data_1UV5
# 
_entry.id   1UV5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1UV5         
PDBE  EBI-14384    
WWPDB D_1290014384 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1GNG unspecified 'GLYCOGEN SYNTHASE 3BETA (GSK3) COMPLEX WITH FRATTIDE PEPTIDE' 
PDB 1H8F unspecified 'GLYCOGEN SYNTHASE KINASE 3 BETA.' 
PDB 1I09 unspecified 'STRUCTURE OF GLYCOGEN SYNTHASE KINASE-3 ( GSK3B)' 
PDB 1J1B unspecified 'BINARY COMPLEX STRUCTURE OF HUMAN TAU PROTEIN KINASE I WITHAMPPNP' 
PDB 1J1C unspecified 'BINARY COMPLEX STRUCTURE OF HUMAN TAU PROTEIN KINASE I WITHADP' 
PDB 1O6K unspecified 'STRUCTURE OF ACTIVATED FORM OF PKB KINASE DOMAIN S474D WITH GSK3 PEPTIDE AND AMP-PNP' 
PDB 1O6L unspecified 
'CRYSTAL STRUCTURE OF AN ACTIVATED AKT/ PROTEIN KINASE B (PKB-PIF CHIMERA) TERNARY COMPLEX WITH AMP-PNP AND GSK3 PEPTIDE' 
PDB 1O9U unspecified 'GLYCOGEN SYNTHASE KINASE 3 BETA COMPLEXED WITH AXIN PEPTIDE' 
PDB 1PYX unspecified 'GSK-3 BETA COMPLEXED WITH AMP-PNP' 
PDB 1Q3D unspecified 'GSK-3 BETA COMPLEXED WITH STAUROSPORINE' 
PDB 1Q3W unspecified 'GSK-3 BETA COMPLEXED WITH ALSTERPAULLONE' 
PDB 1Q41 unspecified 
;GSK-3 BETA COMPLEXED WITH INDIRUBIN-3'- MONOXIME
;
PDB 1Q4L unspecified 'GSK-3 BETA COMPLEXED WITH INHIBITOR I-5' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1UV5 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2004-01-14 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dajani, R.'  1 
'Pearl, L.H.' 2 
'Roe, S.M.'   3 
# 
_citation.id                        primary 
_citation.title                     'Gsk-3-Selective Inhibitors Derived from Tyrian Purple Indurubins' 
_citation.journal_abbrev            Chem.Biol. 
_citation.journal_volume            10 
_citation.page_first                1255 
_citation.page_last                 ? 
_citation.year                      2003 
_citation.journal_id_ASTM           CBOLE2 
_citation.country                   UK 
_citation.journal_id_ISSN           1074-5521 
_citation.journal_id_CSD            2050 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14700633 
_citation.pdbx_database_id_DOI      10.1016/J.CHEMBIOL.2003.11.010 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Meijer, L.'            1  
primary 'Skaltsounis, A.-L.'    2  
primary 'Magiatis, P.'          3  
primary 'Polychronopoulous, P.' 4  
primary 'Knockaert, M.'         5  
primary 'Leost, M.'             6  
primary 'Ryan, X.P.'            7  
primary 'Vonica, C.A.'          8  
primary 'Brivanlou, A.'         9  
primary 'Dajani, R.'            10 
primary 'Crovace, C.'           11 
primary 'Tarricone, C.'         12 
primary 'Musacchio, A.'         13 
primary 'Roe, S.M.'             14 
primary 'Pearl, L.H.'           15 
primary 'Greengard, P.'         16 
# 
_cell.entry_id           1UV5 
_cell.length_a           98.333 
_cell.length_b           98.333 
_cell.length_c           198.017 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1UV5 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GLYCOGEN SYNTHASE KINASE-3 BETA' 39658.641 1   2.7.1.37 ? ? ? 
2 non-polymer syn "6-BROMOINDIRUBIN-3'-OXIME"       356.174   1   ?        ? ? ? 
3 non-polymer syn 'PHOSPHATE ION'                   94.971    2   ?        ? ? ? 
4 non-polymer syn 'CHLORIDE ION'                    35.453    1   ?        ? ? ? 
5 non-polymer syn 'COBALT (II) ION'                 58.933    1   ?        ? ? ? 
6 water       nat water                             18.015    112 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GSK-3 BETA' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQGKAFKNRELQIMRKLDHCNIVRLRY
FFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTA
VLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLG
TPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGR
DTPALFNFTTQELSSNPPLATILIPPHARI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQGKAFKNRELQIMRKLDHCNIVRLRY
FFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTA
VLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLG
TPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGR
DTPALFNFTTQELSSNPPLATILIPPHARI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   LYS n 
1 3   VAL n 
1 4   THR n 
1 5   THR n 
1 6   VAL n 
1 7   VAL n 
1 8   ALA n 
1 9   THR n 
1 10  PRO n 
1 11  GLY n 
1 12  GLN n 
1 13  GLY n 
1 14  PRO n 
1 15  ASP n 
1 16  ARG n 
1 17  PRO n 
1 18  GLN n 
1 19  GLU n 
1 20  VAL n 
1 21  SER n 
1 22  TYR n 
1 23  THR n 
1 24  ASP n 
1 25  THR n 
1 26  LYS n 
1 27  VAL n 
1 28  ILE n 
1 29  GLY n 
1 30  ASN n 
1 31  GLY n 
1 32  SER n 
1 33  PHE n 
1 34  GLY n 
1 35  VAL n 
1 36  VAL n 
1 37  TYR n 
1 38  GLN n 
1 39  ALA n 
1 40  LYS n 
1 41  LEU n 
1 42  CYS n 
1 43  ASP n 
1 44  SER n 
1 45  GLY n 
1 46  GLU n 
1 47  LEU n 
1 48  VAL n 
1 49  ALA n 
1 50  ILE n 
1 51  LYS n 
1 52  LYS n 
1 53  VAL n 
1 54  LEU n 
1 55  GLN n 
1 56  GLY n 
1 57  LYS n 
1 58  ALA n 
1 59  PHE n 
1 60  LYS n 
1 61  ASN n 
1 62  ARG n 
1 63  GLU n 
1 64  LEU n 
1 65  GLN n 
1 66  ILE n 
1 67  MET n 
1 68  ARG n 
1 69  LYS n 
1 70  LEU n 
1 71  ASP n 
1 72  HIS n 
1 73  CYS n 
1 74  ASN n 
1 75  ILE n 
1 76  VAL n 
1 77  ARG n 
1 78  LEU n 
1 79  ARG n 
1 80  TYR n 
1 81  PHE n 
1 82  PHE n 
1 83  TYR n 
1 84  SER n 
1 85  SER n 
1 86  GLY n 
1 87  GLU n 
1 88  LYS n 
1 89  LYS n 
1 90  ASP n 
1 91  GLU n 
1 92  VAL n 
1 93  TYR n 
1 94  LEU n 
1 95  ASN n 
1 96  LEU n 
1 97  VAL n 
1 98  LEU n 
1 99  ASP n 
1 100 TYR n 
1 101 VAL n 
1 102 PRO n 
1 103 GLU n 
1 104 THR n 
1 105 VAL n 
1 106 TYR n 
1 107 ARG n 
1 108 VAL n 
1 109 ALA n 
1 110 ARG n 
1 111 HIS n 
1 112 TYR n 
1 113 SER n 
1 114 ARG n 
1 115 ALA n 
1 116 LYS n 
1 117 GLN n 
1 118 THR n 
1 119 LEU n 
1 120 PRO n 
1 121 VAL n 
1 122 ILE n 
1 123 TYR n 
1 124 VAL n 
1 125 LYS n 
1 126 LEU n 
1 127 TYR n 
1 128 MET n 
1 129 TYR n 
1 130 GLN n 
1 131 LEU n 
1 132 PHE n 
1 133 ARG n 
1 134 SER n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 ILE n 
1 139 HIS n 
1 140 SER n 
1 141 PHE n 
1 142 GLY n 
1 143 ILE n 
1 144 CYS n 
1 145 HIS n 
1 146 ARG n 
1 147 ASP n 
1 148 ILE n 
1 149 LYS n 
1 150 PRO n 
1 151 GLN n 
1 152 ASN n 
1 153 LEU n 
1 154 LEU n 
1 155 LEU n 
1 156 ASP n 
1 157 PRO n 
1 158 ASP n 
1 159 THR n 
1 160 ALA n 
1 161 VAL n 
1 162 LEU n 
1 163 LYS n 
1 164 LEU n 
1 165 CYS n 
1 166 ASP n 
1 167 PHE n 
1 168 GLY n 
1 169 SER n 
1 170 ALA n 
1 171 LYS n 
1 172 GLN n 
1 173 LEU n 
1 174 VAL n 
1 175 ARG n 
1 176 GLY n 
1 177 GLU n 
1 178 PRO n 
1 179 ASN n 
1 180 VAL n 
1 181 SER n 
1 182 TYR n 
1 183 ILE n 
1 184 CYS n 
1 185 SER n 
1 186 ARG n 
1 187 TYR n 
1 188 TYR n 
1 189 ARG n 
1 190 ALA n 
1 191 PRO n 
1 192 GLU n 
1 193 LEU n 
1 194 ILE n 
1 195 PHE n 
1 196 GLY n 
1 197 ALA n 
1 198 THR n 
1 199 ASP n 
1 200 TYR n 
1 201 THR n 
1 202 SER n 
1 203 SER n 
1 204 ILE n 
1 205 ASP n 
1 206 VAL n 
1 207 TRP n 
1 208 SER n 
1 209 ALA n 
1 210 GLY n 
1 211 CYS n 
1 212 VAL n 
1 213 LEU n 
1 214 ALA n 
1 215 GLU n 
1 216 LEU n 
1 217 LEU n 
1 218 LEU n 
1 219 GLY n 
1 220 GLN n 
1 221 PRO n 
1 222 ILE n 
1 223 PHE n 
1 224 PRO n 
1 225 GLY n 
1 226 ASP n 
1 227 SER n 
1 228 GLY n 
1 229 VAL n 
1 230 ASP n 
1 231 GLN n 
1 232 LEU n 
1 233 VAL n 
1 234 GLU n 
1 235 ILE n 
1 236 ILE n 
1 237 LYS n 
1 238 VAL n 
1 239 LEU n 
1 240 GLY n 
1 241 THR n 
1 242 PRO n 
1 243 THR n 
1 244 ARG n 
1 245 GLU n 
1 246 GLN n 
1 247 ILE n 
1 248 ARG n 
1 249 GLU n 
1 250 MET n 
1 251 ASN n 
1 252 PRO n 
1 253 ASN n 
1 254 TYR n 
1 255 THR n 
1 256 GLU n 
1 257 PHE n 
1 258 LYS n 
1 259 PHE n 
1 260 PRO n 
1 261 GLN n 
1 262 ILE n 
1 263 LYS n 
1 264 ALA n 
1 265 HIS n 
1 266 PRO n 
1 267 TRP n 
1 268 THR n 
1 269 LYS n 
1 270 VAL n 
1 271 PHE n 
1 272 ARG n 
1 273 PRO n 
1 274 ARG n 
1 275 THR n 
1 276 PRO n 
1 277 PRO n 
1 278 GLU n 
1 279 ALA n 
1 280 ILE n 
1 281 ALA n 
1 282 LEU n 
1 283 CYS n 
1 284 SER n 
1 285 ARG n 
1 286 LEU n 
1 287 LEU n 
1 288 GLU n 
1 289 TYR n 
1 290 THR n 
1 291 PRO n 
1 292 THR n 
1 293 ALA n 
1 294 ARG n 
1 295 LEU n 
1 296 THR n 
1 297 PRO n 
1 298 LEU n 
1 299 GLU n 
1 300 ALA n 
1 301 CYS n 
1 302 ALA n 
1 303 HIS n 
1 304 SER n 
1 305 PHE n 
1 306 PHE n 
1 307 ASP n 
1 308 GLU n 
1 309 LEU n 
1 310 ARG n 
1 311 ASP n 
1 312 PRO n 
1 313 ASN n 
1 314 VAL n 
1 315 LYS n 
1 316 LEU n 
1 317 PRO n 
1 318 ASN n 
1 319 GLY n 
1 320 ARG n 
1 321 ASP n 
1 322 THR n 
1 323 PRO n 
1 324 ALA n 
1 325 LEU n 
1 326 PHE n 
1 327 ASN n 
1 328 PHE n 
1 329 THR n 
1 330 THR n 
1 331 GLN n 
1 332 GLU n 
1 333 LEU n 
1 334 SER n 
1 335 SER n 
1 336 ASN n 
1 337 PRO n 
1 338 PRO n 
1 339 LEU n 
1 340 ALA n 
1 341 THR n 
1 342 ILE n 
1 343 LEU n 
1 344 ILE n 
1 345 PRO n 
1 346 PRO n 
1 347 HIS n 
1 348 ALA n 
1 349 ARG n 
1 350 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'SPODOPTERA FRUGIPERDA' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACULOVIRUS 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'PFASTBAC HTA' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GSKG3B_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P49841 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1UV5 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 350 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P49841 
_struct_ref_seq.db_align_beg                  35 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  384 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       35 
_struct_ref_seq.pdbx_auth_seq_align_end       384 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ?                                                        'C3 H7 N O2'       
89.093  
ARG 'L-peptide linking' y ARGININE                    ?                                                        'C6 H15 N4 O2 1'   
175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ?                                                        'C4 H8 N2 O3'      
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ?                                                        'C4 H7 N O4'       
133.103 
BRW non-polymer         . "6-BROMOINDIRUBIN-3'-OXIME" 
;(3E)-6'-BROMO-2,3'-BIINDOLE-2',3(1H,1'H)-DIONE 3-OXIME
;
'C16 H10 Br N3 O2' 356.174 
CL  non-polymer         . 'CHLORIDE ION'              ?                                                        'Cl -1'            
35.453  
CO  non-polymer         . 'COBALT (II) ION'           ?                                                        'Co 2'             
58.933  
CYS 'L-peptide linking' y CYSTEINE                    ?                                                        'C3 H7 N O2 S'     
121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ?                                                        'C5 H10 N2 O3'     
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ?                                                        'C5 H9 N O4'       
147.129 
GLY 'peptide linking'   y GLYCINE                     ?                                                        'C2 H5 N O2'       
75.067  
HIS 'L-peptide linking' y HISTIDINE                   ?                                                        'C6 H10 N3 O2 1'   
156.162 
HOH non-polymer         . WATER                       ?                                                        'H2 O'             
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ?                                                        'C6 H13 N O2'      
131.173 
LEU 'L-peptide linking' y LEUCINE                     ?                                                        'C6 H13 N O2'      
131.173 
LYS 'L-peptide linking' y LYSINE                      ?                                                        'C6 H15 N2 O2 1'   
147.195 
MET 'L-peptide linking' y METHIONINE                  ?                                                        'C5 H11 N O2 S'    
149.211 
PHE 'L-peptide linking' y PHENYLALANINE               ?                                                        'C9 H11 N O2'      
165.189 
PO4 non-polymer         . 'PHOSPHATE ION'             ?                                                        'O4 P -3'          
94.971  
PRO 'L-peptide linking' y PROLINE                     ?                                                        'C5 H9 N O2'       
115.130 
SER 'L-peptide linking' y SERINE                      ?                                                        'C3 H7 N O3'       
105.093 
THR 'L-peptide linking' y THREONINE                   ?                                                        'C4 H9 N O3'       
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ?                                                        'C11 H12 N2 O2'    
204.225 
TYR 'L-peptide linking' y TYROSINE                    ?                                                        'C9 H11 N O3'      
181.189 
VAL 'L-peptide linking' y VALINE                      ?                                                        'C5 H11 N O2'      
117.146 
# 
_exptl.entry_id          1UV5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.1 
_exptl_crystal.density_percent_sol   75.6 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.50' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2002-09-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9253 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             0.9253 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     1UV5 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             35.000 
_reflns.d_resolution_high            2.800 
_reflns.number_obs                   24630 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.07000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        18.4000 
_reflns.B_iso_Wilson_estimate        54.9 
_reflns.pdbx_redundancy              6.600 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.95 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.28900 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.700 
_reflns_shell.pdbx_redundancy        4.40 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 1UV5 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     24570 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1276631.37 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             24.46 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_obs                          0.193 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.193 
_refine.ls_R_factor_R_free                       0.226 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1204 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               73.6 
_refine.aniso_B[1][1]                            17.00 
_refine.aniso_B[2][2]                            17.00 
_refine.aniso_B[3][3]                            -34.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.350977 
_refine.solvent_model_param_bsol                 55.413 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1H8F' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        1UV5 
_refine_analyze.Luzzati_coordinate_error_obs    0.33 
_refine_analyze.Luzzati_sigma_a_obs             0.52 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.39 
_refine_analyze.Luzzati_sigma_a_free            0.57 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2760 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             112 
_refine_hist.number_atoms_total               2906 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        24.46 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.020 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.9   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.35  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.67  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            3.00  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.16  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.53  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.98 
_refine_ls_shell.number_reflns_R_work             3803 
_refine_ls_shell.R_factor_R_work                  0.321 
_refine_ls_shell.percent_reflns_obs               99.9 
_refine_ls_shell.R_factor_R_free                  0.356 
_refine_ls_shell.R_factor_R_free_error            0.025 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             203 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP      
'X-RAY DIFFRACTION' 2 WATER_REP.PARAM   WATER.TOP        
'X-RAY DIFFRACTION' 3 ION.PARAM         ION.TOP          
'X-RAY DIFFRACTION' 4 BRM3_EPE_PO4.PAR  BRM3_EPE_PO4.TOP 
# 
_struct.entry_id                  1UV5 
_struct.title                     
;GLYCOGEN SYNTHASE KINASE 3 BETA COMPLEXED WITH 6-BROMOINDIRUBIN-3'-OXIME
;
_struct.pdbx_descriptor           'GLYCOGEN SYNTHASE KINASE-3 BETA (E.C.2.7.1.37)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UV5 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
'TRANSFERASE, KINASE, INSULIN PATHWAY, WNT SIGNALING PATHWAY, TRANSFERASE SERINE/THREONINE-PROTEIN KINASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 3 ? 
G N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 61  ? LEU A 70  ? ASN A 95  LEU A 104 1 ? 10 
HELX_P HELX_P2  2  VAL A 105 ? ALA A 115 ? VAL A 139 ALA A 149 1 ? 11 
HELX_P HELX_P3  3  PRO A 120 ? SER A 140 ? PRO A 154 SER A 174 1 ? 21 
HELX_P HELX_P4  4  LYS A 149 ? GLN A 151 ? LYS A 183 GLN A 185 5 ? 3  
HELX_P HELX_P5  5  SER A 185 ? ARG A 189 ? SER A 219 ARG A 223 5 ? 5  
HELX_P HELX_P6  6  ALA A 190 ? PHE A 195 ? ALA A 224 PHE A 229 1 ? 6  
HELX_P HELX_P7  7  SER A 202 ? GLY A 219 ? SER A 236 GLY A 253 1 ? 18 
HELX_P HELX_P8  8  SER A 227 ? GLY A 240 ? SER A 261 GLY A 274 1 ? 14 
HELX_P HELX_P9  9  THR A 243 ? ASN A 251 ? THR A 277 ASN A 285 1 ? 9  
HELX_P HELX_P10 10 PRO A 266 ? VAL A 270 ? PRO A 300 VAL A 304 5 ? 5  
HELX_P HELX_P11 11 PRO A 276 ? LEU A 287 ? PRO A 310 LEU A 321 1 ? 12 
HELX_P HELX_P12 12 THR A 290 ? ARG A 294 ? THR A 324 ARG A 328 5 ? 5  
HELX_P HELX_P13 13 THR A 296 ? ALA A 302 ? THR A 330 ALA A 336 1 ? 7  
HELX_P HELX_P14 14 HIS A 303 ? PHE A 305 ? HIS A 337 PHE A 339 5 ? 3  
HELX_P HELX_P15 15 PHE A 306 ? ASP A 311 ? PHE A 340 ASP A 345 1 ? 6  
HELX_P HELX_P16 16 THR A 329 ? SER A 334 ? THR A 363 SER A 368 1 ? 6  
HELX_P HELX_P17 17 ASN A 336 ? PRO A 338 ? ASN A 370 PRO A 372 5 ? 3  
HELX_P HELX_P18 18 LEU A 339 ? ILE A 344 ? LEU A 373 ILE A 378 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? E CO . CO ? ? ? 1_555 G HOH . O ? ? A CO 1386 A HOH 2111 1_555 ? ? ? ? ? ? ? 2.580 ? 
metalc2 metalc ? ? E CO . CO ? ? ? 1_555 G HOH . O ? ? A CO 1386 A HOH 2112 1_555 ? ? ? ? ? ? ? 2.452 ? 
metalc3 metalc ? ? E CO . CO ? ? ? 1_555 G HOH . O ? ? A CO 1386 A HOH 2110 1_555 ? ? ? ? ? ? ? 2.628 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 8 ? 
AB ? 3 ? 
AC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AA 5 6 ? anti-parallel 
AA 6 7 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 THR A 4   ? PRO A 10  ? THR A 38  PRO A 44  
AA 2 GLN A 18  ? GLY A 29  ? GLN A 52  GLY A 63  
AA 3 VAL A 35  ? LEU A 41  ? VAL A 69  LEU A 75  
AA 4 LEU A 47  ? GLN A 55  ? LEU A 81  GLN A 89  
AA 5 VAL A 92  ? ASP A 99  ? VAL A 126 ASP A 133 
AA 6 LEU A 78  ? SER A 85  ? LEU A 112 SER A 119 
AA 7 THR A 4   ? PRO A 10  ? THR A 38  PRO A 44  
AA 8 THR A 4   ? PRO A 10  ? THR A 38  PRO A 44  
AB 1 GLU A 103 ? THR A 104 ? GLU A 137 THR A 138 
AB 2 LEU A 153 ? ASP A 156 ? LEU A 187 ASP A 190 
AB 3 VAL A 161 ? LEU A 164 ? VAL A 195 LEU A 198 
AC 1 ILE A 143 ? CYS A 144 ? ILE A 177 CYS A 178 
AC 2 LYS A 171 ? GLN A 172 ? LYS A 205 GLN A 206 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ALA A 8   ? N ALA A 42  O GLN A 18  ? O GLN A 52  
AA 2 3 N ILE A 28  ? N ILE A 62  O VAL A 36  ? O VAL A 70  
AA 3 4 N ALA A 39  ? N ALA A 73  O VAL A 48  ? O VAL A 82  
AA 4 5 N GLN A 55  ? N GLN A 89  O VAL A 92  ? O VAL A 126 
AA 5 6 O VAL A 97  ? O VAL A 131 N ARG A 79  ? N ARG A 113 
AA 6 7 N PHE A 81  ? N PHE A 115 O THR A 9   ? O THR A 43  
AB 1 2 N GLU A 103 ? N GLU A 137 O LEU A 155 ? O LEU A 189 
AB 2 3 N ASP A 156 ? N ASP A 190 O VAL A 161 ? O VAL A 195 
AC 1 2 N CYS A 144 ? N CYS A 178 O LYS A 171 ? O LYS A 205 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE PO4 A1384' 
AC2 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL A1385'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CO A1386'  
AC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE PO4 A1387' 
AC5 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE BRW A1383' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  HIS A 139 ? HIS A 173  . ? 1_555 ? 
2  AC1 8  SER A 202 ? SER A 236  . ? 1_555 ? 
3  AC1 8  SER A 203 ? SER A 237  . ? 1_555 ? 
4  AC1 8  PRO A 297 ? PRO A 331  . ? 1_555 ? 
5  AC1 8  HOH G .   ? HOH A 2105 . ? 1_555 ? 
6  AC1 8  HOH G .   ? HOH A 2106 . ? 1_555 ? 
7  AC1 8  HOH G .   ? HOH A 2107 . ? 1_555 ? 
8  AC1 8  HOH G .   ? HOH A 2108 . ? 1_555 ? 
9  AC2 2  LEU A 325 ? LEU A 359  . ? 1_555 ? 
10 AC2 2  PHE A 326 ? PHE A 360  . ? 1_555 ? 
11 AC3 5  ASP A 230 ? ASP A 264  . ? 1_555 ? 
12 AC3 5  HOH G .   ? HOH A 2109 . ? 1_555 ? 
13 AC3 5  HOH G .   ? HOH A 2110 . ? 1_555 ? 
14 AC3 5  HOH G .   ? HOH A 2111 . ? 1_555 ? 
15 AC3 5  HOH G .   ? HOH A 2112 . ? 1_555 ? 
16 AC4 8  ARG A 62  ? ARG A 96   . ? 1_555 ? 
17 AC4 8  ARG A 146 ? ARG A 180  . ? 1_555 ? 
18 AC4 8  LYS A 171 ? LYS A 205  . ? 1_555 ? 
19 AC4 8  ASN A 179 ? ASN A 213  . ? 1_555 ? 
20 AC4 8  VAL A 180 ? VAL A 214  . ? 1_555 ? 
21 AC4 8  GLU A 256 ? GLU A 290  . ? 1_555 ? 
22 AC4 8  PHE A 257 ? PHE A 291  . ? 1_555 ? 
23 AC4 8  HOH G .   ? HOH A 2087 . ? 1_555 ? 
24 AC5 10 ILE A 28  ? ILE A 62   . ? 1_555 ? 
25 AC5 10 ALA A 49  ? ALA A 83   . ? 1_555 ? 
26 AC5 10 ASP A 99  ? ASP A 133  . ? 1_555 ? 
27 AC5 10 TYR A 100 ? TYR A 134  . ? 1_555 ? 
28 AC5 10 VAL A 101 ? VAL A 135  . ? 1_555 ? 
29 AC5 10 PRO A 102 ? PRO A 136  . ? 1_555 ? 
30 AC5 10 ARG A 107 ? ARG A 141  . ? 1_555 ? 
31 AC5 10 LEU A 154 ? LEU A 188  . ? 1_555 ? 
32 AC5 10 ASP A 166 ? ASP A 200  . ? 1_555 ? 
33 AC5 10 HOH G .   ? HOH A 2019 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1UV5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1UV5 
_atom_sites.fract_transf_matrix[1][1]   0.010169 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010169 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005050 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
CL 
CO 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . SER A 1 1   ? 101.977 74.809 25.454  1.00 88.84  ? 35   SER A N    1 
ATOM   2    C  CA   . SER A 1 1   ? 101.104 75.179 26.632  1.00 87.86  ? 35   SER A CA   1 
ATOM   3    C  C    . SER A 1 1   ? 101.389 74.234 27.841  1.00 86.70  ? 35   SER A C    1 
ATOM   4    O  O    . SER A 1 1   ? 102.555 74.010 28.186  1.00 86.94  ? 35   SER A O    1 
ATOM   5    C  CB   . SER A 1 1   ? 99.569  75.200 26.194  1.00 88.16  ? 35   SER A CB   1 
ATOM   6    O  OG   . SER A 1 1   ? 99.128  74.150 25.325  1.00 84.57  ? 35   SER A OG   1 
ATOM   7    N  N    . LYS A 1 2   ? 100.347 73.676 28.462  1.00 84.13  ? 36   LYS A N    1 
ATOM   8    C  CA   . LYS A 1 2   ? 100.475 72.767 29.586  1.00 80.46  ? 36   LYS A CA   1 
ATOM   9    C  C    . LYS A 1 2   ? 100.633 71.331 29.140  1.00 78.05  ? 36   LYS A C    1 
ATOM   10   O  O    . LYS A 1 2   ? 100.334 70.992 28.000  1.00 78.49  ? 36   LYS A O    1 
ATOM   11   C  CB   . LYS A 1 2   ? 99.212  72.845 30.426  1.00 81.83  ? 36   LYS A CB   1 
ATOM   12   C  CG   . LYS A 1 2   ? 97.974  72.510 29.698  1.00 81.80  ? 36   LYS A CG   1 
ATOM   13   C  CD   . LYS A 1 2   ? 97.000  71.864 30.638  1.00 84.79  ? 36   LYS A CD   1 
ATOM   14   C  CE   . LYS A 1 2   ? 95.635  71.705 29.937  1.00 88.19  ? 36   LYS A CE   1 
ATOM   15   N  NZ   . LYS A 1 2   ? 94.647  70.778 30.615  1.00 89.81  ? 36   LYS A NZ   1 
ATOM   16   N  N    . VAL A 1 3   ? 101.086 70.463 30.040  1.00 74.21  ? 37   VAL A N    1 
ATOM   17   C  CA   . VAL A 1 3   ? 101.203 69.064 29.674  1.00 69.15  ? 37   VAL A CA   1 
ATOM   18   C  C    . VAL A 1 3   ? 99.931  68.346 30.127  1.00 67.59  ? 37   VAL A C    1 
ATOM   19   O  O    . VAL A 1 3   ? 99.364  68.703 31.149  1.00 69.06  ? 37   VAL A O    1 
ATOM   20   C  CB   . VAL A 1 3   ? 102.403 68.426 30.269  1.00 66.18  ? 37   VAL A CB   1 
ATOM   21   C  CG1  . VAL A 1 3   ? 102.459 67.004 29.852  1.00 66.30  ? 37   VAL A CG1  1 
ATOM   22   C  CG2  . VAL A 1 3   ? 103.619 69.093 29.768  1.00 65.27  ? 37   VAL A CG2  1 
ATOM   23   N  N    . THR A 1 4   ? 99.463  67.394 29.313  1.00 65.51  ? 38   THR A N    1 
ATOM   24   C  CA   . THR A 1 4   ? 98.237  66.610 29.550  1.00 62.97  ? 38   THR A CA   1 
ATOM   25   C  C    . THR A 1 4   ? 98.557  65.148 29.447  1.00 62.00  ? 38   THR A C    1 
ATOM   26   O  O    . THR A 1 4   ? 99.217  64.699 28.458  1.00 60.76  ? 38   THR A O    1 
ATOM   27   C  CB   . THR A 1 4   ? 97.175  66.831 28.470  1.00 63.79  ? 38   THR A CB   1 
ATOM   28   O  OG1  . THR A 1 4   ? 96.961  68.248 28.265  1.00 65.39  ? 38   THR A OG1  1 
ATOM   29   C  CG2  . THR A 1 4   ? 95.885  66.138 28.853  1.00 60.36  ? 38   THR A CG2  1 
ATOM   30   N  N    . THR A 1 5   ? 98.064  64.394 30.425  1.00 59.90  ? 39   THR A N    1 
ATOM   31   C  CA   . THR A 1 5   ? 98.342  62.975 30.505  1.00 59.05  ? 39   THR A CA   1 
ATOM   32   C  C    . THR A 1 5   ? 97.058  62.198 30.656  1.00 59.28  ? 39   THR A C    1 
ATOM   33   O  O    . THR A 1 5   ? 96.280  62.463 31.552  1.00 60.09  ? 39   THR A O    1 
ATOM   34   C  CB   . THR A 1 5   ? 99.311  62.721 31.675  1.00 57.68  ? 39   THR A CB   1 
ATOM   35   O  OG1  . THR A 1 5   ? 100.588 63.317 31.350  1.00 56.36  ? 39   THR A OG1  1 
ATOM   36   C  CG2  . THR A 1 5   ? 99.512  61.249 31.937  1.00 57.28  ? 39   THR A CG2  1 
ATOM   37   N  N    . VAL A 1 6   ? 96.847  61.230 29.769  1.00 59.14  ? 40   VAL A N    1 
ATOM   38   C  CA   . VAL A 1 6   ? 95.610  60.455 29.778  1.00 57.98  ? 40   VAL A CA   1 
ATOM   39   C  C    . VAL A 1 6   ? 95.945  59.006 29.631  1.00 58.80  ? 40   VAL A C    1 
ATOM   40   O  O    . VAL A 1 6   ? 97.084  58.634 29.308  1.00 57.75  ? 40   VAL A O    1 
ATOM   41   C  CB   . VAL A 1 6   ? 94.765  60.816 28.539  1.00 56.94  ? 40   VAL A CB   1 
ATOM   42   C  CG1  . VAL A 1 6   ? 94.358  62.260 28.587  1.00 52.99  ? 40   VAL A CG1  1 
ATOM   43   C  CG2  . VAL A 1 6   ? 95.597  60.555 27.273  1.00 53.25  ? 40   VAL A CG2  1 
ATOM   44   N  N    . VAL A 1 7   ? 94.930  58.185 29.866  1.00 60.42  ? 41   VAL A N    1 
ATOM   45   C  CA   . VAL A 1 7   ? 95.047  56.730 29.657  1.00 61.94  ? 41   VAL A CA   1 
ATOM   46   C  C    . VAL A 1 7   ? 94.390  56.548 28.289  1.00 63.33  ? 41   VAL A C    1 
ATOM   47   O  O    . VAL A 1 7   ? 93.208  56.873 28.118  1.00 63.38  ? 41   VAL A O    1 
ATOM   48   C  CB   . VAL A 1 7   ? 94.205  55.920 30.618  1.00 60.79  ? 41   VAL A CB   1 
ATOM   49   C  CG1  . VAL A 1 7   ? 94.573  54.481 30.452  1.00 59.55  ? 41   VAL A CG1  1 
ATOM   50   C  CG2  . VAL A 1 7   ? 94.396  56.385 32.063  1.00 62.05  ? 41   VAL A CG2  1 
ATOM   51   N  N    . ALA A 1 8   ? 95.132  56.047 27.315  1.00 64.34  ? 42   ALA A N    1 
ATOM   52   C  CA   . ALA A 1 8   ? 94.558  55.887 25.988  1.00 66.05  ? 42   ALA A CA   1 
ATOM   53   C  C    . ALA A 1 8   ? 94.593  54.438 25.550  1.00 67.91  ? 42   ALA A C    1 
ATOM   54   O  O    . ALA A 1 8   ? 95.333  53.638 26.111  1.00 69.25  ? 42   ALA A O    1 
ATOM   55   C  CB   . ALA A 1 8   ? 95.343  56.725 24.994  1.00 65.07  ? 42   ALA A CB   1 
ATOM   56   N  N    . THR A 1 9   ? 93.800  54.113 24.529  1.00 69.28  ? 43   THR A N    1 
ATOM   57   C  CA   . THR A 1 9   ? 93.777  52.780 23.951  1.00 68.49  ? 43   THR A CA   1 
ATOM   58   C  C    . THR A 1 9   ? 94.304  52.923 22.568  1.00 68.68  ? 43   THR A C    1 
ATOM   59   O  O    . THR A 1 9   ? 94.078  53.941 21.900  1.00 67.58  ? 43   THR A O    1 
ATOM   60   C  CB   . THR A 1 9   ? 92.390  52.234 23.838  1.00 68.15  ? 43   THR A CB   1 
ATOM   61   O  OG1  . THR A 1 9   ? 91.790  52.237 25.133  1.00 70.23  ? 43   THR A OG1  1 
ATOM   62   C  CG2  . THR A 1 9   ? 92.440  50.834 23.287  1.00 67.86  ? 43   THR A CG2  1 
ATOM   63   N  N    . PRO A 1 10  ? 95.041  51.932 22.100  1.00 69.74  ? 44   PRO A N    1 
ATOM   64   C  CA   . PRO A 1 10  ? 95.590  52.003 20.740  1.00 72.18  ? 44   PRO A CA   1 
ATOM   65   C  C    . PRO A 1 10  ? 94.415  51.792 19.770  1.00 76.48  ? 44   PRO A C    1 
ATOM   66   O  O    . PRO A 1 10  ? 93.444  51.065 20.102  1.00 76.10  ? 44   PRO A O    1 
ATOM   67   C  CB   . PRO A 1 10  ? 96.573  50.862 20.706  1.00 70.57  ? 44   PRO A CB   1 
ATOM   68   C  CG   . PRO A 1 10  ? 96.912  50.627 22.134  1.00 69.70  ? 44   PRO A CG   1 
ATOM   69   C  CD   . PRO A 1 10  ? 95.625  50.837 22.866  1.00 69.04  ? 44   PRO A CD   1 
ATOM   70   N  N    . GLY A 1 11  ? 94.493  52.422 18.593  1.00 80.57  ? 45   GLY A N    1 
ATOM   71   C  CA   . GLY A 1 11  ? 93.419  52.321 17.620  1.00 85.80  ? 45   GLY A CA   1 
ATOM   72   C  C    . GLY A 1 11  ? 93.230  50.922 17.097  1.00 90.02  ? 45   GLY A C    1 
ATOM   73   O  O    . GLY A 1 11  ? 92.165  50.287 17.194  1.00 89.33  ? 45   GLY A O    1 
ATOM   74   N  N    . GLN A 1 12  ? 94.324  50.442 16.548  1.00 94.98  ? 46   GLN A N    1 
ATOM   75   C  CA   . GLN A 1 12  ? 94.407  49.131 15.961  1.00 100.90 ? 46   GLN A CA   1 
ATOM   76   C  C    . GLN A 1 12  ? 95.231  48.238 16.880  1.00 103.04 ? 46   GLN A C    1 
ATOM   77   O  O    . GLN A 1 12  ? 96.060  48.698 17.668  1.00 103.53 ? 46   GLN A O    1 
ATOM   78   C  CB   . GLN A 1 12  ? 95.069  49.250 14.568  1.00 103.78 ? 46   GLN A CB   1 
ATOM   79   C  CG   . GLN A 1 12  ? 96.565  49.785 14.529  1.00 108.80 ? 46   GLN A CG   1 
ATOM   80   C  CD   . GLN A 1 12  ? 96.823  51.251 15.086  1.00 111.39 ? 46   GLN A CD   1 
ATOM   81   O  OE1  . GLN A 1 12  ? 96.893  51.482 16.325  1.00 111.23 ? 46   GLN A OE1  1 
ATOM   82   N  NE2  . GLN A 1 12  ? 96.991  52.224 14.156  1.00 111.41 ? 46   GLN A NE2  1 
ATOM   83   N  N    . GLY A 1 13  ? 95.008  46.942 16.774  1.00 105.87 ? 47   GLY A N    1 
ATOM   84   C  CA   . GLY A 1 13  ? 95.777  46.025 17.590  1.00 107.81 ? 47   GLY A CA   1 
ATOM   85   C  C    . GLY A 1 13  ? 95.055  45.738 18.878  1.00 109.49 ? 47   GLY A C    1 
ATOM   86   O  O    . GLY A 1 13  ? 93.874  46.130 19.064  1.00 109.35 ? 47   GLY A O    1 
ATOM   87   N  N    . PRO A 1 14  ? 95.748  45.043 19.802  1.00 110.56 ? 48   PRO A N    1 
ATOM   88   C  CA   . PRO A 1 14  ? 95.280  44.627 21.148  1.00 109.93 ? 48   PRO A CA   1 
ATOM   89   C  C    . PRO A 1 14  ? 94.804  45.826 21.986  1.00 108.89 ? 48   PRO A C    1 
ATOM   90   O  O    . PRO A 1 14  ? 95.468  46.893 21.995  1.00 108.85 ? 48   PRO A O    1 
ATOM   91   C  CB   . PRO A 1 14  ? 96.530  43.986 21.764  1.00 110.34 ? 48   PRO A CB   1 
ATOM   92   C  CG   . PRO A 1 14  ? 97.283  43.468 20.568  1.00 110.56 ? 48   PRO A CG   1 
ATOM   93   C  CD   . PRO A 1 14  ? 97.133  44.581 19.549  1.00 110.63 ? 48   PRO A CD   1 
ATOM   94   N  N    . ASP A 1 15  ? 93.681  45.656 22.681  1.00 106.53 ? 49   ASP A N    1 
ATOM   95   C  CA   . ASP A 1 15  ? 93.165  46.731 23.510  1.00 104.40 ? 49   ASP A CA   1 
ATOM   96   C  C    . ASP A 1 15  ? 93.869  46.772 24.903  1.00 101.53 ? 49   ASP A C    1 
ATOM   97   O  O    . ASP A 1 15  ? 93.394  46.184 25.887  1.00 100.44 ? 49   ASP A O    1 
ATOM   98   C  CB   . ASP A 1 15  ? 91.674  46.538 23.649  1.00 107.18 ? 49   ASP A CB   1 
ATOM   99   C  CG   . ASP A 1 15  ? 91.072  47.470 24.688  1.00 110.56 ? 49   ASP A CG   1 
ATOM   100  O  OD1  . ASP A 1 15  ? 91.503  47.423 25.878  1.00 110.29 ? 49   ASP A OD1  1 
ATOM   101  O  OD2  . ASP A 1 15  ? 90.166  48.257 24.309  1.00 113.56 ? 49   ASP A OD2  1 
ATOM   102  N  N    . ARG A 1 16  ? 95.001  47.475 24.966  1.00 97.65  ? 50   ARG A N    1 
ATOM   103  C  CA   . ARG A 1 16  ? 95.813  47.579 26.171  1.00 93.49  ? 50   ARG A CA   1 
ATOM   104  C  C    . ARG A 1 16  ? 95.975  49.012 26.647  1.00 88.94  ? 50   ARG A C    1 
ATOM   105  O  O    . ARG A 1 16  ? 96.842  49.719 26.178  1.00 87.93  ? 50   ARG A O    1 
ATOM   106  C  CB   . ARG A 1 16  ? 97.187  46.994 25.878  1.00 96.16  ? 50   ARG A CB   1 
ATOM   107  C  CG   . ARG A 1 16  ? 97.152  45.700 25.090  1.00 100.53 ? 50   ARG A CG   1 
ATOM   108  C  CD   . ARG A 1 16  ? 96.432  44.568 25.864  1.00 106.21 ? 50   ARG A CD   1 
ATOM   109  N  NE   . ARG A 1 16  ? 96.223  43.348 25.055  1.00 110.64 ? 50   ARG A NE   1 
ATOM   110  C  CZ   . ARG A 1 16  ? 95.540  42.263 25.449  1.00 112.45 ? 50   ARG A CZ   1 
ATOM   111  N  NH1  . ARG A 1 16  ? 94.979  42.219 26.669  1.00 112.59 ? 50   ARG A NH1  1 
ATOM   112  N  NH2  . ARG A 1 16  ? 95.415  41.216 24.611  1.00 112.81 ? 50   ARG A NH2  1 
ATOM   113  N  N    . PRO A 1 17  ? 95.160  49.450 27.608  1.00 85.12  ? 51   PRO A N    1 
ATOM   114  C  CA   . PRO A 1 17  ? 95.259  50.812 28.100  1.00 82.21  ? 51   PRO A CA   1 
ATOM   115  C  C    . PRO A 1 17  ? 96.674  51.245 28.369  1.00 79.41  ? 51   PRO A C    1 
ATOM   116  O  O    . PRO A 1 17  ? 97.408  50.586 29.073  1.00 79.37  ? 51   PRO A O    1 
ATOM   117  C  CB   . PRO A 1 17  ? 94.437  50.778 29.376  1.00 82.45  ? 51   PRO A CB   1 
ATOM   118  C  CG   . PRO A 1 17  ? 93.376  49.826 29.048  1.00 83.98  ? 51   PRO A CG   1 
ATOM   119  C  CD   . PRO A 1 17  ? 94.202  48.709 28.427  1.00 85.26  ? 51   PRO A CD   1 
ATOM   120  N  N    . GLN A 1 18  ? 97.072  52.367 27.808  1.00 76.74  ? 52   GLN A N    1 
ATOM   121  C  CA   . GLN A 1 18  ? 98.391  52.860 28.061  1.00 74.47  ? 52   GLN A CA   1 
ATOM   122  C  C    . GLN A 1 18  ? 98.402  54.373 28.357  1.00 72.82  ? 52   GLN A C    1 
ATOM   123  O  O    . GLN A 1 18  ? 97.445  55.101 28.048  1.00 72.29  ? 52   GLN A O    1 
ATOM   124  C  CB   . GLN A 1 18  ? 99.289  52.494 26.929  1.00 74.15  ? 52   GLN A CB   1 
ATOM   125  C  CG   . GLN A 1 18  ? 99.376  53.482 25.890  1.00 76.81  ? 52   GLN A CG   1 
ATOM   126  C  CD   . GLN A 1 18  ? 100.150 52.891 24.743  1.00 80.59  ? 52   GLN A CD   1 
ATOM   127  O  OE1  . GLN A 1 18  ? 100.673 53.607 23.865  1.00 83.41  ? 52   GLN A OE1  1 
ATOM   128  N  NE2  . GLN A 1 18  ? 100.230 51.557 24.726  1.00 81.68  ? 52   GLN A NE2  1 
ATOM   129  N  N    . GLU A 1 19  ? 99.469  54.818 29.027  1.00 70.51  ? 53   GLU A N    1 
ATOM   130  C  CA   . GLU A 1 19  ? 99.600  56.211 29.414  1.00 67.06  ? 53   GLU A CA   1 
ATOM   131  C  C    . GLU A 1 19  ? 100.111 57.078 28.292  1.00 65.02  ? 53   GLU A C    1 
ATOM   132  O  O    . GLU A 1 19  ? 101.101 56.727 27.663  1.00 65.91  ? 53   GLU A O    1 
ATOM   133  C  CB   . GLU A 1 19  ? 100.549 56.345 30.575  1.00 66.43  ? 53   GLU A CB   1 
ATOM   134  C  CG   . GLU A 1 19  ? 100.516 57.709 31.122  1.00 67.89  ? 53   GLU A CG   1 
ATOM   135  C  CD   . GLU A 1 19  ? 101.195 57.810 32.452  1.00 70.76  ? 53   GLU A CD   1 
ATOM   136  O  OE1  . GLU A 1 19  ? 102.430 58.039 32.481  1.00 72.37  ? 53   GLU A OE1  1 
ATOM   137  O  OE2  . GLU A 1 19  ? 100.486 57.652 33.474  1.00 71.21  ? 53   GLU A OE2  1 
ATOM   138  N  N    . VAL A 1 20  ? 99.450  58.199 28.011  1.00 62.18  ? 54   VAL A N    1 
ATOM   139  C  CA   . VAL A 1 20  ? 99.934  59.101 26.961  1.00 59.92  ? 54   VAL A CA   1 
ATOM   140  C  C    . VAL A 1 20  ? 99.951  60.552 27.461  1.00 59.21  ? 54   VAL A C    1 
ATOM   141  O  O    . VAL A 1 20  ? 99.003  61.007 28.113  1.00 56.65  ? 54   VAL A O    1 
ATOM   142  C  CB   . VAL A 1 20  ? 99.051  59.039 25.643  1.00 60.17  ? 54   VAL A CB   1 
ATOM   143  C  CG1  . VAL A 1 20  ? 99.539  60.105 24.657  1.00 57.43  ? 54   VAL A CG1  1 
ATOM   144  C  CG2  . VAL A 1 20  ? 99.110  57.642 25.009  1.00 57.03  ? 54   VAL A CG2  1 
ATOM   145  N  N    . SER A 1 21  ? 101.047 61.249 27.159  1.00 59.03  ? 55   SER A N    1 
ATOM   146  C  CA   . SER A 1 21  ? 101.196 62.656 27.549  1.00 60.14  ? 55   SER A CA   1 
ATOM   147  C  C    . SER A 1 21  ? 101.475 63.467 26.298  1.00 59.69  ? 55   SER A C    1 
ATOM   148  O  O    . SER A 1 21  ? 102.311 63.112 25.464  1.00 57.96  ? 55   SER A O    1 
ATOM   149  C  CB   . SER A 1 21  ? 102.387 62.856 28.526  1.00 61.98  ? 55   SER A CB   1 
ATOM   150  O  OG   . SER A 1 21  ? 102.191 62.207 29.771  1.00 63.76  ? 55   SER A OG   1 
ATOM   151  N  N    . TYR A 1 22  ? 100.778 64.579 26.173  1.00 60.08  ? 56   TYR A N    1 
ATOM   152  C  CA   . TYR A 1 22  ? 100.972 65.437 24.999  1.00 60.49  ? 56   TYR A CA   1 
ATOM   153  C  C    . TYR A 1 22  ? 100.866 66.891 25.441  1.00 62.65  ? 56   TYR A C    1 
ATOM   154  O  O    . TYR A 1 22  ? 100.248 67.239 26.471  1.00 61.39  ? 56   TYR A O    1 
ATOM   155  C  CB   . TYR A 1 22  ? 99.927  65.152 23.901  1.00 56.18  ? 56   TYR A CB   1 
ATOM   156  C  CG   . TYR A 1 22  ? 98.487  65.412 24.332  1.00 52.23  ? 56   TYR A CG   1 
ATOM   157  C  CD1  . TYR A 1 22  ? 97.832  66.644 24.103  1.00 50.59  ? 56   TYR A CD1  1 
ATOM   158  C  CD2  . TYR A 1 22  ? 97.788  64.423 24.970  1.00 50.63  ? 56   TYR A CD2  1 
ATOM   159  C  CE1  . TYR A 1 22  ? 96.514  66.839 24.514  1.00 48.62  ? 56   TYR A CE1  1 
ATOM   160  C  CE2  . TYR A 1 22  ? 96.497  64.612 25.375  1.00 50.65  ? 56   TYR A CE2  1 
ATOM   161  C  CZ   . TYR A 1 22  ? 95.863  65.798 25.151  1.00 50.68  ? 56   TYR A CZ   1 
ATOM   162  O  OH   . TYR A 1 22  ? 94.556  65.821 25.577  1.00 51.51  ? 56   TYR A OH   1 
ATOM   163  N  N    . THR A 1 23  ? 101.442 67.741 24.607  1.00 65.78  ? 57   THR A N    1 
ATOM   164  C  CA   . THR A 1 23  ? 101.476 69.157 24.905  1.00 67.87  ? 57   THR A CA   1 
ATOM   165  C  C    . THR A 1 23  ? 101.441 69.971 23.602  1.00 69.07  ? 57   THR A C    1 
ATOM   166  O  O    . THR A 1 23  ? 101.349 69.397 22.502  1.00 69.34  ? 57   THR A O    1 
ATOM   167  C  CB   . THR A 1 23  ? 102.781 69.434 25.732  1.00 67.38  ? 57   THR A CB   1 
ATOM   168  O  OG1  . THR A 1 23  ? 102.679 70.708 26.401  1.00 69.64  ? 57   THR A OG1  1 
ATOM   169  C  CG2  . THR A 1 23  ? 104.029 69.377 24.851  1.00 63.53  ? 57   THR A CG2  1 
ATOM   170  N  N    . ASP A 1 24  ? 101.492 71.297 23.735  1.00 69.91  ? 58   ASP A N    1 
ATOM   171  C  CA   . ASP A 1 24  ? 101.525 72.175 22.569  1.00 70.39  ? 58   ASP A CA   1 
ATOM   172  C  C    . ASP A 1 24  ? 100.271 72.108 21.709  1.00 69.77  ? 58   ASP A C    1 
ATOM   173  O  O    . ASP A 1 24  ? 100.274 72.160 20.489  1.00 69.62  ? 58   ASP A O    1 
ATOM   174  C  CB   . ASP A 1 24  ? 102.787 71.888 21.774  1.00 71.41  ? 58   ASP A CB   1 
ATOM   175  C  CG   . ASP A 1 24  ? 104.054 72.243 22.573  1.00 74.15  ? 58   ASP A CG   1 
ATOM   176  O  OD1  . ASP A 1 24  ? 103.908 72.888 23.647  1.00 76.22  ? 58   ASP A OD1  1 
ATOM   177  O  OD2  . ASP A 1 24  ? 105.184 71.892 22.131  1.00 75.20  ? 58   ASP A OD2  1 
ATOM   178  N  N    . THR A 1 25  ? 99.183  72.059 22.420  1.00 69.33  ? 59   THR A N    1 
ATOM   179  C  CA   . THR A 1 25  ? 97.893  71.997 21.852  1.00 70.19  ? 59   THR A CA   1 
ATOM   180  C  C    . THR A 1 25  ? 97.421  73.300 21.235  1.00 72.43  ? 59   THR A C    1 
ATOM   181  O  O    . THR A 1 25  ? 97.401  74.313 21.897  1.00 75.31  ? 59   THR A O    1 
ATOM   182  C  CB   . THR A 1 25  ? 97.000  71.638 22.974  1.00 69.02  ? 59   THR A CB   1 
ATOM   183  O  OG1  . THR A 1 25  ? 96.852  70.235 22.967  1.00 68.40  ? 59   THR A OG1  1 
ATOM   184  C  CG2  . THR A 1 25  ? 95.699  72.411 22.934  1.00 66.97  ? 59   THR A CG2  1 
ATOM   185  N  N    . LYS A 1 26  ? 97.006  73.284 19.978  1.00 73.70  ? 60   LYS A N    1 
ATOM   186  C  CA   . LYS A 1 26  ? 96.447  74.485 19.324  1.00 72.50  ? 60   LYS A CA   1 
ATOM   187  C  C    . LYS A 1 26  ? 95.310  73.992 18.459  1.00 71.66  ? 60   LYS A C    1 
ATOM   188  O  O    . LYS A 1 26  ? 95.311  72.839 18.022  1.00 73.44  ? 60   LYS A O    1 
ATOM   189  C  CB   . LYS A 1 26  ? 97.447  75.177 18.414  1.00 72.51  ? 60   LYS A CB   1 
ATOM   190  C  CG   . LYS A 1 26  ? 98.029  74.280 17.405  1.00 74.87  ? 60   LYS A CG   1 
ATOM   191  C  CD   . LYS A 1 26  ? 98.379  75.043 16.142  1.00 78.16  ? 60   LYS A CD   1 
ATOM   192  C  CE   . LYS A 1 26  ? 99.747  75.685 16.204  1.00 80.08  ? 60   LYS A CE   1 
ATOM   193  N  NZ   . LYS A 1 26  ? 100.134 76.178 14.837  1.00 80.65  ? 60   LYS A NZ   1 
ATOM   194  N  N    . VAL A 1 27  ? 94.335  74.836 18.176  1.00 69.87  ? 61   VAL A N    1 
ATOM   195  C  CA   . VAL A 1 27  ? 93.229  74.385 17.335  1.00 66.34  ? 61   VAL A CA   1 
ATOM   196  C  C    . VAL A 1 27  ? 93.578  74.427 15.857  1.00 66.05  ? 61   VAL A C    1 
ATOM   197  O  O    . VAL A 1 27  ? 94.295  75.286 15.428  1.00 65.98  ? 61   VAL A O    1 
ATOM   198  C  CB   . VAL A 1 27  ? 92.035  75.235 17.552  1.00 62.92  ? 61   VAL A CB   1 
ATOM   199  C  CG1  . VAL A 1 27  ? 90.973  74.784 16.642  1.00 61.88  ? 61   VAL A CG1  1 
ATOM   200  C  CG2  . VAL A 1 27  ? 91.626  75.176 18.974  1.00 59.80  ? 61   VAL A CG2  1 
ATOM   201  N  N    . ILE A 1 28  ? 93.102  73.508 15.049  1.00 66.96  ? 62   ILE A N    1 
ATOM   202  C  CA   . ILE A 1 28  ? 93.457  73.626 13.647  1.00 68.12  ? 62   ILE A CA   1 
ATOM   203  C  C    . ILE A 1 28  ? 92.341  73.217 12.706  1.00 70.03  ? 62   ILE A C    1 
ATOM   204  O  O    . ILE A 1 28  ? 92.572  73.114 11.489  1.00 69.91  ? 62   ILE A O    1 
ATOM   205  C  CB   . ILE A 1 28  ? 94.711  72.799 13.266  1.00 66.75  ? 62   ILE A CB   1 
ATOM   206  C  CG1  . ILE A 1 28  ? 94.445  71.315 13.469  1.00 66.38  ? 62   ILE A CG1  1 
ATOM   207  C  CG2  . ILE A 1 28  ? 95.881  73.224 14.076  1.00 65.33  ? 62   ILE A CG2  1 
ATOM   208  C  CD1  . ILE A 1 28  ? 95.374  70.485 12.652  1.00 65.38  ? 62   ILE A CD1  1 
ATOM   209  N  N    . GLY A 1 29  ? 91.155  72.997 13.277  1.00 71.30  ? 63   GLY A N    1 
ATOM   210  C  CA   . GLY A 1 29  ? 90.018  72.609 12.485  1.00 73.69  ? 63   GLY A CA   1 
ATOM   211  C  C    . GLY A 1 29  ? 88.765  72.521 13.310  1.00 76.07  ? 63   GLY A C    1 
ATOM   212  O  O    . GLY A 1 29  ? 88.811  72.329 14.504  1.00 76.20  ? 63   GLY A O    1 
ATOM   213  N  N    . ASN A 1 30  ? 87.631  72.670 12.642  1.00 79.84  ? 64   ASN A N    1 
ATOM   214  C  CA   . ASN A 1 30  ? 86.313  72.568 13.255  1.00 83.26  ? 64   ASN A CA   1 
ATOM   215  C  C    . ASN A 1 30  ? 85.384  71.733 12.448  1.00 86.14  ? 64   ASN A C    1 
ATOM   216  O  O    . ASN A 1 30  ? 85.716  71.411 11.298  1.00 87.83  ? 64   ASN A O    1 
ATOM   217  C  CB   . ASN A 1 30  ? 85.752  73.903 13.402  1.00 83.99  ? 64   ASN A CB   1 
ATOM   218  C  CG   . ASN A 1 30  ? 86.082  74.428 14.688  1.00 88.06  ? 64   ASN A CG   1 
ATOM   219  O  OD1  . ASN A 1 30  ? 85.518  73.944 15.696  1.00 89.54  ? 64   ASN A OD1  1 
ATOM   220  N  ND2  . ASN A 1 30  ? 87.059  75.382 14.739  1.00 87.55  ? 64   ASN A ND2  1 
ATOM   221  N  N    . GLY A 1 31  ? 84.235  71.365 13.022  1.00 87.69  ? 65   GLY A N    1 
ATOM   222  C  CA   . GLY A 1 31  ? 83.302  70.515 12.280  1.00 89.20  ? 65   GLY A CA   1 
ATOM   223  C  C    . GLY A 1 31  ? 82.026  70.266 13.039  1.00 91.09  ? 65   GLY A C    1 
ATOM   224  O  O    . GLY A 1 31  ? 81.894  70.663 14.205  1.00 90.89  ? 65   GLY A O    1 
ATOM   225  N  N    . SER A 1 32  ? 81.060  69.623 12.398  1.00 93.09  ? 66   SER A N    1 
ATOM   226  C  CA   . SER A 1 32  ? 79.787  69.370 13.100  1.00 95.50  ? 66   SER A CA   1 
ATOM   227  C  C    . SER A 1 32  ? 79.910  68.053 13.907  1.00 94.86  ? 66   SER A C    1 
ATOM   228  O  O    . SER A 1 32  ? 78.965  67.554 14.527  1.00 93.73  ? 66   SER A O    1 
ATOM   229  C  CB   . SER A 1 32  ? 78.563  69.362 12.107  1.00 97.11  ? 66   SER A CB   1 
ATOM   230  O  OG   . SER A 1 32  ? 78.397  68.154 11.359  1.00 100.39 ? 66   SER A OG   1 
ATOM   231  N  N    . PHE A 1 33  ? 81.105  67.481 13.869  1.00 95.24  ? 67   PHE A N    1 
ATOM   232  C  CA   . PHE A 1 33  ? 81.367  66.272 14.636  1.00 95.31  ? 67   PHE A CA   1 
ATOM   233  C  C    . PHE A 1 33  ? 82.604  66.558 15.569  1.00 94.41  ? 67   PHE A C    1 
ATOM   234  O  O    . PHE A 1 33  ? 83.324  65.617 15.930  1.00 95.68  ? 67   PHE A O    1 
ATOM   235  C  CB   . PHE A 1 33  ? 81.609  65.035 13.708  1.00 96.17  ? 67   PHE A CB   1 
ATOM   236  C  CG   . PHE A 1 33  ? 80.381  64.600 12.881  1.00 99.19  ? 67   PHE A CG   1 
ATOM   237  C  CD1  . PHE A 1 33  ? 80.090  65.175 11.601  1.00 99.56  ? 67   PHE A CD1  1 
ATOM   238  C  CD2  . PHE A 1 33  ? 79.480  63.630 13.378  1.00 99.84  ? 67   PHE A CD2  1 
ATOM   239  C  CE1  . PHE A 1 33  ? 78.930  64.789 10.858  1.00 98.38  ? 67   PHE A CE1  1 
ATOM   240  C  CE2  . PHE A 1 33  ? 78.303  63.246 12.633  1.00 99.21  ? 67   PHE A CE2  1 
ATOM   241  C  CZ   . PHE A 1 33  ? 78.043  63.829 11.385  1.00 98.91  ? 67   PHE A CZ   1 
ATOM   242  N  N    . GLY A 1 34  ? 82.829  67.833 15.954  1.00 91.22  ? 68   GLY A N    1 
ATOM   243  C  CA   . GLY A 1 34  ? 83.944  68.162 16.834  1.00 87.29  ? 68   GLY A CA   1 
ATOM   244  C  C    . GLY A 1 34  ? 85.142  68.996 16.345  1.00 83.66  ? 68   GLY A C    1 
ATOM   245  O  O    . GLY A 1 34  ? 85.271  69.298 15.175  1.00 84.13  ? 68   GLY A O    1 
ATOM   246  N  N    . VAL A 1 35  ? 86.027  69.331 17.279  1.00 79.25  ? 69   VAL A N    1 
ATOM   247  C  CA   . VAL A 1 35  ? 87.216  70.121 17.044  1.00 75.26  ? 69   VAL A CA   1 
ATOM   248  C  C    . VAL A 1 35  ? 88.486  69.294 16.798  1.00 73.31  ? 69   VAL A C    1 
ATOM   249  O  O    . VAL A 1 35  ? 88.659  68.208 17.338  1.00 72.41  ? 69   VAL A O    1 
ATOM   250  C  CB   . VAL A 1 35  ? 87.508  70.955 18.260  1.00 75.91  ? 69   VAL A CB   1 
ATOM   251  C  CG1  . VAL A 1 35  ? 88.677  71.942 17.983  1.00 72.83  ? 69   VAL A CG1  1 
ATOM   252  C  CG2  . VAL A 1 35  ? 86.217  71.595 18.723  1.00 74.95  ? 69   VAL A CG2  1 
ATOM   253  N  N    . VAL A 1 36  ? 89.404  69.833 16.016  1.00 70.51  ? 70   VAL A N    1 
ATOM   254  C  CA   . VAL A 1 36  ? 90.623  69.129 15.717  1.00 67.86  ? 70   VAL A CA   1 
ATOM   255  C  C    . VAL A 1 36  ? 91.783  69.993 16.148  1.00 66.83  ? 70   VAL A C    1 
ATOM   256  O  O    . VAL A 1 36  ? 91.907  71.130 15.697  1.00 66.50  ? 70   VAL A O    1 
ATOM   257  C  CB   . VAL A 1 36  ? 90.728  68.813 14.188  1.00 67.59  ? 70   VAL A CB   1 
ATOM   258  C  CG1  . VAL A 1 36  ? 92.043  68.105 13.848  1.00 65.00  ? 70   VAL A CG1  1 
ATOM   259  C  CG2  . VAL A 1 36  ? 89.561  67.956 13.764  1.00 66.65  ? 70   VAL A CG2  1 
ATOM   260  N  N    . TYR A 1 37  ? 92.629  69.445 17.024  1.00 65.19  ? 71   TYR A N    1 
ATOM   261  C  CA   . TYR A 1 37  ? 93.793  70.167 17.504  1.00 63.28  ? 71   TYR A CA   1 
ATOM   262  C  C    . TYR A 1 37  ? 95.031  69.525 17.032  1.00 62.83  ? 71   TYR A C    1 
ATOM   263  O  O    . TYR A 1 37  ? 95.076  68.337 16.719  1.00 62.31  ? 71   TYR A O    1 
ATOM   264  C  CB   . TYR A 1 37  ? 93.914  70.150 19.023  1.00 61.71  ? 71   TYR A CB   1 
ATOM   265  C  CG   . TYR A 1 37  ? 92.684  70.537 19.762  1.00 61.46  ? 71   TYR A CG   1 
ATOM   266  C  CD1  . TYR A 1 37  ? 91.588  69.676 19.836  1.00 61.20  ? 71   TYR A CD1  1 
ATOM   267  C  CD2  . TYR A 1 37  ? 92.609  71.772 20.406  1.00 60.99  ? 71   TYR A CD2  1 
ATOM   268  C  CE1  . TYR A 1 37  ? 90.439  70.052 20.551  1.00 62.16  ? 71   TYR A CE1  1 
ATOM   269  C  CE2  . TYR A 1 37  ? 91.470  72.158 21.124  1.00 60.70  ? 71   TYR A CE2  1 
ATOM   270  C  CZ   . TYR A 1 37  ? 90.398  71.300 21.193  1.00 61.62  ? 71   TYR A CZ   1 
ATOM   271  O  OH   . TYR A 1 37  ? 89.294  71.693 21.905  1.00 63.42  ? 71   TYR A OH   1 
ATOM   272  N  N    . GLN A 1 38  ? 96.079  70.315 17.004  1.00 63.95  ? 72   GLN A N    1 
ATOM   273  C  CA   . GLN A 1 38  ? 97.369  69.767 16.693  1.00 64.33  ? 72   GLN A CA   1 
ATOM   274  C  C    . GLN A 1 38  ? 97.994  69.630 18.078  1.00 64.38  ? 72   GLN A C    1 
ATOM   275  O  O    . GLN A 1 38  ? 97.598  70.366 19.011  1.00 63.49  ? 72   GLN A O    1 
ATOM   276  C  CB   . GLN A 1 38  ? 98.176  70.713 15.909  1.00 64.78  ? 72   GLN A CB   1 
ATOM   277  C  CG   . GLN A 1 38  ? 99.463  70.092 15.638  1.00 67.23  ? 72   GLN A CG   1 
ATOM   278  C  CD   . GLN A 1 38  ? 100.439 71.120 15.227  1.00 69.22  ? 72   GLN A CD   1 
ATOM   279  O  OE1  . GLN A 1 38  ? 101.111 70.968 14.212  1.00 70.35  ? 72   GLN A OE1  1 
ATOM   280  N  NE2  . GLN A 1 38  ? 100.530 72.198 16.006  1.00 69.40  ? 72   GLN A NE2  1 
ATOM   281  N  N    . ALA A 1 39  ? 98.940  68.694 18.236  1.00 63.29  ? 73   ALA A N    1 
ATOM   282  C  CA   . ALA A 1 39  ? 99.576  68.464 19.547  1.00 62.10  ? 73   ALA A CA   1 
ATOM   283  C  C    . ALA A 1 39  ? 100.884 67.755 19.384  1.00 63.25  ? 73   ALA A C    1 
ATOM   284  O  O    . ALA A 1 39  ? 101.177 67.228 18.309  1.00 63.40  ? 73   ALA A O    1 
ATOM   285  C  CB   . ALA A 1 39  ? 98.678  67.672 20.438  1.00 59.01  ? 73   ALA A CB   1 
ATOM   286  N  N    . LYS A 1 40  ? 101.697 67.752 20.437  1.00 64.90  ? 74   LYS A N    1 
ATOM   287  C  CA   . LYS A 1 40  ? 102.975 67.067 20.344  1.00 65.97  ? 74   LYS A CA   1 
ATOM   288  C  C    . LYS A 1 40  ? 103.022 65.998 21.398  1.00 66.31  ? 74   LYS A C    1 
ATOM   289  O  O    . LYS A 1 40  ? 102.706 66.247 22.579  1.00 65.70  ? 74   LYS A O    1 
ATOM   290  C  CB   . LYS A 1 40  ? 104.135 68.046 20.528  1.00 67.38  ? 74   LYS A CB   1 
ATOM   291  C  CG   . LYS A 1 40  ? 105.498 67.400 20.239  1.00 71.07  ? 74   LYS A CG   1 
ATOM   292  C  CD   . LYS A 1 40  ? 106.672 68.396 20.280  1.00 75.13  ? 74   LYS A CD   1 
ATOM   293  C  CE   . LYS A 1 40  ? 106.864 68.983 21.692  1.00 78.71  ? 74   LYS A CE   1 
ATOM   294  N  NZ   . LYS A 1 40  ? 107.647 70.280 21.714  1.00 82.09  ? 74   LYS A NZ   1 
ATOM   295  N  N    . LEU A 1 41  ? 103.371 64.787 20.981  1.00 66.79  ? 75   LEU A N    1 
ATOM   296  C  CA   . LEU A 1 41  ? 103.484 63.710 21.964  1.00 68.23  ? 75   LEU A CA   1 
ATOM   297  C  C    . LEU A 1 41  ? 104.793 64.006 22.696  1.00 69.39  ? 75   LEU A C    1 
ATOM   298  O  O    . LEU A 1 41  ? 105.857 64.131 22.071  1.00 67.87  ? 75   LEU A O    1 
ATOM   299  C  CB   . LEU A 1 41  ? 103.533 62.345 21.276  1.00 66.41  ? 75   LEU A CB   1 
ATOM   300  C  CG   . LEU A 1 41  ? 102.252 61.923 20.587  1.00 64.04  ? 75   LEU A CG   1 
ATOM   301  C  CD1  . LEU A 1 41  ? 102.483 60.618 19.855  1.00 64.30  ? 75   LEU A CD1  1 
ATOM   302  C  CD2  . LEU A 1 41  ? 101.164 61.791 21.594  1.00 62.39  ? 75   LEU A CD2  1 
ATOM   303  N  N    . CYS A 1 42  ? 104.694 64.119 24.019  1.00 71.90  ? 76   CYS A N    1 
ATOM   304  C  CA   . CYS A 1 42  ? 105.837 64.459 24.872  1.00 73.69  ? 76   CYS A CA   1 
ATOM   305  C  C    . CYS A 1 42  ? 107.093 63.658 24.688  1.00 76.72  ? 76   CYS A C    1 
ATOM   306  O  O    . CYS A 1 42  ? 108.128 64.168 24.219  1.00 76.75  ? 76   CYS A O    1 
ATOM   307  C  CB   . CYS A 1 42  ? 105.436 64.378 26.323  1.00 70.91  ? 76   CYS A CB   1 
ATOM   308  S  SG   . CYS A 1 42  ? 104.269 65.666 26.816  1.00 71.70  ? 76   CYS A SG   1 
ATOM   309  N  N    . ASP A 1 43  ? 107.003 62.385 25.031  1.00 80.33  ? 77   ASP A N    1 
ATOM   310  C  CA   . ASP A 1 43  ? 108.199 61.572 25.001  1.00 83.97  ? 77   ASP A CA   1 
ATOM   311  C  C    . ASP A 1 43  ? 108.816 61.261 23.617  1.00 82.67  ? 77   ASP A C    1 
ATOM   312  O  O    . ASP A 1 43  ? 110.009 60.958 23.534  1.00 83.34  ? 77   ASP A O    1 
ATOM   313  C  CB   . ASP A 1 43  ? 107.970 60.301 25.875  1.00 88.50  ? 77   ASP A CB   1 
ATOM   314  C  CG   . ASP A 1 43  ? 107.291 59.164 25.092  1.00 92.30  ? 77   ASP A CG   1 
ATOM   315  O  OD1  . ASP A 1 43  ? 106.745 59.458 23.988  1.00 92.30  ? 77   ASP A OD1  1 
ATOM   316  O  OD2  . ASP A 1 43  ? 107.323 57.986 25.601  1.00 93.54  ? 77   ASP A OD2  1 
ATOM   317  N  N    . SER A 1 44  ? 108.051 61.366 22.534  1.00 81.54  ? 78   SER A N    1 
ATOM   318  C  CA   . SER A 1 44  ? 108.631 61.096 21.208  1.00 80.04  ? 78   SER A CA   1 
ATOM   319  C  C    . SER A 1 44  ? 108.792 62.368 20.375  1.00 79.31  ? 78   SER A C    1 
ATOM   320  O  O    . SER A 1 44  ? 109.482 62.372 19.356  1.00 78.62  ? 78   SER A O    1 
ATOM   321  C  CB   . SER A 1 44  ? 107.790 60.086 20.437  1.00 79.73  ? 78   SER A CB   1 
ATOM   322  O  OG   . SER A 1 44  ? 106.991 60.731 19.463  1.00 79.51  ? 78   SER A OG   1 
ATOM   323  N  N    . GLY A 1 45  ? 108.157 63.451 20.806  1.00 78.40  ? 79   GLY A N    1 
ATOM   324  C  CA   . GLY A 1 45  ? 108.297 64.694 20.066  1.00 77.63  ? 79   GLY A CA   1 
ATOM   325  C  C    . GLY A 1 45  ? 107.428 64.810 18.819  1.00 77.20  ? 79   GLY A C    1 
ATOM   326  O  O    . GLY A 1 45  ? 107.301 65.907 18.255  1.00 76.22  ? 79   GLY A O    1 
ATOM   327  N  N    . GLU A 1 46  ? 106.818 63.682 18.422  1.00 76.35  ? 80   GLU A N    1 
ATOM   328  C  CA   . GLU A 1 46  ? 105.937 63.590 17.257  1.00 74.00  ? 80   GLU A CA   1 
ATOM   329  C  C    . GLU A 1 46  ? 104.698 64.459 17.408  1.00 71.42  ? 80   GLU A C    1 
ATOM   330  O  O    . GLU A 1 46  ? 104.140 64.637 18.497  1.00 70.33  ? 80   GLU A O    1 
ATOM   331  C  CB   . GLU A 1 46  ? 105.495 62.133 17.013  1.00 76.88  ? 80   GLU A CB   1 
ATOM   332  C  CG   . GLU A 1 46  ? 106.320 61.339 15.976  1.00 80.58  ? 80   GLU A CG   1 
ATOM   333  C  CD   . GLU A 1 46  ? 106.109 59.799 16.035  1.00 83.50  ? 80   GLU A CD   1 
ATOM   334  O  OE1  . GLU A 1 46  ? 106.309 59.201 17.126  1.00 84.41  ? 80   GLU A OE1  1 
ATOM   335  O  OE2  . GLU A 1 46  ? 105.751 59.184 14.990  1.00 85.38  ? 80   GLU A OE2  1 
ATOM   336  N  N    . LEU A 1 47  ? 104.301 64.989 16.261  1.00 68.91  ? 81   LEU A N    1 
ATOM   337  C  CA   . LEU A 1 47  ? 103.133 65.827 16.107  1.00 66.08  ? 81   LEU A CA   1 
ATOM   338  C  C    . LEU A 1 47  ? 101.950 64.950 15.755  1.00 64.68  ? 81   LEU A C    1 
ATOM   339  O  O    . LEU A 1 47  ? 102.012 64.075 14.889  1.00 64.46  ? 81   LEU A O    1 
ATOM   340  C  CB   . LEU A 1 47  ? 103.344 66.794 14.969  1.00 65.20  ? 81   LEU A CB   1 
ATOM   341  C  CG   . LEU A 1 47  ? 104.122 68.037 15.311  1.00 64.43  ? 81   LEU A CG   1 
ATOM   342  C  CD1  . LEU A 1 47  ? 104.326 68.846 14.070  1.00 61.83  ? 81   LEU A CD1  1 
ATOM   343  C  CD2  . LEU A 1 47  ? 103.347 68.837 16.362  1.00 66.11  ? 81   LEU A CD2  1 
ATOM   344  N  N    . VAL A 1 48  ? 100.846 65.183 16.405  1.00 62.59  ? 82   VAL A N    1 
ATOM   345  C  CA   . VAL A 1 48  ? 99.707  64.388 16.115  1.00 60.55  ? 82   VAL A CA   1 
ATOM   346  C  C    . VAL A 1 48  ? 98.509  65.316 16.009  1.00 61.82  ? 82   VAL A C    1 
ATOM   347  O  O    . VAL A 1 48  ? 98.590  66.534 16.252  1.00 62.94  ? 82   VAL A O    1 
ATOM   348  C  CB   . VAL A 1 48  ? 99.488  63.355 17.254  1.00 58.34  ? 82   VAL A CB   1 
ATOM   349  C  CG1  . VAL A 1 48  ? 100.705 62.470 17.366  1.00 55.41  ? 82   VAL A CG1  1 
ATOM   350  C  CG2  . VAL A 1 48  ? 99.164  64.068 18.536  1.00 53.55  ? 82   VAL A CG2  1 
ATOM   351  N  N    . ALA A 1 49  ? 97.380  64.748 15.637  1.00 61.21  ? 83   ALA A N    1 
ATOM   352  C  CA   . ALA A 1 49  ? 96.167  65.521 15.569  1.00 59.84  ? 83   ALA A CA   1 
ATOM   353  C  C    . ALA A 1 49  ? 95.243  64.843 16.542  1.00 59.01  ? 83   ALA A C    1 
ATOM   354  O  O    . ALA A 1 49  ? 95.268  63.606 16.684  1.00 59.41  ? 83   ALA A O    1 
ATOM   355  C  CB   . ALA A 1 49  ? 95.592  65.458 14.198  1.00 60.35  ? 83   ALA A CB   1 
ATOM   356  N  N    . ILE A 1 50  ? 94.420  65.626 17.215  1.00 57.23  ? 84   ILE A N    1 
ATOM   357  C  CA   . ILE A 1 50  ? 93.478  65.073 18.158  1.00 56.65  ? 84   ILE A CA   1 
ATOM   358  C  C    . ILE A 1 50  ? 92.162  65.668 17.758  1.00 57.73  ? 84   ILE A C    1 
ATOM   359  O  O    . ILE A 1 50  ? 92.037  66.893 17.671  1.00 59.33  ? 84   ILE A O    1 
ATOM   360  C  CB   . ILE A 1 50  ? 93.830  65.520 19.620  1.00 55.49  ? 84   ILE A CB   1 
ATOM   361  C  CG1  . ILE A 1 50  ? 95.287  65.139 19.921  1.00 54.47  ? 84   ILE A CG1  1 
ATOM   362  C  CG2  . ILE A 1 50  ? 92.838  64.876 20.638  1.00 52.46  ? 84   ILE A CG2  1 
ATOM   363  C  CD1  . ILE A 1 50  ? 95.744  65.362 21.330  1.00 52.66  ? 84   ILE A CD1  1 
ATOM   364  N  N    . LYS A 1 51  ? 91.171  64.832 17.500  1.00 58.48  ? 85   LYS A N    1 
ATOM   365  C  CA   . LYS A 1 51  ? 89.857  65.342 17.123  1.00 59.86  ? 85   LYS A CA   1 
ATOM   366  C  C    . LYS A 1 51  ? 89.014  65.043 18.335  1.00 60.52  ? 85   LYS A C    1 
ATOM   367  O  O    . LYS A 1 51  ? 89.013  63.920 18.787  1.00 60.91  ? 85   LYS A O    1 
ATOM   368  C  CB   . LYS A 1 51  ? 89.360  64.593 15.878  1.00 61.22  ? 85   LYS A CB   1 
ATOM   369  C  CG   . LYS A 1 51  ? 87.981  64.977 15.405  1.00 61.97  ? 85   LYS A CG   1 
ATOM   370  C  CD   . LYS A 1 51  ? 87.623  64.197 14.176  1.00 62.40  ? 85   LYS A CD   1 
ATOM   371  C  CE   . LYS A 1 51  ? 86.367  64.749 13.529  1.00 61.47  ? 85   LYS A CE   1 
ATOM   372  N  NZ   . LYS A 1 51  ? 86.040  63.907 12.330  1.00 61.40  ? 85   LYS A NZ   1 
ATOM   373  N  N    . LYS A 1 52  ? 88.327  66.046 18.874  1.00 62.36  ? 86   LYS A N    1 
ATOM   374  C  CA   . LYS A 1 52  ? 87.506  65.908 20.088  1.00 64.05  ? 86   LYS A CA   1 
ATOM   375  C  C    . LYS A 1 52  ? 86.027  66.137 19.772  1.00 65.25  ? 86   LYS A C    1 
ATOM   376  O  O    . LYS A 1 52  ? 85.612  67.228 19.405  1.00 63.78  ? 86   LYS A O    1 
ATOM   377  C  CB   . LYS A 1 52  ? 88.011  66.937 21.140  1.00 65.27  ? 86   LYS A CB   1 
ATOM   378  C  CG   . LYS A 1 52  ? 87.394  66.911 22.553  1.00 67.00  ? 86   LYS A CG   1 
ATOM   379  C  CD   . LYS A 1 52  ? 87.854  68.139 23.366  1.00 69.76  ? 86   LYS A CD   1 
ATOM   380  C  CE   . LYS A 1 52  ? 87.231  68.176 24.779  1.00 72.98  ? 86   LYS A CE   1 
ATOM   381  N  NZ   . LYS A 1 52  ? 88.011  67.445 25.861  1.00 76.50  ? 86   LYS A NZ   1 
ATOM   382  N  N    . VAL A 1 53  ? 85.229  65.097 19.950  1.00 68.45  ? 87   VAL A N    1 
ATOM   383  C  CA   . VAL A 1 53  ? 83.792  65.157 19.676  1.00 72.62  ? 87   VAL A CA   1 
ATOM   384  C  C    . VAL A 1 53  ? 83.083  64.876 20.975  1.00 74.83  ? 87   VAL A C    1 
ATOM   385  O  O    . VAL A 1 53  ? 83.607  64.153 21.808  1.00 75.02  ? 87   VAL A O    1 
ATOM   386  C  CB   . VAL A 1 53  ? 83.374  64.050 18.659  1.00 74.00  ? 87   VAL A CB   1 
ATOM   387  C  CG1  . VAL A 1 53  ? 84.545  63.741 17.700  1.00 75.78  ? 87   VAL A CG1  1 
ATOM   388  C  CG2  . VAL A 1 53  ? 83.027  62.771 19.378  1.00 74.12  ? 87   VAL A CG2  1 
ATOM   389  N  N    . LEU A 1 54  ? 81.899  65.442 21.151  1.00 78.14  ? 88   LEU A N    1 
ATOM   390  C  CA   . LEU A 1 54  ? 81.111  65.203 22.345  1.00 81.40  ? 88   LEU A CA   1 
ATOM   391  C  C    . LEU A 1 54  ? 80.514  63.814 22.181  1.00 84.11  ? 88   LEU A C    1 
ATOM   392  O  O    . LEU A 1 54  ? 80.081  63.442 21.109  1.00 83.38  ? 88   LEU A O    1 
ATOM   393  C  CB   . LEU A 1 54  ? 80.030  66.241 22.431  1.00 82.25  ? 88   LEU A CB   1 
ATOM   394  C  CG   . LEU A 1 54  ? 79.438  66.600 23.790  1.00 84.83  ? 88   LEU A CG   1 
ATOM   395  C  CD1  . LEU A 1 54  ? 80.466  66.577 24.955  1.00 84.88  ? 88   LEU A CD1  1 
ATOM   396  C  CD2  . LEU A 1 54  ? 78.867  68.006 23.623  1.00 84.59  ? 88   LEU A CD2  1 
ATOM   397  N  N    . GLN A 1 55  ? 80.523  63.009 23.226  1.00 88.61  ? 89   GLN A N    1 
ATOM   398  C  CA   . GLN A 1 55  ? 80.005  61.656 23.093  1.00 92.91  ? 89   GLN A CA   1 
ATOM   399  C  C    . GLN A 1 55  ? 78.848  61.369 24.047  1.00 96.14  ? 89   GLN A C    1 
ATOM   400  O  O    . GLN A 1 55  ? 78.856  61.833 25.196  1.00 96.52  ? 89   GLN A O    1 
ATOM   401  C  CB   . GLN A 1 55  ? 81.114  60.637 23.297  1.00 93.30  ? 89   GLN A CB   1 
ATOM   402  C  CG   . GLN A 1 55  ? 80.743  59.267 22.798  1.00 94.99  ? 89   GLN A CG   1 
ATOM   403  C  CD   . GLN A 1 55  ? 80.112  59.349 21.415  1.00 95.58  ? 89   GLN A CD   1 
ATOM   404  O  OE1  . GLN A 1 55  ? 80.589  60.076 20.552  1.00 95.53  ? 89   GLN A OE1  1 
ATOM   405  N  NE2  . GLN A 1 55  ? 79.029  58.603 21.204  1.00 95.84  ? 89   GLN A NE2  1 
ATOM   406  N  N    . GLY A 1 56  ? 77.866  60.609 23.531  1.00 99.20  ? 90   GLY A N    1 
ATOM   407  C  CA   . GLY A 1 56  ? 76.658  60.248 24.250  1.00 102.38 ? 90   GLY A CA   1 
ATOM   408  C  C    . GLY A 1 56  ? 76.884  59.180 25.293  1.00 105.04 ? 90   GLY A C    1 
ATOM   409  O  O    . GLY A 1 56  ? 76.098  59.070 26.276  1.00 105.70 ? 90   GLY A O    1 
ATOM   410  N  N    . LYS A 1 57  ? 77.961  58.410 25.105  1.00 106.23 ? 91   LYS A N    1 
ATOM   411  C  CA   . LYS A 1 57  ? 78.311  57.322 26.036  1.00 107.77 ? 91   LYS A CA   1 
ATOM   412  C  C    . LYS A 1 57  ? 77.228  56.239 26.099  1.00 108.34 ? 91   LYS A C    1 
ATOM   413  O  O    . LYS A 1 57  ? 77.515  55.087 26.476  1.00 108.09 ? 91   LYS A O    1 
ATOM   414  C  CB   . LYS A 1 57  ? 78.569  57.856 27.446  1.00 106.83 ? 91   LYS A CB   1 
ATOM   415  C  CG   . LYS A 1 57  ? 80.049  58.042 27.749  1.00 107.51 ? 91   LYS A CG   1 
ATOM   416  C  CD   . LYS A 1 57  ? 80.905  56.745 27.626  1.00 104.80 ? 91   LYS A CD   1 
ATOM   417  C  CE   . LYS A 1 57  ? 82.314  56.994 28.210  1.00 102.73 ? 91   LYS A CE   1 
ATOM   418  N  NZ   . LYS A 1 57  ? 83.159  55.806 28.301  1.00 100.08 ? 91   LYS A NZ   1 
ATOM   419  N  N    . ALA A 1 58  ? 76.004  56.637 25.717  1.00 108.73 ? 92   ALA A N    1 
ATOM   420  C  CA   . ALA A 1 58  ? 74.819  55.786 25.671  1.00 108.37 ? 92   ALA A CA   1 
ATOM   421  C  C    . ALA A 1 58  ? 74.721  55.215 24.257  1.00 108.45 ? 92   ALA A C    1 
ATOM   422  O  O    . ALA A 1 58  ? 73.888  54.338 23.997  1.00 109.33 ? 92   ALA A O    1 
ATOM   423  C  CB   . ALA A 1 58  ? 73.559  56.610 25.978  1.00 108.16 ? 92   ALA A CB   1 
ATOM   424  N  N    . PHE A 1 59  ? 75.554  55.731 23.343  1.00 107.79 ? 93   PHE A N    1 
ATOM   425  C  CA   . PHE A 1 59  ? 75.574  55.273 21.930  1.00 106.15 ? 93   PHE A CA   1 
ATOM   426  C  C    . PHE A 1 59  ? 77.011  55.214 21.436  1.00 102.81 ? 93   PHE A C    1 
ATOM   427  O  O    . PHE A 1 59  ? 77.788  56.101 21.774  1.00 103.76 ? 93   PHE A O    1 
ATOM   428  C  CB   . PHE A 1 59  ? 74.764  56.229 21.013  1.00 108.73 ? 93   PHE A CB   1 
ATOM   429  C  CG   . PHE A 1 59  ? 73.368  56.536 21.523  1.00 111.17 ? 93   PHE A CG   1 
ATOM   430  C  CD1  . PHE A 1 59  ? 73.193  57.376 22.642  1.00 112.35 ? 93   PHE A CD1  1 
ATOM   431  C  CD2  . PHE A 1 59  ? 72.256  55.918 20.952  1.00 110.96 ? 93   PHE A CD2  1 
ATOM   432  C  CE1  . PHE A 1 59  ? 71.935  57.578 23.185  1.00 113.07 ? 93   PHE A CE1  1 
ATOM   433  C  CE2  . PHE A 1 59  ? 70.999  56.109 21.484  1.00 112.17 ? 93   PHE A CE2  1 
ATOM   434  C  CZ   . PHE A 1 59  ? 70.833  56.940 22.606  1.00 113.32 ? 93   PHE A CZ   1 
ATOM   435  N  N    . LYS A 1 60  ? 77.354  54.184 20.651  1.00 98.48  ? 94   LYS A N    1 
ATOM   436  C  CA   . LYS A 1 60  ? 78.710  54.008 20.094  1.00 93.82  ? 94   LYS A CA   1 
ATOM   437  C  C    . LYS A 1 60  ? 79.079  55.151 19.148  1.00 89.58  ? 94   LYS A C    1 
ATOM   438  O  O    . LYS A 1 60  ? 78.209  55.887 18.694  1.00 90.20  ? 94   LYS A O    1 
ATOM   439  C  CB   . LYS A 1 60  ? 78.794  52.700 19.332  1.00 95.59  ? 94   LYS A CB   1 
ATOM   440  C  CG   . LYS A 1 60  ? 78.834  51.444 20.205  1.00 99.86  ? 94   LYS A CG   1 
ATOM   441  C  CD   . LYS A 1 60  ? 78.930  50.168 19.329  1.00 103.45 ? 94   LYS A CD   1 
ATOM   442  C  CE   . LYS A 1 60  ? 79.705  49.027 20.027  1.00 105.51 ? 94   LYS A CE   1 
ATOM   443  N  NZ   . LYS A 1 60  ? 80.113  47.971 19.022  1.00 106.91 ? 94   LYS A NZ   1 
ATOM   444  N  N    . ASN A 1 61  ? 80.354  55.355 18.858  1.00 83.29  ? 95   ASN A N    1 
ATOM   445  C  CA   . ASN A 1 61  ? 80.666  56.433 17.931  1.00 76.94  ? 95   ASN A CA   1 
ATOM   446  C  C    . ASN A 1 61  ? 81.077  55.713 16.643  1.00 75.58  ? 95   ASN A C    1 
ATOM   447  O  O    . ASN A 1 61  ? 82.062  54.951 16.609  1.00 75.36  ? 95   ASN A O    1 
ATOM   448  C  CB   . ASN A 1 61  ? 81.767  57.330 18.486  1.00 72.49  ? 95   ASN A CB   1 
ATOM   449  C  CG   . ASN A 1 61  ? 82.317  58.260 17.458  1.00 69.97  ? 95   ASN A CG   1 
ATOM   450  O  OD1  . ASN A 1 61  ? 83.016  57.835 16.557  1.00 69.07  ? 95   ASN A OD1  1 
ATOM   451  N  ND2  . ASN A 1 61  ? 81.986  59.529 17.560  1.00 67.46  ? 95   ASN A ND2  1 
ATOM   452  N  N    . ARG A 1 62  ? 80.307  55.934 15.580  1.00 72.76  ? 96   ARG A N    1 
ATOM   453  C  CA   . ARG A 1 62  ? 80.562  55.235 14.339  1.00 70.42  ? 96   ARG A CA   1 
ATOM   454  C  C    . ARG A 1 62  ? 81.908  55.639 13.716  1.00 68.29  ? 96   ARG A C    1 
ATOM   455  O  O    . ARG A 1 62  ? 82.597  54.810 13.083  1.00 67.10  ? 96   ARG A O    1 
ATOM   456  C  CB   . ARG A 1 62  ? 79.384  55.480 13.387  1.00 72.53  ? 96   ARG A CB   1 
ATOM   457  C  CG   . ARG A 1 62  ? 79.036  54.368 12.388  1.00 74.47  ? 96   ARG A CG   1 
ATOM   458  C  CD   . ARG A 1 62  ? 78.019  54.889 11.340  1.00 76.20  ? 96   ARG A CD   1 
ATOM   459  N  NE   . ARG A 1 62  ? 76.584  54.702 11.649  1.00 77.55  ? 96   ARG A NE   1 
ATOM   460  C  CZ   . ARG A 1 62  ? 75.602  55.412 11.070  1.00 79.66  ? 96   ARG A CZ   1 
ATOM   461  N  NH1  . ARG A 1 62  ? 75.903  56.365 10.165  1.00 80.50  ? 96   ARG A NH1  1 
ATOM   462  N  NH2  . ARG A 1 62  ? 74.315  55.166 11.361  1.00 80.00  ? 96   ARG A NH2  1 
ATOM   463  N  N    . GLU A 1 63  ? 82.290  56.908 13.896  1.00 65.41  ? 97   GLU A N    1 
ATOM   464  C  CA   . GLU A 1 63  ? 83.556  57.364 13.348  1.00 62.22  ? 97   GLU A CA   1 
ATOM   465  C  C    . GLU A 1 63  ? 84.624  56.494 13.944  1.00 61.27  ? 97   GLU A C    1 
ATOM   466  O  O    . GLU A 1 63  ? 85.481  56.009 13.227  1.00 59.96  ? 97   GLU A O    1 
ATOM   467  C  CB   . GLU A 1 63  ? 83.830  58.813 13.668  1.00 61.55  ? 97   GLU A CB   1 
ATOM   468  C  CG   . GLU A 1 63  ? 85.063  59.291 12.979  1.00 64.32  ? 97   GLU A CG   1 
ATOM   469  C  CD   . GLU A 1 63  ? 85.204  60.841 12.959  1.00 67.92  ? 97   GLU A CD   1 
ATOM   470  O  OE1  . GLU A 1 63  ? 84.254  61.528 13.450  1.00 68.73  ? 97   GLU A OE1  1 
ATOM   471  O  OE2  . GLU A 1 63  ? 86.258  61.358 12.449  1.00 66.78  ? 97   GLU A OE2  1 
ATOM   472  N  N    . LEU A 1 64  ? 84.567  56.259 15.258  1.00 60.94  ? 98   LEU A N    1 
ATOM   473  C  CA   . LEU A 1 64  ? 85.592  55.446 15.897  1.00 60.65  ? 98   LEU A CA   1 
ATOM   474  C  C    . LEU A 1 64  ? 85.498  54.027 15.397  1.00 63.21  ? 98   LEU A C    1 
ATOM   475  O  O    . LEU A 1 64  ? 86.507  53.427 15.028  1.00 63.68  ? 98   LEU A O    1 
ATOM   476  C  CB   . LEU A 1 64  ? 85.466  55.473 17.419  1.00 57.12  ? 98   LEU A CB   1 
ATOM   477  C  CG   . LEU A 1 64  ? 86.460  54.631 18.232  1.00 53.96  ? 98   LEU A CG   1 
ATOM   478  C  CD1  . LEU A 1 64  ? 87.913  54.879 17.880  1.00 53.32  ? 98   LEU A CD1  1 
ATOM   479  C  CD2  . LEU A 1 64  ? 86.234  54.981 19.652  1.00 51.94  ? 98   LEU A CD2  1 
ATOM   480  N  N    . GLN A 1 65  ? 84.275  53.496 15.365  1.00 65.88  ? 99   GLN A N    1 
ATOM   481  C  CA   . GLN A 1 65  ? 84.014  52.132 14.922  1.00 67.85  ? 99   GLN A CA   1 
ATOM   482  C  C    . GLN A 1 65  ? 84.637  51.834 13.526  1.00 67.01  ? 99   GLN A C    1 
ATOM   483  O  O    . GLN A 1 65  ? 85.276  50.782 13.323  1.00 66.22  ? 99   GLN A O    1 
ATOM   484  C  CB   . GLN A 1 65  ? 82.507  51.917 14.961  1.00 72.51  ? 99   GLN A CB   1 
ATOM   485  C  CG   . GLN A 1 65  ? 82.041  50.478 14.802  1.00 81.68  ? 99   GLN A CG   1 
ATOM   486  C  CD   . GLN A 1 65  ? 80.479  50.340 14.769  1.00 87.18  ? 99   GLN A CD   1 
ATOM   487  O  OE1  . GLN A 1 65  ? 79.790  50.830 13.802  1.00 89.51  ? 99   GLN A OE1  1 
ATOM   488  N  NE2  . GLN A 1 65  ? 79.909  49.684 15.833  1.00 88.97  ? 99   GLN A NE2  1 
ATOM   489  N  N    . ILE A 1 66  ? 84.470  52.772 12.583  1.00 65.37  ? 100  ILE A N    1 
ATOM   490  C  CA   . ILE A 1 66  ? 85.010  52.657 11.223  1.00 63.38  ? 100  ILE A CA   1 
ATOM   491  C  C    . ILE A 1 66  ? 86.514  52.802 11.222  1.00 64.65  ? 100  ILE A C    1 
ATOM   492  O  O    . ILE A 1 66  ? 87.211  51.971 10.669  1.00 65.01  ? 100  ILE A O    1 
ATOM   493  C  CB   . ILE A 1 66  ? 84.371  53.713 10.263  1.00 60.93  ? 100  ILE A CB   1 
ATOM   494  C  CG1  . ILE A 1 66  ? 82.918  53.325 10.013  1.00 59.85  ? 100  ILE A CG1  1 
ATOM   495  C  CG2  . ILE A 1 66  ? 85.109  53.793 8.946   1.00 59.19  ? 100  ILE A CG2  1 
ATOM   496  C  CD1  . ILE A 1 66  ? 82.170  54.229 9.124   1.00 60.17  ? 100  ILE A CD1  1 
ATOM   497  N  N    . MET A 1 67  ? 87.026  53.861 11.834  1.00 66.82  ? 101  MET A N    1 
ATOM   498  C  CA   . MET A 1 67  ? 88.454  54.097 11.892  1.00 69.03  ? 101  MET A CA   1 
ATOM   499  C  C    . MET A 1 67  ? 89.217  52.908 12.445  1.00 70.34  ? 101  MET A C    1 
ATOM   500  O  O    . MET A 1 67  ? 90.306  52.585 11.989  1.00 69.47  ? 101  MET A O    1 
ATOM   501  C  CB   . MET A 1 67  ? 88.723  55.308 12.747  1.00 71.26  ? 101  MET A CB   1 
ATOM   502  C  CG   . MET A 1 67  ? 88.142  56.573 12.187  1.00 75.15  ? 101  MET A CG   1 
ATOM   503  S  SD   . MET A 1 67  ? 89.400  57.503 11.341  1.00 80.90  ? 101  MET A SD   1 
ATOM   504  C  CE   . MET A 1 67  ? 89.814  56.323 10.093  1.00 77.87  ? 101  MET A CE   1 
ATOM   505  N  N    . ARG A 1 68  ? 88.667  52.237 13.445  1.00 72.22  ? 102  ARG A N    1 
ATOM   506  C  CA   . ARG A 1 68  ? 89.372  51.093 13.994  1.00 74.05  ? 102  ARG A CA   1 
ATOM   507  C  C    . ARG A 1 68  ? 89.575  49.994 12.961  1.00 75.00  ? 102  ARG A C    1 
ATOM   508  O  O    . ARG A 1 68  ? 90.600  49.309 12.952  1.00 77.21  ? 102  ARG A O    1 
ATOM   509  C  CB   . ARG A 1 68  ? 88.643  50.568 15.192  1.00 73.30  ? 102  ARG A CB   1 
ATOM   510  C  CG   . ARG A 1 68  ? 88.613  51.615 16.256  1.00 78.00  ? 102  ARG A CG   1 
ATOM   511  C  CD   . ARG A 1 68  ? 88.187  51.069 17.574  1.00 79.71  ? 102  ARG A CD   1 
ATOM   512  N  NE   . ARG A 1 68  ? 89.247  50.260 18.169  1.00 82.27  ? 102  ARG A NE   1 
ATOM   513  C  CZ   . ARG A 1 68  ? 89.120  49.642 19.339  1.00 84.40  ? 102  ARG A CZ   1 
ATOM   514  N  NH1  . ARG A 1 68  ? 87.970  49.740 20.027  1.00 83.43  ? 102  ARG A NH1  1 
ATOM   515  N  NH2  . ARG A 1 68  ? 90.158  48.959 19.838  1.00 86.66  ? 102  ARG A NH2  1 
ATOM   516  N  N    . LYS A 1 69  ? 88.623  49.878 12.052  1.00 74.07  ? 103  LYS A N    1 
ATOM   517  C  CA   . LYS A 1 69  ? 88.625  48.877 11.040  1.00 72.78  ? 103  LYS A CA   1 
ATOM   518  C  C    . LYS A 1 69  ? 89.578  49.141 9.855   1.00 71.88  ? 103  LYS A C    1 
ATOM   519  O  O    . LYS A 1 69  ? 90.044  48.215 9.192   1.00 72.68  ? 103  LYS A O    1 
ATOM   520  C  CB   . LYS A 1 69  ? 87.178  48.730 10.561  1.00 75.20  ? 103  LYS A CB   1 
ATOM   521  C  CG   . LYS A 1 69  ? 87.004  47.682 9.480   1.00 81.21  ? 103  LYS A CG   1 
ATOM   522  C  CD   . LYS A 1 69  ? 85.555  47.580 8.890   1.00 85.14  ? 103  LYS A CD   1 
ATOM   523  C  CE   . LYS A 1 69  ? 84.422  47.277 9.918   1.00 85.40  ? 103  LYS A CE   1 
ATOM   524  N  NZ   . LYS A 1 69  ? 83.991  48.509 10.620  1.00 84.97  ? 103  LYS A NZ   1 
ATOM   525  N  N    . LEU A 1 70  ? 89.894  50.393 9.572   1.00 70.03  ? 104  LEU A N    1 
ATOM   526  C  CA   . LEU A 1 70  ? 90.718  50.685 8.404   1.00 67.71  ? 104  LEU A CA   1 
ATOM   527  C  C    . LEU A 1 70  ? 92.199  50.585 8.610   1.00 67.01  ? 104  LEU A C    1 
ATOM   528  O  O    . LEU A 1 70  ? 92.647  50.650 9.714   1.00 68.72  ? 104  LEU A O    1 
ATOM   529  C  CB   . LEU A 1 70  ? 90.389  52.085 7.902   1.00 64.98  ? 104  LEU A CB   1 
ATOM   530  C  CG   . LEU A 1 70  ? 88.906  52.247 7.689   1.00 63.92  ? 104  LEU A CG   1 
ATOM   531  C  CD1  . LEU A 1 70  ? 88.637  53.636 7.226   1.00 63.57  ? 104  LEU A CD1  1 
ATOM   532  C  CD2  . LEU A 1 70  ? 88.435  51.187 6.689   1.00 63.02  ? 104  LEU A CD2  1 
ATOM   533  N  N    . ASP A 1 71  ? 92.966  50.422 7.550   1.00 65.88  ? 105  ASP A N    1 
ATOM   534  C  CA   . ASP A 1 71  ? 94.411  50.431 7.633   1.00 65.10  ? 105  ASP A CA   1 
ATOM   535  C  C    . ASP A 1 71  ? 94.921  50.367 6.198   1.00 64.09  ? 105  ASP A C    1 
ATOM   536  O  O    . ASP A 1 71  ? 94.976  49.305 5.603   1.00 63.70  ? 105  ASP A O    1 
ATOM   537  C  CB   . ASP A 1 71  ? 94.902  49.258 8.437   1.00 68.85  ? 105  ASP A CB   1 
ATOM   538  C  CG   . ASP A 1 71  ? 96.419  49.191 8.520   1.00 72.43  ? 105  ASP A CG   1 
ATOM   539  O  OD1  . ASP A 1 71  ? 96.912  48.257 9.158   1.00 74.84  ? 105  ASP A OD1  1 
ATOM   540  O  OD2  . ASP A 1 71  ? 97.147  50.046 7.959   1.00 76.29  ? 105  ASP A OD2  1 
ATOM   541  N  N    . HIS A 1 72  ? 95.297  51.521 5.657   1.00 62.42  ? 106  HIS A N    1 
ATOM   542  C  CA   . HIS A 1 72  ? 95.716  51.658 4.273   1.00 62.41  ? 106  HIS A CA   1 
ATOM   543  C  C    . HIS A 1 72  ? 96.551  52.922 4.222   1.00 62.51  ? 106  HIS A C    1 
ATOM   544  O  O    . HIS A 1 72  ? 96.214  53.906 4.855   1.00 62.89  ? 106  HIS A O    1 
ATOM   545  C  CB   . HIS A 1 72  ? 94.477  51.822 3.351   1.00 61.70  ? 106  HIS A CB   1 
ATOM   546  C  CG   . HIS A 1 72  ? 94.813  52.013 1.896   1.00 62.52  ? 106  HIS A CG   1 
ATOM   547  N  ND1  . HIS A 1 72  ? 94.640  51.015 0.960   1.00 62.39  ? 106  HIS A ND1  1 
ATOM   548  C  CD2  . HIS A 1 72  ? 95.373  53.062 1.228   1.00 62.18  ? 106  HIS A CD2  1 
ATOM   549  C  CE1  . HIS A 1 72  ? 95.093  51.434 -0.217  1.00 61.56  ? 106  HIS A CE1  1 
ATOM   550  N  NE2  . HIS A 1 72  ? 95.543  52.670 -0.079  1.00 60.92  ? 106  HIS A NE2  1 
ATOM   551  N  N    . CYS A 1 73  ? 97.623  52.909 3.438   1.00 63.90  ? 107  CYS A N    1 
ATOM   552  C  CA   . CYS A 1 73  ? 98.532  54.049 3.344   1.00 64.94  ? 107  CYS A CA   1 
ATOM   553  C  C    . CYS A 1 73  ? 97.902  55.355 2.875   1.00 63.80  ? 107  CYS A C    1 
ATOM   554  O  O    . CYS A 1 73  ? 98.518  56.403 2.924   1.00 63.90  ? 107  CYS A O    1 
ATOM   555  C  CB   . CYS A 1 73  ? 99.715  53.690 2.433   1.00 67.95  ? 107  CYS A CB   1 
ATOM   556  S  SG   . CYS A 1 73  ? 99.350  53.473 0.666   1.00 75.75  ? 107  CYS A SG   1 
ATOM   557  N  N    . ASN A 1 74  ? 96.658  55.322 2.429   1.00 62.94  ? 108  ASN A N    1 
ATOM   558  C  CA   . ASN A 1 74  ? 96.042  56.541 1.956   1.00 60.92  ? 108  ASN A CA   1 
ATOM   559  C  C    . ASN A 1 74  ? 94.912  57.006 2.830   1.00 60.40  ? 108  ASN A C    1 
ATOM   560  O  O    . ASN A 1 74  ? 94.113  57.859 2.448   1.00 60.51  ? 108  ASN A O    1 
ATOM   561  C  CB   . ASN A 1 74  ? 95.590  56.358 0.527   1.00 60.25  ? 108  ASN A CB   1 
ATOM   562  C  CG   . ASN A 1 74  ? 96.724  56.447 -0.414  1.00 60.03  ? 108  ASN A CG   1 
ATOM   563  O  OD1  . ASN A 1 74  ? 97.394  57.463 -0.475  1.00 60.52  ? 108  ASN A OD1  1 
ATOM   564  N  ND2  . ASN A 1 74  ? 96.971  55.382 -1.149  1.00 60.74  ? 108  ASN A ND2  1 
ATOM   565  N  N    . ILE A 1 75  ? 94.857  56.452 4.026   1.00 59.74  ? 109  ILE A N    1 
ATOM   566  C  CA   . ILE A 1 75  ? 93.834  56.831 4.959   1.00 59.16  ? 109  ILE A CA   1 
ATOM   567  C  C    . ILE A 1 75  ? 94.561  57.177 6.219   1.00 59.83  ? 109  ILE A C    1 
ATOM   568  O  O    . ILE A 1 75  ? 95.436  56.418 6.673   1.00 60.37  ? 109  ILE A O    1 
ATOM   569  C  CB   . ILE A 1 75  ? 92.858  55.682 5.174   1.00 57.90  ? 109  ILE A CB   1 
ATOM   570  C  CG1  . ILE A 1 75  ? 92.281  55.332 3.793   1.00 58.47  ? 109  ILE A CG1  1 
ATOM   571  C  CG2  . ILE A 1 75  ? 91.825  56.038 6.227   1.00 53.89  ? 109  ILE A CG2  1 
ATOM   572  C  CD1  . ILE A 1 75  ? 91.015  54.546 3.786   1.00 60.48  ? 109  ILE A CD1  1 
ATOM   573  N  N    . VAL A 1 76  ? 94.223  58.332 6.774   1.00 58.97  ? 110  VAL A N    1 
ATOM   574  C  CA   . VAL A 1 76  ? 94.850  58.763 7.983   1.00 59.15  ? 110  VAL A CA   1 
ATOM   575  C  C    . VAL A 1 76  ? 94.706  57.726 9.130   1.00 60.03  ? 110  VAL A C    1 
ATOM   576  O  O    . VAL A 1 76  ? 93.598  57.236 9.429   1.00 60.56  ? 110  VAL A O    1 
ATOM   577  C  CB   . VAL A 1 76  ? 94.303  60.097 8.398   1.00 58.81  ? 110  VAL A CB   1 
ATOM   578  C  CG1  . VAL A 1 76  ? 92.918  59.939 8.979   1.00 59.76  ? 110  VAL A CG1  1 
ATOM   579  C  CG2  . VAL A 1 76  ? 95.245  60.730 9.371   1.00 59.87  ? 110  VAL A CG2  1 
ATOM   580  N  N    . ARG A 1 77  ? 95.835  57.411 9.766   1.00 60.26  ? 111  ARG A N    1 
ATOM   581  C  CA   . ARG A 1 77  ? 95.916  56.446 10.836  1.00 61.57  ? 111  ARG A CA   1 
ATOM   582  C  C    . ARG A 1 77  ? 95.454  56.924 12.222  1.00 60.94  ? 111  ARG A C    1 
ATOM   583  O  O    . ARG A 1 77  ? 95.857  57.991 12.692  1.00 60.48  ? 111  ARG A O    1 
ATOM   584  C  CB   . ARG A 1 77  ? 97.370  55.950 10.984  1.00 64.87  ? 111  ARG A CB   1 
ATOM   585  C  CG   . ARG A 1 77  ? 97.581  55.022 12.231  1.00 71.39  ? 111  ARG A CG   1 
ATOM   586  C  CD   . ARG A 1 77  ? 98.912  54.233 12.309  1.00 75.96  ? 111  ARG A CD   1 
ATOM   587  N  NE   . ARG A 1 77  ? 99.903  54.873 13.192  1.00 80.40  ? 111  ARG A NE   1 
ATOM   588  C  CZ   . ARG A 1 77  ? 100.995 55.517 12.756  1.00 82.92  ? 111  ARG A CZ   1 
ATOM   589  N  NH1  . ARG A 1 77  ? 101.233 55.588 11.427  1.00 85.15  ? 111  ARG A NH1  1 
ATOM   590  N  NH2  . ARG A 1 77  ? 101.833 56.118 13.622  1.00 81.20  ? 111  ARG A NH2  1 
ATOM   591  N  N    . LEU A 1 78  ? 94.624  56.119 12.880  1.00 58.92  ? 112  LEU A N    1 
ATOM   592  C  CA   . LEU A 1 78  ? 94.191  56.425 14.233  1.00 58.50  ? 112  LEU A CA   1 
ATOM   593  C  C    . LEU A 1 78  ? 95.255  55.823 15.215  1.00 60.56  ? 112  LEU A C    1 
ATOM   594  O  O    . LEU A 1 78  ? 95.477  54.609 15.242  1.00 61.65  ? 112  LEU A O    1 
ATOM   595  C  CB   . LEU A 1 78  ? 92.839  55.795 14.487  1.00 54.96  ? 112  LEU A CB   1 
ATOM   596  C  CG   . LEU A 1 78  ? 92.352  56.055 15.904  1.00 54.57  ? 112  LEU A CG   1 
ATOM   597  C  CD1  . LEU A 1 78  ? 91.843  57.473 15.966  1.00 55.11  ? 112  LEU A CD1  1 
ATOM   598  C  CD2  . LEU A 1 78  ? 91.217  55.112 16.316  1.00 54.85  ? 112  LEU A CD2  1 
ATOM   599  N  N    . ARG A 1 79  ? 95.935  56.637 16.025  1.00 61.81  ? 113  ARG A N    1 
ATOM   600  C  CA   . ARG A 1 79  ? 96.944  56.108 16.945  1.00 61.08  ? 113  ARG A CA   1 
ATOM   601  C  C    . ARG A 1 79  ? 96.324  55.626 18.259  1.00 61.02  ? 113  ARG A C    1 
ATOM   602  O  O    . ARG A 1 79  ? 96.595  54.502 18.731  1.00 62.29  ? 113  ARG A O    1 
ATOM   603  C  CB   . ARG A 1 79  ? 98.004  57.155 17.244  1.00 61.04  ? 113  ARG A CB   1 
ATOM   604  C  CG   . ARG A 1 79  ? 98.802  57.579 16.055  1.00 63.32  ? 113  ARG A CG   1 
ATOM   605  C  CD   . ARG A 1 79  ? 100.007 58.279 16.531  1.00 66.61  ? 113  ARG A CD   1 
ATOM   606  N  NE   . ARG A 1 79  ? 100.800 58.869 15.468  1.00 70.91  ? 113  ARG A NE   1 
ATOM   607  C  CZ   . ARG A 1 79  ? 102.099 59.150 15.588  1.00 73.45  ? 113  ARG A CZ   1 
ATOM   608  N  NH1  . ARG A 1 79  ? 102.735 58.888 16.739  1.00 71.35  ? 113  ARG A NH1  1 
ATOM   609  N  NH2  . ARG A 1 79  ? 102.762 59.676 14.543  1.00 74.65  ? 113  ARG A NH2  1 
ATOM   610  N  N    . TYR A 1 80  ? 95.508  56.464 18.881  1.00 60.18  ? 114  TYR A N    1 
ATOM   611  C  CA   . TYR A 1 80  ? 94.868  56.071 20.140  1.00 59.52  ? 114  TYR A CA   1 
ATOM   612  C  C    . TYR A 1 80  ? 93.552  56.808 20.189  1.00 59.37  ? 114  TYR A C    1 
ATOM   613  O  O    . TYR A 1 80  ? 93.245  57.659 19.349  1.00 58.30  ? 114  TYR A O    1 
ATOM   614  C  CB   . TYR A 1 80  ? 95.665  56.545 21.413  1.00 59.13  ? 114  TYR A CB   1 
ATOM   615  C  CG   . TYR A 1 80  ? 97.162  56.380 21.395  1.00 59.79  ? 114  TYR A CG   1 
ATOM   616  C  CD1  . TYR A 1 80  ? 97.999  57.386 20.881  1.00 60.76  ? 114  TYR A CD1  1 
ATOM   617  C  CD2  . TYR A 1 80  ? 97.751  55.192 21.843  1.00 60.31  ? 114  TYR A CD2  1 
ATOM   618  C  CE1  . TYR A 1 80  ? 99.396  57.213 20.803  1.00 61.90  ? 114  TYR A CE1  1 
ATOM   619  C  CE2  . TYR A 1 80  ? 99.131  54.991 21.786  1.00 61.36  ? 114  TYR A CE2  1 
ATOM   620  C  CZ   . TYR A 1 80  ? 99.962  56.000 21.271  1.00 63.67  ? 114  TYR A CZ   1 
ATOM   621  O  OH   . TYR A 1 80  ? 101.350 55.798 21.281  1.00 65.90  ? 114  TYR A OH   1 
ATOM   622  N  N    . PHE A 1 81  ? 92.781  56.485 21.212  1.00 59.83  ? 115  PHE A N    1 
ATOM   623  C  CA   . PHE A 1 81  ? 91.571  57.235 21.476  1.00 60.00  ? 115  PHE A CA   1 
ATOM   624  C  C    . PHE A 1 81  ? 91.357  57.112 22.993  1.00 60.50  ? 115  PHE A C    1 
ATOM   625  O  O    . PHE A 1 81  ? 91.806  56.152 23.597  1.00 59.35  ? 115  PHE A O    1 
ATOM   626  C  CB   . PHE A 1 81  ? 90.424  56.690 20.665  1.00 60.45  ? 115  PHE A CB   1 
ATOM   627  C  CG   . PHE A 1 81  ? 89.994  55.306 21.057  1.00 60.21  ? 115  PHE A CG   1 
ATOM   628  C  CD1  . PHE A 1 81  ? 88.957  55.136 21.954  1.00 58.35  ? 115  PHE A CD1  1 
ATOM   629  C  CD2  . PHE A 1 81  ? 90.617  54.168 20.498  1.00 59.76  ? 115  PHE A CD2  1 
ATOM   630  C  CE1  . PHE A 1 81  ? 88.542  53.897 22.293  1.00 56.93  ? 115  PHE A CE1  1 
ATOM   631  C  CE2  . PHE A 1 81  ? 90.204  52.924 20.839  1.00 57.16  ? 115  PHE A CE2  1 
ATOM   632  C  CZ   . PHE A 1 81  ? 89.163  52.789 21.743  1.00 58.09  ? 115  PHE A CZ   1 
ATOM   633  N  N    . PHE A 1 82  ? 90.720  58.119 23.588  1.00 61.71  ? 116  PHE A N    1 
ATOM   634  C  CA   . PHE A 1 82  ? 90.457  58.148 25.023  1.00 62.42  ? 116  PHE A CA   1 
ATOM   635  C  C    . PHE A 1 82  ? 89.283  59.029 25.305  1.00 63.66  ? 116  PHE A C    1 
ATOM   636  O  O    . PHE A 1 82  ? 88.928  59.829 24.474  1.00 63.45  ? 116  PHE A O    1 
ATOM   637  C  CB   . PHE A 1 82  ? 91.668  58.713 25.769  1.00 61.42  ? 116  PHE A CB   1 
ATOM   638  C  CG   . PHE A 1 82  ? 92.050  60.107 25.359  1.00 60.26  ? 116  PHE A CG   1 
ATOM   639  C  CD1  . PHE A 1 82  ? 91.516  61.229 26.009  1.00 57.96  ? 116  PHE A CD1  1 
ATOM   640  C  CD2  . PHE A 1 82  ? 92.997  60.295 24.339  1.00 58.96  ? 116  PHE A CD2  1 
ATOM   641  C  CE1  . PHE A 1 82  ? 91.927  62.547 25.655  1.00 56.14  ? 116  PHE A CE1  1 
ATOM   642  C  CE2  . PHE A 1 82  ? 93.416  61.610 23.978  1.00 58.58  ? 116  PHE A CE2  1 
ATOM   643  C  CZ   . PHE A 1 82  ? 92.877  62.736 24.646  1.00 55.56  ? 116  PHE A CZ   1 
ATOM   644  N  N    . TYR A 1 83  ? 88.660  58.886 26.468  1.00 66.97  ? 117  TYR A N    1 
ATOM   645  C  CA   . TYR A 1 83  ? 87.545  59.774 26.810  1.00 70.10  ? 117  TYR A CA   1 
ATOM   646  C  C    . TYR A 1 83  ? 88.035  60.811 27.800  1.00 72.00  ? 117  TYR A C    1 
ATOM   647  O  O    . TYR A 1 83  ? 89.104  60.659 28.356  1.00 71.14  ? 117  TYR A O    1 
ATOM   648  C  CB   . TYR A 1 83  ? 86.402  59.024 27.421  1.00 68.98  ? 117  TYR A CB   1 
ATOM   649  C  CG   . TYR A 1 83  ? 85.856  58.053 26.473  1.00 70.55  ? 117  TYR A CG   1 
ATOM   650  C  CD1  . TYR A 1 83  ? 86.482  56.845 26.258  1.00 70.72  ? 117  TYR A CD1  1 
ATOM   651  C  CD2  . TYR A 1 83  ? 84.775  58.388 25.679  1.00 73.49  ? 117  TYR A CD2  1 
ATOM   652  C  CE1  . TYR A 1 83  ? 86.046  55.982 25.258  1.00 72.54  ? 117  TYR A CE1  1 
ATOM   653  C  CE2  . TYR A 1 83  ? 84.322  57.548 24.671  1.00 73.65  ? 117  TYR A CE2  1 
ATOM   654  C  CZ   . TYR A 1 83  ? 84.962  56.344 24.461  1.00 73.54  ? 117  TYR A CZ   1 
ATOM   655  O  OH   . TYR A 1 83  ? 84.534  55.511 23.443  1.00 73.92  ? 117  TYR A OH   1 
ATOM   656  N  N    . SER A 1 84  ? 87.279  61.890 27.963  1.00 75.50  ? 118  SER A N    1 
ATOM   657  C  CA   . SER A 1 84  ? 87.628  62.937 28.920  1.00 79.26  ? 118  SER A CA   1 
ATOM   658  C  C    . SER A 1 84  ? 86.315  63.613 29.273  1.00 83.42  ? 118  SER A C    1 
ATOM   659  O  O    . SER A 1 84  ? 85.289  63.276 28.685  1.00 83.77  ? 118  SER A O    1 
ATOM   660  C  CB   . SER A 1 84  ? 88.649  63.915 28.308  1.00 76.70  ? 118  SER A CB   1 
ATOM   661  O  OG   . SER A 1 84  ? 88.063  64.833 27.421  1.00 74.96  ? 118  SER A OG   1 
ATOM   662  N  N    . SER A 1 85  ? 86.302  64.505 30.258  1.00 88.73  ? 119  SER A N    1 
ATOM   663  C  CA   . SER A 1 85  ? 85.044  65.176 30.609  1.00 94.37  ? 119  SER A CA   1 
ATOM   664  C  C    . SER A 1 85  ? 85.246  66.667 30.507  1.00 98.02  ? 119  SER A C    1 
ATOM   665  O  O    . SER A 1 85  ? 86.376  67.127 30.281  1.00 98.24  ? 119  SER A O    1 
ATOM   666  C  CB   . SER A 1 85  ? 84.594  64.811 32.014  1.00 94.25  ? 119  SER A CB   1 
ATOM   667  O  OG   . SER A 1 85  ? 85.676  64.940 32.906  1.00 96.18  ? 119  SER A OG   1 
ATOM   668  N  N    . GLY A 1 86  ? 84.150  67.417 30.650  1.00 102.31 ? 120  GLY A N    1 
ATOM   669  C  CA   . GLY A 1 86  ? 84.223  68.878 30.561  1.00 107.37 ? 120  GLY A CA   1 
ATOM   670  C  C    . GLY A 1 86  ? 83.862  69.586 31.864  1.00 110.65 ? 120  GLY A C    1 
ATOM   671  O  O    . GLY A 1 86  ? 83.687  68.914 32.920  1.00 110.61 ? 120  GLY A O    1 
ATOM   672  N  N    . GLU A 1 87  ? 83.758  70.926 31.795  1.00 113.09 ? 121  GLU A N    1 
ATOM   673  C  CA   . GLU A 1 87  ? 83.390  71.732 32.962  1.00 115.29 ? 121  GLU A CA   1 
ATOM   674  C  C    . GLU A 1 87  ? 82.011  71.227 33.554  1.00 117.15 ? 121  GLU A C    1 
ATOM   675  O  O    . GLU A 1 87  ? 81.906  71.015 34.792  1.00 117.78 ? 121  GLU A O    1 
ATOM   676  C  CB   . GLU A 1 87  ? 83.353  73.232 32.555  1.00 113.96 ? 121  GLU A CB   1 
ATOM   677  N  N    . LYS A 1 88  ? 81.010  70.989 32.671  1.00 117.54 ? 122  LYS A N    1 
ATOM   678  C  CA   . LYS A 1 88  ? 79.652  70.499 33.034  1.00 117.69 ? 122  LYS A CA   1 
ATOM   679  C  C    . LYS A 1 88  ? 79.550  68.966 33.260  1.00 117.96 ? 122  LYS A C    1 
ATOM   680  O  O    . LYS A 1 88  ? 80.237  68.196 32.600  1.00 118.03 ? 122  LYS A O    1 
ATOM   681  C  CB   . LYS A 1 88  ? 78.636  70.931 31.933  1.00 117.09 ? 122  LYS A CB   1 
ATOM   682  N  N    . LYS A 1 89  ? 78.685  68.531 34.185  1.00 118.76 ? 123  LYS A N    1 
ATOM   683  C  CA   . LYS A 1 89  ? 78.479  67.085 34.477  1.00 119.13 ? 123  LYS A CA   1 
ATOM   684  C  C    . LYS A 1 89  ? 77.764  66.428 33.280  1.00 119.14 ? 123  LYS A C    1 
ATOM   685  O  O    . LYS A 1 89  ? 77.280  67.144 32.376  1.00 119.61 ? 123  LYS A O    1 
ATOM   686  C  CB   . LYS A 1 89  ? 77.644  66.894 35.780  1.00 118.18 ? 123  LYS A CB   1 
ATOM   687  N  N    . ASP A 1 90  ? 77.683  65.092 33.276  1.00 118.52 ? 124  ASP A N    1 
ATOM   688  C  CA   . ASP A 1 90  ? 77.057  64.369 32.150  1.00 118.19 ? 124  ASP A CA   1 
ATOM   689  C  C    . ASP A 1 90  ? 77.426  65.088 30.824  1.00 115.88 ? 124  ASP A C    1 
ATOM   690  O  O    . ASP A 1 90  ? 76.553  65.643 30.121  1.00 115.57 ? 124  ASP A O    1 
ATOM   691  C  CB   . ASP A 1 90  ? 75.515  64.294 32.301  1.00 121.18 ? 124  ASP A CB   1 
ATOM   692  C  CG   . ASP A 1 90  ? 75.020  62.964 32.984  1.00 123.93 ? 124  ASP A CG   1 
ATOM   693  O  OD1  . ASP A 1 90  ? 75.650  61.888 32.798  1.00 125.10 ? 124  ASP A OD1  1 
ATOM   694  O  OD2  . ASP A 1 90  ? 73.978  63.000 33.702  1.00 124.73 ? 124  ASP A OD2  1 
ATOM   695  N  N    . GLU A 1 91  ? 78.737  65.087 30.537  1.00 111.90 ? 125  GLU A N    1 
ATOM   696  C  CA   . GLU A 1 91  ? 79.350  65.708 29.344  1.00 106.86 ? 125  GLU A CA   1 
ATOM   697  C  C    . GLU A 1 91  ? 80.751  65.064 29.107  1.00 102.48 ? 125  GLU A C    1 
ATOM   698  O  O    . GLU A 1 91  ? 81.802  65.589 29.542  1.00 101.43 ? 125  GLU A O    1 
ATOM   699  C  CB   . GLU A 1 91  ? 79.464  67.235 29.550  1.00 107.83 ? 125  GLU A CB   1 
ATOM   700  C  CG   . GLU A 1 91  ? 80.165  68.040 28.455  1.00 109.56 ? 125  GLU A CG   1 
ATOM   701  C  CD   . GLU A 1 91  ? 80.737  69.368 29.005  1.00 110.70 ? 125  GLU A CD   1 
ATOM   702  O  OE1  . GLU A 1 91  ? 81.253  70.215 28.224  1.00 110.76 ? 125  GLU A OE1  1 
ATOM   703  O  OE2  . GLU A 1 91  ? 80.674  69.562 30.239  1.00 111.19 ? 125  GLU A OE2  1 
ATOM   704  N  N    . VAL A 1 92  ? 80.741  63.912 28.432  1.00 96.73  ? 126  VAL A N    1 
ATOM   705  C  CA   . VAL A 1 92  ? 81.961  63.180 28.108  1.00 90.72  ? 126  VAL A CA   1 
ATOM   706  C  C    . VAL A 1 92  ? 82.372  63.472 26.662  1.00 87.07  ? 126  VAL A C    1 
ATOM   707  O  O    . VAL A 1 92  ? 81.529  63.747 25.812  1.00 86.86  ? 126  VAL A O    1 
ATOM   708  C  CB   . VAL A 1 92  ? 81.754  61.657 28.219  1.00 90.34  ? 126  VAL A CB   1 
ATOM   709  C  CG1  . VAL A 1 92  ? 83.029  60.936 27.840  1.00 89.23  ? 126  VAL A CG1  1 
ATOM   710  C  CG2  . VAL A 1 92  ? 81.341  61.282 29.612  1.00 89.98  ? 126  VAL A CG2  1 
ATOM   711  N  N    . TYR A 1 93  ? 83.670  63.415 26.392  1.00 82.22  ? 127  TYR A N    1 
ATOM   712  C  CA   . TYR A 1 93  ? 84.203  63.636 25.059  1.00 77.04  ? 127  TYR A CA   1 
ATOM   713  C  C    . TYR A 1 93  ? 84.980  62.399 24.621  1.00 73.61  ? 127  TYR A C    1 
ATOM   714  O  O    . TYR A 1 93  ? 85.585  61.702 25.433  1.00 73.45  ? 127  TYR A O    1 
ATOM   715  C  CB   . TYR A 1 93  ? 85.160  64.828 25.036  1.00 77.60  ? 127  TYR A CB   1 
ATOM   716  C  CG   . TYR A 1 93  ? 84.489  66.161 25.166  1.00 79.16  ? 127  TYR A CG   1 
ATOM   717  C  CD1  . TYR A 1 93  ? 84.218  66.726 26.430  1.00 80.40  ? 127  TYR A CD1  1 
ATOM   718  C  CD2  . TYR A 1 93  ? 84.055  66.841 24.038  1.00 78.92  ? 127  TYR A CD2  1 
ATOM   719  C  CE1  . TYR A 1 93  ? 83.524  67.940 26.558  1.00 80.43  ? 127  TYR A CE1  1 
ATOM   720  C  CE2  . TYR A 1 93  ? 83.362  68.039 24.146  1.00 80.09  ? 127  TYR A CE2  1 
ATOM   721  C  CZ   . TYR A 1 93  ? 83.102  68.586 25.402  1.00 81.31  ? 127  TYR A CZ   1 
ATOM   722  O  OH   . TYR A 1 93  ? 82.446  69.792 25.461  1.00 83.66  ? 127  TYR A OH   1 
ATOM   723  N  N    . LEU A 1 94  ? 84.935  62.104 23.333  1.00 69.22  ? 128  LEU A N    1 
ATOM   724  C  CA   . LEU A 1 94  ? 85.696  61.005 22.778  1.00 65.44  ? 128  LEU A CA   1 
ATOM   725  C  C    . LEU A 1 94  ? 86.866  61.762 22.095  1.00 62.99  ? 128  LEU A C    1 
ATOM   726  O  O    . LEU A 1 94  ? 86.636  62.813 21.498  1.00 62.91  ? 128  LEU A O    1 
ATOM   727  C  CB   . LEU A 1 94  ? 84.843  60.219 21.775  1.00 64.31  ? 128  LEU A CB   1 
ATOM   728  C  CG   . LEU A 1 94  ? 85.669  59.437 20.747  1.00 63.90  ? 128  LEU A CG   1 
ATOM   729  C  CD1  . LEU A 1 94  ? 86.554  58.485 21.499  1.00 62.45  ? 128  LEU A CD1  1 
ATOM   730  C  CD2  . LEU A 1 94  ? 84.829  58.729 19.732  1.00 60.53  ? 128  LEU A CD2  1 
ATOM   731  N  N    . ASN A 1 95  ? 88.106  61.276 22.197  1.00 60.00  ? 129  ASN A N    1 
ATOM   732  C  CA   . ASN A 1 95  ? 89.246  61.963 21.605  1.00 58.18  ? 129  ASN A CA   1 
ATOM   733  C  C    . ASN A 1 95  ? 89.973  61.006 20.717  1.00 58.93  ? 129  ASN A C    1 
ATOM   734  O  O    . ASN A 1 95  ? 90.418  59.951 21.193  1.00 60.14  ? 129  ASN A O    1 
ATOM   735  C  CB   . ASN A 1 95  ? 90.239  62.408 22.663  1.00 57.26  ? 129  ASN A CB   1 
ATOM   736  C  CG   . ASN A 1 95  ? 89.694  63.444 23.580  1.00 56.66  ? 129  ASN A CG   1 
ATOM   737  O  OD1  . ASN A 1 95  ? 88.984  63.121 24.550  1.00 56.47  ? 129  ASN A OD1  1 
ATOM   738  N  ND2  . ASN A 1 95  ? 90.019  64.712 23.300  1.00 54.21  ? 129  ASN A ND2  1 
ATOM   739  N  N    . LEU A 1 96  ? 90.136  61.361 19.448  1.00 57.90  ? 130  LEU A N    1 
ATOM   740  C  CA   . LEU A 1 96  ? 90.812  60.493 18.514  1.00 58.31  ? 130  LEU A CA   1 
ATOM   741  C  C    . LEU A 1 96  ? 92.178  61.095 18.261  1.00 58.80  ? 130  LEU A C    1 
ATOM   742  O  O    . LEU A 1 96  ? 92.282  62.259 17.823  1.00 59.53  ? 130  LEU A O    1 
ATOM   743  C  CB   . LEU A 1 96  ? 89.999  60.404 17.208  1.00 59.70  ? 130  LEU A CB   1 
ATOM   744  C  CG   . LEU A 1 96  ? 88.552  59.888 17.328  1.00 60.53  ? 130  LEU A CG   1 
ATOM   745  C  CD1  . LEU A 1 96  ? 87.835  59.982 15.994  1.00 60.51  ? 130  LEU A CD1  1 
ATOM   746  C  CD2  . LEU A 1 96  ? 88.568  58.439 17.781  1.00 61.97  ? 130  LEU A CD2  1 
ATOM   747  N  N    . VAL A 1 97  ? 93.236  60.334 18.556  1.00 58.35  ? 131  VAL A N    1 
ATOM   748  C  CA   . VAL A 1 97  ? 94.612  60.841 18.359  1.00 57.89  ? 131  VAL A CA   1 
ATOM   749  C  C    . VAL A 1 97  ? 95.031  60.252 17.041  1.00 59.16  ? 131  VAL A C    1 
ATOM   750  O  O    . VAL A 1 97  ? 95.239  59.039 16.959  1.00 60.99  ? 131  VAL A O    1 
ATOM   751  C  CB   . VAL A 1 97  ? 95.593  60.389 19.524  1.00 54.90  ? 131  VAL A CB   1 
ATOM   752  C  CG1  . VAL A 1 97  ? 96.940  61.029 19.358  1.00 51.34  ? 131  VAL A CG1  1 
ATOM   753  C  CG2  . VAL A 1 97  ? 94.998  60.763 20.885  1.00 53.46  ? 131  VAL A CG2  1 
ATOM   754  N  N    . LEU A 1 98  ? 95.158  61.084 16.011  1.00 58.84  ? 132  LEU A N    1 
ATOM   755  C  CA   . LEU A 1 98  ? 95.502  60.579 14.685  1.00 59.80  ? 132  LEU A CA   1 
ATOM   756  C  C    . LEU A 1 98  ? 96.808  61.139 14.197  1.00 61.86  ? 132  LEU A C    1 
ATOM   757  O  O    . LEU A 1 98  ? 97.335  62.062 14.813  1.00 63.04  ? 132  LEU A O    1 
ATOM   758  C  CB   . LEU A 1 98  ? 94.409  60.989 13.685  1.00 58.08  ? 132  LEU A CB   1 
ATOM   759  C  CG   . LEU A 1 98  ? 92.988  60.735 14.177  1.00 56.91  ? 132  LEU A CG   1 
ATOM   760  C  CD1  . LEU A 1 98  ? 92.286  62.066 14.346  1.00 55.18  ? 132  LEU A CD1  1 
ATOM   761  C  CD2  . LEU A 1 98  ? 92.269  59.772 13.225  1.00 55.67  ? 132  LEU A CD2  1 
ATOM   762  N  N    . ASP A 1 99  ? 97.320  60.601 13.086  1.00 63.26  ? 133  ASP A N    1 
ATOM   763  C  CA   . ASP A 1 99  ? 98.550  61.104 12.483  1.00 64.29  ? 133  ASP A CA   1 
ATOM   764  C  C    . ASP A 1 99  ? 98.265  62.513 12.078  1.00 63.93  ? 133  ASP A C    1 
ATOM   765  O  O    . ASP A 1 99  ? 97.118  62.879 11.838  1.00 64.49  ? 133  ASP A O    1 
ATOM   766  C  CB   . ASP A 1 99  ? 98.956  60.285 11.261  1.00 67.34  ? 133  ASP A CB   1 
ATOM   767  C  CG   . ASP A 1 99  ? 99.787  59.028 11.639  1.00 72.80  ? 133  ASP A CG   1 
ATOM   768  O  OD1  . ASP A 1 99  ? 99.818  58.687 12.863  1.00 76.20  ? 133  ASP A OD1  1 
ATOM   769  O  OD2  . ASP A 1 99  ? 100.405 58.387 10.733  1.00 72.34  ? 133  ASP A OD2  1 
ATOM   770  N  N    . TYR A 1 100 ? 99.307  63.326 12.026  1.00 63.43  ? 134  TYR A N    1 
ATOM   771  C  CA   . TYR A 1 100 ? 99.166  64.733 11.676  1.00 61.64  ? 134  TYR A CA   1 
ATOM   772  C  C    . TYR A 1 100 ? 99.750  64.927 10.306  1.00 61.37  ? 134  TYR A C    1 
ATOM   773  O  O    . TYR A 1 100 ? 100.833 64.448 10.010  1.00 61.15  ? 134  TYR A O    1 
ATOM   774  C  CB   . TYR A 1 100 ? 99.924  65.622 12.667  1.00 60.26  ? 134  TYR A CB   1 
ATOM   775  C  CG   . TYR A 1 100 ? 100.057 67.045 12.192  1.00 57.97  ? 134  TYR A CG   1 
ATOM   776  C  CD1  . TYR A 1 100 ? 98.960  67.922 12.300  1.00 58.29  ? 134  TYR A CD1  1 
ATOM   777  C  CD2  . TYR A 1 100 ? 101.221 67.499 11.547  1.00 56.52  ? 134  TYR A CD2  1 
ATOM   778  C  CE1  . TYR A 1 100 ? 99.007  69.222 11.771  1.00 58.75  ? 134  TYR A CE1  1 
ATOM   779  C  CE2  . TYR A 1 100 ? 101.292 68.800 10.995  1.00 57.88  ? 134  TYR A CE2  1 
ATOM   780  C  CZ   . TYR A 1 100 ? 100.167 69.650 11.119  1.00 59.36  ? 134  TYR A CZ   1 
ATOM   781  O  OH   . TYR A 1 100 ? 100.142 70.897 10.593  1.00 58.73  ? 134  TYR A OH   1 
ATOM   782  N  N    . VAL A 1 101 ? 99.038  65.617 9.448   1.00 61.59  ? 135  VAL A N    1 
ATOM   783  C  CA   . VAL A 1 101 ? 99.584  65.848 8.147   1.00 62.12  ? 135  VAL A CA   1 
ATOM   784  C  C    . VAL A 1 101 ? 99.558  67.363 8.022   1.00 62.76  ? 135  VAL A C    1 
ATOM   785  O  O    . VAL A 1 101 ? 98.570  67.983 8.391   1.00 62.64  ? 135  VAL A O    1 
ATOM   786  C  CB   . VAL A 1 101 ? 98.733  65.155 7.069   1.00 62.23  ? 135  VAL A CB   1 
ATOM   787  C  CG1  . VAL A 1 101 ? 99.338  65.448 5.676   1.00 62.51  ? 135  VAL A CG1  1 
ATOM   788  C  CG2  . VAL A 1 101 ? 98.684  63.656 7.340   1.00 57.64  ? 135  VAL A CG2  1 
ATOM   789  N  N    . PRO A 1 102 ? 100.649 67.962 7.522   1.00 63.77  ? 136  PRO A N    1 
ATOM   790  C  CA   . PRO A 1 102 ? 100.948 69.381 7.282   1.00 64.30  ? 136  PRO A CA   1 
ATOM   791  C  C    . PRO A 1 102 ? 99.945  70.168 6.430   1.00 65.68  ? 136  PRO A C    1 
ATOM   792  O  O    . PRO A 1 102 ? 99.527  71.250 6.822   1.00 64.53  ? 136  PRO A O    1 
ATOM   793  C  CB   . PRO A 1 102 ? 102.294 69.337 6.579   1.00 64.29  ? 136  PRO A CB   1 
ATOM   794  C  CG   . PRO A 1 102 ? 102.881 68.047 7.014   1.00 66.20  ? 136  PRO A CG   1 
ATOM   795  C  CD   . PRO A 1 102 ? 101.724 67.113 6.982   1.00 64.81  ? 136  PRO A CD   1 
ATOM   796  N  N    . GLU A 1 103 ? 99.575  69.649 5.251   1.00 67.94  ? 137  GLU A N    1 
ATOM   797  C  CA   . GLU A 1 103 ? 98.633  70.347 4.368   1.00 69.15  ? 137  GLU A CA   1 
ATOM   798  C  C    . GLU A 1 103 ? 97.345  69.571 3.957   1.00 68.00  ? 137  GLU A C    1 
ATOM   799  O  O    . GLU A 1 103 ? 97.142  68.425 4.319   1.00 68.09  ? 137  GLU A O    1 
ATOM   800  C  CB   . GLU A 1 103 ? 99.395  70.864 3.135   1.00 71.39  ? 137  GLU A CB   1 
ATOM   801  C  CG   . GLU A 1 103 ? 100.227 72.118 3.399   1.00 77.37  ? 137  GLU A CG   1 
ATOM   802  C  CD   . GLU A 1 103 ? 99.389  73.277 3.986   1.00 83.86  ? 137  GLU A CD   1 
ATOM   803  O  OE1  . GLU A 1 103 ? 99.731  74.465 3.736   1.00 88.45  ? 137  GLU A OE1  1 
ATOM   804  O  OE2  . GLU A 1 103 ? 98.393  73.014 4.716   1.00 86.58  ? 137  GLU A OE2  1 
ATOM   805  N  N    . THR A 1 104 ? 96.444  70.243 3.260   1.00 66.85  ? 138  THR A N    1 
ATOM   806  C  CA   . THR A 1 104 ? 95.226  69.626 2.781   1.00 66.06  ? 138  THR A CA   1 
ATOM   807  C  C    . THR A 1 104 ? 95.106  70.148 1.344   1.00 66.80  ? 138  THR A C    1 
ATOM   808  O  O    . THR A 1 104 ? 95.545  71.250 1.047   1.00 67.16  ? 138  THR A O    1 
ATOM   809  C  CB   . THR A 1 104 ? 93.957  70.067 3.578   1.00 64.99  ? 138  THR A CB   1 
ATOM   810  O  OG1  . THR A 1 104 ? 93.544  71.362 3.141   1.00 64.07  ? 138  THR A OG1  1 
ATOM   811  C  CG2  . THR A 1 104 ? 94.230  70.128 5.053   1.00 66.65  ? 138  THR A CG2  1 
ATOM   812  N  N    . VAL A 1 105 ? 94.522  69.348 0.459   1.00 67.01  ? 139  VAL A N    1 
ATOM   813  C  CA   . VAL A 1 105 ? 94.321  69.698 -0.930  1.00 65.52  ? 139  VAL A CA   1 
ATOM   814  C  C    . VAL A 1 105 ? 93.590  71.030 -0.975  1.00 66.92  ? 139  VAL A C    1 
ATOM   815  O  O    . VAL A 1 105 ? 93.817  71.841 -1.856  1.00 66.85  ? 139  VAL A O    1 
ATOM   816  C  CB   . VAL A 1 105 ? 93.475  68.586 -1.630  1.00 64.92  ? 139  VAL A CB   1 
ATOM   817  C  CG1  . VAL A 1 105 ? 92.889  69.063 -2.960  1.00 62.59  ? 139  VAL A CG1  1 
ATOM   818  C  CG2  . VAL A 1 105 ? 94.334  67.375 -1.852  1.00 63.02  ? 139  VAL A CG2  1 
ATOM   819  N  N    . TYR A 1 106 ? 92.724  71.295 -0.012  1.00 68.15  ? 140  TYR A N    1 
ATOM   820  C  CA   . TYR A 1 106 ? 91.981  72.547 -0.065  1.00 70.91  ? 140  TYR A CA   1 
ATOM   821  C  C    . TYR A 1 106 ? 92.835  73.777 0.004   1.00 71.78  ? 140  TYR A C    1 
ATOM   822  O  O    . TYR A 1 106 ? 92.573  74.773 -0.686  1.00 72.08  ? 140  TYR A O    1 
ATOM   823  C  CB   . TYR A 1 106 ? 90.959  72.641 1.043   1.00 73.63  ? 140  TYR A CB   1 
ATOM   824  C  CG   . TYR A 1 106 ? 90.392  74.030 1.177   1.00 77.13  ? 140  TYR A CG   1 
ATOM   825  C  CD1  . TYR A 1 106 ? 89.859  74.706 0.072   1.00 79.69  ? 140  TYR A CD1  1 
ATOM   826  C  CD2  . TYR A 1 106 ? 90.364  74.663 2.408   1.00 79.21  ? 140  TYR A CD2  1 
ATOM   827  C  CE1  . TYR A 1 106 ? 89.304  75.997 0.217   1.00 81.63  ? 140  TYR A CE1  1 
ATOM   828  C  CE2  . TYR A 1 106 ? 89.807  75.932 2.563   1.00 80.16  ? 140  TYR A CE2  1 
ATOM   829  C  CZ   . TYR A 1 106 ? 89.276  76.586 1.475   1.00 80.86  ? 140  TYR A CZ   1 
ATOM   830  O  OH   . TYR A 1 106 ? 88.641  77.775 1.679   1.00 81.19  ? 140  TYR A OH   1 
ATOM   831  N  N    . ARG A 1 107 ? 93.834  73.726 0.878   1.00 72.30  ? 141  ARG A N    1 
ATOM   832  C  CA   . ARG A 1 107 ? 94.753  74.827 1.044   1.00 71.60  ? 141  ARG A CA   1 
ATOM   833  C  C    . ARG A 1 107 ? 95.669  74.843 -0.183  1.00 70.79  ? 141  ARG A C    1 
ATOM   834  O  O    . ARG A 1 107 ? 95.806  75.867 -0.839  1.00 71.74  ? 141  ARG A O    1 
ATOM   835  C  CB   . ARG A 1 107 ? 95.539  74.660 2.327   1.00 71.94  ? 141  ARG A CB   1 
ATOM   836  C  CG   . ARG A 1 107 ? 94.663  74.490 3.523   1.00 73.40  ? 141  ARG A CG   1 
ATOM   837  C  CD   . ARG A 1 107 ? 95.533  73.964 4.671   1.00 77.16  ? 141  ARG A CD   1 
ATOM   838  N  NE   . ARG A 1 107 ? 95.509  74.901 5.792   1.00 79.82  ? 141  ARG A NE   1 
ATOM   839  C  CZ   . ARG A 1 107 ? 96.543  75.615 6.256   1.00 79.40  ? 141  ARG A CZ   1 
ATOM   840  N  NH1  . ARG A 1 107 ? 97.780  75.521 5.720   1.00 76.95  ? 141  ARG A NH1  1 
ATOM   841  N  NH2  . ARG A 1 107 ? 96.293  76.483 7.240   1.00 78.80  ? 141  ARG A NH2  1 
ATOM   842  N  N    . VAL A 1 108 ? 96.276  73.718 -0.532  1.00 68.88  ? 142  VAL A N    1 
ATOM   843  C  CA   . VAL A 1 108 ? 97.145  73.726 -1.692  1.00 68.22  ? 142  VAL A CA   1 
ATOM   844  C  C    . VAL A 1 108 ? 96.418  74.276 -2.903  1.00 70.06  ? 142  VAL A C    1 
ATOM   845  O  O    . VAL A 1 108 ? 97.009  74.898 -3.751  1.00 70.97  ? 142  VAL A O    1 
ATOM   846  C  CB   . VAL A 1 108 ? 97.649  72.334 -2.017  1.00 66.97  ? 142  VAL A CB   1 
ATOM   847  C  CG1  . VAL A 1 108 ? 98.559  72.349 -3.236  1.00 65.12  ? 142  VAL A CG1  1 
ATOM   848  C  CG2  . VAL A 1 108 ? 98.370  71.801 -0.816  1.00 66.36  ? 142  VAL A CG2  1 
ATOM   849  N  N    . ALA A 1 109 ? 95.117  74.069 -2.994  1.00 72.41  ? 143  ALA A N    1 
ATOM   850  C  CA   . ALA A 1 109 ? 94.378  74.547 -4.160  1.00 74.76  ? 143  ALA A CA   1 
ATOM   851  C  C    . ALA A 1 109 ? 94.078  76.007 -4.067  1.00 76.09  ? 143  ALA A C    1 
ATOM   852  O  O    . ALA A 1 109 ? 93.962  76.672 -5.077  1.00 75.55  ? 143  ALA A O    1 
ATOM   853  C  CB   . ALA A 1 109 ? 93.072  73.780 -4.320  1.00 74.89  ? 143  ALA A CB   1 
ATOM   854  N  N    . ARG A 1 110 ? 93.888  76.478 -2.839  1.00 78.47  ? 144  ARG A N    1 
ATOM   855  C  CA   . ARG A 1 110 ? 93.573  77.870 -2.588  1.00 80.10  ? 144  ARG A CA   1 
ATOM   856  C  C    . ARG A 1 110 ? 94.857  78.621 -2.804  1.00 80.79  ? 144  ARG A C    1 
ATOM   857  O  O    . ARG A 1 110 ? 94.874  79.598 -3.506  1.00 80.82  ? 144  ARG A O    1 
ATOM   858  C  CB   . ARG A 1 110 ? 93.080  78.084 -1.162  1.00 80.09  ? 144  ARG A CB   1 
ATOM   859  C  CG   . ARG A 1 110 ? 92.583  79.486 -0.967  1.00 82.93  ? 144  ARG A CG   1 
ATOM   860  C  CD   . ARG A 1 110 ? 92.119  79.776 0.430   1.00 85.32  ? 144  ARG A CD   1 
ATOM   861  N  NE   . ARG A 1 110 ? 93.155  79.354 1.363   1.00 89.63  ? 144  ARG A NE   1 
ATOM   862  C  CZ   . ARG A 1 110 ? 93.005  79.286 2.690   1.00 92.00  ? 144  ARG A CZ   1 
ATOM   863  N  NH1  . ARG A 1 110 ? 91.834  79.634 3.244   1.00 92.84  ? 144  ARG A NH1  1 
ATOM   864  N  NH2  . ARG A 1 110 ? 94.013  78.820 3.455   1.00 91.58  ? 144  ARG A NH2  1 
ATOM   865  N  N    . HIS A 1 111 ? 95.944  78.147 -2.218  1.00 82.79  ? 145  HIS A N    1 
ATOM   866  C  CA   . HIS A 1 111 ? 97.232  78.793 -2.384  1.00 84.30  ? 145  HIS A CA   1 
ATOM   867  C  C    . HIS A 1 111 ? 97.524  79.042 -3.877  1.00 83.93  ? 145  HIS A C    1 
ATOM   868  O  O    . HIS A 1 111 ? 97.871  80.159 -4.275  1.00 84.52  ? 145  HIS A O    1 
ATOM   869  C  CB   . HIS A 1 111 ? 98.319  77.928 -1.752  1.00 86.87  ? 145  HIS A CB   1 
ATOM   870  C  CG   . HIS A 1 111 ? 99.713  78.383 -2.061  1.00 89.91  ? 145  HIS A CG   1 
ATOM   871  N  ND1  . HIS A 1 111 ? 100.352 79.375 -1.334  1.00 91.02  ? 145  HIS A ND1  1 
ATOM   872  C  CD2  . HIS A 1 111 ? 100.581 77.994 -3.033  1.00 89.94  ? 145  HIS A CD2  1 
ATOM   873  C  CE1  . HIS A 1 111 ? 101.553 79.572 -1.849  1.00 91.30  ? 145  HIS A CE1  1 
ATOM   874  N  NE2  . HIS A 1 111 ? 101.716 78.748 -2.879  1.00 90.96  ? 145  HIS A NE2  1 
ATOM   875  N  N    . TYR A 1 112 ? 97.357  78.022 -4.717  1.00 83.34  ? 146  TYR A N    1 
ATOM   876  C  CA   . TYR A 1 112 ? 97.607  78.174 -6.158  1.00 81.87  ? 146  TYR A CA   1 
ATOM   877  C  C    . TYR A 1 112 ? 96.594  79.099 -6.833  1.00 82.44  ? 146  TYR A C    1 
ATOM   878  O  O    . TYR A 1 112 ? 96.915  79.871 -7.703  1.00 82.50  ? 146  TYR A O    1 
ATOM   879  C  CB   . TYR A 1 112 ? 97.582  76.827 -6.843  1.00 77.78  ? 146  TYR A CB   1 
ATOM   880  C  CG   . TYR A 1 112 ? 98.905  76.124 -6.907  1.00 75.73  ? 146  TYR A CG   1 
ATOM   881  C  CD1  . TYR A 1 112 ? 99.402  75.361 -5.834  1.00 75.12  ? 146  TYR A CD1  1 
ATOM   882  C  CD2  . TYR A 1 112 ? 99.657  76.184 -8.075  1.00 75.55  ? 146  TYR A CD2  1 
ATOM   883  C  CE1  . TYR A 1 112 ? 100.631 74.671 -5.935  1.00 74.50  ? 146  TYR A CE1  1 
ATOM   884  C  CE2  . TYR A 1 112 ? 100.867 75.507 -8.195  1.00 74.69  ? 146  TYR A CE2  1 
ATOM   885  C  CZ   . TYR A 1 112 ? 101.348 74.763 -7.134  1.00 75.17  ? 146  TYR A CZ   1 
ATOM   886  O  OH   . TYR A 1 112 ? 102.560 74.148 -7.322  1.00 75.48  ? 146  TYR A OH   1 
ATOM   887  N  N    . SER A 1 113 ? 95.350  79.001 -6.440  1.00 84.66  ? 147  SER A N    1 
ATOM   888  C  CA   . SER A 1 113 ? 94.310  79.826 -7.011  1.00 86.92  ? 147  SER A CA   1 
ATOM   889  C  C    . SER A 1 113 ? 94.655  81.297 -6.707  1.00 88.02  ? 147  SER A C    1 
ATOM   890  O  O    . SER A 1 113 ? 94.568  82.164 -7.582  1.00 88.31  ? 147  SER A O    1 
ATOM   891  C  CB   . SER A 1 113 ? 92.969  79.405 -6.380  1.00 87.99  ? 147  SER A CB   1 
ATOM   892  O  OG   . SER A 1 113 ? 91.907  80.245 -6.773  1.00 89.62  ? 147  SER A OG   1 
ATOM   893  N  N    . ARG A 1 114 ? 95.067  81.569 -5.470  1.00 89.18  ? 148  ARG A N    1 
ATOM   894  C  CA   . ARG A 1 114 ? 95.450  82.909 -5.040  1.00 89.70  ? 148  ARG A CA   1 
ATOM   895  C  C    . ARG A 1 114 ? 96.586  83.454 -5.904  1.00 90.58  ? 148  ARG A C    1 
ATOM   896  O  O    . ARG A 1 114 ? 96.558  84.618 -6.315  1.00 91.31  ? 148  ARG A O    1 
ATOM   897  C  CB   . ARG A 1 114 ? 95.853  82.887 -3.563  1.00 89.15  ? 148  ARG A CB   1 
ATOM   898  C  CG   . ARG A 1 114 ? 94.650  82.909 -2.617  1.00 89.23  ? 148  ARG A CG   1 
ATOM   899  C  CD   . ARG A 1 114 ? 95.080  82.749 -1.200  1.00 90.91  ? 148  ARG A CD   1 
ATOM   900  N  NE   . ARG A 1 114 ? 93.940  82.776 -0.280  1.00 93.21  ? 148  ARG A NE   1 
ATOM   901  C  CZ   . ARG A 1 114 ? 93.987  82.394 1.008   1.00 94.58  ? 148  ARG A CZ   1 
ATOM   902  N  NH1  . ARG A 1 114 ? 95.141  81.945 1.557   1.00 93.19  ? 148  ARG A NH1  1 
ATOM   903  N  NH2  . ARG A 1 114 ? 92.863  82.446 1.742   1.00 93.25  ? 148  ARG A NH2  1 
ATOM   904  N  N    . ALA A 1 115 ? 97.563  82.595 -6.193  1.00 91.06  ? 149  ALA A N    1 
ATOM   905  C  CA   . ALA A 1 115 ? 98.710  82.929 -7.040  1.00 91.35  ? 149  ALA A CA   1 
ATOM   906  C  C    . ALA A 1 115 ? 98.286  83.038 -8.515  1.00 92.46  ? 149  ALA A C    1 
ATOM   907  O  O    . ALA A 1 115 ? 99.127  83.169 -9.412  1.00 92.55  ? 149  ALA A O    1 
ATOM   908  C  CB   . ALA A 1 115 ? 99.782  81.844 -6.893  1.00 90.40  ? 149  ALA A CB   1 
ATOM   909  N  N    . LYS A 1 116 ? 96.981  82.972 -8.773  1.00 93.99  ? 150  LYS A N    1 
ATOM   910  C  CA   . LYS A 1 116 ? 96.469  83.029 -10.139 1.00 94.58  ? 150  LYS A CA   1 
ATOM   911  C  C    . LYS A 1 116 ? 97.139  81.950 -11.020 1.00 94.01  ? 150  LYS A C    1 
ATOM   912  O  O    . LYS A 1 116 ? 97.607  82.241 -12.104 1.00 94.41  ? 150  LYS A O    1 
ATOM   913  C  CB   . LYS A 1 116 ? 96.742  84.406 -10.726 1.00 96.27  ? 150  LYS A CB   1 
ATOM   914  C  CG   . LYS A 1 116 ? 96.566  85.563 -9.757  1.00 98.73  ? 150  LYS A CG   1 
ATOM   915  C  CD   . LYS A 1 116 ? 95.167  86.131 -9.828  1.00 101.01 ? 150  LYS A CD   1 
ATOM   916  C  CE   . LYS A 1 116 ? 95.182  87.623 -9.441  1.00 102.83 ? 150  LYS A CE   1 
ATOM   917  N  NZ   . LYS A 1 116 ? 93.851  88.271 -9.674  1.00 102.91 ? 150  LYS A NZ   1 
ATOM   918  N  N    . GLN A 1 117 ? 97.212  80.712 -10.541 1.00 93.41  ? 151  GLN A N    1 
ATOM   919  C  CA   . GLN A 1 117 ? 97.794  79.616 -11.314 1.00 93.02  ? 151  GLN A CA   1 
ATOM   920  C  C    . GLN A 1 117 ? 97.088  78.316 -11.035 1.00 91.75  ? 151  GLN A C    1 
ATOM   921  O  O    . GLN A 1 117 ? 96.304  78.175 -10.078 1.00 91.89  ? 151  GLN A O    1 
ATOM   922  C  CB   . GLN A 1 117 ? 99.243  79.405 -10.976 1.00 95.12  ? 151  GLN A CB   1 
ATOM   923  C  CG   . GLN A 1 117 ? 100.066 80.595 -11.217 1.00 100.54 ? 151  GLN A CG   1 
ATOM   924  C  CD   . GLN A 1 117 ? 101.208 80.685 -10.228 1.00 104.01 ? 151  GLN A CD   1 
ATOM   925  O  OE1  . GLN A 1 117 ? 101.986 79.725 -10.054 1.00 105.25 ? 151  GLN A OE1  1 
ATOM   926  N  NE2  . GLN A 1 117 ? 101.324 81.846 -9.562  1.00 106.35 ? 151  GLN A NE2  1 
ATOM   927  N  N    . THR A 1 118 ? 97.388  77.332 -11.860 1.00 89.48  ? 152  THR A N    1 
ATOM   928  C  CA   . THR A 1 118 ? 96.769  76.039 -11.680 1.00 86.60  ? 152  THR A CA   1 
ATOM   929  C  C    . THR A 1 118 ? 97.798  75.030 -11.154 1.00 83.77  ? 152  THR A C    1 
ATOM   930  O  O    . THR A 1 118 ? 98.994  75.093 -11.467 1.00 83.29  ? 152  THR A O    1 
ATOM   931  C  CB   . THR A 1 118 ? 96.164  75.556 -13.006 1.00 86.60  ? 152  THR A CB   1 
ATOM   932  O  OG1  . THR A 1 118 ? 97.219  75.403 -13.954 1.00 88.16  ? 152  THR A OG1  1 
ATOM   933  C  CG2  . THR A 1 118 ? 95.168  76.576 -13.548 1.00 85.78  ? 152  THR A CG2  1 
ATOM   934  N  N    . LEU A 1 119 ? 97.322  74.113 -10.328 1.00 80.69  ? 153  LEU A N    1 
ATOM   935  C  CA   . LEU A 1 119 ? 98.169  73.096 -9.769  1.00 78.28  ? 153  LEU A CA   1 
ATOM   936  C  C    . LEU A 1 119 ? 98.811  72.278 -10.899 1.00 77.58  ? 153  LEU A C    1 
ATOM   937  O  O    . LEU A 1 119 ? 98.141  71.880 -11.836 1.00 78.03  ? 153  LEU A O    1 
ATOM   938  C  CB   . LEU A 1 119 ? 97.319  72.211 -8.886  1.00 75.74  ? 153  LEU A CB   1 
ATOM   939  C  CG   . LEU A 1 119 ? 98.086  71.181 -8.091  1.00 76.43  ? 153  LEU A CG   1 
ATOM   940  C  CD1  . LEU A 1 119 ? 98.870  71.880 -7.040  1.00 75.44  ? 153  LEU A CD1  1 
ATOM   941  C  CD2  . LEU A 1 119 ? 97.117  70.191 -7.463  1.00 76.57  ? 153  LEU A CD2  1 
ATOM   942  N  N    . PRO A 1 120 ? 100.127 72.060 -10.851 1.00 77.08  ? 154  PRO A N    1 
ATOM   943  C  CA   . PRO A 1 120 ? 100.861 71.276 -11.867 1.00 75.94  ? 154  PRO A CA   1 
ATOM   944  C  C    . PRO A 1 120 ? 100.202 69.913 -12.109 1.00 75.23  ? 154  PRO A C    1 
ATOM   945  O  O    . PRO A 1 120 ? 100.039 69.116 -11.192 1.00 76.02  ? 154  PRO A O    1 
ATOM   946  C  CB   . PRO A 1 120 ? 102.214 71.089 -11.225 1.00 76.04  ? 154  PRO A CB   1 
ATOM   947  C  CG   . PRO A 1 120 ? 102.356 72.361 -10.428 1.00 76.91  ? 154  PRO A CG   1 
ATOM   948  C  CD   . PRO A 1 120 ? 101.030 72.651 -9.849  1.00 76.02  ? 154  PRO A CD   1 
ATOM   949  N  N    . VAL A 1 121 ? 99.833  69.625 -13.338 1.00 74.51  ? 155  VAL A N    1 
ATOM   950  C  CA   . VAL A 1 121 ? 99.185  68.349 -13.645 1.00 73.44  ? 155  VAL A CA   1 
ATOM   951  C  C    . VAL A 1 121 ? 99.729  67.058 -12.982 1.00 72.29  ? 155  VAL A C    1 
ATOM   952  O  O    . VAL A 1 121 ? 99.014  66.075 -12.787 1.00 72.23  ? 155  VAL A O    1 
ATOM   953  C  CB   . VAL A 1 121 ? 99.170  68.183 -15.141 1.00 73.78  ? 155  VAL A CB   1 
ATOM   954  C  CG1  . VAL A 1 121 ? 98.602  66.818 -15.498 1.00 75.43  ? 155  VAL A CG1  1 
ATOM   955  C  CG2  . VAL A 1 121 ? 98.377  69.357 -15.759 1.00 73.10  ? 155  VAL A CG2  1 
ATOM   956  N  N    . ILE A 1 122 ? 100.997 67.066 -12.629 1.00 71.45  ? 156  ILE A N    1 
ATOM   957  C  CA   . ILE A 1 122 ? 101.612 65.895 -12.017 1.00 70.56  ? 156  ILE A CA   1 
ATOM   958  C  C    . ILE A 1 122 ? 101.044 65.717 -10.594 1.00 70.34  ? 156  ILE A C    1 
ATOM   959  O  O    . ILE A 1 122 ? 100.820 64.608 -10.100 1.00 69.57  ? 156  ILE A O    1 
ATOM   960  C  CB   . ILE A 1 122 ? 103.188 66.072 -12.020 1.00 69.32  ? 156  ILE A CB   1 
ATOM   961  C  CG1  . ILE A 1 122 ? 103.840 64.877 -11.359 1.00 66.81  ? 156  ILE A CG1  1 
ATOM   962  C  CG2  . ILE A 1 122 ? 103.597 67.403 -11.391 1.00 68.84  ? 156  ILE A CG2  1 
ATOM   963  C  CD1  . ILE A 1 122 ? 103.444 63.613 -12.058 1.00 64.36  ? 156  ILE A CD1  1 
ATOM   964  N  N    . TYR A 1 123 ? 100.787 66.829 -9.940  1.00 70.21  ? 157  TYR A N    1 
ATOM   965  C  CA   . TYR A 1 123 ? 100.237 66.778 -8.619  1.00 71.56  ? 157  TYR A CA   1 
ATOM   966  C  C    . TYR A 1 123 ? 98.792  66.334 -8.713  1.00 70.21  ? 157  TYR A C    1 
ATOM   967  O  O    . TYR A 1 123 ? 98.322  65.518 -7.871  1.00 69.45  ? 157  TYR A O    1 
ATOM   968  C  CB   . TYR A 1 123 ? 100.340 68.162 -7.969  1.00 75.56  ? 157  TYR A CB   1 
ATOM   969  C  CG   . TYR A 1 123 ? 101.763 68.490 -7.571  1.00 79.71  ? 157  TYR A CG   1 
ATOM   970  C  CD1  . TYR A 1 123 ? 102.503 67.588 -6.791  1.00 80.94  ? 157  TYR A CD1  1 
ATOM   971  C  CD2  . TYR A 1 123 ? 102.356 69.703 -7.948  1.00 80.54  ? 157  TYR A CD2  1 
ATOM   972  C  CE1  . TYR A 1 123 ? 103.793 67.884 -6.386  1.00 83.68  ? 157  TYR A CE1  1 
ATOM   973  C  CE2  . TYR A 1 123 ? 103.648 70.018 -7.553  1.00 82.74  ? 157  TYR A CE2  1 
ATOM   974  C  CZ   . TYR A 1 123 ? 104.377 69.105 -6.765  1.00 84.68  ? 157  TYR A CZ   1 
ATOM   975  O  OH   . TYR A 1 123 ? 105.698 69.384 -6.369  1.00 86.57  ? 157  TYR A OH   1 
ATOM   976  N  N    . VAL A 1 124 ? 98.099  66.871 -9.733  1.00 67.01  ? 158  VAL A N    1 
ATOM   977  C  CA   . VAL A 1 124 ? 96.721  66.505 -9.981  1.00 63.84  ? 158  VAL A CA   1 
ATOM   978  C  C    . VAL A 1 124 ? 96.664  64.978 -10.110 1.00 62.84  ? 158  VAL A C    1 
ATOM   979  O  O    . VAL A 1 124 ? 95.882  64.326 -9.414  1.00 62.42  ? 158  VAL A O    1 
ATOM   980  C  CB   . VAL A 1 124 ? 96.153  67.183 -11.223 1.00 62.41  ? 158  VAL A CB   1 
ATOM   981  C  CG1  . VAL A 1 124 ? 94.764  66.652 -11.523 1.00 64.26  ? 158  VAL A CG1  1 
ATOM   982  C  CG2  . VAL A 1 124 ? 96.029  68.654 -10.992 1.00 61.57  ? 158  VAL A CG2  1 
ATOM   983  N  N    . LYS A 1 125 ? 97.514  64.380 -10.934 1.00 61.57  ? 159  LYS A N    1 
ATOM   984  C  CA   . LYS A 1 125 ? 97.468  62.933 -11.063 1.00 61.76  ? 159  LYS A CA   1 
ATOM   985  C  C    . LYS A 1 125 ? 97.748  62.239 -9.747  1.00 62.39  ? 159  LYS A C    1 
ATOM   986  O  O    . LYS A 1 125 ? 96.985  61.376 -9.325  1.00 63.39  ? 159  LYS A O    1 
ATOM   987  C  CB   . LYS A 1 125 ? 98.465  62.452 -12.089 1.00 62.54  ? 159  LYS A CB   1 
ATOM   988  C  CG   . LYS A 1 125 ? 98.498  63.290 -13.362 1.00 63.42  ? 159  LYS A CG   1 
ATOM   989  C  CD   . LYS A 1 125 ? 98.966  62.417 -14.488 1.00 62.97  ? 159  LYS A CD   1 
ATOM   990  C  CE   . LYS A 1 125 ? 99.183  63.174 -15.792 1.00 64.93  ? 159  LYS A CE   1 
ATOM   991  N  NZ   . LYS A 1 125 ? 99.636  62.161 -16.843 1.00 63.53  ? 159  LYS A NZ   1 
ATOM   992  N  N    . LEU A 1 126 ? 98.829  62.621 -9.088  1.00 62.66  ? 160  LEU A N    1 
ATOM   993  C  CA   . LEU A 1 126 ? 99.176  62.007 -7.812  1.00 62.87  ? 160  LEU A CA   1 
ATOM   994  C  C    . LEU A 1 126 ? 98.109  62.088 -6.715  1.00 62.36  ? 160  LEU A C    1 
ATOM   995  O  O    . LEU A 1 126 ? 97.823  61.101 -6.035  1.00 59.99  ? 160  LEU A O    1 
ATOM   996  C  CB   . LEU A 1 126 ? 100.452 62.634 -7.267  1.00 64.25  ? 160  LEU A CB   1 
ATOM   997  C  CG   . LEU A 1 126 ? 101.768 62.213 -7.892  1.00 63.29  ? 160  LEU A CG   1 
ATOM   998  C  CD1  . LEU A 1 126 ? 102.752 63.298 -7.520  1.00 61.97  ? 160  LEU A CD1  1 
ATOM   999  C  CD2  . LEU A 1 126 ? 102.189 60.805 -7.435  1.00 60.94  ? 160  LEU A CD2  1 
ATOM   1000 N  N    . TYR A 1 127 ? 97.552  63.280 -6.519  1.00 62.79  ? 161  TYR A N    1 
ATOM   1001 C  CA   . TYR A 1 127 ? 96.533  63.437 -5.493  1.00 63.38  ? 161  TYR A CA   1 
ATOM   1002 C  C    . TYR A 1 127 ? 95.285  62.658 -5.839  1.00 62.51  ? 161  TYR A C    1 
ATOM   1003 O  O    . TYR A 1 127 ? 94.801  61.849 -5.020  1.00 62.34  ? 161  TYR A O    1 
ATOM   1004 C  CB   . TYR A 1 127 ? 96.166  64.907 -5.295  1.00 65.74  ? 161  TYR A CB   1 
ATOM   1005 C  CG   . TYR A 1 127 ? 97.292  65.774 -4.825  1.00 67.98  ? 161  TYR A CG   1 
ATOM   1006 C  CD1  . TYR A 1 127 ? 98.460  65.222 -4.251  1.00 69.33  ? 161  TYR A CD1  1 
ATOM   1007 C  CD2  . TYR A 1 127 ? 97.208  67.145 -4.970  1.00 68.51  ? 161  TYR A CD2  1 
ATOM   1008 C  CE1  . TYR A 1 127 ? 99.530  66.049 -3.843  1.00 70.56  ? 161  TYR A CE1  1 
ATOM   1009 C  CE2  . TYR A 1 127 ? 98.246  67.976 -4.574  1.00 70.86  ? 161  TYR A CE2  1 
ATOM   1010 C  CZ   . TYR A 1 127 ? 99.405  67.434 -4.015  1.00 72.09  ? 161  TYR A CZ   1 
ATOM   1011 O  OH   . TYR A 1 127 ? 100.413 68.328 -3.672  1.00 75.08  ? 161  TYR A OH   1 
ATOM   1012 N  N    . MET A 1 128 ? 94.755  62.890 -7.043  1.00 60.94  ? 162  MET A N    1 
ATOM   1013 C  CA   . MET A 1 128 ? 93.559  62.172 -7.458  1.00 59.41  ? 162  MET A CA   1 
ATOM   1014 C  C    . MET A 1 128 ? 93.742  60.671 -7.457  1.00 58.42  ? 162  MET A C    1 
ATOM   1015 O  O    . MET A 1 128 ? 92.850  59.935 -7.025  1.00 58.63  ? 162  MET A O    1 
ATOM   1016 C  CB   . MET A 1 128 ? 93.089  62.617 -8.820  1.00 59.59  ? 162  MET A CB   1 
ATOM   1017 C  CG   . MET A 1 128 ? 92.605  64.065 -8.868  1.00 61.88  ? 162  MET A CG   1 
ATOM   1018 S  SD   . MET A 1 128 ? 91.417  64.425 -7.586  1.00 62.15  ? 162  MET A SD   1 
ATOM   1019 C  CE   . MET A 1 128 ? 90.186  63.160 -8.052  1.00 62.00  ? 162  MET A CE   1 
ATOM   1020 N  N    . TYR A 1 129 ? 94.892  60.185 -7.913  1.00 56.89  ? 163  TYR A N    1 
ATOM   1021 C  CA   . TYR A 1 129 ? 95.088  58.743 -7.934  1.00 55.82  ? 163  TYR A CA   1 
ATOM   1022 C  C    . TYR A 1 129 ? 94.983  58.146 -6.515  1.00 55.96  ? 163  TYR A C    1 
ATOM   1023 O  O    . TYR A 1 129 ? 94.289  57.156 -6.276  1.00 55.86  ? 163  TYR A O    1 
ATOM   1024 C  CB   . TYR A 1 129 ? 96.416  58.429 -8.570  1.00 55.64  ? 163  TYR A CB   1 
ATOM   1025 C  CG   . TYR A 1 129 ? 96.785  56.976 -8.547  1.00 56.47  ? 163  TYR A CG   1 
ATOM   1026 C  CD1  . TYR A 1 129 ? 96.719  56.221 -9.699  1.00 57.26  ? 163  TYR A CD1  1 
ATOM   1027 C  CD2  . TYR A 1 129 ? 97.228  56.358 -7.365  1.00 56.80  ? 163  TYR A CD2  1 
ATOM   1028 C  CE1  . TYR A 1 129 ? 97.081  54.885 -9.705  1.00 57.44  ? 163  TYR A CE1  1 
ATOM   1029 C  CE2  . TYR A 1 129 ? 97.594  55.020 -7.349  1.00 57.11  ? 163  TYR A CE2  1 
ATOM   1030 C  CZ   . TYR A 1 129 ? 97.514  54.292 -8.534  1.00 58.33  ? 163  TYR A CZ   1 
ATOM   1031 O  OH   . TYR A 1 129 ? 97.829  52.956 -8.592  1.00 59.48  ? 163  TYR A OH   1 
ATOM   1032 N  N    . GLN A 1 130 ? 95.650  58.769 -5.556  1.00 56.22  ? 164  GLN A N    1 
ATOM   1033 C  CA   . GLN A 1 130 ? 95.631  58.268 -4.191  1.00 56.00  ? 164  GLN A CA   1 
ATOM   1034 C  C    . GLN A 1 130 ? 94.225  58.379 -3.608  1.00 55.07  ? 164  GLN A C    1 
ATOM   1035 O  O    . GLN A 1 130 ? 93.802  57.503 -2.850  1.00 55.41  ? 164  GLN A O    1 
ATOM   1036 C  CB   . GLN A 1 130 ? 96.686  59.017 -3.340  1.00 58.76  ? 164  GLN A CB   1 
ATOM   1037 C  CG   . GLN A 1 130 ? 98.154  59.070 -3.967  1.00 59.54  ? 164  GLN A CG   1 
ATOM   1038 C  CD   . GLN A 1 130 ? 99.171  59.760 -3.072  1.00 60.09  ? 164  GLN A CD   1 
ATOM   1039 O  OE1  . GLN A 1 130 ? 99.480  59.306 -1.958  1.00 59.21  ? 164  GLN A OE1  1 
ATOM   1040 N  NE2  . GLN A 1 130 ? 99.692  60.879 -3.559  1.00 62.77  ? 164  GLN A NE2  1 
ATOM   1041 N  N    . LEU A 1 131 ? 93.484  59.437 -3.958  1.00 53.44  ? 165  LEU A N    1 
ATOM   1042 C  CA   . LEU A 1 131 ? 92.114  59.563 -3.454  1.00 51.80  ? 165  LEU A CA   1 
ATOM   1043 C  C    . LEU A 1 131 ? 91.263  58.365 -3.919  1.00 51.95  ? 165  LEU A C    1 
ATOM   1044 O  O    . LEU A 1 131 ? 90.531  57.756 -3.110  1.00 50.50  ? 165  LEU A O    1 
ATOM   1045 C  CB   . LEU A 1 131 ? 91.467  60.861 -3.919  1.00 49.18  ? 165  LEU A CB   1 
ATOM   1046 C  CG   . LEU A 1 131 ? 89.935  60.912 -3.674  1.00 49.25  ? 165  LEU A CG   1 
ATOM   1047 C  CD1  . LEU A 1 131 ? 89.571  60.752 -2.183  1.00 46.52  ? 165  LEU A CD1  1 
ATOM   1048 C  CD2  . LEU A 1 131 ? 89.388  62.243 -4.183  1.00 47.97  ? 165  LEU A CD2  1 
ATOM   1049 N  N    . PHE A 1 132 ? 91.369  58.028 -5.216  1.00 50.90  ? 166  PHE A N    1 
ATOM   1050 C  CA   . PHE A 1 132 ? 90.618  56.885 -5.758  1.00 51.85  ? 166  PHE A CA   1 
ATOM   1051 C  C    . PHE A 1 132 ? 91.094  55.595 -5.096  1.00 53.81  ? 166  PHE A C    1 
ATOM   1052 O  O    . PHE A 1 132 ? 90.295  54.755 -4.701  1.00 54.95  ? 166  PHE A O    1 
ATOM   1053 C  CB   . PHE A 1 132 ? 90.740  56.754 -7.280  1.00 47.42  ? 166  PHE A CB   1 
ATOM   1054 C  CG   . PHE A 1 132 ? 89.981  57.798 -8.040  1.00 46.50  ? 166  PHE A CG   1 
ATOM   1055 C  CD1  . PHE A 1 132 ? 88.580  57.964 -7.842  1.00 44.75  ? 166  PHE A CD1  1 
ATOM   1056 C  CD2  . PHE A 1 132 ? 90.662  58.675 -8.921  1.00 44.49  ? 166  PHE A CD2  1 
ATOM   1057 C  CE1  . PHE A 1 132 ? 87.842  59.002 -8.501  1.00 44.77  ? 166  PHE A CE1  1 
ATOM   1058 C  CE2  . PHE A 1 132 ? 89.968  59.729 -9.595  1.00 46.19  ? 166  PHE A CE2  1 
ATOM   1059 C  CZ   . PHE A 1 132 ? 88.529  59.894 -9.377  1.00 45.96  ? 166  PHE A CZ   1 
ATOM   1060 N  N    . ARG A 1 133 ? 92.395  55.425 -4.948  1.00 55.78  ? 167  ARG A N    1 
ATOM   1061 C  CA   . ARG A 1 133 ? 92.846  54.215 -4.323  1.00 56.84  ? 167  ARG A CA   1 
ATOM   1062 C  C    . ARG A 1 133 ? 92.214  54.059 -2.953  1.00 57.45  ? 167  ARG A C    1 
ATOM   1063 O  O    . ARG A 1 133 ? 91.786  52.949 -2.583  1.00 59.37  ? 167  ARG A O    1 
ATOM   1064 C  CB   . ARG A 1 133 ? 94.356  54.192 -4.166  1.00 58.21  ? 167  ARG A CB   1 
ATOM   1065 C  CG   . ARG A 1 133 ? 94.813  52.833 -3.649  1.00 60.92  ? 167  ARG A CG   1 
ATOM   1066 C  CD   . ARG A 1 133 ? 96.300  52.659 -3.729  1.00 62.17  ? 167  ARG A CD   1 
ATOM   1067 N  NE   . ARG A 1 133 ? 96.720  51.406 -3.107  1.00 65.51  ? 167  ARG A NE   1 
ATOM   1068 C  CZ   . ARG A 1 133 ? 97.986  51.069 -2.850  1.00 66.59  ? 167  ARG A CZ   1 
ATOM   1069 N  NH1  . ARG A 1 133 ? 98.987  51.886 -3.148  1.00 66.72  ? 167  ARG A NH1  1 
ATOM   1070 N  NH2  . ARG A 1 133 ? 98.256  49.893 -2.296  1.00 67.33  ? 167  ARG A NH2  1 
ATOM   1071 N  N    . SER A 1 134 ? 92.133  55.142 -2.192  1.00 56.43  ? 168  SER A N    1 
ATOM   1072 C  CA   . SER A 1 134 ? 91.573  54.996 -0.845  1.00 57.14  ? 168  SER A CA   1 
ATOM   1073 C  C    . SER A 1 134 ? 90.087  54.677 -0.902  1.00 57.53  ? 168  SER A C    1 
ATOM   1074 O  O    . SER A 1 134 ? 89.489  53.937 -0.066  1.00 58.08  ? 168  SER A O    1 
ATOM   1075 C  CB   . SER A 1 134 ? 91.755  56.293 -0.016  1.00 56.56  ? 168  SER A CB   1 
ATOM   1076 O  OG   . SER A 1 134 ? 90.948  57.340 -0.534  1.00 55.97  ? 168  SER A OG   1 
ATOM   1077 N  N    . LEU A 1 135 ? 89.483  55.319 -1.882  1.00 55.87  ? 169  LEU A N    1 
ATOM   1078 C  CA   . LEU A 1 135 ? 88.069  55.239 -2.063  1.00 53.75  ? 169  LEU A CA   1 
ATOM   1079 C  C    . LEU A 1 135 ? 87.720  53.787 -2.369  1.00 54.03  ? 169  LEU A C    1 
ATOM   1080 O  O    . LEU A 1 135 ? 86.750  53.237 -1.800  1.00 54.69  ? 169  LEU A O    1 
ATOM   1081 C  CB   . LEU A 1 135 ? 87.721  56.245 -3.160  1.00 51.48  ? 169  LEU A CB   1 
ATOM   1082 C  CG   . LEU A 1 135 ? 86.590  57.242 -2.977  1.00 48.61  ? 169  LEU A CG   1 
ATOM   1083 C  CD1  . LEU A 1 135 ? 86.441  57.663 -1.539  1.00 44.32  ? 169  LEU A CD1  1 
ATOM   1084 C  CD2  . LEU A 1 135 ? 86.832  58.389 -3.909  1.00 44.88  ? 169  LEU A CD2  1 
ATOM   1085 N  N    . ALA A 1 136 ? 88.524  53.145 -3.217  1.00 53.57  ? 170  ALA A N    1 
ATOM   1086 C  CA   . ALA A 1 136 ? 88.298  51.738 -3.547  1.00 54.05  ? 170  ALA A CA   1 
ATOM   1087 C  C    . ALA A 1 136 ? 88.405  50.895 -2.258  1.00 55.45  ? 170  ALA A C    1 
ATOM   1088 O  O    . ALA A 1 136 ? 87.558  50.022 -1.982  1.00 54.81  ? 170  ALA A O    1 
ATOM   1089 C  CB   . ALA A 1 136 ? 89.307  51.292 -4.542  1.00 53.59  ? 170  ALA A CB   1 
ATOM   1090 N  N    . TYR A 1 137 ? 89.431  51.211 -1.453  1.00 55.82  ? 171  TYR A N    1 
ATOM   1091 C  CA   . TYR A 1 137 ? 89.685  50.538 -0.172  1.00 55.16  ? 171  TYR A CA   1 
ATOM   1092 C  C    . TYR A 1 137 ? 88.476  50.604 0.729   1.00 55.28  ? 171  TYR A C    1 
ATOM   1093 O  O    . TYR A 1 137 ? 87.908  49.580 1.057   1.00 54.54  ? 171  TYR A O    1 
ATOM   1094 C  CB   . TYR A 1 137 ? 90.902  51.147 0.554   1.00 55.28  ? 171  TYR A CB   1 
ATOM   1095 C  CG   . TYR A 1 137 ? 91.229  50.491 1.891   1.00 57.52  ? 171  TYR A CG   1 
ATOM   1096 C  CD1  . TYR A 1 137 ? 90.896  51.105 3.116   1.00 60.13  ? 171  TYR A CD1  1 
ATOM   1097 C  CD2  . TYR A 1 137 ? 91.816  49.231 1.950   1.00 57.77  ? 171  TYR A CD2  1 
ATOM   1098 C  CE1  . TYR A 1 137 ? 91.153  50.448 4.356   1.00 59.92  ? 171  TYR A CE1  1 
ATOM   1099 C  CE2  . TYR A 1 137 ? 92.066  48.566 3.166   1.00 56.83  ? 171  TYR A CE2  1 
ATOM   1100 C  CZ   . TYR A 1 137 ? 91.737  49.177 4.351   1.00 59.03  ? 171  TYR A CZ   1 
ATOM   1101 O  OH   . TYR A 1 137 ? 91.992  48.513 5.541   1.00 60.94  ? 171  TYR A OH   1 
ATOM   1102 N  N    . ILE A 1 138 ? 88.065  51.797 1.148   1.00 56.36  ? 172  ILE A N    1 
ATOM   1103 C  CA   . ILE A 1 138 ? 86.911  51.821 2.025   1.00 56.20  ? 172  ILE A CA   1 
ATOM   1104 C  C    . ILE A 1 138 ? 85.638  51.240 1.377   1.00 57.44  ? 172  ILE A C    1 
ATOM   1105 O  O    . ILE A 1 138 ? 84.790  50.696 2.073   1.00 57.29  ? 172  ILE A O    1 
ATOM   1106 C  CB   . ILE A 1 138 ? 86.610  53.228 2.542   1.00 54.47  ? 172  ILE A CB   1 
ATOM   1107 C  CG1  . ILE A 1 138 ? 86.226  54.142 1.392   1.00 53.77  ? 172  ILE A CG1  1 
ATOM   1108 C  CG2  . ILE A 1 138 ? 87.809  53.797 3.245   1.00 55.57  ? 172  ILE A CG2  1 
ATOM   1109 C  CD1  . ILE A 1 138 ? 85.548  55.359 1.902   1.00 52.66  ? 172  ILE A CD1  1 
ATOM   1110 N  N    . HIS A 1 139 ? 85.479  51.352 0.061   1.00 58.59  ? 173  HIS A N    1 
ATOM   1111 C  CA   . HIS A 1 139 ? 84.256  50.792 -0.532  1.00 59.60  ? 173  HIS A CA   1 
ATOM   1112 C  C    . HIS A 1 139 ? 84.211  49.291 -0.444  1.00 59.62  ? 173  HIS A C    1 
ATOM   1113 O  O    . HIS A 1 139 ? 83.152  48.703 -0.351  1.00 59.25  ? 173  HIS A O    1 
ATOM   1114 C  CB   . HIS A 1 139 ? 84.109  51.176 -1.988  1.00 59.62  ? 173  HIS A CB   1 
ATOM   1115 C  CG   . HIS A 1 139 ? 83.713  52.595 -2.170  1.00 59.34  ? 173  HIS A CG   1 
ATOM   1116 N  ND1  . HIS A 1 139 ? 83.543  53.168 -3.411  1.00 58.59  ? 173  HIS A ND1  1 
ATOM   1117 C  CD2  . HIS A 1 139 ? 83.487  53.570 -1.267  1.00 59.23  ? 173  HIS A CD2  1 
ATOM   1118 C  CE1  . HIS A 1 139 ? 83.234  54.440 -3.267  1.00 57.92  ? 173  HIS A CE1  1 
ATOM   1119 N  NE2  . HIS A 1 139 ? 83.194  54.711 -1.977  1.00 59.62  ? 173  HIS A NE2  1 
ATOM   1120 N  N    . SER A 1 140 ? 85.383  48.670 -0.500  1.00 60.21  ? 174  SER A N    1 
ATOM   1121 C  CA   . SER A 1 140 ? 85.489  47.238 -0.411  1.00 57.95  ? 174  SER A CA   1 
ATOM   1122 C  C    . SER A 1 140 ? 85.039  46.770 0.950   1.00 58.37  ? 174  SER A C    1 
ATOM   1123 O  O    . SER A 1 140 ? 84.913  45.604 1.157   1.00 61.04  ? 174  SER A O    1 
ATOM   1124 C  CB   . SER A 1 140 ? 86.911  46.819 -0.679  1.00 56.62  ? 174  SER A CB   1 
ATOM   1125 O  OG   . SER A 1 140 ? 87.647  46.713 0.529   1.00 57.33  ? 174  SER A OG   1 
ATOM   1126 N  N    . PHE A 1 141 ? 84.811  47.654 1.906   1.00 59.39  ? 175  PHE A N    1 
ATOM   1127 C  CA   . PHE A 1 141 ? 84.315  47.249 3.218   1.00 59.09  ? 175  PHE A CA   1 
ATOM   1128 C  C    . PHE A 1 141 ? 82.862  47.676 3.208   1.00 58.55  ? 175  PHE A C    1 
ATOM   1129 O  O    . PHE A 1 141 ? 82.159  47.666 4.226   1.00 58.47  ? 175  PHE A O    1 
ATOM   1130 C  CB   . PHE A 1 141 ? 84.998  48.016 4.330   1.00 63.88  ? 175  PHE A CB   1 
ATOM   1131 C  CG   . PHE A 1 141 ? 86.379  47.573 4.613   1.00 70.54  ? 175  PHE A CG   1 
ATOM   1132 C  CD1  . PHE A 1 141 ? 87.416  47.858 3.727   1.00 74.40  ? 175  PHE A CD1  1 
ATOM   1133 C  CD2  . PHE A 1 141 ? 86.666  46.870 5.779   1.00 72.94  ? 175  PHE A CD2  1 
ATOM   1134 C  CE1  . PHE A 1 141 ? 88.746  47.438 4.005   1.00 76.42  ? 175  PHE A CE1  1 
ATOM   1135 C  CE2  . PHE A 1 141 ? 87.958  46.455 6.063   1.00 76.17  ? 175  PHE A CE2  1 
ATOM   1136 C  CZ   . PHE A 1 141 ? 89.007  46.736 5.171   1.00 76.08  ? 175  PHE A CZ   1 
ATOM   1137 N  N    . GLY A 1 142 ? 82.404  48.092 2.044   1.00 57.89  ? 176  GLY A N    1 
ATOM   1138 C  CA   . GLY A 1 142 ? 81.051  48.589 1.942   1.00 58.35  ? 176  GLY A CA   1 
ATOM   1139 C  C    . GLY A 1 142 ? 80.825  49.909 2.663   1.00 59.67  ? 176  GLY A C    1 
ATOM   1140 O  O    . GLY A 1 142 ? 79.660  50.220 2.963   1.00 61.08  ? 176  GLY A O    1 
ATOM   1141 N  N    . ILE A 1 143 ? 81.904  50.677 2.942   1.00 58.22  ? 177  ILE A N    1 
ATOM   1142 C  CA   . ILE A 1 143 ? 81.809  51.960 3.636   1.00 56.34  ? 177  ILE A CA   1 
ATOM   1143 C  C    . ILE A 1 143 ? 81.843  53.069 2.653   1.00 55.40  ? 177  ILE A C    1 
ATOM   1144 O  O    . ILE A 1 143 ? 82.736  53.130 1.831   1.00 56.04  ? 177  ILE A O    1 
ATOM   1145 C  CB   . ILE A 1 143 ? 82.971  52.174 4.594   1.00 57.96  ? 177  ILE A CB   1 
ATOM   1146 C  CG1  . ILE A 1 143 ? 82.895  51.108 5.673   1.00 57.76  ? 177  ILE A CG1  1 
ATOM   1147 C  CG2  . ILE A 1 143 ? 82.922  53.605 5.212   1.00 55.12  ? 177  ILE A CG2  1 
ATOM   1148 C  CD1  . ILE A 1 143 ? 84.135  51.068 6.494   1.00 59.41  ? 177  ILE A CD1  1 
ATOM   1149 N  N    . CYS A 1 144 ? 80.855  53.947 2.716   1.00 54.73  ? 178  CYS A N    1 
ATOM   1150 C  CA   . CYS A 1 144 ? 80.801  55.091 1.817   1.00 53.93  ? 178  CYS A CA   1 
ATOM   1151 C  C    . CYS A 1 144 ? 81.214  56.327 2.663   1.00 53.65  ? 178  CYS A C    1 
ATOM   1152 O  O    . CYS A 1 144 ? 80.658  56.601 3.745   1.00 53.10  ? 178  CYS A O    1 
ATOM   1153 C  CB   . CYS A 1 144 ? 79.386  55.252 1.278   1.00 53.37  ? 178  CYS A CB   1 
ATOM   1154 S  SG   . CYS A 1 144 ? 79.112  56.792 0.335   1.00 58.11  ? 178  CYS A SG   1 
ATOM   1155 N  N    . HIS A 1 145 ? 82.163  57.111 2.176   1.00 52.28  ? 179  HIS A N    1 
ATOM   1156 C  CA   . HIS A 1 145 ? 82.585  58.244 2.951   1.00 51.23  ? 179  HIS A CA   1 
ATOM   1157 C  C    . HIS A 1 145 ? 81.526  59.312 3.139   1.00 51.32  ? 179  HIS A C    1 
ATOM   1158 O  O    . HIS A 1 145 ? 81.406  59.809 4.231   1.00 52.52  ? 179  HIS A O    1 
ATOM   1159 C  CB   . HIS A 1 145 ? 83.834  58.809 2.361   1.00 51.45  ? 179  HIS A CB   1 
ATOM   1160 C  CG   . HIS A 1 145 ? 84.493  59.832 3.217   1.00 52.80  ? 179  HIS A CG   1 
ATOM   1161 N  ND1  . HIS A 1 145 ? 84.042  61.129 3.299   1.00 52.38  ? 179  HIS A ND1  1 
ATOM   1162 C  CD2  . HIS A 1 145 ? 85.637  59.776 3.947   1.00 53.26  ? 179  HIS A CD2  1 
ATOM   1163 C  CE1  . HIS A 1 145 ? 84.890  61.828 4.032   1.00 53.32  ? 179  HIS A CE1  1 
ATOM   1164 N  NE2  . HIS A 1 145 ? 85.866  61.030 4.434   1.00 53.11  ? 179  HIS A NE2  1 
ATOM   1165 N  N    . ARG A 1 146 ? 80.761  59.666 2.108   1.00 51.33  ? 180  ARG A N    1 
ATOM   1166 C  CA   . ARG A 1 146 ? 79.665  60.655 2.239   1.00 52.22  ? 180  ARG A CA   1 
ATOM   1167 C  C    . ARG A 1 146 ? 80.085  62.123 2.460   1.00 53.87  ? 180  ARG A C    1 
ATOM   1168 O  O    . ARG A 1 146 ? 79.235  63.021 2.596   1.00 53.65  ? 180  ARG A O    1 
ATOM   1169 C  CB   . ARG A 1 146 ? 78.690  60.229 3.365   1.00 49.68  ? 180  ARG A CB   1 
ATOM   1170 C  CG   . ARG A 1 146 ? 78.113  58.862 3.111   1.00 50.44  ? 180  ARG A CG   1 
ATOM   1171 C  CD   . ARG A 1 146 ? 76.686  58.762 3.495   1.00 49.28  ? 180  ARG A CD   1 
ATOM   1172 N  NE   . ARG A 1 146 ? 76.652  58.795 4.936   1.00 52.75  ? 180  ARG A NE   1 
ATOM   1173 C  CZ   . ARG A 1 146 ? 75.568  58.675 5.699   1.00 53.06  ? 180  ARG A CZ   1 
ATOM   1174 N  NH1  . ARG A 1 146 ? 74.365  58.519 5.149   1.00 53.45  ? 180  ARG A NH1  1 
ATOM   1175 N  NH2  . ARG A 1 146 ? 75.705  58.674 7.027   1.00 52.01  ? 180  ARG A NH2  1 
ATOM   1176 N  N    . ASP A 1 147 ? 81.395  62.366 2.492   1.00 54.12  ? 181  ASP A N    1 
ATOM   1177 C  CA   . ASP A 1 147 ? 81.868  63.709 2.719   1.00 54.15  ? 181  ASP A CA   1 
ATOM   1178 C  C    . ASP A 1 147 ? 83.199  63.934 2.006   1.00 53.74  ? 181  ASP A C    1 
ATOM   1179 O  O    . ASP A 1 147 ? 84.113  64.555 2.529   1.00 54.97  ? 181  ASP A O    1 
ATOM   1180 C  CB   . ASP A 1 147 ? 81.967  63.940 4.238   1.00 56.67  ? 181  ASP A CB   1 
ATOM   1181 C  CG   . ASP A 1 147 ? 82.059  65.422 4.634   1.00 58.85  ? 181  ASP A CG   1 
ATOM   1182 O  OD1  . ASP A 1 147 ? 81.642  66.283 3.819   1.00 59.51  ? 181  ASP A OD1  1 
ATOM   1183 O  OD2  . ASP A 1 147 ? 82.532  65.713 5.777   1.00 58.33  ? 181  ASP A OD2  1 
ATOM   1184 N  N    . ILE A 1 148 ? 83.335  63.436 0.789   1.00 52.01  ? 182  ILE A N    1 
ATOM   1185 C  CA   . ILE A 1 148 ? 84.561  63.687 0.058   1.00 49.18  ? 182  ILE A CA   1 
ATOM   1186 C  C    . ILE A 1 148 ? 84.602  65.158 -0.413  1.00 50.72  ? 182  ILE A C    1 
ATOM   1187 O  O    . ILE A 1 148 ? 83.753  65.582 -1.186  1.00 49.90  ? 182  ILE A O    1 
ATOM   1188 C  CB   . ILE A 1 148 ? 84.672  62.776 -1.176  1.00 45.88  ? 182  ILE A CB   1 
ATOM   1189 C  CG1  . ILE A 1 148 ? 84.808  61.330 -0.718  1.00 45.64  ? 182  ILE A CG1  1 
ATOM   1190 C  CG2  . ILE A 1 148 ? 85.849  63.154 -2.015  1.00 40.35  ? 182  ILE A CG2  1 
ATOM   1191 C  CD1  . ILE A 1 148 ? 85.968  61.079 0.219   1.00 45.29  ? 182  ILE A CD1  1 
ATOM   1192 N  N    . LYS A 1 149 ? 85.561  65.938 0.095   1.00 52.45  ? 183  LYS A N    1 
ATOM   1193 C  CA   . LYS A 1 149 ? 85.769  67.349 -0.311  1.00 54.04  ? 183  LYS A CA   1 
ATOM   1194 C  C    . LYS A 1 149 ? 87.250  67.668 -0.085  1.00 54.25  ? 183  LYS A C    1 
ATOM   1195 O  O    . LYS A 1 149 ? 87.896  67.000 0.703   1.00 54.66  ? 183  LYS A O    1 
ATOM   1196 C  CB   . LYS A 1 149 ? 84.884  68.290 0.494   1.00 55.17  ? 183  LYS A CB   1 
ATOM   1197 C  CG   . LYS A 1 149 ? 85.057  68.193 1.982   1.00 57.13  ? 183  LYS A CG   1 
ATOM   1198 C  CD   . LYS A 1 149 ? 84.060  69.078 2.683   1.00 59.45  ? 183  LYS A CD   1 
ATOM   1199 C  CE   . LYS A 1 149 ? 84.206  68.988 4.221   1.00 61.13  ? 183  LYS A CE   1 
ATOM   1200 N  NZ   . LYS A 1 149 ? 83.515  70.190 4.850   1.00 63.37  ? 183  LYS A NZ   1 
ATOM   1201 N  N    . PRO A 1 150 ? 87.797  68.706 -0.757  1.00 54.64  ? 184  PRO A N    1 
ATOM   1202 C  CA   . PRO A 1 150 ? 89.216  69.038 -0.590  1.00 55.11  ? 184  PRO A CA   1 
ATOM   1203 C  C    . PRO A 1 150 ? 89.724  69.219 0.876   1.00 56.37  ? 184  PRO A C    1 
ATOM   1204 O  O    . PRO A 1 150 ? 90.864  68.851 1.188   1.00 56.59  ? 184  PRO A O    1 
ATOM   1205 C  CB   . PRO A 1 150 ? 89.387  70.288 -1.442  1.00 53.37  ? 184  PRO A CB   1 
ATOM   1206 C  CG   . PRO A 1 150 ? 88.239  70.237 -2.363  1.00 54.34  ? 184  PRO A CG   1 
ATOM   1207 C  CD   . PRO A 1 150 ? 87.126  69.766 -1.518  1.00 54.17  ? 184  PRO A CD   1 
ATOM   1208 N  N    . GLN A 1 151 ? 88.907  69.746 1.774   1.00 56.26  ? 185  GLN A N    1 
ATOM   1209 C  CA   . GLN A 1 151 ? 89.376  69.900 3.130   1.00 58.58  ? 185  GLN A CA   1 
ATOM   1210 C  C    . GLN A 1 151 ? 89.552  68.549 3.813   1.00 58.56  ? 185  GLN A C    1 
ATOM   1211 O  O    . GLN A 1 151 ? 90.223  68.491 4.835   1.00 59.50  ? 185  GLN A O    1 
ATOM   1212 C  CB   . GLN A 1 151 ? 88.434  70.787 3.977   1.00 62.13  ? 185  GLN A CB   1 
ATOM   1213 C  CG   . GLN A 1 151 ? 87.989  72.120 3.292   1.00 70.76  ? 185  GLN A CG   1 
ATOM   1214 C  CD   . GLN A 1 151 ? 86.874  71.934 2.166   1.00 74.72  ? 185  GLN A CD   1 
ATOM   1215 O  OE1  . GLN A 1 151 ? 85.670  72.074 2.455   1.00 78.62  ? 185  GLN A OE1  1 
ATOM   1216 N  NE2  . GLN A 1 151 ? 87.282  71.613 0.915   1.00 74.21  ? 185  GLN A NE2  1 
ATOM   1217 N  N    . ASN A 1 152 ? 88.974  67.452 3.296   1.00 58.20  ? 186  ASN A N    1 
ATOM   1218 C  CA   . ASN A 1 152 ? 89.157  66.149 3.950   1.00 57.00  ? 186  ASN A CA   1 
ATOM   1219 C  C    . ASN A 1 152 ? 90.207  65.328 3.276   1.00 57.90  ? 186  ASN A C    1 
ATOM   1220 O  O    . ASN A 1 152 ? 90.316  64.137 3.520   1.00 59.15  ? 186  ASN A O    1 
ATOM   1221 C  CB   . ASN A 1 152 ? 87.884  65.333 4.043   1.00 56.52  ? 186  ASN A CB   1 
ATOM   1222 C  CG   . ASN A 1 152 ? 86.864  65.967 4.950   1.00 60.29  ? 186  ASN A CG   1 
ATOM   1223 O  OD1  . ASN A 1 152 ? 87.206  66.744 5.836   1.00 63.65  ? 186  ASN A OD1  1 
ATOM   1224 N  ND2  . ASN A 1 152 ? 85.596  65.631 4.754   1.00 61.21  ? 186  ASN A ND2  1 
ATOM   1225 N  N    . LEU A 1 153 ? 90.990  65.948 2.413   1.00 58.29  ? 187  LEU A N    1 
ATOM   1226 C  CA   . LEU A 1 153 ? 92.066  65.229 1.748   1.00 60.69  ? 187  LEU A CA   1 
ATOM   1227 C  C    . LEU A 1 153 ? 93.391  65.786 2.284   1.00 61.97  ? 187  LEU A C    1 
ATOM   1228 O  O    . LEU A 1 153 ? 93.784  66.897 1.900   1.00 63.15  ? 187  LEU A O    1 
ATOM   1229 C  CB   . LEU A 1 153 ? 91.981  65.433 0.210   1.00 59.94  ? 187  LEU A CB   1 
ATOM   1230 C  CG   . LEU A 1 153 ? 90.611  65.015 -0.344  1.00 57.45  ? 187  LEU A CG   1 
ATOM   1231 C  CD1  . LEU A 1 153 ? 90.527  65.371 -1.762  1.00 54.21  ? 187  LEU A CD1  1 
ATOM   1232 C  CD2  . LEU A 1 153 ? 90.377  63.521 -0.082  1.00 55.07  ? 187  LEU A CD2  1 
ATOM   1233 N  N    . LEU A 1 154 ? 94.069  65.056 3.182   1.00 62.13  ? 188  LEU A N    1 
ATOM   1234 C  CA   . LEU A 1 154 ? 95.330  65.566 3.712   1.00 62.18  ? 188  LEU A CA   1 
ATOM   1235 C  C    . LEU A 1 154 ? 96.476  65.261 2.781   1.00 64.25  ? 188  LEU A C    1 
ATOM   1236 O  O    . LEU A 1 154 ? 96.526  64.196 2.163   1.00 65.07  ? 188  LEU A O    1 
ATOM   1237 C  CB   . LEU A 1 154 ? 95.602  65.018 5.101   1.00 58.86  ? 188  LEU A CB   1 
ATOM   1238 C  CG   . LEU A 1 154 ? 94.449  65.034 6.124   1.00 56.74  ? 188  LEU A CG   1 
ATOM   1239 C  CD1  . LEU A 1 154 ? 94.836  64.224 7.335   1.00 56.35  ? 188  LEU A CD1  1 
ATOM   1240 C  CD2  . LEU A 1 154 ? 94.064  66.395 6.517   1.00 53.13  ? 188  LEU A CD2  1 
ATOM   1241 N  N    . LEU A 1 155 ? 97.401  66.221 2.707   1.00 67.89  ? 189  LEU A N    1 
ATOM   1242 C  CA   . LEU A 1 155 ? 98.628  66.187 1.876   1.00 70.80  ? 189  LEU A CA   1 
ATOM   1243 C  C    . LEU A 1 155 ? 99.911  66.449 2.613   1.00 72.69  ? 189  LEU A C    1 
ATOM   1244 O  O    . LEU A 1 155 ? 99.953  67.325 3.464   1.00 72.00  ? 189  LEU A O    1 
ATOM   1245 C  CB   . LEU A 1 155 ? 98.622  67.310 0.848   1.00 70.42  ? 189  LEU A CB   1 
ATOM   1246 C  CG   . LEU A 1 155 ? 97.688  67.149 -0.288  1.00 69.75  ? 189  LEU A CG   1 
ATOM   1247 C  CD1  . LEU A 1 155 ? 97.740  68.310 -1.205  1.00 70.45  ? 189  LEU A CD1  1 
ATOM   1248 C  CD2  . LEU A 1 155 ? 98.115  65.904 -0.953  1.00 71.54  ? 189  LEU A CD2  1 
ATOM   1249 N  N    . ASP A 1 156 ? 100.964 65.751 2.223   1.00 75.75  ? 190  ASP A N    1 
ATOM   1250 C  CA   . ASP A 1 156 ? 102.275 66.027 2.760   1.00 80.23  ? 190  ASP A CA   1 
ATOM   1251 C  C    . ASP A 1 156 ? 103.044 66.610 1.592   1.00 82.55  ? 190  ASP A C    1 
ATOM   1252 O  O    . ASP A 1 156 ? 103.649 65.853 0.834   1.00 84.21  ? 190  ASP A O    1 
ATOM   1253 C  CB   . ASP A 1 156 ? 102.993 64.778 3.158   1.00 82.14  ? 190  ASP A CB   1 
ATOM   1254 C  CG   . ASP A 1 156 ? 104.333 65.100 3.792   1.00 85.44  ? 190  ASP A CG   1 
ATOM   1255 O  OD1  . ASP A 1 156 ? 105.247 65.638 3.111   1.00 85.57  ? 190  ASP A OD1  1 
ATOM   1256 O  OD2  . ASP A 1 156 ? 104.448 64.843 5.013   1.00 89.45  ? 190  ASP A OD2  1 
ATOM   1257 N  N    . PRO A 1 157 ? 103.065 67.941 1.425   1.00 84.19  ? 191  PRO A N    1 
ATOM   1258 C  CA   . PRO A 1 157 ? 103.758 68.622 0.320   1.00 84.80  ? 191  PRO A CA   1 
ATOM   1259 C  C    . PRO A 1 157 ? 105.093 68.075 -0.155  1.00 85.32  ? 191  PRO A C    1 
ATOM   1260 O  O    . PRO A 1 157 ? 105.398 68.121 -1.363  1.00 86.09  ? 191  PRO A O    1 
ATOM   1261 C  CB   . PRO A 1 157 ? 103.865 70.048 0.819   1.00 85.50  ? 191  PRO A CB   1 
ATOM   1262 C  CG   . PRO A 1 157 ? 102.559 70.222 1.518   1.00 86.15  ? 191  PRO A CG   1 
ATOM   1263 C  CD   . PRO A 1 157 ? 102.555 68.938 2.373   1.00 85.71  ? 191  PRO A CD   1 
ATOM   1264 N  N    . ASP A 1 158 ? 105.875 67.543 0.777   1.00 84.60  ? 192  ASP A N    1 
ATOM   1265 C  CA   . ASP A 1 158 ? 107.167 67.013 0.406   1.00 84.58  ? 192  ASP A CA   1 
ATOM   1266 C  C    . ASP A 1 158 ? 107.113 65.655 -0.229  1.00 83.01  ? 192  ASP A C    1 
ATOM   1267 O  O    . ASP A 1 158 ? 107.554 65.490 -1.379  1.00 83.23  ? 192  ASP A O    1 
ATOM   1268 C  CB   . ASP A 1 158 ? 108.085 67.004 1.616   1.00 88.50  ? 192  ASP A CB   1 
ATOM   1269 C  CG   . ASP A 1 158 ? 108.195 68.411 2.282   1.00 91.85  ? 192  ASP A CG   1 
ATOM   1270 O  OD1  . ASP A 1 158 ? 108.123 69.461 1.550   1.00 91.74  ? 192  ASP A OD1  1 
ATOM   1271 O  OD2  . ASP A 1 158 ? 108.362 68.443 3.544   1.00 92.46  ? 192  ASP A OD2  1 
ATOM   1272 N  N    . THR A 1 159 ? 106.559 64.684 0.488   1.00 80.48  ? 193  THR A N    1 
ATOM   1273 C  CA   . THR A 1 159 ? 106.437 63.329 -0.042  1.00 79.52  ? 193  THR A CA   1 
ATOM   1274 C  C    . THR A 1 159 ? 105.336 63.154 -1.128  1.00 78.41  ? 193  THR A C    1 
ATOM   1275 O  O    . THR A 1 159 ? 105.358 62.162 -1.883  1.00 78.38  ? 193  THR A O    1 
ATOM   1276 C  CB   . THR A 1 159 ? 106.153 62.364 1.069   1.00 80.05  ? 193  THR A CB   1 
ATOM   1277 O  OG1  . THR A 1 159 ? 104.788 62.491 1.492   1.00 82.84  ? 193  THR A OG1  1 
ATOM   1278 C  CG2  . THR A 1 159 ? 106.996 62.702 2.217   1.00 81.64  ? 193  THR A CG2  1 
ATOM   1279 N  N    . ALA A 1 160 ? 104.397 64.112 -1.198  1.00 75.49  ? 194  ALA A N    1 
ATOM   1280 C  CA   . ALA A 1 160 ? 103.280 64.104 -2.155  1.00 72.25  ? 194  ALA A CA   1 
ATOM   1281 C  C    . ALA A 1 160 ? 102.249 62.999 -1.821  1.00 69.69  ? 194  ALA A C    1 
ATOM   1282 O  O    . ALA A 1 160 ? 101.490 62.550 -2.660  1.00 70.34  ? 194  ALA A O    1 
ATOM   1283 C  CB   . ALA A 1 160 ? 103.801 63.935 -3.582  1.00 70.18  ? 194  ALA A CB   1 
ATOM   1284 N  N    . VAL A 1 161 ? 102.205 62.589 -0.572  1.00 66.48  ? 195  VAL A N    1 
ATOM   1285 C  CA   . VAL A 1 161 ? 101.289 61.546 -0.172  1.00 64.02  ? 195  VAL A CA   1 
ATOM   1286 C  C    . VAL A 1 161 ? 99.918  62.119 0.241   1.00 64.68  ? 195  VAL A C    1 
ATOM   1287 O  O    . VAL A 1 161 ? 99.827  63.195 0.897   1.00 65.13  ? 195  VAL A O    1 
ATOM   1288 C  CB   . VAL A 1 161 ? 101.931 60.738 0.967   1.00 61.35  ? 195  VAL A CB   1 
ATOM   1289 C  CG1  . VAL A 1 161 ? 100.945 59.855 1.627   1.00 59.04  ? 195  VAL A CG1  1 
ATOM   1290 C  CG2  . VAL A 1 161 ? 103.008 59.898 0.404   1.00 59.95  ? 195  VAL A CG2  1 
ATOM   1291 N  N    . LEU A 1 162 ? 98.842  61.428 -0.153  1.00 63.10  ? 196  LEU A N    1 
ATOM   1292 C  CA   . LEU A 1 162 ? 97.516  61.936 0.200   1.00 60.58  ? 196  LEU A CA   1 
ATOM   1293 C  C    . LEU A 1 162 ? 96.843  60.981 1.152   1.00 58.68  ? 196  LEU A C    1 
ATOM   1294 O  O    . LEU A 1 162 ? 97.044  59.771 1.059   1.00 58.59  ? 196  LEU A O    1 
ATOM   1295 C  CB   . LEU A 1 162 ? 96.668  62.183 -1.059  1.00 59.77  ? 196  LEU A CB   1 
ATOM   1296 C  CG   . LEU A 1 162 ? 95.219  62.563 -0.740  1.00 59.18  ? 196  LEU A CG   1 
ATOM   1297 C  CD1  . LEU A 1 162 ? 94.618  63.570 -1.712  1.00 58.47  ? 196  LEU A CD1  1 
ATOM   1298 C  CD2  . LEU A 1 162 ? 94.460  61.290 -0.767  1.00 57.52  ? 196  LEU A CD2  1 
ATOM   1299 N  N    . LYS A 1 163 ? 96.095  61.516 2.104   1.00 56.78  ? 197  LYS A N    1 
ATOM   1300 C  CA   . LYS A 1 163 ? 95.421  60.686 3.090   1.00 57.18  ? 197  LYS A CA   1 
ATOM   1301 C  C    . LYS A 1 163 ? 93.987  61.135 3.351   1.00 56.85  ? 197  LYS A C    1 
ATOM   1302 O  O    . LYS A 1 163 ? 93.714  62.295 3.727   1.00 55.75  ? 197  LYS A O    1 
ATOM   1303 C  CB   . LYS A 1 163 ? 96.204  60.676 4.410   1.00 58.86  ? 197  LYS A CB   1 
ATOM   1304 C  CG   . LYS A 1 163 ? 97.429  59.833 4.337   1.00 61.52  ? 197  LYS A CG   1 
ATOM   1305 C  CD   . LYS A 1 163 ? 98.275  60.005 5.545   1.00 64.05  ? 197  LYS A CD   1 
ATOM   1306 C  CE   . LYS A 1 163 ? 99.638  59.325 5.361   1.00 65.65  ? 197  LYS A CE   1 
ATOM   1307 N  NZ   . LYS A 1 163 ? 99.484  57.854 5.348   1.00 65.59  ? 197  LYS A NZ   1 
ATOM   1308 N  N    . LEU A 1 164 ? 93.063  60.198 3.161   1.00 56.03  ? 198  LEU A N    1 
ATOM   1309 C  CA   . LEU A 1 164 ? 91.669  60.488 3.333   1.00 55.06  ? 198  LEU A CA   1 
ATOM   1310 C  C    . LEU A 1 164 ? 91.404  60.596 4.837   1.00 56.12  ? 198  LEU A C    1 
ATOM   1311 O  O    . LEU A 1 164 ? 91.930  59.790 5.624   1.00 56.23  ? 198  LEU A O    1 
ATOM   1312 C  CB   . LEU A 1 164 ? 90.845  59.382 2.690   1.00 53.55  ? 198  LEU A CB   1 
ATOM   1313 C  CG   . LEU A 1 164 ? 89.341  59.617 2.683   1.00 53.50  ? 198  LEU A CG   1 
ATOM   1314 C  CD1  . LEU A 1 164 ? 88.991  60.727 1.705   1.00 53.61  ? 198  LEU A CD1  1 
ATOM   1315 C  CD2  . LEU A 1 164 ? 88.670  58.337 2.320   1.00 51.93  ? 198  LEU A CD2  1 
ATOM   1316 N  N    . CYS A 1 165 ? 90.601  61.568 5.257   1.00 55.82  ? 199  CYS A N    1 
ATOM   1317 C  CA   . CYS A 1 165 ? 90.312  61.703 6.658   1.00 57.70  ? 199  CYS A CA   1 
ATOM   1318 C  C    . CYS A 1 165 ? 88.873  62.167 6.924   1.00 58.67  ? 199  CYS A C    1 
ATOM   1319 O  O    . CYS A 1 165 ? 88.117  62.350 5.989   1.00 59.68  ? 199  CYS A O    1 
ATOM   1320 C  CB   . CYS A 1 165 ? 91.305  62.672 7.271   1.00 58.65  ? 199  CYS A CB   1 
ATOM   1321 S  SG   . CYS A 1 165 ? 90.865  64.382 6.921   1.00 62.57  ? 199  CYS A SG   1 
ATOM   1322 N  N    . ASP A 1 166 ? 88.524  62.379 8.193   1.00 59.52  ? 200  ASP A N    1 
ATOM   1323 C  CA   . ASP A 1 166 ? 87.192  62.778 8.613   1.00 60.20  ? 200  ASP A CA   1 
ATOM   1324 C  C    . ASP A 1 166 ? 86.097  61.773 8.212   1.00 58.84  ? 200  ASP A C    1 
ATOM   1325 O  O    . ASP A 1 166 ? 85.422  61.960 7.218   1.00 57.26  ? 200  ASP A O    1 
ATOM   1326 C  CB   . ASP A 1 166 ? 86.815  64.186 8.111   1.00 62.30  ? 200  ASP A CB   1 
ATOM   1327 C  CG   . ASP A 1 166 ? 85.430  64.691 8.697   1.00 66.37  ? 200  ASP A CG   1 
ATOM   1328 O  OD1  . ASP A 1 166 ? 84.767  63.924 9.446   1.00 66.92  ? 200  ASP A OD1  1 
ATOM   1329 O  OD2  . ASP A 1 166 ? 85.000  65.861 8.409   1.00 67.49  ? 200  ASP A OD2  1 
ATOM   1330 N  N    . PHE A 1 167 ? 85.939  60.701 8.985   1.00 57.76  ? 201  PHE A N    1 
ATOM   1331 C  CA   . PHE A 1 167 ? 84.898  59.723 8.732   1.00 57.78  ? 201  PHE A CA   1 
ATOM   1332 C  C    . PHE A 1 167 ? 83.612  60.006 9.552   1.00 58.93  ? 201  PHE A C    1 
ATOM   1333 O  O    . PHE A 1 167 ? 82.789  59.094 9.858   1.00 58.70  ? 201  PHE A O    1 
ATOM   1334 C  CB   . PHE A 1 167 ? 85.451  58.338 9.002   1.00 57.86  ? 201  PHE A CB   1 
ATOM   1335 C  CG   . PHE A 1 167 ? 86.384  57.884 7.933   1.00 60.10  ? 201  PHE A CG   1 
ATOM   1336 C  CD1  . PHE A 1 167 ? 87.647  58.432 7.829   1.00 60.74  ? 201  PHE A CD1  1 
ATOM   1337 C  CD2  . PHE A 1 167 ? 85.952  56.996 6.941   1.00 60.36  ? 201  PHE A CD2  1 
ATOM   1338 C  CE1  . PHE A 1 167 ? 88.485  58.110 6.742   1.00 61.17  ? 201  PHE A CE1  1 
ATOM   1339 C  CE2  . PHE A 1 167 ? 86.771  56.676 5.858   1.00 61.27  ? 201  PHE A CE2  1 
ATOM   1340 C  CZ   . PHE A 1 167 ? 88.042  57.233 5.758   1.00 61.39  ? 201  PHE A CZ   1 
ATOM   1341 N  N    . GLY A 1 168 ? 83.425  61.293 9.853   1.00 59.17  ? 202  GLY A N    1 
ATOM   1342 C  CA   . GLY A 1 168 ? 82.287  61.741 10.615  1.00 59.47  ? 202  GLY A CA   1 
ATOM   1343 C  C    . GLY A 1 168 ? 80.945  61.422 10.002  1.00 60.53  ? 202  GLY A C    1 
ATOM   1344 O  O    . GLY A 1 168 ? 79.992  61.112 10.714  1.00 62.07  ? 202  GLY A O    1 
ATOM   1345 N  N    . SER A 1 169 ? 80.855  61.488 8.684   1.00 61.14  ? 203  SER A N    1 
ATOM   1346 C  CA   . SER A 1 169 ? 79.615  61.216 7.984   1.00 60.75  ? 203  SER A CA   1 
ATOM   1347 C  C    . SER A 1 169 ? 79.608  59.817 7.358   1.00 61.08  ? 203  SER A C    1 
ATOM   1348 O  O    . SER A 1 169 ? 78.564  59.355 6.902   1.00 61.06  ? 203  SER A O    1 
ATOM   1349 C  CB   . SER A 1 169 ? 79.452  62.286 6.952   1.00 60.60  ? 203  SER A CB   1 
ATOM   1350 O  OG   . SER A 1 169 ? 80.019  63.452 7.505   1.00 62.68  ? 203  SER A OG   1 
ATOM   1351 N  N    . ALA A 1 170 ? 80.760  59.130 7.372   1.00 61.28  ? 204  ALA A N    1 
ATOM   1352 C  CA   . ALA A 1 170 ? 80.885  57.780 6.796   1.00 61.22  ? 204  ALA A CA   1 
ATOM   1353 C  C    . ALA A 1 170 ? 79.869  56.758 7.340   1.00 62.61  ? 204  ALA A C    1 
ATOM   1354 O  O    . ALA A 1 170 ? 79.388  56.806 8.486   1.00 64.01  ? 204  ALA A O    1 
ATOM   1355 C  CB   . ALA A 1 170 ? 82.284  57.249 6.989   1.00 57.99  ? 204  ALA A CB   1 
ATOM   1356 N  N    . LYS A 1 171 ? 79.510  55.808 6.507   1.00 64.01  ? 205  LYS A N    1 
ATOM   1357 C  CA   . LYS A 1 171 ? 78.545  54.817 6.924   1.00 64.90  ? 205  LYS A CA   1 
ATOM   1358 C  C    . LYS A 1 171 ? 78.589  53.587 6.018   1.00 66.93  ? 205  LYS A C    1 
ATOM   1359 O  O    . LYS A 1 171 ? 78.874  53.695 4.797   1.00 66.98  ? 205  LYS A O    1 
ATOM   1360 C  CB   . LYS A 1 171 ? 77.158  55.415 6.862   1.00 63.25  ? 205  LYS A CB   1 
ATOM   1361 C  CG   . LYS A 1 171 ? 76.110  54.364 6.870   1.00 62.91  ? 205  LYS A CG   1 
ATOM   1362 C  CD   . LYS A 1 171 ? 74.761  54.938 6.813   1.00 62.27  ? 205  LYS A CD   1 
ATOM   1363 C  CE   . LYS A 1 171 ? 73.735  53.996 7.386   1.00 60.82  ? 205  LYS A CE   1 
ATOM   1364 N  NZ   . LYS A 1 171 ? 72.381  54.314 6.826   1.00 60.27  ? 205  LYS A NZ   1 
ATOM   1365 N  N    . GLN A 1 172 ? 78.302  52.415 6.587   1.00 67.81  ? 206  GLN A N    1 
ATOM   1366 C  CA   . GLN A 1 172 ? 78.282  51.242 5.759   1.00 69.61  ? 206  GLN A CA   1 
ATOM   1367 C  C    . GLN A 1 172 ? 76.900  51.109 5.098   1.00 69.34  ? 206  GLN A C    1 
ATOM   1368 O  O    . GLN A 1 172 ? 75.935  50.833 5.755   1.00 69.26  ? 206  GLN A O    1 
ATOM   1369 C  CB   . GLN A 1 172 ? 78.611  50.053 6.569   1.00 70.89  ? 206  GLN A CB   1 
ATOM   1370 C  CG   . GLN A 1 172 ? 78.833  48.888 5.677   1.00 78.80  ? 206  GLN A CG   1 
ATOM   1371 C  CD   . GLN A 1 172 ? 79.056  47.617 6.473   1.00 83.73  ? 206  GLN A CD   1 
ATOM   1372 O  OE1  . GLN A 1 172 ? 80.027  47.502 7.273   1.00 86.74  ? 206  GLN A OE1  1 
ATOM   1373 N  NE2  . GLN A 1 172 ? 78.150  46.652 6.290   1.00 85.13  ? 206  GLN A NE2  1 
ATOM   1374 N  N    . LEU A 1 173 ? 76.790  51.354 3.794   1.00 70.05  ? 207  LEU A N    1 
ATOM   1375 C  CA   . LEU A 1 173 ? 75.477  51.275 3.140   1.00 70.65  ? 207  LEU A CA   1 
ATOM   1376 C  C    . LEU A 1 173 ? 75.023  49.859 2.854   1.00 72.54  ? 207  LEU A C    1 
ATOM   1377 O  O    . LEU A 1 173 ? 75.758  49.027 2.308   1.00 73.31  ? 207  LEU A O    1 
ATOM   1378 C  CB   . LEU A 1 173 ? 75.449  52.050 1.823   1.00 67.41  ? 207  LEU A CB   1 
ATOM   1379 C  CG   . LEU A 1 173 ? 76.060  53.430 1.881   1.00 64.15  ? 207  LEU A CG   1 
ATOM   1380 C  CD1  . LEU A 1 173 ? 76.012  54.020 0.481   1.00 63.59  ? 207  LEU A CD1  1 
ATOM   1381 C  CD2  . LEU A 1 173 ? 75.324  54.279 2.939   1.00 62.10  ? 207  LEU A CD2  1 
ATOM   1382 N  N    . VAL A 1 174 ? 73.760  49.624 3.170   1.00 74.14  ? 208  VAL A N    1 
ATOM   1383 C  CA   . VAL A 1 174 ? 73.128  48.316 3.010   1.00 73.91  ? 208  VAL A CA   1 
ATOM   1384 C  C    . VAL A 1 174 ? 71.919  48.431 2.112   1.00 76.21  ? 208  VAL A C    1 
ATOM   1385 O  O    . VAL A 1 174 ? 71.059  49.296 2.368   1.00 76.73  ? 208  VAL A O    1 
ATOM   1386 C  CB   . VAL A 1 174 ? 72.679  47.872 4.337   1.00 70.94  ? 208  VAL A CB   1 
ATOM   1387 C  CG1  . VAL A 1 174 ? 71.828  46.692 4.213   1.00 68.70  ? 208  VAL A CG1  1 
ATOM   1388 C  CG2  . VAL A 1 174 ? 73.876  47.666 5.184   1.00 69.69  ? 208  VAL A CG2  1 
ATOM   1389 N  N    . ARG A 1 175 ? 71.825  47.576 1.080   1.00 78.08  ? 209  ARG A N    1 
ATOM   1390 C  CA   . ARG A 1 175 ? 70.671  47.678 0.162   1.00 79.01  ? 209  ARG A CA   1 
ATOM   1391 C  C    . ARG A 1 175 ? 69.375  47.540 0.907   1.00 78.14  ? 209  ARG A C    1 
ATOM   1392 O  O    . ARG A 1 175 ? 69.241  46.704 1.835   1.00 77.00  ? 209  ARG A O    1 
ATOM   1393 C  CB   . ARG A 1 175 ? 70.703  46.643 -0.946  1.00 82.10  ? 209  ARG A CB   1 
ATOM   1394 C  CG   . ARG A 1 175 ? 71.805  46.807 -1.993  1.00 89.00  ? 209  ARG A CG   1 
ATOM   1395 C  CD   . ARG A 1 175 ? 71.610  45.866 -3.223  1.00 94.03  ? 209  ARG A CD   1 
ATOM   1396 N  NE   . ARG A 1 175 ? 70.359  46.185 -3.932  1.00 99.60  ? 209  ARG A NE   1 
ATOM   1397 C  CZ   . ARG A 1 175 ? 69.158  45.627 -3.696  1.00 101.47 ? 209  ARG A CZ   1 
ATOM   1398 N  NH1  . ARG A 1 175 ? 69.013  44.671 -2.755  1.00 102.04 ? 209  ARG A NH1  1 
ATOM   1399 N  NH2  . ARG A 1 175 ? 68.082  46.066 -4.378  1.00 101.39 ? 209  ARG A NH2  1 
ATOM   1400 N  N    . GLY A 1 176 ? 68.410  48.368 0.526   1.00 77.59  ? 210  GLY A N    1 
ATOM   1401 C  CA   . GLY A 1 176 ? 67.137  48.269 1.201   1.00 78.24  ? 210  GLY A CA   1 
ATOM   1402 C  C    . GLY A 1 176 ? 66.997  49.217 2.359   1.00 79.41  ? 210  GLY A C    1 
ATOM   1403 O  O    . GLY A 1 176 ? 65.911  49.773 2.522   1.00 80.80  ? 210  GLY A O    1 
ATOM   1404 N  N    . GLU A 1 177 ? 68.038  49.414 3.176   1.00 79.70  ? 211  GLU A N    1 
ATOM   1405 C  CA   . GLU A 1 177 ? 67.942  50.372 4.285   1.00 79.43  ? 211  GLU A CA   1 
ATOM   1406 C  C    . GLU A 1 177 ? 68.280  51.774 3.767   1.00 75.94  ? 211  GLU A C    1 
ATOM   1407 O  O    . GLU A 1 177 ? 69.290  51.974 3.108   1.00 75.32  ? 211  GLU A O    1 
ATOM   1408 C  CB   . GLU A 1 177 ? 68.895  49.996 5.391   1.00 84.34  ? 211  GLU A CB   1 
ATOM   1409 C  CG   . GLU A 1 177 ? 68.793  48.540 5.770   1.00 92.62  ? 211  GLU A CG   1 
ATOM   1410 C  CD   . GLU A 1 177 ? 69.999  48.061 6.616   1.00 98.44  ? 211  GLU A CD   1 
ATOM   1411 O  OE1  . GLU A 1 177 ? 71.137  48.618 6.431   1.00 101.60 ? 211  GLU A OE1  1 
ATOM   1412 O  OE2  . GLU A 1 177 ? 69.807  47.127 7.452   1.00 100.48 ? 211  GLU A OE2  1 
ATOM   1413 N  N    . PRO A 1 178 ? 67.428  52.759 4.064   1.00 72.71  ? 212  PRO A N    1 
ATOM   1414 C  CA   . PRO A 1 178 ? 67.505  54.174 3.689   1.00 70.82  ? 212  PRO A CA   1 
ATOM   1415 C  C    . PRO A 1 178 ? 68.627  54.960 4.325   1.00 68.61  ? 212  PRO A C    1 
ATOM   1416 O  O    . PRO A 1 178 ? 69.059  54.634 5.413   1.00 69.02  ? 212  PRO A O    1 
ATOM   1417 C  CB   . PRO A 1 178 ? 66.169  54.726 4.161   1.00 70.77  ? 212  PRO A CB   1 
ATOM   1418 C  CG   . PRO A 1 178 ? 65.306  53.549 4.205   1.00 70.69  ? 212  PRO A CG   1 
ATOM   1419 C  CD   . PRO A 1 178 ? 66.210  52.546 4.838   1.00 71.11  ? 212  PRO A CD   1 
ATOM   1420 N  N    . ASN A 1 179 ? 69.056  56.025 3.653   1.00 66.14  ? 213  ASN A N    1 
ATOM   1421 C  CA   . ASN A 1 179 ? 70.124  56.897 4.176   1.00 63.70  ? 213  ASN A CA   1 
ATOM   1422 C  C    . ASN A 1 179 ? 69.728  58.360 3.999   1.00 62.54  ? 213  ASN A C    1 
ATOM   1423 O  O    . ASN A 1 179 ? 69.035  58.705 3.047   1.00 62.08  ? 213  ASN A O    1 
ATOM   1424 C  CB   . ASN A 1 179 ? 71.387  56.617 3.448   1.00 61.31  ? 213  ASN A CB   1 
ATOM   1425 C  CG   . ASN A 1 179 ? 71.673  55.173 3.400   1.00 61.00  ? 213  ASN A CG   1 
ATOM   1426 O  OD1  . ASN A 1 179 ? 71.909  54.569 4.447   1.00 58.32  ? 213  ASN A OD1  1 
ATOM   1427 N  ND2  . ASN A 1 179 ? 71.637  54.574 2.172   1.00 61.22  ? 213  ASN A ND2  1 
ATOM   1428 N  N    . VAL A 1 180 ? 70.130  59.224 4.923   1.00 61.58  ? 214  VAL A N    1 
ATOM   1429 C  CA   . VAL A 1 180 ? 69.730  60.613 4.747   1.00 59.50  ? 214  VAL A CA   1 
ATOM   1430 C  C    . VAL A 1 180 ? 70.413  61.212 3.510   1.00 59.49  ? 214  VAL A C    1 
ATOM   1431 O  O    . VAL A 1 180 ? 71.537  60.843 3.143   1.00 58.52  ? 214  VAL A O    1 
ATOM   1432 C  CB   . VAL A 1 180 ? 70.100  61.433 5.958   1.00 58.55  ? 214  VAL A CB   1 
ATOM   1433 C  CG1  . VAL A 1 180 ? 69.306  61.016 7.088   1.00 56.92  ? 214  VAL A CG1  1 
ATOM   1434 C  CG2  . VAL A 1 180 ? 71.570  61.259 6.247   1.00 57.71  ? 214  VAL A CG2  1 
ATOM   1435 N  N    . SER A 1 181 ? 69.740  62.144 2.858   1.00 58.53  ? 215  SER A N    1 
ATOM   1436 C  CA   . SER A 1 181 ? 70.353  62.716 1.691   1.00 57.70  ? 215  SER A CA   1 
ATOM   1437 C  C    . SER A 1 181 ? 70.965  64.042 1.980   1.00 58.23  ? 215  SER A C    1 
ATOM   1438 O  O    . SER A 1 181 ? 71.432  64.713 1.062   1.00 59.74  ? 215  SER A O    1 
ATOM   1439 C  CB   . SER A 1 181 ? 69.312  62.879 0.637   1.00 57.66  ? 215  SER A CB   1 
ATOM   1440 O  OG   . SER A 1 181 ? 68.267  63.664 1.175   1.00 59.40  ? 215  SER A OG   1 
ATOM   1441 N  N    . TYR A 1 182 ? 70.992  64.463 3.238   1.00 57.97  ? 216  TYR A N    1 
ATOM   1442 C  CA   . TYR A 1 182 ? 71.557  65.766 3.503   1.00 57.95  ? 216  TYR A CA   1 
ATOM   1443 C  C    . TYR A 1 182 ? 72.972  65.774 3.985   1.00 58.87  ? 216  TYR A C    1 
ATOM   1444 O  O    . TYR A 1 182 ? 73.370  66.714 4.675   1.00 60.71  ? 216  TYR A O    1 
ATOM   1445 C  CB   . TYR A 1 182 ? 70.689  66.570 4.459   1.00 58.67  ? 216  TYR A CB   1 
ATOM   1446 C  CG   . TYR A 1 182 ? 70.195  65.836 5.710   1.00 59.89  ? 216  TYR A CG   1 
ATOM   1447 C  CD1  . TYR A 1 182 ? 71.009  65.654 6.844   1.00 59.52  ? 216  TYR A CD1  1 
ATOM   1448 C  CD2  . TYR A 1 182 ? 68.892  65.345 5.752   1.00 59.90  ? 216  TYR A CD2  1 
ATOM   1449 C  CE1  . TYR A 1 182 ? 70.518  64.996 7.981   1.00 60.56  ? 216  TYR A CE1  1 
ATOM   1450 C  CE2  . TYR A 1 182 ? 68.406  64.705 6.856   1.00 61.04  ? 216  TYR A CE2  1 
ATOM   1451 C  CZ   . TYR A 1 182 ? 69.200  64.520 7.969   1.00 61.64  ? 216  TYR A CZ   1 
ATOM   1452 O  OH   . TYR A 1 182 ? 68.632  63.799 9.013   1.00 63.74  ? 216  TYR A OH   1 
ATOM   1453 N  N    . ILE A 1 183 ? 73.758  64.745 3.663   1.00 57.51  ? 217  ILE A N    1 
ATOM   1454 C  CA   . ILE A 1 183 ? 75.144  64.748 4.067   1.00 55.94  ? 217  ILE A CA   1 
ATOM   1455 C  C    . ILE A 1 183 ? 75.846  65.219 2.825   1.00 56.39  ? 217  ILE A C    1 
ATOM   1456 O  O    . ILE A 1 183 ? 75.243  65.361 1.767   1.00 55.49  ? 217  ILE A O    1 
ATOM   1457 C  CB   . ILE A 1 183 ? 75.668  63.352 4.445   1.00 56.36  ? 217  ILE A CB   1 
ATOM   1458 C  CG1  . ILE A 1 183 ? 75.757  62.401 3.218   1.00 57.47  ? 217  ILE A CG1  1 
ATOM   1459 C  CG2  . ILE A 1 183 ? 74.814  62.763 5.434   1.00 57.67  ? 217  ILE A CG2  1 
ATOM   1460 C  CD1  . ILE A 1 183 ? 74.486  61.965 2.560   1.00 54.05  ? 217  ILE A CD1  1 
ATOM   1461 N  N    . CYS A 1 184 ? 77.133  65.470 2.951   1.00 57.68  ? 218  CYS A N    1 
ATOM   1462 C  CA   . CYS A 1 184 ? 77.947  65.889 1.831   1.00 58.42  ? 218  CYS A CA   1 
ATOM   1463 C  C    . CYS A 1 184 ? 77.915  67.397 1.583   1.00 58.11  ? 218  CYS A C    1 
ATOM   1464 O  O    . CYS A 1 184 ? 76.866  68.011 1.578   1.00 57.84  ? 218  CYS A O    1 
ATOM   1465 C  CB   . CYS A 1 184 ? 77.534  65.115 0.579   1.00 59.39  ? 218  CYS A CB   1 
ATOM   1466 S  SG   . CYS A 1 184 ? 78.852  64.954 -0.602  1.00 62.60  ? 218  CYS A SG   1 
ATOM   1467 N  N    . SER A 1 185 ? 79.098  67.961 1.377   1.00 58.66  ? 219  SER A N    1 
ATOM   1468 C  CA   . SER A 1 185 ? 79.317  69.367 1.131   1.00 61.07  ? 219  SER A CA   1 
ATOM   1469 C  C    . SER A 1 185 ? 78.736  69.845 -0.176  1.00 63.42  ? 219  SER A C    1 
ATOM   1470 O  O    . SER A 1 185 ? 79.049  69.305 -1.213  1.00 65.15  ? 219  SER A O    1 
ATOM   1471 C  CB   . SER A 1 185 ? 80.805  69.631 1.146   1.00 62.12  ? 219  SER A CB   1 
ATOM   1472 O  OG   . SER A 1 185 ? 81.114  71.016 1.165   1.00 66.88  ? 219  SER A OG   1 
ATOM   1473 N  N    . ARG A 1 186 ? 77.921  70.886 -0.144  1.00 66.39  ? 220  ARG A N    1 
ATOM   1474 C  CA   . ARG A 1 186 ? 77.256  71.435 -1.316  1.00 69.81  ? 220  ARG A CA   1 
ATOM   1475 C  C    . ARG A 1 186 ? 77.818  71.171 -2.689  1.00 68.95  ? 220  ARG A C    1 
ATOM   1476 O  O    . ARG A 1 186 ? 77.193  70.523 -3.546  1.00 69.81  ? 220  ARG A O    1 
ATOM   1477 C  CB   . ARG A 1 186 ? 77.121  72.968 -1.221  1.00 76.26  ? 220  ARG A CB   1 
ATOM   1478 C  CG   . ARG A 1 186 ? 76.074  73.451 -0.231  1.00 87.29  ? 220  ARG A CG   1 
ATOM   1479 C  CD   . ARG A 1 186 ? 74.783  72.543 -0.266  1.00 92.59  ? 220  ARG A CD   1 
ATOM   1480 N  NE   . ARG A 1 186 ? 74.066  72.511 1.018   1.00 97.78  ? 220  ARG A NE   1 
ATOM   1481 C  CZ   . ARG A 1 186 ? 73.061  71.681 1.291   1.00 101.82 ? 220  ARG A CZ   1 
ATOM   1482 N  NH1  . ARG A 1 186 ? 72.640  70.805 0.382   1.00 104.19 ? 220  ARG A NH1  1 
ATOM   1483 N  NH2  . ARG A 1 186 ? 72.461  71.724 2.480   1.00 105.01 ? 220  ARG A NH2  1 
ATOM   1484 N  N    . TYR A 1 187 ? 78.994  71.714 -2.916  1.00 66.58  ? 221  TYR A N    1 
ATOM   1485 C  CA   . TYR A 1 187 ? 79.591  71.625 -4.209  1.00 64.75  ? 221  TYR A CA   1 
ATOM   1486 C  C    . TYR A 1 187 ? 79.888  70.212 -4.694  1.00 62.28  ? 221  TYR A C    1 
ATOM   1487 O  O    . TYR A 1 187 ? 80.005  69.989 -5.909  1.00 60.80  ? 221  TYR A O    1 
ATOM   1488 C  CB   . TYR A 1 187 ? 80.876  72.473 -4.225  1.00 67.22  ? 221  TYR A CB   1 
ATOM   1489 C  CG   . TYR A 1 187 ? 80.666  73.946 -3.932  1.00 68.01  ? 221  TYR A CG   1 
ATOM   1490 C  CD1  . TYR A 1 187 ? 81.721  74.718 -3.427  1.00 67.89  ? 221  TYR A CD1  1 
ATOM   1491 C  CD2  . TYR A 1 187 ? 79.405  74.560 -4.140  1.00 69.46  ? 221  TYR A CD2  1 
ATOM   1492 C  CE1  . TYR A 1 187 ? 81.565  76.059 -3.122  1.00 70.01  ? 221  TYR A CE1  1 
ATOM   1493 C  CE2  . TYR A 1 187 ? 79.209  75.921 -3.835  1.00 71.13  ? 221  TYR A CE2  1 
ATOM   1494 C  CZ   . TYR A 1 187 ? 80.304  76.674 -3.321  1.00 72.79  ? 221  TYR A CZ   1 
ATOM   1495 O  OH   . TYR A 1 187 ? 80.151  78.034 -2.977  1.00 74.81  ? 221  TYR A OH   1 
ATOM   1496 N  N    . TYR A 1 188 ? 79.967  69.264 -3.764  1.00 58.90  ? 222  TYR A N    1 
ATOM   1497 C  CA   . TYR A 1 188 ? 80.313  67.901 -4.129  1.00 57.13  ? 222  TYR A CA   1 
ATOM   1498 C  C    . TYR A 1 188 ? 79.199  66.875 -4.155  1.00 56.54  ? 222  TYR A C    1 
ATOM   1499 O  O    . TYR A 1 188 ? 79.451  65.719 -4.446  1.00 56.66  ? 222  TYR A O    1 
ATOM   1500 C  CB   . TYR A 1 188 ? 81.454  67.455 -3.229  1.00 55.33  ? 222  TYR A CB   1 
ATOM   1501 C  CG   . TYR A 1 188 ? 82.508  68.512 -3.217  1.00 55.14  ? 222  TYR A CG   1 
ATOM   1502 C  CD1  . TYR A 1 188 ? 83.496  68.568 -4.199  1.00 55.86  ? 222  TYR A CD1  1 
ATOM   1503 C  CD2  . TYR A 1 188 ? 82.466  69.541 -2.298  1.00 56.25  ? 222  TYR A CD2  1 
ATOM   1504 C  CE1  . TYR A 1 188 ? 84.402  69.634 -4.251  1.00 56.44  ? 222  TYR A CE1  1 
ATOM   1505 C  CE2  . TYR A 1 188 ? 83.363  70.596 -2.350  1.00 56.07  ? 222  TYR A CE2  1 
ATOM   1506 C  CZ   . TYR A 1 188 ? 84.317  70.639 -3.318  1.00 56.29  ? 222  TYR A CZ   1 
ATOM   1507 O  OH   . TYR A 1 188 ? 85.160  71.707 -3.336  1.00 58.05  ? 222  TYR A OH   1 
ATOM   1508 N  N    . ARG A 1 189 ? 77.977  67.302 -3.862  1.00 55.91  ? 223  ARG A N    1 
ATOM   1509 C  CA   . ARG A 1 189 ? 76.809  66.428 -3.839  1.00 55.46  ? 223  ARG A CA   1 
ATOM   1510 C  C    . ARG A 1 189 ? 76.478  65.841 -5.199  1.00 54.60  ? 223  ARG A C    1 
ATOM   1511 O  O    . ARG A 1 189 ? 76.360  66.591 -6.176  1.00 53.45  ? 223  ARG A O    1 
ATOM   1512 C  CB   . ARG A 1 189 ? 75.588  67.230 -3.390  1.00 57.24  ? 223  ARG A CB   1 
ATOM   1513 C  CG   . ARG A 1 189 ? 75.645  67.692 -1.984  1.00 59.25  ? 223  ARG A CG   1 
ATOM   1514 C  CD   . ARG A 1 189 ? 74.629  68.750 -1.707  1.00 61.24  ? 223  ARG A CD   1 
ATOM   1515 N  NE   . ARG A 1 189 ? 73.264  68.222 -1.638  1.00 66.81  ? 223  ARG A NE   1 
ATOM   1516 C  CZ   . ARG A 1 189 ? 72.770  67.397 -0.696  1.00 68.47  ? 223  ARG A CZ   1 
ATOM   1517 N  NH1  . ARG A 1 189 ? 73.525  66.957 0.319   1.00 69.53  ? 223  ARG A NH1  1 
ATOM   1518 N  NH2  . ARG A 1 189 ? 71.494  67.017 -0.763  1.00 68.71  ? 223  ARG A NH2  1 
ATOM   1519 N  N    . ALA A 1 190 ? 76.294  64.516 -5.249  1.00 54.00  ? 224  ALA A N    1 
ATOM   1520 C  CA   . ALA A 1 190 ? 75.909  63.833 -6.504  1.00 54.17  ? 224  ALA A CA   1 
ATOM   1521 C  C    . ALA A 1 190 ? 74.444  64.217 -6.783  1.00 54.39  ? 224  ALA A C    1 
ATOM   1522 O  O    . ALA A 1 190 ? 73.658  64.438 -5.858  1.00 55.43  ? 224  ALA A O    1 
ATOM   1523 C  CB   . ALA A 1 190 ? 76.035  62.311 -6.370  1.00 51.35  ? 224  ALA A CB   1 
ATOM   1524 N  N    . PRO A 1 191 ? 74.055  64.307 -8.055  1.00 53.70  ? 225  PRO A N    1 
ATOM   1525 C  CA   . PRO A 1 191 ? 72.690  64.672 -8.418  1.00 52.87  ? 225  PRO A CA   1 
ATOM   1526 C  C    . PRO A 1 191 ? 71.620  63.914 -7.624  1.00 53.30  ? 225  PRO A C    1 
ATOM   1527 O  O    . PRO A 1 191 ? 70.631  64.497 -7.195  1.00 53.35  ? 225  PRO A O    1 
ATOM   1528 C  CB   . PRO A 1 191 ? 72.634  64.311 -9.889  1.00 53.38  ? 225  PRO A CB   1 
ATOM   1529 C  CG   . PRO A 1 191 ? 74.033  64.430 -10.316 1.00 52.96  ? 225  PRO A CG   1 
ATOM   1530 C  CD   . PRO A 1 191 ? 74.761  63.785 -9.225  1.00 52.68  ? 225  PRO A CD   1 
ATOM   1531 N  N    . GLU A 1 192 ? 71.816  62.612 -7.438  1.00 53.40  ? 226  GLU A N    1 
ATOM   1532 C  CA   . GLU A 1 192 ? 70.842  61.821 -6.724  1.00 53.46  ? 226  GLU A CA   1 
ATOM   1533 C  C    . GLU A 1 192 ? 70.620  62.406 -5.329  1.00 53.71  ? 226  GLU A C    1 
ATOM   1534 O  O    . GLU A 1 192 ? 69.498  62.416 -4.841  1.00 54.91  ? 226  GLU A O    1 
ATOM   1535 C  CB   . GLU A 1 192 ? 71.264  60.332 -6.659  1.00 54.37  ? 226  GLU A CB   1 
ATOM   1536 C  CG   . GLU A 1 192 ? 72.631  60.026 -6.067  1.00 54.66  ? 226  GLU A CG   1 
ATOM   1537 C  CD   . GLU A 1 192 ? 73.698  59.848 -7.160  1.00 57.20  ? 226  GLU A CD   1 
ATOM   1538 O  OE1  . GLU A 1 192 ? 73.728  60.677 -8.117  1.00 56.20  ? 226  GLU A OE1  1 
ATOM   1539 O  OE2  . GLU A 1 192 ? 74.501  58.878 -7.054  1.00 57.25  ? 226  GLU A OE2  1 
ATOM   1540 N  N    . LEU A 1 193 ? 71.681  62.879 -4.675  1.00 52.38  ? 227  LEU A N    1 
ATOM   1541 C  CA   . LEU A 1 193 ? 71.557  63.524 -3.362  1.00 49.77  ? 227  LEU A CA   1 
ATOM   1542 C  C    . LEU A 1 193 ? 70.738  64.797 -3.545  1.00 50.15  ? 227  LEU A C    1 
ATOM   1543 O  O    . LEU A 1 193 ? 69.814  65.037 -2.809  1.00 50.84  ? 227  LEU A O    1 
ATOM   1544 C  CB   . LEU A 1 193 ? 72.915  63.893 -2.815  1.00 47.78  ? 227  LEU A CB   1 
ATOM   1545 C  CG   . LEU A 1 193 ? 73.547  63.020 -1.749  1.00 47.92  ? 227  LEU A CG   1 
ATOM   1546 C  CD1  . LEU A 1 193 ? 72.907  61.715 -1.679  1.00 48.47  ? 227  LEU A CD1  1 
ATOM   1547 C  CD2  . LEU A 1 193 ? 75.008  62.849 -2.017  1.00 48.62  ? 227  LEU A CD2  1 
ATOM   1548 N  N    . ILE A 1 194 ? 71.051  65.635 -4.522  1.00 50.91  ? 228  ILE A N    1 
ATOM   1549 C  CA   . ILE A 1 194 ? 70.258  66.854 -4.698  1.00 52.47  ? 228  ILE A CA   1 
ATOM   1550 C  C    . ILE A 1 194 ? 68.782  66.523 -4.933  1.00 54.21  ? 228  ILE A C    1 
ATOM   1551 O  O    . ILE A 1 194 ? 67.891  67.202 -4.430  1.00 54.00  ? 228  ILE A O    1 
ATOM   1552 C  CB   . ILE A 1 194 ? 70.747  67.704 -5.879  1.00 51.52  ? 228  ILE A CB   1 
ATOM   1553 C  CG1  . ILE A 1 194 ? 72.205  68.078 -5.663  1.00 50.91  ? 228  ILE A CG1  1 
ATOM   1554 C  CG2  . ILE A 1 194 ? 69.920  68.960 -6.018  1.00 49.36  ? 228  ILE A CG2  1 
ATOM   1555 C  CD1  . ILE A 1 194 ? 72.713  68.842 -6.784  1.00 49.96  ? 228  ILE A CD1  1 
ATOM   1556 N  N    . PHE A 1 195 ? 68.524  65.469 -5.693  1.00 55.20  ? 229  PHE A N    1 
ATOM   1557 C  CA   . PHE A 1 195 ? 67.156  65.074 -5.954  1.00 55.47  ? 229  PHE A CA   1 
ATOM   1558 C  C    . PHE A 1 195 ? 66.409  64.427 -4.779  1.00 56.39  ? 229  PHE A C    1 
ATOM   1559 O  O    . PHE A 1 195 ? 65.212  64.067 -4.929  1.00 59.16  ? 229  PHE A O    1 
ATOM   1560 C  CB   . PHE A 1 195 ? 67.126  64.152 -7.139  1.00 54.95  ? 229  PHE A CB   1 
ATOM   1561 C  CG   . PHE A 1 195 ? 67.235  64.871 -8.462  1.00 57.72  ? 229  PHE A CG   1 
ATOM   1562 C  CD1  . PHE A 1 195 ? 66.270  65.828 -8.837  1.00 56.95  ? 229  PHE A CD1  1 
ATOM   1563 C  CD2  . PHE A 1 195 ? 68.236  64.515 -9.390  1.00 57.02  ? 229  PHE A CD2  1 
ATOM   1564 C  CE1  . PHE A 1 195 ? 66.284  66.403 -10.092 1.00 56.56  ? 229  PHE A CE1  1 
ATOM   1565 C  CE2  . PHE A 1 195 ? 68.246  65.093 -10.654 1.00 57.17  ? 229  PHE A CE2  1 
ATOM   1566 C  CZ   . PHE A 1 195 ? 67.261  66.037 -10.997 1.00 56.04  ? 229  PHE A CZ   1 
ATOM   1567 N  N    . GLY A 1 196 ? 67.074  64.292 -3.630  1.00 54.15  ? 230  GLY A N    1 
ATOM   1568 C  CA   . GLY A 1 196 ? 66.442  63.691 -2.492  1.00 53.13  ? 230  GLY A CA   1 
ATOM   1569 C  C    . GLY A 1 196 ? 66.636  62.194 -2.312  1.00 53.97  ? 230  GLY A C    1 
ATOM   1570 O  O    . GLY A 1 196 ? 66.230  61.641 -1.308  1.00 54.67  ? 230  GLY A O    1 
ATOM   1571 N  N    . ALA A 1 197 ? 67.273  61.504 -3.239  1.00 54.19  ? 231  ALA A N    1 
ATOM   1572 C  CA   . ALA A 1 197 ? 67.470  60.062 -3.085  1.00 55.20  ? 231  ALA A CA   1 
ATOM   1573 C  C    . ALA A 1 197 ? 67.831  59.554 -1.677  1.00 56.75  ? 231  ALA A C    1 
ATOM   1574 O  O    . ALA A 1 197 ? 68.650  60.172 -0.995  1.00 57.11  ? 231  ALA A O    1 
ATOM   1575 C  CB   . ALA A 1 197 ? 68.546  59.599 -4.043  1.00 54.36  ? 231  ALA A CB   1 
ATOM   1576 N  N    . THR A 1 198 ? 67.233  58.445 -1.210  1.00 58.30  ? 232  THR A N    1 
ATOM   1577 C  CA   . THR A 1 198 ? 67.675  57.892 0.075   1.00 58.13  ? 232  THR A CA   1 
ATOM   1578 C  C    . THR A 1 198 ? 68.170  56.467 -0.089  1.00 58.13  ? 232  THR A C    1 
ATOM   1579 O  O    . THR A 1 198 ? 68.575  55.816 0.873   1.00 59.35  ? 232  THR A O    1 
ATOM   1580 C  CB   . THR A 1 198 ? 66.633  57.929 1.183   1.00 56.98  ? 232  THR A CB   1 
ATOM   1581 O  OG1  . THR A 1 198 ? 65.516  57.144 0.801   1.00 58.50  ? 232  THR A OG1  1 
ATOM   1582 C  CG2  . THR A 1 198 ? 66.232  59.372 1.489   1.00 55.47  ? 232  THR A CG2  1 
ATOM   1583 N  N    . ASP A 1 199 ? 68.206  56.019 -1.332  1.00 58.55  ? 233  ASP A N    1 
ATOM   1584 C  CA   . ASP A 1 199 ? 68.676  54.684 -1.670  1.00 60.33  ? 233  ASP A CA   1 
ATOM   1585 C  C    . ASP A 1 199 ? 69.930  54.785 -2.530  1.00 59.92  ? 233  ASP A C    1 
ATOM   1586 O  O    . ASP A 1 199 ? 70.155  53.950 -3.406  1.00 61.08  ? 233  ASP A O    1 
ATOM   1587 C  CB   . ASP A 1 199 ? 67.630  54.009 -2.492  1.00 63.32  ? 233  ASP A CB   1 
ATOM   1588 C  CG   . ASP A 1 199 ? 67.315  54.801 -3.764  1.00 68.36  ? 233  ASP A CG   1 
ATOM   1589 O  OD1  . ASP A 1 199 ? 67.892  55.921 -3.946  1.00 70.38  ? 233  ASP A OD1  1 
ATOM   1590 O  OD2  . ASP A 1 199 ? 66.489  54.304 -4.574  1.00 72.35  ? 233  ASP A OD2  1 
ATOM   1591 N  N    . TYR A 1 200 ? 70.735  55.806 -2.310  1.00 57.36  ? 234  TYR A N    1 
ATOM   1592 C  CA   . TYR A 1 200 ? 71.909  55.967 -3.104  1.00 54.78  ? 234  TYR A CA   1 
ATOM   1593 C  C    . TYR A 1 200 ? 72.981  54.971 -2.656  1.00 54.65  ? 234  TYR A C    1 
ATOM   1594 O  O    . TYR A 1 200 ? 72.841  54.309 -1.645  1.00 53.06  ? 234  TYR A O    1 
ATOM   1595 C  CB   . TYR A 1 200 ? 72.372  57.420 -2.986  1.00 53.41  ? 234  TYR A CB   1 
ATOM   1596 C  CG   . TYR A 1 200 ? 72.617  57.863 -1.555  1.00 51.50  ? 234  TYR A CG   1 
ATOM   1597 C  CD1  . TYR A 1 200 ? 73.825  57.534 -0.914  1.00 50.94  ? 234  TYR A CD1  1 
ATOM   1598 C  CD2  . TYR A 1 200 ? 71.639  58.546 -0.820  1.00 49.06  ? 234  TYR A CD2  1 
ATOM   1599 C  CE1  . TYR A 1 200 ? 74.056  57.860 0.404   1.00 47.60  ? 234  TYR A CE1  1 
ATOM   1600 C  CE2  . TYR A 1 200 ? 71.875  58.877 0.523   1.00 49.50  ? 234  TYR A CE2  1 
ATOM   1601 C  CZ   . TYR A 1 200 ? 73.092  58.524 1.107   1.00 48.21  ? 234  TYR A CZ   1 
ATOM   1602 O  OH   . TYR A 1 200 ? 73.368  58.853 2.385   1.00 49.32  ? 234  TYR A OH   1 
ATOM   1603 N  N    . THR A 1 201 ? 74.052  54.880 -3.438  1.00 56.44  ? 235  THR A N    1 
ATOM   1604 C  CA   . THR A 1 201 ? 75.164  53.938 -3.177  1.00 57.50  ? 235  THR A CA   1 
ATOM   1605 C  C    . THR A 1 201 ? 76.502  54.612 -2.981  1.00 57.38  ? 235  THR A C    1 
ATOM   1606 O  O    . THR A 1 201 ? 76.574  55.839 -2.960  1.00 59.79  ? 235  THR A O    1 
ATOM   1607 C  CB   . THR A 1 201 ? 75.325  52.994 -4.352  1.00 56.76  ? 235  THR A CB   1 
ATOM   1608 O  OG1  . THR A 1 201 ? 75.533  53.751 -5.555  1.00 55.58  ? 235  THR A OG1  1 
ATOM   1609 C  CG2  . THR A 1 201 ? 74.083  52.160 -4.489  1.00 55.92  ? 235  THR A CG2  1 
ATOM   1610 N  N    . SER A 1 202 ? 77.566  53.824 -2.875  1.00 56.19  ? 236  SER A N    1 
ATOM   1611 C  CA   . SER A 1 202 ? 78.893  54.392 -2.674  1.00 55.98  ? 236  SER A CA   1 
ATOM   1612 C  C    . SER A 1 202 ? 79.320  55.229 -3.851  1.00 56.15  ? 236  SER A C    1 
ATOM   1613 O  O    . SER A 1 202 ? 80.233  56.018 -3.743  1.00 56.91  ? 236  SER A O    1 
ATOM   1614 C  CB   . SER A 1 202 ? 79.924  53.319 -2.496  1.00 56.17  ? 236  SER A CB   1 
ATOM   1615 O  OG   . SER A 1 202 ? 79.457  52.391 -1.566  1.00 59.34  ? 236  SER A OG   1 
ATOM   1616 N  N    . SER A 1 203 ? 78.677  55.055 -4.994  1.00 55.66  ? 237  SER A N    1 
ATOM   1617 C  CA   . SER A 1 203 ? 79.060  55.832 -6.150  1.00 53.95  ? 237  SER A CA   1 
ATOM   1618 C  C    . SER A 1 203 ? 78.924  57.330 -5.904  1.00 52.06  ? 237  SER A C    1 
ATOM   1619 O  O    . SER A 1 203 ? 79.444  58.100 -6.728  1.00 51.65  ? 237  SER A O    1 
ATOM   1620 C  CB   . SER A 1 203 ? 78.234  55.418 -7.357  1.00 54.85  ? 237  SER A CB   1 
ATOM   1621 O  OG   . SER A 1 203 ? 76.862  55.574 -7.060  1.00 58.48  ? 237  SER A OG   1 
ATOM   1622 N  N    . ILE A 1 204 ? 78.242  57.758 -4.819  1.00 48.47  ? 238  ILE A N    1 
ATOM   1623 C  CA   . ILE A 1 204 ? 78.176  59.193 -4.585  1.00 46.93  ? 238  ILE A CA   1 
ATOM   1624 C  C    . ILE A 1 204 ? 79.623  59.734 -4.299  1.00 47.81  ? 238  ILE A C    1 
ATOM   1625 O  O    . ILE A 1 204 ? 79.966  60.877 -4.697  1.00 46.40  ? 238  ILE A O    1 
ATOM   1626 C  CB   . ILE A 1 204 ? 77.213  59.652 -3.444  1.00 45.51  ? 238  ILE A CB   1 
ATOM   1627 C  CG1  . ILE A 1 204 ? 77.608  59.021 -2.131  1.00 46.70  ? 238  ILE A CG1  1 
ATOM   1628 C  CG2  . ILE A 1 204 ? 75.795  59.332 -3.715  1.00 45.12  ? 238  ILE A CG2  1 
ATOM   1629 C  CD1  . ILE A 1 204 ? 77.083  59.807 -0.933  1.00 42.67  ? 238  ILE A CD1  1 
ATOM   1630 N  N    . ASP A 1 205 ? 80.487  58.914 -3.664  1.00 46.93  ? 239  ASP A N    1 
ATOM   1631 C  CA   . ASP A 1 205 ? 81.865  59.351 -3.417  1.00 47.19  ? 239  ASP A CA   1 
ATOM   1632 C  C    . ASP A 1 205 ? 82.560  59.606 -4.745  1.00 48.23  ? 239  ASP A C    1 
ATOM   1633 O  O    . ASP A 1 205 ? 83.379  60.531 -4.866  1.00 49.15  ? 239  ASP A O    1 
ATOM   1634 C  CB   . ASP A 1 205 ? 82.678  58.350 -2.593  1.00 46.87  ? 239  ASP A CB   1 
ATOM   1635 C  CG   . ASP A 1 205 ? 82.161  58.194 -1.114  1.00 51.00  ? 239  ASP A CG   1 
ATOM   1636 O  OD1  . ASP A 1 205 ? 81.647  59.162 -0.504  1.00 53.05  ? 239  ASP A OD1  1 
ATOM   1637 O  OD2  . ASP A 1 205 ? 82.292  57.086 -0.531  1.00 50.33  ? 239  ASP A OD2  1 
ATOM   1638 N  N    . VAL A 1 206 ? 82.227  58.824 -5.774  1.00 48.43  ? 240  VAL A N    1 
ATOM   1639 C  CA   . VAL A 1 206 ? 82.888  59.021 -7.052  1.00 47.52  ? 240  VAL A CA   1 
ATOM   1640 C  C    . VAL A 1 206 ? 82.502  60.344 -7.739  1.00 48.59  ? 240  VAL A C    1 
ATOM   1641 O  O    . VAL A 1 206 ? 83.363  61.041 -8.299  1.00 47.54  ? 240  VAL A O    1 
ATOM   1642 C  CB   . VAL A 1 206 ? 82.721  57.809 -7.949  1.00 45.68  ? 240  VAL A CB   1 
ATOM   1643 C  CG1  . VAL A 1 206 ? 83.267  58.112 -9.392  1.00 45.79  ? 240  VAL A CG1  1 
ATOM   1644 C  CG2  . VAL A 1 206 ? 83.499  56.675 -7.335  1.00 45.43  ? 240  VAL A CG2  1 
ATOM   1645 N  N    . TRP A 1 207 ? 81.220  60.699 -7.661  1.00 48.01  ? 241  TRP A N    1 
ATOM   1646 C  CA   . TRP A 1 207 ? 80.775  61.944 -8.225  1.00 46.90  ? 241  TRP A CA   1 
ATOM   1647 C  C    . TRP A 1 207 ? 81.616  63.014 -7.517  1.00 47.06  ? 241  TRP A C    1 
ATOM   1648 O  O    . TRP A 1 207 ? 82.282  63.790 -8.174  1.00 46.61  ? 241  TRP A O    1 
ATOM   1649 C  CB   . TRP A 1 207 ? 79.297  62.177 -7.922  1.00 47.56  ? 241  TRP A CB   1 
ATOM   1650 C  CG   . TRP A 1 207 ? 78.838  63.542 -8.327  1.00 47.62  ? 241  TRP A CG   1 
ATOM   1651 C  CD1  . TRP A 1 207 ? 78.960  64.717 -7.611  1.00 46.67  ? 241  TRP A CD1  1 
ATOM   1652 C  CD2  . TRP A 1 207 ? 78.278  63.902 -9.595  1.00 47.16  ? 241  TRP A CD2  1 
ATOM   1653 N  NE1  . TRP A 1 207 ? 78.514  65.781 -8.358  1.00 46.76  ? 241  TRP A NE1  1 
ATOM   1654 C  CE2  . TRP A 1 207 ? 78.090  65.319 -9.577  1.00 47.12  ? 241  TRP A CE2  1 
ATOM   1655 C  CE3  . TRP A 1 207 ? 77.922  63.164 -10.757 1.00 46.03  ? 241  TRP A CE3  1 
ATOM   1656 C  CZ2  . TRP A 1 207 ? 77.561  66.012 -10.661 1.00 45.72  ? 241  TRP A CZ2  1 
ATOM   1657 C  CZ3  . TRP A 1 207 ? 77.406  63.834 -11.827 1.00 44.80  ? 241  TRP A CZ3  1 
ATOM   1658 C  CH2  . TRP A 1 207 ? 77.223  65.259 -11.781 1.00 46.08  ? 241  TRP A CH2  1 
ATOM   1659 N  N    . SER A 1 208 ? 81.618  63.023 -6.185  1.00 46.57  ? 242  SER A N    1 
ATOM   1660 C  CA   . SER A 1 208 ? 82.432  64.008 -5.435  1.00 47.63  ? 242  SER A CA   1 
ATOM   1661 C  C    . SER A 1 208 ? 83.899  64.065 -5.894  1.00 48.42  ? 242  SER A C    1 
ATOM   1662 O  O    . SER A 1 208 ? 84.422  65.133 -6.261  1.00 48.50  ? 242  SER A O    1 
ATOM   1663 C  CB   . SER A 1 208 ? 82.433  63.691 -3.941  1.00 46.57  ? 242  SER A CB   1 
ATOM   1664 O  OG   . SER A 1 208 ? 81.128  63.770 -3.416  1.00 46.83  ? 242  SER A OG   1 
ATOM   1665 N  N    . ALA A 1 209 ? 84.554  62.904 -5.848  1.00 47.89  ? 243  ALA A N    1 
ATOM   1666 C  CA   . ALA A 1 209 ? 85.927  62.795 -6.283  1.00 47.16  ? 243  ALA A CA   1 
ATOM   1667 C  C    . ALA A 1 209 ? 86.020  63.431 -7.696  1.00 47.81  ? 243  ALA A C    1 
ATOM   1668 O  O    . ALA A 1 209 ? 86.960  64.144 -8.012  1.00 48.47  ? 243  ALA A O    1 
ATOM   1669 C  CB   . ALA A 1 209 ? 86.334  61.336 -6.296  1.00 46.05  ? 243  ALA A CB   1 
ATOM   1670 N  N    . GLY A 1 210 ? 85.018  63.216 -8.539  1.00 48.15  ? 244  GLY A N    1 
ATOM   1671 C  CA   . GLY A 1 210 ? 85.054  63.851 -9.844  1.00 48.03  ? 244  GLY A CA   1 
ATOM   1672 C  C    . GLY A 1 210 ? 84.970  65.373 -9.723  1.00 48.76  ? 244  GLY A C    1 
ATOM   1673 O  O    . GLY A 1 210 ? 85.601  66.082 -10.476 1.00 48.33  ? 244  GLY A O    1 
ATOM   1674 N  N    . CYS A 1 211 ? 84.176  65.883 -8.782  1.00 49.37  ? 245  CYS A N    1 
ATOM   1675 C  CA   . CYS A 1 211 ? 84.050  67.321 -8.585  1.00 50.42  ? 245  CYS A CA   1 
ATOM   1676 C  C    . CYS A 1 211 ? 85.399  67.837 -8.131  1.00 51.06  ? 245  CYS A C    1 
ATOM   1677 O  O    . CYS A 1 211 ? 85.796  68.936 -8.477  1.00 50.11  ? 245  CYS A O    1 
ATOM   1678 C  CB   . CYS A 1 211 ? 82.967  67.618 -7.545  1.00 48.50  ? 245  CYS A CB   1 
ATOM   1679 S  SG   . CYS A 1 211 ? 81.337  67.221 -8.231  1.00 55.10  ? 245  CYS A SG   1 
ATOM   1680 N  N    . VAL A 1 212 ? 86.128  67.034 -7.360  1.00 51.99  ? 246  VAL A N    1 
ATOM   1681 C  CA   . VAL A 1 212 ? 87.407  67.509 -6.903  1.00 52.47  ? 246  VAL A CA   1 
ATOM   1682 C  C    . VAL A 1 212 ? 88.360  67.622 -8.040  1.00 54.39  ? 246  VAL A C    1 
ATOM   1683 O  O    . VAL A 1 212 ? 88.997  68.648 -8.175  1.00 56.14  ? 246  VAL A O    1 
ATOM   1684 C  CB   . VAL A 1 212 ? 88.001  66.654 -5.834  1.00 52.28  ? 246  VAL A CB   1 
ATOM   1685 C  CG1  . VAL A 1 212 ? 89.506  67.003 -5.627  1.00 49.99  ? 246  VAL A CG1  1 
ATOM   1686 C  CG2  . VAL A 1 212 ? 87.225  66.911 -4.549  1.00 51.43  ? 246  VAL A CG2  1 
ATOM   1687 N  N    . LEU A 1 213 ? 88.456  66.576 -8.862  1.00 55.34  ? 247  LEU A N    1 
ATOM   1688 C  CA   . LEU A 1 213 ? 89.321  66.582 -10.037 1.00 54.30  ? 247  LEU A CA   1 
ATOM   1689 C  C    . LEU A 1 213 ? 88.998  67.802 -10.903 1.00 54.57  ? 247  LEU A C    1 
ATOM   1690 O  O    . LEU A 1 213 ? 89.883  68.558 -11.302 1.00 54.66  ? 247  LEU A O    1 
ATOM   1691 C  CB   . LEU A 1 213 ? 89.124  65.302 -10.843 1.00 53.24  ? 247  LEU A CB   1 
ATOM   1692 C  CG   . LEU A 1 213 ? 89.731  65.308 -12.245 1.00 52.02  ? 247  LEU A CG   1 
ATOM   1693 C  CD1  . LEU A 1 213 ? 91.222  65.584 -12.081 1.00 52.47  ? 247  LEU A CD1  1 
ATOM   1694 C  CD2  . LEU A 1 213 ? 89.470  64.012 -12.960 1.00 50.11  ? 247  LEU A CD2  1 
ATOM   1695 N  N    . ALA A 1 214 ? 87.734  68.029 -11.193 1.00 55.48  ? 248  ALA A N    1 
ATOM   1696 C  CA   . ALA A 1 214 ? 87.408  69.147 -12.033 1.00 57.62  ? 248  ALA A CA   1 
ATOM   1697 C  C    . ALA A 1 214 ? 87.800  70.464 -11.377 1.00 60.11  ? 248  ALA A C    1 
ATOM   1698 O  O    . ALA A 1 214 ? 88.211  71.404 -12.062 1.00 61.97  ? 248  ALA A O    1 
ATOM   1699 C  CB   . ALA A 1 214 ? 85.932  69.158 -12.352 1.00 56.61  ? 248  ALA A CB   1 
ATOM   1700 N  N    . GLU A 1 215 ? 87.650  70.563 -10.058 1.00 61.39  ? 249  GLU A N    1 
ATOM   1701 C  CA   . GLU A 1 215 ? 87.970  71.808 -9.360  1.00 61.95  ? 249  GLU A CA   1 
ATOM   1702 C  C    . GLU A 1 215 ? 89.470  72.043 -9.418  1.00 62.61  ? 249  GLU A C    1 
ATOM   1703 O  O    . GLU A 1 215 ? 89.942  73.175 -9.492  1.00 64.11  ? 249  GLU A O    1 
ATOM   1704 C  CB   . GLU A 1 215 ? 87.480  71.746 -7.909  1.00 61.56  ? 249  GLU A CB   1 
ATOM   1705 C  CG   . GLU A 1 215 ? 88.195  72.679 -6.983  1.00 63.37  ? 249  GLU A CG   1 
ATOM   1706 C  CD   . GLU A 1 215 ? 87.320  73.199 -5.821  1.00 64.88  ? 249  GLU A CD   1 
ATOM   1707 O  OE1  . GLU A 1 215 ? 86.393  72.458 -5.383  1.00 62.77  ? 249  GLU A OE1  1 
ATOM   1708 O  OE2  . GLU A 1 215 ? 87.588  74.356 -5.356  1.00 65.60  ? 249  GLU A OE2  1 
ATOM   1709 N  N    . LEU A 1 216 ? 90.241  70.972 -9.377  1.00 61.87  ? 250  LEU A N    1 
ATOM   1710 C  CA   . LEU A 1 216 ? 91.663  71.108 -9.415  1.00 60.61  ? 250  LEU A CA   1 
ATOM   1711 C  C    . LEU A 1 216 ? 92.073  71.488 -10.808 1.00 61.60  ? 250  LEU A C    1 
ATOM   1712 O  O    . LEU A 1 216 ? 93.148  72.013 -10.968 1.00 63.32  ? 250  LEU A O    1 
ATOM   1713 C  CB   . LEU A 1 216 ? 92.347  69.810 -9.015  1.00 58.97  ? 250  LEU A CB   1 
ATOM   1714 C  CG   . LEU A 1 216 ? 93.026  69.644 -7.662  1.00 56.92  ? 250  LEU A CG   1 
ATOM   1715 C  CD1  . LEU A 1 216 ? 92.423  70.519 -6.609  1.00 54.82  ? 250  LEU A CD1  1 
ATOM   1716 C  CD2  . LEU A 1 216 ? 92.926  68.184 -7.317  1.00 55.17  ? 250  LEU A CD2  1 
ATOM   1717 N  N    . LEU A 1 217 ? 91.271  71.233 -11.835 1.00 61.88  ? 251  LEU A N    1 
ATOM   1718 C  CA   . LEU A 1 217 ? 91.683  71.637 -13.183 1.00 62.33  ? 251  LEU A CA   1 
ATOM   1719 C  C    . LEU A 1 217 ? 91.183  72.998 -13.564 1.00 63.92  ? 251  LEU A C    1 
ATOM   1720 O  O    . LEU A 1 217 ? 91.700  73.605 -14.506 1.00 66.27  ? 251  LEU A O    1 
ATOM   1721 C  CB   . LEU A 1 217 ? 91.182  70.687 -14.243 1.00 61.33  ? 251  LEU A CB   1 
ATOM   1722 C  CG   . LEU A 1 217 ? 91.707  69.285 -14.064 1.00 62.85  ? 251  LEU A CG   1 
ATOM   1723 C  CD1  . LEU A 1 217 ? 91.144  68.364 -15.146 1.00 62.06  ? 251  LEU A CD1  1 
ATOM   1724 C  CD2  . LEU A 1 217 ? 93.202  69.338 -14.098 1.00 61.64  ? 251  LEU A CD2  1 
ATOM   1725 N  N    . LEU A 1 218 ? 90.165  73.489 -12.875 1.00 64.28  ? 252  LEU A N    1 
ATOM   1726 C  CA   . LEU A 1 218 ? 89.588  74.769 -13.231 1.00 65.74  ? 252  LEU A CA   1 
ATOM   1727 C  C    . LEU A 1 218 ? 90.032  75.909 -12.392 1.00 66.36  ? 252  LEU A C    1 
ATOM   1728 O  O    . LEU A 1 218 ? 89.940  77.074 -12.812 1.00 66.81  ? 252  LEU A O    1 
ATOM   1729 C  CB   . LEU A 1 218 ? 88.097  74.733 -13.104 1.00 66.83  ? 252  LEU A CB   1 
ATOM   1730 C  CG   . LEU A 1 218 ? 87.293  74.052 -14.178 1.00 70.21  ? 252  LEU A CG   1 
ATOM   1731 C  CD1  . LEU A 1 218 ? 85.896  73.745 -13.562 1.00 72.53  ? 252  LEU A CD1  1 
ATOM   1732 C  CD2  . LEU A 1 218 ? 87.189  74.933 -15.406 1.00 68.61  ? 252  LEU A CD2  1 
ATOM   1733 N  N    . GLY A 1 219 ? 90.424  75.574 -11.168 1.00 65.93  ? 253  GLY A N    1 
ATOM   1734 C  CA   . GLY A 1 219 ? 90.818  76.579 -10.214 1.00 65.04  ? 253  GLY A CA   1 
ATOM   1735 C  C    . GLY A 1 219 ? 89.683  77.064 -9.357  1.00 65.30  ? 253  GLY A C    1 
ATOM   1736 O  O    . GLY A 1 219 ? 89.874  77.930 -8.540  1.00 65.15  ? 253  GLY A O    1 
ATOM   1737 N  N    . GLN A 1 220 ? 88.489  76.526 -9.533  1.00 67.95  ? 254  GLN A N    1 
ATOM   1738 C  CA   . GLN A 1 220 ? 87.315  76.885 -8.709  1.00 69.53  ? 254  GLN A CA   1 
ATOM   1739 C  C    . GLN A 1 220 ? 86.340  75.723 -8.815  1.00 67.95  ? 254  GLN A C    1 
ATOM   1740 O  O    . GLN A 1 220 ? 86.483  74.868 -9.681  1.00 69.44  ? 254  GLN A O    1 
ATOM   1741 C  CB   . GLN A 1 220 ? 86.657  78.144 -9.243  1.00 71.68  ? 254  GLN A CB   1 
ATOM   1742 C  CG   . GLN A 1 220 ? 86.461  78.066 -10.724 1.00 77.80  ? 254  GLN A CG   1 
ATOM   1743 C  CD   . GLN A 1 220 ? 85.531  79.148 -11.287 1.00 80.59  ? 254  GLN A CD   1 
ATOM   1744 O  OE1  . GLN A 1 220 ? 84.400  79.318 -10.820 1.00 83.28  ? 254  GLN A OE1  1 
ATOM   1745 N  NE2  . GLN A 1 220 ? 85.998  79.862 -12.312 1.00 81.87  ? 254  GLN A NE2  1 
ATOM   1746 N  N    . PRO A 1 221 ? 85.357  75.645 -7.902  1.00 66.05  ? 255  PRO A N    1 
ATOM   1747 C  CA   . PRO A 1 221 ? 84.342  74.582 -7.886  1.00 63.48  ? 255  PRO A CA   1 
ATOM   1748 C  C    . PRO A 1 221 ? 83.651  74.536 -9.232  1.00 62.53  ? 255  PRO A C    1 
ATOM   1749 O  O    . PRO A 1 221 ? 83.294  75.590 -9.773  1.00 62.81  ? 255  PRO A O    1 
ATOM   1750 C  CB   . PRO A 1 221 ? 83.414  75.042 -6.791  1.00 62.56  ? 255  PRO A CB   1 
ATOM   1751 C  CG   . PRO A 1 221 ? 84.362  75.600 -5.806  1.00 62.81  ? 255  PRO A CG   1 
ATOM   1752 C  CD   . PRO A 1 221 ? 85.292  76.421 -6.654  1.00 64.85  ? 255  PRO A CD   1 
ATOM   1753 N  N    . ILE A 1 222 ? 83.457  73.341 -9.781  1.00 60.62  ? 256  ILE A N    1 
ATOM   1754 C  CA   . ILE A 1 222 ? 82.801  73.241 -11.062 1.00 59.29  ? 256  ILE A CA   1 
ATOM   1755 C  C    . ILE A 1 222 ? 81.293  73.398 -10.971 1.00 60.24  ? 256  ILE A C    1 
ATOM   1756 O  O    . ILE A 1 222 ? 80.683  73.918 -11.872 1.00 60.97  ? 256  ILE A O    1 
ATOM   1757 C  CB   . ILE A 1 222 ? 83.101  71.922 -11.779 1.00 59.13  ? 256  ILE A CB   1 
ATOM   1758 C  CG1  . ILE A 1 222 ? 82.564  72.024 -13.210 1.00 57.37  ? 256  ILE A CG1  1 
ATOM   1759 C  CG2  . ILE A 1 222 ? 82.502  70.739 -10.987 1.00 56.73  ? 256  ILE A CG2  1 
ATOM   1760 C  CD1  . ILE A 1 222 ? 82.865  70.859 -14.094 1.00 58.18  ? 256  ILE A CD1  1 
ATOM   1761 N  N    . PHE A 1 223 ? 80.664  72.949 -9.897  1.00 61.58  ? 257  PHE A N    1 
ATOM   1762 C  CA   . PHE A 1 223 ? 79.206  73.085 -9.793  1.00 61.71  ? 257  PHE A CA   1 
ATOM   1763 C  C    . PHE A 1 223 ? 78.765  73.914 -8.602  1.00 62.16  ? 257  PHE A C    1 
ATOM   1764 O  O    . PHE A 1 223 ? 78.231  73.389 -7.620  1.00 63.07  ? 257  PHE A O    1 
ATOM   1765 C  CB   . PHE A 1 223 ? 78.544  71.726 -9.710  1.00 60.05  ? 257  PHE A CB   1 
ATOM   1766 C  CG   . PHE A 1 223 ? 78.793  70.873 -10.885 1.00 58.92  ? 257  PHE A CG   1 
ATOM   1767 C  CD1  . PHE A 1 223 ? 78.560  71.355 -12.152 1.00 58.57  ? 257  PHE A CD1  1 
ATOM   1768 C  CD2  . PHE A 1 223 ? 79.245  69.582 -10.736 1.00 59.02  ? 257  PHE A CD2  1 
ATOM   1769 C  CE1  . PHE A 1 223 ? 78.776  70.566 -13.241 1.00 58.47  ? 257  PHE A CE1  1 
ATOM   1770 C  CE2  . PHE A 1 223 ? 79.472  68.776 -11.849 1.00 58.00  ? 257  PHE A CE2  1 
ATOM   1771 C  CZ   . PHE A 1 223 ? 79.244  69.264 -13.087 1.00 57.38  ? 257  PHE A CZ   1 
ATOM   1772 N  N    . PRO A 1 224 ? 78.981  75.234 -8.667  1.00 62.86  ? 258  PRO A N    1 
ATOM   1773 C  CA   . PRO A 1 224 ? 78.575  76.096 -7.562  1.00 63.16  ? 258  PRO A CA   1 
ATOM   1774 C  C    . PRO A 1 224 ? 77.061  76.252 -7.710  1.00 65.65  ? 258  PRO A C    1 
ATOM   1775 O  O    . PRO A 1 224 ? 76.472  75.782 -8.711  1.00 67.51  ? 258  PRO A O    1 
ATOM   1776 C  CB   . PRO A 1 224 ? 79.242  77.395 -7.877  1.00 61.31  ? 258  PRO A CB   1 
ATOM   1777 C  CG   . PRO A 1 224 ? 80.156  77.082 -9.047  1.00 61.92  ? 258  PRO A CG   1 
ATOM   1778 C  CD   . PRO A 1 224 ? 79.482  76.044 -9.777  1.00 60.96  ? 258  PRO A CD   1 
ATOM   1779 N  N    . GLY A 1 225 ? 76.423  76.924 -6.766  1.00 65.37  ? 259  GLY A N    1 
ATOM   1780 C  CA   . GLY A 1 225 ? 75.006  77.118 -6.876  1.00 66.49  ? 259  GLY A CA   1 
ATOM   1781 C  C    . GLY A 1 225 ? 74.471  77.326 -5.503  1.00 68.01  ? 259  GLY A C    1 
ATOM   1782 O  O    . GLY A 1 225 ? 74.767  76.542 -4.618  1.00 69.67  ? 259  GLY A O    1 
ATOM   1783 N  N    . ASP A 1 226 ? 73.698  78.377 -5.298  1.00 68.67  ? 260  ASP A N    1 
ATOM   1784 C  CA   . ASP A 1 226 ? 73.137  78.618 -3.987  1.00 68.42  ? 260  ASP A CA   1 
ATOM   1785 C  C    . ASP A 1 226 ? 72.084  77.577 -3.677  1.00 66.54  ? 260  ASP A C    1 
ATOM   1786 O  O    . ASP A 1 226 ? 72.085  76.989 -2.607  1.00 66.60  ? 260  ASP A O    1 
ATOM   1787 C  CB   . ASP A 1 226 ? 72.499  79.991 -3.935  1.00 72.36  ? 260  ASP A CB   1 
ATOM   1788 C  CG   . ASP A 1 226 ? 73.528  81.137 -3.941  1.00 75.92  ? 260  ASP A CG   1 
ATOM   1789 O  OD1  . ASP A 1 226 ? 73.042  82.312 -4.079  1.00 78.31  ? 260  ASP A OD1  1 
ATOM   1790 O  OD2  . ASP A 1 226 ? 74.771  80.853 -3.796  1.00 74.97  ? 260  ASP A OD2  1 
ATOM   1791 N  N    . SER A 1 227 ? 71.177  77.330 -4.599  1.00 63.95  ? 261  SER A N    1 
ATOM   1792 C  CA   . SER A 1 227 ? 70.164  76.341 -4.325  1.00 63.28  ? 261  SER A CA   1 
ATOM   1793 C  C    . SER A 1 227 ? 70.466  75.076 -5.091  1.00 62.24  ? 261  SER A C    1 
ATOM   1794 O  O    . SER A 1 227 ? 71.289  75.077 -5.985  1.00 62.03  ? 261  SER A O    1 
ATOM   1795 C  CB   . SER A 1 227 ? 68.798  76.866 -4.751  1.00 65.14  ? 261  SER A CB   1 
ATOM   1796 O  OG   . SER A 1 227 ? 68.633  76.798 -6.166  1.00 67.71  ? 261  SER A OG   1 
ATOM   1797 N  N    . GLY A 1 228 ? 69.788  73.992 -4.743  1.00 61.76  ? 262  GLY A N    1 
ATOM   1798 C  CA   . GLY A 1 228 ? 69.993  72.743 -5.446  1.00 61.42  ? 262  GLY A CA   1 
ATOM   1799 C  C    . GLY A 1 228 ? 69.550  72.916 -6.886  1.00 61.88  ? 262  GLY A C    1 
ATOM   1800 O  O    . GLY A 1 228 ? 70.097  72.292 -7.791  1.00 61.63  ? 262  GLY A O    1 
ATOM   1801 N  N    . VAL A 1 229 ? 68.539  73.763 -7.100  1.00 62.20  ? 263  VAL A N    1 
ATOM   1802 C  CA   . VAL A 1 229 ? 68.049  74.036 -8.435  1.00 62.41  ? 263  VAL A CA   1 
ATOM   1803 C  C    . VAL A 1 229 ? 69.192  74.650 -9.243  1.00 63.54  ? 263  VAL A C    1 
ATOM   1804 O  O    . VAL A 1 229 ? 69.421  74.269 -10.383 1.00 64.02  ? 263  VAL A O    1 
ATOM   1805 C  CB   . VAL A 1 229 ? 66.862  74.988 -8.422  1.00 61.45  ? 263  VAL A CB   1 
ATOM   1806 C  CG1  . VAL A 1 229 ? 66.612  75.512 -9.812  1.00 61.54  ? 263  VAL A CG1  1 
ATOM   1807 C  CG2  . VAL A 1 229 ? 65.626  74.232 -7.992  1.00 61.11  ? 263  VAL A CG2  1 
ATOM   1808 N  N    . ASP A 1 230 ? 69.929  75.590 -8.659  1.00 64.74  ? 264  ASP A N    1 
ATOM   1809 C  CA   . ASP A 1 230 ? 71.054  76.178 -9.387  1.00 65.34  ? 264  ASP A CA   1 
ATOM   1810 C  C    . ASP A 1 230 ? 72.116  75.103 -9.646  1.00 62.77  ? 264  ASP A C    1 
ATOM   1811 O  O    . ASP A 1 230 ? 72.604  75.000 -10.763 1.00 62.77  ? 264  ASP A O    1 
ATOM   1812 C  CB   . ASP A 1 230 ? 71.670  77.391 -8.638  1.00 69.73  ? 264  ASP A CB   1 
ATOM   1813 C  CG   . ASP A 1 230 ? 70.592  78.361 -8.093  1.00 73.56  ? 264  ASP A CG   1 
ATOM   1814 O  OD1  . ASP A 1 230 ? 69.646  78.720 -8.840  1.00 75.23  ? 264  ASP A OD1  1 
ATOM   1815 O  OD2  . ASP A 1 230 ? 70.691  78.762 -6.904  1.00 76.45  ? 264  ASP A OD2  1 
ATOM   1816 N  N    . GLN A 1 231 ? 72.467  74.281 -8.663  1.00 59.53  ? 265  GLN A N    1 
ATOM   1817 C  CA   . GLN A 1 231 ? 73.463  73.265 -8.952  1.00 58.66  ? 265  GLN A CA   1 
ATOM   1818 C  C    . GLN A 1 231 ? 73.043  72.365 -10.123 1.00 57.55  ? 265  GLN A C    1 
ATOM   1819 O  O    . GLN A 1 231 ? 73.841  72.015 -10.981 1.00 56.35  ? 265  GLN A O    1 
ATOM   1820 C  CB   . GLN A 1 231 ? 73.717  72.408 -7.736  1.00 58.81  ? 265  GLN A CB   1 
ATOM   1821 C  CG   . GLN A 1 231 ? 74.508  73.114 -6.758  1.00 62.29  ? 265  GLN A CG   1 
ATOM   1822 C  CD   . GLN A 1 231 ? 74.795  72.249 -5.583  1.00 65.33  ? 265  GLN A CD   1 
ATOM   1823 O  OE1  . GLN A 1 231 ? 73.972  72.156 -4.614  1.00 63.26  ? 265  GLN A OE1  1 
ATOM   1824 N  NE2  . GLN A 1 231 ? 75.973  71.565 -5.642  1.00 66.07  ? 265  GLN A NE2  1 
ATOM   1825 N  N    . LEU A 1 232 ? 71.778  71.973 -10.120 1.00 56.95  ? 266  LEU A N    1 
ATOM   1826 C  CA   . LEU A 1 232 ? 71.228  71.129 -11.144 1.00 56.27  ? 266  LEU A CA   1 
ATOM   1827 C  C    . LEU A 1 232 ? 71.375  71.874 -12.461 1.00 57.35  ? 266  LEU A C    1 
ATOM   1828 O  O    . LEU A 1 232 ? 71.775  71.295 -13.443 1.00 58.06  ? 266  LEU A O    1 
ATOM   1829 C  CB   . LEU A 1 232 ? 69.773  70.823 -10.807 1.00 55.41  ? 266  LEU A CB   1 
ATOM   1830 C  CG   . LEU A 1 232 ? 69.496  69.402 -10.297 1.00 54.75  ? 266  LEU A CG   1 
ATOM   1831 C  CD1  . LEU A 1 232 ? 70.723  68.709 -9.848  1.00 55.53  ? 266  LEU A CD1  1 
ATOM   1832 C  CD2  . LEU A 1 232 ? 68.543  69.443 -9.202  1.00 54.94  ? 266  LEU A CD2  1 
ATOM   1833 N  N    . VAL A 1 233 ? 71.094  73.170 -12.490 1.00 57.77  ? 267  VAL A N    1 
ATOM   1834 C  CA   . VAL A 1 233 ? 71.261  73.914 -13.717 1.00 57.83  ? 267  VAL A CA   1 
ATOM   1835 C  C    . VAL A 1 233 ? 72.746  73.963 -14.158 1.00 59.32  ? 267  VAL A C    1 
ATOM   1836 O  O    . VAL A 1 233 ? 73.053  73.808 -15.327 1.00 59.01  ? 267  VAL A O    1 
ATOM   1837 C  CB   . VAL A 1 233 ? 70.665  75.291 -13.567 1.00 56.75  ? 267  VAL A CB   1 
ATOM   1838 C  CG1  . VAL A 1 233 ? 71.148  76.165 -14.658 1.00 56.01  ? 267  VAL A CG1  1 
ATOM   1839 C  CG2  . VAL A 1 233 ? 69.122  75.178 -13.594 1.00 53.75  ? 267  VAL A CG2  1 
ATOM   1840 N  N    . GLU A 1 234 ? 73.674  74.147 -13.240 1.00 61.43  ? 268  GLU A N    1 
ATOM   1841 C  CA   . GLU A 1 234 ? 75.090  74.122 -13.611 1.00 64.87  ? 268  GLU A CA   1 
ATOM   1842 C  C    . GLU A 1 234 ? 75.418  72.753 -14.217 1.00 64.57  ? 268  GLU A C    1 
ATOM   1843 O  O    . GLU A 1 234 ? 76.074  72.667 -15.260 1.00 65.39  ? 268  GLU A O    1 
ATOM   1844 C  CB   . GLU A 1 234 ? 76.003  74.245 -12.391 1.00 69.86  ? 268  GLU A CB   1 
ATOM   1845 C  CG   . GLU A 1 234 ? 75.530  75.155 -11.293 1.00 76.11  ? 268  GLU A CG   1 
ATOM   1846 C  CD   . GLU A 1 234 ? 75.908  76.595 -11.586 1.00 80.96  ? 268  GLU A CD   1 
ATOM   1847 O  OE1  . GLU A 1 234 ? 76.126  77.323 -10.581 1.00 82.84  ? 268  GLU A OE1  1 
ATOM   1848 O  OE2  . GLU A 1 234 ? 75.994  76.975 -12.814 1.00 83.47  ? 268  GLU A OE2  1 
ATOM   1849 N  N    . ILE A 1 235 ? 75.013  71.686 -13.521 1.00 62.96  ? 269  ILE A N    1 
ATOM   1850 C  CA   . ILE A 1 235 ? 75.254  70.322 -13.973 1.00 61.66  ? 269  ILE A CA   1 
ATOM   1851 C  C    . ILE A 1 235 ? 74.613  70.104 -15.362 1.00 63.12  ? 269  ILE A C    1 
ATOM   1852 O  O    . ILE A 1 235 ? 75.251  69.610 -16.270 1.00 64.01  ? 269  ILE A O    1 
ATOM   1853 C  CB   . ILE A 1 235 ? 74.679  69.296 -12.982 1.00 58.60  ? 269  ILE A CB   1 
ATOM   1854 C  CG1  . ILE A 1 235 ? 75.543  69.276 -11.721 1.00 57.77  ? 269  ILE A CG1  1 
ATOM   1855 C  CG2  . ILE A 1 235 ? 74.544  67.929 -13.619 1.00 55.18  ? 269  ILE A CG2  1 
ATOM   1856 C  CD1  . ILE A 1 235 ? 74.775  68.823 -10.468 1.00 55.59  ? 269  ILE A CD1  1 
ATOM   1857 N  N    . ILE A 1 236 ? 73.362  70.486 -15.550 1.00 62.99  ? 270  ILE A N    1 
ATOM   1858 C  CA   . ILE A 1 236 ? 72.730  70.288 -16.838 1.00 63.10  ? 270  ILE A CA   1 
ATOM   1859 C  C    . ILE A 1 236 ? 73.489  71.057 -17.904 1.00 63.92  ? 270  ILE A C    1 
ATOM   1860 O  O    . ILE A 1 236 ? 73.551  70.649 -19.044 1.00 63.14  ? 270  ILE A O    1 
ATOM   1861 C  CB   . ILE A 1 236 ? 71.272  70.772 -16.826 1.00 62.81  ? 270  ILE A CB   1 
ATOM   1862 C  CG1  . ILE A 1 236 ? 70.427  69.852 -15.948 1.00 62.30  ? 270  ILE A CG1  1 
ATOM   1863 C  CG2  . ILE A 1 236 ? 70.658  70.638 -18.203 1.00 64.30  ? 270  ILE A CG2  1 
ATOM   1864 C  CD1  . ILE A 1 236 ? 69.155  70.453 -15.580 1.00 59.03  ? 270  ILE A CD1  1 
ATOM   1865 N  N    . LYS A 1 237 ? 74.086  72.181 -17.565 1.00 65.78  ? 271  LYS A N    1 
ATOM   1866 C  CA   . LYS A 1 237 ? 74.805  72.884 -18.603 1.00 67.60  ? 271  LYS A CA   1 
ATOM   1867 C  C    . LYS A 1 237 ? 76.037  72.167 -19.025 1.00 67.88  ? 271  LYS A C    1 
ATOM   1868 O  O    . LYS A 1 237 ? 76.726  72.641 -19.880 1.00 71.45  ? 271  LYS A O    1 
ATOM   1869 C  CB   . LYS A 1 237 ? 75.217  74.287 -18.158 1.00 69.51  ? 271  LYS A CB   1 
ATOM   1870 C  CG   . LYS A 1 237 ? 74.154  75.283 -18.467 1.00 75.14  ? 271  LYS A CG   1 
ATOM   1871 C  CD   . LYS A 1 237 ? 74.646  76.712 -18.437 1.00 80.70  ? 271  LYS A CD   1 
ATOM   1872 C  CE   . LYS A 1 237 ? 74.297  77.391 -17.125 1.00 83.20  ? 271  LYS A CE   1 
ATOM   1873 N  NZ   . LYS A 1 237 ? 75.549  77.501 -16.272 1.00 87.09  ? 271  LYS A NZ   1 
ATOM   1874 N  N    . VAL A 1 238 ? 76.368  71.027 -18.460 1.00 67.84  ? 272  VAL A N    1 
ATOM   1875 C  CA   . VAL A 1 238 ? 77.625  70.380 -18.834 1.00 66.54  ? 272  VAL A CA   1 
ATOM   1876 C  C    . VAL A 1 238 ? 77.408  68.956 -19.267 1.00 68.13  ? 272  VAL A C    1 
ATOM   1877 O  O    . VAL A 1 238 ? 78.222  68.375 -19.963 1.00 69.16  ? 272  VAL A O    1 
ATOM   1878 C  CB   . VAL A 1 238 ? 78.609  70.397 -17.646 1.00 63.69  ? 272  VAL A CB   1 
ATOM   1879 C  CG1  . VAL A 1 238 ? 79.866  69.739 -18.003 1.00 61.66  ? 272  VAL A CG1  1 
ATOM   1880 C  CG2  . VAL A 1 238 ? 78.863  71.781 -17.220 1.00 60.77  ? 272  VAL A CG2  1 
ATOM   1881 N  N    . LEU A 1 239 ? 76.299  68.384 -18.842 1.00 69.42  ? 273  LEU A N    1 
ATOM   1882 C  CA   . LEU A 1 239 ? 75.983  67.019 -19.162 1.00 70.47  ? 273  LEU A CA   1 
ATOM   1883 C  C    . LEU A 1 239 ? 74.731  66.991 -20.003 1.00 73.51  ? 273  LEU A C    1 
ATOM   1884 O  O    . LEU A 1 239 ? 74.395  65.960 -20.575 1.00 75.56  ? 273  LEU A O    1 
ATOM   1885 C  CB   . LEU A 1 239 ? 75.726  66.204 -17.889 1.00 66.58  ? 273  LEU A CB   1 
ATOM   1886 C  CG   . LEU A 1 239 ? 76.696  66.179 -16.717 1.00 64.26  ? 273  LEU A CG   1 
ATOM   1887 C  CD1  . LEU A 1 239 ? 76.375  64.971 -15.894 1.00 61.98  ? 273  LEU A CD1  1 
ATOM   1888 C  CD2  . LEU A 1 239 ? 78.108  66.150 -17.180 1.00 63.77  ? 273  LEU A CD2  1 
ATOM   1889 N  N    . GLY A 1 240 ? 74.012  68.096 -20.078 1.00 75.51  ? 274  GLY A N    1 
ATOM   1890 C  CA   . GLY A 1 240 ? 72.798  68.072 -20.867 1.00 78.66  ? 274  GLY A CA   1 
ATOM   1891 C  C    . GLY A 1 240 ? 71.640  67.651 -19.998 1.00 81.45  ? 274  GLY A C    1 
ATOM   1892 O  O    . GLY A 1 240 ? 71.825  67.151 -18.886 1.00 82.37  ? 274  GLY A O    1 
ATOM   1893 N  N    . THR A 1 241 ? 70.428  67.835 -20.492 1.00 84.08  ? 275  THR A N    1 
ATOM   1894 C  CA   . THR A 1 241 ? 69.283  67.471 -19.664 1.00 85.91  ? 275  THR A CA   1 
ATOM   1895 C  C    . THR A 1 241 ? 69.206  65.942 -19.383 1.00 85.38  ? 275  THR A C    1 
ATOM   1896 O  O    . THR A 1 241 ? 69.619  65.095 -20.183 1.00 84.51  ? 275  THR A O    1 
ATOM   1897 C  CB   . THR A 1 241 ? 67.946  68.082 -20.275 1.00 86.68  ? 275  THR A CB   1 
ATOM   1898 O  OG1  . THR A 1 241 ? 68.163  69.486 -20.552 1.00 88.31  ? 275  THR A OG1  1 
ATOM   1899 C  CG2  . THR A 1 241 ? 66.770  67.964 -19.283 1.00 85.37  ? 275  THR A CG2  1 
ATOM   1900 N  N    . PRO A 1 242 ? 68.749  65.599 -18.186 1.00 85.56  ? 276  PRO A N    1 
ATOM   1901 C  CA   . PRO A 1 242 ? 68.649  64.186 -17.850 1.00 86.88  ? 276  PRO A CA   1 
ATOM   1902 C  C    . PRO A 1 242 ? 67.442  63.511 -18.543 1.00 88.52  ? 276  PRO A C    1 
ATOM   1903 O  O    . PRO A 1 242 ? 66.328  64.070 -18.501 1.00 88.48  ? 276  PRO A O    1 
ATOM   1904 C  CB   . PRO A 1 242 ? 68.467  64.215 -16.316 1.00 85.85  ? 276  PRO A CB   1 
ATOM   1905 C  CG   . PRO A 1 242 ? 69.034  65.514 -15.901 1.00 85.30  ? 276  PRO A CG   1 
ATOM   1906 C  CD   . PRO A 1 242 ? 68.630  66.446 -16.984 1.00 85.08  ? 276  PRO A CD   1 
ATOM   1907 N  N    . THR A 1 243 ? 67.638  62.340 -19.168 1.00 89.19  ? 277  THR A N    1 
ATOM   1908 C  CA   . THR A 1 243 ? 66.513  61.631 -19.780 1.00 89.88  ? 277  THR A CA   1 
ATOM   1909 C  C    . THR A 1 243 ? 65.636  61.172 -18.596 1.00 92.50  ? 277  THR A C    1 
ATOM   1910 O  O    . THR A 1 243 ? 66.136  61.044 -17.470 1.00 91.99  ? 277  THR A O    1 
ATOM   1911 C  CB   . THR A 1 243 ? 66.959  60.390 -20.650 1.00 88.49  ? 277  THR A CB   1 
ATOM   1912 O  OG1  . THR A 1 243 ? 66.967  59.199 -19.868 1.00 88.85  ? 277  THR A OG1  1 
ATOM   1913 C  CG2  . THR A 1 243 ? 68.344  60.597 -21.246 1.00 86.91  ? 277  THR A CG2  1 
ATOM   1914 N  N    . ARG A 1 244 ? 64.338  60.950 -18.842 1.00 95.83  ? 278  ARG A N    1 
ATOM   1915 C  CA   . ARG A 1 244 ? 63.376  60.544 -17.794 1.00 98.36  ? 278  ARG A CA   1 
ATOM   1916 C  C    . ARG A 1 244 ? 63.939  59.298 -17.099 1.00 97.64  ? 278  ARG A C    1 
ATOM   1917 O  O    . ARG A 1 244 ? 63.800  59.124 -15.877 1.00 96.43  ? 278  ARG A O    1 
ATOM   1918 C  CB   . ARG A 1 244 ? 62.006  60.233 -18.425 1.00 102.62 ? 278  ARG A CB   1 
ATOM   1919 C  CG   . ARG A 1 244 ? 60.720  60.797 -17.717 1.00 107.92 ? 278  ARG A CG   1 
ATOM   1920 C  CD   . ARG A 1 244 ? 59.481  59.863 -17.992 1.00 112.96 ? 278  ARG A CD   1 
ATOM   1921 N  NE   . ARG A 1 244 ? 59.431  59.284 -19.360 1.00 116.82 ? 278  ARG A NE   1 
ATOM   1922 C  CZ   . ARG A 1 244 ? 59.020  58.040 -19.666 1.00 118.03 ? 278  ARG A CZ   1 
ATOM   1923 N  NH1  . ARG A 1 244 ? 58.603  57.192 -18.712 1.00 118.54 ? 278  ARG A NH1  1 
ATOM   1924 N  NH2  . ARG A 1 244 ? 59.050  57.629 -20.939 1.00 117.89 ? 278  ARG A NH2  1 
ATOM   1925 N  N    . GLU A 1 245 ? 64.581  58.447 -17.903 1.00 96.99  ? 279  GLU A N    1 
ATOM   1926 C  CA   . GLU A 1 245 ? 65.220  57.227 -17.418 1.00 96.51  ? 279  GLU A CA   1 
ATOM   1927 C  C    . GLU A 1 245 ? 66.181  57.652 -16.323 1.00 95.34  ? 279  GLU A C    1 
ATOM   1928 O  O    . GLU A 1 245 ? 65.956  57.347 -15.137 1.00 95.25  ? 279  GLU A O    1 
ATOM   1929 C  CB   . GLU A 1 245 ? 65.997  56.505 -18.559 1.00 98.08  ? 279  GLU A CB   1 
ATOM   1930 C  CG   . GLU A 1 245 ? 66.765  55.190 -18.190 1.00 101.28 ? 279  GLU A CG   1 
ATOM   1931 C  CD   . GLU A 1 245 ? 66.024  54.265 -17.153 1.00 104.25 ? 279  GLU A CD   1 
ATOM   1932 O  OE1  . GLU A 1 245 ? 64.770  54.358 -17.005 1.00 105.30 ? 279  GLU A OE1  1 
ATOM   1933 O  OE2  . GLU A 1 245 ? 66.697  53.433 -16.481 1.00 104.38 ? 279  GLU A OE2  1 
ATOM   1934 N  N    . GLN A 1 246 ? 67.241  58.366 -16.717 1.00 92.79  ? 280  GLN A N    1 
ATOM   1935 C  CA   . GLN A 1 246 ? 68.220  58.857 -15.772 1.00 90.11  ? 280  GLN A CA   1 
ATOM   1936 C  C    . GLN A 1 246 ? 67.605  59.451 -14.488 1.00 91.13  ? 280  GLN A C    1 
ATOM   1937 O  O    . GLN A 1 246 ? 67.930  59.010 -13.384 1.00 91.30  ? 280  GLN A O    1 
ATOM   1938 C  CB   . GLN A 1 246 ? 69.084  59.874 -16.446 1.00 85.66  ? 280  GLN A CB   1 
ATOM   1939 C  CG   . GLN A 1 246 ? 69.726  59.317 -17.598 1.00 81.21  ? 280  GLN A CG   1 
ATOM   1940 C  CD   . GLN A 1 246 ? 70.570  60.331 -18.298 1.00 81.31  ? 280  GLN A CD   1 
ATOM   1941 O  OE1  . GLN A 1 246 ? 70.099  61.426 -18.629 1.00 79.89  ? 280  GLN A OE1  1 
ATOM   1942 N  NE2  . GLN A 1 246 ? 71.835  59.985 -18.552 1.00 82.03  ? 280  GLN A NE2  1 
ATOM   1943 N  N    . ILE A 1 247 ? 66.719  60.432 -14.602 1.00 91.72  ? 281  ILE A N    1 
ATOM   1944 C  CA   . ILE A 1 247 ? 66.141  61.012 -13.387 1.00 92.66  ? 281  ILE A CA   1 
ATOM   1945 C  C    . ILE A 1 247 ? 65.568  59.951 -12.438 1.00 93.12  ? 281  ILE A C    1 
ATOM   1946 O  O    . ILE A 1 247 ? 65.487  60.155 -11.212 1.00 93.15  ? 281  ILE A O    1 
ATOM   1947 C  CB   . ILE A 1 247 ? 65.022  62.016 -13.724 1.00 92.77  ? 281  ILE A CB   1 
ATOM   1948 C  CG1  . ILE A 1 247 ? 65.596  63.159 -14.561 1.00 93.18  ? 281  ILE A CG1  1 
ATOM   1949 C  CG2  . ILE A 1 247 ? 64.336  62.492 -12.448 1.00 91.60  ? 281  ILE A CG2  1 
ATOM   1950 C  CD1  . ILE A 1 247 ? 65.012  63.208 -15.974 1.00 94.41  ? 281  ILE A CD1  1 
ATOM   1951 N  N    . ARG A 1 248 ? 65.172  58.824 -13.021 1.00 93.33  ? 282  ARG A N    1 
ATOM   1952 C  CA   . ARG A 1 248 ? 64.582  57.727 -12.274 1.00 93.78  ? 282  ARG A CA   1 
ATOM   1953 C  C    . ARG A 1 248 ? 65.650  56.903 -11.561 1.00 93.02  ? 282  ARG A C    1 
ATOM   1954 O  O    . ARG A 1 248 ? 65.407  56.375 -10.456 1.00 92.55  ? 282  ARG A O    1 
ATOM   1955 C  CB   . ARG A 1 248 ? 63.767  56.863 -13.239 1.00 95.55  ? 282  ARG A CB   1 
ATOM   1956 C  CG   . ARG A 1 248 ? 63.012  55.656 -12.641 1.00 97.95  ? 282  ARG A CG   1 
ATOM   1957 C  CD   . ARG A 1 248 ? 62.391  54.867 -13.788 1.00 99.06  ? 282  ARG A CD   1 
ATOM   1958 N  NE   . ARG A 1 248 ? 61.697  55.804 -14.687 1.00 100.97 ? 282  ARG A NE   1 
ATOM   1959 C  CZ   . ARG A 1 248 ? 61.742  55.776 -16.022 1.00 100.96 ? 282  ARG A CZ   1 
ATOM   1960 N  NH1  . ARG A 1 248 ? 62.456  54.844 -16.646 1.00 100.85 ? 282  ARG A NH1  1 
ATOM   1961 N  NH2  . ARG A 1 248 ? 61.070  56.690 -16.730 1.00 100.23 ? 282  ARG A NH2  1 
ATOM   1962 N  N    . GLU A 1 249 ? 66.823  56.798 -12.193 1.00 92.17  ? 283  GLU A N    1 
ATOM   1963 C  CA   . GLU A 1 249 ? 67.957  56.053 -11.645 1.00 91.79  ? 283  GLU A CA   1 
ATOM   1964 C  C    . GLU A 1 249 ? 68.611  56.809 -10.505 1.00 91.29  ? 283  GLU A C    1 
ATOM   1965 O  O    . GLU A 1 249 ? 69.333  56.234 -9.694  1.00 90.68  ? 283  GLU A O    1 
ATOM   1966 C  CB   . GLU A 1 249 ? 68.982  55.811 -12.716 1.00 92.37  ? 283  GLU A CB   1 
ATOM   1967 C  CG   . GLU A 1 249 ? 68.340  55.545 -14.025 1.00 95.73  ? 283  GLU A CG   1 
ATOM   1968 C  CD   . GLU A 1 249 ? 69.167  54.624 -14.905 1.00 97.62  ? 283  GLU A CD   1 
ATOM   1969 O  OE1  . GLU A 1 249 ? 69.435  53.469 -14.457 1.00 98.15  ? 283  GLU A OE1  1 
ATOM   1970 O  OE2  . GLU A 1 249 ? 69.535  55.065 -16.028 1.00 98.20  ? 283  GLU A OE2  1 
ATOM   1971 N  N    . MET A 1 250 ? 68.346  58.110 -10.452 1.00 90.52  ? 284  MET A N    1 
ATOM   1972 C  CA   . MET A 1 250 ? 68.888  58.966 -9.414  1.00 89.61  ? 284  MET A CA   1 
ATOM   1973 C  C    . MET A 1 250 ? 67.999  58.934 -8.195  1.00 91.19  ? 284  MET A C    1 
ATOM   1974 O  O    . MET A 1 250 ? 68.490  58.812 -7.060  1.00 91.52  ? 284  MET A O    1 
ATOM   1975 C  CB   . MET A 1 250 ? 68.992  60.379 -9.930  1.00 86.33  ? 284  MET A CB   1 
ATOM   1976 C  CG   . MET A 1 250 ? 69.729  60.391 -11.214 1.00 81.96  ? 284  MET A CG   1 
ATOM   1977 S  SD   . MET A 1 250 ? 70.502  61.893 -11.561 1.00 78.02  ? 284  MET A SD   1 
ATOM   1978 C  CE   . MET A 1 250 ? 69.418  62.606 -12.798 1.00 78.64  ? 284  MET A CE   1 
ATOM   1979 N  N    . ASN A 1 251 ? 66.690  59.036 -8.428  1.00 92.45  ? 285  ASN A N    1 
ATOM   1980 C  CA   . ASN A 1 251 ? 65.728  59.007 -7.335  1.00 93.73  ? 285  ASN A CA   1 
ATOM   1981 C  C    . ASN A 1 251 ? 64.386  58.536 -7.772  1.00 95.75  ? 285  ASN A C    1 
ATOM   1982 O  O    . ASN A 1 251 ? 63.598  59.317 -8.305  1.00 95.15  ? 285  ASN A O    1 
ATOM   1983 C  CB   . ASN A 1 251 ? 65.563  60.386 -6.717  1.00 92.36  ? 285  ASN A CB   1 
ATOM   1984 C  CG   . ASN A 1 251 ? 64.758  60.350 -5.447  1.00 90.45  ? 285  ASN A CG   1 
ATOM   1985 O  OD1  . ASN A 1 251 ? 64.492  59.280 -4.901  1.00 89.43  ? 285  ASN A OD1  1 
ATOM   1986 N  ND2  . ASN A 1 251 ? 64.382  61.518 -4.953  1.00 89.96  ? 285  ASN A ND2  1 
ATOM   1987 N  N    . PRO A 1 252 ? 64.098  57.245 -7.538  1.00 98.68  ? 286  PRO A N    1 
ATOM   1988 C  CA   . PRO A 1 252 ? 62.824  56.599 -7.894  1.00 100.69 ? 286  PRO A CA   1 
ATOM   1989 C  C    . PRO A 1 252 ? 61.609  57.496 -7.636  1.00 102.12 ? 286  PRO A C    1 
ATOM   1990 O  O    . PRO A 1 252 ? 60.917  57.866 -8.581  1.00 103.84 ? 286  PRO A O    1 
ATOM   1991 C  CB   . PRO A 1 252 ? 62.850  55.337 -7.050  1.00 100.70 ? 286  PRO A CB   1 
ATOM   1992 C  CG   . PRO A 1 252 ? 64.319  54.951 -7.132  1.00 99.51  ? 286  PRO A CG   1 
ATOM   1993 C  CD   . PRO A 1 252 ? 65.021  56.279 -6.896  1.00 98.81  ? 286  PRO A CD   1 
ATOM   1994 N  N    . ASN A 1 253 ? 61.331  57.845 -6.387  1.00 102.95 ? 287  ASN A N    1 
ATOM   1995 C  CA   . ASN A 1 253 ? 60.211  58.758 -6.122  1.00 105.14 ? 287  ASN A CA   1 
ATOM   1996 C  C    . ASN A 1 253 ? 60.861  60.105 -6.328  1.00 105.81 ? 287  ASN A C    1 
ATOM   1997 O  O    . ASN A 1 253 ? 61.808  60.403 -5.625  1.00 107.21 ? 287  ASN A O    1 
ATOM   1998 C  CB   . ASN A 1 253 ? 59.741  58.641 -4.670  1.00 104.82 ? 287  ASN A CB   1 
ATOM   1999 C  CG   . ASN A 1 253 ? 60.464  57.557 -3.933  1.00 104.41 ? 287  ASN A CG   1 
ATOM   2000 O  OD1  . ASN A 1 253 ? 60.517  56.418 -4.384  1.00 104.94 ? 287  ASN A OD1  1 
ATOM   2001 N  ND2  . ASN A 1 253 ? 61.032  57.898 -2.803  1.00 104.22 ? 287  ASN A ND2  1 
ATOM   2002 N  N    . TYR A 1 254 ? 60.407  60.943 -7.246  1.00 105.95 ? 288  TYR A N    1 
ATOM   2003 C  CA   . TYR A 1 254 ? 61.181  62.142 -7.364  1.00 107.51 ? 288  TYR A CA   1 
ATOM   2004 C  C    . TYR A 1 254 ? 60.540  63.528 -7.324  1.00 108.49 ? 288  TYR A C    1 
ATOM   2005 O  O    . TYR A 1 254 ? 61.154  64.477 -6.751  1.00 110.27 ? 288  TYR A O    1 
ATOM   2006 C  CB   . TYR A 1 254 ? 62.100  62.001 -8.586  1.00 107.88 ? 288  TYR A CB   1 
ATOM   2007 C  CG   . TYR A 1 254 ? 61.386  61.595 -9.852  1.00 109.21 ? 288  TYR A CG   1 
ATOM   2008 C  CD1  . TYR A 1 254 ? 60.516  62.482 -10.506 1.00 109.19 ? 288  TYR A CD1  1 
ATOM   2009 C  CD2  . TYR A 1 254 ? 61.575  60.329 -10.399 1.00 109.64 ? 288  TYR A CD2  1 
ATOM   2010 C  CE1  . TYR A 1 254 ? 59.859  62.131 -11.661 1.00 109.84 ? 288  TYR A CE1  1 
ATOM   2011 C  CE2  . TYR A 1 254 ? 60.921  59.947 -11.561 1.00 110.73 ? 288  TYR A CE2  1 
ATOM   2012 C  CZ   . TYR A 1 254 ? 60.062  60.854 -12.195 1.00 111.71 ? 288  TYR A CZ   1 
ATOM   2013 O  OH   . TYR A 1 254 ? 59.420  60.463 -13.367 1.00 112.37 ? 288  TYR A OH   1 
ATOM   2014 N  N    . THR A 1 255 ? 59.332  63.647 -7.896  1.00 106.99 ? 289  THR A N    1 
ATOM   2015 C  CA   . THR A 1 255 ? 58.605  64.932 -8.006  1.00 104.68 ? 289  THR A CA   1 
ATOM   2016 C  C    . THR A 1 255 ? 59.224  65.742 -9.147  1.00 105.04 ? 289  THR A C    1 
ATOM   2017 O  O    . THR A 1 255 ? 60.399  66.152 -9.102  1.00 104.01 ? 289  THR A O    1 
ATOM   2018 C  CB   . THR A 1 255 ? 58.661  65.763 -6.720  1.00 101.88 ? 289  THR A CB   1 
ATOM   2019 O  OG1  . THR A 1 255 ? 58.271  64.944 -5.624  1.00 100.90 ? 289  THR A OG1  1 
ATOM   2020 C  CG2  . THR A 1 255 ? 57.719  66.947 -6.827  1.00 99.11  ? 289  THR A CG2  1 
ATOM   2021 N  N    . GLU A 1 256 ? 58.436  65.936 -10.194 1.00 105.74 ? 290  GLU A N    1 
ATOM   2022 C  CA   . GLU A 1 256 ? 58.944  66.653 -11.357 1.00 107.12 ? 290  GLU A CA   1 
ATOM   2023 C  C    . GLU A 1 256 ? 59.233  68.128 -11.047 1.00 105.85 ? 290  GLU A C    1 
ATOM   2024 O  O    . GLU A 1 256 ? 58.713  68.642 -10.050 1.00 106.15 ? 290  GLU A O    1 
ATOM   2025 C  CB   . GLU A 1 256 ? 57.942  66.526 -12.528 1.00 108.80 ? 290  GLU A CB   1 
ATOM   2026 C  CG   . GLU A 1 256 ? 56.457  66.691 -12.129 1.00 113.03 ? 290  GLU A CG   1 
ATOM   2027 C  CD   . GLU A 1 256 ? 56.030  68.170 -11.838 1.00 116.28 ? 290  GLU A CD   1 
ATOM   2028 O  OE1  . GLU A 1 256 ? 56.087  69.022 -12.782 1.00 116.63 ? 290  GLU A OE1  1 
ATOM   2029 O  OE2  . GLU A 1 256 ? 55.627  68.470 -10.668 1.00 117.32 ? 290  GLU A OE2  1 
ATOM   2030 N  N    . PHE A 1 257 ? 60.071  68.779 -11.872 1.00 104.18 ? 291  PHE A N    1 
ATOM   2031 C  CA   . PHE A 1 257 ? 60.381  70.219 -11.749 1.00 103.47 ? 291  PHE A CA   1 
ATOM   2032 C  C    . PHE A 1 257 ? 60.553  70.852 -13.175 1.00 104.32 ? 291  PHE A C    1 
ATOM   2033 O  O    . PHE A 1 257 ? 60.752  70.138 -14.181 1.00 103.90 ? 291  PHE A O    1 
ATOM   2034 C  CB   . PHE A 1 257 ? 61.653  70.477 -10.844 1.00 100.49 ? 291  PHE A CB   1 
ATOM   2035 C  CG   . PHE A 1 257 ? 62.009  71.972 -10.632 1.00 96.83  ? 291  PHE A CG   1 
ATOM   2036 C  CD1  . PHE A 1 257 ? 61.194  72.817 -9.872  1.00 95.85  ? 291  PHE A CD1  1 
ATOM   2037 C  CD2  . PHE A 1 257 ? 63.103  72.538 -11.275 1.00 95.32  ? 291  PHE A CD2  1 
ATOM   2038 C  CE1  . PHE A 1 257 ? 61.465  74.219 -9.763  1.00 94.79  ? 291  PHE A CE1  1 
ATOM   2039 C  CE2  . PHE A 1 257 ? 63.374  73.924 -11.175 1.00 95.36  ? 291  PHE A CE2  1 
ATOM   2040 C  CZ   . PHE A 1 257 ? 62.549  74.765 -10.419 1.00 94.71  ? 291  PHE A CZ   1 
ATOM   2041 N  N    . LYS A 1 258 ? 60.421  72.186 -13.232 1.00 105.12 ? 292  LYS A N    1 
ATOM   2042 C  CA   . LYS A 1 258 ? 60.563  72.982 -14.447 1.00 105.58 ? 292  LYS A CA   1 
ATOM   2043 C  C    . LYS A 1 258 ? 61.899  72.623 -15.105 1.00 106.47 ? 292  LYS A C    1 
ATOM   2044 O  O    . LYS A 1 258 ? 62.068  71.512 -15.638 1.00 106.10 ? 292  LYS A O    1 
ATOM   2045 C  CB   . LYS A 1 258 ? 60.525  74.485 -14.080 1.00 104.55 ? 292  LYS A CB   1 
ATOM   2046 N  N    . PHE A 1 259 ? 62.831  73.578 -15.059 1.00 107.78 ? 293  PHE A N    1 
ATOM   2047 C  CA   . PHE A 1 259 ? 64.184  73.431 -15.599 1.00 108.71 ? 293  PHE A CA   1 
ATOM   2048 C  C    . PHE A 1 259 ? 64.396  74.022 -16.991 1.00 111.26 ? 293  PHE A C    1 
ATOM   2049 O  O    . PHE A 1 259 ? 64.430  75.259 -17.165 1.00 109.71 ? 293  PHE A O    1 
ATOM   2050 C  CB   . PHE A 1 259 ? 64.685  71.942 -15.630 1.00 105.56 ? 293  PHE A CB   1 
ATOM   2051 C  CG   . PHE A 1 259 ? 65.328  71.468 -14.381 1.00 102.59 ? 293  PHE A CG   1 
ATOM   2052 C  CD1  . PHE A 1 259 ? 65.049  70.192 -13.901 1.00 101.31 ? 293  PHE A CD1  1 
ATOM   2053 C  CD2  . PHE A 1 259 ? 66.145  72.311 -13.644 1.00 101.61 ? 293  PHE A CD2  1 
ATOM   2054 C  CE1  . PHE A 1 259 ? 65.558  69.756 -12.684 1.00 101.24 ? 293  PHE A CE1  1 
ATOM   2055 C  CE2  . PHE A 1 259 ? 66.669  71.900 -12.427 1.00 102.23 ? 293  PHE A CE2  1 
ATOM   2056 C  CZ   . PHE A 1 259 ? 66.369  70.608 -11.936 1.00 102.35 ? 293  PHE A CZ   1 
ATOM   2057 N  N    . PRO A 1 260 ? 64.473  73.123 -18.010 1.00 114.51 ? 294  PRO A N    1 
ATOM   2058 C  CA   . PRO A 1 260 ? 64.714  73.354 -19.430 1.00 116.06 ? 294  PRO A CA   1 
ATOM   2059 C  C    . PRO A 1 260 ? 65.368  74.619 -19.966 1.00 116.23 ? 294  PRO A C    1 
ATOM   2060 O  O    . PRO A 1 260 ? 65.180  75.741 -19.499 1.00 114.04 ? 294  PRO A O    1 
ATOM   2061 C  CB   . PRO A 1 260 ? 63.374  72.975 -20.065 1.00 116.83 ? 294  PRO A CB   1 
ATOM   2062 C  CG   . PRO A 1 260 ? 63.187  71.623 -19.390 1.00 116.28 ? 294  PRO A CG   1 
ATOM   2063 C  CD   . PRO A 1 260 ? 63.512  71.982 -17.918 1.00 115.45 ? 294  PRO A CD   1 
ATOM   2064 N  N    . GLN A 1 261 ? 66.227  74.302 -20.927 1.00 118.17 ? 295  GLN A N    1 
ATOM   2065 C  CA   . GLN A 1 261 ? 67.045  75.183 -21.734 1.00 119.59 ? 295  GLN A CA   1 
ATOM   2066 C  C    . GLN A 1 261 ? 68.592  75.003 -21.625 1.00 119.89 ? 295  GLN A C    1 
ATOM   2067 O  O    . GLN A 1 261 ? 69.250  75.132 -20.572 1.00 118.01 ? 295  GLN A O    1 
ATOM   2068 C  CB   . GLN A 1 261 ? 66.546  76.630 -21.614 1.00 119.75 ? 295  GLN A CB   1 
ATOM   2069 C  CG   . GLN A 1 261 ? 65.063  76.788 -22.157 1.00 121.18 ? 295  GLN A CG   1 
ATOM   2070 C  CD   . GLN A 1 261 ? 64.701  76.031 -23.490 1.00 120.70 ? 295  GLN A CD   1 
ATOM   2071 O  OE1  . GLN A 1 261 ? 63.520  75.760 -23.763 1.00 120.12 ? 295  GLN A OE1  1 
ATOM   2072 N  NE2  . GLN A 1 261 ? 65.700  75.724 -24.305 1.00 120.68 ? 295  GLN A NE2  1 
ATOM   2073 N  N    . ILE A 1 262 ? 69.100  74.641 -22.803 1.00 121.20 ? 296  ILE A N    1 
ATOM   2074 C  CA   . ILE A 1 262 ? 70.480  74.317 -23.091 1.00 122.23 ? 296  ILE A CA   1 
ATOM   2075 C  C    . ILE A 1 262 ? 70.440  72.778 -22.870 1.00 123.32 ? 296  ILE A C    1 
ATOM   2076 O  O    . ILE A 1 262 ? 69.490  72.225 -22.259 1.00 122.12 ? 296  ILE A O    1 
ATOM   2077 C  CB   . ILE A 1 262 ? 71.517  75.102 -22.153 1.00 121.93 ? 296  ILE A CB   1 
ATOM   2078 C  CG1  . ILE A 1 262 ? 71.456  76.623 -22.412 1.00 120.71 ? 296  ILE A CG1  1 
ATOM   2079 C  CG2  . ILE A 1 262 ? 72.958  74.672 -22.475 1.00 120.89 ? 296  ILE A CG2  1 
ATOM   2080 C  CD1  . ILE A 1 262 ? 72.407  77.458 -21.534 1.00 119.14 ? 296  ILE A CD1  1 
ATOM   2081 N  N    . LYS A 1 263 ? 71.429  72.094 -23.439 1.00 124.91 ? 297  LYS A N    1 
ATOM   2082 C  CA   . LYS A 1 263 ? 71.535  70.641 -23.320 1.00 125.94 ? 297  LYS A CA   1 
ATOM   2083 C  C    . LYS A 1 263 ? 72.785  70.198 -24.124 1.00 126.31 ? 297  LYS A C    1 
ATOM   2084 O  O    . LYS A 1 263 ? 73.170  70.861 -25.108 1.00 126.14 ? 297  LYS A O    1 
ATOM   2085 C  CB   . LYS A 1 263 ? 70.248  69.973 -23.833 1.00 126.00 ? 297  LYS A CB   1 
ATOM   2086 C  CG   . LYS A 1 263 ? 70.035  68.533 -23.395 1.00 125.26 ? 297  LYS A CG   1 
ATOM   2087 C  CD   . LYS A 1 263 ? 68.881  67.964 -24.201 1.00 125.97 ? 297  LYS A CD   1 
ATOM   2088 C  CE   . LYS A 1 263 ? 68.193  66.796 -23.502 1.00 126.02 ? 297  LYS A CE   1 
ATOM   2089 N  NZ   . LYS A 1 263 ? 69.091  65.642 -23.249 1.00 125.61 ? 297  LYS A NZ   1 
ATOM   2090 N  N    . ALA A 1 264 ? 73.397  69.093 -23.660 1.00 126.43 ? 298  ALA A N    1 
ATOM   2091 C  CA   . ALA A 1 264 ? 74.638  68.494 -24.196 1.00 125.76 ? 298  ALA A CA   1 
ATOM   2092 C  C    . ALA A 1 264 ? 75.704  69.569 -24.536 1.00 125.54 ? 298  ALA A C    1 
ATOM   2093 O  O    . ALA A 1 264 ? 75.892  69.919 -25.702 1.00 125.95 ? 298  ALA A O    1 
ATOM   2094 C  CB   . ALA A 1 264 ? 74.320  67.604 -25.418 1.00 125.15 ? 298  ALA A CB   1 
ATOM   2095 N  N    . HIS A 1 265 ? 76.398  70.087 -23.510 1.00 125.19 ? 299  HIS A N    1 
ATOM   2096 C  CA   . HIS A 1 265 ? 77.431  71.139 -23.694 1.00 124.21 ? 299  HIS A CA   1 
ATOM   2097 C  C    . HIS A 1 265 ? 78.844  70.595 -23.897 1.00 122.20 ? 299  HIS A C    1 
ATOM   2098 O  O    . HIS A 1 265 ? 79.169  69.446 -23.547 1.00 122.24 ? 299  HIS A O    1 
ATOM   2099 C  CB   . HIS A 1 265 ? 77.462  72.146 -22.513 1.00 125.62 ? 299  HIS A CB   1 
ATOM   2100 C  CG   . HIS A 1 265 ? 76.931  73.522 -22.844 1.00 126.81 ? 299  HIS A CG   1 
ATOM   2101 N  ND1  . HIS A 1 265 ? 75.679  73.735 -23.408 1.00 126.18 ? 299  HIS A ND1  1 
ATOM   2102 C  CD2  . HIS A 1 265 ? 77.465  74.751 -22.620 1.00 126.98 ? 299  HIS A CD2  1 
ATOM   2103 C  CE1  . HIS A 1 265 ? 75.470  75.034 -23.513 1.00 127.05 ? 299  HIS A CE1  1 
ATOM   2104 N  NE2  . HIS A 1 265 ? 76.533  75.671 -23.042 1.00 128.21 ? 299  HIS A NE2  1 
ATOM   2105 N  N    . PRO A 1 266 ? 79.713  71.441 -24.464 1.00 120.19 ? 300  PRO A N    1 
ATOM   2106 C  CA   . PRO A 1 266 ? 81.097  71.065 -24.735 1.00 117.82 ? 300  PRO A CA   1 
ATOM   2107 C  C    . PRO A 1 266 ? 81.878  70.790 -23.484 1.00 114.96 ? 300  PRO A C    1 
ATOM   2108 O  O    . PRO A 1 266 ? 82.256  71.730 -22.790 1.00 114.87 ? 300  PRO A O    1 
ATOM   2109 C  CB   . PRO A 1 266 ? 81.657  72.278 -25.465 1.00 118.59 ? 300  PRO A CB   1 
ATOM   2110 C  CG   . PRO A 1 266 ? 80.439  72.927 -26.061 1.00 119.91 ? 300  PRO A CG   1 
ATOM   2111 C  CD   . PRO A 1 266 ? 79.452  72.810 -24.938 1.00 120.33 ? 300  PRO A CD   1 
ATOM   2112 N  N    . TRP A 1 267 ? 82.113  69.511 -23.198 1.00 111.29 ? 301  TRP A N    1 
ATOM   2113 C  CA   . TRP A 1 267 ? 82.903  69.132 -22.044 1.00 107.91 ? 301  TRP A CA   1 
ATOM   2114 C  C    . TRP A 1 267 ? 84.298  69.783 -22.185 1.00 108.45 ? 301  TRP A C    1 
ATOM   2115 O  O    . TRP A 1 267 ? 84.939  70.095 -21.188 1.00 109.16 ? 301  TRP A O    1 
ATOM   2116 C  CB   . TRP A 1 267 ? 83.025  67.618 -21.983 1.00 103.55 ? 301  TRP A CB   1 
ATOM   2117 C  CG   . TRP A 1 267 ? 82.306  66.936 -20.831 1.00 98.17  ? 301  TRP A CG   1 
ATOM   2118 C  CD1  . TRP A 1 267 ? 81.445  65.884 -20.913 1.00 96.51  ? 301  TRP A CD1  1 
ATOM   2119 C  CD2  . TRP A 1 267 ? 82.477  67.195 -19.439 1.00 95.09  ? 301  TRP A CD2  1 
ATOM   2120 N  NE1  . TRP A 1 267 ? 81.081  65.469 -19.660 1.00 94.05  ? 301  TRP A NE1  1 
ATOM   2121 C  CE2  . TRP A 1 267 ? 81.700  66.262 -18.740 1.00 93.58  ? 301  TRP A CE2  1 
ATOM   2122 C  CE3  . TRP A 1 267 ? 83.212  68.129 -18.715 1.00 94.42  ? 301  TRP A CE3  1 
ATOM   2123 C  CZ2  . TRP A 1 267 ? 81.639  66.237 -17.361 1.00 93.31  ? 301  TRP A CZ2  1 
ATOM   2124 C  CZ3  . TRP A 1 267 ? 83.147  68.104 -17.334 1.00 93.90  ? 301  TRP A CZ3  1 
ATOM   2125 C  CH2  . TRP A 1 267 ? 82.373  67.173 -16.675 1.00 93.41  ? 301  TRP A CH2  1 
ATOM   2126 N  N    . THR A 1 268 ? 84.756  70.018 -23.418 1.00 108.51 ? 302  THR A N    1 
ATOM   2127 C  CA   . THR A 1 268 ? 86.081  70.643 -23.646 1.00 107.47 ? 302  THR A CA   1 
ATOM   2128 C  C    . THR A 1 268 ? 86.083  72.184 -23.557 1.00 105.95 ? 302  THR A C    1 
ATOM   2129 O  O    . THR A 1 268 ? 87.137  72.804 -23.325 1.00 106.26 ? 302  THR A O    1 
ATOM   2130 C  CB   . THR A 1 268 ? 86.669  70.215 -25.024 1.00 107.85 ? 302  THR A CB   1 
ATOM   2131 O  OG1  . THR A 1 268 ? 86.619  68.783 -25.129 1.00 107.71 ? 302  THR A OG1  1 
ATOM   2132 C  CG2  . THR A 1 268 ? 88.129  70.696 -25.180 1.00 106.89 ? 302  THR A CG2  1 
ATOM   2133 N  N    . LYS A 1 269 ? 84.900  72.771 -23.750 1.00 103.31 ? 303  LYS A N    1 
ATOM   2134 C  CA   . LYS A 1 269 ? 84.683  74.202 -23.653 1.00 100.59 ? 303  LYS A CA   1 
ATOM   2135 C  C    . LYS A 1 269 ? 84.511  74.568 -22.157 1.00 97.63  ? 303  LYS A C    1 
ATOM   2136 O  O    . LYS A 1 269 ? 84.145  75.690 -21.817 1.00 97.07  ? 303  LYS A O    1 
ATOM   2137 C  CB   . LYS A 1 269 ? 83.418  74.559 -24.413 1.00 103.35 ? 303  LYS A CB   1 
ATOM   2138 C  CG   . LYS A 1 269 ? 83.083  76.080 -24.481 1.00 107.70 ? 303  LYS A CG   1 
ATOM   2139 C  CD   . LYS A 1 269 ? 81.572  76.360 -24.881 1.00 109.17 ? 303  LYS A CD   1 
ATOM   2140 C  CE   . LYS A 1 269 ? 81.310  77.848 -25.190 1.00 109.38 ? 303  LYS A CE   1 
ATOM   2141 N  NZ   . LYS A 1 269 ? 81.883  78.314 -26.517 1.00 110.29 ? 303  LYS A NZ   1 
ATOM   2142 N  N    . VAL A 1 270 ? 84.766  73.609 -21.267 1.00 94.30  ? 304  VAL A N    1 
ATOM   2143 C  CA   . VAL A 1 270 ? 84.640  73.824 -19.825 1.00 90.77  ? 304  VAL A CA   1 
ATOM   2144 C  C    . VAL A 1 270 ? 85.957  74.260 -19.204 1.00 90.14  ? 304  VAL A C    1 
ATOM   2145 O  O    . VAL A 1 270 ? 85.997  75.217 -18.434 1.00 89.88  ? 304  VAL A O    1 
ATOM   2146 C  CB   . VAL A 1 270 ? 84.230  72.529 -19.069 1.00 89.62  ? 304  VAL A CB   1 
ATOM   2147 C  CG1  . VAL A 1 270 ? 84.066  72.817 -17.602 1.00 87.77  ? 304  VAL A CG1  1 
ATOM   2148 C  CG2  . VAL A 1 270 ? 82.993  71.945 -19.647 1.00 86.47  ? 304  VAL A CG2  1 
ATOM   2149 N  N    . PHE A 1 271 ? 87.032  73.554 -19.543 1.00 88.49  ? 305  PHE A N    1 
ATOM   2150 C  CA   . PHE A 1 271 ? 88.330  73.856 -18.975 1.00 88.15  ? 305  PHE A CA   1 
ATOM   2151 C  C    . PHE A 1 271 ? 89.226  74.736 -19.855 1.00 90.39  ? 305  PHE A C    1 
ATOM   2152 O  O    . PHE A 1 271 ? 88.952  74.885 -21.049 1.00 91.05  ? 305  PHE A O    1 
ATOM   2153 C  CB   . PHE A 1 271 ? 89.024  72.552 -18.706 1.00 84.67  ? 305  PHE A CB   1 
ATOM   2154 C  CG   . PHE A 1 271 ? 88.182  71.575 -17.974 1.00 81.57  ? 305  PHE A CG   1 
ATOM   2155 C  CD1  . PHE A 1 271 ? 88.119  71.600 -16.581 1.00 79.58  ? 305  PHE A CD1  1 
ATOM   2156 C  CD2  . PHE A 1 271 ? 87.496  70.593 -18.662 1.00 79.10  ? 305  PHE A CD2  1 
ATOM   2157 C  CE1  . PHE A 1 271 ? 87.394  70.650 -15.910 1.00 78.24  ? 305  PHE A CE1  1 
ATOM   2158 C  CE2  . PHE A 1 271 ? 86.752  69.625 -17.975 1.00 76.79  ? 305  PHE A CE2  1 
ATOM   2159 C  CZ   . PHE A 1 271 ? 86.707  69.654 -16.610 1.00 76.57  ? 305  PHE A CZ   1 
ATOM   2160 N  N    . ARG A 1 272 ? 90.306  75.288 -19.278 1.00 92.40  ? 306  ARG A N    1 
ATOM   2161 C  CA   . ARG A 1 272 ? 91.270  76.118 -20.016 1.00 94.31  ? 306  ARG A CA   1 
ATOM   2162 C  C    . ARG A 1 272 ? 91.723  75.320 -21.211 1.00 95.37  ? 306  ARG A C    1 
ATOM   2163 O  O    . ARG A 1 272 ? 91.585  74.092 -21.240 1.00 96.01  ? 306  ARG A O    1 
ATOM   2164 C  CB   . ARG A 1 272 ? 92.492  76.410 -19.164 1.00 96.66  ? 306  ARG A CB   1 
ATOM   2165 C  CG   . ARG A 1 272 ? 92.236  76.118 -17.689 1.00 101.67 ? 306  ARG A CG   1 
ATOM   2166 C  CD   . ARG A 1 272 ? 93.435  76.462 -16.801 1.00 104.22 ? 306  ARG A CD   1 
ATOM   2167 N  NE   . ARG A 1 272 ? 93.144  77.602 -15.921 1.00 106.98 ? 306  ARG A NE   1 
ATOM   2168 C  CZ   . ARG A 1 272 ? 92.887  78.850 -16.340 1.00 108.18 ? 306  ARG A CZ   1 
ATOM   2169 N  NH1  . ARG A 1 272 ? 92.879  79.131 -17.650 1.00 108.15 ? 306  ARG A NH1  1 
ATOM   2170 N  NH2  . ARG A 1 272 ? 92.652  79.828 -15.449 1.00 108.15 ? 306  ARG A NH2  1 
ATOM   2171 N  N    . PRO A 1 273 ? 92.312  75.982 -22.210 1.00 96.05  ? 307  PRO A N    1 
ATOM   2172 C  CA   . PRO A 1 273 ? 92.800  75.349 -23.446 1.00 96.35  ? 307  PRO A CA   1 
ATOM   2173 C  C    . PRO A 1 273 ? 93.874  74.272 -23.277 1.00 96.53  ? 307  PRO A C    1 
ATOM   2174 O  O    . PRO A 1 273 ? 93.835  73.212 -23.910 1.00 94.89  ? 307  PRO A O    1 
ATOM   2175 C  CB   . PRO A 1 273 ? 93.300  76.531 -24.236 1.00 96.05  ? 307  PRO A CB   1 
ATOM   2176 C  CG   . PRO A 1 273 ? 92.377  77.618 -23.781 1.00 95.84  ? 307  PRO A CG   1 
ATOM   2177 C  CD   . PRO A 1 273 ? 92.455  77.433 -22.304 1.00 95.68  ? 307  PRO A CD   1 
ATOM   2178 N  N    . ARG A 1 274 ? 94.821  74.568 -22.400 1.00 97.64  ? 308  ARG A N    1 
ATOM   2179 C  CA   . ARG A 1 274 ? 95.923  73.643 -22.144 1.00 98.48  ? 308  ARG A CA   1 
ATOM   2180 C  C    . ARG A 1 274 ? 95.512  72.374 -21.374 1.00 95.76  ? 308  ARG A C    1 
ATOM   2181 O  O    . ARG A 1 274 ? 96.343  71.472 -21.192 1.00 96.32  ? 308  ARG A O    1 
ATOM   2182 C  CB   . ARG A 1 274 ? 97.054  74.359 -21.344 1.00 103.16 ? 308  ARG A CB   1 
ATOM   2183 C  CG   . ARG A 1 274 ? 97.789  75.548 -22.074 1.00 107.92 ? 308  ARG A CG   1 
ATOM   2184 C  CD   . ARG A 1 274 ? 98.451  75.129 -23.416 1.00 110.38 ? 308  ARG A CD   1 
ATOM   2185 N  NE   . ARG A 1 274 ? 98.832  76.292 -24.239 1.00 113.69 ? 308  ARG A NE   1 
ATOM   2186 C  CZ   . ARG A 1 274 ? 97.986  77.088 -24.917 1.00 115.15 ? 308  ARG A CZ   1 
ATOM   2187 N  NH1  . ARG A 1 274 ? 96.671  76.878 -24.891 1.00 115.25 ? 308  ARG A NH1  1 
ATOM   2188 N  NH2  . ARG A 1 274 ? 98.466  78.098 -25.653 1.00 116.53 ? 308  ARG A NH2  1 
ATOM   2189 N  N    . THR A 1 275 ? 94.262  72.301 -20.911 1.00 91.63  ? 309  THR A N    1 
ATOM   2190 C  CA   . THR A 1 275 ? 93.811  71.139 -20.147 1.00 86.87  ? 309  THR A CA   1 
ATOM   2191 C  C    . THR A 1 275 ? 93.942  69.818 -20.912 1.00 84.61  ? 309  THR A C    1 
ATOM   2192 O  O    . THR A 1 275 ? 93.355  69.636 -21.999 1.00 84.14  ? 309  THR A O    1 
ATOM   2193 C  CB   . THR A 1 275 ? 92.362  71.334 -19.695 1.00 86.14  ? 309  THR A CB   1 
ATOM   2194 O  OG1  . THR A 1 275 ? 92.270  72.559 -18.963 1.00 84.13  ? 309  THR A OG1  1 
ATOM   2195 C  CG2  . THR A 1 275 ? 91.889  70.162 -18.830 1.00 84.11  ? 309  THR A CG2  1 
ATOM   2196 N  N    . PRO A 1 276 ? 94.734  68.875 -20.356 1.00 81.90  ? 310  PRO A N    1 
ATOM   2197 C  CA   . PRO A 1 276 ? 94.997  67.542 -20.922 1.00 80.17  ? 310  PRO A CA   1 
ATOM   2198 C  C    . PRO A 1 276 ? 93.727  66.793 -21.236 1.00 80.33  ? 310  PRO A C    1 
ATOM   2199 O  O    . PRO A 1 276 ? 92.845  66.612 -20.391 1.00 80.93  ? 310  PRO A O    1 
ATOM   2200 C  CB   . PRO A 1 276 ? 95.757  66.822 -19.827 1.00 78.19  ? 310  PRO A CB   1 
ATOM   2201 C  CG   . PRO A 1 276 ? 96.418  67.890 -19.126 1.00 78.89  ? 310  PRO A CG   1 
ATOM   2202 C  CD   . PRO A 1 276 ? 95.434  69.033 -19.072 1.00 79.80  ? 310  PRO A CD   1 
ATOM   2203 N  N    . PRO A 1 277 ? 93.604  66.342 -22.474 1.00 80.40  ? 311  PRO A N    1 
ATOM   2204 C  CA   . PRO A 1 277 ? 92.467  65.583 -23.012 1.00 78.95  ? 311  PRO A CA   1 
ATOM   2205 C  C    . PRO A 1 277 ? 91.988  64.477 -22.098 1.00 77.57  ? 311  PRO A C    1 
ATOM   2206 O  O    . PRO A 1 277 ? 90.791  64.300 -21.906 1.00 76.86  ? 311  PRO A O    1 
ATOM   2207 C  CB   . PRO A 1 277 ? 93.032  65.037 -24.303 1.00 78.12  ? 311  PRO A CB   1 
ATOM   2208 C  CG   . PRO A 1 277 ? 93.811  66.216 -24.770 1.00 79.50  ? 311  PRO A CG   1 
ATOM   2209 C  CD   . PRO A 1 277 ? 94.570  66.657 -23.536 1.00 79.64  ? 311  PRO A CD   1 
ATOM   2210 N  N    . GLU A 1 278 ? 92.941  63.728 -21.562 1.00 76.51  ? 312  GLU A N    1 
ATOM   2211 C  CA   . GLU A 1 278 ? 92.652  62.624 -20.685 1.00 76.64  ? 312  GLU A CA   1 
ATOM   2212 C  C    . GLU A 1 278 ? 92.023  63.067 -19.362 1.00 75.22  ? 312  GLU A C    1 
ATOM   2213 O  O    . GLU A 1 278 ? 91.167  62.351 -18.811 1.00 74.96  ? 312  GLU A O    1 
ATOM   2214 C  CB   . GLU A 1 278 ? 93.938  61.847 -20.445 1.00 80.26  ? 312  GLU A CB   1 
ATOM   2215 C  CG   . GLU A 1 278 ? 94.359  61.088 -21.638 1.00 85.16  ? 312  GLU A CG   1 
ATOM   2216 C  CD   . GLU A 1 278 ? 93.421  59.911 -21.910 1.00 89.69  ? 312  GLU A CD   1 
ATOM   2217 O  OE1  . GLU A 1 278 ? 92.172  60.092 -21.916 1.00 91.55  ? 312  GLU A OE1  1 
ATOM   2218 O  OE2  . GLU A 1 278 ? 93.946  58.790 -22.130 1.00 92.82  ? 312  GLU A OE2  1 
ATOM   2219 N  N    . ALA A 1 279 ? 92.431  64.235 -18.855 1.00 72.64  ? 313  ALA A N    1 
ATOM   2220 C  CA   . ALA A 1 279 ? 91.872  64.746 -17.612 1.00 70.63  ? 313  ALA A CA   1 
ATOM   2221 C  C    . ALA A 1 279 ? 90.379  64.995 -17.884 1.00 69.77  ? 313  ALA A C    1 
ATOM   2222 O  O    . ALA A 1 279 ? 89.497  64.587 -17.095 1.00 70.95  ? 313  ALA A O    1 
ATOM   2223 C  CB   . ALA A 1 279 ? 92.575  66.028 -17.177 1.00 68.55  ? 313  ALA A CB   1 
ATOM   2224 N  N    . ILE A 1 280 ? 90.069  65.651 -18.994 1.00 66.53  ? 314  ILE A N    1 
ATOM   2225 C  CA   . ILE A 1 280 ? 88.680  65.856 -19.314 1.00 63.78  ? 314  ILE A CA   1 
ATOM   2226 C  C    . ILE A 1 280 ? 87.985  64.497 -19.528 1.00 62.55  ? 314  ILE A C    1 
ATOM   2227 O  O    . ILE A 1 280 ? 86.841  64.320 -19.111 1.00 62.56  ? 314  ILE A O    1 
ATOM   2228 C  CB   . ILE A 1 280 ? 88.524  66.640 -20.569 1.00 64.05  ? 314  ILE A CB   1 
ATOM   2229 C  CG1  . ILE A 1 280 ? 89.356  67.908 -20.442 1.00 64.50  ? 314  ILE A CG1  1 
ATOM   2230 C  CG2  . ILE A 1 280 ? 87.046  66.878 -20.860 1.00 62.55  ? 314  ILE A CG2  1 
ATOM   2231 C  CD1  . ILE A 1 280 ? 89.099  68.841 -21.557 1.00 65.59  ? 314  ILE A CD1  1 
ATOM   2232 N  N    . ALA A 1 281 ? 88.641  63.533 -20.167 1.00 58.98  ? 315  ALA A N    1 
ATOM   2233 C  CA   . ALA A 1 281 ? 87.980  62.259 -20.360 1.00 57.95  ? 315  ALA A CA   1 
ATOM   2234 C  C    . ALA A 1 281 ? 87.544  61.632 -19.026 1.00 58.15  ? 315  ALA A C    1 
ATOM   2235 O  O    . ALA A 1 281 ? 86.381  61.231 -18.869 1.00 57.49  ? 315  ALA A O    1 
ATOM   2236 C  CB   . ALA A 1 281 ? 88.866  61.306 -21.114 1.00 58.46  ? 315  ALA A CB   1 
ATOM   2237 N  N    . LEU A 1 282 ? 88.489  61.547 -18.079 1.00 57.69  ? 316  LEU A N    1 
ATOM   2238 C  CA   . LEU A 1 282 ? 88.234  61.009 -16.737 1.00 56.59  ? 316  LEU A CA   1 
ATOM   2239 C  C    . LEU A 1 282 ? 87.048  61.725 -16.103 1.00 57.27  ? 316  LEU A C    1 
ATOM   2240 O  O    . LEU A 1 282 ? 86.186  61.094 -15.513 1.00 57.32  ? 316  LEU A O    1 
ATOM   2241 C  CB   . LEU A 1 282 ? 89.436  61.222 -15.852 1.00 54.49  ? 316  LEU A CB   1 
ATOM   2242 C  CG   . LEU A 1 282 ? 89.848  60.168 -14.847 1.00 54.19  ? 316  LEU A CG   1 
ATOM   2243 C  CD1  . LEU A 1 282 ? 90.445  60.906 -13.659 1.00 53.26  ? 316  LEU A CD1  1 
ATOM   2244 C  CD2  . LEU A 1 282 ? 88.703  59.232 -14.480 1.00 52.97  ? 316  LEU A CD2  1 
ATOM   2245 N  N    . CYS A 1 283 ? 86.994  63.051 -16.207 1.00 58.25  ? 317  CYS A N    1 
ATOM   2246 C  CA   . CYS A 1 283 ? 85.867  63.763 -15.623 1.00 60.51  ? 317  CYS A CA   1 
ATOM   2247 C  C    . CYS A 1 283 ? 84.530  63.285 -16.146 1.00 61.41  ? 317  CYS A C    1 
ATOM   2248 O  O    . CYS A 1 283 ? 83.598  63.095 -15.370 1.00 62.82  ? 317  CYS A O    1 
ATOM   2249 C  CB   . CYS A 1 283 ? 85.942  65.254 -15.869 1.00 61.14  ? 317  CYS A CB   1 
ATOM   2250 S  SG   . CYS A 1 283 ? 87.057  66.050 -14.788 1.00 68.09  ? 317  CYS A SG   1 
ATOM   2251 N  N    . SER A 1 284 ? 84.423  63.091 -17.457 1.00 60.93  ? 318  SER A N    1 
ATOM   2252 C  CA   . SER A 1 284 ? 83.178  62.651 -18.053 1.00 59.77  ? 318  SER A CA   1 
ATOM   2253 C  C    . SER A 1 284 ? 82.826  61.317 -17.598 1.00 59.11  ? 318  SER A C    1 
ATOM   2254 O  O    . SER A 1 284 ? 81.651  60.984 -17.558 1.00 60.20  ? 318  SER A O    1 
ATOM   2255 C  CB   . SER A 1 284 ? 83.308  62.526 -19.524 1.00 60.68  ? 318  SER A CB   1 
ATOM   2256 O  OG   . SER A 1 284 ? 84.203  63.514 -19.935 1.00 66.07  ? 318  SER A OG   1 
ATOM   2257 N  N    . ARG A 1 285 ? 83.839  60.519 -17.306 1.00 57.98  ? 319  ARG A N    1 
ATOM   2258 C  CA   . ARG A 1 285 ? 83.575  59.168 -16.923 1.00 58.26  ? 319  ARG A CA   1 
ATOM   2259 C  C    . ARG A 1 285 ? 83.214  59.083 -15.451 1.00 58.30  ? 319  ARG A C    1 
ATOM   2260 O  O    . ARG A 1 285 ? 82.614  58.075 -14.989 1.00 59.98  ? 319  ARG A O    1 
ATOM   2261 C  CB   . ARG A 1 285 ? 84.770  58.273 -17.329 1.00 59.44  ? 319  ARG A CB   1 
ATOM   2262 C  CG   . ARG A 1 285 ? 84.985  58.089 -18.902 1.00 64.69  ? 319  ARG A CG   1 
ATOM   2263 C  CD   . ARG A 1 285 ? 83.673  57.904 -19.825 1.00 67.39  ? 319  ARG A CD   1 
ATOM   2264 N  NE   . ARG A 1 285 ? 82.614  57.298 -19.025 1.00 72.25  ? 319  ARG A NE   1 
ATOM   2265 C  CZ   . ARG A 1 285 ? 82.783  56.158 -18.332 1.00 76.57  ? 319  ARG A CZ   1 
ATOM   2266 N  NH1  . ARG A 1 285 ? 83.955  55.505 -18.390 1.00 77.84  ? 319  ARG A NH1  1 
ATOM   2267 N  NH2  . ARG A 1 285 ? 81.842  55.717 -17.486 1.00 75.33  ? 319  ARG A NH2  1 
ATOM   2268 N  N    . LEU A 1 286 ? 83.520  60.167 -14.724 1.00 56.97  ? 320  LEU A N    1 
ATOM   2269 C  CA   . LEU A 1 286 ? 83.249  60.313 -13.289 1.00 54.94  ? 320  LEU A CA   1 
ATOM   2270 C  C    . LEU A 1 286 ? 81.895  61.063 -13.066 1.00 54.09  ? 320  LEU A C    1 
ATOM   2271 O  O    . LEU A 1 286 ? 81.026  60.588 -12.361 1.00 52.72  ? 320  LEU A O    1 
ATOM   2272 C  CB   . LEU A 1 286 ? 84.438  61.042 -12.645 1.00 54.53  ? 320  LEU A CB   1 
ATOM   2273 C  CG   . LEU A 1 286 ? 85.638  60.323 -11.968 1.00 54.13  ? 320  LEU A CG   1 
ATOM   2274 C  CD1  . LEU A 1 286 ? 85.697  58.897 -12.308 1.00 51.75  ? 320  LEU A CD1  1 
ATOM   2275 C  CD2  . LEU A 1 286 ? 86.925  61.011 -12.311 1.00 52.48  ? 320  LEU A CD2  1 
ATOM   2276 N  N    . LEU A 1 287 ? 81.686  62.213 -13.694 1.00 54.07  ? 321  LEU A N    1 
ATOM   2277 C  CA   . LEU A 1 287 ? 80.426  62.942 -13.525 1.00 54.47  ? 321  LEU A CA   1 
ATOM   2278 C  C    . LEU A 1 287 ? 79.322  62.461 -14.478 1.00 56.34  ? 321  LEU A C    1 
ATOM   2279 O  O    . LEU A 1 287 ? 79.009  63.095 -15.457 1.00 56.82  ? 321  LEU A O    1 
ATOM   2280 C  CB   . LEU A 1 287 ? 80.657  64.431 -13.722 1.00 51.80  ? 321  LEU A CB   1 
ATOM   2281 C  CG   . LEU A 1 287 ? 81.849  64.861 -12.864 1.00 50.12  ? 321  LEU A CG   1 
ATOM   2282 C  CD1  . LEU A 1 287 ? 82.218  66.330 -13.083 1.00 49.40  ? 321  LEU A CD1  1 
ATOM   2283 C  CD2  . LEU A 1 287 ? 81.511  64.617 -11.442 1.00 49.84  ? 321  LEU A CD2  1 
ATOM   2284 N  N    . GLU A 1 288 ? 78.730  61.331 -14.152 1.00 58.39  ? 322  GLU A N    1 
ATOM   2285 C  CA   . GLU A 1 288 ? 77.650  60.751 -14.935 1.00 59.99  ? 322  GLU A CA   1 
ATOM   2286 C  C    . GLU A 1 288 ? 76.283  60.781 -14.216 1.00 58.79  ? 322  GLU A C    1 
ATOM   2287 O  O    . GLU A 1 288 ? 76.181  60.382 -13.060 1.00 58.95  ? 322  GLU A O    1 
ATOM   2288 C  CB   . GLU A 1 288 ? 77.938  59.262 -15.154 1.00 65.33  ? 322  GLU A CB   1 
ATOM   2289 C  CG   . GLU A 1 288 ? 79.135  58.912 -15.976 1.00 71.28  ? 322  GLU A CG   1 
ATOM   2290 C  CD   . GLU A 1 288 ? 78.887  59.098 -17.477 1.00 74.43  ? 322  GLU A CD   1 
ATOM   2291 O  OE1  . GLU A 1 288 ? 79.546  58.347 -18.259 1.00 77.28  ? 322  GLU A OE1  1 
ATOM   2292 O  OE2  . GLU A 1 288 ? 78.065  59.983 -17.856 1.00 74.60  ? 322  GLU A OE2  1 
ATOM   2293 N  N    . TYR A 1 289 ? 75.212  61.193 -14.866 1.00 57.88  ? 323  TYR A N    1 
ATOM   2294 C  CA   . TYR A 1 289 ? 73.929  61.154 -14.179 1.00 57.04  ? 323  TYR A CA   1 
ATOM   2295 C  C    . TYR A 1 289 ? 73.677  59.766 -13.624 1.00 56.58  ? 323  TYR A C    1 
ATOM   2296 O  O    . TYR A 1 289 ? 73.492  59.619 -12.445 1.00 56.23  ? 323  TYR A O    1 
ATOM   2297 C  CB   . TYR A 1 289 ? 72.767  61.475 -15.103 1.00 58.01  ? 323  TYR A CB   1 
ATOM   2298 C  CG   . TYR A 1 289 ? 72.629  62.946 -15.377 1.00 61.45  ? 323  TYR A CG   1 
ATOM   2299 C  CD1  . TYR A 1 289 ? 72.771  63.447 -16.683 1.00 61.38  ? 323  TYR A CD1  1 
ATOM   2300 C  CD2  . TYR A 1 289 ? 72.395  63.852 -14.331 1.00 61.25  ? 323  TYR A CD2  1 
ATOM   2301 C  CE1  . TYR A 1 289 ? 72.687  64.813 -16.945 1.00 62.87  ? 323  TYR A CE1  1 
ATOM   2302 C  CE2  . TYR A 1 289 ? 72.312  65.229 -14.571 1.00 62.75  ? 323  TYR A CE2  1 
ATOM   2303 C  CZ   . TYR A 1 289 ? 72.459  65.714 -15.885 1.00 64.09  ? 323  TYR A CZ   1 
ATOM   2304 O  OH   . TYR A 1 289 ? 72.382  67.094 -16.133 1.00 65.37  ? 323  TYR A OH   1 
ATOM   2305 N  N    . THR A 1 290 ? 73.661  58.728 -14.461 1.00 57.51  ? 324  THR A N    1 
ATOM   2306 C  CA   . THR A 1 290 ? 73.361  57.376 -13.970 1.00 56.75  ? 324  THR A CA   1 
ATOM   2307 C  C    . THR A 1 290 ? 74.449  56.929 -13.026 1.00 57.16  ? 324  THR A C    1 
ATOM   2308 O  O    . THR A 1 290 ? 75.623  56.795 -13.404 1.00 57.20  ? 324  THR A O    1 
ATOM   2309 C  CB   . THR A 1 290 ? 73.188  56.414 -15.132 1.00 56.51  ? 324  THR A CB   1 
ATOM   2310 O  OG1  . THR A 1 290 ? 72.064  56.835 -15.896 1.00 56.13  ? 324  THR A OG1  1 
ATOM   2311 C  CG2  . THR A 1 290 ? 72.944  55.005 -14.616 1.00 56.47  ? 324  THR A CG2  1 
ATOM   2312 N  N    . PRO A 1 291 ? 74.086  56.695 -11.763 1.00 57.35  ? 325  PRO A N    1 
ATOM   2313 C  CA   . PRO A 1 291 ? 75.209  56.301 -10.918 1.00 58.47  ? 325  PRO A CA   1 
ATOM   2314 C  C    . PRO A 1 291 ? 76.013  55.093 -11.242 1.00 60.85  ? 325  PRO A C    1 
ATOM   2315 O  O    . PRO A 1 291 ? 77.245  55.141 -11.104 1.00 63.55  ? 325  PRO A O    1 
ATOM   2316 C  CB   . PRO A 1 291 ? 74.633  56.276 -9.513  1.00 56.91  ? 325  PRO A CB   1 
ATOM   2317 C  CG   . PRO A 1 291 ? 73.158  56.475 -9.681  1.00 58.18  ? 325  PRO A CG   1 
ATOM   2318 C  CD   . PRO A 1 291 ? 72.992  57.244 -10.956 1.00 56.99  ? 325  PRO A CD   1 
ATOM   2319 N  N    . THR A 1 292 ? 75.375  54.005 -11.683 1.00 61.79  ? 326  THR A N    1 
ATOM   2320 C  CA   . THR A 1 292 ? 76.150  52.788 -12.034 1.00 59.63  ? 326  THR A CA   1 
ATOM   2321 C  C    . THR A 1 292 ? 77.012  53.039 -13.275 1.00 57.87  ? 326  THR A C    1 
ATOM   2322 O  O    . THR A 1 292 ? 77.879  52.270 -13.567 1.00 58.55  ? 326  THR A O    1 
ATOM   2323 C  CB   . THR A 1 292 ? 75.274  51.643 -12.380 1.00 59.69  ? 326  THR A CB   1 
ATOM   2324 O  OG1  . THR A 1 292 ? 74.460  52.038 -13.505 1.00 60.74  ? 326  THR A OG1  1 
ATOM   2325 C  CG2  . THR A 1 292 ? 74.386  51.259 -11.215 1.00 57.14  ? 326  THR A CG2  1 
ATOM   2326 N  N    . ALA A 1 293 ? 76.775  54.086 -14.040 1.00 55.97  ? 327  ALA A N    1 
ATOM   2327 C  CA   . ALA A 1 293 ? 77.603  54.309 -15.209 1.00 56.11  ? 327  ALA A CA   1 
ATOM   2328 C  C    . ALA A 1 293 ? 78.864  55.038 -14.866 1.00 57.38  ? 327  ALA A C    1 
ATOM   2329 O  O    . ALA A 1 293 ? 79.642  55.365 -15.777 1.00 59.73  ? 327  ALA A O    1 
ATOM   2330 C  CB   . ALA A 1 293 ? 76.866  55.128 -16.229 1.00 56.50  ? 327  ALA A CB   1 
ATOM   2331 N  N    . ARG A 1 294 ? 79.094  55.332 -13.582 1.00 55.87  ? 328  ARG A N    1 
ATOM   2332 C  CA   . ARG A 1 294 ? 80.301  56.092 -13.229 1.00 52.64  ? 328  ARG A CA   1 
ATOM   2333 C  C    . ARG A 1 294 ? 81.398  55.094 -13.045 1.00 52.25  ? 328  ARG A C    1 
ATOM   2334 O  O    . ARG A 1 294 ? 81.156  54.003 -12.475 1.00 51.46  ? 328  ARG A O    1 
ATOM   2335 C  CB   . ARG A 1 294 ? 80.102  56.838 -11.919 1.00 51.90  ? 328  ARG A CB   1 
ATOM   2336 C  CG   . ARG A 1 294 ? 79.073  57.920 -11.976 1.00 50.98  ? 328  ARG A CG   1 
ATOM   2337 C  CD   . ARG A 1 294 ? 78.754  58.503 -10.635 1.00 47.34  ? 328  ARG A CD   1 
ATOM   2338 N  NE   . ARG A 1 294 ? 77.529  59.276 -10.738 1.00 46.33  ? 328  ARG A NE   1 
ATOM   2339 C  CZ   . ARG A 1 294 ? 76.671  59.467 -9.745  1.00 47.53  ? 328  ARG A CZ   1 
ATOM   2340 N  NH1  . ARG A 1 294 ? 76.915  58.937 -8.536  1.00 47.33  ? 328  ARG A NH1  1 
ATOM   2341 N  NH2  . ARG A 1 294 ? 75.558  60.156 -9.975  1.00 46.38  ? 328  ARG A NH2  1 
ATOM   2342 N  N    . LEU A 1 295 ? 82.607  55.440 -13.490 1.00 49.99  ? 329  LEU A N    1 
ATOM   2343 C  CA   . LEU A 1 295 ? 83.739  54.527 -13.305 1.00 49.70  ? 329  LEU A CA   1 
ATOM   2344 C  C    . LEU A 1 295 ? 83.821  54.080 -11.853 1.00 51.63  ? 329  LEU A C    1 
ATOM   2345 O  O    . LEU A 1 295 ? 83.425  54.814 -10.935 1.00 53.83  ? 329  LEU A O    1 
ATOM   2346 C  CB   . LEU A 1 295 ? 85.012  55.258 -13.604 1.00 48.36  ? 329  LEU A CB   1 
ATOM   2347 C  CG   . LEU A 1 295 ? 85.894  54.943 -14.785 1.00 50.10  ? 329  LEU A CG   1 
ATOM   2348 C  CD1  . LEU A 1 295 ? 85.132  54.297 -15.895 1.00 49.85  ? 329  LEU A CD1  1 
ATOM   2349 C  CD2  . LEU A 1 295 ? 86.482  56.250 -15.247 1.00 49.03  ? 329  LEU A CD2  1 
ATOM   2350 N  N    . THR A 1 296 ? 84.334  52.906 -11.555 1.00 51.99  ? 330  THR A N    1 
ATOM   2351 C  CA   . THR A 1 296 ? 84.498  52.591 -10.144 1.00 52.04  ? 330  THR A CA   1 
ATOM   2352 C  C    . THR A 1 296 ? 85.842  53.250 -9.723  1.00 53.13  ? 330  THR A C    1 
ATOM   2353 O  O    . THR A 1 296 ? 86.641  53.677 -10.599 1.00 50.83  ? 330  THR A O    1 
ATOM   2354 C  CB   . THR A 1 296 ? 84.694  51.124 -9.909  1.00 52.56  ? 330  THR A CB   1 
ATOM   2355 O  OG1  . THR A 1 296 ? 85.917  50.696 -10.572 1.00 52.83  ? 330  THR A OG1  1 
ATOM   2356 C  CG2  . THR A 1 296 ? 83.560  50.402 -10.402 1.00 51.26  ? 330  THR A CG2  1 
ATOM   2357 N  N    . PRO A 1 297 ? 86.104  53.331 -8.379  1.00 54.14  ? 331  PRO A N    1 
ATOM   2358 C  CA   . PRO A 1 297 ? 87.370  53.937 -7.974  1.00 54.10  ? 331  PRO A CA   1 
ATOM   2359 C  C    . PRO A 1 297 ? 88.588  53.195 -8.538  1.00 55.11  ? 331  PRO A C    1 
ATOM   2360 O  O    . PRO A 1 297 ? 89.523  53.834 -9.062  1.00 55.11  ? 331  PRO A O    1 
ATOM   2361 C  CB   . PRO A 1 297 ? 87.313  53.923 -6.439  1.00 52.81  ? 331  PRO A CB   1 
ATOM   2362 C  CG   . PRO A 1 297 ? 86.116  53.075 -6.114  1.00 52.70  ? 331  PRO A CG   1 
ATOM   2363 C  CD   . PRO A 1 297 ? 85.184  53.282 -7.227  1.00 53.41  ? 331  PRO A CD   1 
ATOM   2364 N  N    . LEU A 1 298 ? 88.596  51.867 -8.476  1.00 55.49  ? 332  LEU A N    1 
ATOM   2365 C  CA   . LEU A 1 298 ? 89.751  51.163 -9.019  1.00 56.77  ? 332  LEU A CA   1 
ATOM   2366 C  C    . LEU A 1 298 ? 89.928  51.363 -10.551 1.00 57.91  ? 332  LEU A C    1 
ATOM   2367 O  O    . LEU A 1 298 ? 91.058  51.475 -11.079 1.00 56.61  ? 332  LEU A O    1 
ATOM   2368 C  CB   . LEU A 1 298 ? 89.616  49.699 -8.674  1.00 57.35  ? 332  LEU A CB   1 
ATOM   2369 C  CG   . LEU A 1 298 ? 90.890  49.031 -8.212  1.00 57.53  ? 332  LEU A CG   1 
ATOM   2370 C  CD1  . LEU A 1 298 ? 91.700  49.917 -7.253  1.00 54.72  ? 332  LEU A CD1  1 
ATOM   2371 C  CD2  . LEU A 1 298 ? 90.425  47.706 -7.587  1.00 57.46  ? 332  LEU A CD2  1 
ATOM   2372 N  N    . GLU A 1 299 ? 88.810  51.416 -11.277 1.00 58.80  ? 333  GLU A N    1 
ATOM   2373 C  CA   . GLU A 1 299 ? 88.887  51.626 -12.712 1.00 59.55  ? 333  GLU A CA   1 
ATOM   2374 C  C    . GLU A 1 299 ? 89.439  53.000 -12.994 1.00 59.59  ? 333  GLU A C    1 
ATOM   2375 O  O    . GLU A 1 299 ? 90.066  53.212 -14.042 1.00 60.44  ? 333  GLU A O    1 
ATOM   2376 C  CB   . GLU A 1 299 ? 87.522  51.513 -13.345 1.00 61.00  ? 333  GLU A CB   1 
ATOM   2377 C  CG   . GLU A 1 299 ? 86.909  50.166 -13.222 1.00 63.95  ? 333  GLU A CG   1 
ATOM   2378 C  CD   . GLU A 1 299 ? 85.524  50.163 -13.804 1.00 66.20  ? 333  GLU A CD   1 
ATOM   2379 O  OE1  . GLU A 1 299 ? 84.991  49.062 -14.068 1.00 67.24  ? 333  GLU A OE1  1 
ATOM   2380 O  OE2  . GLU A 1 299 ? 84.977  51.278 -13.998 1.00 67.81  ? 333  GLU A OE2  1 
ATOM   2381 N  N    . ALA A 1 300 ? 89.184  53.943 -12.073 1.00 59.66  ? 334  ALA A N    1 
ATOM   2382 C  CA   . ALA A 1 300 ? 89.671  55.332 -12.182 1.00 58.55  ? 334  ALA A CA   1 
ATOM   2383 C  C    . ALA A 1 300 ? 91.179  55.309 -12.049 1.00 58.68  ? 334  ALA A C    1 
ATOM   2384 O  O    . ALA A 1 300 ? 91.878  55.957 -12.834 1.00 59.79  ? 334  ALA A O    1 
ATOM   2385 C  CB   . ALA A 1 300 ? 89.044  56.237 -11.123 1.00 56.19  ? 334  ALA A CB   1 
ATOM   2386 N  N    . CYS A 1 301 ? 91.705  54.550 -11.098 1.00 59.35  ? 335  CYS A N    1 
ATOM   2387 C  CA   . CYS A 1 301 ? 93.154  54.495 -10.975 1.00 61.01  ? 335  CYS A CA   1 
ATOM   2388 C  C    . CYS A 1 301 ? 93.762  53.948 -12.260 1.00 61.39  ? 335  CYS A C    1 
ATOM   2389 O  O    . CYS A 1 301 ? 94.844  54.413 -12.666 1.00 62.02  ? 335  CYS A O    1 
ATOM   2390 C  CB   . CYS A 1 301 ? 93.592  53.619 -9.810  1.00 62.31  ? 335  CYS A CB   1 
ATOM   2391 S  SG   . CYS A 1 301 ? 93.148  54.253 -8.196  1.00 65.65  ? 335  CYS A SG   1 
ATOM   2392 N  N    . ALA A 1 302 ? 93.075  52.982 -12.906 1.00 60.82  ? 336  ALA A N    1 
ATOM   2393 C  CA   . ALA A 1 302 ? 93.552  52.385 -14.176 1.00 58.48  ? 336  ALA A CA   1 
ATOM   2394 C  C    . ALA A 1 302 ? 93.287  53.257 -15.351 1.00 58.22  ? 336  ALA A C    1 
ATOM   2395 O  O    . ALA A 1 302 ? 93.542  52.858 -16.464 1.00 60.78  ? 336  ALA A O    1 
ATOM   2396 C  CB   . ALA A 1 302 ? 92.933  51.032 -14.427 1.00 55.19  ? 336  ALA A CB   1 
ATOM   2397 N  N    . HIS A 1 303 ? 92.787  54.460 -15.172 1.00 59.30  ? 337  HIS A N    1 
ATOM   2398 C  CA   . HIS A 1 303 ? 92.523  55.290 -16.343 1.00 60.53  ? 337  HIS A CA   1 
ATOM   2399 C  C    . HIS A 1 303 ? 93.821  55.867 -16.992 1.00 62.12  ? 337  HIS A C    1 
ATOM   2400 O  O    . HIS A 1 303 ? 94.866  55.998 -16.355 1.00 62.24  ? 337  HIS A O    1 
ATOM   2401 C  CB   . HIS A 1 303 ? 91.531  56.358 -15.934 1.00 59.71  ? 337  HIS A CB   1 
ATOM   2402 C  CG   . HIS A 1 303 ? 91.050  57.199 -17.071 1.00 60.67  ? 337  HIS A CG   1 
ATOM   2403 N  ND1  . HIS A 1 303 ? 91.820  58.189 -17.649 1.00 60.82  ? 337  HIS A ND1  1 
ATOM   2404 C  CD2  . HIS A 1 303 ? 89.836  57.270 -17.671 1.00 61.25  ? 337  HIS A CD2  1 
ATOM   2405 C  CE1  . HIS A 1 303 ? 91.093  58.846 -18.541 1.00 61.55  ? 337  HIS A CE1  1 
ATOM   2406 N  NE2  . HIS A 1 303 ? 89.885  58.308 -18.572 1.00 62.26  ? 337  HIS A NE2  1 
ATOM   2407 N  N    . SER A 1 304 ? 93.778  56.188 -18.274 1.00 64.78  ? 338  SER A N    1 
ATOM   2408 C  CA   . SER A 1 304 ? 94.987  56.690 -18.946 1.00 66.83  ? 338  SER A CA   1 
ATOM   2409 C  C    . SER A 1 304 ? 95.517  57.940 -18.336 1.00 67.84  ? 338  SER A C    1 
ATOM   2410 O  O    . SER A 1 304 ? 96.696  58.184 -18.411 1.00 69.14  ? 338  SER A O    1 
ATOM   2411 C  CB   . SER A 1 304 ? 94.752  57.045 -20.407 1.00 67.32  ? 338  SER A CB   1 
ATOM   2412 O  OG   . SER A 1 304 ? 93.919  56.124 -21.064 1.00 72.13  ? 338  SER A OG   1 
ATOM   2413 N  N    . PHE A 1 305 ? 94.649  58.777 -17.780 1.00 68.49  ? 339  PHE A N    1 
ATOM   2414 C  CA   . PHE A 1 305 ? 95.118  60.027 -17.184 1.00 67.50  ? 339  PHE A CA   1 
ATOM   2415 C  C    . PHE A 1 305 ? 96.240  59.761 -16.185 1.00 67.21  ? 339  PHE A C    1 
ATOM   2416 O  O    . PHE A 1 305 ? 97.143  60.587 -15.987 1.00 64.85  ? 339  PHE A O    1 
ATOM   2417 C  CB   . PHE A 1 305 ? 93.975  60.732 -16.482 1.00 66.42  ? 339  PHE A CB   1 
ATOM   2418 C  CG   . PHE A 1 305 ? 94.383  61.985 -15.784 1.00 65.08  ? 339  PHE A CG   1 
ATOM   2419 C  CD1  . PHE A 1 305 ? 94.875  63.072 -16.505 1.00 62.52  ? 339  PHE A CD1  1 
ATOM   2420 C  CD2  . PHE A 1 305 ? 94.227  62.083 -14.402 1.00 64.06  ? 339  PHE A CD2  1 
ATOM   2421 C  CE1  . PHE A 1 305 ? 95.207  64.259 -15.873 1.00 62.43  ? 339  PHE A CE1  1 
ATOM   2422 C  CE2  . PHE A 1 305 ? 94.554  63.283 -13.736 1.00 64.26  ? 339  PHE A CE2  1 
ATOM   2423 C  CZ   . PHE A 1 305 ? 95.044  64.378 -14.477 1.00 63.98  ? 339  PHE A CZ   1 
ATOM   2424 N  N    . PHE A 1 306 ? 96.180  58.591 -15.571 1.00 67.75  ? 340  PHE A N    1 
ATOM   2425 C  CA   . PHE A 1 306 ? 97.183  58.275 -14.576 1.00 69.99  ? 340  PHE A CA   1 
ATOM   2426 C  C    . PHE A 1 306 ? 98.346  57.461 -15.130 1.00 70.89  ? 340  PHE A C    1 
ATOM   2427 O  O    . PHE A 1 306 ? 99.061  56.810 -14.375 1.00 70.80  ? 340  PHE A O    1 
ATOM   2428 C  CB   . PHE A 1 306 ? 96.534  57.535 -13.378 1.00 70.03  ? 340  PHE A CB   1 
ATOM   2429 C  CG   . PHE A 1 306 ? 95.505  58.349 -12.663 1.00 70.27  ? 340  PHE A CG   1 
ATOM   2430 C  CD1  . PHE A 1 306 ? 95.821  59.600 -12.151 1.00 70.54  ? 340  PHE A CD1  1 
ATOM   2431 C  CD2  . PHE A 1 306 ? 94.209  57.896 -12.556 1.00 70.73  ? 340  PHE A CD2  1 
ATOM   2432 C  CE1  . PHE A 1 306 ? 94.869  60.389 -11.545 1.00 70.66  ? 340  PHE A CE1  1 
ATOM   2433 C  CE2  . PHE A 1 306 ? 93.240  58.672 -11.952 1.00 71.75  ? 340  PHE A CE2  1 
ATOM   2434 C  CZ   . PHE A 1 306 ? 93.569  59.928 -11.442 1.00 71.91  ? 340  PHE A CZ   1 
ATOM   2435 N  N    . ASP A 1 307 ? 98.569  57.517 -16.433 1.00 71.91  ? 341  ASP A N    1 
ATOM   2436 C  CA   . ASP A 1 307 ? 99.666  56.735 -16.980 1.00 72.75  ? 341  ASP A CA   1 
ATOM   2437 C  C    . ASP A 1 307 ? 101.035 57.239 -16.575 1.00 72.67  ? 341  ASP A C    1 
ATOM   2438 O  O    . ASP A 1 307 ? 101.932 56.416 -16.329 1.00 72.66  ? 341  ASP A O    1 
ATOM   2439 C  CB   . ASP A 1 307 ? 99.591  56.650 -18.510 1.00 73.63  ? 341  ASP A CB   1 
ATOM   2440 C  CG   . ASP A 1 307 ? 98.613  55.593 -18.997 1.00 75.34  ? 341  ASP A CG   1 
ATOM   2441 O  OD1  . ASP A 1 307 ? 98.412  54.553 -18.323 1.00 77.77  ? 341  ASP A OD1  1 
ATOM   2442 O  OD2  . ASP A 1 307 ? 98.058  55.797 -20.080 1.00 75.80  ? 341  ASP A OD2  1 
ATOM   2443 N  N    . GLU A 1 308 ? 101.194 58.570 -16.519 1.00 72.02  ? 342  GLU A N    1 
ATOM   2444 C  CA   . GLU A 1 308 ? 102.476 59.176 -16.143 1.00 71.69  ? 342  GLU A CA   1 
ATOM   2445 C  C    . GLU A 1 308 ? 102.920 58.592 -14.821 1.00 72.11  ? 342  GLU A C    1 
ATOM   2446 O  O    . GLU A 1 308 ? 104.081 58.277 -14.635 1.00 73.04  ? 342  GLU A O    1 
ATOM   2447 C  CB   . GLU A 1 308 ? 102.345 60.682 -16.026 1.00 71.37  ? 342  GLU A CB   1 
ATOM   2448 C  CG   . GLU A 1 308 ? 103.645 61.407 -15.849 1.00 71.42  ? 342  GLU A CG   1 
ATOM   2449 C  CD   . GLU A 1 308 ? 103.464 62.945 -15.874 1.00 74.11  ? 342  GLU A CD   1 
ATOM   2450 O  OE1  . GLU A 1 308 ? 102.417 63.463 -16.346 1.00 73.63  ? 342  GLU A OE1  1 
ATOM   2451 O  OE2  . GLU A 1 308 ? 104.382 63.659 -15.421 1.00 75.86  ? 342  GLU A OE2  1 
ATOM   2452 N  N    . LEU A 1 309 ? 102.009 58.423 -13.880 1.00 71.17  ? 343  LEU A N    1 
ATOM   2453 C  CA   . LEU A 1 309 ? 102.425 57.841 -12.630 1.00 71.23  ? 343  LEU A CA   1 
ATOM   2454 C  C    . LEU A 1 309 ? 103.014 56.443 -12.799 1.00 73.01  ? 343  LEU A C    1 
ATOM   2455 O  O    . LEU A 1 309 ? 103.822 56.028 -11.991 1.00 73.71  ? 343  LEU A O    1 
ATOM   2456 C  CB   . LEU A 1 309 ? 101.254 57.746 -11.666 1.00 67.93  ? 343  LEU A CB   1 
ATOM   2457 C  CG   . LEU A 1 309 ? 100.589 59.084 -11.448 1.00 67.10  ? 343  LEU A CG   1 
ATOM   2458 C  CD1  . LEU A 1 309 ? 99.530  58.902 -10.378 1.00 64.57  ? 343  LEU A CD1  1 
ATOM   2459 C  CD2  . LEU A 1 309 ? 101.647 60.141 -11.087 1.00 66.42  ? 343  LEU A CD2  1 
ATOM   2460 N  N    . ARG A 1 310 ? 102.624 55.702 -13.829 1.00 76.14  ? 344  ARG A N    1 
ATOM   2461 C  CA   . ARG A 1 310 ? 103.117 54.317 -13.986 1.00 80.02  ? 344  ARG A CA   1 
ATOM   2462 C  C    . ARG A 1 310 ? 104.474 54.246 -14.707 1.00 84.18  ? 344  ARG A C    1 
ATOM   2463 O  O    . ARG A 1 310 ? 105.198 53.232 -14.682 1.00 83.59  ? 344  ARG A O    1 
ATOM   2464 C  CB   . ARG A 1 310 ? 102.056 53.443 -14.682 1.00 76.71  ? 344  ARG A CB   1 
ATOM   2465 C  CG   . ARG A 1 310 ? 101.048 52.790 -13.723 1.00 74.82  ? 344  ARG A CG   1 
ATOM   2466 C  CD   . ARG A 1 310 ? 99.900  52.094 -14.456 1.00 73.81  ? 344  ARG A CD   1 
ATOM   2467 N  NE   . ARG A 1 310 ? 99.078  53.030 -15.238 1.00 72.61  ? 344  ARG A NE   1 
ATOM   2468 C  CZ   . ARG A 1 310 ? 97.905  53.514 -14.836 1.00 70.35  ? 344  ARG A CZ   1 
ATOM   2469 N  NH1  . ARG A 1 310 ? 97.407  53.143 -13.658 1.00 70.33  ? 344  ARG A NH1  1 
ATOM   2470 N  NH2  . ARG A 1 310 ? 97.238  54.371 -15.601 1.00 67.44  ? 344  ARG A NH2  1 
ATOM   2471 N  N    . ASP A 1 311 ? 104.809 55.373 -15.316 1.00 89.64  ? 345  ASP A N    1 
ATOM   2472 C  CA   . ASP A 1 311 ? 106.053 55.573 -16.028 1.00 94.70  ? 345  ASP A CA   1 
ATOM   2473 C  C    . ASP A 1 311 ? 107.242 55.212 -15.143 1.00 97.58  ? 345  ASP A C    1 
ATOM   2474 O  O    . ASP A 1 311 ? 107.337 55.662 -13.986 1.00 98.88  ? 345  ASP A O    1 
ATOM   2475 C  CB   . ASP A 1 311 ? 106.128 57.028 -16.399 1.00 97.25  ? 345  ASP A CB   1 
ATOM   2476 C  CG   . ASP A 1 311 ? 106.504 57.215 -17.799 1.00 100.28 ? 345  ASP A CG   1 
ATOM   2477 O  OD1  . ASP A 1 311 ? 107.728 57.064 -18.065 1.00 102.48 ? 345  ASP A OD1  1 
ATOM   2478 O  OD2  . ASP A 1 311 ? 105.576 57.482 -18.613 1.00 102.07 ? 345  ASP A OD2  1 
ATOM   2479 N  N    . PRO A 1 312 ? 108.191 54.419 -15.672 1.00 99.28  ? 346  PRO A N    1 
ATOM   2480 C  CA   . PRO A 1 312 ? 109.377 53.990 -14.922 1.00 99.77  ? 346  PRO A CA   1 
ATOM   2481 C  C    . PRO A 1 312 ? 110.265 55.121 -14.424 1.00 100.76 ? 346  PRO A C    1 
ATOM   2482 O  O    . PRO A 1 312 ? 110.857 55.027 -13.355 1.00 100.14 ? 346  PRO A O    1 
ATOM   2483 C  CB   . PRO A 1 312 ? 110.081 53.080 -15.911 1.00 99.27  ? 346  PRO A CB   1 
ATOM   2484 C  CG   . PRO A 1 312 ? 108.950 52.503 -16.722 1.00 99.02  ? 346  PRO A CG   1 
ATOM   2485 C  CD   . PRO A 1 312 ? 108.151 53.756 -16.984 1.00 99.41  ? 346  PRO A CD   1 
ATOM   2486 N  N    . ASN A 1 313 ? 110.316 56.214 -15.168 1.00 102.43 ? 347  ASN A N    1 
ATOM   2487 C  CA   . ASN A 1 313 ? 111.181 57.338 -14.787 1.00 105.20 ? 347  ASN A CA   1 
ATOM   2488 C  C    . ASN A 1 313 ? 110.615 58.342 -13.785 1.00 105.06 ? 347  ASN A C    1 
ATOM   2489 O  O    . ASN A 1 313 ? 111.331 58.883 -12.937 1.00 105.32 ? 347  ASN A O    1 
ATOM   2490 C  CB   . ASN A 1 313 ? 111.579 58.088 -16.052 1.00 108.61 ? 347  ASN A CB   1 
ATOM   2491 C  CG   . ASN A 1 313 ? 111.951 57.144 -17.170 1.00 112.23 ? 347  ASN A CG   1 
ATOM   2492 O  OD1  . ASN A 1 313 ? 113.123 56.727 -17.289 1.00 113.00 ? 347  ASN A OD1  1 
ATOM   2493 N  ND2  . ASN A 1 313 ? 110.939 56.761 -17.991 1.00 113.85 ? 347  ASN A ND2  1 
ATOM   2494 N  N    . VAL A 1 314 ? 109.316 58.587 -13.908 1.00 104.32 ? 348  VAL A N    1 
ATOM   2495 C  CA   . VAL A 1 314 ? 108.589 59.536 -13.063 1.00 101.53 ? 348  VAL A CA   1 
ATOM   2496 C  C    . VAL A 1 314 ? 109.248 59.907 -11.733 1.00 99.80  ? 348  VAL A C    1 
ATOM   2497 O  O    . VAL A 1 314 ? 109.718 59.049 -10.964 1.00 98.51  ? 348  VAL A O    1 
ATOM   2498 C  CB   . VAL A 1 314 ? 107.107 59.025 -12.843 1.00 101.01 ? 348  VAL A CB   1 
ATOM   2499 C  CG1  . VAL A 1 314 ? 107.057 57.826 -11.901 1.00 99.63  ? 348  VAL A CG1  1 
ATOM   2500 C  CG2  . VAL A 1 314 ? 106.241 60.173 -12.381 1.00 100.92 ? 348  VAL A CG2  1 
ATOM   2501 N  N    . LYS A 1 315 ? 109.313 61.211 -11.496 1.00 98.59  ? 349  LYS A N    1 
ATOM   2502 C  CA   . LYS A 1 315 ? 109.870 61.737 -10.251 1.00 97.80  ? 349  LYS A CA   1 
ATOM   2503 C  C    . LYS A 1 315 ? 109.085 62.984 -9.910  1.00 96.30  ? 349  LYS A C    1 
ATOM   2504 O  O    . LYS A 1 315 ? 108.587 63.693 -10.810 1.00 94.20  ? 349  LYS A O    1 
ATOM   2505 C  CB   . LYS A 1 315 ? 111.365 62.088 -10.400 1.00 98.76  ? 349  LYS A CB   1 
ATOM   2506 C  CG   . LYS A 1 315 ? 112.309 60.882 -10.479 1.00 101.17 ? 349  LYS A CG   1 
ATOM   2507 C  CD   . LYS A 1 315 ? 112.434 60.143 -9.123  1.00 103.87 ? 349  LYS A CD   1 
ATOM   2508 C  CE   . LYS A 1 315 ? 113.013 58.687 -9.240  1.00 104.20 ? 349  LYS A CE   1 
ATOM   2509 N  NZ   . LYS A 1 315 ? 114.415 58.567 -9.731  1.00 103.92 ? 349  LYS A NZ   1 
ATOM   2510 N  N    . LEU A 1 316 ? 108.950 63.236 -8.611  1.00 95.48  ? 350  LEU A N    1 
ATOM   2511 C  CA   . LEU A 1 316 ? 108.232 64.422 -8.171  1.00 95.74  ? 350  LEU A CA   1 
ATOM   2512 C  C    . LEU A 1 316 ? 108.962 65.591 -8.775  1.00 96.14  ? 350  LEU A C    1 
ATOM   2513 O  O    . LEU A 1 316 ? 110.108 65.464 -9.192  1.00 96.23  ? 350  LEU A O    1 
ATOM   2514 C  CB   . LEU A 1 316 ? 108.228 64.545 -6.644  1.00 95.17  ? 350  LEU A CB   1 
ATOM   2515 C  CG   . LEU A 1 316 ? 107.501 63.456 -5.845  1.00 95.31  ? 350  LEU A CG   1 
ATOM   2516 C  CD1  . LEU A 1 316 ? 107.632 63.673 -4.328  1.00 94.84  ? 350  LEU A CD1  1 
ATOM   2517 C  CD2  . LEU A 1 316 ? 106.054 63.479 -6.239  1.00 95.87  ? 350  LEU A CD2  1 
ATOM   2518 N  N    . PRO A 1 317 ? 108.313 66.753 -8.854  1.00 97.16  ? 351  PRO A N    1 
ATOM   2519 C  CA   . PRO A 1 317 ? 109.008 67.904 -9.440  1.00 97.99  ? 351  PRO A CA   1 
ATOM   2520 C  C    . PRO A 1 317 ? 110.269 68.252 -8.638  1.00 98.70  ? 351  PRO A C    1 
ATOM   2521 O  O    . PRO A 1 317 ? 111.157 68.911 -9.138  1.00 98.73  ? 351  PRO A O    1 
ATOM   2522 C  CB   . PRO A 1 317 ? 107.957 69.018 -9.386  1.00 97.07  ? 351  PRO A CB   1 
ATOM   2523 C  CG   . PRO A 1 317 ? 106.684 68.275 -9.436  1.00 97.25  ? 351  PRO A CG   1 
ATOM   2524 C  CD   . PRO A 1 317 ? 106.934 67.105 -8.502  1.00 97.46  ? 351  PRO A CD   1 
ATOM   2525 N  N    . ASN A 1 318 ? 110.336 67.826 -7.383  1.00 99.46  ? 352  ASN A N    1 
ATOM   2526 C  CA   . ASN A 1 318 ? 111.503 68.113 -6.572  1.00 99.81  ? 352  ASN A CA   1 
ATOM   2527 C  C    . ASN A 1 318 ? 112.493 66.944 -6.637  1.00 99.79  ? 352  ASN A C    1 
ATOM   2528 O  O    . ASN A 1 318 ? 113.133 66.627 -5.653  1.00 100.18 ? 352  ASN A O    1 
ATOM   2529 C  CB   . ASN A 1 318 ? 111.079 68.327 -5.132  1.00 101.21 ? 352  ASN A CB   1 
ATOM   2530 C  CG   . ASN A 1 318 ? 110.464 67.069 -4.518  1.00 102.77 ? 352  ASN A CG   1 
ATOM   2531 O  OD1  . ASN A 1 318 ? 110.960 65.943 -4.738  1.00 103.22 ? 352  ASN A OD1  1 
ATOM   2532 N  ND2  . ASN A 1 318 ? 109.394 67.248 -3.733  1.00 103.27 ? 352  ASN A ND2  1 
ATOM   2533 N  N    . GLY A 1 319 ? 112.606 66.285 -7.783  1.00 99.60  ? 353  GLY A N    1 
ATOM   2534 C  CA   . GLY A 1 319 ? 113.537 65.175 -7.903  1.00 98.62  ? 353  GLY A CA   1 
ATOM   2535 C  C    . GLY A 1 319 ? 113.343 63.958 -7.002  1.00 98.82  ? 353  GLY A C    1 
ATOM   2536 O  O    . GLY A 1 319 ? 113.878 62.873 -7.315  1.00 99.01  ? 353  GLY A O    1 
ATOM   2537 N  N    . ARG A 1 320 ? 112.587 64.092 -5.907  1.00 98.29  ? 354  ARG A N    1 
ATOM   2538 C  CA   . ARG A 1 320 ? 112.380 62.952 -5.019  1.00 98.65  ? 354  ARG A CA   1 
ATOM   2539 C  C    . ARG A 1 320 ? 111.497 61.840 -5.639  1.00 98.75  ? 354  ARG A C    1 
ATOM   2540 O  O    . ARG A 1 320 ? 110.794 62.040 -6.656  1.00 99.66  ? 354  ARG A O    1 
ATOM   2541 C  CB   . ARG A 1 320 ? 111.762 63.431 -3.713  1.00 99.75  ? 354  ARG A CB   1 
ATOM   2542 C  CG   . ARG A 1 320 ? 111.626 62.333 -2.660  1.00 102.97 ? 354  ARG A CG   1 
ATOM   2543 C  CD   . ARG A 1 320 ? 110.840 62.817 -1.452  1.00 104.93 ? 354  ARG A CD   1 
ATOM   2544 N  NE   . ARG A 1 320 ? 111.290 64.147 -1.022  1.00 107.26 ? 354  ARG A NE   1 
ATOM   2545 C  CZ   . ARG A 1 320 ? 111.531 64.485 0.248   1.00 107.38 ? 354  ARG A CZ   1 
ATOM   2546 N  NH1  . ARG A 1 320 ? 111.365 63.570 1.213   1.00 106.40 ? 354  ARG A NH1  1 
ATOM   2547 N  NH2  . ARG A 1 320 ? 111.930 65.731 0.546   1.00 105.81 ? 354  ARG A NH2  1 
ATOM   2548 N  N    . ASP A 1 321 ? 111.501 60.657 -5.047  1.00 97.47  ? 355  ASP A N    1 
ATOM   2549 C  CA   . ASP A 1 321 ? 110.651 59.620 -5.600  1.00 95.86  ? 355  ASP A CA   1 
ATOM   2550 C  C    . ASP A 1 321 ? 109.177 59.872 -5.359  1.00 93.25  ? 355  ASP A C    1 
ATOM   2551 O  O    . ASP A 1 321 ? 108.790 60.652 -4.479  1.00 93.14  ? 355  ASP A O    1 
ATOM   2552 C  CB   . ASP A 1 321 ? 110.985 58.294 -4.974  1.00 99.65  ? 355  ASP A CB   1 
ATOM   2553 C  CG   . ASP A 1 321 ? 112.318 57.798 -5.393  1.00 103.12 ? 355  ASP A CG   1 
ATOM   2554 O  OD1  . ASP A 1 321 ? 112.447 57.392 -6.584  1.00 104.51 ? 355  ASP A OD1  1 
ATOM   2555 O  OD2  . ASP A 1 321 ? 113.229 57.839 -4.524  1.00 106.38 ? 355  ASP A OD2  1 
ATOM   2556 N  N    . THR A 1 322 ? 108.347 59.171 -6.124  1.00 89.78  ? 356  THR A N    1 
ATOM   2557 C  CA   . THR A 1 322 ? 106.908 59.291 -5.952  1.00 84.96  ? 356  THR A CA   1 
ATOM   2558 C  C    . THR A 1 322 ? 106.507 58.371 -4.807  1.00 82.44  ? 356  THR A C    1 
ATOM   2559 O  O    . THR A 1 322 ? 107.180 57.377 -4.515  1.00 81.54  ? 356  THR A O    1 
ATOM   2560 C  CB   . THR A 1 322 ? 106.150 58.910 -7.228  1.00 84.21  ? 356  THR A CB   1 
ATOM   2561 O  OG1  . THR A 1 322 ? 106.387 57.532 -7.572  1.00 83.29  ? 356  THR A OG1  1 
ATOM   2562 C  CG2  . THR A 1 322 ? 106.594 59.801 -8.334  1.00 81.28  ? 356  THR A CG2  1 
ATOM   2563 N  N    . PRO A 1 323 ? 105.407 58.697 -4.132  1.00 79.95  ? 357  PRO A N    1 
ATOM   2564 C  CA   . PRO A 1 323 ? 104.914 57.898 -2.997  1.00 78.45  ? 357  PRO A CA   1 
ATOM   2565 C  C    . PRO A 1 323 ? 104.545 56.490 -3.437  1.00 76.97  ? 357  PRO A C    1 
ATOM   2566 O  O    . PRO A 1 323 ? 104.757 56.158 -4.598  1.00 77.32  ? 357  PRO A O    1 
ATOM   2567 C  CB   . PRO A 1 323 ? 103.683 58.685 -2.536  1.00 79.52  ? 357  PRO A CB   1 
ATOM   2568 C  CG   . PRO A 1 323 ? 103.901 60.105 -3.075  1.00 79.83  ? 357  PRO A CG   1 
ATOM   2569 C  CD   . PRO A 1 323 ? 104.547 59.868 -4.402  1.00 78.99  ? 357  PRO A CD   1 
ATOM   2570 N  N    . ALA A 1 324 ? 104.007 55.662 -2.533  1.00 75.93  ? 358  ALA A N    1 
ATOM   2571 C  CA   . ALA A 1 324 ? 103.558 54.290 -2.880  1.00 75.02  ? 358  ALA A CA   1 
ATOM   2572 C  C    . ALA A 1 324 ? 102.278 54.387 -3.761  1.00 75.48  ? 358  ALA A C    1 
ATOM   2573 O  O    . ALA A 1 324 ? 101.337 55.110 -3.421  1.00 75.60  ? 358  ALA A O    1 
ATOM   2574 C  CB   . ALA A 1 324 ? 103.234 53.500 -1.634  1.00 73.49  ? 358  ALA A CB   1 
ATOM   2575 N  N    . LEU A 1 325 ? 102.239 53.678 -4.890  1.00 74.58  ? 359  LEU A N    1 
ATOM   2576 C  CA   . LEU A 1 325 ? 101.082 53.746 -5.766  1.00 72.95  ? 359  LEU A CA   1 
ATOM   2577 C  C    . LEU A 1 325 ? 100.786 52.398 -6.375  1.00 75.09  ? 359  LEU A C    1 
ATOM   2578 O  O    . LEU A 1 325 ? 99.682  52.208 -6.911  1.00 77.09  ? 359  LEU A O    1 
ATOM   2579 C  CB   . LEU A 1 325 ? 101.335 54.714 -6.890  1.00 68.68  ? 359  LEU A CB   1 
ATOM   2580 C  CG   . LEU A 1 325 ? 101.822 56.101 -6.489  1.00 68.60  ? 359  LEU A CG   1 
ATOM   2581 C  CD1  . LEU A 1 325 ? 102.475 56.810 -7.673  1.00 67.02  ? 359  LEU A CD1  1 
ATOM   2582 C  CD2  . LEU A 1 325 ? 100.672 56.913 -5.949  1.00 68.04  ? 359  LEU A CD2  1 
ATOM   2583 N  N    . PHE A 1 326 ? 101.740 51.453 -6.321  1.00 75.12  ? 360  PHE A N    1 
ATOM   2584 C  CA   . PHE A 1 326 ? 101.519 50.155 -6.972  1.00 74.20  ? 360  PHE A CA   1 
ATOM   2585 C  C    . PHE A 1 326 ? 101.528 49.017 -6.021  1.00 74.14  ? 360  PHE A C    1 
ATOM   2586 O  O    . PHE A 1 326 ? 101.261 47.891 -6.414  1.00 75.10  ? 360  PHE A O    1 
ATOM   2587 C  CB   . PHE A 1 326 ? 102.581 49.882 -8.030  1.00 73.67  ? 360  PHE A CB   1 
ATOM   2588 C  CG   . PHE A 1 326 ? 102.881 51.061 -8.887  1.00 74.53  ? 360  PHE A CG   1 
ATOM   2589 C  CD1  . PHE A 1 326 ? 104.189 51.405 -9.183  1.00 74.10  ? 360  PHE A CD1  1 
ATOM   2590 C  CD2  . PHE A 1 326 ? 101.849 51.864 -9.362  1.00 74.26  ? 360  PHE A CD2  1 
ATOM   2591 C  CE1  . PHE A 1 326 ? 104.466 52.563 -9.952  1.00 75.49  ? 360  PHE A CE1  1 
ATOM   2592 C  CE2  . PHE A 1 326 ? 102.124 53.022 -10.127 1.00 75.06  ? 360  PHE A CE2  1 
ATOM   2593 C  CZ   . PHE A 1 326 ? 103.431 53.372 -10.419 1.00 73.68  ? 360  PHE A CZ   1 
ATOM   2594 N  N    . ASN A 1 327 ? 101.847 49.265 -4.767  1.00 73.95  ? 361  ASN A N    1 
ATOM   2595 C  CA   . ASN A 1 327 ? 101.892 48.152 -3.827  1.00 73.76  ? 361  ASN A CA   1 
ATOM   2596 C  C    . ASN A 1 327 ? 100.532 47.614 -3.507  1.00 73.82  ? 361  ASN A C    1 
ATOM   2597 O  O    . ASN A 1 327 ? 100.167 47.529 -2.343  1.00 73.96  ? 361  ASN A O    1 
ATOM   2598 C  CB   . ASN A 1 327 ? 102.554 48.589 -2.540  1.00 73.58  ? 361  ASN A CB   1 
ATOM   2599 C  CG   . ASN A 1 327 ? 102.035 49.873 -2.060  1.00 73.84  ? 361  ASN A CG   1 
ATOM   2600 O  OD1  . ASN A 1 327 ? 101.753 50.770 -2.848  1.00 78.46  ? 361  ASN A OD1  1 
ATOM   2601 N  ND2  . ASN A 1 327 ? 101.914 50.001 -0.770  1.00 73.66  ? 361  ASN A ND2  1 
ATOM   2602 N  N    . PHE A 1 328 ? 99.763  47.259 -4.526  1.00 73.71  ? 362  PHE A N    1 
ATOM   2603 C  CA   . PHE A 1 328 ? 98.420  46.732 -4.287  1.00 74.05  ? 362  PHE A CA   1 
ATOM   2604 C  C    . PHE A 1 328 ? 98.466  45.386 -3.577  1.00 75.36  ? 362  PHE A C    1 
ATOM   2605 O  O    . PHE A 1 328 ? 99.291  44.558 -3.903  1.00 75.93  ? 362  PHE A O    1 
ATOM   2606 C  CB   . PHE A 1 328 ? 97.653  46.583 -5.614  1.00 70.55  ? 362  PHE A CB   1 
ATOM   2607 C  CG   . PHE A 1 328 ? 97.115  47.870 -6.143  1.00 68.03  ? 362  PHE A CG   1 
ATOM   2608 C  CD1  . PHE A 1 328 ? 97.800  48.578 -7.114  1.00 67.10  ? 362  PHE A CD1  1 
ATOM   2609 C  CD2  . PHE A 1 328 ? 95.945  48.413 -5.617  1.00 66.25  ? 362  PHE A CD2  1 
ATOM   2610 C  CE1  . PHE A 1 328 ? 97.326  49.829 -7.557  1.00 66.90  ? 362  PHE A CE1  1 
ATOM   2611 C  CE2  . PHE A 1 328 ? 95.470  49.639 -6.047  1.00 65.72  ? 362  PHE A CE2  1 
ATOM   2612 C  CZ   . PHE A 1 328 ? 96.157  50.356 -7.016  1.00 65.86  ? 362  PHE A CZ   1 
ATOM   2613 N  N    . THR A 1 329 ? 97.608  45.158 -2.598  1.00 77.12  ? 363  THR A N    1 
ATOM   2614 C  CA   . THR A 1 329 ? 97.609  43.857 -1.958  1.00 80.06  ? 363  THR A CA   1 
ATOM   2615 C  C    . THR A 1 329 ? 96.647  42.983 -2.763  1.00 82.24  ? 363  THR A C    1 
ATOM   2616 O  O    . THR A 1 329 ? 95.789  43.503 -3.468  1.00 82.42  ? 363  THR A O    1 
ATOM   2617 C  CB   . THR A 1 329 ? 97.114  43.945 -0.523  1.00 80.09  ? 363  THR A CB   1 
ATOM   2618 O  OG1  . THR A 1 329 ? 95.731  43.588 -0.457  1.00 80.69  ? 363  THR A OG1  1 
ATOM   2619 C  CG2  . THR A 1 329 ? 97.279  45.337 -0.030  1.00 81.29  ? 363  THR A CG2  1 
ATOM   2620 N  N    . THR A 1 330 ? 96.761  41.661 -2.663  1.00 85.09  ? 364  THR A N    1 
ATOM   2621 C  CA   . THR A 1 330 ? 95.856  40.830 -3.443  1.00 87.13  ? 364  THR A CA   1 
ATOM   2622 C  C    . THR A 1 330 ? 94.418  41.155 -3.043  1.00 87.52  ? 364  THR A C    1 
ATOM   2623 O  O    . THR A 1 330 ? 93.549  41.301 -3.920  1.00 88.55  ? 364  THR A O    1 
ATOM   2624 C  CB   . THR A 1 330 ? 96.175  39.322 -3.288  1.00 87.44  ? 364  THR A CB   1 
ATOM   2625 O  OG1  . THR A 1 330 ? 97.501  39.089 -3.775  1.00 88.62  ? 364  THR A OG1  1 
ATOM   2626 C  CG2  . THR A 1 330 ? 95.215  38.467 -4.123  1.00 86.27  ? 364  THR A CG2  1 
ATOM   2627 N  N    . GLN A 1 331 ? 94.180  41.302 -1.738  1.00 87.24  ? 365  GLN A N    1 
ATOM   2628 C  CA   . GLN A 1 331 ? 92.845  41.662 -1.238  1.00 87.33  ? 365  GLN A CA   1 
ATOM   2629 C  C    . GLN A 1 331 ? 92.352  42.974 -1.949  1.00 84.76  ? 365  GLN A C    1 
ATOM   2630 O  O    . GLN A 1 331 ? 91.218  43.058 -2.423  1.00 82.96  ? 365  GLN A O    1 
ATOM   2631 C  CB   . GLN A 1 331 ? 92.903  41.838 0.301   1.00 91.14  ? 365  GLN A CB   1 
ATOM   2632 C  CG   . GLN A 1 331 ? 94.243  41.231 0.988   1.00 96.35  ? 365  GLN A CG   1 
ATOM   2633 C  CD   . GLN A 1 331 ? 94.641  41.865 2.416   1.00 99.86  ? 365  GLN A CD   1 
ATOM   2634 O  OE1  . GLN A 1 331 ? 95.150  43.018 2.508   1.00 100.50 ? 365  GLN A OE1  1 
ATOM   2635 N  NE2  . GLN A 1 331 ? 94.392  41.103 3.503   1.00 99.49  ? 365  GLN A NE2  1 
ATOM   2636 N  N    . GLU A 1 332 ? 93.219  43.982 -2.062  1.00 82.47  ? 366  GLU A N    1 
ATOM   2637 C  CA   . GLU A 1 332 ? 92.857  45.244 -2.722  1.00 80.93  ? 366  GLU A CA   1 
ATOM   2638 C  C    . GLU A 1 332 ? 92.333  45.089 -4.158  1.00 80.59  ? 366  GLU A C    1 
ATOM   2639 O  O    . GLU A 1 332 ? 91.388  45.754 -4.539  1.00 81.52  ? 366  GLU A O    1 
ATOM   2640 C  CB   . GLU A 1 332 ? 94.043  46.203 -2.763  1.00 80.17  ? 366  GLU A CB   1 
ATOM   2641 C  CG   . GLU A 1 332 ? 94.140  47.255 -1.664  1.00 80.65  ? 366  GLU A CG   1 
ATOM   2642 C  CD   . GLU A 1 332 ? 95.125  48.393 -2.046  1.00 81.22  ? 366  GLU A CD   1 
ATOM   2643 O  OE1  . GLU A 1 332 ? 94.656  49.503 -2.469  1.00 80.55  ? 366  GLU A OE1  1 
ATOM   2644 O  OE2  . GLU A 1 332 ? 96.359  48.151 -1.942  1.00 79.71  ? 366  GLU A OE2  1 
ATOM   2645 N  N    . LEU A 1 333 ? 92.945  44.217 -4.957  1.00 80.48  ? 367  LEU A N    1 
ATOM   2646 C  CA   . LEU A 1 333 ? 92.546  44.015 -6.362  1.00 79.21  ? 367  LEU A CA   1 
ATOM   2647 C  C    . LEU A 1 333 ? 91.506  42.937 -6.623  1.00 79.33  ? 367  LEU A C    1 
ATOM   2648 O  O    . LEU A 1 333 ? 91.045  42.751 -7.758  1.00 79.40  ? 367  LEU A O    1 
ATOM   2649 C  CB   . LEU A 1 333 ? 93.774  43.696 -7.202  1.00 77.11  ? 367  LEU A CB   1 
ATOM   2650 C  CG   . LEU A 1 333 ? 94.761  44.857 -7.255  1.00 77.05  ? 367  LEU A CG   1 
ATOM   2651 C  CD1  . LEU A 1 333 ? 96.003  44.441 -8.014  1.00 75.07  ? 367  LEU A CD1  1 
ATOM   2652 C  CD2  . LEU A 1 333 ? 94.089  46.085 -7.884  1.00 75.28  ? 367  LEU A CD2  1 
ATOM   2653 N  N    . SER A 1 334 ? 91.148  42.212 -5.575  1.00 78.87  ? 368  SER A N    1 
ATOM   2654 C  CA   . SER A 1 334 ? 90.204  41.137 -5.727  1.00 78.29  ? 368  SER A CA   1 
ATOM   2655 C  C    . SER A 1 334 ? 88.860  41.616 -6.286  1.00 77.87  ? 368  SER A C    1 
ATOM   2656 O  O    . SER A 1 334 ? 88.118  40.833 -6.853  1.00 78.76  ? 368  SER A O    1 
ATOM   2657 C  CB   . SER A 1 334 ? 90.003  40.465 -4.393  1.00 77.33  ? 368  SER A CB   1 
ATOM   2658 O  OG   . SER A 1 334 ? 89.110  41.234 -3.619  1.00 78.17  ? 368  SER A OG   1 
ATOM   2659 N  N    . SER A 1 335 ? 88.514  42.882 -6.135  1.00 77.15  ? 369  SER A N    1 
ATOM   2660 C  CA   . SER A 1 335 ? 87.223  43.289 -6.696  1.00 76.93  ? 369  SER A CA   1 
ATOM   2661 C  C    . SER A 1 335 ? 87.238  43.333 -8.233  1.00 76.76  ? 369  SER A C    1 
ATOM   2662 O  O    . SER A 1 335 ? 86.201  43.420 -8.847  1.00 76.87  ? 369  SER A O    1 
ATOM   2663 C  CB   . SER A 1 335 ? 86.759  44.669 -6.155  1.00 77.18  ? 369  SER A CB   1 
ATOM   2664 O  OG   . SER A 1 335 ? 87.648  45.749 -6.450  1.00 78.27  ? 369  SER A OG   1 
ATOM   2665 N  N    . ASN A 1 336 ? 88.397  43.267 -8.871  1.00 75.64  ? 370  ASN A N    1 
ATOM   2666 C  CA   . ASN A 1 336 ? 88.409  43.349 -10.318 1.00 73.99  ? 370  ASN A CA   1 
ATOM   2667 C  C    . ASN A 1 336 ? 89.829  43.049 -10.776 1.00 73.36  ? 370  ASN A C    1 
ATOM   2668 O  O    . ASN A 1 336 ? 90.526  43.890 -11.388 1.00 72.40  ? 370  ASN A O    1 
ATOM   2669 C  CB   . ASN A 1 336 ? 87.976  44.742 -10.728 1.00 74.60  ? 370  ASN A CB   1 
ATOM   2670 C  CG   . ASN A 1 336 ? 87.871  44.897 -12.222 1.00 76.43  ? 370  ASN A CG   1 
ATOM   2671 O  OD1  . ASN A 1 336 ? 87.538  45.987 -12.731 1.00 77.27  ? 370  ASN A OD1  1 
ATOM   2672 N  ND2  . ASN A 1 336 ? 88.154  43.810 -12.953 1.00 77.41  ? 370  ASN A ND2  1 
ATOM   2673 N  N    . PRO A 1 337 ? 90.275  41.814 -10.493 1.00 71.89  ? 371  PRO A N    1 
ATOM   2674 C  CA   . PRO A 1 337 ? 91.594  41.265 -10.802 1.00 69.86  ? 371  PRO A CA   1 
ATOM   2675 C  C    . PRO A 1 337 ? 92.194  41.729 -12.119 1.00 68.49  ? 371  PRO A C    1 
ATOM   2676 O  O    . PRO A 1 337 ? 93.326  42.224 -12.160 1.00 68.50  ? 371  PRO A O    1 
ATOM   2677 C  CB   . PRO A 1 337 ? 91.332  39.790 -10.735 1.00 70.33  ? 371  PRO A CB   1 
ATOM   2678 C  CG   . PRO A 1 337 ? 90.340  39.721 -9.545  1.00 70.18  ? 371  PRO A CG   1 
ATOM   2679 C  CD   . PRO A 1 337 ? 89.381  40.762 -9.961  1.00 70.19  ? 371  PRO A CD   1 
ATOM   2680 N  N    . PRO A 1 338 ? 91.444  41.601 -13.225 1.00 66.96  ? 372  PRO A N    1 
ATOM   2681 C  CA   . PRO A 1 338 ? 91.915  42.017 -14.564 1.00 66.11  ? 372  PRO A CA   1 
ATOM   2682 C  C    . PRO A 1 338 ? 92.657  43.371 -14.569 1.00 67.37  ? 372  PRO A C    1 
ATOM   2683 O  O    . PRO A 1 338 ? 93.569  43.582 -15.395 1.00 68.26  ? 372  PRO A O    1 
ATOM   2684 C  CB   . PRO A 1 338 ? 90.647  42.104 -15.377 1.00 63.46  ? 372  PRO A CB   1 
ATOM   2685 C  CG   . PRO A 1 338 ? 89.809  41.081 -14.762 1.00 64.89  ? 372  PRO A CG   1 
ATOM   2686 C  CD   . PRO A 1 338 ? 90.056  41.131 -13.278 1.00 65.60  ? 372  PRO A CD   1 
ATOM   2687 N  N    . LEU A 1 339 ? 92.260  44.280 -13.658 1.00 66.46  ? 373  LEU A N    1 
ATOM   2688 C  CA   . LEU A 1 339 ? 92.874  45.612 -13.579 1.00 64.57  ? 373  LEU A CA   1 
ATOM   2689 C  C    . LEU A 1 339 ? 94.338  45.558 -13.184 1.00 63.84  ? 373  LEU A C    1 
ATOM   2690 O  O    . LEU A 1 339 ? 95.108  46.490 -13.452 1.00 63.02  ? 373  LEU A O    1 
ATOM   2691 C  CB   . LEU A 1 339 ? 92.111  46.502 -12.595 1.00 62.73  ? 373  LEU A CB   1 
ATOM   2692 C  CG   . LEU A 1 339 ? 90.734  46.877 -13.116 1.00 59.90  ? 373  LEU A CG   1 
ATOM   2693 C  CD1  . LEU A 1 339 ? 89.943  47.612 -12.065 1.00 58.33  ? 373  LEU A CD1  1 
ATOM   2694 C  CD2  . LEU A 1 339 ? 90.917  47.712 -14.336 1.00 57.22  ? 373  LEU A CD2  1 
ATOM   2695 N  N    . ALA A 1 340 ? 94.704  44.454 -12.538 1.00 63.25  ? 374  ALA A N    1 
ATOM   2696 C  CA   . ALA A 1 340 ? 96.064  44.254 -12.085 1.00 63.47  ? 374  ALA A CA   1 
ATOM   2697 C  C    . ALA A 1 340 ? 97.032  44.514 -13.238 1.00 64.93  ? 374  ALA A C    1 
ATOM   2698 O  O    . ALA A 1 340 ? 98.034  45.178 -13.074 1.00 65.94  ? 374  ALA A O    1 
ATOM   2699 C  CB   . ALA A 1 340 ? 96.216  42.879 -11.579 1.00 60.48  ? 374  ALA A CB   1 
ATOM   2700 N  N    . THR A 1 341 ? 96.698  44.027 -14.422 1.00 66.77  ? 375  THR A N    1 
ATOM   2701 C  CA   . THR A 1 341 ? 97.559  44.186 -15.577 1.00 67.99  ? 375  THR A CA   1 
ATOM   2702 C  C    . THR A 1 341 ? 97.766  45.645 -15.972 1.00 68.49  ? 375  THR A C    1 
ATOM   2703 O  O    . THR A 1 341 ? 98.618  45.957 -16.799 1.00 70.28  ? 375  THR A O    1 
ATOM   2704 C  CB   . THR A 1 341 ? 97.000  43.377 -16.788 1.00 68.61  ? 375  THR A CB   1 
ATOM   2705 O  OG1  . THR A 1 341 ? 96.113  44.199 -17.573 1.00 72.25  ? 375  THR A OG1  1 
ATOM   2706 C  CG2  . THR A 1 341 ? 96.223  42.158 -16.307 1.00 66.96  ? 375  THR A CG2  1 
ATOM   2707 N  N    . ILE A 1 342 ? 96.979  46.559 -15.434 1.00 68.58  ? 376  ILE A N    1 
ATOM   2708 C  CA   . ILE A 1 342 ? 97.236  47.953 -15.799 1.00 68.60  ? 376  ILE A CA   1 
ATOM   2709 C  C    . ILE A 1 342 ? 97.707  48.648 -14.538 1.00 69.79  ? 376  ILE A C    1 
ATOM   2710 O  O    . ILE A 1 342 ? 98.555  49.557 -14.583 1.00 70.13  ? 376  ILE A O    1 
ATOM   2711 C  CB   . ILE A 1 342 ? 95.994  48.737 -16.247 1.00 66.69  ? 376  ILE A CB   1 
ATOM   2712 C  CG1  . ILE A 1 342 ? 95.409  48.180 -17.536 1.00 65.53  ? 376  ILE A CG1  1 
ATOM   2713 C  CG2  . ILE A 1 342 ? 96.357  50.183 -16.418 1.00 63.58  ? 376  ILE A CG2  1 
ATOM   2714 C  CD1  . ILE A 1 342 ? 94.023  48.757 -17.847 1.00 62.85  ? 376  ILE A CD1  1 
ATOM   2715 N  N    . LEU A 1 343 ? 97.157  48.207 -13.409 1.00 69.81  ? 377  LEU A N    1 
ATOM   2716 C  CA   . LEU A 1 343 ? 97.492  48.838 -12.149 1.00 70.85  ? 377  LEU A CA   1 
ATOM   2717 C  C    . LEU A 1 343 ? 98.953  48.706 -11.830 1.00 73.52  ? 377  LEU A C    1 
ATOM   2718 O  O    . LEU A 1 343 ? 99.629  49.722 -11.673 1.00 74.71  ? 377  LEU A O    1 
ATOM   2719 C  CB   . LEU A 1 343 ? 96.625  48.294 -11.017 1.00 66.66  ? 377  LEU A CB   1 
ATOM   2720 C  CG   . LEU A 1 343 ? 95.236  48.938 -11.119 1.00 63.29  ? 377  LEU A CG   1 
ATOM   2721 C  CD1  . LEU A 1 343 ? 94.442  48.578 -9.903  1.00 61.07  ? 377  LEU A CD1  1 
ATOM   2722 C  CD2  . LEU A 1 343 ? 95.346  50.467 -11.299 1.00 59.87  ? 377  LEU A CD2  1 
ATOM   2723 N  N    . ILE A 1 344 ? 99.443  47.467 -11.769 1.00 75.93  ? 378  ILE A N    1 
ATOM   2724 C  CA   . ILE A 1 344 ? 100.852 47.181 -11.477 1.00 77.74  ? 378  ILE A CA   1 
ATOM   2725 C  C    . ILE A 1 344 ? 101.705 47.211 -12.727 1.00 80.34  ? 378  ILE A C    1 
ATOM   2726 O  O    . ILE A 1 344 ? 101.642 46.321 -13.513 1.00 80.13  ? 378  ILE A O    1 
ATOM   2727 C  CB   . ILE A 1 344 ? 101.002 45.798 -10.860 1.00 76.11  ? 378  ILE A CB   1 
ATOM   2728 C  CG1  . ILE A 1 344 ? 100.440 45.784 -9.443  1.00 75.46  ? 378  ILE A CG1  1 
ATOM   2729 C  CG2  . ILE A 1 344 ? 102.420 45.448 -10.852 1.00 75.92  ? 378  ILE A CG2  1 
ATOM   2730 C  CD1  . ILE A 1 344 ? 99.343  44.772 -9.242  1.00 74.15  ? 378  ILE A CD1  1 
ATOM   2731 N  N    . PRO A 1 345 ? 102.545 48.218 -12.902 1.00 84.81  ? 379  PRO A N    1 
ATOM   2732 C  CA   . PRO A 1 345 ? 103.407 48.338 -14.086 1.00 89.35  ? 379  PRO A CA   1 
ATOM   2733 C  C    . PRO A 1 345 ? 104.293 47.117 -14.350 1.00 94.52  ? 379  PRO A C    1 
ATOM   2734 O  O    . PRO A 1 345 ? 104.434 46.251 -13.476 1.00 95.17  ? 379  PRO A O    1 
ATOM   2735 C  CB   . PRO A 1 345 ? 104.249 49.579 -13.780 1.00 88.82  ? 379  PRO A CB   1 
ATOM   2736 C  CG   . PRO A 1 345 ? 103.402 50.369 -12.824 1.00 87.60  ? 379  PRO A CG   1 
ATOM   2737 C  CD   . PRO A 1 345 ? 102.861 49.269 -11.926 1.00 86.25  ? 379  PRO A CD   1 
ATOM   2738 N  N    . PRO A 1 346 ? 104.918 47.038 -15.560 1.00 98.82  ? 380  PRO A N    1 
ATOM   2739 C  CA   . PRO A 1 346 ? 105.789 45.913 -15.912 1.00 101.53 ? 380  PRO A CA   1 
ATOM   2740 C  C    . PRO A 1 346 ? 106.950 45.806 -14.902 1.00 104.93 ? 380  PRO A C    1 
ATOM   2741 O  O    . PRO A 1 346 ? 107.224 44.708 -14.385 1.00 104.74 ? 380  PRO A O    1 
ATOM   2742 C  CB   . PRO A 1 346 ? 106.253 46.275 -17.320 1.00 100.67 ? 380  PRO A CB   1 
ATOM   2743 C  CG   . PRO A 1 346 ? 105.111 47.029 -17.877 1.00 99.37  ? 380  PRO A CG   1 
ATOM   2744 C  CD   . PRO A 1 346 ? 104.821 47.956 -16.711 1.00 99.56  ? 380  PRO A CD   1 
ATOM   2745 N  N    . HIS A 1 347 ? 107.612 46.938 -14.617 1.00 108.42 ? 381  HIS A N    1 
ATOM   2746 C  CA   . HIS A 1 347 ? 108.711 46.950 -13.647 1.00 113.01 ? 381  HIS A CA   1 
ATOM   2747 C  C    . HIS A 1 347 ? 108.214 46.858 -12.194 1.00 114.27 ? 381  HIS A C    1 
ATOM   2748 O  O    . HIS A 1 347 ? 108.496 47.737 -11.383 1.00 114.31 ? 381  HIS A O    1 
ATOM   2749 C  CB   . HIS A 1 347 ? 109.569 48.206 -13.783 1.00 116.14 ? 381  HIS A CB   1 
ATOM   2750 C  CG   . HIS A 1 347 ? 108.822 49.490 -13.556 1.00 120.88 ? 381  HIS A CG   1 
ATOM   2751 N  ND1  . HIS A 1 347 ? 107.816 49.925 -14.402 1.00 122.87 ? 381  HIS A ND1  1 
ATOM   2752 C  CD2  . HIS A 1 347 ? 108.964 50.457 -12.604 1.00 122.18 ? 381  HIS A CD2  1 
ATOM   2753 C  CE1  . HIS A 1 347 ? 107.377 51.104 -13.979 1.00 123.88 ? 381  HIS A CE1  1 
ATOM   2754 N  NE2  . HIS A 1 347 ? 108.055 51.448 -12.893 1.00 123.06 ? 381  HIS A NE2  1 
ATOM   2755 N  N    . ALA A 1 348 ? 107.474 45.786 -11.890 1.00 115.58 ? 382  ALA A N    1 
ATOM   2756 C  CA   . ALA A 1 348 ? 106.907 45.514 -10.557 1.00 116.14 ? 382  ALA A CA   1 
ATOM   2757 C  C    . ALA A 1 348 ? 106.340 44.055 -10.522 1.00 116.83 ? 382  ALA A C    1 
ATOM   2758 O  O    . ALA A 1 348 ? 106.538 43.353 -9.494  1.00 116.67 ? 382  ALA A O    1 
ATOM   2759 C  CB   . ALA A 1 348 ? 105.806 46.563 -10.204 1.00 114.49 ? 382  ALA A CB   1 
ATOM   2760 N  N    . ARG A 1 349 ? 105.709 43.612 -11.535 1.00 117.33 ? 383  ARG A N    1 
HETATM 2761 C  C1   . BRW B 2 .   ? 94.405  70.408 9.094   1.00 71.76  ? 1383 BRW A C1   1 
HETATM 2762 C  C2   . BRW B 2 .   ? 93.677  69.251 9.602   1.00 71.29  ? 1383 BRW A C2   1 
HETATM 2763 C  C3   . BRW B 2 .   ? 95.808  69.982 8.983   1.00 70.53  ? 1383 BRW A C3   1 
HETATM 2764 N  N4   . BRW B 2 .   ? 95.911  68.670 9.422   1.00 67.24  ? 1383 BRW A N4   1 
HETATM 2765 C  C5   . BRW B 2 .   ? 96.774  70.813 8.520   1.00 72.20  ? 1383 BRW A C5   1 
HETATM 2766 C  C7   . BRW B 2 .   ? 96.378  72.190 8.095   1.00 74.12  ? 1383 BRW A C7   1 
HETATM 2767 C  C9   . BRW B 2 .   ? 95.075  72.591 8.194   1.00 75.01  ? 1383 BRW A C9   1 
HETATM 2768 C  C11  . BRW B 2 .   ? 94.026  71.665 8.717   1.00 73.66  ? 1383 BRW A C11  1 
HETATM 2769 C  C13  . BRW B 2 .   ? 94.633  68.168 9.788   1.00 66.76  ? 1383 BRW A C13  1 
HETATM 2770 C  C14  . BRW B 2 .   ? 94.491  66.914 10.166  1.00 63.12  ? 1383 BRW A C14  1 
HETATM 2771 C  C15  . BRW B 2 .   ? 95.643  65.996 10.351  1.00 62.87  ? 1383 BRW A C15  1 
HETATM 2772 N  N16  . BRW B 2 .   ? 95.164  64.712 10.730  1.00 61.00  ? 1383 BRW A N16  1 
HETATM 2773 C  C17  . BRW B 2 .   ? 93.774  64.793 10.747  1.00 60.61  ? 1383 BRW A C17  1 
HETATM 2774 C  C18  . BRW B 2 .   ? 93.330  66.063 10.474  1.00 60.71  ? 1383 BRW A C18  1 
HETATM 2775 C  C19  . BRW B 2 .   ? 92.846  63.680 11.024  1.00 61.14  ? 1383 BRW A C19  1 
HETATM 2776 C  C20  . BRW B 2 .   ? 91.507  63.922 10.967  1.00 61.47  ? 1383 BRW A C20  1 
HETATM 2777 C  C21  . BRW B 2 .   ? 91.028  65.280 10.691  1.00 60.77  ? 1383 BRW A C21  1 
HETATM 2778 C  C22  . BRW B 2 .   ? 91.882  66.290 10.440  1.00 59.00  ? 1383 BRW A C22  1 
HETATM 2779 O  O23  . BRW B 2 .   ? 96.836  66.277 10.201  1.00 62.17  ? 1383 BRW A O23  1 
HETATM 2780 N  N24  . BRW B 2 .   ? 92.440  69.155 9.870   1.00 76.21  ? 1383 BRW A N24  1 
HETATM 2781 O  O39  . BRW B 2 .   ? 91.456  70.023 9.782   1.00 82.05  ? 1383 BRW A O39  1 
HETATM 2782 BR BR21 . BRW B 2 .   ? 90.240  62.548 11.200  0.50 68.25  ? 1383 BRW A BR21 1 
HETATM 2783 P  P    . PO4 C 3 .   ? 81.701  52.048 -6.244  1.00 71.19  ? 1384 PO4 A P    1 
HETATM 2784 O  O1   . PO4 C 3 .   ? 81.396  51.152 -7.477  1.00 74.64  ? 1384 PO4 A O1   1 
HETATM 2785 O  O2   . PO4 C 3 .   ? 81.739  53.500 -6.599  1.00 70.97  ? 1384 PO4 A O2   1 
HETATM 2786 O  O3   . PO4 C 3 .   ? 83.037  51.555 -5.644  1.00 71.04  ? 1384 PO4 A O3   1 
HETATM 2787 O  O4   . PO4 C 3 .   ? 80.603  51.766 -5.196  1.00 71.62  ? 1384 PO4 A O4   1 
HETATM 2788 CL CL   . CL  D 4 .   ? 105.016 51.491 -5.332  1.00 87.62  ? 1385 CL  A CL   1 
HETATM 2789 CO CO   . CO  E 5 .   ? 81.940  68.034 8.779   1.00 93.54  ? 1386 CO  A CO   1 
HETATM 2790 P  P    . PO4 F 3 .   ? 72.146  57.662 8.229   1.00 94.89  ? 1387 PO4 A P    1 
HETATM 2791 O  O1   . PO4 F 3 .   ? 72.214  57.614 6.646   1.00 90.38  ? 1387 PO4 A O1   1 
HETATM 2792 O  O2   . PO4 F 3 .   ? 70.957  58.399 8.699   1.00 96.25  ? 1387 PO4 A O2   1 
HETATM 2793 O  O3   . PO4 F 3 .   ? 73.463  58.294 8.792   1.00 94.42  ? 1387 PO4 A O3   1 
HETATM 2794 O  O4   . PO4 F 3 .   ? 72.103  56.232 8.816   1.00 96.49  ? 1387 PO4 A O4   1 
HETATM 2795 O  O    . HOH G 6 .   ? 103.712 73.229 30.792  1.00 68.04  ? 2001 HOH A O    1 
HETATM 2796 O  O    . HOH G 6 .   ? 100.841 71.830 32.832  1.00 58.63  ? 2002 HOH A O    1 
HETATM 2797 O  O    . HOH G 6 .   ? 92.697  59.056 30.699  1.00 64.41  ? 2003 HOH A O    1 
HETATM 2798 O  O    . HOH G 6 .   ? 88.095  48.410 22.840  1.00 80.43  ? 2004 HOH A O    1 
HETATM 2799 O  O    . HOH G 6 .   ? 90.769  49.729 26.785  1.00 73.97  ? 2005 HOH A O    1 
HETATM 2800 O  O    . HOH G 6 .   ? 98.494  49.570 24.792  1.00 83.23  ? 2006 HOH A O    1 
HETATM 2801 O  O    . HOH G 6 .   ? 101.907 52.673 21.328  1.00 66.97  ? 2007 HOH A O    1 
HETATM 2802 O  O    . HOH G 6 .   ? 104.090 61.115 25.016  1.00 88.60  ? 2008 HOH A O    1 
HETATM 2803 O  O    . HOH G 6 .   ? 102.066 71.057 18.785  1.00 77.25  ? 2009 HOH A O    1 
HETATM 2804 O  O    . HOH G 6 .   ? 77.038  65.771 14.620  1.00 78.85  ? 2010 HOH A O    1 
HETATM 2805 O  O    . HOH G 6 .   ? 84.202  67.379 12.910  1.00 79.70  ? 2011 HOH A O    1 
HETATM 2806 O  O    . HOH G 6 .   ? 86.381  68.197 12.251  1.00 72.03  ? 2012 HOH A O    1 
HETATM 2807 O  O    . HOH G 6 .   ? 107.508 71.469 24.487  1.00 62.51  ? 2013 HOH A O    1 
HETATM 2808 O  O    . HOH G 6 .   ? 105.207 59.704 21.971  1.00 98.21  ? 2014 HOH A O    1 
HETATM 2809 O  O    . HOH G 6 .   ? 104.716 58.153 19.401  1.00 76.40  ? 2015 HOH A O    1 
HETATM 2810 O  O    . HOH G 6 .   ? 107.435 56.662 17.628  1.00 79.52  ? 2016 HOH A O    1 
HETATM 2811 O  O    . HOH G 6 .   ? 87.629  65.838 10.845  1.00 57.63  ? 2017 HOH A O    1 
HETATM 2812 O  O    . HOH G 6 .   ? 83.856  64.800 12.377  1.00 88.86  ? 2018 HOH A O    1 
HETATM 2813 O  O    . HOH G 6 .   ? 88.238  60.438 11.180  1.00 47.75  ? 2019 HOH A O    1 
HETATM 2814 O  O    . HOH G 6 .   ? 82.417  61.838 15.233  1.00 70.63  ? 2020 HOH A O    1 
HETATM 2815 O  O    . HOH G 6 .   ? 95.946  53.295 7.968   1.00 78.08  ? 2021 HOH A O    1 
HETATM 2816 O  O    . HOH G 6 .   ? 98.405  56.845 -2.762  1.00 90.60  ? 2022 HOH A O    1 
HETATM 2817 O  O    . HOH G 6 .   ? 93.542  54.463 8.793   1.00 69.58  ? 2023 HOH A O    1 
HETATM 2818 O  O    . HOH G 6 .   ? 101.806 56.539 9.163   1.00 64.57  ? 2024 HOH A O    1 
HETATM 2819 O  O    . HOH G 6 .   ? 101.889 56.979 18.495  1.00 81.62  ? 2025 HOH A O    1 
HETATM 2820 O  O    . HOH G 6 .   ? 101.983 61.795 12.926  1.00 65.67  ? 2026 HOH A O    1 
HETATM 2821 O  O    . HOH G 6 .   ? 103.590 57.872 22.222  1.00 66.87  ? 2027 HOH A O    1 
HETATM 2822 O  O    . HOH G 6 .   ? 91.498  61.502 30.016  1.00 69.63  ? 2028 HOH A O    1 
HETATM 2823 O  O    . HOH G 6 .   ? 74.670  49.981 -1.322  1.00 63.43  ? 2029 HOH A O    1 
HETATM 2824 O  O    . HOH G 6 .   ? 77.651  51.113 -8.478  1.00 62.05  ? 2030 HOH A O    1 
HETATM 2825 O  O    . HOH G 6 .   ? 83.700  71.435 28.374  1.00 92.10  ? 2031 HOH A O    1 
HETATM 2826 O  O    . HOH G 6 .   ? 98.499  58.246 8.843   1.00 60.05  ? 2032 HOH A O    1 
HETATM 2827 O  O    . HOH G 6 .   ? 99.325  77.212 1.929   1.00 58.66  ? 2033 HOH A O    1 
HETATM 2828 O  O    . HOH G 6 .   ? 91.914  72.494 5.026   1.00 77.59  ? 2034 HOH A O    1 
HETATM 2829 O  O    . HOH G 6 .   ? 92.724  75.346 6.363   1.00 79.43  ? 2035 HOH A O    1 
HETATM 2830 O  O    . HOH G 6 .   ? 93.400  75.939 -7.930  1.00 64.43  ? 2036 HOH A O    1 
HETATM 2831 O  O    . HOH G 6 .   ? 96.307  78.550 1.120   1.00 79.68  ? 2037 HOH A O    1 
HETATM 2832 O  O    . HOH G 6 .   ? 99.354  80.157 0.813   1.00 67.48  ? 2038 HOH A O    1 
HETATM 2833 O  O    . HOH G 6 .   ? 97.781  81.777 0.030   1.00 65.39  ? 2039 HOH A O    1 
HETATM 2834 O  O    . HOH G 6 .   ? 97.900  80.900 2.963   1.00 91.06  ? 2040 HOH A O    1 
HETATM 2835 O  O    . HOH G 6 .   ? 91.006  82.796 -0.894  1.00 80.65  ? 2041 HOH A O    1 
HETATM 2836 O  O    . HOH G 6 .   ? 101.560 71.047 -14.939 1.00 55.93  ? 2042 HOH A O    1 
HETATM 2837 O  O    . HOH G 6 .   ? 102.979 68.516 -14.070 1.00 63.34  ? 2043 HOH A O    1 
HETATM 2838 O  O    . HOH G 6 .   ? 102.688 71.181 -3.755  1.00 67.23  ? 2044 HOH A O    1 
HETATM 2839 O  O    . HOH G 6 .   ? 100.848 56.952 -1.045  1.00 63.98  ? 2045 HOH A O    1 
HETATM 2840 O  O    . HOH G 6 .   ? 98.469  54.273 -3.051  1.00 63.41  ? 2046 HOH A O    1 
HETATM 2841 O  O    . HOH G 6 .   ? 86.414  48.049 -3.812  1.00 71.60  ? 2047 HOH A O    1 
HETATM 2842 O  O    . HOH G 6 .   ? 92.799  46.145 5.499   1.00 74.76  ? 2048 HOH A O    1 
HETATM 2843 O  O    . HOH G 6 .   ? 88.277  44.595 2.781   1.00 65.94  ? 2049 HOH A O    1 
HETATM 2844 O  O    . HOH G 6 .   ? 82.293  64.759 8.099   1.00 70.73  ? 2050 HOH A O    1 
HETATM 2845 O  O    . HOH G 6 .   ? 81.478  66.487 1.204   1.00 76.99  ? 2051 HOH A O    1 
HETATM 2846 O  O    . HOH G 6 .   ? 79.613  67.282 5.638   1.00 100.16 ? 2052 HOH A O    1 
HETATM 2847 O  O    . HOH G 6 .   ? 80.954  68.746 3.780   1.00 101.95 ? 2053 HOH A O    1 
HETATM 2848 O  O    . HOH G 6 .   ? 81.332  62.226 -0.892  1.00 53.72  ? 2054 HOH A O    1 
HETATM 2849 O  O    . HOH G 6 .   ? 82.750  71.563 7.969   1.00 74.20  ? 2055 HOH A O    1 
HETATM 2850 O  O    . HOH G 6 .   ? 102.183 57.442 6.445   1.00 72.47  ? 2056 HOH A O    1 
HETATM 2851 O  O    . HOH G 6 .   ? 98.190  56.227 6.925   1.00 69.11  ? 2057 HOH A O    1 
HETATM 2852 O  O    . HOH G 6 .   ? 82.793  60.936 6.738   1.00 62.92  ? 2058 HOH A O    1 
HETATM 2853 O  O    . HOH G 6 .   ? 78.004  51.982 9.289   1.00 70.60  ? 2059 HOH A O    1 
HETATM 2854 O  O    . HOH G 6 .   ? 72.483  51.599 4.369   1.00 62.15  ? 2060 HOH A O    1 
HETATM 2855 O  O    . HOH G 6 .   ? 68.199  51.885 0.434   1.00 69.80  ? 2061 HOH A O    1 
HETATM 2856 O  O    . HOH G 6 .   ? 70.956  52.238 0.696   1.00 90.60  ? 2062 HOH A O    1 
HETATM 2857 O  O    . HOH G 6 .   ? 65.398  62.964 1.298   1.00 72.92  ? 2063 HOH A O    1 
HETATM 2858 O  O    . HOH G 6 .   ? 66.764  62.158 4.130   1.00 76.10  ? 2064 HOH A O    1 
HETATM 2859 O  O    . HOH G 6 .   ? 78.346  65.019 5.176   1.00 54.77  ? 2065 HOH A O    1 
HETATM 2860 O  O    . HOH G 6 .   ? 70.997  69.534 2.088   1.00 42.42  ? 2066 HOH A O    1 
HETATM 2861 O  O    . HOH G 6 .   ? 70.200  72.402 2.845   1.00 49.88  ? 2067 HOH A O    1 
HETATM 2862 O  O    . HOH G 6 .   ? 80.181  73.036 -0.854  1.00 70.59  ? 2068 HOH A O    1 
HETATM 2863 O  O    . HOH G 6 .   ? 81.440  71.564 -7.634  1.00 46.44  ? 2069 HOH A O    1 
HETATM 2864 O  O    . HOH G 6 .   ? 78.074  68.373 -7.257  1.00 53.79  ? 2070 HOH A O    1 
HETATM 2865 O  O    . HOH G 6 .   ? 74.201  68.778 2.009   1.00 57.09  ? 2071 HOH A O    1 
HETATM 2866 O  O    . HOH G 6 .   ? 74.129  56.452 -5.963  1.00 50.74  ? 2072 HOH A O    1 
HETATM 2867 O  O    . HOH G 6 .   ? 72.369  51.324 -1.750  1.00 62.23  ? 2073 HOH A O    1 
HETATM 2868 O  O    . HOH G 6 .   ? 75.616  53.149 -8.511  1.00 65.45  ? 2074 HOH A O    1 
HETATM 2869 O  O    . HOH G 6 .   ? 80.546  50.063 -1.267  1.00 53.31  ? 2075 HOH A O    1 
HETATM 2870 O  O    . HOH G 6 .   ? 76.857  51.271 -2.377  1.00 59.22  ? 2076 HOH A O    1 
HETATM 2871 O  O    . HOH G 6 .   ? 77.922  49.929 -0.186  1.00 70.49  ? 2077 HOH A O    1 
HETATM 2872 O  O    . HOH G 6 .   ? 78.140  63.086 -3.186  1.00 52.28  ? 2078 HOH A O    1 
HETATM 2873 O  O    . HOH G 6 .   ? 84.051  71.241 -7.650  1.00 49.71  ? 2079 HOH A O    1 
HETATM 2874 O  O    . HOH G 6 .   ? 90.727  74.834 -7.295  1.00 64.10  ? 2080 HOH A O    1 
HETATM 2875 O  O    . HOH G 6 .   ? 89.784  76.511 -5.457  1.00 55.72  ? 2081 HOH A O    1 
HETATM 2876 O  O    . HOH G 6 .   ? 77.919  77.698 -5.515  1.00 83.11  ? 2082 HOH A O    1 
HETATM 2877 O  O    . HOH G 6 .   ? 73.372  80.345 -7.354  1.00 72.82  ? 2083 HOH A O    1 
HETATM 2878 O  O    . HOH G 6 .   ? 70.327  80.841 -5.646  1.00 89.75  ? 2084 HOH A O    1 
HETATM 2879 O  O    . HOH G 6 .   ? 62.901  60.308 -21.107 1.00 72.96  ? 2085 HOH A O    1 
HETATM 2880 O  O    . HOH G 6 .   ? 69.884  56.654 -5.978  1.00 65.37  ? 2086 HOH A O    1 
HETATM 2881 O  O    . HOH G 6 .   ? 55.915  71.503 -11.565 1.00 59.61  ? 2087 HOH A O    1 
HETATM 2882 O  O    . HOH G 6 .   ? 95.521  63.648 -22.068 1.00 83.53  ? 2088 HOH A O    1 
HETATM 2883 O  O    . HOH G 6 .   ? 79.751  62.992 -18.111 1.00 71.97  ? 2089 HOH A O    1 
HETATM 2884 O  O    . HOH G 6 .   ? 75.592  61.115 -17.601 1.00 58.33  ? 2090 HOH A O    1 
HETATM 2885 O  O    . HOH G 6 .   ? 74.302  58.710 -17.102 1.00 65.32  ? 2091 HOH A O    1 
HETATM 2886 O  O    . HOH G 6 .   ? 79.378  53.450 -10.410 1.00 65.27  ? 2092 HOH A O    1 
HETATM 2887 O  O    . HOH G 6 .   ? 86.185  48.060 -10.677 1.00 65.72  ? 2093 HOH A O    1 
HETATM 2888 O  O    . HOH G 6 .   ? 87.114  50.060 -6.982  1.00 58.37  ? 2094 HOH A O    1 
HETATM 2889 O  O    . HOH G 6 .   ? 82.575  48.339 -14.226 1.00 70.79  ? 2095 HOH A O    1 
HETATM 2890 O  O    . HOH G 6 .   ? 103.736 66.215 -15.847 1.00 60.92  ? 2096 HOH A O    1 
HETATM 2891 O  O    . HOH G 6 .   ? 106.511 66.878 -4.186  1.00 85.34  ? 2097 HOH A O    1 
HETATM 2892 O  O    . HOH G 6 .   ? 93.065  39.896 -6.507  1.00 74.70  ? 2098 HOH A O    1 
HETATM 2893 O  O    . HOH G 6 .   ? 94.438  45.608 1.542   1.00 64.25  ? 2099 HOH A O    1 
HETATM 2894 O  O    . HOH G 6 .   ? 88.610  44.564 -3.694  1.00 56.67  ? 2100 HOH A O    1 
HETATM 2895 O  O    . HOH G 6 .   ? 86.757  47.438 -8.060  1.00 52.97  ? 2101 HOH A O    1 
HETATM 2896 O  O    . HOH G 6 .   ? 98.719  52.117 -11.228 1.00 67.63  ? 2102 HOH A O    1 
HETATM 2897 O  O    . HOH G 6 .   ? 107.189 49.413 -17.270 1.00 81.03  ? 2103 HOH A O    1 
HETATM 2898 O  O    . HOH G 6 .   ? 90.327  70.955 6.985   1.00 61.84  ? 2104 HOH A O    1 
HETATM 2899 O  O    . HOH G 6 .   ? 81.703  54.332 -9.025  1.00 54.51  ? 2105 HOH A O    1 
HETATM 2900 O  O    . HOH G 6 .   ? 84.577  49.817 -4.894  1.00 67.80  ? 2106 HOH A O    1 
HETATM 2901 O  O    . HOH G 6 .   ? 77.847  51.892 -6.220  1.00 84.78  ? 2107 HOH A O    1 
HETATM 2902 O  O    . HOH G 6 .   ? 81.043  49.111 -3.886  1.00 60.33  ? 2108 HOH A O    1 
HETATM 2903 O  O    . HOH G 6 .   ? 83.035  66.255 10.672  1.00 78.65  ? 2109 HOH A O    1 
HETATM 2904 O  O    . HOH G 6 .   ? 81.923  68.478 6.189   1.00 60.46  ? 2110 HOH A O    1 
HETATM 2905 O  O    . HOH G 6 .   ? 84.087  68.361 7.387   1.00 78.60  ? 2111 HOH A O    1 
HETATM 2906 O  O    . HOH G 6 .   ? 79.692  67.522 7.944   1.00 99.35  ? 2112 HOH A O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   35  35  SER SER A . n 
A 1 2   LYS 2   36  36  LYS LYS A . n 
A 1 3   VAL 3   37  37  VAL VAL A . n 
A 1 4   THR 4   38  38  THR THR A . n 
A 1 5   THR 5   39  39  THR THR A . n 
A 1 6   VAL 6   40  40  VAL VAL A . n 
A 1 7   VAL 7   41  41  VAL VAL A . n 
A 1 8   ALA 8   42  42  ALA ALA A . n 
A 1 9   THR 9   43  43  THR THR A . n 
A 1 10  PRO 10  44  44  PRO PRO A . n 
A 1 11  GLY 11  45  45  GLY GLY A . n 
A 1 12  GLN 12  46  46  GLN GLN A . n 
A 1 13  GLY 13  47  47  GLY GLY A . n 
A 1 14  PRO 14  48  48  PRO PRO A . n 
A 1 15  ASP 15  49  49  ASP ASP A . n 
A 1 16  ARG 16  50  50  ARG ARG A . n 
A 1 17  PRO 17  51  51  PRO PRO A . n 
A 1 18  GLN 18  52  52  GLN GLN A . n 
A 1 19  GLU 19  53  53  GLU GLU A . n 
A 1 20  VAL 20  54  54  VAL VAL A . n 
A 1 21  SER 21  55  55  SER SER A . n 
A 1 22  TYR 22  56  56  TYR TYR A . n 
A 1 23  THR 23  57  57  THR THR A . n 
A 1 24  ASP 24  58  58  ASP ASP A . n 
A 1 25  THR 25  59  59  THR THR A . n 
A 1 26  LYS 26  60  60  LYS LYS A . n 
A 1 27  VAL 27  61  61  VAL VAL A . n 
A 1 28  ILE 28  62  62  ILE ILE A . n 
A 1 29  GLY 29  63  63  GLY GLY A . n 
A 1 30  ASN 30  64  64  ASN ASN A . n 
A 1 31  GLY 31  65  65  GLY GLY A . n 
A 1 32  SER 32  66  66  SER SER A . n 
A 1 33  PHE 33  67  67  PHE PHE A . n 
A 1 34  GLY 34  68  68  GLY GLY A . n 
A 1 35  VAL 35  69  69  VAL VAL A . n 
A 1 36  VAL 36  70  70  VAL VAL A . n 
A 1 37  TYR 37  71  71  TYR TYR A . n 
A 1 38  GLN 38  72  72  GLN GLN A . n 
A 1 39  ALA 39  73  73  ALA ALA A . n 
A 1 40  LYS 40  74  74  LYS LYS A . n 
A 1 41  LEU 41  75  75  LEU LEU A . n 
A 1 42  CYS 42  76  76  CYS CYS A . n 
A 1 43  ASP 43  77  77  ASP ASP A . n 
A 1 44  SER 44  78  78  SER SER A . n 
A 1 45  GLY 45  79  79  GLY GLY A . n 
A 1 46  GLU 46  80  80  GLU GLU A . n 
A 1 47  LEU 47  81  81  LEU LEU A . n 
A 1 48  VAL 48  82  82  VAL VAL A . n 
A 1 49  ALA 49  83  83  ALA ALA A . n 
A 1 50  ILE 50  84  84  ILE ILE A . n 
A 1 51  LYS 51  85  85  LYS LYS A . n 
A 1 52  LYS 52  86  86  LYS LYS A . n 
A 1 53  VAL 53  87  87  VAL VAL A . n 
A 1 54  LEU 54  88  88  LEU LEU A . n 
A 1 55  GLN 55  89  89  GLN GLN A . n 
A 1 56  GLY 56  90  90  GLY GLY A . n 
A 1 57  LYS 57  91  91  LYS LYS A . n 
A 1 58  ALA 58  92  92  ALA ALA A . n 
A 1 59  PHE 59  93  93  PHE PHE A . n 
A 1 60  LYS 60  94  94  LYS LYS A . n 
A 1 61  ASN 61  95  95  ASN ASN A . n 
A 1 62  ARG 62  96  96  ARG ARG A . n 
A 1 63  GLU 63  97  97  GLU GLU A . n 
A 1 64  LEU 64  98  98  LEU LEU A . n 
A 1 65  GLN 65  99  99  GLN GLN A . n 
A 1 66  ILE 66  100 100 ILE ILE A . n 
A 1 67  MET 67  101 101 MET MET A . n 
A 1 68  ARG 68  102 102 ARG ARG A . n 
A 1 69  LYS 69  103 103 LYS LYS A . n 
A 1 70  LEU 70  104 104 LEU LEU A . n 
A 1 71  ASP 71  105 105 ASP ASP A . n 
A 1 72  HIS 72  106 106 HIS HIS A . n 
A 1 73  CYS 73  107 107 CYS CYS A . n 
A 1 74  ASN 74  108 108 ASN ASN A . n 
A 1 75  ILE 75  109 109 ILE ILE A . n 
A 1 76  VAL 76  110 110 VAL VAL A . n 
A 1 77  ARG 77  111 111 ARG ARG A . n 
A 1 78  LEU 78  112 112 LEU LEU A . n 
A 1 79  ARG 79  113 113 ARG ARG A . n 
A 1 80  TYR 80  114 114 TYR TYR A . n 
A 1 81  PHE 81  115 115 PHE PHE A . n 
A 1 82  PHE 82  116 116 PHE PHE A . n 
A 1 83  TYR 83  117 117 TYR TYR A . n 
A 1 84  SER 84  118 118 SER SER A . n 
A 1 85  SER 85  119 119 SER SER A . n 
A 1 86  GLY 86  120 120 GLY GLY A . n 
A 1 87  GLU 87  121 121 GLU GLU A . n 
A 1 88  LYS 88  122 122 LYS LYS A . n 
A 1 89  LYS 89  123 123 LYS LYS A . n 
A 1 90  ASP 90  124 124 ASP ASP A . n 
A 1 91  GLU 91  125 125 GLU GLU A . n 
A 1 92  VAL 92  126 126 VAL VAL A . n 
A 1 93  TYR 93  127 127 TYR TYR A . n 
A 1 94  LEU 94  128 128 LEU LEU A . n 
A 1 95  ASN 95  129 129 ASN ASN A . n 
A 1 96  LEU 96  130 130 LEU LEU A . n 
A 1 97  VAL 97  131 131 VAL VAL A . n 
A 1 98  LEU 98  132 132 LEU LEU A . n 
A 1 99  ASP 99  133 133 ASP ASP A . n 
A 1 100 TYR 100 134 134 TYR TYR A . n 
A 1 101 VAL 101 135 135 VAL VAL A . n 
A 1 102 PRO 102 136 136 PRO PRO A . n 
A 1 103 GLU 103 137 137 GLU GLU A . n 
A 1 104 THR 104 138 138 THR THR A . n 
A 1 105 VAL 105 139 139 VAL VAL A . n 
A 1 106 TYR 106 140 140 TYR TYR A . n 
A 1 107 ARG 107 141 141 ARG ARG A . n 
A 1 108 VAL 108 142 142 VAL VAL A . n 
A 1 109 ALA 109 143 143 ALA ALA A . n 
A 1 110 ARG 110 144 144 ARG ARG A . n 
A 1 111 HIS 111 145 145 HIS HIS A . n 
A 1 112 TYR 112 146 146 TYR TYR A . n 
A 1 113 SER 113 147 147 SER SER A . n 
A 1 114 ARG 114 148 148 ARG ARG A . n 
A 1 115 ALA 115 149 149 ALA ALA A . n 
A 1 116 LYS 116 150 150 LYS LYS A . n 
A 1 117 GLN 117 151 151 GLN GLN A . n 
A 1 118 THR 118 152 152 THR THR A . n 
A 1 119 LEU 119 153 153 LEU LEU A . n 
A 1 120 PRO 120 154 154 PRO PRO A . n 
A 1 121 VAL 121 155 155 VAL VAL A . n 
A 1 122 ILE 122 156 156 ILE ILE A . n 
A 1 123 TYR 123 157 157 TYR TYR A . n 
A 1 124 VAL 124 158 158 VAL VAL A . n 
A 1 125 LYS 125 159 159 LYS LYS A . n 
A 1 126 LEU 126 160 160 LEU LEU A . n 
A 1 127 TYR 127 161 161 TYR TYR A . n 
A 1 128 MET 128 162 162 MET MET A . n 
A 1 129 TYR 129 163 163 TYR TYR A . n 
A 1 130 GLN 130 164 164 GLN GLN A . n 
A 1 131 LEU 131 165 165 LEU LEU A . n 
A 1 132 PHE 132 166 166 PHE PHE A . n 
A 1 133 ARG 133 167 167 ARG ARG A . n 
A 1 134 SER 134 168 168 SER SER A . n 
A 1 135 LEU 135 169 169 LEU LEU A . n 
A 1 136 ALA 136 170 170 ALA ALA A . n 
A 1 137 TYR 137 171 171 TYR TYR A . n 
A 1 138 ILE 138 172 172 ILE ILE A . n 
A 1 139 HIS 139 173 173 HIS HIS A . n 
A 1 140 SER 140 174 174 SER SER A . n 
A 1 141 PHE 141 175 175 PHE PHE A . n 
A 1 142 GLY 142 176 176 GLY GLY A . n 
A 1 143 ILE 143 177 177 ILE ILE A . n 
A 1 144 CYS 144 178 178 CYS CYS A . n 
A 1 145 HIS 145 179 179 HIS HIS A . n 
A 1 146 ARG 146 180 180 ARG ARG A . n 
A 1 147 ASP 147 181 181 ASP ASP A . n 
A 1 148 ILE 148 182 182 ILE ILE A . n 
A 1 149 LYS 149 183 183 LYS LYS A . n 
A 1 150 PRO 150 184 184 PRO PRO A . n 
A 1 151 GLN 151 185 185 GLN GLN A . n 
A 1 152 ASN 152 186 186 ASN ASN A . n 
A 1 153 LEU 153 187 187 LEU LEU A . n 
A 1 154 LEU 154 188 188 LEU LEU A . n 
A 1 155 LEU 155 189 189 LEU LEU A . n 
A 1 156 ASP 156 190 190 ASP ASP A . n 
A 1 157 PRO 157 191 191 PRO PRO A . n 
A 1 158 ASP 158 192 192 ASP ASP A . n 
A 1 159 THR 159 193 193 THR THR A . n 
A 1 160 ALA 160 194 194 ALA ALA A . n 
A 1 161 VAL 161 195 195 VAL VAL A . n 
A 1 162 LEU 162 196 196 LEU LEU A . n 
A 1 163 LYS 163 197 197 LYS LYS A . n 
A 1 164 LEU 164 198 198 LEU LEU A . n 
A 1 165 CYS 165 199 199 CYS CYS A . n 
A 1 166 ASP 166 200 200 ASP ASP A . n 
A 1 167 PHE 167 201 201 PHE PHE A . n 
A 1 168 GLY 168 202 202 GLY GLY A . n 
A 1 169 SER 169 203 203 SER SER A . n 
A 1 170 ALA 170 204 204 ALA ALA A . n 
A 1 171 LYS 171 205 205 LYS LYS A . n 
A 1 172 GLN 172 206 206 GLN GLN A . n 
A 1 173 LEU 173 207 207 LEU LEU A . n 
A 1 174 VAL 174 208 208 VAL VAL A . n 
A 1 175 ARG 175 209 209 ARG ARG A . n 
A 1 176 GLY 176 210 210 GLY GLY A . n 
A 1 177 GLU 177 211 211 GLU GLU A . n 
A 1 178 PRO 178 212 212 PRO PRO A . n 
A 1 179 ASN 179 213 213 ASN ASN A . n 
A 1 180 VAL 180 214 214 VAL VAL A . n 
A 1 181 SER 181 215 215 SER SER A . n 
A 1 182 TYR 182 216 216 TYR TYR A . n 
A 1 183 ILE 183 217 217 ILE ILE A . n 
A 1 184 CYS 184 218 218 CYS CYS A . n 
A 1 185 SER 185 219 219 SER SER A . n 
A 1 186 ARG 186 220 220 ARG ARG A . n 
A 1 187 TYR 187 221 221 TYR TYR A . n 
A 1 188 TYR 188 222 222 TYR TYR A . n 
A 1 189 ARG 189 223 223 ARG ARG A . n 
A 1 190 ALA 190 224 224 ALA ALA A . n 
A 1 191 PRO 191 225 225 PRO PRO A . n 
A 1 192 GLU 192 226 226 GLU GLU A . n 
A 1 193 LEU 193 227 227 LEU LEU A . n 
A 1 194 ILE 194 228 228 ILE ILE A . n 
A 1 195 PHE 195 229 229 PHE PHE A . n 
A 1 196 GLY 196 230 230 GLY GLY A . n 
A 1 197 ALA 197 231 231 ALA ALA A . n 
A 1 198 THR 198 232 232 THR THR A . n 
A 1 199 ASP 199 233 233 ASP ASP A . n 
A 1 200 TYR 200 234 234 TYR TYR A . n 
A 1 201 THR 201 235 235 THR THR A . n 
A 1 202 SER 202 236 236 SER SER A . n 
A 1 203 SER 203 237 237 SER SER A . n 
A 1 204 ILE 204 238 238 ILE ILE A . n 
A 1 205 ASP 205 239 239 ASP ASP A . n 
A 1 206 VAL 206 240 240 VAL VAL A . n 
A 1 207 TRP 207 241 241 TRP TRP A . n 
A 1 208 SER 208 242 242 SER SER A . n 
A 1 209 ALA 209 243 243 ALA ALA A . n 
A 1 210 GLY 210 244 244 GLY GLY A . n 
A 1 211 CYS 211 245 245 CYS CYS A . n 
A 1 212 VAL 212 246 246 VAL VAL A . n 
A 1 213 LEU 213 247 247 LEU LEU A . n 
A 1 214 ALA 214 248 248 ALA ALA A . n 
A 1 215 GLU 215 249 249 GLU GLU A . n 
A 1 216 LEU 216 250 250 LEU LEU A . n 
A 1 217 LEU 217 251 251 LEU LEU A . n 
A 1 218 LEU 218 252 252 LEU LEU A . n 
A 1 219 GLY 219 253 253 GLY GLY A . n 
A 1 220 GLN 220 254 254 GLN GLN A . n 
A 1 221 PRO 221 255 255 PRO PRO A . n 
A 1 222 ILE 222 256 256 ILE ILE A . n 
A 1 223 PHE 223 257 257 PHE PHE A . n 
A 1 224 PRO 224 258 258 PRO PRO A . n 
A 1 225 GLY 225 259 259 GLY GLY A . n 
A 1 226 ASP 226 260 260 ASP ASP A . n 
A 1 227 SER 227 261 261 SER SER A . n 
A 1 228 GLY 228 262 262 GLY GLY A . n 
A 1 229 VAL 229 263 263 VAL VAL A . n 
A 1 230 ASP 230 264 264 ASP ASP A . n 
A 1 231 GLN 231 265 265 GLN GLN A . n 
A 1 232 LEU 232 266 266 LEU LEU A . n 
A 1 233 VAL 233 267 267 VAL VAL A . n 
A 1 234 GLU 234 268 268 GLU GLU A . n 
A 1 235 ILE 235 269 269 ILE ILE A . n 
A 1 236 ILE 236 270 270 ILE ILE A . n 
A 1 237 LYS 237 271 271 LYS LYS A . n 
A 1 238 VAL 238 272 272 VAL VAL A . n 
A 1 239 LEU 239 273 273 LEU LEU A . n 
A 1 240 GLY 240 274 274 GLY GLY A . n 
A 1 241 THR 241 275 275 THR THR A . n 
A 1 242 PRO 242 276 276 PRO PRO A . n 
A 1 243 THR 243 277 277 THR THR A . n 
A 1 244 ARG 244 278 278 ARG ARG A . n 
A 1 245 GLU 245 279 279 GLU GLU A . n 
A 1 246 GLN 246 280 280 GLN GLN A . n 
A 1 247 ILE 247 281 281 ILE ILE A . n 
A 1 248 ARG 248 282 282 ARG ARG A . n 
A 1 249 GLU 249 283 283 GLU GLU A . n 
A 1 250 MET 250 284 284 MET MET A . n 
A 1 251 ASN 251 285 285 ASN ASN A . n 
A 1 252 PRO 252 286 286 PRO PRO A . n 
A 1 253 ASN 253 287 287 ASN ASN A . n 
A 1 254 TYR 254 288 288 TYR TYR A . n 
A 1 255 THR 255 289 289 THR THR A . n 
A 1 256 GLU 256 290 290 GLU GLU A . n 
A 1 257 PHE 257 291 291 PHE PHE A . n 
A 1 258 LYS 258 292 292 LYS LYS A . n 
A 1 259 PHE 259 293 293 PHE PHE A . n 
A 1 260 PRO 260 294 294 PRO PRO A . n 
A 1 261 GLN 261 295 295 GLN GLN A . n 
A 1 262 ILE 262 296 296 ILE ILE A . n 
A 1 263 LYS 263 297 297 LYS LYS A . n 
A 1 264 ALA 264 298 298 ALA ALA A . n 
A 1 265 HIS 265 299 299 HIS HIS A . n 
A 1 266 PRO 266 300 300 PRO PRO A . n 
A 1 267 TRP 267 301 301 TRP TRP A . n 
A 1 268 THR 268 302 302 THR THR A . n 
A 1 269 LYS 269 303 303 LYS LYS A . n 
A 1 270 VAL 270 304 304 VAL VAL A . n 
A 1 271 PHE 271 305 305 PHE PHE A . n 
A 1 272 ARG 272 306 306 ARG ARG A . n 
A 1 273 PRO 273 307 307 PRO PRO A . n 
A 1 274 ARG 274 308 308 ARG ARG A . n 
A 1 275 THR 275 309 309 THR THR A . n 
A 1 276 PRO 276 310 310 PRO PRO A . n 
A 1 277 PRO 277 311 311 PRO PRO A . n 
A 1 278 GLU 278 312 312 GLU GLU A . n 
A 1 279 ALA 279 313 313 ALA ALA A . n 
A 1 280 ILE 280 314 314 ILE ILE A . n 
A 1 281 ALA 281 315 315 ALA ALA A . n 
A 1 282 LEU 282 316 316 LEU LEU A . n 
A 1 283 CYS 283 317 317 CYS CYS A . n 
A 1 284 SER 284 318 318 SER SER A . n 
A 1 285 ARG 285 319 319 ARG ARG A . n 
A 1 286 LEU 286 320 320 LEU LEU A . n 
A 1 287 LEU 287 321 321 LEU LEU A . n 
A 1 288 GLU 288 322 322 GLU GLU A . n 
A 1 289 TYR 289 323 323 TYR TYR A . n 
A 1 290 THR 290 324 324 THR THR A . n 
A 1 291 PRO 291 325 325 PRO PRO A . n 
A 1 292 THR 292 326 326 THR THR A . n 
A 1 293 ALA 293 327 327 ALA ALA A . n 
A 1 294 ARG 294 328 328 ARG ARG A . n 
A 1 295 LEU 295 329 329 LEU LEU A . n 
A 1 296 THR 296 330 330 THR THR A . n 
A 1 297 PRO 297 331 331 PRO PRO A . n 
A 1 298 LEU 298 332 332 LEU LEU A . n 
A 1 299 GLU 299 333 333 GLU GLU A . n 
A 1 300 ALA 300 334 334 ALA ALA A . n 
A 1 301 CYS 301 335 335 CYS CYS A . n 
A 1 302 ALA 302 336 336 ALA ALA A . n 
A 1 303 HIS 303 337 337 HIS HIS A . n 
A 1 304 SER 304 338 338 SER SER A . n 
A 1 305 PHE 305 339 339 PHE PHE A . n 
A 1 306 PHE 306 340 340 PHE PHE A . n 
A 1 307 ASP 307 341 341 ASP ASP A . n 
A 1 308 GLU 308 342 342 GLU GLU A . n 
A 1 309 LEU 309 343 343 LEU LEU A . n 
A 1 310 ARG 310 344 344 ARG ARG A . n 
A 1 311 ASP 311 345 345 ASP ASP A . n 
A 1 312 PRO 312 346 346 PRO PRO A . n 
A 1 313 ASN 313 347 347 ASN ASN A . n 
A 1 314 VAL 314 348 348 VAL VAL A . n 
A 1 315 LYS 315 349 349 LYS LYS A . n 
A 1 316 LEU 316 350 350 LEU LEU A . n 
A 1 317 PRO 317 351 351 PRO PRO A . n 
A 1 318 ASN 318 352 352 ASN ASN A . n 
A 1 319 GLY 319 353 353 GLY GLY A . n 
A 1 320 ARG 320 354 354 ARG ARG A . n 
A 1 321 ASP 321 355 355 ASP ASP A . n 
A 1 322 THR 322 356 356 THR THR A . n 
A 1 323 PRO 323 357 357 PRO PRO A . n 
A 1 324 ALA 324 358 358 ALA ALA A . n 
A 1 325 LEU 325 359 359 LEU LEU A . n 
A 1 326 PHE 326 360 360 PHE PHE A . n 
A 1 327 ASN 327 361 361 ASN ASN A . n 
A 1 328 PHE 328 362 362 PHE PHE A . n 
A 1 329 THR 329 363 363 THR THR A . n 
A 1 330 THR 330 364 364 THR THR A . n 
A 1 331 GLN 331 365 365 GLN GLN A . n 
A 1 332 GLU 332 366 366 GLU GLU A . n 
A 1 333 LEU 333 367 367 LEU LEU A . n 
A 1 334 SER 334 368 368 SER SER A . n 
A 1 335 SER 335 369 369 SER SER A . n 
A 1 336 ASN 336 370 370 ASN ASN A . n 
A 1 337 PRO 337 371 371 PRO PRO A . n 
A 1 338 PRO 338 372 372 PRO PRO A . n 
A 1 339 LEU 339 373 373 LEU LEU A . n 
A 1 340 ALA 340 374 374 ALA ALA A . n 
A 1 341 THR 341 375 375 THR THR A . n 
A 1 342 ILE 342 376 376 ILE ILE A . n 
A 1 343 LEU 343 377 377 LEU LEU A . n 
A 1 344 ILE 344 378 378 ILE ILE A . n 
A 1 345 PRO 345 379 379 PRO PRO A . n 
A 1 346 PRO 346 380 380 PRO PRO A . n 
A 1 347 HIS 347 381 381 HIS HIS A . n 
A 1 348 ALA 348 382 382 ALA ALA A . n 
A 1 349 ARG 349 383 383 ARG ARG A . n 
A 1 350 ILE 350 384 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z  1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O ? G HOH . ? A HOH 2111 ? 1_555 CO ? E CO . ? A CO 1386 ? 1_555 O ? G HOH . ? A HOH 2112 ? 1_555 127.3 ? 
2 O ? G HOH . ? A HOH 2111 ? 1_555 CO ? E CO . ? A CO 1386 ? 1_555 O ? G HOH . ? A HOH 2110 ? 1_555 56.8  ? 
3 O ? G HOH . ? A HOH 2112 ? 1_555 CO ? E CO . ? A CO 1386 ? 1_555 O ? G HOH . ? A HOH 2110 ? 1_555 72.2  ? 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2004-01-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.1 ? 1 
MOSFLM 'data reduction' .   ? 2 
SCALA  'data scaling'   .   ? 3 
AMoRE  phasing          .   ? 4 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;
SHEET
DETERMINATION METHOD: DSSP
THE SHEETS PRESENTED AS "AA" IN EACH CHAIN ON SHEET RECORDS
BELOW IS ACTUALLY AN  7-STRANDED BARREL THIS IS REPRESENTED BY
A  8-STRANDED SHEET IN WHICH THE FIRST AND LAST STRANDS
ARE IDENTICAL.
;
# 
_pdbx_entry_details.entry_id             1UV5 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;HIS 350 IN SWISS-PROT SHOULD BE LEU. THIS CONFLICT HAS
BEEN DESCRIBED IN UNIPROT ENTRY P49841
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 N A GLY 259 ? ? O A HOH 2082 ? ? 2.10 
2 1 O A ARG 50  ? ? O A HOH 2006 ? ? 2.16 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A VAL 135 ? ? N  A PRO 136 ? ? CA  A PRO 136 ? ? 131.11 119.30 11.81  1.50 Y 
2 1 NE A ARG 141 ? ? CZ A ARG 141 ? ? NH2 A ARG 141 ? ? 117.20 120.30 -3.10  0.50 N 
3 1 C  A GLU 211 ? ? N  A PRO 212 ? ? CA  A PRO 212 ? ? 128.42 119.30 9.12   1.50 Y 
4 1 C  A PHE 293 ? ? N  A PRO 294 ? ? CA  A PRO 294 ? ? 129.31 119.30 10.01  1.50 Y 
5 1 C  A PHE 293 ? ? N  A PRO 294 ? ? CD  A PRO 294 ? ? 114.95 128.40 -13.45 2.10 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 91  ? ? 62.06   -22.31  
2  1 ASP A 105 ? ? -173.98 99.42   
3  1 CYS A 107 ? ? -59.29  -8.68   
4  1 ASP A 124 ? ? 37.70   63.47   
5  1 GLU A 125 ? ? -159.55 83.66   
6  1 ASP A 181 ? ? -149.26 41.19   
7  1 PRO A 191 ? ? -37.66  -34.38  
8  1 ASP A 200 ? ? 59.35   81.04   
9  1 CYS A 218 ? ? 85.56   133.89  
10 1 ARG A 220 ? ? -21.78  -65.88  
11 1 PHE A 257 ? ? -119.59 72.10   
12 1 THR A 289 ? ? 77.34   113.57  
13 1 LYS A 292 ? ? -52.16  -110.11 
14 1 PHE A 293 ? ? 97.96   -104.91 
15 1 PRO A 294 ? ? 20.65   138.48  
16 1 GLN A 295 ? ? 118.89  117.47  
17 1 ILE A 296 ? ? 92.33   160.09  
18 1 LYS A 297 ? ? 179.04  150.23  
19 1 ALA A 298 ? ? 42.36   78.10   
20 1 VAL A 348 ? ? -19.71  130.69  
21 1 ASN A 352 ? ? -94.44  35.39   
22 1 PRO A 357 ? ? -62.37  -176.24 
23 1 LEU A 359 ? ? -142.81 -15.80  
24 1 ASN A 370 ? ? -172.11 63.39   
25 1 ALA A 382 ? ? -169.47 -40.62  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 121 ? CG  ? A GLU 87  CG  
2  1 Y 1 A GLU 121 ? CD  ? A GLU 87  CD  
3  1 Y 1 A GLU 121 ? OE1 ? A GLU 87  OE1 
4  1 Y 1 A GLU 121 ? OE2 ? A GLU 87  OE2 
5  1 Y 1 A LYS 122 ? CG  ? A LYS 88  CG  
6  1 Y 1 A LYS 122 ? CD  ? A LYS 88  CD  
7  1 Y 1 A LYS 122 ? CE  ? A LYS 88  CE  
8  1 Y 1 A LYS 122 ? NZ  ? A LYS 88  NZ  
9  1 Y 1 A LYS 123 ? CG  ? A LYS 89  CG  
10 1 Y 1 A LYS 123 ? CD  ? A LYS 89  CD  
11 1 Y 1 A LYS 123 ? CE  ? A LYS 89  CE  
12 1 Y 1 A LYS 123 ? NZ  ? A LYS 89  NZ  
13 1 Y 1 A LYS 292 ? CG  ? A LYS 258 CG  
14 1 Y 1 A LYS 292 ? CD  ? A LYS 258 CD  
15 1 Y 1 A LYS 292 ? CE  ? A LYS 258 CE  
16 1 Y 1 A LYS 292 ? NZ  ? A LYS 258 NZ  
17 1 Y 1 A ARG 383 ? CA  ? A ARG 349 CA  
18 1 Y 1 A ARG 383 ? C   ? A ARG 349 C   
19 1 Y 1 A ARG 383 ? O   ? A ARG 349 O   
20 1 Y 1 A ARG 383 ? CB  ? A ARG 349 CB  
21 1 Y 1 A ARG 383 ? CG  ? A ARG 349 CG  
22 1 Y 1 A ARG 383 ? CD  ? A ARG 349 CD  
23 1 Y 1 A ARG 383 ? NE  ? A ARG 349 NE  
24 1 Y 1 A ARG 383 ? CZ  ? A ARG 349 CZ  
25 1 Y 1 A ARG 383 ? NH1 ? A ARG 349 NH1 
26 1 Y 1 A ARG 383 ? NH2 ? A ARG 349 NH2 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     ILE 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      384 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    ILE 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     350 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "6-BROMOINDIRUBIN-3'-OXIME" BRW 
3 'PHOSPHATE ION'             PO4 
4 'CHLORIDE ION'              CL  
5 'COBALT (II) ION'           CO  
6 water                       HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 BRW 1   1383 1383 BRW BRW A . 
C 3 PO4 1   1384 1384 PO4 PO4 A . 
D 4 CL  1   1385 1385 CL  CL  A . 
E 5 CO  1   1386 1386 CO  CO  A . 
F 3 PO4 1   1387 1387 PO4 PO4 A . 
G 6 HOH 1   2001 2001 HOH HOH A . 
G 6 HOH 2   2002 2002 HOH HOH A . 
G 6 HOH 3   2003 2003 HOH HOH A . 
G 6 HOH 4   2004 2004 HOH HOH A . 
G 6 HOH 5   2005 2005 HOH HOH A . 
G 6 HOH 6   2006 2006 HOH HOH A . 
G 6 HOH 7   2007 2007 HOH HOH A . 
G 6 HOH 8   2008 2008 HOH HOH A . 
G 6 HOH 9   2009 2009 HOH HOH A . 
G 6 HOH 10  2010 2010 HOH HOH A . 
G 6 HOH 11  2011 2011 HOH HOH A . 
G 6 HOH 12  2012 2012 HOH HOH A . 
G 6 HOH 13  2013 2013 HOH HOH A . 
G 6 HOH 14  2014 2014 HOH HOH A . 
G 6 HOH 15  2015 2015 HOH HOH A . 
G 6 HOH 16  2016 2016 HOH HOH A . 
G 6 HOH 17  2017 2017 HOH HOH A . 
G 6 HOH 18  2018 2018 HOH HOH A . 
G 6 HOH 19  2019 2019 HOH HOH A . 
G 6 HOH 20  2020 2020 HOH HOH A . 
G 6 HOH 21  2021 2021 HOH HOH A . 
G 6 HOH 22  2022 2022 HOH HOH A . 
G 6 HOH 23  2023 2023 HOH HOH A . 
G 6 HOH 24  2024 2024 HOH HOH A . 
G 6 HOH 25  2025 2025 HOH HOH A . 
G 6 HOH 26  2026 2026 HOH HOH A . 
G 6 HOH 27  2027 2027 HOH HOH A . 
G 6 HOH 28  2028 2028 HOH HOH A . 
G 6 HOH 29  2029 2029 HOH HOH A . 
G 6 HOH 30  2030 2030 HOH HOH A . 
G 6 HOH 31  2031 2031 HOH HOH A . 
G 6 HOH 32  2032 2032 HOH HOH A . 
G 6 HOH 33  2033 2033 HOH HOH A . 
G 6 HOH 34  2034 2034 HOH HOH A . 
G 6 HOH 35  2035 2035 HOH HOH A . 
G 6 HOH 36  2036 2036 HOH HOH A . 
G 6 HOH 37  2037 2037 HOH HOH A . 
G 6 HOH 38  2038 2038 HOH HOH A . 
G 6 HOH 39  2039 2039 HOH HOH A . 
G 6 HOH 40  2040 2040 HOH HOH A . 
G 6 HOH 41  2041 2041 HOH HOH A . 
G 6 HOH 42  2042 2042 HOH HOH A . 
G 6 HOH 43  2043 2043 HOH HOH A . 
G 6 HOH 44  2044 2044 HOH HOH A . 
G 6 HOH 45  2045 2045 HOH HOH A . 
G 6 HOH 46  2046 2046 HOH HOH A . 
G 6 HOH 47  2047 2047 HOH HOH A . 
G 6 HOH 48  2048 2048 HOH HOH A . 
G 6 HOH 49  2049 2049 HOH HOH A . 
G 6 HOH 50  2050 2050 HOH HOH A . 
G 6 HOH 51  2051 2051 HOH HOH A . 
G 6 HOH 52  2052 2052 HOH HOH A . 
G 6 HOH 53  2053 2053 HOH HOH A . 
G 6 HOH 54  2054 2054 HOH HOH A . 
G 6 HOH 55  2055 2055 HOH HOH A . 
G 6 HOH 56  2056 2056 HOH HOH A . 
G 6 HOH 57  2057 2057 HOH HOH A . 
G 6 HOH 58  2058 2058 HOH HOH A . 
G 6 HOH 59  2059 2059 HOH HOH A . 
G 6 HOH 60  2060 2060 HOH HOH A . 
G 6 HOH 61  2061 2061 HOH HOH A . 
G 6 HOH 62  2062 2062 HOH HOH A . 
G 6 HOH 63  2063 2063 HOH HOH A . 
G 6 HOH 64  2064 2064 HOH HOH A . 
G 6 HOH 65  2065 2065 HOH HOH A . 
G 6 HOH 66  2066 2066 HOH HOH A . 
G 6 HOH 67  2067 2067 HOH HOH A . 
G 6 HOH 68  2068 2068 HOH HOH A . 
G 6 HOH 69  2069 2069 HOH HOH A . 
G 6 HOH 70  2070 2070 HOH HOH A . 
G 6 HOH 71  2071 2071 HOH HOH A . 
G 6 HOH 72  2072 2072 HOH HOH A . 
G 6 HOH 73  2073 2073 HOH HOH A . 
G 6 HOH 74  2074 2074 HOH HOH A . 
G 6 HOH 75  2075 2075 HOH HOH A . 
G 6 HOH 76  2076 2076 HOH HOH A . 
G 6 HOH 77  2077 2077 HOH HOH A . 
G 6 HOH 78  2078 2078 HOH HOH A . 
G 6 HOH 79  2079 2079 HOH HOH A . 
G 6 HOH 80  2080 2080 HOH HOH A . 
G 6 HOH 81  2081 2081 HOH HOH A . 
G 6 HOH 82  2082 2082 HOH HOH A . 
G 6 HOH 83  2083 2083 HOH HOH A . 
G 6 HOH 84  2084 2084 HOH HOH A . 
G 6 HOH 85  2085 2085 HOH HOH A . 
G 6 HOH 86  2086 2086 HOH HOH A . 
G 6 HOH 87  2087 2087 HOH HOH A . 
G 6 HOH 88  2088 2088 HOH HOH A . 
G 6 HOH 89  2089 2089 HOH HOH A . 
G 6 HOH 90  2090 2090 HOH HOH A . 
G 6 HOH 91  2091 2091 HOH HOH A . 
G 6 HOH 92  2092 2092 HOH HOH A . 
G 6 HOH 93  2093 2093 HOH HOH A . 
G 6 HOH 94  2094 2094 HOH HOH A . 
G 6 HOH 95  2095 2095 HOH HOH A . 
G 6 HOH 96  2096 2096 HOH HOH A . 
G 6 HOH 97  2097 2097 HOH HOH A . 
G 6 HOH 98  2098 2098 HOH HOH A . 
G 6 HOH 99  2099 2099 HOH HOH A . 
G 6 HOH 100 2100 2100 HOH HOH A . 
G 6 HOH 101 2101 2101 HOH HOH A . 
G 6 HOH 102 2102 2102 HOH HOH A . 
G 6 HOH 103 2103 2103 HOH HOH A . 
G 6 HOH 104 2104 2104 HOH HOH A . 
G 6 HOH 105 2105 2105 HOH HOH A . 
G 6 HOH 106 2106 2106 HOH HOH A . 
G 6 HOH 107 2107 2107 HOH HOH A . 
G 6 HOH 108 2108 2108 HOH HOH A . 
G 6 HOH 109 2109 2109 HOH HOH A . 
G 6 HOH 110 2110 2110 HOH HOH A . 
G 6 HOH 111 2111 2111 HOH HOH A . 
G 6 HOH 112 2112 2112 HOH HOH A . 
#