  1.00   25.28 ? 230  PRO B CG  1 
ATOM   4606  C CD  . PRO B 1 230 ? -6.390  81.668  80.402  1.00   24.81 ? 230  PRO B CD  1 
ATOM   4607  N N   . PHE B 1 231 ? -3.254  80.825  82.038  1.00   20.96 ? 231  PHE B N   1 
ATOM   4608  C CA  . PHE B 1 231 ? -1.911  80.322  82.307  1.00   21.71 ? 231  PHE B CA  1 
ATOM   4609  C C   . PHE B 1 231 ? -0.997  80.691  81.158  1.00   22.08 ? 231  PHE B C   1 
ATOM   4610  O O   . PHE B 1 231 ? -0.584  79.844  80.369  1.00   23.38 ? 231  PHE B O   1 
ATOM   4611  C CB  . PHE B 1 231 ? -1.969  78.820  82.520  1.00   20.92 ? 231  PHE B CB  1 
ATOM   4612  C CG  . PHE B 1 231 ? -3.012  78.408  83.525  1.00   20.46 ? 231  PHE B CG  1 
ATOM   4613  C CD1 . PHE B 1 231 ? -4.275  77.962  83.097  1.00   16.92 ? 231  PHE B CD1 1 
ATOM   4614  C CD2 . PHE B 1 231 ? -2.766  78.542  84.893  1.00   16.90 ? 231  PHE B CD2 1 
ATOM   4615  C CE1 . PHE B 1 231 ? -5.303  77.660  84.027  1.00   18.40 ? 231  PHE B CE1 1 
ATOM   4616  C CE2 . PHE B 1 231 ? -3.780  78.244  85.845  1.00   15.95 ? 231  PHE B CE2 1 
ATOM   4617  C CZ  . PHE B 1 231 ? -5.063  77.801  85.403  1.00   15.50 ? 231  PHE B CZ  1 
ATOM   4618  N N   . ASN B 1 232 ? -0.674  81.976  81.069  1.00   20.61 ? 232  ASN B N   1 
ATOM   4619  C CA  . ASN B 1 232 ? 0.164   82.432  79.971  1.00   19.91 ? 232  ASN B CA  1 
ATOM   4620  C C   . ASN B 1 232 ? 1.655   82.325  80.179  1.00   16.33 ? 232  ASN B C   1 
ATOM   4621  O O   . ASN B 1 232 ? 2.410   82.444  79.224  1.00   13.17 ? 232  ASN B O   1 
ATOM   4622  C CB  . ASN B 1 232 ? -0.187  83.875  79.577  1.00   22.31 ? 232  ASN B CB  1 
ATOM   4623  C CG  . ASN B 1 232 ? 0.025   84.859  80.693  1.00   18.14 ? 232  ASN B CG  1 
ATOM   4624  O OD1 . ASN B 1 232 ? 0.275   86.033  80.452  1.00   25.29 ? 232  ASN B OD1 1 
ATOM   4625  N ND2 . ASN B 1 232 ? -0.087  84.392  81.924  1.00   18.72 ? 232  ASN B ND2 1 
ATOM   4626  N N   . VAL B 1 233 ? 2.093   82.092  81.403  1.00   16.40 ? 233  VAL B N   1 
ATOM   4627  C CA  . VAL B 1 233 ? 3.536   82.002  81.621  1.00   18.70 ? 233  VAL B CA  1 
ATOM   4628  C C   . VAL B 1 233 ? 3.898   80.740  82.389  1.00   16.09 ? 233  VAL B C   1 
ATOM   4629  O O   . VAL B 1 233 ? 3.396   80.519  83.485  1.00   15.98 ? 233  VAL B O   1 
ATOM   4630  C CB  . VAL B 1 233 ? 4.071   83.244  82.357  1.00   19.00 ? 233  VAL B CB  1 
ATOM   4631  C CG1 . VAL B 1 233 ? 5.597   83.233  82.328  1.00   23.41 ? 233  VAL B CG1 1 
ATOM   4632  C CG2 . VAL B 1 233 ? 3.519   84.514  81.693  1.00   18.22 ? 233  VAL B CG2 1 
ATOM   4633  N N   . SER B 1 234 ? 4.784   79.934  81.817  1.00   12.24 ? 234  SER B N   1 
ATOM   4634  C CA  . SER B 1 234 ? 5.154   78.668  82.437  1.00   16.90 ? 234  SER B CA  1 
ATOM   4635  C C   . SER B 1 234 ? 5.790   78.817  83.804  1.00   20.47 ? 234  SER B C   1 
ATOM   4636  O O   . SER B 1 234 ? 6.336   79.869  84.156  1.00   21.50 ? 234  SER B O   1 
ATOM   4637  C CB  . SER B 1 234 ? 6.108   77.866  81.545  1.00   18.48 ? 234  SER B CB  1 
ATOM   4638  O OG  . SER B 1 234 ? 7.382   78.496  81.472  1.00   12.69 ? 234  SER B OG  1 
ATOM   4639  N N   . TYR B 1 235 ? 5.685   77.741  84.568  1.00   19.06 ? 235  TYR B N   1 
ATOM   4640  C CA  . TYR B 1 235 ? 6.243   77.661  85.887  1.00   19.42 ? 235  TYR B CA  1 
ATOM   4641  C C   . TYR B 1 235 ? 7.768   77.870  85.745  1.00   20.60 ? 235  TYR B C   1 
ATOM   4642  O O   . TYR B 1 235 ? 8.363   78.669  86.466  1.00   23.37 ? 235  TYR B O   1 
ATOM   4643  C CB  . TYR B 1 235 ? 5.907   76.282  86.466  1.00   21.32 ? 235  TYR B CB  1 
ATOM   4644  C CG  . TYR B 1 235 ? 6.743   75.849  87.647  1.00   20.12 ? 235  TYR B CG  1 
ATOM   4645  C CD1 . TYR B 1 235 ? 6.648   76.491  88.888  1.00   23.43 ? 235  TYR B CD1 1 
ATOM   4646  C CD2 . TYR B 1 235 ? 7.601   74.768  87.533  1.00   20.25 ? 235  TYR B CD2 1 
ATOM   4647  C CE1 . TYR B 1 235 ? 7.391   76.055  89.989  1.00   21.12 ? 235  TYR B CE1 1 
ATOM   4648  C CE2 . TYR B 1 235 ? 8.348   74.314  88.616  1.00   19.70 ? 235  TYR B CE2 1 
ATOM   4649  C CZ  . TYR B 1 235 ? 8.246   74.950  89.834  1.00   20.74 ? 235  TYR B CZ  1 
ATOM   4650  O OH  . TYR B 1 235 ? 8.993   74.460  90.877  1.00   16.50 ? 235  TYR B OH  1 
ATOM   4651  N N   . VAL B 1 236 ? 8.382   77.172  84.793  1.00   20.22 ? 236  VAL B N   1 
ATOM   4652  C CA  . VAL B 1 236 ? 9.815   77.326  84.582  1.00   21.48 ? 236  VAL B CA  1 
ATOM   4653  C C   . VAL B 1 236 ? 10.212  78.730  84.109  1.00   21.67 ? 236  VAL B C   1 
ATOM   4654  O O   . VAL B 1 236 ? 11.245  79.255  84.530  1.00   21.95 ? 236  VAL B O   1 
ATOM   4655  C CB  . VAL B 1 236 ? 10.375  76.268  83.599  1.00   20.80 ? 236  VAL B CB  1 
ATOM   4656  C CG1 . VAL B 1 236 ? 11.824  76.578  83.247  1.00   21.11 ? 236  VAL B CG1 1 
ATOM   4657  C CG2 . VAL B 1 236 ? 10.331  74.894  84.271  1.00   25.97 ? 236  VAL B CG2 1 
ATOM   4658  N N   . SER B 1 237 ? 9.410   79.353  83.254  1.00   18.47 ? 237  SER B N   1 
ATOM   4659  C CA  . SER B 1 237 ? 9.739   80.702  82.811  1.00   16.71 ? 237  SER B CA  1 
ATOM   4660  C C   . SER B 1 237 ? 9.698   81.640  84.007  1.00   14.26 ? 237  SER B C   1 
ATOM   4661  O O   . SER B 1 237 ? 10.600  82.426  84.216  1.00   15.42 ? 237  SER B O   1 
ATOM   4662  C CB  . SER B 1 237 ? 8.782   81.179  81.730  1.00   13.91 ? 237  SER B CB  1 
ATOM   4663  O OG  . SER B 1 237 ? 9.096   80.583  80.480  1.00   20.58 ? 237  SER B OG  1 
ATOM   4664  N N   . GLN B 1 238 ? 8.658   81.544  84.816  1.00   15.55 ? 238  GLN B N   1 
ATOM   4665  C CA  . GLN B 1 238 ? 8.580   82.396  85.992  1.00   15.61 ? 238  GLN B CA  1 
ATOM   4666  C C   . GLN B 1 238 ? 9.771   82.146  86.922  1.00   17.37 ? 238  GLN B C   1 
ATOM   4667  O O   . GLN B 1 238 ? 10.326  83.091  87.494  1.00   16.64 ? 238  GLN B O   1 
ATOM   4668  C CB  . GLN B 1 238 ? 7.289   82.138  86.725  1.00   14.95 ? 238  GLN B CB  1 
ATOM   4669  C CG  . GLN B 1 238 ? 6.053   82.406  85.859  1.00   21.75 ? 238  GLN B CG  1 
ATOM   4670  C CD  . GLN B 1 238 ? 4.764   82.211  86.636  1.00   22.64 ? 238  GLN B CD  1 
ATOM   4671  O OE1 . GLN B 1 238 ? 3.864   81.460  86.220  1.00   20.34 ? 238  GLN B OE1 1 
ATOM   4672  N NE2 . GLN B 1 238 ? 4.668   82.885  87.777  1.00   13.21 ? 238  GLN B NE2 1 
ATOM   4673  N N   . MET B 1 239 ? 10.159  80.885  87.085  1.00   17.92 ? 239  MET B N   1 
ATOM   4674  C CA  . MET B 1 239 ? 11.297  80.557  87.932  1.00   17.79 ? 239  MET B CA  1 
ATOM   4675  C C   . MET B 1 239 ? 12.545  81.294  87.424  1.00   18.71 ? 239  MET B C   1 
ATOM   4676  O O   . MET B 1 239 ? 13.338  81.810  88.219  1.00   17.80 ? 239  MET B O   1 
ATOM   4677  C CB  . MET B 1 239 ? 11.540  79.056  87.925  1.00   24.57 ? 239  MET B CB  1 
ATOM   4678  C CG  . MET B 1 239 ? 12.443  78.592  89.049  1.00   32.98 ? 239  MET B CG  1 
ATOM   4679  S SD  . MET B 1 239 ? 11.811  79.076  90.709  1.00   39.77 ? 239  MET B SD  1 
ATOM   4680  C CE  . MET B 1 239 ? 10.764  77.645  91.076  1.00   39.17 ? 239  MET B CE  1 
ATOM   4681  N N   . PHE B 1 240 ? 12.707  81.366  86.102  1.00   15.82 ? 240  PHE B N   1 
ATOM   4682  C CA  . PHE B 1 240 ? 13.845  82.060  85.517  1.00   18.03 ? 240  PHE B CA  1 
ATOM   4683  C C   . PHE B 1 240 ? 13.803  83.552  85.861  1.00   20.78 ? 240  PHE B C   1 
ATOM   4684  O O   . PHE B 1 240 ? 14.816  84.139  86.218  1.00   25.42 ? 240  PHE B O   1 
ATOM   4685  C CB  . PHE B 1 240 ? 13.887  81.856  83.992  1.00   15.64 ? 240  PHE B CB  1 
ATOM   4686  C CG  . PHE B 1 240 ? 14.801  80.723  83.556  1.00   20.72 ? 240  PHE B CG  1 
ATOM   4687  C CD1 . PHE B 1 240 ? 16.192  80.856  83.641  1.00   19.68 ? 240  PHE B CD1 1 
ATOM   4688  C CD2 . PHE B 1 240 ? 14.277  79.518  83.097  1.00   17.16 ? 240  PHE B CD2 1 
ATOM   4689  C CE1 . PHE B 1 240 ? 17.037  79.808  83.276  1.00   24.53 ? 240  PHE B CE1 1 
ATOM   4690  C CE2 . PHE B 1 240 ? 15.114  78.461  82.728  1.00   16.75 ? 240  PHE B CE2 1 
ATOM   4691  C CZ  . PHE B 1 240 ? 16.492  78.602  82.816  1.00   23.00 ? 240  PHE B CZ  1 
ATOM   4692  N N   . ALA B 1 241 ? 12.629  84.160  85.778  1.00   20.27 ? 241  ALA B N   1 
ATOM   4693  C CA  . ALA B 1 241 ? 12.495  85.575  86.089  1.00   20.96 ? 241  ALA B CA  1 
ATOM   4694  C C   . ALA B 1 241 ? 12.767  85.855  87.586  1.00   21.17 ? 241  ALA B C   1 
ATOM   4695  O O   . ALA B 1 241 ? 13.372  86.860  87.951  1.00   24.81 ? 241  ALA B O   1 
ATOM   4696  C CB  . ALA B 1 241 ? 11.059  86.075  85.699  1.00   16.22 ? 241  ALA B CB  1 
ATOM   4697  N N   . LYS B 1 242 ? 12.299  84.968  88.445  1.00   20.17 ? 242  LYS B N   1 
ATOM   4698  C CA  . LYS B 1 242 ? 12.501  85.148  89.858  1.00   21.43 ? 242  LYS B CA  1 
ATOM   4699  C C   . LYS B 1 242 ? 13.986  85.017  90.204  1.00   22.78 ? 242  LYS B C   1 
ATOM   4700  O O   . LYS B 1 242 ? 14.536  85.837  90.947  1.00   22.89 ? 242  LYS B O   1 
ATOM   4701  C CB  . LYS B 1 242 ? 11.668  84.127  90.645  1.00   17.84 ? 242  LYS B CB  1 
ATOM   4702  C CG  . LYS B 1 242 ? 10.210  84.516  90.783  1.00   24.43 ? 242  LYS B CG  1 
ATOM   4703  C CD  . LYS B 1 242 ? 9.368   83.443  91.484  1.00   27.62 ? 242  LYS B CD  1 
ATOM   4704  C CE  . LYS B 1 242 ? 9.242   82.195  90.619  1.00   32.80 ? 242  LYS B CE  1 
ATOM   4705  N NZ  . LYS B 1 242 ? 8.423   81.138  91.267  1.00   38.86 ? 242  LYS B NZ  1 
ATOM   4706  N N   . VAL B 1 243 ? 14.633  83.986  89.681  1.00   21.25 ? 243  VAL B N   1 
ATOM   4707  C CA  . VAL B 1 243 ? 16.037  83.804  89.962  1.00   20.96 ? 243  VAL B CA  1 
ATOM   4708  C C   . VAL B 1 243 ? 16.748  85.032  89.426  1.00   22.13 ? 243  VAL B C   1 
ATOM   4709  O O   . VAL B 1 243 ? 17.560  85.634  90.108  1.00   24.54 ? 243  VAL B O   1 
ATOM   4710  C CB  . VAL B 1 243 ? 16.589  82.520  89.294  1.00   18.81 ? 243  VAL B CB  1 
ATOM   4711  C CG1 . VAL B 1 243 ? 18.105  82.470  89.385  1.00   18.76 ? 243  VAL B CG1 1 
ATOM   4712  C CG2 . VAL B 1 243 ? 16.015  81.301  89.997  1.00   16.46 ? 243  VAL B CG2 1 
ATOM   4713  N N   . ALA B 1 244 ? 16.416  85.413  88.203  1.00   24.97 ? 244  ALA B N   1 
ATOM   4714  C CA  . ALA B 1 244 ? 16.998  86.587  87.574  1.00   26.21 ? 244  ALA B CA  1 
ATOM   4715  C C   . ALA B 1 244 ? 16.984  87.814  88.517  1.00   27.00 ? 244  ALA B C   1 
ATOM   4716  O O   . ALA B 1 244 ? 18.025  88.433  88.762  1.00   27.15 ? 244  ALA B O   1 
ATOM   4717  C CB  . ALA B 1 244 ? 16.232  86.905  86.304  1.00   28.85 ? 244  ALA B CB  1 
ATOM   4718  N N   . LEU B 1 245 ? 15.805  88.148  89.036  1.00   23.54 ? 245  LEU B N   1 
ATOM   4719  C CA  . LEU B 1 245 ? 15.633  89.279  89.929  1.00   24.35 ? 245  LEU B CA  1 
ATOM   4720  C C   . LEU B 1 245 ? 16.285  89.075  91.288  1.00   25.48 ? 245  LEU B C   1 
ATOM   4721  O O   . LEU B 1 245 ? 16.483  90.032  92.028  1.00   23.75 ? 245  LEU B O   1 
ATOM   4722  C CB  . LEU B 1 245 ? 14.153  89.589  90.127  1.00   25.45 ? 245  LEU B CB  1 
ATOM   4723  C CG  . LEU B 1 245 ? 13.328  90.099  88.944  1.00   26.86 ? 245  LEU B CG  1 
ATOM   4724  C CD1 . LEU B 1 245 ? 11.878  90.320  89.389  1.00   27.39 ? 245  LEU B CD1 1 
ATOM   4725  C CD2 . LEU B 1 245 ? 13.918  91.373  88.431  1.00   20.46 ? 245  LEU B CD2 1 
ATOM   4726  N N   . ASP B 1 246 ? 16.619  87.832  91.620  1.00   28.54 ? 246  ASP B N   1 
ATOM   4727  C CA  . ASP B 1 246 ? 17.286  87.553  92.880  1.00   24.68 ? 246  ASP B CA  1 
ATOM   4728  C C   . ASP B 1 246 ? 18.771  87.839  92.750  1.00   25.33 ? 246  ASP B C   1 
ATOM   4729  O O   . ASP B 1 246 ? 19.481  87.882  93.747  1.00   21.95 ? 246  ASP B O   1 
ATOM   4730  C CB  . ASP B 1 246 ? 17.104  86.097  93.271  1.00   24.63 ? 246  ASP B CB  1 
ATOM   4731  C CG  . ASP B 1 246 ? 15.814  85.862  94.016  1.00   30.86 ? 246  ASP B CG  1 
ATOM   4732  O OD1 . ASP B 1 246 ? 15.164  86.855  94.436  1.00   33.49 ? 246  ASP B OD1 1 
ATOM   4733  O OD2 . ASP B 1 246 ? 15.463  84.674  94.190  1.00   33.41 ? 246  ASP B OD2 1 
ATOM   4734  N N   . HIS B 1 247 ? 19.227  88.038  91.510  1.00   25.63 ? 247  HIS B N   1 
ATOM   4735  C CA  . HIS B 1 247 ? 20.627  88.308  91.233  1.00   24.35 ? 247  HIS B CA  1 
ATOM   4736  C C   . HIS B 1 247 ? 20.776  89.451  90.255  1.00   25.95 ? 247  HIS B C   1 
ATOM   4737  O O   . HIS B 1 247 ? 21.654  89.434  89.401  1.00   23.56 ? 247  HIS B O   1 
ATOM   4738  C CB  . HIS B 1 247 ? 21.296  87.062  90.666  1.00   27.89 ? 247  HIS B CB  1 
ATOM   4739  C CG  . HIS B 1 247 ? 21.294  85.899  91.607  1.00   24.99 ? 247  HIS B CG  1 
ATOM   4740  N ND1 . HIS B 1 247 ? 20.172  85.140  91.845  1.00   28.05 ? 247  HIS B ND1 1 
ATOM   4741  C CD2 . HIS B 1 247 ? 22.275  85.382  92.388  1.00   26.14 ? 247  HIS B CD2 1 
ATOM   4742  C CE1 . HIS B 1 247 ? 20.457  84.204  92.739  1.00   33.22 ? 247  HIS B CE1 1 
ATOM   4743  N NE2 . HIS B 1 247 ? 21.727  84.331  93.086  1.00   28.71 ? 247  HIS B NE2 1 
ATOM   4744  N N   . ARG B 1 248 ? 19.900  90.442  90.385  1.00   28.42 ? 248  ARG B N   1 
ATOM   4745  C CA  . ARG B 1 248 ? 19.926  91.608  89.515  1.00   31.62 ? 248  ARG B CA  1 
ATOM   4746  C C   . ARG B 1 248 ? 21.280  92.319  89.434  1.00   31.22 ? 248  ARG B C   1 
ATOM   4747  O O   . ARG B 1 248 ? 21.541  93.016  88.456  1.00   32.09 ? 248  ARG B O   1 
ATOM   4748  C CB  . ARG B 1 248 ? 18.853  92.595  89.943  1.00   34.06 ? 248  ARG B CB  1 
ATOM   4749  C CG  . ARG B 1 248 ? 19.017  93.110  91.337  1.00   35.19 ? 248  ARG B CG  1 
ATOM   4750  C CD  . ARG B 1 248 ? 17.833  93.992  91.724  1.00   40.39 ? 248  ARG B CD  1 
ATOM   4751  N NE  . ARG B 1 248 ? 16.628  93.215  92.017  1.00   41.39 ? 248  ARG B NE  1 
ATOM   4752  C CZ  . ARG B 1 248 ? 15.582  93.703  92.686  1.00   45.10 ? 248  ARG B CZ  1 
ATOM   4753  N NH1 . ARG B 1 248 ? 14.515  92.948  92.924  1.00   42.18 ? 248  ARG B NH1 1 
ATOM   4754  N NH2 . ARG B 1 248 ? 15.605  94.959  93.124  1.00   43.91 ? 248  ARG B NH2 1 
ATOM   4755  N N   . GLU B 1 249 ? 22.136  92.156  90.446  1.00   31.56 ? 249  GLU B N   1 
ATOM   4756  C CA  . GLU B 1 249 ? 23.466  92.798  90.418  1.00   30.64 ? 249  GLU B CA  1 
ATOM   4757  C C   . GLU B 1 249 ? 24.237  92.267  89.215  1.00   31.61 ? 249  GLU B C   1 
ATOM   4758  O O   . GLU B 1 249 ? 25.013  92.987  88.574  1.00   30.70 ? 249  GLU B O   1 
ATOM   4759  C CB  . GLU B 1 249 ? 24.269  92.495  91.686  1.00   31.50 ? 249  GLU B CB  1 
ATOM   4760  C CG  . GLU B 1 249 ? 23.536  92.809  92.972  0.0000 38.70 ? 249  GLU B CG  1 
ATOM   4761  C CD  . GLU B 1 249 ? 22.632  91.679  93.411  1.00   44.62 ? 249  GLU B CD  1 
ATOM   4762  O OE1 . GLU B 1 249 ? 21.666  91.969  94.155  1.00   47.43 ? 249  GLU B OE1 1 
ATOM   4763  O OE2 . GLU B 1 249 ? 22.898  90.515  93.023  1.00   44.89 ? 249  GLU B OE2 1 
ATOM   4764  N N   . ILE B 1 250 ? 24.018  90.993  88.913  1.00   30.86 ? 250  ILE B N   1 
ATOM   4765  C CA  . ILE B 1 250 ? 24.676  90.363  87.790  1.00   32.46 ? 250  ILE B CA  1 
ATOM   4766  C C   . ILE B 1 250 ? 24.289  91.080  86.496  1.00   32.01 ? 250  ILE B C   1 
ATOM   4767  O O   . ILE B 1 250 ? 25.149  91.548  85.756  1.00   30.50 ? 250  ILE B O   1 
ATOM   4768  C CB  . ILE B 1 250 ? 24.267  88.882  87.699  1.00   35.34 ? 250  ILE B CB  1 
ATOM   4769  C CG1 . ILE B 1 250 ? 24.592  88.188  89.031  1.00   39.67 ? 250  ILE B CG1 1 
ATOM   4770  C CG2 . ILE B 1 250 ? 24.985  88.205  86.551  1.00   30.86 ? 250  ILE B CG2 1 
ATOM   4771  C CD1 . ILE B 1 250 ? 26.094  88.107  89.346  1.00   45.60 ? 250  ILE B CD1 1 
ATOM   4772  N N   . PHE B 1 251 ? 22.985  91.201  86.262  1.00   31.90 ? 251  PHE B N   1 
ATOM   4773  C CA  . PHE B 1 251 ? 22.479  91.841  85.059  1.00   32.81 ? 251  PHE B CA  1 
ATOM   4774  C C   . PHE B 1 251 ? 22.671  93.357  85.030  1.00   34.07 ? 251  PHE B C   1 
ATOM   4775  O O   . PHE B 1 251 ? 22.605  93.984  83.976  1.00   34.87 ? 251  PHE B O   1 
ATOM   4776  C CB  . PHE B 1 251 ? 20.998  91.489  84.863  1.00   30.84 ? 251  PHE B CB  1 
ATOM   4777  C CG  . PHE B 1 251 ? 20.727  90.006  84.833  1.00   28.25 ? 251  PHE B CG  1 
ATOM   4778  C CD1 . PHE B 1 251 ? 20.484  89.310  86.005  1.00   25.95 ? 251  PHE B CD1 1 
ATOM   4779  C CD2 . PHE B 1 251 ? 20.785  89.297  83.641  1.00   30.66 ? 251  PHE B CD2 1 
ATOM   4780  C CE1 . PHE B 1 251 ? 20.314  87.946  85.996  1.00   26.14 ? 251  PHE B CE1 1 
ATOM   4781  C CE2 . PHE B 1 251 ? 20.614  87.917  83.625  1.00   25.77 ? 251  PHE B CE2 1 
ATOM   4782  C CZ  . PHE B 1 251 ? 20.381  87.246  84.810  1.00   25.71 ? 251  PHE B CZ  1 
ATOM   4783  N N   . GLU B 1 252 ? 22.886  93.954  86.191  1.00   37.20 ? 252  GLU B N   1 
ATOM   4784  C CA  . GLU B 1 252 ? 23.125  95.386  86.255  1.00   34.56 ? 252  GLU B CA  1 
ATOM   4785  C C   . GLU B 1 252 ? 24.520  95.587  85.680  1.00   33.76 ? 252  GLU B C   1 
ATOM   4786  O O   . GLU B 1 252 ? 24.792  96.580  85.019  1.00   34.43 ? 252  GLU B O   1 
ATOM   4787  C CB  . GLU B 1 252 ? 23.077  95.857  87.702  1.00   38.67 ? 252  GLU B CB  1 
ATOM   4788  C CG  . GLU B 1 252 ? 23.420  97.336  87.901  1.00   43.34 ? 252  GLU B CG  1 
ATOM   4789  C CD  . GLU B 1 252 ? 23.074  97.845  89.299  1.00   46.65 ? 252  GLU B CD  1 
ATOM   4790  O OE1 . GLU B 1 252 ? 23.506  98.966  89.656  1.00   46.92 ? 252  GLU B OE1 1 
ATOM   4791  O OE2 . GLU B 1 252 ? 22.353  97.125  90.036  1.00   48.77 ? 252  GLU B OE2 1 
ATOM   4792  N N   . GLU B 1 253 ? 25.405  94.630  85.930  1.00   31.04 ? 253  GLU B N   1 
ATOM   4793  C CA  . GLU B 1 253 ? 26.758  94.714  85.409  1.00   33.51 ? 253  GLU B CA  1 
ATOM   4794  C C   . GLU B 1 253 ? 26.720  94.557  83.885  1.00   30.83 ? 253  GLU B C   1 
ATOM   4795  O O   . GLU B 1 253 ? 27.345  95.330  83.166  1.00   32.06 ? 253  GLU B O   1 
ATOM   4796  C CB  . GLU B 1 253 ? 27.645  93.633  86.031  1.00   36.50 ? 253  GLU B CB  1 
ATOM   4797  C CG  . GLU B 1 253 ? 29.136  93.969  86.044  1.00   44.97 ? 253  GLU B CG  1 
ATOM   4798  C CD  . GLU B 1 253 ? 29.513  94.990  87.126  1.00   53.60 ? 253  GLU B CD  1 
ATOM   4799  O OE1 . GLU B 1 253 ? 28.943  96.106  87.121  1.00   54.51 ? 253  GLU B OE1 1 
ATOM   4800  O OE2 . GLU B 1 253 ? 30.383  94.680  87.979  1.00   52.54 ? 253  GLU B OE2 1 
ATOM   4801  N N   . ARG B 1 254 ? 25.986  93.564  83.392  1.00   28.76 ? 254  ARG B N   1 
ATOM   4802  C CA  . ARG B 1 254 ? 25.868  93.353  81.948  1.00   26.95 ? 254  ARG B CA  1 
ATOM   4803  C C   . ARG B 1 254 ? 25.227  94.559  81.255  1.00   24.38 ? 254  ARG B C   1 
ATOM   4804  O O   . ARG B 1 254 ? 25.675  94.998  80.205  1.00   24.54 ? 254  ARG B O   1 
ATOM   4805  C CB  . ARG B 1 254 ? 25.034  92.112  81.669  1.00   27.92 ? 254  ARG B CB  1 
ATOM   4806  C CG  . ARG B 1 254 ? 25.701  90.819  82.088  1.00   28.38 ? 254  ARG B CG  1 
ATOM   4807  C CD  . ARG B 1 254 ? 24.738  89.640  81.996  1.00   27.18 ? 254  ARG B CD  1 
ATOM   4808  N NE  . ARG B 1 254 ? 25.458  88.367  82.004  1.00   32.41 ? 254  ARG B NE  1 
ATOM   4809  C CZ  . ARG B 1 254 ? 24.996  87.227  81.492  1.00   27.25 ? 254  ARG B CZ  1 
ATOM   4810  N NH1 . ARG B 1 254 ? 23.800  87.174  80.934  1.00   28.52 ? 254  ARG B NH1 1 
ATOM   4811  N NH2 . ARG B 1 254 ? 25.763  86.148  81.497  1.00   21.11 ? 254  ARG B NH2 1 
ATOM   4812  N N   . THR B 1 255 ? 24.187  95.110  81.849  1.00   21.36 ? 255  THR B N   1 
ATOM   4813  C CA  . THR B 1 255 ? 23.523  96.254  81.250  1.00   23.90 ? 255  THR B CA  1 
ATOM   4814  C C   . THR B 1 255 ? 24.480  97.438  81.179  1.00   26.96 ? 255  THR B C   1 
ATOM   4815  O O   . THR B 1 255 ? 24.465  98.212  80.223  1.00   27.75 ? 255  THR B O   1 
ATOM   4816  C CB  . THR B 1 255 ? 22.280  96.652  82.064  1.00   20.80 ? 255  THR B CB  1 
ATOM   4817  O OG1 . THR B 1 255 ? 21.299  95.618  81.942  1.00   23.65 ? 255  THR B OG1 1 
ATOM   4818  C CG2 . THR B 1 255 ? 21.707  97.974  81.566  1.00   20.68 ? 255  THR B CG2 1 
ATOM   4819  N N   . LYS B 1 256 ? 25.299  97.587  82.209  1.00   27.86 ? 256  LYS B N   1 
ATOM   4820  C CA  . LYS B 1 256 ? 26.259  98.671  82.241  1.00   30.13 ? 256  LYS B CA  1 
ATOM   4821  C C   . LYS B 1 256 ? 27.242  98.497  81.075  1.00   28.39 ? 256  LYS B C   1 
ATOM   4822  O O   . LYS B 1 256 ? 27.579  99.465  80.390  1.00   24.08 ? 256  LYS B O   1 
ATOM   4823  C CB  . LYS B 1 256 ? 26.996  98.672  83.587  1.00   33.42 ? 256  LYS B CB  1 
ATOM   4824  C CG  . LYS B 1 256 ? 28.203  99.596  83.647  1.00   42.51 ? 256  LYS B CG  1 
ATOM   4825  C CD  . LYS B 1 256 ? 28.441  100.124 85.052  1.00   48.76 ? 256  LYS B CD  1 
ATOM   4826  C CE  . LYS B 1 256 ? 29.870  100.639 85.221  1.00   50.60 ? 256  LYS B CE  1 
ATOM   4827  N NZ  . LYS B 1 256 ? 30.878  99.526  85.165  1.00   49.48 ? 256  LYS B NZ  1 
ATOM   4828  N N   . PHE B 1 257 ? 27.692  97.260  80.858  1.00   27.82 ? 257  PHE B N   1 
ATOM   4829  C CA  . PHE B 1 257 ? 28.604  96.964  79.758  1.00   28.20 ? 257  PHE B CA  1 
ATOM   4830  C C   . PHE B 1 257 ? 27.940  97.266  78.423  1.00   28.12 ? 257  PHE B C   1 
ATOM   4831  O O   . PHE B 1 257 ? 28.585  97.788  77.528  1.00   31.11 ? 257  PHE B O   1 
ATOM   4832  C CB  . PHE B 1 257 ? 29.028  95.504  79.784  1.00   31.82 ? 257  PHE B CB  1 
ATOM   4833  C CG  . PHE B 1 257 ? 29.725  95.048  78.533  1.00   33.44 ? 257  PHE B CG  1 
ATOM   4834  C CD1 . PHE B 1 257 ? 28.994  94.573  77.445  1.00   30.78 ? 257  PHE B CD1 1 
ATOM   4835  C CD2 . PHE B 1 257 ? 31.112  95.103  78.434  1.00   33.19 ? 257  PHE B CD2 1 
ATOM   4836  C CE1 . PHE B 1 257 ? 29.635  94.164  76.282  1.00   30.27 ? 257  PHE B CE1 1 
ATOM   4837  C CE2 . PHE B 1 257 ? 31.763  94.692  77.265  1.00   29.90 ? 257  PHE B CE2 1 
ATOM   4838  C CZ  . PHE B 1 257 ? 31.023  94.224  76.195  1.00   30.78 ? 257  PHE B CZ  1 
ATOM   4839  N N   . ILE B 1 258 ? 26.655  96.929  78.301  1.00   26.91 ? 258  ILE B N   1 
ATOM   4840  C CA  . ILE B 1 258 ? 25.916  97.165  77.070  1.00   25.24 ? 258  ILE B CA  1 
ATOM   4841  C C   . ILE B 1 258 ? 25.843  98.653  76.774  1.00   26.50 ? 258  ILE B C   1 
ATOM   4842  O O   . ILE B 1 258 ? 26.150  99.080  75.646  1.00   22.88 ? 258  ILE B O   1 
ATOM   4843  C CB  . ILE B 1 258 ? 24.477  96.639  77.144  1.00   26.86 ? 258  ILE B CB  1 
ATOM   4844  C CG1 . ILE B 1 258 ? 24.458  95.127  77.457  1.00   29.95 ? 258  ILE B CG1 1 
ATOM   4845  C CG2 . ILE B 1 258 ? 23.747  96.980  75.861  1.00   21.56 ? 258  ILE B CG2 1 
ATOM   4846  C CD1 . ILE B 1 258 ? 25.317  94.276  76.586  1.00   31.19 ? 258  ILE B CD1 1 
ATOM   4847  N N   . VAL B 1 259 ? 25.431  99.438  77.774  1.00   24.39 ? 259  VAL B N   1 
ATOM   4848  C CA  . VAL B 1 259 ? 25.341  100.887 77.610  1.00   26.05 ? 259  VAL B CA  1 
ATOM   4849  C C   . VAL B 1 259 ? 26.705  101.498 77.307  1.00   28.61 ? 259  VAL B C   1 
ATOM   4850  O O   . VAL B 1 259 ? 26.834  102.367 76.446  1.00   32.92 ? 259  VAL B O   1 
ATOM   4851  C CB  . VAL B 1 259 ? 24.779  101.591 78.866  1.00   25.82 ? 259  VAL B CB  1 
ATOM   4852  C CG1 . VAL B 1 259 ? 25.091  103.101 78.796  1.00   22.68 ? 259  VAL B CG1 1 
ATOM   4853  C CG2 . VAL B 1 259 ? 23.251  101.388 78.961  1.00   15.81 ? 259  VAL B CG2 1 
ATOM   4854  N N   . GLU B 1 260 ? 27.727  101.032 78.007  1.00   32.14 ? 260  GLU B N   1 
ATOM   4855  C CA  . GLU B 1 260 ? 29.071  101.545 77.811  1.00   32.20 ? 260  GLU B CA  1 
ATOM   4856  C C   . GLU B 1 260 ? 29.578  101.131 76.457  1.00   32.45 ? 260  GLU B C   1 
ATOM   4857  O O   . GLU B 1 260 ? 30.492  101.741 75.911  1.00   34.12 ? 260  GLU B O   1 
ATOM   4858  C CB  . GLU B 1 260 ? 29.996  101.003 78.887  1.00   36.11 ? 260  GLU B CB  1 
ATOM   4859  C CG  . GLU B 1 260 ? 29.771  101.640 80.248  1.00   46.64 ? 260  GLU B CG  1 
ATOM   4860  C CD  . GLU B 1 260 ? 30.463  100.879 81.370  1.00   53.67 ? 260  GLU B CD  1 
ATOM   4861  O OE1 . GLU B 1 260 ? 30.841  101.507 82.394  1.00   57.00 ? 260  GLU B OE1 1 
ATOM   4862  O OE2 . GLU B 1 260 ? 30.615  99.646  81.228  1.00   56.55 ? 260  GLU B OE2 1 
ATOM   4863  N N   . GLU B 1 261 ? 28.992  100.070 75.922  1.00   30.05 ? 261  GLU B N   1 
ATOM   4864  C CA  . GLU B 1 261 ? 29.389  99.600  74.615  1.00   26.86 ? 261  GLU B CA  1 
ATOM   4865  C C   . GLU B 1 261 ? 28.604  100.395 73.544  1.00   24.97 ? 261  GLU B C   1 
ATOM   4866  O O   . GLU B 1 261 ? 29.105  100.669 72.455  1.00   23.99 ? 261  GLU B O   1 
ATOM   4867  C CB  . GLU B 1 261 ? 29.083  98.114  74.516  1.00   30.10 ? 261  GLU B CB  1 
ATOM   4868  C CG  . GLU B 1 261 ? 29.980  97.390  73.561  1.00   33.62 ? 261  GLU B CG  1 
ATOM   4869  C CD  . GLU B 1 261 ? 31.396  97.341  74.065  1.00   33.86 ? 261  GLU B CD  1 
ATOM   4870  O OE1 . GLU B 1 261 ? 31.602  96.788  75.158  1.00   38.13 ? 261  GLU B OE1 1 
ATOM   4871  O OE2 . GLU B 1 261 ? 32.303  97.853  73.383  1.00   37.19 ? 261  GLU B OE2 1 
ATOM   4872  N N   . ARG B 1 262 ? 27.369  100.755 73.868  1.00   23.26 ? 262  ARG B N   1 
ATOM   4873  C CA  . ARG B 1 262 ? 26.503  101.525 72.977  1.00   22.74 ? 262  ARG B CA  1 
ATOM   4874  C C   . ARG B 1 262 ? 27.138  102.894 72.692  1.00   25.63 ? 262  ARG B C   1 
ATOM   4875  O O   . ARG B 1 262 ? 27.331  103.286 71.543  1.00   29.13 ? 262  ARG B O   1 
ATOM   4876  C CB  . ARG B 1 262 ? 25.129  101.729 73.640  1.00   16.48 ? 262  ARG B CB  1 
ATOM   4877  C CG  . ARG B 1 262 ? 24.093  102.461 72.777  1.00   21.71 ? 262  ARG B CG  1 
ATOM   4878  C CD  . ARG B 1 262 ? 22.906  102.880 73.615  1.00   19.87 ? 262  ARG B CD  1 
ATOM   4879  N NE  . ARG B 1 262 ? 23.297  103.789 74.692  1.00   18.45 ? 262  ARG B NE  1 
ATOM   4880  C CZ  . ARG B 1 262 ? 22.625  103.937 75.831  1.00   21.19 ? 262  ARG B CZ  1 
ATOM   4881  N NH1 . ARG B 1 262 ? 21.524  103.224 76.063  1.00   20.90 ? 262  ARG B NH1 1 
ATOM   4882  N NH2 . ARG B 1 262 ? 23.036  104.822 76.732  1.00   20.29 ? 262  ARG B NH2 1 
ATOM   4883  N N   . GLU B 1 263 ? 27.451  103.616 73.759  1.00   27.10 ? 263  GLU B N   1 
ATOM   4884  C CA  . GLU B 1 263 ? 28.052  104.934 73.646  1.00   27.82 ? 263  GLU B CA  1 
ATOM   4885  C C   . GLU B 1 263 ? 29.395  104.896 72.937  1.00   27.64 ? 263  GLU B C   1 
ATOM   4886  O O   . GLU B 1 263 ? 29.723  105.794 72.180  1.00   31.30 ? 263  GLU B O   1 
ATOM   4887  C CB  . GLU B 1 263 ? 28.180  105.548 75.031  1.00   26.51 ? 263  GLU B CB  1 
ATOM   4888  C CG  . GLU B 1 263 ? 26.836  105.797 75.649  1.00   28.59 ? 263  GLU B CG  1 
ATOM   4889  C CD  . GLU B 1 263 ? 25.973  106.627 74.735  1.00   28.79 ? 263  GLU B CD  1 
ATOM   4890  O OE1 . GLU B 1 263 ? 26.529  107.570 74.133  1.00   28.77 ? 263  GLU B OE1 1 
ATOM   4891  O OE2 . GLU B 1 263 ? 24.756  106.352 74.623  1.00   24.32 ? 263  GLU B OE2 1 
ATOM   4892  N N   . ARG B 1 264 ? 30.165  103.851 73.175  1.00   28.73 ? 264  ARG B N   1 
ATOM   4893  C CA  . ARG B 1 264 ? 31.453  103.706 72.519  1.00   28.14 ? 264  ARG B CA  1 
ATOM   4894  C C   . ARG B 1 264 ? 31.202  103.661 71.012  1.00   29.27 ? 264  ARG B C   1 
ATOM   4895  O O   . ARG B 1 264 ? 31.807  104.421 70.262  1.00   28.34 ? 264  ARG B O   1 
ATOM   4896  C CB  . ARG B 1 264 ? 32.108  102.419 72.999  1.00   29.68 ? 264  ARG B CB  1 
ATOM   4897  C CG  . ARG B 1 264 ? 33.401  102.028 72.320  1.00   35.01 ? 264  ARG B CG  1 
ATOM   4898  C CD  . ARG B 1 264 ? 33.933  100.724 72.942  1.00   38.57 ? 264  ARG B CD  1 
ATOM   4899  N NE  . ARG B 1 264 ? 35.179  100.303 72.322  1.00   42.89 ? 264  ARG B NE  1 
ATOM   4900  C CZ  . ARG B 1 264 ? 35.260  99.712  71.138  1.00   43.33 ? 264  ARG B CZ  1 
ATOM   4901  N NH1 . ARG B 1 264 ? 34.162  99.461  70.447  1.00   46.55 ? 264  ARG B NH1 1 
ATOM   4902  N NH2 . ARG B 1 264 ? 36.446  99.395  70.641  1.00   42.65 ? 264  ARG B NH2 1 
ATOM   4903  N N   . MET B 1 265 ? 30.297  102.785 70.575  1.00   27.26 ? 265  MET B N   1 
ATOM   4904  C CA  . MET B 1 265 ? 29.956  102.653 69.149  1.00   27.64 ? 265  MET B CA  1 
ATOM   4905  C C   . MET B 1 265 ? 29.313  103.910 68.569  1.00   24.89 ? 265  MET B C   1 
ATOM   4906  O O   . MET B 1 265 ? 29.538  104.249 67.410  1.00   21.89 ? 265  MET B O   1 
ATOM   4907  C CB  . MET B 1 265 ? 29.017  101.455 68.896  1.00   27.79 ? 265  MET B CB  1 
ATOM   4908  C CG  . MET B 1 265 ? 29.760  100.117 68.871  1.00   33.22 ? 265  MET B CG  1 
ATOM   4909  S SD  . MET B 1 265 ? 28.801  98.710  68.261  1.00   38.91 ? 265  MET B SD  1 
ATOM   4910  C CE  . MET B 1 265 ? 27.899  99.476  66.872  1.00   34.23 ? 265  MET B CE  1 
ATOM   4911  N N   . LYS B 1 266 ? 28.501  104.584 69.366  1.00   23.28 ? 266  LYS B N   1 
ATOM   4912  C CA  . LYS B 1 266 ? 27.879  105.799 68.900  1.00   27.51 ? 266  LYS B CA  1 
ATOM   4913  C C   . LYS B 1 266 ? 28.972  106.844 68.632  1.00   29.93 ? 266  LYS B C   1 
ATOM   4914  O O   . LYS B 1 266 ? 28.915  107.549 67.623  1.00   31.57 ? 266  LYS B O   1 
ATOM   4915  C CB  . LYS B 1 266 ? 26.864  106.302 69.933  1.00   27.74 ? 266  LYS B CB  1 
ATOM   4916  C CG  . LYS B 1 266 ? 25.518  105.564 69.839  1.00   28.80 ? 266  LYS B CG  1 
ATOM   4917  C CD  . LYS B 1 266 ? 24.621  105.755 71.060  1.00   30.43 ? 266  LYS B CD  1 
ATOM   4918  C CE  . LYS B 1 266 ? 24.214  107.210 71.263  1.00   28.93 ? 266  LYS B CE  1 
ATOM   4919  N NZ  . LYS B 1 266 ? 23.361  107.369 72.472  1.00   23.16 ? 266  LYS B NZ  1 
ATOM   4920  N N   . SER B 1 267 ? 29.973  106.927 69.514  1.00   28.89 ? 267  SER B N   1 
ATOM   4921  C CA  . SER B 1 267 ? 31.065  107.877 69.331  1.00   28.10 ? 267  SER B CA  1 
ATOM   4922  C C   . SER B 1 267 ? 31.841  107.582 68.046  1.00   28.79 ? 267  SER B C   1 
ATOM   4923  O O   . SER B 1 267 ? 32.060  108.466 67.218  1.00   28.59 ? 267  SER B O   1 
ATOM   4924  C CB  . SER B 1 267 ? 32.032  107.807 70.505  1.00   29.54 ? 267  SER B CB  1 
ATOM   4925  O OG  . SER B 1 267 ? 31.475  108.388 71.667  1.00   26.89 ? 267  SER B OG  1 
ATOM   4926  N N   . ALA B 1 268 ? 32.253  106.330 67.891  1.00   27.28 ? 268  ALA B N   1 
ATOM   4927  C CA  . ALA B 1 268 ? 33.018  105.892 66.728  1.00   28.63 ? 268  ALA B CA  1 
ATOM   4928  C C   . ALA B 1 268 ? 32.308  106.174 65.391  1.00   31.83 ? 268  ALA B C   1 
ATOM   4929  O O   . ALA B 1 268 ? 32.950  106.523 64.387  1.00   30.45 ? 268  ALA B O   1 
ATOM   4930  C CB  . ALA B 1 268 ? 33.311  104.398 66.854  1.00   26.52 ? 268  ALA B CB  1 
ATOM   4931  N N   . LEU B 1 269 ? 30.985  105.997 65.383  1.00   32.56 ? 269  LEU B N   1 
ATOM   4932  C CA  . LEU B 1 269 ? 30.190  106.214 64.185  1.00   31.99 ? 269  LEU B CA  1 
ATOM   4933  C C   . LEU B 1 269 ? 30.192  107.695 63.839  1.00   33.06 ? 269  LEU B C   1 
ATOM   4934  O O   . LEU B 1 269 ? 30.306  108.067 62.670  1.00   32.53 ? 269  LEU B O   1 
ATOM   4935  C CB  . LEU B 1 269 ? 28.748  105.702 64.382  1.00   31.77 ? 269  LEU B CB  1 
ATOM   4936  C CG  . LEU B 1 269 ? 28.588  104.176 64.462  1.00   31.39 ? 269  LEU B CG  1 
ATOM   4937  C CD1 . LEU B 1 269 ? 27.140  103.773 64.718  1.00   31.50 ? 269  LEU B CD1 1 
ATOM   4938  C CD2 . LEU B 1 269 ? 29.070  103.593 63.158  1.00   33.22 ? 269  LEU B CD2 1 
ATOM   4939  N N   . ARG B 1 270 ? 30.062  108.550 64.848  1.00   32.23 ? 270  ARG B N   1 
ATOM   4940  C CA  . ARG B 1 270 ? 30.098  109.980 64.569  1.00   31.13 ? 270  ARG B CA  1 
ATOM   4941  C C   . ARG B 1 270 ? 31.473  110.301 63.960  1.00   28.78 ? 270  ARG B C   1 
ATOM   4942  O O   . ARG B 1 270 ? 31.574  110.906 62.902  1.00   27.59 ? 270  ARG B O   1 
ATOM   4943  C CB  . ARG B 1 270 ? 29.856  110.780 65.853  1.00   34.12 ? 270  ARG B CB  1 
ATOM   4944  C CG  . ARG B 1 270 ? 28.433  110.672 66.401  1.00   30.29 ? 270  ARG B CG  1 
ATOM   4945  C CD  . ARG B 1 270 ? 28.391  110.844 67.922  1.00   29.91 ? 270  ARG B CD  1 
ATOM   4946  N NE  . ARG B 1 270 ? 27.016  110.761 68.425  1.00   35.94 ? 270  ARG B NE  1 
ATOM   4947  C CZ  . ARG B 1 270 ? 26.670  110.566 69.703  1.00   38.35 ? 270  ARG B CZ  1 
ATOM   4948  N NH1 . ARG B 1 270 ? 27.590  110.416 70.657  1.00   30.28 ? 270  ARG B NH1 1 
ATOM   4949  N NH2 . ARG B 1 270 ? 25.386  110.544 70.039  1.00   42.19 ? 270  ARG B NH2 1 
ATOM   4950  N N   . GLU B 1 271 ? 32.530  109.848 64.610  1.00   28.44 ? 271  GLU B N   1 
ATOM   4951  C CA  . GLU B 1 271 ? 33.873  110.105 64.123  1.00   29.42 ? 271  GLU B CA  1 
ATOM   4952  C C   . GLU B 1 271 ? 34.039  109.716 62.671  1.00   28.86 ? 271  GLU B C   1 
ATOM   4953  O O   . GLU B 1 271 ? 34.731  110.397 61.931  1.00   30.63 ? 271  GLU B O   1 
ATOM   4954  C CB  . GLU B 1 271 ? 34.887  109.378 64.999  1.00   27.86 ? 271  GLU B CB  1 
ATOM   4955  C CG  . GLU B 1 271 ? 34.964  109.995 66.372  1.00   33.83 ? 271  GLU B CG  1 
ATOM   4956  C CD  . GLU B 1 271 ? 35.557  109.065 67.400  1.00   36.13 ? 271  GLU B CD  1 
ATOM   4957  O OE1 . GLU B 1 271 ? 35.155  109.172 68.576  1.00   36.03 ? 271  GLU B OE1 1 
ATOM   4958  O OE2 . GLU B 1 271 ? 36.422  108.239 67.038  1.00   39.32 ? 271  GLU B OE2 1 
ATOM   4959  N N   . MET B 1 272 ? 33.393  108.625 62.276  1.00   29.55 ? 272  MET B N   1 
ATOM   4960  C CA  . MET B 1 272 ? 33.439  108.135 60.906  1.00   28.93 ? 272  MET B CA  1 
ATOM   4961  C C   . MET B 1 272 ? 32.587  109.003 59.980  1.00   28.14 ? 272  MET B C   1 
ATOM   4962  O O   . MET B 1 272 ? 32.709  108.936 58.760  1.00   27.33 ? 272  MET B O   1 
ATOM   4963  C CB  . MET B 1 272 ? 32.948  106.683 60.855  1.00   31.43 ? 272  MET B CB  1 
ATOM   4964  C CG  . MET B 1 272 ? 34.042  105.616 60.960  1.00   33.02 ? 272  MET B CG  1 
ATOM   4965  S SD  . MET B 1 272 ? 33.385  103.924 61.148  1.00   39.19 ? 272  MET B SD  1 
ATOM   4966  C CE  . MET B 1 272 ? 33.845  103.578 62.870  1.00   38.80 ? 272  MET B CE  1 
ATOM   4967  N N   . GLY B 1 273 ? 31.712  109.806 60.560  1.00   28.11 ? 273  GLY B N   1 
ATOM   4968  C CA  . GLY B 1 273 ? 30.891  110.683 59.742  1.00   32.51 ? 273  GLY B CA  1 
ATOM   4969  C C   . GLY B 1 273 ? 29.455  110.259 59.505  1.00   33.07 ? 273  GLY B C   1 
ATOM   4970  O O   . GLY B 1 273 ? 28.703  110.966 58.821  1.00   33.96 ? 273  GLY B O   1 
ATOM   4971  N N   . TYR B 1 274 ? 29.062  109.118 60.064  1.00   33.27 ? 274  TYR B N   1 
ATOM   4972  C CA  . TYR B 1 274 ? 27.703  108.622 59.898  1.00   32.83 ? 274  TYR B CA  1 
ATOM   4973  C C   . TYR B 1 274 ? 26.734  109.405 60.752  1.00   32.13 ? 274  TYR B C   1 
ATOM   4974  O O   . TYR B 1 274 ? 27.078  109.838 61.859  1.00   33.39 ? 274  TYR B O   1 
ATOM   4975  C CB  . TYR B 1 274 ? 27.586  107.155 60.319  1.00   33.30 ? 274  TYR B CB  1 
ATOM   4976  C CG  . TYR B 1 274 ? 28.321  106.159 59.463  1.00   32.53 ? 274  TYR B CG  1 
ATOM   4977  C CD1 . TYR B 1 274 ? 29.655  105.852 59.713  1.00   32.70 ? 274  TYR B CD1 1 
ATOM   4978  C CD2 . TYR B 1 274 ? 27.677  105.506 58.410  1.00   30.83 ? 274  TYR B CD2 1 
ATOM   4979  C CE1 . TYR B 1 274 ? 30.327  104.917 58.939  1.00   29.42 ? 274  TYR B CE1 1 
ATOM   4980  C CE2 . TYR B 1 274 ? 28.339  104.575 57.636  1.00   25.36 ? 274  TYR B CE2 1 
ATOM   4981  C CZ  . TYR B 1 274 ? 29.661  104.285 57.901  1.00   27.72 ? 274  TYR B CZ  1 
ATOM   4982  O OH  . TYR B 1 274 ? 30.334  103.372 57.116  1.00   23.92 ? 274  TYR B OH  1 
ATOM   4983  N N   . ARG B 1 275 ? 25.522  109.568 60.235  1.00   33.00 ? 275  ARG B N   1 
ATOM   4984  C CA  . ARG B 1 275 ? 24.433  110.255 60.943  1.00   33.34 ? 275  ARG B CA  1 
ATOM   4985  C C   . ARG B 1 275 ? 23.797  109.170 61.821  1.00   31.48 ? 275  ARG B C   1 
ATOM   4986  O O   . ARG B 1 275 ? 23.451  108.098 61.325  1.00   33.99 ? 275  ARG B O   1 
ATOM   4987  C CB  . ARG B 1 275 ? 23.379  110.770 59.948  1.00   35.55 ? 275  ARG B CB  1 
ATOM   4988  C CG  . ARG B 1 275 ? 23.914  111.735 58.896  1.00   42.88 ? 275  ARG B CG  1 
ATOM   4989  C CD  . ARG B 1 275 ? 22.842  112.144 57.881  1.00   48.86 ? 275  ARG B CD  1 
ATOM   4990  N NE  . ARG B 1 275 ? 22.644  111.147 56.827  1.00   51.16 ? 275  ARG B NE  1 
ATOM   4991  C CZ  . ARG B 1 275 ? 21.452  110.756 56.382  1.00   52.86 ? 275  ARG B CZ  1 
ATOM   4992  N NH1 . ARG B 1 275 ? 21.369  109.847 55.416  1.00   50.08 ? 275  ARG B NH1 1 
ATOM   4993  N NH2 . ARG B 1 275 ? 20.340  111.264 56.910  1.00   51.24 ? 275  ARG B NH2 1 
ATOM   4994  N N   . ILE B 1 276 ? 23.653  109.429 63.112  1.00   29.16 ? 276  ILE B N   1 
ATOM   4995  C CA  . ILE B 1 276 ? 23.079  108.433 64.006  1.00   30.49 ? 276  ILE B CA  1 
ATOM   4996  C C   . ILE B 1 276 ? 22.098  109.016 64.999  1.00   30.62 ? 276  ILE B C   1 
ATOM   4997  O O   . ILE B 1 276 ? 22.052  110.223 65.220  1.00   30.13 ? 276  ILE B O   1 
ATOM   4998  C CB  . ILE B 1 276 ? 24.165  107.715 64.808  1.00   31.29 ? 276  ILE B CB  1 
ATOM   4999  C CG1 . ILE B 1 276 ? 24.871  108.720 65.717  1.00   29.71 ? 276  ILE B CG1 1 
ATOM   5000  C CG2 . ILE B 1 276 ? 25.155  107.061 63.855  1.00   29.35 ? 276  ILE B CG2 1 
ATOM   5001  C CD1 . ILE B 1 276 ? 25.637  108.104 66.867  1.00   30.18 ? 276  ILE B CD1 1 
ATOM   5002  N N   . THR B 1 277 ? 21.309  108.150 65.609  1.00   29.61 ? 277  THR B N   1 
ATOM   5003  C CA  . THR B 1 277 ? 20.341  108.628 66.577  1.00   28.14 ? 277  THR B CA  1 
ATOM   5004  C C   . THR B 1 277 ? 20.920  108.593 67.979  1.00   27.87 ? 277  THR B C   1 
ATOM   5005  O O   . THR B 1 277 ? 21.948  107.961 68.230  1.00   24.87 ? 277  THR B O   1 
ATOM   5006  C CB  . THR B 1 277 ? 19.084  107.778 66.587  1.00   30.10 ? 277  THR B CB  1 
ATOM   5007  O OG1 . THR B 1 277 ? 19.396  106.493 67.141  1.00   36.57 ? 277  THR B OG1 1 
ATOM   5008  C CG2 . THR B 1 277 ? 18.546  107.623 65.170  1.00   36.32 ? 277  THR B CG2 1 
ATOM   5009  N N   . ASP B 1 278 ? 20.242  109.285 68.890  1.00   28.14 ? 278  ASP B N   1 
ATOM   5010  C CA  . ASP B 1 278 ? 20.652  109.356 70.285  1.00   26.74 ? 278  ASP B CA  1 
ATOM   5011  C C   . ASP B 1 278 ? 19.944  108.229 71.011  1.00   25.36 ? 278  ASP B C   1 
ATOM   5012  O O   . ASP B 1 278 ? 19.184  108.453 71.960  1.00   22.99 ? 278  ASP B O   1 
ATOM   5013  C CB  . ASP B 1 278 ? 20.260  110.711 70.879  1.00   26.52 ? 278  ASP B CB  1 
ATOM   5014  C CG  . ASP B 1 278 ? 20.757  110.891 72.287  1.00   32.56 ? 278  ASP B CG  1 
ATOM   5015  O OD1 . ASP B 1 278 ? 21.832  110.320 72.602  1.00   33.60 ? 278  ASP B OD1 1 
ATOM   5016  O OD2 . ASP B 1 278 ? 20.083  111.606 73.063  1.00   33.49 ? 278  ASP B OD2 1 
ATOM   5017  N N   . SER B 1 279 ? 20.211  107.018 70.537  1.00   25.72 ? 279  SER B N   1 
ATOM   5018  C CA  . SER B 1 279 ? 19.623  105.802 71.076  1.00   24.68 ? 279  SER B CA  1 
ATOM   5019  C C   . SER B 1 279 ? 19.951  105.537 72.532  1.00   24.92 ? 279  SER B C   1 
ATOM   5020  O O   . SER B 1 279 ? 21.109  105.634 72.968  1.00   21.96 ? 279  SER B O   1 
ATOM   5021  C CB  . SER B 1 279 ? 20.065  104.597 70.260  1.00   25.05 ? 279  SER B CB  1 
ATOM   5022  O OG  . SER B 1 279 ? 19.598  103.398 70.858  1.00   29.51 ? 279  SER B OG  1 
ATOM   5023  N N   . ARG B 1 280 ? 18.912  105.215 73.290  1.00   24.68 ? 280  ARG B N   1 
ATOM   5024  C CA  . ARG B 1 280 ? 19.101  104.883 74.685  1.00   25.44 ? 280  ARG B CA  1 
ATOM   5025  C C   . ARG B 1 280 ? 18.756  103.422 74.867  1.00   23.68 ? 280  ARG B C   1 
ATOM   5026  O O   . ARG B 1 280 ? 18.655  102.929 75.998  1.00   23.94 ? 280  ARG B O   1 
ATOM   5027  C CB  . ARG B 1 280 ? 18.244  105.772 75.583  1.00   25.34 ? 280  ARG B CB  1 
ATOM   5028  C CG  . ARG B 1 280 ? 18.977  107.020 76.047  1.00   33.30 ? 280  ARG B CG  1 
ATOM   5029  C CD  . ARG B 1 280 ? 19.002  108.075 74.976  1.00   35.98 ? 280  ARG B CD  1 
ATOM   5030  N NE  . ARG B 1 280 ? 20.066  109.082 75.115  1.00   44.73 ? 280  ARG B NE  1 
ATOM   5031  C CZ  . ARG B 1 280 ? 20.266  109.881 76.173  1.00   46.71 ? 280  ARG B CZ  1 
ATOM   5032  N NH1 . ARG B 1 280 ? 21.259  110.760 76.147  1.00   43.58 ? 280  ARG B NH1 1 
ATOM   5033  N NH2 . ARG B 1 280 ? 19.510  109.799 77.267  1.00   46.51 ? 280  ARG B NH2 1 
ATOM   5034  N N   . GLY B 1 281 ? 18.574  102.723 73.751  1.00   23.74 ? 281  GLY B N   1 
ATOM   5035  C CA  . GLY B 1 281 ? 18.247  101.301 73.811  1.00   22.83 ? 281  GLY B CA  1 
ATOM   5036  C C   . GLY B 1 281 ? 19.540  100.511 73.861  1.00   22.10 ? 281  GLY B C   1 
ATOM   5037  O O   . GLY B 1 281 ? 20.596  101.083 74.133  1.00   21.11 ? 281  GLY B O   1 
ATOM   5038  N N   . ASN B 1 282 ? 19.463  99.208  73.593  1.00   20.76 ? 282  ASN B N   1 
ATOM   5039  C CA  . ASN B 1 282 ? 20.637  98.342  73.590  1.00   19.26 ? 282  ASN B CA  1 
ATOM   5040  C C   . ASN B 1 282 ? 21.035  98.155  72.125  1.00   21.29 ? 282  ASN B C   1 
ATOM   5041  O O   . ASN B 1 282 ? 21.467  97.080  71.697  1.00   21.14 ? 282  ASN B O   1 
ATOM   5042  C CB  . ASN B 1 282 ? 20.278  96.997  74.171  1.00   21.04 ? 282  ASN B CB  1 
ATOM   5043  C CG  . ASN B 1 282 ? 19.221  96.315  73.350  1.00   19.26 ? 282  ASN B CG  1 
ATOM   5044  O OD1 . ASN B 1 282 ? 18.321  96.960  72.830  1.00   20.34 ? 282  ASN B OD1 1 
ATOM   5045  N ND2 . ASN B 1 282 ? 19.314  95.008  73.242  1.00   18.24 ? 282  ASN B ND2 1 
ATOM   5046  N N   . PHE B 1 283 ? 20.882  99.222  71.356  1.00   20.70 ? 283  PHE B N   1 
ATOM   5047  C CA  . PHE B 1 283 ? 21.206  99.191  69.947  1.00   19.40 ? 283  PHE B CA  1 
ATOM   5048  C C   . PHE B 1 283 ? 21.476  100.618 69.516  1.00   18.88 ? 283  PHE B C   1 
ATOM   5049  O O   . PHE B 1 283 ? 21.195  101.550 70.266  1.00   18.08 ? 283  PHE B O   1 
ATOM   5050  C CB  . PHE B 1 283 ? 19.999  98.673  69.181  1.00   16.56 ? 283  PHE B CB  1 
ATOM   5051  C CG  . PHE B 1 283 ? 18.708  99.395  69.535  1.00   20.88 ? 283  PHE B CG  1 
ATOM   5052  C CD1 . PHE B 1 283 ? 17.951  98.996  70.637  1.00   21.29 ? 283  PHE B CD1 1 
ATOM   5053  C CD2 . PHE B 1 283 ? 18.275  100.496 68.797  1.00   23.71 ? 283  PHE B CD2 1 
ATOM   5054  C CE1 . PHE B 1 283 ? 16.801  99.667  71.000  1.00   24.04 ? 283  PHE B CE1 1 
ATOM   5055  C CE2 . PHE B 1 283 ? 17.116  101.187 69.148  1.00   23.02 ? 283  PHE B CE2 1 
ATOM   5056  C CZ  . PHE B 1 283 ? 16.373  100.768 70.257  1.00   27.32 ? 283  PHE B CZ  1 
ATOM   5057  N N   . VAL B 1 284 ? 22.014  100.785 68.307  1.00   19.55 ? 284  VAL B N   1 
ATOM   5058  C CA  . VAL B 1 284 ? 22.235  102.105 67.726  1.00   20.56 ? 284  VAL B CA  1 
ATOM   5059  C C   . VAL B 1 284 ? 21.513  102.112 66.372  1.00   22.71 ? 284  VAL B C   1 
ATOM   5060  O O   . VAL B 1 284 ? 21.271  101.055 65.759  1.00   21.19 ? 284  VAL B O   1 
ATOM   5061  C CB  . VAL B 1 284 ? 23.733  102.412 67.483  1.00   21.08 ? 284  VAL B CB  1 
ATOM   5062  C CG1 . VAL B 1 284 ? 24.517  102.393 68.806  1.00   17.29 ? 284  VAL B CG1 1 
ATOM   5063  C CG2 . VAL B 1 284 ? 24.312  101.407 66.481  1.00   20.94 ? 284  VAL B CG2 1 
ATOM   5064  N N   . PHE B 1 285 ? 21.139  103.299 65.913  1.00   25.45 ? 285  PHE B N   1 
ATOM   5065  C CA  . PHE B 1 285 ? 20.484  103.417 64.618  1.00   28.57 ? 285  PHE B CA  1 
ATOM   5066  C C   . PHE B 1 285 ? 21.268  104.370 63.720  1.00   27.26 ? 285  PHE B C   1 
ATOM   5067  O O   . PHE B 1 285 ? 21.670  105.448 64.150  1.00   32.41 ? 285  PHE B O   1 
ATOM   5068  C CB  . PHE B 1 285 ? 19.037  103.903 64.765  1.00   26.26 ? 285  PHE B CB  1 
ATOM   5069  C CG  . PHE B 1 285 ? 18.225  103.757 63.503  1.00   30.92 ? 285  PHE B CG  1 
ATOM   5070  C CD1 . PHE B 1 285 ? 17.615  102.537 63.195  1.00   30.79 ? 285  PHE B CD1 1 
ATOM   5071  C CD2 . PHE B 1 285 ? 18.082  104.833 62.609  1.00   30.56 ? 285  PHE B CD2 1 
ATOM   5072  C CE1 . PHE B 1 285 ? 16.870  102.382 62.028  1.00   29.50 ? 285  PHE B CE1 1 
ATOM   5073  C CE2 . PHE B 1 285 ? 17.341  104.696 61.438  1.00   28.99 ? 285  PHE B CE2 1 
ATOM   5074  C CZ  . PHE B 1 285 ? 16.727  103.462 61.147  1.00   32.03 ? 285  PHE B CZ  1 
ATOM   5075  N N   . VAL B 1 286 ? 21.494  103.955 62.478  1.00   27.80 ? 286  VAL B N   1 
ATOM   5076  C CA  . VAL B 1 286 ? 22.220  104.780 61.504  1.00   27.71 ? 286  VAL B CA  1 
ATOM   5077  C C   . VAL B 1 286 ? 21.309  105.181 60.325  1.00   29.34 ? 286  VAL B C   1 
ATOM   5078  O O   . VAL B 1 286 ? 20.671  104.337 59.686  1.00   21.84 ? 286  VAL B O   1 
ATOM   5079  C CB  . VAL B 1 286 ? 23.453  104.037 60.930  1.00   25.23 ? 286  VAL B CB  1 
ATOM   5080  C CG1 . VAL B 1 286 ? 24.353  105.014 60.193  1.00   26.09 ? 286  VAL B CG1 1 
ATOM   5081  C CG2 . VAL B 1 286 ? 24.224  103.339 62.061  1.00   24.22 ? 286  VAL B CG2 1 
ATOM   5082  N N   . PHE B 1 287 ? 21.240  106.487 60.074  1.00   29.97 ? 287  PHE B N   1 
ATOM   5083  C CA  . PHE B 1 287 ? 20.442  107.040 58.987  1.00   32.43 ? 287  PHE B CA  1 
ATOM   5084  C C   . PHE B 1 287 ? 21.227  106.881 57.708  1.00   32.94 ? 287  PHE B C   1 
ATOM   5085  O O   . PHE B 1 287 ? 22.361  107.340 57.609  1.00   34.48 ? 287  PHE B O   1 
ATOM   5086  C CB  . PHE B 1 287 ? 20.177  108.530 59.192  1.00   32.57 ? 287  PHE B CB  1 
ATOM   5087  C CG  . PHE B 1 287 ? 19.143  108.831 60.223  1.00   34.33 ? 287  PHE B CG  1 
ATOM   5088  C CD1 . PHE B 1 287 ? 19.498  109.422 61.432  1.00   31.39 ? 287  PHE B CD1 1 
ATOM   5089  C CD2 . PHE B 1 287 ? 17.798  108.567 59.968  1.00   35.14 ? 287  PHE B CD2 1 
ATOM   5090  C CE1 . PHE B 1 287 ? 18.528  109.749 62.360  1.00   30.70 ? 287  PHE B CE1 1 
ATOM   5091  C CE2 . PHE B 1 287 ? 16.819  108.895 60.899  1.00   32.99 ? 287  PHE B CE2 1 
ATOM   5092  C CZ  . PHE B 1 287 ? 17.178  109.482 62.088  1.00   25.42 ? 287  PHE B CZ  1 
ATOM   5093  N N   . MET B 1 288 ? 20.624  106.243 56.716  1.00   33.52 ? 288  MET B N   1 
ATOM   5094  C CA  . MET B 1 288 ? 21.319  106.049 55.468  1.00   34.16 ? 288  MET B CA  1 
ATOM   5095  C C   . MET B 1 288 ? 20.412  106.231 54.268  1.00   35.78 ? 288  MET B C   1 
ATOM   5096  O O   . MET B 1 288 ? 19.208  105.965 54.323  1.00   32.98 ? 288  MET B O   1 
ATOM   5097  C CB  . MET B 1 288 ? 21.949  104.649 55.428  1.00   35.71 ? 288  MET B CB  1 
ATOM   5098  C CG  . MET B 1 288 ? 23.019  104.420 56.471  1.00   36.29 ? 288  MET B CG  1 
ATOM   5099  S SD  . MET B 1 288 ? 23.916  102.872 56.211  1.00   45.21 ? 288  MET B SD  1 
ATOM   5100  C CE  . MET B 1 288 ? 24.951  103.294 54.798  1.00   36.96 ? 288  MET B CE  1 
ATOM   5101  N N   . GLU B 1 289 ? 21.005  106.700 53.179  1.00   38.14 ? 289  GLU B N   1 
ATOM   5102  C CA  . GLU B 1 289 ? 20.269  106.869 51.941  1.00   41.62 ? 289  GLU B CA  1 
ATOM   5103  C C   . GLU B 1 289 ? 20.179  105.482 51.303  1.00   40.18 ? 289  GLU B C   1 
ATOM   5104  O O   . GLU B 1 289 ? 21.202  104.858 51.006  1.00   39.82 ? 289  GLU B O   1 
ATOM   5105  C CB  . GLU B 1 289 ? 21.017  107.830 51.028  1.00   44.57 ? 289  GLU B CB  1 
ATOM   5106  C CG  . GLU B 1 289 ? 21.801  108.848 51.816  1.00   54.07 ? 289  GLU B CG  1 
ATOM   5107  C CD  . GLU B 1 289 ? 22.036  110.131 51.046  1.00   62.55 ? 289  GLU B CD  1 
ATOM   5108  O OE1 . GLU B 1 289 ? 22.576  110.055 49.922  1.00   66.26 ? 289  GLU B OE1 1 
ATOM   5109  O OE2 . GLU B 1 289 ? 21.686  111.219 51.563  1.00   65.34 ? 289  GLU B OE2 1 
ATOM   5110  N N   . LYS B 1 290 ? 18.947  105.005 51.137  1.00   39.95 ? 290  LYS B N   1 
ATOM   5111  C CA  . LYS B 1 290 ? 18.638  103.708 50.543  1.00   39.40 ? 290  LYS B CA  1 
ATOM   5112  C C   . LYS B 1 290 ? 19.758  103.052 49.742  1.00   38.08 ? 290  LYS B C   1 
ATOM   5113  O O   . LYS B 1 290 ? 20.193  101.948 50.065  1.00   39.24 ? 290  LYS B O   1 
ATOM   5114  C CB  . LYS B 1 290 ? 17.414  103.851 49.648  1.00   43.30 ? 290  LYS B CB  1 
ATOM   5115  C CG  . LYS B 1 290 ? 16.174  104.344 50.369  1.00   49.52 ? 290  LYS B CG  1 
ATOM   5116  C CD  . LYS B 1 290 ? 15.184  104.976 49.389  1.00   54.94 ? 290  LYS B CD  1 
ATOM   5117  C CE  . LYS B 1 290 ? 15.702  106.317 48.851  1.00   57.52 ? 290  LYS B CE  1 
ATOM   5118  N NZ  . LYS B 1 290 ? 14.820  106.906 47.810  1.00   54.26 ? 290  LYS B NZ  1 
ATOM   5119  N N   . GLU B 1 291 ? 20.228  103.735 48.704  1.00   37.29 ? 291  GLU B N   1 
ATOM   5120  C CA  . GLU B 1 291 ? 21.270  103.182 47.854  1.00   37.03 ? 291  GLU B CA  1 
ATOM   5121  C C   . GLU B 1 291 ? 22.580  102.912 48.561  1.00   37.46 ? 291  GLU B C   1 
ATOM   5122  O O   . GLU B 1 291 ? 23.211  101.889 48.316  1.00   41.31 ? 291  GLU B O   1 
ATOM   5123  C CB  . GLU B 1 291 ? 21.508  104.075 46.621  1.00   37.05 ? 291  GLU B CB  1 
ATOM   5124  C CG  . GLU B 1 291 ? 20.265  104.235 45.719  1.00   34.60 ? 291  GLU B CG  1 
ATOM   5125  C CD  . GLU B 1 291 ? 19.615  102.882 45.335  1.00   35.25 ? 291  GLU B CD  1 
ATOM   5126  O OE1 . GLU B 1 291 ? 18.390  102.853 45.067  1.00   28.96 ? 291  GLU B OE1 1 
ATOM   5127  O OE2 . GLU B 1 291 ? 20.331  101.854 45.300  1.00   28.07 ? 291  GLU B OE2 1 
ATOM   5128  N N   . GLU B 1 292 ? 23.002  103.793 49.450  1.00   36.80 ? 292  GLU B N   1 
ATOM   5129  C CA  . GLU B 1 292 ? 24.266  103.543 50.125  1.00   36.55 ? 292  GLU B CA  1 
ATOM   5130  C C   . GLU B 1 292 ? 24.028  102.517 51.232  1.00   35.72 ? 292  GLU B C   1 
ATOM   5131  O O   . GLU B 1 292 ? 24.926  101.764 51.631  1.00   34.04 ? 292  GLU B O   1 
ATOM   5132  C CB  . GLU B 1 292 ? 24.824  104.854 50.675  1.00   39.38 ? 292  GLU B CB  1 
ATOM   5133  C CG  . GLU B 1 292 ? 24.702  106.032 49.675  1.00   48.92 ? 292  GLU B CG  1 
ATOM   5134  C CD  . GLU B 1 292 ? 25.291  105.731 48.281  1.00   50.72 ? 292  GLU B CD  1 
ATOM   5135  O OE1 . GLU B 1 292 ? 26.425  105.205 48.210  1.00   51.75 ? 292  GLU B OE1 1 
ATOM   5136  O OE2 . GLU B 1 292 ? 24.631  106.036 47.260  1.00   47.07 ? 292  GLU B OE2 1 
ATOM   5137  N N   . LYS B 1 293 ? 22.789  102.478 51.703  1.00   34.72 ? 293  LYS B N   1 
ATOM   5138  C CA  . LYS B 1 293 ? 22.397  101.551 52.743  1.00   34.53 ? 293  LYS B CA  1 
ATOM   5139  C C   . LYS B 1 293 ? 22.437  100.131 52.214  1.00   33.56 ? 293  LYS B C   1 
ATOM   5140  O O   . LYS B 1 293 ? 22.938  99.224  52.880  1.00   32.38 ? 293  LYS B O   1 
ATOM   5141  C CB  . LYS B 1 293 ? 20.977  101.844 53.217  1.00   36.16 ? 293  LYS B CB  1 
ATOM   5142  C CG  . LYS B 1 293 ? 20.579  100.939 54.369  1.00   39.62 ? 293  LYS B CG  1 
ATOM   5143  C CD  . LYS B 1 293 ? 19.101  100.969 54.628  1.00   38.16 ? 293  LYS B CD  1 
ATOM   5144  C CE  . LYS B 1 293 ? 18.352  100.299 53.512  1.00   31.88 ? 293  LYS B CE  1 
ATOM   5145  N NZ  . LYS B 1 293 ? 16.913  100.294 53.855  1.00   36.52 ? 293  LYS B NZ  1 
ATOM   5146  N N   . GLU B 1 294 ? 21.872  99.955  51.021  1.00   34.53 ? 294  GLU B N   1 
ATOM   5147  C CA  . GLU B 1 294 ? 21.827  98.660  50.359  1.00   34.60 ? 294  GLU B CA  1 
ATOM   5148  C C   . GLU B 1 294 ? 23.248  98.185  50.112  1.00   33.90 ? 294  GLU B C   1 
ATOM   5149  O O   . GLU B 1 294 ? 23.563  97.016  50.327  1.00   34.57 ? 294  GLU B O   1 
ATOM   5150  C CB  . GLU B 1 294 ? 21.060  98.760  49.036  1.00   34.06 ? 294  GLU B CB  1 
ATOM   5151  C CG  . GLU B 1 294 ? 19.573  99.103  49.185  1.00   41.85 ? 294  GLU B CG  1 
ATOM   5152  C CD  . GLU B 1 294 ? 18.784  98.084  50.015  1.00   44.29 ? 294  GLU B CD  1 
ATOM   5153  O OE1 . GLU B 1 294 ? 17.536  98.142  49.986  1.00   45.34 ? 294  GLU B OE1 1 
ATOM   5154  O OE2 . GLU B 1 294 ? 19.401  97.232  50.699  1.00   46.58 ? 294  GLU B OE2 1 
ATOM   5155  N N   . ARG B 1 295 ? 24.108  99.098  49.677  1.00   31.61 ? 295  ARG B N   1 
ATOM   5156  C CA  . ARG B 1 295 ? 25.500  98.751  49.436  1.00   31.03 ? 295  ARG B CA  1 
ATOM   5157  C C   . ARG B 1 295 ? 26.137  98.237  50.721  1.00   29.74 ? 295  ARG B C   1 
ATOM   5158  O O   . ARG B 1 295 ? 26.898  97.264  50.710  1.00   30.74 ? 295  ARG B O   1 
ATOM   5159  C CB  . ARG B 1 295 ? 26.262  99.968  48.906  1.00   32.89 ? 295  ARG B CB  1 
ATOM   5160  C CG  . ARG B 1 295 ? 26.451  99.936  47.394  1.00   37.73 ? 295  ARG B CG  1 
ATOM   5161  C CD  . ARG B 1 295 ? 26.383  101.322 46.736  1.00   42.13 ? 295  ARG B CD  1 
ATOM   5162  N NE  . ARG B 1 295 ? 27.175  102.354 47.410  1.00   41.52 ? 295  ARG B NE  1 
ATOM   5163  C CZ  . ARG B 1 295 ? 28.454  102.236 47.770  1.00   43.17 ? 295  ARG B CZ  1 
ATOM   5164  N NH1 . ARG B 1 295 ? 29.061  103.256 48.372  1.00   41.89 ? 295  ARG B NH1 1 
ATOM   5165  N NH2 . ARG B 1 295 ? 29.126  101.108 47.543  1.00   38.17 ? 295  ARG B NH2 1 
ATOM   5166  N N   . LEU B 1 296 ? 25.799  98.876  51.835  1.00   28.42 ? 296  LEU B N   1 
ATOM   5167  C CA  . LEU B 1 296 ? 26.337  98.474  53.127  1.00   27.86 ? 296  LEU B CA  1 
ATOM   5168  C C   . LEU B 1 296 ? 25.841  97.104  53.578  1.00   27.34 ? 296  LEU B C   1 
ATOM   5169  O O   . LEU B 1 296 ? 26.603  96.316  54.148  1.00   28.27 ? 296  LEU B O   1 
ATOM   5170  C CB  . LEU B 1 296 ? 25.998  99.514  54.191  1.00   21.80 ? 296  LEU B CB  1 
ATOM   5171  C CG  . LEU B 1 296 ? 26.458  99.128  55.585  1.00   22.24 ? 296  LEU B CG  1 
ATOM   5172  C CD1 . LEU B 1 296 ? 27.908  98.652  55.548  1.00   12.62 ? 296  LEU B CD1 1 
ATOM   5173  C CD2 . LEU B 1 296 ? 26.279  100.325 56.497  1.00   23.67 ? 296  LEU B CD2 1 
ATOM   5174  N N   . LEU B 1 297 ? 24.561  96.836  53.343  1.00   26.34 ? 297  LEU B N   1 
ATOM   5175  C CA  . LEU B 1 297 ? 23.978  95.559  53.707  1.00   26.41 ? 297  LEU B CA  1 
ATOM   5176  C C   . LEU B 1 297 ? 24.621  94.427  52.919  1.00   26.12 ? 297  LEU B C   1 
ATOM   5177  O O   . LEU B 1 297 ? 24.918  93.384  53.482  1.00   28.89 ? 297  LEU B O   1 
ATOM   5178  C CB  . LEU B 1 297 ? 22.485  95.577  53.450  1.00   21.35 ? 297  LEU B CB  1 
ATOM   5179  C CG  . LEU B 1 297 ? 21.540  96.035  54.555  1.00   23.40 ? 297  LEU B CG  1 
ATOM   5180  C CD1 . LEU B 1 297 ? 22.272  96.204  55.855  1.00   18.28 ? 297  LEU B CD1 1 
ATOM   5181  C CD2 . LEU B 1 297 ? 20.860  97.314  54.140  1.00   25.11 ? 297  LEU B CD2 1 
ATOM   5182  N N   . GLU B 1 298 ? 24.844  94.631  51.620  1.00   24.71 ? 298  GLU B N   1 
ATOM   5183  C CA  . GLU B 1 298 ? 25.465  93.594  50.813  1.00   27.99 ? 298  GLU B CA  1 
ATOM   5184  C C   . GLU B 1 298 ? 26.857  93.279  51.308  1.00   27.48 ? 298  GLU B C   1 
ATOM   5185  O O   . GLU B 1 298 ? 27.261  92.113  51.350  1.00   30.00 ? 298  GLU B O   1 
ATOM   5186  C CB  . GLU B 1 298 ? 25.541  93.992  49.330  1.00   28.57 ? 298  GLU B CB  1 
ATOM   5187  C CG  . GLU B 1 298 ? 26.215  92.911  48.480  1.00   28.41 ? 298  GLU B CG  1 
ATOM   5188  C CD  . GLU B 1 298 ? 25.889  92.993  46.991  1.00   31.60 ? 298  GLU B CD  1 
ATOM   5189  O OE1 . GLU B 1 298 ? 25.527  94.087  46.504  1.00   35.48 ? 298  GLU B OE1 1 
ATOM   5190  O OE2 . GLU B 1 298 ? 26.004  91.964  46.291  1.00   32.20 ? 298  GLU B OE2 1 
ATOM   5191  N N   . HIS B 1 299 ? 27.598  94.318  51.670  1.00   27.69 ? 299  HIS B N   1 
ATOM   5192  C CA  . HIS B 1 299 ? 28.951  94.147  52.185  1.00   26.97 ? 299  HIS B CA  1 
ATOM   5193  C C   . HIS B 1 299 ? 28.895  93.334  53.479  1.00   25.25 ? 299  HIS B C   1 
ATOM   5194  O O   . HIS B 1 299 ? 29.619  92.359  53.651  1.00   25.62 ? 299  HIS B O   1 
ATOM   5195  C CB  . HIS B 1 299 ? 29.585  95.513  52.458  1.00   27.93 ? 299  HIS B CB  1 
ATOM   5196  C CG  . HIS B 1 299 ? 30.901  95.434  53.164  1.00   35.77 ? 299  HIS B CG  1 
ATOM   5197  N ND1 . HIS B 1 299 ? 32.034  94.924  52.567  1.00   35.42 ? 299  HIS B ND1 1 
ATOM   5198  C CD2 . HIS B 1 299 ? 31.249  95.731  54.440  1.00   38.30 ? 299  HIS B CD2 1 
ATOM   5199  C CE1 . HIS B 1 299 ? 33.021  94.909  53.446  1.00   37.85 ? 299  HIS B CE1 1 
ATOM   5200  N NE2 . HIS B 1 299 ? 32.572  95.395  54.590  1.00   34.09 ? 299  HIS B NE2 1 
ATOM   5201  N N   . LEU B 1 300 ? 28.019  93.747  54.384  1.00   24.74 ? 300  LEU B N   1 
ATOM   5202  C CA  . LEU B 1 300 ? 27.866  93.062  55.659  1.00   23.55 ? 300  LEU B CA  1 
ATOM   5203  C C   . LEU B 1 300 ? 27.431  91.606  55.474  1.00   24.57 ? 300  LEU B C   1 
ATOM   5204  O O   . LEU B 1 300 ? 27.880  90.727  56.219  1.00   25.41 ? 300  LEU B O   1 
ATOM   5205  C CB  . LEU B 1 300 ? 26.855  93.814  56.532  1.00   20.06 ? 300  LEU B CB  1 
ATOM   5206  C CG  . LEU B 1 300 ? 27.360  95.152  57.116  1.00   24.07 ? 300  LEU B CG  1 
ATOM   5207  C CD1 . LEU B 1 300 ? 26.245  95.829  57.908  1.00   20.85 ? 300  LEU B CD1 1 
ATOM   5208  C CD2 . LEU B 1 300 ? 28.588  94.921  58.020  1.00   17.37 ? 300  LEU B CD2 1 
ATOM   5209  N N   . ARG B 1 301 ? 26.552  91.353  54.495  1.00   24.06 ? 301  ARG B N   1 
ATOM   5210  C CA  . ARG B 1 301 ? 26.084  89.987  54.199  1.00   24.70 ? 301  ARG B CA  1 
ATOM   5211  C C   . ARG B 1 301 ? 27.258  89.102  53.731  1.00   28.59 ? 301  ARG B C   1 
ATOM   5212  O O   . ARG B 1 301 ? 27.287  87.879  53.973  1.00   26.90 ? 301  ARG B O   1 
ATOM   5213  C CB  . ARG B 1 301 ? 24.995  89.996  53.105  1.00   21.82 ? 301  ARG B CB  1 
ATOM   5214  C CG  . ARG B 1 301 ? 24.519  88.573  52.665  1.00   16.24 ? 301  ARG B CG  1 
ATOM   5215  C CD  . ARG B 1 301 ? 25.085  88.180  51.316  1.00   16.56 ? 301  ARG B CD  1 
ATOM   5216  N NE  . ARG B 1 301 ? 24.550  89.029  50.248  1.00   20.83 ? 301  ARG B NE  1 
ATOM   5217  C CZ  . ARG B 1 301 ? 25.010  89.036  49.002  1.00   18.36 ? 301  ARG B CZ  1 
ATOM   5218  N NH1 . ARG B 1 301 ? 26.017  88.246  48.662  1.00   16.17 ? 301  ARG B NH1 1 
ATOM   5219  N NH2 . ARG B 1 301 ? 24.487  89.858  48.108  1.00   12.20 ? 301  ARG B NH2 1 
ATOM   5220  N N   . THR B 1 302 ? 28.212  89.721  53.044  1.00   27.45 ? 302  THR B N   1 
ATOM   5221  C CA  . THR B 1 302 ? 29.386  89.020  52.565  1.00   31.63 ? 302  THR B CA  1 
ATOM   5222  C C   . THR B 1 302 ? 30.245  88.602  53.751  1.00   31.76 ? 302  THR B C   1 
ATOM   5223  O O   . THR B 1 302 ? 31.027  87.672  53.650  1.00   33.10 ? 302  THR B O   1 
ATOM   5224  C CB  . THR B 1 302 ? 30.242  89.933  51.624  1.00   32.69 ? 302  THR B CB  1 
ATOM   5225  O OG1 . THR B 1 302 ? 29.582  90.067  50.360  1.00   38.04 ? 302  THR B OG1 1 
ATOM   5226  C CG2 . THR B 1 302 ? 31.611  89.340  51.383  1.00   35.78 ? 302  THR B CG2 1 
ATOM   5227  N N   . LYS B 1 303 ? 30.091  89.275  54.883  1.00   32.74 ? 303  LYS B N   1 
ATOM   5228  C CA  . LYS B 1 303 ? 30.901  88.953  56.049  1.00   34.59 ? 303  LYS B CA  1 
ATOM   5229  C C   . LYS B 1 303 ? 30.131  88.310  57.206  1.00   33.58 ? 303  LYS B C   1 
ATOM   5230  O O   . LYS B 1 303 ? 30.534  88.398  58.368  1.00   32.66 ? 303  LYS B O   1 
ATOM   5231  C CB  . LYS B 1 303 ? 31.649  90.213  56.488  1.00   36.56 ? 303  LYS B CB  1 
ATOM   5232  C CG  . LYS B 1 303 ? 32.522  90.763  55.335  1.00   45.27 ? 303  LYS B CG  1 
ATOM   5233  C CD  . LYS B 1 303 ? 33.699  91.610  55.798  1.00   49.63 ? 303  LYS B CD  1 
ATOM   5234  C CE  . LYS B 1 303 ? 34.745  91.807  54.684  1.00   54.40 ? 303  LYS B CE  1 
ATOM   5235  N NZ  . LYS B 1 303 ? 35.544  90.567  54.360  1.00   55.18 ? 303  LYS B NZ  1 
ATOM   5236  N N   . ASN B 1 304 ? 29.027  87.641  56.866  1.00   32.21 ? 304  ASN B N   1 
ATOM   5237  C CA  . ASN B 1 304 ? 28.173  86.957  57.838  1.00   27.44 ? 304  ASN B CA  1 
ATOM   5238  C C   . ASN B 1 304 ? 27.693  87.828  58.982  1.00   25.46 ? 304  ASN B C   1 
ATOM   5239  O O   . ASN B 1 304 ? 27.593  87.366  60.112  1.00   24.51 ? 304  ASN B O   1 
ATOM   5240  C CB  . ASN B 1 304 ? 28.889  85.761  58.422  1.00   29.91 ? 304  ASN B CB  1 
ATOM   5241  C CG  . ASN B 1 304 ? 29.117  84.673  57.403  1.00   34.19 ? 304  ASN B CG  1 
ATOM   5242  O OD1 . ASN B 1 304 ? 28.171  84.025  56.934  1.00   35.39 ? 304  ASN B OD1 1 
ATOM   5243  N ND2 . ASN B 1 304 ? 30.382  84.455  57.053  1.00   33.66 ? 304  ASN B ND2 1 
ATOM   5244  N N   . VAL B 1 305 ? 27.368  89.071  58.672  1.00   22.12 ? 305  VAL B N   1 
ATOM   5245  C CA  . VAL B 1 305 ? 26.907  90.028  59.667  1.00   21.95 ? 305  VAL B CA  1 
ATOM   5246  C C   . VAL B 1 305 ? 25.486  90.443  59.320  1.00   21.66 ? 305  VAL B C   1 
ATOM   5247  O O   . VAL B 1 305 ? 25.220  90.855  58.201  1.00   21.83 ? 305  VAL B O   1 
ATOM   5248  C CB  . VAL B 1 305 ? 27.803  91.296  59.680  1.00   22.29 ? 305  VAL B CB  1 
ATOM   5249  C CG1 . VAL B 1 305 ? 27.266  92.300  60.695  1.00   20.34 ? 305  VAL B CG1 1 
ATOM   5250  C CG2 . VAL B 1 305 ? 29.263  90.908  59.995  1.00   15.21 ? 305  VAL B CG2 1 
ATOM   5251  N N   . ALA B 1 306 ? 24.571  90.335  60.270  1.00   21.20 ? 306  ALA B N   1 
ATOM   5252  C CA  . ALA B 1 306 ? 23.187  90.705  60.000  1.00   22.87 ? 306  ALA B CA  1 
ATOM   5253  C C   . ALA B 1 306 ? 22.692  91.828  60.896  1.00   21.10 ? 306  ALA B C   1 
ATOM   5254  O O   . ALA B 1 306 ? 22.753  91.708  62.114  1.00   23.39 ? 306  ALA B O   1 
ATOM   5255  C CB  . ALA B 1 306 ? 22.269  89.471  60.154  1.00   17.72 ? 306  ALA B CB  1 
ATOM   5256  N N   . VAL B 1 307 ? 22.224  92.919  60.304  1.00   20.81 ? 307  VAL B N   1 
ATOM   5257  C CA  . VAL B 1 307 ? 21.678  94.027  61.092  1.00   20.06 ? 307  VAL B CA  1 
ATOM   5258  C C   . VAL B 1 307 ? 20.254  94.185  60.596  1.00   20.94 ? 307  VAL B C   1 
ATOM   5259  O O   . VAL B 1 307 ? 19.878  93.524  59.638  1.00   20.67 ? 307  VAL B O   1 
ATOM   5260  C CB  . VAL B 1 307 ? 22.418  95.366  60.877  1.00   21.36 ? 307  VAL B CB  1 
ATOM   5261  C CG1 . VAL B 1 307 ? 23.769  95.353  61.577  1.00   21.49 ? 307  VAL B CG1 1 
ATOM   5262  C CG2 . VAL B 1 307 ? 22.577  95.644  59.397  1.00   16.16 ? 307  VAL B CG2 1 
ATOM   5263  N N   . ARG B 1 308 ? 19.456  95.023  61.250  1.00   20.87 ? 308  ARG B N   1 
ATOM   5264  C CA  . ARG B 1 308 ? 18.089  95.232  60.815  1.00   21.27 ? 308  ARG B CA  1 
ATOM   5265  C C   . ARG B 1 308 ? 17.993  96.456  59.888  1.00   23.71 ? 308  ARG B C   1 
ATOM   5266  O O   . ARG B 1 308 ? 18.406  97.572  60.236  1.00   23.64 ? 308  ARG B O   1 
ATOM   5267  C CB  . ARG B 1 308 ? 17.159  95.398  62.025  1.00   20.43 ? 308  ARG B CB  1 
ATOM   5268  C CG  . ARG B 1 308 ? 15.677  95.441  61.682  1.00   19.17 ? 308  ARG B CG  1 
ATOM   5269  C CD  . ARG B 1 308 ? 15.195  94.139  61.083  1.00   19.42 ? 308  ARG B CD  1 
ATOM   5270  N NE  . ARG B 1 308 ? 15.437  93.009  61.965  1.00   22.69 ? 308  ARG B NE  1 
ATOM   5271  C CZ  . ARG B 1 308 ? 15.320  91.728  61.610  1.00   25.87 ? 308  ARG B CZ  1 
ATOM   5272  N NH1 . ARG B 1 308 ? 14.956  91.377  60.375  1.00   22.17 ? 308  ARG B NH1 1 
ATOM   5273  N NH2 . ARG B 1 308 ? 15.580  90.782  62.503  1.00   28.13 ? 308  ARG B NH2 1 
ATOM   5274  N N   . SER B 1 309 ? 17.465  96.214  58.697  1.00   23.85 ? 309  SER B N   1 
ATOM   5275  C CA  . SER B 1 309 ? 17.287  97.241  57.687  1.00   25.71 ? 309  SER B CA  1 
ATOM   5276  C C   . SER B 1 309 ? 15.963  97.947  57.878  1.00   25.55 ? 309  SER B C   1 
ATOM   5277  O O   . SER B 1 309 ? 14.986  97.347  58.291  1.00   26.72 ? 309  SER B O   1 
ATOM   5278  C CB  . SER B 1 309 ? 17.332  96.622  56.279  1.00   26.25 ? 309  SER B CB  1 
ATOM   5279  O OG  . SER B 1 309 ? 16.991  97.586  55.297  1.00   31.36 ? 309  SER B OG  1 
ATOM   5280  N N   . PHE B 1 310 ? 15.932  99.229  57.560  1.00   27.11 ? 310  PHE B N   1 
ATOM   5281  C CA  . PHE B 1 310 ? 14.717  100.013 57.714  1.00   28.30 ? 310  PHE B CA  1 
ATOM   5282  C C   . PHE B 1 310 ? 14.645  101.099 56.649  1.00   28.60 ? 310  PHE B C   1 
ATOM   5283  O O   . PHE B 1 310 ? 15.654  101.452 56.023  1.00   27.36 ? 310  PHE B O   1 
ATOM   5284  C CB  . PHE B 1 310 ? 14.692  100.680 59.098  1.00   26.75 ? 310  PHE B CB  1 
ATOM   5285  C CG  . PHE B 1 310 ? 14.299  99.764  60.212  1.00   24.67 ? 310  PHE B CG  1 
ATOM   5286  C CD1 . PHE B 1 310 ? 12.953  99.510  60.469  1.00   21.48 ? 310  PHE B CD1 1 
ATOM   5287  C CD2 . PHE B 1 310 ? 15.270  99.155  61.016  1.00   21.72 ? 310  PHE B CD2 1 
ATOM   5288  C CE1 . PHE B 1 310 ? 12.570  98.669  61.506  1.00   20.09 ? 310  PHE B CE1 1 
ATOM   5289  C CE2 . PHE B 1 310 ? 14.899  98.302  62.069  1.00   20.81 ? 310  PHE B CE2 1 
ATOM   5290  C CZ  . PHE B 1 310 ? 13.548  98.057  62.316  1.00   23.64 ? 310  PHE B CZ  1 
ATOM   5291  N N   . ARG B 1 311 ? 13.450  101.651 56.469  1.00   31.02 ? 311  ARG B N   1 
ATOM   5292  C CA  . ARG B 1 311 ? 13.260  102.717 55.490  1.00   32.66 ? 311  ARG B CA  1 
ATOM   5293  C C   . ARG B 1 311 ? 14.302  103.819 55.721  1.00   30.63 ? 311  ARG B C   1 
ATOM   5294  O O   . ARG B 1 311 ? 14.959  104.283 54.794  1.00   29.24 ? 311  ARG B O   1 
ATOM   5295  C CB  . ARG B 1 311 ? 11.856  103.298 55.619  1.00   35.75 ? 311  ARG B CB  1 
ATOM   5296  C CG  . ARG B 1 311 ? 11.510  104.295 54.530  1.00   45.65 ? 311  ARG B CG  1 
ATOM   5297  C CD  . ARG B 1 311 ? 10.267  103.846 53.764  1.00   49.36 ? 311  ARG B CD  1 
ATOM   5298  N NE  . ARG B 1 311 ? 10.276  104.350 52.392  1.00   54.29 ? 311  ARG B NE  1 
ATOM   5299  C CZ  . ARG B 1 311 ? 9.517   103.871 51.408  1.00   55.19 ? 311  ARG B CZ  1 
ATOM   5300  N NH1 . ARG B 1 311 ? 9.597   104.394 50.189  1.00   54.53 ? 311  ARG B NH1 1 
ATOM   5301  N NH2 . ARG B 1 311 ? 8.680   102.865 51.638  1.00   54.38 ? 311  ARG B NH2 1 
ATOM   5302  N N   . GLU B 1 312 ? 14.475  104.201 56.975  1.00   30.30 ? 312  GLU B N   1 
ATOM   5303  C CA  . GLU B 1 312 ? 15.402  105.267 57.304  1.00   32.28 ? 312  GLU B CA  1 
ATOM   5304  C C   . GLU B 1 312 ? 16.874  104.851 57.302  1.00   31.58 ? 312  GLU B C   1 
ATOM   5305  O O   . GLU B 1 312 ? 17.776  105.691 57.156  1.00   32.81 ? 312  GLU B O   1 
ATOM   5306  C CB  . GLU B 1 312 ? 15.008  105.893 58.659  1.00   31.41 ? 312  GLU B CB  1 
ATOM   5307  C CG  . GLU B 1 312 ? 13.574  106.444 58.712  1.00   27.07 ? 312  GLU B CG  1 
ATOM   5308  C CD  . GLU B 1 312 ? 12.514  105.353 58.870  1.00   34.79 ? 312  GLU B CD  1 
ATOM   5309  O OE1 . GLU B 1 312 ? 11.299  105.666 58.807  1.00   34.31 ? 312  GLU B OE1 1 
ATOM   5310  O OE2 . GLU B 1 312 ? 12.896  104.173 59.060  1.00   30.66 ? 312  GLU B OE2 1 
ATOM   5311  N N   . GLY B 1 313 ? 17.126  103.559 57.435  1.00   30.98 ? 313  GLY B N   1 
ATOM   5312  C CA  . GLY B 1 313 ? 18.505  103.108 57.448  1.00   29.99 ? 313  GLY B CA  1 
ATOM   5313  C C   . GLY B 1 313 ? 18.660  101.787 58.171  1.00   28.00 ? 313  GLY B C   1 
ATOM   5314  O O   . GLY B 1 313 ? 17.792  100.920 58.068  1.00   28.74 ? 313  GLY B O   1 
ATOM   5315  N N   . VAL B 1 314 ? 19.753  101.630 58.907  1.00   23.74 ? 314  VAL B N   1 
ATOM   5316  C CA  . VAL B 1 314 ? 19.983  100.392 59.633  1.00   24.32 ? 314  VAL B CA  1 
ATOM   5317  C C   . VAL B 1 314 ? 19.991  100.457 61.176  1.00   24.35 ? 314  VAL B C   1 
ATOM   5318  O O   . VAL B 1 314 ? 20.418  101.441 61.782  1.00   23.86 ? 314  VAL B O   1 
ATOM   5319  C CB  . VAL B 1 314 ? 21.293  99.775  59.166  1.00   25.30 ? 314  VAL B CB  1 
ATOM   5320  C CG1 . VAL B 1 314 ? 21.135  99.279  57.721  1.00   27.35 ? 314  VAL B CG1 1 
ATOM   5321  C CG2 . VAL B 1 314 ? 22.386  100.817 59.225  1.00   26.71 ? 314  VAL B CG2 1 
ATOM   5322  N N   . ARG B 1 315 ? 19.470  99.408  61.805  1.00   22.18 ? 315  ARG B N   1 
ATOM   5323  C CA  . ARG B 1 315 ? 19.488  99.311  63.254  1.00   21.01 ? 315  ARG B CA  1 
ATOM   5324  C C   . ARG B 1 315 ? 20.511  98.210  63.593  1.00   21.28 ? 315  ARG B C   1 
ATOM   5325  O O   . ARG B 1 315 ? 20.463  97.091  63.056  1.00   16.17 ? 315  ARG B O   1 
ATOM   5326  C CB  . ARG B 1 315 ? 18.117  98.942  63.814  1.00   20.78 ? 315  ARG B CB  1 
ATOM   5327  C CG  . ARG B 1 315 ? 18.088  98.909  65.323  1.00   23.16 ? 315  ARG B CG  1 
ATOM   5328  C CD  . ARG B 1 315 ? 17.601  97.568  65.854  1.00   24.41 ? 315  ARG B CD  1 
ATOM   5329  N NE  . ARG B 1 315 ? 16.164  97.523  66.060  1.00   22.26 ? 315  ARG B NE  1 
ATOM   5330  C CZ  . ARG B 1 315 ? 15.422  96.428  65.933  1.00   22.24 ? 315  ARG B CZ  1 
ATOM   5331  N NH1 . ARG B 1 315 ? 15.972  95.264  65.591  1.00   23.48 ? 315  ARG B NH1 1 
ATOM   5332  N NH2 . ARG B 1 315 ? 14.119  96.497  66.162  1.00   26.97 ? 315  ARG B NH2 1 
ATOM   5333  N N   . ILE B 1 316 ? 21.458  98.561  64.453  1.00   19.13 ? 316  ILE B N   1 
ATOM   5334  C CA  . ILE B 1 316 ? 22.479  97.639  64.869  1.00   20.59 ? 316  ILE B CA  1 
ATOM   5335  C C   . ILE B 1 316 ? 22.340  97.325  66.366  1.00   23.64 ? 316  ILE B C   1 
ATOM   5336  O O   . ILE B 1 316 ? 22.353  98.228  67.230  1.00   22.68 ? 316  ILE B O   1 
ATOM   5337  C CB  . ILE B 1 316 ? 23.868  98.229  64.602  1.00   19.86 ? 316  ILE B CB  1 
ATOM   5338  C CG1 . ILE B 1 316 ? 23.931  98.786  63.180  1.00   18.83 ? 316  ILE B CG1 1 
ATOM   5339  C CG2 . ILE B 1 316 ? 24.907  97.186  64.778  1.00   16.89 ? 316  ILE B CG2 1 
ATOM   5340  C CD1 . ILE B 1 316 ? 25.335  99.287  62.758  1.00   21.18 ? 316  ILE B CD1 1 
ATOM   5341  N N   . THR B 1 317 ? 22.191  96.047  66.680  1.00   22.40 ? 317  THR B N   1 
ATOM   5342  C CA  . THR B 1 317 ? 22.103  95.655  68.067  1.00   22.42 ? 317  THR B CA  1 
ATOM   5343  C C   . THR B 1 317 ? 23.528  95.573  68.596  1.00   21.75 ? 317  THR B C   1 
ATOM   5344  O O   . THR B 1 317 ? 24.468  95.192  67.880  1.00   18.57 ? 317  THR B O   1 
ATOM   5345  C CB  . THR B 1 317 ? 21.431  94.270  68.239  1.00   24.53 ? 317  THR B CB  1 
ATOM   5346  O OG1 . THR B 1 317 ? 20.089  94.321  67.725  1.00   25.79 ? 317  THR B OG1 1 
ATOM   5347  C CG2 . THR B 1 317 ? 21.421  93.872  69.720  1.00   21.79 ? 317  THR B CG2 1 
ATOM   5348  N N   . ILE B 1 318 ? 23.672  95.966  69.856  1.00   23.75 ? 318  ILE B N   1 
ATOM   5349  C CA  . ILE B 1 318 ? 24.948  95.924  70.535  1.00   21.76 ? 318  ILE B CA  1 
ATOM   5350  C C   . ILE B 1 318 ? 25.243  94.494  70.939  1.00   22.42 ? 318  ILE B C   1 
ATOM   5351  O O   . ILE B 1 318 ? 24.409  93.827  71.542  1.00   25.50 ? 318  ILE B O   1 
ATOM   5352  C CB  . ILE B 1 318 ? 24.921  96.808  71.776  1.00   20.74 ? 318  ILE B CB  1 
ATOM   5353  C CG1 . ILE B 1 318 ? 25.001  98.275  71.345  1.00   15.77 ? 318  ILE B CG1 1 
ATOM   5354  C CG2 . ILE B 1 318 ? 26.093  96.449  72.708  1.00   20.62 ? 318  ILE B CG2 1 
ATOM   5355  C CD1 . ILE B 1 318 ? 24.300  99.166  72.289  1.00   24.79 ? 318  ILE B CD1 1 
ATOM   5356  N N   . GLY B 1 319 ? 26.418  94.009  70.575  1.00   18.97 ? 319  GLY B N   1 
ATOM   5357  C CA  . GLY B 1 319 ? 26.747  92.652  70.942  1.00   19.63 ? 319  GLY B CA  1 
ATOM   5358  C C   . GLY B 1 319 ? 27.958  92.617  71.839  1.00   21.24 ? 319  GLY B C   1 
ATOM   5359  O O   . GLY B 1 319 ? 28.204  93.532  72.626  1.00   21.12 ? 319  GLY B O   1 
ATOM   5360  N N   . LYS B 1 320 ? 28.699  91.528  71.727  1.00   23.69 ? 320  LYS B N   1 
ATOM   5361  C CA  . LYS B 1 320 ? 29.914  91.363  72.482  1.00   24.97 ? 320  LYS B CA  1 
ATOM   5362  C C   . LYS B 1 320 ? 30.903  92.385  71.883  1.00   27.16 ? 320  LYS B C   1 
ATOM   5363  O O   . LYS B 1 320 ? 30.681  92.929  70.773  1.00   25.92 ? 320  LYS B O   1 
ATOM   5364  C CB  . LYS B 1 320 ? 30.355  89.917  72.343  1.00   23.91 ? 320  LYS B CB  1 
ATOM   5365  C CG  . LYS B 1 320 ? 29.222  88.953  72.777  1.00   34.67 ? 320  LYS B CG  1 
ATOM   5366  C CD  . LYS B 1 320 ? 29.346  87.543  72.169  1.00   40.07 ? 320  LYS B CD  1 
ATOM   5367  C CE  . LYS B 1 320 ? 30.351  86.651  72.911  1.00   44.50 ? 320  LYS B CE  1 
ATOM   5368  N NZ  . LYS B 1 320 ? 30.808  85.477  72.088  1.00   44.75 ? 320  LYS B NZ  1 
ATOM   5369  N N   . ARG B 1 321 ? 31.951  92.687  72.644  1.00   27.97 ? 321  ARG B N   1 
ATOM   5370  C CA  . ARG B 1 321 ? 32.966  93.655  72.243  1.00   28.63 ? 321  ARG B CA  1 
ATOM   5371  C C   . ARG B 1 321 ? 33.556  93.372  70.848  1.00   28.23 ? 321  ARG B C   1 
ATOM   5372  O O   . ARG B 1 321 ? 33.613  94.274  69.999  1.00   26.03 ? 321  ARG B O   1 
ATOM   5373  C CB  . ARG B 1 321 ? 34.069  93.695  73.313  1.00   34.67 ? 321  ARG B CB  1 
ATOM   5374  C CG  . ARG B 1 321 ? 35.124  94.808  73.147  1.00   41.12 ? 321  ARG B CG  1 
ATOM   5375  C CD  . ARG B 1 321 ? 34.483  96.176  72.886  1.00   46.04 ? 321  ARG B CD  1 
ATOM   5376  N NE  . ARG B 1 321 ? 35.383  97.298  73.153  1.00   48.65 ? 321  ARG B NE  1 
ATOM   5377  C CZ  . ARG B 1 321 ? 35.468  97.929  74.321  1.00   49.16 ? 321  ARG B CZ  1 
ATOM   5378  N NH1 . ARG B 1 321 ? 36.319  98.935  74.475  1.00   49.06 ? 321  ARG B NH1 1 
ATOM   5379  N NH2 . ARG B 1 321 ? 34.691  97.565  75.332  1.00   52.09 ? 321  ARG B NH2 1 
ATOM   5380  N N   . GLU B 1 322 ? 33.970  92.126  70.605  1.00   26.09 ? 322  GLU B N   1 
ATOM   5381  C CA  . GLU B 1 322 ? 34.530  91.758  69.303  1.00   27.30 ? 322  GLU B CA  1 
ATOM   5382  C C   . GLU B 1 322 ? 33.505  91.839  68.153  1.00   27.61 ? 322  GLU B C   1 
ATOM   5383  O O   . GLU B 1 322 ? 33.871  91.912  66.983  1.00   27.82 ? 322  GLU B O   1 
ATOM   5384  C CB  . GLU B 1 322 ? 35.169  90.357  69.356  1.00   24.88 ? 322  GLU B CB  1 
ATOM   5385  C CG  . GLU B 1 322 ? 34.440  89.299  70.187  1.00   32.55 ? 322  GLU B CG  1 
ATOM   5386  C CD  . GLU B 1 322 ? 34.772  89.345  71.696  1.00   41.48 ? 322  GLU B CD  1 
ATOM   5387  O OE1 . GLU B 1 322 ? 34.025  89.982  72.462  1.00   38.50 ? 322  GLU B OE1 1 
ATOM   5388  O OE2 . GLU B 1 322 ? 35.794  88.733  72.125  1.00   48.23 ? 322  GLU B OE2 1 
ATOM   5389  N N   . GLU B 1 323 ? 32.220  91.818  68.479  1.00   26.07 ? 323  GLU B N   1 
ATOM   5390  C CA  . GLU B 1 323 ? 31.215  91.926  67.434  1.00   27.41 ? 323  GLU B CA  1 
ATOM   5391  C C   . GLU B 1 323 ? 31.039  93.423  67.194  1.00   26.16 ? 323  GLU B C   1 
ATOM   5392  O O   . GLU B 1 323 ? 30.922  93.879  66.058  1.00   25.61 ? 323  GLU B O   1 
ATOM   5393  C CB  . GLU B 1 323 ? 29.871  91.312  67.868  1.00   24.63 ? 323  GLU B CB  1 
ATOM   5394  C CG  . GLU B 1 323 ? 29.830  89.793  67.915  1.00   29.67 ? 323  GLU B CG  1 
ATOM   5395  C CD  . GLU B 1 323 ? 28.481  89.262  68.406  1.00   31.14 ? 323  GLU B CD  1 
ATOM   5396  O OE1 . GLU B 1 323 ? 28.137  89.451  69.596  1.00   35.74 ? 323  GLU B OE1 1 
ATOM   5397  O OE2 . GLU B 1 323 ? 27.754  88.658  67.594  1.00   37.16 ? 323  GLU B OE2 1 
ATOM   5398  N N   . ASN B 1 324 ? 31.016  94.195  68.270  1.00   25.07 ? 324  ASN B N   1 
ATOM   5399  C CA  . ASN B 1 324 ? 30.842  95.627  68.092  1.00   26.79 ? 324  ASN B CA  1 
ATOM   5400  C C   . ASN B 1 324 ? 32.026  96.219  67.313  1.00   29.82 ? 324  ASN B C   1 
ATOM   5401  O O   . ASN B 1 324 ? 31.848  97.111  66.468  1.00   30.62 ? 324  ASN B O   1 
ATOM   5402  C CB  . ASN B 1 324 ? 30.660  96.288  69.443  1.00   24.77 ? 324  ASN B CB  1 
ATOM   5403  C CG  . ASN B 1 324 ? 29.384  95.833  70.119  1.00   21.45 ? 324  ASN B CG  1 
ATOM   5404  O OD1 . ASN B 1 324 ? 28.352  95.715  69.474  1.00   24.74 ? 324  ASN B OD1 1 
ATOM   5405  N ND2 . ASN B 1 324 ? 29.453  95.572  71.415  1.00   17.13 ? 324  ASN B ND2 1 
ATOM   5406  N N   . ASP B 1 325 ? 33.227  95.699  67.574  1.00   29.68 ? 325  ASP B N   1 
ATOM   5407  C CA  . ASP B 1 325 ? 34.421  96.156  66.874  1.00   31.31 ? 325  ASP B CA  1 
ATOM   5408  C C   . ASP B 1 325 ? 34.288  95.789  65.394  1.00   32.30 ? 325  ASP B C   1 
ATOM   5409  O O   . ASP B 1 325 ? 34.562  96.602  64.501  1.00   34.61 ? 325  ASP B O   1 
ATOM   5410  C CB  . ASP B 1 325 ? 35.678  95.506  67.462  1.00   30.42 ? 325  ASP B CB  1 
ATOM   5411  C CG  . ASP B 1 325 ? 36.005  96.028  68.842  1.00   29.67 ? 325  ASP B CG  1 
ATOM   5412  O OD1 . ASP B 1 325 ? 35.910  97.254  69.043  1.00   25.96 ? 325  ASP B OD1 1 
ATOM   5413  O OD2 . ASP B 1 325 ? 36.361  95.224  69.723  1.00   37.28 ? 325  ASP B OD2 1 
ATOM   5414  N N   . MET B 1 326 ? 33.874  94.555  65.155  1.00   30.19 ? 326  MET B N   1 
ATOM   5415  C CA  . MET B 1 326 ? 33.682  94.073  63.805  1.00   31.00 ? 326  MET B CA  1 
ATOM   5416  C C   . MET B 1 326 ? 32.758  95.001  63.008  1.00   28.55 ? 326  MET B C   1 
ATOM   5417  O O   . MET B 1 326 ? 33.046  95.337  61.872  1.00   27.75 ? 326  MET B O   1 
ATOM   5418  C CB  . MET B 1 326 ? 33.113  92.649  63.846  1.00   32.42 ? 326  MET B CB  1 
ATOM   5419  C CG  . MET B 1 326 ? 32.175  92.322  62.699  1.00   35.79 ? 326  MET B CG  1 
ATOM   5420  S SD  . MET B 1 326 ? 32.468  90.691  62.045  1.00   39.80 ? 326  MET B SD  1 
ATOM   5421  C CE  . MET B 1 326 ? 32.000  89.651  63.431  1.00   43.75 ? 326  MET B CE  1 
ATOM   5422  N N   . ILE B 1 327 ? 31.639  95.394  63.598  1.00   28.06 ? 327  ILE B N   1 
ATOM   5423  C CA  . ILE B 1 327 ? 30.690  96.292  62.942  1.00   28.16 ? 327  ILE B CA  1 
ATOM   5424  C C   . ILE B 1 327 ? 31.419  97.600  62.607  1.00   28.17 ? 327  ILE B C   1 
ATOM   5425  O O   . ILE B 1 327 ? 31.284  98.135  61.508  1.00   29.34 ? 327  ILE B O   1 
ATOM   5426  C CB  . ILE B 1 327 ? 29.523  96.633  63.881  1.00   28.66 ? 327  ILE B CB  1 
ATOM   5427  C CG1 . ILE B 1 327 ? 28.812  95.363  64.287  1.00   32.50 ? 327  ILE B CG1 1 
ATOM   5428  C CG2 . ILE B 1 327 ? 28.541  97.571  63.213  1.00   32.61 ? 327  ILE B CG2 1 
ATOM   5429  C CD1 . ILE B 1 327 ? 27.964  95.550  65.536  1.00   42.17 ? 327  ILE B CD1 1 
ATOM   5430  N N   . LEU B 1 328 ? 32.179  98.119  63.568  1.00   26.74 ? 328  LEU B N   1 
ATOM   5431  C CA  . LEU B 1 328 ? 32.912  99.354  63.350  1.00   27.67 ? 328  LEU B CA  1 
ATOM   5432  C C   . LEU B 1 328 ? 33.981  99.215  62.283  1.00   29.70 ? 328  LEU B C   1 
ATOM   5433  O O   . LEU B 1 328 ? 34.159  100.109 61.469  1.00   30.76 ? 328  LEU B O   1 
ATOM   5434  C CB  . LEU B 1 328 ? 33.542  99.829  64.656  1.00   25.84 ? 328  LEU B CB  1 
ATOM   5435  C CG  . LEU B 1 328 ? 32.504  100.332 65.664  1.00   24.33 ? 328  LEU B CG  1 
ATOM   5436  C CD1 . LEU B 1 328 ? 33.162  100.659 66.974  1.00   20.73 ? 328  LEU B CD1 1 
ATOM   5437  C CD2 . LEU B 1 328 ? 31.812  101.546 65.086  1.00   21.92 ? 328  LEU B CD2 1 
ATOM   5438  N N   . ARG B 1 329 ? 34.696  98.096  62.290  1.00   32.19 ? 329  ARG B N   1 
ATOM   5439  C CA  . ARG B 1 329 ? 35.746  97.871  61.308  1.00   34.79 ? 329  ARG B CA  1 
ATOM   5440  C C   . ARG B 1 329 ? 35.198  97.772  59.893  1.00   34.21 ? 329  ARG B C   1 
ATOM   5441  O O   . ARG B 1 329 ? 35.806  98.271  58.950  1.00   35.05 ? 329  ARG B O   1 
ATOM   5442  C CB  . ARG B 1 329 ? 36.534  96.607  61.656  1.00   37.03 ? 329  ARG B CB  1 
ATOM   5443  C CG  . ARG B 1 329 ? 37.518  96.798  62.801  1.00   46.04 ? 329  ARG B CG  1 
ATOM   5444  C CD  . ARG B 1 329 ? 37.402  95.696  63.865  1.00   53.89 ? 329  ARG B CD  1 
ATOM   5445  N NE  . ARG B 1 329 ? 37.660  94.357  63.335  1.00   57.80 ? 329  ARG B NE  1 
ATOM   5446  C CZ  . ARG B 1 329 ? 37.502  93.232  64.030  1.00   59.67 ? 329  ARG B CZ  1 
ATOM   5447  N NH1 . ARG B 1 329 ? 37.082  93.282  65.291  1.00   61.14 ? 329  ARG B NH1 1 
ATOM   5448  N NH2 . ARG B 1 329 ? 37.767  92.055  63.471  1.00   59.79 ? 329  ARG B NH2 1 
ATOM   5449  N N   . GLU B 1 330 ? 34.046  97.135  59.736  1.00   34.33 ? 330  GLU B N   1 
ATOM   5450  C CA  . GLU B 1 330 ? 33.469  97.000  58.407  1.00   32.92 ? 330  GLU B CA  1 
ATOM   5451  C C   . GLU B 1 330 ? 32.857  98.307  57.976  1.00   33.59 ? 330  GLU B C   1 
ATOM   5452  O O   . GLU B 1 330 ? 32.888  98.637  56.801  1.00   34.89 ? 330  GLU B O   1 
ATOM   5453  C CB  . GLU B 1 330 ? 32.418  95.885  58.361  1.00   32.26 ? 330  GLU B CB  1 
ATOM   5454  C CG  . GLU B 1 330 ? 32.979  94.530  58.666  1.00   27.05 ? 330  GLU B CG  1 
ATOM   5455  C CD  . GLU B 1 330 ? 34.098  94.137  57.723  1.00   28.63 ? 330  GLU B CD  1 
ATOM   5456  O OE1 . GLU B 1 330 ? 34.893  93.259  58.100  1.00   31.64 ? 330  GLU B OE1 1 
ATOM   5457  O OE2 . GLU B 1 330 ? 34.188  94.677  56.602  1.00   28.62 ? 330  GLU B OE2 1 
ATOM   5458  N N   . LEU B 1 331 ? 32.307  99.064  58.918  1.00   33.73 ? 331  LEU B N   1 
ATOM   5459  C CA  . LEU B 1 331 ? 31.717  100.338 58.537  1.00   36.84 ? 331  LEU B CA  1 
ATOM   5460  C C   . LEU B 1 331 ? 32.819  101.311 58.163  1.00   37.88 ? 331  LEU B C   1 
ATOM   5461  O O   . LEU B 1 331 ? 32.682  102.059 57.211  1.00   37.80 ? 331  LEU B O   1 
ATOM   5462  C CB  . LEU B 1 331 ? 30.858  100.919 59.658  1.00   35.70 ? 331  LEU B CB  1 
ATOM   5463  C CG  . LEU B 1 331 ? 29.657  100.084 60.113  1.00   39.20 ? 331  LEU B CG  1 
ATOM   5464  C CD1 . LEU B 1 331 ? 28.809  100.934 61.044  1.00   38.29 ? 331  LEU B CD1 1 
ATOM   5465  C CD2 . LEU B 1 331 ? 28.827  99.617  58.926  1.00   35.51 ? 331  LEU B CD2 1 
ATOM   5466  N N   . GLU B 1 332 ? 33.921  101.283 58.902  1.00   40.86 ? 332  GLU B N   1 
ATOM   5467  C CA  . GLU B 1 332 ? 35.041  102.169 58.618  1.00   45.45 ? 332  GLU B CA  1 
ATOM   5468  C C   . GLU B 1 332 ? 35.461  101.979 57.171  1.00   47.10 ? 332  GLU B C   1 
ATOM   5469  O O   . GLU B 1 332 ? 35.376  102.906 56.371  1.00   46.05 ? 332  GLU B O   1 
ATOM   5470  C CB  . GLU B 1 332 ? 36.208  101.871 59.560  1.00   45.83 ? 332  GLU B CB  1 
ATOM   5471  C CG  . GLU B 1 332 ? 37.468  102.655 59.262  1.00   52.10 ? 332  GLU B CG  1 
ATOM   5472  C CD  . GLU B 1 332 ? 38.372  102.811 60.484  1.00   58.79 ? 332  GLU B CD  1 
ATOM   5473  O OE1 . GLU B 1 332 ? 38.153  103.762 61.280  1.00   60.03 ? 332  GLU B OE1 1 
ATOM   5474  O OE2 . GLU B 1 332 ? 39.294  101.979 60.649  1.00   59.64 ? 332  GLU B OE2 1 
ATOM   5475  N N   . VAL B 1 333 ? 35.900  100.770 56.841  1.00   50.92 ? 333  VAL B N   1 
ATOM   5476  C CA  . VAL B 1 333 ? 36.314  100.437 55.484  1.00   53.88 ? 333  VAL B CA  1 
ATOM   5477  C C   . VAL B 1 333 ? 35.080  99.987  54.704  1.00   56.03 ? 333  VAL B C   1 
ATOM   5478  O O   . VAL B 1 333 ? 34.655  98.833  54.802  1.00   58.98 ? 333  VAL B O   1 
ATOM   5479  C CB  . VAL B 1 333 ? 37.366  99.298  55.482  1.00   55.48 ? 333  VAL B CB  1 
ATOM   5480  C CG1 . VAL B 1 333 ? 38.675  99.789  56.114  1.00   58.00 ? 333  VAL B CG1 1 
ATOM   5481  C CG2 . VAL B 1 333 ? 36.836  98.095  56.257  1.00   56.25 ? 333  VAL B CG2 1 
ATOM   5482  N N   . PHE B 1 334 ? 34.504  100.911 53.941  1.00   56.06 ? 334  PHE B N   1 
ATOM   5483  C CA  . PHE B 1 334 ? 33.313  100.652 53.141  1.00   54.83 ? 334  PHE B CA  1 
ATOM   5484  C C   . PHE B 1 334 ? 33.088  101.856 52.248  1.00   54.05 ? 334  PHE B C   1 
ATOM   5485  O O   . PHE B 1 334 ? 33.098  101.706 51.010  1.00   54.37 ? 334  PHE B O   1 
ATOM   5486  C CB  . PHE B 1 334 ? 32.087  100.462 54.043  1.00   55.25 ? 334  PHE B CB  1 
ATOM   5487  C CG  . PHE B 1 334 ? 30.771  100.674 53.334  1.00   54.78 ? 334  PHE B CG  1 
ATOM   5488  C CD1 . PHE B 1 334 ? 30.362  99.811  52.320  1.00   53.92 ? 334  PHE B CD1 1 
ATOM   5489  C CD2 . PHE B 1 334 ? 29.948  101.753 53.671  1.00   53.47 ? 334  PHE B CD2 1 
ATOM   5490  C CE1 . PHE B 1 334 ? 29.147  100.020 51.649  1.00   52.33 ? 334  PHE B CE1 1 
ATOM   5491  C CE2 . PHE B 1 334 ? 28.731  101.972 53.005  1.00   51.47 ? 334  PHE B CE2 1 
ATOM   5492  C CZ  . PHE B 1 334 ? 28.331  101.108 51.998  1.00   51.01 ? 334  PHE B CZ  1 
ATOM   5493  N N   . LYS B 1 335 ? 32.900  102.943 52.819  1.00   53.34 ? 335  LYS B N   1 
ATOM   5494  N N   . MET C 1 1   ? -13.482 77.581  8.365   1.00   80.87 ? 1    MET C N   1 
ATOM   5495  C CA  . MET C 1 1   ? -12.188 77.901  9.039   1.00   81.00 ? 1    MET C CA  1 
ATOM   5496  C C   . MET C 1 1   ? -12.345 77.953  10.564  1.00   81.56 ? 1    MET C C   1 
ATOM   5497  O O   . MET C 1 1   ? -13.329 78.489  11.085  1.00   81.49 ? 1    MET C O   1 
ATOM   5498  C CB  . MET C 1 1   ? -11.659 79.246  8.532   1.00   79.39 ? 1    MET C CB  1 
ATOM   5499  C CG  . MET C 1 1   ? -10.306 79.642  9.102   1.00   78.41 ? 1    MET C CG  1 
ATOM   5500  S SD  . MET C 1 1   ? -10.209 81.417  9.465   1.00   79.05 ? 1    MET C SD  1 
ATOM   5501  C CE  . MET C 1 1   ? -10.183 82.115  7.795   1.00   79.44 ? 1    MET C CE  1 
ATOM   5502  N N   . ASN C 1 2   ? -11.374 77.382  11.273  1.00   81.65 ? 2    ASN C N   1 
ATOM   5503  C CA  . ASN C 1 2   ? -11.371 77.366  12.738  1.00   81.26 ? 2    ASN C CA  1 
ATOM   5504  C C   . ASN C 1 2   ? -10.089 78.092  13.135  1.00   80.38 ? 2    ASN C C   1 
ATOM   5505  O O   . ASN C 1 2   ? -9.157  77.491  13.676  1.00   80.62 ? 2    ASN C O   1 
ATOM   5506  C CB  . ASN C 1 2   ? -11.359 75.916  13.253  1.00   83.57 ? 2    ASN C CB  1 
ATOM   5507  C CG  . ASN C 1 2   ? -11.568 75.815  14.768  1.00   85.76 ? 2    ASN C CG  1 
ATOM   5508  O OD1 . ASN C 1 2   ? -12.518 76.382  15.320  1.00   88.48 ? 2    ASN C OD1 1 
ATOM   5509  N ND2 . ASN C 1 2   ? -10.686 75.077  15.441  1.00   83.69 ? 2    ASN C ND2 1 
ATOM   5510  N N   . PRO C 1 3   ? -10.038 79.409  12.874  1.00   79.31 ? 3    PRO C N   1 
ATOM   5511  C CA  . PRO C 1 3   ? -8.912  80.312  13.151  1.00   77.88 ? 3    PRO C CA  1 
ATOM   5512  C C   . PRO C 1 3   ? -8.294  80.251  14.545  1.00   75.85 ? 3    PRO C C   1 
ATOM   5513  O O   . PRO C 1 3   ? -8.980  80.452  15.545  1.00   76.87 ? 3    PRO C O   1 
ATOM   5514  C CB  . PRO C 1 3   ? -9.493  81.690  12.831  1.00   79.31 ? 3    PRO C CB  1 
ATOM   5515  C CG  . PRO C 1 3   ? -10.950 81.523  13.164  1.00   80.61 ? 3    PRO C CG  1 
ATOM   5516  C CD  . PRO C 1 3   ? -11.250 80.182  12.546  1.00   80.21 ? 3    PRO C CD  1 
ATOM   5517  N N   . LEU C 1 4   ? -6.992  79.968  14.583  1.00   72.86 ? 4    LEU C N   1 
ATOM   5518  C CA  . LEU C 1 4   ? -6.190  79.882  15.808  1.00   70.57 ? 4    LEU C CA  1 
ATOM   5519  C C   . LEU C 1 4   ? -6.843  79.323  17.075  1.00   69.39 ? 4    LEU C C   1 
ATOM   5520  O O   . LEU C 1 4   ? -6.407  79.609  18.197  1.00   69.60 ? 4    LEU C O   1 
ATOM   5521  C CB  . LEU C 1 4   ? -5.584  81.246  16.097  1.00   71.06 ? 4    LEU C CB  1 
ATOM   5522  C CG  . LEU C 1 4   ? -4.768  81.726  14.896  1.00   71.91 ? 4    LEU C CG  1 
ATOM   5523  C CD1 . LEU C 1 4   ? -4.701  83.244  14.895  1.00   72.22 ? 4    LEU C CD1 1 
ATOM   5524  C CD2 . LEU C 1 4   ? -3.384  81.099  14.926  1.00   69.09 ? 4    LEU C CD2 1 
ATOM   5525  N N   . ASP C 1 5   ? -7.910  78.557  16.883  1.00   66.54 ? 5    ASP C N   1 
ATOM   5526  C CA  . ASP C 1 5   ? -8.595  77.863  17.969  1.00   63.21 ? 5    ASP C CA  1 
ATOM   5527  C C   . ASP C 1 5   ? -7.906  76.537  17.731  1.00   61.99 ? 5    ASP C C   1 
ATOM   5528  O O   . ASP C 1 5   ? -7.911  75.621  18.558  1.00   59.66 ? 5    ASP C O   1 
ATOM   5529  C CB  . ASP C 1 5   ? -10.093 77.722  17.676  1.00   62.99 ? 5    ASP C CB  1 
ATOM   5530  C CG  . ASP C 1 5   ? -10.865 78.992  17.950  1.00   63.78 ? 5    ASP C CG  1 
ATOM   5531  O OD1 . ASP C 1 5   ? -11.233 79.203  19.125  1.00   64.05 ? 5    ASP C OD1 1 
ATOM   5532  O OD2 . ASP C 1 5   ? -11.094 79.779  17.000  1.00   61.00 ? 5    ASP C OD2 1 
ATOM   5533  N N   . LEU C 1 6   ? -7.313  76.482  16.543  1.00   60.22 ? 6    LEU C N   1 
ATOM   5534  C CA  . LEU C 1 6   ? -6.568  75.344  16.054  1.00   60.85 ? 6    LEU C CA  1 
ATOM   5535  C C   . LEU C 1 6   ? -5.233  75.452  16.746  1.00   61.70 ? 6    LEU C C   1 
ATOM   5536  O O   . LEU C 1 6   ? -4.834  74.562  17.495  1.00   60.38 ? 6    LEU C O   1 
ATOM   5537  C CB  . LEU C 1 6   ? -6.422  75.465  14.526  1.00   58.31 ? 6    LEU C CB  1 
ATOM   5538  C CG  . LEU C 1 6   ? -5.290  74.813  13.725  1.00   54.21 ? 6    LEU C CG  1 
ATOM   5539  C CD1 . LEU C 1 6   ? -4.035  75.664  13.845  1.00   53.89 ? 6    LEU C CD1 1 
ATOM   5540  C CD2 . LEU C 1 6   ? -5.056  73.393  14.191  1.00   50.30 ? 6    LEU C CD2 1 
ATOM   5541  N N   . ILE C 1 7   ? -4.575  76.584  16.502  1.00   64.67 ? 7    ILE C N   1 
ATOM   5542  C CA  . ILE C 1 7   ? -3.274  76.907  17.084  1.00   66.14 ? 7    ILE C CA  1 
ATOM   5543  C C   . ILE C 1 7   ? -3.432  76.811  18.593  1.00   65.83 ? 7    ILE C C   1 
ATOM   5544  O O   . ILE C 1 7   ? -2.469  76.878  19.363  1.00   63.93 ? 7    ILE C O   1 
ATOM   5545  C CB  . ILE C 1 7   ? -2.864  78.322  16.676  1.00   68.37 ? 7    ILE C CB  1 
ATOM   5546  N N   . ALA C 1 8   ? -4.688  76.679  18.993  1.00   66.18 ? 8    ALA C N   1 
ATOM   5547  C CA  . ALA C 1 8   ? -5.056  76.540  20.383  1.00   65.18 ? 8    ALA C CA  1 
ATOM   5548  C C   . ALA C 1 8   ? -5.120  75.038  20.582  1.00   62.96 ? 8    ALA C C   1 
ATOM   5549  O O   . ALA C 1 8   ? -4.086  74.389  20.716  1.00   61.68 ? 8    ALA C O   1 
ATOM   5550  C CB  . ALA C 1 8   ? -6.419  77.186  20.633  1.00   68.03 ? 8    ALA C CB  1 
ATOM   5551  N N   . LYS C 1 9   ? -6.319  74.474  20.558  1.00   61.82 ? 9    LYS C N   1 
ATOM   5552  C CA  . LYS C 1 9   ? -6.426  73.038  20.743  1.00   62.27 ? 9    LYS C CA  1 
ATOM   5553  C C   . LYS C 1 9   ? -5.958  72.287  19.504  1.00   61.94 ? 9    LYS C C   1 
ATOM   5554  O O   . LYS C 1 9   ? -6.537  72.396  18.428  1.00   63.68 ? 9    LYS C O   1 
ATOM   5555  C CB  . LYS C 1 9   ? -7.849  72.626  21.105  1.00   64.18 ? 9    LYS C CB  1 
ATOM   5556  C CG  . LYS C 1 9   ? -7.990  71.122  21.296  1.00   66.24 ? 9    LYS C CG  1 
ATOM   5557  C CD  . LYS C 1 9   ? -6.992  70.576  22.320  1.00   64.76 ? 9    LYS C CD  1 
ATOM   5558  C CE  . LYS C 1 9   ? -6.480  69.202  21.891  1.00   63.52 ? 9    LYS C CE  1 
ATOM   5559  N NZ  . LYS C 1 9   ? -5.658  68.534  22.934  1.00   60.96 ? 9    LYS C NZ  1 
ATOM   5560  N N   . ARG C 1 10  ? -4.897  71.516  19.703  1.00   60.99 ? 10   ARG C N   1 
ATOM   5561  C CA  . ARG C 1 10  ? -4.225  70.728  18.685  1.00   58.13 ? 10   ARG C CA  1 
ATOM   5562  C C   . ARG C 1 10  ? -2.962  70.353  19.454  1.00   56.84 ? 10   ARG C C   1 
ATOM   5563  O O   . ARG C 1 10  ? -2.118  69.580  19.002  1.00   56.47 ? 10   ARG C O   1 
ATOM   5564  C CB  . ARG C 1 10  ? -3.881  71.613  17.488  1.00   58.98 ? 10   ARG C CB  1 
ATOM   5565  C CG  . ARG C 1 10  ? -3.182  70.905  16.358  1.00   61.56 ? 10   ARG C CG  1 
ATOM   5566  C CD  . ARG C 1 10  ? -1.678  71.144  16.347  1.00   66.87 ? 10   ARG C CD  1 
ATOM   5567  N NE  . ARG C 1 10  ? -1.343  72.554  16.197  1.00   69.56 ? 10   ARG C NE  1 
ATOM   5568  C CZ  . ARG C 1 10  ? -1.162  73.389  17.214  1.00   72.78 ? 10   ARG C CZ  1 
ATOM   5569  N NH1 . ARG C 1 10  ? -1.279  72.955  18.464  1.00   75.58 ? 10   ARG C NH1 1 
ATOM   5570  N NH2 . ARG C 1 10  ? -0.865  74.661  16.981  1.00   73.91 ? 10   ARG C NH2 1 
ATOM   5571  N N   . ALA C 1 11  ? -2.862  70.945  20.639  1.00   55.21 ? 11   ALA C N   1 
ATOM   5572  C CA  . ALA C 1 11  ? -1.760  70.729  21.566  1.00   53.45 ? 11   ALA C CA  1 
ATOM   5573  C C   . ALA C 1 11  ? -2.422  70.365  22.892  1.00   51.64 ? 11   ALA C C   1 
ATOM   5574  O O   . ALA C 1 11  ? -3.607  70.647  23.092  1.00   50.57 ? 11   ALA C O   1 
ATOM   5575  C CB  . ALA C 1 11  ? -0.930  72.008  21.713  1.00   51.41 ? 11   ALA C CB  1 
ATOM   5576  N N   . TYR C 1 12  ? -1.668  69.731  23.785  1.00   50.25 ? 12   TYR C N   1 
ATOM   5577  C CA  . TYR C 1 12  ? -2.195  69.333  25.086  1.00   47.73 ? 12   TYR C CA  1 
ATOM   5578  C C   . TYR C 1 12  ? -2.418  70.478  26.052  1.00   45.81 ? 12   TYR C C   1 
ATOM   5579  O O   . TYR C 1 12  ? -1.657  71.441  26.093  1.00   44.11 ? 12   TYR C O   1 
ATOM   5580  C CB  . TYR C 1 12  ? -1.270  68.328  25.757  1.00   48.32 ? 12   TYR C CB  1 
ATOM   5581  C CG  . TYR C 1 12  ? -1.116  67.074  24.970  1.00   49.78 ? 12   TYR C CG  1 
ATOM   5582  C CD1 . TYR C 1 12  ? 0.029   66.844  24.220  1.00   52.68 ? 12   TYR C CD1 1 
ATOM   5583  C CD2 . TYR C 1 12  ? -2.134  66.139  24.932  1.00   51.92 ? 12   TYR C CD2 1 
ATOM   5584  C CE1 . TYR C 1 12  ? 0.161   65.709  23.447  1.00   53.79 ? 12   TYR C CE1 1 
ATOM   5585  C CE2 . TYR C 1 12  ? -2.017  65.004  24.159  1.00   55.45 ? 12   TYR C CE2 1 
ATOM   5586  C CZ  . TYR C 1 12  ? -0.866  64.796  23.418  1.00   55.30 ? 12   TYR C CZ  1 
ATOM   5587  O OH  . TYR C 1 12  ? -0.750  63.681  22.631  1.00   60.30 ? 12   TYR C OH  1 
ATOM   5588  N N   . PRO C 1 13  ? -3.461  70.368  26.868  1.00   46.01 ? 13   PRO C N   1 
ATOM   5589  C CA  . PRO C 1 13  ? -3.794  71.396  27.854  1.00   46.14 ? 13   PRO C CA  1 
ATOM   5590  C C   . PRO C 1 13  ? -2.655  71.606  28.853  1.00   45.30 ? 13   PRO C C   1 
ATOM   5591  O O   . PRO C 1 13  ? -1.796  70.743  29.024  1.00   43.25 ? 13   PRO C O   1 
ATOM   5592  C CB  . PRO C 1 13  ? -5.035  70.823  28.534  1.00   46.82 ? 13   PRO C CB  1 
ATOM   5593  C CG  . PRO C 1 13  ? -5.657  69.969  27.459  1.00   47.56 ? 13   PRO C CG  1 
ATOM   5594  C CD  . PRO C 1 13  ? -4.458  69.283  26.875  1.00   46.97 ? 13   PRO C CD  1 
ATOM   5595  N N   . TYR C 1 14  ? -2.654  72.766  29.497  1.00   45.09 ? 14   TYR C N   1 
ATOM   5596  C CA  . TYR C 1 14  ? -1.664  73.083  30.514  1.00   46.21 ? 14   TYR C CA  1 
ATOM   5597  C C   . TYR C 1 14  ? -2.295  72.762  31.857  1.00   48.24 ? 14   TYR C C   1 
ATOM   5598  O O   . TYR C 1 14  ? -3.410  73.189  32.153  1.00   48.05 ? 14   TYR C O   1 
ATOM   5599  C CB  . TYR C 1 14  ? -1.292  74.572  30.486  1.00   43.23 ? 14   TYR C CB  1 
ATOM   5600  C CG  . TYR C 1 14  ? -0.387  75.016  31.633  1.00   42.88 ? 14   TYR C CG  1 
ATOM   5601  C CD1 . TYR C 1 14  ? 0.887   74.468  31.792  1.00   43.40 ? 14   TYR C CD1 1 
ATOM   5602  C CD2 . TYR C 1 14  ? -0.805  75.987  32.552  1.00   45.78 ? 14   TYR C CD2 1 
ATOM   5603  C CE1 . TYR C 1 14  ? 1.723   74.873  32.838  1.00   41.46 ? 14   TYR C CE1 1 
ATOM   5604  C CE2 . TYR C 1 14  ? 0.031   76.408  33.604  1.00   42.69 ? 14   TYR C CE2 1 
ATOM   5605  C CZ  . TYR C 1 14  ? 1.290   75.846  33.738  1.00   42.72 ? 14   TYR C CZ  1 
ATOM   5606  O OH  . TYR C 1 14  ? 2.116   76.256  34.765  1.00   39.19 ? 14   TYR C OH  1 
ATOM   5607  N N   . GLU C 1 15  ? -1.585  72.004  32.672  1.00   52.26 ? 15   GLU C N   1 
ATOM   5608  C CA  . GLU C 1 15  ? -2.102  71.672  33.990  1.00   56.38 ? 15   GLU C CA  1 
ATOM   5609  C C   . GLU C 1 15  ? -0.977  71.767  35.009  1.00   57.55 ? 15   GLU C C   1 
ATOM   5610  O O   . GLU C 1 15  ? 0.192   71.861  34.634  1.00   58.11 ? 15   GLU C O   1 
ATOM   5611  C CB  . GLU C 1 15  ? -2.699  70.267  33.981  1.00   58.19 ? 15   GLU C CB  1 
ATOM   5612  C CG  . GLU C 1 15  ? -3.935  70.127  33.110  1.00   61.52 ? 15   GLU C CG  1 
ATOM   5613  C CD  . GLU C 1 15  ? -4.312  68.675  32.880  1.00   63.25 ? 15   GLU C CD  1 
ATOM   5614  O OE1 . GLU C 1 15  ? -5.248  68.411  32.083  1.00   62.59 ? 15   GLU C OE1 1 
ATOM   5615  O OE2 . GLU C 1 15  ? -3.665  67.799  33.497  1.00   62.82 ? 15   GLU C OE2 1 
ATOM   5616  N N   . THR C 1 16  ? -1.334  71.783  36.291  1.00   58.78 ? 16   THR C N   1 
ATOM   5617  C CA  . THR C 1 16  ? -0.344  71.837  37.357  1.00   59.95 ? 16   THR C CA  1 
ATOM   5618  C C   . THR C 1 16  ? -0.500  70.562  38.167  1.00   61.81 ? 16   THR C C   1 
ATOM   5619  O O   . THR C 1 16  ? -1.544  70.334  38.786  1.00   63.82 ? 16   THR C O   1 
ATOM   5620  C CB  . THR C 1 16  ? -0.544  73.055  38.298  1.00   59.11 ? 16   THR C CB  1 
ATOM   5621  O OG1 . THR C 1 16  ? -1.889  73.071  38.787  1.00   57.06 ? 16   THR C OG1 1 
ATOM   5622  C CG2 . THR C 1 16  ? -0.249  74.356  37.577  1.00   58.84 ? 16   THR C CG2 1 
ATOM   5623  N N   . GLU C 1 17  ? 0.528   69.722  38.131  1.00   62.51 ? 17   GLU C N   1 
ATOM   5624  C CA  . GLU C 1 17  ? 0.523   68.471  38.873  1.00   63.07 ? 17   GLU C CA  1 
ATOM   5625  C C   . GLU C 1 17  ? 0.121   68.780  40.309  1.00   61.97 ? 17   GLU C C   1 
ATOM   5626  O O   . GLU C 1 17  ? 0.485   69.822  40.854  1.00   62.86 ? 17   GLU C O   1 
ATOM   5627  C CB  . GLU C 1 17  ? 1.924   67.847  38.857  1.00   65.67 ? 17   GLU C CB  1 
ATOM   5628  C CG  . GLU C 1 17  ? 2.494   67.602  37.464  1.00   69.10 ? 17   GLU C CG  1 
ATOM   5629  C CD  . GLU C 1 17  ? 1.910   66.361  36.803  1.00   71.89 ? 17   GLU C CD  1 
ATOM   5630  O OE1 . GLU C 1 17  ? 2.158   66.154  35.591  1.00   72.94 ? 17   GLU C OE1 1 
ATOM   5631  O OE2 . GLU C 1 17  ? 1.215   65.588  37.500  1.00   71.15 ? 17   GLU C OE2 1 
ATOM   5632  N N   . LYS C 1 18  ? -0.643  67.882  40.914  1.00   60.31 ? 18   LYS C N   1 
ATOM   5633  C CA  . LYS C 1 18  ? -1.071  68.060  42.292  1.00   57.82 ? 18   LYS C CA  1 
ATOM   5634  C C   . LYS C 1 18  ? -0.424  66.922  43.093  1.00   55.03 ? 18   LYS C C   1 
ATOM   5635  O O   . LYS C 1 18  ? -0.940  65.803  43.141  1.00   54.90 ? 18   LYS C O   1 
ATOM   5636  C CB  . LYS C 1 18  ? -2.599  68.006  42.357  1.00   59.12 ? 18   LYS C CB  1 
ATOM   5637  C CG  . LYS C 1 18  ? -3.283  68.994  41.402  1.00   58.84 ? 18   LYS C CG  1 
ATOM   5638  C CD  . LYS C 1 18  ? -4.770  68.673  41.164  1.00   59.65 ? 18   LYS C CD  1 
ATOM   5639  C CE  . LYS C 1 18  ? -5.642  68.926  42.396  1.00   60.56 ? 18   LYS C CE  1 
ATOM   5640  N NZ  . LYS C 1 18  ? -7.067  68.512  42.194  1.00   60.53 ? 18   LYS C NZ  1 
ATOM   5641  N N   . ARG C 1 19  ? 0.719   67.232  43.705  1.00   51.19 ? 19   ARG C N   1 
ATOM   5642  C CA  . ARG C 1 19  ? 1.512   66.277  44.481  1.00   47.66 ? 19   ARG C CA  1 
ATOM   5643  C C   . ARG C 1 19  ? 0.861   65.814  45.782  1.00   45.57 ? 19   ARG C C   1 
ATOM   5644  O O   . ARG C 1 19  ? 0.129   66.567  46.425  1.00   43.75 ? 19   ARG C O   1 
ATOM   5645  C CB  . ARG C 1 19  ? 2.870   66.888  44.824  1.00   46.55 ? 19   ARG C CB  1 
ATOM   5646  C CG  . ARG C 1 19  ? 3.531   67.679  43.713  1.00   47.11 ? 19   ARG C CG  1 
ATOM   5647  C CD  . ARG C 1 19  ? 4.578   68.609  44.311  1.00   47.19 ? 19   ARG C CD  1 
ATOM   5648  N NE  . ARG C 1 19  ? 5.655   67.879  44.974  1.00   47.56 ? 19   ARG C NE  1 
ATOM   5649  C CZ  . ARG C 1 19  ? 6.702   67.363  44.338  1.00   49.63 ? 19   ARG C CZ  1 
ATOM   5650  N NH1 . ARG C 1 19  ? 6.813   67.503  43.019  1.00   46.50 ? 19   ARG C NH1 1 
ATOM   5651  N NH2 . ARG C 1 19  ? 7.635   66.708  45.019  1.00   48.59 ? 19   ARG C NH2 1 
ATOM   5652  N N   . ASP C 1 20  ? 1.162   64.577  46.171  1.00   42.27 ? 20   ASP C N   1 
ATOM   5653  C CA  . ASP C 1 20  ? 0.638   63.990  47.397  1.00   40.91 ? 20   ASP C CA  1 
ATOM   5654  C C   . ASP C 1 20  ? 1.751   64.011  48.446  1.00   38.81 ? 20   ASP C C   1 
ATOM   5655  O O   . ASP C 1 20  ? 2.889   64.341  48.143  1.00   38.24 ? 20   ASP C O   1 
ATOM   5656  C CB  . ASP C 1 20  ? 0.190   62.544  47.148  1.00   39.76 ? 20   ASP C CB  1 
ATOM   5657  C CG  . ASP C 1 20  ? -1.065  62.179  47.912  1.00   38.86 ? 20   ASP C CG  1 
ATOM   5658  O OD1 . ASP C 1 20  ? -1.136  62.434  49.132  1.00   37.83 ? 20   ASP C OD1 1 
ATOM   5659  O OD2 . ASP C 1 20  ? -1.988  61.627  47.287  1.00   38.40 ? 20   ASP C OD2 1 
ATOM   5660  N N   . LYS C 1 21  ? 1.410   63.653  49.674  1.00   38.62 ? 21   LYS C N   1 
ATOM   5661  C CA  . LYS C 1 21  ? 2.375   63.628  50.761  1.00   39.88 ? 21   LYS C CA  1 
ATOM   5662  C C   . LYS C 1 21  ? 3.678   62.932  50.346  1.00   37.91 ? 21   LYS C C   1 
ATOM   5663  O O   . LYS C 1 21  ? 4.770   63.473  50.521  1.00   36.11 ? 21   LYS C O   1 
ATOM   5664  C CB  . LYS C 1 21  ? 1.760   62.924  51.975  1.00   40.73 ? 21   LYS C CB  1 
ATOM   5665  C CG  . LYS C 1 21  ? 0.667   63.727  52.672  1.00   47.70 ? 21   LYS C CG  1 
ATOM   5666  C CD  . LYS C 1 21  ? -0.483  64.157  51.768  1.00   52.18 ? 21   LYS C CD  1 
ATOM   5667  C CE  . LYS C 1 21  ? -1.541  64.930  52.571  1.00   56.21 ? 21   LYS C CE  1 
ATOM   5668  N NZ  . LYS C 1 21  ? -2.684  65.478  51.760  1.00   59.63 ? 21   LYS C NZ  1 
ATOM   5669  N N   . THR C 1 22  ? 3.554   61.731  49.798  1.00   35.56 ? 22   THR C N   1 
ATOM   5670  C CA  . THR C 1 22  ? 4.722   61.003  49.351  1.00   36.19 ? 22   THR C CA  1 
ATOM   5671  C C   . THR C 1 22  ? 4.640   60.905  47.804  1.00   34.81 ? 22   THR C C   1 
ATOM   5672  O O   . THR C 1 22  ? 3.968   60.038  47.236  1.00   34.33 ? 22   THR C O   1 
ATOM   5673  C CB  . THR C 1 22  ? 4.790   59.634  50.082  1.00   36.13 ? 22   THR C CB  1 
ATOM   5674  O OG1 . THR C 1 22  ? 5.862   58.841  49.560  1.00   38.83 ? 22   THR C OG1 1 
ATOM   5675  C CG2 . THR C 1 22  ? 3.483   58.896  49.946  1.00   44.20 ? 22   THR C CG2 1 
ATOM   5676  N N   . TYR C 1 23  ? 5.336   61.836  47.152  1.00   31.02 ? 23   TYR C N   1 
ATOM   5677  C CA  . TYR C 1 23  ? 5.381   61.984  45.709  1.00   28.75 ? 23   TYR C CA  1 
ATOM   5678  C C   . TYR C 1 23  ? 6.630   61.356  45.070  1.00   27.94 ? 23   TYR C C   1 
ATOM   5679  O O   . TYR C 1 23  ? 7.754   61.808  45.308  1.00   28.46 ? 23   TYR C O   1 
ATOM   5680  C CB  . TYR C 1 23  ? 5.316   63.488  45.381  1.00   29.49 ? 23   TYR C CB  1 
ATOM   5681  C CG  . TYR C 1 23  ? 4.952   63.796  43.953  1.00   29.62 ? 23   TYR C CG  1 
ATOM   5682  C CD1 . TYR C 1 23  ? 3.630   63.721  43.522  1.00   31.43 ? 23   TYR C CD1 1 
ATOM   5683  C CD2 . TYR C 1 23  ? 5.932   64.116  43.017  1.00   28.09 ? 23   TYR C CD2 1 
ATOM   5684  C CE1 . TYR C 1 23  ? 3.293   63.959  42.186  1.00   35.72 ? 23   TYR C CE1 1 
ATOM   5685  C CE2 . TYR C 1 23  ? 5.611   64.347  41.687  1.00   31.86 ? 23   TYR C CE2 1 
ATOM   5686  C CZ  . TYR C 1 23  ? 4.292   64.269  41.276  1.00   34.88 ? 23   TYR C CZ  1 
ATOM   5687  O OH  . TYR C 1 23  ? 3.976   64.486  39.955  1.00   41.28 ? 23   TYR C OH  1 
ATOM   5688  N N   . LEU C 1 24  ? 6.418   60.331  44.242  1.00   26.62 ? 24   LEU C N   1 
ATOM   5689  C CA  . LEU C 1 24  ? 7.498   59.597  43.560  1.00   24.58 ? 24   LEU C CA  1 
ATOM   5690  C C   . LEU C 1 24  ? 7.160   59.466  42.098  1.00   26.16 ? 24   LEU C C   1 
ATOM   5691  O O   . LEU C 1 24  ? 7.370   58.389  41.514  1.00   24.56 ? 24   LEU C O   1 
ATOM   5692  C CB  . LEU C 1 24  ? 7.610   58.171  44.103  1.00   21.33 ? 24   LEU C CB  1 
ATOM   5693  C CG  . LEU C 1 24  ? 7.693   58.038  45.614  1.00   22.79 ? 24   LEU C CG  1 
ATOM   5694  C CD1 . LEU C 1 24  ? 7.642   56.570  46.060  1.00   17.52 ? 24   LEU C CD1 1 
ATOM   5695  C CD2 . LEU C 1 24  ? 8.981   58.682  46.067  1.00   25.56 ? 24   LEU C CD2 1 
ATOM   5696  N N   . ALA C 1 25  ? 6.653   60.548  41.508  1.00   25.48 ? 25   ALA C N   1 
ATOM   5697  C CA  . ALA C 1 25  ? 6.211   60.495  40.124  1.00   25.71 ? 25   ALA C CA  1 
ATOM   5698  C C   . ALA C 1 25  ? 6.899   61.392  39.127  1.00   25.80 ? 25   ALA C C   1 
ATOM   5699  O O   . ALA C 1 25  ? 6.585   61.332  37.948  1.00   23.97 ? 25   ALA C O   1 
ATOM   5700  C CB  . ALA C 1 25  ? 4.697   60.744  40.069  1.00   24.61 ? 25   ALA C CB  1 
ATOM   5701  N N   . LEU C 1 26  ? 7.821   62.234  39.574  1.00   24.59 ? 26   LEU C N   1 
ATOM   5702  C CA  . LEU C 1 26  ? 8.502   63.096  38.626  1.00   23.22 ? 26   LEU C CA  1 
ATOM   5703  C C   . LEU C 1 26  ? 10.021  62.901  38.623  1.00   23.45 ? 26   LEU C C   1 
ATOM   5704  O O   . LEU C 1 26  ? 10.758  63.789  38.207  1.00   22.05 ? 26   LEU C O   1 
ATOM   5705  C CB  . LEU C 1 26  ? 8.149   64.565  38.876  1.00   20.90 ? 26   LEU C CB  1 
ATOM   5706  C CG  . LEU C 1 26  ? 6.774   65.078  38.403  1.00   23.64 ? 26   LEU C CG  1 
ATOM   5707  C CD1 . LEU C 1 26  ? 6.670   66.574  38.683  1.00   14.17 ? 26   LEU C CD1 1 
ATOM   5708  C CD2 . LEU C 1 26  ? 6.577   64.830  36.886  1.00   18.13 ? 26   LEU C CD2 1 
ATOM   5709  N N   . ASN C 1 27  ? 10.490  61.733  39.072  1.00   22.62 ? 27   ASN C N   1 
ATOM   5710  C CA  . ASN C 1 27  ? 11.920  61.451  39.092  1.00   23.63 ? 27   ASN C CA  1 
ATOM   5711  C C   . ASN C 1 27  ? 12.751  62.601  39.691  1.00   24.18 ? 27   ASN C C   1 
ATOM   5712  O O   . ASN C 1 27  ? 13.872  62.873  39.249  1.00   21.44 ? 27   ASN C O   1 
ATOM   5713  C CB  . ASN C 1 27  ? 12.421  61.119  37.672  1.00   24.20 ? 27   ASN C CB  1 
ATOM   5714  C CG  . ASN C 1 27  ? 11.816  59.816  37.116  1.00   22.15 ? 27   ASN C CG  1 
ATOM   5715  O OD1 . ASN C 1 27  ? 11.741  59.598  35.903  1.00   17.39 ? 27   ASN C OD1 1 
ATOM   5716  N ND2 . ASN C 1 27  ? 11.395  58.951  38.016  1.00   16.19 ? 27   ASN C ND2 1 
ATOM   5717  N N   . GLU C 1 28  ? 12.178  63.276  40.692  1.00   23.69 ? 28   GLU C N   1 
ATOM   5718  C CA  . GLU C 1 28  ? 12.836  64.359  41.420  1.00   25.23 ? 28   GLU C CA  1 
ATOM   5719  C C   . GLU C 1 28  ? 13.747  63.752  42.503  1.00   25.52 ? 28   GLU C C   1 
ATOM   5720  O O   . GLU C 1 28  ? 13.472  62.685  43.073  1.00   25.82 ? 28   GLU C O   1 
ATOM   5721  C CB  . GLU C 1 28  ? 11.798  65.265  42.110  1.00   20.76 ? 28   GLU C CB  1 
ATOM   5722  C CG  . GLU C 1 28  ? 10.856  65.980  41.137  1.00   25.63 ? 28   GLU C CG  1 
ATOM   5723  C CD  . GLU C 1 28  ? 9.556   66.427  41.787  1.00   25.97 ? 28   GLU C CD  1 
ATOM   5724  O OE1 . GLU C 1 28  ? 8.938   65.619  42.519  1.00   29.30 ? 28   GLU C OE1 1 
ATOM   5725  O OE2 . GLU C 1 28  ? 9.139   67.578  41.563  1.00   29.39 ? 28   GLU C OE2 1 
ATOM   5726  N N   . ASN C 1 29  ? 14.846  64.428  42.783  1.00   23.42 ? 29   ASN C N   1 
ATOM   5727  C CA  . ASN C 1 29  ? 15.738  63.941  43.807  1.00   23.35 ? 29   ASN C CA  1 
ATOM   5728  C C   . ASN C 1 29  ? 15.042  63.902  45.182  1.00   22.72 ? 29   ASN C C   1 
ATOM   5729  O O   . ASN C 1 29  ? 14.244  64.775  45.516  1.00   20.65 ? 29   ASN C O   1 
ATOM   5730  C CB  . ASN C 1 29  ? 16.984  64.815  43.874  1.00   21.34 ? 29   ASN C CB  1 
ATOM   5731  C CG  . ASN C 1 29  ? 18.097  64.142  44.623  1.00   23.80 ? 29   ASN C CG  1 
ATOM   5732  O OD1 . ASN C 1 29  ? 18.118  64.128  45.872  1.00   23.02 ? 29   ASN C OD1 1 
ATOM   5733  N ND2 . ASN C 1 29  ? 19.020  63.550  43.879  1.00   19.75 ? 29   ASN C ND2 1 
ATOM   5734  N N   . PRO C 1 30  ? 15.341  62.878  46.003  1.00   24.10 ? 30   PRO C N   1 
ATOM   5735  C CA  . PRO C 1 30  ? 14.661  62.877  47.294  1.00   24.45 ? 30   PRO C CA  1 
ATOM   5736  C C   . PRO C 1 30  ? 15.194  63.913  48.262  1.00   22.45 ? 30   PRO C C   1 
ATOM   5737  O O   . PRO C 1 30  ? 14.473  64.384  49.116  1.00   22.04 ? 30   PRO C O   1 
ATOM   5738  C CB  . PRO C 1 30  ? 14.863  61.436  47.801  1.00   22.98 ? 30   PRO C CB  1 
ATOM   5739  C CG  . PRO C 1 30  ? 16.198  61.064  47.233  1.00   24.24 ? 30   PRO C CG  1 
ATOM   5740  C CD  . PRO C 1 30  ? 16.102  61.621  45.807  1.00   26.05 ? 30   PRO C CD  1 
ATOM   5741  N N   . PHE C 1 31  ? 16.442  64.305  48.076  1.00   22.94 ? 31   PHE C N   1 
ATOM   5742  C CA  . PHE C 1 31  ? 17.053  65.229  48.999  1.00   23.42 ? 31   PHE C CA  1 
ATOM   5743  C C   . PHE C 1 31  ? 17.032  66.732  48.670  1.00   23.88 ? 31   PHE C C   1 
ATOM   5744  O O   . PHE C 1 31  ? 17.153  67.131  47.517  1.00   25.47 ? 31   PHE C O   1 
ATOM   5745  C CB  . PHE C 1 31  ? 18.459  64.694  49.255  1.00   23.93 ? 31   PHE C CB  1 
ATOM   5746  C CG  . PHE C 1 31  ? 18.473  63.227  49.665  1.00   20.79 ? 31   PHE C CG  1 
ATOM   5747  C CD1 . PHE C 1 31  ? 19.180  62.275  48.913  1.00   22.20 ? 31   PHE C CD1 1 
ATOM   5748  C CD2 . PHE C 1 31  ? 17.786  62.801  50.798  1.00   17.55 ? 31   PHE C CD2 1 
ATOM   5749  C CE1 . PHE C 1 31  ? 19.215  60.894  49.279  1.00   19.16 ? 31   PHE C CE1 1 
ATOM   5750  C CE2 . PHE C 1 31  ? 17.802  61.439  51.179  1.00   25.81 ? 31   PHE C CE2 1 
ATOM   5751  C CZ  . PHE C 1 31  ? 18.535  60.474  50.399  1.00   19.83 ? 31   PHE C CZ  1 
ATOM   5752  N N   . PRO C 1 32  ? 16.844  67.587  49.695  1.00   22.58 ? 32   PRO C N   1 
ATOM   5753  C CA  . PRO C 1 32  ? 16.813  69.034  49.465  1.00   25.09 ? 32   PRO C CA  1 
ATOM   5754  C C   . PRO C 1 32  ? 18.216  69.479  49.111  1.00   24.86 ? 32   PRO C C   1 
ATOM   5755  O O   . PRO C 1 32  ? 19.191  68.803  49.447  1.00   23.95 ? 32   PRO C O   1 
ATOM   5756  C CB  . PRO C 1 32  ? 16.373  69.592  50.812  1.00   27.68 ? 32   PRO C CB  1 
ATOM   5757  C CG  . PRO C 1 32  ? 17.059  68.614  51.770  1.00   27.78 ? 32   PRO C CG  1 
ATOM   5758  C CD  . PRO C 1 32  ? 16.739  67.288  51.134  1.00   24.67 ? 32   PRO C CD  1 
ATOM   5759  N N   . PHE C 1 33  ? 18.319  70.609  48.429  1.00   23.09 ? 33   PHE C N   1 
ATOM   5760  C CA  . PHE C 1 33  ? 19.623  71.108  48.055  1.00   25.45 ? 33   PHE C CA  1 
ATOM   5761  C C   . PHE C 1 33  ? 20.340  71.444  49.374  1.00   25.42 ? 33   PHE C C   1 
ATOM   5762  O O   . PHE C 1 33  ? 19.749  72.036  50.280  1.00   25.90 ? 33   PHE C O   1 
ATOM   5763  C CB  . PHE C 1 33  ? 19.467  72.335  47.165  1.00   26.40 ? 33   PHE C CB  1 
ATOM   5764  C CG  . PHE C 1 33  ? 20.725  72.743  46.471  1.00   23.36 ? 33   PHE C CG  1 
ATOM   5765  C CD1 . PHE C 1 33  ? 21.194  72.026  45.392  1.00   22.86 ? 33   PHE C CD1 1 
ATOM   5766  C CD2 . PHE C 1 33  ? 21.430  73.869  46.878  1.00   19.75 ? 33   PHE C CD2 1 
ATOM   5767  C CE1 . PHE C 1 33  ? 22.342  72.423  44.718  1.00   22.05 ? 33   PHE C CE1 1 
ATOM   5768  C CE2 . PHE C 1 33  ? 22.583  74.265  46.201  1.00   21.60 ? 33   PHE C CE2 1 
ATOM   5769  C CZ  . PHE C 1 33  ? 23.032  73.544  45.125  1.00   18.68 ? 33   PHE C CZ  1 
ATOM   5770  N N   . PRO C 1 34  ? 21.617  71.046  49.502  1.00   26.56 ? 34   PRO C N   1 
ATOM   5771  C CA  . PRO C 1 34  ? 22.384  71.319  50.731  1.00   25.47 ? 34   PRO C CA  1 
ATOM   5772  C C   . PRO C 1 34  ? 22.192  72.747  51.229  1.00   27.44 ? 34   PRO C C   1 
ATOM   5773  O O   . PRO C 1 34  ? 22.481  73.721  50.532  1.00   27.93 ? 34   PRO C O   1 
ATOM   5774  C CB  . PRO C 1 34  ? 23.816  71.037  50.306  1.00   25.69 ? 34   PRO C CB  1 
ATOM   5775  C CG  . PRO C 1 34  ? 23.656  69.954  49.263  1.00   23.75 ? 34   PRO C CG  1 
ATOM   5776  C CD  . PRO C 1 34  ? 22.479  70.459  48.456  1.00   22.21 ? 34   PRO C CD  1 
ATOM   5777  N N   . GLU C 1 35  ? 21.689  72.869  52.444  1.00   28.76 ? 35   GLU C N   1 
ATOM   5778  C CA  . GLU C 1 35  ? 21.449  74.173  53.052  1.00   30.37 ? 35   GLU C CA  1 
ATOM   5779  C C   . GLU C 1 35  ? 22.696  75.044  52.966  1.00   28.63 ? 35   GLU C C   1 
ATOM   5780  O O   . GLU C 1 35  ? 22.623  76.229  52.644  1.00   28.55 ? 35   GLU C O   1 
ATOM   5781  C CB  . GLU C 1 35  ? 21.058  73.995  54.520  1.00   34.55 ? 35   GLU C CB  1 
ATOM   5782  C CG  . GLU C 1 35  ? 20.243  75.137  55.082  1.00   42.99 ? 35   GLU C CG  1 
ATOM   5783  C CD  . GLU C 1 35  ? 18.865  75.218  54.452  1.00   51.03 ? 35   GLU C CD  1 
ATOM   5784  O OE1 . GLU C 1 35  ? 18.141  74.191  54.471  1.00   54.18 ? 35   GLU C OE1 1 
ATOM   5785  O OE2 . GLU C 1 35  ? 18.506  76.301  53.942  1.00   51.18 ? 35   GLU C OE2 1 
ATOM   5786  N N   . ASP C 1 36  ? 23.843  74.460  53.273  1.00   27.11 ? 36   ASP C N   1 
ATOM   5787  C CA  . ASP C 1 36  ? 25.082  75.215  53.207  1.00   24.32 ? 36   ASP C CA  1 
ATOM   5788  C C   . ASP C 1 36  ? 25.445  75.612  51.783  1.00   22.41 ? 36   ASP C C   1 
ATOM   5789  O O   . ASP C 1 36  ? 26.116  76.604  51.575  1.00   22.79 ? 36   ASP C O   1 
ATOM   5790  C CB  . ASP C 1 36  ? 26.229  74.427  53.851  1.00   26.60 ? 36   ASP C CB  1 
ATOM   5791  C CG  . ASP C 1 36  ? 26.328  72.997  53.341  1.00   30.96 ? 36   ASP C CG  1 
ATOM   5792  O OD1 . ASP C 1 36  ? 25.312  72.253  53.438  1.00   32.30 ? 36   ASP C OD1 1 
ATOM   5793  O OD2 . ASP C 1 36  ? 27.425  72.628  52.855  1.00   30.70 ? 36   ASP C OD2 1 
ATOM   5794  N N   . LEU C 1 37  ? 25.003  74.858  50.789  1.00   21.92 ? 37   LEU C N   1 
ATOM   5795  C CA  . LEU C 1 37  ? 25.342  75.252  49.429  1.00   24.26 ? 37   LEU C CA  1 
ATOM   5796  C C   . LEU C 1 37  ? 24.438  76.414  49.004  1.00   24.86 ? 37   LEU C C   1 
ATOM   5797  O O   . LEU C 1 37  ? 24.810  77.236  48.161  1.00   27.73 ? 37   LEU C O   1 
ATOM   5798  C CB  . LEU C 1 37  ? 25.252  74.061  48.477  1.00   22.55 ? 37   LEU C CB  1 
ATOM   5799  C CG  . LEU C 1 37  ? 26.332  73.012  48.739  1.00   19.63 ? 37   LEU C CG  1 
ATOM   5800  C CD1 . LEU C 1 37  ? 26.409  72.025  47.576  1.00   18.20 ? 37   LEU C CD1 1 
ATOM   5801  C CD2 . LEU C 1 37  ? 27.671  73.698  48.886  1.00   18.05 ? 37   LEU C CD2 1 
ATOM   5802  N N   . VAL C 1 38  ? 23.264  76.505  49.626  1.00   25.71 ? 38   VAL C N   1 
ATOM   5803  C CA  . VAL C 1 38  ? 22.331  77.601  49.369  1.00   22.17 ? 38   VAL C CA  1 
ATOM   5804  C C   . VAL C 1 38  ? 22.996  78.873  49.894  1.00   24.78 ? 38   VAL C C   1 
ATOM   5805  O O   . VAL C 1 38  ? 22.909  79.964  49.296  1.00   24.21 ? 38   VAL C O   1 
ATOM   5806  C CB  . VAL C 1 38  ? 21.023  77.434  50.164  1.00   20.48 ? 38   VAL C CB  1 
ATOM   5807  C CG1 . VAL C 1 38  ? 20.120  78.664  49.964  1.00   15.91 ? 38   VAL C CG1 1 
ATOM   5808  C CG2 . VAL C 1 38  ? 20.317  76.170  49.732  1.00   21.76 ? 38   VAL C CG2 1 
ATOM   5809  N N   . ASP C 1 39  ? 23.640  78.708  51.044  1.00   23.68 ? 39   ASP C N   1 
ATOM   5810  C CA  . ASP C 1 39  ? 24.301  79.794  51.719  1.00   25.57 ? 39   ASP C CA  1 
ATOM   5811  C C   . ASP C 1 39  ? 25.503  80.267  50.906  1.00   28.10 ? 39   ASP C C   1 
ATOM   5812  O O   . ASP C 1 39  ? 25.825  81.462  50.877  1.00   27.95 ? 39   ASP C O   1 
ATOM   5813  C CB  . ASP C 1 39  ? 24.726  79.343  53.116  1.00   23.90 ? 39   ASP C CB  1 
ATOM   5814  C CG  . ASP C 1 39  ? 25.331  80.480  53.923  1.00   29.64 ? 39   ASP C CG  1 
ATOM   5815  O OD1 . ASP C 1 39  ? 26.541  80.742  53.792  1.00   29.66 ? 39   ASP C OD1 1 
ATOM   5816  O OD2 . ASP C 1 39  ? 24.593  81.141  54.685  1.00   31.71 ? 39   ASP C OD2 1 
ATOM   5817  N N   . GLU C 1 40  ? 26.170  79.330  50.239  1.00   28.95 ? 40   GLU C N   1 
ATOM   5818  C CA  . GLU C 1 40  ? 27.311  79.694  49.417  1.00   26.33 ? 40   GLU C CA  1 
ATOM   5819  C C   . GLU C 1 40  ? 26.866  80.599  48.270  1.00   25.83 ? 40   GLU C C   1 
ATOM   5820  O O   . GLU C 1 40  ? 27.529  81.607  47.963  1.00   25.19 ? 40   GLU C O   1 
ATOM   5821  C CB  . GLU C 1 40  ? 28.000  78.456  48.841  1.00   27.07 ? 40   GLU C CB  1 
ATOM   5822  C CG  . GLU C 1 40  ? 29.128  78.820  47.862  1.00   29.36 ? 40   GLU C CG  1 
ATOM   5823  C CD  . GLU C 1 40  ? 30.134  77.696  47.632  1.00   30.82 ? 40   GLU C CD  1 
ATOM   5824  O OE1 . GLU C 1 40  ? 30.870  77.764  46.625  1.00   34.86 ? 40   GLU C OE1 1 
ATOM   5825  O OE2 . GLU C 1 40  ? 30.211  76.759  48.450  1.00   34.09 ? 40   GLU C OE2 1 
ATOM   5826  N N   . VAL C 1 41  ? 25.763  80.224  47.623  1.00   23.30 ? 41   VAL C N   1 
ATOM   5827  C CA  . VAL C 1 41  ? 25.221  80.996  46.504  1.00   21.74 ? 41   VAL C CA  1 
ATOM   5828  C C   . VAL C 1 41  ? 24.877  82.407  47.006  1.00   22.91 ? 41   VAL C C   1 
ATOM   5829  O O   . VAL C 1 41  ? 25.261  83.426  46.399  1.00   19.06 ? 41   VAL C O   1 
ATOM   5830  C CB  . VAL C 1 41  ? 23.942  80.328  45.973  1.00   24.78 ? 41   VAL C CB  1 
ATOM   5831  C CG1 . VAL C 1 41  ? 23.178  81.287  45.078  1.00   24.82 ? 41   VAL C CG1 1 
ATOM   5832  C CG2 . VAL C 1 41  ? 24.287  79.041  45.215  1.00   20.88 ? 41   VAL C CG2 1 
ATOM   5833  N N   . PHE C 1 42  ? 24.151  82.437  48.125  1.00   21.80 ? 42   PHE C N   1 
ATOM   5834  C CA  . PHE C 1 42  ? 23.719  83.662  48.786  1.00   21.74 ? 42   PHE C CA  1 
ATOM   5835  C C   . PHE C 1 42  ? 24.902  84.598  49.078  1.00   22.20 ? 42   PHE C C   1 
ATOM   5836  O O   . PHE C 1 42  ? 24.814  85.832  48.886  1.00   18.06 ? 42   PHE C O   1 
ATOM   5837  C CB  . PHE C 1 42  ? 23.055  83.311  50.116  1.00   22.73 ? 42   PHE C CB  1 
ATOM   5838  C CG  . PHE C 1 42  ? 22.621  84.507  50.910  1.00   22.80 ? 42   PHE C CG  1 
ATOM   5839  C CD1 . PHE C 1 42  ? 22.815  84.549  52.288  1.00   23.58 ? 42   PHE C CD1 1 
ATOM   5840  C CD2 . PHE C 1 42  ? 21.948  85.550  50.292  1.00   22.75 ? 42   PHE C CD2 1 
ATOM   5841  C CE1 . PHE C 1 42  ? 22.337  85.610  53.043  1.00   25.32 ? 42   PHE C CE1 1 
ATOM   5842  C CE2 . PHE C 1 42  ? 21.461  86.619  51.029  1.00   25.80 ? 42   PHE C CE2 1 
ATOM   5843  C CZ  . PHE C 1 42  ? 21.652  86.654  52.408  1.00   28.71 ? 42   PHE C CZ  1 
ATOM   5844  N N   . ARG C 1 43  ? 25.984  84.001  49.580  1.00   19.15 ? 43   ARG C N   1 
ATOM   5845  C CA  . ARG C 1 43  ? 27.184  84.738  49.901  1.00   23.87 ? 43   ARG C CA  1 
ATOM   5846  C C   . ARG C 1 43  ? 27.845  85.238  48.625  1.00   25.77 ? 43   ARG C C   1 
ATOM   5847  O O   . ARG C 1 43  ? 28.202  86.412  48.524  1.00   27.01 ? 43   ARG C O   1 
ATOM   5848  C CB  . ARG C 1 43  ? 28.162  83.859  50.700  1.00   20.90 ? 43   ARG C CB  1 
ATOM   5849  C CG  . ARG C 1 43  ? 27.796  83.765  52.165  1.00   25.06 ? 43   ARG C CG  1 
ATOM   5850  C CD  . ARG C 1 43  ? 27.449  85.158  52.658  1.00   30.35 ? 43   ARG C CD  1 
ATOM   5851  N NE  . ARG C 1 43  ? 26.850  85.219  53.988  1.00   35.88 ? 43   ARG C NE  1 
ATOM   5852  C CZ  . ARG C 1 43  ? 26.018  84.318  54.495  1.00   35.27 ? 43   ARG C CZ  1 
ATOM   5853  N NH1 . ARG C 1 43  ? 25.522  84.490  55.708  1.00   38.84 ? 43   ARG C NH1 1 
ATOM   5854  N NH2 . ARG C 1 43  ? 25.715  83.232  53.817  1.00   41.72 ? 43   ARG C NH2 1 
ATOM   5855  N N   . ARG C 1 44  ? 27.971  84.346  47.647  1.00   28.56 ? 44   ARG C N   1 
ATOM   5856  C CA  . ARG C 1 44  ? 28.624  84.667  46.389  1.00   28.45 ? 44   ARG C CA  1 
ATOM   5857  C C   . ARG C 1 44  ? 27.854  85.665  45.548  1.00   30.93 ? 44   ARG C C   1 
ATOM   5858  O O   . ARG C 1 44  ? 28.451  86.382  44.744  1.00   31.59 ? 44   ARG C O   1 
ATOM   5859  C CB  . ARG C 1 44  ? 28.856  83.387  45.570  1.00   30.60 ? 44   ARG C CB  1 
ATOM   5860  C CG  . ARG C 1 44  ? 30.013  82.507  46.051  1.00   34.40 ? 44   ARG C CG  1 
ATOM   5861  C CD  . ARG C 1 44  ? 30.873  82.081  44.854  1.00   42.47 ? 44   ARG C CD  1 
ATOM   5862  N NE  . ARG C 1 44  ? 30.732  80.661  44.536  1.00   45.81 ? 44   ARG C NE  1 
ATOM   5863  C CZ  . ARG C 1 44  ? 30.664  80.166  43.301  1.00   46.66 ? 44   ARG C CZ  1 
ATOM   5864  N NH1 . ARG C 1 44  ? 30.717  80.974  42.242  1.00   44.63 ? 44   ARG C NH1 1 
ATOM   5865  N NH2 . ARG C 1 44  ? 30.539  78.855  43.128  1.00   44.40 ? 44   ARG C NH2 1 
ATOM   5866  N N   . LEU C 1 45  ? 26.537  85.718  45.750  1.00   30.28 ? 45   LEU C N   1 
ATOM   5867  C CA  . LEU C 1 45  ? 25.649  86.583  44.977  1.00   29.56 ? 45   LEU C CA  1 
ATOM   5868  C C   . LEU C 1 45  ? 26.039  88.068  44.895  1.00   31.02 ? 45   LEU C C   1 
ATOM   5869  O O   . LEU C 1 45  ? 26.289  88.720  45.907  1.00   31.51 ? 45   LEU C O   1 
ATOM   5870  C CB  . LEU C 1 45  ? 24.220  86.432  45.521  1.00   27.47 ? 45   LEU C CB  1 
ATOM   5871  C CG  . LEU C 1 45  ? 23.021  86.952  44.724  1.00   26.20 ? 45   LEU C CG  1 
ATOM   5872  C CD1 . LEU C 1 45  ? 21.734  86.295  45.229  1.00   22.25 ? 45   LEU C CD1 1 
ATOM   5873  C CD2 . LEU C 1 45  ? 22.944  88.470  44.859  1.00   24.26 ? 45   LEU C CD2 1 
ATOM   5874  N N   . ASN C 1 46  ? 26.096  88.594  43.673  1.00   32.91 ? 46   ASN C N   1 
ATOM   5875  C CA  . ASN C 1 46  ? 26.427  89.998  43.451  1.00   32.70 ? 46   ASN C CA  1 
ATOM   5876  C C   . ASN C 1 46  ? 25.167  90.733  43.021  1.00   32.54 ? 46   ASN C C   1 
ATOM   5877  O O   . ASN C 1 46  ? 24.796  90.735  41.847  1.00   33.94 ? 46   ASN C O   1 
ATOM   5878  C CB  . ASN C 1 46  ? 27.511  90.157  42.382  1.00   33.85 ? 46   ASN C CB  1 
ATOM   5879  C CG  . ASN C 1 46  ? 28.007  91.598  42.263  1.00   35.90 ? 46   ASN C CG  1 
ATOM   5880  O OD1 . ASN C 1 46  ? 27.247  92.499  41.934  1.00   36.22 ? 46   ASN C OD1 1 
ATOM   5881  N ND2 . ASN C 1 46  ? 29.294  91.815  42.544  1.00   40.31 ? 46   ASN C ND2 1 
ATOM   5882  N N   . SER C 1 47  ? 24.530  91.366  43.994  1.00   31.66 ? 47   SER C N   1 
ATOM   5883  C CA  . SER C 1 47  ? 23.294  92.094  43.794  1.00   29.41 ? 47   SER C CA  1 
ATOM   5884  C C   . SER C 1 47  ? 23.300  93.040  42.604  1.00   29.61 ? 47   SER C C   1 
ATOM   5885  O O   . SER C 1 47  ? 22.236  93.364  42.067  1.00   31.14 ? 47   SER C O   1 
ATOM   5886  C CB  . SER C 1 47  ? 22.981  92.872  45.058  1.00   31.77 ? 47   SER C CB  1 
ATOM   5887  O OG  . SER C 1 47  ? 21.702  93.452  44.985  1.00   42.22 ? 47   SER C OG  1 
ATOM   5888  N N   . ASP C 1 48  ? 24.482  93.482  42.176  1.00   27.64 ? 48   ASP C N   1 
ATOM   5889  C CA  . ASP C 1 48  ? 24.568  94.428  41.065  1.00   26.68 ? 48   ASP C CA  1 
ATOM   5890  C C   . ASP C 1 48  ? 24.384  93.736  39.732  1.00   24.81 ? 48   ASP C C   1 
ATOM   5891  O O   . ASP C 1 48  ? 23.951  94.339  38.752  1.00   23.04 ? 48   ASP C O   1 
ATOM   5892  C CB  . ASP C 1 48  ? 25.917  95.157  41.066  1.00   27.87 ? 48   ASP C CB  1 
ATOM   5893  C CG  . ASP C 1 48  ? 25.909  96.406  40.180  1.00   29.83 ? 48   ASP C CG  1 
ATOM   5894  O OD1 . ASP C 1 48  ? 26.998  96.856  39.759  1.00   37.92 ? 48   ASP C OD1 1 
ATOM   5895  O OD2 . ASP C 1 48  ? 24.816  96.944  39.910  1.00   25.26 ? 48   ASP C OD2 1 
ATOM   5896  N N   . ALA C 1 49  ? 24.733  92.458  39.700  1.00   24.11 ? 49   ALA C N   1 
ATOM   5897  C CA  . ALA C 1 49  ? 24.588  91.677  38.491  1.00   22.77 ? 49   ALA C CA  1 
ATOM   5898  C C   . ALA C 1 49  ? 23.117  91.388  38.207  1.00   21.91 ? 49   ALA C C   1 
ATOM   5899  O O   . ALA C 1 49  ? 22.744  91.176  37.065  1.00   25.39 ? 49   ALA C O   1 
ATOM   5900  C CB  . ALA C 1 49  ? 25.368  90.362  38.618  1.00   22.27 ? 49   ALA C CB  1 
ATOM   5901  N N   . LEU C 1 50  ? 22.280  91.361  39.234  1.00   21.92 ? 50   LEU C N   1 
ATOM   5902  C CA  . LEU C 1 50  ? 20.867  91.052  39.008  1.00   23.77 ? 50   LEU C CA  1 
ATOM   5903  C C   . LEU C 1 50  ? 20.197  92.070  38.085  1.00   23.66 ? 50   LEU C C   1 
ATOM   5904  O O   . LEU C 1 50  ? 19.191  91.768  37.448  1.00   24.41 ? 50   LEU C O   1 
ATOM   5905  C CB  . LEU C 1 50  ? 20.096  91.008  40.342  1.00   23.13 ? 50   LEU C CB  1 
ATOM   5906  C CG  . LEU C 1 50  ? 20.501  89.932  41.363  1.00   22.96 ? 50   LEU C CG  1 
ATOM   5907  C CD1 . LEU C 1 50  ? 19.778  90.145  42.692  1.00   11.90 ? 50   LEU C CD1 1 
ATOM   5908  C CD2 . LEU C 1 50  ? 20.186  88.549  40.811  1.00   22.70 ? 50   LEU C CD2 1 
ATOM   5909  N N   . ARG C 1 51  ? 20.749  93.280  38.009  1.00   23.89 ? 51   ARG C N   1 
ATOM   5910  C CA  . ARG C 1 51  ? 20.148  94.303  37.164  1.00   20.89 ? 51   ARG C CA  1 
ATOM   5911  C C   . ARG C 1 51  ? 20.575  94.208  35.693  1.00   21.74 ? 51   ARG C C   1 
ATOM   5912  O O   . ARG C 1 51  ? 19.987  94.866  34.836  1.00   22.84 ? 51   ARG C O   1 
ATOM   5913  C CB  . ARG C 1 51  ? 20.483  95.699  37.700  1.00   20.32 ? 51   ARG C CB  1 
ATOM   5914  C CG  . ARG C 1 51  ? 21.912  96.131  37.415  1.00   21.91 ? 51   ARG C CG  1 
ATOM   5915  C CD  . ARG C 1 51  ? 22.269  97.515  37.953  1.00   22.63 ? 51   ARG C CD  1 
ATOM   5916  N NE  . ARG C 1 51  ? 23.669  97.815  37.667  1.00   19.61 ? 51   ARG C NE  1 
ATOM   5917  C CZ  . ARG C 1 51  ? 24.112  98.366  36.538  1.00   24.19 ? 51   ARG C CZ  1 
ATOM   5918  N NH1 . ARG C 1 51  ? 23.249  98.702  35.582  1.00   21.33 ? 51   ARG C NH1 1 
ATOM   5919  N NH2 . ARG C 1 51  ? 25.424  98.551  36.349  1.00   16.16 ? 51   ARG C NH2 1 
ATOM   5920  N N   . ILE C 1 52  ? 21.597  93.409  35.391  1.00   18.55 ? 52   ILE C N   1 
ATOM   5921  C CA  . ILE C 1 52  ? 22.023  93.331  34.007  1.00   20.45 ? 52   ILE C CA  1 
ATOM   5922  C C   . ILE C 1 52  ? 21.580  92.090  33.240  1.00   22.34 ? 52   ILE C C   1 
ATOM   5923  O O   . ILE C 1 52  ? 21.090  91.116  33.832  1.00   22.66 ? 52   ILE C O   1 
ATOM   5924  C CB  . ILE C 1 52  ? 23.566  93.440  33.855  1.00   20.35 ? 52   ILE C CB  1 
ATOM   5925  C CG1 . ILE C 1 52  ? 24.255  92.182  34.390  1.00   20.19 ? 52   ILE C CG1 1 
ATOM   5926  C CG2 . ILE C 1 52  ? 24.069  94.673  34.556  1.00   23.03 ? 52   ILE C CG2 1 
ATOM   5927  C CD1 . ILE C 1 52  ? 25.723  92.112  34.050  1.00   18.63 ? 52   ILE C CD1 1 
ATOM   5928  N N   . TYR C 1 53  ? 21.734  92.154  31.914  1.00   20.31 ? 53   TYR C N   1 
ATOM   5929  C CA  . TYR C 1 53  ? 21.413  91.039  31.037  1.00   20.03 ? 53   TYR C CA  1 
ATOM   5930  C C   . TYR C 1 53  ? 22.671  90.203  31.107  1.00   22.77 ? 53   TYR C C   1 
ATOM   5931  O O   . TYR C 1 53  ? 23.688  90.487  30.447  1.00   23.53 ? 53   TYR C O   1 
ATOM   5932  C CB  . TYR C 1 53  ? 21.134  91.521  29.615  1.00   18.15 ? 53   TYR C CB  1 
ATOM   5933  C CG  . TYR C 1 53  ? 19.722  92.031  29.477  1.00   21.98 ? 53   TYR C CG  1 
ATOM   5934  C CD1 . TYR C 1 53  ? 18.645  91.142  29.437  1.00   17.74 ? 53   TYR C CD1 1 
ATOM   5935  C CD2 . TYR C 1 53  ? 19.448  93.403  29.499  1.00   21.43 ? 53   TYR C CD2 1 
ATOM   5936  C CE1 . TYR C 1 53  ? 17.338  91.609  29.436  1.00   22.79 ? 53   TYR C CE1 1 
ATOM   5937  C CE2 . TYR C 1 53  ? 18.149  93.877  29.498  1.00   18.44 ? 53   TYR C CE2 1 
ATOM   5938  C CZ  . TYR C 1 53  ? 17.098  92.979  29.472  1.00   21.72 ? 53   TYR C CZ  1 
ATOM   5939  O OH  . TYR C 1 53  ? 15.808  93.452  29.510  1.00   27.09 ? 53   TYR C OH  1 
ATOM   5940  N N   . TYR C 1 54  ? 22.580  89.186  31.961  1.00   22.79 ? 54   TYR C N   1 
ATOM   5941  C CA  . TYR C 1 54  ? 23.660  88.270  32.266  1.00   21.29 ? 54   TYR C CA  1 
ATOM   5942  C C   . TYR C 1 54  ? 23.894  87.205  31.215  1.00   21.79 ? 54   TYR C C   1 
ATOM   5943  O O   . TYR C 1 54  ? 22.981  86.496  30.846  1.00   17.08 ? 54   TYR C O   1 
ATOM   5944  C CB  . TYR C 1 54  ? 23.364  87.608  33.621  1.00   18.28 ? 54   TYR C CB  1 
ATOM   5945  C CG  . TYR C 1 54  ? 24.579  87.044  34.294  1.00   19.64 ? 54   TYR C CG  1 
ATOM   5946  C CD1 . TYR C 1 54  ? 25.565  87.874  34.829  1.00   19.97 ? 54   TYR C CD1 1 
ATOM   5947  C CD2 . TYR C 1 54  ? 24.771  85.677  34.362  1.00   20.10 ? 54   TYR C CD2 1 
ATOM   5948  C CE1 . TYR C 1 54  ? 26.708  87.349  35.407  1.00   27.08 ? 54   TYR C CE1 1 
ATOM   5949  C CE2 . TYR C 1 54  ? 25.908  85.145  34.935  1.00   27.10 ? 54   TYR C CE2 1 
ATOM   5950  C CZ  . TYR C 1 54  ? 26.872  85.978  35.453  1.00   23.22 ? 54   TYR C CZ  1 
ATOM   5951  O OH  . TYR C 1 54  ? 27.997  85.431  35.987  1.00   25.72 ? 54   TYR C OH  1 
ATOM   5952  N N   . ASP C 1 55  ? 25.137  87.097  30.749  1.00   24.74 ? 55   ASP C N   1 
ATOM   5953  C CA  . ASP C 1 55  ? 25.513  86.106  29.749  1.00   28.62 ? 55   ASP C CA  1 
ATOM   5954  C C   . ASP C 1 55  ? 24.973  84.789  30.243  1.00   27.71 ? 55   ASP C C   1 
ATOM   5955  O O   . ASP C 1 55  ? 25.406  84.332  31.272  1.00   26.85 ? 55   ASP C O   1 
ATOM   5956  C CB  . ASP C 1 55  ? 27.037  86.015  29.642  1.00   31.84 ? 55   ASP C CB  1 
ATOM   5957  C CG  . ASP C 1 55  ? 27.652  87.237  28.995  1.00   36.78 ? 55   ASP C CG  1 
ATOM   5958  O OD1 . ASP C 1 55  ? 28.881  87.386  29.076  1.00   34.67 ? 55   ASP C OD1 1 
ATOM   5959  O OD2 . ASP C 1 55  ? 26.910  88.039  28.390  1.00   39.61 ? 55   ASP C OD2 1 
ATOM   5960  N N   . SER C 1 56  ? 24.019  84.200  29.526  1.00   33.53 ? 56   SER C N   1 
ATOM   5961  C CA  . SER C 1 56  ? 23.429  82.940  29.955  1.00   38.96 ? 56   SER C CA  1 
ATOM   5962  C C   . SER C 1 56  ? 24.534  81.889  29.878  1.00   43.25 ? 56   SER C C   1 
ATOM   5963  O O   . SER C 1 56  ? 24.932  81.315  30.902  1.00   47.78 ? 56   SER C O   1 
ATOM   5964  C CB  . SER C 1 56  ? 22.245  82.562  29.086  1.00   38.96 ? 56   SER C CB  1 
ATOM   5965  O OG  . SER C 1 56  ? 21.664  81.397  29.622  1.00   42.17 ? 56   SER C OG  1 
ATOM   5966  N N   . PRO C 1 57  ? 25.034  81.590  28.677  1.00   39.27 ? 57   PRO C N   1 
ATOM   5967  C CA  . PRO C 1 57  ? 26.084  80.596  28.862  1.00   37.76 ? 57   PRO C CA  1 
ATOM   5968  C C   . PRO C 1 57  ? 27.229  81.413  29.487  1.00   36.30 ? 57   PRO C C   1 
ATOM   5969  O O   . PRO C 1 57  ? 27.982  82.094  28.808  1.00   36.37 ? 57   PRO C O   1 
ATOM   5970  C CB  . PRO C 1 57  ? 26.371  80.134  27.437  1.00   37.26 ? 57   PRO C CB  1 
ATOM   5971  C CG  . PRO C 1 57  ? 25.056  80.264  26.800  1.00   40.11 ? 57   PRO C CG  1 
ATOM   5972  C CD  . PRO C 1 57  ? 24.560  81.606  27.289  1.00   37.19 ? 57   PRO C CD  1 
ATOM   5973  N N   . ASP C 1 58  ? 27.291  81.388  30.803  1.00   35.92 ? 58   ASP C N   1 
ATOM   5974  C CA  . ASP C 1 58  ? 28.308  82.086  31.576  1.00   35.98 ? 58   ASP C CA  1 
ATOM   5975  C C   . ASP C 1 58  ? 29.677  81.396  31.359  1.00   34.21 ? 58   ASP C C   1 
ATOM   5976  O O   . ASP C 1 58  ? 29.762  80.171  31.304  1.00   30.36 ? 58   ASP C O   1 
ATOM   5977  C CB  . ASP C 1 58  ? 27.909  81.995  33.050  1.00   40.78 ? 58   ASP C CB  1 
ATOM   5978  C CG  . ASP C 1 58  ? 28.723  82.874  33.937  1.00   40.16 ? 58   ASP C CG  1 
ATOM   5979  O OD1 . ASP C 1 58  ? 28.764  82.597  35.159  1.00   31.73 ? 58   ASP C OD1 1 
ATOM   5980  O OD2 . ASP C 1 58  ? 29.303  83.844  33.406  1.00   46.14 ? 58   ASP C OD2 1 
ATOM   5981  N N   . GLU C 1 59  ? 30.738  82.184  31.239  1.00   32.60 ? 59   GLU C N   1 
ATOM   5982  C CA  . GLU C 1 59  ? 32.070  81.638  31.029  1.00   33.66 ? 59   GLU C CA  1 
ATOM   5983  C C   . GLU C 1 59  ? 32.446  80.613  32.083  1.00   33.46 ? 59   GLU C C   1 
ATOM   5984  O O   . GLU C 1 59  ? 32.816  79.497  31.754  1.00   33.65 ? 59   GLU C O   1 
ATOM   5985  C CB  . GLU C 1 59  ? 33.108  82.761  31.013  1.00   35.18 ? 59   GLU C CB  1 
ATOM   5986  C CG  . GLU C 1 59  ? 34.546  82.283  30.940  1.00   41.64 ? 59   GLU C CG  1 
ATOM   5987  C CD  . GLU C 1 59  ? 35.438  83.215  30.123  1.00   45.53 ? 59   GLU C CD  1 
ATOM   5988  O OE1 . GLU C 1 59  ? 35.532  84.410  30.462  1.00   47.56 ? 59   GLU C OE1 1 
ATOM   5989  O OE2 . GLU C 1 59  ? 36.047  82.753  29.135  1.00   47.42 ? 59   GLU C OE2 1 
ATOM   5990  N N   . GLU C 1 60  ? 32.330  81.011  33.346  1.00   32.36 ? 60   GLU C N   1 
ATOM   5991  C CA  . GLU C 1 60  ? 32.652  80.172  34.480  1.00   31.86 ? 60   GLU C CA  1 
ATOM   5992  C C   . GLU C 1 60  ? 31.816  78.913  34.503  1.00   30.79 ? 60   GLU C C   1 
ATOM   5993  O O   . GLU C 1 60  ? 32.303  77.860  34.893  1.00   29.54 ? 60   GLU C O   1 
ATOM   5994  C CB  . GLU C 1 60  ? 32.423  80.942  35.775  1.00   36.25 ? 60   GLU C CB  1 
ATOM   5995  C CG  . GLU C 1 60  ? 32.967  82.365  35.754  1.00   47.87 ? 60   GLU C CG  1 
ATOM   5996  C CD  . GLU C 1 60  ? 32.420  83.215  36.885  1.00   54.47 ? 60   GLU C CD  1 
ATOM   5997  O OE1 . GLU C 1 60  ? 32.448  84.467  36.759  1.00   56.74 ? 60   GLU C OE1 1 
ATOM   5998  O OE2 . GLU C 1 60  ? 31.965  82.622  37.892  1.00   55.89 ? 60   GLU C OE2 1 
ATOM   5999  N N   . LEU C 1 61  ? 30.557  79.017  34.096  1.00   29.09 ? 61   LEU C N   1 
ATOM   6000  C CA  . LEU C 1 61  ? 29.703  77.844  34.090  1.00   28.40 ? 61   LEU C CA  1 
ATOM   6001  C C   . LEU C 1 61  ? 30.172  76.838  33.051  1.00   27.60 ? 61   LEU C C   1 
ATOM   6002  O O   . LEU C 1 61  ? 30.195  75.636  33.316  1.00   26.18 ? 61   LEU C O   1 
ATOM   6003  C CB  . LEU C 1 61  ? 28.231  78.205  33.833  1.00   24.57 ? 61   LEU C CB  1 
ATOM   6004  C CG  . LEU C 1 61  ? 27.341  76.956  33.719  1.00   24.34 ? 61   LEU C CG  1 
ATOM   6005  C CD1 . LEU C 1 61  ? 27.572  76.082  34.920  1.00   13.39 ? 61   LEU C CD1 1 
ATOM   6006  C CD2 . LEU C 1 61  ? 25.863  77.328  33.618  1.00   25.30 ? 61   LEU C CD2 1 
ATOM   6007  N N   . ILE C 1 62  ? 30.544  77.332  31.874  1.00   28.27 ? 62   ILE C N   1 
ATOM   6008  C CA  . ILE C 1 62  ? 31.015  76.470  30.799  1.00   30.91 ? 62   ILE C CA  1 
ATOM   6009  C C   . ILE C 1 62  ? 32.250  75.697  31.237  1.00   33.82 ? 62   ILE C C   1 
ATOM   6010  O O   . ILE C 1 62  ? 32.345  74.490  31.004  1.00   35.51 ? 62   ILE C O   1 
ATOM   6011  C CB  . ILE C 1 62  ? 31.344  77.276  29.528  1.00   30.84 ? 62   ILE C CB  1 
ATOM   6012  C CG1 . ILE C 1 62  ? 30.054  77.840  28.934  1.00   30.75 ? 62   ILE C CG1 1 
ATOM   6013  C CG2 . ILE C 1 62  ? 32.021  76.398  28.502  1.00   30.03 ? 62   ILE C CG2 1 
ATOM   6014  C CD1 . ILE C 1 62  ? 28.974  76.808  28.767  1.00   28.47 ? 62   ILE C CD1 1 
ATOM   6015  N N   . GLU C 1 63  ? 33.176  76.396  31.893  1.00   34.10 ? 63   GLU C N   1 
ATOM   6016  C CA  . GLU C 1 63  ? 34.410  75.794  32.388  1.00   36.94 ? 63   GLU C CA  1 
ATOM   6017  C C   . GLU C 1 63  ? 34.104  74.637  33.345  1.00   35.82 ? 63   GLU C C   1 
ATOM   6018  O O   . GLU C 1 63  ? 34.637  73.529  33.207  1.00   33.99 ? 63   GLU C O   1 
ATOM   6019  C CB  . GLU C 1 63  ? 35.251  76.851  33.122  1.00   40.72 ? 63   GLU C CB  1 
ATOM   6020  C CG  . GLU C 1 63  ? 35.588  78.077  32.276  1.00   46.74 ? 63   GLU C CG  1 
ATOM   6021  C CD  . GLU C 1 63  ? 36.284  79.176  33.068  1.00   52.84 ? 63   GLU C CD  1 
ATOM   6022  O OE1 . GLU C 1 63  ? 37.461  79.474  32.766  1.00   56.38 ? 63   GLU C OE1 1 
ATOM   6023  O OE2 . GLU C 1 63  ? 35.657  79.741  33.990  1.00   55.25 ? 63   GLU C OE2 1 
ATOM   6024  N N   . LYS C 1 64  ? 33.234  74.906  34.311  1.00   33.53 ? 64   LYS C N   1 
ATOM   6025  C CA  . LYS C 1 64  ? 32.861  73.915  35.292  1.00   32.86 ? 64   LYS C CA  1 
ATOM   6026  C C   . LYS C 1 64  ? 32.197  72.714  34.629  1.00   33.54 ? 64   LYS C C   1 
ATOM   6027  O O   . LYS C 1 64  ? 32.416  71.569  35.015  1.00   31.70 ? 64   LYS C O   1 
ATOM   6028  C CB  . LYS C 1 64  ? 31.946  74.566  36.330  1.00   37.78 ? 64   LYS C CB  1 
ATOM   6029  C CG  . LYS C 1 64  ? 32.674  75.601  37.198  1.00   33.74 ? 64   LYS C CG  1 
ATOM   6030  C CD  . LYS C 1 64  ? 31.763  76.264  38.211  1.00   38.78 ? 64   LYS C CD  1 
ATOM   6031  C CE  . LYS C 1 64  ? 32.512  76.540  39.517  1.00   40.59 ? 64   LYS C CE  1 
ATOM   6032  N NZ  . LYS C 1 64  ? 33.798  77.263  39.315  1.00   36.06 ? 64   LYS C NZ  1 
ATOM   6033  N N   . ILE C 1 65  ? 31.393  72.989  33.613  1.00   33.36 ? 65   ILE C N   1 
ATOM   6034  C CA  . ILE C 1 65  ? 30.735  71.928  32.879  1.00   33.21 ? 65   ILE C CA  1 
ATOM   6035  C C   . ILE C 1 65  ? 31.825  71.090  32.216  1.00   34.94 ? 65   ILE C C   1 
ATOM   6036  O O   . ILE C 1 65  ? 31.873  69.872  32.374  1.00   33.42 ? 65   ILE C O   1 
ATOM   6037  C CB  . ILE C 1 65  ? 29.854  72.487  31.767  1.00   33.11 ? 65   ILE C CB  1 
ATOM   6038  C CG1 . ILE C 1 65  ? 28.678  73.267  32.347  1.00   32.91 ? 65   ILE C CG1 1 
ATOM   6039  C CG2 . ILE C 1 65  ? 29.407  71.349  30.861  1.00   29.16 ? 65   ILE C CG2 1 
ATOM   6040  C CD1 . ILE C 1 65  ? 27.553  72.414  32.811  1.00   36.48 ? 65   ILE C CD1 1 
ATOM   6041  N N   . LEU C 1 66  ? 32.679  71.759  31.445  1.00   34.94 ? 66   LEU C N   1 
ATOM   6042  C CA  . LEU C 1 66  ? 33.772  71.100  30.744  1.00   36.66 ? 66   LEU C CA  1 
ATOM   6043  C C   . LEU C 1 66  ? 34.538  70.231  31.739  1.00   37.95 ? 66   LEU C C   1 
ATOM   6044  O O   . LEU C 1 66  ? 34.826  69.063  31.469  1.00   37.83 ? 66   LEU C O   1 
ATOM   6045  C CB  . LEU C 1 66  ? 34.722  72.136  30.119  1.00   35.34 ? 66   LEU C CB  1 
ATOM   6046  C CG  . LEU C 1 66  ? 34.723  72.491  28.616  1.00   37.71 ? 66   LEU C CG  1 
ATOM   6047  C CD1 . LEU C 1 66  ? 34.916  71.230  27.783  1.00   38.59 ? 66   LEU C CD1 1 
ATOM   6048  C CD2 . LEU C 1 66  ? 33.445  73.198  28.206  1.00   39.13 ? 66   LEU C CD2 1 
ATOM   6049  N N   . SER C 1 67  ? 34.862  70.817  32.890  1.00   38.64 ? 67   SER C N   1 
ATOM   6050  C CA  . SER C 1 67  ? 35.580  70.129  33.955  1.00   36.64 ? 67   SER C CA  1 
ATOM   6051  C C   . SER C 1 67  ? 34.762  68.933  34.430  1.00   38.27 ? 67   SER C C   1 
ATOM   6052  O O   . SER C 1 67  ? 35.303  67.860  34.712  1.00   40.93 ? 67   SER C O   1 
ATOM   6053  C CB  . SER C 1 67  ? 35.820  71.096  35.111  1.00   36.83 ? 67   SER C CB  1 
ATOM   6054  O OG  . SER C 1 67  ? 36.209  70.411  36.288  1.00   38.43 ? 67   SER C OG  1 
ATOM   6055  N N   . TYR C 1 68  ? 33.457  69.121  34.534  1.00   36.09 ? 68   TYR C N   1 
ATOM   6056  C CA  . TYR C 1 68  ? 32.602  68.033  34.950  1.00   36.16 ? 68   TYR C CA  1 
ATOM   6057  C C   . TYR C 1 68  ? 32.594  66.936  33.879  1.00   37.12 ? 68   TYR C C   1 
ATOM   6058  O O   . TYR C 1 68  ? 32.485  65.755  34.194  1.00   38.23 ? 68   TYR C O   1 
ATOM   6059  C CB  . TYR C 1 68  ? 31.177  68.541  35.196  1.00   35.28 ? 68   TYR C CB  1 
ATOM   6060  C CG  . TYR C 1 68  ? 30.201  67.468  35.629  1.00   33.03 ? 68   TYR C CG  1 
ATOM   6061  C CD1 . TYR C 1 68  ? 30.434  66.692  36.765  1.00   34.09 ? 68   TYR C CD1 1 
ATOM   6062  C CD2 . TYR C 1 68  ? 29.052  67.224  34.889  1.00   33.18 ? 68   TYR C CD2 1 
ATOM   6063  C CE1 . TYR C 1 68  ? 29.536  65.692  37.145  1.00   36.17 ? 68   TYR C CE1 1 
ATOM   6064  C CE2 . TYR C 1 68  ? 28.152  66.240  35.254  1.00   32.79 ? 68   TYR C CE2 1 
ATOM   6065  C CZ  . TYR C 1 68  ? 28.390  65.474  36.378  1.00   35.24 ? 68   TYR C CZ  1 
ATOM   6066  O OH  . TYR C 1 68  ? 27.481  64.503  36.724  1.00   32.62 ? 68   TYR C OH  1 
ATOM   6067  N N   . LEU C 1 69  ? 32.701  67.314  32.613  1.00   37.40 ? 69   LEU C N   1 
ATOM   6068  C CA  . LEU C 1 69  ? 32.721  66.308  31.567  1.00   39.30 ? 69   LEU C CA  1 
ATOM   6069  C C   . LEU C 1 69  ? 34.033  65.516  31.641  1.00   41.40 ? 69   LEU C C   1 
ATOM   6070  O O   . LEU C 1 69  ? 34.095  64.367  31.211  1.00   38.48 ? 69   LEU C O   1 
ATOM   6071  C CB  . LEU C 1 69  ? 32.561  66.950  30.180  1.00   39.46 ? 69   LEU C CB  1 
ATOM   6072  C CG  . LEU C 1 69  ? 31.167  67.366  29.664  1.00   40.71 ? 69   LEU C CG  1 
ATOM   6073  C CD1 . LEU C 1 69  ? 30.198  66.184  29.597  1.00   39.33 ? 69   LEU C CD1 1 
ATOM   6074  C CD2 . LEU C 1 69  ? 30.611  68.410  30.569  1.00   44.08 ? 69   LEU C CD2 1 
ATOM   6075  N N   . ASP C 1 70  ? 35.077  66.128  32.192  1.00   44.05 ? 70   ASP C N   1 
ATOM   6076  C CA  . ASP C 1 70  ? 36.373  65.454  32.338  1.00   47.55 ? 70   ASP C CA  1 
ATOM   6077  C C   . ASP C 1 70  ? 36.828  64.885  30.993  1.00   49.46 ? 70   ASP C C   1 
ATOM   6078  O O   . ASP C 1 70  ? 37.458  63.827  30.925  1.00   48.37 ? 70   ASP C O   1 
ATOM   6079  C CB  . ASP C 1 70  ? 36.248  64.311  33.357  1.00   48.48 ? 70   ASP C CB  1 
ATOM   6080  C CG  . ASP C 1 70  ? 37.585  63.907  33.962  1.00   47.90 ? 70   ASP C CG  1 
ATOM   6081  O OD1 . ASP C 1 70  ? 37.593  63.058  34.878  1.00   47.79 ? 70   ASP C OD1 1 
ATOM   6082  O OD2 . ASP C 1 70  ? 38.626  64.438  33.529  1.00   42.28 ? 70   ASP C OD2 1 
ATOM   6083  N N   . THR C 1 71  ? 36.496  65.604  29.928  1.00   51.14 ? 71   THR C N   1 
ATOM   6084  C CA  . THR C 1 71  ? 36.822  65.188  28.577  1.00   53.68 ? 71   THR C CA  1 
ATOM   6085  C C   . THR C 1 71  ? 38.293  65.398  28.253  1.00   54.76 ? 71   THR C C   1 
ATOM   6086  O O   . THR C 1 71  ? 39.114  65.644  29.130  1.00   55.52 ? 71   THR C O   1 
ATOM   6087  C CB  . THR C 1 71  ? 35.986  65.976  27.557  1.00   55.60 ? 71   THR C CB  1 
ATOM   6088  O OG1 . THR C 1 71  ? 36.118  65.383  26.261  1.00   57.25 ? 71   THR C OG1 1 
ATOM   6089  C CG2 . THR C 1 71  ? 36.468  67.432  27.495  1.00   55.80 ? 71   THR C CG2 1 
ATOM   6090  N N   . ASP C 1 72  ? 38.612  65.329  26.971  1.00   56.05 ? 72   ASP C N   1 
ATOM   6091  C CA  . ASP C 1 72  ? 39.981  65.506  26.525  1.00   56.34 ? 72   ASP C CA  1 
ATOM   6092  C C   . ASP C 1 72  ? 39.992  66.292  25.233  1.00   55.49 ? 72   ASP C C   1 
ATOM   6093  O O   . ASP C 1 72  ? 40.961  66.971  24.908  1.00   55.03 ? 72   ASP C O   1 
ATOM   6094  C CB  . ASP C 1 72  ? 40.612  64.141  26.281  1.00   58.69 ? 72   ASP C CB  1 
ATOM   6095  C CG  . ASP C 1 72  ? 42.016  64.239  25.738  1.00   61.63 ? 72   ASP C CG  1 
ATOM   6096  O OD1 . ASP C 1 72  ? 42.560  63.189  25.330  1.00   60.83 ? 72   ASP C OD1 1 
ATOM   6097  O OD2 . ASP C 1 72  ? 42.578  65.357  25.727  1.00   65.76 ? 72   ASP C OD2 1 
ATOM   6098  N N   . PHE C 1 73  ? 38.887  66.211  24.508  1.00   54.53 ? 73   PHE C N   1 
ATOM   6099  C CA  . PHE C 1 73  ? 38.797  66.872  23.226  1.00   51.97 ? 73   PHE C CA  1 
ATOM   6100  C C   . PHE C 1 73  ? 37.781  68.001  23.154  1.00   51.29 ? 73   PHE C C   1 
ATOM   6101  O O   . PHE C 1 73  ? 37.544  68.535  22.072  1.00   55.12 ? 73   PHE C O   1 
ATOM   6102  C CB  . PHE C 1 73  ? 38.430  65.835  22.186  1.00   52.27 ? 73   PHE C CB  1 
ATOM   6103  C CG  . PHE C 1 73  ? 37.047  65.305  22.358  1.00   49.70 ? 73   PHE C CG  1 
ATOM   6104  C CD1 . PHE C 1 73  ? 36.703  64.582  23.490  1.00   48.99 ? 73   PHE C CD1 1 
ATOM   6105  C CD2 . PHE C 1 73  ? 36.069  65.581  21.418  1.00   46.93 ? 73   PHE C CD2 1 
ATOM   6106  C CE1 . PHE C 1 73  ? 35.396  64.146  23.686  1.00   50.42 ? 73   PHE C CE1 1 
ATOM   6107  C CE2 . PHE C 1 73  ? 34.765  65.154  21.599  1.00   48.74 ? 73   PHE C CE2 1 
ATOM   6108  C CZ  . PHE C 1 73  ? 34.423  64.435  22.737  1.00   50.70 ? 73   PHE C CZ  1 
ATOM   6109  N N   . LEU C 1 74  ? 37.182  68.381  24.279  1.00   48.73 ? 74   LEU C N   1 
ATOM   6110  C CA  . LEU C 1 74  ? 36.170  69.433  24.239  1.00   43.85 ? 74   LEU C CA  1 
ATOM   6111  C C   . LEU C 1 74  ? 36.583  70.842  24.673  1.00   43.22 ? 74   LEU C C   1 
ATOM   6112  O O   . LEU C 1 74  ? 37.300  71.027  25.654  1.00   41.49 ? 74   LEU C O   1 
ATOM   6113  C CB  . LEU C 1 74  ? 34.952  68.991  25.048  1.00   41.39 ? 74   LEU C CB  1 
ATOM   6114  C CG  . LEU C 1 74  ? 34.233  67.741  24.547  1.00   38.78 ? 74   LEU C CG  1 
ATOM   6115  C CD1 . LEU C 1 74  ? 33.231  67.306  25.588  1.00   39.05 ? 74   LEU C CD1 1 
ATOM   6116  C CD2 . LEU C 1 74  ? 33.554  68.029  23.223  1.00   37.56 ? 74   LEU C CD2 1 
ATOM   6117  N N   . SER C 1 75  ? 36.116  71.830  23.918  1.00   41.59 ? 75   SER C N   1 
ATOM   6118  C CA  . SER C 1 75  ? 36.385  73.229  24.211  1.00   42.68 ? 75   SER C CA  1 
ATOM   6119  C C   . SER C 1 75  ? 35.040  73.858  24.543  1.00   42.93 ? 75   SER C C   1 
ATOM   6120  O O   . SER C 1 75  ? 33.987  73.229  24.363  1.00   44.90 ? 75   SER C O   1 
ATOM   6121  C CB  . SER C 1 75  ? 36.950  73.948  22.995  1.00   45.35 ? 75   SER C CB  1 
ATOM   6122  O OG  . SER C 1 75  ? 35.897  74.341  22.116  1.00   50.59 ? 75   SER C OG  1 
ATOM   6123  N N   . LYS C 1 76  ? 35.078  75.108  24.988  1.00   41.63 ? 76   LYS C N   1 
ATOM   6124  C CA  . LYS C 1 76  ? 33.870  75.839  25.354  1.00   40.96 ? 76   LYS C CA  1 
ATOM   6125  C C   . LYS C 1 76  ? 32.898  75.959  24.194  1.00   38.82 ? 76   LYS C C   1 
ATOM   6126  O O   . LYS C 1 76  ? 31.750  76.337  24.374  1.00   39.80 ? 76   LYS C O   1 
ATOM   6127  C CB  . LYS C 1 76  ? 34.236  77.228  25.861  1.00   38.06 ? 76   LYS C CB  1 
ATOM   6128  C CG  . LYS C 1 76  ? 34.765  78.134  24.796  1.00   43.20 ? 76   LYS C CG  1 
ATOM   6129  C CD  . LYS C 1 76  ? 35.460  79.338  25.419  1.00   49.36 ? 76   LYS C CD  1 
ATOM   6130  C CE  . LYS C 1 76  ? 35.454  80.537  24.476  1.00   53.63 ? 76   LYS C CE  1 
ATOM   6131  N NZ  . LYS C 1 76  ? 35.852  80.139  23.094  1.00   57.52 ? 76   LYS C NZ  1 
ATOM   6132  N N   . ASN C 1 77  ? 33.360  75.612  23.005  1.00   38.54 ? 77   ASN C N   1 
ATOM   6133  C CA  . ASN C 1 77  ? 32.535  75.695  21.810  1.00   36.46 ? 77   ASN C CA  1 
ATOM   6134  C C   . ASN C 1 77  ? 31.655  74.464  21.593  1.00   35.66 ? 77   ASN C C   1 
ATOM   6135  O O   . ASN C 1 77  ? 30.773  74.473  20.728  1.00   34.24 ? 77   ASN C O   1 
ATOM   6136  C CB  . ASN C 1 77  ? 33.434  75.907  20.588  1.00   38.54 ? 77   ASN C CB  1 
ATOM   6137  C CG  . ASN C 1 77  ? 34.032  77.301  20.536  1.00   40.54 ? 77   ASN C CG  1 
ATOM   6138  O OD1 . ASN C 1 77  ? 35.027  77.539  19.851  1.00   43.68 ? 77   ASN C OD1 1 
ATOM   6139  N ND2 . ASN C 1 77  ? 33.415  78.235  21.252  1.00   42.08 ? 77   ASN C ND2 1 
ATOM   6140  N N   . ASN C 1 78  ? 31.886  73.407  22.364  1.00   32.63 ? 78   ASN C N   1 
ATOM   6141  C CA  . ASN C 1 78  ? 31.093  72.207  22.183  1.00   30.63 ? 78   ASN C CA  1 
ATOM   6142  C C   . ASN C 1 78  ? 30.013  72.116  23.218  1.00   29.03 ? 78   ASN C C   1 
ATOM   6143  O O   . ASN C 1 78  ? 29.323  71.108  23.302  1.00   25.85 ? 78   ASN C O   1 
ATOM   6144  C CB  . ASN C 1 78  ? 31.979  70.953  22.227  1.00   27.46 ? 78   ASN C CB  1 
ATOM   6145  C CG  . ASN C 1 78  ? 33.100  71.011  21.220  1.00   30.87 ? 78   ASN C CG  1 
ATOM   6146  O OD1 . ASN C 1 78  ? 34.226  71.403  21.550  1.00   33.24 ? 78   ASN C OD1 1 
ATOM   6147  N ND2 . ASN C 1 78  ? 32.797  70.661  19.974  1.00   25.79 ? 78   ASN C ND2 1 
ATOM   6148  N N   . VAL C 1 79  ? 29.855  73.187  23.991  1.00   30.27 ? 79   VAL C N   1 
ATOM   6149  C CA  . VAL C 1 79  ? 28.851  73.222  25.055  1.00   28.51 ? 79   VAL C CA  1 
ATOM   6150  C C   . VAL C 1 79  ? 28.060  74.508  25.155  1.00   29.29 ? 79   VAL C C   1 
ATOM   6151  O O   . VAL C 1 79  ? 28.600  75.609  25.019  1.00   29.40 ? 79   VAL C O   1 
ATOM   6152  C CB  . VAL C 1 79  ? 29.474  73.041  26.443  1.00   27.16 ? 79   VAL C CB  1 
ATOM   6153  C CG1 . VAL C 1 79  ? 28.385  72.712  27.440  1.00   31.53 ? 79   VAL C CG1 1 
ATOM   6154  C CG2 . VAL C 1 79  ? 30.557  71.985  26.419  1.00   26.17 ? 79   VAL C CG2 1 
ATOM   6155  N N   . SER C 1 80  ? 26.765  74.354  25.396  1.00   30.59 ? 80   SER C N   1 
ATOM   6156  C CA  . SER C 1 80  ? 25.906  75.498  25.623  1.00   29.25 ? 80   SER C CA  1 
ATOM   6157  C C   . SER C 1 80  ? 25.003  75.116  26.785  1.00   28.74 ? 80   SER C C   1 
ATOM   6158  O O   . SER C 1 80  ? 25.166  74.059  27.400  1.00   28.90 ? 80   SER C O   1 
ATOM   6159  C CB  . SER C 1 80  ? 25.070  75.861  24.390  1.00   31.82 ? 80   SER C CB  1 
ATOM   6160  O OG  . SER C 1 80  ? 24.513  77.168  24.551  1.00   24.38 ? 80   SER C OG  1 
ATOM   6161  N N   . VAL C 1 81  ? 24.055  75.984  27.094  1.00   27.69 ? 81   VAL C N   1 
ATOM   6162  C CA  . VAL C 1 81  ? 23.146  75.733  28.188  1.00   27.27 ? 81   VAL C CA  1 
ATOM   6163  C C   . VAL C 1 81  ? 21.710  75.969  27.737  1.00   27.98 ? 81   VAL C C   1 
ATOM   6164  O O   . VAL C 1 81  ? 21.451  76.543  26.668  1.00   25.40 ? 81   VAL C O   1 
ATOM   6165  C CB  . VAL C 1 81  ? 23.478  76.667  29.364  1.00   28.89 ? 81   VAL C CB  1 
ATOM   6166  C CG1 . VAL C 1 81  ? 23.128  78.108  29.010  1.00   23.09 ? 81   VAL C CG1 1 
ATOM   6167  C CG2 . VAL C 1 81  ? 22.755  76.219  30.584  1.00   32.47 ? 81   VAL C CG2 1 
ATOM   6168  N N   . GLY C 1 82  ? 20.779  75.515  28.563  1.00   27.05 ? 82   GLY C N   1 
ATOM   6169  C CA  . GLY C 1 82  ? 19.379  75.705  28.258  1.00   27.13 ? 82   GLY C CA  1 
ATOM   6170  C C   . GLY C 1 82  ? 18.568  75.855  29.534  1.00   28.11 ? 82   GLY C C   1 
ATOM   6171  O O   . GLY C 1 82  ? 19.009  75.474  30.616  1.00   30.55 ? 82   GLY C O   1 
ATOM   6172  N N   . ASN C 1 83  ? 17.379  76.424  29.397  1.00   27.26 ? 83   ASN C N   1 
ATOM   6173  C CA  . ASN C 1 83  ? 16.449  76.628  30.503  1.00   24.01 ? 83   ASN C CA  1 
ATOM   6174  C C   . ASN C 1 83  ? 15.838  75.262  30.836  1.00   24.80 ? 83   ASN C C   1 
ATOM   6175  O O   . ASN C 1 83  ? 14.624  75.035  30.736  1.00   26.04 ? 83   ASN C O   1 
ATOM   6176  C CB  . ASN C 1 83  ? 15.381  77.625  30.055  1.00   18.91 ? 83   ASN C CB  1 
ATOM   6177  C CG  . ASN C 1 83  ? 14.410  77.981  31.147  1.00   21.99 ? 83   ASN C CG  1 
ATOM   6178  O OD1 . ASN C 1 83  ? 14.754  77.995  32.327  1.00   24.47 ? 83   ASN C OD1 1 
ATOM   6179  N ND2 . ASN C 1 83  ? 13.187  78.309  30.757  1.00   19.95 ? 83   ASN C ND2 1 
ATOM   6180  N N   . GLY C 1 84  ? 16.704  74.345  31.232  1.00   23.79 ? 84   GLY C N   1 
ATOM   6181  C CA  . GLY C 1 84  ? 16.255  73.009  31.551  1.00   18.83 ? 84   GLY C CA  1 
ATOM   6182  C C   . GLY C 1 84  ? 16.616  72.247  30.299  1.00   18.78 ? 84   GLY C C   1 
ATOM   6183  O O   . GLY C 1 84  ? 16.908  72.861  29.280  1.00   20.01 ? 84   GLY C O   1 
ATOM   6184  N N   . ALA C 1 85  ? 16.668  70.926  30.371  1.00   18.27 ? 85   ALA C N   1 
ATOM   6185  C CA  . ALA C 1 85  ? 16.955  70.151  29.177  1.00   16.69 ? 85   ALA C CA  1 
ATOM   6186  C C   . ALA C 1 85  ? 15.693  70.314  28.316  1.00   14.52 ? 85   ALA C C   1 
ATOM   6187  O O   . ALA C 1 85  ? 15.707  70.153  27.097  1.00   15.02 ? 85   ALA C O   1 
ATOM   6188  C CB  . ALA C 1 85  ? 17.178  68.658  29.549  1.00   11.66 ? 85   ALA C CB  1 
ATOM   6189  N N   . ASP C 1 86  ? 14.587  70.619  28.978  1.00   15.88 ? 86   ASP C N   1 
ATOM   6190  C CA  . ASP C 1 86  ? 13.330  70.796  28.272  1.00   15.84 ? 86   ASP C CA  1 
ATOM   6191  C C   . ASP C 1 86  ? 13.515  71.835  27.184  1.00   16.38 ? 86   ASP C C   1 
ATOM   6192  O O   . ASP C 1 86  ? 13.153  71.606  26.042  1.00   16.67 ? 86   ASP C O   1 
ATOM   6193  C CB  . ASP C 1 86  ? 12.209  71.221  29.230  1.00   13.81 ? 86   ASP C CB  1 
ATOM   6194  C CG  . ASP C 1 86  ? 11.462  70.043  29.814  1.00   22.10 ? 86   ASP C CG  1 
ATOM   6195  O OD1 . ASP C 1 86  ? 11.646  68.913  29.268  1.00   23.65 ? 86   ASP C OD1 1 
ATOM   6196  O OD2 . ASP C 1 86  ? 10.695  70.243  30.793  1.00   20.26 ? 86   ASP C OD2 1 
ATOM   6197  N N   . GLU C 1 87  ? 14.098  72.980  27.534  1.00   18.11 ? 87   GLU C N   1 
ATOM   6198  C CA  . GLU C 1 87  ? 14.310  74.012  26.530  1.00   19.83 ? 87   GLU C CA  1 
ATOM   6199  C C   . GLU C 1 87  ? 15.232  73.534  25.371  1.00   19.41 ? 87   GLU C C   1 
ATOM   6200  O O   . GLU C 1 87  ? 15.020  73.897  24.216  1.00   18.67 ? 87   GLU C O   1 
ATOM   6201  C CB  . GLU C 1 87  ? 14.875  75.296  27.173  1.00   20.32 ? 87   GLU C CB  1 
ATOM   6202  C CG  . GLU C 1 87  ? 14.877  76.461  26.185  1.00   23.60 ? 87   GLU C CG  1 
ATOM   6203  C CD  . GLU C 1 87  ? 15.689  77.649  26.631  1.00   29.46 ? 87   GLU C CD  1 
ATOM   6204  O OE1 . GLU C 1 87  ? 16.783  77.427  27.209  1.00   23.49 ? 87   GLU C OE1 1 
ATOM   6205  O OE2 . GLU C 1 87  ? 15.231  78.797  26.376  1.00   28.29 ? 87   GLU C OE2 1 
ATOM   6206  N N   . ILE C 1 88  ? 16.234  72.707  25.675  1.00   22.01 ? 88   ILE C N   1 
ATOM   6207  C CA  . ILE C 1 88  ? 17.151  72.216  24.648  1.00   22.04 ? 88   ILE C CA  1 
ATOM   6208  C C   . ILE C 1 88  ? 16.328  71.438  23.619  1.00   22.06 ? 88   ILE C C   1 
ATOM   6209  O O   . ILE C 1 88  ? 16.417  71.672  22.413  1.00   20.18 ? 88   ILE C O   1 
ATOM   6210  C CB  . ILE C 1 88  ? 18.205  71.233  25.214  1.00   25.40 ? 88   ILE C CB  1 
ATOM   6211  C CG1 . ILE C 1 88  ? 18.814  71.767  26.515  1.00   30.36 ? 88   ILE C CG1 1 
ATOM   6212  C CG2 . ILE C 1 88  ? 19.282  70.969  24.160  1.00   24.76 ? 88   ILE C CG2 1 
ATOM   6213  C CD1 . ILE C 1 88  ? 19.755  72.881  26.339  1.00   37.05 ? 88   ILE C CD1 1 
ATOM   6214  N N   . ILE C 1 89  ? 15.534  70.505  24.131  1.00   22.00 ? 89   ILE C N   1 
ATOM   6215  C CA  . ILE C 1 89  ? 14.670  69.658  23.325  1.00   21.84 ? 89   ILE C CA  1 
ATOM   6216  C C   . ILE C 1 89  ? 13.780  70.527  22.448  1.00   22.64 ? 89   ILE C C   1 
ATOM   6217  O O   . ILE C 1 89  ? 13.709  70.363  21.229  1.00   20.94 ? 89   ILE C O   1 
ATOM   6218  C CB  . ILE C 1 89  ? 13.831  68.766  24.258  1.00   23.83 ? 89   ILE C CB  1 
ATOM   6219  C CG1 . ILE C 1 89  ? 14.758  67.704  24.885  1.00   20.98 ? 89   ILE C CG1 1 
ATOM   6220  C CG2 . ILE C 1 89  ? 12.630  68.148  23.511  1.00   28.88 ? 89   ILE C CG2 1 
ATOM   6221  C CD1 . ILE C 1 89  ? 14.153  66.903  26.069  1.00   13.01 ? 89   ILE C CD1 1 
ATOM   6222  N N   . TYR C 1 90  ? 13.152  71.495  23.087  1.00   22.82 ? 90   TYR C N   1 
ATOM   6223  C CA  . TYR C 1 90  ? 12.254  72.406  22.430  1.00   20.12 ? 90   TYR C CA  1 
ATOM   6224  C C   . TYR C 1 90  ? 12.902  73.177  21.283  1.00   20.80 ? 90   TYR C C   1 
ATOM   6225  O O   . TYR C 1 90  ? 12.371  73.179  20.180  1.00   21.84 ? 90   TYR C O   1 
ATOM   6226  C CB  . TYR C 1 90  ? 11.701  73.323  23.505  1.00   17.27 ? 90   TYR C CB  1 
ATOM   6227  C CG  . TYR C 1 90  ? 10.515  74.156  23.144  1.00   14.85 ? 90   TYR C CG  1 
ATOM   6228  C CD1 . TYR C 1 90  ? 10.676  75.471  22.688  1.00   12.83 ? 90   TYR C CD1 1 
ATOM   6229  C CD2 . TYR C 1 90  ? 9.230   73.705  23.449  1.00   16.97 ? 90   TYR C CD2 1 
ATOM   6230  C CE1 . TYR C 1 90  ? 9.581   76.329  22.583  1.00   18.77 ? 90   TYR C CE1 1 
ATOM   6231  C CE2 . TYR C 1 90  ? 8.129   74.533  23.344  1.00   13.25 ? 90   TYR C CE2 1 
ATOM   6232  C CZ  . TYR C 1 90  ? 8.308   75.854  22.920  1.00   20.68 ? 90   TYR C CZ  1 
ATOM   6233  O OH  . TYR C 1 90  ? 7.217   76.700  22.871  1.00   17.30 ? 90   TYR C OH  1 
ATOM   6234  N N   . VAL C 1 91  ? 14.045  73.817  21.504  1.00   21.57 ? 91   VAL C N   1 
ATOM   6235  C CA  . VAL C 1 91  ? 14.674  74.553  20.403  1.00   21.81 ? 91   VAL C CA  1 
ATOM   6236  C C   . VAL C 1 91  ? 15.138  73.618  19.262  1.00   23.86 ? 91   VAL C C   1 
ATOM   6237  O O   . VAL C 1 91  ? 15.096  73.987  18.089  1.00   24.69 ? 91   VAL C O   1 
ATOM   6238  C CB  . VAL C 1 91  ? 15.909  75.384  20.854  1.00   23.08 ? 91   VAL C CB  1 
ATOM   6239  C CG1 . VAL C 1 91  ? 15.593  76.232  22.122  1.00   9.16  ? 91   VAL C CG1 1 
ATOM   6240  C CG2 . VAL C 1 91  ? 17.078  74.448  21.068  1.00   27.54 ? 91   VAL C CG2 1 
ATOM   6241  N N   . MET C 1 92  ? 15.603  72.420  19.598  1.00   22.99 ? 92   MET C N   1 
ATOM   6242  C CA  . MET C 1 92  ? 16.041  71.479  18.579  1.00   24.10 ? 92   MET C CA  1 
ATOM   6243  C C   . MET C 1 92  ? 14.914  71.117  17.627  1.00   24.31 ? 92   MET C C   1 
ATOM   6244  O O   . MET C 1 92  ? 15.139  70.937  16.424  1.00   25.61 ? 92   MET C O   1 
ATOM   6245  C CB  . MET C 1 92  ? 16.579  70.195  19.220  1.00   25.92 ? 92   MET C CB  1 
ATOM   6246  C CG  . MET C 1 92  ? 17.929  70.400  19.892  1.00   25.03 ? 92   MET C CG  1 
ATOM   6247  S SD  . MET C 1 92  ? 18.697  68.880  20.541  1.00   33.28 ? 92   MET C SD  1 
ATOM   6248  C CE  . MET C 1 92  ? 20.173  69.475  21.166  1.00   34.21 ? 92   MET C CE  1 
ATOM   6249  N N   . MET C 1 93  ? 13.713  70.984  18.171  1.00   23.32 ? 93   MET C N   1 
ATOM   6250  C CA  . MET C 1 93  ? 12.551  70.657  17.366  1.00   24.83 ? 93   MET C CA  1 
ATOM   6251  C C   . MET C 1 93  ? 12.285  71.785  16.386  1.00   26.91 ? 93   MET C C   1 
ATOM   6252  O O   . MET C 1 93  ? 11.682  71.577  15.331  1.00   29.25 ? 93   MET C O   1 
ATOM   6253  C CB  . MET C 1 93  ? 11.336  70.418  18.265  1.00   26.96 ? 93   MET C CB  1 
ATOM   6254  C CG  . MET C 1 93  ? 11.374  69.071  18.959  1.00   27.95 ? 93   MET C CG  1 
ATOM   6255  S SD  . MET C 1 93  ? 9.904   68.761  19.901  1.00   31.85 ? 93   MET C SD  1 
ATOM   6256  C CE  . MET C 1 93  ? 10.069  66.948  20.104  1.00   30.33 ? 93   MET C CE  1 
ATOM   6257  N N   . LEU C 1 94  ? 12.738  72.986  16.736  1.00   27.00 ? 94   LEU C N   1 
ATOM   6258  C CA  . LEU C 1 94  ? 12.571  74.131  15.857  1.00   27.73 ? 94   LEU C CA  1 
ATOM   6259  C C   . LEU C 1 94  ? 13.732  74.156  14.870  1.00   28.38 ? 94   LEU C C   1 
ATOM   6260  O O   . LEU C 1 94  ? 13.664  74.792  13.826  1.00   28.40 ? 94   LEU C O   1 
ATOM   6261  C CB  . LEU C 1 94  ? 12.550  75.427  16.666  1.00   26.73 ? 94   LEU C CB  1 
ATOM   6262  C CG  . LEU C 1 94  ? 11.397  75.532  17.675  1.00   29.65 ? 94   LEU C CG  1 
ATOM   6263  C CD1 . LEU C 1 94  ? 11.600  76.724  18.595  1.00   29.99 ? 94   LEU C CD1 1 
ATOM   6264  C CD2 . LEU C 1 94  ? 10.076  75.629  16.919  1.00   29.08 ? 94   LEU C CD2 1 
ATOM   6265  N N   . MET C 1 95  ? 14.803  73.443  15.182  1.00   28.72 ? 95   MET C N   1 
ATOM   6266  C CA  . MET C 1 95  ? 15.964  73.453  14.295  1.00   30.64 ? 95   MET C CA  1 
ATOM   6267  C C   . MET C 1 95  ? 15.946  72.440  13.151  1.00   31.22 ? 95   MET C C   1 
ATOM   6268  O O   . MET C 1 95  ? 16.497  72.686  12.095  1.00   33.17 ? 95   MET C O   1 
ATOM   6269  C CB  . MET C 1 95  ? 17.241  73.251  15.111  1.00   26.46 ? 95   MET C CB  1 
ATOM   6270  C CG  . MET C 1 95  ? 17.598  74.400  15.996  1.00   25.13 ? 95   MET C CG  1 
ATOM   6271  S SD  . MET C 1 95  ? 18.887  73.902  17.141  1.00   30.52 ? 95   MET C SD  1 
ATOM   6272  C CE  . MET C 1 95  ? 20.360  73.804  15.918  1.00   16.42 ? 95   MET C CE  1 
ATOM   6273  N N   . PHE C 1 96  ? 15.313  71.296  13.346  1.00   32.34 ? 96   PHE C N   1 
ATOM   6274  C CA  . PHE C 1 96  ? 15.301  70.302  12.297  1.00   29.89 ? 96   PHE C CA  1 
ATOM   6275  C C   . PHE C 1 96  ? 14.004  70.250  11.546  1.00   31.35 ? 96   PHE C C   1 
ATOM   6276  O O   . PHE C 1 96  ? 12.940  70.589  12.083  1.00   28.84 ? 96   PHE C O   1 
ATOM   6277  C CB  . PHE C 1 96  ? 15.633  68.937  12.884  1.00   29.50 ? 96   PHE C CB  1 
ATOM   6278  C CG  . PHE C 1 96  ? 17.002  68.872  13.462  1.00   27.93 ? 96   PHE C CG  1 
ATOM   6279  C CD1 . PHE C 1 96  ? 18.074  68.472  12.691  1.00   25.29 ? 96   PHE C CD1 1 
ATOM   6280  C CD2 . PHE C 1 96  ? 17.237  69.323  14.747  1.00   28.23 ? 96   PHE C CD2 1 
ATOM   6281  C CE1 . PHE C 1 96  ? 19.371  68.529  13.180  1.00   21.22 ? 96   PHE C CE1 1 
ATOM   6282  C CE2 . PHE C 1 96  ? 18.527  69.384  15.242  1.00   29.03 ? 96   PHE C CE2 1 
ATOM   6283  C CZ  . PHE C 1 96  ? 19.600  68.984  14.444  1.00   28.00 ? 96   PHE C CZ  1 
ATOM   6284  N N   . ASP C 1 97  ? 14.109  69.824  10.289  1.00   30.23 ? 97   ASP C N   1 
ATOM   6285  C CA  . ASP C 1 97  ? 12.949  69.722  9.438   1.00   31.64 ? 97   ASP C CA  1 
ATOM   6286  C C   . ASP C 1 97  ? 11.970  68.695  9.963   1.00   30.56 ? 97   ASP C C   1 
ATOM   6287  O O   . ASP C 1 97  ? 10.807  68.740  9.617   1.00   30.16 ? 97   ASP C O   1 
ATOM   6288  C CB  . ASP C 1 97  ? 13.351  69.377  8.007   1.00   35.15 ? 97   ASP C CB  1 
ATOM   6289  C CG  . ASP C 1 97  ? 12.153  69.051  7.135   1.00   42.47 ? 97   ASP C CG  1 
ATOM   6290  O OD1 . ASP C 1 97  ? 11.580  67.952  7.305   1.00   42.88 ? 97   ASP C OD1 1 
ATOM   6291  O OD2 . ASP C 1 97  ? 11.771  69.898  6.291   1.00   47.67 ? 97   ASP C OD2 1 
ATOM   6292  N N   . ARG C 1 98  ? 12.436  67.764  10.791  1.00   30.54 ? 98   ARG C N   1 
ATOM   6293  C CA  . ARG C 1 98  ? 11.552  66.754  11.365  1.00   29.73 ? 98   ARG C CA  1 
ATOM   6294  C C   . ARG C 1 98  ? 12.129  66.102  12.606  1.00   27.59 ? 98   ARG C C   1 
ATOM   6295  O O   . ARG C 1 98  ? 13.340  65.926  12.717  1.00   29.78 ? 98   ARG C O   1 
ATOM   6296  C CB  . ARG C 1 98  ? 11.206  65.665  10.348  1.00   31.53 ? 98   ARG C CB  1 
ATOM   6297  C CG  . ARG C 1 98  ? 10.147  64.704  10.873  1.00   37.24 ? 98   ARG C CG  1 
ATOM   6298  C CD  . ARG C 1 98  ? 9.900   63.537  9.934   1.00   41.85 ? 98   ARG C CD  1 
ATOM   6299  N NE  . ARG C 1 98  ? 11.073  62.678  9.761   1.00   42.64 ? 98   ARG C NE  1 
ATOM   6300  C CZ  . ARG C 1 98  ? 10.995  61.407  9.367   1.00   42.75 ? 98   ARG C CZ  1 
ATOM   6301  N NH1 . ARG C 1 98  ? 9.804   60.867  9.114   1.00   40.56 ? 98   ARG C NH1 1 
ATOM   6302  N NH2 . ARG C 1 98  ? 12.090  60.676  9.225   1.00   37.94 ? 98   ARG C NH2 1 
ATOM   6303  N N   . SER C 1 99  ? 11.243  65.758  13.537  1.00   27.45 ? 99   SER C N   1 
ATOM   6304  C CA  . SER C 1 99  ? 11.615  65.109  14.801  1.00   27.36 ? 99   SER C CA  1 
ATOM   6305  C C   . SER C 1 99  ? 11.100  63.670  14.882  1.00   25.02 ? 99   SER C C   1 
ATOM   6306  O O   . SER C 1 99  ? 9.967   63.369  14.498  1.00   26.41 ? 99   SER C O   1 
ATOM   6307  C CB  . SER C 1 99  ? 11.074  65.924  15.975  1.00   23.60 ? 99   SER C CB  1 
ATOM   6308  O OG  . SER C 1 99  ? 11.626  67.228  15.960  1.00   27.69 ? 99   SER C OG  1 
ATOM   6309  N N   . VAL C 1 100 ? 11.937  62.786  15.399  1.00   27.39 ? 100  VAL C N   1 
ATOM   6310  C CA  . VAL C 1 100 ? 11.592  61.368  15.514  1.00   26.05 ? 100  VAL C CA  1 
ATOM   6311  C C   . VAL C 1 100 ? 11.902  60.821  16.890  1.00   24.12 ? 100  VAL C C   1 
ATOM   6312  O O   . VAL C 1 100 ? 12.973  61.062  17.435  1.00   23.70 ? 100  VAL C O   1 
ATOM   6313  C CB  . VAL C 1 100 ? 12.389  60.537  14.483  1.00   26.27 ? 100  VAL C CB  1 
ATOM   6314  C CG1 . VAL C 1 100 ? 11.856  59.110  14.437  1.00   26.51 ? 100  VAL C CG1 1 
ATOM   6315  C CG2 . VAL C 1 100 ? 12.304  61.181  13.117  1.00   27.28 ? 100  VAL C CG2 1 
ATOM   6316  N N   . PHE C 1 101 ? 10.958  60.091  17.471  1.00   25.86 ? 101  PHE C N   1 
ATOM   6317  C CA  . PHE C 1 101 ? 11.210  59.478  18.791  1.00   24.22 ? 101  PHE C CA  1 
ATOM   6318  C C   . PHE C 1 101 ? 10.373  58.226  18.892  1.00   25.56 ? 101  PHE C C   1 
ATOM   6319  O O   . PHE C 1 101 ? 9.419   58.073  18.133  1.00   27.13 ? 101  PHE C O   1 
ATOM   6320  C CB  . PHE C 1 101 ? 10.941  60.454  19.949  1.00   21.49 ? 101  PHE C CB  1 
ATOM   6321  C CG  . PHE C 1 101 ? 9.785   61.369  19.722  1.00   17.28 ? 101  PHE C CG  1 
ATOM   6322  C CD1 . PHE C 1 101 ? 8.484   60.962  20.030  1.00   16.90 ? 101  PHE C CD1 1 
ATOM   6323  C CD2 . PHE C 1 101 ? 9.992   62.623  19.148  1.00   17.83 ? 101  PHE C CD2 1 
ATOM   6324  C CE1 . PHE C 1 101 ? 7.395   61.794  19.761  1.00   21.93 ? 101  PHE C CE1 1 
ATOM   6325  C CE2 . PHE C 1 101 ? 8.920   63.473  18.868  1.00   22.30 ? 101  PHE C CE2 1 
ATOM   6326  C CZ  . PHE C 1 101 ? 7.612   63.059  19.173  1.00   24.72 ? 101  PHE C CZ  1 
ATOM   6327  N N   . PHE C 1 102 ? 10.718  57.332  19.817  1.00   25.85 ? 102  PHE C N   1 
ATOM   6328  C CA  . PHE C 1 102 ? 10.029  56.047  19.908  1.00   25.65 ? 102  PHE C CA  1 
ATOM   6329  C C   . PHE C 1 102 ? 9.419   55.660  21.229  1.00   26.36 ? 102  PHE C C   1 
ATOM   6330  O O   . PHE C 1 102 ? 10.111  55.252  22.153  1.00   24.58 ? 102  PHE C O   1 
ATOM   6331  C CB  . PHE C 1 102 ? 10.995  54.962  19.520  1.00   26.86 ? 102  PHE C CB  1 
ATOM   6332  C CG  . PHE C 1 102 ? 12.085  55.433  18.632  1.00   26.66 ? 102  PHE C CG  1 
ATOM   6333  C CD1 . PHE C 1 102 ? 13.282  55.865  19.171  1.00   27.94 ? 102  PHE C CD1 1 
ATOM   6334  C CD2 . PHE C 1 102 ? 11.941  55.402  17.250  1.00   31.51 ? 102  PHE C CD2 1 
ATOM   6335  C CE1 . PHE C 1 102 ? 14.337  56.252  18.355  1.00   29.37 ? 102  PHE C CE1 1 
ATOM   6336  C CE2 . PHE C 1 102 ? 12.998  55.791  16.417  1.00   29.81 ? 102  PHE C CE2 1 
ATOM   6337  C CZ  . PHE C 1 102 ? 14.195  56.213  16.971  1.00   31.47 ? 102  PHE C CZ  1 
ATOM   6338  N N   . PRO C 1 103 ? 8.099   55.747  21.324  1.00   25.79 ? 103  PRO C N   1 
ATOM   6339  C CA  . PRO C 1 103 ? 7.464   55.388  22.583  1.00   25.17 ? 103  PRO C CA  1 
ATOM   6340  C C   . PRO C 1 103 ? 7.647   53.902  22.932  1.00   25.98 ? 103  PRO C C   1 
ATOM   6341  O O   . PRO C 1 103 ? 7.746   53.044  22.056  1.00   25.84 ? 103  PRO C O   1 
ATOM   6342  C CB  . PRO C 1 103 ? 6.001   55.816  22.362  1.00   25.46 ? 103  PRO C CB  1 
ATOM   6343  C CG  . PRO C 1 103 ? 5.804   55.713  20.901  1.00   20.59 ? 103  PRO C CG  1 
ATOM   6344  C CD  . PRO C 1 103 ? 7.113   56.177  20.309  1.00   25.25 ? 103  PRO C CD  1 
ATOM   6345  N N   . PRO C 1 104 ? 7.656   53.577  24.237  1.00   27.04 ? 104  PRO C N   1 
ATOM   6346  C CA  . PRO C 1 104 ? 7.500   54.492  25.379  1.00   25.28 ? 104  PRO C CA  1 
ATOM   6347  C C   . PRO C 1 104 ? 8.731   55.393  25.575  1.00   27.07 ? 104  PRO C C   1 
ATOM   6348  O O   . PRO C 1 104 ? 9.876   54.916  25.700  1.00   26.35 ? 104  PRO C O   1 
ATOM   6349  C CB  . PRO C 1 104 ? 7.277   53.525  26.537  1.00   23.83 ? 104  PRO C CB  1 
ATOM   6350  C CG  . PRO C 1 104 ? 8.225   52.412  26.207  1.00   22.77 ? 104  PRO C CG  1 
ATOM   6351  C CD  . PRO C 1 104 ? 8.037   52.223  24.694  1.00   25.63 ? 104  PRO C CD  1 
ATOM   6352  N N   . THR C 1 105 ? 8.493   56.702  25.585  1.00   24.89 ? 105  THR C N   1 
ATOM   6353  C CA  . THR C 1 105 ? 9.581   57.649  25.721  1.00   23.06 ? 105  THR C CA  1 
ATOM   6354  C C   . THR C 1 105 ? 9.187   58.910  26.503  1.00   23.89 ? 105  THR C C   1 
ATOM   6355  O O   . THR C 1 105 ? 8.063   59.038  26.997  1.00   22.31 ? 105  THR C O   1 
ATOM   6356  C CB  . THR C 1 105 ? 10.108  58.001  24.318  1.00   24.70 ? 105  THR C CB  1 
ATOM   6357  O OG1 . THR C 1 105 ? 11.118  59.010  24.409  1.00   28.91 ? 105  THR C OG1 1 
ATOM   6358  C CG2 . THR C 1 105 ? 8.954   58.466  23.424  1.00   26.97 ? 105  THR C CG2 1 
ATOM   6359  N N   . TYR C 1 106 ? 10.127  59.830  26.656  1.00   24.62 ? 106  TYR C N   1 
ATOM   6360  C CA  . TYR C 1 106 ? 9.832   61.064  27.377  1.00   22.87 ? 106  TYR C CA  1 
ATOM   6361  C C   . TYR C 1 106 ? 8.564   61.676  26.782  1.00   20.27 ? 106  TYR C C   1 
ATOM   6362  O O   . TYR C 1 106 ? 8.537   62.075  25.619  1.00   16.63 ? 106  TYR C O   1 
ATOM   6363  C CB  . TYR C 1 106 ? 11.001  62.035  27.250  1.00   24.24 ? 106  TYR C CB  1 
ATOM   6364  C CG  . TYR C 1 106 ? 10.869  63.270  28.098  1.00   23.89 ? 106  TYR C CG  1 
ATOM   6365  C CD1 . TYR C 1 106 ? 10.155  63.249  29.308  1.00   20.36 ? 106  TYR C CD1 1 
ATOM   6366  C CD2 . TYR C 1 106 ? 11.481  64.462  27.711  1.00   19.90 ? 106  TYR C CD2 1 
ATOM   6367  C CE1 . TYR C 1 106 ? 10.055  64.403  30.109  1.00   22.10 ? 106  TYR C CE1 1 
ATOM   6368  C CE2 . TYR C 1 106 ? 11.394  65.605  28.490  1.00   21.74 ? 106  TYR C CE2 1 
ATOM   6369  C CZ  . TYR C 1 106 ? 10.682  65.576  29.684  1.00   22.72 ? 106  TYR C CZ  1 
ATOM   6370  O OH  . TYR C 1 106 ? 10.606  66.731  30.416  1.00   21.06 ? 106  TYR C OH  1 
ATOM   6371  N N   . SER C 1 107 ? 7.530   61.747  27.608  1.00   19.93 ? 107  SER C N   1 
ATOM   6372  C CA  . SER C 1 107 ? 6.228   62.247  27.204  1.00   22.25 ? 107  SER C CA  1 
ATOM   6373  C C   . SER C 1 107 ? 6.223   63.661  26.635  1.00   22.95 ? 107  SER C C   1 
ATOM   6374  O O   . SER C 1 107 ? 5.338   64.006  25.864  1.00   25.66 ? 107  SER C O   1 
ATOM   6375  C CB  . SER C 1 107 ? 5.240   62.145  28.378  1.00   22.99 ? 107  SER C CB  1 
ATOM   6376  O OG  . SER C 1 107 ? 5.604   62.992  29.455  1.00   27.03 ? 107  SER C OG  1 
ATOM   6377  N N   . CYS C 1 108 ? 7.208   64.471  26.997  1.00   24.76 ? 108  CYS C N   1 
ATOM   6378  C CA  . CYS C 1 108 ? 7.268   65.830  26.485  1.00   26.75 ? 108  CYS C CA  1 
ATOM   6379  C C   . CYS C 1 108 ? 7.646   65.935  25.005  1.00   25.61 ? 108  CYS C C   1 
ATOM   6380  O O   . CYS C 1 108 ? 7.464   66.984  24.392  1.00   22.98 ? 108  CYS C O   1 
ATOM   6381  C CB  . CYS C 1 108 ? 8.215   66.688  27.339  1.00   27.77 ? 108  CYS C CB  1 
ATOM   6382  S SG  . CYS C 1 108 ? 7.476   67.227  28.898  1.00   34.34 ? 108  CYS C SG  1 
ATOM   6383  N N   . TYR C 1 109 ? 8.175   64.866  24.425  1.00   25.42 ? 109  TYR C N   1 
ATOM   6384  C CA  . TYR C 1 109 ? 8.507   64.931  23.005  1.00   26.73 ? 109  TYR C CA  1 
ATOM   6385  C C   . TYR C 1 109 ? 7.220   65.204  22.208  1.00   27.51 ? 109  TYR C C   1 
ATOM   6386  O O   . TYR C 1 109 ? 7.167   66.128  21.398  1.00   25.63 ? 109  TYR C O   1 
ATOM   6387  C CB  . TYR C 1 109 ? 9.169   63.637  22.516  1.00   23.03 ? 109  TYR C CB  1 
ATOM   6388  C CG  . TYR C 1 109 ? 10.558  63.403  23.098  1.00   23.66 ? 109  TYR C CG  1 
ATOM   6389  C CD1 . TYR C 1 109 ? 11.441  64.467  23.317  1.00   23.69 ? 109  TYR C CD1 1 
ATOM   6390  C CD2 . TYR C 1 109 ? 10.988  62.116  23.434  1.00   21.85 ? 109  TYR C CD2 1 
ATOM   6391  C CE1 . TYR C 1 109 ? 12.710  64.257  23.861  1.00   20.99 ? 109  TYR C CE1 1 
ATOM   6392  C CE2 . TYR C 1 109 ? 12.257  61.895  23.971  1.00   23.39 ? 109  TYR C CE2 1 
ATOM   6393  C CZ  . TYR C 1 109 ? 13.112  62.969  24.183  1.00   24.93 ? 109  TYR C CZ  1 
ATOM   6394  O OH  . TYR C 1 109 ? 14.375  62.751  24.699  1.00   23.81 ? 109  TYR C OH  1 
ATOM   6395  N N   . ARG C 1 110 ? 6.176   64.420  22.460  1.00   28.81 ? 110  ARG C N   1 
ATOM   6396  C CA  . ARG C 1 110 ? 4.906   64.590  21.758  1.00   27.29 ? 110  ARG C CA  1 
ATOM   6397  C C   . ARG C 1 110 ? 4.299   65.965  22.098  1.00   28.11 ? 110  ARG C C   1 
ATOM   6398  O O   . ARG C 1 110 ? 3.865   66.717  21.215  1.00   20.82 ? 110  ARG C O   1 
ATOM   6399  C CB  . ARG C 1 110 ? 3.946   63.469  22.177  1.00   28.17 ? 110  ARG C CB  1 
ATOM   6400  C CG  . ARG C 1 110 ? 2.826   63.146  21.205  1.00   33.50 ? 110  ARG C CG  1 
ATOM   6401  C CD  . ARG C 1 110 ? 2.133   61.873  21.673  1.00   41.23 ? 110  ARG C CD  1 
ATOM   6402  N NE  . ARG C 1 110 ? 1.392   61.166  20.631  1.00   48.35 ? 110  ARG C NE  1 
ATOM   6403  C CZ  . ARG C 1 110 ? 0.361   61.668  19.949  1.00   52.38 ? 110  ARG C CZ  1 
ATOM   6404  N NH1 . ARG C 1 110 ? -0.242  60.932  19.027  1.00   55.29 ? 110  ARG C NH1 1 
ATOM   6405  N NH2 . ARG C 1 110 ? -0.071  62.904  20.175  1.00   52.69 ? 110  ARG C NH2 1 
ATOM   6406  N N   . ILE C 1 111 ? 4.284   66.278  23.393  1.00   27.68 ? 111  ILE C N   1 
ATOM   6407  C CA  . ILE C 1 111 ? 3.740   67.537  23.886  1.00   27.66 ? 111  ILE C CA  1 
ATOM   6408  C C   . ILE C 1 111 ? 4.396   68.730  23.203  1.00   28.29 ? 111  ILE C C   1 
ATOM   6409  O O   . ILE C 1 111 ? 3.706   69.578  22.643  1.00   25.65 ? 111  ILE C O   1 
ATOM   6410  C CB  . ILE C 1 111 ? 3.957   67.671  25.411  1.00   25.36 ? 111  ILE C CB  1 
ATOM   6411  C CG1 . ILE C 1 111 ? 3.186   66.573  26.142  1.00   24.90 ? 111  ILE C CG1 1 
ATOM   6412  C CG2 . ILE C 1 111 ? 3.534   69.064  25.883  1.00   22.81 ? 111  ILE C CG2 1 
ATOM   6413  C CD1 . ILE C 1 111 ? 3.527   66.444  27.624  1.00   19.58 ? 111  ILE C CD1 1 
ATOM   6414  N N   . PHE C 1 112 ? 5.728   68.781  23.260  1.00   30.37 ? 112  PHE C N   1 
ATOM   6415  C CA  . PHE C 1 112 ? 6.505   69.874  22.690  1.00   29.02 ? 112  PHE C CA  1 
ATOM   6416  C C   . PHE C 1 112 ? 6.300   69.983  21.198  1.00   30.30 ? 112  PHE C C   1 
ATOM   6417  O O   . PHE C 1 112 ? 6.010   71.066  20.690  1.00   31.70 ? 112  PHE C O   1 
ATOM   6418  C CB  . PHE C 1 112 ? 8.005   69.696  22.997  1.00   29.65 ? 112  PHE C CB  1 
ATOM   6419  C CG  . PHE C 1 112 ? 8.377   69.969  24.440  1.00   31.39 ? 112  PHE C CG  1 
ATOM   6420  C CD1 . PHE C 1 112 ? 7.410   70.358  25.379  1.00   28.21 ? 112  PHE C CD1 1 
ATOM   6421  C CD2 . PHE C 1 112 ? 9.693   69.831  24.858  1.00   32.60 ? 112  PHE C CD2 1 
ATOM   6422  C CE1 . PHE C 1 112 ? 7.760   70.597  26.698  1.00   27.11 ? 112  PHE C CE1 1 
ATOM   6423  C CE2 . PHE C 1 112 ? 10.053  70.070  26.181  1.00   30.49 ? 112  PHE C CE2 1 
ATOM   6424  C CZ  . PHE C 1 112 ? 9.082   70.453  27.101  1.00   30.35 ? 112  PHE C CZ  1 
ATOM   6425  N N   . ALA C 1 113 ? 6.445   68.864  20.494  1.00   29.07 ? 113  ALA C N   1 
ATOM   6426  C CA  . ALA C 1 113 ? 6.275   68.875  19.040  1.00   28.61 ? 113  ALA C CA  1 
ATOM   6427  C C   . ALA C 1 113 ? 4.896   69.388  18.646  1.00   29.66 ? 113  ALA C C   1 
ATOM   6428  O O   . ALA C 1 113 ? 4.776   70.173  17.723  1.00   28.76 ? 113  ALA C O   1 
ATOM   6429  C CB  . ALA C 1 113 ? 6.512   67.472  18.453  1.00   26.76 ? 113  ALA C CB  1 
ATOM   6430  N N   . LYS C 1 114 ? 3.850   68.950  19.341  1.00   30.54 ? 114  LYS C N   1 
ATOM   6431  C CA  . LYS C 1 114 ? 2.509   69.417  19.016  1.00   31.35 ? 114  LYS C CA  1 
ATOM   6432  C C   . LYS C 1 114 ? 2.304   70.891  19.402  1.00   33.65 ? 114  LYS C C   1 
ATOM   6433  O O   . LYS C 1 114 ? 1.550   71.609  18.746  1.00   30.78 ? 114  LYS C O   1 
ATOM   6434  C CB  . LYS C 1 114 ? 1.457   68.537  19.703  1.00   35.12 ? 114  LYS C CB  1 
ATOM   6435  C CG  . LYS C 1 114 ? 1.170   67.217  18.969  1.00   40.41 ? 114  LYS C CG  1 
ATOM   6436  C CD  . LYS C 1 114 ? 0.236   66.283  19.752  1.00   44.23 ? 114  LYS C CD  1 
ATOM   6437  C CE  . LYS C 1 114 ? -1.114  66.073  19.037  1.00   48.36 ? 114  LYS C CE  1 
ATOM   6438  N NZ  . LYS C 1 114 ? -2.184  67.081  19.379  1.00   50.76 ? 114  LYS C NZ  1 
ATOM   6439  N N   . ALA C 1 115 ? 2.973   71.324  20.474  1.00   34.55 ? 115  ALA C N   1 
ATOM   6440  C CA  . ALA C 1 115 ? 2.899   72.698  20.966  1.00   31.80 ? 115  ALA C CA  1 
ATOM   6441  C C   . ALA C 1 115 ? 3.508   73.626  19.939  1.00   32.99 ? 115  ALA C C   1 
ATOM   6442  O O   . ALA C 1 115 ? 2.965   74.673  19.633  1.00   32.24 ? 115  ALA C O   1 
ATOM   6443  C CB  . ALA C 1 115 ? 3.660   72.816  22.255  1.00   30.78 ? 115  ALA C CB  1 
ATOM   6444  N N   . VAL C 1 116 ? 4.660   73.225  19.419  1.00   35.62 ? 116  VAL C N   1 
ATOM   6445  C CA  . VAL C 1 116 ? 5.384   73.999  18.419  1.00   36.28 ? 116  VAL C CA  1 
ATOM   6446  C C   . VAL C 1 116 ? 4.797   73.745  17.030  1.00   37.29 ? 116  VAL C C   1 
ATOM   6447  O O   . VAL C 1 116 ? 5.070   74.495  16.092  1.00   37.78 ? 116  VAL C O   1 
ATOM   6448  C CB  . VAL C 1 116 ? 6.904   73.620  18.443  1.00   39.07 ? 116  VAL C CB  1 
ATOM   6449  C CG1 . VAL C 1 116 ? 7.460   73.461  17.034  1.00   42.11 ? 116  VAL C CG1 1 
ATOM   6450  C CG2 . VAL C 1 116 ? 7.691   74.678  19.194  1.00   39.27 ? 116  VAL C CG2 1 
ATOM   6451  N N   . GLY C 1 117 ? 3.986   72.695  16.898  1.00   37.22 ? 117  GLY C N   1 
ATOM   6452  C CA  . GLY C 1 117 ? 3.399   72.377  15.604  1.00   37.66 ? 117  GLY C CA  1 
ATOM   6453  C C   . GLY C 1 117 ? 4.480   71.868  14.668  1.00   38.54 ? 117  GLY C C   1 
ATOM   6454  O O   . GLY C 1 117 ? 4.453   72.078  13.449  1.00   39.61 ? 117  GLY C O   1 
ATOM   6455  N N   . ALA C 1 118 ? 5.464   71.214  15.269  1.00   37.02 ? 118  ALA C N   1 
ATOM   6456  C CA  . ALA C 1 118 ? 6.554   70.628  14.522  1.00   36.10 ? 118  ALA C CA  1 
ATOM   6457  C C   . ALA C 1 118 ? 6.118   69.301  13.891  1.00   36.42 ? 118  ALA C C   1 
ATOM   6458  O O   . ALA C 1 118 ? 5.168   68.636  14.327  1.00   35.59 ? 118  ALA C O   1 
ATOM   6459  C CB  . ALA C 1 118 ? 7.758   70.395  15.447  1.00   35.16 ? 118  ALA C CB  1 
ATOM   6460  N N   . LYS C 1 119 ? 6.835   68.928  12.847  1.00   37.48 ? 119  LYS C N   1 
ATOM   6461  C CA  . LYS C 1 119 ? 6.591   67.694  12.129  1.00   37.64 ? 119  LYS C CA  1 
ATOM   6462  C C   . LYS C 1 119 ? 7.356   66.581  12.826  1.00   36.43 ? 119  LYS C C   1 
ATOM   6463  O O   . LYS C 1 119 ? 8.582   66.635  12.987  1.00   35.07 ? 119  LYS C O   1 
ATOM   6464  C CB  . LYS C 1 119 ? 7.087   67.840  10.706  1.00   40.36 ? 119  LYS C CB  1 
ATOM   6465  C CG  . LYS C 1 119 ? 8.511   68.349  10.635  1.00   45.72 ? 119  LYS C CG  1 
ATOM   6466  C CD  . LYS C 1 119 ? 8.672   69.809  11.125  1.00   50.42 ? 119  LYS C CD  1 
ATOM   6467  C CE  . LYS C 1 119 ? 9.499   69.891  12.405  1.00   51.59 ? 119  LYS C CE  1 
ATOM   6468  N NZ  . LYS C 1 119 ? 9.882   71.283  12.794  1.00   59.63 ? 119  LYS C NZ  1 
ATOM   6469  N N   . PHE C 1 120 ? 6.636   65.555  13.242  1.00   35.13 ? 120  PHE C N   1 
ATOM   6470  C CA  . PHE C 1 120 ? 7.296   64.464  13.921  1.00   34.89 ? 120  PHE C CA  1 
ATOM   6471  C C   . PHE C 1 120 ? 6.731   63.133  13.484  1.00   35.96 ? 120  PHE C C   1 
ATOM   6472  O O   . PHE C 1 120 ? 5.772   63.068  12.702  1.00   37.95 ? 120  PHE C O   1 
ATOM   6473  C CB  . PHE C 1 120 ? 7.136   64.630  15.424  1.00   30.96 ? 120  PHE C CB  1 
ATOM   6474  C CG  . PHE C 1 120 ? 5.714   64.573  15.887  1.00   27.56 ? 120  PHE C CG  1 
ATOM   6475  C CD1 . PHE C 1 120 ? 4.821   65.602  15.595  1.00   33.06 ? 120  PHE C CD1 1 
ATOM   6476  C CD2 . PHE C 1 120 ? 5.260   63.490  16.619  1.00   28.65 ? 120  PHE C CD2 1 
ATOM   6477  C CE1 . PHE C 1 120 ? 3.482   65.546  16.037  1.00   30.38 ? 120  PHE C CE1 1 
ATOM   6478  C CE2 . PHE C 1 120 ? 3.932   63.420  17.064  1.00   31.90 ? 120  PHE C CE2 1 
ATOM   6479  C CZ  . PHE C 1 120 ? 3.042   64.453  16.771  1.00   30.19 ? 120  PHE C CZ  1 
ATOM   6480  N N   . LEU C 1 121 ? 7.333   62.068  13.983  1.00   35.90 ? 121  LEU C N   1 
ATOM   6481  C CA  . LEU C 1 121 ? 6.883   60.717  13.662  1.00   36.79 ? 121  LEU C CA  1 
ATOM   6482  C C   . LEU C 1 121 ? 7.259   59.881  14.862  1.00   34.95 ? 121  LEU C C   1 
ATOM   6483  O O   . LEU C 1 121 ? 8.391   59.927  15.329  1.00   38.30 ? 121  LEU C O   1 
ATOM   6484  C CB  . LEU C 1 121 ? 7.592   60.192  12.403  1.00   37.89 ? 121  LEU C CB  1 
ATOM   6485  C CG  . LEU C 1 121 ? 7.062   58.916  11.721  1.00   37.66 ? 121  LEU C CG  1 
ATOM   6486  C CD1 . LEU C 1 121 ? 7.398   57.720  12.550  1.00   38.37 ? 121  LEU C CD1 1 
ATOM   6487  C CD2 . LEU C 1 121 ? 5.542   59.019  11.514  1.00   38.41 ? 121  LEU C CD2 1 
ATOM   6488  N N   . GLU C 1 122 ? 6.299   59.146  15.389  1.00   35.44 ? 122  GLU C N   1 
ATOM   6489  C CA  . GLU C 1 122 ? 6.572   58.296  16.534  1.00   36.16 ? 122  GLU C CA  1 
ATOM   6490  C C   . GLU C 1 122 ? 6.652   56.877  16.036  1.00   35.87 ? 122  GLU C C   1 
ATOM   6491  O O   . GLU C 1 122 ? 5.692   56.394  15.446  1.00   37.31 ? 122  GLU C O   1 
ATOM   6492  C CB  . GLU C 1 122 ? 5.445   58.401  17.549  1.00   35.68 ? 122  GLU C CB  1 
ATOM   6493  C CG  . GLU C 1 122 ? 5.127   59.805  17.964  1.00   38.22 ? 122  GLU C CG  1 
ATOM   6494  C CD  . GLU C 1 122 ? 4.267   59.840  19.192  1.00   40.96 ? 122  GLU C CD  1 
ATOM   6495  O OE1 . GLU C 1 122 ? 3.113   59.379  19.120  1.00   42.99 ? 122  GLU C OE1 1 
ATOM   6496  O OE2 . GLU C 1 122 ? 4.750   60.322  20.235  1.00   42.99 ? 122  GLU C OE2 1 
ATOM   6497  N N   . VAL C 1 123 ? 7.798   56.228  16.217  1.00   33.17 ? 123  VAL C N   1 
ATOM   6498  C CA  . VAL C 1 123 ? 7.923   54.826  15.812  1.00   32.73 ? 123  VAL C CA  1 
ATOM   6499  C C   . VAL C 1 123 ? 8.161   54.017  17.090  1.00   32.02 ? 123  VAL C C   1 
ATOM   6500  O O   . VAL C 1 123 ? 9.273   54.005  17.626  1.00   29.36 ? 123  VAL C O   1 
ATOM   6501  C CB  . VAL C 1 123 ? 9.106   54.556  14.883  1.00   33.99 ? 123  VAL C CB  1 
ATOM   6502  C CG1 . VAL C 1 123 ? 8.713   53.471  13.906  1.00   32.61 ? 123  VAL C CG1 1 
ATOM   6503  C CG2 . VAL C 1 123 ? 9.554   55.823  14.177  1.00   37.33 ? 123  VAL C CG2 1 
ATOM   6504  N N   . PRO C 1 124 ? 7.124   53.316  17.574  1.00   31.07 ? 124  PRO C N   1 
ATOM   6505  C CA  . PRO C 1 124 ? 7.232   52.519  18.795  1.00   30.98 ? 124  PRO C CA  1 
ATOM   6506  C C   . PRO C 1 124 ? 8.405   51.567  18.803  1.00   29.01 ? 124  PRO C C   1 
ATOM   6507  O O   . PRO C 1 124 ? 8.714   50.950  17.793  1.00   28.83 ? 124  PRO C O   1 
ATOM   6508  C CB  . PRO C 1 124 ? 5.895   51.772  18.846  1.00   29.88 ? 124  PRO C CB  1 
ATOM   6509  C CG  . PRO C 1 124 ? 4.974   52.655  18.084  1.00   32.30 ? 124  PRO C CG  1 
ATOM   6510  C CD  . PRO C 1 124 ? 5.830   53.063  16.917  1.00   32.42 ? 124  PRO C CD  1 
ATOM   6511  N N   . LEU C 1 125 ? 9.071   51.496  19.948  1.00   28.53 ? 125  LEU C N   1 
ATOM   6512  C CA  . LEU C 1 125 ? 10.180  50.588  20.163  1.00   28.12 ? 125  LEU C CA  1 
ATOM   6513  C C   . LEU C 1 125 ? 9.617   49.185  20.066  1.00   29.71 ? 125  LEU C C   1 
ATOM   6514  O O   . LEU C 1 125 ? 8.397   48.967  20.148  1.00   28.57 ? 125  LEU C O   1 
ATOM   6515  C CB  . LEU C 1 125 ? 10.739  50.754  21.570  1.00   24.73 ? 125  LEU C CB  1 
ATOM   6516  C CG  . LEU C 1 125 ? 11.386  52.118  21.799  1.00   23.15 ? 125  LEU C CG  1 
ATOM   6517  C CD1 . LEU C 1 125 ? 11.720  52.280  23.280  1.00   15.39 ? 125  LEU C CD1 1 
ATOM   6518  C CD2 . LEU C 1 125 ? 12.636  52.239  20.905  1.00   17.67 ? 125  LEU C CD2 1 
ATOM   6519  N N   . THR C 1 126 ? 10.516  48.230  19.893  1.00   31.28 ? 126  THR C N   1 
ATOM   6520  C CA  . THR C 1 126 ? 10.104  46.849  19.821  1.00   31.82 ? 126  THR C CA  1 
ATOM   6521  C C   . THR C 1 126 ? 9.610   46.476  21.213  1.00   32.96 ? 126  THR C C   1 
ATOM   6522  O O   . THR C 1 126 ? 9.744   47.267  22.155  1.00   32.21 ? 126  THR C O   1 
ATOM   6523  C CB  . THR C 1 126 ? 11.279  45.961  19.346  1.00   33.46 ? 126  THR C CB  1 
ATOM   6524  O OG1 . THR C 1 126 ? 12.458  46.226  20.123  1.00   33.10 ? 126  THR C OG1 1 
ATOM   6525  C CG2 . THR C 1 126 ? 11.576  46.248  17.877  1.00   32.36 ? 126  THR C CG2 1 
ATOM   6526  N N   . LYS C 1 127 ? 9.002   45.298  21.344  1.00   36.01 ? 127  LYS C N   1 
ATOM   6527  C CA  . LYS C 1 127 ? 8.481   44.851  22.637  1.00   33.76 ? 127  LYS C CA  1 
ATOM   6528  C C   . LYS C 1 127 ? 9.618   44.760  23.640  1.00   30.54 ? 127  LYS C C   1 
ATOM   6529  O O   . LYS C 1 127 ? 9.414   44.965  24.833  1.00   30.05 ? 127  LYS C O   1 
ATOM   6530  C CB  . LYS C 1 127 ? 7.773   43.486  22.510  1.00   39.02 ? 127  LYS C CB  1 
ATOM   6531  C CG  . LYS C 1 127 ? 6.922   43.096  23.735  1.00   38.79 ? 127  LYS C CG  1 
ATOM   6532  C CD  . LYS C 1 127 ? 6.318   41.700  23.564  1.00   41.68 ? 127  LYS C CD  1 
ATOM   6533  C CE  . LYS C 1 127 ? 5.631   41.208  24.840  1.00   44.69 ? 127  LYS C CE  1 
ATOM   6534  N NZ  . LYS C 1 127 ? 5.064   39.824  24.716  1.00   42.40 ? 127  LYS C NZ  1 
ATOM   6535  N N   . ASP C 1 128 ? 10.824  44.471  23.164  1.00   29.34 ? 128  ASP C N   1 
ATOM   6536  C CA  . ASP C 1 128 ? 11.962  44.408  24.068  1.00   26.09 ? 128  ASP C CA  1 
ATOM   6537  C C   . ASP C 1 128 ? 12.736  45.713  24.111  1.00   26.31 ? 128  ASP C C   1 
ATOM   6538  O O   . ASP C 1 128 ? 13.948  45.734  24.324  1.00   26.01 ? 128  ASP C O   1 
ATOM   6539  C CB  . ASP C 1 128 ? 12.882  43.234  23.722  1.00   26.53 ? 128  ASP C CB  1 
ATOM   6540  C CG  . ASP C 1 128 ? 13.185  43.137  22.260  1.00   23.66 ? 128  ASP C CG  1 
ATOM   6541  O OD1 . ASP C 1 128 ? 12.418  43.663  21.441  1.00   33.26 ? 128  ASP C OD1 1 
ATOM   6542  O OD2 . ASP C 1 128 ? 14.200  42.507  21.922  1.00   24.09 ? 128  ASP C OD2 1 
ATOM   6543  N N   . LEU C 1 129 ? 12.008  46.803  23.889  1.00   26.29 ? 129  LEU C N   1 
ATOM   6544  C CA  . LEU C 1 129 ? 12.546  48.163  23.954  1.00   26.41 ? 129  LEU C CA  1 
ATOM   6545  C C   . LEU C 1 129 ? 13.717  48.501  23.070  1.00   27.13 ? 129  LEU C C   1 
ATOM   6546  O O   . LEU C 1 129 ? 14.621  49.231  23.485  1.00   27.48 ? 129  LEU C O   1 
ATOM   6547  C CB  . LEU C 1 129 ? 12.922  48.498  25.402  1.00   22.59 ? 129  LEU C CB  1 
ATOM   6548  C CG  . LEU C 1 129 ? 11.844  48.048  26.390  1.00   23.20 ? 129  LEU C CG  1 
ATOM   6549  C CD1 . LEU C 1 129 ? 12.297  48.329  27.809  1.00   24.83 ? 129  LEU C CD1 1 
ATOM   6550  C CD2 . LEU C 1 129 ? 10.525  48.761  26.081  1.00   19.72 ? 129  LEU C CD2 1 
ATOM   6551  N N   . ARG C 1 130 ? 13.720  47.971  21.860  1.00   28.41 ? 130  ARG C N   1 
ATOM   6552  C CA  . ARG C 1 130 ? 14.801  48.295  20.945  1.00   29.94 ? 130  ARG C CA  1 
ATOM   6553  C C   . ARG C 1 130 ? 14.278  49.304  19.919  1.00   30.19 ? 130  ARG C C   1 
ATOM   6554  O O   . ARG C 1 130 ? 13.059  49.458  19.743  1.00   28.45 ? 130  ARG C O   1 
ATOM   6555  C CB  . ARG C 1 130 ? 15.308  47.024  20.246  1.00   30.34 ? 130  ARG C CB  1 
ATOM   6556  C CG  . ARG C 1 130 ? 15.535  45.899  21.230  1.00   35.42 ? 130  ARG C CG  1 
ATOM   6557  C CD  . ARG C 1 130 ? 16.524  44.873  20.747  1.00   38.22 ? 130  ARG C CD  1 
ATOM   6558  N NE  . ARG C 1 130 ? 17.894  45.191  21.131  1.00   41.28 ? 130  ARG C NE  1 
ATOM   6559  C CZ  . ARG C 1 130 ? 18.866  45.466  20.268  1.00   45.40 ? 130  ARG C CZ  1 
ATOM   6560  N NH1 . ARG C 1 130 ? 18.625  45.472  18.961  1.00   49.55 ? 130  ARG C NH1 1 
ATOM   6561  N NH2 . ARG C 1 130 ? 20.088  45.726  20.715  1.00   44.95 ? 130  ARG C NH2 1 
ATOM   6562  N N   . ILE C 1 131 ? 15.197  50.013  19.272  1.00   29.87 ? 131  ILE C N   1 
ATOM   6563  C CA  . ILE C 1 131 ? 14.816  50.962  18.243  1.00   32.11 ? 131  ILE C CA  1 
ATOM   6564  C C   . ILE C 1 131 ? 14.362  50.138  17.039  1.00   34.70 ? 131  ILE C C   1 
ATOM   6565  O O   . ILE C 1 131 ? 15.049  49.217  16.613  1.00   36.45 ? 131  ILE C O   1 
ATOM   6566  C CB  . ILE C 1 131 ? 15.992  51.859  17.857  1.00   30.07 ? 131  ILE C CB  1 
ATOM   6567  C CG1 . ILE C 1 131 ? 16.569  52.499  19.128  1.00   26.39 ? 131  ILE C CG1 1 
ATOM   6568  C CG2 . ILE C 1 131 ? 15.533  52.932  16.876  1.00   22.76 ? 131  ILE C CG2 1 
ATOM   6569  C CD1 . ILE C 1 131 ? 17.653  53.529  18.874  1.00   25.05 ? 131  ILE C CD1 1 
ATOM   6570  N N   . PRO C 1 132 ? 13.174  50.442  16.502  1.00   38.34 ? 132  PRO C N   1 
ATOM   6571  C CA  . PRO C 1 132 ? 12.619  49.730  15.352  1.00   38.86 ? 132  PRO C CA  1 
ATOM   6572  C C   . PRO C 1 132 ? 13.225  50.232  14.055  1.00   42.24 ? 132  PRO C C   1 
ATOM   6573  O O   . PRO C 1 132 ? 14.020  51.172  14.067  1.00   40.66 ? 132  PRO C O   1 
ATOM   6574  C CB  . PRO C 1 132 ? 11.144  50.057  15.446  1.00   38.70 ? 132  PRO C CB  1 
ATOM   6575  C CG  . PRO C 1 132 ? 11.196  51.511  15.906  1.00   40.35 ? 132  PRO C CG  1 
ATOM   6576  C CD  . PRO C 1 132 ? 12.235  51.473  16.991  1.00   37.46 ? 132  PRO C CD  1 
ATOM   6577  N N   . GLU C 1 133 ? 12.846  49.592  12.945  1.00   46.93 ? 133  GLU C N   1 
ATOM   6578  C CA  . GLU C 1 133 ? 13.318  49.973  11.604  1.00   48.90 ? 133  GLU C CA  1 
ATOM   6579  C C   . GLU C 1 133 ? 12.665  51.300  11.264  1.00   46.99 ? 133  GLU C C   1 
ATOM   6580  O O   . GLU C 1 133 ? 11.471  51.464  11.474  1.00   48.81 ? 133  GLU C O   1 
ATOM   6581  C CB  . GLU C 1 133 ? 12.892  48.934  10.554  1.00   50.92 ? 133  GLU C CB  1 
ATOM   6582  C CG  . GLU C 1 133 ? 13.727  47.662  10.498  1.00   56.34 ? 133  GLU C CG  1 
ATOM   6583  C CD  . GLU C 1 133 ? 15.043  47.860  9.767   1.00   59.55 ? 133  GLU C CD  1 
ATOM   6584  O OE1 . GLU C 1 133 ? 15.937  48.521  10.329  1.00   60.42 ? 133  GLU C OE1 1 
ATOM   6585  O OE2 . GLU C 1 133 ? 15.182  47.362  8.624   1.00   62.40 ? 133  GLU C OE2 1 
ATOM   6586  N N   . VAL C 1 134 ? 13.439  52.243  10.737  1.00   47.94 ? 134  VAL C N   1 
ATOM   6587  C CA  . VAL C 1 134 ? 12.906  53.560  10.386  1.00   46.03 ? 134  VAL C CA  1 
ATOM   6588  C C   . VAL C 1 134 ? 13.681  54.216  9.256   1.00   45.57 ? 134  VAL C C   1 
ATOM   6589  O O   . VAL C 1 134 ? 14.898  54.076  9.157   1.00   46.55 ? 134  VAL C O   1 
ATOM   6590  C CB  . VAL C 1 134 ? 12.949  54.506  11.594  1.00   47.78 ? 134  VAL C CB  1 
ATOM   6591  C CG1 . VAL C 1 134 ? 12.012  54.015  12.676  1.00   46.85 ? 134  VAL C CG1 1 
ATOM   6592  C CG2 . VAL C 1 134 ? 14.382  54.596  12.131  1.00   43.83 ? 134  VAL C CG2 1 
ATOM   6593  N N   . ASN C 1 135 ? 12.971  54.953  8.412   1.00   45.83 ? 135  ASN C N   1 
ATOM   6594  C CA  . ASN C 1 135 ? 13.609  55.635  7.293   1.00   44.54 ? 135  ASN C CA  1 
ATOM   6595  C C   . ASN C 1 135 ? 13.899  57.063  7.691   1.00   42.39 ? 135  ASN C C   1 
ATOM   6596  O O   . ASN C 1 135 ? 13.008  57.906  7.700   1.00   40.91 ? 135  ASN C O   1 
ATOM   6597  C CB  . ASN C 1 135 ? 12.694  55.597  6.080   1.00   46.33 ? 135  ASN C CB  1 
ATOM   6598  C CG  . ASN C 1 135 ? 12.345  54.182  5.675   1.00   50.58 ? 135  ASN C CG  1 
ATOM   6599  O OD1 . ASN C 1 135 ? 11.361  53.946  4.972   1.00   52.74 ? 135  ASN C OD1 1 
ATOM   6600  N ND2 . ASN C 1 135 ? 13.158  53.224  6.111   1.00   55.86 ? 135  ASN C ND2 1 
ATOM   6601  N N   . VAL C 1 136 ? 15.153  57.330  8.024   1.00   41.06 ? 136  VAL C N   1 
ATOM   6602  C CA  . VAL C 1 136 ? 15.530  58.660  8.449   1.00   41.69 ? 136  VAL C CA  1 
ATOM   6603  C C   . VAL C 1 136 ? 16.788  59.130  7.746   1.00   41.84 ? 136  VAL C C   1 
ATOM   6604  O O   . VAL C 1 136 ? 17.433  58.352  7.049   1.00   42.10 ? 136  VAL C O   1 
ATOM   6605  C CB  . VAL C 1 136 ? 15.741  58.706  9.983   1.00   43.81 ? 136  VAL C CB  1 
ATOM   6606  C CG1 . VAL C 1 136 ? 15.860  60.143  10.435  1.00   49.22 ? 136  VAL C CG1 1 
ATOM   6607  C CG2 . VAL C 1 136 ? 14.565  58.038  10.700  1.00   42.93 ? 136  VAL C CG2 1 
ATOM   6608  N N   . GLY C 1 137 ? 17.116  60.410  7.921   1.00   41.85 ? 137  GLY C N   1 
ATOM   6609  C CA  . GLY C 1 137 ? 18.300  60.978  7.301   1.00   44.47 ? 137  GLY C CA  1 
ATOM   6610  C C   . GLY C 1 137 ? 18.453  62.457  7.615   1.00   45.40 ? 137  GLY C C   1 
ATOM   6611  O O   . GLY C 1 137 ? 17.704  62.990  8.427   1.00   46.49 ? 137  GLY C O   1 
ATOM   6612  N N   . GLU C 1 138 ? 19.423  63.114  6.978   1.00   46.65 ? 138  GLU C N   1 
ATOM   6613  C CA  . GLU C 1 138 ? 19.682  64.548  7.185   1.00   46.21 ? 138  GLU C CA  1 
ATOM   6614  C C   . GLU C 1 138 ? 18.412  65.367  7.102   1.00   44.11 ? 138  GLU C C   1 
ATOM   6615  O O   . GLU C 1 138 ? 17.574  65.142  6.228   1.00   41.48 ? 138  GLU C O   1 
ATOM   6616  C CB  . GLU C 1 138 ? 20.695  65.084  6.155   1.00   49.14 ? 138  GLU C CB  1 
ATOM   6617  C CG  . GLU C 1 138 ? 22.171  64.994  6.590   1.00   57.21 ? 138  GLU C CG  1 
ATOM   6618  C CD  . GLU C 1 138 ? 23.150  65.592  5.562   1.00   61.54 ? 138  GLU C CD  1 
ATOM   6619  O OE1 . GLU C 1 138 ? 23.022  66.791  5.230   1.00   60.42 ? 138  GLU C OE1 1 
ATOM   6620  O OE2 . GLU C 1 138 ? 24.055  64.864  5.088   1.00   62.70 ? 138  GLU C OE2 1 
ATOM   6621  N N   . GLY C 1 139 ? 18.290  66.331  8.014   1.00   44.03 ? 139  GLY C N   1 
ATOM   6622  C CA  . GLY C 1 139 ? 17.118  67.191  8.067   1.00   40.12 ? 139  GLY C CA  1 
ATOM   6623  C C   . GLY C 1 139 ? 16.230  66.689  9.188   1.00   40.07 ? 139  GLY C C   1 
ATOM   6624  O O   . GLY C 1 139 ? 15.317  67.383  9.652   1.00   39.53 ? 139  GLY C O   1 
ATOM   6625  N N   . ASP C 1 140 ? 16.518  65.461  9.622   1.00   38.23 ? 140  ASP C N   1 
ATOM   6626  C CA  . ASP C 1 140 ? 15.773  64.800  10.693  1.00   35.41 ? 140  ASP C CA  1 
ATOM   6627  C C   . ASP C 1 140 ? 16.519  64.804  12.018  1.00   31.45 ? 140  ASP C C   1 
ATOM   6628  O O   . ASP C 1 140 ? 17.742  64.774  12.052  1.00   27.48 ? 140  ASP C O   1 
ATOM   6629  C CB  . ASP C 1 140 ? 15.503  63.341  10.313  1.00   38.65 ? 140  ASP C CB  1 
ATOM   6630  C CG  . ASP C 1 140 ? 14.261  63.166  9.470   1.00   44.52 ? 140  ASP C CG  1 
ATOM   6631  O OD1 . ASP C 1 140 ? 14.053  62.026  8.994   1.00   47.76 ? 140  ASP C OD1 1 
ATOM   6632  O OD2 . ASP C 1 140 ? 13.493  64.138  9.292   1.00   46.42 ? 140  ASP C OD2 1 
ATOM   6633  N N   . VAL C 1 141 ? 15.776  64.863  13.114  1.00   29.82 ? 141  VAL C N   1 
ATOM   6634  C CA  . VAL C 1 141 ? 16.378  64.777  14.442  1.00   28.08 ? 141  VAL C CA  1 
ATOM   6635  C C   . VAL C 1 141 ? 15.654  63.676  15.209  1.00   26.30 ? 141  VAL C C   1 
ATOM   6636  O O   . VAL C 1 141 ? 14.429  63.671  15.321  1.00   23.32 ? 141  VAL C O   1 
ATOM   6637  C CB  . VAL C 1 141 ? 16.286  66.116  15.240  1.00   28.66 ? 141  VAL C CB  1 
ATOM   6638  C CG1 . VAL C 1 141 ? 14.831  66.474  15.537  1.00   22.58 ? 141  VAL C CG1 1 
ATOM   6639  C CG2 . VAL C 1 141 ? 17.091  66.002  16.511  1.00   21.78 ? 141  VAL C CG2 1 
ATOM   6640  N N   . VAL C 1 142 ? 16.408  62.723  15.727  1.00   27.28 ? 142  VAL C N   1 
ATOM   6641  C CA  . VAL C 1 142 ? 15.781  61.638  16.473  1.00   26.87 ? 142  VAL C CA  1 
ATOM   6642  C C   . VAL C 1 142 ? 16.151  61.725  17.945  1.00   25.36 ? 142  VAL C C   1 
ATOM   6643  O O   . VAL C 1 142 ? 17.339  61.745  18.311  1.00   25.05 ? 142  VAL C O   1 
ATOM   6644  C CB  . VAL C 1 142 ? 16.187  60.255  15.891  1.00   29.82 ? 142  VAL C CB  1 
ATOM   6645  C CG1 . VAL C 1 142 ? 17.692  60.202  15.666  1.00   37.41 ? 142  VAL C CG1 1 
ATOM   6646  C CG2 . VAL C 1 142 ? 15.764  59.138  16.848  1.00   30.81 ? 142  VAL C CG2 1 
ATOM   6647  N N   . PHE C 1 143 ? 15.122  61.799  18.782  1.00   22.13 ? 143  PHE C N   1 
ATOM   6648  C CA  . PHE C 1 143 ? 15.320  61.897  20.207  1.00   25.42 ? 143  PHE C CA  1 
ATOM   6649  C C   . PHE C 1 143 ? 15.419  60.536  20.878  1.00   26.92 ? 143  PHE C C   1 
ATOM   6650  O O   . PHE C 1 143 ? 14.513  59.710  20.819  1.00   28.35 ? 143  PHE C O   1 
ATOM   6651  C CB  . PHE C 1 143 ? 14.201  62.736  20.813  1.00   25.18 ? 143  PHE C CB  1 
ATOM   6652  C CG  . PHE C 1 143 ? 14.314  64.196  20.479  1.00   25.04 ? 143  PHE C CG  1 
ATOM   6653  C CD1 . PHE C 1 143 ? 15.205  65.022  21.170  1.00   24.16 ? 143  PHE C CD1 1 
ATOM   6654  C CD2 . PHE C 1 143 ? 13.562  64.745  19.441  1.00   25.46 ? 143  PHE C CD2 1 
ATOM   6655  C CE1 . PHE C 1 143 ? 15.343  66.385  20.827  1.00   25.14 ? 143  PHE C CE1 1 
ATOM   6656  C CE2 . PHE C 1 143 ? 13.690  66.096  19.093  1.00   25.08 ? 143  PHE C CE2 1 
ATOM   6657  C CZ  . PHE C 1 143 ? 14.579  66.915  19.785  1.00   26.97 ? 143  PHE C CZ  1 
ATOM   6658  N N   . ILE C 1 144 ? 16.554  60.305  21.513  1.00   27.77 ? 144  ILE C N   1 
ATOM   6659  C CA  . ILE C 1 144 ? 16.783  59.043  22.187  1.00   25.73 ? 144  ILE C CA  1 
ATOM   6660  C C   . ILE C 1 144 ? 17.290  59.213  23.594  1.00   24.60 ? 144  ILE C C   1 
ATOM   6661  O O   . ILE C 1 144 ? 18.483  59.461  23.789  1.00   28.12 ? 144  ILE C O   1 
ATOM   6662  C CB  . ILE C 1 144 ? 17.828  58.213  21.454  1.00   24.44 ? 144  ILE C CB  1 
ATOM   6663  C CG1 . ILE C 1 144 ? 17.380  57.980  20.006  1.00   24.58 ? 144  ILE C CG1 1 
ATOM   6664  C CG2 . ILE C 1 144 ? 18.067  56.917  22.220  1.00   18.66 ? 144  ILE C CG2 1 
ATOM   6665  C CD1 . ILE C 1 144 ? 18.500  57.490  19.095  1.00   24.63 ? 144  ILE C CD1 1 
ATOM   6666  N N   . PRO C 1 145 ? 16.403  59.104  24.591  1.00   22.35 ? 145  PRO C N   1 
ATOM   6667  C CA  . PRO C 1 145 ? 16.849  59.242  25.988  1.00   22.91 ? 145  PRO C CA  1 
ATOM   6668  C C   . PRO C 1 145 ? 17.576  57.962  26.388  1.00   23.77 ? 145  PRO C C   1 
ATOM   6669  O O   . PRO C 1 145 ? 17.083  56.855  26.144  1.00   24.72 ? 145  PRO C O   1 
ATOM   6670  C CB  . PRO C 1 145 ? 15.547  59.431  26.752  1.00   24.17 ? 145  PRO C CB  1 
ATOM   6671  C CG  . PRO C 1 145 ? 14.519  58.739  25.849  1.00   23.20 ? 145  PRO C CG  1 
ATOM   6672  C CD  . PRO C 1 145 ? 14.933  59.106  24.481  1.00   21.27 ? 145  PRO C CD  1 
ATOM   6673  N N   . ASN C 1 146 ? 18.751  58.108  26.986  1.00   24.61 ? 146  ASN C N   1 
ATOM   6674  C CA  . ASN C 1 146 ? 19.556  56.948  27.386  1.00   25.13 ? 146  ASN C CA  1 
ATOM   6675  C C   . ASN C 1 146 ? 20.260  57.208  28.717  1.00   24.37 ? 146  ASN C C   1 
ATOM   6676  O O   . ASN C 1 146 ? 21.220  57.957  28.766  1.00   21.99 ? 146  ASN C O   1 
ATOM   6677  C CB  . ASN C 1 146 ? 20.623  56.668  26.316  1.00   30.31 ? 146  ASN C CB  1 
ATOM   6678  C CG  . ASN C 1 146 ? 21.169  55.258  26.385  1.00   28.90 ? 146  ASN C CG  1 
ATOM   6679  O OD1 . ASN C 1 146 ? 20.587  54.331  25.841  1.00   33.18 ? 146  ASN C OD1 1 
ATOM   6680  N ND2 . ASN C 1 146 ? 22.293  55.090  27.075  1.00   37.57 ? 146  ASN C ND2 1 
ATOM   6681  N N   . PRO C 1 147 ? 19.772  56.619  29.826  1.00   25.20 ? 147  PRO C N   1 
ATOM   6682  C CA  . PRO C 1 147 ? 18.620  55.725  29.992  1.00   24.32 ? 147  PRO C CA  1 
ATOM   6683  C C   . PRO C 1 147 ? 17.320  56.306  29.431  1.00   26.69 ? 147  PRO C C   1 
ATOM   6684  O O   . PRO C 1 147 ? 17.118  57.523  29.403  1.00   26.80 ? 147  PRO C O   1 
ATOM   6685  C CB  . PRO C 1 147 ? 18.553  55.542  31.502  1.00   25.50 ? 147  PRO C CB  1 
ATOM   6686  C CG  . PRO C 1 147 ? 20.011  55.676  31.918  1.00   24.23 ? 147  PRO C CG  1 
ATOM   6687  C CD  . PRO C 1 147 ? 20.418  56.869  31.126  1.00   22.66 ? 147  PRO C CD  1 
ATOM   6688  N N   . ASN C 1 148 ? 16.438  55.416  29.002  1.00   27.54 ? 148  ASN C N   1 
ATOM   6689  C CA  . ASN C 1 148 ? 15.163  55.806  28.432  1.00   28.36 ? 148  ASN C CA  1 
ATOM   6690  C C   . ASN C 1 148 ? 14.165  56.221  29.506  1.00   28.25 ? 148  ASN C C   1 
ATOM   6691  O O   . ASN C 1 148 ? 14.221  55.744  30.628  1.00   31.24 ? 148  ASN C O   1 
ATOM   6692  C CB  . ASN C 1 148 ? 14.581  54.642  27.607  1.00   26.20 ? 148  ASN C CB  1 
ATOM   6693  C CG  . ASN C 1 148 ? 13.332  55.036  26.831  1.00   30.11 ? 148  ASN C CG  1 
ATOM   6694  O OD1 . ASN C 1 148 ? 13.368  55.949  25.994  1.00   28.49 ? 148  ASN C OD1 1 
ATOM   6695  N ND2 . ASN C 1 148 ? 12.220  54.352  27.101  1.00   28.54 ? 148  ASN C ND2 1 
ATOM   6696  N N   . ASN C 1 149 ? 13.263  57.127  29.146  1.00   26.92 ? 149  ASN C N   1 
ATOM   6697  C CA  . ASN C 1 149 ? 12.203  57.578  30.052  1.00   27.04 ? 149  ASN C CA  1 
ATOM   6698  C C   . ASN C 1 149 ? 10.963  56.989  29.385  1.00   27.12 ? 149  ASN C C   1 
ATOM   6699  O O   . ASN C 1 149 ? 10.721  57.247  28.210  1.00   31.56 ? 149  ASN C O   1 
ATOM   6700  C CB  . ASN C 1 149 ? 12.134  59.123  30.059  1.00   23.61 ? 149  ASN C CB  1 
ATOM   6701  C CG  . ASN C 1 149 ? 10.995  59.667  30.933  1.00   22.10 ? 149  ASN C CG  1 
ATOM   6702  O OD1 . ASN C 1 149 ? 9.924   59.085  31.016  1.00   24.76 ? 149  ASN C OD1 1 
ATOM   6703  N ND2 . ASN C 1 149 ? 11.228  60.820  31.566  1.00   26.99 ? 149  ASN C ND2 1 
ATOM   6704  N N   . PRO C 1 150 ? 10.122  56.223  30.120  1.00   27.01 ? 150  PRO C N   1 
ATOM   6705  C CA  . PRO C 1 150 ? 10.221  55.871  31.525  1.00   26.75 ? 150  PRO C CA  1 
ATOM   6706  C C   . PRO C 1 150 ? 10.654  54.440  31.817  1.00   26.59 ? 150  PRO C C   1 
ATOM   6707  O O   . PRO C 1 150 ? 10.343  53.937  32.879  1.00   27.97 ? 150  PRO C O   1 
ATOM   6708  C CB  . PRO C 1 150 ? 8.785   56.083  31.988  1.00   28.21 ? 150  PRO C CB  1 
ATOM   6709  C CG  . PRO C 1 150 ? 8.007   55.410  30.821  1.00   27.01 ? 150  PRO C CG  1 
ATOM   6710  C CD  . PRO C 1 150 ? 8.837   55.763  29.568  1.00   26.12 ? 150  PRO C CD  1 
ATOM   6711  N N   . THR C 1 151 ? 11.346  53.769  30.899  1.00   29.11 ? 151  THR C N   1 
ATOM   6712  C CA  . THR C 1 151 ? 11.731  52.394  31.165  1.00   29.11 ? 151  THR C CA  1 
ATOM   6713  C C   . THR C 1 151 ? 12.986  52.349  31.993  1.00   30.73 ? 151  THR C C   1 
ATOM   6714  O O   . THR C 1 151 ? 13.119  51.527  32.881  1.00   32.04 ? 151  THR C O   1 
ATOM   6715  C CB  . THR C 1 151 ? 11.986  51.596  29.873  1.00   29.24 ? 151  THR C CB  1 
ATOM   6716  O OG1 . THR C 1 151 ? 13.073  52.183  29.155  1.00   33.68 ? 151  THR C OG1 1 
ATOM   6717  C CG2 . THR C 1 151 ? 10.765  51.601  29.004  1.00   28.37 ? 151  THR C CG2 1 
ATOM   6718  N N   . GLY C 1 152 ? 13.903  53.263  31.720  1.00   32.02 ? 152  GLY C N   1 
ATOM   6719  C CA  . GLY C 1 152 ? 15.152  53.263  32.446  1.00   29.62 ? 152  GLY C CA  1 
ATOM   6720  C C   . GLY C 1 152 ? 16.133  52.287  31.796  1.00   28.93 ? 152  GLY C C   1 
ATOM   6721  O O   . GLY C 1 152 ? 17.257  52.143  32.276  1.00   28.54 ? 152  GLY C O   1 
ATOM   6722  N N   . HIS C 1 153 ? 15.726  51.620  30.714  1.00   25.94 ? 153  HIS C N   1 
ATOM   6723  C CA  . HIS C 1 153 ? 16.620  50.679  30.040  1.00   26.59 ? 153  HIS C CA  1 
ATOM   6724  C C   . HIS C 1 153 ? 17.662  51.433  29.216  1.00   27.69 ? 153  HIS C C   1 
ATOM   6725  O O   . HIS C 1 153 ? 17.483  52.595  28.874  1.00   26.75 ? 153  HIS C O   1 
ATOM   6726  C CB  . HIS C 1 153 ? 15.852  49.699  29.117  1.00   21.94 ? 153  HIS C CB  1 
ATOM   6727  C CG  . HIS C 1 153 ? 15.498  50.271  27.784  1.00   27.09 ? 153  HIS C CG  1 
ATOM   6728  N ND1 . HIS C 1 153 ? 14.323  50.950  27.551  1.00   21.52 ? 153  HIS C ND1 1 
ATOM   6729  C CD2 . HIS C 1 153 ? 16.190  50.306  26.618  1.00   25.90 ? 153  HIS C CD2 1 
ATOM   6730  C CE1 . HIS C 1 153 ? 14.305  51.371  26.299  1.00   24.13 ? 153  HIS C CE1 1 
ATOM   6731  N NE2 . HIS C 1 153 ? 15.427  50.994  25.710  1.00   24.81 ? 153  HIS C NE2 1 
ATOM   6732  N N   . VAL C 1 154 ? 18.744  50.740  28.883  1.00   30.59 ? 154  VAL C N   1 
ATOM   6733  C CA  . VAL C 1 154 ? 19.841  51.317  28.124  1.00   32.82 ? 154  VAL C CA  1 
ATOM   6734  C C   . VAL C 1 154 ? 20.003  50.729  26.725  1.00   34.17 ? 154  VAL C C   1 
ATOM   6735  O O   . VAL C 1 154 ? 20.282  49.534  26.564  1.00   33.57 ? 154  VAL C O   1 
ATOM   6736  C CB  . VAL C 1 154 ? 21.178  51.116  28.880  1.00   34.32 ? 154  VAL C CB  1 
ATOM   6737  C CG1 . VAL C 1 154 ? 22.347  51.611  28.039  1.00   33.55 ? 154  VAL C CG1 1 
ATOM   6738  C CG2 . VAL C 1 154 ? 21.119  51.825  30.210  1.00   33.11 ? 154  VAL C CG2 1 
ATOM   6739  N N   . PHE C 1 155 ? 19.818  51.581  25.720  1.00   37.08 ? 155  PHE C N   1 
ATOM   6740  C CA  . PHE C 1 155 ? 19.993  51.197  24.323  1.00   38.12 ? 155  PHE C CA  1 
ATOM   6741  C C   . PHE C 1 155 ? 21.480  50.924  24.154  1.00   40.10 ? 155  PHE C C   1 
ATOM   6742  O O   . PHE C 1 155 ? 22.322  51.473  24.888  1.00   40.23 ? 155  PHE C O   1 
ATOM   6743  C CB  . PHE C 1 155 ? 19.618  52.336  23.382  1.00   34.20 ? 155  PHE C CB  1 
ATOM   6744  C CG  . PHE C 1 155 ? 18.169  52.724  23.426  1.00   34.45 ? 155  PHE C CG  1 
ATOM   6745  C CD1 . PHE C 1 155 ? 17.764  53.871  24.125  1.00   31.67 ? 155  PHE C CD1 1 
ATOM   6746  C CD2 . PHE C 1 155 ? 17.209  51.979  22.729  1.00   27.95 ? 155  PHE C CD2 1 
ATOM   6747  C CE1 . PHE C 1 155 ? 16.421  54.271  24.121  1.00   27.52 ? 155  PHE C CE1 1 
ATOM   6748  C CE2 . PHE C 1 155 ? 15.866  52.371  22.720  1.00   25.37 ? 155  PHE C CE2 1 
ATOM   6749  C CZ  . PHE C 1 155 ? 15.474  53.515  23.414  1.00   23.12 ? 155  PHE C CZ  1 
ATOM   6750  N N   . GLU C 1 156 ? 21.807  50.092  23.177  1.00   41.34 ? 156  GLU C N   1 
ATOM   6751  C CA  . GLU C 1 156 ? 23.203  49.760  22.926  1.00   42.39 ? 156  GLU C CA  1 
ATOM   6752  C C   . GLU C 1 156 ? 23.862  50.643  21.874  1.00   43.62 ? 156  GLU C C   1 
ATOM   6753  O O   . GLU C 1 156 ? 23.181  51.327  21.101  1.00   41.26 ? 156  GLU C O   1 
ATOM   6754  C CB  . GLU C 1 156 ? 23.302  48.300  22.539  1.00   42.04 ? 156  GLU C CB  1 
ATOM   6755  C CG  . GLU C 1 156 ? 23.018  47.411  23.733  1.00   45.03 ? 156  GLU C CG  1 
ATOM   6756  C CD  . GLU C 1 156 ? 22.980  45.948  23.389  1.00   47.96 ? 156  GLU C CD  1 
ATOM   6757  O OE1 . GLU C 1 156 ? 21.867  45.423  23.135  1.00   46.22 ? 156  GLU C OE1 1 
ATOM   6758  O OE2 . GLU C 1 156 ? 24.075  45.338  23.372  1.00   51.44 ? 156  GLU C OE2 1 
ATOM   6759  N N   . ARG C 1 157 ? 25.193  50.631  21.851  1.00   45.94 ? 157  ARG C N   1 
ATOM   6760  C CA  . ARG C 1 157 ? 25.943  51.442  20.895  1.00   46.41 ? 157  ARG C CA  1 
ATOM   6761  C C   . ARG C 1 157 ? 25.568  51.126  19.465  1.00   44.85 ? 157  ARG C C   1 
ATOM   6762  O O   . ARG C 1 157 ? 25.419  52.039  18.663  1.00   42.90 ? 157  ARG C O   1 
ATOM   6763  C CB  . ARG C 1 157 ? 27.453  51.262  21.085  1.00   51.03 ? 157  ARG C CB  1 
ATOM   6764  C CG  . ARG C 1 157 ? 27.914  51.649  22.476  1.00   59.25 ? 157  ARG C CG  1 
ATOM   6765  C CD  . ARG C 1 157 ? 29.392  51.993  22.523  1.00   63.03 ? 157  ARG C CD  1 
ATOM   6766  N NE  . ARG C 1 157 ? 29.632  53.060  23.493  1.00   65.00 ? 157  ARG C NE  1 
ATOM   6767  C CZ  . ARG C 1 157 ? 30.817  53.607  23.744  1.00   64.92 ? 157  ARG C CZ  1 
ATOM   6768  N NH1 . ARG C 1 157 ? 31.904  53.189  23.099  1.00   64.46 ? 157  ARG C NH1 1 
ATOM   6769  N NH2 . ARG C 1 157 ? 30.909  54.589  24.630  1.00   62.68 ? 157  ARG C NH2 1 
ATOM   6770  N N   . GLU C 1 158 ? 25.389  49.839  19.151  1.00   44.50 ? 158  GLU C N   1 
ATOM   6771  C CA  . GLU C 1 158 ? 25.045  49.447  17.785  1.00   44.43 ? 158  GLU C CA  1 
ATOM   6772  C C   . GLU C 1 158 ? 23.743  50.101  17.324  1.00   43.94 ? 158  GLU C C   1 
ATOM   6773  O O   . GLU C 1 158 ? 23.663  50.593  16.194  1.00   42.95 ? 158  GLU C O   1 
ATOM   6774  C CB  . GLU C 1 158 ? 24.951  47.915  17.643  1.00   43.95 ? 158  GLU C CB  1 
ATOM   6775  C CG  . GLU C 1 158 ? 24.685  47.459  16.193  1.00   46.45 ? 158  GLU C CG  1 
ATOM   6776  C CD  . GLU C 1 158 ? 24.772  45.944  15.981  1.00   51.36 ? 158  GLU C CD  1 
ATOM   6777  O OE1 . GLU C 1 158 ? 25.894  45.384  15.995  1.00   49.65 ? 158  GLU C OE1 1 
ATOM   6778  O OE2 . GLU C 1 158 ? 23.706  45.313  15.792  1.00   53.30 ? 158  GLU C OE2 1 
ATOM   6779  N N   . GLU C 1 159 ? 22.739  50.120  18.200  1.00   42.31 ? 159  GLU C N   1 
ATOM   6780  C CA  . GLU C 1 159 ? 21.442  50.715  17.883  1.00   43.00 ? 159  GLU C CA  1 
ATOM   6781  C C   . GLU C 1 159 ? 21.543  52.193  17.507  1.00   44.06 ? 159  GLU C C   1 
ATOM   6782  O O   . GLU C 1 159 ? 20.975  52.632  16.504  1.00   46.18 ? 159  GLU C O   1 
ATOM   6783  C CB  . GLU C 1 159 ? 20.495  50.591  19.073  1.00   41.77 ? 159  GLU C CB  1 
ATOM   6784  C CG  . GLU C 1 159 ? 19.852  49.226  19.269  1.00   37.22 ? 159  GLU C CG  1 
ATOM   6785  C CD  . GLU C 1 159 ? 19.011  49.190  20.534  1.00   33.70 ? 159  GLU C CD  1 
ATOM   6786  O OE1 . GLU C 1 159 ? 19.591  49.148  21.639  1.00   37.26 ? 159  GLU C OE1 1 
ATOM   6787  O OE2 . GLU C 1 159 ? 17.776  49.234  20.443  1.00   28.85 ? 159  GLU C OE2 1 
ATOM   6788  N N   . ILE C 1 160 ? 22.254  52.957  18.325  1.00   43.92 ? 160  ILE C N   1 
ATOM   6789  C CA  . ILE C 1 160 ? 22.414  54.383  18.086  1.00   43.26 ? 160  ILE C CA  1 
ATOM   6790  C C   . ILE C 1 160 ? 23.283  54.607  16.859  1.00   41.68 ? 160  ILE C C   1 
ATOM   6791  O O   . ILE C 1 160 ? 22.997  55.467  16.028  1.00   43.42 ? 160  ILE C O   1 
ATOM   6792  C CB  . ILE C 1 160 ? 23.054  55.057  19.303  1.00   41.52 ? 160  ILE C CB  1 
ATOM   6793  C CG1 . ILE C 1 160 ? 22.128  54.897  20.509  1.00   41.54 ? 160  ILE C CG1 1 
ATOM   6794  C CG2 . ILE C 1 160 ? 23.313  56.522  19.008  1.00   41.48 ? 160  ILE C CG2 1 
ATOM   6795  C CD1 . ILE C 1 160 ? 22.849  54.614  21.809  1.00   43.28 ? 160  ILE C CD1 1 
ATOM   6796  N N   . GLU C 1 161 ? 24.342  53.821  16.759  1.00   39.79 ? 161  GLU C N   1 
ATOM   6797  C CA  . GLU C 1 161 ? 25.277  53.892  15.641  1.00   38.03 ? 161  GLU C CA  1 
ATOM   6798  C C   . GLU C 1 161 ? 24.517  53.716  14.319  1.00   38.09 ? 161  GLU C C   1 
ATOM   6799  O O   . GLU C 1 161 ? 24.806  54.387  13.327  1.00   35.78 ? 161  GLU C O   1 
ATOM   6800  C CB  . GLU C 1 161 ? 26.308  52.785  15.799  1.00   38.77 ? 161  GLU C CB  1 
ATOM   6801  C CG  . GLU C 1 161 ? 27.609  53.000  15.079  1.00   41.22 ? 161  GLU C CG  1 
ATOM   6802  C CD  . GLU C 1 161 ? 28.785  52.909  16.026  1.00   45.25 ? 161  GLU C CD  1 
ATOM   6803  O OE1 . GLU C 1 161 ? 28.693  52.128  17.001  1.00   43.17 ? 161  GLU C OE1 1 
ATOM   6804  O OE2 . GLU C 1 161 ? 29.803  53.603  15.789  1.00   48.36 ? 161  GLU C OE2 1 
ATOM   6805  N N   . ARG C 1 162 ? 23.554  52.797  14.319  1.00   39.27 ? 162  ARG C N   1 
ATOM   6806  C CA  . ARG C 1 162 ? 22.733  52.523  13.143  1.00   40.37 ? 162  ARG C CA  1 
ATOM   6807  C C   . ARG C 1 162 ? 22.157  53.861  12.656  1.00   41.80 ? 162  ARG C C   1 
ATOM   6808  O O   . ARG C 1 162 ? 22.393  54.280  11.510  1.00   42.60 ? 162  ARG C O   1 
ATOM   6809  C CB  . ARG C 1 162 ? 21.579  51.577  13.515  1.00   40.41 ? 162  ARG C CB  1 
ATOM   6810  C CG  . ARG C 1 162 ? 21.140  50.607  12.415  1.00   42.15 ? 162  ARG C CG  1 
ATOM   6811  C CD  . ARG C 1 162 ? 19.813  49.935  12.774  1.00   50.20 ? 162  ARG C CD  1 
ATOM   6812  N NE  . ARG C 1 162 ? 19.703  49.605  14.199  1.00   57.73 ? 162  ARG C NE  1 
ATOM   6813  C CZ  . ARG C 1 162 ? 20.473  48.721  14.838  1.00   62.13 ? 162  ARG C CZ  1 
ATOM   6814  N NH1 . ARG C 1 162 ? 21.417  48.058  14.181  1.00   63.65 ? 162  ARG C NH1 1 
ATOM   6815  N NH2 . ARG C 1 162 ? 20.319  48.508  16.142  1.00   60.78 ? 162  ARG C NH2 1 
ATOM   6816  N N   . ILE C 1 163 ? 21.421  54.528  13.546  1.00   39.34 ? 163  ILE C N   1 
ATOM   6817  C CA  . ILE C 1 163 ? 20.793  55.804  13.245  1.00   39.61 ? 163  ILE C CA  1 
ATOM   6818  C C   . ILE C 1 163 ? 21.829  56.857  12.942  1.00   38.04 ? 163  ILE C C   1 
ATOM   6819  O O   . ILE C 1 163 ? 21.709  57.606  11.990  1.00   38.50 ? 163  ILE C O   1 
ATOM   6820  C CB  . ILE C 1 163 ? 19.942  56.286  14.428  1.00   41.00 ? 163  ILE C CB  1 
ATOM   6821  C CG1 . ILE C 1 163 ? 18.883  55.235  14.762  1.00   42.66 ? 163  ILE C CG1 1 
ATOM   6822  C CG2 . ILE C 1 163 ? 19.277  57.589  14.088  1.00   40.42 ? 163  ILE C CG2 1 
ATOM   6823  C CD1 . ILE C 1 163 ? 18.170  55.482  16.075  1.00   44.70 ? 163  ILE C CD1 1 
ATOM   6824  N N   . LEU C 1 164 ? 22.856  56.912  13.766  1.00   38.72 ? 164  LEU C N   1 
ATOM   6825  C CA  . LEU C 1 164 ? 23.900  57.890  13.576  1.00   40.08 ? 164  LEU C CA  1 
ATOM   6826  C C   . LEU C 1 164 ? 24.505  57.813  12.166  1.00   42.78 ? 164  LEU C C   1 
ATOM   6827  O O   . LEU C 1 164 ? 24.797  58.841  11.563  1.00   44.44 ? 164  LEU C O   1 
ATOM   6828  C CB  . LEU C 1 164 ? 24.952  57.708  14.673  1.00   36.67 ? 164  LEU C CB  1 
ATOM   6829  C CG  . LEU C 1 164 ? 25.544  58.969  15.326  1.00   39.30 ? 164  LEU C CG  1 
ATOM   6830  C CD1 . LEU C 1 164 ? 24.536  60.105  15.397  1.00   38.59 ? 164  LEU C CD1 1 
ATOM   6831  C CD2 . LEU C 1 164 ? 26.045  58.609  16.705  1.00   35.43 ? 164  LEU C CD2 1 
ATOM   6832  N N   . LYS C 1 165 ? 24.669  56.608  11.627  1.00   45.49 ? 165  LYS C N   1 
ATOM   6833  C CA  . LYS C 1 165 ? 25.235  56.446  10.288  1.00   45.80 ? 165  LYS C CA  1 
ATOM   6834  C C   . LYS C 1 165 ? 24.228  56.830  9.205   1.00   45.63 ? 165  LYS C C   1 
ATOM   6835  O O   . LYS C 1 165 ? 24.573  56.998  8.039   1.00   46.37 ? 165  LYS C O   1 
ATOM   6836  C CB  . LYS C 1 165 ? 25.728  55.002  10.078  1.00   47.97 ? 165  LYS C CB  1 
ATOM   6837  C CG  . LYS C 1 165 ? 27.001  54.671  10.873  1.00   48.53 ? 165  LYS C CG  1 
ATOM   6838  C CD  . LYS C 1 165 ? 27.697  53.396  10.401  1.00   48.36 ? 165  LYS C CD  1 
ATOM   6839  C CE  . LYS C 1 165 ? 26.864  52.157  10.661  1.00   50.10 ? 165  LYS C CE  1 
ATOM   6840  N NZ  . LYS C 1 165 ? 27.537  50.908  10.175  1.00   53.00 ? 165  LYS C NZ  1 
ATOM   6841  N N   . THR C 1 166 ? 22.975  56.975  9.605   1.00   44.81 ? 166  THR C N   1 
ATOM   6842  C CA  . THR C 1 166 ? 21.912  57.367  8.690   1.00   43.74 ? 166  THR C CA  1 
ATOM   6843  C C   . THR C 1 166 ? 22.119  58.802  8.214   1.00   42.90 ? 166  THR C C   1 
ATOM   6844  O O   . THR C 1 166 ? 21.662  59.203  7.139   1.00   42.33 ? 166  THR C O   1 
ATOM   6845  C CB  . THR C 1 166 ? 20.544  57.259  9.395   1.00   45.04 ? 166  THR C CB  1 
ATOM   6846  O OG1 . THR C 1 166 ? 19.971  55.968  9.132   1.00   42.73 ? 166  THR C OG1 1 
ATOM   6847  C CG2 . THR C 1 166 ? 19.607  58.348  8.937   1.00   46.42 ? 166  THR C CG2 1 
ATOM   6848  N N   . GLY C 1 167 ? 22.835  59.576  9.012   1.00   42.95 ? 167  GLY C N   1 
ATOM   6849  C CA  . GLY C 1 167 ? 23.060  60.966  8.657   1.00   41.18 ? 167  GLY C CA  1 
ATOM   6850  C C   . GLY C 1 167 ? 22.055  61.821  9.416   1.00   41.59 ? 167  GLY C C   1 
ATOM   6851  O O   . GLY C 1 167 ? 22.195  63.059  9.521   1.00   38.79 ? 167  GLY C O   1 
ATOM   6852  N N   . ALA C 1 168 ? 21.025  61.156  9.941   1.00   40.06 ? 168  ALA C N   1 
ATOM   6853  C CA  . ALA C 1 168 ? 20.000  61.840  10.713  1.00   37.89 ? 168  ALA C CA  1 
ATOM   6854  C C   . ALA C 1 168 ? 20.710  62.313  11.955  1.00   37.88 ? 168  ALA C C   1 
ATOM   6855  O O   . ALA C 1 168 ? 21.660  61.671  12.414  1.00   37.46 ? 168  ALA C O   1 
ATOM   6856  C CB  . ALA C 1 168 ? 18.874  60.881  11.071  1.00   35.87 ? 168  ALA C CB  1 
ATOM   6857  N N   . PHE C 1 169 ? 20.286  63.454  12.483  1.00   38.24 ? 169  PHE C N   1 
ATOM   6858  C CA  . PHE C 1 169 ? 20.912  63.999  13.681  1.00   37.38 ? 169  PHE C CA  1 
ATOM   6859  C C   . PHE C 1 169 ? 20.290  63.399  14.941  1.00   35.10 ? 169  PHE C C   1 
ATOM   6860  O O   . PHE C 1 169 ? 19.079  63.481  15.160  1.00   35.46 ? 169  PHE C O   1 
ATOM   6861  C CB  . PHE C 1 169 ? 20.783  65.523  13.697  1.00   37.58 ? 169  PHE C CB  1 
ATOM   6862  C CG  . PHE C 1 169 ? 21.715  66.194  14.670  1.00   38.27 ? 169  PHE C CG  1 
ATOM   6863  C CD1 . PHE C 1 169 ? 21.368  66.325  16.014  1.00   40.52 ? 169  PHE C CD1 1 
ATOM   6864  C CD2 . PHE C 1 169 ? 22.952  66.668  14.250  1.00   35.58 ? 169  PHE C CD2 1 
ATOM   6865  C CE1 . PHE C 1 169 ? 22.246  66.923  16.917  1.00   42.61 ? 169  PHE C CE1 1 
ATOM   6866  C CE2 . PHE C 1 169 ? 23.842  67.268  15.141  1.00   38.05 ? 169  PHE C CE2 1 
ATOM   6867  C CZ  . PHE C 1 169 ? 23.495  67.400  16.475  1.00   42.97 ? 169  PHE C CZ  1 
ATOM   6868  N N   . VAL C 1 170 ? 21.129  62.792  15.768  1.00   33.65 ? 170  VAL C N   1 
ATOM   6869  C CA  . VAL C 1 170 ? 20.650  62.157  16.990  1.00   30.68 ? 170  VAL C CA  1 
ATOM   6870  C C   . VAL C 1 170 ? 20.797  62.988  18.249  1.00   29.12 ? 170  VAL C C   1 
ATOM   6871  O O   . VAL C 1 170 ? 21.881  63.499  18.561  1.00   23.83 ? 170  VAL C O   1 
ATOM   6872  C CB  . VAL C 1 170 ? 21.359  60.804  17.245  1.00   29.01 ? 170  VAL C CB  1 
ATOM   6873  C CG1 . VAL C 1 170 ? 21.003  60.276  18.632  1.00   29.09 ? 170  VAL C CG1 1 
ATOM   6874  C CG2 . VAL C 1 170 ? 20.940  59.795  16.192  1.00   32.48 ? 170  VAL C CG2 1 
ATOM   6875  N N   . ALA C 1 171 ? 19.688  63.105  18.972  1.00   27.21 ? 171  ALA C N   1 
ATOM   6876  C CA  . ALA C 1 171 ? 19.678  63.828  20.231  1.00   28.56 ? 171  ALA C CA  1 
ATOM   6877  C C   . ALA C 1 171 ? 19.680  62.776  21.354  1.00   28.17 ? 171  ALA C C   1 
ATOM   6878  O O   . ALA C 1 171 ? 18.637  62.191  21.675  1.00   32.34 ? 171  ALA C O   1 
ATOM   6879  C CB  . ALA C 1 171 ? 18.449  64.690  20.317  1.00   24.92 ? 171  ALA C CB  1 
ATOM   6880  N N   . LEU C 1 172 ? 20.853  62.527  21.925  1.00   24.66 ? 172  LEU C N   1 
ATOM   6881  C CA  . LEU C 1 172 ? 20.979  61.550  22.991  1.00   25.59 ? 172  LEU C CA  1 
ATOM   6882  C C   . LEU C 1 172 ? 20.720  62.233  24.326  1.00   25.84 ? 172  LEU C C   1 
ATOM   6883  O O   . LEU C 1 172 ? 21.590  62.919  24.882  1.00   23.57 ? 172  LEU C O   1 
ATOM   6884  C CB  . LEU C 1 172 ? 22.373  60.929  22.979  1.00   29.01 ? 172  LEU C CB  1 
ATOM   6885  C CG  . LEU C 1 172 ? 22.418  59.477  23.438  1.00   31.65 ? 172  LEU C CG  1 
ATOM   6886  C CD1 . LEU C 1 172 ? 21.474  58.629  22.582  1.00   33.28 ? 172  LEU C CD1 1 
ATOM   6887  C CD2 . LEU C 1 172 ? 23.838  58.971  23.285  1.00   39.50 ? 172  LEU C CD2 1 
ATOM   6888  N N   . ASP C 1 173 ? 19.509  62.031  24.820  1.00   22.18 ? 173  ASP C N   1 
ATOM   6889  C CA  . ASP C 1 173 ? 19.039  62.625  26.051  1.00   26.50 ? 173  ASP C CA  1 
ATOM   6890  C C   . ASP C 1 173 ? 19.582  61.865  27.262  1.00   26.31 ? 173  ASP C C   1 
ATOM   6891  O O   . ASP C 1 173 ? 19.103  60.780  27.567  1.00   27.17 ? 173  ASP C O   1 
ATOM   6892  C CB  . ASP C 1 173 ? 17.502  62.582  26.048  1.00   32.27 ? 173  ASP C CB  1 
ATOM   6893  C CG  . ASP C 1 173 ? 16.882  63.485  27.088  1.00   33.38 ? 173  ASP C CG  1 
ATOM   6894  O OD1 . ASP C 1 173 ? 17.524  63.724  28.139  1.00   31.02 ? 173  ASP C OD1 1 
ATOM   6895  O OD2 . ASP C 1 173 ? 15.739  63.942  26.852  1.00   34.75 ? 173  ASP C OD2 1 
ATOM   6896  N N   . GLU C 1 174 ? 20.556  62.447  27.959  1.00   24.89 ? 174  GLU C N   1 
ATOM   6897  C CA  . GLU C 1 174 ? 21.169  61.800  29.112  1.00   23.93 ? 174  GLU C CA  1 
ATOM   6898  C C   . GLU C 1 174 ? 20.721  62.421  30.440  1.00   23.15 ? 174  GLU C C   1 
ATOM   6899  O O   . GLU C 1 174 ? 21.528  62.633  31.354  1.00   23.34 ? 174  GLU C O   1 
ATOM   6900  C CB  . GLU C 1 174 ? 22.703  61.850  29.008  1.00   27.89 ? 174  GLU C CB  1 
ATOM   6901  C CG  . GLU C 1 174 ? 23.294  61.051  27.847  1.00   27.24 ? 174  GLU C CG  1 
ATOM   6902  C CD  . GLU C 1 174 ? 24.802  60.835  27.977  1.00   34.15 ? 174  GLU C CD  1 
ATOM   6903  O OE1 . GLU C 1 174 ? 25.462  61.564  28.766  1.00   31.63 ? 174  GLU C OE1 1 
ATOM   6904  O OE2 . GLU C 1 174 ? 25.320  59.939  27.273  1.00   31.60 ? 174  GLU C OE2 1 
ATOM   6905  N N   . ALA C 1 175 ? 19.433  62.726  30.537  1.00   21.55 ? 175  ALA C N   1 
ATOM   6906  C CA  . ALA C 1 175 ? 18.902  63.293  31.767  1.00   22.07 ? 175  ALA C CA  1 
ATOM   6907  C C   . ALA C 1 175 ? 19.180  62.393  32.989  1.00   23.05 ? 175  ALA C C   1 
ATOM   6908  O O   . ALA C 1 175 ? 19.197  62.863  34.128  1.00   21.00 ? 175  ALA C O   1 
ATOM   6909  C CB  . ALA C 1 175 ? 17.379  63.524  31.623  1.00   25.76 ? 175  ALA C CB  1 
ATOM   6910  N N   . TYR C 1 176 ? 19.398  61.099  32.754  1.00   26.03 ? 176  TYR C N   1 
ATOM   6911  C CA  . TYR C 1 176 ? 19.649  60.154  33.842  1.00   24.83 ? 176  TYR C CA  1 
ATOM   6912  C C   . TYR C 1 176 ? 21.071  59.590  33.830  1.00   26.39 ? 176  TYR C C   1 
ATOM   6913  O O   . TYR C 1 176 ? 21.322  58.513  34.368  1.00   28.07 ? 176  TYR C O   1 
ATOM   6914  C CB  . TYR C 1 176 ? 18.625  59.027  33.775  1.00   23.33 ? 176  TYR C CB  1 
ATOM   6915  C CG  . TYR C 1 176 ? 17.219  59.558  33.854  1.00   25.51 ? 176  TYR C CG  1 
ATOM   6916  C CD1 . TYR C 1 176 ? 16.699  60.024  35.056  1.00   28.10 ? 176  TYR C CD1 1 
ATOM   6917  C CD2 . TYR C 1 176 ? 16.434  59.657  32.713  1.00   25.18 ? 176  TYR C CD2 1 
ATOM   6918  C CE1 . TYR C 1 176 ? 15.428  60.583  35.129  1.00   29.98 ? 176  TYR C CE1 1 
ATOM   6919  C CE2 . TYR C 1 176 ? 15.161  60.222  32.767  1.00   29.88 ? 176  TYR C CE2 1 
ATOM   6920  C CZ  . TYR C 1 176 ? 14.665  60.685  33.980  1.00   31.55 ? 176  TYR C CZ  1 
ATOM   6921  O OH  . TYR C 1 176 ? 13.424  61.271  34.046  1.00   34.27 ? 176  TYR C OH  1 
ATOM   6922  N N   . TYR C 1 177 ? 21.999  60.333  33.226  1.00   27.93 ? 177  TYR C N   1 
ATOM   6923  C CA  . TYR C 1 177 ? 23.402  59.916  33.139  1.00   26.35 ? 177  TYR C CA  1 
ATOM   6924  C C   . TYR C 1 177 ? 24.022  59.575  34.503  1.00   27.51 ? 177  TYR C C   1 
ATOM   6925  O O   . TYR C 1 177 ? 24.622  58.507  34.676  1.00   23.78 ? 177  TYR C O   1 
ATOM   6926  C CB  . TYR C 1 177 ? 24.221  61.023  32.499  1.00   25.80 ? 177  TYR C CB  1 
ATOM   6927  C CG  . TYR C 1 177 ? 25.693  60.914  32.809  1.00   28.19 ? 177  TYR C CG  1 
ATOM   6928  C CD1 . TYR C 1 177 ? 26.325  61.886  33.588  1.00   28.71 ? 177  TYR C CD1 1 
ATOM   6929  C CD2 . TYR C 1 177 ? 26.455  59.844  32.325  1.00   27.55 ? 177  TYR C CD2 1 
ATOM   6930  C CE1 . TYR C 1 177 ? 27.674  61.809  33.872  1.00   28.96 ? 177  TYR C CE1 1 
ATOM   6931  C CE2 . TYR C 1 177 ? 27.805  59.753  32.609  1.00   26.85 ? 177  TYR C CE2 1 
ATOM   6932  C CZ  . TYR C 1 177 ? 28.414  60.745  33.383  1.00   33.76 ? 177  TYR C CZ  1 
ATOM   6933  O OH  . TYR C 1 177 ? 29.768  60.684  33.663  1.00   36.27 ? 177  TYR C OH  1 
ATOM   6934  N N   . GLU C 1 178 ? 23.880  60.503  35.451  1.00   25.97 ? 178  GLU C N   1 
ATOM   6935  C CA  . GLU C 1 178 ? 24.411  60.360  36.807  1.00   28.90 ? 178  GLU C CA  1 
ATOM   6936  C C   . GLU C 1 178 ? 24.049  59.046  37.498  1.00   28.32 ? 178  GLU C C   1 
ATOM   6937  O O   . GLU C 1 178 ? 24.855  58.481  38.237  1.00   28.56 ? 178  GLU C O   1 
ATOM   6938  C CB  . GLU C 1 178 ? 23.935  61.517  37.704  1.00   28.28 ? 178  GLU C CB  1 
ATOM   6939  C CG  . GLU C 1 178 ? 24.538  62.901  37.402  1.00   29.39 ? 178  GLU C CG  1 
ATOM   6940  C CD  . GLU C 1 178 ? 24.250  63.405  35.984  1.00   26.69 ? 178  GLU C CD  1 
ATOM   6941  O OE1 . GLU C 1 178 ? 23.233  63.003  35.373  1.00   24.80 ? 178  GLU C OE1 1 
ATOM   6942  O OE2 . GLU C 1 178 ? 25.043  64.215  35.478  1.00   26.23 ? 178  GLU C OE2 1 
ATOM   6943  N N   . PHE C 1 179 ? 22.837  58.571  37.261  1.00   28.90 ? 179  PHE C N   1 
ATOM   6944  C CA  . PHE C 1 179 ? 22.362  57.342  37.879  1.00   27.68 ? 179  PHE C CA  1 
ATOM   6945  C C   . PHE C 1 179 ? 22.739  56.122  37.077  1.00   27.37 ? 179  PHE C C   1 
ATOM   6946  O O   . PHE C 1 179 ? 22.530  54.996  37.506  1.00   28.91 ? 179  PHE C O   1 
ATOM   6947  C CB  . PHE C 1 179 ? 20.854  57.429  38.041  1.00   27.79 ? 179  PHE C CB  1 
ATOM   6948  C CG  . PHE C 1 179 ? 20.408  58.696  38.712  1.00   30.79 ? 179  PHE C CG  1 
ATOM   6949  C CD1 . PHE C 1 179 ? 20.726  58.937  40.045  1.00   26.05 ? 179  PHE C CD1 1 
ATOM   6950  C CD2 . PHE C 1 179 ? 19.692  59.662  38.007  1.00   27.48 ? 179  PHE C CD2 1 
ATOM   6951  C CE1 . PHE C 1 179 ? 20.338  60.117  40.667  1.00   28.06 ? 179  PHE C CE1 1 
ATOM   6952  C CE2 . PHE C 1 179 ? 19.300  60.849  38.625  1.00   27.34 ? 179  PHE C CE2 1 
ATOM   6953  C CZ  . PHE C 1 179 ? 19.619  61.078  39.953  1.00   26.46 ? 179  PHE C CZ  1 
ATOM   6954  N N   . HIS C 1 180 ? 23.309  56.365  35.908  1.00   29.41 ? 180  HIS C N   1 
ATOM   6955  C CA  . HIS C 1 180 ? 23.717  55.300  35.010  1.00   29.57 ? 180  HIS C CA  1 
ATOM   6956  C C   . HIS C 1 180 ? 25.231  55.142  35.006  1.00   28.23 ? 180  HIS C C   1 
ATOM   6957  O O   . HIS C 1 180 ? 25.738  54.080  35.312  1.00   28.52 ? 180  HIS C O   1 
ATOM   6958  C CB  . HIS C 1 180 ? 23.209  55.604  33.602  1.00   33.80 ? 180  HIS C CB  1 
ATOM   6959  C CG  . HIS C 1 180 ? 23.544  54.547  32.604  1.00   35.51 ? 180  HIS C CG  1 
ATOM   6960  N ND1 . HIS C 1 180 ? 23.856  54.837  31.295  1.00   35.43 ? 180  HIS C ND1 1 
ATOM   6961  C CD2 . HIS C 1 180 ? 23.658  53.204  32.733  1.00   36.95 ? 180  HIS C CD2 1 
ATOM   6962  C CE1 . HIS C 1 180 ? 24.153  53.717  30.659  1.00   40.22 ? 180  HIS C CE1 1 
ATOM   6963  N NE2 . HIS C 1 180 ? 24.042  52.712  31.510  1.00   39.80 ? 180  HIS C NE2 1 
ATOM   6964  N N   . GLY C 1 181 ? 25.952  56.201  34.663  1.00   28.51 ? 181  GLY C N   1 
ATOM   6965  C CA  . GLY C 1 181 ? 27.398  56.128  34.652  1.00   29.10 ? 181  GLY C CA  1 
ATOM   6966  C C   . GLY C 1 181 ? 28.007  56.096  33.267  1.00   32.04 ? 181  GLY C C   1 
ATOM   6967  O O   . GLY C 1 181 ? 29.148  56.502  33.090  1.00   30.05 ? 181  GLY C O   1 
ATOM   6968  N N   . GLU C 1 182 ? 27.252  55.630  32.277  1.00   35.25 ? 182  GLU C N   1 
ATOM   6969  C CA  . GLU C 1 182 ? 27.760  55.547  30.905  1.00   38.20 ? 182  GLU C CA  1 
ATOM   6970  C C   . GLU C 1 182 ? 27.210  56.648  29.991  1.00   38.38 ? 182  GLU C C   1 
ATOM   6971  O O   . GLU C 1 182 ? 26.001  56.847  29.891  1.00   38.15 ? 182  GLU C O   1 
ATOM   6972  C CB  . GLU C 1 182 ? 27.436  54.175  30.314  1.00   39.48 ? 182  GLU C CB  1 
ATOM   6973  C CG  . GLU C 1 182 ? 27.646  54.085  28.819  1.00   47.79 ? 182  GLU C CG  1 
ATOM   6974  C CD  . GLU C 1 182 ? 26.888  52.935  28.206  1.00   50.44 ? 182  GLU C CD  1 
ATOM   6975  O OE1 . GLU C 1 182 ? 27.259  51.774  28.492  1.00   51.12 ? 182  GLU C OE1 1 
ATOM   6976  O OE2 . GLU C 1 182 ? 25.922  53.197  27.453  1.00   52.43 ? 182  GLU C OE2 1 
ATOM   6977  N N   . SER C 1 183 ? 28.125  57.336  29.312  1.00   39.50 ? 183  SER C N   1 
ATOM   6978  C CA  . SER C 1 183 ? 27.804  58.437  28.416  1.00   38.78 ? 183  SER C CA  1 
ATOM   6979  C C   . SER C 1 183 ? 28.383  58.241  27.012  1.00   39.58 ? 183  SER C C   1 
ATOM   6980  O O   . SER C 1 183 ? 29.334  57.487  26.828  1.00   40.19 ? 183  SER C O   1 
ATOM   6981  C CB  . SER C 1 183 ? 28.353  59.730  29.014  1.00   37.24 ? 183  SER C CB  1 
ATOM   6982  O OG  . SER C 1 183 ? 28.149  60.821  28.143  1.00   41.51 ? 183  SER C OG  1 
ATOM   6983  N N   . TYR C 1 184 ? 27.806  58.929  26.028  1.00   40.53 ? 184  TYR C N   1 
ATOM   6984  C CA  . TYR C 1 184 ? 28.275  58.834  24.648  1.00   41.81 ? 184  TYR C CA  1 
ATOM   6985  C C   . TYR C 1 184 ? 28.939  60.117  24.184  1.00   40.08 ? 184  TYR C C   1 
ATOM   6986  O O   . TYR C 1 184 ? 29.236  60.280  23.009  1.00   41.51 ? 184  TYR C O   1 
ATOM   6987  C CB  . TYR C 1 184 ? 27.134  58.484  23.688  1.00   45.08 ? 184  TYR C CB  1 
ATOM   6988  C CG  . TYR C 1 184 ? 26.712  57.028  23.739  1.00   53.83 ? 184  TYR C CG  1 
ATOM   6989  C CD1 . TYR C 1 184 ? 26.488  56.309  22.569  1.00   58.10 ? 184  TYR C CD1 1 
ATOM   6990  C CD2 . TYR C 1 184 ? 26.517  56.375  24.956  1.00   57.92 ? 184  TYR C CD2 1 
ATOM   6991  C CE1 . TYR C 1 184 ? 26.076  54.972  22.609  1.00   61.49 ? 184  TYR C CE1 1 
ATOM   6992  C CE2 . TYR C 1 184 ? 26.109  55.045  25.006  1.00   60.70 ? 184  TYR C CE2 1 
ATOM   6993  C CZ  . TYR C 1 184 ? 25.891  54.350  23.828  1.00   62.62 ? 184  TYR C CZ  1 
ATOM   6994  O OH  . TYR C 1 184 ? 25.498  53.028  23.869  1.00   65.12 ? 184  TYR C OH  1 
ATOM   6995  N N   . VAL C 1 185 ? 29.180  61.026  25.110  1.00   38.17 ? 185  VAL C N   1 
ATOM   6996  C CA  . VAL C 1 185 ? 29.825  62.269  24.752  1.00   37.00 ? 185  VAL C CA  1 
ATOM   6997  C C   . VAL C 1 185 ? 31.064  62.029  23.880  1.00   36.98 ? 185  VAL C C   1 
ATOM   6998  O O   . VAL C 1 185 ? 31.374  62.829  23.006  1.00   32.68 ? 185  VAL C O   1 
ATOM   6999  C CB  . VAL C 1 185 ? 30.202  63.079  26.028  1.00   34.46 ? 185  VAL C CB  1 
ATOM   7000  C CG1 . VAL C 1 185 ? 31.077  64.272  25.649  1.00   35.24 ? 185  VAL C CG1 1 
ATOM   7001  C CG2 . VAL C 1 185 ? 28.921  63.587  26.727  1.00   26.22 ? 185  VAL C CG2 1 
ATOM   7002  N N   . ASP C 1 186 ? 31.761  60.917  24.100  1.00   40.81 ? 186  ASP C N   1 
ATOM   7003  C CA  . ASP C 1 186 ? 32.965  60.620  23.319  1.00   42.44 ? 186  ASP C CA  1 
ATOM   7004  C C   . ASP C 1 186 ? 32.699  60.287  21.865  1.00   42.26 ? 186  ASP C C   1 
ATOM   7005  O O   . ASP C 1 186 ? 33.561  60.469  21.011  1.00   44.49 ? 186  ASP C O   1 
ATOM   7006  C CB  . ASP C 1 186 ? 33.778  59.498  23.963  1.00   43.70 ? 186  ASP C CB  1 
ATOM   7007  C CG  . ASP C 1 186 ? 34.657  60.008  25.099  1.00   47.27 ? 186  ASP C CG  1 
ATOM   7008  O OD1 . ASP C 1 186 ? 35.717  59.399  25.375  1.00   48.74 ? 186  ASP C OD1 1 
ATOM   7009  O OD2 . ASP C 1 186 ? 34.281  61.025  25.714  1.00   42.96 ? 186  ASP C OD2 1 
ATOM   7010  N N   . PHE C 1 187 ? 31.508  59.796  21.579  1.00   42.42 ? 187  PHE C N   1 
ATOM   7011  C CA  . PHE C 1 187 ? 31.156  59.491  20.204  1.00   44.36 ? 187  PHE C CA  1 
ATOM   7012  C C   . PHE C 1 187 ? 31.163  60.754  19.367  1.00   44.39 ? 187  PHE C C   1 
ATOM   7013  O O   . PHE C 1 187 ? 31.048  60.696  18.147  1.00   43.56 ? 187  PHE C O   1 
ATOM   7014  C CB  . PHE C 1 187 ? 29.769  58.877  20.130  1.00   44.14 ? 187  PHE C CB  1 
ATOM   7015  C CG  . PHE C 1 187 ? 29.780  57.394  20.134  1.00   51.36 ? 187  PHE C CG  1 
ATOM   7016  C CD1 . PHE C 1 187 ? 29.040  56.686  19.197  1.00   50.75 ? 187  PHE C CD1 1 
ATOM   7017  C CD2 . PHE C 1 187 ? 30.541  56.694  21.078  1.00   53.29 ? 187  PHE C CD2 1 
ATOM   7018  C CE1 . PHE C 1 187 ? 29.050  55.300  19.192  1.00   54.18 ? 187  PHE C CE1 1 
ATOM   7019  C CE2 . PHE C 1 187 ? 30.563  55.310  21.088  1.00   52.51 ? 187  PHE C CE2 1 
ATOM   7020  C CZ  . PHE C 1 187 ? 29.816  54.606  20.144  1.00   55.47 ? 187  PHE C CZ  1 
ATOM   7021  N N   . LEU C 1 188 ? 31.268  61.900  20.027  1.00   45.49 ? 188  LEU C N   1 
ATOM   7022  C CA  . LEU C 1 188 ? 31.287  63.166  19.317  1.00   47.29 ? 188  LEU C CA  1 
ATOM   7023  C C   . LEU C 1 188 ? 32.576  63.303  18.524  1.00   47.28 ? 188  LEU C C   1 
ATOM   7024  O O   . LEU C 1 188 ? 32.709  64.215  17.720  1.00   48.20 ? 188  LEU C O   1 
ATOM   7025  C CB  . LEU C 1 188 ? 31.132  64.341  20.295  1.00   46.64 ? 188  LEU C CB  1 
ATOM   7026  C CG  . LEU C 1 188 ? 29.753  64.551  20.937  1.00   46.14 ? 188  LEU C CG  1 
ATOM   7027  C CD1 . LEU C 1 188 ? 29.859  65.622  22.001  1.00   46.12 ? 188  LEU C CD1 1 
ATOM   7028  C CD2 . LEU C 1 188 ? 28.724  64.947  19.880  1.00   45.68 ? 188  LEU C CD2 1 
ATOM   7029  N N   . LYS C 1 189 ? 33.520  62.394  18.760  1.00   48.09 ? 189  LYS C N   1 
ATOM   7030  C CA  . LYS C 1 189 ? 34.792  62.392  18.038  1.00   46.61 ? 189  LYS C CA  1 
ATOM   7031  C C   . LYS C 1 189 ? 34.638  61.647  16.723  1.00   46.18 ? 189  LYS C C   1 
ATOM   7032  O O   . LYS C 1 189 ? 35.383  61.890  15.784  1.00   44.93 ? 189  LYS C O   1 
ATOM   7033  C CB  . LYS C 1 189 ? 35.887  61.724  18.862  1.00   46.97 ? 189  LYS C CB  1 
ATOM   7034  C CG  . LYS C 1 189 ? 36.540  62.649  19.846  1.00   51.63 ? 189  LYS C CG  1 
ATOM   7035  C CD  . LYS C 1 189 ? 37.684  61.984  20.582  1.00   51.90 ? 189  LYS C CD  1 
ATOM   7036  C CE  . LYS C 1 189 ? 37.212  61.253  21.809  1.00   51.06 ? 189  LYS C CE  1 
ATOM   7037  N NZ  . LYS C 1 189 ? 38.372  60.978  22.694  1.00   54.27 ? 189  LYS C NZ  1 
ATOM   7038  N N   . LYS C 1 190 ? 33.681  60.731  16.649  1.00   45.29 ? 190  LYS C N   1 
ATOM   7039  C CA  . LYS C 1 190 ? 33.479  59.995  15.412  1.00   48.76 ? 190  LYS C CA  1 
ATOM   7040  C C   . LYS C 1 190 ? 32.250  60.505  14.675  1.00   49.62 ? 190  LYS C C   1 
ATOM   7041  O O   . LYS C 1 190 ? 32.141  60.371  13.462  1.00   49.64 ? 190  LYS C O   1 
ATOM   7042  C CB  . LYS C 1 190 ? 33.349  58.492  15.695  1.00   51.06 ? 190  LYS C CB  1 
ATOM   7043  C CG  . LYS C 1 190 ? 34.468  57.658  15.063  1.00   55.37 ? 190  LYS C CG  1 
ATOM   7044  C CD  . LYS C 1 190 ? 34.694  56.331  15.788  1.00   57.06 ? 190  LYS C CD  1 
ATOM   7045  C CE  . LYS C 1 190 ? 35.860  55.552  15.173  1.00   57.50 ? 190  LYS C CE  1 
ATOM   7046  N NZ  . LYS C 1 190 ? 36.225  54.342  15.978  1.00   55.97 ? 190  LYS C NZ  1 
ATOM   7047  N N   . TYR C 1 191 ? 31.327  61.111  15.409  1.00   49.47 ? 191  TYR C N   1 
ATOM   7048  C CA  . TYR C 1 191 ? 30.119  61.627  14.791  1.00   48.34 ? 191  TYR C CA  1 
ATOM   7049  C C   . TYR C 1 191 ? 29.853  63.066  15.175  1.00   46.70 ? 191  TYR C C   1 
ATOM   7050  O O   . TYR C 1 191 ? 29.907  63.427  16.356  1.00   47.76 ? 191  TYR C O   1 
ATOM   7051  C CB  . TYR C 1 191 ? 28.918  60.790  15.199  1.00   48.66 ? 191  TYR C CB  1 
ATOM   7052  C CG  . TYR C 1 191 ? 29.026  59.330  14.843  1.00   51.34 ? 191  TYR C CG  1 
ATOM   7053  C CD1 . TYR C 1 191 ? 29.841  58.467  15.581  1.00   50.39 ? 191  TYR C CD1 1 
ATOM   7054  C CD2 . TYR C 1 191 ? 28.282  58.797  13.782  1.00   52.56 ? 191  TYR C CD2 1 
ATOM   7055  C CE1 . TYR C 1 191 ? 29.907  57.106  15.273  1.00   51.53 ? 191  TYR C CE1 1 
ATOM   7056  C CE2 . TYR C 1 191 ? 28.335  57.438  13.465  1.00   53.08 ? 191  TYR C CE2 1 
ATOM   7057  C CZ  . TYR C 1 191 ? 29.145  56.599  14.211  1.00   50.97 ? 191  TYR C CZ  1 
ATOM   7058  O OH  . TYR C 1 191 ? 29.177  55.260  13.896  1.00   50.32 ? 191  TYR C OH  1 
ATOM   7059  N N   . GLU C 1 192 ? 29.560  63.891  14.179  1.00   44.30 ? 192  GLU C N   1 
ATOM   7060  C CA  . GLU C 1 192 ? 29.261  65.284  14.454  1.00   41.12 ? 192  GLU C CA  1 
ATOM   7061  C C   . GLU C 1 192 ? 27.758  65.494  14.422  1.00   36.89 ? 192  GLU C C   1 
ATOM   7062  O O   . GLU C 1 192 ? 27.256  66.469  14.981  1.00   36.70 ? 192  GLU C O   1 
ATOM   7063  C CB  . GLU C 1 192 ? 29.949  66.212  13.449  1.00   46.86 ? 192  GLU C CB  1 
ATOM   7064  C CG  . GLU C 1 192 ? 29.586  65.963  12.006  1.00   52.66 ? 192  GLU C CG  1 
ATOM   7065  C CD  . GLU C 1 192 ? 30.394  66.831  11.058  1.00   57.55 ? 192  GLU C CD  1 
ATOM   7066  O OE1 . GLU C 1 192 ? 31.617  66.966  11.283  1.00   58.42 ? 192  GLU C OE1 1 
ATOM   7067  O OE2 . GLU C 1 192 ? 29.815  67.368  10.085  1.00   60.58 ? 192  GLU C OE2 1 
ATOM   7068  N N   . ASN C 1 193 ? 27.042  64.571  13.785  1.00   31.32 ? 193  ASN C N   1 
ATOM   7069  C CA  . ASN C 1 193 ? 25.591  64.675  13.706  1.00   30.51 ? 193  ASN C CA  1 
ATOM   7070  C C   . ASN C 1 193 ? 24.911  64.184  14.996  1.00   30.29 ? 193  ASN C C   1 
ATOM   7071  O O   . ASN C 1 193 ? 23.758  63.761  14.986  1.00   29.77 ? 193  ASN C O   1 
ATOM   7072  C CB  . ASN C 1 193 ? 25.072  63.896  12.500  1.00   30.42 ? 193  ASN C CB  1 
ATOM   7073  C CG  . ASN C 1 193 ? 25.602  62.475  12.455  1.00   34.75 ? 193  ASN C CG  1 
ATOM   7074  O OD1 . ASN C 1 193 ? 24.872  61.522  12.149  1.00   34.42 ? 193  ASN C OD1 1 
ATOM   7075  N ND2 . ASN C 1 193 ? 26.882  62.325  12.766  1.00   27.94 ? 193  ASN C ND2 1 
ATOM   7076  N N   . LEU C 1 194 ? 25.628  64.288  16.107  1.00   29.23 ? 194  LEU C N   1 
ATOM   7077  C CA  . LEU C 1 194 ? 25.148  63.851  17.410  1.00   30.64 ? 194  LEU C CA  1 
ATOM   7078  C C   . LEU C 1 194 ? 25.119  64.966  18.464  1.00   28.84 ? 194  LEU C C   1 
ATOM   7079  O O   . LEU C 1 194 ? 25.966  65.858  18.466  1.00   30.27 ? 194  LEU C O   1 
ATOM   7080  C CB  . LEU C 1 194 ? 26.049  62.709  17.910  1.00   30.04 ? 194  LEU C CB  1 
ATOM   7081  C CG  . LEU C 1 194 ? 25.975  62.306  19.392  1.00   34.24 ? 194  LEU C CG  1 
ATOM   7082  C CD1 . LEU C 1 194 ? 24.752  61.420  19.629  1.00   31.53 ? 194  LEU C CD1 1 
ATOM   7083  C CD2 . LEU C 1 194 ? 27.264  61.566  19.794  1.00   34.93 ? 194  LEU C CD2 1 
ATOM   7084  N N   . ALA C 1 195 ? 24.154  64.893  19.375  1.00   28.40 ? 195  ALA C N   1 
ATOM   7085  C CA  . ALA C 1 195 ? 24.047  65.867  20.457  1.00   27.84 ? 195  ALA C CA  1 
ATOM   7086  C C   . ALA C 1 195 ? 23.638  65.191  21.769  1.00   27.87 ? 195  ALA C C   1 
ATOM   7087  O O   . ALA C 1 195 ? 22.596  64.537  21.841  1.00   29.84 ? 195  ALA C O   1 
ATOM   7088  C CB  . ALA C 1 195 ? 23.054  66.922  20.096  1.00   28.49 ? 195  ALA C CB  1 
ATOM   7089  N N   . VAL C 1 196 ? 24.463  65.353  22.796  1.00   24.63 ? 196  VAL C N   1 
ATOM   7090  C CA  . VAL C 1 196 ? 24.214  64.783  24.120  1.00   26.22 ? 196  VAL C CA  1 
ATOM   7091  C C   . VAL C 1 196 ? 23.603  65.839  25.054  1.00   24.70 ? 196  VAL C C   1 
ATOM   7092  O O   . VAL C 1 196 ? 24.208  66.895  25.266  1.00   27.72 ? 196  VAL C O   1 
ATOM   7093  C CB  . VAL C 1 196 ? 25.528  64.310  24.731  1.00   23.32 ? 196  VAL C CB  1 
ATOM   7094  C CG1 . VAL C 1 196 ? 25.458  64.432  26.226  1.00   20.84 ? 196  VAL C CG1 1 
ATOM   7095  C CG2 . VAL C 1 196 ? 25.825  62.894  24.301  1.00   28.66 ? 196  VAL C CG2 1 
ATOM   7096  N N   . ILE C 1 197 ? 22.429  65.559  25.614  1.00   23.30 ? 197  ILE C N   1 
ATOM   7097  C CA  . ILE C 1 197 ? 21.761  66.508  26.513  1.00   21.50 ? 197  ILE C CA  1 
ATOM   7098  C C   . ILE C 1 197 ? 21.803  66.163  28.009  1.00   21.48 ? 197  ILE C C   1 
ATOM   7099  O O   . ILE C 1 197 ? 21.494  65.052  28.412  1.00   20.81 ? 197  ILE C O   1 
ATOM   7100  C CB  . ILE C 1 197 ? 20.276  66.672  26.162  1.00   22.50 ? 197  ILE C CB  1 
ATOM   7101  C CG1 . ILE C 1 197 ? 20.070  66.707  24.646  1.00   23.37 ? 197  ILE C CG1 1 
ATOM   7102  C CG2 . ILE C 1 197 ? 19.741  67.930  26.831  1.00   26.23 ? 197  ILE C CG2 1 
ATOM   7103  C CD1 . ILE C 1 197 ? 20.770  67.812  23.967  1.00   29.47 ? 197  ILE C CD1 1 
ATOM   7104  N N   . ARG C 1 198 ? 22.158  67.128  28.846  1.00   24.99 ? 198  ARG C N   1 
ATOM   7105  C CA  . ARG C 1 198 ? 22.192  66.863  30.289  1.00   25.08 ? 198  ARG C CA  1 
ATOM   7106  C C   . ARG C 1 198 ? 21.371  67.884  31.097  1.00   24.28 ? 198  ARG C C   1 
ATOM   7107  O O   . ARG C 1 198 ? 21.027  68.947  30.579  1.00   23.29 ? 198  ARG C O   1 
ATOM   7108  C CB  . ARG C 1 198 ? 23.634  66.869  30.798  1.00   24.71 ? 198  ARG C CB  1 
ATOM   7109  C CG  . ARG C 1 198 ? 24.584  65.883  30.130  1.00   31.27 ? 198  ARG C CG  1 
ATOM   7110  C CD  . ARG C 1 198 ? 24.520  64.476  30.724  1.00   26.89 ? 198  ARG C CD  1 
ATOM   7111  N NE  . ARG C 1 198 ? 25.656  63.655  30.305  1.00   30.73 ? 198  ARG C NE  1 
ATOM   7112  C CZ  . ARG C 1 198 ? 26.893  63.778  30.787  1.00   31.66 ? 198  ARG C CZ  1 
ATOM   7113  N NH1 . ARG C 1 198 ? 27.168  64.691  31.720  1.00   23.49 ? 198  ARG C NH1 1 
ATOM   7114  N NH2 . ARG C 1 198 ? 27.863  62.988  30.327  1.00   28.97 ? 198  ARG C NH2 1 
ATOM   7115  N N   . THR C 1 199 ? 21.076  67.545  32.358  1.00   23.06 ? 199  THR C N   1 
ATOM   7116  C CA  . THR C 1 199 ? 20.328  68.403  33.274  1.00   22.67 ? 199  THR C CA  1 
ATOM   7117  C C   . THR C 1 199 ? 20.932  68.395  34.685  1.00   24.79 ? 199  THR C C   1 
ATOM   7118  O O   . THR C 1 199 ? 21.757  67.533  35.017  1.00   26.86 ? 199  THR C O   1 
ATOM   7119  C CB  . THR C 1 199 ? 18.855  67.958  33.401  1.00   22.58 ? 199  THR C CB  1 
ATOM   7120  O OG1 . THR C 1 199 ? 18.143  68.904  34.213  1.00   19.22 ? 199  THR C OG1 1 
ATOM   7121  C CG2 . THR C 1 199 ? 18.760  66.550  34.042  1.00   14.99 ? 199  THR C CG2 1 
ATOM   7122  N N   . PHE C 1 200 ? 20.521  69.370  35.498  1.00   23.98 ? 200  PHE C N   1 
ATOM   7123  C CA  . PHE C 1 200 ? 20.963  69.493  36.885  1.00   23.94 ? 200  PHE C CA  1 
ATOM   7124  C C   . PHE C 1 200 ? 19.783  69.213  37.779  1.00   24.81 ? 200  PHE C C   1 
ATOM   7125  O O   . PHE C 1 200 ? 19.921  69.134  38.992  1.00   22.73 ? 200  PHE C O   1 
ATOM   7126  C CB  . PHE C 1 200 ? 21.434  70.906  37.193  1.00   23.78 ? 200  PHE C CB  1 
ATOM   7127  C CG  . PHE C 1 200 ? 22.809  71.194  36.728  1.00   25.69 ? 200  PHE C CG  1 
ATOM   7128  C CD1 . PHE C 1 200 ? 23.070  71.440  35.381  1.00   27.23 ? 200  PHE C CD1 1 
ATOM   7129  C CD2 . PHE C 1 200 ? 23.866  71.230  37.650  1.00   27.91 ? 200  PHE C CD2 1 
ATOM   7130  C CE1 . PHE C 1 200 ? 24.389  71.732  34.942  1.00   26.90 ? 200  PHE C CE1 1 
ATOM   7131  C CE2 . PHE C 1 200 ? 25.186  71.516  37.235  1.00   24.62 ? 200  PHE C CE2 1 
ATOM   7132  C CZ  . PHE C 1 200 ? 25.448  71.770  35.873  1.00   21.18 ? 200  PHE C CZ  1 
ATOM   7133  N N   . SER C 1 201 ? 18.613  69.066  37.166  1.00   25.87 ? 201  SER C N   1 
ATOM   7134  C CA  . SER C 1 201 ? 17.375  68.836  37.903  1.00   24.98 ? 201  SER C CA  1 
ATOM   7135  C C   . SER C 1 201 ? 17.311  67.576  38.755  1.00   27.77 ? 201  SER C C   1 
ATOM   7136  O O   . SER C 1 201 ? 16.795  67.613  39.885  1.00   28.56 ? 201  SER C O   1 
ATOM   7137  C CB  . SER C 1 201 ? 16.193  68.808  36.935  1.00   25.71 ? 201  SER C CB  1 
ATOM   7138  O OG  . SER C 1 201 ? 16.098  70.007  36.205  1.00   14.76 ? 201  SER C OG  1 
ATOM   7139  N N   . LYS C 1 202 ? 17.820  66.468  38.217  1.00   26.46 ? 202  LYS C N   1 
ATOM   7140  C CA  . LYS C 1 202 ? 17.770  65.181  38.913  1.00   29.37 ? 202  LYS C CA  1 
ATOM   7141  C C   . LYS C 1 202 ? 18.846  64.892  39.945  1.00   29.15 ? 202  LYS C C   1 
ATOM   7142  O O   . LYS C 1 202 ? 18.561  64.814  41.142  1.00   30.77 ? 202  LYS C O   1 
ATOM   7143  C CB  . LYS C 1 202 ? 17.747  64.032  37.897  1.00   27.47 ? 202  LYS C CB  1 
ATOM   7144  C CG  . LYS C 1 202 ? 16.376  63.780  37.254  1.00   34.72 ? 202  LYS C CG  1 
ATOM   7145  C CD  . LYS C 1 202 ? 15.957  64.855  36.271  1.00   33.44 ? 202  LYS C CD  1 
ATOM   7146  C CE  . LYS C 1 202 ? 14.476  64.727  35.930  1.00   37.04 ? 202  LYS C CE  1 
ATOM   7147  N NZ  . LYS C 1 202 ? 14.048  63.328  35.734  1.00   40.86 ? 202  LYS C NZ  1 
ATOM   7148  N N   . ALA C 1 203 ? 20.073  64.718  39.472  1.00   28.09 ? 203  ALA C N   1 
ATOM   7149  C CA  . ALA C 1 203 ? 21.195  64.387  40.337  1.00   26.98 ? 203  ALA C CA  1 
ATOM   7150  C C   . ALA C 1 203 ? 21.651  65.491  41.254  1.00   25.10 ? 203  ALA C C   1 
ATOM   7151  O O   . ALA C 1 203 ? 22.461  65.261  42.140  1.00   25.62 ? 203  ALA C O   1 
ATOM   7152  C CB  . ALA C 1 203 ? 22.374  63.917  39.492  1.00   25.70 ? 203  ALA C CB  1 
ATOM   7153  N N   . PHE C 1 204 ? 21.132  66.689  41.062  1.00   25.09 ? 204  PHE C N   1 
ATOM   7154  C CA  . PHE C 1 204 ? 21.563  67.804  41.884  1.00   21.47 ? 204  PHE C CA  1 
ATOM   7155  C C   . PHE C 1 204 ? 20.495  68.547  42.653  1.00   21.13 ? 204  PHE C C   1 
ATOM   7156  O O   . PHE C 1 204 ? 20.769  69.596  43.237  1.00   18.58 ? 204  PHE C O   1 
ATOM   7157  C CB  . PHE C 1 204 ? 22.327  68.774  41.010  1.00   21.20 ? 204  PHE C CB  1 
ATOM   7158  C CG  . PHE C 1 204 ? 23.584  68.200  40.449  1.00   22.17 ? 204  PHE C CG  1 
ATOM   7159  C CD1 . PHE C 1 204 ? 24.809  68.370  41.130  1.00   19.58 ? 204  PHE C CD1 1 
ATOM   7160  C CD2 . PHE C 1 204 ? 23.578  67.573  39.208  1.00   15.38 ? 204  PHE C CD2 1 
ATOM   7161  C CE1 . PHE C 1 204 ? 26.024  67.936  40.566  1.00   21.20 ? 204  PHE C CE1 1 
ATOM   7162  C CE2 . PHE C 1 204 ? 24.785  67.133  38.624  1.00   18.27 ? 204  PHE C CE2 1 
ATOM   7163  C CZ  . PHE C 1 204 ? 26.011  67.317  39.297  1.00   20.10 ? 204  PHE C CZ  1 
ATOM   7164  N N   . SER C 1 205 ? 19.287  68.005  42.676  1.00   21.82 ? 205  SER C N   1 
ATOM   7165  C CA  . SER C 1 205 ? 18.198  68.649  43.401  1.00   23.33 ? 205  SER C CA  1 
ATOM   7166  C C   . SER C 1 205 ? 18.004  70.091  42.961  1.00   24.29 ? 205  SER C C   1 
ATOM   7167  O O   . SER C 1 205 ? 17.787  70.972  43.785  1.00   28.54 ? 205  SER C O   1 
ATOM   7168  C CB  . SER C 1 205 ? 18.461  68.635  44.903  1.00   21.62 ? 205  SER C CB  1 
ATOM   7169  O OG  . SER C 1 205 ? 18.541  67.313  45.404  1.00   25.04 ? 205  SER C OG  1 
ATOM   7170  N N   . LEU C 1 206 ? 18.068  70.338  41.668  1.00   22.87 ? 206  LEU C N   1 
ATOM   7171  C CA  . LEU C 1 206 ? 17.899  71.682  41.180  1.00   22.55 ? 206  LEU C CA  1 
ATOM   7172  C C   . LEU C 1 206 ? 16.760  71.756  40.142  1.00   21.22 ? 206  LEU C C   1 
ATOM   7173  O O   . LEU C 1 206 ? 16.739  72.643  39.304  1.00   23.18 ? 206  LEU C O   1 
ATOM   7174  C CB  . LEU C 1 206 ? 19.244  72.137  40.595  1.00   20.67 ? 206  LEU C CB  1 
ATOM   7175  C CG  . LEU C 1 206 ? 19.986  73.280  41.298  1.00   27.16 ? 206  LEU C CG  1 
ATOM   7176  C CD1 . LEU C 1 206 ? 19.774  73.214  42.776  1.00   25.57 ? 206  LEU C CD1 1 
ATOM   7177  C CD2 . LEU C 1 206 ? 21.460  73.239  40.948  1.00   26.81 ? 206  LEU C CD2 1 
ATOM   7178  N N   . ALA C 1 207 ? 15.816  70.815  40.195  1.00   19.83 ? 207  ALA C N   1 
ATOM   7179  C CA  . ALA C 1 207 ? 14.711  70.798  39.243  1.00   16.66 ? 207  ALA C CA  1 
ATOM   7180  C C   . ALA C 1 207 ? 13.990  72.137  39.164  1.00   16.09 ? 207  ALA C C   1 
ATOM   7181  O O   . ALA C 1 207 ? 13.567  72.559  38.089  1.00   14.52 ? 207  ALA C O   1 
ATOM   7182  C CB  . ALA C 1 207 ? 13.738  69.702  39.595  1.00   17.13 ? 207  ALA C CB  1 
ATOM   7183  N N   . ALA C 1 208 ? 13.882  72.814  40.298  1.00   14.00 ? 208  ALA C N   1 
ATOM   7184  C CA  . ALA C 1 208 ? 13.214  74.114  40.375  1.00   15.50 ? 208  ALA C CA  1 
ATOM   7185  C C   . ALA C 1 208 ? 14.007  75.276  39.753  1.00   15.83 ? 208  ALA C C   1 
ATOM   7186  O O   . ALA C 1 208 ? 13.462  76.335  39.453  1.00   14.24 ? 208  ALA C O   1 
ATOM   7187  C CB  . ALA C 1 208 ? 12.901  74.436  41.838  1.00   17.10 ? 208  ALA C CB  1 
ATOM   7188  N N   . GLN C 1 209 ? 15.290  75.074  39.538  1.00   17.69 ? 209  GLN C N   1 
ATOM   7189  C CA  . GLN C 1 209 ? 16.107  76.131  38.992  1.00   19.70 ? 209  GLN C CA  1 
ATOM   7190  C C   . GLN C 1 209 ? 16.298  76.106  37.487  1.00   20.04 ? 209  GLN C C   1 
ATOM   7191  O O   . GLN C 1 209 ? 16.904  77.010  36.943  1.00   16.43 ? 209  GLN C O   1 
ATOM   7192  C CB  . GLN C 1 209 ? 17.429  76.166  39.749  1.00   20.68 ? 209  GLN C CB  1 
ATOM   7193  C CG  . GLN C 1 209 ? 17.191  76.711  41.133  1.00   19.59 ? 209  GLN C CG  1 
ATOM   7194  C CD  . GLN C 1 209 ? 16.502  78.080  41.063  1.00   22.75 ? 209  GLN C CD  1 
ATOM   7195  O OE1 . GLN C 1 209 ? 17.088  79.048  40.564  1.00   27.47 ? 209  GLN C OE1 1 
ATOM   7196  N NE2 . GLN C 1 209 ? 15.264  78.160  41.539  1.00   16.43 ? 209  GLN C NE2 1 
ATOM   7197  N N   . ARG C 1 210 ? 15.766  75.071  36.827  1.00   20.14 ? 210  ARG C N   1 
ATOM   7198  C CA  . ARG C 1 210 ? 15.798  74.953  35.362  1.00   22.28 ? 210  ARG C CA  1 
ATOM   7199  C C   . ARG C 1 210 ? 17.176  75.153  34.719  1.00   23.42 ? 210  ARG C C   1 
ATOM   7200  O O   . ARG C 1 210 ? 17.449  76.223  34.164  1.00   23.21 ? 210  ARG C O   1 
ATOM   7201  C CB  . ARG C 1 210 ? 14.848  75.990  34.729  1.00   20.59 ? 210  ARG C CB  1 
ATOM   7202  C CG  . ARG C 1 210 ? 13.533  76.224  35.452  1.00   22.84 ? 210  ARG C CG  1 
ATOM   7203  C CD  . ARG C 1 210 ? 12.538  75.175  35.041  1.00   25.33 ? 210  ARG C CD  1 
ATOM   7204  N NE  . ARG C 1 210 ? 13.039  73.889  35.451  1.00   26.77 ? 210  ARG C NE  1 
ATOM   7205  C CZ  . ARG C 1 210 ? 13.135  72.823  34.673  1.00   23.51 ? 210  ARG C CZ  1 
ATOM   7206  N NH1 . ARG C 1 210 ? 12.750  72.857  33.410  1.00   17.81 ? 210  ARG C NH1 1 
ATOM   7207  N NH2 . ARG C 1 210 ? 13.652  71.720  35.176  1.00   26.04 ? 210  ARG C NH2 1 
ATOM   7208  N N   . VAL C 1 211 ? 18.025  74.139  34.778  1.00   24.07 ? 211  VAL C N   1 
ATOM   7209  C CA  . VAL C 1 211 ? 19.338  74.234  34.153  1.00   21.92 ? 211  VAL C CA  1 
ATOM   7210  C C   . VAL C 1 211 ? 19.761  72.947  33.453  1.00   21.42 ? 211  VAL C C   1 
ATOM   7211  O O   . VAL C 1 211 ? 20.057  71.960  34.113  1.00   23.99 ? 211  VAL C O   1 
ATOM   7212  C CB  . VAL C 1 211 ? 20.443  74.546  35.170  1.00   20.54 ? 211  VAL C CB  1 
ATOM   7213  C CG1 . VAL C 1 211 ? 21.751  74.756  34.434  1.00   18.69 ? 211  VAL C CG1 1 
ATOM   7214  C CG2 . VAL C 1 211 ? 20.069  75.757  36.005  1.00   23.10 ? 211  VAL C CG2 1 
ATOM   7215  N N   . GLY C 1 212 ? 19.759  72.958  32.127  1.00   17.40 ? 212  GLY C N   1 
ATOM   7216  C CA  . GLY C 1 212 ? 20.228  71.807  31.388  1.00   19.83 ? 212  GLY C CA  1 
ATOM   7217  C C   . GLY C 1 212 ? 21.375  72.300  30.503  1.00   20.90 ? 212  GLY C C   1 
ATOM   7218  O O   . GLY C 1 212 ? 21.590  73.508  30.375  1.00   18.90 ? 212  GLY C O   1 
ATOM   7219  N N   . TYR C 1 213 ? 22.128  71.391  29.899  1.00   18.62 ? 213  TYR C N   1 
ATOM   7220  C CA  . TYR C 1 213 ? 23.199  71.816  29.017  1.00   21.91 ? 213  TYR C CA  1 
ATOM   7221  C C   . TYR C 1 213 ? 23.366  70.872  27.831  1.00   21.93 ? 213  TYR C C   1 
ATOM   7222  O O   . TYR C 1 213 ? 22.807  69.762  27.823  1.00   21.21 ? 213  TYR C O   1 
ATOM   7223  C CB  . TYR C 1 213 ? 24.511  72.006  29.803  1.00   26.58 ? 213  TYR C CB  1 
ATOM   7224  C CG  . TYR C 1 213 ? 25.011  70.805  30.572  1.00   30.01 ? 213  TYR C CG  1 
ATOM   7225  C CD1 . TYR C 1 213 ? 26.021  69.997  30.062  1.00   30.38 ? 213  TYR C CD1 1 
ATOM   7226  C CD2 . TYR C 1 213 ? 24.463  70.478  31.812  1.00   32.22 ? 213  TYR C CD2 1 
ATOM   7227  C CE1 . TYR C 1 213 ? 26.476  68.880  30.774  1.00   31.33 ? 213  TYR C CE1 1 
ATOM   7228  C CE2 . TYR C 1 213 ? 24.904  69.369  32.531  1.00   30.22 ? 213  TYR C CE2 1 
ATOM   7229  C CZ  . TYR C 1 213 ? 25.907  68.570  32.006  1.00   33.86 ? 213  TYR C CZ  1 
ATOM   7230  O OH  . TYR C 1 213 ? 26.291  67.436  32.695  1.00   29.59 ? 213  TYR C OH  1 
ATOM   7231  N N   . VAL C 1 214 ? 24.093  71.318  26.810  1.00   21.95 ? 214  VAL C N   1 
ATOM   7232  C CA  . VAL C 1 214 ? 24.280  70.525  25.593  1.00   21.76 ? 214  VAL C CA  1 
ATOM   7233  C C   . VAL C 1 214 ? 25.716  70.361  25.208  1.00   20.29 ? 214  VAL C C   1 
ATOM   7234  O O   . VAL C 1 214 ? 26.504  71.290  25.373  1.00   18.72 ? 214  VAL C O   1 
ATOM   7235  C CB  . VAL C 1 214 ? 23.649  71.181  24.348  1.00   21.61 ? 214  VAL C CB  1 
ATOM   7236  C CG1 . VAL C 1 214 ? 23.301  70.084  23.339  1.00   24.09 ? 214  VAL C CG1 1 
ATOM   7237  C CG2 . VAL C 1 214 ? 22.450  72.013  24.727  1.00   22.99 ? 214  VAL C CG2 1 
ATOM   7238  N N   . VAL C 1 215 ? 26.035  69.196  24.651  1.00   19.68 ? 215  VAL C N   1 
ATOM   7239  C CA  . VAL C 1 215 ? 27.393  68.883  24.203  1.00   17.51 ? 215  VAL C CA  1 
ATOM   7240  C C   . VAL C 1 215 ? 27.295  68.354  22.781  1.00   19.52 ? 215  VAL C C   1 
ATOM   7241  O O   . VAL C 1 215 ? 26.697  67.306  22.532  1.00   21.20 ? 215  VAL C O   1 
ATOM   7242  C CB  . VAL C 1 215 ? 28.027  67.807  25.086  1.00   18.17 ? 215  VAL C CB  1 
ATOM   7243  C CG1 . VAL C 1 215 ? 29.473  67.585  24.675  1.00   24.29 ? 215  VAL C CG1 1 
ATOM   7244  C CG2 . VAL C 1 215 ? 27.966  68.229  26.521  1.00   16.87 ? 215  VAL C CG2 1 
ATOM   7245  N N   . ALA C 1 216 ? 27.864  69.089  21.838  1.00   22.04 ? 216  ALA C N   1 
ATOM   7246  C CA  . ALA C 1 216 ? 27.803  68.679  20.439  1.00   23.39 ? 216  ALA C CA  1 
ATOM   7247  C C   . ALA C 1 216 ? 28.906  69.311  19.628  1.00   24.90 ? 216  ALA C C   1 
ATOM   7248  O O   . ALA C 1 216 ? 29.780  69.957  20.179  1.00   24.89 ? 216  ALA C O   1 
ATOM   7249  C CB  . ALA C 1 216 ? 26.467  69.054  19.852  1.00   19.95 ? 216  ALA C CB  1 
ATOM   7250  N N   . SER C 1 217 ? 28.855  69.118  18.311  1.00   29.76 ? 217  SER C N   1 
ATOM   7251  C CA  . SER C 1 217 ? 29.854  69.695  17.434  1.00   33.92 ? 217  SER C CA  1 
ATOM   7252  C C   . SER C 1 217 ? 29.620  71.186  17.440  1.00   37.85 ? 217  SER C C   1 
ATOM   7253  O O   . SER C 1 217 ? 28.469  71.647  17.543  1.00   38.29 ? 217  SER C O   1 
ATOM   7254  C CB  . SER C 1 217 ? 29.684  69.194  16.010  1.00   36.43 ? 217  SER C CB  1 
ATOM   7255  O OG  . SER C 1 217 ? 28.628  69.899  15.383  1.00   36.63 ? 217  SER C OG  1 
ATOM   7256  N N   . GLU C 1 218 ? 30.717  71.924  17.324  1.00   38.49 ? 218  GLU C N   1 
ATOM   7257  C CA  . GLU C 1 218 ? 30.670  73.366  17.284  1.00   41.70 ? 218  GLU C CA  1 
ATOM   7258  C C   . GLU C 1 218 ? 29.608  73.877  16.318  1.00   40.17 ? 218  GLU C C   1 
ATOM   7259  O O   . GLU C 1 218 ? 28.899  74.828  16.626  1.00   41.52 ? 218  GLU C O   1 
ATOM   7260  C CB  . GLU C 1 218 ? 32.043  73.901  16.889  1.00   46.19 ? 218  GLU C CB  1 
ATOM   7261  C CG  . GLU C 1 218 ? 33.121  73.616  17.925  1.00   54.67 ? 218  GLU C CG  1 
ATOM   7262  C CD  . GLU C 1 218 ? 34.408  74.379  17.656  1.00   60.85 ? 218  GLU C CD  1 
ATOM   7263  O OE1 . GLU C 1 218 ? 35.368  74.241  18.457  1.00   63.68 ? 218  GLU C OE1 1 
ATOM   7264  O OE2 . GLU C 1 218 ? 34.453  75.116  16.646  1.00   62.87 ? 218  GLU C OE2 1 
ATOM   7265  N N   . LYS C 1 219 ? 29.506  73.256  15.152  1.00   39.72 ? 219  LYS C N   1 
ATOM   7266  C CA  . LYS C 1 219 ? 28.510  73.657  14.167  1.00   40.19 ? 219  LYS C CA  1 
ATOM   7267  C C   . LYS C 1 219 ? 27.125  73.592  14.789  1.00   39.63 ? 219  LYS C C   1 
ATOM   7268  O O   . LYS C 1 219 ? 26.293  74.450  14.538  1.00   41.15 ? 219  LYS C O   1 
ATOM   7269  C CB  . LYS C 1 219 ? 28.540  72.749  12.930  1.00   41.34 ? 219  LYS C CB  1 
ATOM   7270  C CG  . LYS C 1 219 ? 29.828  72.843  12.138  1.00   45.63 ? 219  LYS C CG  1 
ATOM   7271  C CD  . LYS C 1 219 ? 29.801  71.946  10.906  1.00   49.98 ? 219  LYS C CD  1 
ATOM   7272  C CE  . LYS C 1 219 ? 28.958  72.555  9.802   1.00   51.23 ? 219  LYS C CE  1 
ATOM   7273  N NZ  . LYS C 1 219 ? 27.554  72.783  10.242  1.00   53.74 ? 219  LYS C NZ  1 
ATOM   7274  N N   . PHE C 1 220 ? 26.877  72.573  15.602  1.00   38.10 ? 220  PHE C N   1 
ATOM   7275  C CA  . PHE C 1 220 ? 25.578  72.453  16.238  1.00   33.49 ? 220  PHE C CA  1 
ATOM   7276  C C   . PHE C 1 220 ? 25.396  73.511  17.319  1.00   31.52 ? 220  PHE C C   1 
ATOM   7277  O O   . PHE C 1 220 ? 24.424  74.246  17.315  1.00   33.38 ? 220  PHE C O   1 
ATOM   7278  C CB  . PHE C 1 220 ? 25.413  71.103  16.901  1.00   31.33 ? 220  PHE C CB  1 
ATOM   7279  C CG  . PHE C 1 220 ? 24.108  70.962  17.600  1.00   29.74 ? 220  PHE C CG  1 
ATOM   7280  C CD1 . PHE C 1 220 ? 22.958  70.659  16.879  1.00   28.72 ? 220  PHE C CD1 1 
ATOM   7281  C CD2 . PHE C 1 220 ? 23.997  71.258  18.960  1.00   29.97 ? 220  PHE C CD2 1 
ATOM   7282  C CE1 . PHE C 1 220 ? 21.692  70.660  17.498  1.00   33.66 ? 220  PHE C CE1 1 
ATOM   7283  C CE2 . PHE C 1 220 ? 22.730  71.266  19.597  1.00   33.94 ? 220  PHE C CE2 1 
ATOM   7284  C CZ  . PHE C 1 220 ? 21.576  70.967  18.857  1.00   31.72 ? 220  PHE C CZ  1 
ATOM   7285  N N   . ILE C 1 221 ? 26.331  73.545  18.259  1.00   28.53 ? 221  ILE C N   1 
ATOM   7286  C CA  . ILE C 1 221 ? 26.292  74.476  19.361  1.00   28.09 ? 221  ILE C CA  1 
ATOM   7287  C C   . ILE C 1 221 ? 26.043  75.893  18.861  1.00   30.92 ? 221  ILE C C   1 
ATOM   7288  O O   . ILE C 1 221 ? 25.272  76.651  19.456  1.00   28.81 ? 221  ILE C O   1 
ATOM   7289  C CB  . ILE C 1 221 ? 27.610  74.439  20.127  1.00   26.71 ? 221  ILE C CB  1 
ATOM   7290  C CG1 . ILE C 1 221 ? 27.727  73.113  20.890  1.00   25.40 ? 221  ILE C CG1 1 
ATOM   7291  C CG2 . ILE C 1 221 ? 27.729  75.650  21.028  1.00   27.00 ? 221  ILE C CG2 1 
ATOM   7292  C CD1 . ILE C 1 221 ? 26.684  72.898  21.947  1.00   23.38 ? 221  ILE C CD1 1 
ATOM   7293  N N   . ASP C 1 222 ? 26.696  76.238  17.759  1.00   31.62 ? 222  ASP C N   1 
ATOM   7294  C CA  . ASP C 1 222 ? 26.557  77.551  17.159  1.00   30.71 ? 222  ASP C CA  1 
ATOM   7295  C C   . ASP C 1 222 ? 25.161  77.795  16.611  1.00   30.58 ? 222  ASP C C   1 
ATOM   7296  O O   . ASP C 1 222 ? 24.561  78.833  16.867  1.00   32.49 ? 222  ASP C O   1 
ATOM   7297  C CB  . ASP C 1 222 ? 27.570  77.714  16.037  1.00   33.26 ? 222  ASP C CB  1 
ATOM   7298  C CG  . ASP C 1 222 ? 27.315  78.950  15.210  1.00   33.68 ? 222  ASP C CG  1 
ATOM   7299  O OD1 . ASP C 1 222 ? 27.486  80.079  15.732  1.00   39.81 ? 222  ASP C OD1 1 
ATOM   7300  O OD2 . ASP C 1 222 ? 26.932  78.786  14.038  1.00   32.98 ? 222  ASP C OD2 1 
ATOM   7301  N N   . ALA C 1 223 ? 24.639  76.843  15.848  1.00   29.66 ? 223  ALA C N   1 
ATOM   7302  C CA  . ALA C 1 223 ? 23.314  77.012  15.279  1.00   27.06 ? 223  ALA C CA  1 
ATOM   7303  C C   . ALA C 1 223 ? 22.306  77.054  16.427  1.00   26.86 ? 223  ALA C C   1 
ATOM   7304  O O   . ALA C 1 223 ? 21.307  77.775  16.365  1.00   28.40 ? 223  ALA C O   1 
ATOM   7305  C CB  . ALA C 1 223 ? 23.009  75.877  14.306  1.00   23.19 ? 223  ALA C CB  1 
ATOM   7306  N N   . TYR C 1 224 ? 22.591  76.299  17.483  1.00   25.25 ? 224  TYR C N   1 
ATOM   7307  C CA  . TYR C 1 224 ? 21.713  76.243  18.651  1.00   21.75 ? 224  TYR C CA  1 
ATOM   7308  C C   . TYR C 1 224 ? 21.670  77.592  19.381  1.00   23.72 ? 224  TYR C C   1 
ATOM   7309  O O   . TYR C 1 224 ? 20.608  78.037  19.841  1.00   20.07 ? 224  TYR C O   1 
ATOM   7310  C CB  . TYR C 1 224 ? 22.188  75.155  19.620  1.00   20.83 ? 224  TYR C CB  1 
ATOM   7311  C CG  . TYR C 1 224 ? 21.498  75.209  20.971  1.00   21.79 ? 224  TYR C CG  1 
ATOM   7312  C CD1 . TYR C 1 224 ? 20.169  74.818  21.121  1.00   20.46 ? 224  TYR C CD1 1 
ATOM   7313  C CD2 . TYR C 1 224 ? 22.178  75.694  22.101  1.00   20.23 ? 224  TYR C CD2 1 
ATOM   7314  C CE1 . TYR C 1 224 ? 19.535  74.920  22.372  1.00   22.77 ? 224  TYR C CE1 1 
ATOM   7315  C CE2 . TYR C 1 224 ? 21.563  75.791  23.332  1.00   18.10 ? 224  TYR C CE2 1 
ATOM   7316  C CZ  . TYR C 1 224 ? 20.242  75.409  23.473  1.00   20.17 ? 224  TYR C CZ  1 
ATOM   7317  O OH  . TYR C 1 224 ? 19.626  75.515  24.700  1.00   18.61 ? 224  TYR C OH  1 
ATOM   7318  N N   . ASN C 1 225 ? 22.831  78.240  19.480  1.00   22.51 ? 225  ASN C N   1 
ATOM   7319  C CA  . ASN C 1 225 ? 22.913  79.521  20.150  1.00   23.88 ? 225  ASN C CA  1 
ATOM   7320  C C   . ASN C 1 225 ? 22.207  80.623  19.360  1.00   22.93 ? 225  ASN C C   1 
ATOM   7321  O O   . ASN C 1 225 ? 21.808  81.634  19.929  1.00   23.46 ? 225  ASN C O   1 
ATOM   7322  C CB  . ASN C 1 225 ? 24.381  79.866  20.425  1.00   22.84 ? 225  ASN C CB  1 
ATOM   7323  C CG  . ASN C 1 225 ? 24.952  79.068  21.596  1.00   29.33 ? 225  ASN C CG  1 
ATOM   7324  O OD1 . ASN C 1 225 ? 26.164  78.914  21.715  1.00   35.76 ? 225  ASN C OD1 1 
ATOM   7325  N ND2 . ASN C 1 225 ? 24.078  78.564  22.468  1.00   28.46 ? 225  ASN C ND2 1 
ATOM   7326  N N   . ARG C 1 226 ? 22.010  80.399  18.061  1.00   23.92 ? 226  ARG C N   1 
ATOM   7327  C CA  . ARG C 1 226 ? 21.340  81.373  17.209  1.00   26.48 ? 226  ARG C CA  1 
ATOM   7328  C C   . ARG C 1 226 ? 19.820  81.259  17.248  1.00   25.32 ? 226  ARG C C   1 
ATOM   7329  O O   . ARG C 1 226 ? 19.132  82.242  17.028  1.00   25.87 ? 226  ARG C O   1 
ATOM   7330  C CB  . ARG C 1 226 ? 21.819  81.235  15.762  1.00   28.97 ? 226  ARG C CB  1 
ATOM   7331  C CG  . ARG C 1 226 ? 23.189  81.842  15.490  1.00   37.79 ? 226  ARG C CG  1 
ATOM   7332  C CD  . ARG C 1 226 ? 23.758  81.345  14.158  1.00   46.37 ? 226  ARG C CD  1 
ATOM   7333  N NE  . ARG C 1 226 ? 24.232  82.429  13.297  1.00   51.39 ? 226  ARG C NE  1 
ATOM   7334  C CZ  . ARG C 1 226 ? 25.502  82.639  12.966  1.00   51.92 ? 226  ARG C CZ  1 
ATOM   7335  N NH1 . ARG C 1 226 ? 26.452  81.834  13.422  1.00   50.66 ? 226  ARG C NH1 1 
ATOM   7336  N NH2 . ARG C 1 226 ? 25.818  83.660  12.178  1.00   57.57 ? 226  ARG C NH2 1 
ATOM   7337  N N   . VAL C 1 227 ? 19.302  80.068  17.534  1.00   25.24 ? 227  VAL C N   1 
ATOM   7338  C CA  . VAL C 1 227 ? 17.860  79.843  17.561  1.00   25.49 ? 227  VAL C CA  1 
ATOM   7339  C C   . VAL C 1 227 ? 17.204  80.055  18.938  1.00   25.36 ? 227  VAL C C   1 
ATOM   7340  O O   . VAL C 1 227 ? 16.060  80.509  19.033  1.00   25.81 ? 227  VAL C O   1 
ATOM   7341  C CB  . VAL C 1 227 ? 17.518  78.392  17.061  1.00   26.24 ? 227  VAL C CB  1 
ATOM   7342  C CG1 . VAL C 1 227 ? 16.007  78.228  16.939  1.00   24.34 ? 227  VAL C CG1 1 
ATOM   7343  C CG2 . VAL C 1 227 ? 18.197  78.119  15.724  1.00   23.61 ? 227  VAL C CG2 1 
ATOM   7344  N N   . ARG C 1 228 ? 17.941  79.712  19.989  1.00   24.44 ? 228  ARG C N   1 
ATOM   7345  C CA  . ARG C 1 228 ? 17.485  79.822  21.370  1.00   23.84 ? 228  ARG C CA  1 
ATOM   7346  C C   . ARG C 1 228 ? 17.392  81.273  21.801  1.00   23.94 ? 228  ARG C C   1 
ATOM   7347  O O   . ARG C 1 228 ? 17.872  82.166  21.101  1.00   24.43 ? 228  ARG C O   1 
ATOM   7348  C CB  . ARG C 1 228 ? 18.476  79.115  22.312  1.00   22.98 ? 228  ARG C CB  1 
ATOM   7349  C CG  . ARG C 1 228 ? 19.826  79.862  22.479  1.00   19.83 ? 228  ARG C CG  1 
ATOM   7350  C CD  . ARG C 1 228 ? 20.689  79.183  23.543  1.00   27.11 ? 228  ARG C CD  1 
ATOM   7351  N NE  . ARG C 1 228 ? 22.015  79.772  23.745  1.00   22.82 ? 228  ARG C NE  1 
ATOM   7352  C CZ  . ARG C 1 228 ? 22.287  80.758  24.588  1.00   27.55 ? 228  ARG C CZ  1 
ATOM   7353  N NH1 . ARG C 1 228 ? 21.335  81.299  25.334  1.00   29.79 ? 228  ARG C NH1 1 
ATOM   7354  N NH2 . ARG C 1 228 ? 23.528  81.198  24.688  1.00   29.01 ? 228  ARG C NH2 1 
ATOM   7355  N N   . LEU C 1 229 ? 16.769  81.505  22.952  1.00   23.95 ? 229  LEU C N   1 
ATOM   7356  C CA  . LEU C 1 229 ? 16.693  82.859  23.496  1.00   26.41 ? 229  LEU C CA  1 
ATOM   7357  C C   . LEU C 1 229 ? 18.095  83.247  23.976  1.00   27.81 ? 229  LEU C C   1 
ATOM   7358  O O   . LEU C 1 229 ? 18.856  82.401  24.467  1.00   27.02 ? 229  LEU C O   1 
ATOM   7359  C CB  . LEU C 1 229 ? 15.713  82.910  24.656  1.00   22.73 ? 229  LEU C CB  1 
ATOM   7360  C CG  . LEU C 1 229 ? 14.280  82.776  24.138  1.00   26.42 ? 229  LEU C CG  1 
ATOM   7361  C CD1 . LEU C 1 229 ? 13.363  82.190  25.206  1.00   20.55 ? 229  LEU C CD1 1 
ATOM   7362  C CD2 . LEU C 1 229 ? 13.818  84.158  23.678  1.00   24.37 ? 229  LEU C CD2 1 
ATOM   7363  N N   . PRO C 1 230 ? 18.465  84.522  23.800  1.00   27.62 ? 230  PRO C N   1 
ATOM   7364  C CA  . PRO C 1 230 ? 19.775  85.024  24.213  1.00   29.81 ? 230  PRO C CA  1 
ATOM   7365  C C   . PRO C 1 230 ? 20.063  84.780  25.699  1.00   31.48 ? 230  PRO C C   1 
ATOM   7366  O O   . PRO C 1 230 ? 21.113  84.263  26.060  1.00   34.58 ? 230  PRO C O   1 
ATOM   7367  C CB  . PRO C 1 230 ? 19.686  86.513  23.894  1.00   30.62 ? 230  PRO C CB  1 
ATOM   7368  C CG  . PRO C 1 230 ? 18.790  86.556  22.736  1.00   28.10 ? 230  PRO C CG  1 
ATOM   7369  C CD  . PRO C 1 230 ? 17.725  85.539  23.036  1.00   26.27 ? 230  PRO C CD  1 
ATOM   7370  N N   . PHE C 1 231 ? 19.119  85.154  26.559  1.00   32.53 ? 231  PHE C N   1 
ATOM   7371  C CA  . PHE C 1 231 ? 19.293  85.012  28.011  1.00   31.39 ? 231  PHE C CA  1 
ATOM   7372  C C   . PHE C 1 231 ? 18.298  84.040  28.598  1.00   29.53 ? 231  PHE C C   1 
ATOM   7373  O O   . PHE C 1 231 ? 17.407  84.443  29.339  1.00   26.75 ? 231  PHE C O   1 
ATOM   7374  C CB  . PHE C 1 231 ? 19.143  86.383  28.683  1.00   28.83 ? 231  PHE C CB  1 
ATOM   7375  C CG  . PHE C 1 231 ? 19.988  87.444  28.043  1.00   32.34 ? 231  PHE C CG  1 
ATOM   7376  C CD1 . PHE C 1 231 ? 19.431  88.308  27.103  1.00   33.22 ? 231  PHE C CD1 1 
ATOM   7377  C CD2 . PHE C 1 231 ? 21.362  87.525  28.307  1.00   30.76 ? 231  PHE C CD2 1 
ATOM   7378  C CE1 . PHE C 1 231 ? 20.217  89.238  26.425  1.00   31.99 ? 231  PHE C CE1 1 
ATOM   7379  C CE2 . PHE C 1 231 ? 22.172  88.454  27.633  1.00   32.72 ? 231  PHE C CE2 1 
ATOM   7380  C CZ  . PHE C 1 231 ? 21.592  89.315  26.684  1.00   34.31 ? 231  PHE C CZ  1 
ATOM   7381  N N   . ASN C 1 232 ? 18.488  82.757  28.280  1.00   27.90 ? 232  ASN C N   1 
ATOM   7382  C CA  . ASN C 1 232 ? 17.586  81.713  28.718  1.00   25.04 ? 232  ASN C CA  1 
ATOM   7383  C C   . ASN C 1 232 ? 17.749  81.218  30.159  1.00   26.30 ? 232  ASN C C   1 
ATOM   7384  O O   . ASN C 1 232 ? 16.790  80.701  30.737  1.00   25.68 ? 232  ASN C O   1 
ATOM   7385  C CB  . ASN C 1 232 ? 17.649  80.530  27.743  1.00   23.76 ? 232  ASN C CB  1 
ATOM   7386  C CG  . ASN C 1 232 ? 19.067  80.026  27.503  1.00   24.65 ? 232  ASN C CG  1 
ATOM   7387  O OD1 . ASN C 1 232 ? 19.267  78.872  27.099  1.00   22.95 ? 232  ASN C OD1 1 
ATOM   7388  N ND2 . ASN C 1 232 ? 20.055  80.891  27.725  1.00   14.36 ? 232  ASN C ND2 1 
ATOM   7389  N N   . VAL C 1 233 ? 18.936  81.363  30.751  1.00   24.57 ? 233  VAL C N   1 
ATOM   7390  C CA  . VAL C 1 233 ? 19.117  80.924  32.136  1.00   21.84 ? 233  VAL C CA  1 
ATOM   7391  C C   . VAL C 1 233 ? 19.579  82.059  33.051  1.00   23.86 ? 233  VAL C C   1 
ATOM   7392  O O   . VAL C 1 233 ? 20.628  82.650  32.817  1.00   24.29 ? 233  VAL C O   1 
ATOM   7393  C CB  . VAL C 1 233 ? 20.153  79.761  32.268  1.00   20.64 ? 233  VAL C CB  1 
ATOM   7394  C CG1 . VAL C 1 233 ? 20.306  79.372  33.738  1.00   18.61 ? 233  VAL C CG1 1 
ATOM   7395  C CG2 . VAL C 1 233 ? 19.688  78.562  31.478  1.00   22.72 ? 233  VAL C CG2 1 
ATOM   7396  N N   . SER C 1 234 ? 18.816  82.319  34.115  1.00   22.71 ? 234  SER C N   1 
ATOM   7397  C CA  . SER C 1 234 ? 19.127  83.391  35.062  1.00   20.74 ? 234  SER C CA  1 
ATOM   7398  C C   . SER C 1 234 ? 20.485  83.246  35.771  1.00   21.92 ? 234  SER C C   1 
ATOM   7399  O O   . SER C 1 234 ? 21.075  82.159  35.822  1.00   21.51 ? 234  SER C O   1 
ATOM   7400  C CB  . SER C 1 234 ? 18.026  83.501  36.114  1.00   16.65 ? 234  SER C CB  1 
ATOM   7401  O OG  . SER C 1 234 ? 18.164  82.447  37.045  1.00   15.27 ? 234  SER C OG  1 
ATOM   7402  N N   . TYR C 1 235 ? 20.939  84.369  36.316  1.00   19.68 ? 235  TYR C N   1 
ATOM   7403  C CA  . TYR C 1 235 ? 22.196  84.518  37.030  1.00   23.98 ? 235  TYR C CA  1 
ATOM   7404  C C   . TYR C 1 235 ? 22.242  83.638  38.276  1.00   23.63 ? 235  TYR C C   1 
ATOM   7405  O O   . TYR C 1 235 ? 23.164  82.856  38.475  1.00   25.34 ? 235  TYR C O   1 
ATOM   7406  C CB  . TYR C 1 235 ? 22.351  86.013  37.401  1.00   25.79 ? 235  TYR C CB  1 
ATOM   7407  C CG  . TYR C 1 235 ? 23.353  86.330  38.480  1.00   25.14 ? 235  TYR C CG  1 
ATOM   7408  C CD1 . TYR C 1 235 ? 24.689  85.968  38.348  1.00   26.82 ? 235  TYR C CD1 1 
ATOM   7409  C CD2 . TYR C 1 235 ? 22.966  87.002  39.622  1.00   26.66 ? 235  TYR C CD2 1 
ATOM   7410  C CE1 . TYR C 1 235 ? 25.606  86.271  39.333  1.00   20.12 ? 235  TYR C CE1 1 
ATOM   7411  C CE2 . TYR C 1 235 ? 23.875  87.308  40.608  1.00   23.62 ? 235  TYR C CE2 1 
ATOM   7412  C CZ  . TYR C 1 235 ? 25.184  86.941  40.459  1.00   21.93 ? 235  TYR C CZ  1 
ATOM   7413  O OH  . TYR C 1 235 ? 26.074  87.241  41.464  1.00   21.19 ? 235  TYR C OH  1 
ATOM   7414  N N   . VAL C 1 236 ? 21.218  83.764  39.102  1.00   24.28 ? 236  VAL C N   1 
ATOM   7415  C CA  . VAL C 1 236 ? 21.133  82.993  40.318  1.00   23.71 ? 236  VAL C CA  1 
ATOM   7416  C C   . VAL C 1 236 ? 21.150  81.491  39.994  1.00   25.84 ? 236  VAL C C   1 
ATOM   7417  O O   . VAL C 1 236 ? 21.865  80.718  40.638  1.00   26.92 ? 236  VAL C O   1 
ATOM   7418  C CB  . VAL C 1 236 ? 19.854  83.408  41.092  1.00   25.59 ? 236  VAL C CB  1 
ATOM   7419  C CG1 . VAL C 1 236 ? 19.582  82.452  42.237  1.00   24.11 ? 236  VAL C CG1 1 
ATOM   7420  C CG2 . VAL C 1 236 ? 20.025  84.844  41.622  1.00   19.31 ? 236  VAL C CG2 1 
ATOM   7421  N N   . SER C 1 237 ? 20.395  81.072  38.983  1.00   24.74 ? 237  SER C N   1 
ATOM   7422  C CA  . SER C 1 237 ? 20.383  79.650  38.625  1.00   23.05 ? 237  SER C CA  1 
ATOM   7423  C C   . SER C 1 237 ? 21.750  79.136  38.179  1.00   21.05 ? 237  SER C C   1 
ATOM   7424  O O   . SER C 1 237 ? 22.109  77.990  38.440  1.00   19.29 ? 237  SER C O   1 
ATOM   7425  C CB  . SER C 1 237 ? 19.353  79.365  37.522  1.00   22.53 ? 237  SER C CB  1 
ATOM   7426  O OG  . SER C 1 237 ? 18.025  79.503  38.006  1.00   11.83 ? 237  SER C OG  1 
ATOM   7427  N N   . GLN C 1 238 ? 22.513  79.982  37.495  1.00   22.97 ? 238  GLN C N   1 
ATOM   7428  C CA  . GLN C 1 238 ? 23.832  79.574  37.044  1.00   21.79 ? 238  GLN C CA  1 
ATOM   7429  C C   . GLN C 1 238 ? 24.723  79.446  38.283  1.00   22.40 ? 238  GLN C C   1 
ATOM   7430  O O   . GLN C 1 238 ? 25.557  78.547  38.366  1.00   24.71 ? 238  GLN C O   1 
ATOM   7431  C CB  . GLN C 1 238 ? 24.395  80.599  36.058  1.00   23.76 ? 238  GLN C CB  1 
ATOM   7432  C CG  . GLN C 1 238 ? 23.532  80.808  34.812  1.00   23.45 ? 238  GLN C CG  1 
ATOM   7433  C CD  . GLN C 1 238 ? 24.241  81.600  33.733  1.00   24.79 ? 238  GLN C CD  1 
ATOM   7434  O OE1 . GLN C 1 238 ? 23.682  82.530  33.136  1.00   22.71 ? 238  GLN C OE1 1 
ATOM   7435  N NE2 . GLN C 1 238 ? 25.481  81.228  33.466  1.00   26.23 ? 238  GLN C NE2 1 
ATOM   7436  N N   . MET C 1 239 ? 24.532  80.352  39.238  1.00   21.78 ? 239  MET C N   1 
ATOM   7437  C CA  . MET C 1 239 ? 25.270  80.336  40.496  1.00   22.09 ? 239  MET C CA  1 
ATOM   7438  C C   . MET C 1 239 ? 25.031  79.001  41.178  1.00   22.22 ? 239  MET C C   1 
ATOM   7439  O O   . MET C 1 239 ? 25.974  78.320  41.595  1.00   18.96 ? 239  MET C O   1 
ATOM   7440  C CB  . MET C 1 239 ? 24.779  81.445  41.417  1.00   26.67 ? 239  MET C CB  1 
ATOM   7441  C CG  . MET C 1 239 ? 25.674  82.662  41.437  1.00   37.74 ? 239  MET C CG  1 
ATOM   7442  S SD  . MET C 1 239 ? 27.386  82.213  41.848  1.00   40.95 ? 239  MET C SD  1 
ATOM   7443  C CE  . MET C 1 239 ? 28.257  83.387  40.806  1.00   45.60 ? 239  MET C CE  1 
ATOM   7444  N N   . PHE C 1 240 ? 23.763  78.630  41.309  1.00   20.66 ? 240  PHE C N   1 
ATOM   7445  C CA  . PHE C 1 240 ? 23.417  77.349  41.928  1.00   22.07 ? 240  PHE C CA  1 
ATOM   7446  C C   . PHE C 1 240 ? 24.102  76.166  41.245  1.00   21.07 ? 240  PHE C C   1 
ATOM   7447  O O   . PHE C 1 240 ? 24.664  75.282  41.910  1.00   18.46 ? 240  PHE C O   1 
ATOM   7448  C CB  . PHE C 1 240 ? 21.898  77.139  41.921  1.00   22.39 ? 240  PHE C CB  1 
ATOM   7449  C CG  . PHE C 1 240 ? 21.222  77.606  43.180  1.00   21.61 ? 240  PHE C CG  1 
ATOM   7450  C CD1 . PHE C 1 240 ? 21.231  76.813  44.322  1.00   22.15 ? 240  PHE C CD1 1 
ATOM   7451  C CD2 . PHE C 1 240 ? 20.637  78.864  43.247  1.00   21.86 ? 240  PHE C CD2 1 
ATOM   7452  C CE1 . PHE C 1 240 ? 20.669  77.272  45.515  1.00   19.03 ? 240  PHE C CE1 1 
ATOM   7453  C CE2 . PHE C 1 240 ? 20.080  79.328  44.425  1.00   19.65 ? 240  PHE C CE2 1 
ATOM   7454  C CZ  . PHE C 1 240 ? 20.094  78.536  45.562  1.00   21.00 ? 240  PHE C CZ  1 
ATOM   7455  N N   . ALA C 1 241 ? 24.048  76.165  39.913  1.00   20.01 ? 241  ALA C N   1 
ATOM   7456  C CA  . ALA C 1 241 ? 24.655  75.125  39.102  1.00   19.69 ? 241  ALA C CA  1 
ATOM   7457  C C   . ALA C 1 241 ? 26.145  75.107  39.316  1.00   21.69 ? 241  ALA C C   1 
ATOM   7458  O O   . ALA C 1 241 ? 26.765  74.040  39.341  1.00   18.19 ? 241  ALA C O   1 
ATOM   7459  C CB  . ALA C 1 241 ? 24.384  75.384  37.672  1.00   22.30 ? 241  ALA C CB  1 
ATOM   7460  N N   . LYS C 1 242 ? 26.714  76.304  39.435  1.00   22.75 ? 242  LYS C N   1 
ATOM   7461  C CA  . LYS C 1 242 ? 28.134  76.447  39.632  1.00   24.02 ? 242  LYS C CA  1 
ATOM   7462  C C   . LYS C 1 242 ? 28.610  75.919  40.977  1.00   26.49 ? 242  LYS C C   1 
ATOM   7463  O O   . LYS C 1 242 ? 29.531  75.097  41.029  1.00   27.23 ? 242  LYS C O   1 
ATOM   7464  C CB  . LYS C 1 242 ? 28.528  77.905  39.455  1.00   26.75 ? 242  LYS C CB  1 
ATOM   7465  C CG  . LYS C 1 242 ? 28.685  78.254  37.995  1.00   29.86 ? 242  LYS C CG  1 
ATOM   7466  C CD  . LYS C 1 242 ? 29.353  79.596  37.788  1.00   28.63 ? 242  LYS C CD  1 
ATOM   7467  C CE  . LYS C 1 242 ? 28.420  80.756  38.106  1.00   30.93 ? 242  LYS C CE  1 
ATOM   7468  N NZ  . LYS C 1 242 ? 29.112  82.051  37.843  1.00   22.73 ? 242  LYS C NZ  1 
ATOM   7469  N N   . VAL C 1 243 ? 27.989  76.358  42.066  1.00   25.96 ? 243  VAL C N   1 
ATOM   7470  C CA  . VAL C 1 243 ? 28.413  75.862  43.359  1.00   28.60 ? 243  VAL C CA  1 
ATOM   7471  C C   . VAL C 1 243 ? 28.135  74.359  43.463  1.00   29.47 ? 243  VAL C C   1 
ATOM   7472  O O   . VAL C 1 243 ? 28.875  73.626  44.121  1.00   32.16 ? 243  VAL C O   1 
ATOM   7473  C CB  . VAL C 1 243 ? 27.726  76.627  44.548  1.00   27.34 ? 243  VAL C CB  1 
ATOM   7474  C CG1 . VAL C 1 243 ? 27.565  78.086  44.192  1.00   24.16 ? 243  VAL C CG1 1 
ATOM   7475  C CG2 . VAL C 1 243 ? 26.419  75.980  44.935  1.00   26.46 ? 243  VAL C CG2 1 
ATOM   7476  N N   . ALA C 1 244 ? 27.087  73.894  42.792  1.00   29.91 ? 244  ALA C N   1 
ATOM   7477  C CA  . ALA C 1 244 ? 26.737  72.484  42.815  1.00   28.97 ? 244  ALA C CA  1 
ATOM   7478  C C   . ALA C 1 244 ? 27.911  71.672  42.280  1.00   31.75 ? 244  ALA C C   1 
ATOM   7479  O O   . ALA C 1 244 ? 28.295  70.645  42.848  1.00   30.43 ? 244  ALA C O   1 
ATOM   7480  C CB  . ALA C 1 244 ? 25.509  72.249  41.967  1.00   29.46 ? 244  ALA C CB  1 
ATOM   7481  N N   . LEU C 1 245 ? 28.487  72.141  41.178  1.00   32.30 ? 245  LEU C N   1 
ATOM   7482  C CA  . LEU C 1 245 ? 29.619  71.446  40.587  1.00   34.67 ? 245  LEU C CA  1 
ATOM   7483  C C   . LEU C 1 245 ? 30.854  71.545  41.464  1.00   36.66 ? 245  LEU C C   1 
ATOM   7484  O O   . LEU C 1 245 ? 31.720  70.673  41.416  1.00   38.13 ? 245  LEU C O   1 
ATOM   7485  C CB  . LEU C 1 245 ? 29.918  71.984  39.182  1.00   30.30 ? 245  LEU C CB  1 
ATOM   7486  C CG  . LEU C 1 245 ? 28.930  71.538  38.112  1.00   25.02 ? 245  LEU C CG  1 
ATOM   7487  C CD1 . LEU C 1 245 ? 29.180  72.292  36.818  1.00   26.06 ? 245  LEU C CD1 1 
ATOM   7488  C CD2 . LEU C 1 245 ? 29.044  70.052  37.933  1.00   20.62 ? 245  LEU C CD2 1 
ATOM   7489  N N   . ASP C 1 246 ? 30.935  72.597  42.274  1.00   39.57 ? 246  ASP C N   1 
ATOM   7490  C CA  . ASP C 1 246 ? 32.081  72.763  43.175  1.00   42.32 ? 246  ASP C CA  1 
ATOM   7491  C C   . ASP C 1 246 ? 32.090  71.721  44.288  1.00   40.39 ? 246  ASP C C   1 
ATOM   7492  O O   . ASP C 1 246 ? 33.143  71.387  44.822  1.00   41.97 ? 246  ASP C O   1 
ATOM   7493  C CB  . ASP C 1 246 ? 32.111  74.164  43.801  1.00   43.14 ? 246  ASP C CB  1 
ATOM   7494  C CG  . ASP C 1 246 ? 32.600  75.235  42.838  1.00   45.09 ? 246  ASP C CG  1 
ATOM   7495  O OD1 . ASP C 1 246 ? 33.303  74.892  41.865  1.00   44.65 ? 246  ASP C OD1 1 
ATOM   7496  O OD2 . ASP C 1 246 ? 32.298  76.429  43.066  1.00   47.41 ? 246  ASP C OD2 1 
ATOM   7497  N N   . HIS C 1 247 ? 30.919  71.206  44.631  1.00   39.21 ? 247  HIS C N   1 
ATOM   7498  C CA  . HIS C 1 247 ? 30.813  70.207  45.689  1.00   37.21 ? 247  HIS C CA  1 
ATOM   7499  C C   . HIS C 1 247 ? 30.132  68.970  45.139  1.00   35.93 ? 247  HIS C C   1 
ATOM   7500  O O   . HIS C 1 247 ? 29.188  68.465  45.730  1.00   37.62 ? 247  HIS C O   1 
ATOM   7501  C CB  . HIS C 1 247 ? 30.003  70.792  46.839  1.00   33.94 ? 247  HIS C CB  1 
ATOM   7502  C CG  . HIS C 1 247 ? 30.490  72.136  47.288  1.00   38.58 ? 247  HIS C CG  1 
ATOM   7503  N ND1 . HIS C 1 247 ? 30.410  73.261  46.494  1.00   40.98 ? 247  HIS C ND1 1 
ATOM   7504  C CD2 . HIS C 1 247 ? 31.088  72.533  48.436  1.00   35.28 ? 247  HIS C CD2 1 
ATOM   7505  C CE1 . HIS C 1 247 ? 30.936  74.291  47.130  1.00   37.19 ? 247  HIS C CE1 1 
ATOM   7506  N NE2 . HIS C 1 247 ? 31.355  73.877  48.311  1.00   38.27 ? 247  HIS C NE2 1 
ATOM   7507  N N   . ARG C 1 248 ? 30.621  68.481  44.010  1.00   36.57 ? 248  ARG C N   1 
ATOM   7508  C CA  . ARG C 1 248 ? 30.011  67.327  43.354  1.00   39.52 ? 248  ARG C CA  1 
ATOM   7509  C C   . ARG C 1 248 ? 30.076  66.006  44.113  1.00   41.23 ? 248  ARG C C   1 
ATOM   7510  O O   . ARG C 1 248 ? 29.251  65.119  43.894  1.00   40.25 ? 248  ARG C O   1 
ATOM   7511  C CB  . ARG C 1 248 ? 30.610  67.149  41.961  1.00   40.69 ? 248  ARG C CB  1 
ATOM   7512  C CG  . ARG C 1 248 ? 32.106  66.956  41.965  1.00   43.50 ? 248  ARG C CG  1 
ATOM   7513  C CD  . ARG C 1 248 ? 32.670  67.010  40.546  1.00   48.17 ? 248  ARG C CD  1 
ATOM   7514  N NE  . ARG C 1 248 ? 32.558  68.347  39.963  1.00   47.77 ? 248  ARG C NE  1 
ATOM   7515  C CZ  . ARG C 1 248 ? 33.256  68.761  38.907  1.00   52.21 ? 248  ARG C CZ  1 
ATOM   7516  N NH1 . ARG C 1 248 ? 33.097  69.994  38.436  1.00   52.76 ? 248  ARG C NH1 1 
ATOM   7517  N NH2 . ARG C 1 248 ? 34.125  67.941  38.318  1.00   52.06 ? 248  ARG C NH2 1 
ATOM   7518  N N   . GLU C 1 249 ? 31.040  65.869  45.012  1.00   42.38 ? 249  GLU C N   1 
ATOM   7519  C CA  . GLU C 1 249 ? 31.166  64.630  45.781  1.00   44.27 ? 249  GLU C CA  1 
ATOM   7520  C C   . GLU C 1 249 ? 29.919  64.365  46.631  1.00   41.83 ? 249  GLU C C   1 
ATOM   7521  O O   . GLU C 1 249 ? 29.499  63.219  46.830  1.00   41.44 ? 249  GLU C O   1 
ATOM   7522  C CB  . GLU C 1 249 ? 32.415  64.681  46.680  1.00   46.94 ? 249  GLU C CB  1 
ATOM   7523  C CG  . GLU C 1 249 ? 33.192  65.994  46.635  1.00   53.10 ? 249  GLU C CG  1 
ATOM   7524  C CD  . GLU C 1 249 ? 32.476  67.118  47.359  1.00   56.65 ? 249  GLU C CD  1 
ATOM   7525  O OE1 . GLU C 1 249 ? 33.034  68.232  47.452  1.00   59.95 ? 249  GLU C OE1 1 
ATOM   7526  O OE2 . GLU C 1 249 ? 31.352  66.886  47.845  1.00   61.36 ? 249  GLU C OE2 1 
ATOM   7527  N N   . ILE C 1 250 ? 29.335  65.441  47.133  1.00   40.36 ? 250  ILE C N   1 
ATOM   7528  C CA  . ILE C 1 250 ? 28.138  65.350  47.955  1.00   37.92 ? 250  ILE C CA  1 
ATOM   7529  C C   . ILE C 1 250 ? 26.987  64.741  47.163  1.00   34.86 ? 250  ILE C C   1 
ATOM   7530  O O   . ILE C 1 250 ? 26.320  63.818  47.612  1.00   33.65 ? 250  ILE C O   1 
ATOM   7531  C CB  . ILE C 1 250 ? 27.779  66.756  48.471  1.00   38.93 ? 250  ILE C CB  1 
ATOM   7532  C CG1 . ILE C 1 250 ? 28.735  67.103  49.612  1.00   40.62 ? 250  ILE C CG1 1 
ATOM   7533  C CG2 . ILE C 1 250 ? 26.321  66.839  48.900  1.00   39.02 ? 250  ILE C CG2 1 
ATOM   7534  C CD1 . ILE C 1 250 ? 29.468  68.427  49.450  1.00   44.66 ? 250  ILE C CD1 1 
ATOM   7535  N N   . PHE C 1 251 ? 26.771  65.254  45.965  1.00   33.58 ? 251  PHE C N   1 
ATOM   7536  C CA  . PHE C 1 251 ? 25.705  64.740  45.123  1.00   33.86 ? 251  PHE C CA  1 
ATOM   7537  C C   . PHE C 1 251 ? 26.048  63.336  44.629  1.00   33.96 ? 251  PHE C C   1 
ATOM   7538  O O   . PHE C 1 251 ? 25.163  62.555  44.264  1.00   33.53 ? 251  PHE C O   1 
ATOM   7539  C CB  . PHE C 1 251 ? 25.481  65.688  43.951  1.00   28.68 ? 251  PHE C CB  1 
ATOM   7540  C CG  . PHE C 1 251 ? 25.308  67.110  44.369  1.00   26.67 ? 251  PHE C CG  1 
ATOM   7541  C CD1 . PHE C 1 251 ? 26.411  67.969  44.452  1.00   24.91 ? 251  PHE C CD1 1 
ATOM   7542  C CD2 . PHE C 1 251 ? 24.041  67.600  44.702  1.00   24.47 ? 251  PHE C CD2 1 
ATOM   7543  C CE1 . PHE C 1 251 ? 26.236  69.309  44.866  1.00   21.91 ? 251  PHE C CE1 1 
ATOM   7544  C CE2 . PHE C 1 251 ? 23.858  68.938  45.116  1.00   21.07 ? 251  PHE C CE2 1 
ATOM   7545  C CZ  . PHE C 1 251 ? 24.952  69.788  45.196  1.00   17.77 ? 251  PHE C CZ  1 
ATOM   7546  N N   . GLU C 1 252 ? 27.336  63.023  44.605  1.00   33.26 ? 252  GLU C N   1 
ATOM   7547  C CA  . GLU C 1 252 ? 27.762  61.702  44.192  1.00   33.82 ? 252  GLU C CA  1 
ATOM   7548  C C   . GLU C 1 252 ? 27.326  60.712  45.241  1.00   31.74 ? 252  GLU C C   1 
ATOM   7549  O O   . GLU C 1 252 ? 26.816  59.657  44.910  1.00   27.93 ? 252  GLU C O   1 
ATOM   7550  C CB  . GLU C 1 252 ? 29.273  61.641  44.041  1.00   37.33 ? 252  GLU C CB  1 
ATOM   7551  C CG  . GLU C 1 252 ? 29.750  62.315  42.780  1.00   47.25 ? 252  GLU C CG  1 
ATOM   7552  C CD  . GLU C 1 252 ? 31.233  62.130  42.563  1.00   54.26 ? 252  GLU C CD  1 
ATOM   7553  O OE1 . GLU C 1 252 ? 31.763  62.672  41.558  1.00   55.36 ? 252  GLU C OE1 1 
ATOM   7554  O OE2 . GLU C 1 252 ? 31.856  61.435  43.405  1.00   56.48 ? 252  GLU C OE2 1 
ATOM   7555  N N   . GLU C 1 253 ? 27.538  61.059  46.511  1.00   32.13 ? 253  GLU C N   1 
ATOM   7556  C CA  . GLU C 1 253 ? 27.126  60.183  47.604  1.00   34.02 ? 253  GLU C CA  1 
ATOM   7557  C C   . GLU C 1 253 ? 25.616  59.951  47.527  1.00   33.71 ? 253  GLU C C   1 
ATOM   7558  O O   . GLU C 1 253 ? 25.141  58.821  47.689  1.00   33.10 ? 253  GLU C O   1 
ATOM   7559  C CB  . GLU C 1 253 ? 27.480  60.795  48.956  1.00   32.51 ? 253  GLU C CB  1 
ATOM   7560  C CG  . GLU C 1 253 ? 28.968  60.977  49.157  1.00   43.40 ? 253  GLU C CG  1 
ATOM   7561  C CD  . GLU C 1 253 ? 29.329  61.344  50.588  1.00   49.84 ? 253  GLU C CD  1 
ATOM   7562  O OE1 . GLU C 1 253 ? 30.050  62.362  50.792  1.00   51.35 ? 253  GLU C OE1 1 
ATOM   7563  O OE2 . GLU C 1 253 ? 28.893  60.605  51.500  1.00   51.22 ? 253  GLU C OE2 1 
ATOM   7564  N N   . ARG C 1 254 ? 24.868  61.026  47.263  1.00   33.32 ? 254  ARG C N   1 
ATOM   7565  C CA  . ARG C 1 254 ? 23.414  60.940  47.165  1.00   30.93 ? 254  ARG C CA  1 
ATOM   7566  C C   . ARG C 1 254 ? 22.990  60.007  46.033  1.00   30.62 ? 254  ARG C C   1 
ATOM   7567  O O   . ARG C 1 254 ? 22.109  59.152  46.204  1.00   27.98 ? 254  ARG C O   1 
ATOM   7568  C CB  . ARG C 1 254 ? 22.832  62.325  46.957  1.00   27.78 ? 254  ARG C CB  1 
ATOM   7569  C CG  . ARG C 1 254 ? 22.983  63.209  48.170  1.00   30.34 ? 254  ARG C CG  1 
ATOM   7570  C CD  . ARG C 1 254 ? 22.375  64.543  47.888  1.00   32.21 ? 254  ARG C CD  1 
ATOM   7571  N NE  . ARG C 1 254 ? 22.191  65.370  49.071  1.00   37.25 ? 254  ARG C NE  1 
ATOM   7572  C CZ  . ARG C 1 254 ? 21.326  66.378  49.116  1.00   39.32 ? 254  ARG C CZ  1 
ATOM   7573  N NH1 . ARG C 1 254 ? 20.588  66.649  48.049  1.00   38.31 ? 254  ARG C NH1 1 
ATOM   7574  N NH2 . ARG C 1 254 ? 21.200  67.117  50.210  1.00   38.14 ? 254  ARG C NH2 1 
ATOM   7575  N N   . THR C 1 255 ? 23.623  60.175  44.878  1.00   27.42 ? 255  THR C N   1 
ATOM   7576  C CA  . THR C 1 255 ? 23.343  59.336  43.721  1.00   28.03 ? 255  THR C CA  1 
ATOM   7577  C C   . THR C 1 255 ? 23.625  57.865  44.071  1.00   28.70 ? 255  THR C C   1 
ATOM   7578  O O   . THR C 1 255 ? 22.901  56.958  43.639  1.00   28.54 ? 255  THR C O   1 
ATOM   7579  C CB  . THR C 1 255 ? 24.245  59.733  42.535  1.00   27.75 ? 255  THR C CB  1 
ATOM   7580  O OG1 . THR C 1 255 ? 23.981  61.093  42.166  1.00   34.33 ? 255  THR C OG1 1 
ATOM   7581  C CG2 . THR C 1 255 ? 23.983  58.841  41.345  1.00   27.39 ? 255  THR C CG2 1 
ATOM   7582  N N   . LYS C 1 256 ? 24.689  57.650  44.843  1.00   26.03 ? 256  LYS C N   1 
ATOM   7583  C CA  . LYS C 1 256 ? 25.114  56.328  45.269  1.00   28.05 ? 256  LYS C CA  1 
ATOM   7584  C C   . LYS C 1 256 ? 24.040  55.687  46.146  1.00   27.92 ? 256  LYS C C   1 
ATOM   7585  O O   . LYS C 1 256 ? 23.746  54.490  46.013  1.00   28.36 ? 256  LYS C O   1 
ATOM   7586  C CB  . LYS C 1 256 ? 26.455  56.422  46.027  1.00   31.13 ? 256  LYS C CB  1 
ATOM   7587  C CG  . LYS C 1 256 ? 26.997  55.083  46.537  1.00   34.92 ? 256  LYS C CG  1 
ATOM   7588  C CD  . LYS C 1 256 ? 28.291  55.266  47.342  1.00   40.03 ? 256  LYS C CD  1 
ATOM   7589  C CE  . LYS C 1 256 ? 28.412  54.255  48.493  1.00   40.74 ? 256  LYS C CE  1 
ATOM   7590  N NZ  . LYS C 1 256 ? 28.564  52.841  48.019  1.00   42.54 ? 256  LYS C NZ  1 
ATOM   7591  N N   . PHE C 1 257 ? 23.436  56.487  47.020  1.00   26.75 ? 257  PHE C N   1 
ATOM   7592  C CA  . PHE C 1 257 ? 22.390  55.970  47.880  1.00   26.58 ? 257  PHE C CA  1 
ATOM   7593  C C   . PHE C 1 257 ? 21.173  55.637  47.048  1.00   26.26 ? 257  PHE C C   1 
ATOM   7594  O O   . PHE C 1 257 ? 20.503  54.643  47.306  1.00   26.43 ? 257  PHE C O   1 
ATOM   7595  C CB  . PHE C 1 257 ? 22.005  56.990  48.949  1.00   32.10 ? 257  PHE C CB  1 
ATOM   7596  C CG  . PHE C 1 257 ? 20.697  56.688  49.640  1.00   34.36 ? 257  PHE C CG  1 
ATOM   7597  C CD1 . PHE C 1 257 ? 19.483  57.146  49.112  1.00   36.38 ? 257  PHE C CD1 1 
ATOM   7598  C CD2 . PHE C 1 257 ? 20.680  55.952  50.813  1.00   34.86 ? 257  PHE C CD2 1 
ATOM   7599  C CE1 . PHE C 1 257 ? 18.275  56.869  49.757  1.00   35.96 ? 257  PHE C CE1 1 
ATOM   7600  C CE2 . PHE C 1 257 ? 19.494  55.670  51.462  1.00   38.02 ? 257  PHE C CE2 1 
ATOM   7601  C CZ  . PHE C 1 257 ? 18.282  56.129  50.937  1.00   39.14 ? 257  PHE C CZ  1 
ATOM   7602  N N   . ILE C 1 258 ? 20.910  56.465  46.035  1.00   27.20 ? 258  ILE C N   1 
ATOM   7603  C CA  . ILE C 1 258 ? 19.753  56.287  45.164  1.00   23.54 ? 258  ILE C CA  1 
ATOM   7604  C C   . ILE C 1 258 ? 19.931  55.104  44.248  1.00   25.01 ? 258  ILE C C   1 
ATOM   7605  O O   . ILE C 1 258 ? 18.986  54.356  43.999  1.00   21.42 ? 258  ILE C O   1 
ATOM   7606  C CB  . ILE C 1 258 ? 19.484  57.554  44.335  1.00   22.36 ? 258  ILE C CB  1 
ATOM   7607  C CG1 . ILE C 1 258 ? 19.142  58.715  45.271  1.00   17.72 ? 258  ILE C CG1 1 
ATOM   7608  C CG2 . ILE C 1 258 ? 18.336  57.314  43.356  1.00   24.51 ? 258  ILE C CG2 1 
ATOM   7609  C CD1 . ILE C 1 258 ? 19.308  60.095  44.643  1.00   17.01 ? 258  ILE C CD1 1 
ATOM   7610  N N   . VAL C 1 259 ? 21.146  54.931  43.748  1.00   26.16 ? 259  VAL C N   1 
ATOM   7611  C CA  . VAL C 1 259 ? 21.409  53.798  42.874  1.00   30.17 ? 259  VAL C CA  1 
ATOM   7612  C C   . VAL C 1 259 ? 21.258  52.516  43.671  1.00   30.00 ? 259  VAL C C   1 
ATOM   7613  O O   . VAL C 1 259 ? 20.471  51.646  43.339  1.00   30.01 ? 259  VAL C O   1 
ATOM   7614  C CB  . VAL C 1 259 ? 22.836  53.829  42.291  1.00   35.20 ? 259  VAL C CB  1 
ATOM   7615  C CG1 . VAL C 1 259 ? 23.111  52.530  41.517  1.00   35.28 ? 259  VAL C CG1 1 
ATOM   7616  C CG2 . VAL C 1 259 ? 23.006  55.035  41.376  1.00   37.36 ? 259  VAL C CG2 1 
ATOM   7617  N N   . GLU C 1 260 ? 22.026  52.395  44.736  1.00   33.13 ? 260  GLU C N   1 
ATOM   7618  C CA  . GLU C 1 260 ? 21.953  51.196  45.549  1.00   32.31 ? 260  GLU C CA  1 
ATOM   7619  C C   . GLU C 1 260 ? 20.504  50.953  45.966  1.00   32.87 ? 260  GLU C C   1 
ATOM   7620  O O   . GLU C 1 260 ? 20.000  49.823  45.946  1.00   34.56 ? 260  GLU C O   1 
ATOM   7621  C CB  . GLU C 1 260 ? 22.859  51.356  46.763  1.00   34.80 ? 260  GLU C CB  1 
ATOM   7622  C CG  . GLU C 1 260 ? 24.312  51.460  46.343  1.00   39.77 ? 260  GLU C CG  1 
ATOM   7623  C CD  . GLU C 1 260 ? 25.258  51.646  47.501  1.00   43.31 ? 260  GLU C CD  1 
ATOM   7624  O OE1 . GLU C 1 260 ? 26.472  51.414  47.291  1.00   43.99 ? 260  GLU C OE1 1 
ATOM   7625  O OE2 . GLU C 1 260 ? 24.787  52.030  48.602  1.00   45.18 ? 260  GLU C OE2 1 
ATOM   7626  N N   . GLU C 1 261 ? 19.815  52.024  46.321  1.00   29.90 ? 261  GLU C N   1 
ATOM   7627  C CA  . GLU C 1 261 ? 18.451  51.854  46.741  1.00   27.13 ? 261  GLU C CA  1 
ATOM   7628  C C   . GLU C 1 261 ? 17.622  51.314  45.576  1.00   28.78 ? 261  GLU C C   1 
ATOM   7629  O O   . GLU C 1 261 ? 16.780  50.424  45.757  1.00   26.84 ? 261  GLU C O   1 
ATOM   7630  C CB  . GLU C 1 261 ? 17.901  53.176  47.214  1.00   26.54 ? 261  GLU C CB  1 
ATOM   7631  C CG  . GLU C 1 261 ? 16.720  53.009  48.107  1.00   31.70 ? 261  GLU C CG  1 
ATOM   7632  C CD  . GLU C 1 261 ? 17.094  52.567  49.514  1.00   27.34 ? 261  GLU C CD  1 
ATOM   7633  O OE1 . GLU C 1 261 ? 18.233  52.130  49.747  1.00   31.23 ? 261  GLU C OE1 1 
ATOM   7634  O OE2 . GLU C 1 261 ? 16.231  52.653  50.400  1.00   31.02 ? 261  GLU C OE2 1 
ATOM   7635  N N   . ARG C 1 262 ? 17.861  51.845  44.374  1.00   27.22 ? 262  ARG C N   1 
ATOM   7636  C CA  . ARG C 1 262 ? 17.130  51.396  43.201  1.00   24.71 ? 262  ARG C CA  1 
ATOM   7637  C C   . ARG C 1 262 ? 17.404  49.921  42.896  1.00   26.77 ? 262  ARG C C   1 
ATOM   7638  O O   . ARG C 1 262 ? 16.515  49.199  42.450  1.00   27.34 ? 262  ARG C O   1 
ATOM   7639  C CB  . ARG C 1 262 ? 17.498  52.250  41.991  1.00   24.86 ? 262  ARG C CB  1 
ATOM   7640  C CG  . ARG C 1 262 ? 16.792  51.826  40.704  1.00   25.00 ? 262  ARG C CG  1 
ATOM   7641  C CD  . ARG C 1 262 ? 17.599  52.268  39.503  1.00   21.35 ? 262  ARG C CD  1 
ATOM   7642  N NE  . ARG C 1 262 ? 18.842  51.522  39.371  1.00   17.99 ? 262  ARG C NE  1 
ATOM   7643  C CZ  . ARG C 1 262 ? 19.975  52.042  38.896  1.00   21.83 ? 262  ARG C CZ  1 
ATOM   7644  N NH1 . ARG C 1 262 ? 20.047  53.315  38.519  1.00   18.90 ? 262  ARG C NH1 1 
ATOM   7645  N NH2 . ARG C 1 262 ? 21.045  51.273  38.769  1.00   18.78 ? 262  ARG C NH2 1 
ATOM   7646  N N   . GLU C 1 263 ? 18.632  49.475  43.128  1.00   26.97 ? 263  GLU C N   1 
ATOM   7647  C CA  . GLU C 1 263 ? 19.005  48.088  42.868  1.00   27.34 ? 263  GLU C CA  1 
ATOM   7648  C C   . GLU C 1 263 ? 18.430  47.196  43.952  1.00   26.33 ? 263  GLU C C   1 
ATOM   7649  O O   . GLU C 1 263 ? 18.075  46.039  43.736  1.00   24.78 ? 263  GLU C O   1 
ATOM   7650  C CB  . GLU C 1 263 ? 20.538  47.945  42.805  1.00   28.16 ? 263  GLU C CB  1 
ATOM   7651  C CG  . GLU C 1 263 ? 21.165  48.488  41.491  1.00   30.57 ? 263  GLU C CG  1 
ATOM   7652  C CD  . GLU C 1 263 ? 20.450  47.970  40.225  1.00   28.22 ? 263  GLU C CD  1 
ATOM   7653  O OE1 . GLU C 1 263 ? 20.155  46.758  40.152  1.00   39.01 ? 263  GLU C OE1 1 
ATOM   7654  O OE2 . GLU C 1 263 ? 20.183  48.756  39.296  1.00   23.88 ? 263  GLU C OE2 1 
ATOM   7655  N N   . ARG C 1 264 ? 18.342  47.762  45.137  1.00   30.29 ? 264  ARG C N   1 
ATOM   7656  C CA  . ARG C 1 264 ? 17.796  47.060  46.274  1.00   29.21 ? 264  ARG C CA  1 
ATOM   7657  C C   . ARG C 1 264 ? 16.326  46.769  46.014  1.00   28.85 ? 264  ARG C C   1 
ATOM   7658  O O   . ARG C 1 264 ? 15.873  45.632  46.135  1.00   31.55 ? 264  ARG C O   1 
ATOM   7659  C CB  . ARG C 1 264 ? 17.965  47.930  47.510  1.00   31.89 ? 264  ARG C CB  1 
ATOM   7660  C CG  . ARG C 1 264 ? 17.393  47.338  48.737  1.00   34.65 ? 264  ARG C CG  1 
ATOM   7661  C CD  . ARG C 1 264 ? 17.630  48.224  49.916  1.00   33.52 ? 264  ARG C CD  1 
ATOM   7662  N NE  . ARG C 1 264 ? 16.721  47.798  50.952  1.00   39.05 ? 264  ARG C NE  1 
ATOM   7663  C CZ  . ARG C 1 264 ? 15.561  48.380  51.214  1.00   36.09 ? 264  ARG C CZ  1 
ATOM   7664  N NH1 . ARG C 1 264 ? 15.174  49.443  50.526  1.00   34.56 ? 264  ARG C NH1 1 
ATOM   7665  N NH2 . ARG C 1 264 ? 14.769  47.856  52.134  1.00   38.67 ? 264  ARG C NH2 1 
ATOM   7666  N N   . MET C 1 265 ? 15.577  47.799  45.647  1.00   27.91 ? 265  MET C N   1 
ATOM   7667  C CA  . MET C 1 265 ? 14.166  47.613  45.369  1.00   25.46 ? 265  MET C CA  1 
ATOM   7668  C C   . MET C 1 265 ? 13.979  46.643  44.219  1.00   25.14 ? 265  MET C C   1 
ATOM   7669  O O   . MET C 1 265 ? 13.191  45.704  44.315  1.00   26.94 ? 265  MET C O   1 
ATOM   7670  C CB  . MET C 1 265 ? 13.511  48.945  45.010  1.00   21.48 ? 265  MET C CB  1 
ATOM   7671  C CG  . MET C 1 265 ? 13.392  49.890  46.188  1.00   25.33 ? 265  MET C CG  1 
ATOM   7672  S SD  . MET C 1 265 ? 12.848  51.517  45.652  1.00   28.71 ? 265  MET C SD  1 
ATOM   7673  C CE  . MET C 1 265 ? 11.117  51.170  45.132  1.00   20.95 ? 265  MET C CE  1 
ATOM   7674  N N   . LYS C 1 266 ? 14.710  46.867  43.136  1.00   23.05 ? 266  LYS C N   1 
ATOM   7675  C CA  . LYS C 1 266 ? 14.587  46.001  41.974  1.00   25.91 ? 266  LYS C CA  1 
ATOM   7676  C C   . LYS C 1 266 ? 14.702  44.524  42.337  1.00   26.75 ? 266  LYS C C   1 
ATOM   7677  O O   . LYS C 1 266 ? 13.952  43.700  41.817  1.00   23.12 ? 266  LYS C O   1 
ATOM   7678  C CB  . LYS C 1 266 ? 15.606  46.387  40.899  1.00   21.18 ? 266  LYS C CB  1 
ATOM   7679  C CG  . LYS C 1 266 ? 15.219  47.689  40.173  1.00   23.65 ? 266  LYS C CG  1 
ATOM   7680  C CD  . LYS C 1 266 ? 15.736  47.722  38.731  1.00   26.27 ? 266  LYS C CD  1 
ATOM   7681  C CE  . LYS C 1 266 ? 17.258  47.676  38.666  1.00   29.29 ? 266  LYS C CE  1 
ATOM   7682  N NZ  . LYS C 1 266 ? 17.794  47.630  37.273  1.00   30.49 ? 266  LYS C NZ  1 
ATOM   7683  N N   . SER C 1 267 ? 15.608  44.201  43.260  1.00   28.31 ? 267  SER C N   1 
ATOM   7684  C CA  . SER C 1 267 ? 15.787  42.828  43.705  1.00   31.48 ? 267  SER C CA  1 
ATOM   7685  C C   . SER C 1 267 ? 14.558  42.376  44.482  1.00   31.15 ? 267  SER C C   1 
ATOM   7686  O O   . SER C 1 267 ? 13.999  41.316  44.210  1.00   28.57 ? 267  SER C O   1 
ATOM   7687  C CB  . SER C 1 267 ? 17.019  42.709  44.603  1.00   35.64 ? 267  SER C CB  1 
ATOM   7688  O OG  . SER C 1 267 ? 18.185  43.203  43.960  1.00   37.59 ? 267  SER C OG  1 
ATOM   7689  N N   . ALA C 1 268 ? 14.136  43.196  45.439  1.00   31.53 ? 268  ALA C N   1 
ATOM   7690  C CA  . ALA C 1 268 ? 12.985  42.863  46.268  1.00   32.04 ? 268  ALA C CA  1 
ATOM   7691  C C   . ALA C 1 268 ? 11.744  42.576  45.428  1.00   32.70 ? 268  ALA C C   1 
ATOM   7692  O O   . ALA C 1 268 ? 11.085  41.544  45.598  1.00   32.93 ? 268  ALA C O   1 
ATOM   7693  C CB  . ALA C 1 268 ? 12.700  43.992  47.244  1.00   30.09 ? 268  ALA C CB  1 
ATOM   7694  N N   . LEU C 1 269 ? 11.438  43.501  44.525  1.00   33.87 ? 269  LEU C N   1 
ATOM   7695  C CA  . LEU C 1 269 ? 10.267  43.387  43.654  1.00   34.95 ? 269  LEU C CA  1 
ATOM   7696  C C   . LEU C 1 269 ? 10.277  42.147  42.754  1.00   36.92 ? 269  LEU C C   1 
ATOM   7697  O O   . LEU C 1 269 ? 9.231   41.538  42.508  1.00   36.13 ? 269  LEU C O   1 
ATOM   7698  C CB  . LEU C 1 269 ? 10.152  44.631  42.790  1.00   29.65 ? 269  LEU C CB  1 
ATOM   7699  C CG  . LEU C 1 269 ? 9.887   45.895  43.589  1.00   28.03 ? 269  LEU C CG  1 
ATOM   7700  C CD1 . LEU C 1 269 ? 10.233  47.104  42.765  1.00   21.56 ? 269  LEU C CD1 1 
ATOM   7701  C CD2 . LEU C 1 269 ? 8.431   45.899  44.014  1.00   30.81 ? 269  LEU C CD2 1 
ATOM   7702  N N   . ARG C 1 270 ? 11.448  41.793  42.234  1.00   38.63 ? 270  ARG C N   1 
ATOM   7703  C CA  . ARG C 1 270 ? 11.544  40.617  41.390  1.00   41.71 ? 270  ARG C CA  1 
ATOM   7704  C C   . ARG C 1 270 ? 11.162  39.399  42.240  1.00   41.68 ? 270  ARG C C   1 
ATOM   7705  O O   . ARG C 1 270 ? 10.374  38.568  41.805  1.00   39.52 ? 270  ARG C O   1 
ATOM   7706  C CB  . ARG C 1 270 ? 12.961  40.469  40.817  1.00   45.89 ? 270  ARG C CB  1 
ATOM   7707  C CG  . ARG C 1 270 ? 13.298  41.455  39.691  1.00   47.35 ? 270  ARG C CG  1 
ATOM   7708  C CD  . ARG C 1 270 ? 14.612  41.082  38.972  1.00   51.90 ? 270  ARG C CD  1 
ATOM   7709  N NE  . ARG C 1 270 ? 14.790  41.825  37.716  1.00   56.41 ? 270  ARG C NE  1 
ATOM   7710  C CZ  . ARG C 1 270 ? 15.337  43.041  37.609  1.00   55.20 ? 270  ARG C CZ  1 
ATOM   7711  N NH1 . ARG C 1 270 ? 15.784  43.679  38.688  1.00   54.22 ? 270  ARG C NH1 1 
ATOM   7712  N NH2 . ARG C 1 270 ? 15.422  43.633  36.418  1.00   48.41 ? 270  ARG C NH2 1 
ATOM   7713  N N   . GLU C 1 271 ? 11.700  39.320  43.458  1.00   42.57 ? 271  GLU C N   1 
ATOM   7714  C CA  . GLU C 1 271 ? 11.388  38.226  44.385  1.00   44.37 ? 271  GLU C CA  1 
ATOM   7715  C C   . GLU C 1 271 ? 9.888   38.138  44.716  1.00   43.63 ? 271  GLU C C   1 
ATOM   7716  O O   . GLU C 1 271 ? 9.384   37.062  45.052  1.00   41.20 ? 271  GLU C O   1 
ATOM   7717  C CB  . GLU C 1 271 ? 12.177  38.392  45.683  1.00   48.37 ? 271  GLU C CB  1 
ATOM   7718  C CG  . GLU C 1 271 ? 13.647  38.072  45.551  1.00   54.87 ? 271  GLU C CG  1 
ATOM   7719  C CD  . GLU C 1 271 ? 14.512  38.972  46.415  1.00   61.45 ? 271  GLU C CD  1 
ATOM   7720  O OE1 . GLU C 1 271 ? 14.230  39.095  47.623  1.00   62.84 ? 271  GLU C OE1 1 
ATOM   7721  O OE2 . GLU C 1 271 ? 15.480  39.561  45.887  1.00   67.13 ? 271  GLU C OE2 1 
ATOM   7722  N N   . MET C 1 272 ? 9.182   39.263  44.633  1.00   41.97 ? 272  MET C N   1 
ATOM   7723  C CA  . MET C 1 272 ? 7.756   39.273  44.917  1.00   40.51 ? 272  MET C CA  1 
ATOM   7724  C C   . MET C 1 272 ? 7.039   38.791  43.682  1.00   41.25 ? 272  MET C C   1 
ATOM   7725  O O   . MET C 1 272 ? 5.827   38.540  43.707  1.00   42.42 ? 272  MET C O   1 
ATOM   7726  C CB  . MET C 1 272 ? 7.274   40.680  45.254  1.00   40.19 ? 272  MET C CB  1 
ATOM   7727  C CG  . MET C 1 272 ? 7.791   41.216  46.556  1.00   39.67 ? 272  MET C CG  1 
ATOM   7728  S SD  . MET C 1 272 ? 7.271   42.911  46.769  1.00   40.07 ? 272  MET C SD  1 
ATOM   7729  C CE  . MET C 1 272 ? 8.638   43.551  47.744  1.00   38.91 ? 272  MET C CE  1 
ATOM   7730  N N   . GLY C 1 273 ? 7.788   38.676  42.591  1.00   40.32 ? 273  GLY C N   1 
ATOM   7731  C CA  . GLY C 1 273 ? 7.194   38.223  41.345  1.00   39.39 ? 273  GLY C CA  1 
ATOM   7732  C C   . GLY C 1 273 ? 6.856   39.283  40.311  1.00   38.65 ? 273  GLY C C   1 
ATOM   7733  O O   . GLY C 1 273 ? 6.277   38.955  39.278  1.00   38.54 ? 273  GLY C O   1 
ATOM   7734  N N   . TYR C 1 274 ? 7.193   40.548  40.561  1.00   36.72 ? 274  TYR C N   1 
ATOM   7735  C CA  . TYR C 1 274 ? 6.888   41.601  39.583  1.00   36.18 ? 274  TYR C CA  1 
ATOM   7736  C C   . TYR C 1 274 ? 7.790   41.550  38.356  1.00   35.55 ? 274  TYR C C   1 
ATOM   7737  O O   . TYR C 1 274 ? 8.937   41.101  38.419  1.00   32.46 ? 274  TYR C O   1 
ATOM   7738  C CB  . TYR C 1 274 ? 7.022   42.999  40.195  1.00   35.66 ? 274  TYR C CB  1 
ATOM   7739  C CG  . TYR C 1 274 ? 5.976   43.300  41.215  1.00   36.69 ? 274  TYR C CG  1 
ATOM   7740  C CD1 . TYR C 1 274 ? 6.222   43.126  42.580  1.00   34.33 ? 274  TYR C CD1 1 
ATOM   7741  C CD2 . TYR C 1 274 ? 4.701   43.687  40.816  1.00   32.71 ? 274  TYR C CD2 1 
ATOM   7742  C CE1 . TYR C 1 274 ? 5.213   43.321  43.512  1.00   33.76 ? 274  TYR C CE1 1 
ATOM   7743  C CE2 . TYR C 1 274 ? 3.692   43.881  41.742  1.00   34.76 ? 274  TYR C CE2 1 
ATOM   7744  C CZ  . TYR C 1 274 ? 3.950   43.693  43.084  1.00   30.63 ? 274  TYR C CZ  1 
ATOM   7745  O OH  . TYR C 1 274 ? 2.933   43.839  43.990  1.00   34.68 ? 274  TYR C OH  1 
ATOM   7746  N N   . ARG C 1 275 ? 7.265   42.024  37.237  1.00   34.54 ? 275  ARG C N   1 
ATOM   7747  C CA  . ARG C 1 275 ? 8.057   42.063  36.019  1.00   35.64 ? 275  ARG C CA  1 
ATOM   7748  C C   . ARG C 1 275 ? 8.512   43.512  35.901  1.00   35.13 ? 275  ARG C C   1 
ATOM   7749  O O   . ARG C 1 275 ? 7.719   44.399  35.597  1.00   35.71 ? 275  ARG C O   1 
ATOM   7750  C CB  . ARG C 1 275 ? 7.223   41.671  34.804  1.00   33.76 ? 275  ARG C CB  1 
ATOM   7751  C CG  . ARG C 1 275 ? 8.011   41.661  33.510  1.00   37.25 ? 275  ARG C CG  1 
ATOM   7752  C CD  . ARG C 1 275 ? 7.060   41.631  32.330  1.00   38.49 ? 275  ARG C CD  1 
ATOM   7753  N NE  . ARG C 1 275 ? 7.709   42.073  31.105  1.00   39.57 ? 275  ARG C NE  1 
ATOM   7754  C CZ  . ARG C 1 275 ? 7.128   42.837  30.190  1.00   39.87 ? 275  ARG C CZ  1 
ATOM   7755  N NH1 . ARG C 1 275 ? 5.877   43.241  30.365  1.00   39.81 ? 275  ARG C NH1 1 
ATOM   7756  N NH2 . ARG C 1 275 ? 7.799   43.204  29.107  1.00   39.56 ? 275  ARG C NH2 1 
ATOM   7757  N N   . ILE C 1 276 ? 9.793   43.739  36.154  1.00   34.36 ? 276  ILE C N   1 
ATOM   7758  C CA  . ILE C 1 276 ? 10.336  45.072  36.115  1.00   31.19 ? 276  ILE C CA  1 
ATOM   7759  C C   . ILE C 1 276 ? 11.438  45.185  35.089  1.00   29.32 ? 276  ILE C C   1 
ATOM   7760  O O   . ILE C 1 276 ? 12.116  44.201  34.758  1.00   25.84 ? 276  ILE C O   1 
ATOM   7761  C CB  . ILE C 1 276 ? 10.894  45.478  37.495  1.00   35.36 ? 276  ILE C CB  1 
ATOM   7762  C CG1 . ILE C 1 276 ? 12.310  44.913  37.676  1.00   34.33 ? 276  ILE C CG1 1 
ATOM   7763  C CG2 . ILE C 1 276 ? 9.959   44.944  38.609  1.00   37.09 ? 276  ILE C CG2 1 
ATOM   7764  C CD1 . ILE C 1 276 ? 13.030  45.418  38.896  1.00   32.47 ? 276  ILE C CD1 1 
ATOM   7765  N N   . THR C 1 277 ? 11.581  46.405  34.581  1.00   25.85 ? 277  THR C N   1 
ATOM   7766  C CA  . THR C 1 277 ? 12.594  46.722  33.607  1.00   24.90 ? 277  THR C CA  1 
ATOM   7767  C C   . THR C 1 277 ? 13.920  46.745  34.353  1.00   25.65 ? 277  THR C C   1 
ATOM   7768  O O   . THR C 1 277 ? 13.961  46.796  35.588  1.00   23.06 ? 277  THR C O   1 
ATOM   7769  C CB  . THR C 1 277 ? 12.382  48.116  33.045  1.00   26.99 ? 277  THR C CB  1 
ATOM   7770  O OG1 . THR C 1 277 ? 12.497  49.057  34.124  1.00   29.81 ? 277  THR C OG1 1 
ATOM   7771  C CG2 . THR C 1 277 ? 11.011  48.234  32.397  1.00   23.42 ? 277  THR C CG2 1 
ATOM   7772  N N   . ASP C 1 278 ? 15.006  46.680  33.596  1.00   26.25 ? 278  ASP C N   1 
ATOM   7773  C CA  . ASP C 1 278 ? 16.346  46.736  34.166  1.00   26.62 ? 278  ASP C CA  1 
ATOM   7774  C C   . ASP C 1 278 ? 16.675  48.231  34.143  1.00   28.10 ? 278  ASP C C   1 
ATOM   7775  O O   . ASP C 1 278 ? 17.480  48.708  33.347  1.00   27.86 ? 278  ASP C O   1 
ATOM   7776  C CB  . ASP C 1 278 ? 17.287  45.913  33.293  1.00   23.65 ? 278  ASP C CB  1 
ATOM   7777  C CG  . ASP C 1 278 ? 18.741  46.138  33.621  1.00   28.64 ? 278  ASP C CG  1 
ATOM   7778  O OD1 . ASP C 1 278 ? 19.059  46.583  34.748  1.00   26.96 ? 278  ASP C OD1 1 
ATOM   7779  O OD2 . ASP C 1 278 ? 19.562  45.861  32.729  1.00   32.03 ? 278  ASP C OD2 1 
ATOM   7780  N N   . SER C 1 279 ? 16.003  48.971  35.017  1.00   31.02 ? 279  SER C N   1 
ATOM   7781  C CA  . SER C 1 279 ? 16.158  50.420  35.072  1.00   32.61 ? 279  SER C CA  1 
ATOM   7782  C C   . SER C 1 279 ? 17.512  50.943  35.530  1.00   32.57 ? 279  SER C C   1 
ATOM   7783  O O   . SER C 1 279 ? 18.078  50.460  36.508  1.00   35.22 ? 279  SER C O   1 
ATOM   7784  C CB  . SER C 1 279 ? 15.057  51.023  35.942  1.00   32.57 ? 279  SER C CB  1 
ATOM   7785  O OG  . SER C 1 279 ? 15.233  52.425  36.067  1.00   36.81 ? 279  SER C OG  1 
ATOM   7786  N N   . ARG C 1 280 ? 18.015  51.950  34.825  1.00   30.69 ? 280  ARG C N   1 
ATOM   7787  C CA  . ARG C 1 280 ? 19.293  52.559  35.155  1.00   29.73 ? 280  ARG C CA  1 
ATOM   7788  C C   . ARG C 1 280 ? 19.082  54.047  35.487  1.00   30.19 ? 280  ARG C C   1 
ATOM   7789  O O   . ARG C 1 280 ? 20.034  54.834  35.522  1.00   30.81 ? 280  ARG C O   1 
ATOM   7790  C CB  . ARG C 1 280 ? 20.270  52.386  33.978  1.00   33.18 ? 280  ARG C CB  1 
ATOM   7791  C CG  . ARG C 1 280 ? 20.597  50.905  33.646  1.00   35.86 ? 280  ARG C CG  1 
ATOM   7792  C CD  . ARG C 1 280 ? 21.370  50.254  34.790  1.00   36.32 ? 280  ARG C CD  1 
ATOM   7793  N NE  . ARG C 1 280 ? 21.512  48.800  34.700  1.00   40.02 ? 280  ARG C NE  1 
ATOM   7794  C CZ  . ARG C 1 280 ? 22.127  48.135  33.719  1.00   41.98 ? 280  ARG C CZ  1 
ATOM   7795  N NH1 . ARG C 1 280 ? 22.669  48.779  32.698  1.00   41.98 ? 280  ARG C NH1 1 
ATOM   7796  N NH2 . ARG C 1 280 ? 22.234  46.813  33.780  1.00   43.31 ? 280  ARG C NH2 1 
ATOM   7797  N N   . GLY C 1 281 ? 17.834  54.430  35.737  1.00   27.04 ? 281  GLY C N   1 
ATOM   7798  C CA  . GLY C 1 281 ? 17.533  55.811  36.088  1.00   27.28 ? 281  GLY C CA  1 
ATOM   7799  C C   . GLY C 1 281 ? 17.441  55.955  37.600  1.00   26.14 ? 281  GLY C C   1 
ATOM   7800  O O   . GLY C 1 281 ? 18.056  55.171  38.319  1.00   29.41 ? 281  GLY C O   1 
ATOM   7801  N N   . ASN C 1 282 ? 16.689  56.944  38.089  1.00   23.71 ? 282  ASN C N   1 
ATOM   7802  C CA  . ASN C 1 282 ? 16.535  57.139  39.543  1.00   21.95 ? 282  ASN C CA  1 
ATOM   7803  C C   . ASN C 1 282 ? 15.109  56.743  39.838  1.00   21.33 ? 282  ASN C C   1 
ATOM   7804  O O   . ASN C 1 282 ? 14.362  57.454  40.510  1.00   20.70 ? 282  ASN C O   1 
ATOM   7805  C CB  . ASN C 1 282 ? 16.796  58.617  39.972  1.00   18.61 ? 282  ASN C CB  1 
ATOM   7806  C CG  . ASN C 1 282 ? 15.747  59.618  39.430  1.00   23.64 ? 282  ASN C CG  1 
ATOM   7807  O OD1 . ASN C 1 282 ? 15.405  59.577  38.247  1.00   21.14 ? 282  ASN C OD1 1 
ATOM   7808  N ND2 . ASN C 1 282 ? 15.253  60.521  40.295  1.00   18.38 ? 282  ASN C ND2 1 
ATOM   7809  N N   . PHE C 1 283 ? 14.754  55.572  39.324  1.00   22.28 ? 283  PHE C N   1 
ATOM   7810  C CA  . PHE C 1 283 ? 13.408  55.046  39.475  1.00   23.08 ? 283  PHE C CA  1 
ATOM   7811  C C   . PHE C 1 283 ? 13.345  53.607  38.965  1.00   23.23 ? 283  PHE C C   1 
ATOM   7812  O O   . PHE C 1 283 ? 14.309  53.098  38.392  1.00   20.60 ? 283  PHE C O   1 
ATOM   7813  C CB  . PHE C 1 283 ? 12.446  55.891  38.646  1.00   24.90 ? 283  PHE C CB  1 
ATOM   7814  C CG  . PHE C 1 283 ? 12.823  55.951  37.192  1.00   27.75 ? 283  PHE C CG  1 
ATOM   7815  C CD1 . PHE C 1 283 ? 13.631  56.980  36.715  1.00   24.90 ? 283  PHE C CD1 1 
ATOM   7816  C CD2 . PHE C 1 283 ? 12.453  54.927  36.317  1.00   25.22 ? 283  PHE C CD2 1 
ATOM   7817  C CE1 . PHE C 1 283 ? 14.066  56.985  35.406  1.00   24.86 ? 283  PHE C CE1 1 
ATOM   7818  C CE2 . PHE C 1 283 ? 12.891  54.929  34.995  1.00   23.48 ? 283  PHE C CE2 1 
ATOM   7819  C CZ  . PHE C 1 283 ? 13.697  55.956  34.543  1.00   21.52 ? 283  PHE C CZ  1 
ATOM   7820  N N   . VAL C 1 284 ? 12.207  52.957  39.193  1.00   20.95 ? 284  VAL C N   1 
ATOM   7821  C CA  . VAL C 1 284 ? 11.993  51.598  38.719  1.00   23.64 ? 284  VAL C CA  1 
ATOM   7822  C C   . VAL C 1 284 ? 10.690  51.641  37.927  1.00   24.53 ? 284  VAL C C   1 
ATOM   7823  O O   . VAL C 1 284 ? 9.835   52.515  38.156  1.00   25.92 ? 284  VAL C O   1 
ATOM   7824  C CB  . VAL C 1 284 ? 11.867  50.566  39.879  1.00   20.47 ? 284  VAL C CB  1 
ATOM   7825  C CG1 . VAL C 1 284 ? 13.107  50.596  40.727  1.00   20.30 ? 284  VAL C CG1 1 
ATOM   7826  C CG2 . VAL C 1 284 ? 10.619  50.860  40.730  1.00   23.38 ? 284  VAL C CG2 1 
ATOM   7827  N N   . PHE C 1 285 ? 10.551  50.731  36.973  1.00   24.06 ? 285  PHE C N   1 
ATOM   7828  C CA  . PHE C 1 285 ? 9.339   50.686  36.179  1.00   24.97 ? 285  PHE C CA  1 
ATOM   7829  C C   . PHE C 1 285 ? 8.746   49.317  36.350  1.00   23.99 ? 285  PHE C C   1 
ATOM   7830  O O   . PHE C 1 285 ? 9.408   48.316  36.078  1.00   27.01 ? 285  PHE C O   1 
ATOM   7831  C CB  . PHE C 1 285 ? 9.613   50.934  34.687  1.00   23.32 ? 285  PHE C CB  1 
ATOM   7832  C CG  . PHE C 1 285 ? 8.353   51.096  33.877  1.00   27.54 ? 285  PHE C CG  1 
ATOM   7833  C CD1 . PHE C 1 285 ? 7.716   52.337  33.786  1.00   30.78 ? 285  PHE C CD1 1 
ATOM   7834  C CD2 . PHE C 1 285 ? 7.753   49.998  33.280  1.00   28.74 ? 285  PHE C CD2 1 
ATOM   7835  C CE1 . PHE C 1 285 ? 6.499   52.478  33.113  1.00   31.46 ? 285  PHE C CE1 1 
ATOM   7836  C CE2 . PHE C 1 285 ? 6.546   50.128  32.611  1.00   31.89 ? 285  PHE C CE2 1 
ATOM   7837  C CZ  . PHE C 1 285 ? 5.917   51.374  32.528  1.00   32.84 ? 285  PHE C CZ  1 
ATOM   7838  N N   . VAL C 1 286 ? 7.499   49.271  36.802  1.00   24.64 ? 286  VAL C N   1 
ATOM   7839  C CA  . VAL C 1 286 ? 6.821   47.992  37.003  1.00   25.34 ? 286  VAL C CA  1 
ATOM   7840  C C   . VAL C 1 286 ? 5.754   47.775  35.952  1.00   24.74 ? 286  VAL C C   1 
ATOM   7841  O O   . VAL C 1 286 ? 4.866   48.603  35.812  1.00   27.53 ? 286  VAL C O   1 
ATOM   7842  C CB  . VAL C 1 286 ? 6.181   47.918  38.406  1.00   23.82 ? 286  VAL C CB  1 
ATOM   7843  C CG1 . VAL C 1 286 ? 5.651   46.493  38.672  1.00   21.74 ? 286  VAL C CG1 1 
ATOM   7844  C CG2 . VAL C 1 286 ? 7.218   48.286  39.452  1.00   22.03 ? 286  VAL C CG2 1 
ATOM   7845  N N   . PHE C 1 287 ? 5.853   46.675  35.201  1.00   27.00 ? 287  PHE C N   1 
ATOM   7846  C CA  . PHE C 1 287 ? 4.862   46.376  34.151  1.00   29.54 ? 287  PHE C CA  1 
ATOM   7847  C C   . PHE C 1 287 ? 3.606   45.802  34.755  1.00   30.54 ? 287  PHE C C   1 
ATOM   7848  O O   . PHE C 1 287 ? 3.681   44.885  35.548  1.00   31.61 ? 287  PHE C O   1 
ATOM   7849  C CB  . PHE C 1 287 ? 5.380   45.359  33.153  1.00   27.42 ? 287  PHE C CB  1 
ATOM   7850  C CG  . PHE C 1 287 ? 6.313   45.917  32.136  1.00   25.94 ? 287  PHE C CG  1 
ATOM   7851  C CD1 . PHE C 1 287 ? 7.687   45.807  32.296  1.00   21.59 ? 287  PHE C CD1 1 
ATOM   7852  C CD2 . PHE C 1 287 ? 5.813   46.469  30.965  1.00   23.01 ? 287  PHE C CD2 1 
ATOM   7853  C CE1 . PHE C 1 287 ? 8.548   46.233  31.285  1.00   23.60 ? 287  PHE C CE1 1 
ATOM   7854  C CE2 . PHE C 1 287 ? 6.662   46.896  29.957  1.00   22.41 ? 287  PHE C CE2 1 
ATOM   7855  C CZ  . PHE C 1 287 ? 8.029   46.779  30.109  1.00   21.36 ? 287  PHE C CZ  1 
ATOM   7856  N N   . MET C 1 288 ? 2.453   46.338  34.381  1.00   33.29 ? 288  MET C N   1 
ATOM   7857  C CA  . MET C 1 288 ? 1.194   45.850  34.934  1.00   37.59 ? 288  MET C CA  1 
ATOM   7858  C C   . MET C 1 288 ? 0.046   46.030  33.971  1.00   39.19 ? 288  MET C C   1 
ATOM   7859  O O   . MET C 1 288 ? 0.029   46.977  33.197  1.00   37.16 ? 288  MET C O   1 
ATOM   7860  C CB  . MET C 1 288 ? 0.833   46.597  36.216  1.00   41.03 ? 288  MET C CB  1 
ATOM   7861  C CG  . MET C 1 288 ? 1.958   46.793  37.208  1.00   44.25 ? 288  MET C CG  1 
ATOM   7862  S SD  . MET C 1 288 ? 1.273   47.475  38.735  1.00   49.13 ? 288  MET C SD  1 
ATOM   7863  C CE  . MET C 1 288 ? 0.888   49.147  38.215  1.00   50.59 ? 288  MET C CE  1 
ATOM   7864  N N   . GLU C 1 289 ? -0.928  45.125  34.041  1.00   42.48 ? 289  GLU C N   1 
ATOM   7865  C CA  . GLU C 1 289 ? -2.103  45.220  33.183  1.00   46.02 ? 289  GLU C CA  1 
ATOM   7866  C C   . GLU C 1 289 ? -3.007  46.324  33.725  1.00   45.93 ? 289  GLU C C   1 
ATOM   7867  O O   . GLU C 1 289 ? -2.915  46.689  34.887  1.00   42.96 ? 289  GLU C O   1 
ATOM   7868  C CB  . GLU C 1 289 ? -2.873  43.899  33.151  1.00   49.03 ? 289  GLU C CB  1 
ATOM   7869  C CG  . GLU C 1 289 ? -3.810  43.774  31.951  1.00   55.81 ? 289  GLU C CG  1 
ATOM   7870  C CD  . GLU C 1 289 ? -5.216  43.324  32.335  1.00   60.89 ? 289  GLU C CD  1 
ATOM   7871  O OE1 . GLU C 1 289 ? -6.133  44.182  32.395  1.00   57.91 ? 289  GLU C OE1 1 
ATOM   7872  O OE2 . GLU C 1 289 ? -5.402  42.107  32.578  1.00   62.59 ? 289  GLU C OE2 1 
ATOM   7873  N N   . LYS C 1 290 ? -3.884  46.839  32.871  1.00   48.99 ? 290  LYS C N   1 
ATOM   7874  C CA  . LYS C 1 290 ? -4.796  47.920  33.225  1.00   50.36 ? 290  LYS C CA  1 
ATOM   7875  C C   . LYS C 1 290 ? -5.542  47.699  34.538  1.00   50.82 ? 290  LYS C C   1 
ATOM   7876  O O   . LYS C 1 290 ? -5.569  48.591  35.384  1.00   51.27 ? 290  LYS C O   1 
ATOM   7877  C CB  . LYS C 1 290 ? -5.803  48.140  32.096  1.00   51.94 ? 290  LYS C CB  1 
ATOM   7878  C CG  . LYS C 1 290 ? -6.161  49.591  31.858  1.00   55.15 ? 290  LYS C CG  1 
ATOM   7879  C CD  . LYS C 1 290 ? -4.942  50.377  31.370  1.00   56.75 ? 290  LYS C CD  1 
ATOM   7880  C CE  . LYS C 1 290 ? -4.487  49.947  29.962  1.00   58.01 ? 290  LYS C CE  1 
ATOM   7881  N NZ  . LYS C 1 290 ? -5.399  50.433  28.862  1.00   59.19 ? 290  LYS C NZ  1 
ATOM   7882  N N   . GLU C 1 291 ? -6.130  46.514  34.707  1.00   50.77 ? 291  GLU C N   1 
ATOM   7883  C CA  . GLU C 1 291 ? -6.895  46.183  35.911  1.00   50.24 ? 291  GLU C CA  1 
ATOM   7884  C C   . GLU C 1 291 ? -6.095  46.290  37.204  1.00   49.56 ? 291  GLU C C   1 
ATOM   7885  O O   . GLU C 1 291 ? -6.442  47.075  38.092  1.00   48.91 ? 291  GLU C O   1 
ATOM   7886  C CB  . GLU C 1 291 ? -7.482  44.775  35.794  1.00   54.17 ? 291  GLU C CB  1 
ATOM   7887  C CG  . GLU C 1 291 ? -6.437  43.648  35.638  1.00   60.09 ? 291  GLU C CG  1 
ATOM   7888  C CD  . GLU C 1 291 ? -6.110  42.918  36.941  1.00   63.66 ? 291  GLU C CD  1 
ATOM   7889  O OE1 . GLU C 1 291 ? -5.115  42.149  36.952  1.00   63.93 ? 291  GLU C OE1 1 
ATOM   7890  O OE2 . GLU C 1 291 ? -6.847  43.103  37.941  1.00   61.95 ? 291  GLU C OE2 1 
ATOM   7891  N N   . GLU C 1 292 ? -5.033  45.500  37.311  1.00   47.58 ? 292  GLU C N   1 
ATOM   7892  C CA  . GLU C 1 292 ? -4.195  45.497  38.499  1.00   46.30 ? 292  GLU C CA  1 
ATOM   7893  C C   . GLU C 1 292 ? -3.547  46.866  38.727  1.00   45.16 ? 292  GLU C C   1 
ATOM   7894  O O   . GLU C 1 292 ? -3.525  47.367  39.852  1.00   44.61 ? 292  GLU C O   1 
ATOM   7895  C CB  . GLU C 1 292 ? -3.103  44.407  38.391  1.00   45.85 ? 292  GLU C CB  1 
ATOM   7896  C CG  . GLU C 1 292 ? -2.057  44.641  37.282  1.00   46.59 ? 292  GLU C CG  1 
ATOM   7897  C CD  . GLU C 1 292 ? -0.869  43.674  37.346  1.00   48.18 ? 292  GLU C CD  1 
ATOM   7898  O OE1 . GLU C 1 292 ? -0.527  43.213  38.465  1.00   46.61 ? 292  GLU C OE1 1 
ATOM   7899  O OE2 . GLU C 1 292 ? -0.267  43.393  36.279  1.00   43.82 ? 292  GLU C OE2 1 
ATOM   7900  N N   . LYS C 1 293 ? -3.032  47.466  37.656  1.00   43.44 ? 293  LYS C N   1 
ATOM   7901  C CA  . LYS C 1 293 ? -2.374  48.760  37.753  1.00   43.85 ? 293  LYS C CA  1 
ATOM   7902  C C   . LYS C 1 293 ? -3.210  49.745  38.560  1.00   44.68 ? 293  LYS C C   1 
ATOM   7903  O O   . LYS C 1 293 ? -2.787  50.224  39.617  1.00   43.44 ? 293  LYS C O   1 
ATOM   7904  C CB  . LYS C 1 293 ? -2.103  49.335  36.358  1.00   42.67 ? 293  LYS C CB  1 
ATOM   7905  C CG  . LYS C 1 293 ? -1.456  50.711  36.392  1.00   46.16 ? 293  LYS C CG  1 
ATOM   7906  C CD  . LYS C 1 293 ? -0.983  51.183  35.020  1.00   46.51 ? 293  LYS C CD  1 
ATOM   7907  C CE  . LYS C 1 293 ? -2.131  51.497  34.071  1.00   46.24 ? 293  LYS C CE  1 
ATOM   7908  N NZ  . LYS C 1 293 ? -1.602  51.891  32.736  1.00   35.59 ? 293  LYS C NZ  1 
ATOM   7909  N N   . GLU C 1 294 ? -4.413  50.023  38.071  1.00   44.91 ? 294  GLU C N   1 
ATOM   7910  C CA  . GLU C 1 294 ? -5.307  50.969  38.724  1.00   44.23 ? 294  GLU C CA  1 
ATOM   7911  C C   . GLU C 1 294 ? -5.741  50.615  40.153  1.00   41.30 ? 294  GLU C C   1 
ATOM   7912  O O   . GLU C 1 294 ? -5.970  51.512  40.961  1.00   38.51 ? 294  GLU C O   1 
ATOM   7913  C CB  . GLU C 1 294 ? -6.515  51.226  37.808  1.00   46.88 ? 294  GLU C CB  1 
ATOM   7914  C CG  . GLU C 1 294 ? -6.101  51.964  36.523  1.00   55.21 ? 294  GLU C CG  1 
ATOM   7915  C CD  . GLU C 1 294 ? -7.140  51.915  35.417  1.00   62.61 ? 294  GLU C CD  1 
ATOM   7916  O OE1 . GLU C 1 294 ? -7.600  50.796  35.082  1.00   66.58 ? 294  GLU C OE1 1 
ATOM   7917  O OE2 . GLU C 1 294 ? -7.483  52.993  34.875  1.00   65.29 ? 294  GLU C OE2 1 
ATOM   7918  N N   . ARG C 1 295 ? -5.856  49.331  40.481  1.00   38.60 ? 295  ARG C N   1 
ATOM   7919  C CA  . ARG C 1 295 ? -6.235  48.982  41.846  1.00   38.70 ? 295  ARG C CA  1 
ATOM   7920  C C   . ARG C 1 295 ? -5.076  49.416  42.730  1.00   38.66 ? 295  ARG C C   1 
ATOM   7921  O O   . ARG C 1 295 ? -5.251  49.824  43.881  1.00   39.73 ? 295  ARG C O   1 
ATOM   7922  C CB  . ARG C 1 295 ? -6.422  47.487  42.015  1.00   39.38 ? 295  ARG C CB  1 
ATOM   7923  C CG  . ARG C 1 295 ? -7.477  46.867  41.145  1.00   43.50 ? 295  ARG C CG  1 
ATOM   7924  C CD  . ARG C 1 295 ? -8.213  45.796  41.943  1.00   47.83 ? 295  ARG C CD  1 
ATOM   7925  N NE  . ARG C 1 295 ? -7.383  45.177  42.980  1.00   48.69 ? 295  ARG C NE  1 
ATOM   7926  C CZ  . ARG C 1 295 ? -6.444  44.262  42.756  1.00   48.73 ? 295  ARG C CZ  1 
ATOM   7927  N NH1 . ARG C 1 295 ? -6.197  43.834  41.516  1.00   45.07 ? 295  ARG C NH1 1 
ATOM   7928  N NH2 . ARG C 1 295 ? -5.746  43.777  43.778  1.00   48.79 ? 295  ARG C NH2 1 
ATOM   7929  N N   . LEU C 1 296 ? -3.881  49.308  42.163  1.00   37.82 ? 296  LEU C N   1 
ATOM   7930  C CA  . LEU C 1 296 ? -2.671  49.694  42.858  1.00   36.05 ? 296  LEU C CA  1 
ATOM   7931  C C   . LEU C 1 296 ? -2.711  51.212  43.012  1.00   35.36 ? 296  LEU C C   1 
ATOM   7932  O O   . LEU C 1 296 ? -2.598  51.744  44.111  1.00   33.73 ? 296  LEU C O   1 
ATOM   7933  C CB  . LEU C 1 296 ? -1.459  49.293  42.030  1.00   33.29 ? 296  LEU C CB  1 
ATOM   7934  C CG  . LEU C 1 296 ? -0.108  49.201  42.737  1.00   36.27 ? 296  LEU C CG  1 
ATOM   7935  C CD1 . LEU C 1 296 ? 0.905   49.933  41.902  1.00   28.77 ? 296  LEU C CD1 1 
ATOM   7936  C CD2 . LEU C 1 296 ? -0.165  49.749  44.157  1.00   34.95 ? 296  LEU C CD2 1 
ATOM   7937  N N   . LEU C 1 297 ? -2.875  51.899  41.892  1.00   33.48 ? 297  LEU C N   1 
ATOM   7938  C CA  . LEU C 1 297 ? -2.940  53.345  41.889  1.00   34.75 ? 297  LEU C CA  1 
ATOM   7939  C C   . LEU C 1 297 ? -3.916  53.825  42.960  1.00   35.46 ? 297  LEU C C   1 
ATOM   7940  O O   . LEU C 1 297 ? -3.603  54.748  43.718  1.00   33.72 ? 297  LEU C O   1 
ATOM   7941  C CB  . LEU C 1 297 ? -3.362  53.842  40.504  1.00   30.39 ? 297  LEU C CB  1 
ATOM   7942  C CG  . LEU C 1 297 ? -2.211  54.352  39.615  1.00   35.24 ? 297  LEU C CG  1 
ATOM   7943  C CD1 . LEU C 1 297 ? -0.879  53.708  39.998  1.00   34.14 ? 297  LEU C CD1 1 
ATOM   7944  C CD2 . LEU C 1 297 ? -2.530  54.086  38.154  1.00   30.77 ? 297  LEU C CD2 1 
ATOM   7945  N N   . GLU C 1 298 ? -5.087  53.187  43.014  1.00   33.28 ? 298  GLU C N   1 
ATOM   7946  C CA  . GLU C 1 298 ? -6.123  53.526  43.976  1.00   33.68 ? 298  GLU C CA  1 
ATOM   7947  C C   . GLU C 1 298 ? -5.602  53.303  45.387  1.00   34.90 ? 298  GLU C C   1 
ATOM   7948  O O   . GLU C 1 298 ? -5.632  54.191  46.239  1.00   33.85 ? 298  GLU C O   1 
ATOM   7949  C CB  . GLU C 1 298 ? -7.358  52.654  43.737  1.00   39.88 ? 298  GLU C CB  1 
ATOM   7950  C CG  . GLU C 1 298 ? -8.426  52.732  44.824  1.00   44.70 ? 298  GLU C CG  1 
ATOM   7951  C CD  . GLU C 1 298 ? -8.887  54.157  45.095  1.00   52.91 ? 298  GLU C CD  1 
ATOM   7952  O OE1 . GLU C 1 298 ? -9.026  54.939  44.132  1.00   56.15 ? 298  GLU C OE1 1 
ATOM   7953  O OE2 . GLU C 1 298 ? -9.125  54.496  46.275  1.00   55.57 ? 298  GLU C OE2 1 
ATOM   7954  N N   . HIS C 1 299 ? -5.105  52.106  45.637  1.00   34.93 ? 299  HIS C N   1 
ATOM   7955  C CA  . HIS C 1 299 ? -4.593  51.806  46.955  1.00   33.22 ? 299  HIS C CA  1 
ATOM   7956  C C   . HIS C 1 299 ? -3.498  52.774  47.412  1.00   33.08 ? 299  HIS C C   1 
ATOM   7957  O O   . HIS C 1 299 ? -3.437  53.134  48.591  1.00   31.21 ? 299  HIS C O   1 
ATOM   7958  C CB  . HIS C 1 299 ? -4.053  50.384  46.996  1.00   31.87 ? 299  HIS C CB  1 
ATOM   7959  C CG  . HIS C 1 299 ? -3.437  50.028  48.310  1.00   36.15 ? 299  HIS C CG  1 
ATOM   7960  N ND1 . HIS C 1 299 ? -2.125  49.628  48.429  1.00   39.49 ? 299  HIS C ND1 1 
ATOM   7961  C CD2 . HIS C 1 299 ? -3.926  50.098  49.572  1.00   37.80 ? 299  HIS C CD2 1 
ATOM   7962  C CE1 . HIS C 1 299 ? -1.828  49.471  49.708  1.00   40.50 ? 299  HIS C CE1 1 
ATOM   7963  N NE2 . HIS C 1 299 ? -2.905  49.750  50.423  1.00   38.33 ? 299  HIS C NE2 1 
ATOM   7964  N N   . LEU C 1 300 ? -2.635  53.179  46.483  1.00   31.67 ? 300  LEU C N   1 
ATOM   7965  C CA  . LEU C 1 300 ? -1.537  54.078  46.796  1.00   29.95 ? 300  LEU C CA  1 
ATOM   7966  C C   . LEU C 1 300 ? -2.085  55.430  47.161  1.00   32.04 ? 300  LEU C C   1 
ATOM   7967  O O   . LEU C 1 300 ? -1.552  56.096  48.050  1.00   34.49 ? 300  LEU C O   1 
ATOM   7968  C CB  . LEU C 1 300 ? -0.572  54.180  45.614  1.00   25.27 ? 300  LEU C CB  1 
ATOM   7969  C CG  . LEU C 1 300 ? 0.293   52.932  45.451  1.00   25.61 ? 300  LEU C CG  1 
ATOM   7970  C CD1 . LEU C 1 300 ? 1.222   53.063  44.255  1.00   21.15 ? 300  LEU C CD1 1 
ATOM   7971  C CD2 . LEU C 1 300 ? 1.101   52.731  46.737  1.00   25.60 ? 300  LEU C CD2 1 
ATOM   7972  N N   . ARG C 1 301 ? -3.164  55.832  46.492  1.00   33.39 ? 301  ARG C N   1 
ATOM   7973  C CA  . ARG C 1 301 ? -3.784  57.123  46.800  1.00   34.00 ? 301  ARG C CA  1 
ATOM   7974  C C   . ARG C 1 301 ? -4.276  57.123  48.246  1.00   31.58 ? 301  ARG C C   1 
ATOM   7975  O O   . ARG C 1 301 ? -4.104  58.110  48.961  1.00   29.88 ? 301  ARG C O   1 
ATOM   7976  C CB  . ARG C 1 301 ? -4.946  57.417  45.838  1.00   36.68 ? 301  ARG C CB  1 
ATOM   7977  C CG  . ARG C 1 301 ? -4.509  57.575  44.388  1.00   44.56 ? 301  ARG C CG  1 
ATOM   7978  C CD  . ARG C 1 301 ? -5.665  57.493  43.403  1.00   52.87 ? 301  ARG C CD  1 
ATOM   7979  N NE  . ARG C 1 301 ? -6.529  58.671  43.453  1.00   61.08 ? 301  ARG C NE  1 
ATOM   7980  C CZ  . ARG C 1 301 ? -7.501  58.867  44.344  1.00   63.71 ? 301  ARG C CZ  1 
ATOM   7981  N NH1 . ARG C 1 301 ? -7.755  57.960  45.284  1.00   63.80 ? 301  ARG C NH1 1 
ATOM   7982  N NH2 . ARG C 1 301 ? -8.230  59.978  44.287  1.00   63.35 ? 301  ARG C NH2 1 
ATOM   7983  N N   . THR C 1 302 ? -4.866  56.016  48.690  1.00   30.79 ? 302  THR C N   1 
ATOM   7984  C CA  . THR C 1 302 ? -5.370  55.954  50.068  1.00   33.44 ? 302  THR C CA  1 
ATOM   7985  C C   . THR C 1 302 ? -4.222  56.071  51.088  1.00   35.33 ? 302  THR C C   1 
ATOM   7986  O O   . THR C 1 302 ? -4.453  56.294  52.274  1.00   34.82 ? 302  THR C O   1 
ATOM   7987  C CB  . THR C 1 302 ? -6.206  54.634  50.367  1.00   33.96 ? 302  THR C CB  1 
ATOM   7988  O OG1 . THR C 1 302 ? -5.369  53.473  50.241  1.00   32.25 ? 302  THR C OG1 1 
ATOM   7989  C CG2 . THR C 1 302 ? -7.406  54.514  49.417  1.00   22.63 ? 302  THR C CG2 1 
ATOM   7990  N N   . LYS C 1 303 ? -2.985  55.912  50.631  1.00   35.07 ? 303  LYS C N   1 
ATOM   7991  C CA  . LYS C 1 303 ? -1.855  56.043  51.530  1.00   34.67 ? 303  LYS C CA  1 
ATOM   7992  C C   . LYS C 1 303 ? -1.123  57.341  51.229  1.00   33.17 ? 303  LYS C C   1 
ATOM   7993  O O   . LYS C 1 303 ? -0.068  57.622  51.810  1.00   30.04 ? 303  LYS C O   1 
ATOM   7994  C CB  . LYS C 1 303 ? -0.909  54.844  51.407  1.00   35.58 ? 303  LYS C CB  1 
ATOM   7995  C CG  . LYS C 1 303 ? -1.451  53.600  52.088  1.00   41.34 ? 303  LYS C CG  1 
ATOM   7996  C CD  . LYS C 1 303 ? -0.340  52.609  52.434  1.00   49.74 ? 303  LYS C CD  1 
ATOM   7997  C CE  . LYS C 1 303 ? -0.895  51.307  53.060  1.00   54.40 ? 303  LYS C CE  1 
ATOM   7998  N NZ  . LYS C 1 303 ? -1.544  51.493  54.399  1.00   56.11 ? 303  LYS C NZ  1 
ATOM   7999  N N   . ASN C 1 304 ? -1.704  58.126  50.321  1.00   31.96 ? 304  ASN C N   1 
ATOM   8000  C CA  . ASN C 1 304 ? -1.154  59.418  49.914  1.00   32.09 ? 304  ASN C CA  1 
ATOM   8001  C C   . ASN C 1 304 ? 0.163   59.268  49.179  1.00   32.07 ? 304  ASN C C   1 
ATOM   8002  O O   . ASN C 1 304 ? 1.043   60.122  49.285  1.00   31.16 ? 304  ASN C O   1 
ATOM   8003  C CB  . ASN C 1 304 ? -0.969  60.325  51.137  1.00   30.29 ? 304  ASN C CB  1 
ATOM   8004  C CG  . ASN C 1 304 ? -2.282  60.884  51.636  1.00   31.24 ? 304  ASN C CG  1 
ATOM   8005  O OD1 . ASN C 1 304 ? -2.743  61.914  51.161  1.00   34.33 ? 304  ASN C OD1 1 
ATOM   8006  N ND2 . ASN C 1 304 ? -2.908  60.193  52.583  1.00   33.81 ? 304  ASN C ND2 1 
ATOM   8007  N N   . VAL C 1 305 ? 0.282   58.164  48.446  1.00   31.15 ? 305  VAL C N   1 
ATOM   8008  C CA  . VAL C 1 305 ? 1.473   57.874  47.669  1.00   31.04 ? 305  VAL C CA  1 
ATOM   8009  C C   . VAL C 1 305 ? 1.132   58.187  46.224  1.00   30.25 ? 305  VAL C C   1 
ATOM   8010  O O   . VAL C 1 305 ? 0.054   57.836  45.766  1.00   31.46 ? 305  VAL C O   1 
ATOM   8011  C CB  . VAL C 1 305 ? 1.883   56.386  47.777  1.00   32.58 ? 305  VAL C CB  1 
ATOM   8012  C CG1 . VAL C 1 305 ? 3.196   56.129  47.011  1.00   28.94 ? 305  VAL C CG1 1 
ATOM   8013  C CG2 . VAL C 1 305 ? 2.031   56.010  49.229  1.00   32.94 ? 305  VAL C CG2 1 
ATOM   8014  N N   . ALA C 1 306 ? 2.037   58.868  45.520  1.00   28.73 ? 306  ALA C N   1 
ATOM   8015  C CA  . ALA C 1 306 ? 1.805   59.212  44.130  1.00   25.75 ? 306  ALA C CA  1 
ATOM   8016  C C   . ALA C 1 306 ? 2.959   58.711  43.291  1.00   28.64 ? 306  ALA C C   1 
ATOM   8017  O O   . ALA C 1 306 ? 4.127   58.974  43.617  1.00   27.56 ? 306  ALA C O   1 
ATOM   8018  C CB  . ALA C 1 306 ? 1.657   60.717  43.966  1.00   27.43 ? 306  ALA C CB  1 
ATOM   8019  N N   . VAL C 1 307 ? 2.617   57.998  42.210  1.00   27.47 ? 307  VAL C N   1 
ATOM   8020  C CA  . VAL C 1 307 ? 3.592   57.430  41.284  1.00   27.27 ? 307  VAL C CA  1 
ATOM   8021  C C   . VAL C 1 307 ? 3.130   57.729  39.870  1.00   27.69 ? 307  VAL C C   1 
ATOM   8022  O O   . VAL C 1 307 ? 1.970   58.022  39.673  1.00   32.28 ? 307  VAL C O   1 
ATOM   8023  C CB  . VAL C 1 307 ? 3.745   55.890  41.494  1.00   28.00 ? 307  VAL C CB  1 
ATOM   8024  C CG1 . VAL C 1 307 ? 4.431   55.615  42.841  1.00   22.50 ? 307  VAL C CG1 1 
ATOM   8025  C CG2 . VAL C 1 307 ? 2.390   55.216  41.435  1.00   27.28 ? 307  VAL C CG2 1 
ATOM   8026  N N   . ARG C 1 308 ? 4.026   57.660  38.890  1.00   27.79 ? 308  ARG C N   1 
ATOM   8027  C CA  . ARG C 1 308 ? 3.662   57.992  37.512  1.00   28.85 ? 308  ARG C CA  1 
ATOM   8028  C C   . ARG C 1 308 ? 3.066   56.804  36.768  1.00   30.19 ? 308  ARG C C   1 
ATOM   8029  O O   . ARG C 1 308 ? 3.657   55.723  36.722  1.00   32.57 ? 308  ARG C O   1 
ATOM   8030  C CB  . ARG C 1 308 ? 4.895   58.526  36.765  1.00   29.85 ? 308  ARG C CB  1 
ATOM   8031  C CG  . ARG C 1 308 ? 4.631   59.184  35.409  1.00   33.17 ? 308  ARG C CG  1 
ATOM   8032  C CD  . ARG C 1 308 ? 4.419   60.681  35.493  1.00   33.89 ? 308  ARG C CD  1 
ATOM   8033  N NE  . ARG C 1 308 ? 3.154   61.030  36.128  1.00   45.58 ? 308  ARG C NE  1 
ATOM   8034  C CZ  . ARG C 1 308 ? 2.596   62.237  36.070  1.00   47.30 ? 308  ARG C CZ  1 
ATOM   8035  N NH1 . ARG C 1 308 ? 3.188   63.227  35.406  1.00   48.05 ? 308  ARG C NH1 1 
ATOM   8036  N NH2 . ARG C 1 308 ? 1.429   62.449  36.663  1.00   49.99 ? 308  ARG C NH2 1 
ATOM   8037  N N   . SER C 1 309 ? 1.889   57.008  36.187  1.00   31.27 ? 309  SER C N   1 
ATOM   8038  C CA  . SER C 1 309 ? 1.200   55.956  35.439  1.00   30.48 ? 309  SER C CA  1 
ATOM   8039  C C   . SER C 1 309 ? 1.465   56.079  33.957  1.00   27.87 ? 309  SER C C   1 
ATOM   8040  O O   . SER C 1 309 ? 1.444   57.170  33.406  1.00   26.36 ? 309  SER C O   1 
ATOM   8041  C CB  . SER C 1 309 ? -0.318  56.017  35.670  1.00   33.68 ? 309  SER C CB  1 
ATOM   8042  O OG  . SER C 1 309 ? -0.992  54.985  34.955  1.00   34.04 ? 309  SER C OG  1 
ATOM   8043  N N   . PHE C 1 310 ? 1.725   54.938  33.338  1.00   26.13 ? 310  PHE C N   1 
ATOM   8044  C CA  . PHE C 1 310 ? 1.998   54.814  31.910  1.00   26.99 ? 310  PHE C CA  1 
ATOM   8045  C C   . PHE C 1 310 ? 1.168   53.658  31.369  1.00   28.02 ? 310  PHE C C   1 
ATOM   8046  O O   . PHE C 1 310 ? 0.788   52.743  32.108  1.00   26.49 ? 310  PHE C O   1 
ATOM   8047  C CB  . PHE C 1 310 ? 3.476   54.502  31.660  1.00   25.50 ? 310  PHE C CB  1 
ATOM   8048  C CG  . PHE C 1 310 ? 4.372   55.674  31.840  1.00   26.73 ? 310  PHE C CG  1 
ATOM   8049  C CD1 . PHE C 1 310 ? 4.538   56.593  30.813  1.00   22.87 ? 310  PHE C CD1 1 
ATOM   8050  C CD2 . PHE C 1 310 ? 4.997   55.906  33.062  1.00   22.73 ? 310  PHE C CD2 1 
ATOM   8051  C CE1 . PHE C 1 310 ? 5.307   57.723  31.002  1.00   22.74 ? 310  PHE C CE1 1 
ATOM   8052  C CE2 . PHE C 1 310 ? 5.766   57.034  33.254  1.00   23.97 ? 310  PHE C CE2 1 
ATOM   8053  C CZ  . PHE C 1 310 ? 5.923   57.946  32.228  1.00   23.10 ? 310  PHE C CZ  1 
ATOM   8054  N N   . ARG C 1 311 ? 0.906   53.707  30.075  1.00   30.39 ? 311  ARG C N   1 
ATOM   8055  C CA  . ARG C 1 311 ? 0.122   52.693  29.383  1.00   33.47 ? 311  ARG C CA  1 
ATOM   8056  C C   . ARG C 1 311 ? 0.515   51.269  29.763  1.00   32.36 ? 311  ARG C C   1 
ATOM   8057  O O   . ARG C 1 311 ? -0.343  50.450  30.052  1.00   32.90 ? 311  ARG C O   1 
ATOM   8058  C CB  . ARG C 1 311 ? 0.288   52.892  27.869  1.00   37.66 ? 311  ARG C CB  1 
ATOM   8059  C CG  . ARG C 1 311 ? -0.685  52.153  26.972  1.00   37.99 ? 311  ARG C CG  1 
ATOM   8060  C CD  . ARG C 1 311 ? -0.404  52.562  25.533  1.00   47.50 ? 311  ARG C CD  1 
ATOM   8061  N NE  . ARG C 1 311 ? -1.412  52.123  24.569  1.00   53.39 ? 311  ARG C NE  1 
ATOM   8062  C CZ  . ARG C 1 311 ? -1.545  52.647  23.353  1.00   53.48 ? 311  ARG C CZ  1 
ATOM   8063  N NH1 . ARG C 1 311 ? -0.733  53.626  22.963  1.00   54.01 ? 311  ARG C NH1 1 
ATOM   8064  N NH2 . ARG C 1 311 ? -2.488  52.201  22.530  1.00   52.94 ? 311  ARG C NH2 1 
ATOM   8065  N N   . GLU C 1 312 ? 1.814   50.993  29.804  1.00   36.11 ? 312  GLU C N   1 
ATOM   8066  C CA  . GLU C 1 312 ? 2.294   49.642  30.100  1.00   39.08 ? 312  GLU C CA  1 
ATOM   8067  C C   . GLU C 1 312 ? 2.751   49.329  31.541  1.00   39.16 ? 312  GLU C C   1 
ATOM   8068  O O   . GLU C 1 312 ? 3.264   48.238  31.812  1.00   39.69 ? 312  GLU C O   1 
ATOM   8069  C CB  . GLU C 1 312 ? 3.410   49.291  29.100  1.00   42.55 ? 312  GLU C CB  1 
ATOM   8070  C CG  . GLU C 1 312 ? 2.941   49.249  27.631  1.00   50.63 ? 312  GLU C CG  1 
ATOM   8071  C CD  . GLU C 1 312 ? 4.088   49.320  26.608  1.00   59.22 ? 312  GLU C CD  1 
ATOM   8072  O OE1 . GLU C 1 312 ? 4.707   50.406  26.443  1.00   59.74 ? 312  GLU C OE1 1 
ATOM   8073  O OE2 . GLU C 1 312 ? 4.368   48.283  25.968  1.00   61.18 ? 312  GLU C OE2 1 
ATOM   8074  N N   . GLY C 1 313 ? 2.544   50.261  32.465  1.00   38.04 ? 313  GLY C N   1 
ATOM   8075  C CA  . GLY C 1 313 ? 2.970   50.032  33.838  1.00   37.11 ? 313  GLY C CA  1 
ATOM   8076  C C   . GLY C 1 313 ? 3.169   51.315  34.633  1.00   35.05 ? 313  GLY C C   1 
ATOM   8077  O O   . GLY C 1 313 ? 2.826   52.396  34.167  1.00   33.29 ? 313  GLY C O   1 
ATOM   8078  N N   . VAL C 1 314 ? 3.724   51.210  35.834  1.00   32.58 ? 314  VAL C N   1 
ATOM   8079  C CA  . VAL C 1 314 ? 3.940   52.381  36.668  1.00   29.48 ? 314  VAL C CA  1 
ATOM   8080  C C   . VAL C 1 314 ? 5.417   52.667  36.826  1.00   30.10 ? 314  VAL C C   1 
ATOM   8081  O O   . VAL C 1 314 ? 6.237   51.758  36.857  1.00   31.14 ? 314  VAL C O   1 
ATOM   8082  C CB  . VAL C 1 314 ? 3.361   52.177  38.082  1.00   32.13 ? 314  VAL C CB  1 
ATOM   8083  C CG1 . VAL C 1 314 ? 1.844   52.278  38.057  1.00   24.40 ? 314  VAL C CG1 1 
ATOM   8084  C CG2 . VAL C 1 314 ? 3.797   50.794  38.622  1.00   30.28 ? 314  VAL C CG2 1 
ATOM   8085  N N   . ARG C 1 315 ? 5.760   53.942  36.940  1.00   29.92 ? 315  ARG C N   1 
ATOM   8086  C CA  . ARG C 1 315 ? 7.153   54.309  37.121  1.00   26.08 ? 315  ARG C CA  1 
ATOM   8087  C C   . ARG C 1 315 ? 7.246   54.913  38.500  1.00   23.51 ? 315  ARG C C   1 
ATOM   8088  O O   . ARG C 1 315 ? 6.550   55.865  38.825  1.00   21.07 ? 315  ARG C O   1 
ATOM   8089  C CB  . ARG C 1 315 ? 7.609   55.299  36.047  1.00   28.13 ? 315  ARG C CB  1 
ATOM   8090  C CG  . ARG C 1 315 ? 9.121   55.544  36.031  1.00   30.48 ? 315  ARG C CG  1 
ATOM   8091  C CD  . ARG C 1 315 ? 9.407   57.004  36.257  1.00   29.49 ? 315  ARG C CD  1 
ATOM   8092  N NE  . ARG C 1 315 ? 9.189   57.756  35.037  1.00   33.73 ? 315  ARG C NE  1 
ATOM   8093  C CZ  . ARG C 1 315 ? 8.668   58.977  34.965  1.00   29.66 ? 315  ARG C CZ  1 
ATOM   8094  N NH1 . ARG C 1 315 ? 8.282   59.627  36.046  1.00   23.89 ? 315  ARG C NH1 1 
ATOM   8095  N NH2 . ARG C 1 315 ? 8.562   59.549  33.782  1.00   30.22 ? 315  ARG C NH2 1 
ATOM   8096  N N   . ILE C 1 316 ? 8.101   54.326  39.326  1.00   22.69 ? 316  ILE C N   1 
ATOM   8097  C CA  . ILE C 1 316 ? 8.266   54.778  40.694  1.00   19.58 ? 316  ILE C CA  1 
ATOM   8098  C C   . ILE C 1 316 ? 9.629   55.415  40.922  1.00   18.76 ? 316  ILE C C   1 
ATOM   8099  O O   . ILE C 1 316 ? 10.662  54.777  40.804  1.00   19.51 ? 316  ILE C O   1 
ATOM   8100  C CB  . ILE C 1 316 ? 8.057   53.602  41.661  1.00   16.43 ? 316  ILE C CB  1 
ATOM   8101  C CG1 . ILE C 1 316 ? 6.740   52.915  41.335  1.00   15.14 ? 316  ILE C CG1 1 
ATOM   8102  C CG2 . ILE C 1 316 ? 7.975   54.092  43.099  1.00   15.92 ? 316  ILE C CG2 1 
ATOM   8103  C CD1 . ILE C 1 316 ? 6.585   51.587  42.014  1.00   7.13  ? 316  ILE C CD1 1 
ATOM   8104  N N   . THR C 1 317 ? 9.619   56.696  41.242  1.00   21.55 ? 317  THR C N   1 
ATOM   8105  C CA  . THR C 1 317 ? 10.864  57.407  41.500  1.00   22.98 ? 317  THR C CA  1 
ATOM   8106  C C   . THR C 1 317 ? 11.443  56.960  42.830  1.00   22.41 ? 317  THR C C   1 
ATOM   8107  O O   . THR C 1 317 ? 10.695  56.720  43.768  1.00   23.47 ? 317  THR C O   1 
ATOM   8108  C CB  . THR C 1 317 ? 10.628  58.916  41.561  1.00   18.94 ? 317  THR C CB  1 
ATOM   8109  O OG1 . THR C 1 317 ? 10.170  59.375  40.278  1.00   18.93 ? 317  THR C OG1 1 
ATOM   8110  C CG2 . THR C 1 317 ? 11.916  59.630  41.926  1.00   22.89 ? 317  THR C CG2 1 
ATOM   8111  N N   . ILE C 1 318 ? 12.765  56.841  42.906  1.00   22.61 ? 318  ILE C N   1 
ATOM   8112  C CA  . ILE C 1 318 ? 13.423  56.458  44.151  1.00   25.57 ? 318  ILE C CA  1 
ATOM   8113  C C   . ILE C 1 318 ? 13.396  57.631  45.155  1.00   25.84 ? 318  ILE C C   1 
ATOM   8114  O O   . ILE C 1 318 ? 13.829  58.749  44.854  1.00   22.45 ? 318  ILE C O   1 
ATOM   8115  C CB  . ILE C 1 318 ? 14.918  56.038  43.911  1.00   28.76 ? 318  ILE C CB  1 
ATOM   8116  C CG1 . ILE C 1 318 ? 14.995  54.794  43.000  1.00   30.31 ? 318  ILE C CG1 1 
ATOM   8117  C CG2 . ILE C 1 318 ? 15.597  55.794  45.240  1.00   27.26 ? 318  ILE C CG2 1 
ATOM   8118  C CD1 . ILE C 1 318 ? 14.122  53.583  43.464  1.00   24.47 ? 318  ILE C CD1 1 
ATOM   8119  N N   . GLY C 1 319 ? 12.866  57.371  46.343  1.00   24.88 ? 319  GLY C N   1 
ATOM   8120  C CA  . GLY C 1 319 ? 12.828  58.399  47.364  1.00   22.03 ? 319  GLY C CA  1 
ATOM   8121  C C   . GLY C 1 319 ? 13.731  58.099  48.543  1.00   21.88 ? 319  GLY C C   1 
ATOM   8122  O O   . GLY C 1 319 ? 14.761  57.428  48.414  1.00   19.16 ? 319  GLY C O   1 
ATOM   8123  N N   . LYS C 1 320 ? 13.343  58.626  49.699  1.00   24.61 ? 320  LYS C N   1 
ATOM   8124  C CA  . LYS C 1 320 ? 14.100  58.397  50.931  1.00   27.26 ? 320  LYS C CA  1 
ATOM   8125  C C   . LYS C 1 320 ? 13.958  56.928  51.341  1.00   30.86 ? 320  LYS C C   1 
ATOM   8126  O O   . LYS C 1 320 ? 13.051  56.220  50.869  1.00   31.72 ? 320  LYS C O   1 
ATOM   8127  C CB  . LYS C 1 320 ? 13.557  59.261  52.067  1.00   27.26 ? 320  LYS C CB  1 
ATOM   8128  C CG  . LYS C 1 320 ? 13.720  60.759  51.870  1.00   34.06 ? 320  LYS C CG  1 
ATOM   8129  C CD  . LYS C 1 320 ? 12.984  61.480  52.968  1.00   37.08 ? 320  LYS C CD  1 
ATOM   8130  C CE  . LYS C 1 320 ? 12.923  62.966  52.725  1.00   41.26 ? 320  LYS C CE  1 
ATOM   8131  N NZ  . LYS C 1 320 ? 11.917  63.583  53.643  1.00   42.81 ? 320  LYS C NZ  1 
ATOM   8132  N N   . ARG C 1 321 ? 14.833  56.492  52.241  1.00   31.72 ? 321  ARG C N   1 
ATOM   8133  C CA  . ARG C 1 321 ? 14.846  55.120  52.718  1.00   33.23 ? 321  ARG C CA  1 
ATOM   8134  C C   . ARG C 1 321 ? 13.496  54.581  53.184  1.00   31.71 ? 321  ARG C C   1 
ATOM   8135  O O   . ARG C 1 321 ? 13.077  53.508  52.747  1.00   30.83 ? 321  ARG C O   1 
ATOM   8136  C CB  . ARG C 1 321 ? 15.885  54.971  53.839  1.00   36.27 ? 321  ARG C CB  1 
ATOM   8137  C CG  . ARG C 1 321 ? 16.169  53.521  54.228  1.00   40.08 ? 321  ARG C CG  1 
ATOM   8138  C CD  . ARG C 1 321 ? 17.660  53.301  54.503  1.00   51.29 ? 321  ARG C CD  1 
ATOM   8139  N NE  . ARG C 1 321 ? 18.244  54.327  55.377  1.00   57.02 ? 321  ARG C NE  1 
ATOM   8140  C CZ  . ARG C 1 321 ? 19.493  54.291  55.841  1.00   60.16 ? 321  ARG C CZ  1 
ATOM   8141  N NH1 . ARG C 1 321 ? 19.955  55.260  56.630  1.00   58.68 ? 321  ARG C NH1 1 
ATOM   8142  N NH2 . ARG C 1 321 ? 20.282  53.272  55.516  1.00   59.13 ? 321  ARG C NH2 1 
ATOM   8143  N N   . GLU C 1 322 ? 12.819  55.308  54.069  1.00   30.96 ? 322  GLU C N   1 
ATOM   8144  C CA  . GLU C 1 322 ? 11.521  54.851  54.564  1.00   30.34 ? 322  GLU C CA  1 
ATOM   8145  C C   . GLU C 1 322 ? 10.508  54.811  53.427  1.00   29.44 ? 322  GLU C C   1 
ATOM   8146  O O   . GLU C 1 322 ? 9.648   53.929  53.372  1.00   30.54 ? 322  GLU C O   1 
ATOM   8147  C CB  . GLU C 1 322 ? 10.998  55.752  55.695  1.00   34.55 ? 322  GLU C CB  1 
ATOM   8148  C CG  . GLU C 1 322 ? 10.838  57.217  55.344  1.00   41.39 ? 322  GLU C CG  1 
ATOM   8149  C CD  . GLU C 1 322 ? 12.162  57.992  55.368  1.00   48.14 ? 322  GLU C CD  1 
ATOM   8150  O OE1 . GLU C 1 322 ? 13.216  57.387  55.684  1.00   45.54 ? 322  GLU C OE1 1 
ATOM   8151  O OE2 . GLU C 1 322 ? 12.133  59.218  55.072  1.00   48.58 ? 322  GLU C OE2 1 
ATOM   8152  N N   . GLU C 1 323 ? 10.620  55.765  52.515  1.00   26.23 ? 323  GLU C N   1 
ATOM   8153  C CA  . GLU C 1 323 ? 9.708   55.805  51.386  1.00   27.29 ? 323  GLU C CA  1 
ATOM   8154  C C   . GLU C 1 323 ? 9.886   54.555  50.526  1.00   24.41 ? 323  GLU C C   1 
ATOM   8155  O O   . GLU C 1 323 ? 8.914   53.915  50.150  1.00   22.32 ? 323  GLU C O   1 
ATOM   8156  C CB  . GLU C 1 323 ? 9.943   57.066  50.546  1.00   24.61 ? 323  GLU C CB  1 
ATOM   8157  C CG  . GLU C 1 323 ? 9.823   58.356  51.337  1.00   29.34 ? 323  GLU C CG  1 
ATOM   8158  C CD  . GLU C 1 323 ? 9.794   59.590  50.444  1.00   33.11 ? 323  GLU C CD  1 
ATOM   8159  O OE1 . GLU C 1 323 ? 10.811  59.889  49.756  1.00   32.65 ? 323  GLU C OE1 1 
ATOM   8160  O OE2 . GLU C 1 323 ? 8.737   60.255  50.443  1.00   26.07 ? 323  GLU C OE2 1 
ATOM   8161  N N   . ASN C 1 324 ? 11.126  54.205  50.216  1.00   22.46 ? 324  ASN C N   1 
ATOM   8162  C CA  . ASN C 1 324 ? 11.355  53.029  49.405  1.00   24.98 ? 324  ASN C CA  1 
ATOM   8163  C C   . ASN C 1 324 ? 10.866  51.787  50.139  1.00   27.23 ? 324  ASN C C   1 
ATOM   8164  O O   . ASN C 1 324 ? 10.356  50.859  49.514  1.00   27.01 ? 324  ASN C O   1 
ATOM   8165  C CB  . ASN C 1 324 ? 12.838  52.902  49.056  1.00   22.40 ? 324  ASN C CB  1 
ATOM   8166  C CG  . ASN C 1 324 ? 13.391  54.161  48.417  1.00   23.11 ? 324  ASN C CG  1 
ATOM   8167  O OD1 . ASN C 1 324 ? 12.753  54.766  47.556  1.00   24.76 ? 324  ASN C OD1 1 
ATOM   8168  N ND2 . ASN C 1 324 ? 14.582  54.561  48.832  1.00   17.64 ? 324  ASN C ND2 1 
ATOM   8169  N N   . ASP C 1 325 ? 11.020  51.781  51.465  1.00   30.05 ? 325  ASP C N   1 
ATOM   8170  C CA  . ASP C 1 325 ? 10.600  50.649  52.296  1.00   31.58 ? 325  ASP C CA  1 
ATOM   8171  C C   . ASP C 1 325 ? 9.087   50.524  52.263  1.00   30.39 ? 325  ASP C C   1 
ATOM   8172  O O   . ASP C 1 325 ? 8.553   49.431  52.133  1.00   31.10 ? 325  ASP C O   1 
ATOM   8173  C CB  . ASP C 1 325 ? 11.095  50.819  53.738  1.00   34.27 ? 325  ASP C CB  1 
ATOM   8174  C CG  . ASP C 1 325 ? 12.589  50.565  53.872  1.00   37.45 ? 325  ASP C CG  1 
ATOM   8175  O OD1 . ASP C 1 325 ? 13.300  50.557  52.849  1.00   41.31 ? 325  ASP C OD1 1 
ATOM   8176  O OD2 . ASP C 1 325 ? 13.062  50.383  55.008  1.00   44.16 ? 325  ASP C OD2 1 
ATOM   8177  N N   . MET C 1 326 ? 8.407   51.658  52.363  1.00   30.41 ? 326  MET C N   1 
ATOM   8178  C CA  . MET C 1 326 ? 6.947   51.696  52.300  1.00   27.54 ? 326  MET C CA  1 
ATOM   8179  C C   . MET C 1 326 ? 6.488   51.052  50.988  1.00   26.25 ? 326  MET C C   1 
ATOM   8180  O O   . MET C 1 326 ? 5.645   50.156  50.997  1.00   25.80 ? 326  MET C O   1 
ATOM   8181  C CB  . MET C 1 326 ? 6.473   53.152  52.398  1.00   27.91 ? 326  MET C CB  1 
ATOM   8182  C CG  . MET C 1 326 ? 5.004   53.430  52.070  1.00   29.52 ? 326  MET C CG  1 
ATOM   8183  S SD  . MET C 1 326 ? 4.610   53.339  50.303  1.00   41.68 ? 326  MET C SD  1 
ATOM   8184  C CE  . MET C 1 326 ? 5.350   54.870  49.693  1.00   41.60 ? 326  MET C CE  1 
ATOM   8185  N N   . ILE C 1 327 ? 7.061   51.495  49.866  1.00   26.43 ? 327  ILE C N   1 
ATOM   8186  C CA  . ILE C 1 327 ? 6.699   50.962  48.555  1.00   28.47 ? 327  ILE C CA  1 
ATOM   8187  C C   . ILE C 1 327 ? 6.736   49.426  48.500  1.00   31.62 ? 327  ILE C C   1 
ATOM   8188  O O   . ILE C 1 327 ? 5.721   48.785  48.198  1.00   31.58 ? 327  ILE C O   1 
ATOM   8189  C CB  . ILE C 1 327 ? 7.635   51.537  47.457  1.00   29.04 ? 327  ILE C CB  1 
ATOM   8190  C CG1 . ILE C 1 327 ? 7.289   53.012  47.203  1.00   27.28 ? 327  ILE C CG1 1 
ATOM   8191  C CG2 . ILE C 1 327 ? 7.523   50.722  46.165  1.00   25.63 ? 327  ILE C CG2 1 
ATOM   8192  C CD1 . ILE C 1 327 ? 5.877   53.240  46.664  1.00   26.03 ? 327  ILE C CD1 1 
ATOM   8193  N N   . LEU C 1 328 ? 7.896   48.838  48.796  1.00   32.47 ? 328  LEU C N   1 
ATOM   8194  C CA  . LEU C 1 328 ? 8.046   47.388  48.750  1.00   34.61 ? 328  LEU C CA  1 
ATOM   8195  C C   . LEU C 1 328 ? 7.012   46.703  49.640  1.00   36.52 ? 328  LEU C C   1 
ATOM   8196  O O   . LEU C 1 328 ? 6.407   45.696  49.246  1.00   37.10 ? 328  LEU C O   1 
ATOM   8197  C CB  . LEU C 1 328 ? 9.454   46.987  49.176  1.00   33.79 ? 328  LEU C CB  1 
ATOM   8198  C CG  . LEU C 1 328 ? 10.578  47.594  48.346  1.00   34.57 ? 328  LEU C CG  1 
ATOM   8199  C CD1 . LEU C 1 328 ? 11.931  47.227  48.944  1.00   34.78 ? 328  LEU C CD1 1 
ATOM   8200  C CD2 . LEU C 1 328 ? 10.461  47.103  46.929  1.00   35.68 ? 328  LEU C CD2 1 
ATOM   8201  N N   . ARG C 1 329 ? 6.807   47.246  50.837  1.00   37.35 ? 329  ARG C N   1 
ATOM   8202  C CA  . ARG C 1 329 ? 5.817   46.680  51.741  1.00   40.28 ? 329  ARG C CA  1 
ATOM   8203  C C   . ARG C 1 329 ? 4.437   46.732  51.087  1.00   40.28 ? 329  ARG C C   1 
ATOM   8204  O O   . ARG C 1 329 ? 3.665   45.775  51.161  1.00   40.62 ? 329  ARG C O   1 
ATOM   8205  C CB  . ARG C 1 329 ? 5.779   47.448  53.061  1.00   39.30 ? 329  ARG C CB  1 
ATOM   8206  C CG  . ARG C 1 329 ? 7.018   47.308  53.925  1.00   42.62 ? 329  ARG C CG  1 
ATOM   8207  C CD  . ARG C 1 329 ? 6.670   47.685  55.362  1.00   46.27 ? 329  ARG C CD  1 
ATOM   8208  N NE  . ARG C 1 329 ? 5.795   48.855  55.406  1.00   46.81 ? 329  ARG C NE  1 
ATOM   8209  C CZ  . ARG C 1 329 ? 6.216   50.107  55.274  1.00   45.92 ? 329  ARG C CZ  1 
ATOM   8210  N NH1 . ARG C 1 329 ? 7.513   50.356  55.104  1.00   44.77 ? 329  ARG C NH1 1 
ATOM   8211  N NH2 . ARG C 1 329 ? 5.336   51.103  55.288  1.00   41.51 ? 329  ARG C NH2 1 
ATOM   8212  N N   . GLU C 1 330 ? 4.136   47.845  50.435  1.00   39.04 ? 330  GLU C N   1 
ATOM   8213  C CA  . GLU C 1 330 ? 2.855   47.997  49.778  1.00   41.54 ? 330  GLU C CA  1 
ATOM   8214  C C   . GLU C 1 330 ? 2.754   47.085  48.578  1.00   41.56 ? 330  GLU C C   1 
ATOM   8215  O O   . GLU C 1 330 ? 1.703   46.503  48.320  1.00   42.24 ? 330  GLU C O   1 
ATOM   8216  C CB  . GLU C 1 330 ? 2.635   49.452  49.350  1.00   42.55 ? 330  GLU C CB  1 
ATOM   8217  C CG  . GLU C 1 330 ? 2.634   50.407  50.530  1.00   46.23 ? 330  GLU C CG  1 
ATOM   8218  C CD  . GLU C 1 330 ? 1.730   49.928  51.645  1.00   50.83 ? 330  GLU C CD  1 
ATOM   8219  O OE1 . GLU C 1 330 ? 2.120   50.071  52.825  1.00   53.94 ? 330  GLU C OE1 1 
ATOM   8220  O OE2 . GLU C 1 330 ? 0.628   49.413  51.334  1.00   51.00 ? 330  GLU C OE2 1 
ATOM   8221  N N   . LEU C 1 331 ? 3.845   46.958  47.835  1.00   41.58 ? 331  LEU C N   1 
ATOM   8222  C CA  . LEU C 1 331 ? 3.814   46.082  46.669  1.00   41.81 ? 331  LEU C CA  1 
ATOM   8223  C C   . LEU C 1 331 ? 3.846   44.604  47.045  1.00   41.47 ? 331  LEU C C   1 
ATOM   8224  O O   . LEU C 1 331 ? 3.405   43.755  46.273  1.00   39.37 ? 331  LEU C O   1 
ATOM   8225  C CB  . LEU C 1 331 ? 4.957   46.413  45.712  1.00   37.39 ? 331  LEU C CB  1 
ATOM   8226  C CG  . LEU C 1 331 ? 4.547   47.414  44.631  1.00   39.01 ? 331  LEU C CG  1 
ATOM   8227  C CD1 . LEU C 1 331 ? 3.748   48.550  45.244  1.00   38.22 ? 331  LEU C CD1 1 
ATOM   8228  C CD2 . LEU C 1 331 ? 5.792   47.955  43.940  1.00   37.89 ? 331  LEU C CD2 1 
ATOM   8229  N N   . GLU C 1 332 ? 4.343   44.297  48.238  1.00   42.60 ? 332  GLU C N   1 
ATOM   8230  C CA  . GLU C 1 332 ? 4.420   42.909  48.667  1.00   45.82 ? 332  GLU C CA  1 
ATOM   8231  C C   . GLU C 1 332 ? 3.065   42.341  49.057  1.00   47.31 ? 332  GLU C C   1 
ATOM   8232  O O   . GLU C 1 332 ? 2.911   41.125  49.152  1.00   46.68 ? 332  GLU C O   1 
ATOM   8233  C CB  . GLU C 1 332 ? 5.369   42.751  49.848  1.00   47.08 ? 332  GLU C CB  1 
ATOM   8234  C CG  . GLU C 1 332 ? 5.784   41.307  50.051  1.00   51.62 ? 332  GLU C CG  1 
ATOM   8235  C CD  . GLU C 1 332 ? 5.965   40.944  51.502  1.00   53.88 ? 332  GLU C CD  1 
ATOM   8236  O OE1 . GLU C 1 332 ? 6.712   41.652  52.206  1.00   55.86 ? 332  GLU C OE1 1 
ATOM   8237  O OE2 . GLU C 1 332 ? 5.361   39.941  51.937  1.00   56.78 ? 332  GLU C OE2 1 
ATOM   8238  N N   . VAL C 1 333 ? 2.092   43.221  49.281  1.00   49.61 ? 333  VAL C N   1 
ATOM   8239  C CA  . VAL C 1 333 ? 0.754   42.803  49.672  1.00   52.01 ? 333  VAL C CA  1 
ATOM   8240  C C   . VAL C 1 333 ? -0.275  42.948  48.562  1.00   55.28 ? 333  VAL C C   1 
ATOM   8241  O O   . VAL C 1 333 ? -1.465  42.704  48.784  1.00   55.63 ? 333  VAL C O   1 
ATOM   8242  C CB  . VAL C 1 333 ? 0.260   43.589  50.912  1.00   51.93 ? 333  VAL C CB  1 
ATOM   8243  C CG1 . VAL C 1 333 ? 0.674   42.859  52.174  1.00   50.73 ? 333  VAL C CG1 1 
ATOM   8244  C CG2 . VAL C 1 333 ? 0.850   44.996  50.918  1.00   49.61 ? 333  VAL C CG2 1 
ATOM   8245  N N   . PHE C 1 334 ? 0.176   43.346  47.373  1.00   56.98 ? 334  PHE C N   1 
ATOM   8246  C CA  . PHE C 1 334 ? -0.727  43.500  46.234  1.00   59.32 ? 334  PHE C CA  1 
ATOM   8247  C C   . PHE C 1 334 ? -0.564  42.306  45.304  1.00   61.30 ? 334  PHE C C   1 
ATOM   8248  O O   . PHE C 1 334 ? -1.545  41.719  44.838  1.00   61.94 ? 334  PHE C O   1 
ATOM   8249  C CB  . PHE C 1 334 ? -0.403  44.772  45.469  1.00   58.43 ? 334  PHE C CB  1 
ATOM   8250  C CG  . PHE C 1 334 ? -1.602  45.419  44.866  1.00   56.87 ? 334  PHE C CG  1 
ATOM   8251  C CD1 . PHE C 1 334 ? -2.461  46.178  45.654  1.00   56.18 ? 334  PHE C CD1 1 
ATOM   8252  C CD2 . PHE C 1 334 ? -1.895  45.249  43.516  1.00   56.92 ? 334  PHE C CD2 1 
ATOM   8253  C CE1 . PHE C 1 334 ? -3.601  46.763  45.106  1.00   57.22 ? 334  PHE C CE1 1 
ATOM   8254  C CE2 . PHE C 1 334 ? -3.032  45.827  42.953  1.00   54.94 ? 334  PHE C CE2 1 
ATOM   8255  C CZ  . PHE C 1 334 ? -3.889  46.588  43.751  1.00   57.23 ? 334  PHE C CZ  1 
ATOM   8256  N N   . LYS C 1 335 ? 0.703   41.979  45.043  1.00   64.05 ? 335  LYS C N   1 
ATOM   8257  C CA  . LYS C 1 335 ? 1.134   40.855  44.203  1.00   64.85 ? 335  LYS C CA  1 
ATOM   8258  C C   . LYS C 1 335 ? 2.323   40.226  44.941  1.00   65.23 ? 335  LYS C C   1 
ATOM   8259  O O   . LYS C 1 335 ? 2.760   40.837  45.941  1.00   64.41 ? 335  LYS C O   1 
ATOM   8260  C CB  . LYS C 1 335 ? 1.571   41.350  42.805  1.00   63.35 ? 335  LYS C CB  1 
ATOM   8261  C CG  . LYS C 1 335 ? 2.525   40.417  42.028  1.00   61.76 ? 335  LYS C CG  1 
ATOM   8262  C CD  . LYS C 1 335 ? 1.830   39.176  41.478  1.00   63.85 ? 335  LYS C CD  1 
ATOM   8263  C CE  . LYS C 1 335 ? 1.195   39.432  40.111  1.00   64.95 ? 335  LYS C CE  1 
ATOM   8264  N NZ  . LYS C 1 335 ? 2.197   39.850  39.075  1.00   62.85 ? 335  LYS C NZ  1 
ATOM   8265  O OXT . LYS C 1 335 ? 2.802   39.150  44.524  1.00   67.48 ? 335  LYS C OXT 1 
ATOM   8266  N N   . MET D 1 1   ? 25.601  66.011  7.146   1.00   74.39 ? 1    MET D N   1 
ATOM   8267  C CA  . MET D 1 1   ? 25.222  66.544  8.489   1.00   73.84 ? 1    MET D CA  1 
ATOM   8268  C C   . MET D 1 1   ? 24.673  67.964  8.387   1.00   74.15 ? 1    MET D C   1 
ATOM   8269  O O   . MET D 1 1   ? 23.539  68.227  8.773   1.00   75.05 ? 1    MET D O   1 
ATOM   8270  C CB  . MET D 1 1   ? 26.446  66.529  9.422   1.00   74.14 ? 1    MET D CB  1 
ATOM   8271  C CG  . MET D 1 1   ? 26.152  66.747  10.930  1.00   72.63 ? 1    MET D CG  1 
ATOM   8272  S SD  . MET D 1 1   ? 25.877  68.460  11.486  1.00   65.95 ? 1    MET D SD  1 
ATOM   8273  C CE  . MET D 1 1   ? 27.392  68.798  12.396  1.00   63.08 ? 1    MET D CE  1 
ATOM   8274  N N   . ASN D 1 2   ? 25.491  68.866  7.856   1.00   74.62 ? 2    ASN D N   1 
ATOM   8275  C CA  . ASN D 1 2   ? 25.157  70.284  7.697   1.00   75.31 ? 2    ASN D CA  1 
ATOM   8276  C C   . ASN D 1 2   ? 23.682  70.724  7.692   1.00   74.93 ? 2    ASN D C   1 
ATOM   8277  O O   . ASN D 1 2   ? 23.182  71.137  8.734   1.00   74.91 ? 2    ASN D O   1 
ATOM   8278  C CB  . ASN D 1 2   ? 25.877  70.826  6.460   1.00   78.50 ? 2    ASN D CB  1 
ATOM   8279  C CG  . ASN D 1 2   ? 26.551  69.728  5.653   1.00   80.79 ? 2    ASN D CG  1 
ATOM   8280  O OD1 . ASN D 1 2   ? 27.396  68.989  6.171   1.00   81.31 ? 2    ASN D OD1 1 
ATOM   8281  N ND2 . ASN D 1 2   ? 26.181  69.613  4.382   1.00   81.46 ? 2    ASN D ND2 1 
ATOM   8282  N N   . PRO D 1 3   ? 22.967  70.619  6.541   1.00   73.85 ? 3    PRO D N   1 
ATOM   8283  C CA  . PRO D 1 3   ? 21.556  71.020  6.423   1.00   72.62 ? 3    PRO D CA  1 
ATOM   8284  C C   . PRO D 1 3   ? 20.897  71.516  7.701   1.00   71.01 ? 3    PRO D C   1 
ATOM   8285  O O   . PRO D 1 3   ? 19.883  70.996  8.166   1.00   70.13 ? 3    PRO D O   1 
ATOM   8286  C CB  . PRO D 1 3   ? 20.911  69.771  5.853   1.00   73.48 ? 3    PRO D CB  1 
ATOM   8287  C CG  . PRO D 1 3   ? 21.911  69.416  4.787   1.00   75.14 ? 3    PRO D CG  1 
ATOM   8288  C CD  . PRO D 1 3   ? 23.278  69.633  5.486   1.00   75.01 ? 3    PRO D CD  1 
ATOM   8289  N N   . LEU D 1 4   ? 21.516  72.563  8.227   1.00   69.97 ? 4    LEU D N   1 
ATOM   8290  C CA  . LEU D 1 4   ? 21.154  73.257  9.448   1.00   69.17 ? 4    LEU D CA  1 
ATOM   8291  C C   . LEU D 1 4   ? 22.360  74.169  9.482   1.00   66.38 ? 4    LEU D C   1 
ATOM   8292  O O   . LEU D 1 4   ? 22.627  74.904  10.425  1.00   65.12 ? 4    LEU D O   1 
ATOM   8293  C CB  . LEU D 1 4   ? 21.161  72.305  10.640  1.00   72.36 ? 4    LEU D CB  1 
ATOM   8294  C CG  . LEU D 1 4   ? 20.185  72.738  11.738  1.00   77.42 ? 4    LEU D CG  1 
ATOM   8295  C CD1 . LEU D 1 4   ? 20.754  73.875  12.576  1.00   78.18 ? 4    LEU D CD1 1 
ATOM   8296  C CD2 . LEU D 1 4   ? 18.885  73.155  11.073  1.00   79.72 ? 4    LEU D CD2 1 
ATOM   8297  N N   . ASP D 1 5   ? 23.093  74.053  8.385   1.00   64.24 ? 5    ASP D N   1 
ATOM   8298  C CA  . ASP D 1 5   ? 24.275  74.824  8.087   1.00   60.98 ? 5    ASP D CA  1 
ATOM   8299  C C   . ASP D 1 5   ? 23.627  76.082  7.518   1.00   58.87 ? 5    ASP D C   1 
ATOM   8300  O O   . ASP D 1 5   ? 24.192  77.169  7.527   1.00   54.83 ? 5    ASP D O   1 
ATOM   8301  C CB  . ASP D 1 5   ? 25.056  74.087  7.005   1.00   62.81 ? 5    ASP D CB  1 
ATOM   8302  C CG  . ASP D 1 5   ? 26.497  74.485  6.953   1.00   64.29 ? 5    ASP D CG  1 
ATOM   8303  O OD1 . ASP D 1 5   ? 26.756  75.692  6.779   1.00   66.72 ? 5    ASP D OD1 1 
ATOM   8304  O OD2 . ASP D 1 5   ? 27.365  73.590  7.083   1.00   65.17 ? 5    ASP D OD2 1 
ATOM   8305  N N   . LEU D 1 6   ? 22.414  75.875  7.014   1.00   58.40 ? 6    LEU D N   1 
ATOM   8306  C CA  . LEU D 1 6   ? 21.585  76.913  6.434   1.00   59.56 ? 6    LEU D CA  1 
ATOM   8307  C C   . LEU D 1 6   ? 21.397  77.945  7.534   1.00   59.68 ? 6    LEU D C   1 
ATOM   8308  O O   . LEU D 1 6   ? 21.372  79.147  7.279   1.00   60.52 ? 6    LEU D O   1 
ATOM   8309  C CB  . LEU D 1 6   ? 20.238  76.315  6.034   1.00   61.03 ? 6    LEU D CB  1 
ATOM   8310  C CG  . LEU D 1 6   ? 20.295  74.904  5.429   1.00   62.24 ? 6    LEU D CG  1 
ATOM   8311  C CD1 . LEU D 1 6   ? 18.876  74.403  5.156   1.00   62.78 ? 6    LEU D CD1 1 
ATOM   8312  C CD2 . LEU D 1 6   ? 21.122  74.916  4.151   1.00   62.00 ? 6    LEU D CD2 1 
ATOM   8313  N N   . ILE D 1 7   ? 21.239  77.456  8.762   1.00   58.44 ? 7    ILE D N   1 
ATOM   8314  C CA  . ILE D 1 7   ? 21.110  78.321  9.930   1.00   55.42 ? 7    ILE D CA  1 
ATOM   8315  C C   . ILE D 1 7   ? 22.523  78.860  10.090  1.00   53.98 ? 7    ILE D C   1 
ATOM   8316  O O   . ILE D 1 7   ? 23.452  78.327  9.499   1.00   55.85 ? 7    ILE D O   1 
ATOM   8317  C CB  . ILE D 1 7   ? 20.690  77.505  11.173  1.00   52.31 ? 7    ILE D CB  1 
ATOM   8318  C CG1 . ILE D 1 7   ? 19.249  77.028  10.997  1.00   50.26 ? 7    ILE D CG1 1 
ATOM   8319  C CG2 . ILE D 1 7   ? 20.831  78.332  12.436  1.00   52.66 ? 7    ILE D CG2 1 
ATOM   8320  C CD1 . ILE D 1 7   ? 18.697  76.275  12.171  1.00   43.78 ? 7    ILE D CD1 1 
ATOM   8321  N N   . ALA D 1 8   ? 22.705  79.903  10.877  1.00   53.75 ? 8    ALA D N   1 
ATOM   8322  C CA  . ALA D 1 8   ? 24.039  80.480  11.023  1.00   55.98 ? 8    ALA D CA  1 
ATOM   8323  C C   . ALA D 1 8   ? 24.299  81.192  9.709   1.00   56.64 ? 8    ALA D C   1 
ATOM   8324  O O   . ALA D 1 8   ? 25.203  82.012  9.590   1.00   57.14 ? 8    ALA D O   1 
ATOM   8325  C CB  . ALA D 1 8   ? 25.089  79.393  11.265  1.00   54.32 ? 8    ALA D CB  1 
ATOM   8326  N N   . LYS D 1 9   ? 23.478  80.854  8.722   1.00   58.69 ? 9    LYS D N   1 
ATOM   8327  C CA  . LYS D 1 9   ? 23.543  81.452  7.403   1.00   59.45 ? 9    LYS D CA  1 
ATOM   8328  C C   . LYS D 1 9   ? 22.114  81.821  7.038   1.00   58.24 ? 9    LYS D C   1 
ATOM   8329  O O   . LYS D 1 9   ? 21.698  81.718  5.888   1.00   60.53 ? 9    LYS D O   1 
ATOM   8330  C CB  . LYS D 1 9   ? 24.136  80.465  6.397   1.00   60.43 ? 9    LYS D CB  1 
ATOM   8331  C CG  . LYS D 1 9   ? 25.481  79.934  6.855   1.00   65.68 ? 9    LYS D CG  1 
ATOM   8332  C CD  . LYS D 1 9   ? 26.201  79.120  5.794   1.00   68.82 ? 9    LYS D CD  1 
ATOM   8333  C CE  . LYS D 1 9   ? 26.789  80.003  4.699   1.00   72.62 ? 9    LYS D CE  1 
ATOM   8334  N NZ  . LYS D 1 9   ? 25.744  80.581  3.807   1.00   75.65 ? 9    LYS D NZ  1 
ATOM   8335  N N   . ARG D 1 10  ? 21.363  82.230  8.050   1.00   56.54 ? 10   ARG D N   1 
ATOM   8336  C CA  . ARG D 1 10  ? 19.981  82.640  7.876   1.00   56.81 ? 10   ARG D CA  1 
ATOM   8337  C C   . ARG D 1 10  ? 19.513  83.312  9.165   1.00   55.49 ? 10   ARG D C   1 
ATOM   8338  O O   . ARG D 1 10  ? 18.525  84.042  9.174   1.00   54.65 ? 10   ARG D O   1 
ATOM   8339  C CB  . ARG D 1 10  ? 19.101  81.428  7.523   1.00   59.02 ? 10   ARG D CB  1 
ATOM   8340  C CG  . ARG D 1 10  ? 18.635  80.575  8.688   1.00   62.21 ? 10   ARG D CG  1 
ATOM   8341  C CD  . ARG D 1 10  ? 17.249  80.996  9.128   1.00   64.70 ? 10   ARG D CD  1 
ATOM   8342  N NE  . ARG D 1 10  ? 16.792  80.244  10.292  1.00   67.51 ? 10   ARG D NE  1 
ATOM   8343  C CZ  . ARG D 1 10  ? 16.245  79.034  10.241  1.00   69.85 ? 10   ARG D CZ  1 
ATOM   8344  N NH1 . ARG D 1 10  ? 16.076  78.424  9.078   1.00   71.18 ? 10   ARG D NH1 1 
ATOM   8345  N NH2 . ARG D 1 10  ? 15.864  78.434  11.360  1.00   71.40 ? 10   ARG D NH2 1 
ATOM   8346  N N   . ALA D 1 11  ? 20.243  83.073  10.250  1.00   54.59 ? 11   ALA D N   1 
ATOM   8347  C CA  . ALA D 1 11  ? 19.911  83.661  11.543  1.00   54.25 ? 11   ALA D CA  1 
ATOM   8348  C C   . ALA D 1 11  ? 21.114  84.431  12.083  1.00   53.79 ? 11   ALA D C   1 
ATOM   8349  O O   . ALA D 1 11  ? 22.255  83.972  11.962  1.00   52.70 ? 11   ALA D O   1 
ATOM   8350  C CB  . ALA D 1 11  ? 19.488  82.568  12.534  1.00   53.24 ? 11   ALA D CB  1 
ATOM   8351  N N   . TYR D 1 12  ? 20.857  85.601  12.668  1.00   53.41 ? 12   TYR D N   1 
ATOM   8352  C CA  . TYR D 1 12  ? 21.932  86.426  13.213  1.00   54.25 ? 12   TYR D CA  1 
ATOM   8353  C C   . TYR D 1 12  ? 22.773  85.614  14.186  1.00   54.69 ? 12   TYR D C   1 
ATOM   8354  O O   . TYR D 1 12  ? 22.266  84.749  14.911  1.00   54.48 ? 12   TYR D O   1 
ATOM   8355  C CB  . TYR D 1 12  ? 21.384  87.664  13.937  1.00   52.91 ? 12   TYR D CB  1 
ATOM   8356  C CG  . TYR D 1 12  ? 20.653  88.631  13.039  1.00   55.76 ? 12   TYR D CG  1 
ATOM   8357  C CD1 . TYR D 1 12  ? 19.482  88.254  12.395  1.00   58.98 ? 12   TYR D CD1 1 
ATOM   8358  C CD2 . TYR D 1 12  ? 21.154  89.909  12.801  1.00   59.78 ? 12   TYR D CD2 1 
ATOM   8359  C CE1 . TYR D 1 12  ? 18.827  89.117  11.529  1.00   62.70 ? 12   TYR D CE1 1 
ATOM   8360  C CE2 . TYR D 1 12  ? 20.501  90.790  11.931  1.00   63.92 ? 12   TYR D CE2 1 
ATOM   8361  C CZ  . TYR D 1 12  ? 19.338  90.380  11.295  1.00   64.11 ? 12   TYR D CZ  1 
ATOM   8362  O OH  . TYR D 1 12  ? 18.695  91.209  10.399  1.00   65.68 ? 12   TYR D OH  1 
ATOM   8363  N N   . PRO D 1 13  ? 24.081  85.880  14.209  1.00   54.21 ? 13   PRO D N   1 
ATOM   8364  C CA  . PRO D 1 13  ? 25.004  85.175  15.097  1.00   53.71 ? 13   PRO D CA  1 
ATOM   8365  C C   . PRO D 1 13  ? 24.777  85.486  16.581  1.00   52.92 ? 13   PRO D C   1 
ATOM   8366  O O   . PRO D 1 13  ? 24.108  86.467  16.927  1.00   51.27 ? 13   PRO D O   1 
ATOM   8367  C CB  . PRO D 1 13  ? 26.366  85.641  14.596  1.00   54.13 ? 13   PRO D CB  1 
ATOM   8368  C CG  . PRO D 1 13  ? 26.071  87.025  14.108  1.00   55.49 ? 13   PRO D CG  1 
ATOM   8369  C CD  . PRO D 1 13  ? 24.797  86.836  13.352  1.00   53.83 ? 13   PRO D CD  1 
ATOM   8370  N N   . TYR D 1 14  ? 25.322  84.630  17.448  1.00   51.70 ? 14   TYR D N   1 
ATOM   8371  C CA  . TYR D 1 14  ? 25.211  84.801  18.893  1.00   51.27 ? 14   TYR D CA  1 
ATOM   8372  C C   . TYR D 1 14  ? 26.498  85.402  19.443  1.00   53.30 ? 14   TYR D C   1 
ATOM   8373  O O   . TYR D 1 14  ? 27.606  84.941  19.130  1.00   53.14 ? 14   TYR D O   1 
ATOM   8374  C CB  . TYR D 1 14  ? 24.961  83.459  19.564  1.00   49.36 ? 14   TYR D CB  1 
ATOM   8375  C CG  . TYR D 1 14  ? 25.070  83.506  21.071  1.00   46.79 ? 14   TYR D CG  1 
ATOM   8376  C CD1 . TYR D 1 14  ? 24.014  83.974  21.862  1.00   42.14 ? 14   TYR D CD1 1 
ATOM   8377  C CD2 . TYR D 1 14  ? 26.233  83.076  21.710  1.00   44.20 ? 14   TYR D CD2 1 
ATOM   8378  C CE1 . TYR D 1 14  ? 24.115  84.005  23.247  1.00   39.35 ? 14   TYR D CE1 1 
ATOM   8379  C CE2 . TYR D 1 14  ? 26.346  83.103  23.094  1.00   43.87 ? 14   TYR D CE2 1 
ATOM   8380  C CZ  . TYR D 1 14  ? 25.289  83.563  23.862  1.00   40.33 ? 14   TYR D CZ  1 
ATOM   8381  O OH  . TYR D 1 14  ? 25.414  83.543  25.240  1.00   38.59 ? 14   TYR D OH  1 
ATOM   8382  N N   . GLU D 1 15  ? 26.351  86.426  20.277  1.00   55.07 ? 15   GLU D N   1 
ATOM   8383  C CA  . GLU D 1 15  ? 27.513  87.096  20.860  1.00   55.73 ? 15   GLU D CA  1 
ATOM   8384  C C   . GLU D 1 15  ? 27.256  87.479  22.309  1.00   56.96 ? 15   GLU D C   1 
ATOM   8385  O O   . GLU D 1 15  ? 26.231  87.119  22.879  1.00   57.04 ? 15   GLU D O   1 
ATOM   8386  C CB  . GLU D 1 15  ? 27.846  88.347  20.051  1.00   54.83 ? 15   GLU D CB  1 
ATOM   8387  C CG  . GLU D 1 15  ? 27.816  88.121  18.541  1.00   51.74 ? 15   GLU D CG  1 
ATOM   8388  C CD  . GLU D 1 15  ? 28.510  89.217  17.769  1.00   50.34 ? 15   GLU D CD  1 
ATOM   8389  O OE1 . GLU D 1 15  ? 28.454  89.176  16.519  1.00   47.03 ? 15   GLU D OE1 1 
ATOM   8390  O OE2 . GLU D 1 15  ? 29.114  90.109  18.414  1.00   46.80 ? 15   GLU D OE2 1 
ATOM   8391  N N   . THR D 1 16  ? 28.199  88.200  22.906  1.00   59.08 ? 16   THR D N   1 
ATOM   8392  C CA  . THR D 1 16  ? 28.062  88.637  24.291  1.00   60.01 ? 16   THR D CA  1 
ATOM   8393  C C   . THR D 1 16  ? 28.365  90.114  24.394  1.00   61.34 ? 16   THR D C   1 
ATOM   8394  O O   . THR D 1 16  ? 29.259  90.621  23.721  1.00   61.01 ? 16   THR D O   1 
ATOM   8395  C CB  . THR D 1 16  ? 29.011  87.878  25.223  1.00   60.32 ? 16   THR D CB  1 
ATOM   8396  O OG1 . THR D 1 16  ? 30.349  87.958  24.712  1.00   60.79 ? 16   THR D OG1 1 
ATOM   8397  C CG2 . THR D 1 16  ? 28.584  86.419  25.339  1.00   61.65 ? 16   THR D CG2 1 
ATOM   8398  N N   . GLU D 1 17  ? 27.612  90.799  25.245  1.00   63.96 ? 17   GLU D N   1 
ATOM   8399  C CA  . GLU D 1 17  ? 27.780  92.232  25.432  1.00   66.87 ? 17   GLU D CA  1 
ATOM   8400  C C   . GLU D 1 17  ? 29.038  92.588  26.209  1.00   67.80 ? 17   GLU D C   1 
ATOM   8401  O O   . GLU D 1 17  ? 29.074  92.461  27.437  1.00   68.89 ? 17   GLU D O   1 
ATOM   8402  C CB  . GLU D 1 17  ? 26.555  92.822  26.143  1.00   67.49 ? 17   GLU D CB  1 
ATOM   8403  C CG  . GLU D 1 17  ? 25.294  92.818  25.297  1.00   69.11 ? 17   GLU D CG  1 
ATOM   8404  C CD  . GLU D 1 17  ? 25.437  93.649  24.027  1.00   70.43 ? 17   GLU D CD  1 
ATOM   8405  O OE1 . GLU D 1 17  ? 24.456  93.731  23.256  1.00   70.61 ? 17   GLU D OE1 1 
ATOM   8406  O OE2 . GLU D 1 17  ? 26.526  94.219  23.796  1.00   68.36 ? 17   GLU D OE2 1 
ATOM   8407  N N   . LYS D 1 18  ? 30.064  93.034  25.488  1.00   67.61 ? 18   LYS D N   1 
ATOM   8408  C CA  . LYS D 1 18  ? 31.321  93.432  26.115  1.00   67.06 ? 18   LYS D CA  1 
ATOM   8409  C C   . LYS D 1 18  ? 31.086  94.790  26.767  1.00   64.57 ? 18   LYS D C   1 
ATOM   8410  O O   . LYS D 1 18  ? 31.207  95.827  26.124  1.00   65.02 ? 18   LYS D O   1 
ATOM   8411  C CB  . LYS D 1 18  ? 32.432  93.528  25.065  1.00   70.23 ? 18   LYS D CB  1 
ATOM   8412  C CG  . LYS D 1 18  ? 32.609  92.255  24.249  1.00   73.94 ? 18   LYS D CG  1 
ATOM   8413  C CD  . LYS D 1 18  ? 33.760  92.376  23.269  1.00   77.57 ? 18   LYS D CD  1 
ATOM   8414  C CE  . LYS D 1 18  ? 35.091  92.585  23.990  1.00   80.31 ? 18   LYS D CE  1 
ATOM   8415  N NZ  . LYS D 1 18  ? 36.254  92.588  23.047  1.00   80.48 ? 18   LYS D NZ  1 
ATOM   8416  N N   . ARG D 1 19  ? 30.738  94.766  28.049  1.00   62.56 ? 19   ARG D N   1 
ATOM   8417  C CA  . ARG D 1 19  ? 30.445  95.975  28.808  1.00   59.67 ? 19   ARG D CA  1 
ATOM   8418  C C   . ARG D 1 19  ? 31.670  96.853  29.069  1.00   58.79 ? 19   ARG D C   1 
ATOM   8419  O O   . ARG D 1 19  ? 32.745  96.355  29.405  1.00   59.81 ? 19   ARG D O   1 
ATOM   8420  C CB  . ARG D 1 19  ? 29.804  95.586  30.135  1.00   57.57 ? 19   ARG D CB  1 
ATOM   8421  C CG  . ARG D 1 19  ? 28.805  94.457  30.010  1.00   51.74 ? 19   ARG D CG  1 
ATOM   8422  C CD  . ARG D 1 19  ? 28.227  94.124  31.363  1.00   49.34 ? 19   ARG D CD  1 
ATOM   8423  N NE  . ARG D 1 19  ? 27.311  95.163  31.805  1.00   48.49 ? 19   ARG D NE  1 
ATOM   8424  C CZ  . ARG D 1 19  ? 26.043  95.251  31.417  1.00   46.59 ? 19   ARG D CZ  1 
ATOM   8425  N NH1 . ARG D 1 19  ? 25.525  94.354  30.584  1.00   42.74 ? 19   ARG D NH1 1 
ATOM   8426  N NH2 . ARG D 1 19  ? 25.298  96.256  31.847  1.00   49.70 ? 19   ARG D NH2 1 
ATOM   8427  N N   . ASP D 1 20  ? 31.491  98.161  28.922  1.00   56.45 ? 20   ASP D N   1 
ATOM   8428  C CA  . ASP D 1 20  ? 32.566  99.120  29.131  1.00   55.28 ? 20   ASP D CA  1 
ATOM   8429  C C   . ASP D 1 20  ? 32.439  99.717  30.527  1.00   53.22 ? 20   ASP D C   1 
ATOM   8430  O O   . ASP D 1 20  ? 31.546  99.332  31.279  1.00   54.59 ? 20   ASP D O   1 
ATOM   8431  C CB  . ASP D 1 20  ? 32.487  100.237 28.089  1.00   57.67 ? 20   ASP D CB  1 
ATOM   8432  C CG  . ASP D 1 20  ? 33.847  100.828 27.767  1.00   61.31 ? 20   ASP D CG  1 
ATOM   8433  O OD1 . ASP D 1 20  ? 34.682  100.939 28.693  1.00   63.24 ? 20   ASP D OD1 1 
ATOM   8434  O OD2 . ASP D 1 20  ? 34.080  101.190 26.593  1.00   62.23 ? 20   ASP D OD2 1 
ATOM   8435  N N   . LYS D 1 21  ? 33.327  100.652 30.867  1.00   49.80 ? 21   LYS D N   1 
ATOM   8436  C CA  . LYS D 1 21  ? 33.307  101.302 32.180  1.00   47.06 ? 21   LYS D CA  1 
ATOM   8437  C C   . LYS D 1 21  ? 31.902  101.788 32.514  1.00   43.16 ? 21   LYS D C   1 
ATOM   8438  O O   . LYS D 1 21  ? 31.344  101.467 33.565  1.00   42.27 ? 21   LYS D O   1 
ATOM   8439  C CB  . LYS D 1 21  ? 34.271  102.503 32.212  1.00   50.79 ? 21   LYS D CB  1 
ATOM   8440  C CG  . LYS D 1 21  ? 35.726  102.190 32.606  1.00   54.21 ? 21   LYS D CG  1 
ATOM   8441  C CD  . LYS D 1 21  ? 36.472  101.304 31.592  1.00   55.32 ? 21   LYS D CD  1 
ATOM   8442  C CE  . LYS D 1 21  ? 37.857  100.903 32.127  1.00   55.67 ? 21   LYS D CE  1 
ATOM   8443  N NZ  . LYS D 1 21  ? 38.726  100.203 31.131  1.00   54.40 ? 21   LYS D NZ  1 
ATOM   8444  N N   . THR D 1 22  ? 31.344  102.579 31.611  1.00   39.46 ? 22   THR D N   1 
ATOM   8445  C CA  . THR D 1 22  ? 30.014  103.115 31.793  1.00   36.72 ? 22   THR D CA  1 
ATOM   8446  C C   . THR D 1 22  ? 29.167  102.557 30.645  1.00   33.86 ? 22   THR D C   1 
ATOM   8447  O O   . THR D 1 22  ? 29.284  102.973 29.489  1.00   31.75 ? 22   THR D O   1 
ATOM   8448  C CB  . THR D 1 22  ? 30.083  104.670 31.851  1.00   37.15 ? 22   THR D CB  1 
ATOM   8449  O OG1 . THR D 1 22  ? 28.853  105.244 31.405  1.00   42.40 ? 22   THR D OG1 1 
ATOM   8450  C CG2 . THR D 1 22  ? 31.233  105.184 31.016  1.00   40.67 ? 22   THR D CG2 1 
ATOM   8451  N N   . TYR D 1 23  ? 28.341  101.572 30.992  1.00   31.29 ? 23   TYR D N   1 
ATOM   8452  C CA  . TYR D 1 23  ? 27.500  100.879 30.031  1.00   27.05 ? 23   TYR D CA  1 
ATOM   8453  C C   . TYR D 1 23  ? 26.094  101.410 30.011  1.00   26.85 ? 23   TYR D C   1 
ATOM   8454  O O   . TYR D 1 23  ? 25.381  101.317 30.994  1.00   22.86 ? 23   TYR D O   1 
ATOM   8455  C CB  . TYR D 1 23  ? 27.465  99.396  30.367  1.00   27.63 ? 23   TYR D CB  1 
ATOM   8456  C CG  . TYR D 1 23  ? 27.042  98.537  29.217  1.00   28.31 ? 23   TYR D CG  1 
ATOM   8457  C CD1 . TYR D 1 23  ? 27.859  98.387  28.087  1.00   27.94 ? 23   TYR D CD1 1 
ATOM   8458  C CD2 . TYR D 1 23  ? 25.812  97.898  29.234  1.00   29.50 ? 23   TYR D CD2 1 
ATOM   8459  C CE1 . TYR D 1 23  ? 27.444  97.618  27.000  1.00   26.04 ? 23   TYR D CE1 1 
ATOM   8460  C CE2 . TYR D 1 23  ? 25.392  97.128  28.153  1.00   33.10 ? 23   TYR D CE2 1 
ATOM   8461  C CZ  . TYR D 1 23  ? 26.207  96.992  27.042  1.00   32.65 ? 23   TYR D CZ  1 
ATOM   8462  O OH  . TYR D 1 23  ? 25.780  96.230  25.977  1.00   37.05 ? 23   TYR D OH  1 
ATOM   8463  N N   . LEU D 1 24  ? 25.688  101.947 28.868  1.00   27.77 ? 24   LEU D N   1 
ATOM   8464  C CA  . LEU D 1 24  ? 24.358  102.519 28.733  1.00   29.37 ? 24   LEU D CA  1 
ATOM   8465  C C   . LEU D 1 24  ? 23.670  102.096 27.442  1.00   29.44 ? 24   LEU D C   1 
ATOM   8466  O O   . LEU D 1 24  ? 22.806  102.814 26.930  1.00   30.40 ? 24   LEU D O   1 
ATOM   8467  C CB  . LEU D 1 24  ? 24.450  104.049 28.775  1.00   29.25 ? 24   LEU D CB  1 
ATOM   8468  C CG  . LEU D 1 24  ? 25.121  104.751 29.971  1.00   32.09 ? 24   LEU D CG  1 
ATOM   8469  C CD1 . LEU D 1 24  ? 25.215  106.244 29.665  1.00   29.23 ? 24   LEU D CD1 1 
ATOM   8470  C CD2 . LEU D 1 24  ? 24.321  104.536 31.273  1.00   30.94 ? 24   LEU D CD2 1 
ATOM   8471  N N   . ALA D 1 25  ? 24.021  100.917 26.939  1.00   30.98 ? 25   ALA D N   1 
ATOM   8472  C CA  . ALA D 1 25  ? 23.466  100.429 25.682  1.00   29.86 ? 25   ALA D CA  1 
ATOM   8473  C C   . ALA D 1 25  ? 22.529  99.232  25.742  1.00   30.37 ? 25   ALA D C   1 
ATOM   8474  O O   . ALA D 1 25  ? 22.475  98.473  24.771  1.00   30.60 ? 25   ALA D O   1 
ATOM   8475  C CB  . ALA D 1 25  ? 24.612  100.119 24.719  1.00   30.20 ? 25   ALA D CB  1 
ATOM   8476  N N   . LEU D 1 26  ? 21.793  99.053  26.846  1.00   29.60 ? 26   LEU D N   1 
ATOM   8477  C CA  . LEU D 1 26  ? 20.859  97.915  26.972  1.00   28.14 ? 26   LEU D CA  1 
ATOM   8478  C C   . LEU D 1 26  ? 19.581  98.203  27.750  1.00   29.12 ? 26   LEU D C   1 
ATOM   8479  O O   . LEU D 1 26  ? 18.815  97.284  28.031  1.00   30.06 ? 26   LEU D O   1 
ATOM   8480  C CB  . LEU D 1 26  ? 21.547  96.701  27.618  1.00   30.57 ? 26   LEU D CB  1 
ATOM   8481  C CG  . LEU D 1 26  ? 22.561  95.936  26.741  1.00   33.30 ? 26   LEU D CG  1 
ATOM   8482  C CD1 . LEU D 1 26  ? 23.253  94.825  27.536  1.00   29.82 ? 26   LEU D CD1 1 
ATOM   8483  C CD2 . LEU D 1 26  ? 21.836  95.341  25.521  1.00   31.09 ? 26   LEU D CD2 1 
ATOM   8484  N N   . ASN D 1 27  ? 19.354  99.467  28.100  1.00   29.10 ? 27   ASN D N   1 
ATOM   8485  C CA  . ASN D 1 27  ? 18.168  99.877  28.855  1.00   26.75 ? 27   ASN D CA  1 
ATOM   8486  C C   . ASN D 1 27  ? 18.031  99.231  30.238  1.00   26.92 ? 27   ASN D C   1 
ATOM   8487  O O   . ASN D 1 27  ? 16.917  99.030  30.742  1.00   29.23 ? 27   ASN D O   1 
ATOM   8488  C CB  . ASN D 1 27  ? 16.915  99.644  28.025  1.00   25.07 ? 27   ASN D CB  1 
ATOM   8489  C CG  . ASN D 1 27  ? 16.764  100.658 26.897  1.00   22.98 ? 27   ASN D CG  1 
ATOM   8490  O OD1 . ASN D 1 27  ? 15.891  100.518 26.043  1.00   27.17 ? 27   ASN D OD1 1 
ATOM   8491  N ND2 . ASN D 1 27  ? 17.602  101.686 26.897  1.00   20.88 ? 27   ASN D ND2 1 
ATOM   8492  N N   . GLU D 1 28  ? 19.173  98.944  30.852  1.00   25.65 ? 28   GLU D N   1 
ATOM   8493  C CA  . GLU D 1 28  ? 19.242  98.333  32.187  1.00   28.71 ? 28   GLU D CA  1 
ATOM   8494  C C   . GLU D 1 28  ? 19.078  99.372  33.299  1.00   28.12 ? 28   GLU D C   1 
ATOM   8495  O O   . GLU D 1 28  ? 19.497  100.518 33.149  1.00   30.61 ? 28   GLU D O   1 
ATOM   8496  C CB  . GLU D 1 28  ? 20.594  97.607  32.381  1.00   24.45 ? 28   GLU D CB  1 
ATOM   8497  C CG  . GLU D 1 28  ? 20.761  96.439  31.419  1.00   27.64 ? 28   GLU D CG  1 
ATOM   8498  C CD  . GLU D 1 28  ? 22.207  96.010  31.221  1.00   31.03 ? 28   GLU D CD  1 
ATOM   8499  O OE1 . GLU D 1 28  ? 23.066  96.906  30.999  1.00   29.82 ? 28   GLU D OE1 1 
ATOM   8500  O OE2 . GLU D 1 28  ? 22.467  94.777  31.269  1.00   26.63 ? 28   GLU D OE2 1 
ATOM   8501  N N   . ASN D 1 29  ? 18.470  98.972  34.408  1.00   25.97 ? 29   ASN D N   1 
ATOM   8502  C CA  . ASN D 1 29  ? 18.297  99.886  35.529  1.00   26.78 ? 29   ASN D CA  1 
ATOM   8503  C C   . ASN D 1 29  ? 19.694  100.217 36.078  1.00   26.08 ? 29   ASN D C   1 
ATOM   8504  O O   . ASN D 1 29  ? 20.576  99.355  36.109  1.00   26.97 ? 29   ASN D O   1 
ATOM   8505  C CB  . ASN D 1 29  ? 17.443  99.237  36.617  1.00   27.78 ? 29   ASN D CB  1 
ATOM   8506  C CG  . ASN D 1 29  ? 16.988  100.220 37.673  1.00   28.30 ? 29   ASN D CG  1 
ATOM   8507  O OD1 . ASN D 1 29  ? 17.796  100.752 38.444  1.00   27.03 ? 29   ASN D OD1 1 
ATOM   8508  N ND2 . ASN D 1 29  ? 15.685  100.471 37.717  1.00   28.09 ? 29   ASN D ND2 1 
ATOM   8509  N N   . PRO D 1 30  ? 19.915  101.478 36.497  1.00   25.30 ? 30   PRO D N   1 
ATOM   8510  C CA  . PRO D 1 30  ? 21.210  101.911 37.047  1.00   24.50 ? 30   PRO D CA  1 
ATOM   8511  C C   . PRO D 1 30  ? 21.506  101.305 38.405  1.00   23.98 ? 30   PRO D C   1 
ATOM   8512  O O   . PRO D 1 30  ? 22.664  101.098 38.774  1.00   28.22 ? 30   PRO D O   1 
ATOM   8513  C CB  . PRO D 1 30  ? 21.071  103.428 37.121  1.00   22.70 ? 30   PRO D CB  1 
ATOM   8514  C CG  . PRO D 1 30  ? 19.594  103.629 37.304  1.00   26.26 ? 30   PRO D CG  1 
ATOM   8515  C CD  . PRO D 1 30  ? 18.976  102.607 36.397  1.00   22.55 ? 30   PRO D CD  1 
ATOM   8516  N N   . PHE D 1 31  ? 20.452  100.962 39.131  1.00   24.14 ? 31   PHE D N   1 
ATOM   8517  C CA  . PHE D 1 31  ? 20.617  100.436 40.471  1.00   24.44 ? 31   PHE D CA  1 
ATOM   8518  C C   . PHE D 1 31  ? 20.548  98.924  40.618  1.00   24.47 ? 31   PHE D C   1 
ATOM   8519  O O   . PHE D 1 31  ? 19.868  98.244  39.852  1.00   23.35 ? 31   PHE D O   1 
ATOM   8520  C CB  . PHE D 1 31  ? 19.595  101.115 41.380  1.00   25.34 ? 31   PHE D CB  1 
ATOM   8521  C CG  . PHE D 1 31  ? 19.618  102.619 41.271  1.00   29.71 ? 31   PHE D CG  1 
ATOM   8522  C CD1 . PHE D 1 31  ? 18.521  103.305 40.755  1.00   30.04 ? 31   PHE D CD1 1 
ATOM   8523  C CD2 . PHE D 1 31  ? 20.761  103.343 41.631  1.00   27.46 ? 31   PHE D CD2 1 
ATOM   8524  C CE1 . PHE D 1 31  ? 18.549  104.687 40.590  1.00   36.87 ? 31   PHE D CE1 1 
ATOM   8525  C CE2 . PHE D 1 31  ? 20.807  104.721 41.473  1.00   32.76 ? 31   PHE D CE2 1 
ATOM   8526  C CZ  . PHE D 1 31  ? 19.694  105.401 40.948  1.00   35.75 ? 31   PHE D CZ  1 
ATOM   8527  N N   . PRO D 1 32  ? 21.272  98.379  41.616  1.00   23.63 ? 32   PRO D N   1 
ATOM   8528  C CA  . PRO D 1 32  ? 21.269  96.929  41.839  1.00   23.47 ? 32   PRO D CA  1 
ATOM   8529  C C   . PRO D 1 32  ? 19.960  96.486  42.444  1.00   23.41 ? 32   PRO D C   1 
ATOM   8530  O O   . PRO D 1 32  ? 19.100  97.315  42.749  1.00   24.43 ? 32   PRO D O   1 
ATOM   8531  C CB  . PRO D 1 32  ? 22.449  96.718  42.778  1.00   23.51 ? 32   PRO D CB  1 
ATOM   8532  C CG  . PRO D 1 32  ? 22.504  97.994  43.543  1.00   21.21 ? 32   PRO D CG  1 
ATOM   8533  C CD  . PRO D 1 32  ? 22.218  99.056  42.524  1.00   16.75 ? 32   PRO D CD  1 
ATOM   8534  N N   . PHE D 1 33  ? 19.779  95.179  42.592  1.00   21.93 ? 33   PHE D N   1 
ATOM   8535  C CA  . PHE D 1 33  ? 18.538  94.734  43.191  1.00   21.76 ? 33   PHE D CA  1 
ATOM   8536  C C   . PHE D 1 33  ? 18.778  95.015  44.660  1.00   20.36 ? 33   PHE D C   1 
ATOM   8537  O O   . PHE D 1 33  ? 19.847  94.699  45.175  1.00   16.04 ? 33   PHE D O   1 
ATOM   8538  C CB  . PHE D 1 33  ? 18.285  93.234  42.964  1.00   20.72 ? 33   PHE D CB  1 
ATOM   8539  C CG  . PHE D 1 33  ? 16.894  92.798  43.384  1.00   21.72 ? 33   PHE D CG  1 
ATOM   8540  C CD1 . PHE D 1 33  ? 15.751  93.235  42.663  1.00   13.45 ? 33   PHE D CD1 1 
ATOM   8541  C CD2 . PHE D 1 33  ? 16.718  92.032  44.543  1.00   17.44 ? 33   PHE D CD2 1 
ATOM   8542  C CE1 . PHE D 1 33  ? 14.455  92.922  43.098  1.00   11.47 ? 33   PHE D CE1 1 
ATOM   8543  C CE2 . PHE D 1 33  ? 15.451  91.714  44.987  1.00   16.74 ? 33   PHE D CE2 1 
ATOM   8544  C CZ  . PHE D 1 33  ? 14.301  92.160  44.263  1.00   17.38 ? 33   PHE D CZ  1 
ATOM   8545  N N   . PRO D 1 34  ? 17.795  95.618  45.344  1.00   18.13 ? 34   PRO D N   1 
ATOM   8546  C CA  . PRO D 1 34  ? 17.931  95.937  46.763  1.00   20.98 ? 34   PRO D CA  1 
ATOM   8547  C C   . PRO D 1 34  ? 18.450  94.732  47.566  1.00   24.15 ? 34   PRO D C   1 
ATOM   8548  O O   . PRO D 1 34  ? 17.955  93.591  47.468  1.00   21.66 ? 34   PRO D O   1 
ATOM   8549  C CB  . PRO D 1 34  ? 16.506  96.354  47.165  1.00   23.26 ? 34   PRO D CB  1 
ATOM   8550  C CG  . PRO D 1 34  ? 15.895  96.820  45.906  1.00   17.48 ? 34   PRO D CG  1 
ATOM   8551  C CD  . PRO D 1 34  ? 16.396  95.781  44.921  1.00   21.67 ? 34   PRO D CD  1 
ATOM   8552  N N   . GLU D 1 35  ? 19.461  95.000  48.376  1.00   28.48 ? 35   GLU D N   1 
ATOM   8553  C CA  . GLU D 1 35  ? 20.067  93.950  49.170  1.00   28.77 ? 35   GLU D CA  1 
ATOM   8554  C C   . GLU D 1 35  ? 19.131  93.399  50.218  1.00   26.35 ? 35   GLU D C   1 
ATOM   8555  O O   . GLU D 1 35  ? 19.022  92.191  50.381  1.00   26.35 ? 35   GLU D O   1 
ATOM   8556  C CB  . GLU D 1 35  ? 21.342  94.462  49.835  1.00   30.55 ? 35   GLU D CB  1 
ATOM   8557  C CG  . GLU D 1 35  ? 21.957  93.451  50.783  1.00   33.89 ? 35   GLU D CG  1 
ATOM   8558  C CD  . GLU D 1 35  ? 22.357  92.170  50.086  1.00   35.45 ? 35   GLU D CD  1 
ATOM   8559  O OE1 . GLU D 1 35  ? 22.138  91.101  50.688  1.00   37.36 ? 35   GLU D OE1 1 
ATOM   8560  O OE2 . GLU D 1 35  ? 22.897  92.226  48.950  1.00   38.53 ? 35   GLU D OE2 1 
ATOM   8561  N N   . ASP D 1 36  ? 18.455  94.281  50.938  1.00   26.76 ? 36   ASP D N   1 
ATOM   8562  C CA  . ASP D 1 36  ? 17.550  93.803  51.971  1.00   26.20 ? 36   ASP D CA  1 
ATOM   8563  C C   . ASP D 1 36  ? 16.457  92.908  51.387  1.00   23.37 ? 36   ASP D C   1 
ATOM   8564  O O   . ASP D 1 36  ? 15.890  92.095  52.095  1.00   24.72 ? 36   ASP D O   1 
ATOM   8565  C CB  . ASP D 1 36  ? 16.953  94.974  52.745  1.00   27.86 ? 36   ASP D CB  1 
ATOM   8566  C CG  . ASP D 1 36  ? 16.298  95.983  51.851  1.00   32.01 ? 36   ASP D CG  1 
ATOM   8567  O OD1 . ASP D 1 36  ? 16.354  95.789  50.621  1.00   33.69 ? 36   ASP D OD1 1 
ATOM   8568  O OD2 . ASP D 1 36  ? 15.733  96.966  52.384  1.00   35.18 ? 36   ASP D OD2 1 
ATOM   8569  N N   . LEU D 1 37  ? 16.176  93.051  50.095  1.00   20.65 ? 37   LEU D N   1 
ATOM   8570  C CA  . LEU D 1 37  ? 15.178  92.205  49.439  1.00   19.97 ? 37   LEU D CA  1 
ATOM   8571  C C   . LEU D 1 37  ? 15.849  90.885  49.009  1.00   19.12 ? 37   LEU D C   1 
ATOM   8572  O O   . LEU D 1 37  ? 15.215  89.828  49.016  1.00   18.60 ? 37   LEU D O   1 
ATOM   8573  C CB  . LEU D 1 37  ? 14.582  92.946  48.241  1.00   16.58 ? 37   LEU D CB  1 
ATOM   8574  C CG  . LEU D 1 37  ? 13.870  94.219  48.709  1.00   17.59 ? 37   LEU D CG  1 
ATOM   8575  C CD1 . LEU D 1 37  ? 13.295  94.986  47.534  1.00   19.34 ? 37   LEU D CD1 1 
ATOM   8576  C CD2 . LEU D 1 37  ? 12.771  93.833  49.676  1.00   19.91 ? 37   LEU D CD2 1 
ATOM   8577  N N   . VAL D 1 38  ? 17.123  90.958  48.630  1.00   19.01 ? 38   VAL D N   1 
ATOM   8578  C CA  . VAL D 1 38  ? 17.896  89.773  48.266  1.00   23.44 ? 38   VAL D CA  1 
ATOM   8579  C C   . VAL D 1 38  ? 17.919  88.833  49.483  1.00   25.91 ? 38   VAL D C   1 
ATOM   8580  O O   . VAL D 1 38  ? 17.860  87.611  49.375  1.00   26.76 ? 38   VAL D O   1 
ATOM   8581  C CB  . VAL D 1 38  ? 19.365  90.152  47.914  1.00   22.45 ? 38   VAL D CB  1 
ATOM   8582  C CG1 . VAL D 1 38  ? 20.252  88.906  47.866  1.00   19.50 ? 38   VAL D CG1 1 
ATOM   8583  C CG2 . VAL D 1 38  ? 19.394  90.838  46.556  1.00   24.37 ? 38   VAL D CG2 1 
ATOM   8584  N N   . ASP D 1 39  ? 18.023  89.451  50.650  1.00   28.21 ? 39   ASP D N   1 
ATOM   8585  C CA  . ASP D 1 39  ? 18.059  88.744  51.913  1.00   28.72 ? 39   ASP D CA  1 
ATOM   8586  C C   . ASP D 1 39  ? 16.680  88.162  52.192  1.00   26.75 ? 39   ASP D C   1 
ATOM   8587  O O   . ASP D 1 39  ? 16.560  87.038  52.665  1.00   24.36 ? 39   ASP D O   1 
ATOM   8588  C CB  . ASP D 1 39  ? 18.459  89.718  53.026  1.00   29.34 ? 39   ASP D CB  1 
ATOM   8589  C CG  . ASP D 1 39  ? 19.841  90.323  52.808  1.00   34.92 ? 39   ASP D CG  1 
ATOM   8590  O OD1 . ASP D 1 39  ? 20.069  91.505  53.175  1.00   38.39 ? 39   ASP D OD1 1 
ATOM   8591  O OD2 . ASP D 1 39  ? 20.706  89.599  52.267  1.00   37.38 ? 39   ASP D OD2 1 
ATOM   8592  N N   . GLU D 1 40  ? 15.647  88.953  51.916  1.00   25.38 ? 40   GLU D N   1 
ATOM   8593  C CA  . GLU D 1 40  ? 14.281  88.531  52.137  1.00   26.46 ? 40   GLU D CA  1 
ATOM   8594  C C   . GLU D 1 40  ? 13.978  87.322  51.241  1.00   28.47 ? 40   GLU D C   1 
ATOM   8595  O O   . GLU D 1 40  ? 13.309  86.394  51.666  1.00   27.89 ? 40   GLU D O   1 
ATOM   8596  C CB  . GLU D 1 40  ? 13.344  89.697  51.843  1.00   25.30 ? 40   GLU D CB  1 
ATOM   8597  C CG  . GLU D 1 40  ? 11.862  89.388  51.968  1.00   31.52 ? 40   GLU D CG  1 
ATOM   8598  C CD  . GLU D 1 40  ? 11.486  88.685  53.264  1.00   32.98 ? 40   GLU D CD  1 
ATOM   8599  O OE1 . GLU D 1 40  ? 12.161  88.914  54.300  1.00   33.58 ? 40   GLU D OE1 1 
ATOM   8600  O OE2 . GLU D 1 40  ? 10.500  87.923  53.245  1.00   26.36 ? 40   GLU D OE2 1 
ATOM   8601  N N   . VAL D 1 41  ? 14.491  87.326  50.009  1.00   27.94 ? 41   VAL D N   1 
ATOM   8602  C CA  . VAL D 1 41  ? 14.248  86.215  49.111  1.00   28.17 ? 41   VAL D CA  1 
ATOM   8603  C C   . VAL D 1 41  ? 14.877  84.962  49.708  1.00   30.03 ? 41   VAL D C   1 
ATOM   8604  O O   . VAL D 1 41  ? 14.236  83.906  49.788  1.00   30.05 ? 41   VAL D O   1 
ATOM   8605  C CB  . VAL D 1 41  ? 14.870  86.435  47.707  1.00   30.00 ? 41   VAL D CB  1 
ATOM   8606  C CG1 . VAL D 1 41  ? 14.792  85.142  46.893  1.00   25.16 ? 41   VAL D CG1 1 
ATOM   8607  C CG2 . VAL D 1 41  ? 14.154  87.547  46.979  1.00   28.69 ? 41   VAL D CG2 1 
ATOM   8608  N N   . PHE D 1 42  ? 16.128  85.062  50.135  1.00   27.45 ? 42   PHE D N   1 
ATOM   8609  C CA  . PHE D 1 42  ? 16.762  83.877  50.679  1.00   30.17 ? 42   PHE D CA  1 
ATOM   8610  C C   . PHE D 1 42  ? 16.168  83.385  51.989  1.00   30.72 ? 42   PHE D C   1 
ATOM   8611  O O   . PHE D 1 42  ? 16.235  82.186  52.305  1.00   32.16 ? 42   PHE D O   1 
ATOM   8612  C CB  . PHE D 1 42  ? 18.273  84.070  50.778  1.00   29.10 ? 42   PHE D CB  1 
ATOM   8613  C CG  . PHE D 1 42  ? 18.981  83.772  49.487  1.00   29.07 ? 42   PHE D CG  1 
ATOM   8614  C CD1 . PHE D 1 42  ? 18.905  84.664  48.411  1.00   27.69 ? 42   PHE D CD1 1 
ATOM   8615  C CD2 . PHE D 1 42  ? 19.653  82.556  49.313  1.00   29.02 ? 42   PHE D CD2 1 
ATOM   8616  C CE1 . PHE D 1 42  ? 19.484  84.354  47.176  1.00   26.31 ? 42   PHE D CE1 1 
ATOM   8617  C CE2 . PHE D 1 42  ? 20.237  82.226  48.093  1.00   31.23 ? 42   PHE D CE2 1 
ATOM   8618  C CZ  . PHE D 1 42  ? 20.152  83.133  47.012  1.00   30.59 ? 42   PHE D CZ  1 
ATOM   8619  N N   . ARG D 1 43  ? 15.552  84.301  52.724  1.00   30.12 ? 43   ARG D N   1 
ATOM   8620  C CA  . ARG D 1 43  ? 14.900  83.951  53.967  1.00   30.85 ? 43   ARG D CA  1 
ATOM   8621  C C   . ARG D 1 43  ? 13.706  83.039  53.664  1.00   28.92 ? 43   ARG D C   1 
ATOM   8622  O O   . ARG D 1 43  ? 13.534  82.014  54.312  1.00   28.45 ? 43   ARG D O   1 
ATOM   8623  C CB  . ARG D 1 43  ? 14.412  85.216  54.693  1.00   31.81 ? 43   ARG D CB  1 
ATOM   8624  C CG  . ARG D 1 43  ? 13.936  84.963  56.106  1.00   35.86 ? 43   ARG D CG  1 
ATOM   8625  C CD  . ARG D 1 43  ? 13.180  86.161  56.665  1.00   44.81 ? 43   ARG D CD  1 
ATOM   8626  N NE  . ARG D 1 43  ? 12.655  85.839  57.989  1.00   55.49 ? 43   ARG D NE  1 
ATOM   8627  C CZ  . ARG D 1 43  ? 11.810  86.594  58.688  1.00   57.88 ? 43   ARG D CZ  1 
ATOM   8628  N NH1 . ARG D 1 43  ? 11.402  86.189  59.888  1.00   59.31 ? 43   ARG D NH1 1 
ATOM   8629  N NH2 . ARG D 1 43  ? 11.364  87.744  58.192  1.00   59.51 ? 43   ARG D NH2 1 
ATOM   8630  N N   . ARG D 1 44  ? 12.895  83.403  52.674  1.00   27.52 ? 44   ARG D N   1 
ATOM   8631  C CA  . ARG D 1 44  ? 11.720  82.613  52.319  1.00   29.07 ? 44   ARG D CA  1 
ATOM   8632  C C   . ARG D 1 44  ? 12.096  81.401  51.484  1.00   28.61 ? 44   ARG D C   1 
ATOM   8633  O O   . ARG D 1 44  ? 11.289  80.496  51.281  1.00   31.24 ? 44   ARG D O   1 
ATOM   8634  C CB  . ARG D 1 44  ? 10.728  83.464  51.529  1.00   29.32 ? 44   ARG D CB  1 
ATOM   8635  C CG  . ARG D 1 44  ? 10.218  84.682  52.270  1.00   34.90 ? 44   ARG D CG  1 
ATOM   8636  C CD  . ARG D 1 44  ? 9.492   85.637  51.328  1.00   35.90 ? 44   ARG D CD  1 
ATOM   8637  N NE  . ARG D 1 44  ? 8.494   84.955  50.508  1.00   45.32 ? 44   ARG D NE  1 
ATOM   8638  C CZ  . ARG D 1 44  ? 7.564   85.591  49.793  1.00   47.41 ? 44   ARG D CZ  1 
ATOM   8639  N NH1 . ARG D 1 44  ? 7.506   86.928  49.808  1.00   44.77 ? 44   ARG D NH1 1 
ATOM   8640  N NH2 . ARG D 1 44  ? 6.695   84.896  49.054  1.00   44.85 ? 44   ARG D NH2 1 
ATOM   8641  N N   . LEU D 1 45  ? 13.333  81.383  51.017  1.00   27.73 ? 45   LEU D N   1 
ATOM   8642  C CA  . LEU D 1 45  ? 13.816  80.311  50.170  1.00   24.61 ? 45   LEU D CA  1 
ATOM   8643  C C   . LEU D 1 45  ? 13.821  78.992  50.923  1.00   23.63 ? 45   LEU D C   1 
ATOM   8644  O O   . LEU D 1 45  ? 14.409  78.877  51.990  1.00   24.93 ? 45   LEU D O   1 
ATOM   8645  C CB  . LEU D 1 45  ? 15.206  80.679  49.663  1.00   25.89 ? 45   LEU D CB  1 
ATOM   8646  C CG  . LEU D 1 45  ? 15.660  80.040  48.356  1.00   22.75 ? 45   LEU D CG  1 
ATOM   8647  C CD1 . LEU D 1 45  ? 16.934  80.730  47.837  1.00   26.00 ? 45   LEU D CD1 1 
ATOM   8648  C CD2 . LEU D 1 45  ? 15.901  78.566  48.620  1.00   27.19 ? 45   LEU D CD2 1 
ATOM   8649  N N   . ASN D 1 46  ? 13.127  78.009  50.363  1.00   25.01 ? 46   ASN D N   1 
ATOM   8650  C CA  . ASN D 1 46  ? 13.014  76.677  50.955  1.00   24.55 ? 46   ASN D CA  1 
ATOM   8651  C C   . ASN D 1 46  ? 13.916  75.726  50.177  1.00   24.15 ? 46   ASN D C   1 
ATOM   8652  O O   . ASN D 1 46  ? 13.605  75.355  49.050  1.00   25.99 ? 46   ASN D O   1 
ATOM   8653  C CB  . ASN D 1 46  ? 11.564  76.217  50.864  1.00   29.30 ? 46   ASN D CB  1 
ATOM   8654  C CG  . ASN D 1 46  ? 11.327  74.864  51.519  1.00   30.75 ? 46   ASN D CG  1 
ATOM   8655  O OD1 . ASN D 1 46  ? 11.881  73.841  51.114  1.00   30.51 ? 46   ASN D OD1 1 
ATOM   8656  N ND2 . ASN D 1 46  ? 10.476  74.856  52.531  1.00   29.10 ? 46   ASN D ND2 1 
ATOM   8657  N N   . SER D 1 47  ? 15.032  75.330  50.773  1.00   24.06 ? 47   SER D N   1 
ATOM   8658  C CA  . SER D 1 47  ? 15.962  74.429  50.094  1.00   25.29 ? 47   SER D CA  1 
ATOM   8659  C C   . SER D 1 47  ? 15.245  73.186  49.594  1.00   22.02 ? 47   SER D C   1 
ATOM   8660  O O   . SER D 1 47  ? 15.569  72.638  48.547  1.00   22.55 ? 47   SER D O   1 
ATOM   8661  C CB  . SER D 1 47  ? 17.126  74.031  51.023  1.00   29.28 ? 47   SER D CB  1 
ATOM   8662  O OG  . SER D 1 47  ? 16.675  73.327  52.162  1.00   33.42 ? 47   SER D OG  1 
ATOM   8663  N N   . ASP D 1 48  ? 14.257  72.739  50.331  1.00   22.56 ? 48   ASP D N   1 
ATOM   8664  C CA  . ASP D 1 48  ? 13.552  71.568  49.873  1.00   27.39 ? 48   ASP D CA  1 
ATOM   8665  C C   . ASP D 1 48  ? 12.754  71.796  48.570  1.00   26.62 ? 48   ASP D C   1 
ATOM   8666  O O   . ASP D 1 48  ? 12.579  70.870  47.795  1.00   29.73 ? 48   ASP D O   1 
ATOM   8667  C CB  . ASP D 1 48  ? 12.638  71.020  50.970  1.00   28.84 ? 48   ASP D CB  1 
ATOM   8668  C CG  . ASP D 1 48  ? 12.176  69.613  50.677  1.00   29.29 ? 48   ASP D CG  1 
ATOM   8669  O OD1 . ASP D 1 48  ? 10.964  69.404  50.441  1.00   34.24 ? 48   ASP D OD1 1 
ATOM   8670  O OD2 . ASP D 1 48  ? 13.040  68.717  50.664  1.00   29.35 ? 48   ASP D OD2 1 
ATOM   8671  N N   . ALA D 1 49  ? 12.287  73.017  48.325  1.00   25.30 ? 49   ALA D N   1 
ATOM   8672  C CA  . ALA D 1 49  ? 11.546  73.321  47.111  1.00   20.41 ? 49   ALA D CA  1 
ATOM   8673  C C   . ALA D 1 49  ? 12.442  73.305  45.893  1.00   20.91 ? 49   ALA D C   1 
ATOM   8674  O O   . ALA D 1 49  ? 11.965  73.148  44.777  1.00   24.94 ? 49   ALA D O   1 
ATOM   8675  C CB  . ALA D 1 49  ? 10.892  74.676  47.219  1.00   21.91 ? 49   ALA D CB  1 
ATOM   8676  N N   . LEU D 1 50  ? 13.741  73.485  46.105  1.00   22.80 ? 50   LEU D N   1 
ATOM   8677  C CA  . LEU D 1 50  ? 14.706  73.486  45.000  1.00   22.01 ? 50   LEU D CA  1 
ATOM   8678  C C   . LEU D 1 50  ? 14.814  72.151  44.253  1.00   21.20 ? 50   LEU D C   1 
ATOM   8679  O O   . LEU D 1 50  ? 15.003  72.121  43.047  1.00   23.73 ? 50   LEU D O   1 
ATOM   8680  C CB  . LEU D 1 50  ? 16.101  73.920  45.510  1.00   19.44 ? 50   LEU D CB  1 
ATOM   8681  C CG  . LEU D 1 50  ? 16.274  75.376  45.996  1.00   23.09 ? 50   LEU D CG  1 
ATOM   8682  C CD1 . LEU D 1 50  ? 17.685  75.582  46.545  1.00   15.72 ? 50   LEU D CD1 1 
ATOM   8683  C CD2 . LEU D 1 50  ? 16.012  76.357  44.855  1.00   11.62 ? 50   LEU D CD2 1 
ATOM   8684  N N   . ARG D 1 51  ? 14.669  71.046  44.965  1.00   22.74 ? 51   ARG D N   1 
ATOM   8685  C CA  . ARG D 1 51  ? 14.778  69.727  44.341  1.00   23.32 ? 51   ARG D CA  1 
ATOM   8686  C C   . ARG D 1 51  ? 13.602  69.362  43.451  1.00   22.12 ? 51   ARG D C   1 
ATOM   8687  O O   . ARG D 1 51  ? 13.725  68.467  42.642  1.00   20.36 ? 51   ARG D O   1 
ATOM   8688  C CB  . ARG D 1 51  ? 14.918  68.632  45.402  1.00   25.82 ? 51   ARG D CB  1 
ATOM   8689  C CG  . ARG D 1 51  ? 13.631  68.381  46.205  1.00   24.88 ? 51   ARG D CG  1 
ATOM   8690  C CD  . ARG D 1 51  ? 13.830  67.260  47.196  1.00   27.53 ? 51   ARG D CD  1 
ATOM   8691  N NE  . ARG D 1 51  ? 12.735  66.290  47.129  1.00   34.84 ? 51   ARG D NE  1 
ATOM   8692  C CZ  . ARG D 1 51  ? 11.538  66.494  47.660  1.00   32.04 ? 51   ARG D CZ  1 
ATOM   8693  N NH1 . ARG D 1 51  ? 10.591  65.584  47.569  1.00   28.91 ? 51   ARG D NH1 1 
ATOM   8694  N NH2 . ARG D 1 51  ? 11.292  67.618  48.297  1.00   43.91 ? 51   ARG D NH2 1 
ATOM   8695  N N   . ILE D 1 52  ? 12.463  70.035  43.588  1.00   21.07 ? 52   ILE D N   1 
ATOM   8696  C CA  . ILE D 1 52  ? 11.306  69.660  42.774  1.00   23.45 ? 52   ILE D CA  1 
ATOM   8697  C C   . ILE D 1 52  ? 10.874  70.583  41.624  1.00   21.71 ? 52   ILE D C   1 
ATOM   8698  O O   . ILE D 1 52  ? 11.300  71.730  41.536  1.00   24.45 ? 52   ILE D O   1 
ATOM   8699  C CB  . ILE D 1 52  ? 10.081  69.377  43.697  1.00   23.30 ? 52   ILE D CB  1 
ATOM   8700  C CG1 . ILE D 1 52  ? 9.684   70.626  44.480  1.00   25.98 ? 52   ILE D CG1 1 
ATOM   8701  C CG2 . ILE D 1 52  ? 10.456  68.308  44.715  1.00   25.43 ? 52   ILE D CG2 1 
ATOM   8702  C CD1 . ILE D 1 52  ? 8.889   71.607  43.705  1.00   27.65 ? 52   ILE D CD1 1 
ATOM   8703  N N   . TYR D 1 53  ? 10.037  70.049  40.740  1.00   20.34 ? 53   TYR D N   1 
ATOM   8704  C CA  . TYR D 1 53  ? 9.500   70.804  39.613  1.00   21.22 ? 53   TYR D CA  1 
ATOM   8705  C C   . TYR D 1 53  ? 8.478   71.779  40.177  1.00   21.83 ? 53   TYR D C   1 
ATOM   8706  O O   . TYR D 1 53  ? 7.459   71.358  40.745  1.00   22.09 ? 53   TYR D O   1 
ATOM   8707  C CB  . TYR D 1 53  ? 8.864   69.834  38.622  1.00   23.17 ? 53   TYR D CB  1 
ATOM   8708  C CG  . TYR D 1 53  ? 9.905   69.191  37.735  1.00   24.20 ? 53   TYR D CG  1 
ATOM   8709  C CD1 . TYR D 1 53  ? 10.446  69.894  36.670  1.00   23.88 ? 53   TYR D CD1 1 
ATOM   8710  C CD2 . TYR D 1 53  ? 10.446  67.937  38.036  1.00   27.78 ? 53   TYR D CD2 1 
ATOM   8711  C CE1 . TYR D 1 53  ? 11.511  69.381  35.935  1.00   25.82 ? 53   TYR D CE1 1 
ATOM   8712  C CE2 . TYR D 1 53  ? 11.512  67.417  37.301  1.00   26.73 ? 53   TYR D CE2 1 
ATOM   8713  C CZ  . TYR D 1 53  ? 12.041  68.148  36.264  1.00   27.02 ? 53   TYR D CZ  1 
ATOM   8714  O OH  . TYR D 1 53  ? 13.141  67.671  35.593  1.00   31.49 ? 53   TYR D OH  1 
ATOM   8715  N N   . TYR D 1 54  ? 8.752   73.081  40.032  1.00   18.93 ? 54   TYR D N   1 
ATOM   8716  C CA  . TYR D 1 54  ? 7.875   74.094  40.591  1.00   20.15 ? 54   TYR D CA  1 
ATOM   8717  C C   . TYR D 1 54  ? 6.971   74.856  39.595  1.00   20.43 ? 54   TYR D C   1 
ATOM   8718  O O   . TYR D 1 54  ? 7.432   75.415  38.607  1.00   20.63 ? 54   TYR D O   1 
ATOM   8719  C CB  . TYR D 1 54  ? 8.742   75.071  41.403  1.00   20.05 ? 54   TYR D CB  1 
ATOM   8720  C CG  . TYR D 1 54  ? 7.998   76.025  42.324  1.00   23.99 ? 54   TYR D CG  1 
ATOM   8721  C CD1 . TYR D 1 54  ? 7.650   75.654  43.630  1.00   24.25 ? 54   TYR D CD1 1 
ATOM   8722  C CD2 . TYR D 1 54  ? 7.675   77.315  41.900  1.00   22.96 ? 54   TYR D CD2 1 
ATOM   8723  C CE1 . TYR D 1 54  ? 7.003   76.551  44.489  1.00   26.78 ? 54   TYR D CE1 1 
ATOM   8724  C CE2 . TYR D 1 54  ? 7.034   78.210  42.738  1.00   25.18 ? 54   TYR D CE2 1 
ATOM   8725  C CZ  . TYR D 1 54  ? 6.702   77.829  44.025  1.00   26.98 ? 54   TYR D CZ  1 
ATOM   8726  O OH  . TYR D 1 54  ? 6.076   78.743  44.823  1.00   25.83 ? 54   TYR D OH  1 
ATOM   8727  N N   . ASP D 1 55  ? 5.666   74.853  39.848  1.00   21.17 ? 55   ASP D N   1 
ATOM   8728  C CA  . ASP D 1 55  ? 4.703   75.583  38.995  1.00   22.20 ? 55   ASP D CA  1 
ATOM   8729  C C   . ASP D 1 55  ? 5.318   76.910  38.569  1.00   21.74 ? 55   ASP D C   1 
ATOM   8730  O O   . ASP D 1 55  ? 5.550   77.772  39.411  1.00   18.78 ? 55   ASP D O   1 
ATOM   8731  C CB  . ASP D 1 55  ? 3.414   75.831  39.779  1.00   20.77 ? 55   ASP D CB  1 
ATOM   8732  C CG  . ASP D 1 55  ? 2.770   74.532  40.248  1.00   26.80 ? 55   ASP D CG  1 
ATOM   8733  O OD1 . ASP D 1 55  ? 1.940   74.521  41.189  1.00   27.12 ? 55   ASP D OD1 1 
ATOM   8734  O OD2 . ASP D 1 55  ? 3.120   73.498  39.648  1.00   24.27 ? 55   ASP D OD2 1 
ATOM   8735  N N   . SER D 1 56  ? 5.593   77.086  37.278  1.00   24.60 ? 56   SER D N   1 
ATOM   8736  C CA  . SER D 1 56  ? 6.230   78.321  36.839  1.00   30.97 ? 56   SER D CA  1 
ATOM   8737  C C   . SER D 1 56  ? 5.262   79.429  37.156  1.00   34.25 ? 56   SER D C   1 
ATOM   8738  O O   . SER D 1 56  ? 5.600   80.381  37.882  1.00   38.10 ? 56   SER D O   1 
ATOM   8739  C CB  . SER D 1 56  ? 6.560   78.300  35.361  1.00   32.04 ? 56   SER D CB  1 
ATOM   8740  O OG  . SER D 1 56  ? 6.950   79.608  35.005  1.00   38.83 ? 56   SER D OG  1 
ATOM   8741  N N   . PRO D 1 57  ? 4.062   79.379  36.562  1.00   30.95 ? 57   PRO D N   1 
ATOM   8742  C CA  . PRO D 1 57  ? 3.205   80.486  36.985  1.00   28.22 ? 57   PRO D CA  1 
ATOM   8743  C C   . PRO D 1 57  ? 2.741   79.998  38.373  1.00   27.51 ? 57   PRO D C   1 
ATOM   8744  O O   . PRO D 1 57  ? 1.965   79.056  38.506  1.00   25.04 ? 57   PRO D O   1 
ATOM   8745  C CB  . PRO D 1 57  ? 2.079   80.471  35.961  1.00   29.59 ? 57   PRO D CB  1 
ATOM   8746  C CG  . PRO D 1 57  ? 2.738   79.880  34.755  1.00   34.18 ? 57   PRO D CG  1 
ATOM   8747  C CD  . PRO D 1 57  ? 3.585   78.769  35.314  1.00   25.45 ? 57   PRO D CD  1 
ATOM   8748  N N   . ASP D 1 58  ? 3.306   80.611  39.396  1.00   28.40 ? 58   ASP D N   1 
ATOM   8749  C CA  . ASP D 1 58  ? 3.028   80.337  40.793  1.00   28.13 ? 58   ASP D CA  1 
ATOM   8750  C C   . ASP D 1 58  ? 1.665   80.973  41.168  1.00   29.02 ? 58   ASP D C   1 
ATOM   8751  O O   . ASP D 1 58  ? 1.266   82.007  40.605  1.00   26.96 ? 58   ASP D O   1 
ATOM   8752  C CB  . ASP D 1 58  ? 4.157   81.008  41.594  1.00   37.47 ? 58   ASP D CB  1 
ATOM   8753  C CG  . ASP D 1 58  ? 4.195   80.606  43.034  1.00   41.00 ? 58   ASP D CG  1 
ATOM   8754  O OD1 . ASP D 1 58  ? 5.035   81.162  43.772  1.00   38.50 ? 58   ASP D OD1 1 
ATOM   8755  O OD2 . ASP D 1 58  ? 3.399   79.727  43.422  1.00   51.33 ? 58   ASP D OD2 1 
ATOM   8756  N N   . GLU D 1 59  ? 0.965   80.370  42.124  1.00   26.48 ? 59   GLU D N   1 
ATOM   8757  C CA  . GLU D 1 59  ? -0.317  80.905  42.578  1.00   28.26 ? 59   GLU D CA  1 
ATOM   8758  C C   . GLU D 1 59  ? -0.148  82.290  43.216  1.00   28.18 ? 59   GLU D C   1 
ATOM   8759  O O   . GLU D 1 59  ? -0.852  83.238  42.894  1.00   28.70 ? 59   GLU D O   1 
ATOM   8760  C CB  . GLU D 1 59  ? -0.931  79.966  43.609  1.00   29.55 ? 59   GLU D CB  1 
ATOM   8761  C CG  . GLU D 1 59  ? -2.081  80.576  44.412  1.00   32.17 ? 59   GLU D CG  1 
ATOM   8762  C CD  . GLU D 1 59  ? -2.266  79.890  45.757  0.0000 32.13 ? 59   GLU D CD  1 
ATOM   8763  O OE1 . GLU D 1 59  ? -3.210  80.242  46.498  0.0000 32.60 ? 59   GLU D OE1 1 
ATOM   8764  O OE2 . GLU D 1 59  ? -1.454  79.000  46.078  0.0000 32.60 ? 59   GLU D OE2 1 
ATOM   8765  N N   . GLU D 1 60  ? 0.789   82.374  44.147  1.00   28.66 ? 60   GLU D N   1 
ATOM   8766  C CA  . GLU D 1 60  ? 1.084   83.606  44.841  1.00   25.75 ? 60   GLU D CA  1 
ATOM   8767  C C   . GLU D 1 60  ? 1.597   84.640  43.839  1.00   23.87 ? 60   GLU D C   1 
ATOM   8768  O O   . GLU D 1 60  ? 1.171   85.792  43.860  1.00   23.34 ? 60   GLU D O   1 
ATOM   8769  C CB  . GLU D 1 60  ? 2.116   83.323  45.932  1.00   29.39 ? 60   GLU D CB  1 
ATOM   8770  C CG  . GLU D 1 60  ? 2.535   84.532  46.756  1.00   36.07 ? 60   GLU D CG  1 
ATOM   8771  C CD  . GLU D 1 60  ? 3.549   84.195  47.861  1.00   42.68 ? 60   GLU D CD  1 
ATOM   8772  O OE1 . GLU D 1 60  ? 4.228   83.142  47.784  1.00   42.74 ? 60   GLU D OE1 1 
ATOM   8773  O OE2 . GLU D 1 60  ? 3.689   85.004  48.805  1.00   46.84 ? 60   GLU D OE2 1 
ATOM   8774  N N   . LEU D 1 61  ? 2.500   84.238  42.952  1.00   22.87 ? 61   LEU D N   1 
ATOM   8775  C CA  . LEU D 1 61  ? 3.032   85.178  41.968  1.00   22.77 ? 61   LEU D CA  1 
ATOM   8776  C C   . LEU D 1 61  ? 1.922   85.839  41.151  1.00   22.49 ? 61   LEU D C   1 
ATOM   8777  O O   . LEU D 1 61  ? 1.876   87.038  40.996  1.00   24.67 ? 61   LEU D O   1 
ATOM   8778  C CB  . LEU D 1 61  ? 4.028   84.478  41.034  1.00   20.16 ? 61   LEU D CB  1 
ATOM   8779  C CG  . LEU D 1 61  ? 4.654   85.406  39.986  1.00   23.00 ? 61   LEU D CG  1 
ATOM   8780  C CD1 . LEU D 1 61  ? 5.172   86.683  40.650  1.00   18.08 ? 61   LEU D CD1 1 
ATOM   8781  C CD2 . LEU D 1 61  ? 5.755   84.669  39.251  1.00   20.74 ? 61   LEU D CD2 1 
ATOM   8782  N N   . ILE D 1 62  ? 1.010   85.042  40.639  1.00   26.57 ? 62   ILE D N   1 
ATOM   8783  C CA  . ILE D 1 62  ? -0.074  85.585  39.842  1.00   28.34 ? 62   ILE D CA  1 
ATOM   8784  C C   . ILE D 1 62  ? -0.900  86.544  40.672  1.00   29.84 ? 62   ILE D C   1 
ATOM   8785  O O   . ILE D 1 62  ? -1.252  87.648  40.226  1.00   31.38 ? 62   ILE D O   1 
ATOM   8786  C CB  . ILE D 1 62  ? -0.966  84.453  39.301  1.00   29.08 ? 62   ILE D CB  1 
ATOM   8787  C CG1 . ILE D 1 62  ? -0.160  83.652  38.293  1.00   29.74 ? 62   ILE D CG1 1 
ATOM   8788  C CG2 . ILE D 1 62  ? -2.236  85.006  38.652  1.00   22.99 ? 62   ILE D CG2 1 
ATOM   8789  C CD1 . ILE D 1 62  ? -0.844  82.350  37.870  1.00   38.39 ? 62   ILE D CD1 1 
ATOM   8790  N N   . GLU D 1 63  ? -1.218  86.125  41.885  1.00   30.29 ? 63   GLU D N   1 
ATOM   8791  C CA  . GLU D 1 63  ? -1.995  86.977  42.773  1.00   30.34 ? 63   GLU D CA  1 
ATOM   8792  C C   . GLU D 1 63  ? -1.359  88.357  42.869  1.00   28.26 ? 63   GLU D C   1 
ATOM   8793  O O   . GLU D 1 63  ? -2.004  89.374  42.678  1.00   26.57 ? 63   GLU D O   1 
ATOM   8794  C CB  . GLU D 1 63  ? -2.087  86.327  44.158  1.00   34.60 ? 63   GLU D CB  1 
ATOM   8795  C CG  . GLU D 1 63  ? -2.910  85.026  44.160  1.00   41.74 ? 63   GLU D CG  1 
ATOM   8796  C CD  . GLU D 1 63  ? -3.017  84.385  45.528  1.00   49.05 ? 63   GLU D CD  1 
ATOM   8797  O OE1 . GLU D 1 63  ? -3.903  83.513  45.708  1.00   51.49 ? 63   GLU D OE1 1 
ATOM   8798  O OE2 . GLU D 1 63  ? -2.214  84.750  46.418  1.00   51.59 ? 63   GLU D OE2 1 
ATOM   8799  N N   . LYS D 1 64  ? -0.069  88.376  43.160  1.00   29.65 ? 64   LYS D N   1 
ATOM   8800  C CA  . LYS D 1 64  ? 0.643   89.615  43.297  1.00   29.31 ? 64   LYS D CA  1 
ATOM   8801  C C   . LYS D 1 64  ? 0.711   90.424  42.005  1.00   29.60 ? 64   LYS D C   1 
ATOM   8802  O O   . LYS D 1 64  ? 0.673   91.658  42.035  1.00   29.64 ? 64   LYS D O   1 
ATOM   8803  C CB  . LYS D 1 64  ? 2.034   89.314  43.834  1.00   30.62 ? 64   LYS D CB  1 
ATOM   8804  C CG  . LYS D 1 64  ? 2.007   88.978  45.310  1.00   33.30 ? 64   LYS D CG  1 
ATOM   8805  C CD  . LYS D 1 64  ? 3.371   88.549  45.820  1.00   37.69 ? 64   LYS D CD  1 
ATOM   8806  C CE  . LYS D 1 64  ? 3.315   88.244  47.301  1.00   39.73 ? 64   LYS D CE  1 
ATOM   8807  N NZ  . LYS D 1 64  ? 4.574   87.585  47.714  1.00   43.71 ? 64   LYS D NZ  1 
ATOM   8808  N N   . ILE D 1 65  ? 0.813   89.738  40.872  1.00   26.61 ? 65   ILE D N   1 
ATOM   8809  C CA  . ILE D 1 65  ? 0.872   90.432  39.604  1.00   23.50 ? 65   ILE D CA  1 
ATOM   8810  C C   . ILE D 1 65  ? -0.478  91.115  39.389  1.00   26.51 ? 65   ILE D C   1 
ATOM   8811  O O   . ILE D 1 65  ? -0.525  92.300  39.028  1.00   26.32 ? 65   ILE D O   1 
ATOM   8812  C CB  . ILE D 1 65  ? 1.200   89.450  38.475  1.00   19.76 ? 65   ILE D CB  1 
ATOM   8813  C CG1 . ILE D 1 65  ? 2.706   89.141  38.500  1.00   21.86 ? 65   ILE D CG1 1 
ATOM   8814  C CG2 . ILE D 1 65  ? 0.727   89.989  37.142  1.00   13.30 ? 65   ILE D CG2 1 
ATOM   8815  C CD1 . ILE D 1 65  ? 3.138   87.938  37.613  1.00   16.42 ? 65   ILE D CD1 1 
ATOM   8816  N N   . LEU D 1 66  ? -1.568  90.386  39.632  1.00   26.87 ? 66   LEU D N   1 
ATOM   8817  C CA  . LEU D 1 66  ? -2.914  90.944  39.488  1.00   30.72 ? 66   LEU D CA  1 
ATOM   8818  C C   . LEU D 1 66  ? -3.001  92.164  40.385  1.00   33.23 ? 66   LEU D C   1 
ATOM   8819  O O   . LEU D 1 66  ? -3.439  93.245  39.974  1.00   34.24 ? 66   LEU D O   1 
ATOM   8820  C CB  . LEU D 1 66  ? -3.992  89.965  39.967  1.00   31.84 ? 66   LEU D CB  1 
ATOM   8821  C CG  . LEU D 1 66  ? -4.757  89.058  38.995  1.00   34.32 ? 66   LEU D CG  1 
ATOM   8822  C CD1 . LEU D 1 66  ? -4.881  89.749  37.638  1.00   31.26 ? 66   LEU D CD1 1 
ATOM   8823  C CD2 . LEU D 1 66  ? -4.054  87.731  38.854  1.00   32.61 ? 66   LEU D CD2 1 
ATOM   8824  N N   . SER D 1 67  ? -2.592  91.956  41.631  1.00   33.66 ? 67   SER D N   1 
ATOM   8825  C CA  . SER D 1 67  ? -2.605  93.007  42.630  1.00   34.07 ? 67   SER D CA  1 
ATOM   8826  C C   . SER D 1 67  ? -1.866  94.225  42.088  1.00   33.42 ? 67   SER D C   1 
ATOM   8827  O O   . SER D 1 67  ? -2.329  95.373  42.212  1.00   32.29 ? 67   SER D O   1 
ATOM   8828  C CB  . SER D 1 67  ? -1.937  92.503  43.903  1.00   36.18 ? 67   SER D CB  1 
ATOM   8829  O OG  . SER D 1 67  ? -1.736  93.556  44.815  1.00   38.86 ? 67   SER D OG  1 
ATOM   8830  N N   . TYR D 1 68  ? -0.721  93.967  41.464  1.00   32.01 ? 68   TYR D N   1 
ATOM   8831  C CA  . TYR D 1 68  ? 0.067   95.057  40.906  1.00   31.17 ? 68   TYR D CA  1 
ATOM   8832  C C   . TYR D 1 68  ? -0.720  95.755  39.793  1.00   28.60 ? 68   TYR D C   1 
ATOM   8833  O O   . TYR D 1 68  ? -0.762  96.982  39.722  1.00   27.14 ? 68   TYR D O   1 
ATOM   8834  C CB  . TYR D 1 68  ? 1.412   94.523  40.404  1.00   26.23 ? 68   TYR D CB  1 
ATOM   8835  C CG  . TYR D 1 68  ? 2.321   95.589  39.821  1.00   26.99 ? 68   TYR D CG  1 
ATOM   8836  C CD1 . TYR D 1 68  ? 2.587   96.770  40.509  1.00   25.05 ? 68   TYR D CD1 1 
ATOM   8837  C CD2 . TYR D 1 68  ? 2.935   95.406  38.583  1.00   22.99 ? 68   TYR D CD2 1 
ATOM   8838  C CE1 . TYR D 1 68  ? 3.441   97.741  39.983  1.00   22.17 ? 68   TYR D CE1 1 
ATOM   8839  C CE2 . TYR D 1 68  ? 3.786   96.363  38.059  1.00   24.49 ? 68   TYR D CE2 1 
ATOM   8840  C CZ  . TYR D 1 68  ? 4.036   97.529  38.763  1.00   21.54 ? 68   TYR D CZ  1 
ATOM   8841  O OH  . TYR D 1 68  ? 4.882   98.475  38.234  1.00   21.23 ? 68   TYR D OH  1 
ATOM   8842  N N   . LEU D 1 69  ? -1.365  94.972  38.942  1.00   29.52 ? 69   LEU D N   1 
ATOM   8843  C CA  . LEU D 1 69  ? -2.171  95.514  37.841  1.00   30.71 ? 69   LEU D CA  1 
ATOM   8844  C C   . LEU D 1 69  ? -3.350  96.362  38.368  1.00   31.89 ? 69   LEU D C   1 
ATOM   8845  O O   . LEU D 1 69  ? -3.830  97.281  37.700  1.00   32.08 ? 69   LEU D O   1 
ATOM   8846  C CB  . LEU D 1 69  ? -2.695  94.363  36.965  1.00   25.19 ? 69   LEU D CB  1 
ATOM   8847  C CG  . LEU D 1 69  ? -1.889  93.856  35.752  1.00   28.02 ? 69   LEU D CG  1 
ATOM   8848  C CD1 . LEU D 1 69  ? -0.634  94.661  35.569  1.00   25.85 ? 69   LEU D CD1 1 
ATOM   8849  C CD2 . LEU D 1 69  ? -1.551  92.376  35.921  1.00   27.91 ? 69   LEU D CD2 1 
ATOM   8850  N N   . ASP D 1 70  ? -3.811  96.025  39.566  1.00   34.03 ? 70   ASP D N   1 
ATOM   8851  C CA  . ASP D 1 70  ? -4.897  96.741  40.222  1.00   36.85 ? 70   ASP D CA  1 
ATOM   8852  C C   . ASP D 1 70  ? -6.072  97.072  39.305  1.00   36.25 ? 70   ASP D C   1 
ATOM   8853  O O   . ASP D 1 70  ? -6.440  98.223  39.149  1.00   36.75 ? 70   ASP D O   1 
ATOM   8854  C CB  . ASP D 1 70  ? -4.341  98.033  40.850  1.00   39.00 ? 70   ASP D CB  1 
ATOM   8855  C CG  . ASP D 1 70  ? -5.276  98.640  41.892  1.00   40.09 ? 70   ASP D CG  1 
ATOM   8856  O OD1 . ASP D 1 70  ? -4.951  99.721  42.412  1.00   43.22 ? 70   ASP D OD1 1 
ATOM   8857  O OD2 . ASP D 1 70  ? -6.334  98.046  42.202  1.00   44.74 ? 70   ASP D OD2 1 
ATOM   8858  N N   . THR D 1 71  ? -6.661  96.059  38.693  1.00   38.84 ? 71   THR D N   1 
ATOM   8859  C CA  . THR D 1 71  ? -7.804  96.285  37.827  1.00   39.44 ? 71   THR D CA  1 
ATOM   8860  C C   . THR D 1 71  ? -9.026  95.811  38.597  1.00   41.25 ? 71   THR D C   1 
ATOM   8861  O O   . THR D 1 71  ? -8.988  95.684  39.814  1.00   41.87 ? 71   THR D O   1 
ATOM   8862  C CB  . THR D 1 71  ? -7.696  95.484  36.513  1.00   39.56 ? 71   THR D CB  1 
ATOM   8863  O OG1 . THR D 1 71  ? -7.810  94.078  36.790  1.00   38.86 ? 71   THR D OG1 1 
ATOM   8864  C CG2 . THR D 1 71  ? -6.365  95.759  35.836  1.00   35.11 ? 71   THR D CG2 1 
ATOM   8865  N N   . ASP D 1 72  ? -10.112 95.538  37.896  1.00   43.56 ? 72   ASP D N   1 
ATOM   8866  C CA  . ASP D 1 72  ? -11.318 95.078  38.564  1.00   44.83 ? 72   ASP D CA  1 
ATOM   8867  C C   . ASP D 1 72  ? -12.066 94.137  37.640  1.00   43.67 ? 72   ASP D C   1 
ATOM   8868  O O   . ASP D 1 72  ? -13.277 93.968  37.765  1.00   46.02 ? 72   ASP D O   1 
ATOM   8869  C CB  . ASP D 1 72  ? -12.214 96.262  38.929  1.00   48.72 ? 72   ASP D CB  1 
ATOM   8870  C CG  . ASP D 1 72  ? -12.721 97.006  37.704  1.00   53.66 ? 72   ASP D CG  1 
ATOM   8871  O OD1 . ASP D 1 72  ? -13.583 97.895  37.861  1.00   53.64 ? 72   ASP D OD1 1 
ATOM   8872  O OD2 . ASP D 1 72  ? -12.258 96.697  36.580  1.00   56.20 ? 72   ASP D OD2 1 
ATOM   8873  N N   . PHE D 1 73  ? -11.333 93.538  36.706  1.00   41.80 ? 73   PHE D N   1 
ATOM   8874  C CA  . PHE D 1 73  ? -11.917 92.601  35.754  1.00   39.18 ? 73   PHE D CA  1 
ATOM   8875  C C   . PHE D 1 73  ? -10.939 91.457  35.492  1.00   37.97 ? 73   PHE D C   1 
ATOM   8876  O O   . PHE D 1 73  ? -11.307 90.431  34.928  1.00   38.06 ? 73   PHE D O   1 
ATOM   8877  C CB  . PHE D 1 73  ? -12.277 93.321  34.438  1.00   35.63 ? 73   PHE D CB  1 
ATOM   8878  C CG  . PHE D 1 73  ? -11.090 93.833  33.668  1.00   35.17 ? 73   PHE D CG  1 
ATOM   8879  C CD1 . PHE D 1 73  ? -10.522 93.062  32.653  1.00   35.50 ? 73   PHE D CD1 1 
ATOM   8880  C CD2 . PHE D 1 73  ? -10.499 95.056  33.995  1.00   31.76 ? 73   PHE D CD2 1 
ATOM   8881  C CE1 . PHE D 1 73  ? -9.390  93.489  31.985  1.00   32.10 ? 73   PHE D CE1 1 
ATOM   8882  C CE2 . PHE D 1 73  ? -9.358  95.492  33.326  1.00   33.30 ? 73   PHE D CE2 1 
ATOM   8883  C CZ  . PHE D 1 73  ? -8.802  94.708  32.324  1.00   31.11 ? 73   PHE D CZ  1 
ATOM   8884  N N   . LEU D 1 74  ? -9.690  91.630  35.909  1.00   37.03 ? 74   LEU D N   1 
ATOM   8885  C CA  . LEU D 1 74  ? -8.695  90.588  35.699  1.00   35.52 ? 74   LEU D CA  1 
ATOM   8886  C C   . LEU D 1 74  ? -8.773  89.463  36.719  1.00   35.33 ? 74   LEU D C   1 
ATOM   8887  O O   . LEU D 1 74  ? -9.022  89.695  37.906  1.00   36.34 ? 74   LEU D O   1 
ATOM   8888  C CB  . LEU D 1 74  ? -7.285  91.178  35.721  1.00   32.68 ? 74   LEU D CB  1 
ATOM   8889  C CG  . LEU D 1 74  ? -6.897  92.060  34.531  1.00   33.33 ? 74   LEU D CG  1 
ATOM   8890  C CD1 . LEU D 1 74  ? -5.440  92.505  34.656  1.00   27.59 ? 74   LEU D CD1 1 
ATOM   8891  C CD2 . LEU D 1 74  ? -7.114  91.286  33.239  1.00   28.72 ? 74   LEU D CD2 1 
ATOM   8892  N N   . SER D 1 75  ? -8.576  88.234  36.253  1.00   33.93 ? 75   SER D N   1 
ATOM   8893  C CA  . SER D 1 75  ? -8.564  87.091  37.161  1.00   32.39 ? 75   SER D CA  1 
ATOM   8894  C C   . SER D 1 75  ? -7.244  86.388  36.900  1.00   30.65 ? 75   SER D C   1 
ATOM   8895  O O   . SER D 1 75  ? -6.498  86.762  35.992  1.00   28.34 ? 75   SER D O   1 
ATOM   8896  C CB  . SER D 1 75  ? -9.722  86.125  36.885  1.00   30.87 ? 75   SER D CB  1 
ATOM   8897  O OG  . SER D 1 75  ? -9.454  85.303  35.764  1.00   34.94 ? 75   SER D OG  1 
ATOM   8898  N N   . LYS D 1 76  ? -6.959  85.369  37.702  1.00   30.15 ? 76   LYS D N   1 
ATOM   8899  C CA  . LYS D 1 76  ? -5.726  84.600  37.550  1.00   28.85 ? 76   LYS D CA  1 
ATOM   8900  C C   . LYS D 1 76  ? -5.626  83.966  36.154  1.00   30.11 ? 76   LYS D C   1 
ATOM   8901  O O   . LYS D 1 76  ? -4.559  83.519  35.740  1.00   30.41 ? 76   LYS D O   1 
ATOM   8902  C CB  . LYS D 1 76  ? -5.666  83.519  38.621  1.00   27.23 ? 76   LYS D CB  1 
ATOM   8903  C CG  . LYS D 1 76  ? -6.722  82.401  38.498  1.00   22.12 ? 76   LYS D CG  1 
ATOM   8904  C CD  . LYS D 1 76  ? -6.634  81.459  39.702  1.00   19.35 ? 76   LYS D CD  1 
ATOM   8905  C CE  . LYS D 1 76  ? -7.259  80.075  39.434  1.00   28.00 ? 76   LYS D CE  1 
ATOM   8906  N NZ  . LYS D 1 76  ? -6.986  79.103  40.553  1.00   27.20 ? 76   LYS D NZ  1 
ATOM   8907  N N   . ASN D 1 77  ? -6.744  83.946  35.433  1.00   30.39 ? 77   ASN D N   1 
ATOM   8908  C CA  . ASN D 1 77  ? -6.800  83.356  34.105  1.00   30.53 ? 77   ASN D CA  1 
ATOM   8909  C C   . ASN D 1 77  ? -6.316  84.264  32.984  1.00   29.23 ? 77   ASN D C   1 
ATOM   8910  O O   . ASN D 1 77  ? -6.118  83.802  31.860  1.00   29.63 ? 77   ASN D O   1 
ATOM   8911  C CB  . ASN D 1 77  ? -8.235  82.905  33.799  1.00   33.31 ? 77   ASN D CB  1 
ATOM   8912  C CG  . ASN D 1 77  ? -8.649  81.689  34.603  1.00   36.66 ? 77   ASN D CG  1 
ATOM   8913  O OD1 . ASN D 1 77  ? -9.707  81.669  35.225  1.00   40.82 ? 77   ASN D OD1 1 
ATOM   8914  N ND2 . ASN D 1 77  ? -7.806  80.660  34.588  1.00   32.98 ? 77   ASN D ND2 1 
ATOM   8915  N N   . ASN D 1 78  ? -6.113  85.545  33.284  1.00   26.16 ? 78   ASN D N   1 
ATOM   8916  C CA  . ASN D 1 78  ? -5.693  86.506  32.269  1.00   24.78 ? 78   ASN D CA  1 
ATOM   8917  C C   . ASN D 1 78  ? -4.220  86.791  32.283  1.00   24.21 ? 78   ASN D C   1 
ATOM   8918  O O   . ASN D 1 78  ? -3.729  87.593  31.494  1.00   23.83 ? 78   ASN D O   1 
ATOM   8919  C CB  . ASN D 1 78  ? -6.419  87.827  32.480  1.00   22.26 ? 78   ASN D CB  1 
ATOM   8920  C CG  . ASN D 1 78  ? -7.905  87.683  32.379  1.00   20.91 ? 78   ASN D CG  1 
ATOM   8921  O OD1 . ASN D 1 78  ? -8.617  87.705  33.383  1.00   20.36 ? 78   ASN D OD1 1 
ATOM   8922  N ND2 . ASN D 1 78  ? -8.392  87.527  31.155  1.00   22.55 ? 78   ASN D ND2 1 
ATOM   8923  N N   . VAL D 1 79  ? -3.524  86.103  33.174  1.00   25.15 ? 79   VAL D N   1 
ATOM   8924  C CA  . VAL D 1 79  ? -2.117  86.326  33.388  1.00   22.66 ? 79   VAL D CA  1 
ATOM   8925  C C   . VAL D 1 79  ? -1.245  85.091  33.281  1.00   24.90 ? 79   VAL D C   1 
ATOM   8926  O O   . VAL D 1 79  ? -1.601  84.021  33.774  1.00   26.76 ? 79   VAL D O   1 
ATOM   8927  C CB  . VAL D 1 79  ? -1.949  86.942  34.802  1.00   23.37 ? 79   VAL D CB  1 
ATOM   8928  C CG1 . VAL D 1 79  ? -0.473  87.084  35.172  1.00   17.02 ? 79   VAL D CG1 1 
ATOM   8929  C CG2 . VAL D 1 79  ? -2.679  88.284  34.848  1.00   19.36 ? 79   VAL D CG2 1 
ATOM   8930  N N   . SER D 1 80  ? -0.099  85.230  32.629  1.00   23.60 ? 80   SER D N   1 
ATOM   8931  C CA  . SER D 1 80  ? 0.831   84.116  32.560  1.00   23.78 ? 80   SER D CA  1 
ATOM   8932  C C   . SER D 1 80  ? 2.219   84.716  32.661  1.00   25.05 ? 80   SER D C   1 
ATOM   8933  O O   . SER D 1 80  ? 2.364   85.933  32.594  1.00   27.69 ? 80   SER D O   1 
ATOM   8934  C CB  . SER D 1 80  ? 0.691   83.333  31.266  1.00   23.09 ? 80   SER D CB  1 
ATOM   8935  O OG  . SER D 1 80  ? 1.374   82.105  31.419  1.00   23.75 ? 80   SER D OG  1 
ATOM   8936  N N   . VAL D 1 81  ? 3.236   83.877  32.822  1.00   24.55 ? 81   VAL D N   1 
ATOM   8937  C CA  . VAL D 1 81  ? 4.596   84.377  32.953  1.00   24.52 ? 81   VAL D CA  1 
ATOM   8938  C C   . VAL D 1 81  ? 5.508   83.903  31.840  1.00   24.22 ? 81   VAL D C   1 
ATOM   8939  O O   . VAL D 1 81  ? 5.243   82.896  31.171  1.00   24.24 ? 81   VAL D O   1 
ATOM   8940  C CB  . VAL D 1 81  ? 5.211   83.950  34.313  1.00   28.65 ? 81   VAL D CB  1 
ATOM   8941  C CG1 . VAL D 1 81  ? 5.424   82.431  34.358  1.00   29.47 ? 81   VAL D CG1 1 
ATOM   8942  C CG2 . VAL D 1 81  ? 6.518   84.659  34.523  1.00   31.92 ? 81   VAL D CG2 1 
ATOM   8943  N N   . GLY D 1 82  ? 6.587   84.652  31.651  1.00   21.15 ? 82   GLY D N   1 
ATOM   8944  C CA  . GLY D 1 82  ? 7.549   84.315  30.630  1.00   19.62 ? 82   GLY D CA  1 
ATOM   8945  C C   . GLY D 1 82  ? 8.960   84.335  31.188  1.00   20.60 ? 82   GLY D C   1 
ATOM   8946  O O   . GLY D 1 82  ? 9.236   84.998  32.190  1.00   20.15 ? 82   GLY D O   1 
ATOM   8947  N N   . ASN D 1 83  ? 9.846   83.575  30.555  1.00   19.59 ? 83   ASN D N   1 
ATOM   8948  C CA  . ASN D 1 83  ? 11.248  83.532  30.935  1.00   19.38 ? 83   ASN D CA  1 
ATOM   8949  C C   . ASN D 1 83  ? 11.808  84.825  30.371  1.00   21.47 ? 83   ASN D C   1 
ATOM   8950  O O   . ASN D 1 83  ? 12.654  84.818  29.478  1.00   20.46 ? 83   ASN D O   1 
ATOM   8951  C CB  . ASN D 1 83  ? 11.947  82.346  30.264  1.00   21.87 ? 83   ASN D CB  1 
ATOM   8952  C CG  . ASN D 1 83  ? 13.440  82.301  30.573  1.00   23.68 ? 83   ASN D CG  1 
ATOM   8953  O OD1 . ASN D 1 83  ? 13.846  82.573  31.703  1.00   27.46 ? 83   ASN D OD1 1 
ATOM   8954  N ND2 . ASN D 1 83  ? 14.260  81.955  29.575  1.00   24.19 ? 83   ASN D ND2 1 
ATOM   8955  N N   . GLY D 1 84  ? 11.288  85.924  30.902  1.00   22.60 ? 84   GLY D N   1 
ATOM   8956  C CA  . GLY D 1 84  ? 11.643  87.246  30.429  1.00   25.01 ? 84   GLY D CA  1 
ATOM   8957  C C   . GLY D 1 84  ? 10.543  87.595  29.443  1.00   23.18 ? 84   GLY D C   1 
ATOM   8958  O O   . GLY D 1 84  ? 9.790   86.719  29.030  1.00   25.85 ? 84   GLY D O   1 
ATOM   8959  N N   . ALA D 1 85  ? 10.410  88.862  29.083  1.00   22.94 ? 85   ALA D N   1 
ATOM   8960  C CA  . ALA D 1 85  ? 9.393   89.219  28.101  1.00   20.97 ? 85   ALA D CA  1 
ATOM   8961  C C   . ALA D 1 85  ? 9.815   88.666  26.725  1.00   20.21 ? 85   ALA D C   1 
ATOM   8962  O O   . ALA D 1 85  ? 8.989   88.509  25.828  1.00   17.89 ? 85   ALA D O   1 
ATOM   8963  C CB  . ALA D 1 85  ? 9.232   90.731  28.031  1.00   21.10 ? 85   ALA D CB  1 
ATOM   8964  N N   . ASP D 1 86  ? 11.107  88.385  26.562  1.00   19.52 ? 86   ASP D N   1 
ATOM   8965  C CA  . ASP D 1 86  ? 11.612  87.825  25.313  1.00   22.48 ? 86   ASP D CA  1 
ATOM   8966  C C   . ASP D 1 86  ? 10.938  86.481  25.038  1.00   23.66 ? 86   ASP D C   1 
ATOM   8967  O O   . ASP D 1 86  ? 10.550  86.213  23.903  1.00   22.74 ? 86   ASP D O   1 
ATOM   8968  C CB  . ASP D 1 86  ? 13.123  87.595  25.382  1.00   23.85 ? 86   ASP D CB  1 
ATOM   8969  C CG  . ASP D 1 86  ? 13.925  88.854  25.153  1.00   26.75 ? 86   ASP D CG  1 
ATOM   8970  O OD1 . ASP D 1 86  ? 13.318  89.941  25.083  1.00   32.34 ? 86   ASP D OD1 1 
ATOM   8971  O OD2 . ASP D 1 86  ? 15.169  88.755  25.037  1.00   27.49 ? 86   ASP D OD2 1 
ATOM   8972  N N   . GLU D 1 87  ? 10.767  85.652  26.068  1.00   22.20 ? 87   GLU D N   1 
ATOM   8973  C CA  . GLU D 1 87  ? 10.174  84.344  25.834  1.00   24.81 ? 87   GLU D CA  1 
ATOM   8974  C C   . GLU D 1 87  ? 8.739   84.476  25.393  1.00   25.26 ? 87   GLU D C   1 
ATOM   8975  O O   . GLU D 1 87  ? 8.282   83.717  24.534  1.00   26.91 ? 87   GLU D O   1 
ATOM   8976  C CB  . GLU D 1 87  ? 10.263  83.415  27.066  1.00   24.83 ? 87   GLU D CB  1 
ATOM   8977  C CG  . GLU D 1 87  ? 9.781   81.992  26.775  1.00   21.37 ? 87   GLU D CG  1 
ATOM   8978  C CD  . GLU D 1 87  ? 9.552   81.144  28.017  1.00   23.84 ? 87   GLU D CD  1 
ATOM   8979  O OE1 . GLU D 1 87  ? 8.760   81.535  28.924  1.00   21.48 ? 87   GLU D OE1 1 
ATOM   8980  O OE2 . GLU D 1 87  ? 10.157  80.067  28.085  1.00   27.77 ? 87   GLU D OE2 1 
ATOM   8981  N N   . ILE D 1 88  ? 8.033   85.451  25.961  1.00   26.21 ? 88   ILE D N   1 
ATOM   8982  C CA  . ILE D 1 88  ? 6.634   85.673  25.605  1.00   24.40 ? 88   ILE D CA  1 
ATOM   8983  C C   . ILE D 1 88  ? 6.500   86.032  24.117  1.00   23.81 ? 88   ILE D C   1 
ATOM   8984  O O   . ILE D 1 88  ? 5.634   85.505  23.421  1.00   22.29 ? 88   ILE D O   1 
ATOM   8985  C CB  . ILE D 1 88  ? 6.030   86.777  26.503  1.00   25.42 ? 88   ILE D CB  1 
ATOM   8986  C CG1 . ILE D 1 88  ? 5.985   86.267  27.945  1.00   19.71 ? 88   ILE D CG1 1 
ATOM   8987  C CG2 . ILE D 1 88  ? 4.615   87.188  26.003  1.00   21.19 ? 88   ILE D CG2 1 
ATOM   8988  C CD1 . ILE D 1 88  ? 5.661   87.344  28.981  1.00   16.42 ? 88   ILE D CD1 1 
ATOM   8989  N N   . ILE D 1 89  ? 7.388   86.904  23.650  1.00   23.79 ? 89   ILE D N   1 
ATOM   8990  C CA  . ILE D 1 89  ? 7.435   87.347  22.261  1.00   21.02 ? 89   ILE D CA  1 
ATOM   8991  C C   . ILE D 1 89  ? 7.755   86.155  21.374  1.00   22.29 ? 89   ILE D C   1 
ATOM   8992  O O   . ILE D 1 89  ? 7.114   85.927  20.343  1.00   22.63 ? 89   ILE D O   1 
ATOM   8993  C CB  . ILE D 1 89  ? 8.537   88.377  22.086  1.00   16.39 ? 89   ILE D CB  1 
ATOM   8994  C CG1 . ILE D 1 89  ? 8.132   89.661  22.805  1.00   18.66 ? 89   ILE D CG1 1 
ATOM   8995  C CG2 . ILE D 1 89  ? 8.833   88.594  20.608  1.00   15.30 ? 89   ILE D CG2 1 
ATOM   8996  C CD1 . ILE D 1 89  ? 9.324   90.633  23.071  1.00   18.70 ? 89   ILE D CD1 1 
ATOM   8997  N N   . TYR D 1 90  ? 8.770   85.413  21.799  1.00   23.04 ? 90   TYR D N   1 
ATOM   8998  C CA  . TYR D 1 90  ? 9.248   84.224  21.108  1.00   23.35 ? 90   TYR D CA  1 
ATOM   8999  C C   . TYR D 1 90  ? 8.128   83.169  20.883  1.00   22.35 ? 90   TYR D C   1 
ATOM   9000  O O   . TYR D 1 90  ? 7.847   82.794  19.746  1.00   21.44 ? 90   TYR D O   1 
ATOM   9001  C CB  . TYR D 1 90  ? 10.419  83.661  21.924  1.00   17.80 ? 90   TYR D CB  1 
ATOM   9002  C CG  . TYR D 1 90  ? 11.235  82.577  21.266  1.00   16.17 ? 90   TYR D CG  1 
ATOM   9003  C CD1 . TYR D 1 90  ? 10.843  81.242  21.332  1.00   13.83 ? 90   TYR D CD1 1 
ATOM   9004  C CD2 . TYR D 1 90  ? 12.478  82.871  20.712  1.00   17.74 ? 90   TYR D CD2 1 
ATOM   9005  C CE1 . TYR D 1 90  ? 11.670  80.235  20.892  1.00   15.60 ? 90   TYR D CE1 1 
ATOM   9006  C CE2 . TYR D 1 90  ? 13.336  81.851  20.262  1.00   20.21 ? 90   TYR D CE2 1 
ATOM   9007  C CZ  . TYR D 1 90  ? 12.929  80.538  20.362  1.00   18.84 ? 90   TYR D CZ  1 
ATOM   9008  O OH  . TYR D 1 90  ? 13.792  79.532  19.966  1.00   14.54 ? 90   TYR D OH  1 
ATOM   9009  N N   . VAL D 1 91  ? 7.451   82.742  21.948  1.00   22.85 ? 91   VAL D N   1 
ATOM   9010  C CA  . VAL D 1 91  ? 6.407   81.730  21.792  1.00   25.87 ? 91   VAL D CA  1 
ATOM   9011  C C   . VAL D 1 91  ? 5.228   82.264  20.987  1.00   25.07 ? 91   VAL D C   1 
ATOM   9012  O O   . VAL D 1 91  ? 4.556   81.524  20.271  1.00   26.21 ? 91   VAL D O   1 
ATOM   9013  C CB  . VAL D 1 91  ? 5.912   81.191  23.137  1.00   25.37 ? 91   VAL D CB  1 
ATOM   9014  C CG1 . VAL D 1 91  ? 7.085   80.961  24.067  1.00   24.31 ? 91   VAL D CG1 1 
ATOM   9015  C CG2 . VAL D 1 91  ? 4.933   82.114  23.716  1.00   29.86 ? 91   VAL D CG2 1 
ATOM   9016  N N   . MET D 1 92  ? 4.988   83.558  21.090  1.00   25.95 ? 92   MET D N   1 
ATOM   9017  C CA  . MET D 1 92  ? 3.924   84.147  20.316  1.00   24.23 ? 92   MET D CA  1 
ATOM   9018  C C   . MET D 1 92  ? 4.205   84.007  18.822  1.00   22.54 ? 92   MET D C   1 
ATOM   9019  O O   . MET D 1 92  ? 3.295   83.760  18.052  1.00   17.78 ? 92   MET D O   1 
ATOM   9020  C CB  . MET D 1 92  ? 3.769   85.623  20.674  1.00   25.97 ? 92   MET D CB  1 
ATOM   9021  C CG  . MET D 1 92  ? 3.012   85.840  21.972  1.00   23.77 ? 92   MET D CG  1 
ATOM   9022  S SD  . MET D 1 92  ? 2.635   87.575  22.153  1.00   23.06 ? 92   MET D SD  1 
ATOM   9023  C CE  . MET D 1 92  ? 2.095   87.674  23.781  1.00   20.38 ? 92   MET D CE  1 
ATOM   9024  N N   . MET D 1 93  ? 5.462   84.168  18.414  1.00   23.65 ? 93   MET D N   1 
ATOM   9025  C CA  . MET D 1 93  ? 5.823   84.046  17.004  1.00   22.71 ? 93   MET D CA  1 
ATOM   9026  C C   . MET D 1 93  ? 5.603   82.629  16.534  1.00   24.59 ? 93   MET D C   1 
ATOM   9027  O O   . MET D 1 93  ? 5.421   82.386  15.346  1.00   23.49 ? 93   MET D O   1 
ATOM   9028  C CB  . MET D 1 93  ? 7.287   84.403  16.766  1.00   21.36 ? 93   MET D CB  1 
ATOM   9029  C CG  . MET D 1 93  ? 7.584   85.862  17.019  1.00   25.92 ? 93   MET D CG  1 
ATOM   9030  S SD  . MET D 1 93  ? 9.212   86.464  16.532  1.00   23.32 ? 93   MET D SD  1 
ATOM   9031  C CE  . MET D 1 93  ? 8.714   88.162  16.086  1.00   22.02 ? 93   MET D CE  1 
ATOM   9032  N N   . LEU D 1 94  ? 5.648   81.689  17.473  1.00   25.25 ? 94   LEU D N   1 
ATOM   9033  C CA  . LEU D 1 94  ? 5.437   80.296  17.133  1.00   24.90 ? 94   LEU D CA  1 
ATOM   9034  C C   . LEU D 1 94  ? 3.945   80.042  17.074  1.00   25.27 ? 94   LEU D C   1 
ATOM   9035  O O   . LEU D 1 94  ? 3.519   78.980  16.645  1.00   29.34 ? 94   LEU D O   1 
ATOM   9036  C CB  . LEU D 1 94  ? 6.028   79.404  18.210  1.00   21.82 ? 94   LEU D CB  1 
ATOM   9037  C CG  . LEU D 1 94  ? 7.525   79.494  18.436  1.00   22.84 ? 94   LEU D CG  1 
ATOM   9038  C CD1 . LEU D 1 94  ? 7.853   78.776  19.729  1.00   23.89 ? 94   LEU D CD1 1 
ATOM   9039  C CD2 . LEU D 1 94  ? 8.276   78.867  17.241  1.00   22.81 ? 94   LEU D CD2 1 
ATOM   9040  N N   . MET D 1 95  ? 3.156   81.018  17.509  1.00   25.91 ? 95   MET D N   1 
ATOM   9041  C CA  . MET D 1 95  ? 1.709   80.817  17.563  1.00   29.72 ? 95   MET D CA  1 
ATOM   9042  C C   . MET D 1 95  ? 0.908   81.318  16.389  1.00   30.13 ? 95   MET D C   1 
ATOM   9043  O O   . MET D 1 95  ? -0.115  80.742  16.059  1.00   32.08 ? 95   MET D O   1 
ATOM   9044  C CB  . MET D 1 95  ? 1.130   81.435  18.837  1.00   26.07 ? 95   MET D CB  1 
ATOM   9045  C CG  . MET D 1 95  ? 1.620   80.828  20.147  1.00   27.03 ? 95   MET D CG  1 
ATOM   9046  S SD  . MET D 1 95  ? 1.119   81.838  21.605  1.00   27.34 ? 95   MET D SD  1 
ATOM   9047  C CE  . MET D 1 95  ? -0.714  81.660  21.543  1.00   17.47 ? 95   MET D CE  1 
ATOM   9048  N N   . PHE D 1 96  ? 1.371   82.379  15.747  1.00   31.90 ? 96   PHE D N   1 
ATOM   9049  C CA  . PHE D 1 96  ? 0.637   82.950  14.628  1.00   29.96 ? 96   PHE D CA  1 
ATOM   9050  C C   . PHE D 1 96  ? 1.230   82.637  13.263  1.00   32.20 ? 96   PHE D C   1 
ATOM   9051  O O   . PHE D 1 96  ? 2.376   82.205  13.145  1.00   28.03 ? 96   PHE D O   1 
ATOM   9052  C CB  . PHE D 1 96  ? 0.538   84.447  14.866  1.00   31.37 ? 96   PHE D CB  1 
ATOM   9053  C CG  . PHE D 1 96  ? -0.140  84.780  16.156  1.00   29.63 ? 96   PHE D CG  1 
ATOM   9054  C CD1 . PHE D 1 96  ? -1.508  85.032  16.200  1.00   27.72 ? 96   PHE D CD1 1 
ATOM   9055  C CD2 . PHE D 1 96  ? 0.561   84.705  17.348  1.00   27.80 ? 96   PHE D CD2 1 
ATOM   9056  C CE1 . PHE D 1 96  ? -2.163  85.192  17.418  1.00   25.91 ? 96   PHE D CE1 1 
ATOM   9057  C CE2 . PHE D 1 96  ? -0.078  84.861  18.568  1.00   28.10 ? 96   PHE D CE2 1 
ATOM   9058  C CZ  . PHE D 1 96  ? -1.444  85.103  18.608  1.00   28.17 ? 96   PHE D CZ  1 
ATOM   9059  N N   . ASP D 1 97  ? 0.433   82.841  12.219  1.00   34.06 ? 97   ASP D N   1 
ATOM   9060  C CA  . ASP D 1 97  ? 0.891   82.574  10.860  1.00   35.66 ? 97   ASP D CA  1 
ATOM   9061  C C   . ASP D 1 97  ? 1.976   83.550  10.407  1.00   34.15 ? 97   ASP D C   1 
ATOM   9062  O O   . ASP D 1 97  ? 2.913   83.164  9.739   1.00   37.28 ? 97   ASP D O   1 
ATOM   9063  C CB  . ASP D 1 97  ? -0.284  82.634  9.883   1.00   37.53 ? 97   ASP D CB  1 
ATOM   9064  C CG  . ASP D 1 97  ? -1.346  81.590  10.181  1.00   42.62 ? 97   ASP D CG  1 
ATOM   9065  O OD1 . ASP D 1 97  ? -1.002  80.394  10.265  1.00   48.84 ? 97   ASP D OD1 1 
ATOM   9066  O OD2 . ASP D 1 97  ? -2.529  81.954  10.325  1.00   47.11 ? 97   ASP D OD2 1 
ATOM   9067  N N   . ARG D 1 98  ? 1.842   84.817  10.773  1.00   32.15 ? 98   ARG D N   1 
ATOM   9068  C CA  . ARG D 1 98  ? 2.807   85.821  10.372  1.00   29.35 ? 98   ARG D CA  1 
ATOM   9069  C C   . ARG D 1 98  ? 2.949   86.900  11.445  1.00   28.66 ? 98   ARG D C   1 
ATOM   9070  O O   . ARG D 1 98  ? 1.960   87.308  12.067  1.00   29.10 ? 98   ARG D O   1 
ATOM   9071  C CB  . ARG D 1 98  ? 2.370   86.449  9.034   1.00   27.30 ? 98   ARG D CB  1 
ATOM   9072  C CG  . ARG D 1 98  ? 3.264   87.564  8.540   1.00   19.28 ? 98   ARG D CG  1 
ATOM   9073  C CD  . ARG D 1 98  ? 2.655   88.261  7.325   1.00   28.29 ? 98   ARG D CD  1 
ATOM   9074  N NE  . ARG D 1 98  ? 1.357   88.909  7.558   1.00   24.34 ? 98   ARG D NE  1 
ATOM   9075  C CZ  . ARG D 1 98  ? 0.909   89.946  6.844   1.00   25.34 ? 98   ARG D CZ  1 
ATOM   9076  N NH1 . ARG D 1 98  ? 1.634   90.450  5.859   1.00   27.11 ? 98   ARG D NH1 1 
ATOM   9077  N NH2 . ARG D 1 98  ? -0.263  90.492  7.110   1.00   22.51 ? 98   ARG D NH2 1 
ATOM   9078  N N   . SER D 1 99  ? 4.184   87.343  11.663  1.00   26.13 ? 99   SER D N   1 
ATOM   9079  C CA  . SER D 1 99  ? 4.465   88.377  12.650  1.00   26.89 ? 99   SER D CA  1 
ATOM   9080  C C   . SER D 1 99  ? 4.709   89.672  11.905  1.00   27.31 ? 99   SER D C   1 
ATOM   9081  O O   . SER D 1 99  ? 5.328   89.672  10.831  1.00   29.75 ? 99   SER D O   1 
ATOM   9082  C CB  . SER D 1 99  ? 5.693   88.019  13.493  1.00   25.59 ? 99   SER D CB  1 
ATOM   9083  O OG  . SER D 1 99  ? 5.358   87.079  14.498  1.00   26.69 ? 99   SER D OG  1 
ATOM   9084  N N   . VAL D 1 100 ? 4.220   90.772  12.470  1.00   25.64 ? 100  VAL D N   1 
ATOM   9085  C CA  . VAL D 1 100 ? 4.358   92.088  11.842  1.00   23.11 ? 100  VAL D CA  1 
ATOM   9086  C C   . VAL D 1 100 ? 4.864   93.075  12.872  1.00   22.48 ? 100  VAL D C   1 
ATOM   9087  O O   . VAL D 1 100 ? 4.481   93.038  14.036  1.00   23.71 ? 100  VAL D O   1 
ATOM   9088  C CB  . VAL D 1 100 ? 2.981   92.563  11.275  1.00   22.72 ? 100  VAL D CB  1 
ATOM   9089  C CG1 . VAL D 1 100 ? 3.127   93.892  10.527  1.00   24.77 ? 100  VAL D CG1 1 
ATOM   9090  C CG2 . VAL D 1 100 ? 2.425   91.494  10.327  1.00   19.30 ? 100  VAL D CG2 1 
ATOM   9091  N N   . PHE D 1 101 ? 5.791   93.920  12.465  1.00   22.33 ? 101  PHE D N   1 
ATOM   9092  C CA  . PHE D 1 101 ? 6.319   94.919  13.380  1.00   22.76 ? 101  PHE D CA  1 
ATOM   9093  C C   . PHE D 1 101 ? 6.804   96.061  12.519  1.00   22.95 ? 101  PHE D C   1 
ATOM   9094  O O   . PHE D 1 101 ? 6.925   95.867  11.320  1.00   18.48 ? 101  PHE D O   1 
ATOM   9095  C CB  . PHE D 1 101 ? 7.426   94.342  14.302  1.00   20.82 ? 101  PHE D CB  1 
ATOM   9096  C CG  . PHE D 1 101 ? 8.186   93.184  13.726  1.00   18.50 ? 101  PHE D CG  1 
ATOM   9097  C CD1 . PHE D 1 101 ? 9.429   93.367  13.117  1.00   20.43 ? 101  PHE D CD1 1 
ATOM   9098  C CD2 . PHE D 1 101 ? 7.692   91.899  13.867  1.00   19.11 ? 101  PHE D CD2 1 
ATOM   9099  C CE1 . PHE D 1 101 ? 10.186  92.255  12.667  1.00   23.76 ? 101  PHE D CE1 1 
ATOM   9100  C CE2 . PHE D 1 101 ? 8.419   90.797  13.431  1.00   22.12 ? 101  PHE D CE2 1 
ATOM   9101  C CZ  . PHE D 1 101 ? 9.673   90.966  12.832  1.00   20.93 ? 101  PHE D CZ  1 
ATOM   9102  N N   . PHE D 1 102 ? 7.064   97.232  13.112  1.00   23.49 ? 102  PHE D N   1 
ATOM   9103  C CA  . PHE D 1 102 ? 7.421   98.413  12.329  1.00   21.30 ? 102  PHE D CA  1 
ATOM   9104  C C   . PHE D 1 102 ? 8.655   99.138  12.781  1.00   23.89 ? 102  PHE D C   1 
ATOM   9105  O O   . PHE D 1 102 ? 8.654   99.789  13.822  1.00   24.55 ? 102  PHE D O   1 
ATOM   9106  C CB  . PHE D 1 102 ? 6.266   99.403  12.353  1.00   24.04 ? 102  PHE D CB  1 
ATOM   9107  C CG  . PHE D 1 102 ? 4.912   98.757  12.316  1.00   23.81 ? 102  PHE D CG  1 
ATOM   9108  C CD1 . PHE D 1 102 ? 4.201   98.568  13.490  1.00   27.33 ? 102  PHE D CD1 1 
ATOM   9109  C CD2 . PHE D 1 102 ? 4.351   98.342  11.126  1.00   24.39 ? 102  PHE D CD2 1 
ATOM   9110  C CE1 . PHE D 1 102 ? 2.952   97.977  13.487  1.00   24.04 ? 102  PHE D CE1 1 
ATOM   9111  C CE2 . PHE D 1 102 ? 3.099   97.747  11.112  1.00   27.23 ? 102  PHE D CE2 1 
ATOM   9112  C CZ  . PHE D 1 102 ? 2.397   97.565  12.296  1.00   25.99 ? 102  PHE D CZ  1 
ATOM   9113  N N   . PRO D 1 103 ? 9.723   99.100  11.966  1.00   24.71 ? 103  PRO D N   1 
ATOM   9114  C CA  . PRO D 1 103 ? 10.959  99.772  12.345  1.00   24.34 ? 103  PRO D CA  1 
ATOM   9115  C C   . PRO D 1 103 ? 10.955  101.280 12.134  1.00   26.53 ? 103  PRO D C   1 
ATOM   9116  O O   . PRO D 1 103 ? 10.307  101.774 11.206  1.00   25.98 ? 103  PRO D O   1 
ATOM   9117  C CB  . PRO D 1 103 ? 12.010  99.043  11.509  1.00   23.06 ? 103  PRO D CB  1 
ATOM   9118  C CG  . PRO D 1 103 ? 11.290  98.625  10.333  1.00   22.13 ? 103  PRO D CG  1 
ATOM   9119  C CD  . PRO D 1 103 ? 9.871   98.372  10.696  1.00   19.91 ? 103  PRO D CD  1 
ATOM   9120  N N   . PRO D 1 104 ? 11.678  102.031 13.005  1.00   27.43 ? 104  PRO D N   1 
ATOM   9121  C CA  . PRO D 1 104 ? 12.478  101.525 14.148  1.00   26.11 ? 104  PRO D CA  1 
ATOM   9122  C C   . PRO D 1 104 ? 11.690  100.854 15.266  1.00   24.60 ? 104  PRO D C   1 
ATOM   9123  O O   . PRO D 1 104 ? 10.779  101.445 15.853  1.00   24.32 ? 104  PRO D O   1 
ATOM   9124  C CB  . PRO D 1 104 ? 13.211  102.775 14.638  1.00   27.42 ? 104  PRO D CB  1 
ATOM   9125  C CG  . PRO D 1 104 ? 12.218  103.866 14.342  1.00   25.82 ? 104  PRO D CG  1 
ATOM   9126  C CD  . PRO D 1 104 ? 11.762  103.501 12.935  1.00   25.43 ? 104  PRO D CD  1 
ATOM   9127  N N   . THR D 1 105 ? 12.054  99.607  15.549  1.00   24.42 ? 105  THR D N   1 
ATOM   9128  C CA  . THR D 1 105 ? 11.401  98.834  16.598  1.00   23.41 ? 105  THR D CA  1 
ATOM   9129  C C   . THR D 1 105 ? 12.405  97.895  17.333  1.00   25.96 ? 105  THR D C   1 
ATOM   9130  O O   . THR D 1 105 ? 13.617  97.920  17.085  1.00   22.72 ? 105  THR D O   1 
ATOM   9131  C CB  . THR D 1 105 ? 10.222  98.010  16.000  1.00   23.78 ? 105  THR D CB  1 
ATOM   9132  O OG1 . THR D 1 105 ? 9.598   97.213  17.026  1.00   19.04 ? 105  THR D OG1 1 
ATOM   9133  C CG2 . THR D 1 105 ? 10.731  97.107  14.859  1.00   24.02 ? 105  THR D CG2 1 
ATOM   9134  N N   . TYR D 1 106 ? 11.893  97.084  18.253  1.00   26.77 ? 106  TYR D N   1 
ATOM   9135  C CA  . TYR D 1 106 ? 12.732  96.169  19.003  1.00   28.34 ? 106  TYR D CA  1 
ATOM   9136  C C   . TYR D 1 106 ? 13.488  95.271  18.043  1.00   27.78 ? 106  TYR D C   1 
ATOM   9137  O O   . TYR D 1 106 ? 12.875  94.519  17.279  1.00   28.57 ? 106  TYR D O   1 
ATOM   9138  C CB  . TYR D 1 106 ? 11.853  95.336  19.960  1.00   32.75 ? 106  TYR D CB  1 
ATOM   9139  C CG  . TYR D 1 106 ? 12.594  94.405  20.902  1.00   32.02 ? 106  TYR D CG  1 
ATOM   9140  C CD1 . TYR D 1 106 ? 13.876  94.707  21.370  1.00   27.99 ? 106  TYR D CD1 1 
ATOM   9141  C CD2 . TYR D 1 106 ? 11.998  93.235  21.355  1.00   34.01 ? 106  TYR D CD2 1 
ATOM   9142  C CE1 . TYR D 1 106 ? 14.533  93.861  22.266  1.00   31.67 ? 106  TYR D CE1 1 
ATOM   9143  C CE2 . TYR D 1 106 ? 12.656  92.379  22.250  1.00   32.59 ? 106  TYR D CE2 1 
ATOM   9144  C CZ  . TYR D 1 106 ? 13.911  92.695  22.697  1.00   30.38 ? 106  TYR D CZ  1 
ATOM   9145  O OH  . TYR D 1 106 ? 14.533  91.813  23.559  1.00   30.93 ? 106  TYR D OH  1 
ATOM   9146  N N   . SER D 1 107 ? 14.815  95.367  18.091  1.00   26.06 ? 107  SER D N   1 
ATOM   9147  C CA  . SER D 1 107 ? 15.710  94.605  17.221  1.00   30.27 ? 107  SER D CA  1 
ATOM   9148  C C   . SER D 1 107 ? 15.550  93.101  17.318  1.00   30.19 ? 107  SER D C   1 
ATOM   9149  O O   . SER D 1 107 ? 15.923  92.383  16.390  1.00   29.13 ? 107  SER D O   1 
ATOM   9150  C CB  . SER D 1 107 ? 17.170  94.903  17.553  1.00   33.36 ? 107  SER D CB  1 
ATOM   9151  O OG  . SER D 1 107 ? 17.518  94.219  18.737  1.00   36.77 ? 107  SER D OG  1 
ATOM   9152  N N   . CYS D 1 108 ? 15.013  92.623  18.436  1.00   28.75 ? 108  CYS D N   1 
ATOM   9153  C CA  . CYS D 1 108 ? 14.840  91.201  18.616  1.00   29.82 ? 108  CYS D CA  1 
ATOM   9154  C C   . CYS D 1 108 ? 13.572  90.624  18.000  1.00   28.93 ? 108  CYS D C   1 
ATOM   9155  O O   . CYS D 1 108 ? 13.462  89.401  17.908  1.00   26.42 ? 108  CYS D O   1 
ATOM   9156  C CB  . CYS D 1 108 ? 14.940  90.824  20.107  1.00   35.31 ? 108  CYS D CB  1 
ATOM   9157  S SG  . CYS D 1 108 ? 16.647  90.912  20.786  1.00   35.98 ? 108  CYS D SG  1 
ATOM   9158  N N   . TYR D 1 109 ? 12.621  91.464  17.576  1.00   26.11 ? 109  TYR D N   1 
ATOM   9159  C CA  . TYR D 1 109 ? 11.409  90.926  16.938  1.00   24.38 ? 109  TYR D CA  1 
ATOM   9160  C C   . TYR D 1 109 ? 11.862  90.224  15.670  1.00   26.43 ? 109  TYR D C   1 
ATOM   9161  O O   . TYR D 1 109 ? 11.394  89.135  15.331  1.00   25.52 ? 109  TYR D O   1 
ATOM   9162  C CB  . TYR D 1 109 ? 10.414  92.009  16.523  1.00   22.22 ? 109  TYR D CB  1 
ATOM   9163  C CG  . TYR D 1 109 ? 9.700   92.674  17.661  1.00   22.65 ? 109  TYR D CG  1 
ATOM   9164  C CD1 . TYR D 1 109 ? 9.465   91.989  18.850  1.00   21.33 ? 109  TYR D CD1 1 
ATOM   9165  C CD2 . TYR D 1 109 ? 9.283   94.001  17.559  1.00   18.41 ? 109  TYR D CD2 1 
ATOM   9166  C CE1 . TYR D 1 109 ? 8.844   92.606  19.908  1.00   21.05 ? 109  TYR D CE1 1 
ATOM   9167  C CE2 . TYR D 1 109 ? 8.651   94.631  18.611  1.00   19.83 ? 109  TYR D CE2 1 
ATOM   9168  C CZ  . TYR D 1 109 ? 8.434   93.929  19.790  1.00   21.69 ? 109  TYR D CZ  1 
ATOM   9169  O OH  . TYR D 1 109 ? 7.809   94.542  20.849  1.00   21.03 ? 109  TYR D OH  1 
ATOM   9170  N N   . ARG D 1 110 ? 12.786  90.876  14.979  1.00   26.10 ? 110  ARG D N   1 
ATOM   9171  C CA  . ARG D 1 110 ? 13.327  90.340  13.755  1.00   30.46 ? 110  ARG D CA  1 
ATOM   9172  C C   . ARG D 1 110 ? 14.335  89.238  14.052  1.00   30.90 ? 110  ARG D C   1 
ATOM   9173  O O   . ARG D 1 110 ? 14.420  88.250  13.316  1.00   31.30 ? 110  ARG D O   1 
ATOM   9174  C CB  . ARG D 1 110 ? 13.974  91.468  12.939  1.00   32.28 ? 110  ARG D CB  1 
ATOM   9175  C CG  . ARG D 1 110 ? 15.287  91.108  12.282  1.00   36.00 ? 110  ARG D CG  1 
ATOM   9176  C CD  . ARG D 1 110 ? 15.711  92.200  11.342  1.00   36.19 ? 110  ARG D CD  1 
ATOM   9177  N NE  . ARG D 1 110 ? 14.835  92.245  10.187  1.00   40.39 ? 110  ARG D NE  1 
ATOM   9178  C CZ  . ARG D 1 110 ? 15.185  91.808  8.984   1.00   43.53 ? 110  ARG D CZ  1 
ATOM   9179  N NH1 . ARG D 1 110 ? 16.390  91.296  8.794   1.00   44.29 ? 110  ARG D NH1 1 
ATOM   9180  N NH2 . ARG D 1 110 ? 14.334  91.894  7.972   1.00   42.11 ? 110  ARG D NH2 1 
ATOM   9181  N N   . ILE D 1 111 ? 15.092  89.391  15.134  1.00   30.44 ? 111  ILE D N   1 
ATOM   9182  C CA  . ILE D 1 111 ? 16.072  88.371  15.478  1.00   27.67 ? 111  ILE D CA  1 
ATOM   9183  C C   . ILE D 1 111 ? 15.353  87.068  15.760  1.00   27.31 ? 111  ILE D C   1 
ATOM   9184  O O   . ILE D 1 111 ? 15.785  86.013  15.312  1.00   28.65 ? 111  ILE D O   1 
ATOM   9185  C CB  . ILE D 1 111 ? 16.860  88.677  16.751  1.00   29.04 ? 111  ILE D CB  1 
ATOM   9186  C CG1 . ILE D 1 111 ? 17.661  89.973  16.618  1.00   24.98 ? 111  ILE D CG1 1 
ATOM   9187  C CG2 . ILE D 1 111 ? 17.691  87.459  17.100  1.00   19.83 ? 111  ILE D CG2 1 
ATOM   9188  C CD1 . ILE D 1 111 ? 18.351  90.090  15.330  1.00   34.82 ? 111  ILE D CD1 1 
ATOM   9189  N N   . PHE D 1 112 ? 14.269  87.147  16.526  1.00   26.19 ? 112  PHE D N   1 
ATOM   9190  C CA  . PHE D 1 112 ? 13.540  85.943  16.870  1.00   25.52 ? 112  PHE D CA  1 
ATOM   9191  C C   . PHE D 1 112 ? 12.777  85.406  15.668  1.00   26.04 ? 112  PHE D C   1 
ATOM   9192  O O   . PHE D 1 112 ? 12.675  84.200  15.490  1.00   25.43 ? 112  PHE D O   1 
ATOM   9193  C CB  . PHE D 1 112 ? 12.569  86.184  18.050  1.00   26.82 ? 112  PHE D CB  1 
ATOM   9194  C CG  . PHE D 1 112 ? 13.249  86.573  19.366  1.00   29.09 ? 112  PHE D CG  1 
ATOM   9195  C CD1 . PHE D 1 112 ? 14.633  86.401  19.559  1.00   27.28 ? 112  PHE D CD1 1 
ATOM   9196  C CD2 . PHE D 1 112 ? 12.485  87.123  20.407  1.00   23.97 ? 112  PHE D CD2 1 
ATOM   9197  C CE1 . PHE D 1 112 ? 15.234  86.774  20.755  1.00   28.90 ? 112  PHE D CE1 1 
ATOM   9198  C CE2 . PHE D 1 112 ? 13.069  87.501  21.608  1.00   20.83 ? 112  PHE D CE2 1 
ATOM   9199  C CZ  . PHE D 1 112 ? 14.452  87.329  21.787  1.00   29.17 ? 112  PHE D CZ  1 
ATOM   9200  N N   . ALA D 1 113 ? 12.254  86.298  14.832  1.00   27.01 ? 113  ALA D N   1 
ATOM   9201  C CA  . ALA D 1 113 ? 11.496  85.869  13.656  1.00   24.54 ? 113  ALA D CA  1 
ATOM   9202  C C   . ALA D 1 113 ? 12.347  84.950  12.795  1.00   24.13 ? 113  ALA D C   1 
ATOM   9203  O O   . ALA D 1 113 ? 11.937  83.824  12.507  1.00   27.05 ? 113  ALA D O   1 
ATOM   9204  C CB  . ALA D 1 113 ? 11.038  87.055  12.851  1.00   21.40 ? 113  ALA D CB  1 
ATOM   9205  N N   . LYS D 1 114 ? 13.521  85.416  12.382  1.00   22.42 ? 114  LYS D N   1 
ATOM   9206  C CA  . LYS D 1 114 ? 14.400  84.579  11.566  1.00   24.57 ? 114  LYS D CA  1 
ATOM   9207  C C   . LYS D 1 114 ? 14.809  83.313  12.347  1.00   25.94 ? 114  LYS D C   1 
ATOM   9208  O O   . LYS D 1 114 ? 14.643  82.205  11.856  1.00   26.27 ? 114  LYS D O   1 
ATOM   9209  C CB  . LYS D 1 114 ? 15.661  85.350  11.138  1.00   22.84 ? 114  LYS D CB  1 
ATOM   9210  C CG  . LYS D 1 114 ? 15.491  86.287  9.933   1.00   28.20 ? 114  LYS D CG  1 
ATOM   9211  C CD  . LYS D 1 114 ? 16.597  87.351  9.955   1.00   30.39 ? 114  LYS D CD  1 
ATOM   9212  C CE  . LYS D 1 114 ? 17.038  87.862  8.562   1.00   38.72 ? 114  LYS D CE  1 
ATOM   9213  N NZ  . LYS D 1 114 ? 16.182  88.923  7.912   1.00   41.96 ? 114  LYS D NZ  1 
ATOM   9214  N N   . ALA D 1 115 ? 15.307  83.503  13.570  1.00   26.20 ? 115  ALA D N   1 
ATOM   9215  C CA  . ALA D 1 115 ? 15.768  82.424  14.432  1.00   25.79 ? 115  ALA D CA  1 
ATOM   9216  C C   . ALA D 1 115 ? 14.795  81.259  14.562  1.00   26.88 ? 115  ALA D C   1 
ATOM   9217  O O   . ALA D 1 115 ? 15.181  80.089  14.490  1.00   25.09 ? 115  ALA D O   1 
ATOM   9218  C CB  . ALA D 1 115 ? 16.084  82.980  15.816  1.00   28.66 ? 115  ALA D CB  1 
ATOM   9219  N N   . VAL D 1 116 ? 13.529  81.594  14.747  1.00   26.99 ? 116  VAL D N   1 
ATOM   9220  C CA  . VAL D 1 116 ? 12.459  80.626  14.924  1.00   24.43 ? 116  VAL D CA  1 
ATOM   9221  C C   . VAL D 1 116 ? 11.834  80.189  13.590  1.00   29.49 ? 116  VAL D C   1 
ATOM   9222  O O   . VAL D 1 116 ? 10.991  79.283  13.548  1.00   30.41 ? 116  VAL D O   1 
ATOM   9223  C CB  . VAL D 1 116 ? 11.392  81.259  15.843  1.00   22.95 ? 116  VAL D CB  1 
ATOM   9224  C CG1 . VAL D 1 116 ? 10.007  81.285  15.181  1.00   16.93 ? 116  VAL D CG1 1 
ATOM   9225  C CG2 . VAL D 1 116 ? 11.376  80.547  17.178  1.00   23.01 ? 116  VAL D CG2 1 
ATOM   9226  N N   . GLY D 1 117 ? 12.233  80.849  12.506  1.00   29.47 ? 117  GLY D N   1 
ATOM   9227  C CA  . GLY D 1 117 ? 11.699  80.516  11.198  1.00   30.06 ? 117  GLY D CA  1 
ATOM   9228  C C   . GLY D 1 117 ? 10.299  81.043  10.890  1.00   30.33 ? 117  GLY D C   1 
ATOM   9229  O O   . GLY D 1 117 ? 9.618   80.536  10.003  1.00   29.61 ? 117  GLY D O   1 
ATOM   9230  N N   . ALA D 1 118 ? 9.861   82.065  11.613  1.00   29.58 ? 118  ALA D N   1 
ATOM   9231  C CA  . ALA D 1 118 ? 8.538   82.629  11.385  1.00   26.84 ? 118  ALA D CA  1 
ATOM   9232  C C   . ALA D 1 118 ? 8.452   83.530  10.134  1.00   24.64 ? 118  ALA D C   1 
ATOM   9233  O O   . ALA D 1 118 ? 9.423   84.164  9.747   1.00   24.13 ? 118  ALA D O   1 
ATOM   9234  C CB  . ALA D 1 118 ? 8.115   83.419  12.607  1.00   24.27 ? 118  ALA D CB  1 
ATOM   9235  N N   . LYS D 1 119 ? 7.297   83.543  9.484   1.00   22.41 ? 119  LYS D N   1 
ATOM   9236  C CA  . LYS D 1 119 ? 7.091   84.439  8.361   1.00   24.32 ? 119  LYS D CA  1 
ATOM   9237  C C   . LYS D 1 119 ? 6.921   85.809  9.033   1.00   24.89 ? 119  LYS D C   1 
ATOM   9238  O O   . LYS D 1 119 ? 6.211   85.940  10.049  1.00   26.63 ? 119  LYS D O   1 
ATOM   9239  C CB  . LYS D 1 119 ? 5.807   84.101  7.627   1.00   26.46 ? 119  LYS D CB  1 
ATOM   9240  C CG  . LYS D 1 119 ? 5.642   84.851  6.320   1.00   32.61 ? 119  LYS D CG  1 
ATOM   9241  C CD  . LYS D 1 119 ? 4.266   84.601  5.680   1.00   39.30 ? 119  LYS D CD  1 
ATOM   9242  C CE  . LYS D 1 119 ? 4.230   85.098  4.225   1.00   43.21 ? 119  LYS D CE  1 
ATOM   9243  N NZ  . LYS D 1 119 ? 2.883   84.920  3.596   1.00   39.81 ? 119  LYS D NZ  1 
ATOM   9244  N N   . PHE D 1 120 ? 7.561   86.833  8.493   1.00   23.54 ? 120  PHE D N   1 
ATOM   9245  C CA  . PHE D 1 120 ? 7.413   88.119  9.119   1.00   24.86 ? 120  PHE D CA  1 
ATOM   9246  C C   . PHE D 1 120 ? 7.407   89.243  8.119   1.00   25.13 ? 120  PHE D C   1 
ATOM   9247  O O   . PHE D 1 120 ? 7.941   89.103  7.028   1.00   24.56 ? 120  PHE D O   1 
ATOM   9248  C CB  . PHE D 1 120 ? 8.519   88.348  10.152  1.00   22.09 ? 120  PHE D CB  1 
ATOM   9249  C CG  . PHE D 1 120 ? 9.878   88.562  9.553   1.00   25.18 ? 120  PHE D CG  1 
ATOM   9250  C CD1 . PHE D 1 120 ? 10.661  87.478  9.180   1.00   23.30 ? 120  PHE D CD1 1 
ATOM   9251  C CD2 . PHE D 1 120 ? 10.379  89.864  9.362   1.00   25.02 ? 120  PHE D CD2 1 
ATOM   9252  C CE1 . PHE D 1 120 ? 11.920  87.669  8.631   1.00   22.87 ? 120  PHE D CE1 1 
ATOM   9253  C CE2 . PHE D 1 120 ? 11.637  90.073  8.814   1.00   22.54 ? 120  PHE D CE2 1 
ATOM   9254  C CZ  . PHE D 1 120 ? 12.413  88.972  8.447   1.00   27.89 ? 120  PHE D CZ  1 
ATOM   9255  N N   . LEU D 1 121 ? 6.792   90.355  8.513   1.00   24.95 ? 121  LEU D N   1 
ATOM   9256  C CA  . LEU D 1 121 ? 6.680   91.539  7.677   1.00   24.91 ? 121  LEU D CA  1 
ATOM   9257  C C   . LEU D 1 121 ? 7.108   92.744  8.488   1.00   23.09 ? 121  LEU D C   1 
ATOM   9258  O O   . LEU D 1 121 ? 6.644   92.949  9.594   1.00   26.57 ? 121  LEU D O   1 
ATOM   9259  C CB  . LEU D 1 121 ? 5.227   91.761  7.232   1.00   25.37 ? 121  LEU D CB  1 
ATOM   9260  C CG  . LEU D 1 121 ? 4.907   92.581  5.962   1.00   27.88 ? 121  LEU D CG  1 
ATOM   9261  C CD1 . LEU D 1 121 ? 3.636   93.375  6.168   1.00   23.96 ? 121  LEU D CD1 1 
ATOM   9262  C CD2 . LEU D 1 121 ? 6.042   93.504  5.604   1.00   27.72 ? 121  LEU D CD2 1 
ATOM   9263  N N   . GLU D 1 122 ? 8.008   93.528  7.940   1.00   25.71 ? 122  GLU D N   1 
ATOM   9264  C CA  . GLU D 1 122 ? 8.447   94.750  8.580   1.00   25.48 ? 122  GLU D CA  1 
ATOM   9265  C C   . GLU D 1 122 ? 7.990   95.852  7.657   1.00   25.99 ? 122  GLU D C   1 
ATOM   9266  O O   . GLU D 1 122 ? 8.289   95.821  6.455   1.00   26.02 ? 122  GLU D O   1 
ATOM   9267  C CB  . GLU D 1 122 ? 9.973   94.803  8.674   1.00   24.98 ? 122  GLU D CB  1 
ATOM   9268  C CG  . GLU D 1 122 ? 10.573  93.983  9.780   1.00   24.99 ? 122  GLU D CG  1 
ATOM   9269  C CD  . GLU D 1 122 ? 12.075  94.016  9.716   1.00   27.45 ? 122  GLU D CD  1 
ATOM   9270  O OE1 . GLU D 1 122 ? 12.609  93.803  8.616   1.00   27.00 ? 122  GLU D OE1 1 
ATOM   9271  O OE2 . GLU D 1 122 ? 12.725  94.251  10.758  1.00   36.35 ? 122  GLU D OE2 1 
ATOM   9272  N N   . VAL D 1 123 ? 7.245   96.804  8.193   1.00   27.28 ? 123  VAL D N   1 
ATOM   9273  C CA  . VAL D 1 123 ? 6.785   97.941  7.397   1.00   26.51 ? 123  VAL D CA  1 
ATOM   9274  C C   . VAL D 1 123 ? 7.189   99.185  8.177   1.00   27.72 ? 123  VAL D C   1 
ATOM   9275  O O   . VAL D 1 123 ? 6.538   99.544  9.147   1.00   29.83 ? 123  VAL D O   1 
ATOM   9276  C CB  . VAL D 1 123 ? 5.264   97.915  7.212   1.00   26.64 ? 123  VAL D CB  1 
ATOM   9277  C CG1 . VAL D 1 123 ? 4.823   99.134  6.406   1.00   23.13 ? 123  VAL D CG1 1 
ATOM   9278  C CG2 . VAL D 1 123 ? 4.854   96.626  6.513   1.00   22.82 ? 123  VAL D CG2 1 
ATOM   9279  N N   . PRO D 1 124 ? 8.282   99.854  7.761   1.00   27.79 ? 124  PRO D N   1 
ATOM   9280  C CA  . PRO D 1 124 ? 8.798   101.063 8.422   1.00   26.98 ? 124  PRO D CA  1 
ATOM   9281  C C   . PRO D 1 124 ? 7.783   102.079 8.929   1.00   26.66 ? 124  PRO D C   1 
ATOM   9282  O O   . PRO D 1 124 ? 6.805   102.395 8.254   1.00   27.37 ? 124  PRO D O   1 
ATOM   9283  C CB  . PRO D 1 124 ? 9.723   101.664 7.364   1.00   23.25 ? 124  PRO D CB  1 
ATOM   9284  C CG  . PRO D 1 124 ? 10.241  100.448 6.662   1.00   23.99 ? 124  PRO D CG  1 
ATOM   9285  C CD  . PRO D 1 124 ? 8.993   99.620  6.488   1.00   24.70 ? 124  PRO D CD  1 
ATOM   9286  N N   . LEU D 1 125 ? 8.021   102.590 10.131  1.00   28.49 ? 125  LEU D N   1 
ATOM   9287  C CA  . LEU D 1 125 ? 7.142   103.619 10.691  1.00   31.82 ? 125  LEU D CA  1 
ATOM   9288  C C   . LEU D 1 125 ? 7.207   104.849 9.798   1.00   31.75 ? 125  LEU D C   1 
ATOM   9289  O O   . LEU D 1 125 ? 8.113   104.988 8.981   1.00   29.54 ? 125  LEU D O   1 
ATOM   9290  C CB  . LEU D 1 125 ? 7.590   104.020 12.094  1.00   31.27 ? 125  LEU D CB  1 
ATOM   9291  C CG  . LEU D 1 125 ? 7.237   103.067 13.231  1.00   33.66 ? 125  LEU D CG  1 
ATOM   9292  C CD1 . LEU D 1 125 ? 8.002   103.472 14.488  1.00   28.52 ? 125  LEU D CD1 1 
ATOM   9293  C CD2 . LEU D 1 125 ? 5.731   103.087 13.471  1.00   32.46 ? 125  LEU D CD2 1 
ATOM   9294  N N   . THR D 1 126 ? 6.250   105.749 9.961   1.00   34.64 ? 126  THR D N   1 
ATOM   9295  C CA  . THR D 1 126 ? 6.214   106.970 9.166   1.00   38.80 ? 126  THR D CA  1 
ATOM   9296  C C   . THR D 1 126 ? 7.378   107.871 9.551   1.00   39.91 ? 126  THR D C   1 
ATOM   9297  O O   . THR D 1 126 ? 8.022   107.644 10.583  1.00   40.08 ? 126  THR D O   1 
ATOM   9298  C CB  . THR D 1 126 ? 4.882   107.696 9.393   1.00   37.48 ? 126  THR D CB  1 
ATOM   9299  O OG1 . THR D 1 126 ? 3.900   107.120 8.526   1.00   41.78 ? 126  THR D OG1 1 
ATOM   9300  C CG2 . THR D 1 126 ? 4.992   109.165 9.112   1.00   44.39 ? 126  THR D CG2 1 
ATOM   9301  N N   . LYS D 1 127 ? 7.673   108.868 8.723   1.00   39.43 ? 127  LYS D N   1 
ATOM   9302  C CA  . LYS D 1 127 ? 8.747   109.791 9.065   1.00   43.12 ? 127  LYS D CA  1 
ATOM   9303  C C   . LYS D 1 127 ? 8.314   110.514 10.346  1.00   44.01 ? 127  LYS D C   1 
ATOM   9304  O O   . LYS D 1 127 ? 9.095   111.241 10.965  1.00   44.94 ? 127  LYS D O   1 
ATOM   9305  C CB  . LYS D 1 127 ? 8.973   110.806 7.953   1.00   45.27 ? 127  LYS D CB  1 
ATOM   9306  C CG  . LYS D 1 127 ? 10.450  111.044 7.617   1.00   53.18 ? 127  LYS D CG  1 
ATOM   9307  C CD  . LYS D 1 127 ? 11.263  111.603 8.797   1.00   58.84 ? 127  LYS D CD  1 
ATOM   9308  C CE  . LYS D 1 127 ? 12.119  110.528 9.483   1.00   61.65 ? 127  LYS D CE  1 
ATOM   9309  N NZ  . LYS D 1 127 ? 12.920  111.042 10.657  1.00   60.34 ? 127  LYS D NZ  1 
ATOM   9310  N N   . ASP D 1 128 ? 7.060   110.308 10.735  1.00   43.33 ? 128  ASP D N   1 
ATOM   9311  C CA  . ASP D 1 128 ? 6.525   110.906 11.951  1.00   44.82 ? 128  ASP D CA  1 
ATOM   9312  C C   . ASP D 1 128 ? 6.393   109.871 13.066  1.00   43.28 ? 128  ASP D C   1 
ATOM   9313  O O   . ASP D 1 128 ? 5.730   110.099 14.082  1.00   43.65 ? 128  ASP D O   1 
ATOM   9314  C CB  . ASP D 1 128 ? 5.166   111.531 11.677  1.00   47.46 ? 128  ASP D CB  1 
ATOM   9315  C CG  . ASP D 1 128 ? 5.275   112.854 10.984  1.00   52.09 ? 128  ASP D CG  1 
ATOM   9316  O OD1 . ASP D 1 128 ? 5.855   113.795 11.567  1.00   50.22 ? 128  ASP D OD1 1 
ATOM   9317  O OD2 . ASP D 1 128 ? 4.780   112.949 9.842   1.00   57.86 ? 128  ASP D OD2 1 
ATOM   9318  N N   . LEU D 1 129 ? 7.031   108.726 12.872  1.00   42.78 ? 129  LEU D N   1 
ATOM   9319  C CA  . LEU D 1 129 ? 6.983   107.660 13.863  1.00   37.34 ? 129  LEU D CA  1 
ATOM   9320  C C   . LEU D 1 129 ? 5.559   107.161 14.093  1.00   34.68 ? 129  LEU D C   1 
ATOM   9321  O O   . LEU D 1 129 ? 5.181   106.841 15.207  1.00   36.31 ? 129  LEU D O   1 
ATOM   9322  C CB  . LEU D 1 129 ? 7.616   108.151 15.169  1.00   32.73 ? 129  LEU D CB  1 
ATOM   9323  C CG  . LEU D 1 129 ? 9.091   108.528 14.963  1.00   29.26 ? 129  LEU D CG  1 
ATOM   9324  C CD1 . LEU D 1 129 ? 9.692   109.067 16.236  1.00   32.55 ? 129  LEU D CD1 1 
ATOM   9325  C CD2 . LEU D 1 129 ? 9.873   107.305 14.515  1.00   33.73 ? 129  LEU D CD2 1 
ATOM   9326  N N   . ARG D 1 130 ? 4.777   107.095 13.018  1.00   34.61 ? 130  ARG D N   1 
ATOM   9327  C CA  . ARG D 1 130 ? 3.402   106.603 13.079  1.00   30.98 ? 130  ARG D CA  1 
ATOM   9328  C C   . ARG D 1 130 ? 3.307   105.264 12.367  1.00   29.50 ? 130  ARG D C   1 
ATOM   9329  O O   . ARG D 1 130 ? 4.067   104.992 11.440  1.00   28.67 ? 130  ARG D O   1 
ATOM   9330  C CB  . ARG D 1 130 ? 2.422   107.583 12.403  1.00   32.94 ? 130  ARG D CB  1 
ATOM   9331  C CG  . ARG D 1 130 ? 1.849   108.656 13.316  1.00   43.01 ? 130  ARG D CG  1 
ATOM   9332  C CD  . ARG D 1 130 ? 2.501   110.018 13.093  1.00   48.11 ? 130  ARG D CD  1 
ATOM   9333  N NE  . ARG D 1 130 ? 1.877   111.067 13.904  1.00   56.80 ? 130  ARG D NE  1 
ATOM   9334  C CZ  . ARG D 1 130 ? 1.996   111.170 15.225  1.00   58.19 ? 130  ARG D CZ  1 
ATOM   9335  N NH1 . ARG D 1 130 ? 2.724   110.291 15.906  1.00   59.25 ? 130  ARG D NH1 1 
ATOM   9336  N NH2 . ARG D 1 130 ? 1.378   112.150 15.869  1.00   58.26 ? 130  ARG D NH2 1 
ATOM   9337  N N   . ILE D 1 131 ? 2.363   104.436 12.808  1.00   29.48 ? 131  ILE D N   1 
ATOM   9338  C CA  . ILE D 1 131 ? 2.125   103.127 12.214  1.00   31.78 ? 131  ILE D CA  1 
ATOM   9339  C C   . ILE D 1 131 ? 1.640   103.303 10.778  1.00   31.25 ? 131  ILE D C   1 
ATOM   9340  O O   . ILE D 1 131 ? 0.608   103.921 10.544  1.00   31.37 ? 131  ILE D O   1 
ATOM   9341  C CB  . ILE D 1 131 ? 1.046   102.355 12.994  1.00   31.72 ? 131  ILE D CB  1 
ATOM   9342  C CG1 . ILE D 1 131 ? 1.473   102.200 14.449  1.00   30.13 ? 131  ILE D CG1 1 
ATOM   9343  C CG2 . ILE D 1 131 ? 0.828   100.995 12.360  1.00   35.03 ? 131  ILE D CG2 1 
ATOM   9344  C CD1 . ILE D 1 131 ? 0.514   101.412 15.265  1.00   29.68 ? 131  ILE D CD1 1 
ATOM   9345  N N   . PRO D 1 132 ? 2.377   102.761 9.798   1.00   33.68 ? 132  PRO D N   1 
ATOM   9346  C CA  . PRO D 1 132 ? 2.003   102.876 8.377   1.00   33.55 ? 132  PRO D CA  1 
ATOM   9347  C C   . PRO D 1 132 ? 0.846   101.981 7.983   1.00   31.71 ? 132  PRO D C   1 
ATOM   9348  O O   . PRO D 1 132 ? 0.492   101.075 8.710   1.00   32.02 ? 132  PRO D O   1 
ATOM   9349  C CB  . PRO D 1 132 ? 3.286   102.491 7.651   1.00   29.64 ? 132  PRO D CB  1 
ATOM   9350  C CG  . PRO D 1 132 ? 3.831   101.435 8.523   1.00   32.29 ? 132  PRO D CG  1 
ATOM   9351  C CD  . PRO D 1 132 ? 3.644   102.021 9.931   1.00   34.90 ? 132  PRO D CD  1 
ATOM   9352  N N   . GLU D 1 133 ? 0.264   102.255 6.823   1.00   35.88 ? 133  GLU D N   1 
ATOM   9353  C CA  . GLU D 1 133 ? -0.846  101.470 6.293   1.00   36.09 ? 133  GLU D CA  1 
ATOM   9354  C C   . GLU D 1 133 ? -0.347  100.046 6.078   1.00   34.85 ? 133  GLU D C   1 
ATOM   9355  O O   . GLU D 1 133 ? 0.685   99.859  5.450   1.00   35.68 ? 133  GLU D O   1 
ATOM   9356  C CB  . GLU D 1 133 ? -1.264  102.035 4.938   1.00   43.75 ? 133  GLU D CB  1 
ATOM   9357  C CG  . GLU D 1 133 ? -1.949  103.385 4.990   1.00   52.07 ? 133  GLU D CG  1 
ATOM   9358  C CD  . GLU D 1 133 ? -3.431  103.261 5.300   1.00   60.49 ? 133  GLU D CD  1 
ATOM   9359  O OE1 . GLU D 1 133 ? -3.787  103.013 6.477   1.00   64.13 ? 133  GLU D OE1 1 
ATOM   9360  O OE2 . GLU D 1 133 ? -4.242  103.399 4.355   1.00   62.90 ? 133  GLU D OE2 1 
ATOM   9361  N N   . VAL D 1 134 ? -1.073  99.057  6.579   1.00   31.25 ? 134  VAL D N   1 
ATOM   9362  C CA  . VAL D 1 134 ? -0.665  97.676  6.419   1.00   33.02 ? 134  VAL D CA  1 
ATOM   9363  C C   . VAL D 1 134 ? -1.871  96.798  6.227   1.00   33.55 ? 134  VAL D C   1 
ATOM   9364  O O   . VAL D 1 134 ? -2.935  97.086  6.746   1.00   34.24 ? 134  VAL D O   1 
ATOM   9365  C CB  . VAL D 1 134 ? 0.096   97.142  7.657   1.00   34.13 ? 134  VAL D CB  1 
ATOM   9366  C CG1 . VAL D 1 134 ? 1.551   97.583  7.611   1.00   38.07 ? 134  VAL D CG1 1 
ATOM   9367  C CG2 . VAL D 1 134 ? -0.572  97.653  8.933   1.00   30.37 ? 134  VAL D CG2 1 
ATOM   9368  N N   . ASN D 1 135 ? -1.699  95.723  5.472   1.00   34.15 ? 135  ASN D N   1 
ATOM   9369  C CA  . ASN D 1 135 ? -2.788  94.811  5.225   1.00   34.94 ? 135  ASN D CA  1 
ATOM   9370  C C   . ASN D 1 135 ? -2.619  93.662  6.203   1.00   35.47 ? 135  ASN D C   1 
ATOM   9371  O O   . ASN D 1 135 ? -1.868  92.720  5.953   1.00   33.84 ? 135  ASN D O   1 
ATOM   9372  C CB  . ASN D 1 135 ? -2.743  94.310  3.775   1.00   38.93 ? 135  ASN D CB  1 
ATOM   9373  C CG  . ASN D 1 135 ? -3.951  93.462  3.420   1.00   40.75 ? 135  ASN D CG  1 
ATOM   9374  O OD1 . ASN D 1 135 ? -5.077  93.845  3.711   1.00   42.24 ? 135  ASN D OD1 1 
ATOM   9375  N ND2 . ASN D 1 135 ? -3.723  92.309  2.790   1.00   42.87 ? 135  ASN D ND2 1 
ATOM   9376  N N   . VAL D 1 136 ? -3.321  93.742  7.326   1.00   35.61 ? 136  VAL D N   1 
ATOM   9377  C CA  . VAL D 1 136 ? -3.199  92.713  8.344   1.00   35.09 ? 136  VAL D CA  1 
ATOM   9378  C C   . VAL D 1 136 ? -4.562  92.200  8.805   1.00   32.65 ? 136  VAL D C   1 
ATOM   9379  O O   . VAL D 1 136 ? -5.568  92.846  8.575   1.00   31.51 ? 136  VAL D O   1 
ATOM   9380  C CB  . VAL D 1 136 ? -2.374  93.275  9.534   1.00   36.49 ? 136  VAL D CB  1 
ATOM   9381  C CG1 . VAL D 1 136 ? -2.161  92.213  10.584  1.00   40.28 ? 136  VAL D CG1 1 
ATOM   9382  C CG2 . VAL D 1 136 ? -1.005  93.757  9.022   1.00   34.77 ? 136  VAL D CG2 1 
ATOM   9383  N N   . GLY D 1 137 ? -4.595  91.022  9.424   1.00   33.00 ? 137  GLY D N   1 
ATOM   9384  C CA  . GLY D 1 137 ? -5.853  90.463  9.887   1.00   35.00 ? 137  GLY D CA  1 
ATOM   9385  C C   . GLY D 1 137 ? -5.741  89.204  10.750  1.00   37.45 ? 137  GLY D C   1 
ATOM   9386  O O   . GLY D 1 137 ? -4.671  88.875  11.264  1.00   35.49 ? 137  GLY D O   1 
ATOM   9387  N N   . GLU D 1 138 ? -6.868  88.517  10.921  1.00   36.74 ? 138  GLU D N   1 
ATOM   9388  C CA  . GLU D 1 138 ? -6.928  87.294  11.697  1.00   38.97 ? 138  GLU D CA  1 
ATOM   9389  C C   . GLU D 1 138 ? -5.800  86.360  11.231  1.00   39.03 ? 138  GLU D C   1 
ATOM   9390  O O   . GLU D 1 138 ? -5.654  86.099  10.032  1.00   37.04 ? 138  GLU D O   1 
ATOM   9391  C CB  . GLU D 1 138 ? -8.298  86.641  11.484  1.00   41.94 ? 138  GLU D CB  1 
ATOM   9392  C CG  . GLU D 1 138 ? -8.533  85.293  12.157  1.00   50.16 ? 138  GLU D CG  1 
ATOM   9393  C CD  . GLU D 1 138 ? -8.716  85.397  13.662  1.00   57.69 ? 138  GLU D CD  1 
ATOM   9394  O OE1 . GLU D 1 138 ? -9.488  84.585  14.232  1.00   57.95 ? 138  GLU D OE1 1 
ATOM   9395  O OE2 . GLU D 1 138 ? -8.078  86.283  14.276  1.00   62.96 ? 138  GLU D OE2 1 
ATOM   9396  N N   . GLY D 1 139 ? -4.998  85.871  12.175  1.00   37.59 ? 139  GLY D N   1 
ATOM   9397  C CA  . GLY D 1 139 ? -3.910  84.981  11.818  1.00   36.85 ? 139  GLY D CA  1 
ATOM   9398  C C   . GLY D 1 139 ? -2.558  85.658  11.942  1.00   36.63 ? 139  GLY D C   1 
ATOM   9399  O O   . GLY D 1 139 ? -1.506  84.999  11.984  1.00   36.78 ? 139  GLY D O   1 
ATOM   9400  N N   . ASP D 1 140 ? -2.590  86.984  11.997  1.00   34.74 ? 140  ASP D N   1 
ATOM   9401  C CA  . ASP D 1 140 ? -1.384  87.784  12.119  1.00   34.30 ? 140  ASP D CA  1 
ATOM   9402  C C   . ASP D 1 140 ? -1.265  88.272  13.537  1.00   34.35 ? 140  ASP D C   1 
ATOM   9403  O O   . ASP D 1 140 ? -2.266  88.373  14.248  1.00   34.61 ? 140  ASP D O   1 
ATOM   9404  C CB  . ASP D 1 140 ? -1.452  89.030  11.224  1.00   35.41 ? 140  ASP D CB  1 
ATOM   9405  C CG  . ASP D 1 140 ? -1.069  88.759  9.780   1.00   38.23 ? 140  ASP D CG  1 
ATOM   9406  O OD1 . ASP D 1 140 ? -1.367  89.633  8.955   1.00   35.85 ? 140  ASP D OD1 1 
ATOM   9407  O OD2 . ASP D 1 140 ? -0.465  87.714  9.453   1.00   43.81 ? 140  ASP D OD2 1 
ATOM   9408  N N   . VAL D 1 141 ? -0.032  88.575  13.936  1.00   33.19 ? 141  VAL D N   1 
ATOM   9409  C CA  . VAL D 1 141 ? 0.248   89.132  15.254  1.00   29.94 ? 141  VAL D CA  1 
ATOM   9410  C C   . VAL D 1 141 ? 1.155   90.322  14.969  1.00   29.60 ? 141  VAL D C   1 
ATOM   9411  O O   . VAL D 1 141 ? 2.172   90.198  14.285  1.00   29.95 ? 141  VAL D O   1 
ATOM   9412  C CB  . VAL D 1 141 ? 0.955   88.114  16.207  1.00   30.25 ? 141  VAL D CB  1 
ATOM   9413  C CG1 . VAL D 1 141 ? 2.353   87.769  15.716  1.00   21.58 ? 141  VAL D CG1 1 
ATOM   9414  C CG2 . VAL D 1 141 ? 1.017   88.685  17.607  1.00   29.76 ? 141  VAL D CG2 1 
ATOM   9415  N N   . VAL D 1 142 ? 0.744   91.490  15.443  1.00   29.78 ? 142  VAL D N   1 
ATOM   9416  C CA  . VAL D 1 142 ? 1.508   92.717  15.235  1.00   27.12 ? 142  VAL D CA  1 
ATOM   9417  C C   . VAL D 1 142 ? 2.136   93.131  16.563  1.00   27.66 ? 142  VAL D C   1 
ATOM   9418  O O   . VAL D 1 142 ? 1.446   93.273  17.582  1.00   31.16 ? 142  VAL D O   1 
ATOM   9419  C CB  . VAL D 1 142 ? 0.593   93.828  14.645  1.00   27.96 ? 142  VAL D CB  1 
ATOM   9420  C CG1 . VAL D 1 142 ? -0.744  93.803  15.322  1.00   29.77 ? 142  VAL D CG1 1 
ATOM   9421  C CG2 . VAL D 1 142 ? 1.248   95.206  14.773  1.00   20.53 ? 142  VAL D CG2 1 
ATOM   9422  N N   . PHE D 1 143 ? 3.459   93.270  16.558  1.00   24.02 ? 143  PHE D N   1 
ATOM   9423  C CA  . PHE D 1 143 ? 4.202   93.634  17.752  1.00   21.24 ? 143  PHE D CA  1 
ATOM   9424  C C   . PHE D 1 143 ? 4.386   95.118  17.759  1.00   21.78 ? 143  PHE D C   1 
ATOM   9425  O O   . PHE D 1 143 ? 5.055   95.684  16.879  1.00   21.15 ? 143  PHE D O   1 
ATOM   9426  C CB  . PHE D 1 143 ? 5.575   92.951  17.766  1.00   20.06 ? 143  PHE D CB  1 
ATOM   9427  C CG  . PHE D 1 143 ? 5.508   91.470  17.996  1.00   24.99 ? 143  PHE D CG  1 
ATOM   9428  C CD1 . PHE D 1 143 ? 5.384   90.960  19.283  1.00   26.90 ? 143  PHE D CD1 1 
ATOM   9429  C CD2 . PHE D 1 143 ? 5.518   90.585  16.921  1.00   27.87 ? 143  PHE D CD2 1 
ATOM   9430  C CE1 . PHE D 1 143 ? 5.269   89.582  19.507  1.00   27.65 ? 143  PHE D CE1 1 
ATOM   9431  C CE2 . PHE D 1 143 ? 5.404   89.215  17.128  1.00   31.49 ? 143  PHE D CE2 1 
ATOM   9432  C CZ  . PHE D 1 143 ? 5.278   88.707  18.437  1.00   30.01 ? 143  PHE D CZ  1 
ATOM   9433  N N   . ILE D 1 144 ? 3.792   95.739  18.764  1.00   20.54 ? 144  ILE D N   1 
ATOM   9434  C CA  . ILE D 1 144 ? 3.843   97.180  18.914  1.00   23.61 ? 144  ILE D CA  1 
ATOM   9435  C C   . ILE D 1 144 ? 4.366   97.578  20.291  1.00   24.12 ? 144  ILE D C   1 
ATOM   9436  O O   . ILE D 1 144 ? 3.626   97.589  21.285  1.00   25.72 ? 144  ILE D O   1 
ATOM   9437  C CB  . ILE D 1 144 ? 2.440   97.774  18.721  1.00   26.81 ? 144  ILE D CB  1 
ATOM   9438  C CG1 . ILE D 1 144 ? 1.809   97.207  17.457  1.00   25.73 ? 144  ILE D CG1 1 
ATOM   9439  C CG2 . ILE D 1 144 ? 2.514   99.296  18.640  1.00   28.54 ? 144  ILE D CG2 1 
ATOM   9440  C CD1 . ILE D 1 144 ? 0.403   97.810  17.162  1.00   28.48 ? 144  ILE D CD1 1 
ATOM   9441  N N   . PRO D 1 145 ? 5.657   97.888  20.373  1.00   23.66 ? 145  PRO D N   1 
ATOM   9442  C CA  . PRO D 1 145 ? 6.248   98.289  21.657  1.00   23.95 ? 145  PRO D CA  1 
ATOM   9443  C C   . PRO D 1 145 ? 5.823   99.710  21.995  1.00   25.38 ? 145  PRO D C   1 
ATOM   9444  O O   . PRO D 1 145 ? 6.054   100.636 21.223  1.00   23.12 ? 145  PRO D O   1 
ATOM   9445  C CB  . PRO D 1 145 ? 7.756   98.146  21.419  1.00   22.31 ? 145  PRO D CB  1 
ATOM   9446  C CG  . PRO D 1 145 ? 7.913   98.358  19.933  1.00   23.96 ? 145  PRO D CG  1 
ATOM   9447  C CD  . PRO D 1 145 ? 6.675   97.748  19.311  1.00   23.70 ? 145  PRO D CD  1 
ATOM   9448  N N   . ASN D 1 146 ? 5.178   99.872  23.147  1.00   27.80 ? 146  ASN D N   1 
ATOM   9449  C CA  . ASN D 1 146 ? 4.705   101.178 23.573  1.00   28.90 ? 146  ASN D CA  1 
ATOM   9450  C C   . ASN D 1 146 ? 4.937   101.391 25.063  1.00   28.83 ? 146  ASN D C   1 
ATOM   9451  O O   . ASN D 1 146 ? 4.321   100.711 25.882  1.00   34.49 ? 146  ASN D O   1 
ATOM   9452  C CB  . ASN D 1 146 ? 3.222   101.308 23.255  1.00   28.71 ? 146  ASN D CB  1 
ATOM   9453  C CG  . ASN D 1 146 ? 2.727   102.744 23.340  1.00   31.39 ? 146  ASN D CG  1 
ATOM   9454  O OD1 . ASN D 1 146 ? 3.423   103.682 22.931  1.00   28.40 ? 146  ASN D OD1 1 
ATOM   9455  N ND2 . ASN D 1 146 ? 1.507   102.919 23.843  1.00   28.62 ? 146  ASN D ND2 1 
ATOM   9456  N N   . PRO D 1 147 ? 5.838   102.314 25.440  1.00   26.95 ? 147  PRO D N   1 
ATOM   9457  C CA  . PRO D 1 147 ? 6.665   103.178 24.589  1.00   26.69 ? 147  PRO D CA  1 
ATOM   9458  C C   . PRO D 1 147 ? 7.504   102.360 23.607  1.00   27.47 ? 147  PRO D C   1 
ATOM   9459  O O   . PRO D 1 147 ? 7.896   101.233 23.896  1.00   26.39 ? 147  PRO D O   1 
ATOM   9460  C CB  . PRO D 1 147 ? 7.537   103.926 25.592  1.00   26.12 ? 147  PRO D CB  1 
ATOM   9461  C CG  . PRO D 1 147 ? 6.702   103.975 26.796  1.00   28.33 ? 147  PRO D CG  1 
ATOM   9462  C CD  . PRO D 1 147 ? 6.100   102.601 26.861  1.00   25.65 ? 147  PRO D CD  1 
ATOM   9463  N N   . ASN D 1 148 ? 7.791   102.948 22.450  1.00   28.02 ? 148  ASN D N   1 
ATOM   9464  C CA  . ASN D 1 148 ? 8.554   102.257 21.437  1.00   26.22 ? 148  ASN D CA  1 
ATOM   9465  C C   . ASN D 1 148 ? 10.048  102.130 21.722  1.00   29.59 ? 148  ASN D C   1 
ATOM   9466  O O   . ASN D 1 148 ? 10.652  102.929 22.428  1.00   29.62 ? 148  ASN D O   1 
ATOM   9467  C CB  . ASN D 1 148 ? 8.345   102.934 20.094  1.00   25.23 ? 148  ASN D CB  1 
ATOM   9468  C CG  . ASN D 1 148 ? 8.947   102.147 18.975  1.00   29.16 ? 148  ASN D CG  1 
ATOM   9469  O OD1 . ASN D 1 148 ? 8.650   100.971 18.802  1.00   29.54 ? 148  ASN D OD1 1 
ATOM   9470  N ND2 . ASN D 1 148 ? 9.810   102.787 18.197  1.00   32.65 ? 148  ASN D ND2 1 
ATOM   9471  N N   . ASN D 1 149 ? 10.632  101.084 21.167  1.00   29.25 ? 149  ASN D N   1 
ATOM   9472  C CA  . ASN D 1 149 ? 12.051  100.818 21.306  1.00   27.77 ? 149  ASN D CA  1 
ATOM   9473  C C   . ASN D 1 149 ? 12.569  100.974 19.888  1.00   27.76 ? 149  ASN D C   1 
ATOM   9474  O O   . ASN D 1 149 ? 12.035  100.365 18.976  1.00   28.04 ? 149  ASN D O   1 
ATOM   9475  C CB  . ASN D 1 149 ? 12.244  99.385  21.792  1.00   28.73 ? 149  ASN D CB  1 
ATOM   9476  C CG  . ASN D 1 149 ? 13.686  98.960  21.774  1.00   31.61 ? 149  ASN D CG  1 
ATOM   9477  O OD1 . ASN D 1 149 ? 14.471  99.401  20.923  1.00   31.93 ? 149  ASN D OD1 1 
ATOM   9478  N ND2 . ASN D 1 149 ? 14.050  98.073  22.700  1.00   27.39 ? 149  ASN D ND2 1 
ATOM   9479  N N   . PRO D 1 150 ? 13.632  101.776 19.679  1.00   29.95 ? 150  PRO D N   1 
ATOM   9480  C CA  . PRO D 1 150 ? 14.393  102.541 20.667  1.00   29.85 ? 150  PRO D CA  1 
ATOM   9481  C C   . PRO D 1 150 ? 14.080  104.025 20.806  1.00   30.13 ? 150  PRO D C   1 
ATOM   9482  O O   . PRO D 1 150 ? 14.830  104.739 21.465  1.00   31.09 ? 150  PRO D O   1 
ATOM   9483  C CB  . PRO D 1 150 ? 15.814  102.352 20.178  1.00   32.94 ? 150  PRO D CB  1 
ATOM   9484  C CG  . PRO D 1 150 ? 15.619  102.561 18.701  1.00   31.99 ? 150  PRO D CG  1 
ATOM   9485  C CD  . PRO D 1 150 ? 14.331  101.792 18.380  1.00   29.08 ? 150  PRO D CD  1 
ATOM   9486  N N   . THR D 1 151 ? 12.994  104.477 20.176  1.00   29.92 ? 151  THR D N   1 
ATOM   9487  C CA  . THR D 1 151 ? 12.600  105.884 20.194  1.00   28.83 ? 151  THR D CA  1 
ATOM   9488  C C   . THR D 1 151 ? 11.916  106.289 21.490  1.00   30.71 ? 151  THR D C   1 
ATOM   9489  O O   . THR D 1 151 ? 11.903  107.456 21.856  1.00   32.66 ? 151  THR D O   1 
ATOM   9490  C CB  . THR D 1 151 ? 11.622  106.208 19.020  1.00   28.38 ? 151  THR D CB  1 
ATOM   9491  O OG1 . THR D 1 151 ? 10.480  105.334 19.090  1.00   25.97 ? 151  THR D OG1 1 
ATOM   9492  C CG2 . THR D 1 151 ? 12.336  106.043 17.665  1.00   20.26 ? 151  THR D CG2 1 
ATOM   9493  N N   . GLY D 1 152 ? 11.339  105.328 22.188  1.00   30.76 ? 152  GLY D N   1 
ATOM   9494  C CA  . GLY D 1 152 ? 10.654  105.660 23.418  1.00   30.81 ? 152  GLY D CA  1 
ATOM   9495  C C   . GLY D 1 152 ? 9.402   106.483 23.172  1.00   32.99 ? 152  GLY D C   1 
ATOM   9496  O O   . GLY D 1 152 ? 8.758   106.920 24.134  1.00   32.11 ? 152  GLY D O   1 
ATOM   9497  N N   . HIS D 1 153 ? 9.036   106.715 21.910  1.00   31.74 ? 153  HIS D N   1 
ATOM   9498  C CA  . HIS D 1 153 ? 7.832   107.498 21.670  1.00   31.20 ? 153  HIS D CA  1 
ATOM   9499  C C   . HIS D 1 153 ? 6.593   106.641 21.936  1.00   31.63 ? 153  HIS D C   1 
ATOM   9500  O O   . HIS D 1 153 ? 6.623   105.413 21.839  1.00   30.21 ? 153  HIS D O   1 
ATOM   9501  C CB  . HIS D 1 153 ? 7.794   108.074 20.246  1.00   30.66 ? 153  HIS D CB  1 
ATOM   9502  C CG  . HIS D 1 153 ? 7.316   107.104 19.212  1.00   28.47 ? 153  HIS D CG  1 
ATOM   9503  N ND1 . HIS D 1 153 ? 8.163   106.240 18.554  1.00   31.49 ? 153  HIS D ND1 1 
ATOM   9504  C CD2 . HIS D 1 153 ? 6.072   106.841 18.748  1.00   28.34 ? 153  HIS D CD2 1 
ATOM   9505  C CE1 . HIS D 1 153 ? 7.461   105.487 17.726  1.00   32.86 ? 153  HIS D CE1 1 
ATOM   9506  N NE2 . HIS D 1 153 ? 6.190   105.831 17.828  1.00   31.52 ? 153  HIS D NE2 1 
ATOM   9507  N N   . VAL D 1 154 ? 5.509   107.316 22.287  1.00   32.78 ? 154  VAL D N   1 
ATOM   9508  C CA  . VAL D 1 154 ? 4.241   106.679 22.611  1.00   33.26 ? 154  VAL D CA  1 
ATOM   9509  C C   . VAL D 1 154 ? 3.292   106.712 21.417  1.00   34.02 ? 154  VAL D C   1 
ATOM   9510  O O   . VAL D 1 154 ? 2.962   107.784 20.932  1.00   37.99 ? 154  VAL D O   1 
ATOM   9511  C CB  . VAL D 1 154 ? 3.585   107.428 23.802  1.00   32.65 ? 154  VAL D CB  1 
ATOM   9512  C CG1 . VAL D 1 154 ? 2.191   106.876 24.093  1.00   34.79 ? 154  VAL D CG1 1 
ATOM   9513  C CG2 . VAL D 1 154 ? 4.467   107.311 25.014  1.00   32.78 ? 154  VAL D CG2 1 
ATOM   9514  N N   . PHE D 1 155 ? 2.851   105.560 20.932  1.00   33.62 ? 155  PHE D N   1 
ATOM   9515  C CA  . PHE D 1 155 ? 1.923   105.560 19.804  1.00   33.40 ? 155  PHE D CA  1 
ATOM   9516  C C   . PHE D 1 155 ? 0.579   106.104 20.257  1.00   34.61 ? 155  PHE D C   1 
ATOM   9517  O O   . PHE D 1 155 ? 0.205   105.929 21.402  1.00   34.32 ? 155  PHE D O   1 
ATOM   9518  C CB  . PHE D 1 155 ? 1.759   104.148 19.233  1.00   31.26 ? 155  PHE D CB  1 
ATOM   9519  C CG  . PHE D 1 155 ? 2.971   103.664 18.506  1.00   30.33 ? 155  PHE D CG  1 
ATOM   9520  C CD1 . PHE D 1 155 ? 3.998   103.037 19.188  1.00   26.91 ? 155  PHE D CD1 1 
ATOM   9521  C CD2 . PHE D 1 155 ? 3.119   103.892 17.132  1.00   29.21 ? 155  PHE D CD2 1 
ATOM   9522  C CE1 . PHE D 1 155 ? 5.166   102.636 18.518  1.00   30.04 ? 155  PHE D CE1 1 
ATOM   9523  C CE2 . PHE D 1 155 ? 4.282   103.496 16.454  1.00   27.30 ? 155  PHE D CE2 1 
ATOM   9524  C CZ  . PHE D 1 155 ? 5.306   102.866 17.150  1.00   31.13 ? 155  PHE D CZ  1 
ATOM   9525  N N   . GLU D 1 156 ? -0.154  106.760 19.368  1.00   37.51 ? 156  GLU D N   1 
ATOM   9526  C CA  . GLU D 1 156 ? -1.434  107.320 19.758  1.00   41.67 ? 156  GLU D CA  1 
ATOM   9527  C C   . GLU D 1 156 ? -2.476  106.239 19.881  1.00   42.62 ? 156  GLU D C   1 
ATOM   9528  O O   . GLU D 1 156 ? -2.418  105.215 19.201  1.00   43.19 ? 156  GLU D O   1 
ATOM   9529  C CB  . GLU D 1 156 ? -1.881  108.405 18.774  1.00   45.97 ? 156  GLU D CB  1 
ATOM   9530  C CG  . GLU D 1 156 ? -0.839  109.526 18.621  1.00   54.62 ? 156  GLU D CG  1 
ATOM   9531  C CD  . GLU D 1 156 ? -1.439  110.907 18.374  1.00   61.65 ? 156  GLU D CD  1 
ATOM   9532  O OE1 . GLU D 1 156 ? -0.692  111.911 18.526  1.00   62.67 ? 156  GLU D OE1 1 
ATOM   9533  O OE2 . GLU D 1 156 ? -2.644  110.984 18.029  1.00   63.88 ? 156  GLU D OE2 1 
ATOM   9534  N N   . ARG D 1 157 ? -3.418  106.479 20.781  1.00   45.16 ? 157  ARG D N   1 
ATOM   9535  C CA  . ARG D 1 157 ? -4.514  105.565 21.066  1.00   45.91 ? 157  ARG D CA  1 
ATOM   9536  C C   . ARG D 1 157 ? -5.224  105.010 19.822  1.00   45.46 ? 157  ARG D C   1 
ATOM   9537  O O   . ARG D 1 157 ? -5.514  103.810 19.753  1.00   43.23 ? 157  ARG D O   1 
ATOM   9538  C CB  . ARG D 1 157 ? -5.530  106.281 21.967  1.00   48.36 ? 157  ARG D CB  1 
ATOM   9539  C CG  . ARG D 1 157 ? -6.746  105.454 22.313  1.00   52.81 ? 157  ARG D CG  1 
ATOM   9540  C CD  . ARG D 1 157 ? -8.001  106.298 22.239  1.00   58.40 ? 157  ARG D CD  1 
ATOM   9541  N NE  . ARG D 1 157 ? -9.178  105.536 22.632  1.00   60.49 ? 157  ARG D NE  1 
ATOM   9542  C CZ  . ARG D 1 157 ? -9.376  105.061 23.854  1.00   61.17 ? 157  ARG D CZ  1 
ATOM   9543  N NH1 . ARG D 1 157 ? -8.473  105.276 24.810  1.00   59.09 ? 157  ARG D NH1 1 
ATOM   9544  N NH2 . ARG D 1 157 ? -10.468 104.355 24.112  1.00   62.16 ? 157  ARG D NH2 1 
ATOM   9545  N N   . GLU D 1 158 ? -5.495  105.878 18.845  1.00   45.61 ? 158  GLU D N   1 
ATOM   9546  C CA  . GLU D 1 158 ? -6.191  105.479 17.619  1.00   47.08 ? 158  GLU D CA  1 
ATOM   9547  C C   . GLU D 1 158 ? -5.376  104.624 16.661  1.00   44.85 ? 158  GLU D C   1 
ATOM   9548  O O   . GLU D 1 158 ? -5.943  103.962 15.796  1.00   46.37 ? 158  GLU D O   1 
ATOM   9549  C CB  . GLU D 1 158 ? -6.721  106.709 16.869  1.00   50.59 ? 158  GLU D CB  1 
ATOM   9550  C CG  . GLU D 1 158 ? -6.231  108.050 17.408  1.00   58.87 ? 158  GLU D CG  1 
ATOM   9551  C CD  . GLU D 1 158 ? -6.757  109.237 16.602  1.00   64.37 ? 158  GLU D CD  1 
ATOM   9552  O OE1 . GLU D 1 158 ? -6.592  110.396 17.056  1.00   65.09 ? 158  GLU D OE1 1 
ATOM   9553  O OE2 . GLU D 1 158 ? -7.331  109.008 15.511  1.00   64.72 ? 158  GLU D OE2 1 
ATOM   9554  N N   . GLU D 1 159 ? -4.055  104.651 16.794  1.00   43.99 ? 159  GLU D N   1 
ATOM   9555  C CA  . GLU D 1 159 ? -3.199  103.823 15.942  1.00   42.69 ? 159  GLU D CA  1 
ATOM   9556  C C   . GLU D 1 159 ? -3.401  102.357 16.363  1.00   40.46 ? 159  GLU D C   1 
ATOM   9557  O O   . GLU D 1 159 ? -3.622  101.476 15.535  1.00   40.13 ? 159  GLU D O   1 
ATOM   9558  C CB  . GLU D 1 159 ? -1.714  104.241 16.087  1.00   40.27 ? 159  GLU D CB  1 
ATOM   9559  C CG  . GLU D 1 159 ? -1.406  105.603 15.479  1.00   37.43 ? 159  GLU D CG  1 
ATOM   9560  C CD  . GLU D 1 159 ? 0.073   105.964 15.488  1.00   38.78 ? 159  GLU D CD  1 
ATOM   9561  O OE1 . GLU D 1 159 ? 0.603   106.325 16.560  1.00   38.96 ? 159  GLU D OE1 1 
ATOM   9562  O OE2 . GLU D 1 159 ? 0.705   105.889 14.416  1.00   34.66 ? 159  GLU D OE2 1 
ATOM   9563  N N   . ILE D 1 160 ? -3.359  102.114 17.666  1.00   40.66 ? 160  ILE D N   1 
ATOM   9564  C CA  . ILE D 1 160 ? -3.546  100.771 18.198  1.00   39.73 ? 160  ILE D CA  1 
ATOM   9565  C C   . ILE D 1 160 ? -4.949  100.269 17.883  1.00   38.68 ? 160  ILE D C   1 
ATOM   9566  O O   . ILE D 1 160 ? -5.128  99.114  17.493  1.00   39.75 ? 160  ILE D O   1 
ATOM   9567  C CB  . ILE D 1 160 ? -3.329  100.739 19.731  1.00   38.03 ? 160  ILE D CB  1 
ATOM   9568  C CG1 . ILE D 1 160 ? -1.852  100.964 20.057  1.00   38.74 ? 160  ILE D CG1 1 
ATOM   9569  C CG2 . ILE D 1 160 ? -3.753  99.400  20.292  1.00   40.84 ? 160  ILE D CG2 1 
ATOM   9570  C CD1 . ILE D 1 160 ? -1.299  102.286 19.591  1.00   42.19 ? 160  ILE D CD1 1 
ATOM   9571  N N   . GLU D 1 161 ? -5.946  101.130 18.059  1.00   37.42 ? 161  GLU D N   1 
ATOM   9572  C CA  . GLU D 1 161 ? -7.322  100.736 17.777  1.00   34.85 ? 161  GLU D CA  1 
ATOM   9573  C C   . GLU D 1 161 ? -7.498  100.362 16.312  1.00   33.83 ? 161  GLU D C   1 
ATOM   9574  O O   . GLU D 1 161 ? -8.190  99.400  15.990  1.00   34.09 ? 161  GLU D O   1 
ATOM   9575  C CB  . GLU D 1 161 ? -8.275  101.866 18.138  1.00   36.95 ? 161  GLU D CB  1 
ATOM   9576  C CG  . GLU D 1 161 ? -8.152  102.267 19.578  1.00   38.60 ? 161  GLU D CG  1 
ATOM   9577  C CD  . GLU D 1 161 ? -9.244  103.196 20.014  1.00   39.04 ? 161  GLU D CD  1 
ATOM   9578  O OE1 . GLU D 1 161 ? -9.338  104.317 19.456  1.00   41.18 ? 161  GLU D OE1 1 
ATOM   9579  O OE2 . GLU D 1 161 ? -10.007 102.791 20.918  1.00   39.68 ? 161  GLU D OE2 1 
ATOM   9580  N N   . ARG D 1 162 ? -6.871  101.122 15.426  1.00   32.78 ? 162  ARG D N   1 
ATOM   9581  C CA  . ARG D 1 162 ? -6.959  100.857 13.994  1.00   33.12 ? 162  ARG D CA  1 
ATOM   9582  C C   . ARG D 1 162 ? -6.598  99.394  13.740  1.00   32.90 ? 162  ARG D C   1 
ATOM   9583  O O   . ARG D 1 162 ? -7.421  98.606  13.269  1.00   33.25 ? 162  ARG D O   1 
ATOM   9584  C CB  . ARG D 1 162 ? -5.983  101.757 13.229  1.00   30.56 ? 162  ARG D CB  1 
ATOM   9585  C CG  . ARG D 1 162 ? -6.399  102.046 11.808  1.00   36.72 ? 162  ARG D CG  1 
ATOM   9586  C CD  . ARG D 1 162 ? -7.814  102.609 11.821  1.00   45.53 ? 162  ARG D CD  1 
ATOM   9587  N NE  . ARG D 1 162 ? -8.011  103.503 12.966  1.00   54.98 ? 162  ARG D NE  1 
ATOM   9588  C CZ  . ARG D 1 162 ? -9.198  103.928 13.402  1.00   58.06 ? 162  ARG D CZ  1 
ATOM   9589  N NH1 . ARG D 1 162 ? -10.319 103.549 12.788  1.00   58.23 ? 162  ARG D NH1 1 
ATOM   9590  N NH2 . ARG D 1 162 ? -9.264  104.725 14.465  1.00   56.10 ? 162  ARG D NH2 1 
ATOM   9591  N N   . ILE D 1 163 ? -5.355  99.046  14.072  1.00   31.69 ? 163  ILE D N   1 
ATOM   9592  C CA  . ILE D 1 163 ? -4.858  97.696  13.894  1.00   30.85 ? 163  ILE D CA  1 
ATOM   9593  C C   . ILE D 1 163 ? -5.693  96.687  14.654  1.00   30.47 ? 163  ILE D C   1 
ATOM   9594  O O   . ILE D 1 163 ? -5.974  95.601  14.176  1.00   29.26 ? 163  ILE D O   1 
ATOM   9595  C CB  . ILE D 1 163 ? -3.415  97.592  14.371  1.00   30.85 ? 163  ILE D CB  1 
ATOM   9596  C CG1 . ILE D 1 163 ? -2.534  98.485  13.496  1.00   30.49 ? 163  ILE D CG1 1 
ATOM   9597  C CG2 . ILE D 1 163 ? -2.968  96.125  14.343  1.00   30.56 ? 163  ILE D CG2 1 
ATOM   9598  C CD1 . ILE D 1 163 ? -1.094  98.404  13.832  1.00   36.63 ? 163  ILE D CD1 1 
ATOM   9599  N N   . LEU D 1 164 ? -6.095  97.066  15.849  1.00   30.28 ? 164  LEU D N   1 
ATOM   9600  C CA  . LEU D 1 164 ? -6.892  96.188  16.678  1.00   32.36 ? 164  LEU D CA  1 
ATOM   9601  C C   . LEU D 1 164 ? -8.219  95.869  15.985  1.00   34.61 ? 164  LEU D C   1 
ATOM   9602  O O   . LEU D 1 164 ? -8.644  94.710  15.932  1.00   32.61 ? 164  LEU D O   1 
ATOM   9603  C CB  . LEU D 1 164 ? -7.123  96.869  18.015  1.00   30.06 ? 164  LEU D CB  1 
ATOM   9604  C CG  . LEU D 1 164 ? -7.313  96.068  19.289  1.00   36.61 ? 164  LEU D CG  1 
ATOM   9605  C CD1 . LEU D 1 164 ? -6.498  94.777  19.316  1.00   36.32 ? 164  LEU D CD1 1 
ATOM   9606  C CD2 . LEU D 1 164 ? -6.904  97.002  20.423  1.00   37.04 ? 164  LEU D CD2 1 
ATOM   9607  N N   . LYS D 1 165 ? -8.862  96.888  15.420  1.00   36.55 ? 165  LYS D N   1 
ATOM   9608  C CA  . LYS D 1 165 ? -10.141 96.670  14.746  1.00   39.03 ? 165  LYS D CA  1 
ATOM   9609  C C   . LYS D 1 165 ? -10.000 95.838  13.480  1.00   38.38 ? 165  LYS D C   1 
ATOM   9610  O O   . LYS D 1 165 ? -10.984 95.401  12.885  1.00   39.14 ? 165  LYS D O   1 
ATOM   9611  C CB  . LYS D 1 165 ? -10.811 98.007  14.416  1.00   38.94 ? 165  LYS D CB  1 
ATOM   9612  C CG  . LYS D 1 165 ? -11.319 98.731  15.653  1.00   46.07 ? 165  LYS D CG  1 
ATOM   9613  C CD  . LYS D 1 165 ? -12.124 99.974  15.311  1.00   49.03 ? 165  LYS D CD  1 
ATOM   9614  C CE  . LYS D 1 165 ? -11.266 101.025 14.629  1.00   52.25 ? 165  LYS D CE  1 
ATOM   9615  N NZ  . LYS D 1 165 ? -12.065 102.228 14.260  1.00   53.88 ? 165  LYS D NZ  1 
ATOM   9616  N N   . THR D 1 166 ? -8.764  95.607  13.079  1.00   37.86 ? 166  THR D N   1 
ATOM   9617  C CA  . THR D 1 166 ? -8.505  94.840  11.880  1.00   35.13 ? 166  THR D CA  1 
ATOM   9618  C C   . THR D 1 166 ? -8.730  93.343  12.113  1.00   32.82 ? 166  THR D C   1 
ATOM   9619  O O   . THR D 1 166 ? -8.857  92.565  11.166  1.00   29.67 ? 166  THR D O   1 
ATOM   9620  C CB  . THR D 1 166 ? -7.076  95.098  11.395  1.00   34.87 ? 166  THR D CB  1 
ATOM   9621  O OG1 . THR D 1 166 ? -7.086  95.155  9.972   1.00   37.03 ? 166  THR D OG1 1 
ATOM   9622  C CG2 . THR D 1 166 ? -6.131  93.996  11.856  1.00   27.42 ? 166  THR D CG2 1 
ATOM   9623  N N   . GLY D 1 167 ? -8.801  92.956  13.380  1.00   31.28 ? 167  GLY D N   1 
ATOM   9624  C CA  . GLY D 1 167 ? -9.008  91.559  13.712  1.00   31.00 ? 167  GLY D CA  1 
ATOM   9625  C C   . GLY D 1 167 ? -7.709  90.819  14.009  1.00   31.76 ? 167  GLY D C   1 
ATOM   9626  O O   . GLY D 1 167 ? -7.724  89.726  14.579  1.00   36.08 ? 167  GLY D O   1 
ATOM   9627  N N   . ALA D 1 168 ? -6.583  91.391  13.603  1.00   30.29 ? 168  ALA D N   1 
ATOM   9628  C CA  . ALA D 1 168 ? -5.288  90.779  13.855  1.00   30.82 ? 168  ALA D CA  1 
ATOM   9629  C C   . ALA D 1 168 ? -4.985  90.805  15.351  1.00   30.03 ? 168  ALA D C   1 
ATOM   9630  O O   . ALA D 1 168 ? -5.588  91.563  16.107  1.00   28.82 ? 168  ALA D O   1 
ATOM   9631  C CB  . ALA D 1 168 ? -4.198  91.527  13.090  1.00   31.02 ? 168  ALA D CB  1 
ATOM   9632  N N   . PHE D 1 169 ? -4.059  89.964  15.793  1.00   30.93 ? 169  PHE D N   1 
ATOM   9633  C CA  . PHE D 1 169 ? -3.734  89.940  17.212  1.00   30.51 ? 169  PHE D CA  1 
ATOM   9634  C C   . PHE D 1 169 ? -2.628  90.943  17.527  1.00   31.70 ? 169  PHE D C   1 
ATOM   9635  O O   . PHE D 1 169 ? -1.565  90.934  16.897  1.00   31.15 ? 169  PHE D O   1 
ATOM   9636  C CB  . PHE D 1 169 ? -3.328  88.534  17.656  1.00   28.18 ? 169  PHE D CB  1 
ATOM   9637  C CG  . PHE D 1 169 ? -3.393  88.350  19.135  1.00   27.74 ? 169  PHE D CG  1 
ATOM   9638  C CD1 . PHE D 1 169 ? -2.292  88.641  19.940  1.00   30.97 ? 169  PHE D CD1 1 
ATOM   9639  C CD2 . PHE D 1 169 ? -4.579  87.984  19.740  1.00   24.37 ? 169  PHE D CD2 1 
ATOM   9640  C CE1 . PHE D 1 169 ? -2.390  88.570  21.330  1.00   27.98 ? 169  PHE D CE1 1 
ATOM   9641  C CE2 . PHE D 1 169 ? -4.679  87.914  21.116  1.00   27.90 ? 169  PHE D CE2 1 
ATOM   9642  C CZ  . PHE D 1 169 ? -3.591  88.207  21.910  1.00   25.77 ? 169  PHE D CZ  1 
ATOM   9643  N N   . VAL D 1 170 ? -2.893  91.818  18.495  1.00   32.52 ? 170  VAL D N   1 
ATOM   9644  C CA  . VAL D 1 170 ? -1.937  92.849  18.881  1.00   31.14 ? 170  VAL D CA  1 
ATOM   9645  C C   . VAL D 1 170 ? -1.111  92.551  20.124  1.00   29.05 ? 170  VAL D C   1 
ATOM   9646  O O   . VAL D 1 170 ? -1.640  92.357  21.215  1.00   30.01 ? 170  VAL D O   1 
ATOM   9647  C CB  . VAL D 1 170 ? -2.633  94.193  19.098  1.00   34.05 ? 170  VAL D CB  1 
ATOM   9648  C CG1 . VAL D 1 170 ? -1.598  95.270  19.400  1.00   29.18 ? 170  VAL D CG1 1 
ATOM   9649  C CG2 . VAL D 1 170 ? -3.451  94.545  17.867  1.00   37.50 ? 170  VAL D CG2 1 
ATOM   9650  N N   . ALA D 1 171 ? 0.203   92.518  19.944  1.00   30.36 ? 171  ALA D N   1 
ATOM   9651  C CA  . ALA D 1 171 ? 1.123   92.285  21.048  1.00   28.05 ? 171  ALA D CA  1 
ATOM   9652  C C   . ALA D 1 171 ? 1.632   93.652  21.454  1.00   26.34 ? 171  ALA D C   1 
ATOM   9653  O O   . ALA D 1 171 ? 2.570   94.174  20.850  1.00   27.10 ? 171  ALA D O   1 
ATOM   9654  C CB  . ALA D 1 171 ? 2.273   91.420  20.600  1.00   30.98 ? 171  ALA D CB  1 
ATOM   9655  N N   . LEU D 1 172 ? 0.986   94.248  22.446  1.00   21.75 ? 172  LEU D N   1 
ATOM   9656  C CA  . LEU D 1 172 ? 1.414   95.552  22.907  1.00   23.69 ? 172  LEU D CA  1 
ATOM   9657  C C   . LEU D 1 172 ? 2.508   95.372  23.956  1.00   22.35 ? 172  LEU D C   1 
ATOM   9658  O O   . LEU D 1 172 ? 2.235   95.107  25.125  1.00   21.47 ? 172  LEU D O   1 
ATOM   9659  C CB  . LEU D 1 172 ? 0.244   96.316  23.502  1.00   26.02 ? 172  LEU D CB  1 
ATOM   9660  C CG  . LEU D 1 172 ? 0.447   97.823  23.464  1.00   28.03 ? 172  LEU D CG  1 
ATOM   9661  C CD1 . LEU D 1 172 ? 0.077   98.332  22.089  1.00   25.96 ? 172  LEU D CD1 1 
ATOM   9662  C CD2 . LEU D 1 172 ? -0.436  98.473  24.532  1.00   30.83 ? 172  LEU D CD2 1 
ATOM   9663  N N   . ASP D 1 173 ? 3.750   95.529  23.521  1.00   23.12 ? 173  ASP D N   1 
ATOM   9664  C CA  . ASP D 1 173 ? 4.892   95.336  24.398  1.00   22.74 ? 173  ASP D CA  1 
ATOM   9665  C C   . ASP D 1 173 ? 5.073   96.536  25.329  1.00   23.95 ? 173  ASP D C   1 
ATOM   9666  O O   . ASP D 1 173 ? 5.594   97.576  24.913  1.00   22.06 ? 173  ASP D O   1 
ATOM   9667  C CB  . ASP D 1 173 ? 6.146   95.135  23.541  1.00   23.88 ? 173  ASP D CB  1 
ATOM   9668  C CG  . ASP D 1 173 ? 7.310   94.620  24.338  1.00   30.81 ? 173  ASP D CG  1 
ATOM   9669  O OD1 . ASP D 1 173 ? 7.399   94.966  25.550  1.00   31.33 ? 173  ASP D OD1 1 
ATOM   9670  O OD2 . ASP D 1 173 ? 8.124   93.879  23.725  1.00   27.55 ? 173  ASP D OD2 1 
ATOM   9671  N N   . GLU D 1 174 ? 4.621   96.391  26.579  1.00   23.41 ? 174  GLU D N   1 
ATOM   9672  C CA  . GLU D 1 174 ? 4.754   97.444  27.575  1.00   22.61 ? 174  GLU D CA  1 
ATOM   9673  C C   . GLU D 1 174 ? 6.008   97.266  28.450  1.00   20.92 ? 174  GLU D C   1 
ATOM   9674  O O   . GLU D 1 174 ? 6.013   97.540  29.652  1.00   21.91 ? 174  GLU D O   1 
ATOM   9675  C CB  . GLU D 1 174 ? 3.483   97.514  28.433  1.00   24.88 ? 174  GLU D CB  1 
ATOM   9676  C CG  . GLU D 1 174 ? 2.295   98.130  27.683  1.00   25.96 ? 174  GLU D CG  1 
ATOM   9677  C CD  . GLU D 1 174 ? 1.131   98.547  28.592  1.00   28.77 ? 174  GLU D CD  1 
ATOM   9678  O OE1 . GLU D 1 174 ? 1.177   98.304  29.809  1.00   30.26 ? 174  GLU D OE1 1 
ATOM   9679  O OE2 . GLU D 1 174 ? 0.149   99.134  28.083  1.00   34.09 ? 174  GLU D OE2 1 
ATOM   9680  N N   . ALA D 1 175 ? 7.090   96.823  27.823  1.00   21.71 ? 175  ALA D N   1 
ATOM   9681  C CA  . ALA D 1 175 ? 8.346   96.620  28.530  1.00   18.86 ? 175  ALA D CA  1 
ATOM   9682  C C   . ALA D 1 175 ? 8.745   97.891  29.301  1.00   21.05 ? 175  ALA D C   1 
ATOM   9683  O O   . ALA D 1 175 ? 9.320   97.805  30.390  1.00   22.79 ? 175  ALA D O   1 
ATOM   9684  C CB  . ALA D 1 175 ? 9.454   96.213  27.528  1.00   7.93  ? 175  ALA D CB  1 
ATOM   9685  N N   . TYR D 1 176 ? 8.433   99.070  28.763  1.00   21.42 ? 176  TYR D N   1 
ATOM   9686  C CA  . TYR D 1 176 ? 8.803   100.315 29.444  1.00   23.27 ? 176  TYR D CA  1 
ATOM   9687  C C   . TYR D 1 176 ? 7.652   101.021 30.128  1.00   21.39 ? 176  TYR D C   1 
ATOM   9688  O O   . TYR D 1 176 ? 7.683   102.231 30.309  1.00   23.93 ? 176  TYR D O   1 
ATOM   9689  C CB  . TYR D 1 176 ? 9.509   101.283 28.464  1.00   24.43 ? 176  TYR D CB  1 
ATOM   9690  C CG  . TYR D 1 176 ? 10.736  100.678 27.830  1.00   24.78 ? 176  TYR D CG  1 
ATOM   9691  C CD1 . TYR D 1 176 ? 11.962  100.644 28.511  1.00   24.98 ? 176  TYR D CD1 1 
ATOM   9692  C CD2 . TYR D 1 176 ? 10.648  100.044 26.592  1.00   24.57 ? 176  TYR D CD2 1 
ATOM   9693  C CE1 . TYR D 1 176 ? 13.074  99.974  27.963  1.00   25.18 ? 176  TYR D CE1 1 
ATOM   9694  C CE2 . TYR D 1 176 ? 11.737  99.377  26.044  1.00   22.57 ? 176  TYR D CE2 1 
ATOM   9695  C CZ  . TYR D 1 176 ? 12.942  99.341  26.733  1.00   23.90 ? 176  TYR D CZ  1 
ATOM   9696  O OH  . TYR D 1 176 ? 13.984  98.636  26.217  1.00   18.77 ? 176  TYR D OH  1 
ATOM   9697  N N   . TYR D 1 177 ? 6.648   100.261 30.547  1.00   25.01 ? 177  TYR D N   1 
ATOM   9698  C CA  . TYR D 1 177 ? 5.484   100.842 31.226  1.00   24.55 ? 177  TYR D CA  1 
ATOM   9699  C C   . TYR D 1 177 ? 5.772   101.685 32.461  1.00   24.71 ? 177  TYR D C   1 
ATOM   9700  O O   . TYR D 1 177 ? 5.309   102.817 32.557  1.00   25.29 ? 177  TYR D O   1 
ATOM   9701  C CB  . TYR D 1 177 ? 4.499   99.749  31.629  1.00   24.38 ? 177  TYR D CB  1 
ATOM   9702  C CG  . TYR D 1 177 ? 3.522   100.195 32.709  1.00   24.48 ? 177  TYR D CG  1 
ATOM   9703  C CD1 . TYR D 1 177 ? 3.588   99.659  33.994  1.00   24.49 ? 177  TYR D CD1 1 
ATOM   9704  C CD2 . TYR D 1 177 ? 2.533   101.156 32.440  1.00   26.40 ? 177  TYR D CD2 1 
ATOM   9705  C CE1 . TYR D 1 177 ? 2.707   100.049 34.974  1.00   24.10 ? 177  TYR D CE1 1 
ATOM   9706  C CE2 . TYR D 1 177 ? 1.643   101.561 33.414  1.00   25.71 ? 177  TYR D CE2 1 
ATOM   9707  C CZ  . TYR D 1 177 ? 1.733   100.997 34.678  1.00   29.72 ? 177  TYR D CZ  1 
ATOM   9708  O OH  . TYR D 1 177 ? 0.806   101.346 35.633  1.00   33.75 ? 177  TYR D OH  1 
ATOM   9709  N N   . GLU D 1 178 ? 6.490   101.107 33.421  1.00   24.29 ? 178  GLU D N   1 
ATOM   9710  C CA  . GLU D 1 178 ? 6.808   101.805 34.662  1.00   24.43 ? 178  GLU D CA  1 
ATOM   9711  C C   . GLU D 1 178 ? 7.341   103.222 34.474  1.00   26.10 ? 178  GLU D C   1 
ATOM   9712  O O   . GLU D 1 178 ? 7.143   104.076 35.350  1.00   26.18 ? 178  GLU D O   1 
ATOM   9713  C CB  . GLU D 1 178 ? 7.835   101.020 35.482  1.00   20.44 ? 178  GLU D CB  1 
ATOM   9714  C CG  . GLU D 1 178 ? 7.290   99.790  36.170  1.00   26.52 ? 178  GLU D CG  1 
ATOM   9715  C CD  . GLU D 1 178 ? 6.747   98.750  35.195  1.00   33.60 ? 178  GLU D CD  1 
ATOM   9716  O OE1 . GLU D 1 178 ? 7.276   98.637  34.055  1.00   29.07 ? 178  GLU D OE1 1 
ATOM   9717  O OE2 . GLU D 1 178 ? 5.798   98.036  35.590  1.00   35.14 ? 178  GLU D OE2 1 
ATOM   9718  N N   . PHE D 1 179 ? 7.999   103.485 33.348  1.00   23.73 ? 179  PHE D N   1 
ATOM   9719  C CA  . PHE D 1 179 ? 8.585   104.806 33.119  1.00   25.12 ? 179  PHE D CA  1 
ATOM   9720  C C   . PHE D 1 179 ? 7.669   105.763 32.376  1.00   24.44 ? 179  PHE D C   1 
ATOM   9721  O O   . PHE D 1 179 ? 7.893   106.965 32.387  1.00   23.37 ? 179  PHE D O   1 
ATOM   9722  C CB  . PHE D 1 179 ? 9.913   104.674 32.374  1.00   19.76 ? 179  PHE D CB  1 
ATOM   9723  C CG  . PHE D 1 179 ? 10.841  103.682 32.984  1.00   20.02 ? 179  PHE D CG  1 
ATOM   9724  C CD1 . PHE D 1 179 ? 11.478  103.959 34.194  1.00   17.70 ? 179  PHE D CD1 1 
ATOM   9725  C CD2 . PHE D 1 179 ? 11.057  102.444 32.364  1.00   19.68 ? 179  PHE D CD2 1 
ATOM   9726  C CE1 . PHE D 1 179 ? 12.322  103.020 34.788  1.00   8.07  ? 179  PHE D CE1 1 
ATOM   9727  C CE2 . PHE D 1 179 ? 11.895  101.488 32.937  1.00   20.19 ? 179  PHE D CE2 1 
ATOM   9728  C CZ  . PHE D 1 179 ? 12.533  101.770 34.154  1.00   18.97 ? 179  PHE D CZ  1 
ATOM   9729  N N   . HIS D 1 180 ? 6.641   105.220 31.740  1.00   25.40 ? 180  HIS D N   1 
ATOM   9730  C CA  . HIS D 1 180 ? 5.670   106.016 31.005  1.00   27.32 ? 180  HIS D CA  1 
ATOM   9731  C C   . HIS D 1 180 ? 4.540   106.301 31.976  1.00   26.87 ? 180  HIS D C   1 
ATOM   9732  O O   . HIS D 1 180 ? 4.432   107.390 32.506  1.00   27.75 ? 180  HIS D O   1 
ATOM   9733  C CB  . HIS D 1 180 ? 5.122   105.237 29.790  1.00   26.41 ? 180  HIS D CB  1 
ATOM   9734  C CG  . HIS D 1 180 ? 4.049   105.962 29.031  1.00   27.66 ? 180  HIS D CG  1 
ATOM   9735  N ND1 . HIS D 1 180 ? 3.045   105.305 28.348  1.00   27.16 ? 180  HIS D ND1 1 
ATOM   9736  C CD2 . HIS D 1 180 ? 3.839   107.284 28.823  1.00   24.35 ? 180  HIS D CD2 1 
ATOM   9737  C CE1 . HIS D 1 180 ? 2.264   106.194 27.755  1.00   24.62 ? 180  HIS D CE1 1 
ATOM   9738  N NE2 . HIS D 1 180 ? 2.726   107.401 28.025  1.00   19.02 ? 180  HIS D NE2 1 
ATOM   9739  N N   . GLY D 1 181 ? 3.700   105.310 32.226  1.00   30.68 ? 181  GLY D N   1 
ATOM   9740  C CA  . GLY D 1 181 ? 2.598   105.538 33.146  1.00   31.84 ? 181  GLY D CA  1 
ATOM   9741  C C   . GLY D 1 181 ? 1.258   104.998 32.684  1.00   31.78 ? 181  GLY D C   1 
ATOM   9742  O O   . GLY D 1 181 ? 0.371   104.721 33.490  1.00   32.92 ? 181  GLY D O   1 
ATOM   9743  N N   . GLU D 1 182 ? 1.097   104.845 31.380  1.00   32.67 ? 182  GLU D N   1 
ATOM   9744  C CA  . GLU D 1 182 ? -0.154  104.326 30.875  1.00   33.44 ? 182  GLU D CA  1 
ATOM   9745  C C   . GLU D 1 182 ? -0.025  102.934 30.325  1.00   32.07 ? 182  GLU D C   1 
ATOM   9746  O O   . GLU D 1 182 ? 1.035   102.516 29.871  1.00   34.29 ? 182  GLU D O   1 
ATOM   9747  C CB  . GLU D 1 182 ? -0.693  105.211 29.786  1.00   36.13 ? 182  GLU D CB  1 
ATOM   9748  C CG  . GLU D 1 182 ? -0.935  106.601 30.218  1.00   40.38 ? 182  GLU D CG  1 
ATOM   9749  C CD  . GLU D 1 182 ? -1.883  107.270 29.288  1.00   46.39 ? 182  GLU D CD  1 
ATOM   9750  O OE1 . GLU D 1 182 ? -1.750  108.502 29.107  1.00   51.20 ? 182  GLU D OE1 1 
ATOM   9751  O OE2 . GLU D 1 182 ? -2.755  106.558 28.748  1.00   42.90 ? 182  GLU D OE2 1 
ATOM   9752  N N   . SER D 1 183 ? -1.131  102.219 30.362  1.00   31.38 ? 183  SER D N   1 
ATOM   9753  C CA  . SER D 1 183 ? -1.158  100.876 29.861  1.00   30.07 ? 183  SER D CA  1 
ATOM   9754  C C   . SER D 1 183 ? -2.487  100.707 29.193  1.00   32.38 ? 183  SER D C   1 
ATOM   9755  O O   . SER D 1 183 ? -3.432  101.401 29.535  1.00   31.87 ? 183  SER D O   1 
ATOM   9756  C CB  . SER D 1 183 ? -1.018  99.882  30.999  1.00   28.17 ? 183  SER D CB  1 
ATOM   9757  O OG  . SER D 1 183 ? -1.270  98.569  30.537  1.00   33.47 ? 183  SER D OG  1 
ATOM   9758  N N   . TYR D 1 184 ? -2.548  99.786  28.235  1.00   34.92 ? 184  TYR D N   1 
ATOM   9759  C CA  . TYR D 1 184 ? -3.767  99.497  27.501  1.00   34.13 ? 184  TYR D CA  1 
ATOM   9760  C C   . TYR D 1 184 ? -4.434  98.259  28.068  1.00   34.41 ? 184  TYR D C   1 
ATOM   9761  O O   . TYR D 1 184 ? -5.365  97.726  27.454  1.00   32.65 ? 184  TYR D O   1 
ATOM   9762  C CB  . TYR D 1 184 ? -3.458  99.273  26.028  1.00   36.51 ? 184  TYR D CB  1 
ATOM   9763  C CG  . TYR D 1 184 ? -3.178  100.539 25.265  1.00   39.73 ? 184  TYR D CG  1 
ATOM   9764  C CD1 . TYR D 1 184 ? -4.144  101.099 24.432  1.00   41.31 ? 184  TYR D CD1 1 
ATOM   9765  C CD2 . TYR D 1 184 ? -1.945  101.178 25.373  1.00   40.24 ? 184  TYR D CD2 1 
ATOM   9766  C CE1 . TYR D 1 184 ? -3.886  102.266 23.723  1.00   45.01 ? 184  TYR D CE1 1 
ATOM   9767  C CE2 . TYR D 1 184 ? -1.673  102.344 24.672  1.00   40.72 ? 184  TYR D CE2 1 
ATOM   9768  C CZ  . TYR D 1 184 ? -2.647  102.886 23.849  1.00   45.05 ? 184  TYR D CZ  1 
ATOM   9769  O OH  . TYR D 1 184 ? -2.392  104.050 23.162  1.00   50.22 ? 184  TYR D OH  1 
ATOM   9770  N N   . VAL D 1 185 ? -3.953  97.798  29.225  1.00   33.56 ? 185  VAL D N   1 
ATOM   9771  C CA  . VAL D 1 185 ? -4.520  96.618  29.887  1.00   33.37 ? 185  VAL D CA  1 
ATOM   9772  C C   . VAL D 1 185 ? -6.039  96.714  29.929  1.00   33.72 ? 185  VAL D C   1 
ATOM   9773  O O   . VAL D 1 185 ? -6.739  95.711  29.761  1.00   30.90 ? 185  VAL D O   1 
ATOM   9774  C CB  . VAL D 1 185 ? -4.000  96.475  31.344  1.00   36.69 ? 185  VAL D CB  1 
ATOM   9775  C CG1 . VAL D 1 185 ? -4.854  95.475  32.103  1.00   34.85 ? 185  VAL D CG1 1 
ATOM   9776  C CG2 . VAL D 1 185 ? -2.530  96.016  31.349  1.00   31.13 ? 185  VAL D CG2 1 
ATOM   9777  N N   . ASP D 1 186 ? -6.534  97.938  30.118  1.00   35.42 ? 186  ASP D N   1 
ATOM   9778  C CA  . ASP D 1 186 ? -7.968  98.210  30.191  1.00   39.76 ? 186  ASP D CA  1 
ATOM   9779  C C   . ASP D 1 186 ? -8.744  97.839  28.933  1.00   39.38 ? 186  ASP D C   1 
ATOM   9780  O O   . ASP D 1 186 ? -9.888  97.392  29.026  1.00   39.61 ? 186  ASP D O   1 
ATOM   9781  C CB  . ASP D 1 186 ? -8.205  99.689  30.530  1.00   44.19 ? 186  ASP D CB  1 
ATOM   9782  C CG  . ASP D 1 186 ? -9.150  99.877  31.709  1.00   48.78 ? 186  ASP D CG  1 
ATOM   9783  O OD1 . ASP D 1 186 ? -9.289  101.032 32.175  1.00   51.49 ? 186  ASP D OD1 1 
ATOM   9784  O OD2 . ASP D 1 186 ? -9.756  98.874  32.163  1.00   53.34 ? 186  ASP D OD2 1 
ATOM   9785  N N   . PHE D 1 187 ? -8.134  98.009  27.763  1.00   40.04 ? 187  PHE D N   1 
ATOM   9786  C CA  . PHE D 1 187 ? -8.803  97.658  26.510  1.00   40.85 ? 187  PHE D CA  1 
ATOM   9787  C C   . PHE D 1 187 ? -9.114  96.181  26.467  1.00   42.21 ? 187  PHE D C   1 
ATOM   9788  O O   . PHE D 1 187 ? -9.870  95.730  25.616  1.00   45.46 ? 187  PHE D O   1 
ATOM   9789  C CB  . PHE D 1 187 ? -7.924  97.958  25.300  1.00   41.83 ? 187  PHE D CB  1 
ATOM   9790  C CG  . PHE D 1 187 ? -8.035  99.367  24.788  1.00   42.71 ? 187  PHE D CG  1 
ATOM   9791  C CD1 . PHE D 1 187 ? -7.883  99.625  23.431  1.00   42.74 ? 187  PHE D CD1 1 
ATOM   9792  C CD2 . PHE D 1 187 ? -8.271  100.428 25.652  1.00   41.88 ? 187  PHE D CD2 1 
ATOM   9793  C CE1 . PHE D 1 187 ? -7.965  100.906 22.944  1.00   42.55 ? 187  PHE D CE1 1 
ATOM   9794  C CE2 . PHE D 1 187 ? -8.355  101.718 25.175  1.00   40.90 ? 187  PHE D CE2 1 
ATOM   9795  C CZ  . PHE D 1 187 ? -8.202  101.960 23.820  1.00   45.08 ? 187  PHE D CZ  1 
ATOM   9796  N N   . LEU D 1 188 ? -8.504  95.421  27.361  1.00   42.71 ? 188  LEU D N   1 
ATOM   9797  C CA  . LEU D 1 188 ? -8.729  93.991  27.378  1.00   43.71 ? 188  LEU D CA  1 
ATOM   9798  C C   . LEU D 1 188 ? -10.205 93.784  27.663  1.00   45.10 ? 188  LEU D C   1 
ATOM   9799  O O   . LEU D 1 188 ? -10.786 92.801  27.225  1.00   45.52 ? 188  LEU D O   1 
ATOM   9800  C CB  . LEU D 1 188 ? -7.863  93.328  28.459  1.00   41.61 ? 188  LEU D CB  1 
ATOM   9801  C CG  . LEU D 1 188 ? -6.914  92.197  28.047  1.00   42.24 ? 188  LEU D CG  1 
ATOM   9802  C CD1 . LEU D 1 188 ? -7.723  91.068  27.426  1.00   46.18 ? 188  LEU D CD1 1 
ATOM   9803  C CD2 . LEU D 1 188 ? -5.847  92.693  27.082  1.00   39.94 ? 188  LEU D CD2 1 
ATOM   9804  N N   . LYS D 1 189 ? -10.810 94.722  28.390  1.00   45.88 ? 189  LYS D N   1 
ATOM   9805  C CA  . LYS D 1 189 ? -12.241 94.639  28.703  1.00   47.34 ? 189  LYS D CA  1 
ATOM   9806  C C   . LYS D 1 189 ? -13.055 94.591  27.408  1.00   46.92 ? 189  LYS D C   1 
ATOM   9807  O O   . LYS D 1 189 ? -14.087 93.922  27.322  1.00   45.16 ? 189  LYS D O   1 
ATOM   9808  C CB  . LYS D 1 189 ? -12.686 95.850  29.519  1.00   49.09 ? 189  LYS D CB  1 
ATOM   9809  C CG  . LYS D 1 189 ? -12.332 95.812  30.999  1.00   54.33 ? 189  LYS D CG  1 
ATOM   9810  C CD  . LYS D 1 189 ? -12.850 97.081  31.684  1.00   57.69 ? 189  LYS D CD  1 
ATOM   9811  C CE  . LYS D 1 189 ? -13.291 96.821  33.122  1.00   59.22 ? 189  LYS D CE  1 
ATOM   9812  N NZ  . LYS D 1 189 ? -13.989 98.008  33.714  1.00   62.78 ? 189  LYS D NZ  1 
ATOM   9813  N N   . LYS D 1 190 ? -12.580 95.311  26.402  1.00   47.41 ? 190  LYS D N   1 
ATOM   9814  C CA  . LYS D 1 190 ? -13.248 95.359  25.110  1.00   48.38 ? 190  LYS D CA  1 
ATOM   9815  C C   . LYS D 1 190 ? -12.668 94.305  24.165  1.00   47.59 ? 190  LYS D C   1 
ATOM   9816  O O   . LYS D 1 190 ? -13.285 93.264  23.910  1.00   48.54 ? 190  LYS D O   1 
ATOM   9817  C CB  . LYS D 1 190 ? -13.088 96.751  24.482  1.00   51.09 ? 190  LYS D CB  1 
ATOM   9818  C CG  . LYS D 1 190 ? -13.536 97.918  25.379  1.00   56.01 ? 190  LYS D CG  1 
ATOM   9819  C CD  . LYS D 1 190 ? -12.507 98.252  26.481  1.00   59.86 ? 190  LYS D CD  1 
ATOM   9820  C CE  . LYS D 1 190 ? -12.934 99.454  27.359  1.00   59.79 ? 190  LYS D CE  1 
ATOM   9821  N NZ  . LYS D 1 190 ? -14.047 99.148  28.307  1.00   54.25 ? 190  LYS D NZ  1 
ATOM   9822  N N   . TYR D 1 191 ? -11.468 94.570  23.663  1.00   44.14 ? 191  TYR D N   1 
ATOM   9823  C CA  . TYR D 1 191 ? -10.829 93.656  22.736  1.00   42.10 ? 191  TYR D CA  1 
ATOM   9824  C C   . TYR D 1 191 ? -10.263 92.384  23.348  1.00   42.45 ? 191  TYR D C   1 
ATOM   9825  O O   . TYR D 1 191 ? -9.678  92.401  24.435  1.00   43.82 ? 191  TYR D O   1 
ATOM   9826  C CB  . TYR D 1 191 ? -9.734  94.388  21.987  1.00   40.72 ? 191  TYR D CB  1 
ATOM   9827  C CG  . TYR D 1 191 ? -10.203 95.682  21.367  1.00   41.52 ? 191  TYR D CG  1 
ATOM   9828  C CD1 . TYR D 1 191 ? -10.179 96.881  22.093  1.00   43.55 ? 191  TYR D CD1 1 
ATOM   9829  C CD2 . TYR D 1 191 ? -10.593 95.724  20.030  1.00   40.51 ? 191  TYR D CD2 1 
ATOM   9830  C CE1 . TYR D 1 191 ? -10.515 98.099  21.482  1.00   42.57 ? 191  TYR D CE1 1 
ATOM   9831  C CE2 . TYR D 1 191 ? -10.938 96.928  19.412  1.00   40.74 ? 191  TYR D CE2 1 
ATOM   9832  C CZ  . TYR D 1 191 ? -10.890 98.111  20.134  1.00   41.14 ? 191  TYR D CZ  1 
ATOM   9833  O OH  . TYR D 1 191 ? -11.172 99.298  19.490  1.00   40.40 ? 191  TYR D OH  1 
ATOM   9834  N N   . GLU D 1 192 ? -10.448 91.279  22.631  1.00   40.04 ? 192  GLU D N   1 
ATOM   9835  C CA  . GLU D 1 192 ? -9.955  89.970  23.051  1.00   37.95 ? 192  GLU D CA  1 
ATOM   9836  C C   . GLU D 1 192 ? -8.798  89.561  22.151  1.00   35.06 ? 192  GLU D C   1 
ATOM   9837  O O   . GLU D 1 192 ? -8.195  88.517  22.351  1.00   35.57 ? 192  GLU D O   1 
ATOM   9838  C CB  . GLU D 1 192 ? -11.069 88.922  22.962  1.00   40.07 ? 192  GLU D CB  1 
ATOM   9839  C CG  . GLU D 1 192 ? -11.776 88.921  21.614  1.00   50.24 ? 192  GLU D CG  1 
ATOM   9840  C CD  . GLU D 1 192 ? -13.031 88.067  21.585  1.00   55.00 ? 192  GLU D CD  1 
ATOM   9841  O OE1 . GLU D 1 192 ? -13.701 87.961  22.635  1.00   60.23 ? 192  GLU D OE1 1 
ATOM   9842  O OE2 . GLU D 1 192 ? -13.360 87.524  20.507  1.00   55.58 ? 192  GLU D OE2 1 
ATOM   9843  N N   . ASN D 1 193 ? -8.480  90.395  21.167  1.00   34.86 ? 193  ASN D N   1 
ATOM   9844  C CA  . ASN D 1 193 ? -7.391  90.117  20.228  1.00   33.38 ? 193  ASN D CA  1 
ATOM   9845  C C   . ASN D 1 193 ? -6.187  90.986  20.573  1.00   32.20 ? 193  ASN D C   1 
ATOM   9846  O O   . ASN D 1 193 ? -5.500  91.479  19.689  1.00   30.73 ? 193  ASN D O   1 
ATOM   9847  C CB  . ASN D 1 193 ? -7.845  90.401  18.783  1.00   30.34 ? 193  ASN D CB  1 
ATOM   9848  C CG  . ASN D 1 193 ? -8.197  91.863  18.554  1.00   29.87 ? 193  ASN D CG  1 
ATOM   9849  O OD1 . ASN D 1 193 ? -7.790  92.474  17.556  1.00   30.24 ? 193  ASN D OD1 1 
ATOM   9850  N ND2 . ASN D 1 193 ? -8.952  92.434  19.476  1.00   26.72 ? 193  ASN D ND2 1 
ATOM   9851  N N   . LEU D 1 194 ? -5.946  91.173  21.868  1.00   32.28 ? 194  LEU D N   1 
ATOM   9852  C CA  . LEU D 1 194 ? -4.830  91.992  22.347  1.00   33.04 ? 194  LEU D CA  1 
ATOM   9853  C C   . LEU D 1 194 ? -4.114  91.337  23.519  1.00   34.03 ? 194  LEU D C   1 
ATOM   9854  O O   . LEU D 1 194 ? -4.717  90.607  24.306  1.00   35.61 ? 194  LEU D O   1 
ATOM   9855  C CB  . LEU D 1 194 ? -5.341  93.362  22.796  1.00   31.15 ? 194  LEU D CB  1 
ATOM   9856  C CG  . LEU D 1 194 ? -4.436  94.207  23.695  1.00   31.28 ? 194  LEU D CG  1 
ATOM   9857  C CD1 . LEU D 1 194 ? -3.310  94.788  22.864  1.00   28.53 ? 194  LEU D CD1 1 
ATOM   9858  C CD2 . LEU D 1 194 ? -5.247  95.327  24.343  1.00   28.58 ? 194  LEU D CD2 1 
ATOM   9859  N N   . ALA D 1 195 ? -2.825  91.595  23.644  1.00   32.71 ? 195  ALA D N   1 
ATOM   9860  C CA  . ALA D 1 195 ? -2.090  91.042  24.771  1.00   32.41 ? 195  ALA D CA  1 
ATOM   9861  C C   . ALA D 1 195 ? -1.044  92.050  25.214  1.00   31.49 ? 195  ALA D C   1 
ATOM   9862  O O   . ALA D 1 195 ? -0.290  92.576  24.392  1.00   31.74 ? 195  ALA D O   1 
ATOM   9863  C CB  . ALA D 1 195 ? -1.433  89.741  24.379  1.00   29.67 ? 195  ALA D CB  1 
ATOM   9864  N N   . VAL D 1 196 ? -1.010  92.345  26.504  1.00   29.09 ? 196  VAL D N   1 
ATOM   9865  C CA  . VAL D 1 196 ? -0.014  93.275  27.006  1.00   27.37 ? 196  VAL D CA  1 
ATOM   9866  C C   . VAL D 1 196 ? 1.147   92.496  27.640  1.00   27.70 ? 196  VAL D C   1 
ATOM   9867  O O   . VAL D 1 196 ? 0.942   91.619  28.487  1.00   27.97 ? 196  VAL D O   1 
ATOM   9868  C CB  . VAL D 1 196 ? -0.616  94.246  28.058  1.00   25.36 ? 196  VAL D CB  1 
ATOM   9869  C CG1 . VAL D 1 196 ? 0.487   95.115  28.647  1.00   24.77 ? 196  VAL D CG1 1 
ATOM   9870  C CG2 . VAL D 1 196 ? -1.686  95.115  27.440  1.00   24.47 ? 196  VAL D CG2 1 
ATOM   9871  N N   . ILE D 1 197 ? 2.363   92.839  27.239  1.00   27.01 ? 197  ILE D N   1 
ATOM   9872  C CA  . ILE D 1 197 ? 3.564   92.190  27.752  1.00   28.40 ? 197  ILE D CA  1 
ATOM   9873  C C   . ILE D 1 197 ? 4.308   93.109  28.734  1.00   28.30 ? 197  ILE D C   1 
ATOM   9874  O O   . ILE D 1 197 ? 4.554   94.268  28.420  1.00   31.28 ? 197  ILE D O   1 
ATOM   9875  C CB  . ILE D 1 197 ? 4.497   91.800  26.570  1.00   23.90 ? 197  ILE D CB  1 
ATOM   9876  C CG1 . ILE D 1 197 ? 3.735   90.872  25.624  1.00   21.39 ? 197  ILE D CG1 1 
ATOM   9877  C CG2 . ILE D 1 197 ? 5.766   91.092  27.082  1.00   16.61 ? 197  ILE D CG2 1 
ATOM   9878  C CD1 . ILE D 1 197 ? 4.299   90.853  24.203  1.00   23.92 ? 197  ILE D CD1 1 
ATOM   9879  N N   . ARG D 1 198 ? 4.657   92.585  29.912  1.00   28.29 ? 198  ARG D N   1 
ATOM   9880  C CA  . ARG D 1 198 ? 5.367   93.354  30.944  1.00   25.07 ? 198  ARG D CA  1 
ATOM   9881  C C   . ARG D 1 198 ? 6.638   92.648  31.429  1.00   24.82 ? 198  ARG D C   1 
ATOM   9882  O O   . ARG D 1 198 ? 6.800   91.444  31.236  1.00   25.99 ? 198  ARG D O   1 
ATOM   9883  C CB  . ARG D 1 198 ? 4.459   93.564  32.146  1.00   25.16 ? 198  ARG D CB  1 
ATOM   9884  C CG  . ARG D 1 198 ? 3.197   94.363  31.902  1.00   23.90 ? 198  ARG D CG  1 
ATOM   9885  C CD  . ARG D 1 198 ? 3.538   95.822  31.588  1.00   31.30 ? 198  ARG D CD  1 
ATOM   9886  N NE  . ARG D 1 198 ? 2.377   96.687  31.730  1.00   25.94 ? 198  ARG D NE  1 
ATOM   9887  C CZ  . ARG D 1 198 ? 1.770   96.915  32.883  1.00   24.24 ? 198  ARG D CZ  1 
ATOM   9888  N NH1 . ARG D 1 198 ? 2.235   96.339  33.976  1.00   18.66 ? 198  ARG D NH1 1 
ATOM   9889  N NH2 . ARG D 1 198 ? 0.689   97.684  32.935  1.00   24.66 ? 198  ARG D NH2 1 
ATOM   9890  N N   . THR D 1 199 ? 7.532   93.376  32.090  1.00   22.60 ? 199  THR D N   1 
ATOM   9891  C CA  . THR D 1 199 ? 8.760   92.751  32.571  1.00   21.84 ? 199  THR D CA  1 
ATOM   9892  C C   . THR D 1 199 ? 9.243   93.279  33.917  1.00   23.53 ? 199  THR D C   1 
ATOM   9893  O O   . THR D 1 199 ? 8.864   94.354  34.343  1.00   26.76 ? 199  THR D O   1 
ATOM   9894  C CB  . THR D 1 199 ? 9.926   92.934  31.548  1.00   22.07 ? 199  THR D CB  1 
ATOM   9895  O OG1 . THR D 1 199 ? 11.127  92.381  32.104  1.00   19.84 ? 199  THR D OG1 1 
ATOM   9896  C CG2 . THR D 1 199 ? 10.164  94.462  31.225  1.00   18.64 ? 199  THR D CG2 1 
ATOM   9897  N N   . PHE D 1 200 ? 10.097  92.512  34.580  1.00   24.98 ? 200  PHE D N   1 
ATOM   9898  C CA  . PHE D 1 200 ? 10.657  92.940  35.855  1.00   24.96 ? 200  PHE D CA  1 
ATOM   9899  C C   . PHE D 1 200 ? 12.108  93.312  35.648  1.00   24.42 ? 200  PHE D C   1 
ATOM   9900  O O   . PHE D 1 200 ? 12.824  93.561  36.617  1.00   23.07 ? 200  PHE D O   1 
ATOM   9901  C CB  . PHE D 1 200 ? 10.625  91.822  36.885  1.00   25.93 ? 200  PHE D CB  1 
ATOM   9902  C CG  . PHE D 1 200 ? 9.286   91.594  37.506  1.00   29.71 ? 200  PHE D CG  1 
ATOM   9903  C CD1 . PHE D 1 200 ? 8.381   90.713  36.932  1.00   28.85 ? 200  PHE D CD1 1 
ATOM   9904  C CD2 . PHE D 1 200 ? 8.937   92.233  38.690  1.00   31.14 ? 200  PHE D CD2 1 
ATOM   9905  C CE1 . PHE D 1 200 ? 7.152   90.470  37.533  1.00   32.14 ? 200  PHE D CE1 1 
ATOM   9906  C CE2 . PHE D 1 200 ? 7.700   91.994  39.299  1.00   31.37 ? 200  PHE D CE2 1 
ATOM   9907  C CZ  . PHE D 1 200 ? 6.812   91.114  38.722  1.00   31.09 ? 200  PHE D CZ  1 
ATOM   9908  N N   . SER D 1 201 ? 12.533  93.337  34.385  1.00   23.78 ? 201  SER D N   1 
ATOM   9909  C CA  . SER D 1 201 ? 13.934  93.618  34.027  1.00   25.83 ? 201  SER D CA  1 
ATOM   9910  C C   . SER D 1 201 ? 14.473  95.039  34.185  1.00   26.09 ? 201  SER D C   1 
ATOM   9911  O O   . SER D 1 201 ? 15.610  95.238  34.628  1.00   26.70 ? 201  SER D O   1 
ATOM   9912  C CB  . SER D 1 201 ? 14.201  93.196  32.577  1.00   22.25 ? 201  SER D CB  1 
ATOM   9913  O OG  . SER D 1 201 ? 14.013  91.807  32.388  1.00   25.83 ? 201  SER D OG  1 
ATOM   9914  N N   . LYS D 1 202 ? 13.656  96.009  33.801  1.00   27.30 ? 202  LYS D N   1 
ATOM   9915  C CA  . LYS D 1 202 ? 14.040  97.412  33.782  1.00   27.25 ? 202  LYS D CA  1 
ATOM   9916  C C   . LYS D 1 202 ? 13.791  98.157  35.085  1.00   26.88 ? 202  LYS D C   1 
ATOM   9917  O O   . LYS D 1 202 ? 14.729  98.613  35.744  1.00   25.63 ? 202  LYS D O   1 
ATOM   9918  C CB  . LYS D 1 202 ? 13.272  98.110  32.654  1.00   30.52 ? 202  LYS D CB  1 
ATOM   9919  C CG  . LYS D 1 202 ? 13.126  97.296  31.358  1.00   32.17 ? 202  LYS D CG  1 
ATOM   9920  C CD  . LYS D 1 202 ? 14.430  97.160  30.617  1.00   32.59 ? 202  LYS D CD  1 
ATOM   9921  C CE  . LYS D 1 202 ? 14.217  96.475  29.281  1.00   36.60 ? 202  LYS D CE  1 
ATOM   9922  N NZ  . LYS D 1 202 ? 15.217  96.915  28.254  1.00   40.36 ? 202  LYS D NZ  1 
ATOM   9923  N N   . ALA D 1 203 ? 12.516  98.274  35.446  1.00   23.82 ? 203  ALA D N   1 
ATOM   9924  C CA  . ALA D 1 203 ? 12.113  98.989  36.640  1.00   23.39 ? 203  ALA D CA  1 
ATOM   9925  C C   . ALA D 1 203 ? 12.403  98.276  37.944  1.00   23.98 ? 203  ALA D C   1 
ATOM   9926  O O   . ALA D 1 203 ? 12.387  98.904  39.004  1.00   24.90 ? 203  ALA D O   1 
ATOM   9927  C CB  . ALA D 1 203 ? 10.616  99.314  36.562  1.00   24.94 ? 203  ALA D CB  1 
ATOM   9928  N N   . PHE D 1 204 ? 12.669  96.972  37.878  1.00   23.57 ? 204  PHE D N   1 
ATOM   9929  C CA  . PHE D 1 204 ? 12.916  96.201  39.090  1.00   23.68 ? 204  PHE D CA  1 
ATOM   9930  C C   . PHE D 1 204 ? 14.321  95.639  39.205  1.00   24.69 ? 204  PHE D C   1 
ATOM   9931  O O   . PHE D 1 204 ? 14.629  94.897  40.136  1.00   25.81 ? 204  PHE D O   1 
ATOM   9932  C CB  . PHE D 1 204 ? 11.884  95.073  39.199  1.00   24.44 ? 204  PHE D CB  1 
ATOM   9933  C CG  . PHE D 1 204 ? 10.472  95.563  39.344  1.00   23.96 ? 204  PHE D CG  1 
ATOM   9934  C CD1 . PHE D 1 204 ? 9.967   95.922  40.597  1.00   23.49 ? 204  PHE D CD1 1 
ATOM   9935  C CD2 . PHE D 1 204 ? 9.649   95.685  38.221  1.00   24.22 ? 204  PHE D CD2 1 
ATOM   9936  C CE1 . PHE D 1 204 ? 8.652   96.395  40.728  1.00   23.89 ? 204  PHE D CE1 1 
ATOM   9937  C CE2 . PHE D 1 204 ? 8.340   96.155  38.334  1.00   23.03 ? 204  PHE D CE2 1 
ATOM   9938  C CZ  . PHE D 1 204 ? 7.838   96.511  39.591  1.00   22.89 ? 204  PHE D CZ  1 
ATOM   9939  N N   . SER D 1 205 ? 15.168  95.961  38.240  1.00   23.07 ? 205  SER D N   1 
ATOM   9940  C CA  . SER D 1 205 ? 16.544  95.508  38.305  1.00   24.64 ? 205  SER D CA  1 
ATOM   9941  C C   . SER D 1 205 ? 16.694  93.994  38.399  1.00   23.76 ? 205  SER D C   1 
ATOM   9942  O O   . SER D 1 205 ? 17.594  93.495  39.069  1.00   22.63 ? 205  SER D O   1 
ATOM   9943  C CB  . SER D 1 205 ? 17.229  96.181  39.503  1.00   22.96 ? 205  SER D CB  1 
ATOM   9944  O OG  . SER D 1 205 ? 17.145  97.594  39.388  1.00   23.74 ? 205  SER D OG  1 
ATOM   9945  N N   . LEU D 1 206 ? 15.824  93.262  37.704  1.00   25.57 ? 206  LEU D N   1 
ATOM   9946  C CA  . LEU D 1 206 ? 15.877  91.807  37.714  1.00   23.49 ? 206  LEU D CA  1 
ATOM   9947  C C   . LEU D 1 206 ? 16.182  91.249  36.326  1.00   24.90 ? 206  LEU D C   1 
ATOM   9948  O O   . LEU D 1 206 ? 15.917  90.072  36.050  1.00   22.10 ? 206  LEU D O   1 
ATOM   9949  C CB  . LEU D 1 206 ? 14.549  91.243  38.232  1.00   21.60 ? 206  LEU D CB  1 
ATOM   9950  C CG  . LEU D 1 206 ? 14.305  91.339  39.739  1.00   14.24 ? 206  LEU D CG  1 
ATOM   9951  C CD1 . LEU D 1 206 ? 12.875  90.898  40.078  1.00   9.52  ? 206  LEU D CD1 1 
ATOM   9952  C CD2 . LEU D 1 206 ? 15.330  90.465  40.444  1.00   16.65 ? 206  LEU D CD2 1 
ATOM   9953  N N   . ALA D 1 207 ? 16.756  92.091  35.463  1.00   25.15 ? 207  ALA D N   1 
ATOM   9954  C CA  . ALA D 1 207 ? 17.090  91.686  34.094  1.00   24.85 ? 207  ALA D CA  1 
ATOM   9955  C C   . ALA D 1 207 ? 17.760  90.314  34.013  1.00   26.60 ? 207  ALA D C   1 
ATOM   9956  O O   . ALA D 1 207 ? 17.588  89.585  33.031  1.00   27.36 ? 207  ALA D O   1 
ATOM   9957  C CB  . ALA D 1 207 ? 17.976  92.717  33.454  1.00   24.00 ? 207  ALA D CB  1 
ATOM   9958  N N   . ALA D 1 208 ? 18.524  89.966  35.041  1.00   22.18 ? 208  ALA D N   1 
ATOM   9959  C CA  . ALA D 1 208 ? 19.226  88.705  35.044  1.00   21.67 ? 208  ALA D CA  1 
ATOM   9960  C C   . ALA D 1 208 ? 18.401  87.516  35.562  1.00   22.15 ? 208  ALA D C   1 
ATOM   9961  O O   . ALA D 1 208 ? 18.823  86.374  35.451  1.00   22.90 ? 208  ALA D O   1 
ATOM   9962  C CB  . ALA D 1 208 ? 20.489  88.853  35.867  1.00   22.00 ? 208  ALA D CB  1 
ATOM   9963  N N   . GLN D 1 209 ? 17.233  87.784  36.126  1.00   20.53 ? 209  GLN D N   1 
ATOM   9964  C CA  . GLN D 1 209 ? 16.405  86.726  36.659  1.00   19.53 ? 209  GLN D CA  1 
ATOM   9965  C C   . GLN D 1 209 ? 15.309  86.335  35.685  1.00   22.21 ? 209  GLN D C   1 
ATOM   9966  O O   . GLN D 1 209 ? 14.555  85.406  35.930  1.00   24.64 ? 209  GLN D O   1 
ATOM   9967  C CB  . GLN D 1 209 ? 15.836  87.139  38.024  1.00   22.15 ? 209  GLN D CB  1 
ATOM   9968  C CG  . GLN D 1 209 ? 16.921  87.142  39.129  1.00   15.67 ? 209  GLN D CG  1 
ATOM   9969  C CD  . GLN D 1 209 ? 17.519  85.753  39.278  1.00   19.49 ? 209  GLN D CD  1 
ATOM   9970  O OE1 . GLN D 1 209 ? 16.788  84.810  39.571  1.00   22.26 ? 209  GLN D OE1 1 
ATOM   9971  N NE2 . GLN D 1 209 ? 18.835  85.612  39.056  1.00   12.21 ? 209  GLN D NE2 1 
ATOM   9972  N N   . ARG D 1 210 ? 15.227  87.066  34.585  1.00   19.16 ? 210  ARG D N   1 
ATOM   9973  C CA  . ARG D 1 210 ? 14.285  86.775  33.533  1.00   19.84 ? 210  ARG D CA  1 
ATOM   9974  C C   . ARG D 1 210 ? 12.839  86.535  33.980  1.00   20.37 ? 210  ARG D C   1 
ATOM   9975  O O   . ARG D 1 210 ? 12.411  85.377  34.116  1.00   18.54 ? 210  ARG D O   1 
ATOM   9976  C CB  . ARG D 1 210 ? 14.775  85.533  32.758  1.00   15.85 ? 210  ARG D CB  1 
ATOM   9977  C CG  . ARG D 1 210 ? 16.299  85.402  32.676  1.00   22.02 ? 210  ARG D CG  1 
ATOM   9978  C CD  . ARG D 1 210 ? 16.983  86.605  31.942  1.00   13.87 ? 210  ARG D CD  1 
ATOM   9979  N NE  . ARG D 1 210 ? 16.469  86.749  30.584  1.00   15.41 ? 210  ARG D NE  1 
ATOM   9980  C CZ  . ARG D 1 210 ? 15.746  87.790  30.155  1.00   20.94 ? 210  ARG D CZ  1 
ATOM   9981  N NH1 . ARG D 1 210 ? 15.296  87.835  28.897  1.00   17.06 ? 210  ARG D NH1 1 
ATOM   9982  N NH2 . ARG D 1 210 ? 15.498  88.805  30.975  1.00   16.29 ? 210  ARG D NH2 1 
ATOM   9983  N N   . VAL D 1 211 ? 12.084  87.603  34.211  1.00   17.20 ? 211  VAL D N   1 
ATOM   9984  C CA  . VAL D 1 211 ? 10.688  87.444  34.550  1.00   16.92 ? 211  VAL D CA  1 
ATOM   9985  C C   . VAL D 1 211 ? 9.787   88.475  33.850  1.00   20.16 ? 211  VAL D C   1 
ATOM   9986  O O   . VAL D 1 211 ? 9.855   89.695  34.091  1.00   19.08 ? 211  VAL D O   1 
ATOM   9987  C CB  . VAL D 1 211 ? 10.455  87.506  36.064  1.00   21.67 ? 211  VAL D CB  1 
ATOM   9988  C CG1 . VAL D 1 211 ? 9.024   87.091  36.382  1.00   12.60 ? 211  VAL D CG1 1 
ATOM   9989  C CG2 . VAL D 1 211 ? 11.438  86.589  36.763  1.00   23.42 ? 211  VAL D CG2 1 
ATOM   9990  N N   . GLY D 1 212 ? 8.975   87.960  32.942  1.00   21.63 ? 212  GLY D N   1 
ATOM   9991  C CA  . GLY D 1 212 ? 8.046   88.794  32.212  1.00   21.43 ? 212  GLY D CA  1 
ATOM   9992  C C   . GLY D 1 212 ? 6.689   88.157  32.404  1.00   21.53 ? 212  GLY D C   1 
ATOM   9993  O O   . GLY D 1 212 ? 6.589   87.009  32.828  1.00   23.64 ? 212  GLY D O   1 
ATOM   9994  N N   . TYR D 1 213 ? 5.640   88.907  32.124  1.00   21.27 ? 213  TYR D N   1 
ATOM   9995  C CA  . TYR D 1 213 ? 4.323   88.371  32.250  1.00   21.67 ? 213  TYR D CA  1 
ATOM   9996  C C   . TYR D 1 213 ? 3.464   88.987  31.166  1.00   23.13 ? 213  TYR D C   1 
ATOM   9997  O O   . TYR D 1 213 ? 3.838   90.004  30.581  1.00   22.05 ? 213  TYR D O   1 
ATOM   9998  C CB  . TYR D 1 213 ? 3.781   88.607  33.661  1.00   22.38 ? 213  TYR D CB  1 
ATOM   9999  C CG  . TYR D 1 213 ? 3.789   90.044  34.146  1.00   23.97 ? 213  TYR D CG  1 
ATOM   10000 C CD1 . TYR D 1 213 ? 2.657   90.830  34.025  1.00   26.63 ? 213  TYR D CD1 1 
ATOM   10001 C CD2 . TYR D 1 213 ? 4.921   90.589  34.756  1.00   25.69 ? 213  TYR D CD2 1 
ATOM   10002 C CE1 . TYR D 1 213 ? 2.629   92.128  34.504  1.00   28.07 ? 213  TYR D CE1 1 
ATOM   10003 C CE2 . TYR D 1 213 ? 4.925   91.893  35.235  1.00   23.80 ? 213  TYR D CE2 1 
ATOM   10004 C CZ  . TYR D 1 213 ? 3.766   92.662  35.108  1.00   30.56 ? 213  TYR D CZ  1 
ATOM   10005 O OH  . TYR D 1 213 ? 3.740   93.961  35.578  1.00   28.58 ? 213  TYR D OH  1 
ATOM   10006 N N   . VAL D 1 214 ? 2.347   88.321  30.875  1.00   22.29 ? 214  VAL D N   1 
ATOM   10007 C CA  . VAL D 1 214 ? 1.397   88.731  29.847  1.00   23.22 ? 214  VAL D CA  1 
ATOM   10008 C C   . VAL D 1 214 ? -0.026  88.839  30.419  1.00   23.09 ? 214  VAL D C   1 
ATOM   10009 O O   . VAL D 1 214 ? -0.460  87.982  31.182  1.00   18.84 ? 214  VAL D O   1 
ATOM   10010 C CB  . VAL D 1 214 ? 1.303   87.677  28.720  1.00   24.13 ? 214  VAL D CB  1 
ATOM   10011 C CG1 . VAL D 1 214 ? 0.990   88.335  27.396  1.00   22.76 ? 214  VAL D CG1 1 
ATOM   10012 C CG2 . VAL D 1 214 ? 2.552   86.877  28.666  1.00   28.71 ? 214  VAL D CG2 1 
ATOM   10013 N N   . VAL D 1 215 ? -0.747  89.885  30.048  1.00   23.57 ? 215  VAL D N   1 
ATOM   10014 C CA  . VAL D 1 215 ? -2.130  90.042  30.474  1.00   23.60 ? 215  VAL D CA  1 
ATOM   10015 C C   . VAL D 1 215 ? -2.921  89.920  29.164  1.00   25.11 ? 215  VAL D C   1 
ATOM   10016 O O   . VAL D 1 215 ? -2.655  90.640  28.203  1.00   24.82 ? 215  VAL D O   1 
ATOM   10017 C CB  . VAL D 1 215 ? -2.402  91.454  31.105  1.00   23.72 ? 215  VAL D CB  1 
ATOM   10018 C CG1 . VAL D 1 215 ? -3.692  91.423  31.903  1.00   15.09 ? 215  VAL D CG1 1 
ATOM   10019 C CG2 . VAL D 1 215 ? -1.254  91.873  31.997  1.00   18.66 ? 215  VAL D CG2 1 
ATOM   10020 N N   . ALA D 1 216 ? -3.867  88.992  29.096  1.00   26.97 ? 216  ALA D N   1 
ATOM   10021 C CA  . ALA D 1 216 ? -4.645  88.828  27.872  1.00   26.23 ? 216  ALA D CA  1 
ATOM   10022 C C   . ALA D 1 216 ? -5.963  88.143  28.149  1.00   29.28 ? 216  ALA D C   1 
ATOM   10023 O O   . ALA D 1 216 ? -6.307  87.871  29.311  1.00   31.89 ? 216  ALA D O   1 
ATOM   10024 C CB  . ALA D 1 216 ? -3.861  88.032  26.868  1.00   23.56 ? 216  ALA D CB  1 
ATOM   10025 N N   . SER D 1 217 ? -6.705  87.885  27.078  1.00   29.14 ? 217  SER D N   1 
ATOM   10026 C CA  . SER D 1 217 ? -7.978  87.185  27.159  1.00   29.52 ? 217  SER D CA  1 
ATOM   10027 C C   . SER D 1 217 ? -7.714  85.761  27.680  1.00   31.03 ? 217  SER D C   1 
ATOM   10028 O O   . SER D 1 217 ? -6.615  85.219  27.529  1.00   27.38 ? 217  SER D O   1 
ATOM   10029 C CB  . SER D 1 217 ? -8.574  87.083  25.764  1.00   32.20 ? 217  SER D CB  1 
ATOM   10030 O OG  . SER D 1 217 ? -7.660  86.422  24.896  1.00   32.44 ? 217  SER D OG  1 
ATOM   10031 N N   . GLU D 1 218 ? -8.722  85.156  28.285  1.00   31.86 ? 218  GLU D N   1 
ATOM   10032 C CA  . GLU D 1 218 ? -8.562  83.809  28.797  1.00   33.32 ? 218  GLU D CA  1 
ATOM   10033 C C   . GLU D 1 218 ? -8.156  82.876  27.656  1.00   32.15 ? 218  GLU D C   1 
ATOM   10034 O O   . GLU D 1 218 ? -7.333  81.988  27.838  1.00   35.99 ? 218  GLU D O   1 
ATOM   10035 C CB  . GLU D 1 218 ? -9.869  83.336  29.445  1.00   33.86 ? 218  GLU D CB  1 
ATOM   10036 C CG  . GLU D 1 218 ? -10.412 84.312  30.491  1.00   42.58 ? 218  GLU D CG  1 
ATOM   10037 C CD  . GLU D 1 218 ? -11.659 83.798  31.207  1.00   46.60 ? 218  GLU D CD  1 
ATOM   10038 O OE1 . GLU D 1 218 ? -11.512 83.137  32.263  1.00   49.71 ? 218  GLU D OE1 1 
ATOM   10039 O OE2 . GLU D 1 218 ? -12.785 84.047  30.706  1.00   48.43 ? 218  GLU D OE2 1 
ATOM   10040 N N   . LYS D 1 219 ? -8.718  83.095  26.476  1.00   32.00 ? 219  LYS D N   1 
ATOM   10041 C CA  . LYS D 1 219 ? -8.420  82.255  25.317  1.00   31.37 ? 219  LYS D CA  1 
ATOM   10042 C C   . LYS D 1 219 ? -6.932  82.281  24.905  1.00   27.34 ? 219  LYS D C   1 
ATOM   10043 O O   . LYS D 1 219 ? -6.327  81.231  24.675  1.00   26.62 ? 219  LYS D O   1 
ATOM   10044 C CB  . LYS D 1 219 ? -9.311  82.685  24.146  1.00   32.95 ? 219  LYS D CB  1 
ATOM   10045 C CG  . LYS D 1 219 ? -9.424  81.678  23.017  1.00   41.79 ? 219  LYS D CG  1 
ATOM   10046 C CD  . LYS D 1 219 ? -10.570 82.043  22.064  1.00   45.97 ? 219  LYS D CD  1 
ATOM   10047 C CE  . LYS D 1 219 ? -10.361 81.472  20.666  1.00   49.44 ? 219  LYS D CE  1 
ATOM   10048 N NZ  . LYS D 1 219 ? -11.477 81.811  19.743  1.00   50.51 ? 219  LYS D NZ  1 
ATOM   10049 N N   . PHE D 1 220 ? -6.347  83.471  24.812  1.00   26.30 ? 220  PHE D N   1 
ATOM   10050 C CA  . PHE D 1 220 ? -4.946  83.580  24.442  1.00   25.15 ? 220  PHE D CA  1 
ATOM   10051 C C   . PHE D 1 220 ? -4.093  82.865  25.496  1.00   27.38 ? 220  PHE D C   1 
ATOM   10052 O O   . PHE D 1 220 ? -3.288  81.986  25.179  1.00   28.62 ? 220  PHE D O   1 
ATOM   10053 C CB  . PHE D 1 220 ? -4.505  85.038  24.364  1.00   18.97 ? 220  PHE D CB  1 
ATOM   10054 C CG  . PHE D 1 220 ? -3.023  85.189  24.190  1.00   24.42 ? 220  PHE D CG  1 
ATOM   10055 C CD1 . PHE D 1 220 ? -2.432  84.954  22.952  1.00   18.95 ? 220  PHE D CD1 1 
ATOM   10056 C CD2 . PHE D 1 220 ? -2.198  85.438  25.297  1.00   25.78 ? 220  PHE D CD2 1 
ATOM   10057 C CE1 . PHE D 1 220 ? -1.053  84.954  22.822  1.00   25.45 ? 220  PHE D CE1 1 
ATOM   10058 C CE2 . PHE D 1 220 ? -0.804  85.441  25.185  1.00   20.43 ? 220  PHE D CE2 1 
ATOM   10059 C CZ  . PHE D 1 220 ? -0.227  85.197  23.947  1.00   26.18 ? 220  PHE D CZ  1 
ATOM   10060 N N   . ILE D 1 221 ? -4.283  83.267  26.749  1.00   24.20 ? 221  ILE D N   1 
ATOM   10061 C CA  . ILE D 1 221 ? -3.559  82.682  27.853  1.00   24.11 ? 221  ILE D CA  1 
ATOM   10062 C C   . ILE D 1 221 ? -3.619  81.155  27.755  1.00   26.69 ? 221  ILE D C   1 
ATOM   10063 O O   . ILE D 1 221 ? -2.581  80.490  27.870  1.00   28.13 ? 221  ILE D O   1 
ATOM   10064 C CB  . ILE D 1 221 ? -4.138  83.200  29.209  1.00   23.54 ? 221  ILE D CB  1 
ATOM   10065 C CG1 . ILE D 1 221 ? -3.927  84.719  29.307  1.00   26.98 ? 221  ILE D CG1 1 
ATOM   10066 C CG2 . ILE D 1 221 ? -3.443  82.552  30.392  1.00   21.49 ? 221  ILE D CG2 1 
ATOM   10067 C CD1 . ILE D 1 221 ? -2.472  85.169  29.406  1.00   20.07 ? 221  ILE D CD1 1 
ATOM   10068 N N   . ASP D 1 222 ? -4.807  80.583  27.526  1.00   25.51 ? 222  ASP D N   1 
ATOM   10069 C CA  . ASP D 1 222 ? -4.895  79.119  27.384  1.00   26.58 ? 222  ASP D CA  1 
ATOM   10070 C C   . ASP D 1 222 ? -3.955  78.652  26.272  1.00   23.51 ? 222  ASP D C   1 
ATOM   10071 O O   . ASP D 1 222 ? -3.101  77.787  26.462  1.00   22.29 ? 222  ASP D O   1 
ATOM   10072 C CB  . ASP D 1 222 ? -6.294  78.665  26.998  1.00   30.39 ? 222  ASP D CB  1 
ATOM   10073 C CG  . ASP D 1 222 ? -6.339  77.171  26.678  1.00   33.62 ? 222  ASP D CG  1 
ATOM   10074 O OD1 . ASP D 1 222 ? -6.514  76.387  27.628  1.00   32.26 ? 222  ASP D OD1 1 
ATOM   10075 O OD2 . ASP D 1 222 ? -6.166  76.781  25.489  1.00   35.37 ? 222  ASP D OD2 1 
ATOM   10076 N N   . ALA D 1 223 ? -4.141  79.217  25.092  1.00   22.70 ? 223  ALA D N   1 
ATOM   10077 C CA  . ALA D 1 223 ? -3.295  78.865  23.957  1.00   21.22 ? 223  ALA D CA  1 
ATOM   10078 C C   . ALA D 1 223 ? -1.824  78.943  24.354  1.00   19.72 ? 223  ALA D C   1 
ATOM   10079 O O   . ALA D 1 223 ? -1.121  77.947  24.289  1.00   21.94 ? 223  ALA D O   1 
ATOM   10080 C CB  . ALA D 1 223 ? -3.572  79.788  22.778  1.00   17.58 ? 223  ALA D CB  1 
ATOM   10081 N N   . TYR D 1 224 ? -1.395  80.126  24.796  1.00   18.30 ? 224  TYR D N   1 
ATOM   10082 C CA  . TYR D 1 224 ? -0.023  80.411  25.200  1.00   19.27 ? 224  TYR D CA  1 
ATOM   10083 C C   . TYR D 1 224 ? 0.594   79.428  26.176  1.00   20.25 ? 224  TYR D C   1 
ATOM   10084 O O   . TYR D 1 224 ? 1.757   79.038  26.007  1.00   18.47 ? 224  TYR D O   1 
ATOM   10085 C CB  . TYR D 1 224 ? 0.047   81.806  25.809  1.00   22.40 ? 224  TYR D CB  1 
ATOM   10086 C CG  . TYR D 1 224 ? 1.361   82.126  26.477  1.00   21.90 ? 224  TYR D CG  1 
ATOM   10087 C CD1 . TYR D 1 224 ? 2.475   82.512  25.734  1.00   21.32 ? 224  TYR D CD1 1 
ATOM   10088 C CD2 . TYR D 1 224 ? 1.499   82.015  27.857  1.00   24.74 ? 224  TYR D CD2 1 
ATOM   10089 C CE1 . TYR D 1 224 ? 3.713   82.783  26.359  1.00   18.91 ? 224  TYR D CE1 1 
ATOM   10090 C CE2 . TYR D 1 224 ? 2.717   82.271  28.489  1.00   25.63 ? 224  TYR D CE2 1 
ATOM   10091 C CZ  . TYR D 1 224 ? 3.823   82.655  27.727  1.00   25.23 ? 224  TYR D CZ  1 
ATOM   10092 O OH  . TYR D 1 224 ? 5.035   82.886  28.329  1.00   25.60 ? 224  TYR D OH  1 
ATOM   10093 N N   . ASN D 1 225 ? -0.174  79.053  27.197  1.00   20.91 ? 225  ASN D N   1 
ATOM   10094 C CA  . ASN D 1 225 ? 0.295   78.125  28.215  1.00   22.06 ? 225  ASN D CA  1 
ATOM   10095 C C   . ASN D 1 225 ? 0.485   76.727  27.639  1.00   24.48 ? 225  ASN D C   1 
ATOM   10096 O O   . ASN D 1 225 ? 1.309   75.942  28.133  1.00   24.24 ? 225  ASN D O   1 
ATOM   10097 C CB  . ASN D 1 225 ? -0.688  78.068  29.392  1.00   24.32 ? 225  ASN D CB  1 
ATOM   10098 C CG  . ASN D 1 225 ? -0.489  79.198  30.389  1.00   27.54 ? 225  ASN D CG  1 
ATOM   10099 O OD1 . ASN D 1 225 ? 0.582   79.810  30.472  1.00   23.12 ? 225  ASN D OD1 1 
ATOM   10100 N ND2 . ASN D 1 225 ? -1.522  79.467  31.167  1.00   28.82 ? 225  ASN D ND2 1 
ATOM   10101 N N   . ARG D 1 226 ? -0.259  76.419  26.583  1.00   26.35 ? 226  ARG D N   1 
ATOM   10102 C CA  . ARG D 1 226 ? -0.143  75.102  25.941  1.00   27.97 ? 226  ARG D CA  1 
ATOM   10103 C C   . ARG D 1 226 ? 1.103   75.088  25.083  1.00   28.46 ? 226  ARG D C   1 
ATOM   10104 O O   . ARG D 1 226 ? 1.798   74.077  24.984  1.00   29.51 ? 226  ARG D O   1 
ATOM   10105 C CB  . ARG D 1 226 ? -1.357  74.815  25.049  1.00   26.91 ? 226  ARG D CB  1 
ATOM   10106 C CG  . ARG D 1 226 ? -2.684  74.911  25.776  1.00   25.63 ? 226  ARG D CG  1 
ATOM   10107 C CD  . ARG D 1 226 ? -3.812  74.933  24.794  1.00   27.11 ? 226  ARG D CD  1 
ATOM   10108 N NE  . ARG D 1 226 ? -4.455  73.640  24.666  1.00   29.99 ? 226  ARG D NE  1 
ATOM   10109 C CZ  . ARG D 1 226 ? -5.583  73.312  25.281  1.00   30.00 ? 226  ARG D CZ  1 
ATOM   10110 N NH1 . ARG D 1 226 ? -6.193  74.187  26.059  1.00   29.61 ? 226  ARG D NH1 1 
ATOM   10111 N NH2 . ARG D 1 226 ? -6.091  72.101  25.124  1.00   32.18 ? 226  ARG D NH2 1 
ATOM   10112 N N   . VAL D 1 227 ? 1.398   76.229  24.474  1.00   27.64 ? 227  VAL D N   1 
ATOM   10113 C CA  . VAL D 1 227 ? 2.554   76.324  23.596  1.00   26.58 ? 227  VAL D CA  1 
ATOM   10114 C C   . VAL D 1 227 ? 3.945   76.499  24.255  1.00   24.99 ? 227  VAL D C   1 
ATOM   10115 O O   . VAL D 1 227 ? 4.914   75.935  23.780  1.00   25.34 ? 227  VAL D O   1 
ATOM   10116 C CB  . VAL D 1 227 ? 2.313   77.455  22.563  1.00   25.35 ? 227  VAL D CB  1 
ATOM   10117 C CG1 . VAL D 1 227 ? 3.447   77.535  21.595  1.00   22.26 ? 227  VAL D CG1 1 
ATOM   10118 C CG2 . VAL D 1 227 ? 1.030   77.194  21.816  1.00   32.72 ? 227  VAL D CG2 1 
ATOM   10119 N N   . ARG D 1 228 ? 4.040   77.266  25.340  1.00   26.07 ? 228  ARG D N   1 
ATOM   10120 C CA  . ARG D 1 228 ? 5.328   77.522  26.016  1.00   24.80 ? 228  ARG D CA  1 
ATOM   10121 C C   . ARG D 1 228 ? 5.798   76.334  26.823  1.00   24.67 ? 228  ARG D C   1 
ATOM   10122 O O   . ARG D 1 228 ? 5.085   75.332  26.954  1.00   25.33 ? 228  ARG D O   1 
ATOM   10123 C CB  . ARG D 1 228 ? 5.204   78.696  26.981  1.00   21.98 ? 228  ARG D CB  1 
ATOM   10124 C CG  . ARG D 1 228 ? 4.184   78.437  28.093  1.00   23.26 ? 228  ARG D CG  1 
ATOM   10125 C CD  . ARG D 1 228 ? 4.538   79.158  29.398  1.00   21.06 ? 228  ARG D CD  1 
ATOM   10126 N NE  . ARG D 1 228 ? 3.429   79.127  30.352  1.00   18.12 ? 228  ARG D NE  1 
ATOM   10127 C CZ  . ARG D 1 228 ? 3.456   78.513  31.535  1.00   17.29 ? 228  ARG D CZ  1 
ATOM   10128 N NH1 . ARG D 1 228 ? 4.531   77.861  31.944  1.00   11.76 ? 228  ARG D NH1 1 
ATOM   10129 N NH2 . ARG D 1 228 ? 2.400   78.568  32.323  1.00   10.82 ? 228  ARG D NH2 1 
ATOM   10130 N N   . LEU D 1 229 ? 6.995   76.464  27.388  1.00   24.56 ? 229  LEU D N   1 
ATOM   10131 C CA  . LEU D 1 229 ? 7.557   75.418  28.249  1.00   25.59 ? 229  LEU D CA  1 
ATOM   10132 C C   . LEU D 1 229 ? 6.780   75.449  29.558  1.00   23.98 ? 229  LEU D C   1 
ATOM   10133 O O   . LEU D 1 229 ? 6.435   76.530  30.049  1.00   22.26 ? 229  LEU D O   1 
ATOM   10134 C CB  . LEU D 1 229 ? 9.040   75.671  28.508  1.00   22.63 ? 229  LEU D CB  1 
ATOM   10135 C CG  . LEU D 1 229 ? 9.863   75.298  27.291  1.00   23.70 ? 229  LEU D CG  1 
ATOM   10136 C CD1 . LEU D 1 229 ? 11.051  76.223  27.140  1.00   25.79 ? 229  LEU D CD1 1 
ATOM   10137 C CD2 . LEU D 1 229 ? 10.269  73.864  27.420  1.00   22.88 ? 229  LEU D CD2 1 
ATOM   10138 N N   . PRO D 1 230 ? 6.465   74.265  30.120  1.00   25.26 ? 230  PRO D N   1 
ATOM   10139 C CA  . PRO D 1 230 ? 5.716   74.156  31.385  1.00   23.85 ? 230  PRO D CA  1 
ATOM   10140 C C   . PRO D 1 230 ? 6.464   74.809  32.561  1.00   22.80 ? 230  PRO D C   1 
ATOM   10141 O O   . PRO D 1 230 ? 5.891   75.601  33.310  1.00   24.07 ? 230  PRO D O   1 
ATOM   10142 C CB  . PRO D 1 230 ? 5.547   72.636  31.586  1.00   20.12 ? 230  PRO D CB  1 
ATOM   10143 C CG  . PRO D 1 230 ? 5.725   72.064  30.245  1.00   24.62 ? 230  PRO D CG  1 
ATOM   10144 C CD  . PRO D 1 230 ? 6.767   72.930  29.568  1.00   25.35 ? 230  PRO D CD  1 
ATOM   10145 N N   . PHE D 1 231 ? 7.735   74.469  32.744  1.00   20.46 ? 231  PHE D N   1 
ATOM   10146 C CA  . PHE D 1 231 ? 8.482   75.069  33.846  1.00   19.32 ? 231  PHE D CA  1 
ATOM   10147 C C   . PHE D 1 231 ? 9.448   76.112  33.292  1.00   18.89 ? 231  PHE D C   1 
ATOM   10148 O O   . PHE D 1 231 ? 10.677  75.935  33.320  1.00   16.82 ? 231  PHE D O   1 
ATOM   10149 C CB  . PHE D 1 231 ? 9.205   73.992  34.637  1.00   18.53 ? 231  PHE D CB  1 
ATOM   10150 C CG  . PHE D 1 231 ? 8.294   72.900  35.098  1.00   21.70 ? 231  PHE D CG  1 
ATOM   10151 C CD1 . PHE D 1 231 ? 8.250   71.686  34.397  1.00   24.63 ? 231  PHE D CD1 1 
ATOM   10152 C CD2 . PHE D 1 231 ? 7.405   73.107  36.152  1.00   20.98 ? 231  PHE D CD2 1 
ATOM   10153 C CE1 . PHE D 1 231 ? 7.337   70.684  34.722  1.00   23.74 ? 231  PHE D CE1 1 
ATOM   10154 C CE2 . PHE D 1 231 ? 6.471   72.109  36.502  1.00   21.30 ? 231  PHE D CE2 1 
ATOM   10155 C CZ  . PHE D 1 231 ? 6.439   70.884  35.776  1.00   24.51 ? 231  PHE D CZ  1 
ATOM   10156 N N   . ASN D 1 232 ? 8.870   77.205  32.810  1.00   13.21 ? 232  ASN D N   1 
ATOM   10157 C CA  . ASN D 1 232 ? 9.660   78.239  32.195  1.00   18.32 ? 232  ASN D CA  1 
ATOM   10158 C C   . ASN D 1 232 ? 10.334  79.265  33.135  1.00   17.16 ? 232  ASN D C   1 
ATOM   10159 O O   . ASN D 1 232 ? 11.363  79.853  32.782  1.00   20.02 ? 232  ASN D O   1 
ATOM   10160 C CB  . ASN D 1 232 ? 8.821   78.960  31.097  1.00   20.21 ? 232  ASN D CB  1 
ATOM   10161 C CG  . ASN D 1 232 ? 7.515   79.607  31.624  1.00   23.75 ? 232  ASN D CG  1 
ATOM   10162 O OD1 . ASN D 1 232 ? 7.031   80.623  31.101  1.00   28.99 ? 232  ASN D OD1 1 
ATOM   10163 N ND2 . ASN D 1 232 ? 6.944   79.001  32.649  1.00   17.28 ? 232  ASN D ND2 1 
ATOM   10164 N N   . VAL D 1 233 ? 9.774   79.482  34.315  1.00   15.87 ? 233  VAL D N   1 
ATOM   10165 C CA  . VAL D 1 233 ? 10.349  80.438  35.246  1.00   19.35 ? 233  VAL D CA  1 
ATOM   10166 C C   . VAL D 1 233 ? 10.723  79.733  36.556  1.00   21.31 ? 233  VAL D C   1 
ATOM   10167 O O   . VAL D 1 233 ? 9.875   79.133  37.203  1.00   23.02 ? 233  VAL D O   1 
ATOM   10168 C CB  . VAL D 1 233 ? 9.355   81.605  35.533  1.00   18.72 ? 233  VAL D CB  1 
ATOM   10169 C CG1 . VAL D 1 233 ? 9.963   82.587  36.521  1.00   12.81 ? 233  VAL D CG1 1 
ATOM   10170 C CG2 . VAL D 1 233 ? 9.013   82.325  34.206  1.00   13.01 ? 233  VAL D CG2 1 
ATOM   10171 N N   . SER D 1 234 ? 11.991  79.826  36.950  1.00   21.48 ? 234  SER D N   1 
ATOM   10172 C CA  . SER D 1 234 ? 12.478  79.143  38.142  1.00   22.96 ? 234  SER D CA  1 
ATOM   10173 C C   . SER D 1 234 ? 11.879  79.593  39.461  1.00   22.56 ? 234  SER D C   1 
ATOM   10174 O O   . SER D 1 234 ? 11.360  80.713  39.597  1.00   26.39 ? 234  SER D O   1 
ATOM   10175 C CB  . SER D 1 234 ? 14.006  79.251  38.237  1.00   24.13 ? 234  SER D CB  1 
ATOM   10176 O OG  . SER D 1 234 ? 14.406  80.596  38.472  1.00   23.83 ? 234  SER D OG  1 
ATOM   10177 N N   . TYR D 1 235 ? 11.950  78.688  40.425  1.00   17.87 ? 235  TYR D N   1 
ATOM   10178 C CA  . TYR D 1 235 ? 11.472  78.965  41.759  1.00   18.74 ? 235  TYR D CA  1 
ATOM   10179 C C   . TYR D 1 235 ? 12.057  80.264  42.321  1.00   19.31 ? 235  TYR D C   1 
ATOM   10180 O O   . TYR D 1 235 ? 11.323  81.148  42.733  1.00   20.90 ? 235  TYR D O   1 
ATOM   10181 C CB  . TYR D 1 235 ? 11.871  77.822  42.689  1.00   16.58 ? 235  TYR D CB  1 
ATOM   10182 C CG  . TYR D 1 235 ? 11.621  78.068  44.167  1.00   16.85 ? 235  TYR D CG  1 
ATOM   10183 C CD1 . TYR D 1 235 ? 10.326  78.114  44.674  1.00   16.73 ? 235  TYR D CD1 1 
ATOM   10184 C CD2 . TYR D 1 235 ? 12.683  78.168  45.070  1.00   18.63 ? 235  TYR D CD2 1 
ATOM   10185 C CE1 . TYR D 1 235 ? 10.089  78.239  46.041  1.00   18.28 ? 235  TYR D CE1 1 
ATOM   10186 C CE2 . TYR D 1 235 ? 12.457  78.299  46.451  1.00   20.30 ? 235  TYR D CE2 1 
ATOM   10187 C CZ  . TYR D 1 235 ? 11.154  78.333  46.925  1.00   21.61 ? 235  TYR D CZ  1 
ATOM   10188 O OH  . TYR D 1 235 ? 10.913  78.489  48.271  1.00   19.08 ? 235  TYR D OH  1 
ATOM   10189 N N   . VAL D 1 236 ? 13.382  80.383  42.340  1.00   16.91 ? 236  VAL D N   1 
ATOM   10190 C CA  . VAL D 1 236 ? 13.982  81.576  42.915  1.00   18.48 ? 236  VAL D CA  1 
ATOM   10191 C C   . VAL D 1 236 ? 13.683  82.888  42.186  1.00   17.35 ? 236  VAL D C   1 
ATOM   10192 O O   . VAL D 1 236 ? 13.544  83.925  42.823  1.00   15.79 ? 236  VAL D O   1 
ATOM   10193 C CB  . VAL D 1 236 ? 15.478  81.360  43.106  1.00   18.92 ? 236  VAL D CB  1 
ATOM   10194 C CG1 . VAL D 1 236 ? 16.122  82.600  43.700  1.00   20.56 ? 236  VAL D CG1 1 
ATOM   10195 C CG2 . VAL D 1 236 ? 15.690  80.157  44.038  1.00   20.35 ? 236  VAL D CG2 1 
ATOM   10196 N N   . SER D 1 237 ? 13.539  82.831  40.866  1.00   20.44 ? 237  SER D N   1 
ATOM   10197 C CA  . SER D 1 237 ? 13.216  84.009  40.058  1.00   20.42 ? 237  SER D CA  1 
ATOM   10198 C C   . SER D 1 237 ? 11.813  84.495  40.398  1.00   19.81 ? 237  SER D C   1 
ATOM   10199 O O   . SER D 1 237 ? 11.572  85.706  40.515  1.00   22.08 ? 237  SER D O   1 
ATOM   10200 C CB  . SER D 1 237 ? 13.311  83.693  38.559  1.00   17.48 ? 237  SER D CB  1 
ATOM   10201 O OG  . SER D 1 237 ? 14.611  83.974  38.078  1.00   15.40 ? 237  SER D OG  1 
ATOM   10202 N N   . GLN D 1 238 ? 10.893  83.544  40.537  1.00   18.96 ? 238  GLN D N   1 
ATOM   10203 C CA  . GLN D 1 238 ? 9.525   83.884  40.896  1.00   18.89 ? 238  GLN D CA  1 
ATOM   10204 C C   . GLN D 1 238 ? 9.500   84.496  42.279  1.00   18.99 ? 238  GLN D C   1 
ATOM   10205 O O   . GLN D 1 238 ? 8.656   85.365  42.559  1.00   18.05 ? 238  GLN D O   1 
ATOM   10206 C CB  . GLN D 1 238 ? 8.640   82.657  40.872  1.00   14.54 ? 238  GLN D CB  1 
ATOM   10207 C CG  . GLN D 1 238 ? 8.466   82.094  39.469  1.00   15.41 ? 238  GLN D CG  1 
ATOM   10208 C CD  . GLN D 1 238 ? 7.579   80.892  39.460  1.00   21.38 ? 238  GLN D CD  1 
ATOM   10209 O OE1 . GLN D 1 238 ? 7.913   79.830  38.903  1.00   19.17 ? 238  GLN D OE1 1 
ATOM   10210 N NE2 . GLN D 1 238 ? 6.421   81.039  40.089  1.00   19.43 ? 238  GLN D NE2 1 
ATOM   10211 N N   . MET D 1 239 ? 10.419  84.050  43.134  1.00   18.03 ? 239  MET D N   1 
ATOM   10212 C CA  . MET D 1 239 ? 10.517  84.564  44.493  1.00   22.00 ? 239  MET D CA  1 
ATOM   10213 C C   . MET D 1 239 ? 10.979  86.024  44.504  1.00   20.70 ? 239  MET D C   1 
ATOM   10214 O O   . MET D 1 239 ? 10.427  86.855  45.228  1.00   19.87 ? 239  MET D O   1 
ATOM   10215 C CB  . MET D 1 239 ? 11.489  83.707  45.309  1.00   25.71 ? 239  MET D CB  1 
ATOM   10216 C CG  . MET D 1 239 ? 10.801  82.682  46.207  1.00   35.40 ? 239  MET D CG  1 
ATOM   10217 S SD  . MET D 1 239 ? 9.782   83.472  47.483  1.00   35.46 ? 239  MET D SD  1 
ATOM   10218 C CE  . MET D 1 239 ? 10.922  84.649  48.047  1.00   38.67 ? 239  MET D CE  1 
ATOM   10219 N N   . PHE D 1 240 ? 12.004  86.306  43.707  1.00   18.55 ? 240  PHE D N   1 
ATOM   10220 C CA  . PHE D 1 240 ? 12.563  87.641  43.542  1.00   20.55 ? 240  PHE D CA  1 
ATOM   10221 C C   . PHE D 1 240 ? 11.456  88.560  43.019  1.00   23.08 ? 240  PHE D C   1 
ATOM   10222 O O   . PHE D 1 240 ? 11.336  89.715  43.451  1.00   21.21 ? 240  PHE D O   1 
ATOM   10223 C CB  . PHE D 1 240 ? 13.695  87.624  42.508  1.00   20.27 ? 240  PHE D CB  1 
ATOM   10224 C CG  . PHE D 1 240 ? 15.060  87.457  43.089  1.00   17.16 ? 240  PHE D CG  1 
ATOM   10225 C CD1 . PHE D 1 240 ? 15.669  88.508  43.760  1.00   16.81 ? 240  PHE D CD1 1 
ATOM   10226 C CD2 . PHE D 1 240 ? 15.749  86.259  42.945  1.00   17.90 ? 240  PHE D CD2 1 
ATOM   10227 C CE1 . PHE D 1 240 ? 16.962  88.375  44.282  1.00   18.62 ? 240  PHE D CE1 1 
ATOM   10228 C CE2 . PHE D 1 240 ? 17.042  86.102  43.460  1.00   21.69 ? 240  PHE D CE2 1 
ATOM   10229 C CZ  . PHE D 1 240 ? 17.654  87.169  44.130  1.00   19.73 ? 240  PHE D CZ  1 
ATOM   10230 N N   . ALA D 1 241 ? 10.653  88.053  42.085  1.00   21.01 ? 241  ALA D N   1 
ATOM   10231 C CA  . ALA D 1 241 ? 9.588   88.873  41.542  1.00   25.08 ? 241  ALA D CA  1 
ATOM   10232 C C   . ALA D 1 241 ? 8.503   89.107  42.605  1.00   22.81 ? 241  ALA D C   1 
ATOM   10233 O O   . ALA D 1 241 ? 7.965   90.211  42.711  1.00   22.43 ? 241  ALA D O   1 
ATOM   10234 C CB  . ALA D 1 241 ? 9.006   88.227  40.273  1.00   26.01 ? 241  ALA D CB  1 
ATOM   10235 N N   . LYS D 1 242 ? 8.210   88.088  43.404  1.00   23.85 ? 242  LYS D N   1 
ATOM   10236 C CA  . LYS D 1 242 ? 7.199   88.235  44.466  1.00   27.43 ? 242  LYS D CA  1 
ATOM   10237 C C   . LYS D 1 242 ? 7.690   89.173  45.585  1.00   28.84 ? 242  LYS D C   1 
ATOM   10238 O O   . LYS D 1 242 ? 6.917   89.952  46.161  1.00   27.99 ? 242  LYS D O   1 
ATOM   10239 C CB  . LYS D 1 242 ? 6.817   86.870  45.062  1.00   22.68 ? 242  LYS D CB  1 
ATOM   10240 C CG  . LYS D 1 242 ? 5.827   86.074  44.208  1.00   25.11 ? 242  LYS D CG  1 
ATOM   10241 C CD  . LYS D 1 242 ? 5.492   84.727  44.841  1.00   20.51 ? 242  LYS D CD  1 
ATOM   10242 C CE  . LYS D 1 242 ? 6.635   83.759  44.644  1.00   18.31 ? 242  LYS D CE  1 
ATOM   10243 N NZ  . LYS D 1 242 ? 6.711   82.819  45.768  1.00   17.28 ? 242  LYS D NZ  1 
ATOM   10244 N N   . VAL D 1 243 ? 8.978   89.077  45.895  1.00   29.32 ? 243  VAL D N   1 
ATOM   10245 C CA  . VAL D 1 243 ? 9.568   89.941  46.902  1.00   28.26 ? 243  VAL D CA  1 
ATOM   10246 C C   . VAL D 1 243 ? 9.544   91.371  46.389  1.00   28.69 ? 243  VAL D C   1 
ATOM   10247 O O   . VAL D 1 243 ? 9.173   92.276  47.110  1.00   31.25 ? 243  VAL D O   1 
ATOM   10248 C CB  . VAL D 1 243 ? 11.033  89.555  47.201  1.00   27.55 ? 243  VAL D CB  1 
ATOM   10249 C CG1 . VAL D 1 243 ? 11.703  90.636  48.053  1.00   27.59 ? 243  VAL D CG1 1 
ATOM   10250 C CG2 . VAL D 1 243 ? 11.067  88.219  47.947  1.00   26.16 ? 243  VAL D CG2 1 
ATOM   10251 N N   . ALA D 1 244 ? 9.935   91.559  45.133  1.00   30.28 ? 244  ALA D N   1 
ATOM   10252 C CA  . ALA D 1 244 ? 9.960   92.876  44.515  1.00   28.60 ? 244  ALA D CA  1 
ATOM   10253 C C   . ALA D 1 244 ? 8.579   93.512  44.569  1.00   28.41 ? 244  ALA D C   1 
ATOM   10254 O O   . ALA D 1 244 ? 8.448   94.687  44.873  1.00   28.41 ? 244  ALA D O   1 
ATOM   10255 C CB  . ALA D 1 244 ? 10.421  92.758  43.080  1.00   29.39 ? 244  ALA D CB  1 
ATOM   10256 N N   . LEU D 1 245 ? 7.544   92.731  44.281  1.00   28.74 ? 245  LEU D N   1 
ATOM   10257 C CA  . LEU D 1 245 ? 6.185   93.265  44.312  1.00   29.57 ? 245  LEU D CA  1 
ATOM   10258 C C   . LEU D 1 245 ? 5.731   93.625  45.728  1.00   30.70 ? 245  LEU D C   1 
ATOM   10259 O O   . LEU D 1 245 ? 4.945   94.559  45.913  1.00   31.82 ? 245  LEU D O   1 
ATOM   10260 C CB  . LEU D 1 245 ? 5.204   92.269  43.695  1.00   27.91 ? 245  LEU D CB  1 
ATOM   10261 C CG  . LEU D 1 245 ? 5.363   92.008  42.196  1.00   29.33 ? 245  LEU D CG  1 
ATOM   10262 C CD1 . LEU D 1 245 ? 4.291   90.995  41.756  1.00   23.33 ? 245  LEU D CD1 1 
ATOM   10263 C CD2 . LEU D 1 245 ? 5.241   93.331  41.405  1.00   24.59 ? 245  LEU D CD2 1 
ATOM   10264 N N   . ASP D 1 246 ? 6.226   92.902  46.726  1.00   30.57 ? 246  ASP D N   1 
ATOM   10265 C CA  . ASP D 1 246 ? 5.847   93.182  48.107  1.00   32.77 ? 246  ASP D CA  1 
ATOM   10266 C C   . ASP D 1 246 ? 6.520   94.434  48.656  1.00   34.58 ? 246  ASP D C   1 
ATOM   10267 O O   . ASP D 1 246 ? 6.038   95.016  49.621  1.00   37.16 ? 246  ASP D O   1 
ATOM   10268 C CB  . ASP D 1 246 ? 6.174   91.995  49.030  1.00   30.67 ? 246  ASP D CB  1 
ATOM   10269 C CG  . ASP D 1 246 ? 5.223   90.820  48.850  1.00   33.36 ? 246  ASP D CG  1 
ATOM   10270 O OD1 . ASP D 1 246 ? 4.004   91.068  48.635  1.00   31.39 ? 246  ASP D OD1 1 
ATOM   10271 O OD2 . ASP D 1 246 ? 5.691   89.654  48.945  1.00   35.09 ? 246  ASP D OD2 1 
ATOM   10272 N N   . HIS D 1 247 ? 7.637   94.842  48.062  1.00   35.46 ? 247  HIS D N   1 
ATOM   10273 C CA  . HIS D 1 247 ? 8.336   96.026  48.543  1.00   37.53 ? 247  HIS D CA  1 
ATOM   10274 C C   . HIS D 1 247 ? 8.743   96.931  47.390  1.00   40.48 ? 247  HIS D C   1 
ATOM   10275 O O   . HIS D 1 247 ? 9.930   97.192  47.193  1.00   40.72 ? 247  HIS D O   1 
ATOM   10276 C CB  . HIS D 1 247 ? 9.576   95.618  49.320  1.00   37.23 ? 247  HIS D CB  1 
ATOM   10277 C CG  . HIS D 1 247 ? 9.294   94.675  50.451  1.00   39.28 ? 247  HIS D CG  1 
ATOM   10278 N ND1 . HIS D 1 247 ? 9.075   93.328  50.260  1.00   37.49 ? 247  HIS D ND1 1 
ATOM   10279 C CD2 . HIS D 1 247 ? 9.236   94.879  51.787  1.00   33.80 ? 247  HIS D CD2 1 
ATOM   10280 C CE1 . HIS D 1 247 ? 8.900   92.744  51.430  1.00   35.79 ? 247  HIS D CE1 1 
ATOM   10281 N NE2 . HIS D 1 247 ? 8.990   93.663  52.371  1.00   36.46 ? 247  HIS D NE2 1 
ATOM   10282 N N   . ARG D 1 248 ? 7.758   97.427  46.642  1.00   41.58 ? 248  ARG D N   1 
ATOM   10283 C CA  . ARG D 1 248 ? 8.064   98.257  45.490  1.00   43.31 ? 248  ARG D CA  1 
ATOM   10284 C C   . ARG D 1 248 ? 8.274   99.744  45.790  1.00   44.03 ? 248  ARG D C   1 
ATOM   10285 O O   . ARG D 1 248 ? 8.666   100.515 44.913  1.00   45.12 ? 248  ARG D O   1 
ATOM   10286 C CB  . ARG D 1 248 ? 6.986   98.070  44.423  1.00   43.00 ? 248  ARG D CB  1 
ATOM   10287 C CG  . ARG D 1 248 ? 5.775   98.947  44.560  1.00   41.08 ? 248  ARG D CG  1 
ATOM   10288 C CD  . ARG D 1 248 ? 4.747   98.578  43.473  1.00   40.28 ? 248  ARG D CD  1 
ATOM   10289 N NE  . ARG D 1 248 ? 4.214   97.241  43.710  1.00   33.79 ? 248  ARG D NE  1 
ATOM   10290 C CZ  . ARG D 1 248 ? 2.917   96.943  43.799  1.00   32.18 ? 248  ARG D CZ  1 
ATOM   10291 N NH1 . ARG D 1 248 ? 2.530   95.696  44.031  1.00   27.54 ? 248  ARG D NH1 1 
ATOM   10292 N NH2 . ARG D 1 248 ? 2.004   97.888  43.640  1.00   30.20 ? 248  ARG D NH2 1 
ATOM   10293 N N   . GLU D 1 249 ? 8.045   100.144 47.033  1.00   41.90 ? 249  GLU D N   1 
ATOM   10294 C CA  . GLU D 1 249 ? 8.224   101.538 47.394  1.00   40.92 ? 249  GLU D CA  1 
ATOM   10295 C C   . GLU D 1 249 ? 9.618   102.028 46.964  1.00   39.13 ? 249  GLU D C   1 
ATOM   10296 O O   . GLU D 1 249 ? 9.775   103.141 46.464  1.00   37.56 ? 249  GLU D O   1 
ATOM   10297 C CB  . GLU D 1 249 ? 8.039   101.714 48.903  1.00   44.94 ? 249  GLU D CB  1 
ATOM   10298 C CG  . GLU D 1 249 ? 7.131   102.882 49.294  1.00   49.76 ? 249  GLU D CG  1 
ATOM   10299 C CD  . GLU D 1 249 ? 5.932   102.451 50.140  1.00   54.65 ? 249  GLU D CD  1 
ATOM   10300 O OE1 . GLU D 1 249 ? 4.943   101.943 49.557  1.00   55.85 ? 249  GLU D OE1 1 
ATOM   10301 O OE2 . GLU D 1 249 ? 5.988   102.615 51.388  1.00   53.24 ? 249  GLU D OE2 1 
ATOM   10302 N N   . ILE D 1 250 ? 10.628  101.189 47.146  1.00   36.59 ? 250  ILE D N   1 
ATOM   10303 C CA  . ILE D 1 250 ? 11.980  101.561 46.764  1.00   34.56 ? 250  ILE D CA  1 
ATOM   10304 C C   . ILE D 1 250 ? 12.078  101.707 45.229  1.00   34.68 ? 250  ILE D C   1 
ATOM   10305 O O   . ILE D 1 250 ? 12.738  102.623 44.706  1.00   34.78 ? 250  ILE D O   1 
ATOM   10306 C CB  . ILE D 1 250 ? 13.013  100.509 47.321  1.00   38.11 ? 250  ILE D CB  1 
ATOM   10307 C CG1 . ILE D 1 250 ? 14.434  101.078 47.309  1.00   39.32 ? 250  ILE D CG1 1 
ATOM   10308 C CG2 . ILE D 1 250 ? 12.965  99.215  46.520  1.00   36.27 ? 250  ILE D CG2 1 
ATOM   10309 C CD1 . ILE D 1 250 ? 15.117  101.035 45.982  1.00   42.85 ? 250  ILE D CD1 1 
ATOM   10310 N N   . PHE D 1 251 ? 11.406  100.816 44.503  1.00   30.84 ? 251  PHE D N   1 
ATOM   10311 C CA  . PHE D 1 251 ? 11.431  100.881 43.053  1.00   27.99 ? 251  PHE D CA  1 
ATOM   10312 C C   . PHE D 1 251 ? 10.721  102.156 42.571  1.00   29.06 ? 251  PHE D C   1 
ATOM   10313 O O   . PHE D 1 251 ? 11.138  102.787 41.586  1.00   26.56 ? 251  PHE D O   1 
ATOM   10314 C CB  . PHE D 1 251 ? 10.793  99.620  42.474  1.00   25.22 ? 251  PHE D CB  1 
ATOM   10315 C CG  . PHE D 1 251 ? 11.461  98.348  42.939  1.00   22.53 ? 251  PHE D CG  1 
ATOM   10316 C CD1 . PHE D 1 251 ? 10.807  97.475  43.807  1.00   19.63 ? 251  PHE D CD1 1 
ATOM   10317 C CD2 . PHE D 1 251 ? 12.759  98.052  42.552  1.00   20.57 ? 251  PHE D CD2 1 
ATOM   10318 C CE1 . PHE D 1 251 ? 11.434  96.329  44.289  1.00   19.95 ? 251  PHE D CE1 1 
ATOM   10319 C CE2 . PHE D 1 251 ? 13.410  96.897  43.029  1.00   23.63 ? 251  PHE D CE2 1 
ATOM   10320 C CZ  . PHE D 1 251 ? 12.744  96.035  43.901  1.00   24.19 ? 251  PHE D CZ  1 
ATOM   10321 N N   . GLU D 1 252 ? 9.670   102.556 43.286  1.00   29.76 ? 252  GLU D N   1 
ATOM   10322 C CA  . GLU D 1 252 ? 8.946   103.766 42.924  1.00   31.58 ? 252  GLU D CA  1 
ATOM   10323 C C   . GLU D 1 252 ? 9.884   104.953 42.897  1.00   31.13 ? 252  GLU D C   1 
ATOM   10324 O O   . GLU D 1 252 ? 9.827   105.798 41.998  1.00   32.23 ? 252  GLU D O   1 
ATOM   10325 C CB  . GLU D 1 252 ? 7.815   104.018 43.902  1.00   33.63 ? 252  GLU D CB  1 
ATOM   10326 C CG  . GLU D 1 252 ? 6.491   103.526 43.377  1.00   40.70 ? 252  GLU D CG  1 
ATOM   10327 C CD  . GLU D 1 252 ? 5.656   102.822 44.419  1.00   45.14 ? 252  GLU D CD  1 
ATOM   10328 O OE1 . GLU D 1 252 ? 4.528   102.401 44.076  1.00   48.34 ? 252  GLU D OE1 1 
ATOM   10329 O OE2 . GLU D 1 252 ? 6.120   102.683 45.569  1.00   46.66 ? 252  GLU D OE2 1 
ATOM   10330 N N   . GLU D 1 253 ? 10.779  104.999 43.870  1.00   32.41 ? 253  GLU D N   1 
ATOM   10331 C CA  . GLU D 1 253 ? 11.721  106.094 43.956  1.00   32.54 ? 253  GLU D CA  1 
ATOM   10332 C C   . GLU D 1 253 ? 12.775  105.993 42.884  1.00   29.79 ? 253  GLU D C   1 
ATOM   10333 O O   . GLU D 1 253 ? 13.167  106.991 42.303  1.00   27.73 ? 253  GLU D O   1 
ATOM   10334 C CB  . GLU D 1 253 ? 12.352  106.114 45.337  1.00   34.02 ? 253  GLU D CB  1 
ATOM   10335 C CG  . GLU D 1 253 ? 11.318  106.306 46.420  1.00   39.00 ? 253  GLU D CG  1 
ATOM   10336 C CD  . GLU D 1 253 ? 11.893  106.146 47.803  1.00   45.33 ? 253  GLU D CD  1 
ATOM   10337 O OE1 . GLU D 1 253 ? 12.522  105.095 48.043  1.00   45.92 ? 253  GLU D OE1 1 
ATOM   10338 O OE2 . GLU D 1 253 ? 11.711  107.063 48.645  1.00   46.64 ? 253  GLU D OE2 1 
ATOM   10339 N N   . ARG D 1 254 ? 13.227  104.783 42.601  1.00   27.82 ? 254  ARG D N   1 
ATOM   10340 C CA  . ARG D 1 254 ? 14.234  104.623 41.559  1.00   26.77 ? 254  ARG D CA  1 
ATOM   10341 C C   . ARG D 1 254 ? 13.702  105.056 40.190  1.00   27.24 ? 254  ARG D C   1 
ATOM   10342 O O   . ARG D 1 254 ? 14.419  105.663 39.391  1.00   27.86 ? 254  ARG D O   1 
ATOM   10343 C CB  . ARG D 1 254 ? 14.708  103.174 41.507  1.00   22.35 ? 254  ARG D CB  1 
ATOM   10344 C CG  . ARG D 1 254 ? 15.369  102.707 42.804  1.00   21.92 ? 254  ARG D CG  1 
ATOM   10345 C CD  . ARG D 1 254 ? 15.907  101.290 42.639  1.00   22.30 ? 254  ARG D CD  1 
ATOM   10346 N NE  . ARG D 1 254 ? 16.855  100.916 43.676  1.00   19.22 ? 254  ARG D NE  1 
ATOM   10347 C CZ  . ARG D 1 254 ? 17.451  99.733  43.741  1.00   23.60 ? 254  ARG D CZ  1 
ATOM   10348 N NH1 . ARG D 1 254 ? 17.186  98.796  42.830  1.00   18.29 ? 254  ARG D NH1 1 
ATOM   10349 N NH2 . ARG D 1 254 ? 18.337  99.496  44.702  1.00   21.42 ? 254  ARG D NH2 1 
ATOM   10350 N N   . THR D 1 255 ? 12.440  104.739 39.924  1.00   28.67 ? 255  THR D N   1 
ATOM   10351 C CA  . THR D 1 255 ? 11.803  105.082 38.654  1.00   29.87 ? 255  THR D CA  1 
ATOM   10352 C C   . THR D 1 255 ? 11.629  106.594 38.512  1.00   31.03 ? 255  THR D C   1 
ATOM   10353 O O   . THR D 1 255 ? 11.892  107.171 37.454  1.00   32.23 ? 255  THR D O   1 
ATOM   10354 C CB  . THR D 1 255 ? 10.391  104.449 38.527  1.00   27.52 ? 255  THR D CB  1 
ATOM   10355 O OG1 . THR D 1 255 ? 10.470  103.033 38.700  1.00   30.95 ? 255  THR D OG1 1 
ATOM   10356 C CG2 . THR D 1 255 ? 9.831   104.737 37.162  1.00   28.73 ? 255  THR D CG2 1 
ATOM   10357 N N   . LYS D 1 256 ? 11.157  107.225 39.578  1.00   31.30 ? 256  LYS D N   1 
ATOM   10358 C CA  . LYS D 1 256 ? 10.961  108.662 39.578  1.00   33.42 ? 256  LYS D CA  1 
ATOM   10359 C C   . LYS D 1 256 ? 12.303  109.343 39.284  1.00   32.57 ? 256  LYS D C   1 
ATOM   10360 O O   . LYS D 1 256 ? 12.384  110.241 38.437  1.00   34.42 ? 256  LYS D O   1 
ATOM   10361 C CB  . LYS D 1 256 ? 10.387  109.105 40.933  1.00   34.32 ? 256  LYS D CB  1 
ATOM   10362 C CG  . LYS D 1 256 ? 10.286  110.613 41.138  1.00   39.27 ? 256  LYS D CG  1 
ATOM   10363 C CD  . LYS D 1 256 ? 9.521   110.918 42.425  1.00   44.72 ? 256  LYS D CD  1 
ATOM   10364 C CE  . LYS D 1 256 ? 9.542   112.391 42.805  1.00   43.93 ? 256  LYS D CE  1 
ATOM   10365 N NZ  . LYS D 1 256 ? 10.886  112.823 43.275  1.00   47.10 ? 256  LYS D NZ  1 
ATOM   10366 N N   . PHE D 1 257 ? 13.362  108.908 39.960  1.00   30.83 ? 257  PHE D N   1 
ATOM   10367 C CA  . PHE D 1 257 ? 14.670  109.509 39.721  1.00   31.56 ? 257  PHE D CA  1 
ATOM   10368 C C   . PHE D 1 257 ? 15.026  109.345 38.250  1.00   32.89 ? 257  PHE D C   1 
ATOM   10369 O O   . PHE D 1 257 ? 15.481  110.296 37.597  1.00   32.08 ? 257  PHE D O   1 
ATOM   10370 C CB  . PHE D 1 257 ? 15.738  108.865 40.611  1.00   29.29 ? 257  PHE D CB  1 
ATOM   10371 C CG  . PHE D 1 257 ? 17.152  109.103 40.143  1.00   29.12 ? 257  PHE D CG  1 
ATOM   10372 C CD1 . PHE D 1 257 ? 17.764  108.240 39.235  1.00   26.80 ? 257  PHE D CD1 1 
ATOM   10373 C CD2 . PHE D 1 257 ? 17.882  110.172 40.640  1.00   30.62 ? 257  PHE D CD2 1 
ATOM   10374 C CE1 . PHE D 1 257 ? 19.102  108.438 38.830  1.00   28.67 ? 257  PHE D CE1 1 
ATOM   10375 C CE2 . PHE D 1 257 ? 19.204  110.387 40.256  1.00   31.31 ? 257  PHE D CE2 1 
ATOM   10376 C CZ  . PHE D 1 257 ? 19.824  109.510 39.342  1.00   33.00 ? 257  PHE D CZ  1 
ATOM   10377 N N   . ILE D 1 258 ? 14.782  108.149 37.717  1.00   33.29 ? 258  ILE D N   1 
ATOM   10378 C CA  . ILE D 1 258 ? 15.073  107.862 36.318  1.00   31.91 ? 258  ILE D CA  1 
ATOM   10379 C C   . ILE D 1 258 ? 14.271  108.731 35.342  1.00   32.53 ? 258  ILE D C   1 
ATOM   10380 O O   . ILE D 1 258 ? 14.844  109.277 34.392  1.00   31.18 ? 258  ILE D O   1 
ATOM   10381 C CB  . ILE D 1 258 ? 14.846  106.351 36.002  1.00   31.21 ? 258  ILE D CB  1 
ATOM   10382 C CG1 . ILE D 1 258 ? 15.879  105.503 36.767  1.00   30.50 ? 258  ILE D CG1 1 
ATOM   10383 C CG2 . ILE D 1 258 ? 14.993  106.109 34.496  1.00   27.98 ? 258  ILE D CG2 1 
ATOM   10384 C CD1 . ILE D 1 258 ? 15.658  103.999 36.704  1.00   23.70 ? 258  ILE D CD1 1 
ATOM   10385 N N   . VAL D 1 259 ? 12.965  108.889 35.575  1.00   33.54 ? 259  VAL D N   1 
ATOM   10386 C CA  . VAL D 1 259 ? 12.139  109.695 34.660  1.00   36.13 ? 259  VAL D CA  1 
ATOM   10387 C C   . VAL D 1 259 ? 12.541  111.156 34.670  1.00   37.13 ? 259  VAL D C   1 
ATOM   10388 O O   . VAL D 1 259 ? 12.598  111.796 33.620  1.00   39.16 ? 259  VAL D O   1 
ATOM   10389 C CB  . VAL D 1 259 ? 10.608  109.634 34.976  1.00   35.58 ? 259  VAL D CB  1 
ATOM   10390 C CG1 . VAL D 1 259 ? 10.117  108.204 34.994  1.00   36.15 ? 259  VAL D CG1 1 
ATOM   10391 C CG2 . VAL D 1 259 ? 10.319  110.307 36.276  1.00   41.45 ? 259  VAL D CG2 1 
ATOM   10392 N N   . GLU D 1 260 ? 12.816  111.682 35.858  1.00   37.23 ? 260  GLU D N   1 
ATOM   10393 C CA  . GLU D 1 260 ? 13.202  113.079 35.998  1.00   34.73 ? 260  GLU D CA  1 
ATOM   10394 C C   . GLU D 1 260 ? 14.569  113.298 35.373  1.00   32.14 ? 260  GLU D C   1 
ATOM   10395 O O   . GLU D 1 260 ? 14.808  114.308 34.726  1.00   30.69 ? 260  GLU D O   1 
ATOM   10396 C CB  . GLU D 1 260 ? 13.228  113.484 37.481  1.00   38.14 ? 260  GLU D CB  1 
ATOM   10397 C CG  . GLU D 1 260 ? 11.875  113.398 38.186  1.00   42.90 ? 260  GLU D CG  1 
ATOM   10398 C CD  . GLU D 1 260 ? 11.943  113.778 39.670  1.00   48.03 ? 260  GLU D CD  1 
ATOM   10399 O OE1 . GLU D 1 260 ? 12.816  113.246 40.392  1.00   49.01 ? 260  GLU D OE1 1 
ATOM   10400 O OE2 . GLU D 1 260 ? 11.111  114.598 40.122  1.00   47.53 ? 260  GLU D OE2 1 
ATOM   10401 N N   . GLU D 1 261 ? 15.467  112.343 35.562  1.00   32.66 ? 261  GLU D N   1 
ATOM   10402 C CA  . GLU D 1 261 ? 16.796  112.473 34.992  1.00   32.86 ? 261  GLU D CA  1 
ATOM   10403 C C   . GLU D 1 261 ? 16.678  112.426 33.470  1.00   32.74 ? 261  GLU D C   1 
ATOM   10404 O O   . GLU D 1 261 ? 17.465  113.049 32.762  1.00   31.79 ? 261  GLU D O   1 
ATOM   10405 C CB  . GLU D 1 261 ? 17.706  111.353 35.499  1.00   35.43 ? 261  GLU D CB  1 
ATOM   10406 C CG  . GLU D 1 261 ? 19.196  111.658 35.375  1.00   41.04 ? 261  GLU D CG  1 
ATOM   10407 C CD  . GLU D 1 261 ? 19.752  112.494 36.529  1.00   41.19 ? 261  GLU D CD  1 
ATOM   10408 O OE1 . GLU D 1 261 ? 19.160  113.547 36.878  1.00   38.48 ? 261  GLU D OE1 1 
ATOM   10409 O OE2 . GLU D 1 261 ? 20.802  112.091 37.074  1.00   39.50 ? 261  GLU D OE2 1 
ATOM   10410 N N   . ARG D 1 262 ? 15.681  111.686 32.980  1.00   33.67 ? 262  ARG D N   1 
ATOM   10411 C CA  . ARG D 1 262 ? 15.425  111.564 31.541  1.00   32.63 ? 262  ARG D CA  1 
ATOM   10412 C C   . ARG D 1 262 ? 14.922  112.907 31.002  1.00   32.89 ? 262  ARG D C   1 
ATOM   10413 O O   . ARG D 1 262 ? 15.373  113.370 29.950  1.00   29.91 ? 262  ARG D O   1 
ATOM   10414 C CB  . ARG D 1 262 ? 14.365  110.493 31.263  1.00   30.30 ? 262  ARG D CB  1 
ATOM   10415 C CG  . ARG D 1 262 ? 14.022  110.334 29.787  1.00   30.37 ? 262  ARG D CG  1 
ATOM   10416 C CD  . ARG D 1 262 ? 12.721  109.564 29.580  1.00   24.66 ? 262  ARG D CD  1 
ATOM   10417 N NE  . ARG D 1 262 ? 11.562  110.379 29.921  1.00   28.83 ? 262  ARG D NE  1 
ATOM   10418 C CZ  . ARG D 1 262 ? 10.404  109.875 30.351  1.00   34.90 ? 262  ARG D CZ  1 
ATOM   10419 N NH1 . ARG D 1 262 ? 10.256  108.559 30.496  1.00   32.24 ? 262  ARG D NH1 1 
ATOM   10420 N NH2 . ARG D 1 262 ? 9.386   110.682 30.642  1.00   31.56 ? 262  ARG D NH2 1 
ATOM   10421 N N   . GLU D 1 263 ? 13.977  113.518 31.714  1.00   32.80 ? 263  GLU D N   1 
ATOM   10422 C CA  . GLU D 1 263 ? 13.459  114.810 31.284  1.00   35.71 ? 263  GLU D CA  1 
ATOM   10423 C C   . GLU D 1 263 ? 14.608  115.813 31.337  1.00   35.08 ? 263  GLU D C   1 
ATOM   10424 O O   . GLU D 1 263 ? 14.737  116.670 30.474  1.00   34.29 ? 263  GLU D O   1 
ATOM   10425 C CB  . GLU D 1 263 ? 12.310  115.280 32.180  1.00   34.41 ? 263  GLU D CB  1 
ATOM   10426 C CG  . GLU D 1 263 ? 11.171  114.269 32.376  1.00   43.76 ? 263  GLU D CG  1 
ATOM   10427 C CD  . GLU D 1 263 ? 10.434  113.852 31.090  1.00   50.92 ? 263  GLU D CD  1 
ATOM   10428 O OE1 . GLU D 1 263 ? 9.239   113.481 31.202  1.00   49.67 ? 263  GLU D OE1 1 
ATOM   10429 O OE2 . GLU D 1 263 ? 11.033  113.868 29.983  1.00   52.26 ? 263  GLU D OE2 1 
ATOM   10430 N N   . ARG D 1 264 ? 15.460  115.680 32.345  1.00   38.03 ? 264  ARG D N   1 
ATOM   10431 C CA  . ARG D 1 264 ? 16.600  116.566 32.485  1.00   38.03 ? 264  ARG D CA  1 
ATOM   10432 C C   . ARG D 1 264 ? 17.516  116.380 31.295  1.00   38.53 ? 264  ARG D C   1 
ATOM   10433 O O   . ARG D 1 264 ? 18.007  117.344 30.741  1.00   39.15 ? 264  ARG D O   1 
ATOM   10434 C CB  . ARG D 1 264 ? 17.382  116.269 33.772  1.00   40.29 ? 264  ARG D CB  1 
ATOM   10435 C CG  . ARG D 1 264 ? 18.407  117.349 34.148  1.00   39.09 ? 264  ARG D CG  1 
ATOM   10436 C CD  . ARG D 1 264 ? 19.301  116.922 35.308  1.00   39.03 ? 264  ARG D CD  1 
ATOM   10437 N NE  . ARG D 1 264 ? 20.512  116.266 34.835  1.00   39.51 ? 264  ARG D NE  1 
ATOM   10438 C CZ  . ARG D 1 264 ? 21.374  115.627 35.613  1.00   42.79 ? 264  ARG D CZ  1 
ATOM   10439 N NH1 . ARG D 1 264 ? 21.172  115.542 36.916  1.00   49.96 ? 264  ARG D NH1 1 
ATOM   10440 N NH2 . ARG D 1 264 ? 22.449  115.073 35.082  1.00   43.93 ? 264  ARG D NH2 1 
ATOM   10441 N N   . MET D 1 265 ? 17.758  115.138 30.897  1.00   39.68 ? 265  MET D N   1 
ATOM   10442 C CA  . MET D 1 265 ? 18.634  114.928 29.757  1.00   40.40 ? 265  MET D CA  1 
ATOM   10443 C C   . MET D 1 265 ? 17.999  115.337 28.438  1.00   40.16 ? 265  MET D C   1 
ATOM   10444 O O   . MET D 1 265 ? 18.706  115.746 27.520  1.00   40.65 ? 265  MET D O   1 
ATOM   10445 C CB  . MET D 1 265 ? 19.069  113.477 29.672  1.00   45.16 ? 265  MET D CB  1 
ATOM   10446 C CG  . MET D 1 265 ? 20.433  113.231 30.255  1.00   50.25 ? 265  MET D CG  1 
ATOM   10447 S SD  . MET D 1 265 ? 20.790  111.492 30.305  1.00   46.38 ? 265  MET D SD  1 
ATOM   10448 C CE  . MET D 1 265 ? 19.948  111.109 31.816  1.00   52.06 ? 265  MET D CE  1 
ATOM   10449 N N   . LYS D 1 266 ? 16.677  115.237 28.335  1.00   37.03 ? 266  LYS D N   1 
ATOM   10450 C CA  . LYS D 1 266 ? 16.031  115.606 27.085  1.00   38.34 ? 266  LYS D CA  1 
ATOM   10451 C C   . LYS D 1 266 ? 16.039  117.117 26.855  1.00   39.12 ? 266  LYS D C   1 
ATOM   10452 O O   . LYS D 1 266 ? 15.929  117.582 25.717  1.00   37.96 ? 266  LYS D O   1 
ATOM   10453 C CB  . LYS D 1 266 ? 14.603  115.053 27.024  1.00   33.61 ? 266  LYS D CB  1 
ATOM   10454 C CG  . LYS D 1 266 ? 14.555  113.538 26.971  1.00   31.12 ? 266  LYS D CG  1 
ATOM   10455 C CD  . LYS D 1 266 ? 13.244  113.056 26.371  1.00   34.29 ? 266  LYS D CD  1 
ATOM   10456 C CE  . LYS D 1 266 ? 12.050  113.608 27.119  1.00   31.68 ? 266  LYS D CE  1 
ATOM   10457 N NZ  . LYS D 1 266 ? 10.758  113.052 26.643  1.00   31.96 ? 266  LYS D NZ  1 
ATOM   10458 N N   . SER D 1 267 ? 16.190  117.883 27.931  1.00   39.67 ? 267  SER D N   1 
ATOM   10459 C CA  . SER D 1 267 ? 16.218  119.340 27.824  1.00   39.53 ? 267  SER D CA  1 
ATOM   10460 C C   . SER D 1 267 ? 17.594  119.808 27.396  1.00   37.37 ? 267  SER D C   1 
ATOM   10461 O O   . SER D 1 267 ? 17.722  120.574 26.448  1.00   40.18 ? 267  SER D O   1 
ATOM   10462 C CB  . SER D 1 267 ? 15.820  119.993 29.151  1.00   36.74 ? 267  SER D CB  1 
ATOM   10463 O OG  . SER D 1 267 ? 14.443  119.767 29.394  1.00   34.99 ? 267  SER D OG  1 
ATOM   10464 N N   . ALA D 1 268 ? 18.621  119.329 28.080  1.00   35.87 ? 268  ALA D N   1 
ATOM   10465 C CA  . ALA D 1 268 ? 19.985  119.714 27.734  1.00   38.47 ? 268  ALA D CA  1 
ATOM   10466 C C   . ALA D 1 268 ? 20.279  119.444 26.250  1.00   40.34 ? 268  ALA D C   1 
ATOM   10467 O O   . ALA D 1 268 ? 20.791  120.307 25.537  1.00   39.26 ? 268  ALA D O   1 
ATOM   10468 C CB  . ALA D 1 268 ? 20.987  118.953 28.615  1.00   34.80 ? 268  ALA D CB  1 
ATOM   10469 N N   . LEU D 1 269 ? 19.934  118.243 25.788  1.00   42.68 ? 269  LEU D N   1 
ATOM   10470 C CA  . LEU D 1 269 ? 20.172  117.855 24.407  1.00   43.44 ? 269  LEU D CA  1 
ATOM   10471 C C   . LEU D 1 269 ? 19.463  118.759 23.405  1.00   45.41 ? 269  LEU D C   1 
ATOM   10472 O O   . LEU D 1 269 ? 20.022  119.080 22.347  1.00   46.49 ? 269  LEU D O   1 
ATOM   10473 C CB  . LEU D 1 269 ? 19.753  116.400 24.202  1.00   40.86 ? 269  LEU D CB  1 
ATOM   10474 C CG  . LEU D 1 269 ? 20.501  115.448 25.146  1.00   39.81 ? 269  LEU D CG  1 
ATOM   10475 C CD1 . LEU D 1 269 ? 20.117  113.994 24.861  1.00   35.94 ? 269  LEU D CD1 1 
ATOM   10476 C CD2 . LEU D 1 269 ? 22.012  115.657 24.980  1.00   38.25 ? 269  LEU D CD2 1 
ATOM   10477 N N   . ARG D 1 270 ? 18.235  119.153 23.717  1.00   45.35 ? 270  ARG D N   1 
ATOM   10478 C CA  . ARG D 1 270 ? 17.506  120.036 22.822  1.00   47.87 ? 270  ARG D CA  1 
ATOM   10479 C C   . ARG D 1 270 ? 18.206  121.382 22.813  1.00   49.09 ? 270  ARG D C   1 
ATOM   10480 O O   . ARG D 1 270 ? 18.348  122.006 21.769  1.00   48.24 ? 270  ARG D O   1 
ATOM   10481 C CB  . ARG D 1 270 ? 16.074  120.224 23.292  1.00   47.85 ? 270  ARG D CB  1 
ATOM   10482 C CG  . ARG D 1 270 ? 15.234  119.000 23.136  1.00   49.31 ? 270  ARG D CG  1 
ATOM   10483 C CD  . ARG D 1 270 ? 13.901  119.206 23.805  1.00   52.67 ? 270  ARG D CD  1 
ATOM   10484 N NE  . ARG D 1 270 ? 13.149  117.960 23.862  1.00   55.25 ? 270  ARG D NE  1 
ATOM   10485 C CZ  . ARG D 1 270 ? 12.234  117.685 24.785  1.00   54.19 ? 270  ARG D CZ  1 
ATOM   10486 N NH1 . ARG D 1 270 ? 11.959  118.575 25.735  1.00   53.73 ? 270  ARG D NH1 1 
ATOM   10487 N NH2 . ARG D 1 270 ? 11.598  116.521 24.756  1.00   50.27 ? 270  ARG D NH2 1 
ATOM   10488 N N   . GLU D 1 271 ? 18.646  121.815 23.990  1.00   51.71 ? 271  GLU D N   1 
ATOM   10489 C CA  . GLU D 1 271 ? 19.346  123.087 24.135  1.00   53.82 ? 271  GLU D CA  1 
ATOM   10490 C C   . GLU D 1 271 ? 20.587  123.107 23.263  1.00   51.55 ? 271  GLU D C   1 
ATOM   10491 O O   . GLU D 1 271 ? 20.891  124.103 22.623  1.00   50.35 ? 271  GLU D O   1 
ATOM   10492 C CB  . GLU D 1 271 ? 19.749  123.319 25.595  1.00   59.43 ? 271  GLU D CB  1 
ATOM   10493 C CG  . GLU D 1 271 ? 18.689  124.002 26.433  1.00   65.57 ? 271  GLU D CG  1 
ATOM   10494 C CD  . GLU D 1 271 ? 18.454  125.437 26.001  1.00   71.97 ? 271  GLU D CD  1 
ATOM   10495 O OE1 . GLU D 1 271 ? 19.404  126.254 26.084  1.00   72.37 ? 271  GLU D OE1 1 
ATOM   10496 O OE2 . GLU D 1 271 ? 17.317  125.744 25.575  1.00   76.19 ? 271  GLU D OE2 1 
ATOM   10497 N N   . MET D 1 272 ? 21.305  121.995 23.249  1.00   49.65 ? 272  MET D N   1 
ATOM   10498 C CA  . MET D 1 272 ? 22.514  121.897 22.452  1.00   48.32 ? 272  MET D CA  1 
ATOM   10499 C C   . MET D 1 272 ? 22.115  121.746 20.979  1.00   46.82 ? 272  MET D C   1 
ATOM   10500 O O   . MET D 1 272 ? 22.967  121.629 20.092  1.00   45.27 ? 272  MET D O   1 
ATOM   10501 C CB  . MET D 1 272 ? 23.343  120.710 22.944  1.00   48.49 ? 272  MET D CB  1 
ATOM   10502 C CG  . MET D 1 272 ? 23.592  120.775 24.443  1.00   49.08 ? 272  MET D CG  1 
ATOM   10503 S SD  . MET D 1 272 ? 24.211  119.256 25.131  1.00   54.93 ? 272  MET D SD  1 
ATOM   10504 C CE  . MET D 1 272 ? 24.718  119.778 26.743  1.00   55.26 ? 272  MET D CE  1 
ATOM   10505 N N   . GLY D 1 273 ? 20.801  121.755 20.750  1.00   44.67 ? 273  GLY D N   1 
ATOM   10506 C CA  . GLY D 1 273 ? 20.265  121.641 19.412  1.00   43.25 ? 273  GLY D CA  1 
ATOM   10507 C C   . GLY D 1 273 ? 20.033  120.247 18.855  1.00   43.59 ? 273  GLY D C   1 
ATOM   10508 O O   . GLY D 1 273 ? 19.497  120.107 17.754  1.00   43.57 ? 273  GLY D O   1 
ATOM   10509 N N   . TYR D 1 274 ? 20.430  119.216 19.594  1.00   42.10 ? 274  TYR D N   1 
ATOM   10510 C CA  . TYR D 1 274 ? 20.249  117.851 19.133  1.00   38.98 ? 274  TYR D CA  1 
ATOM   10511 C C   . TYR D 1 274 ? 18.801  117.513 18.826  1.00   38.75 ? 274  TYR D C   1 
ATOM   10512 O O   . TYR D 1 274 ? 17.888  117.967 19.514  1.00   38.75 ? 274  TYR D O   1 
ATOM   10513 C CB  . TYR D 1 274 ? 20.768  116.871 20.169  1.00   37.49 ? 274  TYR D CB  1 
ATOM   10514 C CG  . TYR D 1 274 ? 22.255  116.753 20.175  1.00   35.70 ? 274  TYR D CG  1 
ATOM   10515 C CD1 . TYR D 1 274 ? 23.024  117.332 21.185  1.00   34.27 ? 274  TYR D CD1 1 
ATOM   10516 C CD2 . TYR D 1 274 ? 22.901  116.069 19.159  1.00   33.29 ? 274  TYR D CD2 1 
ATOM   10517 C CE1 . TYR D 1 274 ? 24.420  117.225 21.178  1.00   34.96 ? 274  TYR D CE1 1 
ATOM   10518 C CE2 . TYR D 1 274 ? 24.279  115.952 19.133  1.00   33.63 ? 274  TYR D CE2 1 
ATOM   10519 C CZ  . TYR D 1 274 ? 25.045  116.530 20.145  1.00   37.07 ? 274  TYR D CZ  1 
ATOM   10520 O OH  . TYR D 1 274 ? 26.428  116.405 20.113  1.00   36.71 ? 274  TYR D OH  1 
ATOM   10521 N N   . ARG D 1 275 ? 18.604  116.702 17.791  1.00   39.53 ? 275  ARG D N   1 
ATOM   10522 C CA  . ARG D 1 275 ? 17.274  116.279 17.377  1.00   41.85 ? 275  ARG D CA  1 
ATOM   10523 C C   . ARG D 1 275 ? 16.961  114.998 18.141  1.00   42.14 ? 275  ARG D C   1 
ATOM   10524 O O   . ARG D 1 275 ? 17.482  113.923 17.821  1.00   43.02 ? 275  ARG D O   1 
ATOM   10525 C CB  . ARG D 1 275 ? 17.254  116.038 15.861  1.00   43.68 ? 275  ARG D CB  1 
ATOM   10526 C CG  . ARG D 1 275 ? 15.937  115.537 15.276  1.00   44.94 ? 275  ARG D CG  1 
ATOM   10527 C CD  . ARG D 1 275 ? 15.879  115.841 13.769  1.00   47.67 ? 275  ARG D CD  1 
ATOM   10528 N NE  . ARG D 1 275 ? 15.616  114.672 12.922  1.00   48.98 ? 275  ARG D NE  1 
ATOM   10529 C CZ  . ARG D 1 275 ? 16.556  113.954 12.306  1.00   53.09 ? 275  ARG D CZ  1 
ATOM   10530 N NH1 . ARG D 1 275 ? 17.841  114.272 12.437  1.00   54.62 ? 275  ARG D NH1 1 
ATOM   10531 N NH2 . ARG D 1 275 ? 16.217  112.928 11.533  1.00   52.46 ? 275  ARG D NH2 1 
ATOM   10532 N N   . ILE D 1 276 ? 16.106  115.122 19.153  1.00   40.03 ? 276  ILE D N   1 
ATOM   10533 C CA  . ILE D 1 276 ? 15.770  113.987 19.996  1.00   37.92 ? 276  ILE D CA  1 
ATOM   10534 C C   . ILE D 1 276 ? 14.309  113.637 19.929  1.00   36.71 ? 276  ILE D C   1 
ATOM   10535 O O   . ILE D 1 276 ? 13.489  114.427 19.484  1.00   38.89 ? 276  ILE D O   1 
ATOM   10536 C CB  . ILE D 1 276 ? 16.134  114.261 21.480  1.00   39.35 ? 276  ILE D CB  1 
ATOM   10537 C CG1 . ILE D 1 276 ? 14.946  114.885 22.223  1.00   37.68 ? 276  ILE D CG1 1 
ATOM   10538 C CG2 . ILE D 1 276 ? 17.310  115.211 21.559  1.00   37.09 ? 276  ILE D CG2 1 
ATOM   10539 C CD1 . ILE D 1 276 ? 14.395  116.120 21.558  1.00   38.63 ? 276  ILE D CD1 1 
ATOM   10540 N N   . THR D 1 277 ? 13.996  112.444 20.406  1.00   35.43 ? 277  THR D N   1 
ATOM   10541 C CA  . THR D 1 277 ? 12.636  111.972 20.423  1.00   33.30 ? 277  THR D CA  1 
ATOM   10542 C C   . THR D 1 277 ? 12.043  112.270 21.794  1.00   31.97 ? 277  THR D C   1 
ATOM   10543 O O   . THR D 1 277 ? 12.759  112.591 22.740  1.00   35.67 ? 277  THR D O   1 
ATOM   10544 C CB  . THR D 1 277 ? 12.591  110.459 20.176  1.00   32.54 ? 277  THR D CB  1 
ATOM   10545 O OG1 . THR D 1 277 ? 13.064  109.774 21.340  1.00   34.22 ? 277  THR D OG1 1 
ATOM   10546 C CG2 . THR D 1 277 ? 13.493  110.096 19.016  1.00   33.87 ? 277  THR D CG2 1 
ATOM   10547 N N   . ASP D 1 278 ? 10.729  112.172 21.894  1.00   31.13 ? 278  ASP D N   1 
ATOM   10548 C CA  . ASP D 1 278 ? 10.056  112.410 23.152  1.00   31.53 ? 278  ASP D CA  1 
ATOM   10549 C C   . ASP D 1 278 ? 9.907   111.046 23.806  1.00   29.88 ? 278  ASP D C   1 
ATOM   10550 O O   . ASP D 1 278 ? 8.825   110.445 23.812  1.00   30.08 ? 278  ASP D O   1 
ATOM   10551 C CB  . ASP D 1 278 ? 8.692   113.058 22.923  1.00   30.16 ? 278  ASP D CB  1 
ATOM   10552 C CG  . ASP D 1 278 ? 8.026   113.441 24.215  1.00   35.68 ? 278  ASP D CG  1 
ATOM   10553 O OD1 . ASP D 1 278 ? 8.778   113.672 25.185  1.00   39.05 ? 278  ASP D OD1 1 
ATOM   10554 O OD2 . ASP D 1 278 ? 6.774   113.520 24.273  1.00   37.71 ? 278  ASP D OD2 1 
ATOM   10555 N N   . SER D 1 279 ? 11.023  110.571 24.343  1.00   28.84 ? 279  SER D N   1 
ATOM   10556 C CA  . SER D 1 279 ? 11.107  109.276 24.987  1.00   29.74 ? 279  SER D CA  1 
ATOM   10557 C C   . SER D 1 279 ? 10.331  109.233 26.290  1.00   31.35 ? 279  SER D C   1 
ATOM   10558 O O   . SER D 1 279 ? 10.303  110.206 27.028  1.00   34.26 ? 279  SER D O   1 
ATOM   10559 C CB  . SER D 1 279 ? 12.579  108.947 25.250  1.00   29.29 ? 279  SER D CB  1 
ATOM   10560 O OG  . SER D 1 279 ? 12.729  107.811 26.077  1.00   24.58 ? 279  SER D OG  1 
ATOM   10561 N N   . ARG D 1 280 ? 9.713   108.085 26.563  1.00   31.74 ? 280  ARG D N   1 
ATOM   10562 C CA  . ARG D 1 280 ? 8.929   107.863 27.773  1.00   28.16 ? 280  ARG D CA  1 
ATOM   10563 C C   . ARG D 1 280 ? 9.375   106.536 28.349  1.00   28.48 ? 280  ARG D C   1 
ATOM   10564 O O   . ARG D 1 280 ? 8.626   105.868 29.068  1.00   29.43 ? 280  ARG D O   1 
ATOM   10565 C CB  . ARG D 1 280 ? 7.446   107.816 27.427  1.00   25.06 ? 280  ARG D CB  1 
ATOM   10566 C CG  . ARG D 1 280 ? 6.963   109.087 26.801  1.00   22.82 ? 280  ARG D CG  1 
ATOM   10567 C CD  . ARG D 1 280 ? 7.375   110.273 27.638  1.00   24.95 ? 280  ARG D CD  1 
ATOM   10568 N NE  . ARG D 1 280 ? 6.900   111.530 27.072  1.00   26.48 ? 280  ARG D NE  1 
ATOM   10569 C CZ  . ARG D 1 280 ? 5.623   111.907 27.064  1.00   32.86 ? 280  ARG D CZ  1 
ATOM   10570 N NH1 . ARG D 1 280 ? 4.680   111.121 27.596  1.00   33.15 ? 280  ARG D NH1 1 
ATOM   10571 N NH2 . ARG D 1 280 ? 5.279   113.071 26.521  1.00   31.20 ? 280  ARG D NH2 1 
ATOM   10572 N N   . GLY D 1 281 ? 10.599  106.149 27.991  1.00   28.68 ? 281  GLY D N   1 
ATOM   10573 C CA  . GLY D 1 281 ? 11.187  104.902 28.467  1.00   25.87 ? 281  GLY D CA  1 
ATOM   10574 C C   . GLY D 1 281 ? 12.284  105.285 29.435  1.00   24.79 ? 281  GLY D C   1 
ATOM   10575 O O   . GLY D 1 281 ? 12.256  106.387 29.971  1.00   20.86 ? 281  GLY D O   1 
ATOM   10576 N N   . ASN D 1 282 ? 13.249  104.408 29.670  1.00   24.87 ? 282  ASN D N   1 
ATOM   10577 C CA  . ASN D 1 282 ? 14.320  104.755 30.603  1.00   25.50 ? 282  ASN D CA  1 
ATOM   10578 C C   . ASN D 1 282 ? 15.582  105.085 29.827  1.00   26.28 ? 282  ASN D C   1 
ATOM   10579 O O   . ASN D 1 282 ? 16.671  104.637 30.163  1.00   27.58 ? 282  ASN D O   1 
ATOM   10580 C CB  . ASN D 1 282 ? 14.588  103.615 31.586  1.00   27.18 ? 282  ASN D CB  1 
ATOM   10581 C CG  . ASN D 1 282 ? 14.951  102.333 30.895  1.00   26.07 ? 282  ASN D CG  1 
ATOM   10582 O OD1 . ASN D 1 282 ? 14.374  102.016 29.865  1.00   30.92 ? 282  ASN D OD1 1 
ATOM   10583 N ND2 . ASN D 1 282 ? 15.898  101.576 31.460  1.00   19.13 ? 282  ASN D ND2 1 
ATOM   10584 N N   . PHE D 1 283 ? 15.431  105.920 28.810  1.00   25.61 ? 283  PHE D N   1 
ATOM   10585 C CA  . PHE D 1 283 ? 16.550  106.292 27.977  1.00   25.56 ? 283  PHE D CA  1 
ATOM   10586 C C   . PHE D 1 283 ? 16.103  107.444 27.087  1.00   24.86 ? 283  PHE D C   1 
ATOM   10587 O O   . PHE D 1 283 ? 14.936  107.864 27.130  1.00   22.44 ? 283  PHE D O   1 
ATOM   10588 C CB  . PHE D 1 283 ? 16.909  105.111 27.084  1.00   27.29 ? 283  PHE D CB  1 
ATOM   10589 C CG  . PHE D 1 283 ? 15.738  104.608 26.270  1.00   26.10 ? 283  PHE D CG  1 
ATOM   10590 C CD1 . PHE D 1 283 ? 14.937  103.581 26.753  1.00   24.99 ? 283  PHE D CD1 1 
ATOM   10591 C CD2 . PHE D 1 283 ? 15.402  105.211 25.055  1.00   27.67 ? 283  PHE D CD2 1 
ATOM   10592 C CE1 . PHE D 1 283 ? 13.832  103.157 26.061  1.00   23.63 ? 283  PHE D CE1 1 
ATOM   10593 C CE2 . PHE D 1 283 ? 14.292  104.798 24.345  1.00   25.45 ? 283  PHE D CE2 1 
ATOM   10594 C CZ  . PHE D 1 283 ? 13.500  103.766 24.850  1.00   30.60 ? 283  PHE D CZ  1 
ATOM   10595 N N   . VAL D 1 284 ? 17.022  107.943 26.270  1.00   22.28 ? 284  VAL D N   1 
ATOM   10596 C CA  . VAL D 1 284 ? 16.680  109.005 25.325  1.00   25.40 ? 284  VAL D CA  1 
ATOM   10597 C C   . VAL D 1 284 ? 17.174  108.591 23.953  1.00   27.07 ? 284  VAL D C   1 
ATOM   10598 O O   . VAL D 1 284 ? 18.102  107.777 23.838  1.00   29.85 ? 284  VAL D O   1 
ATOM   10599 C CB  . VAL D 1 284 ? 17.313  110.352 25.703  1.00   19.64 ? 284  VAL D CB  1 
ATOM   10600 C CG1 . VAL D 1 284 ? 16.769  110.812 27.049  1.00   22.30 ? 284  VAL D CG1 1 
ATOM   10601 C CG2 . VAL D 1 284 ? 18.790  110.225 25.721  1.00   19.10 ? 284  VAL D CG2 1 
ATOM   10602 N N   . PHE D 1 285 ? 16.533  109.113 22.911  1.00   28.78 ? 285  PHE D N   1 
ATOM   10603 C CA  . PHE D 1 285 ? 16.953  108.797 21.554  1.00   29.30 ? 285  PHE D CA  1 
ATOM   10604 C C   . PHE D 1 285 ? 17.440  110.050 20.814  1.00   30.18 ? 285  PHE D C   1 
ATOM   10605 O O   . PHE D 1 285 ? 16.766  111.070 20.802  1.00   29.46 ? 285  PHE D O   1 
ATOM   10606 C CB  . PHE D 1 285 ? 15.821  108.142 20.759  1.00   31.44 ? 285  PHE D CB  1 
ATOM   10607 C CG  . PHE D 1 285 ? 16.304  107.470 19.511  1.00   32.39 ? 285  PHE D CG  1 
ATOM   10608 C CD1 . PHE D 1 285 ? 16.775  106.165 19.558  1.00   30.17 ? 285  PHE D CD1 1 
ATOM   10609 C CD2 . PHE D 1 285 ? 16.396  108.183 18.313  1.00   31.79 ? 285  PHE D CD2 1 
ATOM   10610 C CE1 . PHE D 1 285 ? 17.336  105.578 18.438  1.00   34.75 ? 285  PHE D CE1 1 
ATOM   10611 C CE2 . PHE D 1 285 ? 16.951  107.619 17.188  1.00   35.28 ? 285  PHE D CE2 1 
ATOM   10612 C CZ  . PHE D 1 285 ? 17.430  106.298 17.247  1.00   38.85 ? 285  PHE D CZ  1 
ATOM   10613 N N   . VAL D 1 286 ? 18.615  109.961 20.198  1.00   29.50 ? 286  VAL D N   1 
ATOM   10614 C CA  . VAL D 1 286 ? 19.183  111.091 19.468  1.00   32.89 ? 286  VAL D CA  1 
ATOM   10615 C C   . VAL D 1 286 ? 19.337  110.806 17.962  1.00   34.43 ? 286  VAL D C   1 
ATOM   10616 O O   . VAL D 1 286 ? 20.154  109.980 17.560  1.00   30.01 ? 286  VAL D O   1 
ATOM   10617 C CB  . VAL D 1 286 ? 20.588  111.457 20.009  1.00   34.62 ? 286  VAL D CB  1 
ATOM   10618 C CG1 . VAL D 1 286 ? 21.098  112.729 19.338  1.00   35.30 ? 286  VAL D CG1 1 
ATOM   10619 C CG2 . VAL D 1 286 ? 20.555  111.587 21.515  1.00   34.17 ? 286  VAL D CG2 1 
ATOM   10620 N N   . PHE D 1 287 ? 18.558  111.494 17.132  1.00   37.32 ? 287  PHE D N   1 
ATOM   10621 C CA  . PHE D 1 287 ? 18.650  111.310 15.691  1.00   40.10 ? 287  PHE D CA  1 
ATOM   10622 C C   . PHE D 1 287 ? 19.980  111.833 15.173  1.00   41.59 ? 287  PHE D C   1 
ATOM   10623 O O   . PHE D 1 287 ? 20.381  112.958 15.467  1.00   39.10 ? 287  PHE D O   1 
ATOM   10624 C CB  . PHE D 1 287 ? 17.522  112.046 14.980  1.00   43.02 ? 287  PHE D CB  1 
ATOM   10625 C CG  . PHE D 1 287 ? 16.172  111.430 15.189  1.00   43.76 ? 287  PHE D CG  1 
ATOM   10626 C CD1 . PHE D 1 287 ? 15.186  112.107 15.907  1.00   42.64 ? 287  PHE D CD1 1 
ATOM   10627 C CD2 . PHE D 1 287 ? 15.883  110.178 14.663  1.00   44.48 ? 287  PHE D CD2 1 
ATOM   10628 C CE1 . PHE D 1 287 ? 13.923  111.549 16.100  1.00   43.95 ? 287  PHE D CE1 1 
ATOM   10629 C CE2 . PHE D 1 287 ? 14.628  109.610 14.849  1.00   45.10 ? 287  PHE D CE2 1 
ATOM   10630 C CZ  . PHE D 1 287 ? 13.643  110.297 15.571  1.00   42.94 ? 287  PHE D CZ  1 
ATOM   10631 N N   . MET D 1 288 ? 20.670  111.011 14.399  1.00   43.93 ? 288  MET D N   1 
ATOM   10632 C CA  . MET D 1 288 ? 21.946  111.422 13.847  1.00   48.04 ? 288  MET D CA  1 
ATOM   10633 C C   . MET D 1 288 ? 22.214  110.761 12.511  1.00   50.43 ? 288  MET D C   1 
ATOM   10634 O O   . MET D 1 288 ? 21.933  109.575 12.319  1.00   49.51 ? 288  MET D O   1 
ATOM   10635 C CB  . MET D 1 288 ? 23.092  111.077 14.793  1.00   50.73 ? 288  MET D CB  1 
ATOM   10636 C CG  . MET D 1 288 ? 23.083  111.802 16.117  1.00   53.96 ? 288  MET D CG  1 
ATOM   10637 S SD  . MET D 1 288 ? 24.562  111.372 17.010  1.00   59.15 ? 288  MET D SD  1 
ATOM   10638 C CE  . MET D 1 288 ? 25.597  112.799 16.695  1.00   57.91 ? 288  MET D CE  1 
ATOM   10639 N N   . GLU D 1 289 ? 22.770  111.545 11.597  1.00   52.47 ? 289  GLU D N   1 
ATOM   10640 C CA  . GLU D 1 289 ? 23.110  111.061 10.275  1.00   56.48 ? 289  GLU D CA  1 
ATOM   10641 C C   . GLU D 1 289 ? 24.282  110.092 10.399  1.00   56.76 ? 289  GLU D C   1 
ATOM   10642 O O   . GLU D 1 289 ? 25.140  110.242 11.266  1.00   53.99 ? 289  GLU D O   1 
ATOM   10643 C CB  . GLU D 1 289 ? 23.461  112.246 9.377   1.00   61.82 ? 289  GLU D CB  1 
ATOM   10644 C CG  . GLU D 1 289 ? 22.306  113.235 9.229   1.00   69.93 ? 289  GLU D CG  1 
ATOM   10645 C CD  . GLU D 1 289 ? 22.737  114.587 8.672   1.00   75.54 ? 289  GLU D CD  1 
ATOM   10646 O OE1 . GLU D 1 289 ? 23.287  114.616 7.550   1.00   78.63 ? 289  GLU D OE1 1 
ATOM   10647 O OE2 . GLU D 1 289 ? 22.523  115.620 9.352   1.00   77.33 ? 289  GLU D OE2 1 
ATOM   10648 N N   . LYS D 1 290 ? 24.293  109.096 9.524   1.00   58.57 ? 290  LYS D N   1 
ATOM   10649 C CA  . LYS D 1 290 ? 25.308  108.049 9.497   1.00   62.74 ? 290  LYS D CA  1 
ATOM   10650 C C   . LYS D 1 290 ? 26.719  108.453 9.919   1.00   62.73 ? 290  LYS D C   1 
ATOM   10651 O O   . LYS D 1 290 ? 27.243  107.944 10.912  1.00   62.34 ? 290  LYS D O   1 
ATOM   10652 C CB  . LYS D 1 290 ? 25.380  107.421 8.100   1.00   66.02 ? 290  LYS D CB  1 
ATOM   10653 C CG  . LYS D 1 290 ? 24.030  107.277 7.414   1.00   72.60 ? 290  LYS D CG  1 
ATOM   10654 C CD  . LYS D 1 290 ? 23.503  108.631 6.929   1.00   75.31 ? 290  LYS D CD  1 
ATOM   10655 C CE  . LYS D 1 290 ? 21.993  108.620 6.784   1.00   75.90 ? 290  LYS D CE  1 
ATOM   10656 N NZ  . LYS D 1 290 ? 21.340  108.364 8.099   1.00   77.99 ? 290  LYS D NZ  1 
ATOM   10657 N N   . GLU D 1 291 ? 27.339  109.355 9.165   1.00   62.63 ? 291  GLU D N   1 
ATOM   10658 C CA  . GLU D 1 291 ? 28.700  109.764 9.484   1.00   63.74 ? 291  GLU D CA  1 
ATOM   10659 C C   . GLU D 1 291 ? 28.898  110.528 10.784  1.00   62.79 ? 291  GLU D C   1 
ATOM   10660 O O   . GLU D 1 291 ? 29.755  110.166 11.592  1.00   61.74 ? 291  GLU D O   1 
ATOM   10661 C CB  . GLU D 1 291 ? 29.298  110.558 8.331   1.00   66.64 ? 291  GLU D CB  1 
ATOM   10662 C CG  . GLU D 1 291 ? 30.175  109.709 7.413   1.00   74.08 ? 291  GLU D CG  1 
ATOM   10663 C CD  . GLU D 1 291 ? 31.269  108.939 8.167   1.00   78.52 ? 291  GLU D CD  1 
ATOM   10664 O OE1 . GLU D 1 291 ? 31.944  109.551 9.029   1.00   79.27 ? 291  GLU D OE1 1 
ATOM   10665 O OE2 . GLU D 1 291 ? 31.456  107.727 7.885   1.00   77.53 ? 291  GLU D OE2 1 
ATOM   10666 N N   . GLU D 1 292 ? 28.131  111.587 11.004  1.00   62.12 ? 292  GLU D N   1 
ATOM   10667 C CA  . GLU D 1 292 ? 28.314  112.323 12.244  1.00   61.96 ? 292  GLU D CA  1 
ATOM   10668 C C   . GLU D 1 292 ? 27.911  111.452 13.435  1.00   61.25 ? 292  GLU D C   1 
ATOM   10669 O O   . GLU D 1 292 ? 28.271  111.754 14.574  1.00   60.51 ? 292  GLU D O   1 
ATOM   10670 C CB  . GLU D 1 292 ? 27.501  113.622 12.250  1.00   62.97 ? 292  GLU D CB  1 
ATOM   10671 C CG  . GLU D 1 292 ? 26.054  113.466 12.674  1.00   66.50 ? 292  GLU D CG  1 
ATOM   10672 C CD  . GLU D 1 292 ? 25.503  114.713 13.359  1.00   66.88 ? 292  GLU D CD  1 
ATOM   10673 O OE1 . GLU D 1 292 ? 26.159  115.227 14.291  1.00   67.63 ? 292  GLU D OE1 1 
ATOM   10674 O OE2 . GLU D 1 292 ? 24.408  115.170 12.976  1.00   68.38 ? 292  GLU D OE2 1 
ATOM   10675 N N   . LYS D 1 293 ? 27.174  110.367 13.165  1.00   59.95 ? 293  LYS D N   1 
ATOM   10676 C CA  . LYS D 1 293 ? 26.703  109.455 14.217  1.00   56.80 ? 293  LYS D CA  1 
ATOM   10677 C C   . LYS D 1 293 ? 27.825  108.564 14.731  1.00   56.05 ? 293  LYS D C   1 
ATOM   10678 O O   . LYS D 1 293 ? 28.047  108.453 15.938  1.00   55.27 ? 293  LYS D O   1 
ATOM   10679 C CB  . LYS D 1 293 ? 25.571  108.562 13.704  1.00   57.16 ? 293  LYS D CB  1 
ATOM   10680 C CG  . LYS D 1 293 ? 24.806  107.835 14.810  1.00   54.70 ? 293  LYS D CG  1 
ATOM   10681 C CD  . LYS D 1 293 ? 24.113  106.588 14.285  1.00   55.87 ? 293  LYS D CD  1 
ATOM   10682 C CE  . LYS D 1 293 ? 25.119  105.472 14.010  1.00   56.26 ? 293  LYS D CE  1 
ATOM   10683 N NZ  . LYS D 1 293 ? 24.508  104.309 13.307  1.00   48.76 ? 293  LYS D NZ  1 
ATOM   10684 N N   . GLU D 1 294 ? 28.526  107.915 13.813  1.00   54.80 ? 294  GLU D N   1 
ATOM   10685 C CA  . GLU D 1 294 ? 29.620  107.051 14.209  1.00   54.37 ? 294  GLU D CA  1 
ATOM   10686 C C   . GLU D 1 294 ? 30.798  107.865 14.708  1.00   53.50 ? 294  GLU D C   1 
ATOM   10687 O O   . GLU D 1 294 ? 31.629  107.369 15.474  1.00   51.89 ? 294  GLU D O   1 
ATOM   10688 C CB  . GLU D 1 294 ? 30.043  106.172 13.045  1.00   55.36 ? 294  GLU D CB  1 
ATOM   10689 C CG  . GLU D 1 294 ? 29.123  105.006 12.834  1.00   56.20 ? 294  GLU D CG  1 
ATOM   10690 C CD  . GLU D 1 294 ? 28.700  104.892 11.404  1.00   60.88 ? 294  GLU D CD  1 
ATOM   10691 O OE1 . GLU D 1 294 ? 27.970  103.927 11.077  1.00   63.31 ? 294  GLU D OE1 1 
ATOM   10692 O OE2 . GLU D 1 294 ? 29.097  105.772 10.609  1.00   63.16 ? 294  GLU D OE2 1 
ATOM   10693 N N   . ARG D 1 295 ? 30.871  109.116 14.265  1.00   52.32 ? 295  ARG D N   1 
ATOM   10694 C CA  . ARG D 1 295 ? 31.938  109.994 14.701  1.00   51.25 ? 295  ARG D CA  1 
ATOM   10695 C C   . ARG D 1 295 ? 31.813  110.103 16.222  1.00   49.59 ? 295  ARG D C   1 
ATOM   10696 O O   . ARG D 1 295 ? 32.806  110.115 16.939  1.00   49.26 ? 295  ARG D O   1 
ATOM   10697 C CB  . ARG D 1 295 ? 31.783  111.375 14.056  1.00   51.43 ? 295  ARG D CB  1 
ATOM   10698 C CG  . ARG D 1 295 ? 33.103  112.078 13.796  1.00   53.99 ? 295  ARG D CG  1 
ATOM   10699 C CD  . ARG D 1 295 ? 33.041  113.533 14.228  1.00   57.01 ? 295  ARG D CD  1 
ATOM   10700 N NE  . ARG D 1 295 ? 31.920  114.235 13.622  1.00   56.04 ? 295  ARG D NE  1 
ATOM   10701 C CZ  . ARG D 1 295 ? 31.377  115.338 14.129  1.00   60.86 ? 295  ARG D CZ  1 
ATOM   10702 N NH1 . ARG D 1 295 ? 31.855  115.866 15.255  1.00   61.24 ? 295  ARG D NH1 1 
ATOM   10703 N NH2 . ARG D 1 295 ? 30.348  115.912 13.517  1.00   61.89 ? 295  ARG D NH2 1 
ATOM   10704 N N   . LEU D 1 296 ? 30.572  110.160 16.699  1.00   48.34 ? 296  LEU D N   1 
ATOM   10705 C CA  . LEU D 1 296 ? 30.273  110.262 18.124  1.00   46.53 ? 296  LEU D CA  1 
ATOM   10706 C C   . LEU D 1 296 ? 30.565  108.951 18.856  1.00   46.65 ? 296  LEU D C   1 
ATOM   10707 O O   . LEU D 1 296 ? 31.045  108.956 19.989  1.00   47.55 ? 296  LEU D O   1 
ATOM   10708 C CB  . LEU D 1 296 ? 28.805  110.664 18.303  1.00   45.09 ? 296  LEU D CB  1 
ATOM   10709 C CG  . LEU D 1 296 ? 28.171  110.758 19.691  1.00   44.07 ? 296  LEU D CG  1 
ATOM   10710 C CD1 . LEU D 1 296 ? 27.713  109.394 20.115  1.00   46.60 ? 296  LEU D CD1 1 
ATOM   10711 C CD2 . LEU D 1 296 ? 29.156  111.365 20.683  1.00   45.24 ? 296  LEU D CD2 1 
ATOM   10712 N N   . LEU D 1 297 ? 30.269  107.830 18.212  1.00   44.77 ? 297  LEU D N   1 
ATOM   10713 C CA  . LEU D 1 297 ? 30.535  106.540 18.827  1.00   48.41 ? 297  LEU D CA  1 
ATOM   10714 C C   . LEU D 1 297 ? 32.039  106.395 19.096  1.00   50.39 ? 297  LEU D C   1 
ATOM   10715 O O   . LEU D 1 297 ? 32.462  106.063 20.209  1.00   50.98 ? 297  LEU D O   1 
ATOM   10716 C CB  . LEU D 1 297 ? 30.043  105.395 17.917  1.00   45.25 ? 297  LEU D CB  1 
ATOM   10717 C CG  . LEU D 1 297 ? 28.569  105.002 18.041  1.00   43.42 ? 297  LEU D CG  1 
ATOM   10718 C CD1 . LEU D 1 297 ? 27.688  106.198 17.807  1.00   46.66 ? 297  LEU D CD1 1 
ATOM   10719 C CD2 . LEU D 1 297 ? 28.256  103.902 17.058  1.00   45.12 ? 297  LEU D CD2 1 
ATOM   10720 N N   . GLU D 1 298 ? 32.846  106.653 18.076  1.00   51.47 ? 298  GLU D N   1 
ATOM   10721 C CA  . GLU D 1 298 ? 34.285  106.555 18.230  1.00   52.98 ? 298  GLU D CA  1 
ATOM   10722 C C   . GLU D 1 298 ? 34.746  107.471 19.359  1.00   52.72 ? 298  GLU D C   1 
ATOM   10723 O O   . GLU D 1 298 ? 35.672  107.134 20.092  1.00   51.81 ? 298  GLU D O   1 
ATOM   10724 C CB  . GLU D 1 298 ? 34.983  106.947 16.929  1.00   55.98 ? 298  GLU D CB  1 
ATOM   10725 C CG  . GLU D 1 298 ? 35.819  105.830 16.328  1.00   56.50 ? 298  GLU D CG  1 
ATOM   10726 C CD  . GLU D 1 298 ? 36.889  105.352 17.274  1.00   56.49 ? 298  GLU D CD  1 
ATOM   10727 O OE1 . GLU D 1 298 ? 37.688  106.196 17.710  1.00   58.41 ? 298  GLU D OE1 1 
ATOM   10728 O OE2 . GLU D 1 298 ? 36.934  104.140 17.584  1.00   58.90 ? 298  GLU D OE2 1 
ATOM   10729 N N   . HIS D 1 299 ? 34.099  108.627 19.490  1.00   51.87 ? 299  HIS D N   1 
ATOM   10730 C CA  . HIS D 1 299 ? 34.448  109.572 20.541  1.00   53.38 ? 299  HIS D CA  1 
ATOM   10731 C C   . HIS D 1 299 ? 34.013  109.048 21.905  1.00   55.28 ? 299  HIS D C   1 
ATOM   10732 O O   . HIS D 1 299 ? 34.787  109.091 22.867  1.00   55.13 ? 299  HIS D O   1 
ATOM   10733 C CB  . HIS D 1 299 ? 33.795  110.930 20.294  1.00   52.91 ? 299  HIS D CB  1 
ATOM   10734 C CG  . HIS D 1 299 ? 34.007  111.909 21.407  1.00   55.70 ? 299  HIS D CG  1 
ATOM   10735 N ND1 . HIS D 1 299 ? 35.207  112.026 22.077  1.00   56.64 ? 299  HIS D ND1 1 
ATOM   10736 C CD2 . HIS D 1 299 ? 33.173  112.816 21.970  1.00   58.18 ? 299  HIS D CD2 1 
ATOM   10737 C CE1 . HIS D 1 299 ? 35.102  112.959 23.007  1.00   57.27 ? 299  HIS D CE1 1 
ATOM   10738 N NE2 . HIS D 1 299 ? 33.877  113.455 22.965  1.00   59.39 ? 299  HIS D NE2 1 
ATOM   10739 N N   . LEU D 1 300 ? 32.772  108.566 21.993  1.00   55.41 ? 300  LEU D N   1 
ATOM   10740 C CA  . LEU D 1 300 ? 32.259  108.034 23.251  1.00   55.40 ? 300  LEU D CA  1 
ATOM   10741 C C   . LEU D 1 300 ? 33.070  106.820 23.650  1.00   56.29 ? 300  LEU D C   1 
ATOM   10742 O O   . LEU D 1 300 ? 33.286  106.564 24.834  1.00   56.45 ? 300  LEU D O   1 
ATOM   10743 C CB  . LEU D 1 300 ? 30.801  107.624 23.113  1.00   52.77 ? 300  LEU D CB  1 
ATOM   10744 C CG  . LEU D 1 300 ? 29.810  108.753 22.888  1.00   53.17 ? 300  LEU D CG  1 
ATOM   10745 C CD1 . LEU D 1 300 ? 28.395  108.209 23.029  1.00   50.18 ? 300  LEU D CD1 1 
ATOM   10746 C CD2 . LEU D 1 300 ? 30.074  109.854 23.904  1.00   50.67 ? 300  LEU D CD2 1 
ATOM   10747 N N   . ARG D 1 301 ? 33.511  106.080 22.640  1.00   56.78 ? 301  ARG D N   1 
ATOM   10748 C CA  . ARG D 1 301 ? 34.292  104.873 22.841  1.00   59.59 ? 301  ARG D CA  1 
ATOM   10749 C C   . ARG D 1 301 ? 35.605  105.196 23.546  1.00   61.55 ? 301  ARG D C   1 
ATOM   10750 O O   . ARG D 1 301 ? 36.086  104.422 24.383  1.00   60.69 ? 301  ARG D O   1 
ATOM   10751 C CB  . ARG D 1 301 ? 34.547  104.220 21.487  1.00   60.22 ? 301  ARG D CB  1 
ATOM   10752 C CG  . ARG D 1 301 ? 35.363  102.959 21.535  1.00   64.04 ? 301  ARG D CG  1 
ATOM   10753 C CD  . ARG D 1 301 ? 35.316  102.284 20.186  1.00   68.37 ? 301  ARG D CD  1 
ATOM   10754 N NE  . ARG D 1 301 ? 33.984  101.750 19.898  1.00   71.59 ? 301  ARG D NE  1 
ATOM   10755 C CZ  . ARG D 1 301 ? 33.394  101.810 18.705  1.00   72.03 ? 301  ARG D CZ  1 
ATOM   10756 N NH1 . ARG D 1 301 ? 34.008  102.386 17.677  1.00   71.23 ? 301  ARG D NH1 1 
ATOM   10757 N NH2 . ARG D 1 301 ? 32.188  101.288 18.535  1.00   70.41 ? 301  ARG D NH2 1 
ATOM   10758 N N   . THR D 1 302 ? 36.177  106.347 23.204  1.00   62.75 ? 302  THR D N   1 
ATOM   10759 C CA  . THR D 1 302 ? 37.427  106.807 23.801  1.00   63.53 ? 302  THR D CA  1 
ATOM   10760 C C   . THR D 1 302 ? 37.247  106.972 25.303  1.00   62.67 ? 302  THR D C   1 
ATOM   10761 O O   . THR D 1 302 ? 38.095  106.549 26.090  1.00   63.13 ? 302  THR D O   1 
ATOM   10762 C CB  . THR D 1 302 ? 37.851  108.168 23.218  1.00   65.52 ? 302  THR D CB  1 
ATOM   10763 O OG1 . THR D 1 302 ? 38.336  107.983 21.884  1.00   65.85 ? 302  THR D OG1 1 
ATOM   10764 C CG2 . THR D 1 302 ? 38.928  108.819 24.081  1.00   65.30 ? 302  THR D CG2 1 
ATOM   10765 N N   . LYS D 1 303 ? 36.136  107.604 25.679  1.00   60.90 ? 303  LYS D N   1 
ATOM   10766 C CA  . LYS D 1 303 ? 35.798  107.846 27.076  1.00   58.47 ? 303  LYS D CA  1 
ATOM   10767 C C   . LYS D 1 303 ? 35.158  106.604 27.690  1.00   56.39 ? 303  LYS D C   1 
ATOM   10768 O O   . LYS D 1 303 ? 34.349  106.708 28.612  1.00   55.54 ? 303  LYS D O   1 
ATOM   10769 C CB  . LYS D 1 303 ? 34.825  109.022 27.191  1.00   58.97 ? 303  LYS D CB  1 
ATOM   10770 C CG  . LYS D 1 303 ? 35.334  110.356 26.645  1.00   59.87 ? 303  LYS D CG  1 
ATOM   10771 C CD  . LYS D 1 303 ? 36.595  110.825 27.359  1.00   59.59 ? 303  LYS D CD  1 
ATOM   10772 C CE  . LYS D 1 303 ? 36.763  112.330 27.251  1.00   60.10 ? 303  LYS D CE  1 
ATOM   10773 N NZ  . LYS D 1 303 ? 36.692  112.825 25.852  1.00   61.46 ? 303  LYS D NZ  1 
ATOM   10774 N N   . ASN D 1 304 ? 35.517  105.438 27.158  1.00   54.13 ? 304  ASN D N   1 
ATOM   10775 C CA  . ASN D 1 304 ? 35.004  104.158 27.644  1.00   51.94 ? 304  ASN D CA  1 
ATOM   10776 C C   . ASN D 1 304 ? 33.525  104.176 28.031  1.00   49.26 ? 304  ASN D C   1 
ATOM   10777 O O   . ASN D 1 304 ? 33.156  103.810 29.146  1.00   48.63 ? 304  ASN D O   1 
ATOM   10778 C CB  . ASN D 1 304 ? 35.847  103.675 28.830  1.00   51.19 ? 304  ASN D CB  1 
ATOM   10779 C CG  . ASN D 1 304 ? 37.238  103.234 28.414  1.00   51.76 ? 304  ASN D CG  1 
ATOM   10780 O OD1 . ASN D 1 304 ? 38.119  104.052 28.189  1.00   53.94 ? 304  ASN D OD1 1 
ATOM   10781 N ND2 . ASN D 1 304 ? 37.432  101.931 28.291  1.00   51.76 ? 304  ASN D ND2 1 
ATOM   10782 N N   . VAL D 1 305 ? 32.682  104.600 27.099  1.00   46.59 ? 305  VAL D N   1 
ATOM   10783 C CA  . VAL D 1 305 ? 31.247  104.666 27.325  1.00   45.06 ? 305  VAL D CA  1 
ATOM   10784 C C   . VAL D 1 305 ? 30.582  103.800 26.264  1.00   44.83 ? 305  VAL D C   1 
ATOM   10785 O O   . VAL D 1 305 ? 31.132  103.611 25.175  1.00   44.66 ? 305  VAL D O   1 
ATOM   10786 C CB  . VAL D 1 305 ? 30.747  106.102 27.172  1.00   45.52 ? 305  VAL D CB  1 
ATOM   10787 C CG1 . VAL D 1 305 ? 29.248  106.169 27.403  1.00   45.42 ? 305  VAL D CG1 1 
ATOM   10788 C CG2 . VAL D 1 305 ? 31.501  107.016 28.132  1.00   46.54 ? 305  VAL D CG2 1 
ATOM   10789 N N   . ALA D 1 306 ? 29.407  103.262 26.562  1.00   41.55 ? 306  ALA D N   1 
ATOM   10790 C CA  . ALA D 1 306 ? 28.737  102.436 25.565  1.00   40.07 ? 306  ALA D CA  1 
ATOM   10791 C C   . ALA D 1 306 ? 27.265  102.778 25.399  1.00   37.57 ? 306  ALA D C   1 
ATOM   10792 O O   . ALA D 1 306 ? 26.479  102.645 26.334  1.00   39.18 ? 306  ALA D O   1 
ATOM   10793 C CB  . ALA D 1 306 ? 28.897  100.948 25.910  1.00   40.43 ? 306  ALA D CB  1 
ATOM   10794 N N   . VAL D 1 307 ? 26.901  103.222 24.199  1.00   35.55 ? 307  VAL D N   1 
ATOM   10795 C CA  . VAL D 1 307 ? 25.514  103.568 23.874  1.00   32.79 ? 307  VAL D CA  1 
ATOM   10796 C C   . VAL D 1 307 ? 25.045  102.584 22.807  1.00   33.01 ? 307  VAL D C   1 
ATOM   10797 O O   . VAL D 1 307 ? 25.853  101.820 22.274  1.00   33.28 ? 307  VAL D O   1 
ATOM   10798 C CB  . VAL D 1 307 ? 25.397  105.012 23.337  1.00   30.47 ? 307  VAL D CB  1 
ATOM   10799 C CG1 . VAL D 1 307 ? 25.695  106.015 24.449  1.00   24.58 ? 307  VAL D CG1 1 
ATOM   10800 C CG2 . VAL D 1 307 ? 26.368  105.213 22.173  1.00   29.70 ? 307  VAL D CG2 1 
ATOM   10801 N N   . ARG D 1 308 ? 23.754  102.588 22.497  1.00   32.64 ? 308  ARG D N   1 
ATOM   10802 C CA  . ARG D 1 308 ? 23.224  101.662 21.500  1.00   31.47 ? 308  ARG D CA  1 
ATOM   10803 C C   . ARG D 1 308 ? 23.074  102.340 20.155  1.00   32.73 ? 308  ARG D C   1 
ATOM   10804 O O   . ARG D 1 308 ? 22.391  103.363 20.031  1.00   34.18 ? 308  ARG D O   1 
ATOM   10805 C CB  . ARG D 1 308 ? 21.870  101.104 21.963  1.00   33.13 ? 308  ARG D CB  1 
ATOM   10806 C CG  . ARG D 1 308 ? 21.238  100.041 21.053  1.00   32.31 ? 308  ARG D CG  1 
ATOM   10807 C CD  . ARG D 1 308 ? 22.166  98.857  20.773  1.00   33.77 ? 308  ARG D CD  1 
ATOM   10808 N NE  . ARG D 1 308 ? 22.608  98.180  21.986  1.00   35.84 ? 308  ARG D NE  1 
ATOM   10809 C CZ  . ARG D 1 308 ? 23.379  97.096  21.994  1.00   40.86 ? 308  ARG D CZ  1 
ATOM   10810 N NH1 . ARG D 1 308 ? 23.798  96.574  20.846  1.00   39.61 ? 308  ARG D NH1 1 
ATOM   10811 N NH2 . ARG D 1 308 ? 23.731  96.523  23.144  1.00   40.86 ? 308  ARG D NH2 1 
ATOM   10812 N N   . SER D 1 309 ? 23.711  101.766 19.145  1.00   31.38 ? 309  SER D N   1 
ATOM   10813 C CA  . SER D 1 309 ? 23.649  102.330 17.798  1.00   34.01 ? 309  SER D CA  1 
ATOM   10814 C C   . SER D 1 309 ? 22.459  101.836 16.974  1.00   33.10 ? 309  SER D C   1 
ATOM   10815 O O   . SER D 1 309 ? 22.132  100.650 16.952  1.00   30.11 ? 309  SER D O   1 
ATOM   10816 C CB  . SER D 1 309 ? 24.947  102.018 17.033  1.00   37.26 ? 309  SER D CB  1 
ATOM   10817 O OG  . SER D 1 309 ? 24.914  102.519 15.709  1.00   38.34 ? 309  SER D OG  1 
ATOM   10818 N N   . PHE D 1 310 ? 21.813  102.761 16.285  1.00   35.04 ? 310  PHE D N   1 
ATOM   10819 C CA  . PHE D 1 310 ? 20.682  102.410 15.444  1.00   38.01 ? 310  PHE D CA  1 
ATOM   10820 C C   . PHE D 1 310 ? 20.814  103.073 14.084  1.00   41.34 ? 310  PHE D C   1 
ATOM   10821 O O   . PHE D 1 310 ? 21.563  104.038 13.915  1.00   42.09 ? 310  PHE D O   1 
ATOM   10822 C CB  . PHE D 1 310 ? 19.369  102.812 16.114  1.00   37.32 ? 310  PHE D CB  1 
ATOM   10823 C CG  . PHE D 1 310 ? 18.920  101.845 17.160  1.00   38.14 ? 310  PHE D CG  1 
ATOM   10824 C CD1 . PHE D 1 310 ? 18.367  100.617 16.794  1.00   38.24 ? 310  PHE D CD1 1 
ATOM   10825 C CD2 . PHE D 1 310 ? 19.133  102.108 18.507  1.00   35.79 ? 310  PHE D CD2 1 
ATOM   10826 C CE1 . PHE D 1 310 ? 18.041  99.659  17.755  1.00   34.16 ? 310  PHE D CE1 1 
ATOM   10827 C CE2 . PHE D 1 310 ? 18.810  101.153 19.476  1.00   38.77 ? 310  PHE D CE2 1 
ATOM   10828 C CZ  . PHE D 1 310 ? 18.266  99.927  19.098  1.00   38.86 ? 310  PHE D CZ  1 
ATOM   10829 N N   . ARG D 1 311 ? 20.078  102.548 13.114  1.00   43.05 ? 311  ARG D N   1 
ATOM   10830 C CA  . ARG D 1 311 ? 20.119  103.068 11.764  1.00   43.25 ? 311  ARG D CA  1 
ATOM   10831 C C   . ARG D 1 311 ? 19.898  104.576 11.733  1.00   41.71 ? 311  ARG D C   1 
ATOM   10832 O O   . ARG D 1 311 ? 20.559  105.288 10.977  1.00   42.13 ? 311  ARG D O   1 
ATOM   10833 C CB  . ARG D 1 311 ? 19.054  102.372 10.928  1.00   46.34 ? 311  ARG D CB  1 
ATOM   10834 C CG  . ARG D 1 311 ? 19.331  102.367 9.446   1.00   50.49 ? 311  ARG D CG  1 
ATOM   10835 C CD  . ARG D 1 311 ? 18.178  101.718 8.690   1.00   52.28 ? 311  ARG D CD  1 
ATOM   10836 N NE  . ARG D 1 311 ? 18.528  101.396 7.311   1.00   53.50 ? 311  ARG D NE  1 
ATOM   10837 C CZ  . ARG D 1 311 ? 18.984  102.274 6.423   1.00   53.98 ? 311  ARG D CZ  1 
ATOM   10838 N NH1 . ARG D 1 311 ? 19.270  101.876 5.195   1.00   56.14 ? 311  ARG D NH1 1 
ATOM   10839 N NH2 . ARG D 1 311 ? 19.158  103.546 6.759   1.00   51.44 ? 311  ARG D NH2 1 
ATOM   10840 N N   . GLU D 1 312 ? 18.993  105.053 12.582  1.00   40.48 ? 312  GLU D N   1 
ATOM   10841 C CA  . GLU D 1 312 ? 18.619  106.473 12.640  1.00   39.09 ? 312  GLU D CA  1 
ATOM   10842 C C   . GLU D 1 312 ? 19.316  107.357 13.683  1.00   37.84 ? 312  GLU D C   1 
ATOM   10843 O O   . GLU D 1 312 ? 19.105  108.573 13.690  1.00   40.09 ? 312  GLU D O   1 
ATOM   10844 C CB  . GLU D 1 312 ? 17.103  106.608 12.862  1.00   36.68 ? 312  GLU D CB  1 
ATOM   10845 C CG  . GLU D 1 312 ? 16.243  105.810 11.911  1.00   40.71 ? 312  GLU D CG  1 
ATOM   10846 C CD  . GLU D 1 312 ? 16.222  104.317 12.230  1.00   45.49 ? 312  GLU D CD  1 
ATOM   10847 O OE1 . GLU D 1 312 ? 15.872  103.521 11.328  1.00   47.34 ? 312  GLU D OE1 1 
ATOM   10848 O OE2 . GLU D 1 312 ? 16.545  103.938 13.378  1.00   46.24 ? 312  GLU D OE2 1 
ATOM   10849 N N   . GLY D 1