data_1UWB
# 
_entry.id   1UWB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1UWB         
WWPDB D_1000176990 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1UWB 
_pdbx_database_status.recvd_initial_deposition_date   1996-11-21 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Das, K.'    1 
'Ding, J.'   2 
'Hsiou, Y.'  3 
'Arnold, E.' 4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Crystal structures of 8-Cl and 9-Cl TIBO complexed with wild-type HIV-1 RT and 8-Cl TIBO complexed with the Tyr181Cys HIV-1 RT drug-resistant mutant.
;
J.Mol.Biol.            264 1085 1100 1996 JMOBAK UK 0022-2836 0070 ? 9000632 10.1006/jmbi.1996.0698 
1       
;Targeting HIV Reverse Transcriptase for Anti-Aids Drug Design: Structural and Biological Considerations for Chemotherapeutic Strategies
;
'Drug Des.Discovery'   13  29   ?    1996 DDDIEV SZ 1055-9612 2080 ? ?       ?                      
2       
;Structure of Unliganded HIV-1 Reverse Transcriptase at 2.7 A Resolution: Implications of Conformational Changes for Polymerization and Inhibition Mechanisms
;
Structure              4   853  ?    1996 STRUE6 UK 0969-2126 2005 ? ?       ?                      
3       'Insights Into DNA Polymerization Mechanisms from Structure and Function Analysis of HIV-1 Reverse Transcriptase' 
Biochemistry           34  5351 ?    1995 BICHAW US 0006-2960 0033 ? ?       ?                      
4       
'Structure of HIV-1 Reverse Transcriptase in a Complex with the Non-Nucleoside Inhibitor Alpha-Apa R 95845 at 2.8 A Resolution' 
Structure              3   365  ?    1995 STRUE6 UK 0969-2126 2005 ? ?       ?                      
5       'Structure of HIV-1 RT/TIBO R 86183 Complex Reveals Similarity in the Binding of Diverse Nonnucleoside Inhibitors' 
Nat.Struct.Biol.       2   407  ?    1995 NSBIEW US 1072-8368 2024 ? ?       ?                      
6       
;Locations of Anti-Aids Drug Binding Sites and Resistance Mutations in the Three-Dimensional Structure of HIV-1 Reverse Transcriptase. Implications for Mechanisms of Drug Inhibition and Resistance
;
J.Mol.Biol.            243 369  ?    1994 JMOBAK UK 0022-2836 0070 ? ?       ?                      
7       
;Crystal Structure of Human Immunodeficiency Virus Type 1 Reverse Transcriptase Complexed with Double-Stranded DNA at 3.0 A Resolution Shows Bent DNA
;
Proc.Natl.Acad.Sci.USA 90  6320 ?    1993 PNASA6 US 0027-8424 0040 ? ?       ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Das, K.'             1  
primary 'Ding, J.'            2  
primary 'Hsiou, Y.'           3  
primary 'Clark Jr., A.D.'     4  
primary 'Moereels, H.'        5  
primary 'Koymans, L.'         6  
primary 'Andries, K.'         7  
primary 'Pauwels, R.'         8  
primary 'Janssen, P.A.'       9  
primary 'Boyer, P.L.'         10 
primary 'Clark, P.'           11 
primary 'Smith Jr., R.H.'     12 
primary 'Kroeger Smith, M.B.' 13 
primary 'Michejda, C.J.'      14 
primary 'Hughes, S.H.'        15 
primary 'Arnold, E.'          16 
1       'Arnold, E.'          17 
1       'Das, K.'             18 
1       'Ding, J.'            19 
1       'Yadav, P.N.'         20 
1       'Hsiou, Y.'           21 
1       'Boyer, P.L.'         22 
1       'Hughes, S.H.'        23 
2       'Hsiou, Y.'           24 
2       'Ding, J.'            25 
2       'Das, K.'             26 
2       'Clark Junior, A.D.'  27 
2       'Hughes, S.H.'        28 
2       'Arnold, E.'          29 
3       'Patel, P.H.'         30 
3       'Jacobo-Molina, A.'   31 
3       'Ding, J.'            32 
3       'Tantillo, C.'        33 
3       'Clark Junior, A.D.'  34 
3       'Raag, R.'            35 
3       'Nanni, R.G.'         36 
3       'Hughes, S.H.'        37 
3       'Arnold, E.'          38 
4       'Ding, J.'            39 
4       'Das, K.'             40 
4       'Tantillo, C.'        41 
4       'Zhang, W.'           42 
4       'Clark Junior, A.D.'  43 
4       'Jessen, S.'          44 
4       'Lu, X.'              45 
4       'Hsiou, Y.'           46 
4       'Jacobo-Molina, A.'   47 
4       'Andries, K.'         48 
4       'al., et'             49 
5       'Ding, J.'            50 
5       'Das, K.'             51 
5       'Moereels, H.'        52 
5       'Koymans, L.'         53 
5       'Andries, K.'         54 
5       'Janssen, P.A.'       55 
5       'Hughes, S.H.'        56 
5       'Arnold, E.'          57 
6       'Tantillo, C.'        58 
6       'Ding, J.'            59 
6       'Jacobo-Molina, A.'   60 
6       'Nanni, R.G.'         61 
6       'Boyer, P.L.'         62 
6       'Hughes, S.H.'        63 
6       'Pauwels, R.'         64 
6       'Andries, K.'         65 
6       'Janssen, P.A.'       66 
6       'Arnold, E.'          67 
7       'Jacobo-Molina, A.'   68 
7       'Ding, J.'            69 
7       'Nanni, R.G.'         70 
7       'Clark Junior, A.D.'  71 
7       'Lu, X.'              72 
7       'Tantillo, C.'        73 
7       'Williams, R.L.'      74 
7       'Kamer, G.'           75 
7       'Ferris, A.L.'        76 
7       'Clark, P.'           77 
7       'al., et'             78 
# 
_cell.entry_id           1UWB 
_cell.length_a           225.700 
_cell.length_b           69.200 
_cell.length_c           104.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         106.60 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1UWB 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'REVERSE TRANSCRIPTASE'                                                                                   
64214.621 1 2.7.7.49 'Y181C, C280S' ? ? 
2 polymer     man 'REVERSE TRANSCRIPTASE'                                                                                   
49851.328 1 2.7.7.49 'Y181C, C280S' ? ? 
3 non-polymer syn '5-CHLORO-8-METHYL-7-(3-METHYL-BUT-2-ENYL)-6,7,8,9-TETRAHYDRO-2H-2,7,9A-TRIAZA-BENZO[CD]AZULENE-1-THIONE' 
321.868   1 ?        ?              ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
;
A ? 
2 'polypeptide(L)' no no 
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWY
;
;PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYD
PSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWET
WWTEYWQATWIPEWEFVNTPPLVKLWY
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   ILE n 
1 3   SER n 
1 4   PRO n 
1 5   ILE n 
1 6   GLU n 
1 7   THR n 
1 8   VAL n 
1 9   PRO n 
1 10  VAL n 
1 11  LYS n 
1 12  LEU n 
1 13  LYS n 
1 14  PRO n 
1 15  GLY n 
1 16  MET n 
1 17  ASP n 
1 18  GLY n 
1 19  PRO n 
1 20  LYS n 
1 21  VAL n 
1 22  LYS n 
1 23  GLN n 
1 24  TRP n 
1 25  PRO n 
1 26  LEU n 
1 27  THR n 
1 28  GLU n 
1 29  GLU n 
1 30  LYS n 
1 31  ILE n 
1 32  LYS n 
1 33  ALA n 
1 34  LEU n 
1 35  VAL n 
1 36  GLU n 
1 37  ILE n 
1 38  CYS n 
1 39  THR n 
1 40  GLU n 
1 41  MET n 
1 42  GLU n 
1 43  LYS n 
1 44  GLU n 
1 45  GLY n 
1 46  LYS n 
1 47  ILE n 
1 48  SER n 
1 49  LYS n 
1 50  ILE n 
1 51  GLY n 
1 52  PRO n 
1 53  GLU n 
1 54  ASN n 
1 55  PRO n 
1 56  TYR n 
1 57  ASN n 
1 58  THR n 
1 59  PRO n 
1 60  VAL n 
1 61  PHE n 
1 62  ALA n 
1 63  ILE n 
1 64  LYS n 
1 65  LYS n 
1 66  LYS n 
1 67  ASP n 
1 68  SER n 
1 69  THR n 
1 70  LYS n 
1 71  TRP n 
1 72  ARG n 
1 73  LYS n 
1 74  LEU n 
1 75  VAL n 
1 76  ASP n 
1 77  PHE n 
1 78  ARG n 
1 79  GLU n 
1 80  LEU n 
1 81  ASN n 
1 82  LYS n 
1 83  ARG n 
1 84  THR n 
1 85  GLN n 
1 86  ASP n 
1 87  PHE n 
1 88  TRP n 
1 89  GLU n 
1 90  VAL n 
1 91  GLN n 
1 92  LEU n 
1 93  GLY n 
1 94  ILE n 
1 95  PRO n 
1 96  HIS n 
1 97  PRO n 
1 98  ALA n 
1 99  GLY n 
1 100 LEU n 
1 101 LYS n 
1 102 LYS n 
1 103 LYS n 
1 104 LYS n 
1 105 SER n 
1 106 VAL n 
1 107 THR n 
1 108 VAL n 
1 109 LEU n 
1 110 ASP n 
1 111 VAL n 
1 112 GLY n 
1 113 ASP n 
1 114 ALA n 
1 115 TYR n 
1 116 PHE n 
1 117 SER n 
1 118 VAL n 
1 119 PRO n 
1 120 LEU n 
1 121 ASP n 
1 122 GLU n 
1 123 ASP n 
1 124 PHE n 
1 125 ARG n 
1 126 LYS n 
1 127 TYR n 
1 128 THR n 
1 129 ALA n 
1 130 PHE n 
1 131 THR n 
1 132 ILE n 
1 133 PRO n 
1 134 SER n 
1 135 ILE n 
1 136 ASN n 
1 137 ASN n 
1 138 GLU n 
1 139 THR n 
1 140 PRO n 
1 141 GLY n 
1 142 ILE n 
1 143 ARG n 
1 144 TYR n 
1 145 GLN n 
1 146 TYR n 
1 147 ASN n 
1 148 VAL n 
1 149 LEU n 
1 150 PRO n 
1 151 GLN n 
1 152 GLY n 
1 153 TRP n 
1 154 LYS n 
1 155 GLY n 
1 156 SER n 
1 157 PRO n 
1 158 ALA n 
1 159 ILE n 
1 160 PHE n 
1 161 GLN n 
1 162 SER n 
1 163 SER n 
1 164 MET n 
1 165 THR n 
1 166 LYS n 
1 167 ILE n 
1 168 LEU n 
1 169 GLU n 
1 170 PRO n 
1 171 PHE n 
1 172 LYS n 
1 173 LYS n 
1 174 GLN n 
1 175 ASN n 
1 176 PRO n 
1 177 ASP n 
1 178 ILE n 
1 179 VAL n 
1 180 ILE n 
1 181 CYS n 
1 182 GLN n 
1 183 TYR n 
1 184 MET n 
1 185 ASP n 
1 186 ASP n 
1 187 LEU n 
1 188 TYR n 
1 189 VAL n 
1 190 GLY n 
1 191 SER n 
1 192 ASP n 
1 193 LEU n 
1 194 GLU n 
1 195 ILE n 
1 196 GLY n 
1 197 GLN n 
1 198 HIS n 
1 199 ARG n 
1 200 THR n 
1 201 LYS n 
1 202 ILE n 
1 203 GLU n 
1 204 GLU n 
1 205 LEU n 
1 206 ARG n 
1 207 GLN n 
1 208 HIS n 
1 209 LEU n 
1 210 LEU n 
1 211 ARG n 
1 212 TRP n 
1 213 GLY n 
1 214 LEU n 
1 215 THR n 
1 216 THR n 
1 217 PRO n 
1 218 ASP n 
1 219 LYS n 
1 220 LYS n 
1 221 HIS n 
1 222 GLN n 
1 223 LYS n 
1 224 GLU n 
1 225 PRO n 
1 226 PRO n 
1 227 PHE n 
1 228 LEU n 
1 229 TRP n 
1 230 MET n 
1 231 GLY n 
1 232 TYR n 
1 233 GLU n 
1 234 LEU n 
1 235 HIS n 
1 236 PRO n 
1 237 ASP n 
1 238 LYS n 
1 239 TRP n 
1 240 THR n 
1 241 VAL n 
1 242 GLN n 
1 243 PRO n 
1 244 ILE n 
1 245 VAL n 
1 246 LEU n 
1 247 PRO n 
1 248 GLU n 
1 249 LYS n 
1 250 ASP n 
1 251 SER n 
1 252 TRP n 
1 253 THR n 
1 254 VAL n 
1 255 ASN n 
1 256 ASP n 
1 257 ILE n 
1 258 GLN n 
1 259 LYS n 
1 260 LEU n 
1 261 VAL n 
1 262 GLY n 
1 263 LYS n 
1 264 LEU n 
1 265 ASN n 
1 266 TRP n 
1 267 ALA n 
1 268 SER n 
1 269 GLN n 
1 270 ILE n 
1 271 TYR n 
1 272 PRO n 
1 273 GLY n 
1 274 ILE n 
1 275 LYS n 
1 276 VAL n 
1 277 ARG n 
1 278 GLN n 
1 279 LEU n 
1 280 SER n 
1 281 LYS n 
1 282 LEU n 
1 283 LEU n 
1 284 ARG n 
1 285 GLY n 
1 286 THR n 
1 287 LYS n 
1 288 ALA n 
1 289 LEU n 
1 290 THR n 
1 291 GLU n 
1 292 VAL n 
1 293 ILE n 
1 294 PRO n 
1 295 LEU n 
1 296 THR n 
1 297 GLU n 
1 298 GLU n 
1 299 ALA n 
1 300 GLU n 
1 301 LEU n 
1 302 GLU n 
1 303 LEU n 
1 304 ALA n 
1 305 GLU n 
1 306 ASN n 
1 307 ARG n 
1 308 GLU n 
1 309 ILE n 
1 310 LEU n 
1 311 LYS n 
1 312 GLU n 
1 313 PRO n 
1 314 VAL n 
1 315 HIS n 
1 316 GLY n 
1 317 VAL n 
1 318 TYR n 
1 319 TYR n 
1 320 ASP n 
1 321 PRO n 
1 322 SER n 
1 323 LYS n 
1 324 ASP n 
1 325 LEU n 
1 326 ILE n 
1 327 ALA n 
1 328 GLU n 
1 329 ILE n 
1 330 GLN n 
1 331 LYS n 
1 332 GLN n 
1 333 GLY n 
1 334 GLN n 
1 335 GLY n 
1 336 GLN n 
1 337 TRP n 
1 338 THR n 
1 339 TYR n 
1 340 GLN n 
1 341 ILE n 
1 342 TYR n 
1 343 GLN n 
1 344 GLU n 
1 345 PRO n 
1 346 PHE n 
1 347 LYS n 
1 348 ASN n 
1 349 LEU n 
1 350 LYS n 
1 351 THR n 
1 352 GLY n 
1 353 LYS n 
1 354 TYR n 
1 355 ALA n 
1 356 ARG n 
1 357 MET n 
1 358 ARG n 
1 359 GLY n 
1 360 ALA n 
1 361 HIS n 
1 362 THR n 
1 363 ASN n 
1 364 ASP n 
1 365 VAL n 
1 366 LYS n 
1 367 GLN n 
1 368 LEU n 
1 369 THR n 
1 370 GLU n 
1 371 ALA n 
1 372 VAL n 
1 373 GLN n 
1 374 LYS n 
1 375 ILE n 
1 376 THR n 
1 377 THR n 
1 378 GLU n 
1 379 SER n 
1 380 ILE n 
1 381 VAL n 
1 382 ILE n 
1 383 TRP n 
1 384 GLY n 
1 385 LYS n 
1 386 THR n 
1 387 PRO n 
1 388 LYS n 
1 389 PHE n 
1 390 LYS n 
1 391 LEU n 
1 392 PRO n 
1 393 ILE n 
1 394 GLN n 
1 395 LYS n 
1 396 GLU n 
1 397 THR n 
1 398 TRP n 
1 399 GLU n 
1 400 THR n 
1 401 TRP n 
1 402 TRP n 
1 403 THR n 
1 404 GLU n 
1 405 TYR n 
1 406 TRP n 
1 407 GLN n 
1 408 ALA n 
1 409 THR n 
1 410 TRP n 
1 411 ILE n 
1 412 PRO n 
1 413 GLU n 
1 414 TRP n 
1 415 GLU n 
1 416 PHE n 
1 417 VAL n 
1 418 ASN n 
1 419 THR n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 VAL n 
1 424 LYS n 
1 425 LEU n 
1 426 TRP n 
1 427 TYR n 
1 428 GLN n 
1 429 LEU n 
1 430 GLU n 
1 431 LYS n 
1 432 GLU n 
1 433 PRO n 
1 434 ILE n 
1 435 VAL n 
1 436 GLY n 
1 437 ALA n 
1 438 GLU n 
1 439 THR n 
1 440 PHE n 
1 441 TYR n 
1 442 VAL n 
1 443 ASP n 
1 444 GLY n 
1 445 ALA n 
1 446 ALA n 
1 447 ASN n 
1 448 ARG n 
1 449 GLU n 
1 450 THR n 
1 451 LYS n 
1 452 LEU n 
1 453 GLY n 
1 454 LYS n 
1 455 ALA n 
1 456 GLY n 
1 457 TYR n 
1 458 VAL n 
1 459 THR n 
1 460 ASN n 
1 461 LYS n 
1 462 GLY n 
1 463 ARG n 
1 464 GLN n 
1 465 LYS n 
1 466 VAL n 
1 467 VAL n 
1 468 PRO n 
1 469 LEU n 
1 470 THR n 
1 471 ASN n 
1 472 THR n 
1 473 THR n 
1 474 ASN n 
1 475 GLN n 
1 476 LYS n 
1 477 THR n 
1 478 GLU n 
1 479 LEU n 
1 480 GLN n 
1 481 ALA n 
1 482 ILE n 
1 483 TYR n 
1 484 LEU n 
1 485 ALA n 
1 486 LEU n 
1 487 GLN n 
1 488 ASP n 
1 489 SER n 
1 490 GLY n 
1 491 LEU n 
1 492 GLU n 
1 493 VAL n 
1 494 ASN n 
1 495 ILE n 
1 496 VAL n 
1 497 THR n 
1 498 ASP n 
1 499 SER n 
1 500 GLN n 
1 501 TYR n 
1 502 ALA n 
1 503 LEU n 
1 504 GLY n 
1 505 ILE n 
1 506 ILE n 
1 507 GLN n 
1 508 ALA n 
1 509 GLN n 
1 510 PRO n 
1 511 ASP n 
1 512 LYS n 
1 513 SER n 
1 514 GLU n 
1 515 SER n 
1 516 GLU n 
1 517 LEU n 
1 518 VAL n 
1 519 ASN n 
1 520 GLN n 
1 521 ILE n 
1 522 ILE n 
1 523 GLU n 
1 524 GLN n 
1 525 LEU n 
1 526 ILE n 
1 527 LYS n 
1 528 LYS n 
1 529 GLU n 
1 530 LYS n 
1 531 VAL n 
1 532 TYR n 
1 533 LEU n 
1 534 ALA n 
1 535 TRP n 
1 536 VAL n 
1 537 PRO n 
1 538 ALA n 
1 539 HIS n 
1 540 LYS n 
1 541 GLY n 
1 542 ILE n 
1 543 GLY n 
1 544 GLY n 
1 545 ASN n 
1 546 GLU n 
1 547 GLN n 
1 548 VAL n 
1 549 ASP n 
1 550 LYS n 
1 551 LEU n 
1 552 VAL n 
1 553 SER n 
1 554 ALA n 
1 555 GLY n 
1 556 ILE n 
1 557 ARG n 
1 558 LYS n 
2 1   PRO n 
2 2   ILE n 
2 3   SER n 
2 4   PRO n 
2 5   ILE n 
2 6   GLU n 
2 7   THR n 
2 8   VAL n 
2 9   PRO n 
2 10  VAL n 
2 11  LYS n 
2 12  LEU n 
2 13  LYS n 
2 14  PRO n 
2 15  GLY n 
2 16  MET n 
2 17  ASP n 
2 18  GLY n 
2 19  PRO n 
2 20  LYS n 
2 21  VAL n 
2 22  LYS n 
2 23  GLN n 
2 24  TRP n 
2 25  PRO n 
2 26  LEU n 
2 27  THR n 
2 28  GLU n 
2 29  GLU n 
2 30  LYS n 
2 31  ILE n 
2 32  LYS n 
2 33  ALA n 
2 34  LEU n 
2 35  VAL n 
2 36  GLU n 
2 37  ILE n 
2 38  CYS n 
2 39  THR n 
2 40  GLU n 
2 41  MET n 
2 42  GLU n 
2 43  LYS n 
2 44  GLU n 
2 45  GLY n 
2 46  LYS n 
2 47  ILE n 
2 48  SER n 
2 49  LYS n 
2 50  ILE n 
2 51  GLY n 
2 52  PRO n 
2 53  GLU n 
2 54  ASN n 
2 55  PRO n 
2 56  TYR n 
2 57  ASN n 
2 58  THR n 
2 59  PRO n 
2 60  VAL n 
2 61  PHE n 
2 62  ALA n 
2 63  ILE n 
2 64  LYS n 
2 65  LYS n 
2 66  LYS n 
2 67  ASP n 
2 68  SER n 
2 69  THR n 
2 70  LYS n 
2 71  TRP n 
2 72  ARG n 
2 73  LYS n 
2 74  LEU n 
2 75  VAL n 
2 76  ASP n 
2 77  PHE n 
2 78  ARG n 
2 79  GLU n 
2 80  LEU n 
2 81  ASN n 
2 82  LYS n 
2 83  ARG n 
2 84  THR n 
2 85  GLN n 
2 86  ASP n 
2 87  PHE n 
2 88  TRP n 
2 89  GLU n 
2 90  VAL n 
2 91  GLN n 
2 92  LEU n 
2 93  GLY n 
2 94  ILE n 
2 95  PRO n 
2 96  HIS n 
2 97  PRO n 
2 98  ALA n 
2 99  GLY n 
2 100 LEU n 
2 101 LYS n 
2 102 LYS n 
2 103 LYS n 
2 104 LYS n 
2 105 SER n 
2 106 VAL n 
2 107 THR n 
2 108 VAL n 
2 109 LEU n 
2 110 ASP n 
2 111 VAL n 
2 112 GLY n 
2 113 ASP n 
2 114 ALA n 
2 115 TYR n 
2 116 PHE n 
2 117 SER n 
2 118 VAL n 
2 119 PRO n 
2 120 LEU n 
2 121 ASP n 
2 122 GLU n 
2 123 ASP n 
2 124 PHE n 
2 125 ARG n 
2 126 LYS n 
2 127 TYR n 
2 128 THR n 
2 129 ALA n 
2 130 PHE n 
2 131 THR n 
2 132 ILE n 
2 133 PRO n 
2 134 SER n 
2 135 ILE n 
2 136 ASN n 
2 137 ASN n 
2 138 GLU n 
2 139 THR n 
2 140 PRO n 
2 141 GLY n 
2 142 ILE n 
2 143 ARG n 
2 144 TYR n 
2 145 GLN n 
2 146 TYR n 
2 147 ASN n 
2 148 VAL n 
2 149 LEU n 
2 150 PRO n 
2 151 GLN n 
2 152 GLY n 
2 153 TRP n 
2 154 LYS n 
2 155 GLY n 
2 156 SER n 
2 157 PRO n 
2 158 ALA n 
2 159 ILE n 
2 160 PHE n 
2 161 GLN n 
2 162 SER n 
2 163 SER n 
2 164 MET n 
2 165 THR n 
2 166 LYS n 
2 167 ILE n 
2 168 LEU n 
2 169 GLU n 
2 170 PRO n 
2 171 PHE n 
2 172 LYS n 
2 173 LYS n 
2 174 GLN n 
2 175 ASN n 
2 176 PRO n 
2 177 ASP n 
2 178 ILE n 
2 179 VAL n 
2 180 ILE n 
2 181 CYS n 
2 182 GLN n 
2 183 TYR n 
2 184 MET n 
2 185 ASP n 
2 186 ASP n 
2 187 LEU n 
2 188 TYR n 
2 189 VAL n 
2 190 GLY n 
2 191 SER n 
2 192 ASP n 
2 193 LEU n 
2 194 GLU n 
2 195 ILE n 
2 196 GLY n 
2 197 GLN n 
2 198 HIS n 
2 199 ARG n 
2 200 THR n 
2 201 LYS n 
2 202 ILE n 
2 203 GLU n 
2 204 GLU n 
2 205 LEU n 
2 206 ARG n 
2 207 GLN n 
2 208 HIS n 
2 209 LEU n 
2 210 LEU n 
2 211 ARG n 
2 212 TRP n 
2 213 GLY n 
2 214 LEU n 
2 215 THR n 
2 216 THR n 
2 217 PRO n 
2 218 ASP n 
2 219 LYS n 
2 220 LYS n 
2 221 HIS n 
2 222 GLN n 
2 223 LYS n 
2 224 GLU n 
2 225 PRO n 
2 226 PRO n 
2 227 PHE n 
2 228 LEU n 
2 229 TRP n 
2 230 MET n 
2 231 GLY n 
2 232 TYR n 
2 233 GLU n 
2 234 LEU n 
2 235 HIS n 
2 236 PRO n 
2 237 ASP n 
2 238 LYS n 
2 239 TRP n 
2 240 THR n 
2 241 VAL n 
2 242 GLN n 
2 243 PRO n 
2 244 ILE n 
2 245 VAL n 
2 246 LEU n 
2 247 PRO n 
2 248 GLU n 
2 249 LYS n 
2 250 ASP n 
2 251 SER n 
2 252 TRP n 
2 253 THR n 
2 254 VAL n 
2 255 ASN n 
2 256 ASP n 
2 257 ILE n 
2 258 GLN n 
2 259 LYS n 
2 260 LEU n 
2 261 VAL n 
2 262 GLY n 
2 263 LYS n 
2 264 LEU n 
2 265 ASN n 
2 266 TRP n 
2 267 ALA n 
2 268 SER n 
2 269 GLN n 
2 270 ILE n 
2 271 TYR n 
2 272 PRO n 
2 273 GLY n 
2 274 ILE n 
2 275 LYS n 
2 276 VAL n 
2 277 ARG n 
2 278 GLN n 
2 279 LEU n 
2 280 SER n 
2 281 LYS n 
2 282 LEU n 
2 283 LEU n 
2 284 ARG n 
2 285 GLY n 
2 286 THR n 
2 287 LYS n 
2 288 ALA n 
2 289 LEU n 
2 290 THR n 
2 291 GLU n 
2 292 VAL n 
2 293 ILE n 
2 294 PRO n 
2 295 LEU n 
2 296 THR n 
2 297 GLU n 
2 298 GLU n 
2 299 ALA n 
2 300 GLU n 
2 301 LEU n 
2 302 GLU n 
2 303 LEU n 
2 304 ALA n 
2 305 GLU n 
2 306 ASN n 
2 307 ARG n 
2 308 GLU n 
2 309 ILE n 
2 310 LEU n 
2 311 LYS n 
2 312 GLU n 
2 313 PRO n 
2 314 VAL n 
2 315 HIS n 
2 316 GLY n 
2 317 VAL n 
2 318 TYR n 
2 319 TYR n 
2 320 ASP n 
2 321 PRO n 
2 322 SER n 
2 323 LYS n 
2 324 ASP n 
2 325 LEU n 
2 326 ILE n 
2 327 ALA n 
2 328 GLU n 
2 329 ILE n 
2 330 GLN n 
2 331 LYS n 
2 332 GLN n 
2 333 GLY n 
2 334 GLN n 
2 335 GLY n 
2 336 GLN n 
2 337 TRP n 
2 338 THR n 
2 339 TYR n 
2 340 GLN n 
2 341 ILE n 
2 342 TYR n 
2 343 GLN n 
2 344 GLU n 
2 345 PRO n 
2 346 PHE n 
2 347 LYS n 
2 348 ASN n 
2 349 LEU n 
2 350 LYS n 
2 351 THR n 
2 352 GLY n 
2 353 LYS n 
2 354 TYR n 
2 355 ALA n 
2 356 ARG n 
2 357 MET n 
2 358 ARG n 
2 359 GLY n 
2 360 ALA n 
2 361 HIS n 
2 362 THR n 
2 363 ASN n 
2 364 ASP n 
2 365 VAL n 
2 366 LYS n 
2 367 GLN n 
2 368 LEU n 
2 369 THR n 
2 370 GLU n 
2 371 ALA n 
2 372 VAL n 
2 373 GLN n 
2 374 LYS n 
2 375 ILE n 
2 376 THR n 
2 377 THR n 
2 378 GLU n 
2 379 SER n 
2 380 ILE n 
2 381 VAL n 
2 382 ILE n 
2 383 TRP n 
2 384 GLY n 
2 385 LYS n 
2 386 THR n 
2 387 PRO n 
2 388 LYS n 
2 389 PHE n 
2 390 LYS n 
2 391 LEU n 
2 392 PRO n 
2 393 ILE n 
2 394 GLN n 
2 395 LYS n 
2 396 GLU n 
2 397 THR n 
2 398 TRP n 
2 399 GLU n 
2 400 THR n 
2 401 TRP n 
2 402 TRP n 
2 403 THR n 
2 404 GLU n 
2 405 TYR n 
2 406 TRP n 
2 407 GLN n 
2 408 ALA n 
2 409 THR n 
2 410 TRP n 
2 411 ILE n 
2 412 PRO n 
2 413 GLU n 
2 414 TRP n 
2 415 GLU n 
2 416 PHE n 
2 417 VAL n 
2 418 ASN n 
2 419 THR n 
2 420 PRO n 
2 421 PRO n 
2 422 LEU n 
2 423 VAL n 
2 424 LYS n 
2 425 LEU n 
2 426 TRP n 
2 427 TYR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? Lentivirus ? ? BH10 ? ? ? ? 'Human immunodeficiency virus 1' 11676 ? 293 1065288 ? ? ? ? ? 'Escherichia coli' 
562 Escherichia ? ? ? ? ? 293 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? ? Lentivirus ? ? BH10 ? ? ? ? 'Human immunodeficiency virus 1' 11676 ? 293 1065288 ? ? ? ? ? 'Escherichia coli' 
562 Escherichia ? ? ? ? ? 293 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP POL_HV1B1 P03366 1 599 ? ? 
2 UNP POL_HV1B1 P03366 2 599 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1UWB A 1 ? 558 ? P03366 599 ? 1156 ? 1 558 
2 2 1UWB B 1 ? 427 ? P03366 599 ? 1025 ? 1 427 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1UWB CYS A 181 ? UNP P03366 TYR 348 ENGINEERED 181 1 
1 1UWB SER A 280 ? UNP P03366 CYS 447 ENGINEERED 280 2 
2 1UWB CYS B 181 ? UNP P03366 TYR 348 ENGINEERED 181 3 
2 1UWB SER B 280 ? UNP P03366 CYS 447 ENGINEERED 280 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                    'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ?                    'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                    'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                    'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ?                    'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE ?                    'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                    'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ?                    'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ?                    'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE ?                    'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ?                    'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ?                    'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ?                    'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                    'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ?                    'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ?                    'C3 H7 N O3'      105.093 
TBO non-polymer         . 
'5-CHLORO-8-METHYL-7-(3-METHYL-BUT-2-ENYL)-6,7,8,9-TETRAHYDRO-2H-2,7,9A-TRIAZA-BENZO[CD]AZULENE-1-THIONE' 'TBO 8; TIBO R86183' 
'C16 H20 Cl N3 S' 321.868 
THR 'L-peptide linking' y THREONINE ?                    'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                    'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ?                    'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ?                    'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1UWB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.44 
_exptl_crystal.density_percent_sol   65. 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   1996-03 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             0.918 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1UWB 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   ? 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.1050000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        52.2 
_reflns.pdbx_redundancy              2.62 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1UWB 
_refine.ls_number_reflns_obs                     21825 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               10000000.00 
_refine.pdbx_data_cutoff_low_absF                10.0000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            3.2 
_refine.ls_percent_reflns_obs                    85.0 
_refine.ls_R_factor_obs                          0.2740000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2740000 
_refine.ls_R_factor_R_free                       0.3600000 
_refine.ls_R_factor_R_free_error                 0.011 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1059 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               69.6 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1UWB 
_refine_analyze.Luzzati_coordinate_error_obs    0.51 
_refine_analyze.Luzzati_sigma_a_obs             0.61 
_refine_analyze.Luzzati_d_res_low_obs           10.0 
_refine_analyze.Luzzati_coordinate_error_free   0.71 
_refine_analyze.Luzzati_sigma_a_free            0.68 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7802 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             21 
_refine_hist.number_atoms_total               7823 
_refine_hist.d_res_high                       3.2 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.011 ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.8   ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.7  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.60  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             1.57  1.50 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            2.82  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             1.64  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            2.68  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       3.20 
_refine_ls_shell.d_res_low                        3.31 
_refine_ls_shell.number_reflns_R_work             1944 
_refine_ls_shell.R_factor_R_work                  0.3870000 
_refine_ls_shell.percent_reflns_obs               80.7 
_refine_ls_shell.R_factor_R_free                  0.3600000 
_refine_ls_shell.R_factor_R_free_error            0.037 
_refine_ls_shell.percent_reflns_R_free            4.6 
_refine_ls_shell.number_reflns_R_free             94 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 TBO.PAR      TBO.TOP      'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1UWB 
_struct.title                     'TYR 181 CYS HIV-1 RT/8-CL TIBO' 
_struct.pdbx_descriptor           
'REVERSE TRANSCRIPTASE, 5-CHLORO-8-METHYL-7-(3-METHYL-BUT-2-ENYL)-6,7,8,9-TETRAHYDRO-2H-2,7,9A-TRIAZA-BENZO[CD]AZULENE-1-THIONE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1UWB 
_struct_keywords.pdbx_keywords   'ASPARTYL PROTEASE' 
_struct_keywords.text            
;AIDS, POLYPROTEIN, HYDROLASE, ASPARTYL PROTEASE, ENDONUCLEASE, RNA-DIRECTED DNA POLYMERASE, TYR181CYS HIV-1 RT/8-CL TIBO, DRUG-RESISTANT MUTANT
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA   GLU A 28  ? GLU A 44  ? GLU A 28  GLU A 44  1 ? 17 
HELX_P HELX_P2  AB   ARG A 78  ? ARG A 83  ? ARG A 78  ARG A 83  1 ? 6  
HELX_P HELX_P3  AC   ALA A 114 ? SER A 117 ? ALA A 114 SER A 117 1 ? 4  
HELX_P HELX_P4  AD   GLU A 122 ? TYR A 127 ? GLU A 122 TYR A 127 1 ? 6  
HELX_P HELX_P5  AE   LYS A 154 ? GLN A 174 ? LYS A 154 GLN A 174 1 ? 21 
HELX_P HELX_P6  AF   ILE A 195 ? TRP A 212 ? ILE A 195 TRP A 212 1 ? 18 
HELX_P HELX_P7  AH   VAL A 254 ? GLN A 269 ? VAL A 254 GLN A 269 1 ? 16 
HELX_P HELX_P8  AI   ARG A 277 ? LEU A 283 ? ARG A 277 LEU A 283 1 ? 7  
HELX_P HELX_P9  AJ   GLU A 297 ? LYS A 311 ? GLU A 297 LYS A 311 1 ? 15 
HELX_P HELX_P10 AK   ASP A 364 ? TRP A 383 ? ASP A 364 TRP A 383 1 ? 20 
HELX_P HELX_P11 AL   LYS A 395 ? GLU A 404 ? LYS A 395 GLU A 404 1 ? 10 
HELX_P HELX_P12 "A'" ASN A 474 ? ASP A 488 ? ASN A 474 ASP A 488 1 ? 15 
HELX_P HELX_P13 "B'" GLN A 500 ? ALA A 508 ? GLN A 500 ALA A 508 1 ? 9  
HELX_P HELX_P14 "D'" GLU A 516 ? LYS A 527 ? GLU A 516 LYS A 527 1 ? 12 
HELX_P HELX_P15 "E'" GLY A 544 ? ALA A 554 ? GLY A 544 ALA A 554 1 ? 11 
HELX_P HELX_P16 BA   GLU B 28  ? GLU B 44  ? GLU B 28  GLU B 44  1 ? 17 
HELX_P HELX_P17 BB   ARG B 78  ? VAL B 90  ? ARG B 78  VAL B 90  1 ? 13 
HELX_P HELX_P18 BC   GLY B 112 ? SER B 117 ? GLY B 112 SER B 117 1 ? 6  
HELX_P HELX_P19 BD   GLU B 122 ? THR B 128 ? GLU B 122 THR B 128 1 ? 7  
HELX_P HELX_P20 BE   LYS B 154 ? GLN B 174 ? LYS B 154 GLN B 174 1 ? 21 
HELX_P HELX_P21 BF   ILE B 195 ? TRP B 212 ? ILE B 195 TRP B 212 1 ? 18 
HELX_P HELX_P22 BH   VAL B 254 ? ILE B 270 ? VAL B 254 ILE B 270 1 ? 17 
HELX_P HELX_P23 BI   ARG B 277 ? LEU B 283 ? ARG B 277 LEU B 283 1 ? 7  
HELX_P HELX_P24 BJ   GLU B 297 ? LYS B 311 ? GLU B 297 LYS B 311 1 ? 15 
HELX_P HELX_P25 BK   ASP B 364 ? TRP B 383 ? ASP B 364 TRP B 383 1 ? 20 
HELX_P HELX_P26 BL   LYS B 395 ? TYR B 405 ? LYS B 395 TYR B 405 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1  ? 3 ? 
S2  ? 2 ? 
S3  ? 3 ? 
S4  ? 4 ? 
S5  ? 5 ? 
S6  ? 5 ? 
S7  ? 3 ? 
S8  ? 2 ? 
S9  ? 3 ? 
S10 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1  1 2 ? anti-parallel 
S1  2 3 ? anti-parallel 
S2  1 2 ? anti-parallel 
S3  1 2 ? anti-parallel 
S3  2 3 ? anti-parallel 
S4  1 2 ? anti-parallel 
S4  2 3 ? anti-parallel 
S4  3 4 ? anti-parallel 
S5  1 2 ? anti-parallel 
S5  2 3 ? anti-parallel 
S5  3 4 ? parallel      
S5  4 5 ? parallel      
S6  1 2 ? anti-parallel 
S6  2 3 ? anti-parallel 
S6  3 4 ? parallel      
S6  4 5 ? parallel      
S7  1 2 ? anti-parallel 
S7  2 3 ? anti-parallel 
S8  1 2 ? anti-parallel 
S9  1 2 ? anti-parallel 
S9  2 3 ? anti-parallel 
S10 1 2 ? anti-parallel 
S10 2 3 ? anti-parallel 
S10 3 4 ? parallel      
S10 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1  1 ILE A 47  ? ILE A 50  ? ILE A 47  ILE A 50  
S1  2 ILE A 142 ? TYR A 146 ? ILE A 142 TYR A 146 
S1  3 THR A 128 ? ILE A 132 ? THR A 128 ILE A 132 
S2  1 ASN A 57  ? LYS A 64  ? ASN A 57  LYS A 64  
S2  2 ARG A 72  ? PHE A 77  ? ARG A 72  PHE A 77  
S3  1 SER A 105 ? VAL A 111 ? SER A 105 VAL A 111 
S3  2 ASP A 186 ? SER A 191 ? ASP A 186 SER A 191 
S3  3 ILE A 178 ? TYR A 183 ? ILE A 178 TYR A 183 
S4  1 PHE A 227 ? TRP A 229 ? PHE A 227 TRP A 229 
S4  2 TYR A 232 ? HIS A 235 ? TYR A 232 HIS A 235 
S4  3 LYS A 238 ? VAL A 241 ? LYS A 238 VAL A 241 
S4  4 VAL A 314 ? ASP A 320 ? VAL A 314 ASP A 320 
S5  1 LYS A 347 ? ARG A 356 ? LYS A 347 ARG A 356 
S5  2 GLN A 336 ? TYR A 342 ? GLN A 336 TYR A 342 
S5  3 LEU A 325 ? GLN A 332 ? LEU A 325 GLN A 332 
S5  4 PRO A 387 ? LEU A 391 ? PRO A 387 LEU A 391 
S5  5 GLU A 413 ? THR A 419 ? GLU A 413 THR A 419 
S6  1 GLY A 462 ? THR A 470 ? GLY A 462 THR A 470 
S6  2 LEU A 452 ? THR A 459 ? LEU A 452 THR A 459 
S6  3 GLU A 438 ? ASN A 447 ? GLU A 438 ASN A 447 
S6  4 GLU A 492 ? THR A 497 ? GLU A 492 THR A 497 
S6  5 LYS A 530 ? VAL A 536 ? LYS A 530 VAL A 536 
S7  1 ILE B 47  ? GLY B 51  ? ILE B 47  GLY B 51  
S7  2 ILE B 142 ? TYR B 146 ? ILE B 142 TYR B 146 
S7  3 ALA B 129 ? ILE B 132 ? ALA B 129 ILE B 132 
S8  1 TYR B 56  ? LYS B 64  ? TYR B 56  LYS B 64  
S8  2 TRP B 71  ? ASP B 76  ? TRP B 71  ASP B 76  
S9  1 SER B 105 ? ASP B 110 ? SER B 105 ASP B 110 
S9  2 ASP B 186 ? SER B 191 ? ASP B 186 SER B 191 
S9  3 ILE B 178 ? TYR B 183 ? ILE B 178 TYR B 183 
S10 1 LYS B 347 ? ARG B 356 ? LYS B 347 ARG B 356 
S10 2 GLN B 336 ? TYR B 342 ? GLN B 336 TYR B 342 
S10 3 LEU B 325 ? LYS B 331 ? LEU B 325 LYS B 331 
S10 4 PRO B 387 ? LEU B 391 ? PRO B 387 LEU B 391 
S10 5 GLU B 413 ? VAL B 417 ? GLU B 413 VAL B 417 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE TBO A 559' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 LEU A 100 ? LEU A 100 . ? 1_555 ? 
2 AC1 6 LYS A 101 ? LYS A 101 . ? 1_555 ? 
3 AC1 6 LYS A 103 ? LYS A 103 . ? 1_555 ? 
4 AC1 6 TYR A 188 ? TYR A 188 . ? 1_555 ? 
5 AC1 6 TRP A 229 ? TRP A 229 . ? 1_555 ? 
6 AC1 6 TYR A 318 ? TYR A 318 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1UWB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1UWB 
_atom_sites.fract_transf_matrix[1][1]   0.004431 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001321 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014451 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009947 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 1   ? 171.815 -18.311 78.210  1.00 91.12 ? 1   PRO A N   1 
ATOM   2    C  CA  . PRO A 1 1   ? 172.135 -17.468 77.034  1.00 89.84 ? 1   PRO A CA  1 
ATOM   3    C  C   . PRO A 1 1   ? 171.139 -16.300 76.973  1.00 88.41 ? 1   PRO A C   1 
ATOM   4    O  O   . PRO A 1 1   ? 170.554 -15.924 77.994  1.00 88.94 ? 1   PRO A O   1 
ATOM   5    C  CB  . PRO A 1 1   ? 172.003 -18.358 75.800  1.00 90.75 ? 1   PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 1   ? 172.118 -19.784 76.415  1.00 91.29 ? 1   PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 1   ? 171.429 -19.684 77.767  1.00 90.90 ? 1   PRO A CD  1 
ATOM   8    N  N   . ILE A 1 2   ? 170.932 -15.754 75.779  1.00 85.89 ? 2   ILE A N   1 
ATOM   9    C  CA  . ILE A 1 2   ? 170.016 -14.640 75.589  1.00 82.87 ? 2   ILE A CA  1 
ATOM   10   C  C   . ILE A 1 2   ? 169.433 -14.730 74.186  1.00 80.31 ? 2   ILE A C   1 
ATOM   11   O  O   . ILE A 1 2   ? 169.688 -15.696 73.466  1.00 80.28 ? 2   ILE A O   1 
ATOM   12   C  CB  . ILE A 1 2   ? 170.757 -13.287 75.668  1.00 84.05 ? 2   ILE A CB  1 
ATOM   13   C  CG1 . ILE A 1 2   ? 171.905 -13.289 74.656  1.00 83.97 ? 2   ILE A CG1 1 
ATOM   14   C  CG2 . ILE A 1 2   ? 171.247 -13.014 77.104  1.00 83.37 ? 2   ILE A CG2 1 
ATOM   15   C  CD1 . ILE A 1 2   ? 172.302 -11.919 74.191  1.00 84.47 ? 2   ILE A CD1 1 
ATOM   16   N  N   . SER A 1 3   ? 168.682 -13.711 73.790  1.00 77.19 ? 3   SER A N   1 
ATOM   17   C  CA  . SER A 1 3   ? 168.107 -13.667 72.452  1.00 75.66 ? 3   SER A CA  1 
ATOM   18   C  C   . SER A 1 3   ? 168.619 -12.398 71.773  1.00 74.84 ? 3   SER A C   1 
ATOM   19   O  O   . SER A 1 3   ? 168.524 -11.306 72.333  1.00 74.64 ? 3   SER A O   1 
ATOM   20   C  CB  . SER A 1 3   ? 166.577 -13.655 72.512  1.00 75.77 ? 3   SER A CB  1 
ATOM   21   O  OG  . SER A 1 3   ? 166.016 -13.620 71.207  1.00 75.12 ? 3   SER A OG  1 
ATOM   22   N  N   . PRO A 1 4   ? 169.152 -12.517 70.540  1.00 74.09 ? 4   PRO A N   1 
ATOM   23   C  CA  . PRO A 1 4   ? 169.662 -11.325 69.837  1.00 71.90 ? 4   PRO A CA  1 
ATOM   24   C  C   . PRO A 1 4   ? 168.509 -10.491 69.269  1.00 70.36 ? 4   PRO A C   1 
ATOM   25   O  O   . PRO A 1 4   ? 168.686 -9.782  68.285  1.00 70.30 ? 4   PRO A O   1 
ATOM   26   C  CB  . PRO A 1 4   ? 170.487 -11.925 68.679  1.00 72.48 ? 4   PRO A CB  1 
ATOM   27   C  CG  . PRO A 1 4   ? 170.672 -13.384 69.054  1.00 73.47 ? 4   PRO A CG  1 
ATOM   28   C  CD  . PRO A 1 4   ? 169.401 -13.737 69.749  1.00 73.36 ? 4   PRO A CD  1 
ATOM   29   N  N   . ILE A 1 5   ? 167.340 -10.569 69.895  1.00 67.91 ? 5   ILE A N   1 
ATOM   30   C  CA  . ILE A 1 5   ? 166.176 -9.854  69.403  1.00 66.38 ? 5   ILE A CA  1 
ATOM   31   C  C   . ILE A 1 5   ? 166.277 -8.335  69.468  1.00 66.79 ? 5   ILE A C   1 
ATOM   32   O  O   . ILE A 1 5   ? 166.876 -7.766  70.376  1.00 66.42 ? 5   ILE A O   1 
ATOM   33   C  CB  . ILE A 1 5   ? 164.888 -10.347 70.098  1.00 65.15 ? 5   ILE A CB  1 
ATOM   34   C  CG1 . ILE A 1 5   ? 163.649 -9.775  69.406  1.00 63.30 ? 5   ILE A CG1 1 
ATOM   35   C  CG2 . ILE A 1 5   ? 164.928 -9.996  71.572  1.00 65.55 ? 5   ILE A CG2 1 
ATOM   36   C  CD1 . ILE A 1 5   ? 162.379 -10.546 69.691  1.00 60.85 ? 5   ILE A CD1 1 
ATOM   37   N  N   . GLU A 1 6   ? 165.707 -7.707  68.456  1.00 67.40 ? 6   GLU A N   1 
ATOM   38   C  CA  . GLU A 1 6   ? 165.683 -6.268  68.313  1.00 68.72 ? 6   GLU A CA  1 
ATOM   39   C  C   . GLU A 1 6   ? 164.981 -5.694  69.538  1.00 68.48 ? 6   GLU A C   1 
ATOM   40   O  O   . GLU A 1 6   ? 163.755 -5.764  69.641  1.00 67.88 ? 6   GLU A O   1 
ATOM   41   C  CB  . GLU A 1 6   ? 164.891 -5.949  67.045  1.00 70.82 ? 6   GLU A CB  1 
ATOM   42   C  CG  . GLU A 1 6   ? 165.098 -4.584  66.429  1.00 73.74 ? 6   GLU A CG  1 
ATOM   43   C  CD  . GLU A 1 6   ? 164.384 -4.449  65.076  1.00 76.01 ? 6   GLU A CD  1 
ATOM   44   O  OE1 . GLU A 1 6   ? 163.444 -5.238  64.800  1.00 76.97 ? 6   GLU A OE1 1 
ATOM   45   O  OE2 . GLU A 1 6   ? 164.772 -3.559  64.283  1.00 77.11 ? 6   GLU A OE2 1 
ATOM   46   N  N   . THR A 1 7   ? 165.770 -5.176  70.477  1.00 68.88 ? 7   THR A N   1 
ATOM   47   C  CA  . THR A 1 7   ? 165.247 -4.597  71.723  1.00 68.62 ? 7   THR A CA  1 
ATOM   48   C  C   . THR A 1 7   ? 164.156 -3.537  71.507  1.00 69.57 ? 7   THR A C   1 
ATOM   49   O  O   . THR A 1 7   ? 164.001 -2.990  70.405  1.00 68.80 ? 7   THR A O   1 
ATOM   50   C  CB  . THR A 1 7   ? 166.376 -3.955  72.582  1.00 67.81 ? 7   THR A CB  1 
ATOM   51   O  OG1 . THR A 1 7   ? 165.882 -3.657  73.898  1.00 65.98 ? 7   THR A OG1 1 
ATOM   52   C  CG2 . THR A 1 7   ? 166.862 -2.657  71.933  1.00 66.68 ? 7   THR A CG2 1 
ATOM   53   N  N   . VAL A 1 8   ? 163.424 -3.259  72.585  1.00 71.18 ? 8   VAL A N   1 
ATOM   54   C  CA  . VAL A 1 8   ? 162.350 -2.273  72.606  1.00 72.79 ? 8   VAL A CA  1 
ATOM   55   C  C   . VAL A 1 8   ? 162.798 -1.122  73.503  1.00 74.28 ? 8   VAL A C   1 
ATOM   56   O  O   . VAL A 1 8   ? 163.274 -1.341  74.627  1.00 73.33 ? 8   VAL A O   1 
ATOM   57   C  CB  . VAL A 1 8   ? 161.018 -2.856  73.180  1.00 72.03 ? 8   VAL A CB  1 
ATOM   58   C  CG1 . VAL A 1 8   ? 159.915 -1.816  73.114  1.00 72.42 ? 8   VAL A CG1 1 
ATOM   59   C  CG2 . VAL A 1 8   ? 160.595 -4.070  72.386  1.00 73.28 ? 8   VAL A CG2 1 
ATOM   60   N  N   . PRO A 1 9   ? 162.713 0.119   72.979  1.00 75.84 ? 9   PRO A N   1 
ATOM   61   C  CA  . PRO A 1 9   ? 163.083 1.369   73.657  1.00 76.27 ? 9   PRO A CA  1 
ATOM   62   C  C   . PRO A 1 9   ? 161.984 1.903   74.589  1.00 75.95 ? 9   PRO A C   1 
ATOM   63   O  O   . PRO A 1 9   ? 160.805 1.993   74.214  1.00 76.33 ? 9   PRO A O   1 
ATOM   64   C  CB  . PRO A 1 9   ? 163.385 2.314   72.483  1.00 76.14 ? 9   PRO A CB  1 
ATOM   65   C  CG  . PRO A 1 9   ? 162.418 1.863   71.439  1.00 76.11 ? 9   PRO A CG  1 
ATOM   66   C  CD  . PRO A 1 9   ? 162.398 0.360   71.553  1.00 75.70 ? 9   PRO A CD  1 
ATOM   67   N  N   . VAL A 1 10  ? 162.381 2.231   75.814  1.00 75.20 ? 10  VAL A N   1 
ATOM   68   C  CA  . VAL A 1 10  ? 161.436 2.733   76.803  1.00 73.72 ? 10  VAL A CA  1 
ATOM   69   C  C   . VAL A 1 10  ? 161.903 4.082   77.309  1.00 74.21 ? 10  VAL A C   1 
ATOM   70   O  O   . VAL A 1 10  ? 163.089 4.282   77.600  1.00 73.44 ? 10  VAL A O   1 
ATOM   71   C  CB  . VAL A 1 10  ? 161.299 1.767   78.022  1.00 71.74 ? 10  VAL A CB  1 
ATOM   72   C  CG1 . VAL A 1 10  ? 160.223 2.243   78.963  1.00 70.77 ? 10  VAL A CG1 1 
ATOM   73   C  CG2 . VAL A 1 10  ? 160.965 0.381   77.554  1.00 70.97 ? 10  VAL A CG2 1 
ATOM   74   N  N   . LYS A 1 11  ? 160.978 5.025   77.350  1.00 74.46 ? 11  LYS A N   1 
ATOM   75   C  CA  . LYS A 1 11  ? 161.276 6.349   77.856  1.00 74.77 ? 11  LYS A CA  1 
ATOM   76   C  C   . LYS A 1 11  ? 160.498 6.475   79.155  1.00 74.21 ? 11  LYS A C   1 
ATOM   77   O  O   . LYS A 1 11  ? 159.481 5.802   79.354  1.00 73.51 ? 11  LYS A O   1 
ATOM   78   C  CB  . LYS A 1 11  ? 160.859 7.428   76.847  1.00 74.84 ? 11  LYS A CB  1 
ATOM   79   C  CG  . LYS A 1 11  ? 159.447 7.285   76.316  1.00 74.93 ? 11  LYS A CG  1 
ATOM   80   C  CD  . LYS A 1 11  ? 159.264 8.046   75.017  1.00 75.63 ? 11  LYS A CD  1 
ATOM   81   C  CE  . LYS A 1 11  ? 157.823 7.933   74.507  1.00 76.23 ? 11  LYS A CE  1 
ATOM   82   N  NZ  . LYS A 1 11  ? 157.608 8.674   73.225  1.00 75.87 ? 11  LYS A NZ  1 
ATOM   83   N  N   . LEU A 1 12  ? 161.036 7.228   80.098  1.00 74.48 ? 12  LEU A N   1 
ATOM   84   C  CA  . LEU A 1 12  ? 160.311 7.395   81.335  1.00 74.62 ? 12  LEU A CA  1 
ATOM   85   C  C   . LEU A 1 12  ? 159.274 8.459   81.114  1.00 74.43 ? 12  LEU A C   1 
ATOM   86   O  O   . LEU A 1 12  ? 159.447 9.335   80.254  1.00 73.11 ? 12  LEU A O   1 
ATOM   87   C  CB  . LEU A 1 12  ? 161.221 7.784   82.487  1.00 74.85 ? 12  LEU A CB  1 
ATOM   88   C  CG  . LEU A 1 12  ? 161.887 6.591   83.168  1.00 75.71 ? 12  LEU A CG  1 
ATOM   89   C  CD1 . LEU A 1 12  ? 162.576 7.058   84.422  1.00 77.18 ? 12  LEU A CD1 1 
ATOM   90   C  CD2 . LEU A 1 12  ? 160.858 5.541   83.533  1.00 76.03 ? 12  LEU A CD2 1 
ATOM   91   N  N   . LYS A 1 13  ? 158.189 8.355   81.867  1.00 74.48 ? 13  LYS A N   1 
ATOM   92   C  CA  . LYS A 1 13  ? 157.102 9.300   81.775  1.00 75.00 ? 13  LYS A CA  1 
ATOM   93   C  C   . LYS A 1 13  ? 157.645 10.723  81.696  1.00 75.81 ? 13  LYS A C   1 
ATOM   94   O  O   . LYS A 1 13  ? 158.562 11.106  82.440  1.00 74.50 ? 13  LYS A O   1 
ATOM   95   C  CB  . LYS A 1 13  ? 156.150 9.132   82.953  1.00 73.24 ? 13  LYS A CB  1 
ATOM   96   C  CG  . LYS A 1 13  ? 155.627 7.723   83.060  1.00 72.29 ? 13  LYS A CG  1 
ATOM   97   C  CD  . LYS A 1 13  ? 154.290 7.653   83.760  1.00 72.37 ? 13  LYS A CD  1 
ATOM   98   C  CE  . LYS A 1 13  ? 153.169 8.203   82.880  1.00 71.91 ? 13  LYS A CE  1 
ATOM   99   N  NZ  . LYS A 1 13  ? 151.810 7.925   83.447  1.00 72.84 ? 13  LYS A NZ  1 
ATOM   100  N  N   . PRO A 1 14  ? 157.111 11.506  80.747  1.00 76.85 ? 14  PRO A N   1 
ATOM   101  C  CA  . PRO A 1 14  ? 157.484 12.898  80.486  1.00 78.50 ? 14  PRO A CA  1 
ATOM   102  C  C   . PRO A 1 14  ? 157.667 13.765  81.743  1.00 80.27 ? 14  PRO A C   1 
ATOM   103  O  O   . PRO A 1 14  ? 156.774 13.891  82.593  1.00 79.27 ? 14  PRO A O   1 
ATOM   104  C  CB  . PRO A 1 14  ? 156.361 13.391  79.553  1.00 77.46 ? 14  PRO A CB  1 
ATOM   105  C  CG  . PRO A 1 14  ? 155.249 12.372  79.738  1.00 76.96 ? 14  PRO A CG  1 
ATOM   106  C  CD  . PRO A 1 14  ? 155.993 11.100  79.878  1.00 76.46 ? 14  PRO A CD  1 
ATOM   107  N  N   . GLY A 1 15  ? 158.875 14.304  81.867  1.00 81.57 ? 15  GLY A N   1 
ATOM   108  C  CA  . GLY A 1 15  ? 159.211 15.155  82.990  1.00 83.48 ? 15  GLY A CA  1 
ATOM   109  C  C   . GLY A 1 15  ? 159.600 14.381  84.236  1.00 84.45 ? 15  GLY A C   1 
ATOM   110  O  O   . GLY A 1 15  ? 159.834 14.998  85.276  1.00 85.13 ? 15  GLY A O   1 
ATOM   111  N  N   . MET A 1 16  ? 159.691 13.052  84.140  1.00 86.20 ? 16  MET A N   1 
ATOM   112  C  CA  . MET A 1 16  ? 160.068 12.235  85.293  1.00 86.10 ? 16  MET A CA  1 
ATOM   113  C  C   . MET A 1 16  ? 161.513 11.769  85.300  1.00 85.07 ? 16  MET A C   1 
ATOM   114  O  O   . MET A 1 16  ? 162.187 11.821  84.277  1.00 83.62 ? 16  MET A O   1 
ATOM   115  C  CB  . MET A 1 16  ? 159.135 11.046  85.479  1.00 89.08 ? 16  MET A CB  1 
ATOM   116  C  CG  . MET A 1 16  ? 157.756 11.466  85.941  1.00 93.99 ? 16  MET A CG  1 
ATOM   117  S  SD  . MET A 1 16  ? 156.881 10.167  86.866  1.00 99.56 ? 16  MET A SD  1 
ATOM   118  C  CE  . MET A 1 16  ? 157.074 10.717  88.589  1.00 98.76 ? 16  MET A CE  1 
ATOM   119  N  N   . ASP A 1 17  ? 161.968 11.322  86.472  1.00 84.34 ? 17  ASP A N   1 
ATOM   120  C  CA  . ASP A 1 17  ? 163.340 10.858  86.657  1.00 84.11 ? 17  ASP A CA  1 
ATOM   121  C  C   . ASP A 1 17  ? 163.440 9.575   87.491  1.00 84.57 ? 17  ASP A C   1 
ATOM   122  O  O   . ASP A 1 17  ? 162.638 9.347   88.402  1.00 83.47 ? 17  ASP A O   1 
ATOM   123  C  CB  . ASP A 1 17  ? 164.185 11.946  87.320  1.00 83.11 ? 17  ASP A CB  1 
ATOM   124  C  CG  . ASP A 1 17  ? 165.663 11.726  87.132  1.00 82.15 ? 17  ASP A CG  1 
ATOM   125  O  OD1 . ASP A 1 17  ? 166.046 11.261  86.039  1.00 81.08 ? 17  ASP A OD1 1 
ATOM   126  O  OD2 . ASP A 1 17  ? 166.444 12.016  88.054  1.00 82.24 ? 17  ASP A OD2 1 
ATOM   127  N  N   . GLY A 1 18  ? 164.467 8.781   87.183  1.00 85.03 ? 18  GLY A N   1 
ATOM   128  C  CA  . GLY A 1 18  ? 164.727 7.506   87.835  1.00 85.27 ? 18  GLY A CA  1 
ATOM   129  C  C   . GLY A 1 18  ? 164.739 7.491   89.346  1.00 85.07 ? 18  GLY A C   1 
ATOM   130  O  O   . GLY A 1 18  ? 165.210 8.432   89.981  1.00 83.65 ? 18  GLY A O   1 
ATOM   131  N  N   . PRO A 1 19  ? 164.298 6.372   89.940  1.00 86.73 ? 19  PRO A N   1 
ATOM   132  C  CA  . PRO A 1 19  ? 164.237 6.212   91.395  1.00 88.14 ? 19  PRO A CA  1 
ATOM   133  C  C   . PRO A 1 19  ? 165.558 6.427   92.149  1.00 88.90 ? 19  PRO A C   1 
ATOM   134  O  O   . PRO A 1 19  ? 166.628 5.996   91.710  1.00 88.55 ? 19  PRO A O   1 
ATOM   135  C  CB  . PRO A 1 19  ? 163.654 4.792   91.567  1.00 88.47 ? 19  PRO A CB  1 
ATOM   136  C  CG  . PRO A 1 19  ? 164.030 4.086   90.300  1.00 87.66 ? 19  PRO A CG  1 
ATOM   137  C  CD  . PRO A 1 19  ? 163.857 5.145   89.246  1.00 87.37 ? 19  PRO A CD  1 
ATOM   138  N  N   . LYS A 1 20  ? 165.474 7.215   93.220  1.00 90.01 ? 20  LYS A N   1 
ATOM   139  C  CA  . LYS A 1 20  ? 166.634 7.491   94.074  1.00 91.15 ? 20  LYS A CA  1 
ATOM   140  C  C   . LYS A 1 20  ? 166.442 6.652   95.339  1.00 91.96 ? 20  LYS A C   1 
ATOM   141  O  O   . LYS A 1 20  ? 167.046 6.903   96.386  1.00 91.44 ? 20  LYS A O   1 
ATOM   142  C  CB  . LYS A 1 20  ? 166.732 8.982   94.439  1.00 91.28 ? 20  LYS A CB  1 
ATOM   143  C  CG  . LYS A 1 20  ? 167.107 9.919   93.287  1.00 91.01 ? 20  LYS A CG  1 
ATOM   144  C  CD  . LYS A 1 20  ? 165.922 10.192  92.376  1.00 91.30 ? 20  LYS A CD  1 
ATOM   145  C  CE  . LYS A 1 20  ? 166.264 11.190  91.276  1.00 91.94 ? 20  LYS A CE  1 
ATOM   146  N  NZ  . LYS A 1 20  ? 165.112 11.377  90.339  1.00 91.66 ? 20  LYS A NZ  1 
ATOM   147  N  N   . VAL A 1 21  ? 165.609 5.628   95.196  1.00 93.26 ? 21  VAL A N   1 
ATOM   148  C  CA  . VAL A 1 21  ? 165.260 4.702   96.258  1.00 95.29 ? 21  VAL A CA  1 
ATOM   149  C  C   . VAL A 1 21  ? 166.439 3.863   96.758  1.00 96.32 ? 21  VAL A C   1 
ATOM   150  O  O   . VAL A 1 21  ? 166.845 2.898   96.098  1.00 96.64 ? 21  VAL A O   1 
ATOM   151  C  CB  . VAL A 1 21  ? 164.160 3.725   95.762  1.00 95.66 ? 21  VAL A CB  1 
ATOM   152  C  CG1 . VAL A 1 21  ? 163.616 2.903   96.909  1.00 95.57 ? 21  VAL A CG1 1 
ATOM   153  C  CG2 . VAL A 1 21  ? 163.042 4.488   95.090  1.00 95.98 ? 21  VAL A CG2 1 
ATOM   154  N  N   . LYS A 1 22  ? 167.004 4.240   97.903  1.00 97.63 ? 22  LYS A N   1 
ATOM   155  C  CA  . LYS A 1 22  ? 168.102 3.466   98.498  1.00 99.05 ? 22  LYS A CA  1 
ATOM   156  C  C   . LYS A 1 22  ? 167.423 2.345   99.305  1.00 99.46 ? 22  LYS A C   1 
ATOM   157  O  O   . LYS A 1 22  ? 166.191 2.268   99.344  1.00 99.63 ? 22  LYS A O   1 
ATOM   158  C  CB  . LYS A 1 22  ? 168.961 4.330   99.440  1.00 99.18 ? 22  LYS A CB  1 
ATOM   159  C  CG  . LYS A 1 22  ? 169.736 5.445   98.768  1.00 98.83 ? 22  LYS A CG  1 
ATOM   160  C  CD  . LYS A 1 22  ? 170.399 6.317   99.817  1.00 98.44 ? 22  LYS A CD  1 
ATOM   161  C  CE  . LYS A 1 22  ? 170.881 7.642   99.232  1.00 98.44 ? 22  LYS A CE  1 
ATOM   162  N  NZ  . LYS A 1 22  ? 171.319 8.595   100.304 1.00 97.59 ? 22  LYS A NZ  1 
ATOM   163  N  N   . GLN A 1 23  ? 168.196 1.486   99.960  1.00 99.90 ? 23  GLN A N   1 
ATOM   164  C  CA  . GLN A 1 23  ? 167.582 0.419   100.735 1.00 99.90 ? 23  GLN A CA  1 
ATOM   165  C  C   . GLN A 1 23  ? 168.134 0.350   102.128 1.00 99.90 ? 23  GLN A C   1 
ATOM   166  O  O   . GLN A 1 23  ? 169.255 0.785   102.381 1.00 99.90 ? 23  GLN A O   1 
ATOM   167  C  CB  . GLN A 1 23  ? 167.813 -0.940  100.075 1.00 99.90 ? 23  GLN A CB  1 
ATOM   168  C  CG  . GLN A 1 23  ? 167.192 -2.106  100.847 1.00 99.90 ? 23  GLN A CG  1 
ATOM   169  C  CD  . GLN A 1 23  ? 167.633 -3.452  100.320 1.00 99.90 ? 23  GLN A CD  1 
ATOM   170  O  OE1 . GLN A 1 23  ? 168.182 -3.546  99.227  1.00 99.90 ? 23  GLN A OE1 1 
ATOM   171  N  NE2 . GLN A 1 23  ? 167.392 -4.503  101.094 1.00 99.90 ? 23  GLN A NE2 1 
ATOM   172  N  N   . TRP A 1 24  ? 167.311 -0.141  103.051 1.00 99.90 ? 24  TRP A N   1 
ATOM   173  C  CA  . TRP A 1 24  ? 167.775 -0.340  104.414 1.00 99.90 ? 24  TRP A CA  1 
ATOM   174  C  C   . TRP A 1 24  ? 168.635 -1.561  104.121 1.00 99.90 ? 24  TRP A C   1 
ATOM   175  O  O   . TRP A 1 24  ? 168.099 -2.634  103.781 1.00 99.90 ? 24  TRP A O   1 
ATOM   176  C  CB  . TRP A 1 24  ? 166.628 -0.716  105.360 1.00 99.90 ? 24  TRP A CB  1 
ATOM   177  C  CG  . TRP A 1 24  ? 165.589 0.379   105.575 1.00 99.90 ? 24  TRP A CG  1 
ATOM   178  C  CD1 . TRP A 1 24  ? 164.518 0.677   104.754 1.00 99.90 ? 24  TRP A CD1 1 
ATOM   179  C  CD2 . TRP A 1 24  ? 165.524 1.304   106.666 1.00 99.90 ? 24  TRP A CD2 1 
ATOM   180  N  NE1 . TRP A 1 24  ? 163.802 1.732   105.278 1.00 99.90 ? 24  TRP A NE1 1 
ATOM   181  C  CE2 . TRP A 1 24  ? 164.396 2.132   106.444 1.00 99.90 ? 24  TRP A CE2 1 
ATOM   182  C  CE3 . TRP A 1 24  ? 166.307 1.517   107.807 1.00 99.90 ? 24  TRP A CE3 1 
ATOM   183  C  CZ2 . TRP A 1 24  ? 164.033 3.165   107.331 1.00 99.90 ? 24  TRP A CZ2 1 
ATOM   184  C  CZ3 . TRP A 1 24  ? 165.949 2.537   108.689 1.00 99.90 ? 24  TRP A CZ3 1 
ATOM   185  C  CH2 . TRP A 1 24  ? 164.818 3.347   108.440 1.00 99.90 ? 24  TRP A CH2 1 
ATOM   186  N  N   . PRO A 1 25  ? 169.977 -1.386  104.147 1.00 99.90 ? 25  PRO A N   1 
ATOM   187  C  CA  . PRO A 1 25  ? 170.894 -2.503  103.872 1.00 99.90 ? 25  PRO A CA  1 
ATOM   188  C  C   . PRO A 1 25  ? 170.510 -3.755  104.665 1.00 99.90 ? 25  PRO A C   1 
ATOM   189  O  O   . PRO A 1 25  ? 170.566 -3.765  105.896 1.00 99.90 ? 25  PRO A O   1 
ATOM   190  C  CB  . PRO A 1 25  ? 172.272 -1.938  104.253 1.00 99.90 ? 25  PRO A CB  1 
ATOM   191  C  CG  . PRO A 1 25  ? 171.952 -0.834  105.230 1.00 99.90 ? 25  PRO A CG  1 
ATOM   192  C  CD  . PRO A 1 25  ? 170.702 -0.220  104.704 1.00 99.90 ? 25  PRO A CD  1 
ATOM   193  N  N   . LEU A 1 26  ? 170.031 -4.774  103.952 1.00 99.90 ? 26  LEU A N   1 
ATOM   194  C  CA  . LEU A 1 26  ? 169.594 -6.011  104.583 1.00 99.90 ? 26  LEU A CA  1 
ATOM   195  C  C   . LEU A 1 26  ? 170.749 -6.744  105.269 1.00 99.90 ? 26  LEU A C   1 
ATOM   196  O  O   . LEU A 1 26  ? 171.924 -6.366  105.130 1.00 99.90 ? 26  LEU A O   1 
ATOM   197  C  CB  . LEU A 1 26  ? 168.825 -6.909  103.588 1.00 99.90 ? 26  LEU A CB  1 
ATOM   198  C  CG  . LEU A 1 26  ? 169.437 -7.385  102.267 1.00 99.90 ? 26  LEU A CG  1 
ATOM   199  C  CD1 . LEU A 1 26  ? 170.338 -8.604  102.474 1.00 99.90 ? 26  LEU A CD1 1 
ATOM   200  C  CD2 . LEU A 1 26  ? 168.319 -7.753  101.332 1.00 99.90 ? 26  LEU A CD2 1 
ATOM   201  N  N   . THR A 1 27  ? 170.395 -7.770  106.037 1.00 99.90 ? 27  THR A N   1 
ATOM   202  C  CA  . THR A 1 27  ? 171.359 -8.566  106.778 1.00 99.81 ? 27  THR A CA  1 
ATOM   203  C  C   . THR A 1 27  ? 172.569 -8.988  105.935 1.00 98.13 ? 27  THR A C   1 
ATOM   204  O  O   . THR A 1 27  ? 172.429 -9.671  104.913 1.00 97.42 ? 27  THR A O   1 
ATOM   205  C  CB  . THR A 1 27  ? 170.672 -9.806  107.424 1.00 99.56 ? 27  THR A CB  1 
ATOM   206  O  OG1 . THR A 1 27  ? 171.656 -10.621 108.073 1.00 99.52 ? 27  THR A OG1 1 
ATOM   207  C  CG2 . THR A 1 27  ? 169.915 -10.630 106.379 1.00 97.67 ? 27  THR A CG2 1 
ATOM   208  N  N   . GLU A 1 28  ? 173.756 -8.573  106.371 1.00 95.88 ? 28  GLU A N   1 
ATOM   209  C  CA  . GLU A 1 28  ? 174.994 -8.913  105.685 1.00 94.31 ? 28  GLU A CA  1 
ATOM   210  C  C   . GLU A 1 28  ? 175.068 -10.413 105.343 1.00 93.33 ? 28  GLU A C   1 
ATOM   211  O  O   . GLU A 1 28  ? 175.825 -10.824 104.460 1.00 93.16 ? 28  GLU A O   1 
ATOM   212  C  CB  . GLU A 1 28  ? 176.212 -8.482  106.517 1.00 94.69 ? 28  GLU A CB  1 
ATOM   213  C  CG  . GLU A 1 28  ? 176.336 -9.146  107.896 1.00 95.78 ? 28  GLU A CG  1 
ATOM   214  C  CD  . GLU A 1 28  ? 175.549 -8.438  108.997 1.00 96.16 ? 28  GLU A CD  1 
ATOM   215  O  OE1 . GLU A 1 28  ? 174.306 -8.585  109.055 1.00 96.79 ? 28  GLU A OE1 1 
ATOM   216  O  OE2 . GLU A 1 28  ? 176.188 -7.748  109.825 1.00 96.38 ? 28  GLU A OE2 1 
ATOM   217  N  N   . GLU A 1 29  ? 174.265 -11.216 106.037 1.00 92.59 ? 29  GLU A N   1 
ATOM   218  C  CA  . GLU A 1 29  ? 174.190 -12.654 105.809 1.00 93.00 ? 29  GLU A CA  1 
ATOM   219  C  C   . GLU A 1 29  ? 173.647 -12.928 104.404 1.00 91.55 ? 29  GLU A C   1 
ATOM   220  O  O   . GLU A 1 29  ? 174.318 -13.557 103.579 1.00 90.95 ? 29  GLU A O   1 
ATOM   221  C  CB  . GLU A 1 29  ? 173.254 -13.300 106.841 1.00 94.64 ? 29  GLU A CB  1 
ATOM   222  C  CG  . GLU A 1 29  ? 172.931 -14.772 106.571 1.00 97.09 ? 29  GLU A CG  1 
ATOM   223  C  CD  . GLU A 1 29  ? 171.566 -15.191 107.113 1.00 98.44 ? 29  GLU A CD  1 
ATOM   224  O  OE1 . GLU A 1 29  ? 170.536 -14.753 106.550 1.00 99.11 ? 29  GLU A OE1 1 
ATOM   225  O  OE2 . GLU A 1 29  ? 171.522 -15.970 108.091 1.00 98.30 ? 29  GLU A OE2 1 
ATOM   226  N  N   . LYS A 1 30  ? 172.433 -12.451 104.130 1.00 89.95 ? 30  LYS A N   1 
ATOM   227  C  CA  . LYS A 1 30  ? 171.827 -12.647 102.817 1.00 88.15 ? 30  LYS A CA  1 
ATOM   228  C  C   . LYS A 1 30  ? 172.423 -11.703 101.760 1.00 87.34 ? 30  LYS A C   1 
ATOM   229  O  O   . LYS A 1 30  ? 171.951 -11.659 100.619 1.00 87.45 ? 30  LYS A O   1 
ATOM   230  C  CB  . LYS A 1 30  ? 170.290 -12.555 102.881 1.00 87.67 ? 30  LYS A CB  1 
ATOM   231  C  CG  . LYS A 1 30  ? 169.626 -13.677 103.705 1.00 85.45 ? 30  LYS A CG  1 
ATOM   232  C  CD  . LYS A 1 30  ? 168.519 -14.439 102.957 1.00 84.32 ? 30  LYS A CD  1 
ATOM   233  C  CE  . LYS A 1 30  ? 169.054 -15.237 101.768 1.00 83.21 ? 30  LYS A CE  1 
ATOM   234  N  NZ  . LYS A 1 30  ? 168.078 -16.249 101.266 1.00 81.01 ? 30  LYS A NZ  1 
ATOM   235  N  N   . ILE A 1 31  ? 173.456 -10.948 102.148 1.00 86.80 ? 31  ILE A N   1 
ATOM   236  C  CA  . ILE A 1 31  ? 174.163 -10.049 101.224 1.00 85.93 ? 31  ILE A CA  1 
ATOM   237  C  C   . ILE A 1 31  ? 175.151 -10.867 100.366 1.00 84.99 ? 31  ILE A C   1 
ATOM   238  O  O   . ILE A 1 31  ? 175.266 -10.639 99.156  1.00 84.10 ? 31  ILE A O   1 
ATOM   239  C  CB  . ILE A 1 31  ? 174.899 -8.873  101.961 1.00 85.50 ? 31  ILE A CB  1 
ATOM   240  C  CG1 . ILE A 1 31  ? 173.940 -7.674  102.108 1.00 84.85 ? 31  ILE A CG1 1 
ATOM   241  C  CG2 . ILE A 1 31  ? 176.205 -8.493  101.225 1.00 84.74 ? 31  ILE A CG2 1 
ATOM   242  C  CD1 . ILE A 1 31  ? 174.521 -6.429  102.782 1.00 84.38 ? 31  ILE A CD1 1 
ATOM   243  N  N   . LYS A 1 32  ? 175.833 -11.836 100.982 1.00 83.16 ? 32  LYS A N   1 
ATOM   244  C  CA  . LYS A 1 32  ? 176.761 -12.701 100.253 1.00 81.74 ? 32  LYS A CA  1 
ATOM   245  C  C   . LYS A 1 32  ? 175.998 -13.415 99.150  1.00 81.42 ? 32  LYS A C   1 
ATOM   246  O  O   . LYS A 1 32  ? 176.543 -13.688 98.081  1.00 82.23 ? 32  LYS A O   1 
ATOM   247  C  CB  . LYS A 1 32  ? 177.367 -13.748 101.174 1.00 81.02 ? 32  LYS A CB  1 
ATOM   248  C  CG  . LYS A 1 32  ? 178.785 -13.468 101.543 1.00 80.69 ? 32  LYS A CG  1 
ATOM   249  C  CD  . LYS A 1 32  ? 179.289 -14.506 102.515 1.00 80.99 ? 32  LYS A CD  1 
ATOM   250  C  CE  . LYS A 1 32  ? 180.635 -14.100 103.088 1.00 80.34 ? 32  LYS A CE  1 
ATOM   251  N  NZ  . LYS A 1 32  ? 180.997 -14.979 104.216 1.00 81.85 ? 32  LYS A NZ  1 
ATOM   252  N  N   . ALA A 1 33  ? 174.743 -13.746 99.445  1.00 81.59 ? 33  ALA A N   1 
ATOM   253  C  CA  . ALA A 1 33  ? 173.854 -14.417 98.502  1.00 81.45 ? 33  ALA A CA  1 
ATOM   254  C  C   . ALA A 1 33  ? 173.628 -13.491 97.314  1.00 80.77 ? 33  ALA A C   1 
ATOM   255  O  O   . ALA A 1 33  ? 173.985 -13.838 96.186  1.00 81.30 ? 33  ALA A O   1 
ATOM   256  C  CB  . ALA A 1 33  ? 172.511 -14.761 99.175  1.00 82.08 ? 33  ALA A CB  1 
ATOM   257  N  N   . LEU A 1 34  ? 173.065 -12.307 97.579  1.00 78.69 ? 34  LEU A N   1 
ATOM   258  C  CA  . LEU A 1 34  ? 172.799 -11.311 96.540  1.00 76.01 ? 34  LEU A CA  1 
ATOM   259  C  C   . LEU A 1 34  ? 174.007 -11.198 95.612  1.00 74.04 ? 34  LEU A C   1 
ATOM   260  O  O   . LEU A 1 34  ? 173.878 -11.319 94.392  1.00 72.80 ? 34  LEU A O   1 
ATOM   261  C  CB  . LEU A 1 34  ? 172.476 -9.939  97.163  1.00 75.80 ? 34  LEU A CB  1 
ATOM   262  C  CG  . LEU A 1 34  ? 171.102 -9.701  97.810  1.00 74.41 ? 34  LEU A CG  1 
ATOM   263  C  CD1 . LEU A 1 34  ? 171.033 -8.278  98.335  1.00 71.97 ? 34  LEU A CD1 1 
ATOM   264  C  CD2 . LEU A 1 34  ? 169.979 -9.942  96.809  1.00 73.04 ? 34  LEU A CD2 1 
ATOM   265  N  N   . VAL A 1 35  ? 175.184 -11.035 96.208  1.00 72.68 ? 35  VAL A N   1 
ATOM   266  C  CA  . VAL A 1 35  ? 176.410 -10.927 95.443  1.00 71.15 ? 35  VAL A CA  1 
ATOM   267  C  C   . VAL A 1 35  ? 176.590 -12.195 94.616  1.00 70.26 ? 35  VAL A C   1 
ATOM   268  O  O   . VAL A 1 35  ? 176.547 -12.139 93.392  1.00 70.86 ? 35  VAL A O   1 
ATOM   269  C  CB  . VAL A 1 35  ? 177.650 -10.736 96.355  1.00 71.03 ? 35  VAL A CB  1 
ATOM   270  C  CG1 . VAL A 1 35  ? 178.858 -10.368 95.514  1.00 71.23 ? 35  VAL A CG1 1 
ATOM   271  C  CG2 . VAL A 1 35  ? 177.395 -9.656  97.395  1.00 71.61 ? 35  VAL A CG2 1 
ATOM   272  N  N   . GLU A 1 36  ? 176.716 -13.340 95.285  1.00 68.73 ? 36  GLU A N   1 
ATOM   273  C  CA  . GLU A 1 36  ? 176.920 -14.624 94.616  1.00 67.92 ? 36  GLU A CA  1 
ATOM   274  C  C   . GLU A 1 36  ? 175.895 -14.909 93.526  1.00 67.92 ? 36  GLU A C   1 
ATOM   275  O  O   . GLU A 1 36  ? 176.228 -15.492 92.492  1.00 67.93 ? 36  GLU A O   1 
ATOM   276  C  CB  . GLU A 1 36  ? 176.937 -15.757 95.635  1.00 67.14 ? 36  GLU A CB  1 
ATOM   277  N  N   . ILE A 1 37  ? 174.661 -14.470 93.745  1.00 67.50 ? 37  ILE A N   1 
ATOM   278  C  CA  . ILE A 1 37  ? 173.578 -14.686 92.794  1.00 68.03 ? 37  ILE A CA  1 
ATOM   279  C  C   . ILE A 1 37  ? 173.712 -13.765 91.588  1.00 69.06 ? 37  ILE A C   1 
ATOM   280  O  O   . ILE A 1 37  ? 173.486 -14.174 90.450  1.00 69.71 ? 37  ILE A O   1 
ATOM   281  C  CB  . ILE A 1 37  ? 172.206 -14.458 93.454  1.00 67.43 ? 37  ILE A CB  1 
ATOM   282  C  CG1 . ILE A 1 37  ? 172.040 -15.409 94.643  1.00 66.60 ? 37  ILE A CG1 1 
ATOM   283  C  CG2 . ILE A 1 37  ? 171.086 -14.666 92.440  1.00 67.09 ? 37  ILE A CG2 1 
ATOM   284  C  CD1 . ILE A 1 37  ? 170.790 -15.152 95.485  1.00 64.57 ? 37  ILE A CD1 1 
ATOM   285  N  N   . CYS A 1 38  ? 174.104 -12.525 91.837  1.00 70.24 ? 38  CYS A N   1 
ATOM   286  C  CA  . CYS A 1 38  ? 174.264 -11.550 90.769  1.00 70.80 ? 38  CYS A CA  1 
ATOM   287  C  C   . CYS A 1 38  ? 175.548 -11.737 89.960  1.00 71.14 ? 38  CYS A C   1 
ATOM   288  O  O   . CYS A 1 38  ? 175.610 -11.340 88.800  1.00 69.74 ? 38  CYS A O   1 
ATOM   289  C  CB  . CYS A 1 38  ? 174.202 -10.142 91.358  1.00 70.32 ? 38  CYS A CB  1 
ATOM   290  S  SG  . CYS A 1 38  ? 172.696 -9.833  92.287  1.00 70.96 ? 38  CYS A SG  1 
ATOM   291  N  N   . THR A 1 39  ? 176.570 -12.318 90.587  1.00 72.94 ? 39  THR A N   1 
ATOM   292  C  CA  . THR A 1 39  ? 177.847 -12.570 89.924  1.00 74.84 ? 39  THR A CA  1 
ATOM   293  C  C   . THR A 1 39  ? 177.558 -13.493 88.757  1.00 74.84 ? 39  THR A C   1 
ATOM   294  O  O   . THR A 1 39  ? 178.000 -13.249 87.630  1.00 74.82 ? 39  THR A O   1 
ATOM   295  C  CB  . THR A 1 39  ? 178.863 -13.245 90.870  1.00 75.49 ? 39  THR A CB  1 
ATOM   296  O  OG1 . THR A 1 39  ? 179.249 -12.314 91.892  1.00 76.39 ? 39  THR A OG1 1 
ATOM   297  C  CG2 . THR A 1 39  ? 180.091 -13.700 90.099  1.00 76.50 ? 39  THR A CG2 1 
ATOM   298  N  N   . GLU A 1 40  ? 176.813 -14.553 89.041  1.00 74.59 ? 40  GLU A N   1 
ATOM   299  C  CA  . GLU A 1 40  ? 176.442 -15.498 88.019  1.00 74.04 ? 40  GLU A CA  1 
ATOM   300  C  C   . GLU A 1 40  ? 175.534 -14.780 87.056  1.00 73.21 ? 40  GLU A C   1 
ATOM   301  O  O   . GLU A 1 40  ? 175.851 -14.740 85.895  1.00 73.10 ? 40  GLU A O   1 
ATOM   302  C  CB  . GLU A 1 40  ? 175.733 -16.688 88.631  1.00 75.15 ? 40  GLU A CB  1 
ATOM   303  C  CG  . GLU A 1 40  ? 175.814 -17.958 87.809  1.00 77.63 ? 40  GLU A CG  1 
ATOM   304  C  CD  . GLU A 1 40  ? 177.243 -18.482 87.651  1.00 79.07 ? 40  GLU A CD  1 
ATOM   305  O  OE1 . GLU A 1 40  ? 177.986 -18.511 88.658  1.00 79.74 ? 40  GLU A OE1 1 
ATOM   306  O  OE2 . GLU A 1 40  ? 177.624 -18.872 86.522  1.00 79.73 ? 40  GLU A OE2 1 
ATOM   307  N  N   . MET A 1 41  ? 174.500 -14.101 87.552  1.00 72.23 ? 41  MET A N   1 
ATOM   308  C  CA  . MET A 1 41  ? 173.567 -13.369 86.691  1.00 71.47 ? 41  MET A CA  1 
ATOM   309  C  C   . MET A 1 41  ? 174.318 -12.426 85.747  1.00 70.80 ? 41  MET A C   1 
ATOM   310  O  O   . MET A 1 41  ? 173.939 -12.231 84.585  1.00 70.00 ? 41  MET A O   1 
ATOM   311  C  CB  . MET A 1 41  ? 172.588 -12.560 87.543  1.00 72.35 ? 41  MET A CB  1 
ATOM   312  C  CG  . MET A 1 41  ? 171.581 -13.359 88.383  1.00 71.57 ? 41  MET A CG  1 
ATOM   313  S  SD  . MET A 1 41  ? 170.363 -12.222 89.165  1.00 71.83 ? 41  MET A SD  1 
ATOM   314  C  CE  . MET A 1 41  ? 168.832 -12.747 88.403  1.00 70.03 ? 41  MET A CE  1 
ATOM   315  N  N   . GLU A 1 42  ? 175.387 -11.844 86.273  1.00 70.53 ? 42  GLU A N   1 
ATOM   316  C  CA  . GLU A 1 42  ? 176.244 -10.925 85.541  1.00 70.54 ? 42  GLU A CA  1 
ATOM   317  C  C   . GLU A 1 42  ? 177.032 -11.766 84.553  1.00 69.27 ? 42  GLU A C   1 
ATOM   318  O  O   . GLU A 1 42  ? 177.217 -11.379 83.400  1.00 68.43 ? 42  GLU A O   1 
ATOM   319  C  CB  . GLU A 1 42  ? 177.167 -10.223 86.531  1.00 72.36 ? 42  GLU A CB  1 
ATOM   320  C  CG  . GLU A 1 42  ? 178.350 -9.509  85.940  1.00 75.10 ? 42  GLU A CG  1 
ATOM   321  C  CD  . GLU A 1 42  ? 179.515 -9.529  86.904  1.00 76.98 ? 42  GLU A CD  1 
ATOM   322  O  OE1 . GLU A 1 42  ? 179.839 -10.638 87.390  1.00 78.15 ? 42  GLU A OE1 1 
ATOM   323  O  OE2 . GLU A 1 42  ? 180.087 -8.452  87.194  1.00 78.55 ? 42  GLU A OE2 1 
ATOM   324  N  N   . LYS A 1 43  ? 177.431 -12.952 85.009  1.00 67.67 ? 43  LYS A N   1 
ATOM   325  C  CA  . LYS A 1 43  ? 178.167 -13.919 84.201  1.00 66.10 ? 43  LYS A CA  1 
ATOM   326  C  C   . LYS A 1 43  ? 177.203 -14.608 83.219  1.00 65.41 ? 43  LYS A C   1 
ATOM   327  O  O   . LYS A 1 43  ? 177.632 -15.262 82.269  1.00 63.19 ? 43  LYS A O   1 
ATOM   328  C  CB  . LYS A 1 43  ? 178.832 -14.963 85.100  1.00 65.16 ? 43  LYS A CB  1 
ATOM   329  C  CG  . LYS A 1 43  ? 179.960 -15.732 84.429  1.00 63.31 ? 43  LYS A CG  1 
ATOM   330  C  CD  . LYS A 1 43  ? 180.297 -16.990 85.195  1.00 62.48 ? 43  LYS A CD  1 
ATOM   331  C  CE  . LYS A 1 43  ? 180.639 -16.694 86.641  1.00 61.86 ? 43  LYS A CE  1 
ATOM   332  N  NZ  . LYS A 1 43  ? 180.687 -17.961 87.419  1.00 61.16 ? 43  LYS A NZ  1 
ATOM   333  N  N   . GLU A 1 44  ? 175.902 -14.484 83.474  1.00 66.68 ? 44  GLU A N   1 
ATOM   334  C  CA  . GLU A 1 44  ? 174.878 -15.045 82.598  1.00 68.50 ? 44  GLU A CA  1 
ATOM   335  C  C   . GLU A 1 44  ? 174.566 -13.901 81.645  1.00 69.05 ? 44  GLU A C   1 
ATOM   336  O  O   . GLU A 1 44  ? 173.622 -13.967 80.849  1.00 68.95 ? 44  GLU A O   1 
ATOM   337  C  CB  . GLU A 1 44  ? 173.592 -15.408 83.351  1.00 69.57 ? 44  GLU A CB  1 
ATOM   338  C  CG  . GLU A 1 44  ? 173.713 -16.231 84.621  1.00 72.05 ? 44  GLU A CG  1 
ATOM   339  C  CD  . GLU A 1 44  ? 174.476 -17.517 84.444  1.00 73.58 ? 44  GLU A CD  1 
ATOM   340  O  OE1 . GLU A 1 44  ? 175.716 -17.478 84.367  1.00 75.12 ? 44  GLU A OE1 1 
ATOM   341  O  OE2 . GLU A 1 44  ? 173.845 -18.584 84.413  1.00 74.91 ? 44  GLU A OE2 1 
ATOM   342  N  N   . GLY A 1 45  ? 175.334 -12.821 81.793  1.00 69.98 ? 45  GLY A N   1 
ATOM   343  C  CA  . GLY A 1 45  ? 175.194 -11.650 80.952  1.00 71.38 ? 45  GLY A CA  1 
ATOM   344  C  C   . GLY A 1 45  ? 174.055 -10.738 81.324  1.00 72.02 ? 45  GLY A C   1 
ATOM   345  O  O   . GLY A 1 45  ? 174.059 -9.551  80.991  1.00 72.33 ? 45  GLY A O   1 
ATOM   346  N  N   . LYS A 1 46  ? 173.101 -11.271 82.066  1.00 72.28 ? 46  LYS A N   1 
ATOM   347  C  CA  . LYS A 1 46  ? 171.944 -10.490 82.441  1.00 73.14 ? 46  LYS A CA  1 
ATOM   348  C  C   . LYS A 1 46  ? 172.245 -9.154  83.127  1.00 73.15 ? 46  LYS A C   1 
ATOM   349  O  O   . LYS A 1 46  ? 171.471 -8.202  82.990  1.00 72.98 ? 46  LYS A O   1 
ATOM   350  C  CB  . LYS A 1 46  ? 170.980 -11.340 83.265  1.00 73.75 ? 46  LYS A CB  1 
ATOM   351  C  CG  . LYS A 1 46  ? 170.124 -12.276 82.429  1.00 74.69 ? 46  LYS A CG  1 
ATOM   352  C  CD  . LYS A 1 46  ? 170.686 -13.676 82.370  1.00 77.59 ? 46  LYS A CD  1 
ATOM   353  C  CE  . LYS A 1 46  ? 169.722 -14.632 81.640  1.00 79.15 ? 46  LYS A CE  1 
ATOM   354  N  NZ  . LYS A 1 46  ? 169.979 -16.074 81.985  1.00 79.43 ? 46  LYS A NZ  1 
ATOM   355  N  N   . ILE A 1 47  ? 173.391 -9.057  83.794  1.00 72.98 ? 47  ILE A N   1 
ATOM   356  C  CA  . ILE A 1 47  ? 173.754 -7.833  84.498  1.00 73.12 ? 47  ILE A CA  1 
ATOM   357  C  C   . ILE A 1 47  ? 175.103 -7.270  84.059  1.00 73.56 ? 47  ILE A C   1 
ATOM   358  O  O   . ILE A 1 47  ? 175.974 -8.011  83.593  1.00 74.49 ? 47  ILE A O   1 
ATOM   359  C  CB  . ILE A 1 47  ? 173.861 -8.084  86.017  1.00 73.55 ? 47  ILE A CB  1 
ATOM   360  C  CG1 . ILE A 1 47  ? 172.646 -8.852  86.530  1.00 73.70 ? 47  ILE A CG1 1 
ATOM   361  C  CG2 . ILE A 1 47  ? 173.996 -6.771  86.757  1.00 74.04 ? 47  ILE A CG2 1 
ATOM   362  C  CD1 . ILE A 1 47  ? 172.728 -9.178  88.017  1.00 73.92 ? 47  ILE A CD1 1 
ATOM   363  N  N   . SER A 1 48  ? 175.269 -5.961  84.243  1.00 72.86 ? 48  SER A N   1 
ATOM   364  C  CA  . SER A 1 48  ? 176.509 -5.268  83.929  1.00 72.58 ? 48  SER A CA  1 
ATOM   365  C  C   . SER A 1 48  ? 176.842 -4.409  85.132  1.00 72.46 ? 48  SER A C   1 
ATOM   366  O  O   . SER A 1 48  ? 176.118 -3.469  85.431  1.00 71.02 ? 48  SER A O   1 
ATOM   367  C  CB  . SER A 1 48  ? 176.350 -4.398  82.686  1.00 71.66 ? 48  SER A CB  1 
ATOM   368  O  OG  . SER A 1 48  ? 176.322 -5.204  81.529  1.00 71.63 ? 48  SER A OG  1 
ATOM   369  N  N   . LYS A 1 49  ? 177.904 -4.772  85.847  1.00 75.12 ? 49  LYS A N   1 
ATOM   370  C  CA  . LYS A 1 49  ? 178.324 -4.039  87.037  1.00 78.14 ? 49  LYS A CA  1 
ATOM   371  C  C   . LYS A 1 49  ? 178.912 -2.671  86.728  1.00 80.81 ? 49  LYS A C   1 
ATOM   372  O  O   . LYS A 1 49  ? 179.964 -2.544  86.076  1.00 80.77 ? 49  LYS A O   1 
ATOM   373  C  CB  . LYS A 1 49  ? 179.304 -4.854  87.893  1.00 76.88 ? 49  LYS A CB  1 
ATOM   374  C  CG  . LYS A 1 49  ? 180.728 -4.971  87.351  1.00 75.41 ? 49  LYS A CG  1 
ATOM   375  C  CD  . LYS A 1 49  ? 181.725 -4.721  88.475  1.00 74.04 ? 49  LYS A CD  1 
ATOM   376  C  CE  . LYS A 1 49  ? 183.160 -4.754  87.987  1.00 72.26 ? 49  LYS A CE  1 
ATOM   377  N  NZ  . LYS A 1 49  ? 184.107 -4.465  89.101  1.00 70.70 ? 49  LYS A NZ  1 
ATOM   378  N  N   . ILE A 1 50  ? 178.191 -1.642  87.154  1.00 84.28 ? 50  ILE A N   1 
ATOM   379  C  CA  . ILE A 1 50  ? 178.591 -0.255  86.948  1.00 88.34 ? 50  ILE A CA  1 
ATOM   380  C  C   . ILE A 1 50  ? 178.046 0.546   88.128  1.00 90.95 ? 50  ILE A C   1 
ATOM   381  O  O   . ILE A 1 50  ? 176.880 0.400   88.512  1.00 90.37 ? 50  ILE A O   1 
ATOM   382  C  CB  . ILE A 1 50  ? 177.967 0.346   85.644  1.00 89.11 ? 50  ILE A CB  1 
ATOM   383  C  CG1 . ILE A 1 50  ? 178.246 -0.564  84.438  1.00 89.56 ? 50  ILE A CG1 1 
ATOM   384  C  CG2 . ILE A 1 50  ? 178.508 1.763   85.396  1.00 88.99 ? 50  ILE A CG2 1 
ATOM   385  C  CD1 . ILE A 1 50  ? 177.365 -0.272  83.235  1.00 89.32 ? 50  ILE A CD1 1 
ATOM   386  N  N   . GLY A 1 51  ? 178.901 1.381   88.704  1.00 93.43 ? 51  GLY A N   1 
ATOM   387  C  CA  . GLY A 1 51  ? 178.486 2.207   89.824  1.00 95.76 ? 51  GLY A CA  1 
ATOM   388  C  C   . GLY A 1 51  ? 178.642 3.706   89.687  1.00 97.86 ? 51  GLY A C   1 
ATOM   389  O  O   . GLY A 1 51  ? 177.739 4.448   90.104  1.00 97.56 ? 51  GLY A O   1 
ATOM   390  N  N   . PRO A 1 52  ? 179.767 4.187   89.098  1.00 98.22 ? 52  PRO A N   1 
ATOM   391  C  CA  . PRO A 1 52  ? 180.021 5.625   88.925  1.00 98.31 ? 52  PRO A CA  1 
ATOM   392  C  C   . PRO A 1 52  ? 178.964 6.543   88.259  1.00 97.66 ? 52  PRO A C   1 
ATOM   393  O  O   . PRO A 1 52  ? 178.174 7.179   88.963  1.00 97.98 ? 52  PRO A O   1 
ATOM   394  C  CB  . PRO A 1 52  ? 181.388 5.654   88.195  1.00 98.76 ? 52  PRO A CB  1 
ATOM   395  C  CG  . PRO A 1 52  ? 181.459 4.276   87.551  1.00 99.67 ? 52  PRO A CG  1 
ATOM   396  C  CD  . PRO A 1 52  ? 180.923 3.413   88.596  1.00 98.91 ? 52  PRO A CD  1 
ATOM   397  N  N   . GLU A 1 53  ? 178.964 6.616   86.929  1.00 96.18 ? 53  GLU A N   1 
ATOM   398  C  CA  . GLU A 1 53  ? 178.042 7.479   86.184  1.00 95.41 ? 53  GLU A CA  1 
ATOM   399  C  C   . GLU A 1 53  ? 176.578 7.021   86.195  1.00 93.77 ? 53  GLU A C   1 
ATOM   400  O  O   . GLU A 1 53  ? 175.972 6.853   85.137  1.00 93.38 ? 53  GLU A O   1 
ATOM   401  C  CB  . GLU A 1 53  ? 178.526 7.624   84.735  1.00 96.85 ? 53  GLU A CB  1 
ATOM   402  C  CG  . GLU A 1 53  ? 180.059 7.645   84.543  1.00 98.74 ? 53  GLU A CG  1 
ATOM   403  C  CD  . GLU A 1 53  ? 180.615 6.338   83.967  1.00 99.90 ? 53  GLU A CD  1 
ATOM   404  O  OE1 . GLU A 1 53  ? 179.960 5.282   84.120  1.00 99.90 ? 53  GLU A OE1 1 
ATOM   405  O  OE2 . GLU A 1 53  ? 181.711 6.365   83.359  1.00 99.90 ? 53  GLU A OE2 1 
ATOM   406  N  N   . ASN A 1 54  ? 176.020 6.814   87.386  1.00 92.22 ? 54  ASN A N   1 
ATOM   407  C  CA  . ASN A 1 54  ? 174.633 6.372   87.516  1.00 90.64 ? 54  ASN A CA  1 
ATOM   408  C  C   . ASN A 1 54  ? 174.129 6.542   88.941  1.00 88.00 ? 54  ASN A C   1 
ATOM   409  O  O   . ASN A 1 54  ? 174.515 5.804   89.847  1.00 87.62 ? 54  ASN A O   1 
ATOM   410  C  CB  . ASN A 1 54  ? 174.477 4.902   87.096  1.00 91.32 ? 54  ASN A CB  1 
ATOM   411  C  CG  . ASN A 1 54  ? 173.024 4.423   87.140  1.00 91.43 ? 54  ASN A CG  1 
ATOM   412  O  OD1 . ASN A 1 54  ? 172.189 4.945   87.884  1.00 92.05 ? 54  ASN A OD1 1 
ATOM   413  N  ND2 . ASN A 1 54  ? 172.720 3.432   86.326  1.00 92.17 ? 54  ASN A ND2 1 
ATOM   414  N  N   . PRO A 1 55  ? 173.281 7.552   89.157  1.00 85.91 ? 55  PRO A N   1 
ATOM   415  C  CA  . PRO A 1 55  ? 172.709 7.831   90.474  1.00 84.61 ? 55  PRO A CA  1 
ATOM   416  C  C   . PRO A 1 55  ? 171.648 6.804   90.843  1.00 82.63 ? 55  PRO A C   1 
ATOM   417  O  O   . PRO A 1 55  ? 171.714 6.166   91.894  1.00 82.76 ? 55  PRO A O   1 
ATOM   418  C  CB  . PRO A 1 55  ? 172.068 9.212   90.278  1.00 84.89 ? 55  PRO A CB  1 
ATOM   419  C  CG  . PRO A 1 55  ? 172.868 9.817   89.161  1.00 85.19 ? 55  PRO A CG  1 
ATOM   420  C  CD  . PRO A 1 55  ? 173.021 8.663   88.224  1.00 85.36 ? 55  PRO A CD  1 
ATOM   421  N  N   . TYR A 1 56  ? 170.696 6.639   89.936  1.00 80.36 ? 56  TYR A N   1 
ATOM   422  C  CA  . TYR A 1 56  ? 169.544 5.757   90.095  1.00 78.90 ? 56  TYR A CA  1 
ATOM   423  C  C   . TYR A 1 56  ? 169.746 4.409   90.765  1.00 79.37 ? 56  TYR A C   1 
ATOM   424  O  O   . TYR A 1 56  ? 170.422 3.527   90.225  1.00 79.62 ? 56  TYR A O   1 
ATOM   425  C  CB  . TYR A 1 56  ? 168.869 5.595   88.745  1.00 75.69 ? 56  TYR A CB  1 
ATOM   426  C  CG  . TYR A 1 56  ? 168.735 6.923   88.057  1.00 72.12 ? 56  TYR A CG  1 
ATOM   427  C  CD1 . TYR A 1 56  ? 168.074 7.980   88.672  1.00 70.53 ? 56  TYR A CD1 1 
ATOM   428  C  CD2 . TYR A 1 56  ? 169.313 7.141   86.819  1.00 71.13 ? 56  TYR A CD2 1 
ATOM   429  C  CE1 . TYR A 1 56  ? 167.995 9.217   88.072  1.00 69.23 ? 56  TYR A CE1 1 
ATOM   430  C  CE2 . TYR A 1 56  ? 169.238 8.376   86.209  1.00 69.67 ? 56  TYR A CE2 1 
ATOM   431  C  CZ  . TYR A 1 56  ? 168.579 9.405   86.841  1.00 69.84 ? 56  TYR A CZ  1 
ATOM   432  O  OH  . TYR A 1 56  ? 168.504 10.631  86.229  1.00 70.86 ? 56  TYR A OH  1 
ATOM   433  N  N   . ASN A 1 57  ? 169.058 4.241   91.895  1.00 78.96 ? 57  ASN A N   1 
ATOM   434  C  CA  . ASN A 1 57  ? 169.123 3.030   92.699  1.00 78.75 ? 57  ASN A CA  1 
ATOM   435  C  C   . ASN A 1 57  ? 167.739 2.461   93.042  1.00 78.80 ? 57  ASN A C   1 
ATOM   436  O  O   . ASN A 1 57  ? 166.731 3.174   92.994  1.00 79.65 ? 57  ASN A O   1 
ATOM   437  C  CB  . ASN A 1 57  ? 169.875 3.319   94.005  1.00 78.11 ? 57  ASN A CB  1 
ATOM   438  C  CG  . ASN A 1 57  ? 170.397 2.050   94.670  1.00 77.46 ? 57  ASN A CG  1 
ATOM   439  O  OD1 . ASN A 1 57  ? 171.250 1.366   94.123  1.00 76.56 ? 57  ASN A OD1 1 
ATOM   440  N  ND2 . ASN A 1 57  ? 169.876 1.729   95.851  1.00 75.80 ? 57  ASN A ND2 1 
ATOM   441  N  N   . THR A 1 58  ? 167.726 1.178   93.400  1.00 78.22 ? 58  THR A N   1 
ATOM   442  C  CA  . THR A 1 58  ? 166.537 0.445   93.813  1.00 77.42 ? 58  THR A CA  1 
ATOM   443  C  C   . THR A 1 58  ? 167.071 -0.586  94.823  1.00 78.88 ? 58  THR A C   1 
ATOM   444  O  O   . THR A 1 58  ? 168.267 -0.900  94.830  1.00 78.02 ? 58  THR A O   1 
ATOM   445  C  CB  . THR A 1 58  ? 165.840 -0.260  92.597  1.00 76.20 ? 58  THR A CB  1 
ATOM   446  O  OG1 . THR A 1 58  ? 165.460 0.737   91.638  1.00 75.86 ? 58  THR A OG1 1 
ATOM   447  C  CG2 . THR A 1 58  ? 164.564 -0.992  93.023  1.00 74.08 ? 58  THR A CG2 1 
ATOM   448  N  N   . PRO A 1 59  ? 166.222 -1.012  95.771  1.00 81.30 ? 59  PRO A N   1 
ATOM   449  C  CA  . PRO A 1 59  ? 166.505 -1.990  96.832  1.00 82.93 ? 59  PRO A CA  1 
ATOM   450  C  C   . PRO A 1 59  ? 166.572 -3.464  96.396  1.00 83.73 ? 59  PRO A C   1 
ATOM   451  O  O   . PRO A 1 59  ? 165.637 -3.995  95.783  1.00 83.37 ? 59  PRO A O   1 
ATOM   452  C  CB  . PRO A 1 59  ? 165.353 -1.760  97.810  1.00 83.43 ? 59  PRO A CB  1 
ATOM   453  C  CG  . PRO A 1 59  ? 164.242 -1.302  96.908  1.00 83.70 ? 59  PRO A CG  1 
ATOM   454  C  CD  . PRO A 1 59  ? 164.943 -0.326  96.036  1.00 82.39 ? 59  PRO A CD  1 
ATOM   455  N  N   . VAL A 1 60  ? 167.657 -4.127  96.785  1.00 85.62 ? 60  VAL A N   1 
ATOM   456  C  CA  . VAL A 1 60  ? 167.887 -5.531  96.455  1.00 87.05 ? 60  VAL A CA  1 
ATOM   457  C  C   . VAL A 1 60  ? 167.495 -6.438  97.624  1.00 89.01 ? 60  VAL A C   1 
ATOM   458  O  O   . VAL A 1 60  ? 168.202 -6.507  98.631  1.00 88.48 ? 60  VAL A O   1 
ATOM   459  C  CB  . VAL A 1 60  ? 169.380 -5.796  96.120  1.00 86.23 ? 60  VAL A CB  1 
ATOM   460  C  CG1 . VAL A 1 60  ? 169.519 -7.036  95.256  1.00 85.75 ? 60  VAL A CG1 1 
ATOM   461  C  CG2 . VAL A 1 60  ? 169.979 -4.598  95.426  1.00 86.44 ? 60  VAL A CG2 1 
ATOM   462  N  N   . PHE A 1 61  ? 166.364 -7.117  97.501  1.00 91.33 ? 61  PHE A N   1 
ATOM   463  C  CA  . PHE A 1 61  ? 165.903 -8.021  98.550  1.00 93.63 ? 61  PHE A CA  1 
ATOM   464  C  C   . PHE A 1 61  ? 166.282 -9.478  98.242  1.00 95.11 ? 61  PHE A C   1 
ATOM   465  O  O   . PHE A 1 61  ? 166.605 -9.813  97.093  1.00 94.55 ? 61  PHE A O   1 
ATOM   466  C  CB  . PHE A 1 61  ? 164.380 -7.882  98.741  1.00 94.43 ? 61  PHE A CB  1 
ATOM   467  C  CG  . PHE A 1 61  ? 163.949 -6.561  99.367  1.00 95.38 ? 61  PHE A CG  1 
ATOM   468  C  CD1 . PHE A 1 61  ? 164.806 -5.828  100.192 1.00 95.02 ? 61  PHE A CD1 1 
ATOM   469  C  CD2 . PHE A 1 61  ? 162.661 -6.062  99.138  1.00 95.38 ? 61  PHE A CD2 1 
ATOM   470  C  CE1 . PHE A 1 61  ? 164.387 -4.617  100.772 1.00 94.85 ? 61  PHE A CE1 1 
ATOM   471  C  CE2 . PHE A 1 61  ? 162.234 -4.856  99.711  1.00 94.42 ? 61  PHE A CE2 1 
ATOM   472  C  CZ  . PHE A 1 61  ? 163.097 -4.134  100.527 1.00 94.75 ? 61  PHE A CZ  1 
ATOM   473  N  N   . ALA A 1 62  ? 166.283 -10.328 99.274  1.00 96.71 ? 62  ALA A N   1 
ATOM   474  C  CA  . ALA A 1 62  ? 166.624 -11.749 99.112  1.00 98.94 ? 62  ALA A CA  1 
ATOM   475  C  C   . ALA A 1 62  ? 166.332 -12.647 100.326 1.00 99.90 ? 62  ALA A C   1 
ATOM   476  O  O   . ALA A 1 62  ? 166.745 -12.337 101.445 1.00 99.90 ? 62  ALA A O   1 
ATOM   477  C  CB  . ALA A 1 62  ? 168.102 -11.899 98.713  1.00 99.70 ? 62  ALA A CB  1 
ATOM   478  N  N   . ILE A 1 63  ? 165.607 -13.742 100.081 1.00 99.90 ? 63  ILE A N   1 
ATOM   479  C  CA  . ILE A 1 63  ? 165.228 -14.768 101.078 1.00 99.90 ? 63  ILE A CA  1 
ATOM   480  C  C   . ILE A 1 63  ? 164.741 -15.984 100.224 1.00 99.90 ? 63  ILE A C   1 
ATOM   481  O  O   . ILE A 1 63  ? 164.995 -16.015 99.013  1.00 99.90 ? 63  ILE A O   1 
ATOM   482  C  CB  . ILE A 1 63  ? 164.066 -14.286 102.066 1.00 99.90 ? 63  ILE A CB  1 
ATOM   483  C  CG1 . ILE A 1 63  ? 164.427 -12.986 102.795 1.00 99.90 ? 63  ILE A CG1 1 
ATOM   484  C  CG2 . ILE A 1 63  ? 163.815 -15.323 103.165 1.00 99.76 ? 63  ILE A CG2 1 
ATOM   485  C  CD1 . ILE A 1 63  ? 163.364 -12.500 103.783 1.00 98.06 ? 63  ILE A CD1 1 
ATOM   486  N  N   . LYS A 1 64  ? 164.111 -16.990 100.846 1.00 99.90 ? 64  LYS A N   1 
ATOM   487  C  CA  . LYS A 1 64  ? 163.565 -18.173 100.146 1.00 99.90 ? 64  LYS A CA  1 
ATOM   488  C  C   . LYS A 1 64  ? 162.026 -18.270 100.363 1.00 99.90 ? 64  LYS A C   1 
ATOM   489  O  O   . LYS A 1 64  ? 161.545 -18.078 101.485 1.00 99.90 ? 64  LYS A O   1 
ATOM   490  C  CB  . LYS A 1 64  ? 164.296 -19.446 100.598 1.00 99.90 ? 64  LYS A CB  1 
ATOM   491  C  CG  . LYS A 1 64  ? 164.661 -19.466 102.071 1.00 99.90 ? 64  LYS A CG  1 
ATOM   492  C  CD  . LYS A 1 64  ? 165.771 -20.458 102.362 1.00 99.90 ? 64  LYS A CD  1 
ATOM   493  C  CE  . LYS A 1 64  ? 166.068 -20.522 103.858 1.00 99.90 ? 64  LYS A CE  1 
ATOM   494  N  NZ  . LYS A 1 64  ? 166.557 -19.221 104.422 1.00 99.90 ? 64  LYS A NZ  1 
ATOM   495  N  N   . LYS A 1 65  ? 161.264 -18.535 99.290  1.00 99.90 ? 65  LYS A N   1 
ATOM   496  C  CA  . LYS A 1 65  ? 159.777 -18.594 99.341  1.00 99.90 ? 65  LYS A CA  1 
ATOM   497  C  C   . LYS A 1 65  ? 158.996 -19.933 99.321  1.00 99.90 ? 65  LYS A C   1 
ATOM   498  O  O   . LYS A 1 65  ? 158.304 -20.248 100.286 1.00 99.90 ? 65  LYS A O   1 
ATOM   499  C  CB  . LYS A 1 65  ? 159.161 -17.643 98.278  1.00 99.90 ? 65  LYS A CB  1 
ATOM   500  C  CG  . LYS A 1 65  ? 159.488 -17.957 96.789  1.00 99.90 ? 65  LYS A CG  1 
ATOM   501  C  CD  . LYS A 1 65  ? 158.330 -18.636 96.035  1.00 99.90 ? 65  LYS A CD  1 
ATOM   502  C  CE  . LYS A 1 65  ? 158.740 -19.019 94.619  1.00 99.90 ? 65  LYS A CE  1 
ATOM   503  N  NZ  . LYS A 1 65  ? 157.737 -19.908 93.974  1.00 99.90 ? 65  LYS A NZ  1 
ATOM   504  N  N   . LYS A 1 66  ? 159.033 -20.656 98.198  1.00 99.90 ? 66  LYS A N   1 
ATOM   505  C  CA  . LYS A 1 66  ? 158.315 -21.928 98.035  1.00 99.90 ? 66  LYS A CA  1 
ATOM   506  C  C   . LYS A 1 66  ? 159.238 -23.165 98.085  1.00 99.90 ? 66  LYS A C   1 
ATOM   507  O  O   . LYS A 1 66  ? 160.380 -23.083 98.564  1.00 99.90 ? 66  LYS A O   1 
ATOM   508  C  CB  . LYS A 1 66  ? 157.474 -21.917 96.739  1.00 99.90 ? 66  LYS A CB  1 
ATOM   509  N  N   . ASP A 1 67  ? 158.748 -24.293 97.562  1.00 99.90 ? 67  ASP A N   1 
ATOM   510  C  CA  . ASP A 1 67  ? 159.457 -25.595 97.530  1.00 99.90 ? 67  ASP A CA  1 
ATOM   511  C  C   . ASP A 1 67  ? 160.958 -25.708 97.114  1.00 99.90 ? 67  ASP A C   1 
ATOM   512  O  O   . ASP A 1 67  ? 161.523 -26.802 97.161  1.00 99.90 ? 67  ASP A O   1 
ATOM   513  C  CB  . ASP A 1 67  ? 158.628 -26.621 96.706  1.00 99.90 ? 67  ASP A CB  1 
ATOM   514  C  CG  . ASP A 1 67  ? 157.313 -27.046 97.390  1.00 99.90 ? 67  ASP A CG  1 
ATOM   515  O  OD1 . ASP A 1 67  ? 156.755 -26.260 98.184  1.00 99.90 ? 67  ASP A OD1 1 
ATOM   516  O  OD2 . ASP A 1 67  ? 156.841 -28.176 97.115  1.00 99.90 ? 67  ASP A OD2 1 
ATOM   517  N  N   . SER A 1 68  ? 161.604 -24.614 96.722  1.00 99.90 ? 68  SER A N   1 
ATOM   518  C  CA  . SER A 1 68  ? 163.007 -24.665 96.303  1.00 99.77 ? 68  SER A CA  1 
ATOM   519  C  C   . SER A 1 68  ? 164.047 -24.955 97.398  1.00 97.21 ? 68  SER A C   1 
ATOM   520  O  O   . SER A 1 68  ? 163.751 -24.867 98.597  1.00 96.26 ? 68  SER A O   1 
ATOM   521  C  CB  . SER A 1 68  ? 163.388 -23.378 95.570  1.00 99.90 ? 68  SER A CB  1 
ATOM   522  O  OG  . SER A 1 68  ? 163.303 -22.237 96.408  1.00 99.36 ? 68  SER A OG  1 
ATOM   523  N  N   . THR A 1 69  ? 165.267 -25.295 96.969  1.00 94.23 ? 69  THR A N   1 
ATOM   524  C  CA  . THR A 1 69  ? 166.380 -25.597 97.878  1.00 91.49 ? 69  THR A CA  1 
ATOM   525  C  C   . THR A 1 69  ? 167.530 -24.598 97.689  1.00 88.93 ? 69  THR A C   1 
ATOM   526  O  O   . THR A 1 69  ? 168.703 -24.978 97.653  1.00 88.13 ? 69  THR A O   1 
ATOM   527  C  CB  . THR A 1 69  ? 166.919 -27.020 97.613  1.00 91.31 ? 69  THR A CB  1 
ATOM   528  O  OG1 . THR A 1 69  ? 165.837 -27.879 97.218  1.00 91.40 ? 69  THR A OG1 1 
ATOM   529  C  CG2 . THR A 1 69  ? 167.578 -27.578 98.872  1.00 90.50 ? 69  THR A CG2 1 
ATOM   530  N  N   . LYS A 1 70  ? 167.180 -23.316 97.599  1.00 86.35 ? 70  LYS A N   1 
ATOM   531  C  CA  . LYS A 1 70  ? 168.152 -22.250 97.375  1.00 82.69 ? 70  LYS A CA  1 
ATOM   532  C  C   . LYS A 1 70  ? 167.566 -20.853 97.681  1.00 81.92 ? 70  LYS A C   1 
ATOM   533  O  O   . LYS A 1 70  ? 166.339 -20.679 97.712  1.00 82.47 ? 70  LYS A O   1 
ATOM   534  C  CB  . LYS A 1 70  ? 168.668 -22.321 95.919  1.00 80.07 ? 70  LYS A CB  1 
ATOM   535  C  CG  . LYS A 1 70  ? 167.584 -22.365 94.802  1.00 75.38 ? 70  LYS A CG  1 
ATOM   536  C  CD  . LYS A 1 70  ? 166.952 -23.746 94.612  1.00 71.62 ? 70  LYS A CD  1 
ATOM   537  C  CE  . LYS A 1 70  ? 165.900 -23.751 93.513  1.00 70.00 ? 70  LYS A CE  1 
ATOM   538  N  NZ  . LYS A 1 70  ? 165.022 -24.963 93.569  1.00 67.73 ? 70  LYS A NZ  1 
ATOM   539  N  N   . TRP A 1 71  ? 168.447 -19.877 97.930  1.00 81.11 ? 71  TRP A N   1 
ATOM   540  C  CA  . TRP A 1 71  ? 168.056 -18.486 98.222  1.00 79.76 ? 71  TRP A CA  1 
ATOM   541  C  C   . TRP A 1 71  ? 167.591 -17.803 96.931  1.00 78.62 ? 71  TRP A C   1 
ATOM   542  O  O   . TRP A 1 71  ? 168.233 -17.942 95.890  1.00 78.38 ? 71  TRP A O   1 
ATOM   543  C  CB  . TRP A 1 71  ? 169.237 -17.733 98.820  1.00 79.47 ? 71  TRP A CB  1 
ATOM   544  N  N   . ARG A 1 72  ? 166.492 -17.061 96.994  1.00 76.40 ? 72  ARG A N   1 
ATOM   545  C  CA  . ARG A 1 72  ? 165.967 -16.388 95.806  1.00 75.67 ? 72  ARG A CA  1 
ATOM   546  C  C   . ARG A 1 72  ? 166.195 -14.873 95.850  1.00 75.18 ? 72  ARG A C   1 
ATOM   547  O  O   . ARG A 1 72  ? 166.398 -14.304 96.925  1.00 74.83 ? 72  ARG A O   1 
ATOM   548  C  CB  . ARG A 1 72  ? 164.490 -16.712 95.619  1.00 74.39 ? 72  ARG A CB  1 
ATOM   549  N  N   . LYS A 1 73  ? 166.199 -14.234 94.679  1.00 73.74 ? 73  LYS A N   1 
ATOM   550  C  CA  . LYS A 1 73  ? 166.426 -12.797 94.589  1.00 73.97 ? 73  LYS A CA  1 
ATOM   551  C  C   . LYS A 1 73  ? 165.170 -12.060 94.227  1.00 75.83 ? 73  LYS A C   1 
ATOM   552  O  O   . LYS A 1 73  ? 164.345 -12.544 93.447  1.00 75.35 ? 73  LYS A O   1 
ATOM   553  C  CB  . LYS A 1 73  ? 167.502 -12.458 93.569  1.00 73.73 ? 73  LYS A CB  1 
ATOM   554  C  CG  . LYS A 1 73  ? 167.768 -10.968 93.428  1.00 74.04 ? 73  LYS A CG  1 
ATOM   555  C  CD  . LYS A 1 73  ? 167.352 -10.450 92.053  1.00 74.65 ? 73  LYS A CD  1 
ATOM   556  C  CE  . LYS A 1 73  ? 168.388 -9.455  91.554  1.00 74.97 ? 73  LYS A CE  1 
ATOM   557  N  NZ  . LYS A 1 73  ? 168.601 -8.366  92.547  1.00 74.22 ? 73  LYS A NZ  1 
ATOM   558  N  N   . LEU A 1 74  ? 165.067 -10.857 94.768  1.00 78.23 ? 74  LEU A N   1 
ATOM   559  C  CA  . LEU A 1 74  ? 163.918 -10.015 94.554  1.00 80.37 ? 74  LEU A CA  1 
ATOM   560  C  C   . LEU A 1 74  ? 164.352 -8.586  94.662  1.00 81.62 ? 74  LEU A C   1 
ATOM   561  O  O   . LEU A 1 74  ? 165.159 -8.221  95.511  1.00 80.92 ? 74  LEU A O   1 
ATOM   562  C  CB  . LEU A 1 74  ? 162.878 -10.258 95.640  1.00 83.12 ? 74  LEU A CB  1 
ATOM   563  C  CG  . LEU A 1 74  ? 162.306 -11.670 95.745  1.00 85.27 ? 74  LEU A CG  1 
ATOM   564  C  CD1 . LEU A 1 74  ? 161.719 -11.858 97.117  1.00 86.65 ? 74  LEU A CD1 1 
ATOM   565  C  CD2 . LEU A 1 74  ? 161.268 -11.931 94.659  1.00 86.42 ? 74  LEU A CD2 1 
ATOM   566  N  N   . VAL A 1 75  ? 163.767 -7.772  93.808  1.00 83.53 ? 75  VAL A N   1 
ATOM   567  C  CA  . VAL A 1 75  ? 164.028 -6.351  93.765  1.00 84.70 ? 75  VAL A CA  1 
ATOM   568  C  C   . VAL A 1 75  ? 162.837 -5.831  92.991  1.00 86.20 ? 75  VAL A C   1 
ATOM   569  O  O   . VAL A 1 75  ? 162.581 -6.282  91.864  1.00 85.95 ? 75  VAL A O   1 
ATOM   570  C  CB  . VAL A 1 75  ? 165.327 -6.012  92.979  1.00 84.01 ? 75  VAL A CB  1 
ATOM   571  C  CG1 . VAL A 1 75  ? 165.464 -4.505  92.799  1.00 82.89 ? 75  VAL A CG1 1 
ATOM   572  C  CG2 . VAL A 1 75  ? 166.536 -6.540  93.699  1.00 82.48 ? 75  VAL A CG2 1 
ATOM   573  N  N   . ASP A 1 76  ? 162.022 -5.016  93.649  1.00 87.80 ? 76  ASP A N   1 
ATOM   574  C  CA  . ASP A 1 76  ? 160.873 -4.443  92.977  1.00 89.16 ? 76  ASP A CA  1 
ATOM   575  C  C   . ASP A 1 76  ? 161.150 -2.977  92.769  1.00 88.34 ? 76  ASP A C   1 
ATOM   576  O  O   . ASP A 1 76  ? 161.486 -2.232  93.694  1.00 88.05 ? 76  ASP A O   1 
ATOM   577  C  CB  . ASP A 1 76  ? 159.573 -4.664  93.746  1.00 91.53 ? 76  ASP A CB  1 
ATOM   578  C  CG  . ASP A 1 76  ? 158.388 -4.929  92.815  1.00 93.10 ? 76  ASP A CG  1 
ATOM   579  O  OD1 . ASP A 1 76  ? 158.581 -4.951  91.576  1.00 93.42 ? 76  ASP A OD1 1 
ATOM   580  O  OD2 . ASP A 1 76  ? 157.263 -5.128  93.327  1.00 94.83 ? 76  ASP A OD2 1 
ATOM   581  N  N   . PHE A 1 77  ? 161.019 -2.585  91.518  1.00 88.92 ? 77  PHE A N   1 
ATOM   582  C  CA  . PHE A 1 77  ? 161.297 -1.232  91.107  1.00 90.30 ? 77  PHE A CA  1 
ATOM   583  C  C   . PHE A 1 77  ? 160.007 -0.452  91.009  1.00 89.61 ? 77  PHE A C   1 
ATOM   584  O  O   . PHE A 1 77  ? 159.888 0.432   90.170  1.00 88.30 ? 77  PHE A O   1 
ATOM   585  C  CB  . PHE A 1 77  ? 161.992 -1.265  89.744  1.00 91.35 ? 77  PHE A CB  1 
ATOM   586  C  CG  . PHE A 1 77  ? 162.933 -2.432  89.569  1.00 93.05 ? 77  PHE A CG  1 
ATOM   587  C  CD1 . PHE A 1 77  ? 162.442 -3.698  89.234  1.00 93.15 ? 77  PHE A CD1 1 
ATOM   588  C  CD2 . PHE A 1 77  ? 164.303 -2.270  89.754  1.00 92.84 ? 77  PHE A CD2 1 
ATOM   589  C  CE1 . PHE A 1 77  ? 163.298 -4.787  89.085  1.00 94.24 ? 77  PHE A CE1 1 
ATOM   590  C  CE2 . PHE A 1 77  ? 165.171 -3.350  89.608  1.00 94.17 ? 77  PHE A CE2 1 
ATOM   591  C  CZ  . PHE A 1 77  ? 164.666 -4.616  89.273  1.00 94.48 ? 77  PHE A CZ  1 
ATOM   592  N  N   . ARG A 1 78  ? 159.045 -0.777  91.871  1.00 89.63 ? 78  ARG A N   1 
ATOM   593  C  CA  . ARG A 1 78  ? 157.757 -0.097  91.873  1.00 90.09 ? 78  ARG A CA  1 
ATOM   594  C  C   . ARG A 1 78  ? 157.895 1.398   91.594  1.00 89.93 ? 78  ARG A C   1 
ATOM   595  O  O   . ARG A 1 78  ? 157.159 1.947   90.768  1.00 89.14 ? 78  ARG A O   1 
ATOM   596  C  CB  . ARG A 1 78  ? 157.013 -0.345  93.189  1.00 90.26 ? 78  ARG A CB  1 
ATOM   597  C  CG  . ARG A 1 78  ? 155.790 -1.256  93.019  1.00 92.03 ? 78  ARG A CG  1 
ATOM   598  C  CD  . ARG A 1 78  ? 154.783 -0.643  92.025  1.00 93.08 ? 78  ARG A CD  1 
ATOM   599  N  NE  . ARG A 1 78  ? 154.068 -1.634  91.213  1.00 93.66 ? 78  ARG A NE  1 
ATOM   600  C  CZ  . ARG A 1 78  ? 153.600 -1.398  89.988  1.00 94.01 ? 78  ARG A CZ  1 
ATOM   601  N  NH1 . ARG A 1 78  ? 153.763 -0.207  89.428  1.00 94.46 ? 78  ARG A NH1 1 
ATOM   602  N  NH2 . ARG A 1 78  ? 152.972 -2.352  89.315  1.00 94.11 ? 78  ARG A NH2 1 
ATOM   603  N  N   . GLU A 1 79  ? 158.895 2.024   92.216  1.00 90.65 ? 79  GLU A N   1 
ATOM   604  C  CA  . GLU A 1 79  ? 159.160 3.447   92.021  1.00 90.52 ? 79  GLU A CA  1 
ATOM   605  C  C   . GLU A 1 79  ? 159.462 3.709   90.548  1.00 88.44 ? 79  GLU A C   1 
ATOM   606  O  O   . GLU A 1 79  ? 158.885 4.602   89.924  1.00 88.58 ? 79  GLU A O   1 
ATOM   607  C  CB  . GLU A 1 79  ? 160.342 3.887   92.876  1.00 92.62 ? 79  GLU A CB  1 
ATOM   608  C  CG  . GLU A 1 79  ? 160.532 5.399   92.907  1.00 96.63 ? 79  GLU A CG  1 
ATOM   609  C  CD  . GLU A 1 79  ? 159.346 6.145   93.516  1.00 98.59 ? 79  GLU A CD  1 
ATOM   610  O  OE1 . GLU A 1 79  ? 158.979 5.846   94.678  1.00 99.90 ? 79  GLU A OE1 1 
ATOM   611  O  OE2 . GLU A 1 79  ? 158.786 7.034   92.833  1.00 99.37 ? 79  GLU A OE2 1 
ATOM   612  N  N   . LEU A 1 80  ? 160.368 2.913   90.001  1.00 85.69 ? 80  LEU A N   1 
ATOM   613  C  CA  . LEU A 1 80  ? 160.722 3.016   88.604  1.00 83.18 ? 80  LEU A CA  1 
ATOM   614  C  C   . LEU A 1 80  ? 159.476 2.766   87.754  1.00 81.56 ? 80  LEU A C   1 
ATOM   615  O  O   . LEU A 1 80  ? 159.137 3.574   86.899  1.00 80.18 ? 80  LEU A O   1 
ATOM   616  C  CB  . LEU A 1 80  ? 161.783 1.973   88.283  1.00 84.70 ? 80  LEU A CB  1 
ATOM   617  C  CG  . LEU A 1 80  ? 161.732 1.336   86.891  1.00 85.52 ? 80  LEU A CG  1 
ATOM   618  C  CD1 . LEU A 1 80  ? 162.019 2.378   85.814  1.00 87.08 ? 80  LEU A CD1 1 
ATOM   619  C  CD2 . LEU A 1 80  ? 162.727 0.190   86.812  1.00 85.28 ? 80  LEU A CD2 1 
ATOM   620  N  N   . ASN A 1 81  ? 158.808 1.643   88.006  1.00 80.95 ? 81  ASN A N   1 
ATOM   621  C  CA  . ASN A 1 81  ? 157.600 1.242   87.280  1.00 81.75 ? 81  ASN A CA  1 
ATOM   622  C  C   . ASN A 1 81  ? 156.623 2.382   87.123  1.00 80.94 ? 81  ASN A C   1 
ATOM   623  O  O   . ASN A 1 81  ? 155.973 2.522   86.087  1.00 80.87 ? 81  ASN A O   1 
ATOM   624  C  CB  . ASN A 1 81  ? 156.888 0.096   87.999  1.00 82.92 ? 81  ASN A CB  1 
ATOM   625  C  CG  . ASN A 1 81  ? 157.689 -1.188  87.991  1.00 84.23 ? 81  ASN A CG  1 
ATOM   626  O  OD1 . ASN A 1 81  ? 158.489 -1.427  87.088  1.00 84.62 ? 81  ASN A OD1 1 
ATOM   627  N  ND2 . ASN A 1 81  ? 157.470 -2.029  88.995  1.00 85.17 ? 81  ASN A ND2 1 
ATOM   628  N  N   . LYS A 1 82  ? 156.480 3.164   88.184  1.00 80.91 ? 82  LYS A N   1 
ATOM   629  C  CA  . LYS A 1 82  ? 155.582 4.308   88.159  1.00 80.55 ? 82  LYS A CA  1 
ATOM   630  C  C   . LYS A 1 82  ? 156.169 5.362   87.217  1.00 78.42 ? 82  LYS A C   1 
ATOM   631  O  O   . LYS A 1 82  ? 155.484 5.859   86.314  1.00 78.09 ? 82  LYS A O   1 
ATOM   632  C  CB  . LYS A 1 82  ? 155.384 4.865   89.578  1.00 82.44 ? 82  LYS A CB  1 
ATOM   633  C  CG  . LYS A 1 82  ? 154.537 3.969   90.512  1.00 84.79 ? 82  LYS A CG  1 
ATOM   634  C  CD  . LYS A 1 82  ? 153.057 3.892   90.072  1.00 86.49 ? 82  LYS A CD  1 
ATOM   635  C  CE  . LYS A 1 82  ? 152.201 2.924   90.938  1.00 87.12 ? 82  LYS A CE  1 
ATOM   636  N  NZ  . LYS A 1 82  ? 151.444 3.523   92.104  1.00 85.99 ? 82  LYS A NZ  1 
ATOM   637  N  N   . ARG A 1 83  ? 157.457 5.650   87.396  1.00 75.89 ? 83  ARG A N   1 
ATOM   638  C  CA  . ARG A 1 83  ? 158.158 6.616   86.555  1.00 73.53 ? 83  ARG A CA  1 
ATOM   639  C  C   . ARG A 1 83  ? 158.106 6.161   85.090  1.00 72.74 ? 83  ARG A C   1 
ATOM   640  O  O   . ARG A 1 83  ? 158.321 6.954   84.171  1.00 71.50 ? 83  ARG A O   1 
ATOM   641  C  CB  . ARG A 1 83  ? 159.626 6.743   87.001  1.00 71.77 ? 83  ARG A CB  1 
ATOM   642  C  CG  . ARG A 1 83  ? 159.930 7.863   88.020  1.00 70.39 ? 83  ARG A CG  1 
ATOM   643  C  CD  . ARG A 1 83  ? 159.570 7.531   89.485  1.00 68.87 ? 83  ARG A CD  1 
ATOM   644  N  NE  . ARG A 1 83  ? 159.802 8.675   90.379  1.00 66.50 ? 83  ARG A NE  1 
ATOM   645  C  CZ  . ARG A 1 83  ? 160.764 8.737   91.300  1.00 65.31 ? 83  ARG A CZ  1 
ATOM   646  N  NH1 . ARG A 1 83  ? 161.589 7.715   91.467  1.00 64.39 ? 83  ARG A NH1 1 
ATOM   647  N  NH2 . ARG A 1 83  ? 160.924 9.835   92.034  1.00 65.38 ? 83  ARG A NH2 1 
ATOM   648  N  N   . THR A 1 84  ? 157.819 4.877   84.898  1.00 72.86 ? 84  THR A N   1 
ATOM   649  C  CA  . THR A 1 84  ? 157.740 4.237   83.592  1.00 72.48 ? 84  THR A CA  1 
ATOM   650  C  C   . THR A 1 84  ? 156.489 4.572   82.782  1.00 71.59 ? 84  THR A C   1 
ATOM   651  O  O   . THR A 1 84  ? 155.391 4.722   83.325  1.00 70.32 ? 84  THR A O   1 
ATOM   652  C  CB  . THR A 1 84  ? 157.841 2.704   83.764  1.00 73.17 ? 84  THR A CB  1 
ATOM   653  O  OG1 . THR A 1 84  ? 159.088 2.379   84.396  1.00 73.58 ? 84  THR A OG1 1 
ATOM   654  C  CG2 . THR A 1 84  ? 157.743 1.985   82.431  1.00 74.22 ? 84  THR A CG2 1 
ATOM   655  N  N   . GLN A 1 85  ? 156.694 4.709   81.473  1.00 70.92 ? 85  GLN A N   1 
ATOM   656  C  CA  . GLN A 1 85  ? 155.631 4.999   80.512  1.00 69.28 ? 85  GLN A CA  1 
ATOM   657  C  C   . GLN A 1 85  ? 154.669 3.827   80.445  1.00 67.85 ? 85  GLN A C   1 
ATOM   658  O  O   . GLN A 1 85  ? 154.941 2.751   80.964  1.00 66.28 ? 85  GLN A O   1 
ATOM   659  C  CB  . GLN A 1 85  ? 156.214 5.184   79.102  1.00 70.55 ? 85  GLN A CB  1 
ATOM   660  C  CG  . GLN A 1 85  ? 156.790 3.878   78.509  1.00 71.58 ? 85  GLN A CG  1 
ATOM   661  C  CD  . GLN A 1 85  ? 156.985 3.905   76.997  1.00 72.53 ? 85  GLN A CD  1 
ATOM   662  O  OE1 . GLN A 1 85  ? 158.048 4.296   76.498  1.00 72.12 ? 85  GLN A OE1 1 
ATOM   663  N  NE2 . GLN A 1 85  ? 155.973 3.445   76.264  1.00 72.28 ? 85  GLN A NE2 1 
ATOM   664  N  N   . ASP A 1 86  ? 153.592 4.012   79.699  1.00 68.60 ? 86  ASP A N   1 
ATOM   665  C  CA  . ASP A 1 86  ? 152.596 2.963   79.545  1.00 70.04 ? 86  ASP A CA  1 
ATOM   666  C  C   . ASP A 1 86  ? 152.703 2.238   78.198  1.00 69.80 ? 86  ASP A C   1 
ATOM   667  O  O   . ASP A 1 86  ? 152.987 2.831   77.151  1.00 67.26 ? 86  ASP A O   1 
ATOM   668  C  CB  . ASP A 1 86  ? 151.190 3.520   79.800  1.00 71.75 ? 86  ASP A CB  1 
ATOM   669  C  CG  . ASP A 1 86  ? 151.056 4.177   81.186  1.00 73.44 ? 86  ASP A CG  1 
ATOM   670  O  OD1 . ASP A 1 86  ? 152.037 4.160   81.972  1.00 74.02 ? 86  ASP A OD1 1 
ATOM   671  O  OD2 . ASP A 1 86  ? 149.963 4.718   81.486  1.00 76.43 ? 86  ASP A OD2 1 
ATOM   672  N  N   . PHE A 1 87  ? 152.530 0.928   78.262  1.00 71.12 ? 87  PHE A N   1 
ATOM   673  C  CA  . PHE A 1 87  ? 152.642 0.065   77.106  1.00 72.72 ? 87  PHE A CA  1 
ATOM   674  C  C   . PHE A 1 87  ? 151.263 -0.428  76.694  1.00 74.71 ? 87  PHE A C   1 
ATOM   675  O  O   . PHE A 1 87  ? 150.236 0.128   77.088  1.00 74.94 ? 87  PHE A O   1 
ATOM   676  C  CB  . PHE A 1 87  ? 153.528 -1.149  77.454  1.00 73.17 ? 87  PHE A CB  1 
ATOM   677  C  CG  . PHE A 1 87  ? 154.788 -0.795  78.184  1.00 72.98 ? 87  PHE A CG  1 
ATOM   678  C  CD1 . PHE A 1 87  ? 154.779 -0.629  79.572  1.00 72.36 ? 87  PHE A CD1 1 
ATOM   679  C  CD2 . PHE A 1 87  ? 155.974 -0.577  77.487  1.00 72.11 ? 87  PHE A CD2 1 
ATOM   680  C  CE1 . PHE A 1 87  ? 155.926 -0.243  80.253  1.00 72.93 ? 87  PHE A CE1 1 
ATOM   681  C  CE2 . PHE A 1 87  ? 157.129 -0.192  78.158  1.00 72.66 ? 87  PHE A CE2 1 
ATOM   682  C  CZ  . PHE A 1 87  ? 157.103 -0.023  79.545  1.00 71.88 ? 87  PHE A CZ  1 
ATOM   683  N  N   . TRP A 1 88  ? 151.267 -1.486  75.893  1.00 76.78 ? 88  TRP A N   1 
ATOM   684  C  CA  . TRP A 1 88  ? 150.067 -2.120  75.412  1.00 78.05 ? 88  TRP A CA  1 
ATOM   685  C  C   . TRP A 1 88  ? 149.516 -3.065  76.480  1.00 80.30 ? 88  TRP A C   1 
ATOM   686  O  O   . TRP A 1 88  ? 150.289 -3.738  77.178  1.00 80.22 ? 88  TRP A O   1 
ATOM   687  C  CB  . TRP A 1 88  ? 150.383 -2.891  74.140  1.00 77.52 ? 88  TRP A CB  1 
ATOM   688  C  CG  . TRP A 1 88  ? 149.167 -3.284  73.485  1.00 76.97 ? 88  TRP A CG  1 
ATOM   689  C  CD1 . TRP A 1 88  ? 148.890 -4.494  72.914  1.00 77.21 ? 88  TRP A CD1 1 
ATOM   690  C  CD2 . TRP A 1 88  ? 147.993 -2.504  73.387  1.00 76.37 ? 88  TRP A CD2 1 
ATOM   691  N  NE1 . TRP A 1 88  ? 147.594 -4.515  72.480  1.00 77.52 ? 88  TRP A NE1 1 
ATOM   692  C  CE2 . TRP A 1 88  ? 147.020 -3.302  72.757  1.00 77.46 ? 88  TRP A CE2 1 
ATOM   693  C  CE3 . TRP A 1 88  ? 147.658 -1.207  73.787  1.00 75.10 ? 88  TRP A CE3 1 
ATOM   694  C  CZ2 . TRP A 1 88  ? 145.714 -2.838  72.523  1.00 78.35 ? 88  TRP A CZ2 1 
ATOM   695  C  CZ3 . TRP A 1 88  ? 146.390 -0.748  73.557  1.00 76.81 ? 88  TRP A CZ3 1 
ATOM   696  C  CH2 . TRP A 1 88  ? 145.425 -1.556  72.929  1.00 77.79 ? 88  TRP A CH2 1 
ATOM   697  N  N   . GLU A 1 89  ? 148.191 -3.105  76.631  1.00 82.99 ? 89  GLU A N   1 
ATOM   698  C  CA  . GLU A 1 89  ? 147.589 -3.974  77.647  1.00 85.07 ? 89  GLU A CA  1 
ATOM   699  C  C   . GLU A 1 89  ? 147.673 -5.451  77.349  1.00 85.59 ? 89  GLU A C   1 
ATOM   700  O  O   . GLU A 1 89  ? 146.878 -6.009  76.587  1.00 84.71 ? 89  GLU A O   1 
ATOM   701  C  CB  . GLU A 1 89  ? 146.142 -3.614  78.002  1.00 87.16 ? 89  GLU A CB  1 
ATOM   702  C  CG  . GLU A 1 89  ? 145.666 -4.415  79.236  1.00 89.96 ? 89  GLU A CG  1 
ATOM   703  C  CD  . GLU A 1 89  ? 144.317 -3.983  79.826  1.00 91.32 ? 89  GLU A CD  1 
ATOM   704  O  OE1 . GLU A 1 89  ? 143.822 -2.864  79.553  1.00 92.24 ? 89  GLU A OE1 1 
ATOM   705  O  OE2 . GLU A 1 89  ? 143.761 -4.779  80.613  1.00 91.55 ? 89  GLU A OE2 1 
ATOM   706  N  N   . VAL A 1 90  ? 148.608 -6.072  78.047  1.00 86.44 ? 90  VAL A N   1 
ATOM   707  C  CA  . VAL A 1 90  ? 148.904 -7.483  77.948  1.00 87.81 ? 90  VAL A CA  1 
ATOM   708  C  C   . VAL A 1 90  ? 147.749 -8.402  77.575  1.00 88.52 ? 90  VAL A C   1 
ATOM   709  O  O   . VAL A 1 90  ? 147.722 -8.972  76.484  1.00 88.03 ? 90  VAL A O   1 
ATOM   710  C  CB  . VAL A 1 90  ? 149.571 -7.969  79.269  1.00 87.84 ? 90  VAL A CB  1 
ATOM   711  C  CG1 . VAL A 1 90  ? 150.851 -7.173  79.513  1.00 88.17 ? 90  VAL A CG1 1 
ATOM   712  C  CG2 . VAL A 1 90  ? 148.638 -7.769  80.466  1.00 86.77 ? 90  VAL A CG2 1 
ATOM   713  N  N   . GLN A 1 91  ? 146.770 -8.496  78.460  1.00 89.33 ? 91  GLN A N   1 
ATOM   714  C  CA  . GLN A 1 91  ? 145.642 -9.376  78.248  1.00 89.49 ? 91  GLN A CA  1 
ATOM   715  C  C   . GLN A 1 91  ? 144.415 -8.589  78.580  1.00 87.15 ? 91  GLN A C   1 
ATOM   716  O  O   . GLN A 1 91  ? 143.899 -8.675  79.693  1.00 87.43 ? 91  GLN A O   1 
ATOM   717  C  CB  . GLN A 1 91  ? 145.709 -10.561 79.213  1.00 93.03 ? 91  GLN A CB  1 
ATOM   718  C  CG  . GLN A 1 91  ? 147.083 -11.192 79.406  1.00 97.30 ? 91  GLN A CG  1 
ATOM   719  C  CD  . GLN A 1 91  ? 147.122 -12.143 80.605  1.00 99.90 ? 91  GLN A CD  1 
ATOM   720  O  OE1 . GLN A 1 91  ? 146.617 -11.816 81.682  1.00 99.90 ? 91  GLN A OE1 1 
ATOM   721  N  NE2 . GLN A 1 91  ? 147.740 -13.315 80.428  1.00 99.90 ? 91  GLN A NE2 1 
ATOM   722  N  N   . LEU A 1 92  ? 143.967 -7.762  77.656  1.00 85.31 ? 92  LEU A N   1 
ATOM   723  C  CA  . LEU A 1 92  ? 142.761 -7.006  77.948  1.00 84.53 ? 92  LEU A CA  1 
ATOM   724  C  C   . LEU A 1 92  ? 141.569 -7.962  78.025  1.00 82.23 ? 92  LEU A C   1 
ATOM   725  O  O   . LEU A 1 92  ? 140.495 -7.594  78.507  1.00 82.95 ? 92  LEU A O   1 
ATOM   726  C  CB  . LEU A 1 92  ? 142.537 -5.884  76.922  1.00 86.35 ? 92  LEU A CB  1 
ATOM   727  C  CG  . LEU A 1 92  ? 141.384 -4.876  77.135  1.00 85.87 ? 92  LEU A CG  1 
ATOM   728  C  CD1 . LEU A 1 92  ? 141.188 -4.520  78.609  1.00 84.12 ? 92  LEU A CD1 1 
ATOM   729  C  CD2 . LEU A 1 92  ? 141.636 -3.614  76.309  1.00 85.39 ? 92  LEU A CD2 1 
ATOM   730  N  N   . GLY A 1 93  ? 141.784 -9.204  77.608  1.00 78.92 ? 93  GLY A N   1 
ATOM   731  C  CA  . GLY A 1 93  ? 140.719 -10.177 77.659  1.00 74.99 ? 93  GLY A CA  1 
ATOM   732  C  C   . GLY A 1 93  ? 141.265 -11.582 77.642  1.00 72.23 ? 93  GLY A C   1 
ATOM   733  O  O   . GLY A 1 93  ? 142.272 -11.855 76.985  1.00 71.47 ? 93  GLY A O   1 
ATOM   734  N  N   . ILE A 1 94  ? 140.625 -12.450 78.419  1.00 70.32 ? 94  ILE A N   1 
ATOM   735  C  CA  . ILE A 1 94  ? 140.989 -13.870 78.512  1.00 68.40 ? 94  ILE A CA  1 
ATOM   736  C  C   . ILE A 1 94  ? 140.153 -14.660 77.505  1.00 65.08 ? 94  ILE A C   1 
ATOM   737  O  O   . ILE A 1 94  ? 138.956 -14.396 77.354  1.00 66.67 ? 94  ILE A O   1 
ATOM   738  C  CB  . ILE A 1 94  ? 140.709 -14.468 79.939  1.00 68.89 ? 94  ILE A CB  1 
ATOM   739  C  CG1 . ILE A 1 94  ? 139.437 -13.840 80.551  1.00 68.71 ? 94  ILE A CG1 1 
ATOM   740  C  CG2 . ILE A 1 94  ? 141.959 -14.350 80.826  1.00 68.70 ? 94  ILE A CG2 1 
ATOM   741  C  CD1 . ILE A 1 94  ? 139.175 -14.198 82.011  1.00 68.85 ? 94  ILE A CD1 1 
ATOM   742  N  N   . PRO A 1 95  ? 140.782 -15.572 76.740  1.00 60.84 ? 95  PRO A N   1 
ATOM   743  C  CA  . PRO A 1 95  ? 139.979 -16.338 75.779  1.00 56.67 ? 95  PRO A CA  1 
ATOM   744  C  C   . PRO A 1 95  ? 139.002 -17.248 76.547  1.00 52.97 ? 95  PRO A C   1 
ATOM   745  O  O   . PRO A 1 95  ? 139.331 -17.782 77.614  1.00 53.00 ? 95  PRO A O   1 
ATOM   746  C  CB  . PRO A 1 95  ? 141.034 -17.165 75.033  1.00 57.32 ? 95  PRO A CB  1 
ATOM   747  C  CG  . PRO A 1 95  ? 142.285 -16.342 75.170  1.00 58.52 ? 95  PRO A CG  1 
ATOM   748  C  CD  . PRO A 1 95  ? 142.216 -15.878 76.596  1.00 59.39 ? 95  PRO A CD  1 
ATOM   749  N  N   . HIS A 1 96  ? 137.773 -17.374 76.072  1.00 47.43 ? 96  HIS A N   1 
ATOM   750  C  CA  . HIS A 1 96  ? 136.876 -18.253 76.787  1.00 40.85 ? 96  HIS A CA  1 
ATOM   751  C  C   . HIS A 1 96  ? 136.882 -19.662 76.237  1.00 36.39 ? 96  HIS A C   1 
ATOM   752  O  O   . HIS A 1 96  ? 136.488 -19.891 75.094  1.00 34.45 ? 96  HIS A O   1 
ATOM   753  C  CB  . HIS A 1 96  ? 135.447 -17.765 76.822  1.00 41.53 ? 96  HIS A CB  1 
ATOM   754  C  CG  . HIS A 1 96  ? 134.565 -18.709 77.564  1.00 42.23 ? 96  HIS A CG  1 
ATOM   755  N  ND1 . HIS A 1 96  ? 134.761 -18.991 78.900  1.00 43.30 ? 96  HIS A ND1 1 
ATOM   756  C  CD2 . HIS A 1 96  ? 133.629 -19.577 77.129  1.00 42.65 ? 96  HIS A CD2 1 
ATOM   757  C  CE1 . HIS A 1 96  ? 133.993 -20.004 79.251  1.00 43.07 ? 96  HIS A CE1 1 
ATOM   758  N  NE2 . HIS A 1 96  ? 133.295 -20.379 78.197  1.00 44.17 ? 96  HIS A NE2 1 
ATOM   759  N  N   . PRO A 1 97  ? 137.271 -20.634 77.076  1.00 32.05 ? 97  PRO A N   1 
ATOM   760  C  CA  . PRO A 1 97  ? 137.329 -22.037 76.695  1.00 28.89 ? 97  PRO A CA  1 
ATOM   761  C  C   . PRO A 1 97  ? 136.240 -22.517 75.762  1.00 27.18 ? 97  PRO A C   1 
ATOM   762  O  O   . PRO A 1 97  ? 136.546 -23.044 74.704  1.00 25.59 ? 97  PRO A O   1 
ATOM   763  C  CB  . PRO A 1 97  ? 137.360 -22.722 78.038  1.00 26.39 ? 97  PRO A CB  1 
ATOM   764  C  CG  . PRO A 1 97  ? 138.365 -21.861 78.711  1.00 25.20 ? 97  PRO A CG  1 
ATOM   765  C  CD  . PRO A 1 97  ? 137.848 -20.467 78.420  1.00 28.31 ? 97  PRO A CD  1 
ATOM   766  N  N   . ALA A 1 98  ? 134.985 -22.254 76.080  1.00 26.48 ? 98  ALA A N   1 
ATOM   767  C  CA  . ALA A 1 98  ? 133.922 -22.693 75.174  1.00 29.77 ? 98  ALA A CA  1 
ATOM   768  C  C   . ALA A 1 98  ? 134.159 -22.290 73.699  1.00 31.38 ? 98  ALA A C   1 
ATOM   769  O  O   . ALA A 1 98  ? 133.626 -22.914 72.777  1.00 28.40 ? 98  ALA A O   1 
ATOM   770  C  CB  . ALA A 1 98  ? 132.569 -22.171 75.653  1.00 29.74 ? 98  ALA A CB  1 
ATOM   771  N  N   . GLY A 1 99  ? 134.958 -21.241 73.506  1.00 34.75 ? 99  GLY A N   1 
ATOM   772  C  CA  . GLY A 1 99  ? 135.274 -20.739 72.184  1.00 38.33 ? 99  GLY A CA  1 
ATOM   773  C  C   . GLY A 1 99  ? 136.310 -21.544 71.451  1.00 42.48 ? 99  GLY A C   1 
ATOM   774  O  O   . GLY A 1 99  ? 136.299 -21.589 70.226  1.00 43.17 ? 99  GLY A O   1 
ATOM   775  N  N   . LEU A 1 100 ? 137.214 -22.167 72.199  1.00 46.12 ? 100 LEU A N   1 
ATOM   776  C  CA  . LEU A 1 100 ? 138.287 -22.979 71.621  1.00 49.55 ? 100 LEU A CA  1 
ATOM   777  C  C   . LEU A 1 100 ? 137.723 -24.054 70.683  1.00 53.83 ? 100 LEU A C   1 
ATOM   778  O  O   . LEU A 1 100 ? 136.512 -24.241 70.613  1.00 52.17 ? 100 LEU A O   1 
ATOM   779  C  CB  . LEU A 1 100 ? 139.095 -23.657 72.739  1.00 47.10 ? 100 LEU A CB  1 
ATOM   780  C  CG  . LEU A 1 100 ? 139.585 -22.807 73.907  1.00 44.33 ? 100 LEU A CG  1 
ATOM   781  C  CD1 . LEU A 1 100 ? 140.550 -23.596 74.741  1.00 43.56 ? 100 LEU A CD1 1 
ATOM   782  C  CD2 . LEU A 1 100 ? 140.266 -21.579 73.398  1.00 46.18 ? 100 LEU A CD2 1 
ATOM   783  N  N   . LYS A 1 101 ? 138.600 -24.745 69.957  1.00 59.16 ? 101 LYS A N   1 
ATOM   784  C  CA  . LYS A 1 101 ? 138.170 -25.814 69.052  1.00 63.42 ? 101 LYS A CA  1 
ATOM   785  C  C   . LYS A 1 101 ? 138.945 -27.088 69.382  1.00 65.83 ? 101 LYS A C   1 
ATOM   786  O  O   . LYS A 1 101 ? 140.031 -27.016 69.982  1.00 66.28 ? 101 LYS A O   1 
ATOM   787  C  CB  . LYS A 1 101 ? 138.389 -25.410 67.605  1.00 64.39 ? 101 LYS A CB  1 
ATOM   788  C  CG  . LYS A 1 101 ? 137.636 -24.164 67.224  1.00 66.18 ? 101 LYS A CG  1 
ATOM   789  C  CD  . LYS A 1 101 ? 137.785 -23.948 65.764  1.00 68.19 ? 101 LYS A CD  1 
ATOM   790  C  CE  . LYS A 1 101 ? 138.062 -22.498 65.430  1.00 69.86 ? 101 LYS A CE  1 
ATOM   791  N  NZ  . LYS A 1 101 ? 138.370 -22.403 63.965  1.00 72.16 ? 101 LYS A NZ  1 
ATOM   792  N  N   . LYS A 1 102 ? 138.408 -28.247 68.987  1.00 67.71 ? 102 LYS A N   1 
ATOM   793  C  CA  . LYS A 1 102 ? 139.063 -29.526 69.305  1.00 68.53 ? 102 LYS A CA  1 
ATOM   794  C  C   . LYS A 1 102 ? 140.277 -29.909 68.463  1.00 66.70 ? 102 LYS A C   1 
ATOM   795  O  O   . LYS A 1 102 ? 140.258 -29.816 67.228  1.00 64.90 ? 102 LYS A O   1 
ATOM   796  C  CB  . LYS A 1 102 ? 138.048 -30.687 69.361  1.00 70.93 ? 102 LYS A CB  1 
ATOM   797  C  CG  . LYS A 1 102 ? 137.878 -31.519 68.078  1.00 73.99 ? 102 LYS A CG  1 
ATOM   798  C  CD  . LYS A 1 102 ? 136.871 -32.668 68.274  1.00 75.39 ? 102 LYS A CD  1 
ATOM   799  C  CE  . LYS A 1 102 ? 137.246 -33.572 69.449  1.00 75.87 ? 102 LYS A CE  1 
ATOM   800  N  NZ  . LYS A 1 102 ? 136.283 -34.698 69.607  1.00 75.25 ? 102 LYS A NZ  1 
ATOM   801  N  N   . LYS A 1 103 ? 141.329 -30.335 69.163  1.00 65.62 ? 103 LYS A N   1 
ATOM   802  C  CA  . LYS A 1 103 ? 142.594 -30.765 68.558  1.00 64.20 ? 103 LYS A CA  1 
ATOM   803  C  C   . LYS A 1 103 ? 142.932 -32.148 69.142  1.00 63.31 ? 103 LYS A C   1 
ATOM   804  O  O   . LYS A 1 103 ? 142.454 -32.498 70.226  1.00 63.29 ? 103 LYS A O   1 
ATOM   805  C  CB  . LYS A 1 103 ? 143.719 -29.755 68.863  1.00 61.59 ? 103 LYS A CB  1 
ATOM   806  C  CG  . LYS A 1 103 ? 143.332 -28.285 68.637  1.00 59.20 ? 103 LYS A CG  1 
ATOM   807  C  CD  . LYS A 1 103 ? 142.918 -27.985 67.184  1.00 57.95 ? 103 LYS A CD  1 
ATOM   808  C  CE  . LYS A 1 103 ? 142.256 -26.609 67.046  1.00 54.64 ? 103 LYS A CE  1 
ATOM   809  N  NZ  . LYS A 1 103 ? 141.884 -26.267 65.649  1.00 50.27 ? 103 LYS A NZ  1 
ATOM   810  N  N   . LYS A 1 104 ? 143.721 -32.940 68.420  1.00 62.06 ? 104 LYS A N   1 
ATOM   811  C  CA  . LYS A 1 104 ? 144.071 -34.273 68.897  1.00 60.32 ? 104 LYS A CA  1 
ATOM   812  C  C   . LYS A 1 104 ? 145.097 -34.224 70.010  1.00 59.82 ? 104 LYS A C   1 
ATOM   813  O  O   . LYS A 1 104 ? 144.926 -34.846 71.066  1.00 60.13 ? 104 LYS A O   1 
ATOM   814  C  CB  . LYS A 1 104 ? 144.534 -35.149 67.742  1.00 59.57 ? 104 LYS A CB  1 
ATOM   815  C  CG  . LYS A 1 104 ? 143.429 -35.329 66.728  1.00 59.33 ? 104 LYS A CG  1 
ATOM   816  C  CD  . LYS A 1 104 ? 143.872 -36.104 65.517  1.00 60.97 ? 104 LYS A CD  1 
ATOM   817  C  CE  . LYS A 1 104 ? 142.840 -36.018 64.396  1.00 61.11 ? 104 LYS A CE  1 
ATOM   818  N  NZ  . LYS A 1 104 ? 143.313 -36.673 63.141  1.00 60.97 ? 104 LYS A NZ  1 
ATOM   819  N  N   . SER A 1 105 ? 146.148 -33.451 69.798  1.00 59.09 ? 105 SER A N   1 
ATOM   820  C  CA  . SER A 1 105 ? 147.170 -33.332 70.815  1.00 59.06 ? 105 SER A CA  1 
ATOM   821  C  C   . SER A 1 105 ? 147.478 -31.856 71.074  1.00 58.64 ? 105 SER A C   1 
ATOM   822  O  O   . SER A 1 105 ? 147.307 -31.012 70.194  1.00 57.06 ? 105 SER A O   1 
ATOM   823  C  CB  . SER A 1 105 ? 148.419 -34.129 70.407  1.00 59.49 ? 105 SER A CB  1 
ATOM   824  O  OG  . SER A 1 105 ? 149.284 -34.374 71.512  1.00 59.62 ? 105 SER A OG  1 
ATOM   825  N  N   . VAL A 1 106 ? 147.861 -31.555 72.311  1.00 57.80 ? 106 VAL A N   1 
ATOM   826  C  CA  . VAL A 1 106 ? 148.188 -30.201 72.745  1.00 57.64 ? 106 VAL A CA  1 
ATOM   827  C  C   . VAL A 1 106 ? 149.365 -30.375 73.679  1.00 56.53 ? 106 VAL A C   1 
ATOM   828  O  O   . VAL A 1 106 ? 149.897 -31.473 73.793  1.00 55.38 ? 106 VAL A O   1 
ATOM   829  C  CB  . VAL A 1 106 ? 147.013 -29.570 73.558  1.00 58.56 ? 106 VAL A CB  1 
ATOM   830  C  CG1 . VAL A 1 106 ? 147.259 -28.080 73.808  1.00 57.90 ? 106 VAL A CG1 1 
ATOM   831  C  CG2 . VAL A 1 106 ? 145.690 -29.768 72.817  1.00 60.16 ? 106 VAL A CG2 1 
ATOM   832  N  N   . THR A 1 107 ? 149.808 -29.278 74.278  1.00 58.23 ? 107 THR A N   1 
ATOM   833  C  CA  . THR A 1 107 ? 150.902 -29.276 75.242  1.00 59.63 ? 107 THR A CA  1 
ATOM   834  C  C   . THR A 1 107 ? 151.262 -27.845 75.666  1.00 58.95 ? 107 THR A C   1 
ATOM   835  O  O   . THR A 1 107 ? 150.887 -26.862 75.009  1.00 57.36 ? 107 THR A O   1 
ATOM   836  C  CB  . THR A 1 107 ? 152.140 -30.054 74.724  1.00 61.69 ? 107 THR A CB  1 
ATOM   837  O  OG1 . THR A 1 107 ? 153.146 -30.105 75.752  1.00 62.16 ? 107 THR A OG1 1 
ATOM   838  C  CG2 . THR A 1 107 ? 152.677 -29.415 73.438  1.00 61.39 ? 107 THR A CG2 1 
ATOM   839  N  N   . VAL A 1 108 ? 151.951 -27.742 76.794  1.00 58.17 ? 108 VAL A N   1 
ATOM   840  C  CA  . VAL A 1 108 ? 152.324 -26.451 77.348  1.00 59.11 ? 108 VAL A CA  1 
ATOM   841  C  C   . VAL A 1 108 ? 153.760 -26.456 77.785  1.00 57.14 ? 108 VAL A C   1 
ATOM   842  O  O   . VAL A 1 108 ? 154.196 -27.354 78.499  1.00 56.67 ? 108 VAL A O   1 
ATOM   843  C  CB  . VAL A 1 108 ? 151.457 -26.086 78.572  1.00 62.20 ? 108 VAL A CB  1 
ATOM   844  C  CG1 . VAL A 1 108 ? 151.874 -24.730 79.147  1.00 62.93 ? 108 VAL A CG1 1 
ATOM   845  C  CG2 . VAL A 1 108 ? 149.988 -26.091 78.196  1.00 63.64 ? 108 VAL A CG2 1 
ATOM   846  N  N   . LEU A 1 109 ? 154.451 -25.378 77.443  1.00 56.79 ? 109 LEU A N   1 
ATOM   847  C  CA  . LEU A 1 109 ? 155.864 -25.247 77.732  1.00 56.08 ? 109 LEU A CA  1 
ATOM   848  C  C   . LEU A 1 109 ? 156.179 -24.064 78.604  1.00 55.96 ? 109 LEU A C   1 
ATOM   849  O  O   . LEU A 1 109 ? 155.796 -22.939 78.278  1.00 54.80 ? 109 LEU A O   1 
ATOM   850  C  CB  . LEU A 1 109 ? 156.592 -25.062 76.409  1.00 55.18 ? 109 LEU A CB  1 
ATOM   851  C  CG  . LEU A 1 109 ? 156.007 -25.921 75.292  1.00 54.23 ? 109 LEU A CG  1 
ATOM   852  C  CD1 . LEU A 1 109 ? 155.976 -25.167 73.987  1.00 55.85 ? 109 LEU A CD1 1 
ATOM   853  C  CD2 . LEU A 1 109 ? 156.786 -27.207 75.191  1.00 56.30 ? 109 LEU A CD2 1 
ATOM   854  N  N   . ASP A 1 110 ? 156.837 -24.304 79.731  1.00 56.29 ? 110 ASP A N   1 
ATOM   855  C  CA  . ASP A 1 110 ? 157.205 -23.176 80.547  1.00 57.85 ? 110 ASP A CA  1 
ATOM   856  C  C   . ASP A 1 110 ? 158.354 -22.527 79.818  1.00 59.23 ? 110 ASP A C   1 
ATOM   857  O  O   . ASP A 1 110 ? 159.408 -23.149 79.605  1.00 58.63 ? 110 ASP A O   1 
ATOM   858  C  CB  . ASP A 1 110 ? 157.682 -23.548 81.939  1.00 57.20 ? 110 ASP A CB  1 
ATOM   859  C  CG  . ASP A 1 110 ? 158.262 -22.340 82.673  1.00 56.88 ? 110 ASP A CG  1 
ATOM   860  O  OD1 . ASP A 1 110 ? 157.555 -21.311 82.777  1.00 54.22 ? 110 ASP A OD1 1 
ATOM   861  O  OD2 . ASP A 1 110 ? 159.443 -22.391 83.081  1.00 57.33 ? 110 ASP A OD2 1 
ATOM   862  N  N   . VAL A 1 111 ? 158.146 -21.267 79.464  1.00 61.15 ? 111 VAL A N   1 
ATOM   863  C  CA  . VAL A 1 111 ? 159.138 -20.483 78.750  1.00 62.47 ? 111 VAL A CA  1 
ATOM   864  C  C   . VAL A 1 111 ? 160.210 -20.010 79.729  1.00 63.08 ? 111 VAL A C   1 
ATOM   865  O  O   . VAL A 1 111 ? 160.616 -18.842 79.719  1.00 61.84 ? 111 VAL A O   1 
ATOM   866  C  CB  . VAL A 1 111 ? 158.468 -19.283 78.056  1.00 62.49 ? 111 VAL A CB  1 
ATOM   867  C  CG1 . VAL A 1 111 ? 159.402 -18.691 77.009  1.00 62.76 ? 111 VAL A CG1 1 
ATOM   868  C  CG2 . VAL A 1 111 ? 157.145 -19.717 77.418  1.00 61.09 ? 111 VAL A CG2 1 
ATOM   869  N  N   . GLY A 1 112 ? 160.670 -20.946 80.556  1.00 65.03 ? 112 GLY A N   1 
ATOM   870  C  CA  . GLY A 1 112 ? 161.674 -20.656 81.555  1.00 67.52 ? 112 GLY A CA  1 
ATOM   871  C  C   . GLY A 1 112 ? 161.460 -19.302 82.200  1.00 68.19 ? 112 GLY A C   1 
ATOM   872  O  O   . GLY A 1 112 ? 160.334 -18.912 82.538  1.00 67.28 ? 112 GLY A O   1 
ATOM   873  N  N   . ASP A 1 113 ? 162.563 -18.585 82.376  1.00 69.90 ? 113 ASP A N   1 
ATOM   874  C  CA  . ASP A 1 113 ? 162.528 -17.253 82.959  1.00 70.37 ? 113 ASP A CA  1 
ATOM   875  C  C   . ASP A 1 113 ? 162.549 -16.305 81.797  1.00 69.08 ? 113 ASP A C   1 
ATOM   876  O  O   . ASP A 1 113 ? 163.494 -15.532 81.578  1.00 67.33 ? 113 ASP A O   1 
ATOM   877  C  CB  . ASP A 1 113 ? 163.696 -17.031 83.909  1.00 72.82 ? 113 ASP A CB  1 
ATOM   878  C  CG  . ASP A 1 113 ? 163.538 -17.820 85.196  1.00 75.10 ? 113 ASP A CG  1 
ATOM   879  O  OD1 . ASP A 1 113 ? 162.386 -17.941 85.691  1.00 75.82 ? 113 ASP A OD1 1 
ATOM   880  O  OD2 . ASP A 1 113 ? 164.555 -18.346 85.699  1.00 77.14 ? 113 ASP A OD2 1 
ATOM   881  N  N   . ALA A 1 114 ? 161.499 -16.494 81.012  1.00 68.05 ? 114 ALA A N   1 
ATOM   882  C  CA  . ALA A 1 114 ? 161.199 -15.766 79.818  1.00 67.49 ? 114 ALA A CA  1 
ATOM   883  C  C   . ALA A 1 114 ? 161.841 -14.399 79.812  1.00 68.78 ? 114 ALA A C   1 
ATOM   884  O  O   . ALA A 1 114 ? 162.835 -14.180 79.143  1.00 69.14 ? 114 ALA A O   1 
ATOM   885  C  CB  . ALA A 1 114 ? 159.720 -15.651 79.712  1.00 66.79 ? 114 ALA A CB  1 
ATOM   886  N  N   . TYR A 1 115 ? 161.327 -13.522 80.658  1.00 71.14 ? 115 TYR A N   1 
ATOM   887  C  CA  . TYR A 1 115 ? 161.812 -12.147 80.750  1.00 73.21 ? 115 TYR A CA  1 
ATOM   888  C  C   . TYR A 1 115 ? 163.334 -11.967 80.738  1.00 71.96 ? 115 TYR A C   1 
ATOM   889  O  O   . TYR A 1 115 ? 163.851 -11.140 79.991  1.00 72.12 ? 115 TYR A O   1 
ATOM   890  C  CB  . TYR A 1 115 ? 161.219 -11.469 81.994  1.00 77.79 ? 115 TYR A CB  1 
ATOM   891  C  CG  . TYR A 1 115 ? 159.742 -11.750 82.185  1.00 82.86 ? 115 TYR A CG  1 
ATOM   892  C  CD1 . TYR A 1 115 ? 158.770 -10.954 81.573  1.00 84.64 ? 115 TYR A CD1 1 
ATOM   893  C  CD2 . TYR A 1 115 ? 159.315 -12.842 82.949  1.00 85.01 ? 115 TYR A CD2 1 
ATOM   894  C  CE1 . TYR A 1 115 ? 157.403 -11.243 81.716  1.00 86.72 ? 115 TYR A CE1 1 
ATOM   895  C  CE2 . TYR A 1 115 ? 157.950 -13.141 83.099  1.00 86.69 ? 115 TYR A CE2 1 
ATOM   896  C  CZ  . TYR A 1 115 ? 157.001 -12.341 82.480  1.00 87.52 ? 115 TYR A CZ  1 
ATOM   897  O  OH  . TYR A 1 115 ? 155.656 -12.647 82.624  1.00 87.10 ? 115 TYR A OH  1 
ATOM   898  N  N   . PHE A 1 116 ? 164.041 -12.759 81.536  1.00 70.06 ? 116 PHE A N   1 
ATOM   899  C  CA  . PHE A 1 116 ? 165.487 -12.646 81.619  1.00 67.72 ? 116 PHE A CA  1 
ATOM   900  C  C   . PHE A 1 116 ? 166.226 -12.774 80.330  1.00 65.46 ? 116 PHE A C   1 
ATOM   901  O  O   . PHE A 1 116 ? 167.136 -12.008 80.069  1.00 64.45 ? 116 PHE A O   1 
ATOM   902  C  CB  . PHE A 1 116 ? 166.036 -13.644 82.605  1.00 70.75 ? 116 PHE A CB  1 
ATOM   903  C  CG  . PHE A 1 116 ? 165.927 -13.180 84.000  1.00 74.09 ? 116 PHE A CG  1 
ATOM   904  C  CD1 . PHE A 1 116 ? 166.937 -12.398 84.558  1.00 75.70 ? 116 PHE A CD1 1 
ATOM   905  C  CD2 . PHE A 1 116 ? 164.793 -13.464 84.746  1.00 76.51 ? 116 PHE A CD2 1 
ATOM   906  C  CE1 . PHE A 1 116 ? 166.823 -11.897 85.847  1.00 76.83 ? 116 PHE A CE1 1 
ATOM   907  C  CE2 . PHE A 1 116 ? 164.660 -12.970 86.038  1.00 79.38 ? 116 PHE A CE2 1 
ATOM   908  C  CZ  . PHE A 1 116 ? 165.683 -12.181 86.594  1.00 79.53 ? 116 PHE A CZ  1 
ATOM   909  N  N   . SER A 1 117 ? 165.884 -13.789 79.554  1.00 62.14 ? 117 SER A N   1 
ATOM   910  C  CA  . SER A 1 117 ? 166.541 -13.987 78.284  1.00 57.94 ? 117 SER A CA  1 
ATOM   911  C  C   . SER A 1 117 ? 166.431 -12.702 77.461  1.00 57.17 ? 117 SER A C   1 
ATOM   912  O  O   . SER A 1 117 ? 167.393 -12.320 76.792  1.00 57.48 ? 117 SER A O   1 
ATOM   913  C  CB  . SER A 1 117 ? 165.872 -15.147 77.557  1.00 56.61 ? 117 SER A CB  1 
ATOM   914  O  OG  . SER A 1 117 ? 164.481 -14.918 77.472  1.00 53.12 ? 117 SER A OG  1 
ATOM   915  N  N   . VAL A 1 118 ? 165.279 -12.022 77.562  1.00 56.14 ? 118 VAL A N   1 
ATOM   916  C  CA  . VAL A 1 118 ? 164.991 -10.778 76.820  1.00 54.89 ? 118 VAL A CA  1 
ATOM   917  C  C   . VAL A 1 118 ? 165.805 -9.556  77.264  1.00 55.71 ? 118 VAL A C   1 
ATOM   918  O  O   . VAL A 1 118 ? 165.803 -9.209  78.443  1.00 54.14 ? 118 VAL A O   1 
ATOM   919  C  CB  . VAL A 1 118 ? 163.472 -10.448 76.822  1.00 53.73 ? 118 VAL A CB  1 
ATOM   920  C  CG1 . VAL A 1 118 ? 163.190 -9.114  76.117  1.00 51.52 ? 118 VAL A CG1 1 
ATOM   921  C  CG2 . VAL A 1 118 ? 162.707 -11.557 76.123  1.00 52.77 ? 118 VAL A CG2 1 
ATOM   922  N  N   . PRO A 1 119 ? 166.464 -8.860  76.297  1.00 57.06 ? 119 PRO A N   1 
ATOM   923  C  CA  . PRO A 1 119 ? 167.312 -7.673  76.468  1.00 56.73 ? 119 PRO A CA  1 
ATOM   924  C  C   . PRO A 1 119 ? 166.609 -6.349  76.677  1.00 56.30 ? 119 PRO A C   1 
ATOM   925  O  O   . PRO A 1 119 ? 165.787 -5.897  75.870  1.00 56.40 ? 119 PRO A O   1 
ATOM   926  C  CB  . PRO A 1 119 ? 168.126 -7.654  75.181  1.00 57.05 ? 119 PRO A CB  1 
ATOM   927  C  CG  . PRO A 1 119 ? 167.106 -8.065  74.169  1.00 57.50 ? 119 PRO A CG  1 
ATOM   928  C  CD  . PRO A 1 119 ? 166.410 -9.229  74.863  1.00 58.15 ? 119 PRO A CD  1 
ATOM   929  N  N   . LEU A 1 120 ? 166.993 -5.708  77.763  1.00 56.83 ? 120 LEU A N   1 
ATOM   930  C  CA  . LEU A 1 120 ? 166.449 -4.422  78.128  1.00 57.10 ? 120 LEU A CA  1 
ATOM   931  C  C   . LEU A 1 120 ? 166.974 -3.440  77.114  1.00 55.97 ? 120 LEU A C   1 
ATOM   932  O  O   . LEU A 1 120 ? 168.097 -3.590  76.625  1.00 54.74 ? 120 LEU A O   1 
ATOM   933  C  CB  . LEU A 1 120 ? 166.966 -4.038  79.514  1.00 58.18 ? 120 LEU A CB  1 
ATOM   934  C  CG  . LEU A 1 120 ? 166.285 -2.904  80.272  1.00 57.98 ? 120 LEU A CG  1 
ATOM   935  C  CD1 . LEU A 1 120 ? 164.780 -3.160  80.342  1.00 58.02 ? 120 LEU A CD1 1 
ATOM   936  C  CD2 . LEU A 1 120 ? 166.884 -2.839  81.669  1.00 57.15 ? 120 LEU A CD2 1 
ATOM   937  N  N   . ASP A 1 121 ? 166.145 -2.483  76.732  1.00 55.02 ? 121 ASP A N   1 
ATOM   938  C  CA  . ASP A 1 121 ? 166.627 -1.493  75.811  1.00 55.31 ? 121 ASP A CA  1 
ATOM   939  C  C   . ASP A 1 121 ? 167.946 -1.007  76.411  1.00 56.04 ? 121 ASP A C   1 
ATOM   940  O  O   . ASP A 1 121 ? 168.054 -0.773  77.623  1.00 54.20 ? 121 ASP A O   1 
ATOM   941  C  CB  . ASP A 1 121 ? 165.663 -0.331  75.693  1.00 54.30 ? 121 ASP A CB  1 
ATOM   942  C  CG  . ASP A 1 121 ? 166.286 0.840   74.991  1.00 54.33 ? 121 ASP A CG  1 
ATOM   943  O  OD1 . ASP A 1 121 ? 166.856 0.624   73.898  1.00 52.89 ? 121 ASP A OD1 1 
ATOM   944  O  OD2 . ASP A 1 121 ? 166.256 1.952   75.563  1.00 54.27 ? 121 ASP A OD2 1 
ATOM   945  N  N   . GLU A 1 122 ? 168.941 -0.863  75.555  1.00 57.05 ? 122 GLU A N   1 
ATOM   946  C  CA  . GLU A 1 122 ? 170.260 -0.447  75.984  1.00 59.19 ? 122 GLU A CA  1 
ATOM   947  C  C   . GLU A 1 122 ? 170.336 0.753   76.925  1.00 59.85 ? 122 GLU A C   1 
ATOM   948  O  O   . GLU A 1 122 ? 171.273 0.873   77.720  1.00 59.44 ? 122 GLU A O   1 
ATOM   949  C  CB  . GLU A 1 122 ? 171.141 -0.207  74.767  1.00 59.93 ? 122 GLU A CB  1 
ATOM   950  C  CG  . GLU A 1 122 ? 172.616 -0.111  75.108  1.00 61.95 ? 122 GLU A CG  1 
ATOM   951  C  CD  . GLU A 1 122 ? 173.111 -1.327  75.873  1.00 63.03 ? 122 GLU A CD  1 
ATOM   952  O  OE1 . GLU A 1 122 ? 172.995 -2.450  75.332  1.00 62.53 ? 122 GLU A OE1 1 
ATOM   953  O  OE2 . GLU A 1 122 ? 173.603 -1.163  77.016  1.00 62.86 ? 122 GLU A OE2 1 
ATOM   954  N  N   . ASP A 1 123 ? 169.347 1.629   76.859  1.00 62.10 ? 123 ASP A N   1 
ATOM   955  C  CA  . ASP A 1 123 ? 169.360 2.814   77.703  1.00 64.55 ? 123 ASP A CA  1 
ATOM   956  C  C   . ASP A 1 123 ? 168.697 2.697   79.064  1.00 65.54 ? 123 ASP A C   1 
ATOM   957  O  O   . ASP A 1 123 ? 169.302 3.038   80.083  1.00 64.69 ? 123 ASP A O   1 
ATOM   958  C  CB  . ASP A 1 123 ? 168.758 3.998   76.958  1.00 66.30 ? 123 ASP A CB  1 
ATOM   959  C  CG  . ASP A 1 123 ? 169.660 4.511   75.876  1.00 67.85 ? 123 ASP A CG  1 
ATOM   960  O  OD1 . ASP A 1 123 ? 169.621 3.945   74.767  1.00 69.07 ? 123 ASP A OD1 1 
ATOM   961  O  OD2 . ASP A 1 123 ? 170.417 5.469   76.141  1.00 70.61 ? 123 ASP A OD2 1 
ATOM   962  N  N   . PHE A 1 124 ? 167.459 2.210   79.088  1.00 65.29 ? 124 PHE A N   1 
ATOM   963  C  CA  . PHE A 1 124 ? 166.692 2.095   80.337  1.00 65.23 ? 124 PHE A CA  1 
ATOM   964  C  C   . PHE A 1 124 ? 167.466 1.406   81.468  1.00 64.39 ? 124 PHE A C   1 
ATOM   965  O  O   . PHE A 1 124 ? 167.176 1.586   82.659  1.00 63.05 ? 124 PHE A O   1 
ATOM   966  C  CB  . PHE A 1 124 ? 165.361 1.381   80.062  1.00 64.90 ? 124 PHE A CB  1 
ATOM   967  C  CG  . PHE A 1 124 ? 164.150 2.121   80.571  1.00 63.63 ? 124 PHE A CG  1 
ATOM   968  C  CD1 . PHE A 1 124 ? 163.942 3.454   80.242  1.00 62.66 ? 124 PHE A CD1 1 
ATOM   969  C  CD2 . PHE A 1 124 ? 163.206 1.471   81.363  1.00 63.59 ? 124 PHE A CD2 1 
ATOM   970  C  CE1 . PHE A 1 124 ? 162.817 4.124   80.690  1.00 63.02 ? 124 PHE A CE1 1 
ATOM   971  C  CE2 . PHE A 1 124 ? 162.077 2.131   81.817  1.00 63.07 ? 124 PHE A CE2 1 
ATOM   972  C  CZ  . PHE A 1 124 ? 161.881 3.458   81.480  1.00 64.12 ? 124 PHE A CZ  1 
ATOM   973  N  N   . ARG A 1 125 ? 168.478 0.650   81.065  1.00 65.85 ? 125 ARG A N   1 
ATOM   974  C  CA  . ARG A 1 125 ? 169.352 -0.092  81.961  1.00 66.21 ? 125 ARG A CA  1 
ATOM   975  C  C   . ARG A 1 125 ? 169.836 0.737   83.147  1.00 67.88 ? 125 ARG A C   1 
ATOM   976  O  O   . ARG A 1 125 ? 169.714 0.309   84.301  1.00 68.38 ? 125 ARG A O   1 
ATOM   977  C  CB  . ARG A 1 125 ? 170.514 -0.661  81.141  1.00 63.76 ? 125 ARG A CB  1 
ATOM   978  C  CG  . ARG A 1 125 ? 169.972 -1.508  80.001  1.00 60.56 ? 125 ARG A CG  1 
ATOM   979  C  CD  . ARG A 1 125 ? 171.002 -2.025  79.072  1.00 55.76 ? 125 ARG A CD  1 
ATOM   980  N  NE  . ARG A 1 125 ? 170.418 -3.096  78.281  1.00 51.75 ? 125 ARG A NE  1 
ATOM   981  C  CZ  . ARG A 1 125 ? 171.129 -4.042  77.688  1.00 51.03 ? 125 ARG A CZ  1 
ATOM   982  N  NH1 . ARG A 1 125 ? 172.449 -4.040  77.792  1.00 50.15 ? 125 ARG A NH1 1 
ATOM   983  N  NH2 . ARG A 1 125 ? 170.523 -5.009  77.020  1.00 50.44 ? 125 ARG A NH2 1 
ATOM   984  N  N   . LYS A 1 126 ? 170.286 1.959   82.872  1.00 68.77 ? 126 LYS A N   1 
ATOM   985  C  CA  . LYS A 1 126 ? 170.772 2.853   83.922  1.00 69.56 ? 126 LYS A CA  1 
ATOM   986  C  C   . LYS A 1 126 ? 169.756 2.967   85.042  1.00 70.31 ? 126 LYS A C   1 
ATOM   987  O  O   . LYS A 1 126 ? 170.095 2.997   86.220  1.00 70.03 ? 126 LYS A O   1 
ATOM   988  C  CB  . LYS A 1 126 ? 171.065 4.236   83.348  1.00 68.24 ? 126 LYS A CB  1 
ATOM   989  C  CG  . LYS A 1 126 ? 169.930 4.813   82.546  1.00 66.64 ? 126 LYS A CG  1 
ATOM   990  C  CD  . LYS A 1 126 ? 170.451 5.751   81.471  1.00 67.41 ? 126 LYS A CD  1 
ATOM   991  C  CE  . LYS A 1 126 ? 171.358 5.036   80.466  1.00 66.08 ? 126 LYS A CE  1 
ATOM   992  N  NZ  . LYS A 1 126 ? 171.733 5.921   79.334  1.00 63.87 ? 126 LYS A NZ  1 
ATOM   993  N  N   . TYR A 1 127 ? 168.492 2.971   84.667  1.00 72.06 ? 127 TYR A N   1 
ATOM   994  C  CA  . TYR A 1 127 ? 167.433 3.078   85.646  1.00 74.29 ? 127 TYR A CA  1 
ATOM   995  C  C   . TYR A 1 127 ? 167.313 1.818   86.498  1.00 74.35 ? 127 TYR A C   1 
ATOM   996  O  O   . TYR A 1 127 ? 167.207 1.892   87.727  1.00 74.70 ? 127 TYR A O   1 
ATOM   997  C  CB  . TYR A 1 127 ? 166.134 3.420   84.923  1.00 75.32 ? 127 TYR A CB  1 
ATOM   998  C  CG  . TYR A 1 127 ? 166.308 4.684   84.122  1.00 77.41 ? 127 TYR A CG  1 
ATOM   999  C  CD1 . TYR A 1 127 ? 167.064 5.738   84.641  1.00 77.54 ? 127 TYR A CD1 1 
ATOM   1000 C  CD2 . TYR A 1 127 ? 165.774 4.820   82.839  1.00 77.99 ? 127 TYR A CD2 1 
ATOM   1001 C  CE1 . TYR A 1 127 ? 167.292 6.888   83.915  1.00 77.69 ? 127 TYR A CE1 1 
ATOM   1002 C  CE2 . TYR A 1 127 ? 165.997 5.982   82.094  1.00 77.53 ? 127 TYR A CE2 1 
ATOM   1003 C  CZ  . TYR A 1 127 ? 166.762 7.012   82.646  1.00 78.21 ? 127 TYR A CZ  1 
ATOM   1004 O  OH  . TYR A 1 127 ? 167.022 8.168   81.948  1.00 78.80 ? 127 TYR A OH  1 
ATOM   1005 N  N   . THR A 1 128 ? 167.441 0.665   85.854  1.00 74.40 ? 128 THR A N   1 
ATOM   1006 C  CA  . THR A 1 128 ? 167.336 -0.602  86.559  1.00 73.55 ? 128 THR A CA  1 
ATOM   1007 C  C   . THR A 1 128 ? 168.526 -0.868  87.486  1.00 74.42 ? 128 THR A C   1 
ATOM   1008 O  O   . THR A 1 128 ? 168.718 -1.992  87.945  1.00 73.92 ? 128 THR A O   1 
ATOM   1009 C  CB  . THR A 1 128 ? 167.111 -1.777  85.563  1.00 72.07 ? 128 THR A CB  1 
ATOM   1010 O  OG1 . THR A 1 128 ? 168.059 -1.714  84.494  1.00 70.93 ? 128 THR A OG1 1 
ATOM   1011 C  CG2 . THR A 1 128 ? 165.740 -1.684  84.958  1.00 70.42 ? 128 THR A CG2 1 
ATOM   1012 N  N   . ALA A 1 129 ? 169.284 0.182   87.794  1.00 74.63 ? 129 ALA A N   1 
ATOM   1013 C  CA  . ALA A 1 129 ? 170.445 0.067   88.656  1.00 76.14 ? 129 ALA A CA  1 
ATOM   1014 C  C   . ALA A 1 129 ? 170.007 -0.164  90.094  1.00 77.81 ? 129 ALA A C   1 
ATOM   1015 O  O   . ALA A 1 129 ? 168.978 0.358   90.531  1.00 77.39 ? 129 ALA A O   1 
ATOM   1016 C  CB  . ALA A 1 129 ? 171.298 1.312   88.561  1.00 75.56 ? 129 ALA A CB  1 
ATOM   1017 N  N   . PHE A 1 130 ? 170.778 -0.987  90.807  1.00 80.52 ? 130 PHE A N   1 
ATOM   1018 C  CA  . PHE A 1 130 ? 170.515 -1.317  92.213  1.00 83.50 ? 130 PHE A CA  1 
ATOM   1019 C  C   . PHE A 1 130 ? 171.817 -1.369  93.021  1.00 85.51 ? 130 PHE A C   1 
ATOM   1020 O  O   . PHE A 1 130 ? 172.900 -1.228  92.446  1.00 84.43 ? 130 PHE A O   1 
ATOM   1021 C  CB  . PHE A 1 130 ? 169.723 -2.633  92.339  1.00 84.74 ? 130 PHE A CB  1 
ATOM   1022 C  CG  . PHE A 1 130 ? 170.363 -3.818  91.635  1.00 86.83 ? 130 PHE A CG  1 
ATOM   1023 C  CD1 . PHE A 1 130 ? 171.456 -4.484  92.195  1.00 87.42 ? 130 PHE A CD1 1 
ATOM   1024 C  CD2 . PHE A 1 130 ? 169.849 -4.287  90.420  1.00 87.63 ? 130 PHE A CD2 1 
ATOM   1025 C  CE1 . PHE A 1 130 ? 172.023 -5.595  91.562  1.00 87.68 ? 130 PHE A CE1 1 
ATOM   1026 C  CE2 . PHE A 1 130 ? 170.412 -5.402  89.775  1.00 87.32 ? 130 PHE A CE2 1 
ATOM   1027 C  CZ  . PHE A 1 130 ? 171.498 -6.054  90.348  1.00 87.37 ? 130 PHE A CZ  1 
ATOM   1028 N  N   . THR A 1 131 ? 171.708 -1.590  94.336  1.00 88.43 ? 131 THR A N   1 
ATOM   1029 C  CA  . THR A 1 131 ? 172.876 -1.637  95.235  1.00 90.94 ? 131 THR A CA  1 
ATOM   1030 C  C   . THR A 1 131 ? 172.923 -2.770  96.275  1.00 92.08 ? 131 THR A C   1 
ATOM   1031 O  O   . THR A 1 131 ? 171.977 -2.957  97.052  1.00 91.46 ? 131 THR A O   1 
ATOM   1032 C  CB  . THR A 1 131 ? 173.033 -0.267  95.978  1.00 90.75 ? 131 THR A CB  1 
ATOM   1033 O  OG1 . THR A 1 131 ? 173.599 0.686   95.080  1.00 90.06 ? 131 THR A OG1 1 
ATOM   1034 C  CG2 . THR A 1 131 ? 173.911 -0.376  97.217  1.00 89.61 ? 131 THR A CG2 1 
ATOM   1035 N  N   . ILE A 1 132 ? 174.057 -3.488  96.294  1.00 94.37 ? 132 ILE A N   1 
ATOM   1036 C  CA  . ILE A 1 132 ? 174.321 -4.580  97.252  1.00 96.64 ? 132 ILE A CA  1 
ATOM   1037 C  C   . ILE A 1 132 ? 175.543 -4.195  98.116  1.00 97.63 ? 132 ILE A C   1 
ATOM   1038 O  O   . ILE A 1 132 ? 176.700 -4.408  97.713  1.00 98.08 ? 132 ILE A O   1 
ATOM   1039 C  CB  . ILE A 1 132 ? 174.678 -5.936  96.552  1.00 96.35 ? 132 ILE A CB  1 
ATOM   1040 C  CG1 . ILE A 1 132 ? 173.544 -6.417  95.645  1.00 96.53 ? 132 ILE A CG1 1 
ATOM   1041 C  CG2 . ILE A 1 132 ? 174.965 -7.015  97.603  1.00 95.34 ? 132 ILE A CG2 1 
ATOM   1042 C  CD1 . ILE A 1 132 ? 173.891 -7.693  94.885  1.00 96.67 ? 132 ILE A CD1 1 
ATOM   1043 N  N   . PRO A 1 133 ? 175.309 -3.582  99.295  1.00 98.04 ? 133 PRO A N   1 
ATOM   1044 C  CA  . PRO A 1 133 ? 176.447 -3.214  100.144 1.00 98.55 ? 133 PRO A CA  1 
ATOM   1045 C  C   . PRO A 1 133 ? 177.109 -4.485  100.660 1.00 99.05 ? 133 PRO A C   1 
ATOM   1046 O  O   . PRO A 1 133 ? 176.486 -5.550  100.681 1.00 98.85 ? 133 PRO A O   1 
ATOM   1047 C  CB  . PRO A 1 133 ? 175.786 -2.439  101.289 1.00 98.69 ? 133 PRO A CB  1 
ATOM   1048 C  CG  . PRO A 1 133 ? 174.517 -1.914  100.676 1.00 98.28 ? 133 PRO A CG  1 
ATOM   1049 C  CD  . PRO A 1 133 ? 174.048 -3.103  99.884  1.00 97.99 ? 133 PRO A CD  1 
ATOM   1050 N  N   . SER A 1 134 ? 178.379 -4.393  101.034 1.00 98.60 ? 134 SER A N   1 
ATOM   1051 C  CA  . SER A 1 134 ? 179.072 -5.556  101.557 1.00 98.82 ? 134 SER A CA  1 
ATOM   1052 C  C   . SER A 1 134 ? 178.505 -5.903  102.949 1.00 98.59 ? 134 SER A C   1 
ATOM   1053 O  O   . SER A 1 134 ? 177.553 -6.679  103.050 1.00 98.45 ? 134 SER A O   1 
ATOM   1054 C  CB  . SER A 1 134 ? 180.581 -5.306  101.604 1.00 98.59 ? 134 SER A CB  1 
ATOM   1055 N  N   . ILE A 1 135 ? 179.051 -5.310  104.010 1.00 98.02 ? 135 ILE A N   1 
ATOM   1056 C  CA  . ILE A 1 135 ? 178.573 -5.591  105.362 1.00 96.40 ? 135 ILE A CA  1 
ATOM   1057 C  C   . ILE A 1 135 ? 177.725 -4.428  105.871 1.00 96.62 ? 135 ILE A C   1 
ATOM   1058 O  O   . ILE A 1 135 ? 176.925 -3.850  105.127 1.00 95.89 ? 135 ILE A O   1 
ATOM   1059 C  CB  . ILE A 1 135 ? 179.759 -5.852  106.296 1.00 94.90 ? 135 ILE A CB  1 
ATOM   1060 N  N   . ASN A 1 136 ? 177.893 -4.106  107.152 1.00 96.86 ? 136 ASN A N   1 
ATOM   1061 C  CA  . ASN A 1 136 ? 177.168 -3.006  107.777 1.00 96.93 ? 136 ASN A CA  1 
ATOM   1062 C  C   . ASN A 1 136 ? 177.871 -1.675  107.502 1.00 96.47 ? 136 ASN A C   1 
ATOM   1063 O  O   . ASN A 1 136 ? 177.234 -0.624  107.445 1.00 95.66 ? 136 ASN A O   1 
ATOM   1064 C  CB  . ASN A 1 136 ? 177.057 -3.247  109.288 1.00 96.41 ? 136 ASN A CB  1 
ATOM   1065 N  N   . ASN A 1 137 ? 179.186 -1.732  107.316 1.00 96.21 ? 137 ASN A N   1 
ATOM   1066 C  CA  . ASN A 1 137 ? 179.971 -0.531  107.065 1.00 95.36 ? 137 ASN A CA  1 
ATOM   1067 C  C   . ASN A 1 137 ? 181.014 -0.798  105.997 1.00 95.32 ? 137 ASN A C   1 
ATOM   1068 O  O   . ASN A 1 137 ? 181.097 -0.057  105.019 1.00 95.88 ? 137 ASN A O   1 
ATOM   1069 C  CB  . ASN A 1 137 ? 180.634 -0.054  108.348 1.00 96.11 ? 137 ASN A CB  1 
ATOM   1070 N  N   . GLU A 1 138 ? 181.833 -1.830  106.204 1.00 94.81 ? 138 GLU A N   1 
ATOM   1071 C  CA  . GLU A 1 138 ? 182.860 -2.204  105.235 1.00 94.59 ? 138 GLU A CA  1 
ATOM   1072 C  C   . GLU A 1 138 ? 182.076 -2.550  103.982 1.00 94.89 ? 138 GLU A C   1 
ATOM   1073 O  O   . GLU A 1 138 ? 181.566 -3.666  103.858 1.00 94.73 ? 138 GLU A O   1 
ATOM   1074 C  CB  . GLU A 1 138 ? 183.628 -3.416  105.727 1.00 92.27 ? 138 GLU A CB  1 
ATOM   1075 N  N   . THR A 1 139 ? 181.915 -1.568  103.098 1.00 95.73 ? 139 THR A N   1 
ATOM   1076 C  CA  . THR A 1 139 ? 181.143 -1.758  101.882 1.00 96.19 ? 139 THR A CA  1 
ATOM   1077 C  C   . THR A 1 139 ? 181.425 -0.700  100.824 1.00 96.26 ? 139 THR A C   1 
ATOM   1078 O  O   . THR A 1 139 ? 181.551 0.489   101.134 1.00 95.80 ? 139 THR A O   1 
ATOM   1079 C  CB  . THR A 1 139 ? 179.639 -1.758  102.223 1.00 95.42 ? 139 THR A CB  1 
ATOM   1080 N  N   . PRO A 1 140 ? 181.619 -1.139  99.568  1.00 96.80 ? 140 PRO A N   1 
ATOM   1081 C  CA  . PRO A 1 140 ? 181.892 -0.300  98.389  1.00 96.96 ? 140 PRO A CA  1 
ATOM   1082 C  C   . PRO A 1 140 ? 180.594 -0.047  97.598  1.00 96.72 ? 140 PRO A C   1 
ATOM   1083 O  O   . PRO A 1 140 ? 180.607 0.620   96.563  1.00 96.17 ? 140 PRO A O   1 
ATOM   1084 C  CB  . PRO A 1 140 ? 182.863 -1.157  97.562  1.00 96.44 ? 140 PRO A CB  1 
ATOM   1085 C  CG  . PRO A 1 140 ? 183.344 -2.233  98.533  1.00 96.35 ? 140 PRO A CG  1 
ATOM   1086 C  CD  . PRO A 1 140 ? 182.106 -2.508  99.328  1.00 96.11 ? 140 PRO A CD  1 
ATOM   1087 N  N   . GLY A 1 141 ? 179.497 -0.641  98.073  1.00 97.95 ? 141 GLY A N   1 
ATOM   1088 C  CA  . GLY A 1 141 ? 178.196 -0.493  97.436  1.00 98.15 ? 141 GLY A CA  1 
ATOM   1089 C  C   . GLY A 1 141 ? 178.103 -0.974  95.998  1.00 98.59 ? 141 GLY A C   1 
ATOM   1090 O  O   . GLY A 1 141 ? 177.484 -0.306  95.167  1.00 98.28 ? 141 GLY A O   1 
ATOM   1091 N  N   . ILE A 1 142 ? 178.657 -2.155  95.724  1.00 98.55 ? 142 ILE A N   1 
ATOM   1092 C  CA  . ILE A 1 142 ? 178.648 -2.728  94.377  1.00 98.34 ? 142 ILE A CA  1 
ATOM   1093 C  C   . ILE A 1 142 ? 177.299 -2.564  93.664  1.00 98.35 ? 142 ILE A C   1 
ATOM   1094 O  O   . ILE A 1 142 ? 176.271 -3.109  94.089  1.00 98.01 ? 142 ILE A O   1 
ATOM   1095 C  CB  . ILE A 1 142 ? 179.106 -4.228  94.375  1.00 97.35 ? 142 ILE A CB  1 
ATOM   1096 C  CG1 . ILE A 1 142 ? 178.077 -5.132  95.067  1.00 96.37 ? 142 ILE A CG1 1 
ATOM   1097 C  CG2 . ILE A 1 142 ? 180.451 -4.359  95.085  1.00 96.67 ? 142 ILE A CG2 1 
ATOM   1098 C  CD1 . ILE A 1 142 ? 178.411 -6.611  95.006  1.00 94.33 ? 142 ILE A CD1 1 
ATOM   1099 N  N   . ARG A 1 143 ? 177.308 -1.728  92.630  1.00 98.56 ? 143 ARG A N   1 
ATOM   1100 C  CA  . ARG A 1 143 ? 176.115 -1.454  91.834  1.00 98.74 ? 143 ARG A CA  1 
ATOM   1101 C  C   . ARG A 1 143 ? 176.117 -2.291  90.556  1.00 98.20 ? 143 ARG A C   1 
ATOM   1102 O  O   . ARG A 1 143 ? 177.174 -2.537  89.952  1.00 98.54 ? 143 ARG A O   1 
ATOM   1103 C  CB  . ARG A 1 143 ? 176.023 0.037   91.472  1.00 98.67 ? 143 ARG A CB  1 
ATOM   1104 C  CG  . ARG A 1 143 ? 175.936 0.985   92.659  1.00 98.11 ? 143 ARG A CG  1 
ATOM   1105 C  CD  . ARG A 1 143 ? 175.765 2.438   92.197  1.00 97.02 ? 143 ARG A CD  1 
ATOM   1106 N  NE  . ARG A 1 143 ? 174.436 2.674   91.642  1.00 95.68 ? 143 ARG A NE  1 
ATOM   1107 C  CZ  . ARG A 1 143 ? 173.348 2.853   92.378  1.00 93.71 ? 143 ARG A CZ  1 
ATOM   1108 N  NH1 . ARG A 1 143 ? 173.428 2.836   93.695  1.00 92.15 ? 143 ARG A NH1 1 
ATOM   1109 N  NH2 . ARG A 1 143 ? 172.174 2.988   91.798  1.00 91.84 ? 143 ARG A NH2 1 
ATOM   1110 N  N   . TYR A 1 144 ? 174.926 -2.732  90.159  1.00 95.90 ? 144 TYR A N   1 
ATOM   1111 C  CA  . TYR A 1 144 ? 174.735 -3.541  88.963  1.00 91.67 ? 144 TYR A CA  1 
ATOM   1112 C  C   . TYR A 1 144 ? 173.500 -3.017  88.254  1.00 89.03 ? 144 TYR A C   1 
ATOM   1113 O  O   . TYR A 1 144 ? 172.684 -2.307  88.847  1.00 87.83 ? 144 TYR A O   1 
ATOM   1114 C  CB  . TYR A 1 144 ? 174.471 -4.996  89.340  1.00 92.64 ? 144 TYR A CB  1 
ATOM   1115 C  CG  . TYR A 1 144 ? 175.601 -5.750  90.000  1.00 94.20 ? 144 TYR A CG  1 
ATOM   1116 C  CD1 . TYR A 1 144 ? 175.795 -5.692  91.386  1.00 94.14 ? 144 TYR A CD1 1 
ATOM   1117 C  CD2 . TYR A 1 144 ? 176.421 -6.600  89.251  1.00 95.02 ? 144 TYR A CD2 1 
ATOM   1118 C  CE1 . TYR A 1 144 ? 176.775 -6.470  92.012  1.00 94.98 ? 144 TYR A CE1 1 
ATOM   1119 C  CE2 . TYR A 1 144 ? 177.403 -7.384  89.866  1.00 95.94 ? 144 TYR A CE2 1 
ATOM   1120 C  CZ  . TYR A 1 144 ? 177.574 -7.317  91.247  1.00 95.58 ? 144 TYR A CZ  1 
ATOM   1121 O  OH  . TYR A 1 144 ? 178.530 -8.110  91.848  1.00 95.53 ? 144 TYR A OH  1 
ATOM   1122 N  N   . GLN A 1 145 ? 173.364 -3.369  86.986  1.00 86.82 ? 145 GLN A N   1 
ATOM   1123 C  CA  . GLN A 1 145 ? 172.202 -2.958  86.219  1.00 84.45 ? 145 GLN A CA  1 
ATOM   1124 C  C   . GLN A 1 145 ? 171.818 -4.088  85.284  1.00 82.92 ? 145 GLN A C   1 
ATOM   1125 O  O   . GLN A 1 145 ? 172.646 -4.933  84.930  1.00 81.66 ? 145 GLN A O   1 
ATOM   1126 C  CB  . GLN A 1 145 ? 172.468 -1.678  85.430  1.00 84.50 ? 145 GLN A CB  1 
ATOM   1127 C  CG  . GLN A 1 145 ? 173.606 -1.791  84.444  1.00 86.41 ? 145 GLN A CG  1 
ATOM   1128 C  CD  . GLN A 1 145 ? 173.622 -0.661  83.442  1.00 87.78 ? 145 GLN A CD  1 
ATOM   1129 O  OE1 . GLN A 1 145 ? 172.976 0.373   83.637  1.00 87.62 ? 145 GLN A OE1 1 
ATOM   1130 N  NE2 . GLN A 1 145 ? 174.356 -0.852  82.350  1.00 88.75 ? 145 GLN A NE2 1 
ATOM   1131 N  N   . TYR A 1 146 ? 170.543 -4.125  84.936  1.00 81.16 ? 146 TYR A N   1 
ATOM   1132 C  CA  . TYR A 1 146 ? 170.009 -5.145  84.055  1.00 80.04 ? 146 TYR A CA  1 
ATOM   1133 C  C   . TYR A 1 146 ? 170.320 -4.861  82.581  1.00 77.99 ? 146 TYR A C   1 
ATOM   1134 O  O   . TYR A 1 146 ? 170.529 -3.717  82.176  1.00 78.09 ? 146 TYR A O   1 
ATOM   1135 C  CB  . TYR A 1 146 ? 168.484 -5.267  84.256  1.00 81.58 ? 146 TYR A CB  1 
ATOM   1136 C  CG  . TYR A 1 146 ? 168.037 -6.123  85.436  1.00 82.18 ? 146 TYR A CG  1 
ATOM   1137 C  CD1 . TYR A 1 146 ? 168.144 -5.664  86.751  1.00 80.97 ? 146 TYR A CD1 1 
ATOM   1138 C  CD2 . TYR A 1 146 ? 167.477 -7.386  85.225  1.00 82.30 ? 146 TYR A CD2 1 
ATOM   1139 C  CE1 . TYR A 1 146 ? 167.701 -6.443  87.824  1.00 81.44 ? 146 TYR A CE1 1 
ATOM   1140 C  CE2 . TYR A 1 146 ? 167.029 -8.170  86.291  1.00 82.79 ? 146 TYR A CE2 1 
ATOM   1141 C  CZ  . TYR A 1 146 ? 167.141 -7.697  87.585  1.00 82.32 ? 146 TYR A CZ  1 
ATOM   1142 O  OH  . TYR A 1 146 ? 166.668 -8.485  88.618  1.00 82.28 ? 146 TYR A OH  1 
ATOM   1143 N  N   . ASN A 1 147 ? 170.437 -5.931  81.810  1.00 75.28 ? 147 ASN A N   1 
ATOM   1144 C  CA  . ASN A 1 147 ? 170.674 -5.851  80.379  1.00 72.70 ? 147 ASN A CA  1 
ATOM   1145 C  C   . ASN A 1 147 ? 169.523 -6.632  79.779  1.00 71.90 ? 147 ASN A C   1 
ATOM   1146 O  O   . ASN A 1 147 ? 169.398 -6.770  78.562  1.00 71.18 ? 147 ASN A O   1 
ATOM   1147 C  CB  . ASN A 1 147 ? 171.989 -6.525  80.025  1.00 71.10 ? 147 ASN A CB  1 
ATOM   1148 C  CG  . ASN A 1 147 ? 173.149 -5.942  80.782  1.00 70.68 ? 147 ASN A CG  1 
ATOM   1149 O  OD1 . ASN A 1 147 ? 173.327 -4.725  80.832  1.00 70.07 ? 147 ASN A OD1 1 
ATOM   1150 N  ND2 . ASN A 1 147 ? 173.944 -6.806  81.391  1.00 71.41 ? 147 ASN A ND2 1 
ATOM   1151 N  N   . VAL A 1 148 ? 168.674 -7.134  80.671  1.00 71.04 ? 148 VAL A N   1 
ATOM   1152 C  CA  . VAL A 1 148 ? 167.505 -7.928  80.331  1.00 70.02 ? 148 VAL A CA  1 
ATOM   1153 C  C   . VAL A 1 148 ? 166.271 -7.397  81.097  1.00 69.39 ? 148 VAL A C   1 
ATOM   1154 O  O   . VAL A 1 148 ? 166.414 -6.532  81.975  1.00 69.21 ? 148 VAL A O   1 
ATOM   1155 C  CB  . VAL A 1 148 ? 167.758 -9.404  80.705  1.00 70.01 ? 148 VAL A CB  1 
ATOM   1156 C  CG1 . VAL A 1 148 ? 169.021 -9.910  79.999  1.00 69.42 ? 148 VAL A CG1 1 
ATOM   1157 C  CG2 . VAL A 1 148 ? 167.888 -9.562  82.226  1.00 68.92 ? 148 VAL A CG2 1 
ATOM   1158 N  N   . LEU A 1 149 ? 165.074 -7.883  80.750  1.00 67.28 ? 149 LEU A N   1 
ATOM   1159 C  CA  . LEU A 1 149 ? 163.843 -7.461  81.422  1.00 64.33 ? 149 LEU A CA  1 
ATOM   1160 C  C   . LEU A 1 149 ? 163.931 -7.874  82.887  1.00 65.87 ? 149 LEU A C   1 
ATOM   1161 O  O   . LEU A 1 149 ? 163.903 -9.066  83.210  1.00 65.81 ? 149 LEU A O   1 
ATOM   1162 C  CB  . LEU A 1 149 ? 162.614 -8.107  80.788  1.00 59.06 ? 149 LEU A CB  1 
ATOM   1163 C  CG  . LEU A 1 149 ? 162.216 -7.597  79.413  1.00 56.24 ? 149 LEU A CG  1 
ATOM   1164 C  CD1 . LEU A 1 149 ? 160.944 -8.283  78.949  1.00 53.62 ? 149 LEU A CD1 1 
ATOM   1165 C  CD2 . LEU A 1 149 ? 162.036 -6.101  79.462  1.00 54.21 ? 149 LEU A CD2 1 
ATOM   1166 N  N   . PRO A 1 150 ? 164.052 -6.886  83.793  1.00 66.90 ? 150 PRO A N   1 
ATOM   1167 C  CA  . PRO A 1 150 ? 164.160 -7.038  85.252  1.00 66.45 ? 150 PRO A CA  1 
ATOM   1168 C  C   . PRO A 1 150 ? 162.950 -7.725  85.860  1.00 66.24 ? 150 PRO A C   1 
ATOM   1169 O  O   . PRO A 1 150 ? 161.828 -7.569  85.351  1.00 66.38 ? 150 PRO A O   1 
ATOM   1170 C  CB  . PRO A 1 150 ? 164.282 -5.597  85.736  1.00 67.10 ? 150 PRO A CB  1 
ATOM   1171 C  CG  . PRO A 1 150 ? 164.873 -4.893  84.548  1.00 68.53 ? 150 PRO A CG  1 
ATOM   1172 C  CD  . PRO A 1 150 ? 164.069 -5.461  83.431  1.00 67.57 ? 150 PRO A CD  1 
ATOM   1173 N  N   . GLN A 1 151 ? 163.167 -8.424  86.977  1.00 65.53 ? 151 GLN A N   1 
ATOM   1174 C  CA  . GLN A 1 151 ? 162.093 -9.167  87.627  1.00 65.24 ? 151 GLN A CA  1 
ATOM   1175 C  C   . GLN A 1 151 ? 160.797 -8.361  87.807  1.00 63.95 ? 151 GLN A C   1 
ATOM   1176 O  O   . GLN A 1 151 ? 159.774 -8.691  87.200  1.00 64.34 ? 151 GLN A O   1 
ATOM   1177 C  CB  . GLN A 1 151 ? 162.580 -9.836  88.928  1.00 67.11 ? 151 GLN A CB  1 
ATOM   1178 C  CG  . GLN A 1 151 ? 161.905 -11.205 89.207  1.00 70.54 ? 151 GLN A CG  1 
ATOM   1179 C  CD  . GLN A 1 151 ? 162.778 -12.200 89.997  1.00 73.71 ? 151 GLN A CD  1 
ATOM   1180 O  OE1 . GLN A 1 151 ? 163.584 -11.816 90.856  1.00 75.08 ? 151 GLN A OE1 1 
ATOM   1181 N  NE2 . GLN A 1 151 ? 162.609 -13.492 89.697  1.00 74.09 ? 151 GLN A NE2 1 
ATOM   1182 N  N   . GLY A 1 152 ? 160.837 -7.271  88.561  1.00 61.82 ? 152 GLY A N   1 
ATOM   1183 C  CA  . GLY A 1 152 ? 159.620 -6.497  88.737  1.00 59.19 ? 152 GLY A CA  1 
ATOM   1184 C  C   . GLY A 1 152 ? 159.537 -5.212  87.930  1.00 57.57 ? 152 GLY A C   1 
ATOM   1185 O  O   . GLY A 1 152 ? 159.540 -4.137  88.519  1.00 57.82 ? 152 GLY A O   1 
ATOM   1186 N  N   . TRP A 1 153 ? 159.467 -5.296  86.603  1.00 56.05 ? 153 TRP A N   1 
ATOM   1187 C  CA  . TRP A 1 153 ? 159.370 -4.090  85.779  1.00 53.53 ? 153 TRP A CA  1 
ATOM   1188 C  C   . TRP A 1 153 ? 158.082 -4.013  84.949  1.00 53.50 ? 153 TRP A C   1 
ATOM   1189 O  O   . TRP A 1 153 ? 157.734 -4.940  84.211  1.00 52.18 ? 153 TRP A O   1 
ATOM   1190 C  CB  . TRP A 1 153 ? 160.598 -3.898  84.873  1.00 51.57 ? 153 TRP A CB  1 
ATOM   1191 C  CG  . TRP A 1 153 ? 160.468 -2.630  84.090  1.00 48.88 ? 153 TRP A CG  1 
ATOM   1192 C  CD1 . TRP A 1 153 ? 160.275 -1.373  84.598  1.00 48.65 ? 153 TRP A CD1 1 
ATOM   1193 C  CD2 . TRP A 1 153 ? 160.333 -2.509  82.676  1.00 47.33 ? 153 TRP A CD2 1 
ATOM   1194 N  NE1 . TRP A 1 153 ? 159.997 -0.487  83.590  1.00 47.04 ? 153 TRP A NE1 1 
ATOM   1195 C  CE2 . TRP A 1 153 ? 160.023 -1.158  82.397  1.00 46.73 ? 153 TRP A CE2 1 
ATOM   1196 C  CE3 . TRP A 1 153 ? 160.422 -3.411  81.618  1.00 45.85 ? 153 TRP A CE3 1 
ATOM   1197 C  CZ2 . TRP A 1 153 ? 159.809 -0.694  81.103  1.00 44.89 ? 153 TRP A CZ2 1 
ATOM   1198 C  CZ3 . TRP A 1 153 ? 160.206 -2.950  80.338  1.00 44.56 ? 153 TRP A CZ3 1 
ATOM   1199 C  CH2 . TRP A 1 153 ? 159.898 -1.603  80.091  1.00 44.45 ? 153 TRP A CH2 1 
ATOM   1200 N  N   . LYS A 1 154 ? 157.446 -2.844  84.997  1.00 53.46 ? 154 LYS A N   1 
ATOM   1201 C  CA  . LYS A 1 154 ? 156.178 -2.591  84.314  1.00 53.52 ? 154 LYS A CA  1 
ATOM   1202 C  C   . LYS A 1 154 ? 156.064 -3.064  82.868  1.00 54.15 ? 154 LYS A C   1 
ATOM   1203 O  O   . LYS A 1 154 ? 155.076 -3.703  82.478  1.00 54.69 ? 154 LYS A O   1 
ATOM   1204 C  CB  . LYS A 1 154 ? 155.792 -1.109  84.396  1.00 51.52 ? 154 LYS A CB  1 
ATOM   1205 C  CG  . LYS A 1 154 ? 154.339 -0.882  84.017  1.00 51.06 ? 154 LYS A CG  1 
ATOM   1206 C  CD  . LYS A 1 154 ? 153.856 0.512   84.334  1.00 49.08 ? 154 LYS A CD  1 
ATOM   1207 C  CE  . LYS A 1 154 ? 154.412 1.536   83.374  1.00 48.69 ? 154 LYS A CE  1 
ATOM   1208 N  NZ  . LYS A 1 154 ? 153.770 2.871   83.544  1.00 44.80 ? 154 LYS A NZ  1 
ATOM   1209 N  N   . GLY A 1 155 ? 157.051 -2.727  82.056  1.00 54.05 ? 155 GLY A N   1 
ATOM   1210 C  CA  . GLY A 1 155 ? 156.975 -3.130  80.675  1.00 52.44 ? 155 GLY A CA  1 
ATOM   1211 C  C   . GLY A 1 155 ? 157.281 -4.581  80.454  1.00 51.66 ? 155 GLY A C   1 
ATOM   1212 O  O   . GLY A 1 155 ? 156.605 -5.211  79.634  1.00 51.68 ? 155 GLY A O   1 
ATOM   1213 N  N   . SER A 1 156 ? 158.228 -5.110  81.239  1.00 50.31 ? 156 SER A N   1 
ATOM   1214 C  CA  . SER A 1 156 ? 158.712 -6.491  81.127  1.00 49.33 ? 156 SER A CA  1 
ATOM   1215 C  C   . SER A 1 156 ? 157.735 -7.433  80.420  1.00 49.20 ? 156 SER A C   1 
ATOM   1216 O  O   . SER A 1 156 ? 158.039 -7.955  79.340  1.00 49.75 ? 156 SER A O   1 
ATOM   1217 C  CB  . SER A 1 156 ? 159.184 -7.037  82.490  1.00 47.28 ? 156 SER A CB  1 
ATOM   1218 O  OG  . SER A 1 156 ? 160.297 -6.295  82.990  1.00 42.77 ? 156 SER A OG  1 
ATOM   1219 N  N   . PRO A 1 157 ? 156.521 -7.598  80.971  1.00 49.00 ? 157 PRO A N   1 
ATOM   1220 C  CA  . PRO A 1 157 ? 155.561 -8.485  80.310  1.00 49.34 ? 157 PRO A CA  1 
ATOM   1221 C  C   . PRO A 1 157 ? 155.223 -8.077  78.851  1.00 49.20 ? 157 PRO A C   1 
ATOM   1222 O  O   . PRO A 1 157 ? 155.482 -8.835  77.908  1.00 48.71 ? 157 PRO A O   1 
ATOM   1223 C  CB  . PRO A 1 157 ? 154.344 -8.387  81.230  1.00 48.87 ? 157 PRO A CB  1 
ATOM   1224 C  CG  . PRO A 1 157 ? 154.975 -8.200  82.585  1.00 47.86 ? 157 PRO A CG  1 
ATOM   1225 C  CD  . PRO A 1 157 ? 156.009 -7.159  82.285  1.00 48.16 ? 157 PRO A CD  1 
ATOM   1226 N  N   . ALA A 1 158 ? 154.672 -6.875  78.679  1.00 48.58 ? 158 ALA A N   1 
ATOM   1227 C  CA  . ALA A 1 158 ? 154.280 -6.365  77.367  1.00 47.52 ? 158 ALA A CA  1 
ATOM   1228 C  C   . ALA A 1 158 ? 155.352 -6.638  76.347  1.00 46.80 ? 158 ALA A C   1 
ATOM   1229 O  O   . ALA A 1 158 ? 155.103 -7.248  75.307  1.00 47.49 ? 158 ALA A O   1 
ATOM   1230 C  CB  . ALA A 1 158 ? 154.027 -4.875  77.445  1.00 47.07 ? 158 ALA A CB  1 
ATOM   1231 N  N   . ILE A 1 159 ? 156.555 -6.191  76.677  1.00 46.43 ? 159 ILE A N   1 
ATOM   1232 C  CA  . ILE A 1 159 ? 157.718 -6.357  75.817  1.00 46.32 ? 159 ILE A CA  1 
ATOM   1233 C  C   . ILE A 1 159 ? 157.819 -7.815  75.432  1.00 44.80 ? 159 ILE A C   1 
ATOM   1234 O  O   . ILE A 1 159 ? 157.600 -8.194  74.281  1.00 42.99 ? 159 ILE A O   1 
ATOM   1235 C  CB  . ILE A 1 159 ? 159.047 -6.039  76.570  1.00 47.50 ? 159 ILE A CB  1 
ATOM   1236 C  CG1 . ILE A 1 159 ? 158.902 -4.798  77.458  1.00 47.38 ? 159 ILE A CG1 1 
ATOM   1237 C  CG2 . ILE A 1 159 ? 160.188 -5.886  75.571  1.00 47.58 ? 159 ILE A CG2 1 
ATOM   1238 C  CD1 . ILE A 1 159 ? 158.413 -3.559  76.720  1.00 48.27 ? 159 ILE A CD1 1 
ATOM   1239 N  N   . PHE A 1 160 ? 158.127 -8.617  76.440  1.00 43.46 ? 160 PHE A N   1 
ATOM   1240 C  CA  . PHE A 1 160 ? 158.299 -10.023 76.264  1.00 42.44 ? 160 PHE A CA  1 
ATOM   1241 C  C   . PHE A 1 160 ? 157.240 -10.606 75.370  1.00 41.61 ? 160 PHE A C   1 
ATOM   1242 O  O   . PHE A 1 160 ? 157.568 -11.326 74.433  1.00 41.53 ? 160 PHE A O   1 
ATOM   1243 C  CB  . PHE A 1 160 ? 158.312 -10.748 77.605  1.00 44.10 ? 160 PHE A CB  1 
ATOM   1244 C  CG  . PHE A 1 160 ? 158.333 -12.228 77.461  1.00 46.30 ? 160 PHE A CG  1 
ATOM   1245 C  CD1 . PHE A 1 160 ? 157.136 -12.950 77.292  1.00 47.27 ? 160 PHE A CD1 1 
ATOM   1246 C  CD2 . PHE A 1 160 ? 159.540 -12.894 77.337  1.00 46.89 ? 160 PHE A CD2 1 
ATOM   1247 C  CE1 . PHE A 1 160 ? 157.143 -14.313 76.985  1.00 46.79 ? 160 PHE A CE1 1 
ATOM   1248 C  CE2 . PHE A 1 160 ? 159.566 -14.255 77.028  1.00 48.76 ? 160 PHE A CE2 1 
ATOM   1249 C  CZ  . PHE A 1 160 ? 158.364 -14.969 76.847  1.00 47.71 ? 160 PHE A CZ  1 
ATOM   1250 N  N   . GLN A 1 161 ? 155.973 -10.323 75.655  1.00 41.95 ? 161 GLN A N   1 
ATOM   1251 C  CA  . GLN A 1 161 ? 154.919 -10.877 74.819  1.00 43.10 ? 161 GLN A CA  1 
ATOM   1252 C  C   . GLN A 1 161 ? 155.226 -10.525 73.391  1.00 41.48 ? 161 GLN A C   1 
ATOM   1253 O  O   . GLN A 1 161 ? 155.244 -11.389 72.528  1.00 41.48 ? 161 GLN A O   1 
ATOM   1254 C  CB  . GLN A 1 161 ? 153.524 -10.333 75.131  1.00 47.26 ? 161 GLN A CB  1 
ATOM   1255 C  CG  . GLN A 1 161 ? 152.496 -10.852 74.087  1.00 52.39 ? 161 GLN A CG  1 
ATOM   1256 C  CD  . GLN A 1 161 ? 151.245 -9.989  73.927  1.00 55.68 ? 161 GLN A CD  1 
ATOM   1257 O  OE1 . GLN A 1 161 ? 150.199 -10.280 74.514  1.00 58.11 ? 161 GLN A OE1 1 
ATOM   1258 N  NE2 . GLN A 1 161 ? 151.334 -8.951  73.094  1.00 57.83 ? 161 GLN A NE2 1 
ATOM   1259 N  N   . SER A 1 162 ? 155.454 -9.244  73.146  1.00 40.08 ? 162 SER A N   1 
ATOM   1260 C  CA  . SER A 1 162 ? 155.750 -8.793  71.808  1.00 39.16 ? 162 SER A CA  1 
ATOM   1261 C  C   . SER A 1 162 ? 156.883 -9.639  71.256  1.00 36.53 ? 162 SER A C   1 
ATOM   1262 O  O   . SER A 1 162 ? 156.709 -10.361 70.273  1.00 35.36 ? 162 SER A O   1 
ATOM   1263 C  CB  . SER A 1 162 ? 156.139 -7.320  71.828  1.00 40.72 ? 162 SER A CB  1 
ATOM   1264 O  OG  . SER A 1 162 ? 156.126 -6.781  70.514  1.00 43.75 ? 162 SER A OG  1 
ATOM   1265 N  N   . SER A 1 163 ? 158.021 -9.591  71.934  1.00 33.79 ? 163 SER A N   1 
ATOM   1266 C  CA  . SER A 1 163 ? 159.196 -10.347 71.538  1.00 32.19 ? 163 SER A CA  1 
ATOM   1267 C  C   . SER A 1 163 ? 158.848 -11.753 71.082  1.00 32.00 ? 163 SER A C   1 
ATOM   1268 O  O   . SER A 1 163 ? 158.999 -12.090 69.914  1.00 29.05 ? 163 SER A O   1 
ATOM   1269 C  CB  . SER A 1 163 ? 160.164 -10.399 72.705  1.00 31.09 ? 163 SER A CB  1 
ATOM   1270 O  OG  . SER A 1 163 ? 160.405 -9.093  73.162  1.00 28.72 ? 163 SER A OG  1 
ATOM   1271 N  N   . MET A 1 164 ? 158.358 -12.558 72.015  1.00 35.57 ? 164 MET A N   1 
ATOM   1272 C  CA  . MET A 1 164 ? 157.972 -13.929 71.724  1.00 39.25 ? 164 MET A CA  1 
ATOM   1273 C  C   . MET A 1 164 ? 157.012 -13.945 70.528  1.00 40.14 ? 164 MET A C   1 
ATOM   1274 O  O   . MET A 1 164 ? 157.241 -14.676 69.563  1.00 39.42 ? 164 MET A O   1 
ATOM   1275 C  CB  . MET A 1 164 ? 157.333 -14.576 72.969  1.00 41.51 ? 164 MET A CB  1 
ATOM   1276 C  CG  . MET A 1 164 ? 156.775 -16.012 72.777  1.00 44.79 ? 164 MET A CG  1 
ATOM   1277 S  SD  . MET A 1 164 ? 157.900 -17.331 72.121  1.00 47.52 ? 164 MET A SD  1 
ATOM   1278 C  CE  . MET A 1 164 ? 159.073 -17.489 73.453  1.00 46.74 ? 164 MET A CE  1 
ATOM   1279 N  N   . THR A 1 165 ? 155.982 -13.100 70.581  1.00 41.38 ? 165 THR A N   1 
ATOM   1280 C  CA  . THR A 1 165 ? 154.985 -12.982 69.517  1.00 43.72 ? 165 THR A CA  1 
ATOM   1281 C  C   . THR A 1 165 ? 155.702 -12.980 68.167  1.00 45.62 ? 165 THR A C   1 
ATOM   1282 O  O   . THR A 1 165 ? 155.233 -13.578 67.182  1.00 45.58 ? 165 THR A O   1 
ATOM   1283 C  CB  . THR A 1 165 ? 154.171 -11.663 69.655  1.00 41.67 ? 165 THR A CB  1 
ATOM   1284 O  OG1 . THR A 1 165 ? 153.409 -11.690 70.864  1.00 39.97 ? 165 THR A OG1 1 
ATOM   1285 C  CG2 . THR A 1 165 ? 153.213 -11.477 68.485  1.00 43.27 ? 165 THR A CG2 1 
ATOM   1286 N  N   . LYS A 1 166 ? 156.852 -12.313 68.149  1.00 46.96 ? 166 LYS A N   1 
ATOM   1287 C  CA  . LYS A 1 166 ? 157.688 -12.212 66.965  1.00 48.49 ? 166 LYS A CA  1 
ATOM   1288 C  C   . LYS A 1 166 ? 158.434 -13.531 66.764  1.00 47.91 ? 166 LYS A C   1 
ATOM   1289 O  O   . LYS A 1 166 ? 158.238 -14.240 65.769  1.00 48.36 ? 166 LYS A O   1 
ATOM   1290 C  CB  . LYS A 1 166 ? 158.732 -11.108 67.155  1.00 51.27 ? 166 LYS A CB  1 
ATOM   1291 C  CG  . LYS A 1 166 ? 158.216 -9.827  67.769  1.00 53.50 ? 166 LYS A CG  1 
ATOM   1292 C  CD  . LYS A 1 166 ? 159.376 -9.067  68.366  1.00 57.22 ? 166 LYS A CD  1 
ATOM   1293 C  CE  . LYS A 1 166 ? 158.921 -7.835  69.114  1.00 58.36 ? 166 LYS A CE  1 
ATOM   1294 N  NZ  . LYS A 1 166 ? 159.932 -7.450  70.141  1.00 60.64 ? 166 LYS A NZ  1 
ATOM   1295 N  N   . ILE A 1 167 ? 159.294 -13.843 67.731  1.00 46.53 ? 167 ILE A N   1 
ATOM   1296 C  CA  . ILE A 1 167 ? 160.124 -15.035 67.712  1.00 42.49 ? 167 ILE A CA  1 
ATOM   1297 C  C   . ILE A 1 167 ? 159.489 -16.274 67.104  1.00 42.31 ? 167 ILE A C   1 
ATOM   1298 O  O   . ILE A 1 167 ? 160.116 -16.970 66.304  1.00 43.06 ? 167 ILE A O   1 
ATOM   1299 C  CB  . ILE A 1 167 ? 160.679 -15.303 69.104  1.00 38.02 ? 167 ILE A CB  1 
ATOM   1300 C  CG1 . ILE A 1 167 ? 161.708 -14.219 69.406  1.00 34.62 ? 167 ILE A CG1 1 
ATOM   1301 C  CG2 . ILE A 1 167 ? 161.262 -16.678 69.183  1.00 38.25 ? 167 ILE A CG2 1 
ATOM   1302 C  CD1 . ILE A 1 167 ? 162.582 -14.484 70.564  1.00 31.38 ? 167 ILE A CD1 1 
ATOM   1303 N  N   . LEU A 1 168 ? 158.225 -16.501 67.413  1.00 42.20 ? 168 LEU A N   1 
ATOM   1304 C  CA  . LEU A 1 168 ? 157.514 -17.658 66.891  1.00 43.81 ? 168 LEU A CA  1 
ATOM   1305 C  C   . LEU A 1 168 ? 157.282 -17.555 65.384  1.00 44.18 ? 168 LEU A C   1 
ATOM   1306 O  O   . LEU A 1 168 ? 157.464 -18.526 64.644  1.00 43.25 ? 168 LEU A O   1 
ATOM   1307 C  CB  . LEU A 1 168 ? 156.167 -17.810 67.619  1.00 42.95 ? 168 LEU A CB  1 
ATOM   1308 C  CG  . LEU A 1 168 ? 156.230 -17.786 69.158  1.00 42.26 ? 168 LEU A CG  1 
ATOM   1309 C  CD1 . LEU A 1 168 ? 154.843 -17.923 69.748  1.00 43.10 ? 168 LEU A CD1 1 
ATOM   1310 C  CD2 . LEU A 1 168 ? 157.132 -18.885 69.691  1.00 41.83 ? 168 LEU A CD2 1 
ATOM   1311 N  N   . GLU A 1 169 ? 156.963 -16.341 64.950  1.00 46.21 ? 169 GLU A N   1 
ATOM   1312 C  CA  . GLU A 1 169 ? 156.644 -16.014 63.565  1.00 48.74 ? 169 GLU A CA  1 
ATOM   1313 C  C   . GLU A 1 169 ? 157.173 -16.881 62.423  1.00 50.17 ? 169 GLU A C   1 
ATOM   1314 O  O   . GLU A 1 169 ? 156.409 -17.658 61.837  1.00 48.92 ? 169 GLU A O   1 
ATOM   1315 C  CB  . GLU A 1 169 ? 156.897 -14.528 63.271  1.00 49.35 ? 169 GLU A CB  1 
ATOM   1316 C  CG  . GLU A 1 169 ? 156.279 -14.092 61.960  1.00 52.34 ? 169 GLU A CG  1 
ATOM   1317 C  CD  . GLU A 1 169 ? 154.837 -14.562 61.845  1.00 53.61 ? 169 GLU A CD  1 
ATOM   1318 O  OE1 . GLU A 1 169 ? 154.077 -14.315 62.817  1.00 54.66 ? 169 GLU A OE1 1 
ATOM   1319 O  OE2 . GLU A 1 169 ? 154.480 -15.202 60.819  1.00 52.58 ? 169 GLU A OE2 1 
ATOM   1320 N  N   . PRO A 1 170 ? 158.472 -16.758 62.079  1.00 52.34 ? 170 PRO A N   1 
ATOM   1321 C  CA  . PRO A 1 170 ? 158.959 -17.592 60.981  1.00 53.27 ? 170 PRO A CA  1 
ATOM   1322 C  C   . PRO A 1 170 ? 158.520 -19.032 61.179  1.00 54.95 ? 170 PRO A C   1 
ATOM   1323 O  O   . PRO A 1 170 ? 157.847 -19.601 60.317  1.00 53.24 ? 170 PRO A O   1 
ATOM   1324 C  CB  . PRO A 1 170 ? 160.482 -17.442 61.084  1.00 53.17 ? 170 PRO A CB  1 
ATOM   1325 C  CG  . PRO A 1 170 ? 160.711 -17.118 62.535  1.00 52.36 ? 170 PRO A CG  1 
ATOM   1326 C  CD  . PRO A 1 170 ? 159.605 -16.127 62.781  1.00 52.96 ? 170 PRO A CD  1 
ATOM   1327 N  N   . PHE A 1 171 ? 158.798 -19.562 62.369  1.00 56.47 ? 171 PHE A N   1 
ATOM   1328 C  CA  . PHE A 1 171 ? 158.458 -20.930 62.679  1.00 58.63 ? 171 PHE A CA  1 
ATOM   1329 C  C   . PHE A 1 171 ? 157.022 -21.197 62.335  1.00 59.04 ? 171 PHE A C   1 
ATOM   1330 O  O   . PHE A 1 171 ? 156.731 -21.979 61.449  1.00 59.36 ? 171 PHE A O   1 
ATOM   1331 C  CB  . PHE A 1 171 ? 158.670 -21.227 64.156  1.00 60.39 ? 171 PHE A CB  1 
ATOM   1332 C  CG  . PHE A 1 171 ? 158.553 -22.695 64.498  1.00 62.45 ? 171 PHE A CG  1 
ATOM   1333 C  CD1 . PHE A 1 171 ? 157.308 -23.290 64.686  1.00 62.15 ? 171 PHE A CD1 1 
ATOM   1334 C  CD2 . PHE A 1 171 ? 159.695 -23.495 64.579  1.00 62.52 ? 171 PHE A CD2 1 
ATOM   1335 C  CE1 . PHE A 1 171 ? 157.206 -24.652 64.941  1.00 62.02 ? 171 PHE A CE1 1 
ATOM   1336 C  CE2 . PHE A 1 171 ? 159.601 -24.851 64.832  1.00 61.24 ? 171 PHE A CE2 1 
ATOM   1337 C  CZ  . PHE A 1 171 ? 158.353 -25.434 65.012  1.00 61.47 ? 171 PHE A CZ  1 
ATOM   1338 N  N   . LYS A 1 172 ? 156.125 -20.519 63.024  1.00 60.80 ? 172 LYS A N   1 
ATOM   1339 C  CA  . LYS A 1 172 ? 154.719 -20.723 62.775  1.00 63.45 ? 172 LYS A CA  1 
ATOM   1340 C  C   . LYS A 1 172 ? 154.404 -20.511 61.297  1.00 64.65 ? 172 LYS A C   1 
ATOM   1341 O  O   . LYS A 1 172 ? 153.519 -21.162 60.745  1.00 64.27 ? 172 LYS A O   1 
ATOM   1342 C  CB  . LYS A 1 172 ? 153.883 -19.804 63.663  1.00 65.11 ? 172 LYS A CB  1 
ATOM   1343 C  CG  . LYS A 1 172 ? 154.305 -18.355 63.639  1.00 66.65 ? 172 LYS A CG  1 
ATOM   1344 C  CD  . LYS A 1 172 ? 153.112 -17.432 63.463  1.00 68.82 ? 172 LYS A CD  1 
ATOM   1345 C  CE  . LYS A 1 172 ? 152.104 -17.585 64.593  1.00 70.11 ? 172 LYS A CE  1 
ATOM   1346 N  NZ  . LYS A 1 172 ? 152.679 -17.192 65.914  1.00 73.04 ? 172 LYS A NZ  1 
ATOM   1347 N  N   . LYS A 1 173 ? 155.157 -19.636 60.644  1.00 64.81 ? 173 LYS A N   1 
ATOM   1348 C  CA  . LYS A 1 173 ? 154.917 -19.395 59.239  1.00 65.90 ? 173 LYS A CA  1 
ATOM   1349 C  C   . LYS A 1 173 ? 155.138 -20.747 58.561  1.00 66.14 ? 173 LYS A C   1 
ATOM   1350 O  O   . LYS A 1 173 ? 154.193 -21.411 58.113  1.00 65.44 ? 173 LYS A O   1 
ATOM   1351 C  CB  . LYS A 1 173 ? 155.902 -18.350 58.700  1.00 67.24 ? 173 LYS A CB  1 
ATOM   1352 C  CG  . LYS A 1 173 ? 155.587 -17.907 57.275  1.00 70.55 ? 173 LYS A CG  1 
ATOM   1353 C  CD  . LYS A 1 173 ? 156.677 -17.046 56.624  1.00 71.28 ? 173 LYS A CD  1 
ATOM   1354 C  CE  . LYS A 1 173 ? 156.254 -16.644 55.201  1.00 71.57 ? 173 LYS A CE  1 
ATOM   1355 N  NZ  . LYS A 1 173 ? 157.361 -16.075 54.377  1.00 72.80 ? 173 LYS A NZ  1 
ATOM   1356 N  N   . GLN A 1 174 ? 156.384 -21.195 58.631  1.00 66.13 ? 174 GLN A N   1 
ATOM   1357 C  CA  . GLN A 1 174 ? 156.825 -22.457 58.050  1.00 66.50 ? 174 GLN A CA  1 
ATOM   1358 C  C   . GLN A 1 174 ? 155.944 -23.648 58.485  1.00 65.53 ? 174 GLN A C   1 
ATOM   1359 O  O   . GLN A 1 174 ? 155.615 -24.523 57.673  1.00 66.18 ? 174 GLN A O   1 
ATOM   1360 C  CB  . GLN A 1 174 ? 158.269 -22.704 58.496  1.00 67.38 ? 174 GLN A CB  1 
ATOM   1361 C  CG  . GLN A 1 174 ? 159.167 -21.468 58.356  1.00 70.64 ? 174 GLN A CG  1 
ATOM   1362 C  CD  . GLN A 1 174 ? 160.373 -21.486 59.293  1.00 72.10 ? 174 GLN A CD  1 
ATOM   1363 O  OE1 . GLN A 1 174 ? 160.578 -22.444 60.031  1.00 73.16 ? 174 GLN A OE1 1 
ATOM   1364 N  NE2 . GLN A 1 174 ? 161.162 -20.413 59.279  1.00 71.99 ? 174 GLN A NE2 1 
ATOM   1365 N  N   . ASN A 1 175 ? 155.543 -23.638 59.759  1.00 62.95 ? 175 ASN A N   1 
ATOM   1366 C  CA  . ASN A 1 175 ? 154.753 -24.698 60.381  1.00 60.52 ? 175 ASN A CA  1 
ATOM   1367 C  C   . ASN A 1 175 ? 153.439 -24.049 60.732  1.00 59.18 ? 175 ASN A C   1 
ATOM   1368 O  O   . ASN A 1 175 ? 153.055 -23.978 61.907  1.00 59.10 ? 175 ASN A O   1 
ATOM   1369 C  CB  . ASN A 1 175 ? 155.463 -25.175 61.646  1.00 59.38 ? 175 ASN A CB  1 
ATOM   1370 C  CG  . ASN A 1 175 ? 156.930 -25.502 61.401  1.00 58.75 ? 175 ASN A CG  1 
ATOM   1371 O  OD1 . ASN A 1 175 ? 157.296 -26.653 61.180  1.00 58.78 ? 175 ASN A OD1 1 
ATOM   1372 N  ND2 . ASN A 1 175 ? 157.775 -24.480 61.415  1.00 58.09 ? 175 ASN A ND2 1 
ATOM   1373 N  N   . PRO A 1 176 ? 152.647 -23.733 59.697  1.00 58.46 ? 176 PRO A N   1 
ATOM   1374 C  CA  . PRO A 1 176 ? 151.332 -23.084 59.714  1.00 59.03 ? 176 PRO A CA  1 
ATOM   1375 C  C   . PRO A 1 176 ? 150.188 -23.759 60.475  1.00 58.70 ? 176 PRO A C   1 
ATOM   1376 O  O   . PRO A 1 176 ? 149.356 -23.084 61.086  1.00 57.55 ? 176 PRO A O   1 
ATOM   1377 C  CB  . PRO A 1 176 ? 151.001 -23.014 58.239  1.00 57.25 ? 176 PRO A CB  1 
ATOM   1378 C  CG  . PRO A 1 176 ? 151.496 -24.354 57.807  1.00 57.68 ? 176 PRO A CG  1 
ATOM   1379 C  CD  . PRO A 1 176 ? 152.836 -24.438 58.416  1.00 57.51 ? 176 PRO A CD  1 
ATOM   1380 N  N   . ASP A 1 177 ? 150.184 -25.085 60.491  1.00 58.21 ? 177 ASP A N   1 
ATOM   1381 C  CA  . ASP A 1 177 ? 149.103 -25.798 61.138  1.00 57.03 ? 177 ASP A CA  1 
ATOM   1382 C  C   . ASP A 1 177 ? 149.154 -26.204 62.588  1.00 55.29 ? 177 ASP A C   1 
ATOM   1383 O  O   . ASP A 1 177 ? 148.509 -27.172 62.988  1.00 53.77 ? 177 ASP A O   1 
ATOM   1384 C  CB  . ASP A 1 177 ? 148.660 -26.971 60.275  1.00 59.33 ? 177 ASP A CB  1 
ATOM   1385 C  CG  . ASP A 1 177 ? 147.677 -26.558 59.191  1.00 61.34 ? 177 ASP A CG  1 
ATOM   1386 O  OD1 . ASP A 1 177 ? 147.632 -25.355 58.859  1.00 61.75 ? 177 ASP A OD1 1 
ATOM   1387 O  OD2 . ASP A 1 177 ? 146.932 -27.439 58.702  1.00 61.68 ? 177 ASP A OD2 1 
ATOM   1388 N  N   . ILE A 1 178 ? 149.928 -25.483 63.382  1.00 54.29 ? 178 ILE A N   1 
ATOM   1389 C  CA  . ILE A 1 178 ? 149.996 -25.787 64.801  1.00 54.05 ? 178 ILE A CA  1 
ATOM   1390 C  C   . ILE A 1 178 ? 149.809 -24.514 65.580  1.00 53.49 ? 178 ILE A C   1 
ATOM   1391 O  O   . ILE A 1 178 ? 150.762 -23.795 65.897  1.00 53.53 ? 178 ILE A O   1 
ATOM   1392 C  CB  . ILE A 1 178 ? 151.310 -26.458 65.231  1.00 55.02 ? 178 ILE A CB  1 
ATOM   1393 C  CG1 . ILE A 1 178 ? 151.472 -27.788 64.493  1.00 56.67 ? 178 ILE A CG1 1 
ATOM   1394 C  CG2 . ILE A 1 178 ? 151.268 -26.730 66.742  1.00 54.81 ? 178 ILE A CG2 1 
ATOM   1395 C  CD1 . ILE A 1 178 ? 152.455 -28.739 65.152  1.00 58.46 ? 178 ILE A CD1 1 
ATOM   1396 N  N   . VAL A 1 179 ? 148.553 -24.244 65.882  1.00 52.51 ? 179 VAL A N   1 
ATOM   1397 C  CA  . VAL A 1 179 ? 148.184 -23.051 66.605  1.00 51.97 ? 179 VAL A CA  1 
ATOM   1398 C  C   . VAL A 1 179 ? 148.919 -22.915 67.950  1.00 50.66 ? 179 VAL A C   1 
ATOM   1399 O  O   . VAL A 1 179 ? 149.270 -23.910 68.629  1.00 48.47 ? 179 VAL A O   1 
ATOM   1400 C  CB  . VAL A 1 179 ? 146.637 -22.982 66.765  1.00 53.82 ? 179 VAL A CB  1 
ATOM   1401 C  CG1 . VAL A 1 179 ? 146.206 -21.673 67.442  1.00 54.86 ? 179 VAL A CG1 1 
ATOM   1402 C  CG2 . VAL A 1 179 ? 145.978 -23.118 65.387  1.00 52.31 ? 179 VAL A CG2 1 
ATOM   1403 N  N   . ILE A 1 180 ? 149.189 -21.664 68.296  1.00 48.96 ? 180 ILE A N   1 
ATOM   1404 C  CA  . ILE A 1 180 ? 149.888 -21.343 69.513  1.00 46.93 ? 180 ILE A CA  1 
ATOM   1405 C  C   . ILE A 1 180 ? 149.209 -20.163 70.162  1.00 47.90 ? 180 ILE A C   1 
ATOM   1406 O  O   . ILE A 1 180 ? 148.486 -19.406 69.510  1.00 47.68 ? 180 ILE A O   1 
ATOM   1407 C  CB  . ILE A 1 180 ? 151.346 -20.957 69.204  1.00 44.76 ? 180 ILE A CB  1 
ATOM   1408 C  CG1 . ILE A 1 180 ? 151.965 -22.029 68.312  1.00 44.43 ? 180 ILE A CG1 1 
ATOM   1409 C  CG2 . ILE A 1 180 ? 152.152 -20.825 70.493  1.00 43.19 ? 180 ILE A CG2 1 
ATOM   1410 C  CD1 . ILE A 1 180 ? 153.390 -21.773 67.969  1.00 45.64 ? 180 ILE A CD1 1 
ATOM   1411 N  N   . CYS A 1 181 ? 149.428 -20.059 71.462  1.00 48.88 ? 181 CYS A N   1 
ATOM   1412 C  CA  . CYS A 1 181 ? 148.913 -18.999 72.303  1.00 50.35 ? 181 CYS A CA  1 
ATOM   1413 C  C   . CYS A 1 181 ? 149.889 -19.021 73.464  1.00 52.67 ? 181 CYS A C   1 
ATOM   1414 O  O   . CYS A 1 181 ? 150.457 -20.075 73.791  1.00 52.77 ? 181 CYS A O   1 
ATOM   1415 C  CB  . CYS A 1 181 ? 147.516 -19.330 72.775  1.00 47.30 ? 181 CYS A CB  1 
ATOM   1416 N  N   . GLN A 1 182 ? 150.188 -17.854 74.008  1.00 56.50 ? 182 GLN A N   1 
ATOM   1417 C  CA  . GLN A 1 182 ? 151.100 -17.787 75.144  1.00 61.08 ? 182 GLN A CA  1 
ATOM   1418 C  C   . GLN A 1 182 ? 150.329 -17.239 76.324  1.00 61.89 ? 182 GLN A C   1 
ATOM   1419 O  O   . GLN A 1 182 ? 149.379 -16.474 76.148  1.00 62.31 ? 182 GLN A O   1 
ATOM   1420 C  CB  . GLN A 1 182 ? 152.315 -16.900 74.844  1.00 63.76 ? 182 GLN A CB  1 
ATOM   1421 C  CG  . GLN A 1 182 ? 151.995 -15.487 74.341  1.00 69.17 ? 182 GLN A CG  1 
ATOM   1422 C  CD  . GLN A 1 182 ? 153.247 -14.639 74.082  1.00 71.45 ? 182 GLN A CD  1 
ATOM   1423 O  OE1 . GLN A 1 182 ? 154.280 -14.815 74.732  1.00 73.37 ? 182 GLN A OE1 1 
ATOM   1424 N  NE2 . GLN A 1 182 ? 153.144 -13.697 73.148  1.00 71.73 ? 182 GLN A NE2 1 
ATOM   1425 N  N   . TYR A 1 183 ? 150.687 -17.673 77.518  1.00 63.30 ? 183 TYR A N   1 
ATOM   1426 C  CA  . TYR A 1 183 ? 150.014 -17.190 78.693  1.00 65.53 ? 183 TYR A CA  1 
ATOM   1427 C  C   . TYR A 1 183 ? 151.054 -17.083 79.773  1.00 65.59 ? 183 TYR A C   1 
ATOM   1428 O  O   . TYR A 1 183 ? 151.618 -18.091 80.207  1.00 63.23 ? 183 TYR A O   1 
ATOM   1429 C  CB  . TYR A 1 183 ? 148.894 -18.119 79.115  1.00 70.04 ? 183 TYR A CB  1 
ATOM   1430 C  CG  . TYR A 1 183 ? 147.950 -17.429 80.067  1.00 75.83 ? 183 TYR A CG  1 
ATOM   1431 C  CD1 . TYR A 1 183 ? 148.260 -17.308 81.423  1.00 77.92 ? 183 TYR A CD1 1 
ATOM   1432 C  CD2 . TYR A 1 183 ? 146.779 -16.842 79.602  1.00 77.92 ? 183 TYR A CD2 1 
ATOM   1433 C  CE1 . TYR A 1 183 ? 147.428 -16.613 82.296  1.00 80.17 ? 183 TYR A CE1 1 
ATOM   1434 C  CE2 . TYR A 1 183 ? 145.934 -16.146 80.464  1.00 80.55 ? 183 TYR A CE2 1 
ATOM   1435 C  CZ  . TYR A 1 183 ? 146.264 -16.035 81.808  1.00 81.52 ? 183 TYR A CZ  1 
ATOM   1436 O  OH  . TYR A 1 183 ? 145.416 -15.346 82.648  1.00 83.49 ? 183 TYR A OH  1 
ATOM   1437 N  N   . MET A 1 184 ? 151.238 -15.860 80.262  1.00 66.47 ? 184 MET A N   1 
ATOM   1438 C  CA  . MET A 1 184 ? 152.270 -15.572 81.250  1.00 68.56 ? 184 MET A CA  1 
ATOM   1439 C  C   . MET A 1 184 ? 153.516 -16.053 80.516  1.00 68.75 ? 184 MET A C   1 
ATOM   1440 O  O   . MET A 1 184 ? 153.608 -15.929 79.290  1.00 70.20 ? 184 MET A O   1 
ATOM   1441 C  CB  . MET A 1 184 ? 152.066 -16.368 82.547  1.00 71.40 ? 184 MET A CB  1 
ATOM   1442 C  CG  . MET A 1 184 ? 150.964 -15.842 83.456  1.00 76.18 ? 184 MET A CG  1 
ATOM   1443 S  SD  . MET A 1 184 ? 151.188 -14.106 83.958  1.00 81.19 ? 184 MET A SD  1 
ATOM   1444 C  CE  . MET A 1 184 ? 152.677 -14.232 84.992  1.00 81.11 ? 184 MET A CE  1 
ATOM   1445 N  N   . ASP A 1 185 ? 154.437 -16.677 81.221  1.00 66.80 ? 185 ASP A N   1 
ATOM   1446 C  CA  . ASP A 1 185 ? 155.611 -17.166 80.545  1.00 64.23 ? 185 ASP A CA  1 
ATOM   1447 C  C   . ASP A 1 185 ? 155.363 -18.622 80.176  1.00 62.80 ? 185 ASP A C   1 
ATOM   1448 O  O   . ASP A 1 185 ? 156.213 -19.479 80.410  1.00 62.05 ? 185 ASP A O   1 
ATOM   1449 C  CB  . ASP A 1 185 ? 156.821 -17.021 81.454  1.00 64.87 ? 185 ASP A CB  1 
ATOM   1450 C  CG  . ASP A 1 185 ? 156.513 -17.416 82.875  1.00 65.87 ? 185 ASP A CG  1 
ATOM   1451 O  OD1 . ASP A 1 185 ? 155.864 -16.616 83.588  1.00 66.96 ? 185 ASP A OD1 1 
ATOM   1452 O  OD2 . ASP A 1 185 ? 156.897 -18.538 83.256  1.00 66.45 ? 185 ASP A OD2 1 
ATOM   1453 N  N   . ASP A 1 186 ? 154.182 -18.900 79.625  1.00 61.15 ? 186 ASP A N   1 
ATOM   1454 C  CA  . ASP A 1 186 ? 153.815 -20.253 79.222  1.00 60.66 ? 186 ASP A CA  1 
ATOM   1455 C  C   . ASP A 1 186 ? 153.313 -20.367 77.787  1.00 58.78 ? 186 ASP A C   1 
ATOM   1456 O  O   . ASP A 1 186 ? 152.632 -19.480 77.268  1.00 57.90 ? 186 ASP A O   1 
ATOM   1457 C  CB  . ASP A 1 186 ? 152.805 -20.854 80.196  1.00 62.41 ? 186 ASP A CB  1 
ATOM   1458 C  CG  . ASP A 1 186 ? 153.458 -21.338 81.486  1.00 64.65 ? 186 ASP A CG  1 
ATOM   1459 O  OD1 . ASP A 1 186 ? 154.686 -21.176 81.646  1.00 65.89 ? 186 ASP A OD1 1 
ATOM   1460 O  OD2 . ASP A 1 186 ? 152.751 -21.897 82.348  1.00 66.84 ? 186 ASP A OD2 1 
ATOM   1461 N  N   . LEU A 1 187 ? 153.632 -21.485 77.158  1.00 56.76 ? 187 LEU A N   1 
ATOM   1462 C  CA  . LEU A 1 187 ? 153.252 -21.692 75.781  1.00 56.50 ? 187 LEU A CA  1 
ATOM   1463 C  C   . LEU A 1 187 ? 152.366 -22.878 75.540  1.00 57.33 ? 187 LEU A C   1 
ATOM   1464 O  O   . LEU A 1 187 ? 152.738 -24.010 75.823  1.00 56.24 ? 187 LEU A O   1 
ATOM   1465 C  CB  . LEU A 1 187 ? 154.502 -21.812 74.934  1.00 55.91 ? 187 LEU A CB  1 
ATOM   1466 C  CG  . LEU A 1 187 ? 155.131 -20.460 74.617  1.00 54.52 ? 187 LEU A CG  1 
ATOM   1467 C  CD1 . LEU A 1 187 ? 156.574 -20.617 74.240  1.00 53.60 ? 187 LEU A CD1 1 
ATOM   1468 C  CD2 . LEU A 1 187 ? 154.356 -19.810 73.492  1.00 54.31 ? 187 LEU A CD2 1 
ATOM   1469 N  N   . TYR A 1 188 ? 151.215 -22.603 74.943  1.00 59.14 ? 188 TYR A N   1 
ATOM   1470 C  CA  . TYR A 1 188 ? 150.225 -23.622 74.634  1.00 60.98 ? 188 TYR A CA  1 
ATOM   1471 C  C   . TYR A 1 188 ? 150.235 -23.963 73.180  1.00 61.63 ? 188 TYR A C   1 
ATOM   1472 O  O   . TYR A 1 188 ? 149.677 -23.238 72.359  1.00 61.94 ? 188 TYR A O   1 
ATOM   1473 C  CB  . TYR A 1 188 ? 148.842 -23.125 74.975  1.00 62.82 ? 188 TYR A CB  1 
ATOM   1474 C  CG  . TYR A 1 188 ? 148.508 -23.262 76.422  1.00 65.19 ? 188 TYR A CG  1 
ATOM   1475 C  CD1 . TYR A 1 188 ? 149.185 -22.513 77.393  1.00 67.43 ? 188 TYR A CD1 1 
ATOM   1476 C  CD2 . TYR A 1 188 ? 147.530 -24.161 76.833  1.00 65.98 ? 188 TYR A CD2 1 
ATOM   1477 C  CE1 . TYR A 1 188 ? 148.891 -22.660 78.740  1.00 68.08 ? 188 TYR A CE1 1 
ATOM   1478 C  CE2 . TYR A 1 188 ? 147.220 -24.318 78.168  1.00 67.16 ? 188 TYR A CE2 1 
ATOM   1479 C  CZ  . TYR A 1 188 ? 147.903 -23.573 79.120  1.00 68.40 ? 188 TYR A CZ  1 
ATOM   1480 O  OH  . TYR A 1 188 ? 147.592 -23.770 80.449  1.00 68.56 ? 188 TYR A OH  1 
ATOM   1481 N  N   . VAL A 1 189 ? 150.848 -25.081 72.852  1.00 62.32 ? 189 VAL A N   1 
ATOM   1482 C  CA  . VAL A 1 189 ? 150.898 -25.479 71.465  1.00 63.38 ? 189 VAL A CA  1 
ATOM   1483 C  C   . VAL A 1 189 ? 150.027 -26.707 71.328  1.00 63.78 ? 189 VAL A C   1 
ATOM   1484 O  O   . VAL A 1 189 ? 150.096 -27.635 72.138  1.00 62.76 ? 189 VAL A O   1 
ATOM   1485 C  CB  . VAL A 1 189 ? 152.338 -25.779 71.012  1.00 63.13 ? 189 VAL A CB  1 
ATOM   1486 C  CG1 . VAL A 1 189 ? 152.412 -25.775 69.510  1.00 61.57 ? 189 VAL A CG1 1 
ATOM   1487 C  CG2 . VAL A 1 189 ? 153.292 -24.742 71.576  1.00 61.95 ? 189 VAL A CG2 1 
ATOM   1488 N  N   . GLY A 1 190 ? 149.183 -26.696 70.313  1.00 65.64 ? 190 GLY A N   1 
ATOM   1489 C  CA  . GLY A 1 190 ? 148.297 -27.813 70.095  1.00 68.34 ? 190 GLY A CA  1 
ATOM   1490 C  C   . GLY A 1 190 ? 148.157 -28.041 68.614  1.00 70.98 ? 190 GLY A C   1 
ATOM   1491 O  O   . GLY A 1 190 ? 148.551 -27.189 67.816  1.00 70.12 ? 190 GLY A O   1 
ATOM   1492 N  N   . SER A 1 191 ? 147.601 -29.191 68.252  1.00 74.72 ? 191 SER A N   1 
ATOM   1493 C  CA  . SER A 1 191 ? 147.391 -29.557 66.855  1.00 77.39 ? 191 SER A CA  1 
ATOM   1494 C  C   . SER A 1 191 ? 146.722 -30.932 66.735  1.00 78.69 ? 191 SER A C   1 
ATOM   1495 O  O   . SER A 1 191 ? 146.576 -31.666 67.725  1.00 78.02 ? 191 SER A O   1 
ATOM   1496 C  CB  . SER A 1 191 ? 148.725 -29.566 66.096  1.00 77.59 ? 191 SER A CB  1 
ATOM   1497 O  OG  . SER A 1 191 ? 149.594 -30.571 66.598  1.00 77.61 ? 191 SER A OG  1 
ATOM   1498 N  N   . ASP A 1 192 ? 146.328 -31.264 65.509  1.00 80.71 ? 192 ASP A N   1 
ATOM   1499 C  CA  . ASP A 1 192 ? 145.694 -32.539 65.187  1.00 82.81 ? 192 ASP A CA  1 
ATOM   1500 C  C   . ASP A 1 192 ? 146.744 -33.453 64.575  1.00 84.28 ? 192 ASP A C   1 
ATOM   1501 O  O   . ASP A 1 192 ? 146.614 -33.891 63.420  1.00 84.16 ? 192 ASP A O   1 
ATOM   1502 C  CB  . ASP A 1 192 ? 144.562 -32.325 64.188  1.00 81.29 ? 192 ASP A CB  1 
ATOM   1503 C  CG  . ASP A 1 192 ? 143.491 -31.447 64.734  1.00 79.95 ? 192 ASP A CG  1 
ATOM   1504 O  OD1 . ASP A 1 192 ? 142.691 -31.949 65.551  1.00 78.05 ? 192 ASP A OD1 1 
ATOM   1505 O  OD2 . ASP A 1 192 ? 143.478 -30.254 64.370  1.00 78.81 ? 192 ASP A OD2 1 
ATOM   1506 N  N   . LEU A 1 193 ? 147.800 -33.700 65.349  1.00 85.26 ? 193 LEU A N   1 
ATOM   1507 C  CA  . LEU A 1 193 ? 148.900 -34.542 64.900  1.00 86.80 ? 193 LEU A CA  1 
ATOM   1508 C  C   . LEU A 1 193 ? 149.162 -35.680 65.870  1.00 87.48 ? 193 LEU A C   1 
ATOM   1509 O  O   . LEU A 1 193 ? 149.144 -35.491 67.093  1.00 89.73 ? 193 LEU A O   1 
ATOM   1510 C  CB  . LEU A 1 193 ? 150.171 -33.707 64.692  1.00 86.59 ? 193 LEU A CB  1 
ATOM   1511 C  CG  . LEU A 1 193 ? 150.062 -32.551 63.686  1.00 85.71 ? 193 LEU A CG  1 
ATOM   1512 C  CD1 . LEU A 1 193 ? 151.423 -31.906 63.534  1.00 86.04 ? 193 LEU A CD1 1 
ATOM   1513 C  CD2 . LEU A 1 193 ? 149.541 -33.030 62.325  1.00 85.81 ? 193 LEU A CD2 1 
ATOM   1514 N  N   . GLU A 1 194 ? 149.395 -36.855 65.291  1.00 87.95 ? 194 GLU A N   1 
ATOM   1515 C  CA  . GLU A 1 194 ? 149.658 -38.119 65.991  1.00 88.15 ? 194 GLU A CA  1 
ATOM   1516 C  C   . GLU A 1 194 ? 150.661 -37.970 67.145  1.00 86.07 ? 194 GLU A C   1 
ATOM   1517 O  O   . GLU A 1 194 ? 151.806 -37.676 66.888  1.00 85.42 ? 194 GLU A O   1 
ATOM   1518 C  CB  . GLU A 1 194 ? 150.175 -39.139 64.954  1.00 90.31 ? 194 GLU A CB  1 
ATOM   1519 C  CG  . GLU A 1 194 ? 149.290 -39.230 63.671  1.00 92.88 ? 194 GLU A CG  1 
ATOM   1520 C  CD  . GLU A 1 194 ? 150.036 -39.686 62.400  1.00 93.93 ? 194 GLU A CD  1 
ATOM   1521 O  OE1 . GLU A 1 194 ? 151.204 -40.137 62.505  1.00 94.31 ? 194 GLU A OE1 1 
ATOM   1522 O  OE2 . GLU A 1 194 ? 149.445 -39.579 61.289  1.00 94.40 ? 194 GLU A OE2 1 
ATOM   1523 N  N   . ILE A 1 195 ? 150.228 -38.183 68.391  1.00 83.76 ? 195 ILE A N   1 
ATOM   1524 C  CA  . ILE A 1 195 ? 151.078 -38.058 69.593  1.00 81.68 ? 195 ILE A CA  1 
ATOM   1525 C  C   . ILE A 1 195 ? 152.576 -37.902 69.308  1.00 79.72 ? 195 ILE A C   1 
ATOM   1526 O  O   . ILE A 1 195 ? 153.161 -36.855 69.590  1.00 78.24 ? 195 ILE A O   1 
ATOM   1527 C  CB  . ILE A 1 195 ? 150.800 -39.229 70.616  1.00 82.89 ? 195 ILE A CB  1 
ATOM   1528 C  CG1 . ILE A 1 195 ? 149.497 -38.955 71.395  1.00 83.07 ? 195 ILE A CG1 1 
ATOM   1529 C  CG2 . ILE A 1 195 ? 151.968 -39.425 71.589  1.00 82.38 ? 195 ILE A CG2 1 
ATOM   1530 C  CD1 . ILE A 1 195 ? 149.162 -39.978 72.500  1.00 81.19 ? 195 ILE A CD1 1 
ATOM   1531 N  N   . GLY A 1 196 ? 153.163 -38.919 68.684  1.00 78.42 ? 196 GLY A N   1 
ATOM   1532 C  CA  . GLY A 1 196 ? 154.574 -38.882 68.335  1.00 76.74 ? 196 GLY A CA  1 
ATOM   1533 C  C   . GLY A 1 196 ? 154.809 -37.810 67.292  1.00 75.17 ? 196 GLY A C   1 
ATOM   1534 O  O   . GLY A 1 196 ? 155.699 -36.982 67.451  1.00 74.01 ? 196 GLY A O   1 
ATOM   1535 N  N   . GLN A 1 197 ? 154.015 -37.850 66.218  1.00 74.42 ? 197 GLN A N   1 
ATOM   1536 C  CA  . GLN A 1 197 ? 154.056 -36.868 65.128  1.00 73.21 ? 197 GLN A CA  1 
ATOM   1537 C  C   . GLN A 1 197 ? 153.809 -35.469 65.719  1.00 72.78 ? 197 GLN A C   1 
ATOM   1538 O  O   . GLN A 1 197 ? 154.302 -34.464 65.192  1.00 72.12 ? 197 GLN A O   1 
ATOM   1539 C  CB  . GLN A 1 197 ? 152.990 -37.202 64.064  1.00 72.55 ? 197 GLN A CB  1 
ATOM   1540 C  CG  . GLN A 1 197 ? 152.927 -36.226 62.875  1.00 72.58 ? 197 GLN A CG  1 
ATOM   1541 C  CD  . GLN A 1 197 ? 151.801 -36.530 61.876  1.00 71.35 ? 197 GLN A CD  1 
ATOM   1542 O  OE1 . GLN A 1 197 ? 150.648 -36.135 62.071  1.00 71.14 ? 197 GLN A OE1 1 
ATOM   1543 N  NE2 . GLN A 1 197 ? 152.141 -37.219 60.797  1.00 71.24 ? 197 GLN A NE2 1 
ATOM   1544 N  N   . HIS A 1 198 ? 153.046 -35.408 66.814  1.00 71.82 ? 198 HIS A N   1 
ATOM   1545 C  CA  . HIS A 1 198 ? 152.789 -34.145 67.491  1.00 70.66 ? 198 HIS A CA  1 
ATOM   1546 C  C   . HIS A 1 198 ? 154.139 -33.858 68.129  1.00 70.38 ? 198 HIS A C   1 
ATOM   1547 O  O   . HIS A 1 198 ? 154.672 -32.757 67.995  1.00 70.92 ? 198 HIS A O   1 
ATOM   1548 C  CB  . HIS A 1 198 ? 151.701 -34.288 68.572  1.00 69.35 ? 198 HIS A CB  1 
ATOM   1549 C  CG  . HIS A 1 198 ? 151.220 -32.977 69.138  1.00 70.16 ? 198 HIS A CG  1 
ATOM   1550 N  ND1 . HIS A 1 198 ? 150.263 -32.198 68.518  1.00 68.00 ? 198 HIS A ND1 1 
ATOM   1551 C  CD2 . HIS A 1 198 ? 151.571 -32.307 70.264  1.00 70.90 ? 198 HIS A CD2 1 
ATOM   1552 C  CE1 . HIS A 1 198 ? 150.053 -31.106 69.233  1.00 68.14 ? 198 HIS A CE1 1 
ATOM   1553 N  NE2 . HIS A 1 198 ? 150.833 -31.147 70.298  1.00 69.64 ? 198 HIS A NE2 1 
ATOM   1554 N  N   . ARG A 1 199 ? 154.738 -34.893 68.715  1.00 70.43 ? 199 ARG A N   1 
ATOM   1555 C  CA  . ARG A 1 199 ? 156.038 -34.765 69.356  1.00 71.06 ? 199 ARG A CA  1 
ATOM   1556 C  C   . ARG A 1 199 ? 157.125 -34.342 68.360  1.00 70.91 ? 199 ARG A C   1 
ATOM   1557 O  O   . ARG A 1 199 ? 158.084 -33.650 68.734  1.00 70.92 ? 199 ARG A O   1 
ATOM   1558 C  CB  . ARG A 1 199 ? 156.438 -36.073 70.033  1.00 71.98 ? 199 ARG A CB  1 
ATOM   1559 C  CG  . ARG A 1 199 ? 157.327 -35.857 71.255  1.00 73.53 ? 199 ARG A CG  1 
ATOM   1560 C  CD  . ARG A 1 199 ? 156.659 -36.317 72.559  1.00 73.76 ? 199 ARG A CD  1 
ATOM   1561 N  NE  . ARG A 1 199 ? 155.288 -35.829 72.715  1.00 73.89 ? 199 ARG A NE  1 
ATOM   1562 C  CZ  . ARG A 1 199 ? 154.212 -36.490 72.299  1.00 73.12 ? 199 ARG A CZ  1 
ATOM   1563 N  NH1 . ARG A 1 199 ? 154.355 -37.664 71.701  1.00 71.05 ? 199 ARG A NH1 1 
ATOM   1564 N  NH2 . ARG A 1 199 ? 153.000 -35.981 72.485  1.00 72.89 ? 199 ARG A NH2 1 
ATOM   1565 N  N   . THR A 1 200 ? 156.959 -34.738 67.098  1.00 70.03 ? 200 THR A N   1 
ATOM   1566 C  CA  . THR A 1 200 ? 157.904 -34.405 66.026  1.00 69.86 ? 200 THR A CA  1 
ATOM   1567 C  C   . THR A 1 200 ? 158.118 -32.887 65.943  1.00 69.32 ? 200 THR A C   1 
ATOM   1568 O  O   . THR A 1 200 ? 159.249 -32.380 66.061  1.00 67.85 ? 200 THR A O   1 
ATOM   1569 C  CB  . THR A 1 200 ? 157.371 -34.894 64.641  1.00 70.56 ? 200 THR A CB  1 
ATOM   1570 O  OG1 . THR A 1 200 ? 157.205 -36.318 64.654  1.00 70.76 ? 200 THR A OG1 1 
ATOM   1571 C  CG2 . THR A 1 200 ? 158.327 -34.503 63.501  1.00 71.28 ? 200 THR A CG2 1 
ATOM   1572 N  N   . LYS A 1 201 ? 157.011 -32.171 65.761  1.00 68.48 ? 201 LYS A N   1 
ATOM   1573 C  CA  . LYS A 1 201 ? 157.034 -30.722 65.635  1.00 67.43 ? 201 LYS A CA  1 
ATOM   1574 C  C   . LYS A 1 201 ? 157.395 -30.009 66.921  1.00 65.60 ? 201 LYS A C   1 
ATOM   1575 O  O   . LYS A 1 201 ? 158.116 -29.008 66.907  1.00 65.19 ? 201 LYS A O   1 
ATOM   1576 C  CB  . LYS A 1 201 ? 155.692 -30.224 65.114  1.00 68.43 ? 201 LYS A CB  1 
ATOM   1577 C  CG  . LYS A 1 201 ? 155.427 -30.587 63.656  1.00 71.70 ? 201 LYS A CG  1 
ATOM   1578 C  CD  . LYS A 1 201 ? 156.389 -29.860 62.691  1.00 74.17 ? 201 LYS A CD  1 
ATOM   1579 C  CE  . LYS A 1 201 ? 156.062 -30.130 61.204  1.00 74.96 ? 201 LYS A CE  1 
ATOM   1580 N  NZ  . LYS A 1 201 ? 157.053 -29.534 60.242  1.00 76.29 ? 201 LYS A NZ  1 
ATOM   1581 N  N   . ILE A 1 202 ? 156.893 -30.530 68.030  1.00 64.10 ? 202 ILE A N   1 
ATOM   1582 C  CA  . ILE A 1 202 ? 157.157 -29.945 69.336  1.00 63.19 ? 202 ILE A CA  1 
ATOM   1583 C  C   . ILE A 1 202 ? 158.631 -29.635 69.447  1.00 62.29 ? 202 ILE A C   1 
ATOM   1584 O  O   . ILE A 1 202 ? 159.042 -28.527 69.792  1.00 60.53 ? 202 ILE A O   1 
ATOM   1585 C  CB  . ILE A 1 202 ? 156.822 -30.936 70.469  1.00 64.12 ? 202 ILE A CB  1 
ATOM   1586 C  CG1 . ILE A 1 202 ? 155.332 -31.320 70.431  1.00 63.64 ? 202 ILE A CG1 1 
ATOM   1587 C  CG2 . ILE A 1 202 ? 157.280 -30.371 71.817  1.00 64.09 ? 202 ILE A CG2 1 
ATOM   1588 C  CD1 . ILE A 1 202 ? 154.365 -30.150 70.267  1.00 63.13 ? 202 ILE A CD1 1 
ATOM   1589 N  N   . GLU A 1 203 ? 159.423 -30.642 69.132  1.00 61.96 ? 203 GLU A N   1 
ATOM   1590 C  CA  . GLU A 1 203 ? 160.844 -30.497 69.201  1.00 61.59 ? 203 GLU A CA  1 
ATOM   1591 C  C   . GLU A 1 203 ? 161.300 -29.432 68.240  1.00 60.41 ? 203 GLU A C   1 
ATOM   1592 O  O   . GLU A 1 203 ? 161.998 -28.506 68.634  1.00 59.76 ? 203 GLU A O   1 
ATOM   1593 C  CB  . GLU A 1 203 ? 161.515 -31.820 68.881  1.00 62.95 ? 203 GLU A CB  1 
ATOM   1594 C  CG  . GLU A 1 203 ? 162.944 -31.878 69.366  1.00 64.97 ? 203 GLU A CG  1 
ATOM   1595 C  CD  . GLU A 1 203 ? 163.078 -31.428 70.813  1.00 64.88 ? 203 GLU A CD  1 
ATOM   1596 O  OE1 . GLU A 1 203 ? 162.237 -31.815 71.657  1.00 64.01 ? 203 GLU A OE1 1 
ATOM   1597 O  OE2 . GLU A 1 203 ? 164.026 -30.675 71.106  1.00 66.72 ? 203 GLU A OE2 1 
ATOM   1598 N  N   . GLU A 1 204 ? 160.856 -29.541 66.993  1.00 59.74 ? 204 GLU A N   1 
ATOM   1599 C  CA  . GLU A 1 204 ? 161.232 -28.589 65.952  1.00 59.90 ? 204 GLU A CA  1 
ATOM   1600 C  C   . GLU A 1 204 ? 161.131 -27.167 66.506  1.00 58.06 ? 204 GLU A C   1 
ATOM   1601 O  O   . GLU A 1 204 ? 162.067 -26.360 66.422  1.00 56.96 ? 204 GLU A O   1 
ATOM   1602 C  CB  . GLU A 1 204 ? 160.328 -28.771 64.714  1.00 61.27 ? 204 GLU A CB  1 
ATOM   1603 C  CG  . GLU A 1 204 ? 160.364 -30.195 64.100  1.00 63.19 ? 204 GLU A CG  1 
ATOM   1604 C  CD  . GLU A 1 204 ? 159.832 -30.282 62.656  1.00 64.27 ? 204 GLU A CD  1 
ATOM   1605 O  OE1 . GLU A 1 204 ? 159.838 -29.258 61.933  1.00 64.89 ? 204 GLU A OE1 1 
ATOM   1606 O  OE2 . GLU A 1 204 ? 159.427 -31.392 62.233  1.00 64.90 ? 204 GLU A OE2 1 
ATOM   1607 N  N   . LEU A 1 205 ? 160.015 -26.918 67.169  1.00 57.05 ? 205 LEU A N   1 
ATOM   1608 C  CA  . LEU A 1 205 ? 159.747 -25.634 67.768  1.00 55.08 ? 205 LEU A CA  1 
ATOM   1609 C  C   . LEU A 1 205 ? 160.668 -25.404 68.929  1.00 55.17 ? 205 LEU A C   1 
ATOM   1610 O  O   . LEU A 1 205 ? 161.420 -24.428 68.957  1.00 53.58 ? 205 LEU A O   1 
ATOM   1611 C  CB  . LEU A 1 205 ? 158.312 -25.598 68.246  1.00 52.88 ? 205 LEU A CB  1 
ATOM   1612 C  CG  . LEU A 1 205 ? 157.970 -24.274 68.893  1.00 52.37 ? 205 LEU A CG  1 
ATOM   1613 C  CD1 . LEU A 1 205 ? 158.352 -23.088 68.000  1.00 50.47 ? 205 LEU A CD1 1 
ATOM   1614 C  CD2 . LEU A 1 205 ? 156.498 -24.304 69.191  1.00 54.76 ? 205 LEU A CD2 1 
ATOM   1615 N  N   . ARG A 1 206 ? 160.603 -26.333 69.874  1.00 55.13 ? 206 ARG A N   1 
ATOM   1616 C  CA  . ARG A 1 206 ? 161.394 -26.300 71.088  1.00 55.96 ? 206 ARG A CA  1 
ATOM   1617 C  C   . ARG A 1 206 ? 162.801 -25.871 70.713  1.00 55.39 ? 206 ARG A C   1 
ATOM   1618 O  O   . ARG A 1 206 ? 163.400 -24.972 71.311  1.00 55.56 ? 206 ARG A O   1 
ATOM   1619 C  CB  . ARG A 1 206 ? 161.405 -27.696 71.713  1.00 57.39 ? 206 ARG A CB  1 
ATOM   1620 C  CG  . ARG A 1 206 ? 162.003 -27.733 73.098  1.00 61.41 ? 206 ARG A CG  1 
ATOM   1621 C  CD  . ARG A 1 206 ? 161.994 -29.127 73.691  1.00 65.44 ? 206 ARG A CD  1 
ATOM   1622 N  NE  . ARG A 1 206 ? 163.286 -29.439 74.308  1.00 70.00 ? 206 ARG A NE  1 
ATOM   1623 C  CZ  . ARG A 1 206 ? 163.655 -30.646 74.742  1.00 72.41 ? 206 ARG A CZ  1 
ATOM   1624 N  NH1 . ARG A 1 206 ? 162.825 -31.677 74.643  1.00 74.25 ? 206 ARG A NH1 1 
ATOM   1625 N  NH2 . ARG A 1 206 ? 164.877 -30.837 75.233  1.00 73.22 ? 206 ARG A NH2 1 
ATOM   1626 N  N   . GLN A 1 207 ? 163.256 -26.439 69.617  1.00 54.44 ? 207 GLN A N   1 
ATOM   1627 C  CA  . GLN A 1 207 ? 164.559 -26.158 69.119  1.00 54.07 ? 207 GLN A CA  1 
ATOM   1628 C  C   . GLN A 1 207 ? 164.612 -24.764 68.558  1.00 53.55 ? 207 GLN A C   1 
ATOM   1629 O  O   . GLN A 1 207 ? 165.477 -23.968 68.921  1.00 52.17 ? 207 GLN A O   1 
ATOM   1630 C  CB  . GLN A 1 207 ? 164.924 -27.210 68.079  1.00 56.95 ? 207 GLN A CB  1 
ATOM   1631 C  CG  . GLN A 1 207 ? 165.275 -28.548 68.715  1.00 60.76 ? 207 GLN A CG  1 
ATOM   1632 C  CD  . GLN A 1 207 ? 166.348 -28.400 69.802  1.00 63.93 ? 207 GLN A CD  1 
ATOM   1633 O  OE1 . GLN A 1 207 ? 166.924 -27.328 69.980  1.00 66.65 ? 207 GLN A OE1 1 
ATOM   1634 N  NE2 . GLN A 1 207 ? 166.633 -29.484 70.515  1.00 64.52 ? 207 GLN A NE2 1 
ATOM   1635 N  N   . HIS A 1 208 ? 163.653 -24.455 67.698  1.00 53.77 ? 208 HIS A N   1 
ATOM   1636 C  CA  . HIS A 1 208 ? 163.579 -23.143 67.069  1.00 55.02 ? 208 HIS A CA  1 
ATOM   1637 C  C   . HIS A 1 208 ? 163.811 -22.059 68.089  1.00 53.96 ? 208 HIS A C   1 
ATOM   1638 O  O   . HIS A 1 208 ? 164.687 -21.215 67.945  1.00 52.73 ? 208 HIS A O   1 
ATOM   1639 C  CB  . HIS A 1 208 ? 162.195 -22.930 66.469  1.00 56.24 ? 208 HIS A CB  1 
ATOM   1640 C  CG  . HIS A 1 208 ? 161.903 -21.504 66.104  1.00 57.81 ? 208 HIS A CG  1 
ATOM   1641 N  ND1 . HIS A 1 208 ? 162.752 -20.734 65.341  1.00 56.73 ? 208 HIS A ND1 1 
ATOM   1642 C  CD2 . HIS A 1 208 ? 160.813 -20.730 66.342  1.00 58.21 ? 208 HIS A CD2 1 
ATOM   1643 C  CE1 . HIS A 1 208 ? 162.197 -19.555 65.110  1.00 56.63 ? 208 HIS A CE1 1 
ATOM   1644 N  NE2 . HIS A 1 208 ? 161.020 -19.531 65.709  1.00 57.58 ? 208 HIS A NE2 1 
ATOM   1645 N  N   . LEU A 1 209 ? 162.986 -22.100 69.115  1.00 54.19 ? 209 LEU A N   1 
ATOM   1646 C  CA  . LEU A 1 209 ? 163.047 -21.130 70.174  1.00 55.77 ? 209 LEU A CA  1 
ATOM   1647 C  C   . LEU A 1 209 ? 164.410 -21.217 70.822  1.00 56.48 ? 209 LEU A C   1 
ATOM   1648 O  O   . LEU A 1 209 ? 165.044 -20.206 71.110  1.00 55.58 ? 209 LEU A O   1 
ATOM   1649 C  CB  . LEU A 1 209 ? 161.922 -21.410 71.172  1.00 55.42 ? 209 LEU A CB  1 
ATOM   1650 C  CG  . LEU A 1 209 ? 160.539 -21.507 70.503  1.00 55.25 ? 209 LEU A CG  1 
ATOM   1651 C  CD1 . LEU A 1 209 ? 159.490 -21.863 71.522  1.00 54.67 ? 209 LEU A CD1 1 
ATOM   1652 C  CD2 . LEU A 1 209 ? 160.161 -20.208 69.806  1.00 54.70 ? 209 LEU A CD2 1 
ATOM   1653 N  N   . LEU A 1 210 ? 164.887 -22.439 70.978  1.00 59.15 ? 210 LEU A N   1 
ATOM   1654 C  CA  . LEU A 1 210 ? 166.181 -22.659 71.575  1.00 62.76 ? 210 LEU A CA  1 
ATOM   1655 C  C   . LEU A 1 210 ? 167.259 -21.880 70.828  1.00 64.57 ? 210 LEU A C   1 
ATOM   1656 O  O   . LEU A 1 210 ? 168.242 -21.438 71.421  1.00 64.29 ? 210 LEU A O   1 
ATOM   1657 C  CB  . LEU A 1 210 ? 166.499 -24.150 71.592  1.00 64.68 ? 210 LEU A CB  1 
ATOM   1658 C  CG  . LEU A 1 210 ? 167.799 -24.599 72.272  1.00 67.19 ? 210 LEU A CG  1 
ATOM   1659 C  CD1 . LEU A 1 210 ? 168.172 -23.697 73.458  1.00 67.67 ? 210 LEU A CD1 1 
ATOM   1660 C  CD2 . LEU A 1 210 ? 167.639 -26.050 72.722  1.00 68.34 ? 210 LEU A CD2 1 
ATOM   1661 N  N   . ARG A 1 211 ? 167.066 -21.679 69.534  1.00 67.51 ? 211 ARG A N   1 
ATOM   1662 C  CA  . ARG A 1 211 ? 168.042 -20.926 68.762  1.00 70.83 ? 211 ARG A CA  1 
ATOM   1663 C  C   . ARG A 1 211 ? 168.097 -19.482 69.227  1.00 71.06 ? 211 ARG A C   1 
ATOM   1664 O  O   . ARG A 1 211 ? 169.081 -18.782 68.996  1.00 70.49 ? 211 ARG A O   1 
ATOM   1665 C  CB  . ARG A 1 211 ? 167.692 -20.979 67.283  1.00 74.87 ? 211 ARG A CB  1 
ATOM   1666 C  CG  . ARG A 1 211 ? 167.959 -22.330 66.689  1.00 80.69 ? 211 ARG A CG  1 
ATOM   1667 C  CD  . ARG A 1 211 ? 167.332 -22.470 65.327  1.00 85.73 ? 211 ARG A CD  1 
ATOM   1668 N  NE  . ARG A 1 211 ? 167.593 -23.790 64.755  1.00 90.61 ? 211 ARG A NE  1 
ATOM   1669 C  CZ  . ARG A 1 211 ? 167.296 -24.947 65.344  1.00 92.91 ? 211 ARG A CZ  1 
ATOM   1670 N  NH1 . ARG A 1 211 ? 166.722 -24.968 66.541  1.00 94.87 ? 211 ARG A NH1 1 
ATOM   1671 N  NH2 . ARG A 1 211 ? 167.547 -26.095 64.721  1.00 94.85 ? 211 ARG A NH2 1 
ATOM   1672 N  N   . TRP A 1 212 ? 167.026 -19.051 69.882  1.00 71.48 ? 212 TRP A N   1 
ATOM   1673 C  CA  . TRP A 1 212 ? 166.908 -17.694 70.391  1.00 72.00 ? 212 TRP A CA  1 
ATOM   1674 C  C   . TRP A 1 212 ? 167.256 -17.551 71.862  1.00 72.89 ? 212 TRP A C   1 
ATOM   1675 O  O   . TRP A 1 212 ? 166.857 -16.578 72.490  1.00 73.48 ? 212 TRP A O   1 
ATOM   1676 C  CB  . TRP A 1 212 ? 165.488 -17.204 70.189  1.00 71.64 ? 212 TRP A CB  1 
ATOM   1677 C  CG  . TRP A 1 212 ? 165.049 -17.263 68.788  1.00 72.48 ? 212 TRP A CG  1 
ATOM   1678 C  CD1 . TRP A 1 212 ? 164.454 -18.321 68.157  1.00 71.96 ? 212 TRP A CD1 1 
ATOM   1679 C  CD2 . TRP A 1 212 ? 165.094 -16.199 67.825  1.00 72.34 ? 212 TRP A CD2 1 
ATOM   1680 N  NE1 . TRP A 1 212 ? 164.119 -17.973 66.872  1.00 72.00 ? 212 TRP A NE1 1 
ATOM   1681 C  CE2 . TRP A 1 212 ? 164.499 -16.674 66.645  1.00 72.27 ? 212 TRP A CE2 1 
ATOM   1682 C  CE3 . TRP A 1 212 ? 165.582 -14.877 67.869  1.00 71.68 ? 212 TRP A CE3 1 
ATOM   1683 C  CZ2 . TRP A 1 212 ? 164.364 -15.879 65.495  1.00 70.98 ? 212 TRP A CZ2 1 
ATOM   1684 C  CZ3 . TRP A 1 212 ? 165.447 -14.087 66.725  1.00 70.66 ? 212 TRP A CZ3 1 
ATOM   1685 C  CH2 . TRP A 1 212 ? 164.843 -14.593 65.555  1.00 70.37 ? 212 TRP A CH2 1 
ATOM   1686 N  N   . GLY A 1 213 ? 167.972 -18.520 72.422  1.00 74.18 ? 213 GLY A N   1 
ATOM   1687 C  CA  . GLY A 1 213 ? 168.344 -18.458 73.832  1.00 74.77 ? 213 GLY A CA  1 
ATOM   1688 C  C   . GLY A 1 213 ? 167.184 -18.612 74.820  1.00 75.86 ? 213 GLY A C   1 
ATOM   1689 O  O   . GLY A 1 213 ? 167.322 -18.314 76.017  1.00 75.09 ? 213 GLY A O   1 
ATOM   1690 N  N   . LEU A 1 214 ? 166.054 -19.121 74.325  1.00 75.65 ? 214 LEU A N   1 
ATOM   1691 C  CA  . LEU A 1 214 ? 164.848 -19.325 75.129  1.00 74.78 ? 214 LEU A CA  1 
ATOM   1692 C  C   . LEU A 1 214 ? 164.798 -20.738 75.702  1.00 75.10 ? 214 LEU A C   1 
ATOM   1693 O  O   . LEU A 1 214 ? 164.449 -21.703 75.006  1.00 74.84 ? 214 LEU A O   1 
ATOM   1694 C  CB  . LEU A 1 214 ? 163.611 -19.071 74.270  1.00 74.09 ? 214 LEU A CB  1 
ATOM   1695 C  CG  . LEU A 1 214 ? 163.644 -17.776 73.457  1.00 72.22 ? 214 LEU A CG  1 
ATOM   1696 C  CD1 . LEU A 1 214 ? 162.408 -17.680 72.583  1.00 70.71 ? 214 LEU A CD1 1 
ATOM   1697 C  CD2 . LEU A 1 214 ? 163.744 -16.591 74.407  1.00 71.18 ? 214 LEU A CD2 1 
ATOM   1698 N  N   . THR A 1 215 ? 165.094 -20.846 76.990  1.00 75.74 ? 215 THR A N   1 
ATOM   1699 C  CA  . THR A 1 215 ? 165.128 -22.135 77.668  1.00 75.98 ? 215 THR A CA  1 
ATOM   1700 C  C   . THR A 1 215 ? 163.811 -22.839 78.010  1.00 76.43 ? 215 THR A C   1 
ATOM   1701 O  O   . THR A 1 215 ? 163.051 -22.394 78.876  1.00 75.58 ? 215 THR A O   1 
ATOM   1702 C  CB  . THR A 1 215 ? 165.977 -22.030 78.929  1.00 76.19 ? 215 THR A CB  1 
ATOM   1703 O  OG1 . THR A 1 215 ? 167.139 -21.242 78.635  1.00 77.15 ? 215 THR A OG1 1 
ATOM   1704 C  CG2 . THR A 1 215 ? 166.414 -23.427 79.388  1.00 77.96 ? 215 THR A CG2 1 
ATOM   1705 N  N   . THR A 1 216 ? 163.610 -23.987 77.365  1.00 77.06 ? 216 THR A N   1 
ATOM   1706 C  CA  . THR A 1 216 ? 162.445 -24.839 77.571  1.00 77.57 ? 216 THR A CA  1 
ATOM   1707 C  C   . THR A 1 216 ? 163.003 -26.188 78.048  1.00 79.08 ? 216 THR A C   1 
ATOM   1708 O  O   . THR A 1 216 ? 163.553 -26.964 77.259  1.00 78.25 ? 216 THR A O   1 
ATOM   1709 C  CB  . THR A 1 216 ? 161.667 -25.041 76.257  1.00 76.49 ? 216 THR A CB  1 
ATOM   1710 O  OG1 . THR A 1 216 ? 161.420 -23.759 75.672  1.00 75.69 ? 216 THR A OG1 1 
ATOM   1711 C  CG2 . THR A 1 216 ? 160.347 -25.746 76.524  1.00 74.71 ? 216 THR A CG2 1 
ATOM   1712 N  N   . PRO A 1 217 ? 162.867 -26.488 79.351  1.00 80.59 ? 217 PRO A N   1 
ATOM   1713 C  CA  . PRO A 1 217 ? 163.372 -27.748 79.908  1.00 80.54 ? 217 PRO A CA  1 
ATOM   1714 C  C   . PRO A 1 217 ? 162.490 -28.965 79.721  1.00 80.99 ? 217 PRO A C   1 
ATOM   1715 O  O   . PRO A 1 217 ? 162.772 -30.017 80.291  1.00 81.07 ? 217 PRO A O   1 
ATOM   1716 C  CB  . PRO A 1 217 ? 163.575 -27.420 81.397  1.00 80.53 ? 217 PRO A CB  1 
ATOM   1717 C  CG  . PRO A 1 217 ? 162.944 -26.026 81.609  1.00 80.92 ? 217 PRO A CG  1 
ATOM   1718 C  CD  . PRO A 1 217 ? 162.139 -25.730 80.380  1.00 80.83 ? 217 PRO A CD  1 
ATOM   1719 N  N   . ASP A 1 218 ? 161.415 -28.816 78.954  1.00 82.33 ? 218 ASP A N   1 
ATOM   1720 C  CA  . ASP A 1 218 ? 160.507 -29.930 78.702  1.00 83.93 ? 218 ASP A CA  1 
ATOM   1721 C  C   . ASP A 1 218 ? 161.377 -31.059 78.179  1.00 86.93 ? 218 ASP A C   1 
ATOM   1722 O  O   . ASP A 1 218 ? 162.246 -30.823 77.344  1.00 88.09 ? 218 ASP A O   1 
ATOM   1723 C  CB  . ASP A 1 218 ? 159.478 -29.553 77.667  1.00 83.41 ? 218 ASP A CB  1 
ATOM   1724 N  N   . LYS A 1 219 ? 161.174 -32.271 78.685  1.00 88.99 ? 219 LYS A N   1 
ATOM   1725 C  CA  . LYS A 1 219 ? 161.985 -33.407 78.252  1.00 91.64 ? 219 LYS A CA  1 
ATOM   1726 C  C   . LYS A 1 219 ? 161.501 -33.855 76.873  1.00 92.35 ? 219 LYS A C   1 
ATOM   1727 O  O   . LYS A 1 219 ? 162.221 -33.759 75.886  1.00 92.26 ? 219 LYS A O   1 
ATOM   1728 C  CB  . LYS A 1 219 ? 161.873 -34.542 79.271  1.00 91.28 ? 219 LYS A CB  1 
ATOM   1729 N  N   . LYS A 1 220 ? 160.284 -34.377 76.829  1.00 93.22 ? 220 LYS A N   1 
ATOM   1730 C  CA  . LYS A 1 220 ? 159.670 -34.820 75.588  1.00 93.44 ? 220 LYS A CA  1 
ATOM   1731 C  C   . LYS A 1 220 ? 158.328 -34.112 75.637  1.00 94.35 ? 220 LYS A C   1 
ATOM   1732 O  O   . LYS A 1 220 ? 157.266 -34.749 75.592  1.00 95.26 ? 220 LYS A O   1 
ATOM   1733 C  CB  . LYS A 1 220 ? 159.484 -36.339 75.589  1.00 92.77 ? 220 LYS A CB  1 
ATOM   1734 N  N   . HIS A 1 221 ? 158.396 -32.789 75.813  1.00 93.72 ? 221 HIS A N   1 
ATOM   1735 C  CA  . HIS A 1 221 ? 157.209 -31.936 75.907  1.00 92.81 ? 221 HIS A CA  1 
ATOM   1736 C  C   . HIS A 1 221 ? 156.375 -32.300 77.141  1.00 91.80 ? 221 HIS A C   1 
ATOM   1737 O  O   . HIS A 1 221 ? 155.220 -32.723 77.026  1.00 92.14 ? 221 HIS A O   1 
ATOM   1738 C  CB  . HIS A 1 221 ? 156.366 -32.058 74.642  1.00 94.03 ? 221 HIS A CB  1 
ATOM   1739 N  N   . GLN A 1 222 ? 156.966 -32.109 78.320  1.00 91.16 ? 222 GLN A N   1 
ATOM   1740 C  CA  . GLN A 1 222 ? 156.325 -32.433 79.603  1.00 90.27 ? 222 GLN A CA  1 
ATOM   1741 C  C   . GLN A 1 222 ? 155.108 -31.590 80.028  1.00 88.66 ? 222 GLN A C   1 
ATOM   1742 O  O   . GLN A 1 222 ? 155.265 -30.443 80.462  1.00 88.01 ? 222 GLN A O   1 
ATOM   1743 C  CB  . GLN A 1 222 ? 157.380 -32.440 80.712  1.00 90.91 ? 222 GLN A CB  1 
ATOM   1744 N  N   . LYS A 1 223 ? 153.921 -32.201 80.014  1.00 86.68 ? 223 LYS A N   1 
ATOM   1745 C  CA  . LYS A 1 223 ? 152.688 -31.509 80.390  1.00 85.01 ? 223 LYS A CA  1 
ATOM   1746 C  C   . LYS A 1 223 ? 151.660 -32.424 81.083  1.00 84.10 ? 223 LYS A C   1 
ATOM   1747 O  O   . LYS A 1 223 ? 151.626 -33.627 80.835  1.00 84.44 ? 223 LYS A O   1 
ATOM   1748 C  CB  . LYS A 1 223 ? 152.069 -30.853 79.157  1.00 84.53 ? 223 LYS A CB  1 
ATOM   1749 N  N   . GLU A 1 224 ? 150.823 -31.838 81.942  1.00 83.24 ? 224 GLU A N   1 
ATOM   1750 C  CA  . GLU A 1 224 ? 149.776 -32.563 82.673  1.00 81.72 ? 224 GLU A CA  1 
ATOM   1751 C  C   . GLU A 1 224 ? 148.477 -32.495 81.888  1.00 82.16 ? 224 GLU A C   1 
ATOM   1752 O  O   . GLU A 1 224 ? 147.793 -31.471 81.941  1.00 82.19 ? 224 GLU A O   1 
ATOM   1753 C  CB  . GLU A 1 224 ? 149.483 -31.881 84.017  1.00 78.85 ? 224 GLU A CB  1 
ATOM   1754 C  CG  . GLU A 1 224 ? 150.676 -31.290 84.725  1.00 77.07 ? 224 GLU A CG  1 
ATOM   1755 C  CD  . GLU A 1 224 ? 151.696 -32.333 85.113  1.00 76.99 ? 224 GLU A CD  1 
ATOM   1756 O  OE1 . GLU A 1 224 ? 151.472 -33.535 84.849  1.00 76.84 ? 224 GLU A OE1 1 
ATOM   1757 O  OE2 . GLU A 1 224 ? 152.732 -31.953 85.693  1.00 76.79 ? 224 GLU A OE2 1 
ATOM   1758 N  N   . PRO A 1 225 ? 148.082 -33.593 81.207  1.00 82.07 ? 225 PRO A N   1 
ATOM   1759 C  CA  . PRO A 1 225 ? 146.839 -33.611 80.425  1.00 82.59 ? 225 PRO A CA  1 
ATOM   1760 C  C   . PRO A 1 225 ? 145.677 -32.804 81.048  1.00 83.15 ? 225 PRO A C   1 
ATOM   1761 O  O   . PRO A 1 225 ? 144.794 -32.316 80.325  1.00 82.60 ? 225 PRO A O   1 
ATOM   1762 C  CB  . PRO A 1 225 ? 146.522 -35.098 80.347  1.00 81.86 ? 225 PRO A CB  1 
ATOM   1763 C  CG  . PRO A 1 225 ? 147.892 -35.687 80.190  1.00 81.63 ? 225 PRO A CG  1 
ATOM   1764 C  CD  . PRO A 1 225 ? 148.714 -34.925 81.219  1.00 82.07 ? 225 PRO A CD  1 
ATOM   1765 N  N   . PRO A 1 226 ? 145.581 -32.798 82.402  1.00 84.96 ? 226 PRO A N   1 
ATOM   1766 C  CA  . PRO A 1 226 ? 144.503 -32.005 83.008  1.00 85.98 ? 226 PRO A CA  1 
ATOM   1767 C  C   . PRO A 1 226 ? 145.059 -30.584 83.204  1.00 85.90 ? 226 PRO A C   1 
ATOM   1768 O  O   . PRO A 1 226 ? 145.928 -30.357 84.054  1.00 86.30 ? 226 PRO A O   1 
ATOM   1769 C  CB  . PRO A 1 226 ? 144.260 -32.725 84.337  1.00 86.38 ? 226 PRO A CB  1 
ATOM   1770 C  CG  . PRO A 1 226 ? 145.630 -33.224 84.697  1.00 86.86 ? 226 PRO A CG  1 
ATOM   1771 C  CD  . PRO A 1 226 ? 146.147 -33.746 83.388  1.00 85.95 ? 226 PRO A CD  1 
ATOM   1772 N  N   . PHE A 1 227 ? 144.607 -29.649 82.369  1.00 85.85 ? 227 PHE A N   1 
ATOM   1773 C  CA  . PHE A 1 227 ? 145.090 -28.274 82.440  1.00 84.76 ? 227 PHE A CA  1 
ATOM   1774 C  C   . PHE A 1 227 ? 144.360 -27.343 83.380  1.00 82.43 ? 227 PHE A C   1 
ATOM   1775 O  O   . PHE A 1 227 ? 143.160 -27.137 83.248  1.00 81.47 ? 227 PHE A O   1 
ATOM   1776 C  CB  . PHE A 1 227 ? 145.162 -27.686 81.047  1.00 87.03 ? 227 PHE A CB  1 
ATOM   1777 C  CG  . PHE A 1 227 ? 146.085 -28.426 80.161  1.00 91.02 ? 227 PHE A CG  1 
ATOM   1778 C  CD1 . PHE A 1 227 ? 147.411 -28.610 80.539  1.00 92.74 ? 227 PHE A CD1 1 
ATOM   1779 C  CD2 . PHE A 1 227 ? 145.634 -28.990 78.973  1.00 93.70 ? 227 PHE A CD2 1 
ATOM   1780 C  CE1 . PHE A 1 227 ? 148.293 -29.344 79.741  1.00 95.22 ? 227 PHE A CE1 1 
ATOM   1781 C  CE2 . PHE A 1 227 ? 146.503 -29.730 78.157  1.00 96.14 ? 227 PHE A CE2 1 
ATOM   1782 C  CZ  . PHE A 1 227 ? 147.836 -29.913 78.544  1.00 96.38 ? 227 PHE A CZ  1 
ATOM   1783 N  N   . LEU A 1 228 ? 145.117 -26.742 84.295  1.00 80.90 ? 228 LEU A N   1 
ATOM   1784 C  CA  . LEU A 1 228 ? 144.563 -25.834 85.304  1.00 79.17 ? 228 LEU A CA  1 
ATOM   1785 C  C   . LEU A 1 228 ? 144.673 -24.355 84.871  1.00 77.27 ? 228 LEU A C   1 
ATOM   1786 O  O   . LEU A 1 228 ? 145.512 -23.606 85.383  1.00 76.84 ? 228 LEU A O   1 
ATOM   1787 C  CB  . LEU A 1 228 ? 145.295 -26.063 86.641  1.00 78.62 ? 228 LEU A CB  1 
ATOM   1788 C  CG  . LEU A 1 228 ? 145.830 -27.480 86.914  1.00 77.34 ? 228 LEU A CG  1 
ATOM   1789 C  CD1 . LEU A 1 228 ? 146.598 -27.510 88.229  1.00 76.98 ? 228 LEU A CD1 1 
ATOM   1790 C  CD2 . LEU A 1 228 ? 144.685 -28.479 86.928  1.00 77.20 ? 228 LEU A CD2 1 
ATOM   1791 N  N   . TRP A 1 229 ? 143.795 -23.922 83.968  1.00 75.30 ? 229 TRP A N   1 
ATOM   1792 C  CA  . TRP A 1 229 ? 143.842 -22.550 83.468  1.00 73.64 ? 229 TRP A CA  1 
ATOM   1793 C  C   . TRP A 1 229 ? 142.677 -21.698 83.884  1.00 73.59 ? 229 TRP A C   1 
ATOM   1794 O  O   . TRP A 1 229 ? 141.535 -22.008 83.546  1.00 73.20 ? 229 TRP A O   1 
ATOM   1795 C  CB  . TRP A 1 229 ? 143.898 -22.524 81.944  1.00 71.43 ? 229 TRP A CB  1 
ATOM   1796 C  CG  . TRP A 1 229 ? 144.072 -21.136 81.374  1.00 69.06 ? 229 TRP A CG  1 
ATOM   1797 C  CD1 . TRP A 1 229 ? 145.211 -20.385 81.390  1.00 68.71 ? 229 TRP A CD1 1 
ATOM   1798 C  CD2 . TRP A 1 229 ? 143.090 -20.360 80.675  1.00 68.42 ? 229 TRP A CD2 1 
ATOM   1799 N  NE1 . TRP A 1 229 ? 145.006 -19.198 80.741  1.00 67.58 ? 229 TRP A NE1 1 
ATOM   1800 C  CE2 . TRP A 1 229 ? 143.714 -19.150 80.288  1.00 67.98 ? 229 TRP A CE2 1 
ATOM   1801 C  CE3 . TRP A 1 229 ? 141.747 -20.569 80.336  1.00 67.02 ? 229 TRP A CE3 1 
ATOM   1802 C  CZ2 . TRP A 1 229 ? 143.046 -18.150 79.578  1.00 67.17 ? 229 TRP A CZ2 1 
ATOM   1803 C  CZ3 . TRP A 1 229 ? 141.080 -19.575 79.631  1.00 67.60 ? 229 TRP A CZ3 1 
ATOM   1804 C  CH2 . TRP A 1 229 ? 141.736 -18.377 79.259  1.00 68.15 ? 229 TRP A CH2 1 
ATOM   1805 N  N   . MET A 1 230 ? 142.990 -20.558 84.499  1.00 73.30 ? 230 MET A N   1 
ATOM   1806 C  CA  . MET A 1 230 ? 141.969 -19.618 84.946  1.00 72.41 ? 230 MET A CA  1 
ATOM   1807 C  C   . MET A 1 230 ? 140.811 -20.394 85.513  1.00 70.82 ? 230 MET A C   1 
ATOM   1808 O  O   . MET A 1 230 ? 139.671 -20.223 85.083  1.00 70.34 ? 230 MET A O   1 
ATOM   1809 C  CB  . MET A 1 230 ? 141.489 -18.761 83.776  1.00 73.25 ? 230 MET A CB  1 
ATOM   1810 C  CG  . MET A 1 230 ? 142.583 -17.924 83.193  1.00 74.94 ? 230 MET A CG  1 
ATOM   1811 S  SD  . MET A 1 230 ? 143.370 -17.030 84.511  1.00 78.30 ? 230 MET A SD  1 
ATOM   1812 C  CE  . MET A 1 230 ? 142.275 -15.568 84.569  1.00 79.01 ? 230 MET A CE  1 
ATOM   1813 N  N   . GLY A 1 231 ? 141.144 -21.346 86.380  1.00 69.86 ? 231 GLY A N   1 
ATOM   1814 C  CA  . GLY A 1 231 ? 140.132 -22.173 87.003  1.00 68.58 ? 231 GLY A CA  1 
ATOM   1815 C  C   . GLY A 1 231 ? 139.704 -23.322 86.118  1.00 66.55 ? 231 GLY A C   1 
ATOM   1816 O  O   . GLY A 1 231 ? 139.394 -24.395 86.622  1.00 67.84 ? 231 GLY A O   1 
ATOM   1817 N  N   . TYR A 1 232 ? 139.649 -23.097 84.812  1.00 65.57 ? 232 TYR A N   1 
ATOM   1818 C  CA  . TYR A 1 232 ? 139.263 -24.148 83.893  1.00 63.37 ? 232 TYR A CA  1 
ATOM   1819 C  C   . TYR A 1 232 ? 140.237 -25.294 83.990  1.00 62.43 ? 232 TYR A C   1 
ATOM   1820 O  O   . TYR A 1 232 ? 141.386 -25.137 84.394  1.00 59.64 ? 232 TYR A O   1 
ATOM   1821 C  CB  . TYR A 1 232 ? 139.263 -23.669 82.446  1.00 63.14 ? 232 TYR A CB  1 
ATOM   1822 C  CG  . TYR A 1 232 ? 138.417 -22.468 82.166  1.00 62.40 ? 232 TYR A CG  1 
ATOM   1823 C  CD1 . TYR A 1 232 ? 138.912 -21.188 82.372  1.00 61.77 ? 232 TYR A CD1 1 
ATOM   1824 C  CD2 . TYR A 1 232 ? 137.151 -22.607 81.613  1.00 62.83 ? 232 TYR A CD2 1 
ATOM   1825 C  CE1 . TYR A 1 232 ? 138.173 -20.071 82.025  1.00 63.76 ? 232 TYR A CE1 1 
ATOM   1826 C  CE2 . TYR A 1 232 ? 136.394 -21.492 81.255  1.00 63.88 ? 232 TYR A CE2 1 
ATOM   1827 C  CZ  . TYR A 1 232 ? 136.915 -20.225 81.462  1.00 64.52 ? 232 TYR A CZ  1 
ATOM   1828 O  OH  . TYR A 1 232 ? 136.208 -19.106 81.061  1.00 65.58 ? 232 TYR A OH  1 
ATOM   1829 N  N   . GLU A 1 233 ? 139.750 -26.439 83.563  1.00 62.92 ? 233 GLU A N   1 
ATOM   1830 C  CA  . GLU A 1 233 ? 140.492 -27.675 83.524  1.00 64.99 ? 233 GLU A CA  1 
ATOM   1831 C  C   . GLU A 1 233 ? 140.193 -28.100 82.090  1.00 66.27 ? 233 GLU A C   1 
ATOM   1832 O  O   . GLU A 1 233 ? 139.036 -28.328 81.707  1.00 64.97 ? 233 GLU A O   1 
ATOM   1833 C  CB  . GLU A 1 233 ? 139.974 -28.695 84.545  1.00 66.29 ? 233 GLU A CB  1 
ATOM   1834 C  CG  . GLU A 1 233 ? 140.946 -29.868 84.757  1.00 68.08 ? 233 GLU A CG  1 
ATOM   1835 C  CD  . GLU A 1 233 ? 140.386 -30.989 85.627  1.00 68.28 ? 233 GLU A CD  1 
ATOM   1836 O  OE1 . GLU A 1 233 ? 139.451 -31.695 85.177  1.00 68.32 ? 233 GLU A OE1 1 
ATOM   1837 O  OE2 . GLU A 1 233 ? 140.911 -31.185 86.747  1.00 67.17 ? 233 GLU A OE2 1 
ATOM   1838 N  N   . LEU A 1 234 ? 141.242 -28.131 81.278  1.00 68.06 ? 234 LEU A N   1 
ATOM   1839 C  CA  . LEU A 1 234 ? 141.084 -28.451 79.876  1.00 68.97 ? 234 LEU A CA  1 
ATOM   1840 C  C   . LEU A 1 234 ? 141.780 -29.700 79.386  1.00 69.72 ? 234 LEU A C   1 
ATOM   1841 O  O   . LEU A 1 234 ? 142.708 -30.227 80.012  1.00 67.57 ? 234 LEU A O   1 
ATOM   1842 C  CB  . LEU A 1 234 ? 141.494 -27.248 79.030  1.00 69.73 ? 234 LEU A CB  1 
ATOM   1843 C  CG  . LEU A 1 234 ? 140.900 -25.910 79.495  1.00 70.58 ? 234 LEU A CG  1 
ATOM   1844 C  CD1 . LEU A 1 234 ? 141.876 -25.169 80.411  1.00 69.24 ? 234 LEU A CD1 1 
ATOM   1845 C  CD2 . LEU A 1 234 ? 140.573 -25.056 78.282  1.00 71.75 ? 234 LEU A CD2 1 
ATOM   1846 N  N   . HIS A 1 235 ? 141.265 -30.178 78.261  1.00 72.28 ? 235 HIS A N   1 
ATOM   1847 C  CA  . HIS A 1 235 ? 141.727 -31.383 77.588  1.00 74.47 ? 235 HIS A CA  1 
ATOM   1848 C  C   . HIS A 1 235 ? 141.398 -31.090 76.114  1.00 74.93 ? 235 HIS A C   1 
ATOM   1849 O  O   . HIS A 1 235 ? 140.361 -30.502 75.828  1.00 74.65 ? 235 HIS A O   1 
ATOM   1850 C  CB  . HIS A 1 235 ? 140.914 -32.591 78.095  1.00 75.86 ? 235 HIS A CB  1 
ATOM   1851 C  CG  . HIS A 1 235 ? 140.595 -32.552 79.571  1.00 76.46 ? 235 HIS A CG  1 
ATOM   1852 N  ND1 . HIS A 1 235 ? 139.566 -31.788 80.092  1.00 76.20 ? 235 HIS A ND1 1 
ATOM   1853 C  CD2 . HIS A 1 235 ? 141.141 -33.209 80.619  1.00 76.00 ? 235 HIS A CD2 1 
ATOM   1854 C  CE1 . HIS A 1 235 ? 139.492 -31.985 81.395  1.00 75.49 ? 235 HIS A CE1 1 
ATOM   1855 N  NE2 . HIS A 1 235 ? 140.434 -32.841 81.744  1.00 75.60 ? 235 HIS A NE2 1 
ATOM   1856 N  N   . PRO A 1 236 ? 142.197 -31.614 75.166  1.00 76.28 ? 236 PRO A N   1 
ATOM   1857 C  CA  . PRO A 1 236 ? 142.076 -31.450 73.703  1.00 76.99 ? 236 PRO A CA  1 
ATOM   1858 C  C   . PRO A 1 236 ? 140.706 -31.673 73.075  1.00 77.32 ? 236 PRO A C   1 
ATOM   1859 O  O   . PRO A 1 236 ? 140.538 -31.518 71.859  1.00 75.69 ? 236 PRO A O   1 
ATOM   1860 C  CB  . PRO A 1 236 ? 143.065 -32.483 73.166  1.00 77.97 ? 236 PRO A CB  1 
ATOM   1861 C  CG  . PRO A 1 236 ? 142.971 -33.572 74.165  1.00 78.25 ? 236 PRO A CG  1 
ATOM   1862 C  CD  . PRO A 1 236 ? 143.075 -32.758 75.459  1.00 77.70 ? 236 PRO A CD  1 
ATOM   1863 N  N   . ASP A 1 237 ? 139.732 -32.023 73.904  1.00 77.58 ? 237 ASP A N   1 
ATOM   1864 C  CA  . ASP A 1 237 ? 138.392 -32.288 73.425  1.00 78.63 ? 237 ASP A CA  1 
ATOM   1865 C  C   . ASP A 1 237 ? 137.306 -31.817 74.394  1.00 78.88 ? 237 ASP A C   1 
ATOM   1866 O  O   . ASP A 1 237 ? 136.134 -31.739 74.011  1.00 78.73 ? 237 ASP A O   1 
ATOM   1867 C  CB  . ASP A 1 237 ? 138.245 -33.787 73.176  1.00 79.61 ? 237 ASP A CB  1 
ATOM   1868 C  CG  . ASP A 1 237 ? 138.571 -34.622 74.411  1.00 80.67 ? 237 ASP A CG  1 
ATOM   1869 O  OD1 . ASP A 1 237 ? 139.488 -34.260 75.186  1.00 80.03 ? 237 ASP A OD1 1 
ATOM   1870 O  OD2 . ASP A 1 237 ? 137.890 -35.649 74.602  1.00 81.79 ? 237 ASP A OD2 1 
ATOM   1871 N  N   . LYS A 1 238 ? 137.687 -31.500 75.634  1.00 79.29 ? 238 LYS A N   1 
ATOM   1872 C  CA  . LYS A 1 238 ? 136.712 -31.051 76.628  1.00 79.32 ? 238 LYS A CA  1 
ATOM   1873 C  C   . LYS A 1 238 ? 137.321 -30.093 77.624  1.00 79.28 ? 238 LYS A C   1 
ATOM   1874 O  O   . LYS A 1 238 ? 138.513 -30.164 77.931  1.00 79.63 ? 238 LYS A O   1 
ATOM   1875 C  CB  . LYS A 1 238 ? 136.067 -32.241 77.369  1.00 79.74 ? 238 LYS A CB  1 
ATOM   1876 C  CG  . LYS A 1 238 ? 136.928 -32.898 78.462  1.00 78.89 ? 238 LYS A CG  1 
ATOM   1877 C  CD  . LYS A 1 238 ? 136.450 -34.313 78.866  1.00 78.20 ? 238 LYS A CD  1 
ATOM   1878 C  CE  . LYS A 1 238 ? 135.116 -34.330 79.593  1.00 77.59 ? 238 LYS A CE  1 
ATOM   1879 N  NZ  . LYS A 1 238 ? 134.624 -35.716 79.848  1.00 75.40 ? 238 LYS A NZ  1 
ATOM   1880 N  N   . TRP A 1 239 ? 136.483 -29.224 78.163  1.00 80.26 ? 239 TRP A N   1 
ATOM   1881 C  CA  . TRP A 1 239 ? 136.927 -28.235 79.130  1.00 81.95 ? 239 TRP A CA  1 
ATOM   1882 C  C   . TRP A 1 239 ? 135.916 -28.204 80.274  1.00 83.43 ? 239 TRP A C   1 
ATOM   1883 O  O   . TRP A 1 239 ? 134.722 -28.449 80.059  1.00 82.71 ? 239 TRP A O   1 
ATOM   1884 C  CB  . TRP A 1 239 ? 136.993 -26.858 78.459  1.00 78.91 ? 239 TRP A CB  1 
ATOM   1885 C  CG  . TRP A 1 239 ? 135.643 -26.275 78.197  1.00 75.51 ? 239 TRP A CG  1 
ATOM   1886 C  CD1 . TRP A 1 239 ? 134.830 -26.519 77.127  1.00 74.00 ? 239 TRP A CD1 1 
ATOM   1887 C  CD2 . TRP A 1 239 ? 134.912 -25.441 79.080  1.00 74.94 ? 239 TRP A CD2 1 
ATOM   1888 N  NE1 . TRP A 1 239 ? 133.622 -25.887 77.301  1.00 73.01 ? 239 TRP A NE1 1 
ATOM   1889 C  CE2 . TRP A 1 239 ? 133.649 -25.222 78.495  1.00 74.94 ? 239 TRP A CE2 1 
ATOM   1890 C  CE3 . TRP A 1 239 ? 135.192 -24.872 80.328  1.00 75.57 ? 239 TRP A CE3 1 
ATOM   1891 C  CZ2 . TRP A 1 239 ? 132.658 -24.451 79.122  1.00 76.64 ? 239 TRP A CZ2 1 
ATOM   1892 C  CZ3 . TRP A 1 239 ? 134.222 -24.114 80.949  1.00 77.08 ? 239 TRP A CZ3 1 
ATOM   1893 C  CH2 . TRP A 1 239 ? 132.964 -23.909 80.344  1.00 77.15 ? 239 TRP A CH2 1 
ATOM   1894 N  N   . THR A 1 240 ? 136.384 -27.857 81.469  1.00 85.29 ? 240 THR A N   1 
ATOM   1895 C  CA  . THR A 1 240 ? 135.533 -27.793 82.654  1.00 87.18 ? 240 THR A CA  1 
ATOM   1896 C  C   . THR A 1 240 ? 136.336 -27.255 83.821  1.00 88.03 ? 240 THR A C   1 
ATOM   1897 O  O   . THR A 1 240 ? 137.549 -27.235 83.765  1.00 88.03 ? 240 THR A O   1 
ATOM   1898 C  CB  . THR A 1 240 ? 135.105 -29.205 83.107  1.00 88.04 ? 240 THR A CB  1 
ATOM   1899 O  OG1 . THR A 1 240 ? 136.238 -30.077 83.082  1.00 89.86 ? 240 THR A OG1 1 
ATOM   1900 C  CG2 . THR A 1 240 ? 134.027 -29.771 82.255  1.00 88.34 ? 240 THR A CG2 1 
ATOM   1901 N  N   . VAL A 1 241 ? 135.656 -26.846 84.887  1.00 89.75 ? 241 VAL A N   1 
ATOM   1902 C  CA  . VAL A 1 241 ? 136.319 -26.390 86.116  1.00 91.31 ? 241 VAL A CA  1 
ATOM   1903 C  C   . VAL A 1 241 ? 135.881 -27.387 87.207  1.00 91.20 ? 241 VAL A C   1 
ATOM   1904 O  O   . VAL A 1 241 ? 134.688 -27.518 87.487  1.00 90.95 ? 241 VAL A O   1 
ATOM   1905 C  CB  . VAL A 1 241 ? 135.867 -24.971 86.532  1.00 91.97 ? 241 VAL A CB  1 
ATOM   1906 C  CG1 . VAL A 1 241 ? 136.425 -24.634 87.912  1.00 93.22 ? 241 VAL A CG1 1 
ATOM   1907 C  CG2 . VAL A 1 241 ? 136.356 -23.964 85.512  1.00 92.01 ? 241 VAL A CG2 1 
ATOM   1908 N  N   . GLN A 1 242 ? 136.824 -28.088 87.810  1.00 90.82 ? 242 GLN A N   1 
ATOM   1909 C  CA  . GLN A 1 242 ? 136.457 -29.069 88.822  1.00 89.45 ? 242 GLN A CA  1 
ATOM   1910 C  C   . GLN A 1 242 ? 136.423 -28.611 90.273  1.00 87.77 ? 242 GLN A C   1 
ATOM   1911 O  O   . GLN A 1 242 ? 135.423 -28.812 90.969  1.00 87.14 ? 242 GLN A O   1 
ATOM   1912 C  CB  . GLN A 1 242 ? 137.328 -30.321 88.678  1.00 89.39 ? 242 GLN A CB  1 
ATOM   1913 C  CG  . GLN A 1 242 ? 136.535 -31.606 88.714  1.00 89.42 ? 242 GLN A CG  1 
ATOM   1914 C  CD  . GLN A 1 242 ? 137.100 -32.646 87.761  1.00 89.51 ? 242 GLN A CD  1 
ATOM   1915 O  OE1 . GLN A 1 242 ? 136.449 -33.039 86.793  1.00 89.03 ? 242 GLN A OE1 1 
ATOM   1916 N  NE2 . GLN A 1 242 ? 138.334 -33.072 88.013  1.00 90.48 ? 242 GLN A NE2 1 
ATOM   1917 N  N   . PRO A 1 243 ? 137.516 -27.988 90.751  1.00 87.38 ? 243 PRO A N   1 
ATOM   1918 C  CA  . PRO A 1 243 ? 137.529 -27.532 92.142  1.00 87.77 ? 243 PRO A CA  1 
ATOM   1919 C  C   . PRO A 1 243 ? 136.471 -26.485 92.386  1.00 86.74 ? 243 PRO A C   1 
ATOM   1920 O  O   . PRO A 1 243 ? 136.656 -25.298 92.094  1.00 87.40 ? 243 PRO A O   1 
ATOM   1921 C  CB  . PRO A 1 243 ? 138.928 -26.929 92.310  1.00 87.31 ? 243 PRO A CB  1 
ATOM   1922 C  CG  . PRO A 1 243 ? 139.210 -26.402 90.940  1.00 88.44 ? 243 PRO A CG  1 
ATOM   1923 C  CD  . PRO A 1 243 ? 138.711 -27.490 90.037  1.00 87.85 ? 243 PRO A CD  1 
ATOM   1924 N  N   . ILE A 1 244 ? 135.334 -26.944 92.872  1.00 85.21 ? 244 ILE A N   1 
ATOM   1925 C  CA  . ILE A 1 244 ? 134.219 -26.086 93.172  1.00 83.32 ? 244 ILE A CA  1 
ATOM   1926 C  C   . ILE A 1 244 ? 133.504 -26.773 94.296  1.00 82.95 ? 244 ILE A C   1 
ATOM   1927 O  O   . ILE A 1 244 ? 132.907 -27.837 94.124  1.00 82.87 ? 244 ILE A O   1 
ATOM   1928 C  CB  . ILE A 1 244 ? 133.244 -25.974 92.003  1.00 81.71 ? 244 ILE A CB  1 
ATOM   1929 C  CG1 . ILE A 1 244 ? 133.954 -25.426 90.764  1.00 80.52 ? 244 ILE A CG1 1 
ATOM   1930 C  CG2 . ILE A 1 244 ? 132.114 -25.064 92.399  1.00 81.70 ? 244 ILE A CG2 1 
ATOM   1931 C  CD1 . ILE A 1 244 ? 133.073 -25.312 89.585  1.00 80.01 ? 244 ILE A CD1 1 
ATOM   1932 N  N   . VAL A 1 245 ? 133.631 -26.194 95.471  1.00 83.61 ? 245 VAL A N   1 
ATOM   1933 C  CA  . VAL A 1 245 ? 132.978 -26.752 96.621  1.00 85.22 ? 245 VAL A CA  1 
ATOM   1934 C  C   . VAL A 1 245 ? 132.118 -25.659 97.210  1.00 86.21 ? 245 VAL A C   1 
ATOM   1935 O  O   . VAL A 1 245 ? 132.513 -24.491 97.247  1.00 86.40 ? 245 VAL A O   1 
ATOM   1936 C  CB  . VAL A 1 245 ? 133.984 -27.278 97.686  1.00 84.93 ? 245 VAL A CB  1 
ATOM   1937 C  CG1 . VAL A 1 245 ? 134.923 -28.279 97.056  1.00 84.86 ? 245 VAL A CG1 1 
ATOM   1938 C  CG2 . VAL A 1 245 ? 134.749 -26.137 98.347  1.00 83.64 ? 245 VAL A CG2 1 
ATOM   1939 N  N   . LEU A 1 246 ? 130.900 -26.026 97.569  1.00 87.26 ? 246 LEU A N   1 
ATOM   1940 C  CA  . LEU A 1 246 ? 129.989 -25.081 98.177  1.00 88.77 ? 246 LEU A CA  1 
ATOM   1941 C  C   . LEU A 1 246 ? 130.017 -25.508 99.630  1.00 89.24 ? 246 LEU A C   1 
ATOM   1942 O  O   . LEU A 1 246 ? 129.407 -26.520 99.986  1.00 90.56 ? 246 LEU A O   1 
ATOM   1943 C  CB  . LEU A 1 246 ? 128.586 -25.279 97.615  1.00 88.57 ? 246 LEU A CB  1 
ATOM   1944 C  CG  . LEU A 1 246 ? 128.516 -25.549 96.110  1.00 89.17 ? 246 LEU A CG  1 
ATOM   1945 C  CD1 . LEU A 1 246 ? 127.064 -25.603 95.671  1.00 88.78 ? 246 LEU A CD1 1 
ATOM   1946 C  CD2 . LEU A 1 246 ? 129.258 -24.460 95.356  1.00 89.60 ? 246 LEU A CD2 1 
ATOM   1947 N  N   . PRO A 1 247 ? 130.818 -24.825 100.463 1.00 89.77 ? 247 PRO A N   1 
ATOM   1948 C  CA  . PRO A 1 247 ? 130.898 -25.180 101.882 1.00 90.38 ? 247 PRO A CA  1 
ATOM   1949 C  C   . PRO A 1 247 ? 129.567 -25.125 102.645 1.00 90.30 ? 247 PRO A C   1 
ATOM   1950 O  O   . PRO A 1 247 ? 128.691 -24.310 102.343 1.00 89.98 ? 247 PRO A O   1 
ATOM   1951 C  CB  . PRO A 1 247 ? 131.876 -24.137 102.432 1.00 90.53 ? 247 PRO A CB  1 
ATOM   1952 C  CG  . PRO A 1 247 ? 132.782 -23.897 101.272 1.00 90.18 ? 247 PRO A CG  1 
ATOM   1953 C  CD  . PRO A 1 247 ? 131.825 -23.800 100.125 1.00 89.84 ? 247 PRO A CD  1 
ATOM   1954 N  N   . GLU A 1 248 ? 129.443 -25.995 103.644 1.00 90.57 ? 248 GLU A N   1 
ATOM   1955 C  CA  . GLU A 1 248 ? 128.262 -26.042 104.494 1.00 92.18 ? 248 GLU A CA  1 
ATOM   1956 C  C   . GLU A 1 248 ? 128.743 -25.959 105.940 1.00 92.42 ? 248 GLU A C   1 
ATOM   1957 O  O   . GLU A 1 248 ? 129.647 -26.690 106.367 1.00 92.31 ? 248 GLU A O   1 
ATOM   1958 C  CB  . GLU A 1 248 ? 127.412 -27.312 104.258 1.00 92.96 ? 248 GLU A CB  1 
ATOM   1959 C  CG  . GLU A 1 248 ? 128.087 -28.652 104.557 1.00 94.15 ? 248 GLU A CG  1 
ATOM   1960 C  CD  . GLU A 1 248 ? 127.089 -29.760 104.918 1.00 95.51 ? 248 GLU A CD  1 
ATOM   1961 O  OE1 . GLU A 1 248 ? 126.327 -30.212 104.031 1.00 95.40 ? 248 GLU A OE1 1 
ATOM   1962 O  OE2 . GLU A 1 248 ? 127.073 -30.182 106.099 1.00 95.64 ? 248 GLU A OE2 1 
ATOM   1963 N  N   . LYS A 1 249 ? 128.192 -24.997 106.658 1.00 93.00 ? 249 LYS A N   1 
ATOM   1964 C  CA  . LYS A 1 249 ? 128.539 -24.784 108.039 1.00 92.85 ? 249 LYS A CA  1 
ATOM   1965 C  C   . LYS A 1 249 ? 127.327 -24.128 108.665 1.00 94.03 ? 249 LYS A C   1 
ATOM   1966 O  O   . LYS A 1 249 ? 126.293 -23.930 108.022 1.00 93.83 ? 249 LYS A O   1 
ATOM   1967 C  CB  . LYS A 1 249 ? 129.765 -23.883 108.156 1.00 92.59 ? 249 LYS A CB  1 
ATOM   1968 N  N   . ASP A 1 250 ? 127.485 -23.790 109.929 1.00 94.56 ? 250 ASP A N   1 
ATOM   1969 C  CA  . ASP A 1 250 ? 126.454 -23.166 110.732 1.00 94.73 ? 250 ASP A CA  1 
ATOM   1970 C  C   . ASP A 1 250 ? 126.535 -21.642 110.839 1.00 94.51 ? 250 ASP A C   1 
ATOM   1971 O  O   . ASP A 1 250 ? 125.596 -20.944 110.469 1.00 93.95 ? 250 ASP A O   1 
ATOM   1972 C  CB  . ASP A 1 250 ? 126.503 -23.786 112.130 1.00 95.12 ? 250 ASP A CB  1 
ATOM   1973 C  CG  . ASP A 1 250 ? 127.946 -24.031 112.631 1.00 96.34 ? 250 ASP A CG  1 
ATOM   1974 O  OD1 . ASP A 1 250 ? 128.934 -23.589 111.992 1.00 96.15 ? 250 ASP A OD1 1 
ATOM   1975 O  OD2 . ASP A 1 250 ? 128.087 -24.687 113.686 1.00 98.22 ? 250 ASP A OD2 1 
ATOM   1976 N  N   . SER A 1 251 ? 127.660 -21.141 111.351 1.00 94.77 ? 251 SER A N   1 
ATOM   1977 C  CA  . SER A 1 251 ? 127.878 -19.708 111.573 1.00 94.65 ? 251 SER A CA  1 
ATOM   1978 C  C   . SER A 1 251 ? 128.110 -18.905 110.310 1.00 95.26 ? 251 SER A C   1 
ATOM   1979 O  O   . SER A 1 251 ? 129.043 -18.105 110.245 1.00 94.96 ? 251 SER A O   1 
ATOM   1980 C  CB  . SER A 1 251 ? 129.037 -19.479 112.561 1.00 93.51 ? 251 SER A CB  1 
ATOM   1981 O  OG  . SER A 1 251 ? 130.167 -20.274 112.237 1.00 91.98 ? 251 SER A OG  1 
ATOM   1982 N  N   . TRP A 1 252 ? 127.227 -19.088 109.333 1.00 96.37 ? 252 TRP A N   1 
ATOM   1983 C  CA  . TRP A 1 252 ? 127.314 -18.394 108.059 1.00 97.95 ? 252 TRP A CA  1 
ATOM   1984 C  C   . TRP A 1 252 ? 127.504 -16.890 108.274 1.00 97.76 ? 252 TRP A C   1 
ATOM   1985 O  O   . TRP A 1 252 ? 126.701 -16.255 108.959 1.00 97.06 ? 252 TRP A O   1 
ATOM   1986 C  CB  . TRP A 1 252 ? 126.034 -18.625 107.235 1.00 99.77 ? 252 TRP A CB  1 
ATOM   1987 C  CG  . TRP A 1 252 ? 125.943 -19.949 106.485 1.00 99.90 ? 252 TRP A CG  1 
ATOM   1988 C  CD1 . TRP A 1 252 ? 125.029 -20.956 106.700 1.00 99.90 ? 252 TRP A CD1 1 
ATOM   1989 C  CD2 . TRP A 1 252 ? 126.738 -20.370 105.368 1.00 99.90 ? 252 TRP A CD2 1 
ATOM   1990 N  NE1 . TRP A 1 252 ? 125.207 -21.965 105.775 1.00 99.90 ? 252 TRP A NE1 1 
ATOM   1991 C  CE2 . TRP A 1 252 ? 126.243 -21.630 104.951 1.00 99.90 ? 252 TRP A CE2 1 
ATOM   1992 C  CE3 . TRP A 1 252 ? 127.813 -19.800 104.674 1.00 99.90 ? 252 TRP A CE3 1 
ATOM   1993 C  CZ2 . TRP A 1 252 ? 126.798 -22.335 103.865 1.00 99.90 ? 252 TRP A CZ2 1 
ATOM   1994 C  CZ3 . TRP A 1 252 ? 128.364 -20.497 103.605 1.00 99.90 ? 252 TRP A CZ3 1 
ATOM   1995 C  CH2 . TRP A 1 252 ? 127.852 -21.749 103.213 1.00 99.90 ? 252 TRP A CH2 1 
ATOM   1996 N  N   . THR A 1 253 ? 128.611 -16.351 107.764 1.00 98.06 ? 253 THR A N   1 
ATOM   1997 C  CA  . THR A 1 253 ? 128.895 -14.918 107.840 1.00 97.85 ? 253 THR A CA  1 
ATOM   1998 C  C   . THR A 1 253 ? 128.776 -14.369 106.410 1.00 97.35 ? 253 THR A C   1 
ATOM   1999 O  O   . THR A 1 253 ? 128.543 -15.130 105.461 1.00 97.42 ? 253 THR A O   1 
ATOM   2000 C  CB  . THR A 1 253 ? 130.313 -14.594 108.412 1.00 97.97 ? 253 THR A CB  1 
ATOM   2001 O  OG1 . THR A 1 253 ? 131.325 -15.190 107.584 1.00 98.30 ? 253 THR A OG1 1 
ATOM   2002 C  CG2 . THR A 1 253 ? 130.450 -15.098 109.854 1.00 98.66 ? 253 THR A CG2 1 
ATOM   2003 N  N   . VAL A 1 254 ? 128.976 -13.065 106.245 1.00 96.85 ? 254 VAL A N   1 
ATOM   2004 C  CA  . VAL A 1 254 ? 128.855 -12.429 104.931 1.00 95.41 ? 254 VAL A CA  1 
ATOM   2005 C  C   . VAL A 1 254 ? 129.875 -12.900 103.898 1.00 93.19 ? 254 VAL A C   1 
ATOM   2006 O  O   . VAL A 1 254 ? 129.508 -13.416 102.835 1.00 91.46 ? 254 VAL A O   1 
ATOM   2007 C  CB  . VAL A 1 254 ? 128.938 -10.881 105.043 1.00 96.56 ? 254 VAL A CB  1 
ATOM   2008 C  CG1 . VAL A 1 254 ? 128.545 -10.240 103.717 1.00 96.92 ? 254 VAL A CG1 1 
ATOM   2009 C  CG2 . VAL A 1 254 ? 128.023 -10.379 106.163 1.00 96.98 ? 254 VAL A CG2 1 
ATOM   2010 N  N   . ASN A 1 255 ? 131.150 -12.699 104.218 1.00 91.31 ? 255 ASN A N   1 
ATOM   2011 C  CA  . ASN A 1 255 ? 132.253 -13.074 103.343 1.00 90.27 ? 255 ASN A CA  1 
ATOM   2012 C  C   . ASN A 1 255 ? 131.974 -14.419 102.674 1.00 89.33 ? 255 ASN A C   1 
ATOM   2013 O  O   . ASN A 1 255 ? 132.100 -14.573 101.455 1.00 87.87 ? 255 ASN A O   1 
ATOM   2014 C  CB  . ASN A 1 255 ? 133.558 -13.126 104.149 1.00 89.16 ? 255 ASN A CB  1 
ATOM   2015 C  CG  . ASN A 1 255 ? 134.791 -13.259 103.271 1.00 88.55 ? 255 ASN A CG  1 
ATOM   2016 O  OD1 . ASN A 1 255 ? 135.827 -13.751 103.713 1.00 88.15 ? 255 ASN A OD1 1 
ATOM   2017 N  ND2 . ASN A 1 255 ? 134.689 -12.814 102.030 1.00 88.81 ? 255 ASN A ND2 1 
ATOM   2018 N  N   . ASP A 1 256 ? 131.498 -15.358 103.480 1.00 89.76 ? 256 ASP A N   1 
ATOM   2019 C  CA  . ASP A 1 256 ? 131.178 -16.692 103.012 1.00 90.61 ? 256 ASP A CA  1 
ATOM   2020 C  C   . ASP A 1 256 ? 130.073 -16.708 101.961 1.00 89.44 ? 256 ASP A C   1 
ATOM   2021 O  O   . ASP A 1 256 ? 130.190 -17.390 100.947 1.00 88.73 ? 256 ASP A O   1 
ATOM   2022 C  CB  . ASP A 1 256 ? 130.788 -17.588 104.198 1.00 92.90 ? 256 ASP A CB  1 
ATOM   2023 C  CG  . ASP A 1 256 ? 131.890 -17.691 105.262 1.00 95.51 ? 256 ASP A CG  1 
ATOM   2024 O  OD1 . ASP A 1 256 ? 133.085 -17.814 104.898 1.00 96.72 ? 256 ASP A OD1 1 
ATOM   2025 O  OD2 . ASP A 1 256 ? 131.549 -17.671 106.468 1.00 94.69 ? 256 ASP A OD2 1 
ATOM   2026 N  N   . ILE A 1 257 ? 129.006 -15.953 102.199 1.00 89.21 ? 257 ILE A N   1 
ATOM   2027 C  CA  . ILE A 1 257 ? 127.884 -15.902 101.267 1.00 89.95 ? 257 ILE A CA  1 
ATOM   2028 C  C   . ILE A 1 257 ? 128.377 -15.440 99.921  1.00 90.94 ? 257 ILE A C   1 
ATOM   2029 O  O   . ILE A 1 257 ? 128.098 -16.067 98.897  1.00 90.91 ? 257 ILE A O   1 
ATOM   2030 C  CB  . ILE A 1 257 ? 126.786 -14.937 101.748 1.00 89.83 ? 257 ILE A CB  1 
ATOM   2031 C  CG1 . ILE A 1 257 ? 126.220 -15.439 103.074 1.00 91.14 ? 257 ILE A CG1 1 
ATOM   2032 C  CG2 . ILE A 1 257 ? 125.683 -14.808 100.703 1.00 89.75 ? 257 ILE A CG2 1 
ATOM   2033 C  CD1 . ILE A 1 257 ? 126.025 -16.954 103.112 1.00 92.05 ? 257 ILE A CD1 1 
ATOM   2034 N  N   . GLN A 1 258 ? 129.136 -14.350 99.945  1.00 91.15 ? 258 GLN A N   1 
ATOM   2035 C  CA  . GLN A 1 258 ? 129.715 -13.759 98.743  1.00 90.69 ? 258 GLN A CA  1 
ATOM   2036 C  C   . GLN A 1 258 ? 130.516 -14.850 98.036  1.00 88.30 ? 258 GLN A C   1 
ATOM   2037 O  O   . GLN A 1 258 ? 130.291 -15.143 96.858  1.00 86.93 ? 258 GLN A O   1 
ATOM   2038 C  CB  . GLN A 1 258 ? 130.654 -12.617 99.137  1.00 93.48 ? 258 GLN A CB  1 
ATOM   2039 C  CG  . GLN A 1 258 ? 130.065 -11.611 100.121 1.00 96.42 ? 258 GLN A CG  1 
ATOM   2040 C  CD  . GLN A 1 258 ? 131.147 -10.827 100.865 1.00 98.61 ? 258 GLN A CD  1 
ATOM   2041 O  OE1 . GLN A 1 258 ? 132.303 -11.257 100.945 1.00 99.90 ? 258 GLN A OE1 1 
ATOM   2042 N  NE2 . GLN A 1 258 ? 130.771 -9.685  101.429 1.00 98.96 ? 258 GLN A NE2 1 
ATOM   2043 N  N   . LYS A 1 259 ? 131.427 -15.464 98.788  1.00 86.21 ? 259 LYS A N   1 
ATOM   2044 C  CA  . LYS A 1 259 ? 132.264 -16.541 98.281  1.00 83.45 ? 259 LYS A CA  1 
ATOM   2045 C  C   . LYS A 1 259 ? 131.409 -17.645 97.674  1.00 82.99 ? 259 LYS A C   1 
ATOM   2046 O  O   . LYS A 1 259 ? 131.730 -18.174 96.609  1.00 83.75 ? 259 LYS A O   1 
ATOM   2047 C  CB  . LYS A 1 259 ? 133.140 -17.112 99.401  1.00 82.07 ? 259 LYS A CB  1 
ATOM   2048 C  CG  . LYS A 1 259 ? 134.382 -16.284 99.693  1.00 81.41 ? 259 LYS A CG  1 
ATOM   2049 C  CD  . LYS A 1 259 ? 135.187 -16.854 100.854 1.00 80.75 ? 259 LYS A CD  1 
ATOM   2050 C  CE  . LYS A 1 259 ? 134.491 -16.576 102.166 1.00 80.26 ? 259 LYS A CE  1 
ATOM   2051 N  NZ  . LYS A 1 259 ? 135.291 -16.932 103.361 1.00 80.48 ? 259 LYS A NZ  1 
ATOM   2052 N  N   . LEU A 1 260 ? 130.299 -17.964 98.331  1.00 80.01 ? 260 LEU A N   1 
ATOM   2053 C  CA  . LEU A 1 260 ? 129.406 -19.005 97.846  1.00 77.56 ? 260 LEU A CA  1 
ATOM   2054 C  C   . LEU A 1 260 ? 128.907 -18.570 96.486  1.00 74.98 ? 260 LEU A C   1 
ATOM   2055 O  O   . LEU A 1 260 ? 129.055 -19.292 95.499  1.00 73.98 ? 260 LEU A O   1 
ATOM   2056 C  CB  . LEU A 1 260 ? 128.220 -19.182 98.793  1.00 77.89 ? 260 LEU A CB  1 
ATOM   2057 C  CG  . LEU A 1 260 ? 127.372 -20.432 98.570  1.00 77.55 ? 260 LEU A CG  1 
ATOM   2058 C  CD1 . LEU A 1 260 ? 128.208 -21.682 98.856  1.00 75.98 ? 260 LEU A CD1 1 
ATOM   2059 C  CD2 . LEU A 1 260 ? 126.164 -20.373 99.478  1.00 77.42 ? 260 LEU A CD2 1 
ATOM   2060 N  N   . VAL A 1 261 ? 128.409 -17.338 96.448  1.00 73.41 ? 261 VAL A N   1 
ATOM   2061 C  CA  . VAL A 1 261 ? 127.864 -16.719 95.246  1.00 71.82 ? 261 VAL A CA  1 
ATOM   2062 C  C   . VAL A 1 261 ? 128.891 -16.623 94.108  1.00 70.44 ? 261 VAL A C   1 
ATOM   2063 O  O   . VAL A 1 261 ? 128.559 -16.821 92.939  1.00 69.76 ? 261 VAL A O   1 
ATOM   2064 C  CB  . VAL A 1 261 ? 127.261 -15.329 95.588  1.00 72.09 ? 261 VAL A CB  1 
ATOM   2065 C  CG1 . VAL A 1 261 ? 126.685 -14.659 94.341  1.00 72.33 ? 261 VAL A CG1 1 
ATOM   2066 C  CG2 . VAL A 1 261 ? 126.170 -15.486 96.647  1.00 71.23 ? 261 VAL A CG2 1 
ATOM   2067 N  N   . GLY A 1 262 ? 130.136 -16.317 94.442  1.00 69.36 ? 262 GLY A N   1 
ATOM   2068 C  CA  . GLY A 1 262 ? 131.159 -16.254 93.417  1.00 68.37 ? 262 GLY A CA  1 
ATOM   2069 C  C   . GLY A 1 262 ? 131.361 -17.666 92.901  1.00 67.72 ? 262 GLY A C   1 
ATOM   2070 O  O   . GLY A 1 262 ? 131.246 -17.924 91.699  1.00 66.52 ? 262 GLY A O   1 
ATOM   2071 N  N   . LYS A 1 263 ? 131.549 -18.592 93.840  1.00 67.34 ? 263 LYS A N   1 
ATOM   2072 C  CA  . LYS A 1 263 ? 131.763 -20.002 93.539  1.00 67.94 ? 263 LYS A CA  1 
ATOM   2073 C  C   . LYS A 1 263 ? 130.638 -20.569 92.723  1.00 68.04 ? 263 LYS A C   1 
ATOM   2074 O  O   . LYS A 1 263 ? 130.857 -21.408 91.853  1.00 68.06 ? 263 LYS A O   1 
ATOM   2075 C  CB  . LYS A 1 263 ? 131.929 -20.812 94.818  1.00 68.29 ? 263 LYS A CB  1 
ATOM   2076 C  CG  . LYS A 1 263 ? 133.220 -20.489 95.502  1.00 70.51 ? 263 LYS A CG  1 
ATOM   2077 C  CD  . LYS A 1 263 ? 133.505 -21.390 96.672  1.00 74.51 ? 263 LYS A CD  1 
ATOM   2078 C  CE  . LYS A 1 263 ? 134.950 -21.184 97.155  1.00 76.50 ? 263 LYS A CE  1 
ATOM   2079 N  NZ  . LYS A 1 263 ? 135.379 -22.184 98.184  1.00 77.08 ? 263 LYS A NZ  1 
ATOM   2080 N  N   . LEU A 1 264 ? 129.430 -20.096 92.997  1.00 68.59 ? 264 LEU A N   1 
ATOM   2081 C  CA  . LEU A 1 264 ? 128.249 -20.548 92.270  1.00 68.56 ? 264 LEU A CA  1 
ATOM   2082 C  C   . LEU A 1 264 ? 128.234 -20.039 90.806  1.00 67.74 ? 264 LEU A C   1 
ATOM   2083 O  O   . LEU A 1 264 ? 128.228 -20.843 89.860  1.00 67.89 ? 264 LEU A O   1 
ATOM   2084 C  CB  . LEU A 1 264 ? 126.962 -20.116 93.006  1.00 69.30 ? 264 LEU A CB  1 
ATOM   2085 C  CG  . LEU A 1 264 ? 126.696 -20.552 94.457  1.00 68.67 ? 264 LEU A CG  1 
ATOM   2086 C  CD1 . LEU A 1 264 ? 125.536 -19.741 94.991  1.00 67.42 ? 264 LEU A CD1 1 
ATOM   2087 C  CD2 . LEU A 1 264 ? 126.405 -22.047 94.558  1.00 68.27 ? 264 LEU A CD2 1 
ATOM   2088 N  N   . ASN A 1 265 ? 128.255 -18.714 90.630  1.00 66.00 ? 265 ASN A N   1 
ATOM   2089 C  CA  . ASN A 1 265 ? 128.227 -18.092 89.301  1.00 63.60 ? 265 ASN A CA  1 
ATOM   2090 C  C   . ASN A 1 265 ? 129.257 -18.716 88.387  1.00 63.61 ? 265 ASN A C   1 
ATOM   2091 O  O   . ASN A 1 265 ? 128.984 -18.995 87.219  1.00 62.50 ? 265 ASN A O   1 
ATOM   2092 C  CB  . ASN A 1 265 ? 128.523 -16.595 89.389  1.00 61.47 ? 265 ASN A CB  1 
ATOM   2093 C  CG  . ASN A 1 265 ? 127.432 -15.818 90.070  1.00 59.10 ? 265 ASN A CG  1 
ATOM   2094 O  OD1 . ASN A 1 265 ? 126.266 -15.881 89.686  1.00 56.55 ? 265 ASN A OD1 1 
ATOM   2095 N  ND2 . ASN A 1 265 ? 127.813 -15.051 91.081  1.00 58.84 ? 265 ASN A ND2 1 
ATOM   2096 N  N   . TRP A 1 266 ? 130.443 -18.941 88.940  1.00 63.17 ? 266 TRP A N   1 
ATOM   2097 C  CA  . TRP A 1 266 ? 131.545 -19.524 88.194  1.00 63.16 ? 266 TRP A CA  1 
ATOM   2098 C  C   . TRP A 1 266 ? 131.162 -20.818 87.471  1.00 60.89 ? 266 TRP A C   1 
ATOM   2099 O  O   . TRP A 1 266 ? 131.228 -20.900 86.246  1.00 60.83 ? 266 TRP A O   1 
ATOM   2100 C  CB  . TRP A 1 266 ? 132.745 -19.755 89.125  1.00 65.98 ? 266 TRP A CB  1 
ATOM   2101 C  CG  . TRP A 1 266 ? 133.941 -20.336 88.417  1.00 68.29 ? 266 TRP A CG  1 
ATOM   2102 C  CD1 . TRP A 1 266 ? 134.609 -21.490 88.735  1.00 68.54 ? 266 TRP A CD1 1 
ATOM   2103 C  CD2 . TRP A 1 266 ? 134.546 -19.841 87.209  1.00 70.12 ? 266 TRP A CD2 1 
ATOM   2104 N  NE1 . TRP A 1 266 ? 135.575 -21.745 87.795  1.00 69.52 ? 266 TRP A NE1 1 
ATOM   2105 C  CE2 . TRP A 1 266 ? 135.560 -20.756 86.846  1.00 70.52 ? 266 TRP A CE2 1 
ATOM   2106 C  CE3 . TRP A 1 266 ? 134.321 -18.718 86.396  1.00 70.56 ? 266 TRP A CE3 1 
ATOM   2107 C  CZ2 . TRP A 1 266 ? 136.355 -20.586 85.694  1.00 70.05 ? 266 TRP A CZ2 1 
ATOM   2108 C  CZ3 . TRP A 1 266 ? 135.111 -18.551 85.251  1.00 70.66 ? 266 TRP A CZ3 1 
ATOM   2109 C  CH2 . TRP A 1 266 ? 136.115 -19.483 84.913  1.00 69.92 ? 266 TRP A CH2 1 
ATOM   2110 N  N   . ALA A 1 267 ? 130.684 -21.799 88.222  1.00 58.77 ? 267 ALA A N   1 
ATOM   2111 C  CA  . ALA A 1 267 ? 130.308 -23.078 87.645  1.00 56.42 ? 267 ALA A CA  1 
ATOM   2112 C  C   . ALA A 1 267 ? 129.157 -23.033 86.629  1.00 55.03 ? 267 ALA A C   1 
ATOM   2113 O  O   . ALA A 1 267 ? 129.095 -23.867 85.716  1.00 54.67 ? 267 ALA A O   1 
ATOM   2114 C  CB  . ALA A 1 267 ? 129.988 -24.044 88.753  1.00 56.79 ? 267 ALA A CB  1 
ATOM   2115 N  N   . SER A 1 268 ? 128.282 -22.038 86.767  1.00 54.04 ? 268 SER A N   1 
ATOM   2116 C  CA  . SER A 1 268 ? 127.096 -21.859 85.912  1.00 54.11 ? 268 SER A CA  1 
ATOM   2117 C  C   . SER A 1 268 ? 127.358 -22.007 84.419  1.00 54.42 ? 268 SER A C   1 
ATOM   2118 O  O   . SER A 1 268 ? 126.534 -22.553 83.658  1.00 52.68 ? 268 SER A O   1 
ATOM   2119 C  CB  . SER A 1 268 ? 126.479 -20.480 86.173  1.00 53.98 ? 268 SER A CB  1 
ATOM   2120 O  OG  . SER A 1 268 ? 126.584 -20.116 87.541  1.00 52.63 ? 268 SER A OG  1 
ATOM   2121 N  N   . GLN A 1 269 ? 128.503 -21.469 84.015  1.00 54.44 ? 269 GLN A N   1 
ATOM   2122 C  CA  . GLN A 1 269 ? 128.936 -21.504 82.635  1.00 55.02 ? 269 GLN A CA  1 
ATOM   2123 C  C   . GLN A 1 269 ? 128.704 -22.898 82.122  1.00 53.63 ? 269 GLN A C   1 
ATOM   2124 O  O   . GLN A 1 269 ? 128.041 -23.096 81.132  1.00 51.44 ? 269 GLN A O   1 
ATOM   2125 C  CB  . GLN A 1 269 ? 130.441 -21.241 82.522  1.00 58.41 ? 269 GLN A CB  1 
ATOM   2126 C  CG  . GLN A 1 269 ? 130.989 -19.966 83.163  1.00 62.97 ? 269 GLN A CG  1 
ATOM   2127 C  CD  . GLN A 1 269 ? 132.528 -19.882 83.063  1.00 65.61 ? 269 GLN A CD  1 
ATOM   2128 O  OE1 . GLN A 1 269 ? 133.243 -20.814 83.445  1.00 66.08 ? 269 GLN A OE1 1 
ATOM   2129 N  NE2 . GLN A 1 269 ? 133.033 -18.773 82.524  1.00 67.68 ? 269 GLN A NE2 1 
ATOM   2130 N  N   . ILE A 1 270 ? 129.222 -23.874 82.851  1.00 52.76 ? 270 ILE A N   1 
ATOM   2131 C  CA  . ILE A 1 270 ? 129.112 -25.251 82.430  1.00 50.61 ? 270 ILE A CA  1 
ATOM   2132 C  C   . ILE A 1 270 ? 127.946 -26.025 83.022  1.00 50.26 ? 270 ILE A C   1 
ATOM   2133 O  O   . ILE A 1 270 ? 127.284 -26.791 82.327  1.00 48.56 ? 270 ILE A O   1 
ATOM   2134 C  CB  . ILE A 1 270 ? 130.441 -25.979 82.670  1.00 47.46 ? 270 ILE A CB  1 
ATOM   2135 C  CG1 . ILE A 1 270 ? 130.361 -27.395 82.106  1.00 45.91 ? 270 ILE A CG1 1 
ATOM   2136 C  CG2 . ILE A 1 270 ? 130.823 -25.915 84.132  1.00 45.83 ? 270 ILE A CG2 1 
ATOM   2137 C  CD1 . ILE A 1 270 ? 130.001 -27.422 80.625  1.00 43.65 ? 270 ILE A CD1 1 
ATOM   2138 N  N   . TYR A 1 271 ? 127.708 -25.828 84.307  1.00 51.93 ? 271 TYR A N   1 
ATOM   2139 C  CA  . TYR A 1 271 ? 126.635 -26.520 84.987  1.00 54.31 ? 271 TYR A CA  1 
ATOM   2140 C  C   . TYR A 1 271 ? 125.298 -25.926 84.624  1.00 54.35 ? 271 TYR A C   1 
ATOM   2141 O  O   . TYR A 1 271 ? 124.989 -24.787 84.969  1.00 53.11 ? 271 TYR A O   1 
ATOM   2142 C  CB  . TYR A 1 271 ? 126.866 -26.480 86.484  1.00 57.37 ? 271 TYR A CB  1 
ATOM   2143 C  CG  . TYR A 1 271 ? 128.052 -27.314 86.930  1.00 61.03 ? 271 TYR A CG  1 
ATOM   2144 C  CD1 . TYR A 1 271 ? 128.311 -28.571 86.363  1.00 63.96 ? 271 TYR A CD1 1 
ATOM   2145 C  CD2 . TYR A 1 271 ? 128.863 -26.896 87.985  1.00 63.31 ? 271 TYR A CD2 1 
ATOM   2146 C  CE1 . TYR A 1 271 ? 129.352 -29.400 86.854  1.00 64.68 ? 271 TYR A CE1 1 
ATOM   2147 C  CE2 . TYR A 1 271 ? 129.902 -27.710 88.489  1.00 65.03 ? 271 TYR A CE2 1 
ATOM   2148 C  CZ  . TYR A 1 271 ? 130.140 -28.963 87.925  1.00 65.75 ? 271 TYR A CZ  1 
ATOM   2149 O  OH  . TYR A 1 271 ? 131.131 -29.779 88.464  1.00 66.31 ? 271 TYR A OH  1 
ATOM   2150 N  N   . PRO A 1 272 ? 124.476 -26.703 83.917  1.00 56.47 ? 272 PRO A N   1 
ATOM   2151 C  CA  . PRO A 1 272 ? 123.155 -26.245 83.495  1.00 58.93 ? 272 PRO A CA  1 
ATOM   2152 C  C   . PRO A 1 272 ? 122.147 -26.147 84.632  1.00 61.19 ? 272 PRO A C   1 
ATOM   2153 O  O   . PRO A 1 272 ? 121.659 -27.179 85.112  1.00 62.12 ? 272 PRO A O   1 
ATOM   2154 C  CB  . PRO A 1 272 ? 122.723 -27.314 82.470  1.00 57.54 ? 272 PRO A CB  1 
ATOM   2155 C  CG  . PRO A 1 272 ? 124.001 -27.991 82.072  1.00 58.13 ? 272 PRO A CG  1 
ATOM   2156 C  CD  . PRO A 1 272 ? 124.756 -28.040 83.373  1.00 57.14 ? 272 PRO A CD  1 
ATOM   2157 N  N   . GLY A 1 273 ? 121.867 -24.926 85.094  1.00 61.80 ? 273 GLY A N   1 
ATOM   2158 C  CA  . GLY A 1 273 ? 120.861 -24.763 86.132  1.00 62.10 ? 273 GLY A CA  1 
ATOM   2159 C  C   . GLY A 1 273 ? 121.064 -23.831 87.308  1.00 61.99 ? 273 GLY A C   1 
ATOM   2160 O  O   . GLY A 1 273 ? 120.146 -23.111 87.680  1.00 62.72 ? 273 GLY A O   1 
ATOM   2161 N  N   . ILE A 1 274 ? 122.237 -23.878 87.923  1.00 62.34 ? 274 ILE A N   1 
ATOM   2162 C  CA  . ILE A 1 274 ? 122.546 -23.059 89.094  1.00 62.71 ? 274 ILE A CA  1 
ATOM   2163 C  C   . ILE A 1 274 ? 121.731 -21.777 89.314  1.00 63.97 ? 274 ILE A C   1 
ATOM   2164 O  O   . ILE A 1 274 ? 121.519 -20.989 88.393  1.00 63.82 ? 274 ILE A O   1 
ATOM   2165 C  CB  . ILE A 1 274 ? 124.026 -22.722 89.112  1.00 62.43 ? 274 ILE A CB  1 
ATOM   2166 C  CG1 . ILE A 1 274 ? 124.826 -24.009 88.927  1.00 62.55 ? 274 ILE A CG1 1 
ATOM   2167 C  CG2 . ILE A 1 274 ? 124.397 -22.011 90.415  1.00 61.51 ? 274 ILE A CG2 1 
ATOM   2168 C  CD1 . ILE A 1 274 ? 126.281 -23.781 88.720  1.00 63.74 ? 274 ILE A CD1 1 
ATOM   2169 N  N   . LYS A 1 275 ? 121.279 -21.592 90.553  1.00 65.72 ? 275 LYS A N   1 
ATOM   2170 C  CA  . LYS A 1 275 ? 120.493 -20.427 90.956  1.00 66.51 ? 275 LYS A CA  1 
ATOM   2171 C  C   . LYS A 1 275 ? 121.276 -19.688 92.041  1.00 66.69 ? 275 LYS A C   1 
ATOM   2172 O  O   . LYS A 1 275 ? 122.120 -20.285 92.716  1.00 64.76 ? 275 LYS A O   1 
ATOM   2173 C  CB  . LYS A 1 275 ? 119.156 -20.883 91.558  1.00 67.93 ? 275 LYS A CB  1 
ATOM   2174 C  CG  . LYS A 1 275 ? 118.361 -21.887 90.726  1.00 70.25 ? 275 LYS A CG  1 
ATOM   2175 C  CD  . LYS A 1 275 ? 117.062 -22.288 91.440  1.00 72.64 ? 275 LYS A CD  1 
ATOM   2176 C  CE  . LYS A 1 275 ? 116.150 -23.148 90.553  1.00 73.27 ? 275 LYS A CE  1 
ATOM   2177 N  NZ  . LYS A 1 275 ? 114.915 -23.664 91.240  1.00 73.25 ? 275 LYS A NZ  1 
ATOM   2178 N  N   . VAL A 1 276 ? 121.043 -18.386 92.186  1.00 68.78 ? 276 VAL A N   1 
ATOM   2179 C  CA  . VAL A 1 276 ? 121.725 -17.616 93.238  1.00 71.66 ? 276 VAL A CA  1 
ATOM   2180 C  C   . VAL A 1 276 ? 120.919 -16.409 93.784  1.00 73.82 ? 276 VAL A C   1 
ATOM   2181 O  O   . VAL A 1 276 ? 121.374 -15.739 94.720  1.00 73.83 ? 276 VAL A O   1 
ATOM   2182 C  CB  . VAL A 1 276 ? 123.145 -17.104 92.806  1.00 71.05 ? 276 VAL A CB  1 
ATOM   2183 C  CG1 . VAL A 1 276 ? 123.981 -16.790 94.029  1.00 69.41 ? 276 VAL A CG1 1 
ATOM   2184 C  CG2 . VAL A 1 276 ? 123.879 -18.117 91.945  1.00 70.82 ? 276 VAL A CG2 1 
ATOM   2185 N  N   . ARG A 1 277 ? 119.717 -16.176 93.235  1.00 75.42 ? 277 ARG A N   1 
ATOM   2186 C  CA  . ARG A 1 277 ? 118.815 -15.056 93.617  1.00 76.31 ? 277 ARG A CA  1 
ATOM   2187 C  C   . ARG A 1 277 ? 118.801 -14.638 95.095  1.00 75.68 ? 277 ARG A C   1 
ATOM   2188 O  O   . ARG A 1 277 ? 119.128 -13.495 95.428  1.00 76.02 ? 277 ARG A O   1 
ATOM   2189 C  CB  . ARG A 1 277 ? 117.366 -15.360 93.176  1.00 78.49 ? 277 ARG A CB  1 
ATOM   2190 C  CG  . ARG A 1 277 ? 116.288 -14.394 93.714  1.00 82.30 ? 277 ARG A CG  1 
ATOM   2191 C  CD  . ARG A 1 277 ? 114.867 -14.998 93.604  1.00 85.27 ? 277 ARG A CD  1 
ATOM   2192 N  NE  . ARG A 1 277 ? 113.870 -14.244 94.376  1.00 87.53 ? 277 ARG A NE  1 
ATOM   2193 C  CZ  . ARG A 1 277 ? 113.174 -13.211 93.904  1.00 87.66 ? 277 ARG A CZ  1 
ATOM   2194 N  NH1 . ARG A 1 277 ? 113.358 -12.803 92.652  1.00 89.22 ? 277 ARG A NH1 1 
ATOM   2195 N  NH2 . ARG A 1 277 ? 112.310 -12.568 94.686  1.00 87.99 ? 277 ARG A NH2 1 
ATOM   2196 N  N   . GLN A 1 278 ? 118.382 -15.569 95.953  1.00 74.56 ? 278 GLN A N   1 
ATOM   2197 C  CA  . GLN A 1 278 ? 118.279 -15.340 97.393  1.00 71.40 ? 278 GLN A CA  1 
ATOM   2198 C  C   . GLN A 1 278 ? 119.642 -15.057 98.025  1.00 69.85 ? 278 GLN A C   1 
ATOM   2199 O  O   . GLN A 1 278 ? 119.866 -13.954 98.517  1.00 69.71 ? 278 GLN A O   1 
ATOM   2200 C  CB  . GLN A 1 278 ? 117.584 -16.528 98.082  1.00 70.29 ? 278 GLN A CB  1 
ATOM   2201 C  CG  . GLN A 1 278 ? 116.385 -17.132 97.307  1.00 68.69 ? 278 GLN A CG  1 
ATOM   2202 C  CD  . GLN A 1 278 ? 115.229 -16.158 97.039  1.00 67.53 ? 278 GLN A CD  1 
ATOM   2203 O  OE1 . GLN A 1 278 ? 115.334 -14.955 97.282  1.00 67.61 ? 278 GLN A OE1 1 
ATOM   2204 N  NE2 . GLN A 1 278 ? 114.122 -16.686 96.527  1.00 66.01 ? 278 GLN A NE2 1 
ATOM   2205 N  N   . LEU A 1 279 ? 120.556 -16.030 97.960  1.00 68.71 ? 279 LEU A N   1 
ATOM   2206 C  CA  . LEU A 1 279 ? 121.916 -15.898 98.523  1.00 67.69 ? 279 LEU A CA  1 
ATOM   2207 C  C   . LEU A 1 279 ? 122.500 -14.516 98.236  1.00 66.49 ? 279 LEU A C   1 
ATOM   2208 O  O   . LEU A 1 279 ? 123.205 -13.923 99.067  1.00 64.85 ? 279 LEU A O   1 
ATOM   2209 C  CB  . LEU A 1 279 ? 122.846 -16.958 97.911  1.00 69.62 ? 279 LEU A CB  1 
ATOM   2210 C  CG  . LEU A 1 279 ? 122.517 -18.438 98.141  1.00 70.22 ? 279 LEU A CG  1 
ATOM   2211 C  CD1 . LEU A 1 279 ? 123.517 -19.335 97.437  1.00 69.71 ? 279 LEU A CD1 1 
ATOM   2212 C  CD2 . LEU A 1 279 ? 122.540 -18.721 99.624  1.00 71.21 ? 279 LEU A CD2 1 
ATOM   2213 N  N   . SER A 1 280 ? 122.189 -14.028 97.038  1.00 64.97 ? 280 SER A N   1 
ATOM   2214 C  CA  . SER A 1 280 ? 122.636 -12.734 96.567  1.00 62.66 ? 280 SER A CA  1 
ATOM   2215 C  C   . SER A 1 280 ? 121.778 -11.639 97.180  1.00 61.04 ? 280 SER A C   1 
ATOM   2216 O  O   . SER A 1 280 ? 122.292 -10.769 97.891  1.00 61.59 ? 280 SER A O   1 
ATOM   2217 C  CB  . SER A 1 280 ? 122.568 -12.694 95.038  1.00 62.87 ? 280 SER A CB  1 
ATOM   2218 O  OG  . SER A 1 280 ? 123.404 -13.694 94.462  1.00 63.95 ? 280 SER A OG  1 
ATOM   2219 N  N   . LYS A 1 281 ? 120.466 -11.733 96.972  1.00 58.23 ? 281 LYS A N   1 
ATOM   2220 C  CA  . LYS A 1 281 ? 119.516 -10.755 97.497  1.00 56.26 ? 281 LYS A CA  1 
ATOM   2221 C  C   . LYS A 1 281 ? 119.838 -10.490 98.958  1.00 55.19 ? 281 LYS A C   1 
ATOM   2222 O  O   . LYS A 1 281 ? 119.722 -9.366  99.441  1.00 53.23 ? 281 LYS A O   1 
ATOM   2223 C  CB  . LYS A 1 281 ? 118.093 -11.283 97.350  1.00 54.78 ? 281 LYS A CB  1 
ATOM   2224 N  N   . LEU A 1 282 ? 120.326 -11.537 99.617  1.00 56.14 ? 282 LEU A N   1 
ATOM   2225 C  CA  . LEU A 1 282 ? 120.708 -11.531 101.023 1.00 57.09 ? 282 LEU A CA  1 
ATOM   2226 C  C   . LEU A 1 282 ? 121.900 -10.628 101.273 1.00 58.06 ? 282 LEU A C   1 
ATOM   2227 O  O   . LEU A 1 282 ? 121.848 -9.733  102.134 1.00 58.31 ? 282 LEU A O   1 
ATOM   2228 C  CB  . LEU A 1 282 ? 121.043 -12.952 101.469 1.00 56.20 ? 282 LEU A CB  1 
ATOM   2229 N  N   . LEU A 1 283 ? 122.975 -10.878 100.523 1.00 59.63 ? 283 LEU A N   1 
ATOM   2230 C  CA  . LEU A 1 283 ? 124.219 -10.122 100.624 1.00 60.35 ? 283 LEU A CA  1 
ATOM   2231 C  C   . LEU A 1 283 ? 123.972 -8.612  100.631 1.00 61.99 ? 283 LEU A C   1 
ATOM   2232 O  O   . LEU A 1 283 ? 124.786 -7.848  101.159 1.00 61.99 ? 283 LEU A O   1 
ATOM   2233 C  CB  . LEU A 1 283 ? 125.145 -10.510 99.485  1.00 58.72 ? 283 LEU A CB  1 
ATOM   2234 N  N   . ARG A 1 284 ? 122.811 -8.210  100.114 1.00 64.66 ? 284 ARG A N   1 
ATOM   2235 C  CA  . ARG A 1 284 ? 122.381 -6.814  100.024 1.00 67.33 ? 284 ARG A CA  1 
ATOM   2236 C  C   . ARG A 1 284 ? 122.732 -5.890  101.205 1.00 68.92 ? 284 ARG A C   1 
ATOM   2237 O  O   . ARG A 1 284 ? 122.619 -4.662  101.090 1.00 70.42 ? 284 ARG A O   1 
ATOM   2238 C  CB  . ARG A 1 284 ? 120.884 -6.753  99.756  1.00 66.34 ? 284 ARG A CB  1 
ATOM   2239 N  N   . GLY A 1 285 ? 123.078 -6.463  102.349 1.00 68.47 ? 285 GLY A N   1 
ATOM   2240 C  CA  . GLY A 1 285 ? 123.450 -5.638  103.472 1.00 70.75 ? 285 GLY A CA  1 
ATOM   2241 C  C   . GLY A 1 285 ? 124.686 -4.814  103.132 1.00 72.82 ? 285 GLY A C   1 
ATOM   2242 O  O   . GLY A 1 285 ? 125.365 -5.068  102.134 1.00 72.03 ? 285 GLY A O   1 
ATOM   2243 N  N   . THR A 1 286 ? 124.938 -3.775  103.922 1.00 75.31 ? 286 THR A N   1 
ATOM   2244 C  CA  . THR A 1 286 ? 126.100 -2.914  103.728 1.00 76.48 ? 286 THR A CA  1 
ATOM   2245 C  C   . THR A 1 286 ? 127.316 -3.383  104.552 1.00 77.54 ? 286 THR A C   1 
ATOM   2246 O  O   . THR A 1 286 ? 127.201 -4.228  105.444 1.00 76.62 ? 286 THR A O   1 
ATOM   2247 C  CB  . THR A 1 286 ? 125.740 -1.460  104.061 1.00 76.24 ? 286 THR A CB  1 
ATOM   2248 N  N   . LYS A 1 287 ? 128.462 -2.781  104.234 1.00 79.87 ? 287 LYS A N   1 
ATOM   2249 C  CA  . LYS A 1 287 ? 129.814 -2.993  104.817 1.00 81.18 ? 287 LYS A CA  1 
ATOM   2250 C  C   . LYS A 1 287 ? 130.290 -4.038  105.855 1.00 81.91 ? 287 LYS A C   1 
ATOM   2251 O  O   . LYS A 1 287 ? 131.442 -4.475  105.772 1.00 82.00 ? 287 LYS A O   1 
ATOM   2252 C  CB  . LYS A 1 287 ? 130.425 -1.618  105.176 1.00 81.94 ? 287 LYS A CB  1 
ATOM   2253 N  N   . ALA A 1 288 ? 129.475 -4.401  106.841 1.00 81.29 ? 288 ALA A N   1 
ATOM   2254 C  CA  . ALA A 1 288 ? 129.927 -5.354  107.853 1.00 81.04 ? 288 ALA A CA  1 
ATOM   2255 C  C   . ALA A 1 288 ? 130.125 -6.753  107.269 1.00 80.52 ? 288 ALA A C   1 
ATOM   2256 O  O   . ALA A 1 288 ? 129.155 -7.454  107.006 1.00 80.73 ? 288 ALA A O   1 
ATOM   2257 C  CB  . ALA A 1 288 ? 128.945 -5.395  109.028 1.00 81.29 ? 288 ALA A CB  1 
ATOM   2258 N  N   . LEU A 1 289 ? 131.380 -7.177  107.129 1.00 80.84 ? 289 LEU A N   1 
ATOM   2259 C  CA  . LEU A 1 289 ? 131.688 -8.501  106.579 1.00 81.41 ? 289 LEU A CA  1 
ATOM   2260 C  C   . LEU A 1 289 ? 131.945 -9.595  107.623 1.00 81.14 ? 289 LEU A C   1 
ATOM   2261 O  O   . LEU A 1 289 ? 131.787 -10.791 107.334 1.00 80.52 ? 289 LEU A O   1 
ATOM   2262 C  CB  . LEU A 1 289 ? 132.876 -8.419  105.618 1.00 82.48 ? 289 LEU A CB  1 
ATOM   2263 N  N   . THR A 1 290 ? 132.371 -9.184  108.816 1.00 80.76 ? 290 THR A N   1 
ATOM   2264 C  CA  . THR A 1 290 ? 132.672 -10.110 109.912 1.00 79.88 ? 290 THR A CA  1 
ATOM   2265 C  C   . THR A 1 290 ? 131.428 -10.595 110.679 1.00 79.60 ? 290 THR A C   1 
ATOM   2266 O  O   . THR A 1 290 ? 131.523 -11.442 111.586 1.00 79.70 ? 290 THR A O   1 
ATOM   2267 C  CB  . THR A 1 290 ? 133.682 -9.476  110.864 1.00 79.48 ? 290 THR A CB  1 
ATOM   2268 N  N   . GLU A 1 291 ? 130.271 -10.032 110.328 1.00 79.23 ? 291 GLU A N   1 
ATOM   2269 C  CA  . GLU A 1 291 ? 128.994 -10.394 110.942 1.00 78.39 ? 291 GLU A CA  1 
ATOM   2270 C  C   . GLU A 1 291 ? 128.435 -11.658 110.266 1.00 77.79 ? 291 GLU A C   1 
ATOM   2271 O  O   . GLU A 1 291 ? 128.811 -11.992 109.134 1.00 77.34 ? 291 GLU A O   1 
ATOM   2272 C  CB  . GLU A 1 291 ? 127.997 -9.231  110.809 1.00 77.65 ? 291 GLU A CB  1 
ATOM   2273 N  N   . VAL A 1 292 ? 127.545 -12.357 110.967 1.00 76.32 ? 292 VAL A N   1 
ATOM   2274 C  CA  . VAL A 1 292 ? 126.925 -13.573 110.450 1.00 74.49 ? 292 VAL A CA  1 
ATOM   2275 C  C   . VAL A 1 292 ? 125.599 -13.259 109.743 1.00 73.87 ? 292 VAL A C   1 
ATOM   2276 O  O   . VAL A 1 292 ? 124.784 -12.472 110.236 1.00 73.02 ? 292 VAL A O   1 
ATOM   2277 C  CB  . VAL A 1 292 ? 126.719 -14.573 111.575 1.00 73.55 ? 292 VAL A CB  1 
ATOM   2278 N  N   . ILE A 1 293 ? 125.395 -13.886 108.586 1.00 73.91 ? 293 ILE A N   1 
ATOM   2279 C  CA  . ILE A 1 293 ? 124.199 -13.672 107.777 1.00 74.28 ? 293 ILE A CA  1 
ATOM   2280 C  C   . ILE A 1 293 ? 123.135 -14.767 107.914 1.00 74.78 ? 293 ILE A C   1 
ATOM   2281 O  O   . ILE A 1 293 ? 123.343 -15.913 107.493 1.00 73.95 ? 293 ILE A O   1 
ATOM   2282 C  CB  . ILE A 1 293 ? 124.589 -13.501 106.320 1.00 74.70 ? 293 ILE A CB  1 
ATOM   2283 N  N   . PRO A 1 294 ? 121.957 -14.405 108.470 1.00 75.26 ? 294 PRO A N   1 
ATOM   2284 C  CA  . PRO A 1 294 ? 120.772 -15.243 108.720 1.00 74.77 ? 294 PRO A CA  1 
ATOM   2285 C  C   . PRO A 1 294 ? 120.153 -15.877 107.472 1.00 74.67 ? 294 PRO A C   1 
ATOM   2286 O  O   . PRO A 1 294 ? 119.049 -15.498 107.056 1.00 73.69 ? 294 PRO A O   1 
ATOM   2287 C  CB  . PRO A 1 294 ? 119.794 -14.259 109.372 1.00 74.73 ? 294 PRO A CB  1 
ATOM   2288 C  CG  . PRO A 1 294 ? 120.695 -13.294 110.071 1.00 74.40 ? 294 PRO A CG  1 
ATOM   2289 C  CD  . PRO A 1 294 ? 121.753 -13.053 109.027 1.00 75.26 ? 294 PRO A CD  1 
ATOM   2290 N  N   . LEU A 1 295 ? 120.862 -16.834 106.878 1.00 75.00 ? 295 LEU A N   1 
ATOM   2291 C  CA  . LEU A 1 295 ? 120.358 -17.515 105.691 1.00 75.75 ? 295 LEU A CA  1 
ATOM   2292 C  C   . LEU A 1 295 ? 118.982 -18.036 106.010 1.00 75.88 ? 295 LEU A C   1 
ATOM   2293 O  O   . LEU A 1 295 ? 118.839 -19.028 106.724 1.00 76.56 ? 295 LEU A O   1 
ATOM   2294 C  CB  . LEU A 1 295 ? 121.257 -18.691 105.293 1.00 75.90 ? 295 LEU A CB  1 
ATOM   2295 C  CG  . LEU A 1 295 ? 122.397 -18.383 104.322 1.00 74.81 ? 295 LEU A CG  1 
ATOM   2296 C  CD1 . LEU A 1 295 ? 123.359 -17.401 104.964 1.00 74.40 ? 295 LEU A CD1 1 
ATOM   2297 C  CD2 . LEU A 1 295 ? 123.110 -19.665 103.946 1.00 73.62 ? 295 LEU A CD2 1 
ATOM   2298 N  N   . THR A 1 296 ? 117.971 -17.323 105.542 1.00 76.74 ? 296 THR A N   1 
ATOM   2299 C  CA  . THR A 1 296 ? 116.608 -17.746 105.792 1.00 78.27 ? 296 THR A CA  1 
ATOM   2300 C  C   . THR A 1 296 ? 116.327 -18.995 104.942 1.00 79.45 ? 296 THR A C   1 
ATOM   2301 O  O   . THR A 1 296 ? 117.161 -19.402 104.124 1.00 79.43 ? 296 THR A O   1 
ATOM   2302 C  CB  . THR A 1 296 ? 115.594 -16.607 105.510 1.00 78.12 ? 296 THR A CB  1 
ATOM   2303 O  OG1 . THR A 1 296 ? 115.101 -16.700 104.164 1.00 77.14 ? 296 THR A OG1 1 
ATOM   2304 C  CG2 . THR A 1 296 ? 116.249 -15.240 105.738 1.00 77.69 ? 296 THR A CG2 1 
ATOM   2305 N  N   . GLU A 1 297 ? 115.151 -19.591 105.134 1.00 80.40 ? 297 GLU A N   1 
ATOM   2306 C  CA  . GLU A 1 297 ? 114.748 -20.814 104.429 1.00 80.63 ? 297 GLU A CA  1 
ATOM   2307 C  C   . GLU A 1 297 ? 114.816 -20.751 102.906 1.00 79.74 ? 297 GLU A C   1 
ATOM   2308 O  O   . GLU A 1 297 ? 115.344 -21.667 102.264 1.00 78.69 ? 297 GLU A O   1 
ATOM   2309 C  CB  . GLU A 1 297 ? 113.345 -21.247 104.884 1.00 81.65 ? 297 GLU A CB  1 
ATOM   2310 N  N   . GLU A 1 298 ? 114.247 -19.693 102.335 1.00 80.15 ? 298 GLU A N   1 
ATOM   2311 C  CA  . GLU A 1 298 ? 114.248 -19.506 100.884 1.00 80.92 ? 298 GLU A CA  1 
ATOM   2312 C  C   . GLU A 1 298 ? 115.673 -19.673 100.358 1.00 81.05 ? 298 GLU A C   1 
ATOM   2313 O  O   . GLU A 1 298 ? 115.893 -20.215 99.264  1.00 80.52 ? 298 GLU A O   1 
ATOM   2314 C  CB  . GLU A 1 298 ? 113.705 -18.121 100.533 1.00 81.50 ? 298 GLU A CB  1 
ATOM   2315 N  N   . ALA A 1 299 ? 116.630 -19.207 101.159 1.00 80.27 ? 299 ALA A N   1 
ATOM   2316 C  CA  . ALA A 1 299 ? 118.044 -19.311 100.829 1.00 79.59 ? 299 ALA A CA  1 
ATOM   2317 C  C   . ALA A 1 299 ? 118.456 -20.793 100.828 1.00 79.36 ? 299 ALA A C   1 
ATOM   2318 O  O   . ALA A 1 299 ? 118.763 -21.359 99.769  1.00 79.60 ? 299 ALA A O   1 
ATOM   2319 C  CB  . ALA A 1 299 ? 118.885 -18.512 101.838 1.00 78.91 ? 299 ALA A CB  1 
ATOM   2320 N  N   . GLU A 1 300 ? 118.394 -21.428 102.002 1.00 78.71 ? 300 GLU A N   1 
ATOM   2321 C  CA  . GLU A 1 300 ? 118.767 -22.840 102.154 1.00 76.34 ? 300 GLU A CA  1 
ATOM   2322 C  C   . GLU A 1 300 ? 118.257 -23.705 101.006 1.00 75.13 ? 300 GLU A C   1 
ATOM   2323 O  O   . GLU A 1 300 ? 119.005 -24.538 100.481 1.00 74.87 ? 300 GLU A O   1 
ATOM   2324 C  CB  . GLU A 1 300 ? 118.281 -23.389 103.502 1.00 76.81 ? 300 GLU A CB  1 
ATOM   2325 N  N   . LEU A 1 301 ? 117.015 -23.461 100.585 1.00 72.86 ? 301 LEU A N   1 
ATOM   2326 C  CA  . LEU A 1 301 ? 116.403 -24.208 99.485  1.00 72.45 ? 301 LEU A CA  1 
ATOM   2327 C  C   . LEU A 1 301 ? 117.283 -24.188 98.233  1.00 71.30 ? 301 LEU A C   1 
ATOM   2328 O  O   . LEU A 1 301 ? 117.784 -25.228 97.807  1.00 69.91 ? 301 LEU A O   1 
ATOM   2329 C  CB  . LEU A 1 301 ? 115.008 -23.653 99.169  1.00 71.66 ? 301 LEU A CB  1 
ATOM   2330 N  N   . GLU A 1 302 ? 117.521 -22.997 97.693  1.00 70.51 ? 302 GLU A N   1 
ATOM   2331 C  CA  . GLU A 1 302 ? 118.340 -22.850 96.498  1.00 68.93 ? 302 GLU A CA  1 
ATOM   2332 C  C   . GLU A 1 302 ? 119.731 -23.413 96.729  1.00 68.61 ? 302 GLU A C   1 
ATOM   2333 O  O   . GLU A 1 302 ? 120.291 -24.035 95.845  1.00 67.34 ? 302 GLU A O   1 
ATOM   2334 C  CB  . GLU A 1 302 ? 118.426 -21.388 96.080  1.00 68.43 ? 302 GLU A CB  1 
ATOM   2335 N  N   . LEU A 1 303 ? 120.273 -23.226 97.925  1.00 69.29 ? 303 LEU A N   1 
ATOM   2336 C  CA  . LEU A 1 303 ? 121.605 -23.725 98.232  1.00 71.03 ? 303 LEU A CA  1 
ATOM   2337 C  C   . LEU A 1 303 ? 121.748 -25.220 98.057  1.00 71.29 ? 303 LEU A C   1 
ATOM   2338 O  O   . LEU A 1 303 ? 122.579 -25.669 97.282  1.00 70.69 ? 303 LEU A O   1 
ATOM   2339 C  CB  . LEU A 1 303 ? 122.032 -23.354 99.647  1.00 71.73 ? 303 LEU A CB  1 
ATOM   2340 C  CG  . LEU A 1 303 ? 123.362 -23.998 100.071 1.00 73.99 ? 303 LEU A CG  1 
ATOM   2341 C  CD1 . LEU A 1 303 ? 124.455 -23.715 99.035  1.00 73.35 ? 303 LEU A CD1 1 
ATOM   2342 C  CD2 . LEU A 1 303 ? 123.782 -23.493 101.455 1.00 74.91 ? 303 LEU A CD2 1 
ATOM   2343 N  N   . ALA A 1 304 ? 121.004 -25.993 98.835  1.00 73.27 ? 304 ALA A N   1 
ATOM   2344 C  CA  . ALA A 1 304 ? 121.078 -27.450 98.730  1.00 74.75 ? 304 ALA A CA  1 
ATOM   2345 C  C   . ALA A 1 304 ? 120.452 -27.923 97.416  1.00 75.66 ? 304 ALA A C   1 
ATOM   2346 O  O   . ALA A 1 304 ? 120.748 -29.018 96.926  1.00 74.60 ? 304 ALA A O   1 
ATOM   2347 C  CB  . ALA A 1 304 ? 120.402 -28.114 99.928  1.00 76.23 ? 304 ALA A CB  1 
ATOM   2348 N  N   . GLU A 1 305 ? 119.582 -27.086 96.861  1.00 76.60 ? 305 GLU A N   1 
ATOM   2349 C  CA  . GLU A 1 305 ? 118.933 -27.364 95.589  1.00 77.33 ? 305 GLU A CA  1 
ATOM   2350 C  C   . GLU A 1 305 ? 120.081 -27.366 94.571  1.00 78.33 ? 305 GLU A C   1 
ATOM   2351 O  O   . GLU A 1 305 ? 120.224 -28.304 93.776  1.00 78.88 ? 305 GLU A O   1 
ATOM   2352 C  CB  . GLU A 1 305 ? 117.959 -26.229 95.280  1.00 76.84 ? 305 GLU A CB  1 
ATOM   2353 C  CG  . GLU A 1 305 ? 116.905 -26.502 94.233  1.00 77.59 ? 305 GLU A CG  1 
ATOM   2354 C  CD  . GLU A 1 305 ? 115.868 -25.383 94.164  1.00 77.93 ? 305 GLU A CD  1 
ATOM   2355 O  OE1 . GLU A 1 305 ? 116.175 -24.248 94.605  1.00 77.20 ? 305 GLU A OE1 1 
ATOM   2356 O  OE2 . GLU A 1 305 ? 114.743 -25.643 93.680  1.00 77.81 ? 305 GLU A OE2 1 
ATOM   2357 N  N   . ASN A 1 306 ? 120.938 -26.343 94.683  1.00 78.11 ? 306 ASN A N   1 
ATOM   2358 C  CA  . ASN A 1 306 ? 122.119 -26.133 93.828  1.00 77.56 ? 306 ASN A CA  1 
ATOM   2359 C  C   . ASN A 1 306 ? 123.108 -27.270 94.093  1.00 77.21 ? 306 ASN A C   1 
ATOM   2360 O  O   . ASN A 1 306 ? 123.602 -27.940 93.175  1.00 76.44 ? 306 ASN A O   1 
ATOM   2361 C  CB  . ASN A 1 306 ? 122.794 -24.793 94.199  1.00 76.88 ? 306 ASN A CB  1 
ATOM   2362 C  CG  . ASN A 1 306 ? 122.787 -23.767 93.058  1.00 76.63 ? 306 ASN A CG  1 
ATOM   2363 O  OD1 . ASN A 1 306 ? 122.385 -24.059 91.927  1.00 75.12 ? 306 ASN A OD1 1 
ATOM   2364 N  ND2 . ASN A 1 306 ? 123.250 -22.557 93.358  1.00 75.56 ? 306 ASN A ND2 1 
ATOM   2365 N  N   . ARG A 1 307 ? 123.379 -27.456 95.379  1.00 76.56 ? 307 ARG A N   1 
ATOM   2366 C  CA  . ARG A 1 307 ? 124.277 -28.469 95.909  1.00 75.89 ? 307 ARG A CA  1 
ATOM   2367 C  C   . ARG A 1 307 ? 124.075 -29.775 95.144  1.00 75.38 ? 307 ARG A C   1 
ATOM   2368 O  O   . ARG A 1 307 ? 125.024 -30.330 94.585  1.00 74.10 ? 307 ARG A O   1 
ATOM   2369 C  CB  . ARG A 1 307 ? 123.936 -28.656 97.388  1.00 75.62 ? 307 ARG A CB  1 
ATOM   2370 C  CG  . ARG A 1 307 ? 125.089 -28.955 98.303  1.00 75.90 ? 307 ARG A CG  1 
ATOM   2371 C  CD  . ARG A 1 307 ? 124.643 -28.795 99.748  1.00 76.87 ? 307 ARG A CD  1 
ATOM   2372 N  NE  . ARG A 1 307 ? 124.828 -27.432 100.258 1.00 77.97 ? 307 ARG A NE  1 
ATOM   2373 C  CZ  . ARG A 1 307 ? 125.987 -26.969 100.722 1.00 77.91 ? 307 ARG A CZ  1 
ATOM   2374 N  NH1 . ARG A 1 307 ? 127.052 -27.759 100.721 1.00 79.06 ? 307 ARG A NH1 1 
ATOM   2375 N  NH2 . ARG A 1 307 ? 126.079 -25.749 101.244 1.00 77.43 ? 307 ARG A NH2 1 
ATOM   2376 N  N   . GLU A 1 308 ? 122.821 -30.220 95.090  1.00 75.83 ? 308 GLU A N   1 
ATOM   2377 C  CA  . GLU A 1 308 ? 122.435 -31.441 94.390  1.00 77.02 ? 308 GLU A CA  1 
ATOM   2378 C  C   . GLU A 1 308 ? 123.072 -31.459 92.995  1.00 77.31 ? 308 GLU A C   1 
ATOM   2379 O  O   . GLU A 1 308 ? 123.730 -32.433 92.602  1.00 77.92 ? 308 GLU A O   1 
ATOM   2380 C  CB  . GLU A 1 308 ? 120.898 -31.507 94.282  1.00 78.47 ? 308 GLU A CB  1 
ATOM   2381 C  CG  . GLU A 1 308 ? 120.328 -32.618 93.360  1.00 79.78 ? 308 GLU A CG  1 
ATOM   2382 C  CD  . GLU A 1 308 ? 119.859 -33.878 94.108  1.00 80.57 ? 308 GLU A CD  1 
ATOM   2383 O  OE1 . GLU A 1 308 ? 120.534 -34.304 95.081  1.00 80.70 ? 308 GLU A OE1 1 
ATOM   2384 O  OE2 . GLU A 1 308 ? 118.811 -34.447 93.705  1.00 79.29 ? 308 GLU A OE2 1 
ATOM   2385 N  N   . ILE A 1 309 ? 122.910 -30.354 92.276  1.00 76.64 ? 309 ILE A N   1 
ATOM   2386 C  CA  . ILE A 1 309 ? 123.463 -30.234 90.942  1.00 76.34 ? 309 ILE A CA  1 
ATOM   2387 C  C   . ILE A 1 309 ? 124.980 -30.348 91.000  1.00 76.64 ? 309 ILE A C   1 
ATOM   2388 O  O   . ILE A 1 309 ? 125.551 -31.258 90.401  1.00 76.18 ? 309 ILE A O   1 
ATOM   2389 C  CB  . ILE A 1 309 ? 123.094 -28.895 90.317  1.00 76.39 ? 309 ILE A CB  1 
ATOM   2390 C  CG1 . ILE A 1 309 ? 121.600 -28.639 90.504  1.00 75.81 ? 309 ILE A CG1 1 
ATOM   2391 C  CG2 . ILE A 1 309 ? 123.471 -28.897 88.836  1.00 76.80 ? 309 ILE A CG2 1 
ATOM   2392 C  CD1 . ILE A 1 309 ? 121.150 -27.277 90.052  1.00 74.87 ? 309 ILE A CD1 1 
ATOM   2393 N  N   . LEU A 1 310 ? 125.608 -29.460 91.776  1.00 77.25 ? 310 LEU A N   1 
ATOM   2394 C  CA  . LEU A 1 310 ? 127.071 -29.416 91.937  1.00 77.96 ? 310 LEU A CA  1 
ATOM   2395 C  C   . LEU A 1 310 ? 127.710 -30.769 92.212  1.00 79.25 ? 310 LEU A C   1 
ATOM   2396 O  O   . LEU A 1 310 ? 128.793 -31.072 91.708  1.00 78.31 ? 310 LEU A O   1 
ATOM   2397 C  CB  . LEU A 1 310 ? 127.475 -28.461 93.076  1.00 76.65 ? 310 LEU A CB  1 
ATOM   2398 C  CG  . LEU A 1 310 ? 128.990 -28.385 93.344  1.00 75.48 ? 310 LEU A CG  1 
ATOM   2399 C  CD1 . LEU A 1 310 ? 129.526 -27.044 92.939  1.00 74.09 ? 310 LEU A CD1 1 
ATOM   2400 C  CD2 . LEU A 1 310 ? 129.322 -28.693 94.796  1.00 74.76 ? 310 LEU A CD2 1 
ATOM   2401 N  N   . LYS A 1 311 ? 127.081 -31.530 93.099  1.00 81.76 ? 311 LYS A N   1 
ATOM   2402 C  CA  . LYS A 1 311 ? 127.579 -32.841 93.469  1.00 84.79 ? 311 LYS A CA  1 
ATOM   2403 C  C   . LYS A 1 311 ? 127.901 -33.618 92.205  1.00 87.16 ? 311 LYS A C   1 
ATOM   2404 O  O   . LYS A 1 311 ? 129.036 -34.072 92.019  1.00 88.81 ? 311 LYS A O   1 
ATOM   2405 C  CB  . LYS A 1 311 ? 126.540 -33.574 94.282  1.00 83.96 ? 311 LYS A CB  1 
ATOM   2406 N  N   . GLU A 1 312 ? 126.907 -33.729 91.326  1.00 89.43 ? 312 GLU A N   1 
ATOM   2407 C  CA  . GLU A 1 312 ? 127.056 -34.446 90.064  1.00 91.79 ? 312 GLU A CA  1 
ATOM   2408 C  C   . GLU A 1 312 ? 127.888 -33.629 89.061  1.00 92.85 ? 312 GLU A C   1 
ATOM   2409 O  O   . GLU A 1 312 ? 127.481 -32.539 88.658  1.00 93.76 ? 312 GLU A O   1 
ATOM   2410 C  CB  . GLU A 1 312 ? 125.674 -34.762 89.482  1.00 91.67 ? 312 GLU A CB  1 
ATOM   2411 N  N   . PRO A 1 313 ? 129.076 -34.139 88.669  1.00 93.31 ? 313 PRO A N   1 
ATOM   2412 C  CA  . PRO A 1 313 ? 130.003 -33.495 87.716  1.00 94.04 ? 313 PRO A CA  1 
ATOM   2413 C  C   . PRO A 1 313 ? 129.697 -33.599 86.194  1.00 94.65 ? 313 PRO A C   1 
ATOM   2414 O  O   . PRO A 1 313 ? 129.632 -34.704 85.631  1.00 95.77 ? 313 PRO A O   1 
ATOM   2415 C  CB  . PRO A 1 313 ? 131.339 -34.148 88.066  1.00 93.86 ? 313 PRO A CB  1 
ATOM   2416 C  CG  . PRO A 1 313 ? 130.930 -35.527 88.485  1.00 93.26 ? 313 PRO A CG  1 
ATOM   2417 C  CD  . PRO A 1 313 ? 129.732 -35.270 89.353  1.00 92.61 ? 313 PRO A CD  1 
ATOM   2418 N  N   . VAL A 1 314 ? 129.566 -32.435 85.537  1.00 94.81 ? 314 VAL A N   1 
ATOM   2419 C  CA  . VAL A 1 314 ? 129.276 -32.322 84.087  1.00 93.67 ? 314 VAL A CA  1 
ATOM   2420 C  C   . VAL A 1 314 ? 130.531 -31.792 83.358  1.00 91.43 ? 314 VAL A C   1 
ATOM   2421 O  O   . VAL A 1 314 ? 131.454 -31.301 83.999  1.00 90.75 ? 314 VAL A O   1 
ATOM   2422 C  CB  . VAL A 1 314 ? 128.033 -31.372 83.819  1.00 94.48 ? 314 VAL A CB  1 
ATOM   2423 C  CG1 . VAL A 1 314 ? 127.771 -31.212 82.329  1.00 94.77 ? 314 VAL A CG1 1 
ATOM   2424 C  CG2 . VAL A 1 314 ? 126.765 -31.934 84.484  1.00 94.91 ? 314 VAL A CG2 1 
ATOM   2425 N  N   . HIS A 1 315 ? 130.561 -31.889 82.031  1.00 88.72 ? 315 HIS A N   1 
ATOM   2426 C  CA  . HIS A 1 315 ? 131.713 -31.433 81.251  1.00 86.33 ? 315 HIS A CA  1 
ATOM   2427 C  C   . HIS A 1 315 ? 131.269 -30.695 79.973  1.00 84.71 ? 315 HIS A C   1 
ATOM   2428 O  O   . HIS A 1 315 ? 130.145 -30.911 79.497  1.00 84.73 ? 315 HIS A O   1 
ATOM   2429 C  CB  . HIS A 1 315 ? 132.561 -32.636 80.875  1.00 87.05 ? 315 HIS A CB  1 
ATOM   2430 C  CG  . HIS A 1 315 ? 131.825 -33.616 80.026  1.00 88.30 ? 315 HIS A CG  1 
ATOM   2431 N  ND1 . HIS A 1 315 ? 130.877 -34.477 80.541  1.00 90.27 ? 315 HIS A ND1 1 
ATOM   2432 C  CD2 . HIS A 1 315 ? 131.799 -33.784 78.684  1.00 89.06 ? 315 HIS A CD2 1 
ATOM   2433 C  CE1 . HIS A 1 315 ? 130.294 -35.127 79.550  1.00 90.51 ? 315 HIS A CE1 1 
ATOM   2434 N  NE2 . HIS A 1 315 ? 130.835 -34.723 78.413  1.00 90.60 ? 315 HIS A NE2 1 
ATOM   2435 N  N   . GLY A 1 316 ? 132.163 -29.878 79.399  1.00 82.26 ? 316 GLY A N   1 
ATOM   2436 C  CA  . GLY A 1 316 ? 131.839 -29.124 78.187  1.00 77.50 ? 316 GLY A CA  1 
ATOM   2437 C  C   . GLY A 1 316 ? 132.660 -29.427 76.939  1.00 73.93 ? 316 GLY A C   1 
ATOM   2438 O  O   . GLY A 1 316 ? 133.837 -29.815 77.034  1.00 73.86 ? 316 GLY A O   1 
ATOM   2439 N  N   . VAL A 1 317 ? 132.064 -29.184 75.770  1.00 69.53 ? 317 VAL A N   1 
ATOM   2440 C  CA  . VAL A 1 317 ? 132.717 -29.449 74.483  1.00 65.02 ? 317 VAL A CA  1 
ATOM   2441 C  C   . VAL A 1 317 ? 133.373 -28.199 73.871  1.00 62.40 ? 317 VAL A C   1 
ATOM   2442 O  O   . VAL A 1 317 ? 133.216 -27.094 74.405  1.00 61.80 ? 317 VAL A O   1 
ATOM   2443 C  CB  . VAL A 1 317 ? 131.719 -30.108 73.460  1.00 63.47 ? 317 VAL A CB  1 
ATOM   2444 C  CG1 . VAL A 1 317 ? 131.067 -31.336 74.083  1.00 62.20 ? 317 VAL A CG1 1 
ATOM   2445 C  CG2 . VAL A 1 317 ? 130.651 -29.130 73.007  1.00 60.99 ? 317 VAL A CG2 1 
ATOM   2446 N  N   . TYR A 1 318 ? 134.126 -28.399 72.780  1.00 59.19 ? 318 TYR A N   1 
ATOM   2447 C  CA  . TYR A 1 318 ? 134.832 -27.327 72.040  1.00 56.12 ? 318 TYR A CA  1 
ATOM   2448 C  C   . TYR A 1 318 ? 134.146 -26.850 70.733  1.00 55.46 ? 318 TYR A C   1 
ATOM   2449 O  O   . TYR A 1 318 ? 133.106 -27.397 70.313  1.00 55.70 ? 318 TYR A O   1 
ATOM   2450 C  CB  . TYR A 1 318 ? 136.287 -27.739 71.744  1.00 51.42 ? 318 TYR A CB  1 
ATOM   2451 C  CG  . TYR A 1 318 ? 137.198 -27.785 72.960  1.00 46.10 ? 318 TYR A CG  1 
ATOM   2452 C  CD1 . TYR A 1 318 ? 136.801 -27.247 74.176  1.00 45.38 ? 318 TYR A CD1 1 
ATOM   2453 C  CD2 . TYR A 1 318 ? 138.456 -28.365 72.893  1.00 43.25 ? 318 TYR A CD2 1 
ATOM   2454 C  CE1 . TYR A 1 318 ? 137.637 -27.285 75.295  1.00 43.34 ? 318 TYR A CE1 1 
ATOM   2455 C  CE2 . TYR A 1 318 ? 139.292 -28.408 74.009  1.00 41.07 ? 318 TYR A CE2 1 
ATOM   2456 C  CZ  . TYR A 1 318 ? 138.881 -27.863 75.207  1.00 40.78 ? 318 TYR A CZ  1 
ATOM   2457 O  OH  . TYR A 1 318 ? 139.721 -27.863 76.304  1.00 36.20 ? 318 TYR A OH  1 
ATOM   2458 N  N   . TYR A 1 319 ? 134.752 -25.873 70.061  1.00 53.48 ? 319 TYR A N   1 
ATOM   2459 C  CA  . TYR A 1 319 ? 134.164 -25.323 68.841  1.00 51.92 ? 319 TYR A CA  1 
ATOM   2460 C  C   . TYR A 1 319 ? 134.545 -25.937 67.515  1.00 50.69 ? 319 TYR A C   1 
ATOM   2461 O  O   . TYR A 1 319 ? 135.693 -26.330 67.272  1.00 48.58 ? 319 TYR A O   1 
ATOM   2462 C  CB  . TYR A 1 319 ? 134.349 -23.794 68.743  1.00 52.61 ? 319 TYR A CB  1 
ATOM   2463 C  CG  . TYR A 1 319 ? 133.509 -23.113 67.646  1.00 52.55 ? 319 TYR A CG  1 
ATOM   2464 C  CD1 . TYR A 1 319 ? 132.185 -23.498 67.400  1.00 53.24 ? 319 TYR A CD1 1 
ATOM   2465 C  CD2 . TYR A 1 319 ? 134.017 -22.052 66.894  1.00 52.27 ? 319 TYR A CD2 1 
ATOM   2466 C  CE1 . TYR A 1 319 ? 131.379 -22.833 66.430  1.00 52.51 ? 319 TYR A CE1 1 
ATOM   2467 C  CE2 . TYR A 1 319 ? 133.215 -21.378 65.922  1.00 51.49 ? 319 TYR A CE2 1 
ATOM   2468 C  CZ  . TYR A 1 319 ? 131.897 -21.776 65.700  1.00 50.28 ? 319 TYR A CZ  1 
ATOM   2469 O  OH  . TYR A 1 319 ? 131.100 -21.126 64.768  1.00 46.56 ? 319 TYR A OH  1 
ATOM   2470 N  N   . ASP A 1 320 ? 133.519 -26.057 66.689  1.00 49.62 ? 320 ASP A N   1 
ATOM   2471 C  CA  . ASP A 1 320 ? 133.640 -26.548 65.342  1.00 50.19 ? 320 ASP A CA  1 
ATOM   2472 C  C   . ASP A 1 320 ? 132.941 -25.500 64.508  1.00 49.72 ? 320 ASP A C   1 
ATOM   2473 O  O   . ASP A 1 320 ? 131.713 -25.494 64.364  1.00 48.59 ? 320 ASP A O   1 
ATOM   2474 C  CB  . ASP A 1 320 ? 132.929 -27.881 65.129  1.00 50.08 ? 320 ASP A CB  1 
ATOM   2475 C  CG  . ASP A 1 320 ? 132.695 -28.166 63.665  1.00 49.74 ? 320 ASP A CG  1 
ATOM   2476 O  OD1 . ASP A 1 320 ? 133.674 -28.016 62.893  1.00 48.59 ? 320 ASP A OD1 1 
ATOM   2477 O  OD2 . ASP A 1 320 ? 131.518 -28.432 63.310  1.00 49.30 ? 320 ASP A OD2 1 
ATOM   2478 N  N   . PRO A 1 321 ? 133.718 -24.640 63.879  1.00 49.16 ? 321 PRO A N   1 
ATOM   2479 C  CA  . PRO A 1 321 ? 133.144 -23.586 63.050  1.00 50.06 ? 321 PRO A CA  1 
ATOM   2480 C  C   . PRO A 1 321 ? 132.318 -24.077 61.884  1.00 50.56 ? 321 PRO A C   1 
ATOM   2481 O  O   . PRO A 1 321 ? 131.601 -23.309 61.273  1.00 50.48 ? 321 PRO A O   1 
ATOM   2482 C  CB  . PRO A 1 321 ? 134.377 -22.812 62.584  1.00 50.49 ? 321 PRO A CB  1 
ATOM   2483 C  CG  . PRO A 1 321 ? 135.362 -23.092 63.682  1.00 48.80 ? 321 PRO A CG  1 
ATOM   2484 C  CD  . PRO A 1 321 ? 135.176 -24.524 63.943  1.00 47.00 ? 321 PRO A CD  1 
ATOM   2485 N  N   . SER A 1 322 ? 132.384 -25.370 61.609  1.00 52.19 ? 322 SER A N   1 
ATOM   2486 C  CA  . SER A 1 322 ? 131.624 -25.898 60.499  1.00 55.12 ? 322 SER A CA  1 
ATOM   2487 C  C   . SER A 1 322 ? 130.197 -26.199 60.930  1.00 57.25 ? 322 SER A C   1 
ATOM   2488 O  O   . SER A 1 322 ? 129.559 -27.103 60.404  1.00 57.94 ? 322 SER A O   1 
ATOM   2489 C  CB  . SER A 1 322 ? 132.291 -27.148 59.906  1.00 55.72 ? 322 SER A CB  1 
ATOM   2490 O  OG  . SER A 1 322 ? 132.121 -28.283 60.740  1.00 57.88 ? 322 SER A OG  1 
ATOM   2491 N  N   . LYS A 1 323 ? 129.703 -25.462 61.915  1.00 60.28 ? 323 LYS A N   1 
ATOM   2492 C  CA  . LYS A 1 323 ? 128.336 -25.681 62.365  1.00 61.83 ? 323 LYS A CA  1 
ATOM   2493 C  C   . LYS A 1 323 ? 127.675 -24.468 63.010  1.00 62.03 ? 323 LYS A C   1 
ATOM   2494 O  O   . LYS A 1 323 ? 128.334 -23.475 63.352  1.00 61.58 ? 323 LYS A O   1 
ATOM   2495 C  CB  . LYS A 1 323 ? 128.282 -26.888 63.307  1.00 63.21 ? 323 LYS A CB  1 
ATOM   2496 N  N   . ASP A 1 324 ? 126.356 -24.578 63.150  1.00 61.82 ? 324 ASP A N   1 
ATOM   2497 C  CA  . ASP A 1 324 ? 125.499 -23.558 63.739  1.00 61.80 ? 324 ASP A CA  1 
ATOM   2498 C  C   . ASP A 1 324 ? 125.533 -23.574 65.257  1.00 60.50 ? 324 ASP A C   1 
ATOM   2499 O  O   . ASP A 1 324 ? 125.348 -24.631 65.873  1.00 59.05 ? 324 ASP A O   1 
ATOM   2500 C  CB  . ASP A 1 324 ? 124.030 -23.777 63.316  1.00 62.38 ? 324 ASP A CB  1 
ATOM   2501 C  CG  . ASP A 1 324 ? 123.724 -23.291 61.897  1.00 62.62 ? 324 ASP A CG  1 
ATOM   2502 O  OD1 . ASP A 1 324 ? 124.511 -22.498 61.324  1.00 63.13 ? 324 ASP A OD1 1 
ATOM   2503 O  OD2 . ASP A 1 324 ? 122.665 -23.703 61.368  1.00 60.88 ? 324 ASP A OD2 1 
ATOM   2504 N  N   . LEU A 1 325 ? 125.750 -22.397 65.843  1.00 60.60 ? 325 LEU A N   1 
ATOM   2505 C  CA  . LEU A 1 325 ? 125.743 -22.219 67.294  1.00 60.50 ? 325 LEU A CA  1 
ATOM   2506 C  C   . LEU A 1 325 ? 124.260 -22.055 67.658  1.00 59.93 ? 325 LEU A C   1 
ATOM   2507 O  O   . LEU A 1 325 ? 123.506 -21.367 66.945  1.00 59.72 ? 325 LEU A O   1 
ATOM   2508 C  CB  . LEU A 1 325 ? 126.523 -20.956 67.696  1.00 60.52 ? 325 LEU A CB  1 
ATOM   2509 C  CG  . LEU A 1 325 ? 128.060 -21.015 67.703  1.00 60.39 ? 325 LEU A CG  1 
ATOM   2510 C  CD1 . LEU A 1 325 ? 128.629 -19.633 67.835  1.00 60.15 ? 325 LEU A CD1 1 
ATOM   2511 C  CD2 . LEU A 1 325 ? 128.571 -21.886 68.830  1.00 59.11 ? 325 LEU A CD2 1 
ATOM   2512 N  N   . ILE A 1 326 ? 123.826 -22.684 68.746  1.00 58.71 ? 326 ILE A N   1 
ATOM   2513 C  CA  . ILE A 1 326 ? 122.426 -22.585 69.120  1.00 57.47 ? 326 ILE A CA  1 
ATOM   2514 C  C   . ILE A 1 326 ? 122.216 -22.142 70.548  1.00 57.00 ? 326 ILE A C   1 
ATOM   2515 O  O   . ILE A 1 326 ? 122.796 -22.695 71.481  1.00 54.85 ? 326 ILE A O   1 
ATOM   2516 C  CB  . ILE A 1 326 ? 121.679 -23.902 68.872  1.00 56.63 ? 326 ILE A CB  1 
ATOM   2517 C  CG1 . ILE A 1 326 ? 121.971 -24.398 67.457  1.00 56.69 ? 326 ILE A CG1 1 
ATOM   2518 C  CG2 . ILE A 1 326 ? 120.177 -23.678 68.990  1.00 54.29 ? 326 ILE A CG2 1 
ATOM   2519 C  CD1 . ILE A 1 326 ? 121.770 -25.880 67.281  1.00 59.08 ? 326 ILE A CD1 1 
ATOM   2520 N  N   . ALA A 1 327 ? 121.373 -21.127 70.690  1.00 58.02 ? 327 ALA A N   1 
ATOM   2521 C  CA  . ALA A 1 327 ? 121.032 -20.556 71.978  1.00 58.10 ? 327 ALA A CA  1 
ATOM   2522 C  C   . ALA A 1 327 ? 119.592 -20.926 72.314  1.00 58.69 ? 327 ALA A C   1 
ATOM   2523 O  O   . ALA A 1 327 ? 118.674 -20.593 71.575  1.00 56.05 ? 327 ALA A O   1 
ATOM   2524 C  CB  . ALA A 1 327 ? 121.193 -19.046 71.931  1.00 58.60 ? 327 ALA A CB  1 
ATOM   2525 N  N   . GLU A 1 328 ? 119.417 -21.627 73.431  1.00 59.36 ? 328 GLU A N   1 
ATOM   2526 C  CA  . GLU A 1 328 ? 118.114 -22.079 73.906  1.00 59.60 ? 328 GLU A CA  1 
ATOM   2527 C  C   . GLU A 1 328 ? 117.839 -21.536 75.320  1.00 59.70 ? 328 GLU A C   1 
ATOM   2528 O  O   . GLU A 1 328 ? 118.728 -21.556 76.189  1.00 58.13 ? 328 GLU A O   1 
ATOM   2529 C  CB  . GLU A 1 328 ? 118.123 -23.597 73.896  1.00 59.92 ? 328 GLU A CB  1 
ATOM   2530 C  CG  . GLU A 1 328 ? 116.889 -24.250 74.421  1.00 62.27 ? 328 GLU A CG  1 
ATOM   2531 C  CD  . GLU A 1 328 ? 116.961 -25.740 74.261  1.00 62.22 ? 328 GLU A CD  1 
ATOM   2532 O  OE1 . GLU A 1 328 ? 117.902 -26.349 74.820  1.00 61.58 ? 328 GLU A OE1 1 
ATOM   2533 O  OE2 . GLU A 1 328 ? 116.089 -26.293 73.556  1.00 64.01 ? 328 GLU A OE2 1 
ATOM   2534 N  N   . ILE A 1 329 ? 116.613 -21.064 75.551  1.00 60.79 ? 329 ILE A N   1 
ATOM   2535 C  CA  . ILE A 1 329 ? 116.258 -20.473 76.847  1.00 61.47 ? 329 ILE A CA  1 
ATOM   2536 C  C   . ILE A 1 329 ? 115.031 -21.041 77.565  1.00 60.30 ? 329 ILE A C   1 
ATOM   2537 O  O   . ILE A 1 329 ? 114.162 -21.679 76.958  1.00 58.54 ? 329 ILE A O   1 
ATOM   2538 C  CB  . ILE A 1 329 ? 116.052 -18.940 76.705  1.00 63.29 ? 329 ILE A CB  1 
ATOM   2539 C  CG1 . ILE A 1 329 ? 117.150 -18.344 75.809  1.00 64.08 ? 329 ILE A CG1 1 
ATOM   2540 C  CG2 . ILE A 1 329 ? 116.063 -18.259 78.089  1.00 62.95 ? 329 ILE A CG2 1 
ATOM   2541 C  CD1 . ILE A 1 329 ? 116.984 -16.870 75.520  1.00 63.10 ? 329 ILE A CD1 1 
ATOM   2542 N  N   . GLN A 1 330 ? 114.974 -20.782 78.870  1.00 59.52 ? 330 GLN A N   1 
ATOM   2543 C  CA  . GLN A 1 330 ? 113.875 -21.228 79.719  1.00 59.08 ? 330 GLN A CA  1 
ATOM   2544 C  C   . GLN A 1 330 ? 113.854 -20.421 81.009  1.00 59.20 ? 330 GLN A C   1 
ATOM   2545 O  O   . GLN A 1 330 ? 114.911 -19.959 81.475  1.00 57.85 ? 330 GLN A O   1 
ATOM   2546 C  CB  . GLN A 1 330 ? 114.037 -22.705 80.073  1.00 59.08 ? 330 GLN A CB  1 
ATOM   2547 C  CG  . GLN A 1 330 ? 115.290 -23.015 80.884  1.00 57.37 ? 330 GLN A CG  1 
ATOM   2548 C  CD  . GLN A 1 330 ? 116.505 -23.339 80.029  1.00 57.61 ? 330 GLN A CD  1 
ATOM   2549 O  OE1 . GLN A 1 330 ? 116.758 -22.713 78.997  1.00 57.23 ? 330 GLN A OE1 1 
ATOM   2550 N  NE2 . GLN A 1 330 ? 117.276 -24.319 80.473  1.00 56.65 ? 330 GLN A NE2 1 
ATOM   2551 N  N   . LYS A 1 331 ? 112.656 -20.226 81.566  1.00 60.22 ? 331 LYS A N   1 
ATOM   2552 C  CA  . LYS A 1 331 ? 112.517 -19.490 82.827  1.00 61.48 ? 331 LYS A CA  1 
ATOM   2553 C  C   . LYS A 1 331 ? 112.533 -20.505 83.960  1.00 63.23 ? 331 LYS A C   1 
ATOM   2554 O  O   . LYS A 1 331 ? 111.564 -21.234 84.165  1.00 62.23 ? 331 LYS A O   1 
ATOM   2555 C  CB  . LYS A 1 331 ? 111.211 -18.688 82.890  1.00 61.02 ? 331 LYS A CB  1 
ATOM   2556 C  CG  . LYS A 1 331 ? 111.023 -17.969 84.226  1.00 59.78 ? 331 LYS A CG  1 
ATOM   2557 C  CD  . LYS A 1 331 ? 109.612 -17.454 84.412  1.00 59.89 ? 331 LYS A CD  1 
ATOM   2558 C  CE  . LYS A 1 331 ? 109.378 -16.988 85.852  1.00 60.15 ? 331 LYS A CE  1 
ATOM   2559 N  NZ  . LYS A 1 331 ? 108.043 -16.343 86.081  1.00 58.65 ? 331 LYS A NZ  1 
ATOM   2560 N  N   . GLN A 1 332 ? 113.632 -20.546 84.701  1.00 65.04 ? 332 GLN A N   1 
ATOM   2561 C  CA  . GLN A 1 332 ? 113.740 -21.493 85.795  1.00 67.61 ? 332 GLN A CA  1 
ATOM   2562 C  C   . GLN A 1 332 ? 112.994 -21.029 87.040  1.00 68.84 ? 332 GLN A C   1 
ATOM   2563 O  O   . GLN A 1 332 ? 112.845 -21.781 88.005  1.00 69.67 ? 332 GLN A O   1 
ATOM   2564 C  CB  . GLN A 1 332 ? 115.207 -21.800 86.122  1.00 69.80 ? 332 GLN A CB  1 
ATOM   2565 C  CG  . GLN A 1 332 ? 116.006 -20.693 86.835  1.00 72.22 ? 332 GLN A CG  1 
ATOM   2566 C  CD  . GLN A 1 332 ? 117.332 -21.216 87.428  1.00 73.45 ? 332 GLN A CD  1 
ATOM   2567 O  OE1 . GLN A 1 332 ? 117.522 -22.426 87.563  1.00 75.11 ? 332 GLN A OE1 1 
ATOM   2568 N  NE2 . GLN A 1 332 ? 118.232 -20.307 87.804  1.00 72.40 ? 332 GLN A NE2 1 
ATOM   2569 N  N   . GLY A 1 333 ? 112.509 -19.797 87.012  1.00 69.40 ? 333 GLY A N   1 
ATOM   2570 C  CA  . GLY A 1 333 ? 111.802 -19.284 88.159  1.00 70.52 ? 333 GLY A CA  1 
ATOM   2571 C  C   . GLY A 1 333 ? 111.634 -17.794 88.076  1.00 70.57 ? 333 GLY A C   1 
ATOM   2572 O  O   . GLY A 1 333 ? 112.065 -17.150 87.120  1.00 70.23 ? 333 GLY A O   1 
ATOM   2573 N  N   . GLN A 1 334 ? 111.029 -17.244 89.113  1.00 72.30 ? 334 GLN A N   1 
ATOM   2574 C  CA  . GLN A 1 334 ? 110.764 -15.823 89.184  1.00 73.61 ? 334 GLN A CA  1 
ATOM   2575 C  C   . GLN A 1 334 ? 112.046 -15.049 89.133  1.00 73.80 ? 334 GLN A C   1 
ATOM   2576 O  O   . GLN A 1 334 ? 112.967 -15.277 89.925  1.00 73.79 ? 334 GLN A O   1 
ATOM   2577 C  CB  . GLN A 1 334 ? 109.962 -15.495 90.440  1.00 75.90 ? 334 GLN A CB  1 
ATOM   2578 C  CG  . GLN A 1 334 ? 108.518 -16.028 90.392  1.00 78.39 ? 334 GLN A CG  1 
ATOM   2579 C  CD  . GLN A 1 334 ? 108.438 -17.546 90.152  1.00 79.41 ? 334 GLN A CD  1 
ATOM   2580 O  OE1 . GLN A 1 334 ? 108.366 -18.014 89.007  1.00 78.82 ? 334 GLN A OE1 1 
ATOM   2581 N  NE2 . GLN A 1 334 ? 108.475 -18.315 91.235  1.00 79.90 ? 334 GLN A NE2 1 
ATOM   2582 N  N   . GLY A 1 335 ? 112.119 -14.200 88.118  1.00 74.32 ? 335 GLY A N   1 
ATOM   2583 C  CA  . GLY A 1 335 ? 113.284 -13.368 87.901  1.00 74.72 ? 335 GLY A CA  1 
ATOM   2584 C  C   . GLY A 1 335 ? 114.415 -14.081 87.181  1.00 74.72 ? 335 GLY A C   1 
ATOM   2585 O  O   . GLY A 1 335 ? 115.173 -13.465 86.422  1.00 74.78 ? 335 GLY A O   1 
ATOM   2586 N  N   . GLN A 1 336 ? 114.525 -15.387 87.389  1.00 75.32 ? 336 GLN A N   1 
ATOM   2587 C  CA  . GLN A 1 336 ? 115.604 -16.149 86.774  1.00 75.27 ? 336 GLN A CA  1 
ATOM   2588 C  C   . GLN A 1 336 ? 115.297 -16.846 85.437  1.00 73.04 ? 336 GLN A C   1 
ATOM   2589 O  O   . GLN A 1 336 ? 114.190 -17.347 85.210  1.00 71.68 ? 336 GLN A O   1 
ATOM   2590 C  CB  . GLN A 1 336 ? 116.200 -17.141 87.799  1.00 79.72 ? 336 GLN A CB  1 
ATOM   2591 C  CG  . GLN A 1 336 ? 116.831 -16.485 89.067  1.00 84.45 ? 336 GLN A CG  1 
ATOM   2592 C  CD  . GLN A 1 336 ? 117.663 -17.470 89.921  1.00 87.32 ? 336 GLN A CD  1 
ATOM   2593 O  OE1 . GLN A 1 336 ? 118.877 -17.295 90.111  1.00 88.55 ? 336 GLN A OE1 1 
ATOM   2594 N  NE2 . GLN A 1 336 ? 117.010 -18.510 90.427  1.00 88.39 ? 336 GLN A NE2 1 
ATOM   2595 N  N   . TRP A 1 337 ? 116.304 -16.856 84.559  1.00 70.71 ? 337 TRP A N   1 
ATOM   2596 C  CA  . TRP A 1 337 ? 116.248 -17.472 83.231  1.00 67.39 ? 337 TRP A CA  1 
ATOM   2597 C  C   . TRP A 1 337 ? 117.593 -18.172 82.954  1.00 68.31 ? 337 TRP A C   1 
ATOM   2598 O  O   . TRP A 1 337 ? 118.623 -17.841 83.574  1.00 67.06 ? 337 TRP A O   1 
ATOM   2599 C  CB  . TRP A 1 337 ? 116.069 -16.406 82.159  1.00 63.19 ? 337 TRP A CB  1 
ATOM   2600 C  CG  . TRP A 1 337 ? 114.903 -15.541 82.309  1.00 57.83 ? 337 TRP A CG  1 
ATOM   2601 C  CD1 . TRP A 1 337 ? 114.782 -14.454 83.131  1.00 56.87 ? 337 TRP A CD1 1 
ATOM   2602 C  CD2 . TRP A 1 337 ? 113.714 -15.605 81.553  1.00 56.33 ? 337 TRP A CD2 1 
ATOM   2603 N  NE1 . TRP A 1 337 ? 113.583 -13.833 82.920  1.00 54.21 ? 337 TRP A NE1 1 
ATOM   2604 C  CE2 . TRP A 1 337 ? 112.906 -14.519 81.949  1.00 56.13 ? 337 TRP A CE2 1 
ATOM   2605 C  CE3 . TRP A 1 337 ? 113.246 -16.475 80.566  1.00 55.34 ? 337 TRP A CE3 1 
ATOM   2606 C  CZ2 . TRP A 1 337 ? 111.640 -14.279 81.382  1.00 56.31 ? 337 TRP A CZ2 1 
ATOM   2607 C  CZ3 . TRP A 1 337 ? 112.009 -16.247 80.010  1.00 54.61 ? 337 TRP A CZ3 1 
ATOM   2608 C  CH2 . TRP A 1 337 ? 111.216 -15.157 80.417  1.00 55.31 ? 337 TRP A CH2 1 
ATOM   2609 N  N   . THR A 1 338 ? 117.591 -19.122 82.017  1.00 68.42 ? 338 THR A N   1 
ATOM   2610 C  CA  . THR A 1 338 ? 118.818 -19.830 81.664  1.00 68.68 ? 338 THR A CA  1 
ATOM   2611 C  C   . THR A 1 338 ? 118.922 -20.084 80.186  1.00 68.30 ? 338 THR A C   1 
ATOM   2612 O  O   . THR A 1 338 ? 117.917 -20.095 79.459  1.00 66.67 ? 338 THR A O   1 
ATOM   2613 C  CB  . THR A 1 338 ? 118.954 -21.204 82.365  1.00 70.44 ? 338 THR A CB  1 
ATOM   2614 O  OG1 . THR A 1 338 ? 117.653 -21.743 82.641  1.00 71.28 ? 338 THR A OG1 1 
ATOM   2615 C  CG2 . THR A 1 338 ? 119.786 -21.099 83.636  1.00 71.14 ? 338 THR A CG2 1 
ATOM   2616 N  N   . TYR A 1 339 ? 120.157 -20.351 79.779  1.00 69.30 ? 339 TYR A N   1 
ATOM   2617 C  CA  . TYR A 1 339 ? 120.502 -20.613 78.397  1.00 70.12 ? 339 TYR A CA  1 
ATOM   2618 C  C   . TYR A 1 339 ? 121.576 -21.679 78.333  1.00 70.56 ? 339 TYR A C   1 
ATOM   2619 O  O   . TYR A 1 339 ? 122.273 -21.964 79.321  1.00 70.04 ? 339 TYR A O   1 
ATOM   2620 C  CB  . TYR A 1 339 ? 121.031 -19.336 77.715  1.00 70.49 ? 339 TYR A CB  1 
ATOM   2621 C  CG  . TYR A 1 339 ? 122.176 -18.641 78.451  1.00 70.69 ? 339 TYR A CG  1 
ATOM   2622 C  CD1 . TYR A 1 339 ? 123.488 -19.109 78.367  1.00 70.46 ? 339 TYR A CD1 1 
ATOM   2623 C  CD2 . TYR A 1 339 ? 121.935 -17.521 79.240  1.00 70.51 ? 339 TYR A CD2 1 
ATOM   2624 C  CE1 . TYR A 1 339 ? 124.523 -18.484 79.062  1.00 71.09 ? 339 TYR A CE1 1 
ATOM   2625 C  CE2 . TYR A 1 339 ? 122.956 -16.892 79.935  1.00 71.40 ? 339 TYR A CE2 1 
ATOM   2626 C  CZ  . TYR A 1 339 ? 124.245 -17.371 79.846  1.00 71.77 ? 339 TYR A CZ  1 
ATOM   2627 O  OH  . TYR A 1 339 ? 125.239 -16.767 80.592  1.00 72.43 ? 339 TYR A OH  1 
ATOM   2628 N  N   . GLN A 1 340 ? 121.766 -22.177 77.120  1.00 71.47 ? 340 GLN A N   1 
ATOM   2629 C  CA  . GLN A 1 340 ? 122.748 -23.205 76.817  1.00 72.01 ? 340 GLN A CA  1 
ATOM   2630 C  C   . GLN A 1 340 ? 123.060 -23.090 75.318  1.00 70.66 ? 340 GLN A C   1 
ATOM   2631 O  O   . GLN A 1 340 ? 122.145 -22.913 74.501  1.00 70.37 ? 340 GLN A O   1 
ATOM   2632 C  CB  . GLN A 1 340 ? 122.149 -24.574 77.141  1.00 74.93 ? 340 GLN A CB  1 
ATOM   2633 C  CG  . GLN A 1 340 ? 120.778 -24.811 76.479  1.00 78.30 ? 340 GLN A CG  1 
ATOM   2634 C  CD  . GLN A 1 340 ? 119.708 -25.289 77.449  1.00 79.37 ? 340 GLN A CD  1 
ATOM   2635 O  OE1 . GLN A 1 340 ? 118.876 -24.509 77.915  1.00 80.04 ? 340 GLN A OE1 1 
ATOM   2636 N  NE2 . GLN A 1 340 ? 119.717 -26.583 77.743  1.00 80.17 ? 340 GLN A NE2 1 
ATOM   2637 N  N   . ILE A 1 341 ? 124.342 -23.119 74.961  1.00 69.12 ? 341 ILE A N   1 
ATOM   2638 C  CA  . ILE A 1 341 ? 124.733 -23.028 73.557  1.00 67.66 ? 341 ILE A CA  1 
ATOM   2639 C  C   . ILE A 1 341 ? 125.342 -24.350 73.117  1.00 66.85 ? 341 ILE A C   1 
ATOM   2640 O  O   . ILE A 1 341 ? 126.311 -24.828 73.711  1.00 64.80 ? 341 ILE A O   1 
ATOM   2641 C  CB  . ILE A 1 341 ? 125.737 -21.884 73.272  1.00 66.78 ? 341 ILE A CB  1 
ATOM   2642 C  CG1 . ILE A 1 341 ? 125.432 -20.659 74.138  1.00 67.04 ? 341 ILE A CG1 1 
ATOM   2643 C  CG2 . ILE A 1 341 ? 125.640 -21.480 71.794  1.00 64.93 ? 341 ILE A CG2 1 
ATOM   2644 C  CD1 . ILE A 1 341 ? 125.978 -20.719 75.560  1.00 66.41 ? 341 ILE A CD1 1 
ATOM   2645 N  N   . TYR A 1 342 ? 124.769 -24.934 72.073  1.00 66.44 ? 342 TYR A N   1 
ATOM   2646 C  CA  . TYR A 1 342 ? 125.250 -26.210 71.569  1.00 65.97 ? 342 TYR A CA  1 
ATOM   2647 C  C   . TYR A 1 342 ? 125.290 -26.235 70.050  1.00 66.71 ? 342 TYR A C   1 
ATOM   2648 O  O   . TYR A 1 342 ? 124.548 -25.489 69.394  1.00 64.46 ? 342 TYR A O   1 
ATOM   2649 C  CB  . TYR A 1 342 ? 124.375 -27.362 72.099  1.00 64.80 ? 342 TYR A CB  1 
ATOM   2650 C  CG  . TYR A 1 342 ? 122.884 -27.197 71.849  1.00 62.61 ? 342 TYR A CG  1 
ATOM   2651 C  CD1 . TYR A 1 342 ? 122.075 -26.511 72.756  1.00 61.69 ? 342 TYR A CD1 1 
ATOM   2652 C  CD2 . TYR A 1 342 ? 122.283 -27.717 70.706  1.00 61.81 ? 342 TYR A CD2 1 
ATOM   2653 C  CE1 . TYR A 1 342 ? 120.697 -26.344 72.529  1.00 61.37 ? 342 TYR A CE1 1 
ATOM   2654 C  CE2 . TYR A 1 342 ? 120.907 -27.558 70.468  1.00 61.42 ? 342 TYR A CE2 1 
ATOM   2655 C  CZ  . TYR A 1 342 ? 120.122 -26.870 71.383  1.00 61.11 ? 342 TYR A CZ  1 
ATOM   2656 O  OH  . TYR A 1 342 ? 118.774 -26.707 71.147  1.00 58.68 ? 342 TYR A OH  1 
ATOM   2657 N  N   . GLN A 1 343 ? 126.199 -27.061 69.519  1.00 68.19 ? 343 GLN A N   1 
ATOM   2658 C  CA  . GLN A 1 343 ? 126.391 -27.265 68.071  1.00 69.15 ? 343 GLN A CA  1 
ATOM   2659 C  C   . GLN A 1 343 ? 125.509 -28.447 67.623  1.00 72.18 ? 343 GLN A C   1 
ATOM   2660 O  O   . GLN A 1 343 ? 124.656 -28.310 66.734  1.00 71.51 ? 343 GLN A O   1 
ATOM   2661 C  CB  . GLN A 1 343 ? 127.864 -27.603 67.767  1.00 65.61 ? 343 GLN A CB  1 
ATOM   2662 C  CG  . GLN A 1 343 ? 128.824 -26.427 67.777  1.00 61.02 ? 343 GLN A CG  1 
ATOM   2663 C  CD  . GLN A 1 343 ? 128.717 -25.561 66.532  1.00 58.39 ? 343 GLN A CD  1 
ATOM   2664 O  OE1 . GLN A 1 343 ? 127.788 -24.781 66.377  1.00 55.88 ? 343 GLN A OE1 1 
ATOM   2665 N  NE2 . GLN A 1 343 ? 129.681 -25.691 65.644  1.00 56.53 ? 343 GLN A NE2 1 
ATOM   2666 N  N   . GLU A 1 344 ? 125.753 -29.604 68.235  1.00 76.34 ? 344 GLU A N   1 
ATOM   2667 C  CA  . GLU A 1 344 ? 125.010 -30.838 67.962  1.00 80.17 ? 344 GLU A CA  1 
ATOM   2668 C  C   . GLU A 1 344 ? 124.268 -31.289 69.242  1.00 81.24 ? 344 GLU A C   1 
ATOM   2669 O  O   . GLU A 1 344 ? 124.728 -31.038 70.381  1.00 80.06 ? 344 GLU A O   1 
ATOM   2670 C  CB  . GLU A 1 344 ? 125.939 -31.964 67.410  1.00 82.57 ? 344 GLU A CB  1 
ATOM   2671 C  CG  . GLU A 1 344 ? 127.426 -31.615 67.268  1.00 85.94 ? 344 GLU A CG  1 
ATOM   2672 C  CD  . GLU A 1 344 ? 128.213 -31.791 68.566  1.00 88.12 ? 344 GLU A CD  1 
ATOM   2673 O  OE1 . GLU A 1 344 ? 128.234 -32.923 69.094  1.00 90.17 ? 344 GLU A OE1 1 
ATOM   2674 O  OE2 . GLU A 1 344 ? 128.841 -30.819 69.045  1.00 88.94 ? 344 GLU A OE2 1 
ATOM   2675 N  N   . PRO A 1 345 ? 123.098 -31.941 69.058  1.00 82.09 ? 345 PRO A N   1 
ATOM   2676 C  CA  . PRO A 1 345 ? 122.219 -32.443 70.125  1.00 81.61 ? 345 PRO A CA  1 
ATOM   2677 C  C   . PRO A 1 345 ? 122.870 -32.982 71.394  1.00 80.98 ? 345 PRO A C   1 
ATOM   2678 O  O   . PRO A 1 345 ? 123.674 -33.919 71.369  1.00 80.74 ? 345 PRO A O   1 
ATOM   2679 C  CB  . PRO A 1 345 ? 121.349 -33.487 69.409  1.00 82.68 ? 345 PRO A CB  1 
ATOM   2680 C  CG  . PRO A 1 345 ? 122.070 -33.729 68.077  1.00 83.58 ? 345 PRO A CG  1 
ATOM   2681 C  CD  . PRO A 1 345 ? 122.619 -32.404 67.742  1.00 82.45 ? 345 PRO A CD  1 
ATOM   2682 N  N   . PHE A 1 346 ? 122.551 -32.298 72.480  1.00 80.63 ? 346 PHE A N   1 
ATOM   2683 C  CA  . PHE A 1 346 ? 123.009 -32.636 73.813  1.00 80.88 ? 346 PHE A CA  1 
ATOM   2684 C  C   . PHE A 1 346 ? 124.505 -32.840 74.072  1.00 80.05 ? 346 PHE A C   1 
ATOM   2685 O  O   . PHE A 1 346 ? 124.915 -33.757 74.789  1.00 79.44 ? 346 PHE A O   1 
ATOM   2686 C  CB  . PHE A 1 346 ? 122.204 -33.814 74.352  1.00 83.71 ? 346 PHE A CB  1 
ATOM   2687 C  CG  . PHE A 1 346 ? 120.707 -33.592 74.365  1.00 86.34 ? 346 PHE A CG  1 
ATOM   2688 C  CD1 . PHE A 1 346 ? 119.932 -33.817 73.214  1.00 88.20 ? 346 PHE A CD1 1 
ATOM   2689 C  CD2 . PHE A 1 346 ? 120.057 -33.203 75.541  1.00 87.13 ? 346 PHE A CD2 1 
ATOM   2690 C  CE1 . PHE A 1 346 ? 118.534 -33.657 73.233  1.00 87.00 ? 346 PHE A CE1 1 
ATOM   2691 C  CE2 . PHE A 1 346 ? 118.666 -33.039 75.572  1.00 87.24 ? 346 PHE A CE2 1 
ATOM   2692 C  CZ  . PHE A 1 346 ? 117.905 -33.264 74.412  1.00 87.51 ? 346 PHE A CZ  1 
ATOM   2693 N  N   . LYS A 1 347 ? 125.316 -32.002 73.448  1.00 78.69 ? 347 LYS A N   1 
ATOM   2694 C  CA  . LYS A 1 347 ? 126.754 -32.026 73.665  1.00 77.21 ? 347 LYS A CA  1 
ATOM   2695 C  C   . LYS A 1 347 ? 127.002 -30.597 74.117  1.00 77.50 ? 347 LYS A C   1 
ATOM   2696 O  O   . LYS A 1 347 ? 127.125 -29.671 73.298  1.00 77.62 ? 347 LYS A O   1 
ATOM   2697 C  CB  . LYS A 1 347 ? 127.482 -32.357 72.373  1.00 76.13 ? 347 LYS A CB  1 
ATOM   2698 C  CG  . LYS A 1 347 ? 127.403 -33.824 72.035  1.00 75.25 ? 347 LYS A CG  1 
ATOM   2699 C  CD  . LYS A 1 347 ? 128.260 -34.629 72.977  1.00 75.73 ? 347 LYS A CD  1 
ATOM   2700 C  CE  . LYS A 1 347 ? 129.740 -34.332 72.740  1.00 76.74 ? 347 LYS A CE  1 
ATOM   2701 N  NZ  . LYS A 1 347 ? 130.649 -35.205 73.540  1.00 76.74 ? 347 LYS A NZ  1 
ATOM   2702 N  N   . ASN A 1 348 ? 126.964 -30.422 75.437  1.00 76.92 ? 348 ASN A N   1 
ATOM   2703 C  CA  . ASN A 1 348 ? 127.106 -29.114 76.071  1.00 75.80 ? 348 ASN A CA  1 
ATOM   2704 C  C   . ASN A 1 348 ? 128.381 -28.358 75.782  1.00 73.67 ? 348 ASN A C   1 
ATOM   2705 O  O   . ASN A 1 348 ? 129.486 -28.858 76.001  1.00 71.45 ? 348 ASN A O   1 
ATOM   2706 C  CB  . ASN A 1 348 ? 126.872 -29.191 77.590  1.00 78.38 ? 348 ASN A CB  1 
ATOM   2707 C  CG  . ASN A 1 348 ? 125.847 -28.147 78.089  1.00 80.04 ? 348 ASN A CG  1 
ATOM   2708 O  OD1 . ASN A 1 348 ? 124.826 -27.898 77.437  1.00 79.85 ? 348 ASN A OD1 1 
ATOM   2709 N  ND2 . ASN A 1 348 ? 126.121 -27.542 79.250  1.00 79.31 ? 348 ASN A ND2 1 
ATOM   2710 N  N   . LEU A 1 349 ? 128.189 -27.148 75.266  1.00 72.11 ? 349 LEU A N   1 
ATOM   2711 C  CA  . LEU A 1 349 ? 129.259 -26.229 74.910  1.00 70.35 ? 349 LEU A CA  1 
ATOM   2712 C  C   . LEU A 1 349 ? 129.301 -25.144 76.002  1.00 69.74 ? 349 LEU A C   1 
ATOM   2713 O  O   . LEU A 1 349 ? 130.356 -24.919 76.613  1.00 69.54 ? 349 LEU A O   1 
ATOM   2714 C  CB  . LEU A 1 349 ? 128.956 -25.632 73.529  1.00 68.85 ? 349 LEU A CB  1 
ATOM   2715 C  CG  . LEU A 1 349 ? 130.044 -25.039 72.647  1.00 66.95 ? 349 LEU A CG  1 
ATOM   2716 C  CD1 . LEU A 1 349 ? 131.165 -26.005 72.461  1.00 66.50 ? 349 LEU A CD1 1 
ATOM   2717 C  CD2 . LEU A 1 349 ? 129.451 -24.703 71.313  1.00 66.55 ? 349 LEU A CD2 1 
ATOM   2718 N  N   . LYS A 1 350 ? 128.148 -24.522 76.285  1.00 68.21 ? 350 LYS A N   1 
ATOM   2719 C  CA  . LYS A 1 350 ? 128.055 -23.490 77.326  1.00 66.56 ? 350 LYS A CA  1 
ATOM   2720 C  C   . LYS A 1 350 ? 126.664 -23.222 77.946  1.00 64.31 ? 350 LYS A C   1 
ATOM   2721 O  O   . LYS A 1 350 ? 125.638 -23.225 77.267  1.00 63.07 ? 350 LYS A O   1 
ATOM   2722 C  CB  . LYS A 1 350 ? 128.651 -22.168 76.839  1.00 69.36 ? 350 LYS A CB  1 
ATOM   2723 C  CG  . LYS A 1 350 ? 128.866 -21.171 77.971  1.00 71.93 ? 350 LYS A CG  1 
ATOM   2724 C  CD  . LYS A 1 350 ? 129.226 -19.796 77.470  1.00 73.95 ? 350 LYS A CD  1 
ATOM   2725 C  CE  . LYS A 1 350 ? 129.637 -18.883 78.624  1.00 76.04 ? 350 LYS A CE  1 
ATOM   2726 N  NZ  . LYS A 1 350 ? 128.548 -18.637 79.620  1.00 77.10 ? 350 LYS A NZ  1 
ATOM   2727 N  N   . THR A 1 351 ? 126.678 -22.896 79.232  1.00 61.39 ? 351 THR A N   1 
ATOM   2728 C  CA  . THR A 1 351 ? 125.483 -22.610 80.011  1.00 58.41 ? 351 THR A CA  1 
ATOM   2729 C  C   . THR A 1 351 ? 125.714 -21.262 80.662  1.00 58.06 ? 351 THR A C   1 
ATOM   2730 O  O   . THR A 1 351 ? 126.748 -20.623 80.478  1.00 57.63 ? 351 THR A O   1 
ATOM   2731 C  CB  . THR A 1 351 ? 125.271 -23.618 81.160  1.00 56.11 ? 351 THR A CB  1 
ATOM   2732 O  OG1 . THR A 1 351 ? 125.954 -24.839 80.873  1.00 53.84 ? 351 THR A OG1 1 
ATOM   2733 C  CG2 . THR A 1 351 ? 123.796 -23.895 81.349  1.00 55.05 ? 351 THR A CG2 1 
ATOM   2734 N  N   . GLY A 1 352 ? 124.771 -20.865 81.489  1.00 57.29 ? 352 GLY A N   1 
ATOM   2735 C  CA  . GLY A 1 352 ? 124.881 -19.594 82.144  1.00 56.97 ? 352 GLY A CA  1 
ATOM   2736 C  C   . GLY A 1 352 ? 123.469 -19.121 82.350  1.00 57.79 ? 352 GLY A C   1 
ATOM   2737 O  O   . GLY A 1 352 ? 122.503 -19.783 81.945  1.00 55.59 ? 352 GLY A O   1 
ATOM   2738 N  N   . LYS A 1 353 ? 123.356 -17.883 82.797  1.00 60.04 ? 353 LYS A N   1 
ATOM   2739 C  CA  . LYS A 1 353 ? 122.057 -17.339 83.118  1.00 62.62 ? 353 LYS A CA  1 
ATOM   2740 C  C   . LYS A 1 353 ? 122.093 -15.825 83.151  1.00 64.64 ? 353 LYS A C   1 
ATOM   2741 O  O   . LYS A 1 353 ? 123.140 -15.207 83.343  1.00 64.69 ? 353 LYS A O   1 
ATOM   2742 C  CB  . LYS A 1 353 ? 121.702 -17.825 84.516  1.00 62.51 ? 353 LYS A CB  1 
ATOM   2743 C  CG  . LYS A 1 353 ? 122.884 -17.581 85.454  1.00 62.37 ? 353 LYS A CG  1 
ATOM   2744 C  CD  . LYS A 1 353 ? 122.677 -18.022 86.877  1.00 61.98 ? 353 LYS A CD  1 
ATOM   2745 C  CE  . LYS A 1 353 ? 123.928 -17.706 87.688  1.00 61.32 ? 353 LYS A CE  1 
ATOM   2746 N  NZ  . LYS A 1 353 ? 124.286 -16.255 87.631  1.00 60.24 ? 353 LYS A NZ  1 
ATOM   2747 N  N   . TYR A 1 354 ? 120.920 -15.240 82.996  1.00 67.67 ? 354 TYR A N   1 
ATOM   2748 C  CA  . TYR A 1 354 ? 120.773 -13.809 83.060  1.00 71.64 ? 354 TYR A CA  1 
ATOM   2749 C  C   . TYR A 1 354 ? 119.926 -13.535 84.298  1.00 73.34 ? 354 TYR A C   1 
ATOM   2750 O  O   . TYR A 1 354 ? 118.831 -14.087 84.451  1.00 73.22 ? 354 TYR A O   1 
ATOM   2751 C  CB  . TYR A 1 354 ? 120.062 -13.273 81.820  1.00 73.93 ? 354 TYR A CB  1 
ATOM   2752 C  CG  . TYR A 1 354 ? 119.429 -11.918 82.058  1.00 76.57 ? 354 TYR A CG  1 
ATOM   2753 C  CD1 . TYR A 1 354 ? 120.216 -10.796 82.347  1.00 78.19 ? 354 TYR A CD1 1 
ATOM   2754 C  CD2 . TYR A 1 354 ? 118.040 -11.772 82.080  1.00 77.76 ? 354 TYR A CD2 1 
ATOM   2755 C  CE1 . TYR A 1 354 ? 119.632 -9.562  82.659  1.00 79.23 ? 354 TYR A CE1 1 
ATOM   2756 C  CE2 . TYR A 1 354 ? 117.445 -10.544 82.392  1.00 78.86 ? 354 TYR A CE2 1 
ATOM   2757 C  CZ  . TYR A 1 354 ? 118.244 -9.449  82.684  1.00 79.79 ? 354 TYR A CZ  1 
ATOM   2758 O  OH  . TYR A 1 354 ? 117.650 -8.248  83.012  1.00 80.74 ? 354 TYR A OH  1 
ATOM   2759 N  N   . ALA A 1 355 ? 120.449 -12.698 85.185  1.00 76.51 ? 355 ALA A N   1 
ATOM   2760 C  CA  . ALA A 1 355 ? 119.742 -12.327 86.405  1.00 78.65 ? 355 ALA A CA  1 
ATOM   2761 C  C   . ALA A 1 355 ? 118.971 -11.017 86.167  1.00 81.02 ? 355 ALA A C   1 
ATOM   2762 O  O   . ALA A 1 355 ? 119.565 -10.030 85.708  1.00 81.77 ? 355 ALA A O   1 
ATOM   2763 C  CB  . ALA A 1 355 ? 120.748 -12.157 87.545  1.00 77.95 ? 355 ALA A CB  1 
ATOM   2764 N  N   . ARG A 1 356 ? 117.663 -11.018 86.457  1.00 82.92 ? 356 ARG A N   1 
ATOM   2765 C  CA  . ARG A 1 356 ? 116.806 -9.837  86.287  1.00 85.03 ? 356 ARG A CA  1 
ATOM   2766 C  C   . ARG A 1 356 ? 117.545 -8.610  86.804  1.00 86.63 ? 356 ARG A C   1 
ATOM   2767 O  O   . ARG A 1 356 ? 118.079 -8.599  87.922  1.00 85.79 ? 356 ARG A O   1 
ATOM   2768 C  CB  . ARG A 1 356 ? 115.482 -10.015 87.018  1.00 83.36 ? 356 ARG A CB  1 
ATOM   2769 N  N   . MET A 1 357 ? 117.577 -7.582  85.967  1.00 90.56 ? 357 MET A N   1 
ATOM   2770 C  CA  . MET A 1 357 ? 118.304 -6.349  86.259  1.00 94.01 ? 357 MET A CA  1 
ATOM   2771 C  C   . MET A 1 357 ? 117.620 -5.323  87.162  1.00 95.25 ? 357 MET A C   1 
ATOM   2772 O  O   . MET A 1 357 ? 116.610 -5.608  87.809  1.00 94.92 ? 357 MET A O   1 
ATOM   2773 C  CB  . MET A 1 357 ? 118.731 -5.680  84.929  1.00 93.37 ? 357 MET A CB  1 
ATOM   2774 N  N   . ARG A 1 358 ? 118.239 -4.142  87.245  1.00 97.18 ? 358 ARG A N   1 
ATOM   2775 C  CA  . ARG A 1 358 ? 117.697 -3.030  88.020  1.00 98.38 ? 358 ARG A CA  1 
ATOM   2776 C  C   . ARG A 1 358 ? 116.376 -2.668  87.327  1.00 99.17 ? 358 ARG A C   1 
ATOM   2777 O  O   . ARG A 1 358 ? 116.142 -3.055  86.172  1.00 99.36 ? 358 ARG A O   1 
ATOM   2778 C  CB  . ARG A 1 358 ? 118.661 -1.836  88.012  1.00 98.10 ? 358 ARG A CB  1 
ATOM   2779 N  N   . GLY A 1 359 ? 115.544 -1.885  88.005  1.00 99.02 ? 359 GLY A N   1 
ATOM   2780 C  CA  . GLY A 1 359 ? 114.249 -1.534  87.442  1.00 97.71 ? 359 GLY A CA  1 
ATOM   2781 C  C   . GLY A 1 359 ? 113.304 -2.562  88.032  1.00 96.17 ? 359 GLY A C   1 
ATOM   2782 O  O   . GLY A 1 359 ? 112.792 -3.444  87.341  1.00 96.53 ? 359 GLY A O   1 
ATOM   2783 N  N   . ALA A 1 360 ? 113.076 -2.402  89.329  1.00 95.04 ? 360 ALA A N   1 
ATOM   2784 C  CA  . ALA A 1 360 ? 112.253 -3.279  90.130  1.00 92.85 ? 360 ALA A CA  1 
ATOM   2785 C  C   . ALA A 1 360 ? 111.035 -3.970  89.517  1.00 91.36 ? 360 ALA A C   1 
ATOM   2786 O  O   . ALA A 1 360 ? 110.811 -5.147  89.780  1.00 91.66 ? 360 ALA A O   1 
ATOM   2787 C  CB  . ALA A 1 360 ? 111.846 -2.548  91.409  1.00 92.77 ? 360 ALA A CB  1 
ATOM   2788 N  N   . HIS A 1 361 ? 110.268 -3.264  88.693  1.00 88.98 ? 361 HIS A N   1 
ATOM   2789 C  CA  . HIS A 1 361 ? 109.052 -3.853  88.118  1.00 87.21 ? 361 HIS A CA  1 
ATOM   2790 C  C   . HIS A 1 361 ? 109.173 -3.939  86.623  1.00 84.55 ? 361 HIS A C   1 
ATOM   2791 O  O   . HIS A 1 361 ? 109.156 -2.929  85.925  1.00 84.42 ? 361 HIS A O   1 
ATOM   2792 C  CB  . HIS A 1 361 ? 107.863 -3.001  88.531  1.00 89.84 ? 361 HIS A CB  1 
ATOM   2793 C  CG  . HIS A 1 361 ? 107.995 -2.476  89.930  1.00 93.24 ? 361 HIS A CG  1 
ATOM   2794 N  ND1 . HIS A 1 361 ? 108.655 -1.298  90.218  1.00 94.84 ? 361 HIS A ND1 1 
ATOM   2795 C  CD2 . HIS A 1 361 ? 107.628 -3.002  91.121  1.00 94.92 ? 361 HIS A CD2 1 
ATOM   2796 C  CE1 . HIS A 1 361 ? 108.693 -1.126  91.531  1.00 95.80 ? 361 HIS A CE1 1 
ATOM   2797 N  NE2 . HIS A 1 361 ? 108.078 -2.146  92.098  1.00 96.27 ? 361 HIS A NE2 1 
ATOM   2798 N  N   . THR A 1 362 ? 109.232 -5.168  86.136  1.00 82.65 ? 362 THR A N   1 
ATOM   2799 C  CA  . THR A 1 362 ? 109.411 -5.419  84.713  1.00 79.73 ? 362 THR A CA  1 
ATOM   2800 C  C   . THR A 1 362 ? 108.462 -6.458  84.165  1.00 76.57 ? 362 THR A C   1 
ATOM   2801 O  O   . THR A 1 362 ? 107.659 -7.029  84.894  1.00 78.01 ? 362 THR A O   1 
ATOM   2802 C  CB  . THR A 1 362 ? 110.816 -5.974  84.448  1.00 81.27 ? 362 THR A CB  1 
ATOM   2803 O  OG1 . THR A 1 362 ? 111.696 -5.588  85.512  1.00 82.45 ? 362 THR A OG1 1 
ATOM   2804 C  CG2 . THR A 1 362 ? 111.366 -5.466  83.114  1.00 82.33 ? 362 THR A CG2 1 
ATOM   2805 N  N   . ASN A 1 363 ? 108.567 -6.693  82.864  1.00 72.22 ? 363 ASN A N   1 
ATOM   2806 C  CA  . ASN A 1 363 ? 107.765 -7.687  82.176  1.00 68.94 ? 363 ASN A CA  1 
ATOM   2807 C  C   . ASN A 1 363 ? 108.702 -8.843  81.804  1.00 67.33 ? 363 ASN A C   1 
ATOM   2808 O  O   . ASN A 1 363 ? 109.863 -8.616  81.454  1.00 67.80 ? 363 ASN A O   1 
ATOM   2809 C  CB  . ASN A 1 363 ? 107.144 -7.067  80.923  1.00 68.40 ? 363 ASN A CB  1 
ATOM   2810 C  CG  . ASN A 1 363 ? 106.640 -8.104  79.952  1.00 67.31 ? 363 ASN A CG  1 
ATOM   2811 O  OD1 . ASN A 1 363 ? 107.414 -8.689  79.213  1.00 66.12 ? 363 ASN A OD1 1 
ATOM   2812 N  ND2 . ASN A 1 363 ? 105.343 -8.347  79.959  1.00 68.10 ? 363 ASN A ND2 1 
ATOM   2813 N  N   . ASP A 1 364 ? 108.202 -10.074 81.895  1.00 64.58 ? 364 ASP A N   1 
ATOM   2814 C  CA  . ASP A 1 364 ? 108.998 -11.263 81.581  1.00 60.56 ? 364 ASP A CA  1 
ATOM   2815 C  C   . ASP A 1 364 ? 109.534 -11.273 80.171  1.00 56.68 ? 364 ASP A C   1 
ATOM   2816 O  O   . ASP A 1 364 ? 110.709 -11.539 79.962  1.00 55.46 ? 364 ASP A O   1 
ATOM   2817 C  CB  . ASP A 1 364 ? 108.184 -12.535 81.823  1.00 62.91 ? 364 ASP A CB  1 
ATOM   2818 C  CG  . ASP A 1 364 ? 108.422 -13.131 83.203  1.00 62.80 ? 364 ASP A CG  1 
ATOM   2819 O  OD1 . ASP A 1 364 ? 109.432 -12.778 83.851  1.00 64.06 ? 364 ASP A OD1 1 
ATOM   2820 O  OD2 . ASP A 1 364 ? 107.598 -13.961 83.639  1.00 63.95 ? 364 ASP A OD2 1 
ATOM   2821 N  N   . VAL A 1 365 ? 108.649 -11.018 79.214  1.00 52.66 ? 365 VAL A N   1 
ATOM   2822 C  CA  . VAL A 1 365 ? 109.001 -10.979 77.798  1.00 47.98 ? 365 VAL A CA  1 
ATOM   2823 C  C   . VAL A 1 365 ? 110.158 -10.001 77.620  1.00 44.65 ? 365 VAL A C   1 
ATOM   2824 O  O   . VAL A 1 365 ? 111.233 -10.381 77.158  1.00 42.63 ? 365 VAL A O   1 
ATOM   2825 C  CB  . VAL A 1 365 ? 107.805 -10.494 76.951  1.00 48.67 ? 365 VAL A CB  1 
ATOM   2826 C  CG1 . VAL A 1 365 ? 107.956 -10.943 75.519  1.00 47.93 ? 365 VAL A CG1 1 
ATOM   2827 C  CG2 . VAL A 1 365 ? 106.490 -10.980 77.553  1.00 48.47 ? 365 VAL A CG2 1 
ATOM   2828 N  N   . LYS A 1 366 ? 109.933 -8.754  78.030  1.00 41.15 ? 366 LYS A N   1 
ATOM   2829 C  CA  . LYS A 1 366 ? 110.944 -7.713  77.955  1.00 39.78 ? 366 LYS A CA  1 
ATOM   2830 C  C   . LYS A 1 366 ? 112.208 -8.302  78.521  1.00 37.76 ? 366 LYS A C   1 
ATOM   2831 O  O   . LYS A 1 366 ? 113.250 -8.337  77.877  1.00 36.47 ? 366 LYS A O   1 
ATOM   2832 C  CB  . LYS A 1 366 ? 110.527 -6.510  78.789  1.00 38.65 ? 366 LYS A CB  1 
ATOM   2833 N  N   . GLN A 1 367 ? 112.063 -8.888  79.688  1.00 38.40 ? 367 GLN A N   1 
ATOM   2834 C  CA  . GLN A 1 367 ? 113.188 -9.476  80.354  1.00 39.94 ? 367 GLN A CA  1 
ATOM   2835 C  C   . GLN A 1 367 ? 113.808 -10.550 79.502  1.00 39.71 ? 367 GLN A C   1 
ATOM   2836 O  O   . GLN A 1 367 ? 115.021 -10.576 79.318  1.00 40.70 ? 367 GLN A O   1 
ATOM   2837 C  CB  . GLN A 1 367 ? 112.751 -10.064 81.670  1.00 42.55 ? 367 GLN A CB  1 
ATOM   2838 C  CG  . GLN A 1 367 ? 113.909 -10.282 82.580  1.00 47.82 ? 367 GLN A CG  1 
ATOM   2839 C  CD  . GLN A 1 367 ? 113.498 -10.860 83.899  1.00 50.75 ? 367 GLN A CD  1 
ATOM   2840 O  OE1 . GLN A 1 367 ? 114.300 -11.517 84.565  1.00 52.19 ? 367 GLN A OE1 1 
ATOM   2841 N  NE2 . GLN A 1 367 ? 112.240 -10.627 84.295  1.00 51.63 ? 367 GLN A NE2 1 
ATOM   2842 N  N   . LEU A 1 368 ? 112.962 -11.397 78.937  1.00 39.33 ? 368 LEU A N   1 
ATOM   2843 C  CA  . LEU A 1 368 ? 113.407 -12.495 78.099  1.00 40.01 ? 368 LEU A CA  1 
ATOM   2844 C  C   . LEU A 1 368 ? 114.295 -11.943 77.000  1.00 38.92 ? 368 LEU A C   1 
ATOM   2845 O  O   . LEU A 1 368 ? 115.383 -12.459 76.718  1.00 37.73 ? 368 LEU A O   1 
ATOM   2846 C  CB  . LEU A 1 368 ? 112.197 -13.201 77.477  1.00 41.48 ? 368 LEU A CB  1 
ATOM   2847 C  CG  . LEU A 1 368 ? 112.455 -14.160 76.304  1.00 42.70 ? 368 LEU A CG  1 
ATOM   2848 C  CD1 . LEU A 1 368 ? 113.313 -15.372 76.706  1.00 40.10 ? 368 LEU A CD1 1 
ATOM   2849 C  CD2 . LEU A 1 368 ? 111.114 -14.608 75.769  1.00 43.11 ? 368 LEU A CD2 1 
ATOM   2850 N  N   . THR A 1 369 ? 113.811 -10.879 76.388  1.00 36.88 ? 369 THR A N   1 
ATOM   2851 C  CA  . THR A 1 369 ? 114.529 -10.232 75.325  1.00 34.78 ? 369 THR A CA  1 
ATOM   2852 C  C   . THR A 1 369 ? 115.837 -9.670  75.866  1.00 32.61 ? 369 THR A C   1 
ATOM   2853 O  O   . THR A 1 369 ? 116.908 -9.886  75.287  1.00 31.07 ? 369 THR A O   1 
ATOM   2854 C  CB  . THR A 1 369 ? 113.660 -9.153  74.739  1.00 35.75 ? 369 THR A CB  1 
ATOM   2855 O  OG1 . THR A 1 369 ? 112.345 -9.691  74.518  1.00 35.33 ? 369 THR A OG1 1 
ATOM   2856 C  CG2 . THR A 1 369 ? 114.227 -8.699  73.437  1.00 35.78 ? 369 THR A CG2 1 
ATOM   2857 N  N   . GLU A 1 370 ? 115.757 -9.020  77.022  1.00 31.85 ? 370 GLU A N   1 
ATOM   2858 C  CA  . GLU A 1 370 ? 116.938 -8.459  77.671  1.00 33.06 ? 370 GLU A CA  1 
ATOM   2859 C  C   . GLU A 1 370 ? 117.944 -9.582  77.860  1.00 31.05 ? 370 GLU A C   1 
ATOM   2860 O  O   . GLU A 1 370 ? 119.158 -9.367  77.904  1.00 30.25 ? 370 GLU A O   1 
ATOM   2861 C  CB  . GLU A 1 370 ? 116.572 -7.874  79.036  1.00 36.48 ? 370 GLU A CB  1 
ATOM   2862 C  CG  . GLU A 1 370 ? 115.838 -6.528  78.964  1.00 44.67 ? 370 GLU A CG  1 
ATOM   2863 C  CD  . GLU A 1 370 ? 115.287 -6.046  80.324  1.00 48.83 ? 370 GLU A CD  1 
ATOM   2864 O  OE1 . GLU A 1 370 ? 116.110 -5.814  81.254  1.00 49.35 ? 370 GLU A OE1 1 
ATOM   2865 O  OE2 . GLU A 1 370 ? 114.035 -5.887  80.444  1.00 49.95 ? 370 GLU A OE2 1 
ATOM   2866 N  N   . ALA A 1 371 ? 117.414 -10.792 77.951  1.00 30.00 ? 371 ALA A N   1 
ATOM   2867 C  CA  . ALA A 1 371 ? 118.215 -11.983 78.142  1.00 28.41 ? 371 ALA A CA  1 
ATOM   2868 C  C   . ALA A 1 371 ? 118.903 -12.423 76.833  1.00 26.67 ? 371 ALA A C   1 
ATOM   2869 O  O   . ALA A 1 371 ? 120.137 -12.529 76.762  1.00 24.76 ? 371 ALA A O   1 
ATOM   2870 C  CB  . ALA A 1 371 ? 117.321 -13.100 78.716  1.00 25.83 ? 371 ALA A CB  1 
ATOM   2871 N  N   . VAL A 1 372 ? 118.099 -12.619 75.793  1.00 26.15 ? 372 VAL A N   1 
ATOM   2872 C  CA  . VAL A 1 372 ? 118.588 -13.043 74.485  1.00 25.83 ? 372 VAL A CA  1 
ATOM   2873 C  C   . VAL A 1 372 ? 119.823 -12.272 74.098  1.00 25.56 ? 372 VAL A C   1 
ATOM   2874 O  O   . VAL A 1 372 ? 120.737 -12.802 73.462  1.00 24.52 ? 372 VAL A O   1 
ATOM   2875 C  CB  . VAL A 1 372 ? 117.567 -12.740 73.422  1.00 26.78 ? 372 VAL A CB  1 
ATOM   2876 C  CG1 . VAL A 1 372 ? 118.080 -13.202 72.047  1.00 26.87 ? 372 VAL A CG1 1 
ATOM   2877 C  CG2 . VAL A 1 372 ? 116.211 -13.331 73.821  1.00 25.99 ? 372 VAL A CG2 1 
ATOM   2878 N  N   . GLN A 1 373 ? 119.791 -10.993 74.440  1.00 24.29 ? 373 GLN A N   1 
ATOM   2879 C  CA  . GLN A 1 373 ? 120.882 -10.094 74.169  1.00 23.99 ? 373 GLN A CA  1 
ATOM   2880 C  C   . GLN A 1 373 ? 122.205 -10.622 74.745  1.00 21.34 ? 373 GLN A C   1 
ATOM   2881 O  O   . GLN A 1 373 ? 123.095 -10.985 74.001  1.00 18.90 ? 373 GLN A O   1 
ATOM   2882 C  CB  . GLN A 1 373 ? 120.530 -8.693  74.713  1.00 27.15 ? 373 GLN A CB  1 
ATOM   2883 C  CG  . GLN A 1 373 ? 121.611 -7.588  74.538  1.00 30.53 ? 373 GLN A CG  1 
ATOM   2884 C  CD  . GLN A 1 373 ? 122.112 -7.437  73.101  1.00 30.90 ? 373 GLN A CD  1 
ATOM   2885 O  OE1 . GLN A 1 373 ? 123.045 -8.135  72.689  1.00 33.71 ? 373 GLN A OE1 1 
ATOM   2886 N  NE2 . GLN A 1 373 ? 121.487 -6.546  72.332  1.00 28.85 ? 373 GLN A NE2 1 
ATOM   2887 N  N   . LYS A 1 374 ? 122.308 -10.706 76.062  1.00 21.31 ? 374 LYS A N   1 
ATOM   2888 C  CA  . LYS A 1 374 ? 123.525 -11.167 76.732  1.00 23.65 ? 374 LYS A CA  1 
ATOM   2889 C  C   . LYS A 1 374 ? 124.136 -12.349 75.977  1.00 23.89 ? 374 LYS A C   1 
ATOM   2890 O  O   . LYS A 1 374 ? 125.359 -12.472 75.809  1.00 21.12 ? 374 LYS A O   1 
ATOM   2891 C  CB  . LYS A 1 374 ? 123.168 -11.573 78.178  1.00 27.88 ? 374 LYS A CB  1 
ATOM   2892 C  CG  . LYS A 1 374 ? 124.302 -12.142 79.042  1.00 29.58 ? 374 LYS A CG  1 
ATOM   2893 C  CD  . LYS A 1 374 ? 125.322 -11.077 79.389  1.00 31.57 ? 374 LYS A CD  1 
ATOM   2894 C  CE  . LYS A 1 374 ? 126.735 -11.651 79.372  1.00 32.64 ? 374 LYS A CE  1 
ATOM   2895 N  NZ  . LYS A 1 374 ? 126.915 -12.777 80.344  1.00 34.38 ? 374 LYS A NZ  1 
ATOM   2896 N  N   . ILE A 1 375 ? 123.234 -13.185 75.495  1.00 25.48 ? 375 ILE A N   1 
ATOM   2897 C  CA  . ILE A 1 375 ? 123.551 -14.380 74.740  1.00 26.67 ? 375 ILE A CA  1 
ATOM   2898 C  C   . ILE A 1 375 ? 124.170 -13.924 73.437  1.00 25.82 ? 375 ILE A C   1 
ATOM   2899 O  O   . ILE A 1 375 ? 125.311 -14.291 73.113  1.00 25.28 ? 375 ILE A O   1 
ATOM   2900 C  CB  . ILE A 1 375 ? 122.242 -15.151 74.457  1.00 28.42 ? 375 ILE A CB  1 
ATOM   2901 C  CG1 . ILE A 1 375 ? 121.529 -15.422 75.784  1.00 29.04 ? 375 ILE A CG1 1 
ATOM   2902 C  CG2 . ILE A 1 375 ? 122.518 -16.442 73.691  1.00 27.98 ? 375 ILE A CG2 1 
ATOM   2903 C  CD1 . ILE A 1 375 ? 120.210 -16.076 75.624  1.00 30.65 ? 375 ILE A CD1 1 
ATOM   2904 N  N   . THR A 1 376 ? 123.399 -13.119 72.708  1.00 24.83 ? 376 THR A N   1 
ATOM   2905 C  CA  . THR A 1 376 ? 123.816 -12.548 71.442  1.00 24.56 ? 376 THR A CA  1 
ATOM   2906 C  C   . THR A 1 376 ? 125.235 -12.072 71.666  1.00 23.73 ? 376 THR A C   1 
ATOM   2907 O  O   . THR A 1 376 ? 126.181 -12.636 71.134  1.00 22.65 ? 376 THR A O   1 
ATOM   2908 C  CB  . THR A 1 376 ? 122.919 -11.366 71.092  1.00 24.32 ? 376 THR A CB  1 
ATOM   2909 O  OG1 . THR A 1 376 ? 121.561 -11.703 71.410  1.00 26.31 ? 376 THR A OG1 1 
ATOM   2910 C  CG2 . THR A 1 376 ? 123.004 -11.050 69.628  1.00 24.57 ? 376 THR A CG2 1 
ATOM   2911 N  N   . THR A 1 377 ? 125.364 -11.124 72.572  1.00 25.27 ? 377 THR A N   1 
ATOM   2912 C  CA  . THR A 1 377 ? 126.638 -10.548 72.980  1.00 30.03 ? 377 THR A CA  1 
ATOM   2913 C  C   . THR A 1 377 ? 127.846 -11.512 73.110  1.00 30.81 ? 377 THR A C   1 
ATOM   2914 O  O   . THR A 1 377 ? 128.922 -11.251 72.546  1.00 30.90 ? 377 THR A O   1 
ATOM   2915 C  CB  . THR A 1 377 ? 126.421 -9.844  74.324  1.00 32.58 ? 377 THR A CB  1 
ATOM   2916 O  OG1 . THR A 1 377 ? 125.447 -8.802  74.153  1.00 34.28 ? 377 THR A OG1 1 
ATOM   2917 C  CG2 . THR A 1 377 ? 127.736 -9.293  74.900  1.00 33.62 ? 377 THR A CG2 1 
ATOM   2918 N  N   . GLU A 1 378 ? 127.685 -12.583 73.886  1.00 31.50 ? 378 GLU A N   1 
ATOM   2919 C  CA  . GLU A 1 378 ? 128.755 -13.567 74.099  1.00 31.86 ? 378 GLU A CA  1 
ATOM   2920 C  C   . GLU A 1 378 ? 129.244 -14.271 72.821  1.00 31.06 ? 378 GLU A C   1 
ATOM   2921 O  O   . GLU A 1 378 ? 130.443 -14.292 72.507  1.00 27.81 ? 378 GLU A O   1 
ATOM   2922 C  CB  . GLU A 1 378 ? 128.278 -14.620 75.101  1.00 35.24 ? 378 GLU A CB  1 
ATOM   2923 C  CG  . GLU A 1 378 ? 128.093 -14.119 76.533  1.00 37.62 ? 378 GLU A CG  1 
ATOM   2924 C  CD  . GLU A 1 378 ? 127.379 -15.146 77.423  1.00 38.35 ? 378 GLU A CD  1 
ATOM   2925 O  OE1 . GLU A 1 378 ? 126.166 -15.394 77.161  1.00 39.10 ? 378 GLU A OE1 1 
ATOM   2926 O  OE2 . GLU A 1 378 ? 128.022 -15.682 78.376  1.00 34.42 ? 378 GLU A OE2 1 
ATOM   2927 N  N   . SER A 1 379 ? 128.297 -14.858 72.099  1.00 31.07 ? 379 SER A N   1 
ATOM   2928 C  CA  . SER A 1 379 ? 128.572 -15.577 70.856  1.00 30.58 ? 379 SER A CA  1 
ATOM   2929 C  C   . SER A 1 379 ? 129.500 -14.779 69.945  1.00 27.12 ? 379 SER A C   1 
ATOM   2930 O  O   . SER A 1 379 ? 130.305 -15.325 69.195  1.00 26.04 ? 379 SER A O   1 
ATOM   2931 C  CB  . SER A 1 379 ? 127.254 -15.844 70.139  1.00 33.12 ? 379 SER A CB  1 
ATOM   2932 O  OG  . SER A 1 379 ? 127.446 -16.717 69.042  1.00 38.67 ? 379 SER A OG  1 
ATOM   2933 N  N   . ILE A 1 380 ? 129.323 -13.473 69.999  1.00 24.88 ? 380 ILE A N   1 
ATOM   2934 C  CA  . ILE A 1 380 ? 130.121 -12.542 69.258  1.00 22.93 ? 380 ILE A CA  1 
ATOM   2935 C  C   . ILE A 1 380 ? 131.515 -12.685 69.844  1.00 23.82 ? 380 ILE A C   1 
ATOM   2936 O  O   . ILE A 1 380 ? 132.402 -13.278 69.245  1.00 24.94 ? 380 ILE A O   1 
ATOM   2937 C  CB  . ILE A 1 380 ? 129.640 -11.124 69.555  1.00 20.74 ? 380 ILE A CB  1 
ATOM   2938 C  CG1 . ILE A 1 380 ? 128.123 -11.017 69.336  1.00 20.18 ? 380 ILE A CG1 1 
ATOM   2939 C  CG2 . ILE A 1 380 ? 130.468 -10.109 68.792  1.00 22.11 ? 380 ILE A CG2 1 
ATOM   2940 C  CD1 . ILE A 1 380 ? 127.602 -11.331 67.934  1.00 18.03 ? 380 ILE A CD1 1 
ATOM   2941 N  N   . VAL A 1 381 ? 131.655 -12.247 71.085  1.00 23.78 ? 381 VAL A N   1 
ATOM   2942 C  CA  . VAL A 1 381 ? 132.921 -12.278 71.776  1.00 24.50 ? 381 VAL A CA  1 
ATOM   2943 C  C   . VAL A 1 381 ? 133.635 -13.594 71.706  1.00 26.48 ? 381 VAL A C   1 
ATOM   2944 O  O   . VAL A 1 381 ? 134.854 -13.638 71.844  1.00 26.79 ? 381 VAL A O   1 
ATOM   2945 C  CB  . VAL A 1 381 ? 132.738 -11.963 73.244  1.00 24.85 ? 381 VAL A CB  1 
ATOM   2946 C  CG1 . VAL A 1 381 ? 134.105 -11.699 73.903  1.00 26.70 ? 381 VAL A CG1 1 
ATOM   2947 C  CG2 . VAL A 1 381 ? 131.784 -10.778 73.408  1.00 26.48 ? 381 VAL A CG2 1 
ATOM   2948 N  N   . ILE A 1 382 ? 132.897 -14.674 71.505  1.00 29.06 ? 382 ILE A N   1 
ATOM   2949 C  CA  . ILE A 1 382 ? 133.553 -15.963 71.473  1.00 33.03 ? 382 ILE A CA  1 
ATOM   2950 C  C   . ILE A 1 382 ? 133.801 -16.516 70.095  1.00 35.31 ? 382 ILE A C   1 
ATOM   2951 O  O   . ILE A 1 382 ? 134.935 -16.573 69.628  1.00 36.28 ? 382 ILE A O   1 
ATOM   2952 C  CB  . ILE A 1 382 ? 132.808 -17.020 72.303  1.00 33.40 ? 382 ILE A CB  1 
ATOM   2953 C  CG1 . ILE A 1 382 ? 132.338 -16.429 73.640  1.00 36.29 ? 382 ILE A CG1 1 
ATOM   2954 C  CG2 . ILE A 1 382 ? 133.757 -18.145 72.627  1.00 33.46 ? 382 ILE A CG2 1 
ATOM   2955 C  CD1 . ILE A 1 382 ? 131.927 -17.452 74.713  1.00 33.29 ? 382 ILE A CD1 1 
ATOM   2956 N  N   . TRP A 1 383 ? 132.728 -16.939 69.451  1.00 39.02 ? 383 TRP A N   1 
ATOM   2957 C  CA  . TRP A 1 383 ? 132.820 -17.523 68.127  1.00 42.24 ? 383 TRP A CA  1 
ATOM   2958 C  C   . TRP A 1 383 ? 132.350 -16.526 67.094  1.00 42.90 ? 383 TRP A C   1 
ATOM   2959 O  O   . TRP A 1 383 ? 131.956 -16.911 65.990  1.00 42.87 ? 383 TRP A O   1 
ATOM   2960 C  CB  . TRP A 1 383 ? 131.957 -18.775 68.051  1.00 46.22 ? 383 TRP A CB  1 
ATOM   2961 C  CG  . TRP A 1 383 ? 132.047 -19.618 69.276  1.00 49.88 ? 383 TRP A CG  1 
ATOM   2962 C  CD1 . TRP A 1 383 ? 132.950 -20.614 69.531  1.00 50.46 ? 383 TRP A CD1 1 
ATOM   2963 C  CD2 . TRP A 1 383 ? 131.184 -19.552 70.425  1.00 52.54 ? 383 TRP A CD2 1 
ATOM   2964 N  NE1 . TRP A 1 383 ? 132.696 -21.178 70.761  1.00 53.04 ? 383 TRP A NE1 1 
ATOM   2965 C  CE2 . TRP A 1 383 ? 131.622 -20.545 71.334  1.00 52.58 ? 383 TRP A CE2 1 
ATOM   2966 C  CE3 . TRP A 1 383 ? 130.087 -18.743 70.776  1.00 51.77 ? 383 TRP A CE3 1 
ATOM   2967 C  CZ2 . TRP A 1 383 ? 130.997 -20.756 72.573  1.00 51.33 ? 383 TRP A CZ2 1 
ATOM   2968 C  CZ3 . TRP A 1 383 ? 129.469 -18.951 72.005  1.00 49.80 ? 383 TRP A CZ3 1 
ATOM   2969 C  CH2 . TRP A 1 383 ? 129.927 -19.950 72.888  1.00 50.26 ? 383 TRP A CH2 1 
ATOM   2970 N  N   . GLY A 1 384 ? 132.305 -15.260 67.501  1.00 43.78 ? 384 GLY A N   1 
ATOM   2971 C  CA  . GLY A 1 384 ? 131.907 -14.169 66.624  1.00 45.59 ? 384 GLY A CA  1 
ATOM   2972 C  C   . GLY A 1 384 ? 130.714 -14.374 65.712  1.00 47.62 ? 384 GLY A C   1 
ATOM   2973 O  O   . GLY A 1 384 ? 130.585 -13.692 64.679  1.00 46.98 ? 384 GLY A O   1 
ATOM   2974 N  N   . LYS A 1 385 ? 129.844 -15.304 66.088  1.00 47.44 ? 385 LYS A N   1 
ATOM   2975 C  CA  . LYS A 1 385 ? 128.664 -15.606 65.300  1.00 48.00 ? 385 LYS A CA  1 
ATOM   2976 C  C   . LYS A 1 385 ? 127.457 -15.114 66.077  1.00 47.35 ? 385 LYS A C   1 
ATOM   2977 O  O   . LYS A 1 385 ? 127.595 -14.429 67.087  1.00 46.29 ? 385 LYS A O   1 
ATOM   2978 C  CB  . LYS A 1 385 ? 128.556 -17.126 65.078  1.00 49.10 ? 385 LYS A CB  1 
ATOM   2979 C  CG  . LYS A 1 385 ? 129.714 -17.768 64.290  1.00 50.87 ? 385 LYS A CG  1 
ATOM   2980 C  CD  . LYS A 1 385 ? 129.503 -17.686 62.775  1.00 51.12 ? 385 LYS A CD  1 
ATOM   2981 C  CE  . LYS A 1 385 ? 130.837 -17.656 62.013  1.00 52.58 ? 385 LYS A CE  1 
ATOM   2982 N  NZ  . LYS A 1 385 ? 130.677 -17.475 60.530  1.00 51.06 ? 385 LYS A NZ  1 
ATOM   2983 N  N   . THR A 1 386 ? 126.275 -15.405 65.556  1.00 48.72 ? 386 THR A N   1 
ATOM   2984 C  CA  . THR A 1 386 ? 125.032 -15.057 66.218  1.00 51.41 ? 386 THR A CA  1 
ATOM   2985 C  C   . THR A 1 386 ? 124.348 -16.423 66.308  1.00 52.47 ? 386 THR A C   1 
ATOM   2986 O  O   . THR A 1 386 ? 124.047 -17.040 65.282  1.00 53.29 ? 386 THR A O   1 
ATOM   2987 C  CB  . THR A 1 386 ? 124.195 -14.023 65.406  1.00 50.26 ? 386 THR A CB  1 
ATOM   2988 O  OG1 . THR A 1 386 ? 123.903 -14.524 64.098  1.00 50.07 ? 386 THR A OG1 1 
ATOM   2989 C  CG2 . THR A 1 386 ? 124.957 -12.711 65.273  1.00 51.12 ? 386 THR A CG2 1 
ATOM   2990 N  N   . PRO A 1 387 ? 124.164 -16.946 67.537  1.00 53.36 ? 387 PRO A N   1 
ATOM   2991 C  CA  . PRO A 1 387 ? 123.526 -18.258 67.651  1.00 54.51 ? 387 PRO A CA  1 
ATOM   2992 C  C   . PRO A 1 387 ? 122.076 -18.179 67.238  1.00 54.41 ? 387 PRO A C   1 
ATOM   2993 O  O   . PRO A 1 387 ? 121.413 -17.172 67.489  1.00 53.83 ? 387 PRO A O   1 
ATOM   2994 C  CB  . PRO A 1 387 ? 123.657 -18.565 69.142  1.00 53.22 ? 387 PRO A CB  1 
ATOM   2995 C  CG  . PRO A 1 387 ? 123.447 -17.217 69.769  1.00 52.34 ? 387 PRO A CG  1 
ATOM   2996 C  CD  . PRO A 1 387 ? 124.240 -16.282 68.858  1.00 53.90 ? 387 PRO A CD  1 
ATOM   2997 N  N   . LYS A 1 388 ? 121.599 -19.197 66.534  1.00 55.29 ? 388 LYS A N   1 
ATOM   2998 C  CA  . LYS A 1 388 ? 120.202 -19.182 66.172  1.00 56.61 ? 388 LYS A CA  1 
ATOM   2999 C  C   . LYS A 1 388 ? 119.518 -19.461 67.520  1.00 56.22 ? 388 LYS A C   1 
ATOM   3000 O  O   . LYS A 1 388 ? 119.985 -20.290 68.314  1.00 54.32 ? 388 LYS A O   1 
ATOM   3001 C  CB  . LYS A 1 388 ? 119.883 -20.239 65.119  1.00 57.42 ? 388 LYS A CB  1 
ATOM   3002 C  CG  . LYS A 1 388 ? 118.648 -19.884 64.274  1.00 61.09 ? 388 LYS A CG  1 
ATOM   3003 C  CD  . LYS A 1 388 ? 118.334 -20.938 63.182  1.00 65.37 ? 388 LYS A CD  1 
ATOM   3004 C  CE  . LYS A 1 388 ? 119.363 -20.942 62.021  1.00 67.53 ? 388 LYS A CE  1 
ATOM   3005 N  NZ  . LYS A 1 388 ? 119.154 -22.048 61.026  1.00 67.90 ? 388 LYS A NZ  1 
ATOM   3006 N  N   . PHE A 1 389 ? 118.468 -18.712 67.815  1.00 55.98 ? 389 PHE A N   1 
ATOM   3007 C  CA  . PHE A 1 389 ? 117.804 -18.879 69.080  1.00 56.47 ? 389 PHE A CA  1 
ATOM   3008 C  C   . PHE A 1 389 ? 116.618 -19.835 69.147  1.00 57.20 ? 389 PHE A C   1 
ATOM   3009 O  O   . PHE A 1 389 ? 115.799 -19.941 68.214  1.00 56.36 ? 389 PHE A O   1 
ATOM   3010 C  CB  . PHE A 1 389 ? 117.440 -17.514 69.649  1.00 56.70 ? 389 PHE A CB  1 
ATOM   3011 C  CG  . PHE A 1 389 ? 118.615 -16.750 70.179  1.00 55.63 ? 389 PHE A CG  1 
ATOM   3012 C  CD1 . PHE A 1 389 ? 119.506 -16.138 69.315  1.00 55.32 ? 389 PHE A CD1 1 
ATOM   3013 C  CD2 . PHE A 1 389 ? 118.823 -16.640 71.555  1.00 56.25 ? 389 PHE A CD2 1 
ATOM   3014 C  CE1 . PHE A 1 389 ? 120.592 -15.425 69.814  1.00 57.13 ? 389 PHE A CE1 1 
ATOM   3015 C  CE2 . PHE A 1 389 ? 119.902 -15.931 72.064  1.00 55.41 ? 389 PHE A CE2 1 
ATOM   3016 C  CZ  . PHE A 1 389 ? 120.791 -15.321 71.196  1.00 56.83 ? 389 PHE A CZ  1 
ATOM   3017 N  N   . LYS A 1 390 ? 116.537 -20.492 70.304  1.00 58.29 ? 390 LYS A N   1 
ATOM   3018 C  CA  . LYS A 1 390 ? 115.502 -21.456 70.656  1.00 58.52 ? 390 LYS A CA  1 
ATOM   3019 C  C   . LYS A 1 390 ? 114.756 -20.799 71.802  1.00 56.65 ? 390 LYS A C   1 
ATOM   3020 O  O   . LYS A 1 390 ? 115.215 -20.783 72.965  1.00 53.44 ? 390 LYS A O   1 
ATOM   3021 C  CB  . LYS A 1 390 ? 116.115 -22.791 71.089  1.00 61.16 ? 390 LYS A CB  1 
ATOM   3022 C  CG  . LYS A 1 390 ? 116.577 -23.640 69.913  1.00 64.12 ? 390 LYS A CG  1 
ATOM   3023 C  CD  . LYS A 1 390 ? 116.370 -25.139 70.151  1.00 65.51 ? 390 LYS A CD  1 
ATOM   3024 C  CE  . LYS A 1 390 ? 116.539 -25.926 68.847  1.00 65.21 ? 390 LYS A CE  1 
ATOM   3025 N  NZ  . LYS A 1 390 ? 116.527 -27.392 69.062  1.00 64.22 ? 390 LYS A NZ  1 
ATOM   3026 N  N   . LEU A 1 391 ? 113.600 -20.251 71.442  1.00 56.13 ? 391 LEU A N   1 
ATOM   3027 C  CA  . LEU A 1 391 ? 112.789 -19.499 72.373  1.00 54.53 ? 391 LEU A CA  1 
ATOM   3028 C  C   . LEU A 1 391 ? 111.441 -20.016 72.795  1.00 52.13 ? 391 LEU A C   1 
ATOM   3029 O  O   . LEU A 1 391 ? 110.514 -20.117 71.989  1.00 50.65 ? 391 LEU A O   1 
ATOM   3030 C  CB  . LEU A 1 391 ? 112.640 -18.083 71.846  1.00 55.44 ? 391 LEU A CB  1 
ATOM   3031 C  CG  . LEU A 1 391 ? 114.020 -17.443 71.759  1.00 56.26 ? 391 LEU A CG  1 
ATOM   3032 C  CD1 . LEU A 1 391 ? 113.865 -16.056 71.202  1.00 57.57 ? 391 LEU A CD1 1 
ATOM   3033 C  CD2 . LEU A 1 391 ? 114.695 -17.434 73.144  1.00 53.62 ? 391 LEU A CD2 1 
ATOM   3034 N  N   . PRO A 1 392 ? 111.306 -20.293 74.098  1.00 51.01 ? 392 PRO A N   1 
ATOM   3035 C  CA  . PRO A 1 392 ? 110.074 -20.794 74.703  1.00 51.18 ? 392 PRO A CA  1 
ATOM   3036 C  C   . PRO A 1 392 ? 108.994 -19.701 74.750  1.00 51.85 ? 392 PRO A C   1 
ATOM   3037 O  O   . PRO A 1 392 ? 108.597 -19.247 75.828  1.00 50.52 ? 392 PRO A O   1 
ATOM   3038 C  CB  . PRO A 1 392 ? 110.540 -21.223 76.099  1.00 50.44 ? 392 PRO A CB  1 
ATOM   3039 C  CG  . PRO A 1 392 ? 111.680 -20.289 76.384  1.00 49.81 ? 392 PRO A CG  1 
ATOM   3040 C  CD  . PRO A 1 392 ? 112.408 -20.263 75.079  1.00 49.89 ? 392 PRO A CD  1 
ATOM   3041 N  N   . ILE A 1 393 ? 108.540 -19.264 73.573  1.00 52.89 ? 393 ILE A N   1 
ATOM   3042 C  CA  . ILE A 1 393 ? 107.510 -18.230 73.481  1.00 54.85 ? 393 ILE A CA  1 
ATOM   3043 C  C   . ILE A 1 393 ? 106.935 -18.037 72.080  1.00 56.25 ? 393 ILE A C   1 
ATOM   3044 O  O   . ILE A 1 393 ? 107.646 -18.109 71.082  1.00 55.95 ? 393 ILE A O   1 
ATOM   3045 C  CB  . ILE A 1 393 ? 108.018 -16.868 73.998  1.00 54.66 ? 393 ILE A CB  1 
ATOM   3046 C  CG1 . ILE A 1 393 ? 106.936 -15.796 73.793  1.00 55.29 ? 393 ILE A CG1 1 
ATOM   3047 C  CG2 . ILE A 1 393 ? 109.334 -16.511 73.336  1.00 52.56 ? 393 ILE A CG2 1 
ATOM   3048 C  CD1 . ILE A 1 393 ? 107.391 -14.389 74.050  1.00 55.59 ? 393 ILE A CD1 1 
ATOM   3049 N  N   . GLN A 1 394 ? 105.632 -17.792 72.025  1.00 59.51 ? 394 GLN A N   1 
ATOM   3050 C  CA  . GLN A 1 394 ? 104.929 -17.584 70.767  1.00 63.10 ? 394 GLN A CA  1 
ATOM   3051 C  C   . GLN A 1 394 ? 105.375 -16.314 70.037  1.00 64.14 ? 394 GLN A C   1 
ATOM   3052 O  O   . GLN A 1 394 ? 105.754 -15.316 70.655  1.00 63.85 ? 394 GLN A O   1 
ATOM   3053 C  CB  . GLN A 1 394 ? 103.402 -17.577 71.012  1.00 66.03 ? 394 GLN A CB  1 
ATOM   3054 C  CG  . GLN A 1 394 ? 102.500 -17.325 69.777  1.00 68.32 ? 394 GLN A CG  1 
ATOM   3055 C  CD  . GLN A 1 394 ? 101.020 -17.711 70.007  1.00 71.02 ? 394 GLN A CD  1 
ATOM   3056 O  OE1 . GLN A 1 394 ? 100.186 -16.871 70.372  1.00 71.06 ? 394 GLN A OE1 1 
ATOM   3057 N  NE2 . GLN A 1 394 ? 100.694 -18.981 69.760  1.00 71.70 ? 394 GLN A NE2 1 
ATOM   3058 N  N   . LYS A 1 395 ? 105.334 -16.381 68.709  1.00 65.88 ? 395 LYS A N   1 
ATOM   3059 C  CA  . LYS A 1 395 ? 105.714 -15.267 67.847  1.00 66.94 ? 395 LYS A CA  1 
ATOM   3060 C  C   . LYS A 1 395 ? 104.664 -14.157 67.855  1.00 66.10 ? 395 LYS A C   1 
ATOM   3061 O  O   . LYS A 1 395 ? 105.010 -12.989 67.717  1.00 65.40 ? 395 LYS A O   1 
ATOM   3062 C  CB  . LYS A 1 395 ? 105.936 -15.750 66.399  1.00 68.56 ? 395 LYS A CB  1 
ATOM   3063 C  CG  . LYS A 1 395 ? 107.131 -16.722 66.166  1.00 70.11 ? 395 LYS A CG  1 
ATOM   3064 C  CD  . LYS A 1 395 ? 108.439 -16.030 65.711  1.00 68.58 ? 395 LYS A CD  1 
ATOM   3065 C  CE  . LYS A 1 395 ? 108.249 -15.089 64.530  1.00 68.83 ? 395 LYS A CE  1 
ATOM   3066 N  NZ  . LYS A 1 395 ? 107.676 -15.795 63.348  1.00 70.63 ? 395 LYS A NZ  1 
ATOM   3067 N  N   . GLU A 1 396 ? 103.391 -14.520 67.997  1.00 65.59 ? 396 GLU A N   1 
ATOM   3068 C  CA  . GLU A 1 396 ? 102.318 -13.524 68.011  1.00 66.14 ? 396 GLU A CA  1 
ATOM   3069 C  C   . GLU A 1 396 ? 102.499 -12.676 69.237  1.00 64.84 ? 396 GLU A C   1 
ATOM   3070 O  O   . GLU A 1 396 ? 102.353 -11.454 69.197  1.00 64.52 ? 396 GLU A O   1 
ATOM   3071 C  CB  . GLU A 1 396 ? 100.939 -14.177 68.067  1.00 67.94 ? 396 GLU A CB  1 
ATOM   3072 C  CG  . GLU A 1 396 ? 100.430 -14.683 66.731  1.00 71.80 ? 396 GLU A CG  1 
ATOM   3073 C  CD  . GLU A 1 396 ? 100.918 -16.084 66.391  1.00 74.25 ? 396 GLU A CD  1 
ATOM   3074 O  OE1 . GLU A 1 396 ? 102.144 -16.354 66.484  1.00 75.66 ? 396 GLU A OE1 1 
ATOM   3075 O  OE2 . GLU A 1 396 ? 100.059 -16.921 66.027  1.00 75.24 ? 396 GLU A OE2 1 
ATOM   3076 N  N   . THR A 1 397 ? 102.798 -13.367 70.330  1.00 64.42 ? 397 THR A N   1 
ATOM   3077 C  CA  . THR A 1 397 ? 103.041 -12.753 71.620  1.00 64.05 ? 397 THR A CA  1 
ATOM   3078 C  C   . THR A 1 397 ? 104.217 -11.801 71.422  1.00 62.89 ? 397 THR A C   1 
ATOM   3079 O  O   . THR A 1 397 ? 104.064 -10.579 71.420  1.00 62.19 ? 397 THR A O   1 
ATOM   3080 C  CB  . THR A 1 397 ? 103.444 -13.841 72.661  1.00 64.80 ? 397 THR A CB  1 
ATOM   3081 O  OG1 . THR A 1 397 ? 102.642 -15.010 72.461  1.00 65.87 ? 397 THR A OG1 1 
ATOM   3082 C  CG2 . THR A 1 397 ? 103.214 -13.356 74.080  1.00 66.21 ? 397 THR A CG2 1 
ATOM   3083 N  N   . TRP A 1 398 ? 105.383 -12.388 71.193  1.00 61.55 ? 398 TRP A N   1 
ATOM   3084 C  CA  . TRP A 1 398 ? 106.589 -11.627 70.985  1.00 61.00 ? 398 TRP A CA  1 
ATOM   3085 C  C   . TRP A 1 398 ? 106.316 -10.390 70.147  1.00 60.52 ? 398 TRP A C   1 
ATOM   3086 O  O   . TRP A 1 398 ? 106.555 -9.251  70.564  1.00 60.01 ? 398 TRP A O   1 
ATOM   3087 C  CB  . TRP A 1 398 ? 107.611 -12.472 70.238  1.00 61.35 ? 398 TRP A CB  1 
ATOM   3088 C  CG  . TRP A 1 398 ? 108.662 -11.599 69.740  1.00 61.56 ? 398 TRP A CG  1 
ATOM   3089 C  CD1 . TRP A 1 398 ? 108.956 -11.322 68.436  1.00 60.78 ? 398 TRP A CD1 1 
ATOM   3090 C  CD2 . TRP A 1 398 ? 109.462 -10.729 70.536  1.00 62.05 ? 398 TRP A CD2 1 
ATOM   3091 N  NE1 . TRP A 1 398 ? 109.879 -10.313 68.377  1.00 61.95 ? 398 TRP A NE1 1 
ATOM   3092 C  CE2 . TRP A 1 398 ? 110.211 -9.932  69.654  1.00 62.54 ? 398 TRP A CE2 1 
ATOM   3093 C  CE3 . TRP A 1 398 ? 109.608 -10.533 71.917  1.00 62.62 ? 398 TRP A CE3 1 
ATOM   3094 C  CZ2 . TRP A 1 398 ? 111.101 -8.949  70.107  1.00 62.96 ? 398 TRP A CZ2 1 
ATOM   3095 C  CZ3 . TRP A 1 398 ? 110.487 -9.560  72.366  1.00 62.45 ? 398 TRP A CZ3 1 
ATOM   3096 C  CH2 . TRP A 1 398 ? 111.221 -8.780  71.466  1.00 62.51 ? 398 TRP A CH2 1 
ATOM   3097 N  N   . GLU A 1 399 ? 105.869 -10.668 68.931  1.00 60.70 ? 399 GLU A N   1 
ATOM   3098 C  CA  . GLU A 1 399 ? 105.560 -9.665  67.949  1.00 59.82 ? 399 GLU A CA  1 
ATOM   3099 C  C   . GLU A 1 399 ? 104.792 -8.533  68.570  1.00 57.89 ? 399 GLU A C   1 
ATOM   3100 O  O   . GLU A 1 399 ? 105.314 -7.435  68.716  1.00 57.90 ? 399 GLU A O   1 
ATOM   3101 C  CB  . GLU A 1 399 ? 104.765 -10.292 66.820  1.00 61.61 ? 399 GLU A CB  1 
ATOM   3102 C  CG  . GLU A 1 399 ? 104.155 -9.298  65.873  1.00 65.14 ? 399 GLU A CG  1 
ATOM   3103 C  CD  . GLU A 1 399 ? 103.000 -9.890  65.095  1.00 67.01 ? 399 GLU A CD  1 
ATOM   3104 O  OE1 . GLU A 1 399 ? 102.422 -10.916 65.546  1.00 67.83 ? 399 GLU A OE1 1 
ATOM   3105 O  OE2 . GLU A 1 399 ? 102.666 -9.318  64.033  1.00 68.12 ? 399 GLU A OE2 1 
ATOM   3106 N  N   . THR A 1 400 ? 103.587 -8.822  69.020  1.00 56.62 ? 400 THR A N   1 
ATOM   3107 C  CA  . THR A 1 400 ? 102.762 -7.795  69.612  1.00 57.02 ? 400 THR A CA  1 
ATOM   3108 C  C   . THR A 1 400 ? 103.489 -7.078  70.752  1.00 57.03 ? 400 THR A C   1 
ATOM   3109 O  O   . THR A 1 400 ? 103.332 -5.871  70.923  1.00 55.73 ? 400 THR A O   1 
ATOM   3110 C  CB  . THR A 1 400 ? 101.434 -8.388  70.078  1.00 57.65 ? 400 THR A CB  1 
ATOM   3111 O  OG1 . THR A 1 400 ? 101.683 -9.443  71.012  1.00 58.06 ? 400 THR A OG1 1 
ATOM   3112 C  CG2 . THR A 1 400 ? 100.682 -8.968  68.884  1.00 57.32 ? 400 THR A CG2 1 
ATOM   3113 N  N   . TRP A 1 401 ? 104.359 -7.801  71.453  1.00 58.33 ? 401 TRP A N   1 
ATOM   3114 C  CA  . TRP A 1 401 ? 105.117 -7.239  72.563  1.00 60.88 ? 401 TRP A CA  1 
ATOM   3115 C  C   . TRP A 1 401 ? 105.989 -6.077  72.134  1.00 61.59 ? 401 TRP A C   1 
ATOM   3116 O  O   . TRP A 1 401 ? 105.859 -4.955  72.654  1.00 61.10 ? 401 TRP A O   1 
ATOM   3117 C  CB  . TRP A 1 401 ? 106.018 -8.298  73.187  1.00 65.22 ? 401 TRP A CB  1 
ATOM   3118 C  CG  . TRP A 1 401 ? 106.963 -7.725  74.202  1.00 69.23 ? 401 TRP A CG  1 
ATOM   3119 C  CD1 . TRP A 1 401 ? 108.314 -7.951  74.305  1.00 70.68 ? 401 TRP A CD1 1 
ATOM   3120 C  CD2 . TRP A 1 401 ? 106.623 -6.833  75.265  1.00 70.53 ? 401 TRP A CD2 1 
ATOM   3121 N  NE1 . TRP A 1 401 ? 108.829 -7.259  75.376  1.00 71.08 ? 401 TRP A NE1 1 
ATOM   3122 C  CE2 . TRP A 1 401 ? 107.815 -6.564  75.983  1.00 71.46 ? 401 TRP A CE2 1 
ATOM   3123 C  CE3 . TRP A 1 401 ? 105.425 -6.234  75.685  1.00 71.04 ? 401 TRP A CE3 1 
ATOM   3124 C  CZ2 . TRP A 1 401 ? 107.842 -5.720  77.098  1.00 72.12 ? 401 TRP A CZ2 1 
ATOM   3125 C  CZ3 . TRP A 1 401 ? 105.448 -5.397  76.789  1.00 72.47 ? 401 TRP A CZ3 1 
ATOM   3126 C  CH2 . TRP A 1 401 ? 106.652 -5.148  77.487  1.00 73.10 ? 401 TRP A CH2 1 
ATOM   3127 N  N   . TRP A 1 402 ? 106.928 -6.369  71.235  1.00 62.00 ? 402 TRP A N   1 
ATOM   3128 C  CA  . TRP A 1 402 ? 107.835 -5.347  70.730  1.00 62.75 ? 402 TRP A CA  1 
ATOM   3129 C  C   . TRP A 1 402 ? 107.115 -4.281  69.869  1.00 62.01 ? 402 TRP A C   1 
ATOM   3130 O  O   . TRP A 1 402 ? 107.505 -3.106  69.857  1.00 61.67 ? 402 TRP A O   1 
ATOM   3131 C  CB  . TRP A 1 402 ? 109.014 -5.985  69.980  1.00 63.79 ? 402 TRP A CB  1 
ATOM   3132 C  CG  . TRP A 1 402 ? 108.633 -6.697  68.742  1.00 64.25 ? 402 TRP A CG  1 
ATOM   3133 C  CD1 . TRP A 1 402 ? 108.396 -8.022  68.607  1.00 65.05 ? 402 TRP A CD1 1 
ATOM   3134 C  CD2 . TRP A 1 402 ? 108.403 -6.118  67.455  1.00 65.93 ? 402 TRP A CD2 1 
ATOM   3135 N  NE1 . TRP A 1 402 ? 108.035 -8.326  67.316  1.00 66.35 ? 402 TRP A NE1 1 
ATOM   3136 C  CE2 . TRP A 1 402 ? 108.021 -7.168  66.585  1.00 66.23 ? 402 TRP A CE2 1 
ATOM   3137 C  CE3 . TRP A 1 402 ? 108.473 -4.811  66.953  1.00 65.80 ? 402 TRP A CE3 1 
ATOM   3138 C  CZ2 . TRP A 1 402 ? 107.704 -6.952  65.242  1.00 65.83 ? 402 TRP A CZ2 1 
ATOM   3139 C  CZ3 . TRP A 1 402 ? 108.157 -4.595  65.615  1.00 66.59 ? 402 TRP A CZ3 1 
ATOM   3140 C  CH2 . TRP A 1 402 ? 107.777 -5.661  64.775  1.00 65.89 ? 402 TRP A CH2 1 
ATOM   3141 N  N   . THR A 1 403 ? 106.061 -4.685  69.164  1.00 59.97 ? 403 THR A N   1 
ATOM   3142 C  CA  . THR A 1 403 ? 105.294 -3.750  68.353  1.00 57.86 ? 403 THR A CA  1 
ATOM   3143 C  C   . THR A 1 403 ? 104.642 -2.746  69.311  1.00 60.02 ? 403 THR A C   1 
ATOM   3144 O  O   . THR A 1 403 ? 104.184 -1.677  68.900  1.00 61.76 ? 403 THR A O   1 
ATOM   3145 C  CB  . THR A 1 403 ? 104.203 -4.477  67.543  1.00 55.24 ? 403 THR A CB  1 
ATOM   3146 O  OG1 . THR A 1 403 ? 104.795 -5.532  66.780  1.00 51.70 ? 403 THR A OG1 1 
ATOM   3147 C  CG2 . THR A 1 403 ? 103.518 -3.521  66.593  1.00 53.37 ? 403 THR A CG2 1 
ATOM   3148 N  N   . GLU A 1 404 ? 104.612 -3.097  70.591  1.00 60.31 ? 404 GLU A N   1 
ATOM   3149 C  CA  . GLU A 1 404 ? 104.026 -2.246  71.609  1.00 61.27 ? 404 GLU A CA  1 
ATOM   3150 C  C   . GLU A 1 404 ? 105.028 -1.340  72.309  1.00 61.46 ? 404 GLU A C   1 
ATOM   3151 O  O   . GLU A 1 404 ? 104.843 -0.119  72.361  1.00 61.36 ? 404 GLU A O   1 
ATOM   3152 C  CB  . GLU A 1 404 ? 103.341 -3.104  72.665  1.00 63.70 ? 404 GLU A CB  1 
ATOM   3153 C  CG  . GLU A 1 404 ? 102.013 -3.724  72.240  1.00 66.57 ? 404 GLU A CG  1 
ATOM   3154 C  CD  . GLU A 1 404 ? 101.345 -4.494  73.381  1.00 67.47 ? 404 GLU A CD  1 
ATOM   3155 O  OE1 . GLU A 1 404 ? 101.672 -5.685  73.573  1.00 67.85 ? 404 GLU A OE1 1 
ATOM   3156 O  OE2 . GLU A 1 404 ? 100.504 -3.906  74.095  1.00 68.33 ? 404 GLU A OE2 1 
ATOM   3157 N  N   . TYR A 1 405 ? 106.060 -1.956  72.886  1.00 60.71 ? 405 TYR A N   1 
ATOM   3158 C  CA  . TYR A 1 405 ? 107.092 -1.240  73.637  1.00 59.44 ? 405 TYR A CA  1 
ATOM   3159 C  C   . TYR A 1 405 ? 107.540 0.082   73.015  1.00 58.50 ? 405 TYR A C   1 
ATOM   3160 O  O   . TYR A 1 405 ? 107.446 0.282   71.805  1.00 57.10 ? 405 TYR A O   1 
ATOM   3161 C  CB  . TYR A 1 405 ? 108.314 -2.150  73.886  1.00 59.09 ? 405 TYR A CB  1 
ATOM   3162 C  CG  . TYR A 1 405 ? 109.131 -1.793  75.128  1.00 58.67 ? 405 TYR A CG  1 
ATOM   3163 C  CD1 . TYR A 1 405 ? 108.517 -1.226  76.249  1.00 57.56 ? 405 TYR A CD1 1 
ATOM   3164 C  CD2 . TYR A 1 405 ? 110.511 -2.042  75.190  1.00 57.79 ? 405 TYR A CD2 1 
ATOM   3165 C  CE1 . TYR A 1 405 ? 109.245 -0.913  77.403  1.00 57.34 ? 405 TYR A CE1 1 
ATOM   3166 C  CE2 . TYR A 1 405 ? 111.254 -1.731  76.351  1.00 57.80 ? 405 TYR A CE2 1 
ATOM   3167 C  CZ  . TYR A 1 405 ? 110.607 -1.165  77.455  1.00 57.12 ? 405 TYR A CZ  1 
ATOM   3168 O  OH  . TYR A 1 405 ? 111.284 -0.848  78.615  1.00 53.73 ? 405 TYR A OH  1 
ATOM   3169 N  N   . TRP A 1 406 ? 107.986 0.990   73.881  1.00 58.73 ? 406 TRP A N   1 
ATOM   3170 C  CA  . TRP A 1 406 ? 108.481 2.309   73.482  1.00 58.19 ? 406 TRP A CA  1 
ATOM   3171 C  C   . TRP A 1 406 ? 109.937 2.215   73.013  1.00 57.07 ? 406 TRP A C   1 
ATOM   3172 O  O   . TRP A 1 406 ? 110.312 2.751   71.972  1.00 57.23 ? 406 TRP A O   1 
ATOM   3173 C  CB  . TRP A 1 406 ? 108.362 3.311   74.657  1.00 57.94 ? 406 TRP A CB  1 
ATOM   3174 C  CG  . TRP A 1 406 ? 109.167 2.969   75.893  1.00 56.26 ? 406 TRP A CG  1 
ATOM   3175 C  CD1 . TRP A 1 406 ? 108.799 2.120   76.891  1.00 55.18 ? 406 TRP A CD1 1 
ATOM   3176 C  CD2 . TRP A 1 406 ? 110.459 3.490   76.271  1.00 57.21 ? 406 TRP A CD2 1 
ATOM   3177 N  NE1 . TRP A 1 406 ? 109.769 2.075   77.859  1.00 56.35 ? 406 TRP A NE1 1 
ATOM   3178 C  CE2 . TRP A 1 406 ? 110.798 2.908   77.507  1.00 55.96 ? 406 TRP A CE2 1 
ATOM   3179 C  CE3 . TRP A 1 406 ? 111.354 4.401   75.676  1.00 57.80 ? 406 TRP A CE3 1 
ATOM   3180 C  CZ2 . TRP A 1 406 ? 111.991 3.201   78.174  1.00 53.98 ? 406 TRP A CZ2 1 
ATOM   3181 C  CZ3 . TRP A 1 406 ? 112.540 4.690   76.340  1.00 56.51 ? 406 TRP A CZ3 1 
ATOM   3182 C  CH2 . TRP A 1 406 ? 112.842 4.090   77.574  1.00 54.92 ? 406 TRP A CH2 1 
ATOM   3183 N  N   . GLN A 1 407 ? 110.757 1.586   73.839  1.00 55.92 ? 407 GLN A N   1 
ATOM   3184 C  CA  . GLN A 1 407 ? 112.158 1.384   73.557  1.00 56.98 ? 407 GLN A CA  1 
ATOM   3185 C  C   . GLN A 1 407 ? 112.168 0.436   72.346  1.00 58.76 ? 407 GLN A C   1 
ATOM   3186 O  O   . GLN A 1 407 ? 111.137 -0.157  72.040  1.00 59.04 ? 407 GLN A O   1 
ATOM   3187 C  CB  . GLN A 1 407 ? 112.746 0.695   74.771  1.00 56.64 ? 407 GLN A CB  1 
ATOM   3188 C  CG  . GLN A 1 407 ? 114.139 1.056   75.141  1.00 56.36 ? 407 GLN A CG  1 
ATOM   3189 C  CD  . GLN A 1 407 ? 114.601 0.246   76.333  1.00 56.87 ? 407 GLN A CD  1 
ATOM   3190 O  OE1 . GLN A 1 407 ? 115.165 0.781   77.290  1.00 57.72 ? 407 GLN A OE1 1 
ATOM   3191 N  NE2 . GLN A 1 407 ? 114.362 -1.059  76.282  1.00 55.94 ? 407 GLN A NE2 1 
ATOM   3192 N  N   . ALA A 1 408 ? 113.316 0.256   71.687  1.00 59.95 ? 408 ALA A N   1 
ATOM   3193 C  CA  . ALA A 1 408 ? 113.416 -0.633  70.507  1.00 60.81 ? 408 ALA A CA  1 
ATOM   3194 C  C   . ALA A 1 408 ? 114.370 -1.825  70.689  1.00 61.04 ? 408 ALA A C   1 
ATOM   3195 O  O   . ALA A 1 408 ? 115.298 -1.770  71.508  1.00 60.95 ? 408 ALA A O   1 
ATOM   3196 C  CB  . ALA A 1 408 ? 113.817 0.168   69.270  1.00 61.03 ? 408 ALA A CB  1 
ATOM   3197 N  N   . THR A 1 409 ? 114.164 -2.883  69.902  1.00 62.32 ? 409 THR A N   1 
ATOM   3198 C  CA  . THR A 1 409 ? 114.997 -4.088  69.995  1.00 64.06 ? 409 THR A CA  1 
ATOM   3199 C  C   . THR A 1 409 ? 115.193 -4.839  68.691  1.00 65.43 ? 409 THR A C   1 
ATOM   3200 O  O   . THR A 1 409 ? 114.725 -4.426  67.619  1.00 65.69 ? 409 THR A O   1 
ATOM   3201 C  CB  . THR A 1 409 ? 114.413 -5.114  70.969  1.00 63.90 ? 409 THR A CB  1 
ATOM   3202 O  OG1 . THR A 1 409 ? 112.993 -5.203  70.773  1.00 65.55 ? 409 THR A OG1 1 
ATOM   3203 C  CG2 . THR A 1 409 ? 114.757 -4.771  72.403  1.00 64.66 ? 409 THR A CG2 1 
ATOM   3204 N  N   . TRP A 1 410 ? 115.846 -5.986  68.804  1.00 66.53 ? 410 TRP A N   1 
ATOM   3205 C  CA  . TRP A 1 410 ? 116.092 -6.784  67.639  1.00 68.86 ? 410 TRP A CA  1 
ATOM   3206 C  C   . TRP A 1 410 ? 116.106 -8.280  67.898  1.00 69.44 ? 410 TRP A C   1 
ATOM   3207 O  O   . TRP A 1 410 ? 117.037 -8.809  68.503  1.00 67.81 ? 410 TRP A O   1 
ATOM   3208 C  CB  . TRP A 1 410 ? 117.386 -6.345  66.971  1.00 70.93 ? 410 TRP A CB  1 
ATOM   3209 C  CG  . TRP A 1 410 ? 117.605 -7.072  65.727  1.00 73.03 ? 410 TRP A CG  1 
ATOM   3210 C  CD1 . TRP A 1 410 ? 118.739 -7.692  65.349  1.00 73.77 ? 410 TRP A CD1 1 
ATOM   3211 C  CD2 . TRP A 1 410 ? 116.622 -7.368  64.722  1.00 74.84 ? 410 TRP A CD2 1 
ATOM   3212 N  NE1 . TRP A 1 410 ? 118.539 -8.376  64.174  1.00 75.23 ? 410 TRP A NE1 1 
ATOM   3213 C  CE2 . TRP A 1 410 ? 117.244 -8.196  63.765  1.00 75.52 ? 410 TRP A CE2 1 
ATOM   3214 C  CE3 . TRP A 1 410 ? 115.273 -7.023  64.543  1.00 75.24 ? 410 TRP A CE3 1 
ATOM   3215 C  CZ2 . TRP A 1 410 ? 116.565 -8.689  62.638  1.00 75.67 ? 410 TRP A CZ2 1 
ATOM   3216 C  CZ3 . TRP A 1 410 ? 114.595 -7.516  63.419  1.00 77.05 ? 410 TRP A CZ3 1 
ATOM   3217 C  CH2 . TRP A 1 410 ? 115.246 -8.339  62.484  1.00 75.29 ? 410 TRP A CH2 1 
ATOM   3218 N  N   . ILE A 1 411 ? 115.065 -8.948  67.410  1.00 71.25 ? 411 ILE A N   1 
ATOM   3219 C  CA  . ILE A 1 411 ? 114.934 -10.391 67.546  1.00 73.66 ? 411 ILE A CA  1 
ATOM   3220 C  C   . ILE A 1 411 ? 115.609 -11.123 66.418  1.00 76.48 ? 411 ILE A C   1 
ATOM   3221 O  O   . ILE A 1 411 ? 115.179 -11.052 65.265  1.00 76.06 ? 411 ILE A O   1 
ATOM   3222 C  CB  . ILE A 1 411 ? 113.473 -10.879 67.565  1.00 72.45 ? 411 ILE A CB  1 
ATOM   3223 C  CG1 . ILE A 1 411 ? 112.533 -9.870  66.891  1.00 72.08 ? 411 ILE A CG1 1 
ATOM   3224 C  CG2 . ILE A 1 411 ? 113.096 -11.306 68.957  1.00 72.33 ? 411 ILE A CG2 1 
ATOM   3225 C  CD1 . ILE A 1 411 ? 112.375 -10.051 65.381  1.00 69.02 ? 411 ILE A CD1 1 
ATOM   3226 N  N   . PRO A 1 412 ? 116.695 -11.829 66.732  1.00 80.49 ? 412 PRO A N   1 
ATOM   3227 C  CA  . PRO A 1 412 ? 117.417 -12.586 65.706  1.00 83.94 ? 412 PRO A CA  1 
ATOM   3228 C  C   . PRO A 1 412 ? 116.535 -13.728 65.170  1.00 86.50 ? 412 PRO A C   1 
ATOM   3229 O  O   . PRO A 1 412 ? 115.318 -13.763 65.422  1.00 86.01 ? 412 PRO A O   1 
ATOM   3230 C  CB  . PRO A 1 412 ? 118.630 -13.122 66.480  1.00 84.22 ? 412 PRO A CB  1 
ATOM   3231 C  CG  . PRO A 1 412 ? 118.122 -13.210 67.923  1.00 82.92 ? 412 PRO A CG  1 
ATOM   3232 C  CD  . PRO A 1 412 ? 117.360 -11.926 68.047  1.00 81.67 ? 412 PRO A CD  1 
ATOM   3233 N  N   . GLU A 1 413 ? 117.141 -14.632 64.396  1.00 89.04 ? 413 GLU A N   1 
ATOM   3234 C  CA  . GLU A 1 413 ? 116.415 -15.783 63.858  1.00 90.46 ? 413 GLU A CA  1 
ATOM   3235 C  C   . GLU A 1 413 ? 116.112 -16.671 65.055  1.00 89.73 ? 413 GLU A C   1 
ATOM   3236 O  O   . GLU A 1 413 ? 117.029 -17.120 65.763  1.00 89.56 ? 413 GLU A O   1 
ATOM   3237 C  CB  . GLU A 1 413 ? 117.254 -16.562 62.830  1.00 91.48 ? 413 GLU A CB  1 
ATOM   3238 C  CG  . GLU A 1 413 ? 117.174 -16.024 61.396  1.00 93.30 ? 413 GLU A CG  1 
ATOM   3239 C  CD  . GLU A 1 413 ? 117.755 -16.980 60.346  1.00 94.18 ? 413 GLU A CD  1 
ATOM   3240 O  OE1 . GLU A 1 413 ? 118.098 -18.132 60.693  1.00 94.17 ? 413 GLU A OE1 1 
ATOM   3241 O  OE2 . GLU A 1 413 ? 117.861 -16.577 59.164  1.00 94.79 ? 413 GLU A OE2 1 
ATOM   3242 N  N   . TRP A 1 414 ? 114.826 -16.886 65.304  1.00 88.60 ? 414 TRP A N   1 
ATOM   3243 C  CA  . TRP A 1 414 ? 114.429 -17.697 66.430  1.00 87.18 ? 414 TRP A CA  1 
ATOM   3244 C  C   . TRP A 1 414 ? 113.137 -18.412 66.171  1.00 86.49 ? 414 TRP A C   1 
ATOM   3245 O  O   . TRP A 1 414 ? 112.257 -17.915 65.458  1.00 85.55 ? 414 TRP A O   1 
ATOM   3246 C  CB  . TRP A 1 414 ? 114.253 -16.823 67.660  1.00 86.96 ? 414 TRP A CB  1 
ATOM   3247 C  CG  . TRP A 1 414 ? 113.078 -15.905 67.568  1.00 87.15 ? 414 TRP A CG  1 
ATOM   3248 C  CD1 . TRP A 1 414 ? 113.038 -14.667 66.985  1.00 87.48 ? 414 TRP A CD1 1 
ATOM   3249 C  CD2 . TRP A 1 414 ? 111.782 -16.132 68.121  1.00 87.36 ? 414 TRP A CD2 1 
ATOM   3250 N  NE1 . TRP A 1 414 ? 111.793 -14.103 67.155  1.00 87.30 ? 414 TRP A NE1 1 
ATOM   3251 C  CE2 . TRP A 1 414 ? 111.002 -14.981 67.850  1.00 87.76 ? 414 TRP A CE2 1 
ATOM   3252 C  CE3 . TRP A 1 414 ? 111.200 -17.196 68.825  1.00 87.23 ? 414 TRP A CE3 1 
ATOM   3253 C  CZ2 . TRP A 1 414 ? 109.671 -14.863 68.264  1.00 87.19 ? 414 TRP A CZ2 1 
ATOM   3254 C  CZ3 . TRP A 1 414 ? 109.872 -17.080 69.235  1.00 87.61 ? 414 TRP A CZ3 1 
ATOM   3255 C  CH2 . TRP A 1 414 ? 109.124 -15.920 68.953  1.00 86.69 ? 414 TRP A CH2 1 
ATOM   3256 N  N   . GLU A 1 415 ? 113.024 -19.580 66.779  1.00 85.57 ? 415 GLU A N   1 
ATOM   3257 C  CA  . GLU A 1 415 ? 111.831 -20.370 66.656  1.00 85.04 ? 415 GLU A CA  1 
ATOM   3258 C  C   . GLU A 1 415 ? 111.238 -20.549 68.023  1.00 83.80 ? 415 GLU A C   1 
ATOM   3259 O  O   . GLU A 1 415 ? 111.950 -20.553 69.035  1.00 81.75 ? 415 GLU A O   1 
ATOM   3260 C  CB  . GLU A 1 415 ? 112.133 -21.736 66.056  1.00 86.98 ? 415 GLU A CB  1 
ATOM   3261 C  CG  . GLU A 1 415 ? 111.650 -21.885 64.624  1.00 91.81 ? 415 GLU A CG  1 
ATOM   3262 C  CD  . GLU A 1 415 ? 111.865 -23.288 64.057  1.00 95.13 ? 415 GLU A CD  1 
ATOM   3263 O  OE1 . GLU A 1 415 ? 112.893 -23.926 64.399  1.00 96.89 ? 415 GLU A OE1 1 
ATOM   3264 O  OE2 . GLU A 1 415 ? 111.006 -23.746 63.263  1.00 96.36 ? 415 GLU A OE2 1 
ATOM   3265 N  N   . PHE A 1 416 ? 109.914 -20.592 68.038  1.00 84.10 ? 416 PHE A N   1 
ATOM   3266 C  CA  . PHE A 1 416 ? 109.156 -20.808 69.250  1.00 83.48 ? 416 PHE A CA  1 
ATOM   3267 C  C   . PHE A 1 416 ? 109.180 -22.313 69.481  1.00 82.33 ? 416 PHE A C   1 
ATOM   3268 O  O   . PHE A 1 416 ? 109.133 -23.095 68.527  1.00 81.49 ? 416 PHE A O   1 
ATOM   3269 C  CB  . PHE A 1 416 ? 107.709 -20.326 69.063  1.00 85.66 ? 416 PHE A CB  1 
ATOM   3270 C  CG  . PHE A 1 416 ? 106.696 -21.073 69.917  1.00 88.05 ? 416 PHE A CG  1 
ATOM   3271 C  CD1 . PHE A 1 416 ? 106.816 -21.120 71.309  1.00 89.40 ? 416 PHE A CD1 1 
ATOM   3272 C  CD2 . PHE A 1 416 ? 105.626 -21.745 69.322  1.00 89.00 ? 416 PHE A CD2 1 
ATOM   3273 C  CE1 . PHE A 1 416 ? 105.895 -21.831 72.089  1.00 88.76 ? 416 PHE A CE1 1 
ATOM   3274 C  CE2 . PHE A 1 416 ? 104.701 -22.458 70.095  1.00 88.12 ? 416 PHE A CE2 1 
ATOM   3275 C  CZ  . PHE A 1 416 ? 104.835 -22.497 71.479  1.00 89.32 ? 416 PHE A CZ  1 
ATOM   3276 N  N   . VAL A 1 417 ? 109.272 -22.710 70.744  1.00 81.39 ? 417 VAL A N   1 
ATOM   3277 C  CA  . VAL A 1 417 ? 109.278 -24.118 71.112  1.00 80.51 ? 417 VAL A CA  1 
ATOM   3278 C  C   . VAL A 1 417 ? 108.361 -24.277 72.311  1.00 78.84 ? 417 VAL A C   1 
ATOM   3279 O  O   . VAL A 1 417 ? 108.206 -23.351 73.109  1.00 77.13 ? 417 VAL A O   1 
ATOM   3280 C  CB  . VAL A 1 417 ? 110.709 -24.633 71.481  1.00 81.08 ? 417 VAL A CB  1 
ATOM   3281 C  CG1 . VAL A 1 417 ? 111.150 -24.111 72.854  1.00 80.12 ? 417 VAL A CG1 1 
ATOM   3282 C  CG2 . VAL A 1 417 ? 110.757 -26.171 71.432  1.00 81.77 ? 417 VAL A CG2 1 
ATOM   3283 N  N   . ASN A 1 418 ? 107.702 -25.425 72.399  1.00 79.19 ? 418 ASN A N   1 
ATOM   3284 C  CA  . ASN A 1 418 ? 106.824 -25.675 73.523  1.00 79.32 ? 418 ASN A CA  1 
ATOM   3285 C  C   . ASN A 1 418 ? 107.663 -26.276 74.628  1.00 79.53 ? 418 ASN A C   1 
ATOM   3286 O  O   . ASN A 1 418 ? 108.479 -27.169 74.397  1.00 79.29 ? 418 ASN A O   1 
ATOM   3287 C  CB  . ASN A 1 418 ? 105.677 -26.611 73.166  1.00 76.35 ? 418 ASN A CB  1 
ATOM   3288 C  CG  . ASN A 1 418 ? 104.643 -26.675 74.258  1.00 74.85 ? 418 ASN A CG  1 
ATOM   3289 O  OD1 . ASN A 1 418 ? 104.920 -26.346 75.407  1.00 72.96 ? 418 ASN A OD1 1 
ATOM   3290 N  ND2 . ASN A 1 418 ? 103.438 -27.070 73.906  1.00 75.65 ? 418 ASN A ND2 1 
ATOM   3291 N  N   . THR A 1 419 ? 107.471 -25.749 75.822  1.00 81.22 ? 419 THR A N   1 
ATOM   3292 C  CA  . THR A 1 419 ? 108.190 -26.179 76.998  1.00 83.70 ? 419 THR A CA  1 
ATOM   3293 C  C   . THR A 1 419 ? 107.358 -25.688 78.171  1.00 84.59 ? 419 THR A C   1 
ATOM   3294 O  O   . THR A 1 419 ? 106.308 -25.072 77.980  1.00 84.67 ? 419 THR A O   1 
ATOM   3295 C  CB  . THR A 1 419 ? 109.606 -25.551 77.047  1.00 83.40 ? 419 THR A CB  1 
ATOM   3296 O  OG1 . THR A 1 419 ? 109.562 -24.203 76.562  1.00 84.10 ? 419 THR A OG1 1 
ATOM   3297 C  CG2 . THR A 1 419 ? 110.588 -26.367 76.224  1.00 83.03 ? 419 THR A CG2 1 
ATOM   3298 N  N   . PRO A 1 420 ? 107.800 -25.978 79.401  1.00 85.60 ? 420 PRO A N   1 
ATOM   3299 C  CA  . PRO A 1 420 ? 107.072 -25.552 80.603  1.00 88.78 ? 420 PRO A CA  1 
ATOM   3300 C  C   . PRO A 1 420 ? 106.820 -24.039 80.826  1.00 88.19 ? 420 PRO A C   1 
ATOM   3301 O  O   . PRO A 1 420 ? 105.757 -23.552 80.431  1.00 89.29 ? 420 PRO A O   1 
ATOM   3302 C  CB  . PRO A 1 420 ? 107.834 -26.256 81.736  1.00 88.63 ? 420 PRO A CB  1 
ATOM   3303 C  CG  . PRO A 1 420 ? 109.224 -26.536 81.124  1.00 87.85 ? 420 PRO A CG  1 
ATOM   3304 C  CD  . PRO A 1 420 ? 108.871 -26.935 79.738  1.00 87.00 ? 420 PRO A CD  1 
ATOM   3305 N  N   . PRO A 1 421 ? 107.755 -23.277 81.459  1.00 87.50 ? 421 PRO A N   1 
ATOM   3306 C  CA  . PRO A 1 421 ? 107.390 -21.863 81.612  1.00 88.85 ? 421 PRO A CA  1 
ATOM   3307 C  C   . PRO A 1 421 ? 107.165 -21.202 80.260  1.00 87.48 ? 421 PRO A C   1 
ATOM   3308 O  O   . PRO A 1 421 ? 107.936 -21.406 79.314  1.00 86.98 ? 421 PRO A O   1 
ATOM   3309 C  CB  . PRO A 1 421 ? 108.600 -21.269 82.342  1.00 88.22 ? 421 PRO A CB  1 
ATOM   3310 C  CG  . PRO A 1 421 ? 109.135 -22.431 83.103  1.00 88.13 ? 421 PRO A CG  1 
ATOM   3311 C  CD  . PRO A 1 421 ? 109.085 -23.504 82.053  1.00 88.48 ? 421 PRO A CD  1 
ATOM   3312 N  N   . LEU A 1 422 ? 106.074 -20.453 80.165  1.00 86.43 ? 422 LEU A N   1 
ATOM   3313 C  CA  . LEU A 1 422 ? 105.750 -19.774 78.934  1.00 86.43 ? 422 LEU A CA  1 
ATOM   3314 C  C   . LEU A 1 422 ? 105.601 -18.274 79.139  1.00 86.53 ? 422 LEU A C   1 
ATOM   3315 O  O   . LEU A 1 422 ? 104.808 -17.805 79.972  1.00 87.27 ? 422 LEU A O   1 
ATOM   3316 C  CB  . LEU A 1 422 ? 104.478 -20.349 78.327  1.00 85.48 ? 422 LEU A CB  1 
ATOM   3317 C  CG  . LEU A 1 422 ? 104.634 -20.503 76.822  1.00 84.34 ? 422 LEU A CG  1 
ATOM   3318 C  CD1 . LEU A 1 422 ? 105.529 -21.705 76.549  1.00 83.58 ? 422 LEU A CD1 1 
ATOM   3319 C  CD2 . LEU A 1 422 ? 103.276 -20.671 76.177  1.00 84.75 ? 422 LEU A CD2 1 
ATOM   3320 N  N   . VAL A 1 423 ? 106.404 -17.524 78.396  1.00 85.47 ? 423 VAL A N   1 
ATOM   3321 C  CA  . VAL A 1 423 ? 106.359 -16.081 78.478  1.00 82.81 ? 423 VAL A CA  1 
ATOM   3322 C  C   . VAL A 1 423 ? 105.220 -15.707 77.559  1.00 82.14 ? 423 VAL A C   1 
ATOM   3323 O  O   . VAL A 1 423 ? 105.128 -16.192 76.420  1.00 79.99 ? 423 VAL A O   1 
ATOM   3324 C  CB  . VAL A 1 423 ? 107.660 -15.417 77.972  1.00 81.74 ? 423 VAL A CB  1 
ATOM   3325 C  CG1 . VAL A 1 423 ? 107.881 -14.098 78.695  1.00 80.22 ? 423 VAL A CG1 1 
ATOM   3326 C  CG2 . VAL A 1 423 ? 108.846 -16.343 78.153  1.00 79.85 ? 423 VAL A CG2 1 
ATOM   3327 N  N   . LYS A 1 424 ? 104.306 -14.918 78.098  1.00 81.61 ? 424 LYS A N   1 
ATOM   3328 C  CA  . LYS A 1 424 ? 103.167 -14.473 77.329  1.00 82.39 ? 424 LYS A CA  1 
ATOM   3329 C  C   . LYS A 1 424 ? 102.483 -13.335 78.039  1.00 81.90 ? 424 LYS A C   1 
ATOM   3330 O  O   . LYS A 1 424 ? 102.692 -13.108 79.237  1.00 82.16 ? 424 LYS A O   1 
ATOM   3331 C  CB  . LYS A 1 424 ? 102.180 -15.615 77.110  1.00 83.66 ? 424 LYS A CB  1 
ATOM   3332 C  CG  . LYS A 1 424 ? 101.737 -16.308 78.383  1.00 84.36 ? 424 LYS A CG  1 
ATOM   3333 C  CD  . LYS A 1 424 ? 100.734 -17.389 78.051  1.00 85.91 ? 424 LYS A CD  1 
ATOM   3334 C  CE  . LYS A 1 424 ? 100.580 -18.375 79.185  1.00 86.30 ? 424 LYS A CE  1 
ATOM   3335 N  NZ  . LYS A 1 424 ? 99.688  -19.476 78.751  1.00 88.80 ? 424 LYS A NZ  1 
ATOM   3336 N  N   . LEU A 1 425 ? 101.688 -12.593 77.280  1.00 81.25 ? 425 LEU A N   1 
ATOM   3337 C  CA  . LEU A 1 425 ? 100.963 -11.472 77.836  1.00 79.95 ? 425 LEU A CA  1 
ATOM   3338 C  C   . LEU A 1 425 ? 99.860  -11.987 78.721  1.00 79.52 ? 425 LEU A C   1 
ATOM   3339 O  O   . LEU A 1 425 ? 98.925  -12.648 78.261  1.00 79.25 ? 425 LEU A O   1 
ATOM   3340 C  CB  . LEU A 1 425 ? 100.384 -10.571 76.740  1.00 78.74 ? 425 LEU A CB  1 
ATOM   3341 C  CG  . LEU A 1 425 ? 101.266 -9.389  76.319  1.00 75.84 ? 425 LEU A CG  1 
ATOM   3342 C  CD1 . LEU A 1 425 ? 100.594 -8.663  75.191  1.00 76.63 ? 425 LEU A CD1 1 
ATOM   3343 C  CD2 . LEU A 1 425 ? 101.514 -8.436  77.477  1.00 73.13 ? 425 LEU A CD2 1 
ATOM   3344 N  N   . TRP A 1 426 ? 100.048 -11.786 80.013  1.00 79.03 ? 426 TRP A N   1 
ATOM   3345 C  CA  . TRP A 1 426 ? 99.048  -12.178 80.969  1.00 79.08 ? 426 TRP A CA  1 
ATOM   3346 C  C   . TRP A 1 426 ? 97.892  -11.173 80.791  1.00 78.49 ? 426 TRP A C   1 
ATOM   3347 O  O   . TRP A 1 426 ? 96.942  -11.461 80.060  1.00 78.44 ? 426 TRP A O   1 
ATOM   3348 C  CB  . TRP A 1 426 ? 99.653  -12.183 82.377  1.00 80.70 ? 426 TRP A CB  1 
ATOM   3349 C  CG  . TRP A 1 426 ? 100.293 -13.525 82.770  1.00 82.64 ? 426 TRP A CG  1 
ATOM   3350 C  CD1 . TRP A 1 426 ? 101.434 -13.722 83.518  1.00 82.95 ? 426 TRP A CD1 1 
ATOM   3351 C  CD2 . TRP A 1 426 ? 99.765  -14.831 82.510  1.00 83.28 ? 426 TRP A CD2 1 
ATOM   3352 N  NE1 . TRP A 1 426 ? 101.627 -15.064 83.749  1.00 82.92 ? 426 TRP A NE1 1 
ATOM   3353 C  CE2 . TRP A 1 426 ? 100.619 -15.767 83.142  1.00 83.90 ? 426 TRP A CE2 1 
ATOM   3354 C  CE3 . TRP A 1 426 ? 98.644  -15.301 81.807  1.00 84.21 ? 426 TRP A CE3 1 
ATOM   3355 C  CZ2 . TRP A 1 426 ? 100.384 -17.148 83.094  1.00 85.65 ? 426 TRP A CZ2 1 
ATOM   3356 C  CZ3 . TRP A 1 426 ? 98.411  -16.673 81.759  1.00 86.28 ? 426 TRP A CZ3 1 
ATOM   3357 C  CH2 . TRP A 1 426 ? 99.277  -17.581 82.400  1.00 86.19 ? 426 TRP A CH2 1 
ATOM   3358 N  N   . TYR A 1 427 ? 97.992  -9.978  81.374  1.00 76.42 ? 427 TYR A N   1 
ATOM   3359 C  CA  . TYR A 1 427 ? 96.928  -8.987  81.209  1.00 74.89 ? 427 TYR A CA  1 
ATOM   3360 C  C   . TYR A 1 427 ? 97.226  -8.128  80.006  1.00 74.79 ? 427 TYR A C   1 
ATOM   3361 O  O   . TYR A 1 427 ? 98.312  -8.213  79.434  1.00 74.92 ? 427 TYR A O   1 
ATOM   3362 C  CB  . TYR A 1 427 ? 96.784  -8.086  82.436  1.00 74.69 ? 427 TYR A CB  1 
ATOM   3363 C  CG  . TYR A 1 427 ? 97.972  -7.186  82.760  1.00 74.59 ? 427 TYR A CG  1 
ATOM   3364 C  CD1 . TYR A 1 427 ? 99.084  -7.690  83.432  1.00 74.95 ? 427 TYR A CD1 1 
ATOM   3365 C  CD2 . TYR A 1 427 ? 97.936  -5.815  82.500  1.00 73.57 ? 427 TYR A CD2 1 
ATOM   3366 C  CE1 . TYR A 1 427 ? 100.115 -6.865  83.857  1.00 73.41 ? 427 TYR A CE1 1 
ATOM   3367 C  CE2 . TYR A 1 427 ? 98.971  -4.980  82.926  1.00 73.65 ? 427 TYR A CE2 1 
ATOM   3368 C  CZ  . TYR A 1 427 ? 100.054 -5.520  83.608  1.00 73.91 ? 427 TYR A CZ  1 
ATOM   3369 O  OH  . TYR A 1 427 ? 101.056 -4.722  84.103  1.00 74.32 ? 427 TYR A OH  1 
ATOM   3370 N  N   . GLN A 1 428 ? 96.277  -7.274  79.647  1.00 74.86 ? 428 GLN A N   1 
ATOM   3371 C  CA  . GLN A 1 428 ? 96.468  -6.383  78.517  1.00 74.88 ? 428 GLN A CA  1 
ATOM   3372 C  C   . GLN A 1 428 ? 95.396  -5.319  78.452  1.00 73.47 ? 428 GLN A C   1 
ATOM   3373 O  O   . GLN A 1 428 ? 94.290  -5.592  77.997  1.00 73.27 ? 428 GLN A O   1 
ATOM   3374 C  CB  . GLN A 1 428 ? 96.478  -7.163  77.213  1.00 77.31 ? 428 GLN A CB  1 
ATOM   3375 C  CG  . GLN A 1 428 ? 97.153  -6.385  76.099  1.00 81.09 ? 428 GLN A CG  1 
ATOM   3376 C  CD  . GLN A 1 428 ? 96.945  -7.010  74.736  1.00 83.51 ? 428 GLN A CD  1 
ATOM   3377 O  OE1 . GLN A 1 428 ? 97.478  -8.081  74.442  1.00 85.55 ? 428 GLN A OE1 1 
ATOM   3378 N  NE2 . GLN A 1 428 ? 96.171  -6.339  73.890  1.00 83.85 ? 428 GLN A NE2 1 
ATOM   3379 N  N   . LEU A 1 429 ? 95.768  -4.097  78.835  1.00 72.00 ? 429 LEU A N   1 
ATOM   3380 C  CA  . LEU A 1 429 ? 94.865  -2.948  78.864  1.00 71.18 ? 429 LEU A CA  1 
ATOM   3381 C  C   . LEU A 1 429 ? 94.064  -2.658  77.605  1.00 72.04 ? 429 LEU A C   1 
ATOM   3382 O  O   . LEU A 1 429 ? 94.211  -3.309  76.570  1.00 70.80 ? 429 LEU A O   1 
ATOM   3383 C  CB  . LEU A 1 429 ? 95.609  -1.667  79.244  1.00 69.89 ? 429 LEU A CB  1 
ATOM   3384 C  CG  . LEU A 1 429 ? 96.456  -1.546  80.512  1.00 69.97 ? 429 LEU A CG  1 
ATOM   3385 C  CD1 . LEU A 1 429 ? 96.385  -0.096  80.985  1.00 69.70 ? 429 LEU A CD1 1 
ATOM   3386 C  CD2 . LEU A 1 429 ? 95.971  -2.471  81.611  1.00 70.42 ? 429 LEU A CD2 1 
ATOM   3387 N  N   . GLU A 1 430 ? 93.192  -1.665  77.732  1.00 74.85 ? 430 GLU A N   1 
ATOM   3388 C  CA  . GLU A 1 430 ? 92.340  -1.223  76.640  1.00 76.82 ? 430 GLU A CA  1 
ATOM   3389 C  C   . GLU A 1 430 ? 92.986  -0.063  75.917  1.00 78.25 ? 430 GLU A C   1 
ATOM   3390 O  O   . GLU A 1 430 ? 94.083  0.388   76.277  1.00 79.01 ? 430 GLU A O   1 
ATOM   3391 C  CB  . GLU A 1 430 ? 90.960  -0.784  77.152  1.00 75.93 ? 430 GLU A CB  1 
ATOM   3392 C  CG  . GLU A 1 430 ? 89.964  -1.916  77.341  1.00 75.09 ? 430 GLU A CG  1 
ATOM   3393 C  CD  . GLU A 1 430 ? 89.745  -2.740  76.074  1.00 74.74 ? 430 GLU A CD  1 
ATOM   3394 O  OE1 . GLU A 1 430 ? 89.124  -2.230  75.111  1.00 74.64 ? 430 GLU A OE1 1 
ATOM   3395 O  OE2 . GLU A 1 430 ? 90.184  -3.908  76.049  1.00 72.53 ? 430 GLU A OE2 1 
ATOM   3396 N  N   . LYS A 1 431 ? 92.264  0.439   74.921  1.00 79.39 ? 431 LYS A N   1 
ATOM   3397 C  CA  . LYS A 1 431 ? 92.723  1.558   74.116  1.00 79.97 ? 431 LYS A CA  1 
ATOM   3398 C  C   . LYS A 1 431 ? 91.813  2.781   74.262  1.00 80.52 ? 431 LYS A C   1 
ATOM   3399 O  O   . LYS A 1 431 ? 92.290  3.878   74.558  1.00 81.74 ? 431 LYS A O   1 
ATOM   3400 C  CB  . LYS A 1 431 ? 92.817  1.145   72.643  1.00 78.99 ? 431 LYS A CB  1 
ATOM   3401 C  CG  . LYS A 1 431 ? 93.909  0.130   72.340  1.00 77.66 ? 431 LYS A CG  1 
ATOM   3402 C  CD  . LYS A 1 431 ? 95.293  0.694   72.620  1.00 76.92 ? 431 LYS A CD  1 
ATOM   3403 C  CE  . LYS A 1 431 ? 96.209  0.433   71.449  1.00 76.61 ? 431 LYS A CE  1 
ATOM   3404 N  NZ  . LYS A 1 431 ? 96.067  -0.971  70.973  1.00 77.94 ? 431 LYS A NZ  1 
ATOM   3405 N  N   . GLU A 1 432 ? 90.507  2.587   74.085  1.00 80.63 ? 432 GLU A N   1 
ATOM   3406 C  CA  . GLU A 1 432 ? 89.550  3.693   74.175  1.00 80.21 ? 432 GLU A CA  1 
ATOM   3407 C  C   . GLU A 1 432 ? 88.672  3.554   75.421  1.00 79.54 ? 432 GLU A C   1 
ATOM   3408 O  O   . GLU A 1 432 ? 88.524  2.451   75.960  1.00 79.17 ? 432 GLU A O   1 
ATOM   3409 C  CB  . GLU A 1 432 ? 88.682  3.754   72.903  1.00 80.17 ? 432 GLU A CB  1 
ATOM   3410 C  CG  . GLU A 1 432 ? 89.455  4.016   71.577  1.00 80.22 ? 432 GLU A CG  1 
ATOM   3411 C  CD  . GLU A 1 432 ? 89.948  5.469   71.394  1.00 80.77 ? 432 GLU A CD  1 
ATOM   3412 O  OE1 . GLU A 1 432 ? 90.261  6.152   72.398  1.00 81.11 ? 432 GLU A OE1 1 
ATOM   3413 O  OE2 . GLU A 1 432 ? 90.032  5.930   70.231  1.00 79.81 ? 432 GLU A OE2 1 
ATOM   3414 N  N   . PRO A 1 433 ? 88.122  4.681   75.927  1.00 78.53 ? 433 PRO A N   1 
ATOM   3415 C  CA  . PRO A 1 433 ? 87.260  4.674   77.117  1.00 78.33 ? 433 PRO A CA  1 
ATOM   3416 C  C   . PRO A 1 433 ? 86.083  3.699   76.983  1.00 79.49 ? 433 PRO A C   1 
ATOM   3417 O  O   . PRO A 1 433 ? 85.229  3.858   76.095  1.00 80.47 ? 433 PRO A O   1 
ATOM   3418 C  CB  . PRO A 1 433 ? 86.812  6.142   77.224  1.00 77.03 ? 433 PRO A CB  1 
ATOM   3419 C  CG  . PRO A 1 433 ? 86.930  6.656   75.827  1.00 76.56 ? 433 PRO A CG  1 
ATOM   3420 C  CD  . PRO A 1 433 ? 88.229  6.045   75.383  1.00 76.94 ? 433 PRO A CD  1 
ATOM   3421 N  N   . ILE A 1 434 ? 86.059  2.680   77.851  1.00 79.91 ? 434 ILE A N   1 
ATOM   3422 C  CA  . ILE A 1 434 ? 85.010  1.643   77.821  1.00 79.08 ? 434 ILE A CA  1 
ATOM   3423 C  C   . ILE A 1 434 ? 83.605  2.215   78.060  1.00 79.73 ? 434 ILE A C   1 
ATOM   3424 O  O   . ILE A 1 434 ? 83.343  2.814   79.107  1.00 79.58 ? 434 ILE A O   1 
ATOM   3425 C  CB  . ILE A 1 434 ? 85.248  0.513   78.877  1.00 76.79 ? 434 ILE A CB  1 
ATOM   3426 C  CG1 . ILE A 1 434 ? 86.727  0.157   78.999  1.00 74.50 ? 434 ILE A CG1 1 
ATOM   3427 C  CG2 . ILE A 1 434 ? 84.495  -0.740  78.463  1.00 75.92 ? 434 ILE A CG2 1 
ATOM   3428 C  CD1 . ILE A 1 434 ? 86.997  -0.804  80.115  1.00 69.93 ? 434 ILE A CD1 1 
ATOM   3429 N  N   . VAL A 1 435 ? 82.706  2.023   77.093  1.00 79.93 ? 435 VAL A N   1 
ATOM   3430 C  CA  . VAL A 1 435 ? 81.327  2.513   77.207  1.00 80.36 ? 435 VAL A CA  1 
ATOM   3431 C  C   . VAL A 1 435 ? 80.482  1.690   78.205  1.00 80.81 ? 435 VAL A C   1 
ATOM   3432 O  O   . VAL A 1 435 ? 80.482  0.449   78.172  1.00 81.66 ? 435 VAL A O   1 
ATOM   3433 C  CB  . VAL A 1 435 ? 80.588  2.599   75.803  1.00 80.82 ? 435 VAL A CB  1 
ATOM   3434 C  CG1 . VAL A 1 435 ? 81.151  3.744   74.964  1.00 81.03 ? 435 VAL A CG1 1 
ATOM   3435 C  CG2 . VAL A 1 435 ? 80.699  1.287   75.029  1.00 79.65 ? 435 VAL A CG2 1 
ATOM   3436 N  N   . GLY A 1 436 ? 79.794  2.388   79.108  1.00 79.06 ? 436 GLY A N   1 
ATOM   3437 C  CA  . GLY A 1 436 ? 78.966  1.723   80.096  1.00 76.18 ? 436 GLY A CA  1 
ATOM   3438 C  C   . GLY A 1 436 ? 79.715  1.385   81.371  1.00 74.36 ? 436 GLY A C   1 
ATOM   3439 O  O   . GLY A 1 436 ? 79.172  1.513   82.475  1.00 74.96 ? 436 GLY A O   1 
ATOM   3440 N  N   . ALA A 1 437 ? 80.962  0.946   81.219  1.00 71.64 ? 437 ALA A N   1 
ATOM   3441 C  CA  . ALA A 1 437 ? 81.796  0.590   82.357  1.00 68.37 ? 437 ALA A CA  1 
ATOM   3442 C  C   . ALA A 1 437 ? 81.767  1.744   83.341  1.00 66.71 ? 437 ALA A C   1 
ATOM   3443 O  O   . ALA A 1 437 ? 81.926  2.912   82.969  1.00 66.38 ? 437 ALA A O   1 
ATOM   3444 C  CB  . ALA A 1 437 ? 83.220  0.310   81.914  1.00 67.04 ? 437 ALA A CB  1 
ATOM   3445 N  N   . GLU A 1 438 ? 81.494  1.418   84.591  1.00 64.03 ? 438 GLU A N   1 
ATOM   3446 C  CA  . GLU A 1 438 ? 81.442  2.441   85.607  1.00 61.47 ? 438 GLU A CA  1 
ATOM   3447 C  C   . GLU A 1 438 ? 82.826  3.096   85.659  1.00 58.24 ? 438 GLU A C   1 
ATOM   3448 O  O   . GLU A 1 438 ? 83.851  2.410   85.695  1.00 57.07 ? 438 GLU A O   1 
ATOM   3449 C  CB  . GLU A 1 438 ? 81.036  1.816   86.954  1.00 63.65 ? 438 GLU A CB  1 
ATOM   3450 C  CG  . GLU A 1 438 ? 80.480  2.800   88.017  1.00 65.08 ? 438 GLU A CG  1 
ATOM   3451 C  CD  . GLU A 1 438 ? 79.692  2.115   89.158  1.00 66.12 ? 438 GLU A CD  1 
ATOM   3452 O  OE1 . GLU A 1 438 ? 79.466  0.886   89.101  1.00 66.40 ? 438 GLU A OE1 1 
ATOM   3453 O  OE2 . GLU A 1 438 ? 79.270  2.811   90.108  1.00 65.34 ? 438 GLU A OE2 1 
ATOM   3454 N  N   . THR A 1 439 ? 82.845  4.411   85.484  1.00 55.15 ? 439 THR A N   1 
ATOM   3455 C  CA  . THR A 1 439 ? 84.078  5.185   85.540  1.00 53.14 ? 439 THR A CA  1 
ATOM   3456 C  C   . THR A 1 439 ? 84.500  5.343   87.001  1.00 50.85 ? 439 THR A C   1 
ATOM   3457 O  O   . THR A 1 439 ? 83.663  5.581   87.875  1.00 50.75 ? 439 THR A O   1 
ATOM   3458 C  CB  . THR A 1 439 ? 83.883  6.574   84.917  1.00 53.17 ? 439 THR A CB  1 
ATOM   3459 O  OG1 . THR A 1 439 ? 83.319  6.421   83.607  1.00 53.13 ? 439 THR A OG1 1 
ATOM   3460 C  CG2 . THR A 1 439 ? 85.210  7.279   84.788  1.00 51.53 ? 439 THR A CG2 1 
ATOM   3461 N  N   . PHE A 1 440 ? 85.793  5.217   87.262  1.00 48.80 ? 440 PHE A N   1 
ATOM   3462 C  CA  . PHE A 1 440 ? 86.313  5.315   88.614  1.00 47.31 ? 440 PHE A CA  1 
ATOM   3463 C  C   . PHE A 1 440 ? 87.371  6.371   88.777  1.00 45.38 ? 440 PHE A C   1 
ATOM   3464 O  O   . PHE A 1 440 ? 88.532  6.133   88.473  1.00 44.28 ? 440 PHE A O   1 
ATOM   3465 C  CB  . PHE A 1 440 ? 86.901  3.981   89.053  1.00 49.86 ? 440 PHE A CB  1 
ATOM   3466 C  CG  . PHE A 1 440 ? 85.877  2.968   89.419  1.00 53.01 ? 440 PHE A CG  1 
ATOM   3467 C  CD1 . PHE A 1 440 ? 85.079  2.377   88.440  1.00 53.98 ? 440 PHE A CD1 1 
ATOM   3468 C  CD2 . PHE A 1 440 ? 85.704  2.592   90.755  1.00 54.38 ? 440 PHE A CD2 1 
ATOM   3469 C  CE1 . PHE A 1 440 ? 84.117  1.423   88.778  1.00 54.77 ? 440 PHE A CE1 1 
ATOM   3470 C  CE2 . PHE A 1 440 ? 84.749  1.639   91.112  1.00 54.71 ? 440 PHE A CE2 1 
ATOM   3471 C  CZ  . PHE A 1 440 ? 83.950  1.052   90.124  1.00 55.57 ? 440 PHE A CZ  1 
ATOM   3472 N  N   . TYR A 1 441 ? 86.969  7.525   89.288  1.00 43.91 ? 441 TYR A N   1 
ATOM   3473 C  CA  . TYR A 1 441 ? 87.891  8.625   89.526  1.00 42.09 ? 441 TYR A CA  1 
ATOM   3474 C  C   . TYR A 1 441 ? 88.580  8.232   90.818  1.00 41.87 ? 441 TYR A C   1 
ATOM   3475 O  O   . TYR A 1 441 ? 88.167  8.597   91.920  1.00 41.28 ? 441 TYR A O   1 
ATOM   3476 C  CB  . TYR A 1 441 ? 87.129  9.949   89.638  1.00 40.85 ? 441 TYR A CB  1 
ATOM   3477 C  CG  . TYR A 1 441 ? 86.434  10.305  88.342  1.00 39.85 ? 441 TYR A CG  1 
ATOM   3478 C  CD1 . TYR A 1 441 ? 85.573  9.404   87.719  1.00 39.47 ? 441 TYR A CD1 1 
ATOM   3479 C  CD2 . TYR A 1 441 ? 86.704  11.500  87.689  1.00 41.00 ? 441 TYR A CD2 1 
ATOM   3480 C  CE1 . TYR A 1 441 ? 85.006  9.679   86.479  1.00 38.39 ? 441 TYR A CE1 1 
ATOM   3481 C  CE2 . TYR A 1 441 ? 86.139  11.785  86.437  1.00 39.17 ? 441 TYR A CE2 1 
ATOM   3482 C  CZ  . TYR A 1 441 ? 85.298  10.863  85.838  1.00 38.79 ? 441 TYR A CZ  1 
ATOM   3483 O  OH  . TYR A 1 441 ? 84.776  11.110  84.589  1.00 37.56 ? 441 TYR A OH  1 
ATOM   3484 N  N   . VAL A 1 442 ? 89.552  7.349   90.660  1.00 42.08 ? 442 VAL A N   1 
ATOM   3485 C  CA  . VAL A 1 442 ? 90.298  6.836   91.782  1.00 41.28 ? 442 VAL A CA  1 
ATOM   3486 C  C   . VAL A 1 442 ? 91.278  7.889   92.272  1.00 41.87 ? 442 VAL A C   1 
ATOM   3487 O  O   . VAL A 1 442 ? 91.798  8.701   91.490  1.00 43.33 ? 442 VAL A O   1 
ATOM   3488 C  CB  . VAL A 1 442 ? 91.038  5.529   91.403  1.00 38.99 ? 442 VAL A CB  1 
ATOM   3489 C  CG1 . VAL A 1 442 ? 91.830  5.032   92.552  1.00 36.19 ? 442 VAL A CG1 1 
ATOM   3490 C  CG2 . VAL A 1 442 ? 90.052  4.483   91.011  1.00 37.57 ? 442 VAL A CG2 1 
ATOM   3491 N  N   . ASP A 1 443 ? 91.480  7.902   93.580  1.00 41.54 ? 443 ASP A N   1 
ATOM   3492 C  CA  . ASP A 1 443 ? 92.396  8.826   94.183  1.00 42.72 ? 443 ASP A CA  1 
ATOM   3493 C  C   . ASP A 1 443 ? 92.880  8.301   95.518  1.00 44.55 ? 443 ASP A C   1 
ATOM   3494 O  O   . ASP A 1 443 ? 92.314  7.374   96.092  1.00 43.93 ? 443 ASP A O   1 
ATOM   3495 C  CB  . ASP A 1 443 ? 91.737  10.181  94.378  1.00 40.68 ? 443 ASP A CB  1 
ATOM   3496 C  CG  . ASP A 1 443 ? 92.723  11.321  94.269  1.00 40.04 ? 443 ASP A CG  1 
ATOM   3497 O  OD1 . ASP A 1 443 ? 93.322  11.713  95.296  1.00 37.05 ? 443 ASP A OD1 1 
ATOM   3498 O  OD2 . ASP A 1 443 ? 92.898  11.821  93.137  1.00 40.62 ? 443 ASP A OD2 1 
ATOM   3499 N  N   . GLY A 1 444 ? 93.955  8.911   95.989  1.00 46.56 ? 444 GLY A N   1 
ATOM   3500 C  CA  . GLY A 1 444 ? 94.561  8.560   97.251  1.00 49.14 ? 444 GLY A CA  1 
ATOM   3501 C  C   . GLY A 1 444 ? 95.450  9.744   97.582  1.00 51.66 ? 444 GLY A C   1 
ATOM   3502 O  O   . GLY A 1 444 ? 95.532  10.696  96.798  1.00 52.66 ? 444 GLY A O   1 
ATOM   3503 N  N   . ALA A 1 445 ? 96.072  9.720   98.752  1.00 53.27 ? 445 ALA A N   1 
ATOM   3504 C  CA  . ALA A 1 445 ? 96.970  10.789  99.182  1.00 54.24 ? 445 ALA A CA  1 
ATOM   3505 C  C   . ALA A 1 445 ? 97.612  10.315  100.481 1.00 55.00 ? 445 ALA A C   1 
ATOM   3506 O  O   . ALA A 1 445 ? 97.342  9.195   100.940 1.00 54.28 ? 445 ALA A O   1 
ATOM   3507 C  CB  . ALA A 1 445 ? 96.193  12.094  99.408  1.00 54.69 ? 445 ALA A CB  1 
ATOM   3508 N  N   . ALA A 1 446 ? 98.494  11.132  101.041 1.00 55.80 ? 446 ALA A N   1 
ATOM   3509 C  CA  . ALA A 1 446 ? 99.159  10.800  102.290 1.00 56.19 ? 446 ALA A CA  1 
ATOM   3510 C  C   . ALA A 1 446 ? 99.977  11.962  102.757 1.00 56.95 ? 446 ALA A C   1 
ATOM   3511 O  O   . ALA A 1 446 ? 100.521 12.733  101.965 1.00 57.03 ? 446 ALA A O   1 
ATOM   3512 C  CB  . ALA A 1 446 ? 100.052 9.579   102.127 1.00 56.45 ? 446 ALA A CB  1 
ATOM   3513 N  N   . ASN A 1 447 ? 100.029 12.120  104.059 1.00 58.32 ? 447 ASN A N   1 
ATOM   3514 C  CA  . ASN A 1 447 ? 100.817 13.185  104.590 1.00 59.61 ? 447 ASN A CA  1 
ATOM   3515 C  C   . ASN A 1 447 ? 102.107 12.488  104.938 1.00 60.95 ? 447 ASN A C   1 
ATOM   3516 O  O   . ASN A 1 447 ? 102.128 11.666  105.845 1.00 60.55 ? 447 ASN A O   1 
ATOM   3517 C  CB  . ASN A 1 447 ? 100.158 13.763  105.821 1.00 59.93 ? 447 ASN A CB  1 
ATOM   3518 C  CG  . ASN A 1 447 ? 100.931 14.912  106.385 1.00 61.43 ? 447 ASN A CG  1 
ATOM   3519 O  OD1 . ASN A 1 447 ? 102.088 14.764  106.776 1.00 61.27 ? 447 ASN A OD1 1 
ATOM   3520 N  ND2 . ASN A 1 447 ? 100.314 16.082  106.405 1.00 62.13 ? 447 ASN A ND2 1 
ATOM   3521 N  N   . ARG A 1 448 ? 103.159 12.769  104.170 1.00 63.33 ? 448 ARG A N   1 
ATOM   3522 C  CA  . ARG A 1 448 ? 104.482 12.156  104.380 1.00 66.76 ? 448 ARG A CA  1 
ATOM   3523 C  C   . ARG A 1 448 ? 104.997 12.281  105.818 1.00 67.75 ? 448 ARG A C   1 
ATOM   3524 O  O   . ARG A 1 448 ? 105.703 11.405  106.334 1.00 67.22 ? 448 ARG A O   1 
ATOM   3525 C  CB  . ARG A 1 448 ? 105.533 12.761  103.426 1.00 68.01 ? 448 ARG A CB  1 
ATOM   3526 C  CG  . ARG A 1 448 ? 105.355 12.423  101.939 1.00 68.79 ? 448 ARG A CG  1 
ATOM   3527 C  CD  . ARG A 1 448 ? 106.547 12.887  101.070 1.00 68.50 ? 448 ARG A CD  1 
ATOM   3528 N  NE  . ARG A 1 448 ? 106.161 12.931  99.660  1.00 66.78 ? 448 ARG A NE  1 
ATOM   3529 C  CZ  . ARG A 1 448 ? 106.091 14.040  98.930  1.00 65.43 ? 448 ARG A CZ  1 
ATOM   3530 N  NH1 . ARG A 1 448 ? 106.406 15.217  99.451  1.00 64.10 ? 448 ARG A NH1 1 
ATOM   3531 N  NH2 . ARG A 1 448 ? 105.599 13.982  97.705  1.00 64.84 ? 448 ARG A NH2 1 
ATOM   3532 N  N   . GLU A 1 449 ? 104.659 13.399  106.441 1.00 68.98 ? 449 GLU A N   1 
ATOM   3533 C  CA  . GLU A 1 449 ? 105.078 13.658  107.795 1.00 70.29 ? 449 GLU A CA  1 
ATOM   3534 C  C   . GLU A 1 449 ? 104.331 12.691  108.693 1.00 70.07 ? 449 GLU A C   1 
ATOM   3535 O  O   . GLU A 1 449 ? 104.943 11.974  109.480 1.00 70.59 ? 449 GLU A O   1 
ATOM   3536 C  CB  . GLU A 1 449 ? 104.755 15.108  108.162 1.00 72.68 ? 449 GLU A CB  1 
ATOM   3537 C  CG  . GLU A 1 449 ? 105.748 15.738  109.127 1.00 77.00 ? 449 GLU A CG  1 
ATOM   3538 C  CD  . GLU A 1 449 ? 107.192 15.622  108.647 1.00 80.05 ? 449 GLU A CD  1 
ATOM   3539 O  OE1 . GLU A 1 449 ? 107.530 16.235  107.609 1.00 82.24 ? 449 GLU A OE1 1 
ATOM   3540 O  OE2 . GLU A 1 449 ? 107.989 14.908  109.302 1.00 81.41 ? 449 GLU A OE2 1 
ATOM   3541 N  N   . THR A 1 450 ? 103.017 12.613  108.504 1.00 70.23 ? 450 THR A N   1 
ATOM   3542 C  CA  . THR A 1 450 ? 102.185 11.734  109.314 1.00 71.01 ? 450 THR A CA  1 
ATOM   3543 C  C   . THR A 1 450 ? 102.356 10.256  108.994 1.00 71.86 ? 450 THR A C   1 
ATOM   3544 O  O   . THR A 1 450 ? 101.985 9.403   109.807 1.00 72.71 ? 450 THR A O   1 
ATOM   3545 C  CB  . THR A 1 450 ? 100.689 12.102  109.210 1.00 70.98 ? 450 THR A CB  1 
ATOM   3546 O  OG1 . THR A 1 450 ? 100.209 11.864  107.876 1.00 70.33 ? 450 THR A OG1 1 
ATOM   3547 C  CG2 . THR A 1 450 ? 100.481 13.565  109.582 1.00 71.17 ? 450 THR A CG2 1 
ATOM   3548 N  N   . LYS A 1 451 ? 102.898 9.954   107.814 1.00 72.50 ? 451 LYS A N   1 
ATOM   3549 C  CA  . LYS A 1 451 ? 103.102 8.570   107.376 1.00 73.09 ? 451 LYS A CA  1 
ATOM   3550 C  C   . LYS A 1 451 ? 101.766 7.815   107.254 1.00 74.14 ? 451 LYS A C   1 
ATOM   3551 O  O   . LYS A 1 451 ? 101.729 6.579   107.265 1.00 72.79 ? 451 LYS A O   1 
ATOM   3552 C  CB  . LYS A 1 451 ? 104.053 7.840   108.347 1.00 72.40 ? 451 LYS A CB  1 
ATOM   3553 N  N   . LEU A 1 452 ? 100.675 8.565   107.103 1.00 75.46 ? 452 LEU A N   1 
ATOM   3554 C  CA  . LEU A 1 452 ? 99.338  7.982   106.996 1.00 75.96 ? 452 LEU A CA  1 
ATOM   3555 C  C   . LEU A 1 452 ? 98.623  8.544   105.782 1.00 75.87 ? 452 LEU A C   1 
ATOM   3556 O  O   . LEU A 1 452 ? 98.800  9.720   105.427 1.00 76.09 ? 452 LEU A O   1 
ATOM   3557 C  CB  . LEU A 1 452 ? 98.500  8.286   108.244 1.00 76.22 ? 452 LEU A CB  1 
ATOM   3558 C  CG  . LEU A 1 452 ? 99.147  8.122   109.625 1.00 76.90 ? 452 LEU A CG  1 
ATOM   3559 C  CD1 . LEU A 1 452 ? 98.160  8.553   110.701 1.00 77.93 ? 452 LEU A CD1 1 
ATOM   3560 C  CD2 . LEU A 1 452 ? 99.622  6.695   109.858 1.00 75.61 ? 452 LEU A CD2 1 
ATOM   3561 N  N   . GLY A 1 453 ? 97.784  7.709   105.185 1.00 74.88 ? 453 GLY A N   1 
ATOM   3562 C  CA  . GLY A 1 453 ? 97.048  8.106   104.010 1.00 74.06 ? 453 GLY A CA  1 
ATOM   3563 C  C   . GLY A 1 453 ? 95.618  7.621   103.982 1.00 73.72 ? 453 GLY A C   1 
ATOM   3564 O  O   . GLY A 1 453 ? 95.072  7.153   104.979 1.00 72.82 ? 453 GLY A O   1 
ATOM   3565 N  N   . LYS A 1 454 ? 95.036  7.689   102.798 1.00 74.68 ? 454 LYS A N   1 
ATOM   3566 C  CA  . LYS A 1 454 ? 93.654  7.307   102.574 1.00 75.19 ? 454 LYS A CA  1 
ATOM   3567 C  C   . LYS A 1 454 ? 93.503  6.958   101.104 1.00 74.72 ? 454 LYS A C   1 
ATOM   3568 O  O   . LYS A 1 454 ? 93.989  7.686   100.234 1.00 74.20 ? 454 LYS A O   1 
ATOM   3569 C  CB  . LYS A 1 454 ? 92.752  8.503   102.910 1.00 77.44 ? 454 LYS A CB  1 
ATOM   3570 C  CG  . LYS A 1 454 ? 93.378  9.864   102.517 1.00 78.56 ? 454 LYS A CG  1 
ATOM   3571 C  CD  . LYS A 1 454 ? 92.520  11.062  102.884 1.00 79.30 ? 454 LYS A CD  1 
ATOM   3572 C  CE  . LYS A 1 454 ? 91.985  10.986  104.317 1.00 80.69 ? 454 LYS A CE  1 
ATOM   3573 N  NZ  . LYS A 1 454 ? 93.023  10.810  105.380 1.00 82.34 ? 454 LYS A NZ  1 
ATOM   3574 N  N   . ALA A 1 455 ? 92.900  5.814   100.823 1.00 73.89 ? 455 ALA A N   1 
ATOM   3575 C  CA  . ALA A 1 455 ? 92.682  5.417   99.435  1.00 73.50 ? 455 ALA A CA  1 
ATOM   3576 C  C   . ALA A 1 455 ? 91.178  5.416   99.217  1.00 72.60 ? 455 ALA A C   1 
ATOM   3577 O  O   . ALA A 1 455 ? 90.424  5.159   100.159 1.00 72.10 ? 455 ALA A O   1 
ATOM   3578 C  CB  . ALA A 1 455 ? 93.275  4.035   99.154  1.00 73.11 ? 455 ALA A CB  1 
ATOM   3579 N  N   . GLY A 1 456 ? 90.751  5.756   98.000  1.00 71.61 ? 456 GLY A N   1 
ATOM   3580 C  CA  . GLY A 1 456 ? 89.328  5.787   97.677  1.00 70.66 ? 456 GLY A CA  1 
ATOM   3581 C  C   . GLY A 1 456 ? 88.983  6.319   96.297  1.00 69.12 ? 456 GLY A C   1 
ATOM   3582 O  O   . GLY A 1 456 ? 89.855  6.422   95.433  1.00 70.24 ? 456 GLY A O   1 
ATOM   3583 N  N   . TYR A 1 457 ? 87.712  6.626   96.080  1.00 67.28 ? 457 TYR A N   1 
ATOM   3584 C  CA  . TYR A 1 457 ? 87.242  7.148   94.808  1.00 65.24 ? 457 TYR A CA  1 
ATOM   3585 C  C   . TYR A 1 457 ? 85.769  7.487   94.938  1.00 63.83 ? 457 TYR A C   1 
ATOM   3586 O  O   . TYR A 1 457 ? 85.207  7.479   96.032  1.00 63.04 ? 457 TYR A O   1 
ATOM   3587 C  CB  . TYR A 1 457 ? 87.426  6.094   93.695  1.00 65.36 ? 457 TYR A CB  1 
ATOM   3588 C  CG  . TYR A 1 457 ? 86.655  4.816   93.925  1.00 66.46 ? 457 TYR A CG  1 
ATOM   3589 C  CD1 . TYR A 1 457 ? 85.261  4.790   93.819  1.00 66.43 ? 457 TYR A CD1 1 
ATOM   3590 C  CD2 . TYR A 1 457 ? 87.304  3.653   94.326  1.00 66.38 ? 457 TYR A CD2 1 
ATOM   3591 C  CE1 . TYR A 1 457 ? 84.531  3.651   94.117  1.00 66.27 ? 457 TYR A CE1 1 
ATOM   3592 C  CE2 . TYR A 1 457 ? 86.577  2.492   94.624  1.00 66.35 ? 457 TYR A CE2 1 
ATOM   3593 C  CZ  . TYR A 1 457 ? 85.191  2.504   94.522  1.00 66.68 ? 457 TYR A CZ  1 
ATOM   3594 O  OH  . TYR A 1 457 ? 84.468  1.370   94.840  1.00 63.66 ? 457 TYR A OH  1 
ATOM   3595 N  N   . VAL A 1 458 ? 85.165  7.742   93.783  1.00 62.38 ? 458 VAL A N   1 
ATOM   3596 C  CA  . VAL A 1 458 ? 83.745  8.064   93.663  1.00 59.78 ? 458 VAL A CA  1 
ATOM   3597 C  C   . VAL A 1 458 ? 83.379  7.628   92.258  1.00 57.52 ? 458 VAL A C   1 
ATOM   3598 O  O   . VAL A 1 458 ? 83.897  8.186   91.289  1.00 56.49 ? 458 VAL A O   1 
ATOM   3599 C  CB  . VAL A 1 458 ? 83.490  9.587   93.776  1.00 60.98 ? 458 VAL A CB  1 
ATOM   3600 C  CG1 . VAL A 1 458 ? 82.019  9.901   93.448  1.00 61.04 ? 458 VAL A CG1 1 
ATOM   3601 C  CG2 . VAL A 1 458 ? 83.859  10.103  95.165  1.00 60.85 ? 458 VAL A CG2 1 
ATOM   3602 N  N   . THR A 1 459 ? 82.595  6.563   92.132  1.00 56.51 ? 459 THR A N   1 
ATOM   3603 C  CA  . THR A 1 459 ? 82.196  6.101   90.804  1.00 55.13 ? 459 THR A CA  1 
ATOM   3604 C  C   . THR A 1 459 ? 81.177  7.072   90.239  1.00 56.21 ? 459 THR A C   1 
ATOM   3605 O  O   . THR A 1 459 ? 80.528  7.807   90.991  1.00 54.63 ? 459 THR A O   1 
ATOM   3606 C  CB  . THR A 1 459 ? 81.595  4.693   90.826  1.00 51.78 ? 459 THR A CB  1 
ATOM   3607 O  OG1 . THR A 1 459 ? 80.270  4.740   91.361  1.00 49.49 ? 459 THR A OG1 1 
ATOM   3608 C  CG2 . THR A 1 459 ? 82.429  3.788   91.675  1.00 48.50 ? 459 THR A CG2 1 
ATOM   3609 N  N   . ASN A 1 460 ? 81.032  7.055   88.918  1.00 58.21 ? 460 ASN A N   1 
ATOM   3610 C  CA  . ASN A 1 460 ? 80.097  7.946   88.237  1.00 60.41 ? 460 ASN A CA  1 
ATOM   3611 C  C   . ASN A 1 460 ? 78.700  7.791   88.809  1.00 61.20 ? 460 ASN A C   1 
ATOM   3612 O  O   . ASN A 1 460 ? 77.900  8.734   88.797  1.00 62.26 ? 460 ASN A O   1 
ATOM   3613 C  CB  . ASN A 1 460 ? 80.086  7.690   86.719  1.00 62.01 ? 460 ASN A CB  1 
ATOM   3614 C  CG  . ASN A 1 460 ? 79.670  6.266   86.356  1.00 63.38 ? 460 ASN A CG  1 
ATOM   3615 O  OD1 . ASN A 1 460 ? 80.500  5.358   86.311  1.00 63.24 ? 460 ASN A OD1 1 
ATOM   3616 N  ND2 . ASN A 1 460 ? 78.386  6.073   86.080  1.00 63.99 ? 460 ASN A ND2 1 
ATOM   3617 N  N   . LYS A 1 461 ? 78.424  6.596   89.332  1.00 61.92 ? 461 LYS A N   1 
ATOM   3618 C  CA  . LYS A 1 461 ? 77.126  6.279   89.924  1.00 60.80 ? 461 LYS A CA  1 
ATOM   3619 C  C   . LYS A 1 461 ? 77.041  6.746   91.374  1.00 59.59 ? 461 LYS A C   1 
ATOM   3620 O  O   . LYS A 1 461 ? 76.821  5.934   92.267  1.00 58.98 ? 461 LYS A O   1 
ATOM   3621 C  CB  . LYS A 1 461 ? 76.873  4.773   89.828  1.00 60.48 ? 461 LYS A CB  1 
ATOM   3622 C  CG  . LYS A 1 461 ? 76.937  4.275   88.401  1.00 60.67 ? 461 LYS A CG  1 
ATOM   3623 C  CD  . LYS A 1 461 ? 76.692  2.789   88.293  1.00 62.68 ? 461 LYS A CD  1 
ATOM   3624 C  CE  . LYS A 1 461 ? 76.775  2.345   86.846  1.00 63.75 ? 461 LYS A CE  1 
ATOM   3625 N  NZ  . LYS A 1 461 ? 75.787  3.106   86.026  1.00 67.69 ? 461 LYS A NZ  1 
ATOM   3626 N  N   . GLY A 1 462 ? 77.292  8.040   91.593  1.00 57.85 ? 462 GLY A N   1 
ATOM   3627 C  CA  . GLY A 1 462 ? 77.251  8.642   92.920  1.00 54.91 ? 462 GLY A CA  1 
ATOM   3628 C  C   . GLY A 1 462 ? 77.820  7.815   94.059  1.00 53.08 ? 462 GLY A C   1 
ATOM   3629 O  O   . GLY A 1 462 ? 77.676  8.186   95.228  1.00 51.96 ? 462 GLY A O   1 
ATOM   3630 N  N   . ARG A 1 463 ? 78.533  6.750   93.701  1.00 51.32 ? 463 ARG A N   1 
ATOM   3631 C  CA  . ARG A 1 463 ? 79.123  5.803   94.632  1.00 49.95 ? 463 ARG A CA  1 
ATOM   3632 C  C   . ARG A 1 463 ? 80.501  6.273   95.137  1.00 47.42 ? 463 ARG A C   1 
ATOM   3633 O  O   . ARG A 1 463 ? 81.332  6.748   94.363  1.00 45.72 ? 463 ARG A O   1 
ATOM   3634 C  CB  . ARG A 1 463 ? 79.216  4.436   93.923  1.00 51.53 ? 463 ARG A CB  1 
ATOM   3635 C  CG  . ARG A 1 463 ? 79.663  3.259   94.764  1.00 52.99 ? 463 ARG A CG  1 
ATOM   3636 C  CD  . ARG A 1 463 ? 80.426  2.250   93.917  1.00 55.64 ? 463 ARG A CD  1 
ATOM   3637 N  NE  . ARG A 1 463 ? 79.604  1.500   92.962  1.00 58.95 ? 463 ARG A NE  1 
ATOM   3638 C  CZ  . ARG A 1 463 ? 79.976  0.349   92.391  1.00 60.73 ? 463 ARG A CZ  1 
ATOM   3639 N  NH1 . ARG A 1 463 ? 81.161  -0.188  92.663  1.00 59.88 ? 463 ARG A NH1 1 
ATOM   3640 N  NH2 . ARG A 1 463 ? 79.141  -0.303  91.585  1.00 62.42 ? 463 ARG A NH2 1 
ATOM   3641 N  N   . GLN A 1 464 ? 80.717  6.159   96.444  1.00 45.15 ? 464 GLN A N   1 
ATOM   3642 C  CA  . GLN A 1 464 ? 81.971  6.555   97.069  1.00 42.70 ? 464 GLN A CA  1 
ATOM   3643 C  C   . GLN A 1 464 ? 82.443  5.437   97.982  1.00 41.29 ? 464 GLN A C   1 
ATOM   3644 O  O   . GLN A 1 464 ? 81.732  4.441   98.193  1.00 39.57 ? 464 GLN A O   1 
ATOM   3645 C  CB  . GLN A 1 464 ? 81.814  7.827   97.900  1.00 45.36 ? 464 GLN A CB  1 
ATOM   3646 C  CG  . GLN A 1 464 ? 81.361  9.049   97.127  1.00 48.80 ? 464 GLN A CG  1 
ATOM   3647 C  CD  . GLN A 1 464 ? 81.243  10.290  98.007  1.00 51.50 ? 464 GLN A CD  1 
ATOM   3648 O  OE1 . GLN A 1 464 ? 81.976  10.455  98.991  1.00 52.57 ? 464 GLN A OE1 1 
ATOM   3649 N  NE2 . GLN A 1 464 ? 80.314  11.173  97.652  1.00 52.53 ? 464 GLN A NE2 1 
ATOM   3650 N  N   . LYS A 1 465 ? 83.631  5.640   98.544  1.00 38.65 ? 465 LYS A N   1 
ATOM   3651 C  CA  . LYS A 1 465 ? 84.292  4.698   99.440  1.00 35.63 ? 465 LYS A CA  1 
ATOM   3652 C  C   . LYS A 1 465 ? 85.622  5.337   99.853  1.00 35.58 ? 465 LYS A C   1 
ATOM   3653 O  O   . LYS A 1 465 ? 86.042  6.328   99.255  1.00 35.14 ? 465 LYS A O   1 
ATOM   3654 C  CB  . LYS A 1 465 ? 84.541  3.369   98.719  1.00 31.37 ? 465 LYS A CB  1 
ATOM   3655 C  CG  . LYS A 1 465 ? 85.501  2.455   99.425  1.00 29.66 ? 465 LYS A CG  1 
ATOM   3656 C  CD  . LYS A 1 465 ? 85.438  1.064   98.869  1.00 29.29 ? 465 LYS A CD  1 
ATOM   3657 C  CE  . LYS A 1 465 ? 86.062  0.073   99.840  1.00 29.07 ? 465 LYS A CE  1 
ATOM   3658 N  NZ  . LYS A 1 465 ? 85.464  -1.281  99.661  1.00 26.92 ? 465 LYS A NZ  1 
ATOM   3659 N  N   . VAL A 1 466 ? 86.236  4.812   100.910 1.00 35.60 ? 466 VAL A N   1 
ATOM   3660 C  CA  . VAL A 1 466 ? 87.518  5.285   101.426 1.00 35.31 ? 466 VAL A CA  1 
ATOM   3661 C  C   . VAL A 1 466 ? 88.058  4.161   102.287 1.00 37.20 ? 466 VAL A C   1 
ATOM   3662 O  O   . VAL A 1 466 ? 87.365  3.165   102.476 1.00 37.80 ? 466 VAL A O   1 
ATOM   3663 C  CB  . VAL A 1 466 ? 87.362  6.559   102.321 1.00 33.70 ? 466 VAL A CB  1 
ATOM   3664 C  CG1 . VAL A 1 466 ? 88.645  6.853   103.097 1.00 31.56 ? 466 VAL A CG1 1 
ATOM   3665 C  CG2 . VAL A 1 466 ? 87.012  7.777   101.467 1.00 32.52 ? 466 VAL A CG2 1 
ATOM   3666 N  N   . VAL A 1 467 ? 89.337  4.269   102.656 1.00 39.43 ? 467 VAL A N   1 
ATOM   3667 C  CA  . VAL A 1 467 ? 90.037  3.343   103.543 1.00 39.66 ? 467 VAL A CA  1 
ATOM   3668 C  C   . VAL A 1 467 ? 91.246  4.094   104.032 1.00 42.77 ? 467 VAL A C   1 
ATOM   3669 O  O   . VAL A 1 467 ? 92.104  4.489   103.233 1.00 41.85 ? 467 VAL A O   1 
ATOM   3670 C  CB  . VAL A 1 467 ? 90.601  2.084   102.857 1.00 39.15 ? 467 VAL A CB  1 
ATOM   3671 C  CG1 . VAL A 1 467 ? 91.148  1.126   103.938 1.00 36.55 ? 467 VAL A CG1 1 
ATOM   3672 C  CG2 . VAL A 1 467 ? 89.551  1.406   101.974 1.00 38.47 ? 467 VAL A CG2 1 
ATOM   3673 N  N   . PRO A 1 468 ? 91.316  4.335   105.347 1.00 46.84 ? 468 PRO A N   1 
ATOM   3674 C  CA  . PRO A 1 468 ? 92.437  5.045   105.976 1.00 49.03 ? 468 PRO A CA  1 
ATOM   3675 C  C   . PRO A 1 468 ? 93.632  4.089   105.905 1.00 51.54 ? 468 PRO A C   1 
ATOM   3676 O  O   . PRO A 1 468 ? 93.460  2.866   105.724 1.00 50.66 ? 468 PRO A O   1 
ATOM   3677 C  CB  . PRO A 1 468 ? 91.952  5.261   107.408 1.00 48.94 ? 468 PRO A CB  1 
ATOM   3678 C  CG  . PRO A 1 468 ? 91.107  4.041   107.649 1.00 49.42 ? 468 PRO A CG  1 
ATOM   3679 C  CD  . PRO A 1 468 ? 90.342  3.878   106.354 1.00 48.33 ? 468 PRO A CD  1 
ATOM   3680 N  N   . LEU A 1 469 ? 94.836  4.643   105.996 1.00 54.56 ? 469 LEU A N   1 
ATOM   3681 C  CA  . LEU A 1 469 ? 96.043  3.838   105.877 1.00 57.23 ? 469 LEU A CA  1 
ATOM   3682 C  C   . LEU A 1 469 ? 97.215  4.334   106.726 1.00 59.57 ? 469 LEU A C   1 
ATOM   3683 O  O   . LEU A 1 469 ? 97.556  5.517   106.728 1.00 58.83 ? 469 LEU A O   1 
ATOM   3684 C  CB  . LEU A 1 469 ? 96.439  3.784   104.398 1.00 56.43 ? 469 LEU A CB  1 
ATOM   3685 C  CG  . LEU A 1 469 ? 95.222  3.596   103.462 1.00 55.65 ? 469 LEU A CG  1 
ATOM   3686 C  CD1 . LEU A 1 469 ? 95.440  4.181   102.094 1.00 55.55 ? 469 LEU A CD1 1 
ATOM   3687 C  CD2 . LEU A 1 469 ? 94.831  2.129   103.377 1.00 55.81 ? 469 LEU A CD2 1 
ATOM   3688 N  N   . THR A 1 470 ? 97.796  3.414   107.484 1.00 63.33 ? 470 THR A N   1 
ATOM   3689 C  CA  . THR A 1 470 ? 98.940  3.705   108.338 1.00 67.46 ? 470 THR A CA  1 
ATOM   3690 C  C   . THR A 1 470 ? 100.158 3.171   107.609 1.00 69.79 ? 470 THR A C   1 
ATOM   3691 O  O   . THR A 1 470 ? 100.168 2.004   107.194 1.00 69.42 ? 470 THR A O   1 
ATOM   3692 C  CB  . THR A 1 470 ? 98.837  3.009   109.729 1.00 67.69 ? 470 THR A CB  1 
ATOM   3693 O  OG1 . THR A 1 470 ? 97.819  3.650   110.505 1.00 69.00 ? 470 THR A OG1 1 
ATOM   3694 C  CG2 . THR A 1 470 ? 100.165 3.087   110.493 1.00 67.13 ? 470 THR A CG2 1 
ATOM   3695 N  N   . ASN A 1 471 ? 101.168 4.031   107.477 1.00 71.35 ? 471 ASN A N   1 
ATOM   3696 C  CA  . ASN A 1 471 ? 102.424 3.720   106.798 1.00 71.68 ? 471 ASN A CA  1 
ATOM   3697 C  C   . ASN A 1 471 ? 102.213 3.725   105.283 1.00 71.79 ? 471 ASN A C   1 
ATOM   3698 O  O   . ASN A 1 471 ? 102.321 2.677   104.643 1.00 71.86 ? 471 ASN A O   1 
ATOM   3699 C  CB  . ASN A 1 471 ? 102.993 2.349   107.226 1.00 72.98 ? 471 ASN A CB  1 
ATOM   3700 C  CG  . ASN A 1 471 ? 103.102 2.189   108.732 1.00 73.88 ? 471 ASN A CG  1 
ATOM   3701 O  OD1 . ASN A 1 471 ? 103.058 1.066   109.245 1.00 73.51 ? 471 ASN A OD1 1 
ATOM   3702 N  ND2 . ASN A 1 471 ? 103.241 3.302   109.450 1.00 74.78 ? 471 ASN A ND2 1 
ATOM   3703 N  N   . THR A 1 472 ? 101.895 4.886   104.709 1.00 72.36 ? 472 THR A N   1 
ATOM   3704 C  CA  . THR A 1 472 ? 101.685 4.962   103.255 1.00 71.65 ? 472 THR A CA  1 
ATOM   3705 C  C   . THR A 1 472 ? 102.107 6.275   102.583 1.00 70.43 ? 472 THR A C   1 
ATOM   3706 O  O   . THR A 1 472 ? 101.983 7.358   103.159 1.00 70.72 ? 472 THR A O   1 
ATOM   3707 C  CB  . THR A 1 472 ? 100.217 4.630   102.855 1.00 71.70 ? 472 THR A CB  1 
ATOM   3708 O  OG1 . THR A 1 472 ? 100.088 4.638   101.421 1.00 73.43 ? 472 THR A OG1 1 
ATOM   3709 C  CG2 . THR A 1 472 ? 99.254  5.628   103.470 1.00 70.75 ? 472 THR A CG2 1 
ATOM   3710 N  N   . THR A 1 473 ? 102.621 6.155   101.362 1.00 67.59 ? 473 THR A N   1 
ATOM   3711 C  CA  . THR A 1 473 ? 103.056 7.298   100.577 1.00 65.73 ? 473 THR A CA  1 
ATOM   3712 C  C   . THR A 1 473 ? 101.954 7.646   99.598  1.00 63.61 ? 473 THR A C   1 
ATOM   3713 O  O   . THR A 1 473 ? 101.129 6.795   99.262  1.00 60.43 ? 473 THR A O   1 
ATOM   3714 C  CB  . THR A 1 473 ? 104.316 6.953   99.752  1.00 66.78 ? 473 THR A CB  1 
ATOM   3715 O  OG1 . THR A 1 473 ? 105.332 6.457   100.630 1.00 68.43 ? 473 THR A OG1 1 
ATOM   3716 C  CG2 . THR A 1 473 ? 104.843 8.187   98.992  1.00 67.13 ? 473 THR A CG2 1 
ATOM   3717 N  N   . ASN A 1 474 ? 101.974 8.894   99.135  1.00 62.68 ? 474 ASN A N   1 
ATOM   3718 C  CA  . ASN A 1 474 ? 101.023 9.399   98.153  1.00 63.12 ? 474 ASN A CA  1 
ATOM   3719 C  C   . ASN A 1 474 ? 101.074 8.445   96.986  1.00 62.70 ? 474 ASN A C   1 
ATOM   3720 O  O   . ASN A 1 474 ? 100.091 8.248   96.291  1.00 61.83 ? 474 ASN A O   1 
ATOM   3721 C  CB  . ASN A 1 474 ? 101.431 10.788  97.675  1.00 65.28 ? 474 ASN A CB  1 
ATOM   3722 C  CG  . ASN A 1 474 ? 101.654 11.758  98.822  1.00 67.01 ? 474 ASN A CG  1 
ATOM   3723 O  OD1 . ASN A 1 474 ? 100.855 12.665  99.052  1.00 65.85 ? 474 ASN A OD1 1 
ATOM   3724 N  ND2 . ASN A 1 474 ? 102.754 11.575  99.545  1.00 68.27 ? 474 ASN A ND2 1 
ATOM   3725 N  N   . GLN A 1 475 ? 102.247 7.857   96.789  1.00 62.93 ? 475 GLN A N   1 
ATOM   3726 C  CA  . GLN A 1 475 ? 102.453 6.883   95.741  1.00 63.03 ? 475 GLN A CA  1 
ATOM   3727 C  C   . GLN A 1 475 ? 101.737 5.577   96.082  1.00 63.23 ? 475 GLN A C   1 
ATOM   3728 O  O   . GLN A 1 475 ? 100.796 5.199   95.384  1.00 64.11 ? 475 GLN A O   1 
ATOM   3729 C  CB  . GLN A 1 475 ? 103.939 6.638   95.556  1.00 65.14 ? 475 GLN A CB  1 
ATOM   3730 C  CG  . GLN A 1 475 ? 104.680 7.847   95.026  1.00 66.09 ? 475 GLN A CG  1 
ATOM   3731 C  CD  . GLN A 1 475 ? 106.082 7.498   94.593  1.00 66.61 ? 475 GLN A CD  1 
ATOM   3732 O  OE1 . GLN A 1 475 ? 106.401 6.331   94.359  1.00 65.49 ? 475 GLN A OE1 1 
ATOM   3733 N  NE2 . GLN A 1 475 ? 106.935 8.506   94.493  1.00 66.93 ? 475 GLN A NE2 1 
ATOM   3734 N  N   . LYS A 1 476 ? 102.163 4.910   97.162  1.00 62.23 ? 476 LYS A N   1 
ATOM   3735 C  CA  . LYS A 1 476 ? 101.549 3.642   97.604  1.00 59.87 ? 476 LYS A CA  1 
ATOM   3736 C  C   . LYS A 1 476 ? 100.019 3.730   97.598  1.00 57.70 ? 476 LYS A C   1 
ATOM   3737 O  O   . LYS A 1 476 ? 99.321  2.881   97.022  1.00 55.00 ? 476 LYS A O   1 
ATOM   3738 C  CB  . LYS A 1 476 ? 102.057 3.267   99.002  1.00 60.91 ? 476 LYS A CB  1 
ATOM   3739 C  CG  . LYS A 1 476 ? 103.563 3.005   99.053  1.00 62.36 ? 476 LYS A CG  1 
ATOM   3740 C  CD  . LYS A 1 476 ? 103.991 2.455   100.404 1.00 64.79 ? 476 LYS A CD  1 
ATOM   3741 C  CE  . LYS A 1 476 ? 105.500 2.191   100.480 1.00 67.96 ? 476 LYS A CE  1 
ATOM   3742 N  NZ  . LYS A 1 476 ? 106.347 3.427   100.393 1.00 69.83 ? 476 LYS A NZ  1 
ATOM   3743 N  N   . THR A 1 477 ? 99.523  4.798   98.209  1.00 55.40 ? 477 THR A N   1 
ATOM   3744 C  CA  . THR A 1 477 ? 98.100  5.074   98.273  1.00 54.43 ? 477 THR A CA  1 
ATOM   3745 C  C   . THR A 1 477 ? 97.468  5.074   96.876  1.00 53.86 ? 477 THR A C   1 
ATOM   3746 O  O   . THR A 1 477 ? 96.410  4.476   96.679  1.00 53.98 ? 477 THR A O   1 
ATOM   3747 C  CB  . THR A 1 477 ? 97.843  6.445   98.921  1.00 53.58 ? 477 THR A CB  1 
ATOM   3748 O  OG1 . THR A 1 477 ? 98.787  7.384   98.410  1.00 53.70 ? 477 THR A OG1 1 
ATOM   3749 C  CG2 . THR A 1 477 ? 97.977  6.387   100.411 1.00 51.79 ? 477 THR A CG2 1 
ATOM   3750 N  N   . GLU A 1 478 ? 98.106  5.748   95.917  1.00 53.53 ? 478 GLU A N   1 
ATOM   3751 C  CA  . GLU A 1 478 ? 97.594  5.818   94.541  1.00 52.84 ? 478 GLU A CA  1 
ATOM   3752 C  C   . GLU A 1 478 ? 97.307  4.422   93.958  1.00 50.56 ? 478 GLU A C   1 
ATOM   3753 O  O   . GLU A 1 478 ? 96.194  4.147   93.490  1.00 50.09 ? 478 GLU A O   1 
ATOM   3754 C  CB  . GLU A 1 478 ? 98.573  6.577   93.629  1.00 55.85 ? 478 GLU A CB  1 
ATOM   3755 C  CG  . GLU A 1 478 ? 98.692  8.093   93.880  1.00 61.09 ? 478 GLU A CG  1 
ATOM   3756 C  CD  . GLU A 1 478 ? 99.819  8.786   93.059  1.00 64.56 ? 478 GLU A CD  1 
ATOM   3757 O  OE1 . GLU A 1 478 ? 100.950 8.250   92.952  1.00 65.92 ? 478 GLU A OE1 1 
ATOM   3758 O  OE2 . GLU A 1 478 ? 99.575  9.888   92.518  1.00 65.88 ? 478 GLU A OE2 1 
ATOM   3759 N  N   . LEU A 1 479 ? 98.311  3.546   94.000  1.00 47.04 ? 479 LEU A N   1 
ATOM   3760 C  CA  . LEU A 1 479 ? 98.199  2.168   93.497  1.00 43.31 ? 479 LEU A CA  1 
ATOM   3761 C  C   . LEU A 1 479 ? 97.048  1.502   94.190  1.00 40.89 ? 479 LEU A C   1 
ATOM   3762 O  O   . LEU A 1 479 ? 96.135  0.935   93.581  1.00 36.60 ? 479 LEU A O   1 
ATOM   3763 C  CB  . LEU A 1 479 ? 99.437  1.365   93.885  1.00 43.75 ? 479 LEU A CB  1 
ATOM   3764 C  CG  . LEU A 1 479 ? 100.725 1.370   93.083  1.00 42.18 ? 479 LEU A CG  1 
ATOM   3765 C  CD1 . LEU A 1 479 ? 101.649 0.388   93.760  1.00 42.33 ? 479 LEU A CD1 1 
ATOM   3766 C  CD2 . LEU A 1 479 ? 100.464 0.955   91.645  1.00 41.97 ? 479 LEU A CD2 1 
ATOM   3767 N  N   . GLN A 1 480 ? 97.198  1.524   95.505  1.00 39.97 ? 480 GLN A N   1 
ATOM   3768 C  CA  . GLN A 1 480 ? 96.254  0.987   96.442  1.00 39.19 ? 480 GLN A CA  1 
ATOM   3769 C  C   . GLN A 1 480 ? 94.891  1.386   95.964  1.00 36.37 ? 480 GLN A C   1 
ATOM   3770 O  O   . GLN A 1 480 ? 94.009  0.552   95.789  1.00 34.50 ? 480 GLN A O   1 
ATOM   3771 C  CB  . GLN A 1 480 ? 96.515  1.628   97.800  1.00 41.68 ? 480 GLN A CB  1 
ATOM   3772 C  CG  . GLN A 1 480 ? 95.754  0.973   98.901  1.00 46.66 ? 480 GLN A CG  1 
ATOM   3773 C  CD  . GLN A 1 480 ? 95.929  -0.538  98.871  1.00 48.80 ? 480 GLN A CD  1 
ATOM   3774 O  OE1 . GLN A 1 480 ? 96.877  -1.082  99.461  1.00 47.30 ? 480 GLN A OE1 1 
ATOM   3775 N  NE2 . GLN A 1 480 ? 95.029  -1.224  98.151  1.00 50.21 ? 480 GLN A NE2 1 
ATOM   3776 N  N   . ALA A 1 481 ? 94.790  2.683   95.695  1.00 34.80 ? 481 ALA A N   1 
ATOM   3777 C  CA  . ALA A 1 481 ? 93.600  3.341   95.221  1.00 32.95 ? 481 ALA A CA  1 
ATOM   3778 C  C   . ALA A 1 481 ? 93.135  2.661   93.964  1.00 31.07 ? 481 ALA A C   1 
ATOM   3779 O  O   . ALA A 1 481 ? 91.951  2.414   93.787  1.00 31.30 ? 481 ALA A O   1 
ATOM   3780 C  CB  . ALA A 1 481 ? 93.899  4.788   94.950  1.00 33.15 ? 481 ALA A CB  1 
ATOM   3781 N  N   . ILE A 1 482 ? 94.054  2.331   93.084  1.00 29.62 ? 482 ILE A N   1 
ATOM   3782 C  CA  . ILE A 1 482 ? 93.618  1.676   91.874  1.00 31.55 ? 482 ILE A CA  1 
ATOM   3783 C  C   . ILE A 1 482 ? 93.182  0.265   92.160  1.00 31.23 ? 482 ILE A C   1 
ATOM   3784 O  O   . ILE A 1 482 ? 92.230  -0.231  91.558  1.00 28.17 ? 482 ILE A O   1 
ATOM   3785 C  CB  . ILE A 1 482 ? 94.701  1.585   90.855  1.00 32.78 ? 482 ILE A CB  1 
ATOM   3786 C  CG1 . ILE A 1 482 ? 95.618  2.793   90.957  1.00 32.58 ? 482 ILE A CG1 1 
ATOM   3787 C  CG2 . ILE A 1 482 ? 94.058  1.494   89.472  1.00 34.75 ? 482 ILE A CG2 1 
ATOM   3788 C  CD1 . ILE A 1 482 ? 96.978  2.507   90.425  1.00 32.43 ? 482 ILE A CD1 1 
ATOM   3789 N  N   . TYR A 1 483 ? 93.913  -0.374  93.068  1.00 33.79 ? 483 TYR A N   1 
ATOM   3790 C  CA  . TYR A 1 483 ? 93.666  -1.753  93.489  1.00 36.74 ? 483 TYR A CA  1 
ATOM   3791 C  C   . TYR A 1 483 ? 92.230  -1.894  93.991  1.00 37.02 ? 483 TYR A C   1 
ATOM   3792 O  O   . TYR A 1 483 ? 91.549  -2.879  93.702  1.00 34.49 ? 483 TYR A O   1 
ATOM   3793 C  CB  . TYR A 1 483 ? 94.658  -2.133  94.608  1.00 40.31 ? 483 TYR A CB  1 
ATOM   3794 C  CG  . TYR A 1 483 ? 94.528  -3.561  95.134  1.00 42.34 ? 483 TYR A CG  1 
ATOM   3795 C  CD1 . TYR A 1 483 ? 94.363  -4.647  94.254  1.00 43.09 ? 483 TYR A CD1 1 
ATOM   3796 C  CD2 . TYR A 1 483 ? 94.488  -3.823  96.509  1.00 41.00 ? 483 TYR A CD2 1 
ATOM   3797 C  CE1 . TYR A 1 483 ? 94.145  -5.951  94.736  1.00 41.77 ? 483 TYR A CE1 1 
ATOM   3798 C  CE2 . TYR A 1 483 ? 94.268  -5.129  96.994  1.00 39.99 ? 483 TYR A CE2 1 
ATOM   3799 C  CZ  . TYR A 1 483 ? 94.089  -6.184  96.101  1.00 40.09 ? 483 TYR A CZ  1 
ATOM   3800 O  OH  . TYR A 1 483 ? 93.782  -7.448  96.565  1.00 39.20 ? 483 TYR A OH  1 
ATOM   3801 N  N   . LEU A 1 484 ? 91.794  -0.919  94.779  1.00 39.25 ? 484 LEU A N   1 
ATOM   3802 C  CA  . LEU A 1 484 ? 90.437  -0.925  95.294  1.00 41.52 ? 484 LEU A CA  1 
ATOM   3803 C  C   . LEU A 1 484 ? 89.562  -0.895  94.081  1.00 41.09 ? 484 LEU A C   1 
ATOM   3804 O  O   . LEU A 1 484 ? 88.763  -1.804  93.857  1.00 38.92 ? 484 LEU A O   1 
ATOM   3805 C  CB  . LEU A 1 484 ? 90.143  0.331   96.109  1.00 45.36 ? 484 LEU A CB  1 
ATOM   3806 C  CG  . LEU A 1 484 ? 90.648  0.460   97.547  1.00 48.96 ? 484 LEU A CG  1 
ATOM   3807 C  CD1 . LEU A 1 484 ? 89.939  1.660   98.204  1.00 50.08 ? 484 LEU A CD1 1 
ATOM   3808 C  CD2 . LEU A 1 484 ? 90.361  -0.819  98.341  1.00 49.43 ? 484 LEU A CD2 1 
ATOM   3809 N  N   . ALA A 1 485 ? 89.774  0.148   93.283  1.00 41.34 ? 485 ALA A N   1 
ATOM   3810 C  CA  . ALA A 1 485 ? 89.035  0.360   92.057  1.00 44.74 ? 485 ALA A CA  1 
ATOM   3811 C  C   . ALA A 1 485 ? 88.817  -0.993  91.402  1.00 46.37 ? 485 ALA A C   1 
ATOM   3812 O  O   . ALA A 1 485 ? 87.687  -1.375  91.085  1.00 45.77 ? 485 ALA A O   1 
ATOM   3813 C  CB  . ALA A 1 485 ? 89.819  1.270   91.139  1.00 43.87 ? 485 ALA A CB  1 
ATOM   3814 N  N   . LEU A 1 486 ? 89.900  -1.753  91.336  1.00 48.42 ? 486 LEU A N   1 
ATOM   3815 C  CA  . LEU A 1 486 ? 89.888  -3.073  90.751  1.00 50.46 ? 486 LEU A CA  1 
ATOM   3816 C  C   . LEU A 1 486 ? 88.993  -4.053  91.481  1.00 53.26 ? 486 LEU A C   1 
ATOM   3817 O  O   . LEU A 1 486 ? 88.207  -4.777  90.868  1.00 54.13 ? 486 LEU A O   1 
ATOM   3818 C  CB  . LEU A 1 486 ? 91.293  -3.613  90.749  1.00 49.15 ? 486 LEU A CB  1 
ATOM   3819 C  CG  . LEU A 1 486 ? 92.095  -2.932  89.684  1.00 48.08 ? 486 LEU A CG  1 
ATOM   3820 C  CD1 . LEU A 1 486 ? 93.538  -3.277  89.907  1.00 48.29 ? 486 LEU A CD1 1 
ATOM   3821 C  CD2 . LEU A 1 486 ? 91.567  -3.419  88.343  1.00 47.90 ? 486 LEU A CD2 1 
ATOM   3822 N  N   . GLN A 1 487 ? 89.137  -4.103  92.795  1.00 55.77 ? 487 GLN A N   1 
ATOM   3823 C  CA  . GLN A 1 487 ? 88.347  -5.026  93.581  1.00 58.11 ? 487 GLN A CA  1 
ATOM   3824 C  C   . GLN A 1 487 ? 86.886  -4.770  93.339  1.00 58.15 ? 487 GLN A C   1 
ATOM   3825 O  O   . GLN A 1 487 ? 86.187  -5.607  92.768  1.00 57.83 ? 487 GLN A O   1 
ATOM   3826 C  CB  . GLN A 1 487 ? 88.639  -4.840  95.060  1.00 60.81 ? 487 GLN A CB  1 
ATOM   3827 C  CG  . GLN A 1 487 ? 90.093  -5.036  95.435  1.00 65.09 ? 487 GLN A CG  1 
ATOM   3828 C  CD  . GLN A 1 487 ? 90.375  -4.541  96.833  1.00 66.74 ? 487 GLN A CD  1 
ATOM   3829 O  OE1 . GLN A 1 487 ? 89.744  -3.595  97.298  1.00 69.56 ? 487 GLN A OE1 1 
ATOM   3830 N  NE2 . GLN A 1 487 ? 91.314  -5.178  97.518  1.00 68.18 ? 487 GLN A NE2 1 
ATOM   3831 N  N   . ASP A 1 488 ? 86.467  -3.569  93.725  1.00 58.61 ? 488 ASP A N   1 
ATOM   3832 C  CA  . ASP A 1 488 ? 85.079  -3.120  93.628  1.00 59.45 ? 488 ASP A CA  1 
ATOM   3833 C  C   . ASP A 1 488 ? 84.490  -3.043  92.233  1.00 59.41 ? 488 ASP A C   1 
ATOM   3834 O  O   . ASP A 1 488 ? 83.276  -3.116  92.070  1.00 59.62 ? 488 ASP A O   1 
ATOM   3835 C  CB  . ASP A 1 488 ? 84.917  -1.768  94.335  1.00 60.83 ? 488 ASP A CB  1 
ATOM   3836 C  CG  . ASP A 1 488 ? 85.242  -1.839  95.828  1.00 62.44 ? 488 ASP A CG  1 
ATOM   3837 O  OD1 . ASP A 1 488 ? 86.124  -2.643  96.211  1.00 63.78 ? 488 ASP A OD1 1 
ATOM   3838 O  OD2 . ASP A 1 488 ? 84.619  -1.090  96.617  1.00 62.36 ? 488 ASP A OD2 1 
ATOM   3839 N  N   . SER A 1 489 ? 85.331  -2.849  91.230  1.00 60.26 ? 489 SER A N   1 
ATOM   3840 C  CA  . SER A 1 489 ? 84.846  -2.777  89.866  1.00 61.12 ? 489 SER A CA  1 
ATOM   3841 C  C   . SER A 1 489 ? 84.267  -4.117  89.395  1.00 62.94 ? 489 SER A C   1 
ATOM   3842 O  O   . SER A 1 489 ? 84.403  -5.137  90.078  1.00 63.01 ? 489 SER A O   1 
ATOM   3843 C  CB  . SER A 1 489 ? 85.981  -2.345  88.966  1.00 59.59 ? 489 SER A CB  1 
ATOM   3844 O  OG  . SER A 1 489 ? 87.175  -2.988  89.353  1.00 58.45 ? 489 SER A OG  1 
ATOM   3845 N  N   . GLY A 1 490 ? 83.600  -4.106  88.240  1.00 64.96 ? 490 GLY A N   1 
ATOM   3846 C  CA  . GLY A 1 490 ? 83.017  -5.328  87.700  1.00 68.04 ? 490 GLY A CA  1 
ATOM   3847 C  C   . GLY A 1 490 ? 83.955  -6.017  86.723  1.00 70.49 ? 490 GLY A C   1 
ATOM   3848 O  O   . GLY A 1 490 ? 85.157  -6.112  86.971  1.00 71.97 ? 490 GLY A O   1 
ATOM   3849 N  N   . LEU A 1 491 ? 83.408  -6.524  85.619  1.00 72.09 ? 491 LEU A N   1 
ATOM   3850 C  CA  . LEU A 1 491 ? 84.225  -7.183  84.597  1.00 73.08 ? 491 LEU A CA  1 
ATOM   3851 C  C   . LEU A 1 491 ? 84.924  -6.116  83.751  1.00 73.50 ? 491 LEU A C   1 
ATOM   3852 O  O   . LEU A 1 491 ? 86.121  -6.226  83.475  1.00 73.76 ? 491 LEU A O   1 
ATOM   3853 C  CB  . LEU A 1 491 ? 83.367  -8.085  83.706  1.00 71.81 ? 491 LEU A CB  1 
ATOM   3854 C  CG  . LEU A 1 491 ? 82.583  -9.178  84.433  1.00 72.22 ? 491 LEU A CG  1 
ATOM   3855 C  CD1 . LEU A 1 491 ? 81.784  -9.977  83.430  1.00 71.11 ? 491 LEU A CD1 1 
ATOM   3856 C  CD2 . LEU A 1 491 ? 83.528  -10.077 85.215  1.00 70.69 ? 491 LEU A CD2 1 
ATOM   3857 N  N   . GLU A 1 492 ? 84.145  -5.125  83.302  1.00 74.10 ? 492 GLU A N   1 
ATOM   3858 C  CA  . GLU A 1 492 ? 84.629  -3.995  82.495  1.00 74.60 ? 492 GLU A CA  1 
ATOM   3859 C  C   . GLU A 1 492 ? 84.761  -2.768  83.398  1.00 74.55 ? 492 GLU A C   1 
ATOM   3860 O  O   . GLU A 1 492 ? 83.838  -2.464  84.175  1.00 75.80 ? 492 GLU A O   1 
ATOM   3861 C  CB  . GLU A 1 492 ? 83.638  -3.668  81.376  1.00 74.30 ? 492 GLU A CB  1 
ATOM   3862 C  CG  . GLU A 1 492 ? 83.944  -4.323  80.053  1.00 75.21 ? 492 GLU A CG  1 
ATOM   3863 C  CD  . GLU A 1 492 ? 82.734  -4.413  79.146  1.00 75.63 ? 492 GLU A CD  1 
ATOM   3864 O  OE1 . GLU A 1 492 ? 82.175  -3.354  78.777  1.00 75.84 ? 492 GLU A OE1 1 
ATOM   3865 O  OE2 . GLU A 1 492 ? 82.344  -5.553  78.800  1.00 76.56 ? 492 GLU A OE2 1 
ATOM   3866 N  N   . VAL A 1 493 ? 85.865  -2.033  83.273  1.00 73.29 ? 493 VAL A N   1 
ATOM   3867 C  CA  . VAL A 1 493 ? 86.058  -0.869  84.124  1.00 70.73 ? 493 VAL A CA  1 
ATOM   3868 C  C   . VAL A 1 493 ? 86.940  0.245   83.570  1.00 70.16 ? 493 VAL A C   1 
ATOM   3869 O  O   . VAL A 1 493 ? 87.898  0.006   82.822  1.00 69.44 ? 493 VAL A O   1 
ATOM   3870 C  CB  . VAL A 1 493 ? 86.596  -1.295  85.517  1.00 69.75 ? 493 VAL A CB  1 
ATOM   3871 C  CG1 . VAL A 1 493 ? 87.965  -1.936  85.386  1.00 68.11 ? 493 VAL A CG1 1 
ATOM   3872 C  CG2 . VAL A 1 493 ? 86.635  -0.109  86.473  1.00 68.88 ? 493 VAL A CG2 1 
ATOM   3873 N  N   . ASN A 1 494 ? 86.570  1.469   83.943  1.00 67.74 ? 494 ASN A N   1 
ATOM   3874 C  CA  . ASN A 1 494 ? 87.290  2.676   83.573  1.00 64.37 ? 494 ASN A CA  1 
ATOM   3875 C  C   . ASN A 1 494 ? 87.864  3.194   84.878  1.00 62.28 ? 494 ASN A C   1 
ATOM   3876 O  O   . ASN A 1 494 ? 87.121  3.565   85.784  1.00 62.61 ? 494 ASN A O   1 
ATOM   3877 C  CB  . ASN A 1 494 ? 86.340  3.728   83.007  1.00 63.56 ? 494 ASN A CB  1 
ATOM   3878 C  CG  . ASN A 1 494 ? 85.558  3.230   81.830  1.00 63.10 ? 494 ASN A CG  1 
ATOM   3879 O  OD1 . ASN A 1 494 ? 86.084  2.533   80.959  1.00 61.26 ? 494 ASN A OD1 1 
ATOM   3880 N  ND2 . ASN A 1 494 ? 84.288  3.588   81.789  1.00 63.81 ? 494 ASN A ND2 1 
ATOM   3881 N  N   . ILE A 1 495 ? 89.178  3.166   85.000  1.00 59.58 ? 495 ILE A N   1 
ATOM   3882 C  CA  . ILE A 1 495 ? 89.810  3.639   86.203  1.00 57.67 ? 495 ILE A CA  1 
ATOM   3883 C  C   . ILE A 1 495 ? 90.484  4.942   85.813  1.00 57.44 ? 495 ILE A C   1 
ATOM   3884 O  O   . ILE A 1 495 ? 91.020  5.065   84.715  1.00 56.81 ? 495 ILE A O   1 
ATOM   3885 C  CB  . ILE A 1 495 ? 90.819  2.599   86.731  1.00 58.05 ? 495 ILE A CB  1 
ATOM   3886 C  CG1 . ILE A 1 495 ? 90.194  1.201   86.662  1.00 56.85 ? 495 ILE A CG1 1 
ATOM   3887 C  CG2 . ILE A 1 495 ? 91.228  2.933   88.178  1.00 57.26 ? 495 ILE A CG2 1 
ATOM   3888 C  CD1 . ILE A 1 495 ? 91.080  0.102   87.187  1.00 55.62 ? 495 ILE A CD1 1 
ATOM   3889 N  N   . VAL A 1 496 ? 90.425  5.922   86.704  1.00 57.39 ? 496 VAL A N   1 
ATOM   3890 C  CA  . VAL A 1 496 ? 90.990  7.243   86.459  1.00 57.64 ? 496 VAL A CA  1 
ATOM   3891 C  C   . VAL A 1 496 ? 91.907  7.646   87.605  1.00 57.77 ? 496 VAL A C   1 
ATOM   3892 O  O   . VAL A 1 496 ? 91.476  7.749   88.758  1.00 55.78 ? 496 VAL A O   1 
ATOM   3893 C  CB  . VAL A 1 496 ? 89.867  8.296   86.348  1.00 58.20 ? 496 VAL A CB  1 
ATOM   3894 C  CG1 . VAL A 1 496 ? 90.457  9.688   86.190  1.00 58.75 ? 496 VAL A CG1 1 
ATOM   3895 C  CG2 . VAL A 1 496 ? 88.923  7.955   85.199  1.00 57.51 ? 496 VAL A CG2 1 
ATOM   3896 N  N   . THR A 1 497 ? 93.164  7.923   87.283  1.00 59.13 ? 497 THR A N   1 
ATOM   3897 C  CA  . THR A 1 497 ? 94.101  8.298   88.320  1.00 60.56 ? 497 THR A CA  1 
ATOM   3898 C  C   . THR A 1 497 ? 94.834  9.599   88.061  1.00 59.79 ? 497 THR A C   1 
ATOM   3899 O  O   . THR A 1 497 ? 94.969  10.065  86.924  1.00 58.69 ? 497 THR A O   1 
ATOM   3900 C  CB  . THR A 1 497 ? 95.155  7.178   88.587  1.00 62.19 ? 497 THR A CB  1 
ATOM   3901 O  OG1 . THR A 1 497 ? 96.133  7.172   87.538  1.00 63.61 ? 497 THR A OG1 1 
ATOM   3902 C  CG2 . THR A 1 497 ? 94.496  5.799   88.663  1.00 62.59 ? 497 THR A CG2 1 
ATOM   3903 N  N   . ASP A 1 498 ? 95.317  10.154  89.161  1.00 60.08 ? 498 ASP A N   1 
ATOM   3904 C  CA  . ASP A 1 498 ? 96.073  11.389  89.188  1.00 60.53 ? 498 ASP A CA  1 
ATOM   3905 C  C   . ASP A 1 498 ? 97.548  11.028  89.358  1.00 58.73 ? 498 ASP A C   1 
ATOM   3906 O  O   . ASP A 1 498 ? 98.387  11.890  89.624  1.00 57.85 ? 498 ASP A O   1 
ATOM   3907 C  CB  . ASP A 1 498 ? 95.606  12.212  90.400  1.00 65.06 ? 498 ASP A CB  1 
ATOM   3908 C  CG  . ASP A 1 498 ? 95.849  11.494  91.744  1.00 68.36 ? 498 ASP A CG  1 
ATOM   3909 O  OD1 . ASP A 1 498 ? 95.826  10.238  91.789  1.00 70.60 ? 498 ASP A OD1 1 
ATOM   3910 O  OD2 . ASP A 1 498 ? 96.061  12.192  92.766  1.00 69.10 ? 498 ASP A OD2 1 
ATOM   3911 N  N   . SER A 1 499 ? 97.856  9.740   89.255  1.00 56.63 ? 499 SER A N   1 
ATOM   3912 C  CA  . SER A 1 499 ? 99.226  9.285   89.431  1.00 55.51 ? 499 SER A CA  1 
ATOM   3913 C  C   . SER A 1 499 ? 100.099 9.294   88.198  1.00 54.73 ? 499 SER A C   1 
ATOM   3914 O  O   . SER A 1 499 ? 99.832  8.592   87.225  1.00 54.68 ? 499 SER A O   1 
ATOM   3915 C  CB  . SER A 1 499 ? 99.278  7.877   90.025  1.00 54.99 ? 499 SER A CB  1 
ATOM   3916 O  OG  . SER A 1 499 ? 100.629 7.510   90.280  1.00 53.45 ? 499 SER A OG  1 
ATOM   3917 N  N   . GLN A 1 500 ? 101.179 10.054  88.272  1.00 53.71 ? 500 GLN A N   1 
ATOM   3918 C  CA  . GLN A 1 500 ? 102.123 10.093  87.187  1.00 52.94 ? 500 GLN A CA  1 
ATOM   3919 C  C   . GLN A 1 500 ? 102.697 8.685   87.227  1.00 52.99 ? 500 GLN A C   1 
ATOM   3920 O  O   . GLN A 1 500 ? 102.678 7.942   86.244  1.00 51.01 ? 500 GLN A O   1 
ATOM   3921 C  CB  . GLN A 1 500 ? 103.220 11.100  87.520  1.00 53.24 ? 500 GLN A CB  1 
ATOM   3922 C  CG  . GLN A 1 500 ? 104.045 11.506  86.329  1.00 52.43 ? 500 GLN A CG  1 
ATOM   3923 C  CD  . GLN A 1 500 ? 103.181 12.107  85.233  1.00 51.45 ? 500 GLN A CD  1 
ATOM   3924 O  OE1 . GLN A 1 500 ? 102.208 11.496  84.784  1.00 49.31 ? 500 GLN A OE1 1 
ATOM   3925 N  NE2 . GLN A 1 500 ? 103.525 13.312  84.807  1.00 49.73 ? 500 GLN A NE2 1 
ATOM   3926 N  N   . TYR A 1 501 ? 103.067 8.310   88.449  1.00 52.75 ? 501 TYR A N   1 
ATOM   3927 C  CA  . TYR A 1 501 ? 103.660 7.030   88.781  1.00 53.27 ? 501 TYR A CA  1 
ATOM   3928 C  C   . TYR A 1 501 ? 102.907 5.797   88.312  1.00 51.73 ? 501 TYR A C   1 
ATOM   3929 O  O   . TYR A 1 501 ? 103.326 5.105   87.386  1.00 52.03 ? 501 TYR A O   1 
ATOM   3930 C  CB  . TYR A 1 501 ? 103.841 6.938   90.295  1.00 55.12 ? 501 TYR A CB  1 
ATOM   3931 C  CG  . TYR A 1 501 ? 104.612 5.711   90.736  1.00 57.94 ? 501 TYR A CG  1 
ATOM   3932 C  CD1 . TYR A 1 501 ? 105.558 5.121   89.894  1.00 59.15 ? 501 TYR A CD1 1 
ATOM   3933 C  CD2 . TYR A 1 501 ? 104.452 5.180   92.017  1.00 58.18 ? 501 TYR A CD2 1 
ATOM   3934 C  CE1 . TYR A 1 501 ? 106.343 4.035   90.321  1.00 60.64 ? 501 TYR A CE1 1 
ATOM   3935 C  CE2 . TYR A 1 501 ? 105.231 4.088   92.462  1.00 59.92 ? 501 TYR A CE2 1 
ATOM   3936 C  CZ  . TYR A 1 501 ? 106.181 3.521   91.607  1.00 60.65 ? 501 TYR A CZ  1 
ATOM   3937 O  OH  . TYR A 1 501 ? 106.982 2.457   92.014  1.00 59.29 ? 501 TYR A OH  1 
ATOM   3938 N  N   . ALA A 1 502 ? 101.853 5.469   89.041  1.00 51.03 ? 502 ALA A N   1 
ATOM   3939 C  CA  . ALA A 1 502 ? 101.045 4.301   88.753  1.00 50.93 ? 502 ALA A CA  1 
ATOM   3940 C  C   . ALA A 1 502 ? 100.626 4.263   87.305  1.00 51.08 ? 502 ALA A C   1 
ATOM   3941 O  O   . ALA A 1 502 ? 100.474 3.183   86.721  1.00 50.87 ? 502 ALA A O   1 
ATOM   3942 C  CB  . ALA A 1 502 ? 99.840  4.290   89.642  1.00 51.75 ? 502 ALA A CB  1 
ATOM   3943 N  N   . LEU A 1 503 ? 100.387 5.446   86.750  1.00 51.54 ? 503 LEU A N   1 
ATOM   3944 C  CA  . LEU A 1 503 ? 100.013 5.568   85.361  1.00 52.49 ? 503 LEU A CA  1 
ATOM   3945 C  C   . LEU A 1 503 ? 101.068 4.781   84.603  1.00 52.81 ? 503 LEU A C   1 
ATOM   3946 O  O   . LEU A 1 503 ? 100.785 3.718   84.045  1.00 52.19 ? 503 LEU A O   1 
ATOM   3947 C  CB  . LEU A 1 503 ? 100.067 7.035   84.955  1.00 55.39 ? 503 LEU A CB  1 
ATOM   3948 C  CG  . LEU A 1 503 ? 100.288 7.354   83.475  1.00 58.78 ? 503 LEU A CG  1 
ATOM   3949 C  CD1 . LEU A 1 503 ? 99.023  7.054   82.665  1.00 58.29 ? 503 LEU A CD1 1 
ATOM   3950 C  CD2 . LEU A 1 503 ? 100.729 8.809   83.313  1.00 59.28 ? 503 LEU A CD2 1 
ATOM   3951 N  N   . GLY A 1 504 ? 102.307 5.255   84.682  1.00 52.49 ? 504 GLY A N   1 
ATOM   3952 C  CA  . GLY A 1 504 ? 103.394 4.581   84.005  1.00 52.36 ? 504 GLY A CA  1 
ATOM   3953 C  C   . GLY A 1 504 ? 103.443 3.114   84.381  1.00 52.68 ? 504 GLY A C   1 
ATOM   3954 O  O   . GLY A 1 504 ? 103.229 2.248   83.534  1.00 51.53 ? 504 GLY A O   1 
ATOM   3955 N  N   . ILE A 1 505 ? 103.665 2.845   85.664  1.00 54.17 ? 505 ILE A N   1 
ATOM   3956 C  CA  . ILE A 1 505 ? 103.745 1.487   86.194  1.00 56.75 ? 505 ILE A CA  1 
ATOM   3957 C  C   . ILE A 1 505 ? 102.824 0.450   85.547  1.00 57.79 ? 505 ILE A C   1 
ATOM   3958 O  O   . ILE A 1 505 ? 103.288 -0.576  85.035  1.00 57.10 ? 505 ILE A O   1 
ATOM   3959 C  CB  . ILE A 1 505 ? 103.518 1.478   87.717  1.00 56.37 ? 505 ILE A CB  1 
ATOM   3960 C  CG1 . ILE A 1 505 ? 104.854 1.636   88.422  1.00 58.44 ? 505 ILE A CG1 1 
ATOM   3961 C  CG2 . ILE A 1 505 ? 102.836 0.189   88.176  1.00 56.64 ? 505 ILE A CG2 1 
ATOM   3962 C  CD1 . ILE A 1 505 ? 104.877 1.017   89.817  1.00 59.97 ? 505 ILE A CD1 1 
ATOM   3963 N  N   . ILE A 1 506 ? 101.522 0.694   85.608  1.00 59.57 ? 506 ILE A N   1 
ATOM   3964 C  CA  . ILE A 1 506 ? 100.570 -0.238  85.034  1.00 62.12 ? 506 ILE A CA  1 
ATOM   3965 C  C   . ILE A 1 506 ? 100.754 -0.342  83.528  1.00 63.99 ? 506 ILE A C   1 
ATOM   3966 O  O   . ILE A 1 506 ? 100.682 -1.440  82.957  1.00 63.98 ? 506 ILE A O   1 
ATOM   3967 C  CB  . ILE A 1 506 ? 99.137  0.170   85.381  1.00 62.83 ? 506 ILE A CB  1 
ATOM   3968 C  CG1 . ILE A 1 506 ? 98.947  0.027   86.886  1.00 63.65 ? 506 ILE A CG1 1 
ATOM   3969 C  CG2 . ILE A 1 506 ? 98.126  -0.670  84.603  1.00 63.26 ? 506 ILE A CG2 1 
ATOM   3970 C  CD1 . ILE A 1 506 ? 97.520  0.100   87.337  1.00 65.41 ? 506 ILE A CD1 1 
ATOM   3971 N  N   . GLN A 1 507 ? 101.028 0.798   82.894  1.00 64.86 ? 507 GLN A N   1 
ATOM   3972 C  CA  . GLN A 1 507 ? 101.236 0.844   81.456  1.00 65.97 ? 507 GLN A CA  1 
ATOM   3973 C  C   . GLN A 1 507 ? 102.447 0.026   81.059  1.00 65.65 ? 507 GLN A C   1 
ATOM   3974 O  O   . GLN A 1 507 ? 102.515 -0.496  79.951  1.00 64.45 ? 507 GLN A O   1 
ATOM   3975 C  CB  . GLN A 1 507 ? 101.411 2.278   81.001  1.00 68.17 ? 507 GLN A CB  1 
ATOM   3976 C  CG  . GLN A 1 507 ? 100.232 3.142   81.368  1.00 73.12 ? 507 GLN A CG  1 
ATOM   3977 C  CD  . GLN A 1 507 ? 99.947  4.221   80.343  1.00 76.63 ? 507 GLN A CD  1 
ATOM   3978 O  OE1 . GLN A 1 507 ? 99.041  5.042   80.526  1.00 78.97 ? 507 GLN A OE1 1 
ATOM   3979 N  NE2 . GLN A 1 507 ? 100.694 4.208   79.238  1.00 79.00 ? 507 GLN A NE2 1 
ATOM   3980 N  N   . ALA A 1 508 ? 103.393 -0.094  81.982  1.00 66.25 ? 508 ALA A N   1 
ATOM   3981 C  CA  . ALA A 1 508 ? 104.606 -0.866  81.753  1.00 66.86 ? 508 ALA A CA  1 
ATOM   3982 C  C   . ALA A 1 508 ? 104.263 -2.344  81.615  1.00 66.92 ? 508 ALA A C   1 
ATOM   3983 O  O   . ALA A 1 508 ? 105.108 -3.161  81.237  1.00 67.10 ? 508 ALA A O   1 
ATOM   3984 C  CB  . ALA A 1 508 ? 105.569 -0.666  82.905  1.00 66.55 ? 508 ALA A CB  1 
ATOM   3985 N  N   . GLN A 1 509 ? 103.037 -2.682  81.998  1.00 67.21 ? 509 GLN A N   1 
ATOM   3986 C  CA  . GLN A 1 509 ? 102.547 -4.043  81.944  1.00 67.27 ? 509 GLN A CA  1 
ATOM   3987 C  C   . GLN A 1 509 ? 103.565 -4.998  82.529  1.00 67.44 ? 509 GLN A C   1 
ATOM   3988 O  O   . GLN A 1 509 ? 103.753 -6.105  82.033  1.00 67.18 ? 509 GLN A O   1 
ATOM   3989 C  CB  . GLN A 1 509 ? 102.194 -4.410  80.510  1.00 67.47 ? 509 GLN A CB  1 
ATOM   3990 C  CG  . GLN A 1 509 ? 101.122 -3.504  79.944  1.00 70.32 ? 509 GLN A CG  1 
ATOM   3991 C  CD  . GLN A 1 509 ? 100.680 -3.891  78.545  1.00 73.32 ? 509 GLN A CD  1 
ATOM   3992 O  OE1 . GLN A 1 509 ? 100.776 -5.049  78.145  1.00 75.86 ? 509 GLN A OE1 1 
ATOM   3993 N  NE2 . GLN A 1 509 ? 100.159 -2.922  77.803  1.00 74.10 ? 509 GLN A NE2 1 
ATOM   3994 N  N   . PRO A 1 510 ? 104.202 -4.601  83.640  1.00 68.95 ? 510 PRO A N   1 
ATOM   3995 C  CA  . PRO A 1 510 ? 105.197 -5.487  84.228  1.00 70.75 ? 510 PRO A CA  1 
ATOM   3996 C  C   . PRO A 1 510 ? 104.488 -6.692  84.802  1.00 72.78 ? 510 PRO A C   1 
ATOM   3997 O  O   . PRO A 1 510 ? 103.353 -7.001  84.424  1.00 72.90 ? 510 PRO A O   1 
ATOM   3998 C  CB  . PRO A 1 510 ? 105.802 -4.633  85.357  1.00 69.81 ? 510 PRO A CB  1 
ATOM   3999 C  CG  . PRO A 1 510 ? 105.345 -3.243  85.074  1.00 70.03 ? 510 PRO A CG  1 
ATOM   4000 C  CD  . PRO A 1 510 ? 103.964 -3.467  84.541  1.00 69.72 ? 510 PRO A CD  1 
ATOM   4001 N  N   . ASP A 1 511 ? 105.168 -7.362  85.721  1.00 75.27 ? 511 ASP A N   1 
ATOM   4002 C  CA  . ASP A 1 511 ? 104.626 -8.523  86.401  1.00 78.68 ? 511 ASP A CA  1 
ATOM   4003 C  C   . ASP A 1 511 ? 105.671 -9.050  87.375  1.00 79.91 ? 511 ASP A C   1 
ATOM   4004 O  O   . ASP A 1 511 ? 106.708 -8.405  87.575  1.00 78.80 ? 511 ASP A O   1 
ATOM   4005 C  CB  . ASP A 1 511 ? 104.125 -9.599  85.406  1.00 80.59 ? 511 ASP A CB  1 
ATOM   4006 C  CG  . ASP A 1 511 ? 105.236 -10.441 84.803  1.00 82.56 ? 511 ASP A CG  1 
ATOM   4007 O  OD1 . ASP A 1 511 ? 106.304 -9.890  84.473  1.00 84.62 ? 511 ASP A OD1 1 
ATOM   4008 O  OD2 . ASP A 1 511 ? 105.018 -11.666 84.654  1.00 82.82 ? 511 ASP A OD2 1 
ATOM   4009 N  N   . LYS A 1 512 ? 105.333 -10.162 88.038  1.00 82.38 ? 512 LYS A N   1 
ATOM   4010 C  CA  . LYS A 1 512 ? 106.174 -10.845 89.039  1.00 84.88 ? 512 LYS A CA  1 
ATOM   4011 C  C   . LYS A 1 512 ? 107.103 -9.923  89.856  1.00 85.58 ? 512 LYS A C   1 
ATOM   4012 O  O   . LYS A 1 512 ? 108.329 -9.974  89.704  1.00 86.86 ? 512 LYS A O   1 
ATOM   4013 C  CB  . LYS A 1 512 ? 106.980 -11.997 88.398  1.00 86.20 ? 512 LYS A CB  1 
ATOM   4014 C  CG  . LYS A 1 512 ? 106.150 -13.040 87.624  1.00 88.45 ? 512 LYS A CG  1 
ATOM   4015 C  CD  . LYS A 1 512 ? 104.956 -13.576 88.428  1.00 89.24 ? 512 LYS A CD  1 
ATOM   4016 C  CE  . LYS A 1 512 ? 104.128 -14.603 87.633  1.00 88.74 ? 512 LYS A CE  1 
ATOM   4017 N  NZ  . LYS A 1 512 ? 104.821 -15.920 87.510  1.00 89.23 ? 512 LYS A NZ  1 
ATOM   4018 N  N   . SER A 1 513 ? 106.520 -9.123  90.749  1.00 85.64 ? 513 SER A N   1 
ATOM   4019 C  CA  . SER A 1 513 ? 107.300 -8.207  91.569  1.00 84.51 ? 513 SER A CA  1 
ATOM   4020 C  C   . SER A 1 513 ? 107.254 -8.441  93.083  1.00 84.62 ? 513 SER A C   1 
ATOM   4021 O  O   . SER A 1 513 ? 106.560 -9.326  93.597  1.00 83.65 ? 513 SER A O   1 
ATOM   4022 C  CB  . SER A 1 513 ? 106.938 -6.756  91.239  1.00 84.03 ? 513 SER A CB  1 
ATOM   4023 O  OG  . SER A 1 513 ? 107.519 -6.345  90.017  1.00 82.80 ? 513 SER A OG  1 
ATOM   4024 N  N   . GLU A 1 514 ? 108.005 -7.602  93.780  1.00 84.32 ? 514 GLU A N   1 
ATOM   4025 C  CA  . GLU A 1 514 ? 108.156 -7.630  95.230  1.00 84.30 ? 514 GLU A CA  1 
ATOM   4026 C  C   . GLU A 1 514 ? 107.223 -6.665  95.947  1.00 83.53 ? 514 GLU A C   1 
ATOM   4027 O  O   . GLU A 1 514 ? 107.233 -6.573  97.178  1.00 84.44 ? 514 GLU A O   1 
ATOM   4028 C  CB  . GLU A 1 514 ? 109.608 -7.292  95.590  1.00 85.08 ? 514 GLU A CB  1 
ATOM   4029 C  CG  . GLU A 1 514 ? 110.117 -5.937  95.035  1.00 85.69 ? 514 GLU A CG  1 
ATOM   4030 C  CD  . GLU A 1 514 ? 110.131 -5.875  93.508  1.00 86.48 ? 514 GLU A CD  1 
ATOM   4031 O  OE1 . GLU A 1 514 ? 110.781 -6.748  92.881  1.00 86.68 ? 514 GLU A OE1 1 
ATOM   4032 O  OE2 . GLU A 1 514 ? 109.430 -4.997  92.943  1.00 85.51 ? 514 GLU A OE2 1 
ATOM   4033 N  N   . SER A 1 515 ? 106.402 -5.956  95.185  1.00 82.13 ? 515 SER A N   1 
ATOM   4034 C  CA  . SER A 1 515 ? 105.483 -5.008  95.785  1.00 80.80 ? 515 SER A CA  1 
ATOM   4035 C  C   . SER A 1 515 ? 104.108 -5.664  95.786  1.00 80.68 ? 515 SER A C   1 
ATOM   4036 O  O   . SER A 1 515 ? 103.382 -5.564  94.799  1.00 81.26 ? 515 SER A O   1 
ATOM   4037 C  CB  . SER A 1 515 ? 105.474 -3.692  94.993  1.00 79.21 ? 515 SER A CB  1 
ATOM   4038 O  OG  . SER A 1 515 ? 104.629 -2.717  95.583  1.00 76.71 ? 515 SER A OG  1 
ATOM   4039 N  N   . GLU A 1 516 ? 103.785 -6.387  96.863  1.00 79.96 ? 516 GLU A N   1 
ATOM   4040 C  CA  . GLU A 1 516 ? 102.492 -7.058  97.005  1.00 78.40 ? 516 GLU A CA  1 
ATOM   4041 C  C   . GLU A 1 516 ? 101.440 -6.161  96.400  1.00 76.58 ? 516 GLU A C   1 
ATOM   4042 O  O   . GLU A 1 516 ? 100.748 -6.542  95.455  1.00 75.51 ? 516 GLU A O   1 
ATOM   4043 C  CB  . GLU A 1 516 ? 102.167 -7.287  98.483  1.00 80.77 ? 516 GLU A CB  1 
ATOM   4044 C  CG  . GLU A 1 516 ? 102.676 -8.611  99.026  1.00 84.21 ? 516 GLU A CG  1 
ATOM   4045 C  CD  . GLU A 1 516 ? 102.076 -9.818  98.306  1.00 86.78 ? 516 GLU A CD  1 
ATOM   4046 O  OE1 . GLU A 1 516 ? 100.830 -9.914  98.218  1.00 87.27 ? 516 GLU A OE1 1 
ATOM   4047 O  OE2 . GLU A 1 516 ? 102.856 -10.676 97.832  1.00 89.52 ? 516 GLU A OE2 1 
ATOM   4048 N  N   . LEU A 1 517 ? 101.420 -4.934  96.912  1.00 74.42 ? 517 LEU A N   1 
ATOM   4049 C  CA  . LEU A 1 517 ? 100.524 -3.869  96.483  1.00 72.56 ? 517 LEU A CA  1 
ATOM   4050 C  C   . LEU A 1 517 ? 100.277 -3.977  94.965  1.00 71.61 ? 517 LEU A C   1 
ATOM   4051 O  O   . LEU A 1 517 ? 99.147  -4.226  94.512  1.00 70.83 ? 517 LEU A O   1 
ATOM   4052 C  CB  . LEU A 1 517 ? 101.183 -2.531  96.879  1.00 72.20 ? 517 LEU A CB  1 
ATOM   4053 C  CG  . LEU A 1 517 ? 100.714 -1.105  96.573  1.00 70.76 ? 517 LEU A CG  1 
ATOM   4054 C  CD1 . LEU A 1 517 ? 99.281  -0.851  96.964  1.00 69.05 ? 517 LEU A CD1 1 
ATOM   4055 C  CD2 . LEU A 1 517 ? 101.630 -0.164  97.323  1.00 69.55 ? 517 LEU A CD2 1 
ATOM   4056 N  N   . VAL A 1 518 ? 101.370 -3.937  94.209  1.00 69.97 ? 518 VAL A N   1 
ATOM   4057 C  CA  . VAL A 1 518 ? 101.334 -4.026  92.756  1.00 67.98 ? 518 VAL A CA  1 
ATOM   4058 C  C   . VAL A 1 518 ? 100.922 -5.436  92.302  1.00 67.92 ? 518 VAL A C   1 
ATOM   4059 O  O   . VAL A 1 518 ? 99.978  -5.592  91.532  1.00 67.33 ? 518 VAL A O   1 
ATOM   4060 C  CB  . VAL A 1 518 ? 102.720 -3.679  92.154  1.00 65.63 ? 518 VAL A CB  1 
ATOM   4061 C  CG1 . VAL A 1 518 ? 102.619 -3.485  90.670  1.00 64.23 ? 518 VAL A CG1 1 
ATOM   4062 C  CG2 . VAL A 1 518 ? 103.282 -2.438  92.798  1.00 64.02 ? 518 VAL A CG2 1 
ATOM   4063 N  N   . ASN A 1 519 ? 101.608 -6.450  92.818  1.00 67.75 ? 519 ASN A N   1 
ATOM   4064 C  CA  . ASN A 1 519 ? 101.354 -7.843  92.472  1.00 68.45 ? 519 ASN A CA  1 
ATOM   4065 C  C   . ASN A 1 519 ? 99.869  -8.122  92.410  1.00 68.90 ? 519 ASN A C   1 
ATOM   4066 O  O   . ASN A 1 519 ? 99.389  -8.862  91.544  1.00 68.02 ? 519 ASN A O   1 
ATOM   4067 C  CB  . ASN A 1 519 ? 101.959 -8.768  93.532  1.00 69.82 ? 519 ASN A CB  1 
ATOM   4068 C  CG  . ASN A 1 519 ? 103.427 -8.465  93.826  1.00 70.19 ? 519 ASN A CG  1 
ATOM   4069 O  OD1 . ASN A 1 519 ? 104.033 -7.560  93.236  1.00 69.14 ? 519 ASN A OD1 1 
ATOM   4070 N  ND2 . ASN A 1 519 ? 104.003 -9.222  94.759  1.00 70.13 ? 519 ASN A ND2 1 
ATOM   4071 N  N   . GLN A 1 520 ? 99.158  -7.519  93.356  1.00 70.49 ? 520 GLN A N   1 
ATOM   4072 C  CA  . GLN A 1 520 ? 97.716  -7.662  93.504  1.00 71.72 ? 520 GLN A CA  1 
ATOM   4073 C  C   . GLN A 1 520 ? 96.972  -7.043  92.362  1.00 71.67 ? 520 GLN A C   1 
ATOM   4074 O  O   . GLN A 1 520 ? 96.139  -7.693  91.714  1.00 71.88 ? 520 GLN A O   1 
ATOM   4075 C  CB  . GLN A 1 520 ? 97.278  -7.014  94.802  1.00 71.54 ? 520 GLN A CB  1 
ATOM   4076 C  CG  . GLN A 1 520 ? 97.852  -7.713  96.003  1.00 74.23 ? 520 GLN A CG  1 
ATOM   4077 C  CD  . GLN A 1 520 ? 97.582  -6.980  97.287  1.00 76.44 ? 520 GLN A CD  1 
ATOM   4078 O  OE1 . GLN A 1 520 ? 96.966  -5.918  97.293  1.00 78.45 ? 520 GLN A OE1 1 
ATOM   4079 N  NE2 . GLN A 1 520 ? 98.032  -7.548  98.392  1.00 77.22 ? 520 GLN A NE2 1 
ATOM   4080 N  N   . ILE A 1 521 ? 97.243  -5.761  92.161  1.00 71.14 ? 521 ILE A N   1 
ATOM   4081 C  CA  . ILE A 1 521 ? 96.645  -4.993  91.077  1.00 71.09 ? 521 ILE A CA  1 
ATOM   4082 C  C   . ILE A 1 521 ? 96.842  -5.841  89.821  1.00 68.96 ? 521 ILE A C   1 
ATOM   4083 O  O   . ILE A 1 521 ? 95.886  -6.163  89.119  1.00 68.09 ? 521 ILE A O   1 
ATOM   4084 C  CB  . ILE A 1 521 ? 97.358  -3.612  90.957  1.00 71.70 ? 521 ILE A CB  1 
ATOM   4085 C  CG1 . ILE A 1 521 ? 97.196  -2.845  92.283  1.00 71.64 ? 521 ILE A CG1 1 
ATOM   4086 C  CG2 . ILE A 1 521 ? 96.795  -2.806  89.774  1.00 71.13 ? 521 ILE A CG2 1 
ATOM   4087 C  CD1 . ILE A 1 521 ? 98.210  -1.748  92.534  1.00 70.54 ? 521 ILE A CD1 1 
ATOM   4088 N  N   . ILE A 1 522 ? 98.070  -6.320  89.656  1.00 68.01 ? 522 ILE A N   1 
ATOM   4089 C  CA  . ILE A 1 522 ? 98.473  -7.177  88.545  1.00 67.41 ? 522 ILE A CA  1 
ATOM   4090 C  C   . ILE A 1 522 ? 97.503  -8.350  88.441  1.00 66.01 ? 522 ILE A C   1 
ATOM   4091 O  O   . ILE A 1 522 ? 96.771  -8.496  87.458  1.00 64.75 ? 522 ILE A O   1 
ATOM   4092 C  CB  . ILE A 1 522 ? 99.934  -7.718  88.786  1.00 66.84 ? 522 ILE A CB  1 
ATOM   4093 C  CG1 . ILE A 1 522 ? 100.970 -6.648  88.428  1.00 64.89 ? 522 ILE A CG1 1 
ATOM   4094 C  CG2 . ILE A 1 522 ? 100.199 -8.998  88.002  1.00 67.07 ? 522 ILE A CG2 1 
ATOM   4095 C  CD1 . ILE A 1 522 ? 102.360 -7.002  88.854  1.00 61.52 ? 522 ILE A CD1 1 
ATOM   4096 N  N   . GLU A 1 523 ? 97.455  -9.130  89.512  1.00 64.61 ? 523 GLU A N   1 
ATOM   4097 C  CA  . GLU A 1 523 ? 96.612  -10.300 89.595  1.00 63.45 ? 523 GLU A CA  1 
ATOM   4098 C  C   . GLU A 1 523 ? 95.144  -10.011 89.317  1.00 62.41 ? 523 GLU A C   1 
ATOM   4099 O  O   . GLU A 1 523 ? 94.421  -10.882 88.846  1.00 58.54 ? 523 GLU A O   1 
ATOM   4100 C  CB  . GLU A 1 523 ? 96.763  -10.909 90.969  1.00 64.37 ? 523 GLU A CB  1 
ATOM   4101 C  CG  . GLU A 1 523 ? 96.494  -12.369 90.993  1.00 67.26 ? 523 GLU A CG  1 
ATOM   4102 C  CD  . GLU A 1 523 ? 96.333  -12.873 92.400  1.00 68.79 ? 523 GLU A CD  1 
ATOM   4103 O  OE1 . GLU A 1 523 ? 97.358  -13.053 93.100  1.00 69.48 ? 523 GLU A OE1 1 
ATOM   4104 O  OE2 . GLU A 1 523 ? 95.171  -13.071 92.808  1.00 69.60 ? 523 GLU A OE2 1 
ATOM   4105 N  N   . GLN A 1 524 ? 94.709  -8.793  89.628  1.00 63.93 ? 524 GLN A N   1 
ATOM   4106 C  CA  . GLN A 1 524 ? 93.325  -8.371  89.403  1.00 66.82 ? 524 GLN A CA  1 
ATOM   4107 C  C   . GLN A 1 524 ? 93.125  -8.121  87.913  1.00 68.21 ? 524 GLN A C   1 
ATOM   4108 O  O   . GLN A 1 524 ? 92.142  -8.546  87.314  1.00 68.48 ? 524 GLN A O   1 
ATOM   4109 C  CB  . GLN A 1 524 ? 93.013  -7.065  90.153  1.00 68.43 ? 524 GLN A CB  1 
ATOM   4110 C  CG  . GLN A 1 524 ? 93.321  -7.078  91.636  1.00 69.94 ? 524 GLN A CG  1 
ATOM   4111 C  CD  . GLN A 1 524 ? 92.099  -6.828  92.496  1.00 70.55 ? 524 GLN A CD  1 
ATOM   4112 O  OE1 . GLN A 1 524 ? 91.257  -5.998  92.175  1.00 70.27 ? 524 GLN A OE1 1 
ATOM   4113 N  NE2 . GLN A 1 524 ? 92.005  -7.546  93.608  1.00 69.67 ? 524 GLN A NE2 1 
ATOM   4114 N  N   . LEU A 1 525 ? 94.056  -7.381  87.332  1.00 69.58 ? 525 LEU A N   1 
ATOM   4115 C  CA  . LEU A 1 525 ? 94.026  -7.049  85.916  1.00 70.98 ? 525 LEU A CA  1 
ATOM   4116 C  C   . LEU A 1 525 ? 94.032  -8.349  85.141  1.00 72.01 ? 525 LEU A C   1 
ATOM   4117 O  O   . LEU A 1 525 ? 93.416  -8.464  84.084  1.00 71.42 ? 525 LEU A O   1 
ATOM   4118 C  CB  . LEU A 1 525 ? 95.267  -6.234  85.563  1.00 71.79 ? 525 LEU A CB  1 
ATOM   4119 C  CG  . LEU A 1 525 ? 95.498  -5.065  86.519  1.00 71.88 ? 525 LEU A CG  1 
ATOM   4120 C  CD1 . LEU A 1 525 ? 96.932  -4.577  86.428  1.00 71.91 ? 525 LEU A CD1 1 
ATOM   4121 C  CD2 . LEU A 1 525 ? 94.488  -3.967  86.248  1.00 70.61 ? 525 LEU A CD2 1 
ATOM   4122 N  N   . ILE A 1 526 ? 94.800  -9.297  85.667  1.00 73.79 ? 526 ILE A N   1 
ATOM   4123 C  CA  . ILE A 1 526 ? 94.934  -10.643 85.118  1.00 76.25 ? 526 ILE A CA  1 
ATOM   4124 C  C   . ILE A 1 526 ? 93.539  -11.258 85.149  1.00 76.97 ? 526 ILE A C   1 
ATOM   4125 O  O   . ILE A 1 526 ? 93.019  -11.760 84.151  1.00 77.52 ? 526 ILE A O   1 
ATOM   4126 C  CB  . ILE A 1 526 ? 95.829  -11.511 86.057  1.00 77.13 ? 526 ILE A CB  1 
ATOM   4127 C  CG1 . ILE A 1 526 ? 97.314  -11.275 85.797  1.00 76.80 ? 526 ILE A CG1 1 
ATOM   4128 C  CG2 . ILE A 1 526 ? 95.467  -12.987 85.952  1.00 78.17 ? 526 ILE A CG2 1 
ATOM   4129 C  CD1 . ILE A 1 526 ? 98.218  -12.137 86.690  1.00 76.13 ? 526 ILE A CD1 1 
ATOM   4130 N  N   . LYS A 1 527 ? 92.979  -11.244 86.351  1.00 78.04 ? 527 LYS A N   1 
ATOM   4131 C  CA  . LYS A 1 527 ? 91.667  -11.779 86.634  1.00 77.92 ? 527 LYS A CA  1 
ATOM   4132 C  C   . LYS A 1 527 ? 90.609  -11.144 85.732  1.00 76.77 ? 527 LYS A C   1 
ATOM   4133 O  O   . LYS A 1 527 ? 89.716  -11.836 85.236  1.00 77.30 ? 527 LYS A O   1 
ATOM   4134 C  CB  . LYS A 1 527 ? 91.374  -11.537 88.127  1.00 79.40 ? 527 LYS A CB  1 
ATOM   4135 C  CG  . LYS A 1 527 ? 89.960  -11.826 88.607  1.00 81.89 ? 527 LYS A CG  1 
ATOM   4136 C  CD  . LYS A 1 527 ? 89.911  -11.911 90.132  1.00 82.35 ? 527 LYS A CD  1 
ATOM   4137 C  CE  . LYS A 1 527 ? 90.556  -13.203 90.615  1.00 82.84 ? 527 LYS A CE  1 
ATOM   4138 N  NZ  . LYS A 1 527 ? 90.800  -13.185 92.080  1.00 83.64 ? 527 LYS A NZ  1 
ATOM   4139 N  N   . LYS A 1 528 ? 90.784  -9.861  85.433  1.00 74.49 ? 528 LYS A N   1 
ATOM   4140 C  CA  . LYS A 1 528 ? 89.827  -9.120  84.622  1.00 73.83 ? 528 LYS A CA  1 
ATOM   4141 C  C   . LYS A 1 528 ? 89.616  -9.463  83.140  1.00 73.40 ? 528 LYS A C   1 
ATOM   4142 O  O   . LYS A 1 528 ? 90.159  -10.437 82.602  1.00 72.67 ? 528 LYS A O   1 
ATOM   4143 C  CB  . LYS A 1 528 ? 90.034  -7.616  84.808  1.00 73.30 ? 528 LYS A CB  1 
ATOM   4144 C  CG  . LYS A 1 528 ? 89.662  -7.147  86.205  1.00 73.96 ? 528 LYS A CG  1 
ATOM   4145 C  CD  . LYS A 1 528 ? 89.226  -5.692  86.234  1.00 74.24 ? 528 LYS A CD  1 
ATOM   4146 C  CE  . LYS A 1 528 ? 88.321  -5.425  87.422  1.00 73.91 ? 528 LYS A CE  1 
ATOM   4147 N  NZ  . LYS A 1 528 ? 88.995  -5.659  88.716  1.00 73.81 ? 528 LYS A NZ  1 
ATOM   4148 N  N   . GLU A 1 529 ? 88.753  -8.670  82.512  1.00 73.28 ? 529 GLU A N   1 
ATOM   4149 C  CA  . GLU A 1 529 ? 88.389  -8.837  81.110  1.00 73.85 ? 529 GLU A CA  1 
ATOM   4150 C  C   . GLU A 1 529 ? 88.687  -7.598  80.275  1.00 73.13 ? 529 GLU A C   1 
ATOM   4151 O  O   . GLU A 1 529 ? 89.222  -7.709  79.174  1.00 74.46 ? 529 GLU A O   1 
ATOM   4152 C  CB  . GLU A 1 529 ? 86.886  -9.165  80.996  1.00 73.86 ? 529 GLU A CB  1 
ATOM   4153 C  CG  . GLU A 1 529 ? 86.203  -8.709  79.683  1.00 73.12 ? 529 GLU A CG  1 
ATOM   4154 C  CD  . GLU A 1 529 ? 84.957  -7.855  79.922  1.00 72.10 ? 529 GLU A CD  1 
ATOM   4155 O  OE1 . GLU A 1 529 ? 84.966  -7.033  80.852  1.00 70.64 ? 529 GLU A OE1 1 
ATOM   4156 O  OE2 . GLU A 1 529 ? 83.964  -8.002  79.180  1.00 72.61 ? 529 GLU A OE2 1 
ATOM   4157 N  N   . LYS A 1 530 ? 88.328  -6.424  80.790  1.00 71.42 ? 530 LYS A N   1 
ATOM   4158 C  CA  . LYS A 1 530 ? 88.513  -5.190  80.042  1.00 68.84 ? 530 LYS A CA  1 
ATOM   4159 C  C   . LYS A 1 530 ? 88.667  -3.955  80.920  1.00 66.52 ? 530 LYS A C   1 
ATOM   4160 O  O   . LYS A 1 530 ? 87.685  -3.397  81.406  1.00 66.73 ? 530 LYS A O   1 
ATOM   4161 C  CB  . LYS A 1 530 ? 87.317  -5.008  79.105  1.00 69.34 ? 530 LYS A CB  1 
ATOM   4162 C  CG  . LYS A 1 530 ? 87.380  -3.781  78.234  1.00 70.49 ? 530 LYS A CG  1 
ATOM   4163 C  CD  . LYS A 1 530 ? 86.122  -3.613  77.406  1.00 72.30 ? 530 LYS A CD  1 
ATOM   4164 C  CE  . LYS A 1 530 ? 85.754  -4.897  76.666  1.00 73.37 ? 530 LYS A CE  1 
ATOM   4165 N  NZ  . LYS A 1 530 ? 84.576  -4.716  75.762  1.00 72.95 ? 530 LYS A NZ  1 
ATOM   4166 N  N   . VAL A 1 531 ? 89.901  -3.511  81.096  1.00 63.86 ? 531 VAL A N   1 
ATOM   4167 C  CA  . VAL A 1 531 ? 90.157  -2.336  81.906  1.00 61.90 ? 531 VAL A CA  1 
ATOM   4168 C  C   . VAL A 1 531 ? 90.647  -1.217  81.014  1.00 61.14 ? 531 VAL A C   1 
ATOM   4169 O  O   . VAL A 1 531 ? 91.385  -1.449  80.054  1.00 60.02 ? 531 VAL A O   1 
ATOM   4170 C  CB  . VAL A 1 531 ? 91.273  -2.579  82.959  1.00 61.55 ? 531 VAL A CB  1 
ATOM   4171 C  CG1 . VAL A 1 531 ? 91.407  -1.373  83.887  1.00 60.48 ? 531 VAL A CG1 1 
ATOM   4172 C  CG2 . VAL A 1 531 ? 91.003  -3.826  83.749  1.00 60.13 ? 531 VAL A CG2 1 
ATOM   4173 N  N   . TYR A 1 532 ? 90.228  0.000   81.326  1.00 60.09 ? 532 TYR A N   1 
ATOM   4174 C  CA  . TYR A 1 532 ? 90.682  1.162   80.589  1.00 58.85 ? 532 TYR A CA  1 
ATOM   4175 C  C   . TYR A 1 532 ? 91.143  2.094   81.674  1.00 57.65 ? 532 TYR A C   1 
ATOM   4176 O  O   . TYR A 1 532 ? 90.368  2.527   82.520  1.00 56.94 ? 532 TYR A O   1 
ATOM   4177 C  CB  . TYR A 1 532 ? 89.567  1.825   79.776  1.00 57.75 ? 532 TYR A CB  1 
ATOM   4178 C  CG  . TYR A 1 532 ? 89.988  3.120   79.099  1.00 54.00 ? 532 TYR A CG  1 
ATOM   4179 C  CD1 . TYR A 1 532 ? 90.910  3.121   78.059  1.00 52.28 ? 532 TYR A CD1 1 
ATOM   4180 C  CD2 . TYR A 1 532 ? 89.435  4.338   79.481  1.00 52.30 ? 532 TYR A CD2 1 
ATOM   4181 C  CE1 . TYR A 1 532 ? 91.257  4.302   77.416  1.00 50.83 ? 532 TYR A CE1 1 
ATOM   4182 C  CE2 . TYR A 1 532 ? 89.779  5.517   78.842  1.00 51.05 ? 532 TYR A CE2 1 
ATOM   4183 C  CZ  . TYR A 1 532 ? 90.681  5.493   77.810  1.00 50.77 ? 532 TYR A CZ  1 
ATOM   4184 O  OH  . TYR A 1 532 ? 90.962  6.657   77.138  1.00 50.28 ? 532 TYR A OH  1 
ATOM   4185 N  N   . LEU A 1 533 ? 92.439  2.270   81.736  1.00 57.33 ? 533 LEU A N   1 
ATOM   4186 C  CA  . LEU A 1 533 ? 92.965  3.162   82.701  1.00 58.78 ? 533 LEU A CA  1 
ATOM   4187 C  C   . LEU A 1 533 ? 93.265  4.422   81.909  1.00 61.25 ? 533 LEU A C   1 
ATOM   4188 O  O   . LEU A 1 533 ? 93.330  4.386   80.678  1.00 61.01 ? 533 LEU A O   1 
ATOM   4189 C  CB  . LEU A 1 533 ? 94.216  2.561   83.307  1.00 58.54 ? 533 LEU A CB  1 
ATOM   4190 C  CG  . LEU A 1 533 ? 94.877  3.421   84.382  1.00 59.60 ? 533 LEU A CG  1 
ATOM   4191 C  CD1 . LEU A 1 533 ? 93.863  3.851   85.416  1.00 58.74 ? 533 LEU A CD1 1 
ATOM   4192 C  CD2 . LEU A 1 533 ? 95.996  2.639   85.037  1.00 61.30 ? 533 LEU A CD2 1 
ATOM   4193 N  N   . ALA A 1 534 ? 93.333  5.549   82.607  1.00 64.14 ? 534 ALA A N   1 
ATOM   4194 C  CA  . ALA A 1 534 ? 93.649  6.843   81.999  1.00 66.41 ? 534 ALA A CA  1 
ATOM   4195 C  C   . ALA A 1 534 ? 94.243  7.754   83.077  1.00 68.25 ? 534 ALA A C   1 
ATOM   4196 O  O   . ALA A 1 534 ? 93.999  7.561   84.279  1.00 66.87 ? 534 ALA A O   1 
ATOM   4197 C  CB  . ALA A 1 534 ? 92.409  7.469   81.372  1.00 66.82 ? 534 ALA A CB  1 
ATOM   4198 N  N   . TRP A 1 535 ? 95.019  8.742   82.642  1.00 70.07 ? 535 TRP A N   1 
ATOM   4199 C  CA  . TRP A 1 535 ? 95.679  9.644   83.569  1.00 71.96 ? 535 TRP A CA  1 
ATOM   4200 C  C   . TRP A 1 535 ? 95.422  11.120  83.327  1.00 75.09 ? 535 TRP A C   1 
ATOM   4201 O  O   . TRP A 1 535 ? 95.545  11.599  82.196  1.00 76.25 ? 535 TRP A O   1 
ATOM   4202 C  CB  . TRP A 1 535 ? 97.179  9.389   83.529  1.00 70.36 ? 535 TRP A CB  1 
ATOM   4203 C  CG  . TRP A 1 535 ? 97.959  10.346  84.329  1.00 69.45 ? 535 TRP A CG  1 
ATOM   4204 C  CD1 . TRP A 1 535 ? 98.236  10.262  85.663  1.00 68.49 ? 535 TRP A CD1 1 
ATOM   4205 C  CD2 . TRP A 1 535 ? 98.548  11.561  83.871  1.00 69.28 ? 535 TRP A CD2 1 
ATOM   4206 N  NE1 . TRP A 1 535 ? 98.958  11.356  86.064  1.00 68.60 ? 535 TRP A NE1 1 
ATOM   4207 C  CE2 . TRP A 1 535 ? 99.162  12.169  84.983  1.00 69.18 ? 535 TRP A CE2 1 
ATOM   4208 C  CE3 . TRP A 1 535 ? 98.604  12.203  82.625  1.00 69.12 ? 535 TRP A CE3 1 
ATOM   4209 C  CZ2 . TRP A 1 535 ? 99.835  13.401  84.888  1.00 69.25 ? 535 TRP A CZ2 1 
ATOM   4210 C  CZ3 . TRP A 1 535 ? 99.270  13.414  82.528  1.00 68.68 ? 535 TRP A CZ3 1 
ATOM   4211 C  CH2 . TRP A 1 535 ? 99.876  14.000  83.652  1.00 69.70 ? 535 TRP A CH2 1 
ATOM   4212 N  N   . VAL A 1 536 ? 95.155  11.845  84.416  1.00 78.25 ? 536 VAL A N   1 
ATOM   4213 C  CA  . VAL A 1 536 ? 94.886  13.288  84.382  1.00 81.32 ? 536 VAL A CA  1 
ATOM   4214 C  C   . VAL A 1 536 ? 95.598  14.057  85.516  1.00 83.42 ? 536 VAL A C   1 
ATOM   4215 O  O   . VAL A 1 536 ? 95.849  13.511  86.603  1.00 82.51 ? 536 VAL A O   1 
ATOM   4216 C  CB  . VAL A 1 536 ? 93.351  13.613  84.411  1.00 82.04 ? 536 VAL A CB  1 
ATOM   4217 C  CG1 . VAL A 1 536 ? 92.745  13.474  83.020  1.00 81.47 ? 536 VAL A CG1 1 
ATOM   4218 C  CG2 . VAL A 1 536 ? 92.625  12.700  85.387  1.00 82.11 ? 536 VAL A CG2 1 
ATOM   4219 N  N   . PRO A 1 537 ? 95.954  15.336  85.255  1.00 85.24 ? 537 PRO A N   1 
ATOM   4220 C  CA  . PRO A 1 537 ? 96.640  16.247  86.184  1.00 86.68 ? 537 PRO A CA  1 
ATOM   4221 C  C   . PRO A 1 537 ? 95.929  16.459  87.510  1.00 87.04 ? 537 PRO A C   1 
ATOM   4222 O  O   . PRO A 1 537 ? 94.995  17.270  87.635  1.00 87.11 ? 537 PRO A O   1 
ATOM   4223 C  CB  . PRO A 1 537 ? 96.739  17.541  85.387  1.00 86.70 ? 537 PRO A CB  1 
ATOM   4224 C  CG  . PRO A 1 537 ? 96.826  17.065  83.977  1.00 87.14 ? 537 PRO A CG  1 
ATOM   4225 C  CD  . PRO A 1 537 ? 95.794  15.973  83.935  1.00 85.63 ? 537 PRO A CD  1 
ATOM   4226 N  N   . ALA A 1 538 ? 96.487  15.784  88.510  1.00 88.42 ? 538 ALA A N   1 
ATOM   4227 C  CA  . ALA A 1 538 ? 96.020  15.768  89.890  1.00 89.88 ? 538 ALA A CA  1 
ATOM   4228 C  C   . ALA A 1 538 ? 95.363  17.028  90.449  1.00 90.86 ? 538 ALA A C   1 
ATOM   4229 O  O   . ALA A 1 538 ? 94.217  16.997  90.909  1.00 91.01 ? 538 ALA A O   1 
ATOM   4230 C  CB  . ALA A 1 538 ? 97.171  15.338  90.808  1.00 89.67 ? 538 ALA A CB  1 
ATOM   4231 N  N   . HIS A 1 539 ? 96.090  18.138  90.410  1.00 91.37 ? 539 HIS A N   1 
ATOM   4232 C  CA  . HIS A 1 539 ? 95.584  19.377  90.979  1.00 91.07 ? 539 HIS A CA  1 
ATOM   4233 C  C   . HIS A 1 539 ? 95.194  20.395  89.938  1.00 90.82 ? 539 HIS A C   1 
ATOM   4234 O  O   . HIS A 1 539 ? 94.779  21.491  90.290  1.00 91.09 ? 539 HIS A O   1 
ATOM   4235 C  CB  . HIS A 1 539 ? 96.645  20.001  91.891  1.00 90.64 ? 539 HIS A CB  1 
ATOM   4236 C  CG  . HIS A 1 539 ? 97.175  19.068  92.936  1.00 90.05 ? 539 HIS A CG  1 
ATOM   4237 N  ND1 . HIS A 1 539 ? 98.285  18.275  92.732  1.00 89.93 ? 539 HIS A ND1 1 
ATOM   4238 C  CD2 . HIS A 1 539 ? 96.758  18.817  94.197  1.00 89.83 ? 539 HIS A CD2 1 
ATOM   4239 C  CE1 . HIS A 1 539 ? 98.531  17.575  93.826  1.00 89.31 ? 539 HIS A CE1 1 
ATOM   4240 N  NE2 . HIS A 1 539 ? 97.619  17.885  94.727  1.00 90.40 ? 539 HIS A NE2 1 
ATOM   4241 N  N   . LYS A 1 540 ? 95.258  20.023  88.666  1.00 91.62 ? 540 LYS A N   1 
ATOM   4242 C  CA  . LYS A 1 540 ? 94.942  20.974  87.610  1.00 93.43 ? 540 LYS A CA  1 
ATOM   4243 C  C   . LYS A 1 540 ? 93.529  21.539  87.660  1.00 94.68 ? 540 LYS A C   1 
ATOM   4244 O  O   . LYS A 1 540 ? 93.134  22.339  86.804  1.00 95.43 ? 540 LYS A O   1 
ATOM   4245 C  CB  . LYS A 1 540 ? 95.243  20.388  86.234  1.00 93.54 ? 540 LYS A CB  1 
ATOM   4246 C  CG  . LYS A 1 540 ? 95.456  21.434  85.115  1.00 93.42 ? 540 LYS A CG  1 
ATOM   4247 C  CD  . LYS A 1 540 ? 96.771  22.241  85.232  1.00 92.94 ? 540 LYS A CD  1 
ATOM   4248 C  CE  . LYS A 1 540 ? 96.684  23.435  86.184  1.00 91.79 ? 540 LYS A CE  1 
ATOM   4249 N  NZ  . LYS A 1 540 ? 97.409  23.185  87.464  1.00 91.05 ? 540 LYS A NZ  1 
ATOM   4250 N  N   . GLY A 1 541 ? 92.753  21.110  88.643  1.00 95.12 ? 541 GLY A N   1 
ATOM   4251 C  CA  . GLY A 1 541 ? 91.421  21.652  88.756  1.00 95.60 ? 541 GLY A CA  1 
ATOM   4252 C  C   . GLY A 1 541 ? 90.365  20.906  87.977  1.00 95.59 ? 541 GLY A C   1 
ATOM   4253 O  O   . GLY A 1 541 ? 89.382  21.499  87.514  1.00 96.53 ? 541 GLY A O   1 
ATOM   4254 N  N   . ILE A 1 542 ? 90.617  19.633  87.718  1.00 94.41 ? 542 ILE A N   1 
ATOM   4255 C  CA  . ILE A 1 542 ? 89.606  18.828  87.060  1.00 92.17 ? 542 ILE A CA  1 
ATOM   4256 C  C   . ILE A 1 542 ? 88.703  18.552  88.266  1.00 91.48 ? 542 ILE A C   1 
ATOM   4257 O  O   . ILE A 1 542 ? 89.201  18.369  89.375  1.00 91.33 ? 542 ILE A O   1 
ATOM   4258 C  CB  . ILE A 1 542 ? 90.189  17.502  86.498  1.00 91.72 ? 542 ILE A CB  1 
ATOM   4259 C  CG1 . ILE A 1 542 ? 89.144  16.386  86.600  1.00 91.22 ? 542 ILE A CG1 1 
ATOM   4260 C  CG2 . ILE A 1 542 ? 91.520  17.158  87.170  1.00 89.77 ? 542 ILE A CG2 1 
ATOM   4261 C  CD1 . ILE A 1 542 ? 89.692  14.982  86.440  1.00 90.85 ? 542 ILE A CD1 1 
ATOM   4262 N  N   . GLY A 1 543 ? 87.395  18.640  88.084  1.00 90.54 ? 543 GLY A N   1 
ATOM   4263 C  CA  . GLY A 1 543 ? 86.487  18.388  89.187  1.00 89.68 ? 543 GLY A CA  1 
ATOM   4264 C  C   . GLY A 1 543 ? 86.496  16.915  89.540  1.00 90.48 ? 543 GLY A C   1 
ATOM   4265 O  O   . GLY A 1 543 ? 86.309  16.556  90.705  1.00 90.37 ? 543 GLY A O   1 
ATOM   4266 N  N   . GLY A 1 544 ? 86.736  16.070  88.533  1.00 90.72 ? 544 GLY A N   1 
ATOM   4267 C  CA  . GLY A 1 544 ? 86.834  14.632  88.741  1.00 91.64 ? 544 GLY A CA  1 
ATOM   4268 C  C   . GLY A 1 544 ? 87.911  14.337  89.781  1.00 92.11 ? 544 GLY A C   1 
ATOM   4269 O  O   . GLY A 1 544 ? 87.935  13.270  90.403  1.00 91.90 ? 544 GLY A O   1 
ATOM   4270 N  N   . ASN A 1 545 ? 88.849  15.276  89.906  1.00 93.37 ? 545 ASN A N   1 
ATOM   4271 C  CA  . ASN A 1 545 ? 89.925  15.211  90.886  1.00 93.62 ? 545 ASN A CA  1 
ATOM   4272 C  C   . ASN A 1 545 ? 89.498  16.039  92.084  1.00 93.58 ? 545 ASN A C   1 
ATOM   4273 O  O   . ASN A 1 545 ? 89.550  15.560  93.213  1.00 93.99 ? 545 ASN A O   1 
ATOM   4274 C  CB  . ASN A 1 545 ? 91.218  15.773  90.317  1.00 93.21 ? 545 ASN A CB  1 
ATOM   4275 C  CG  . ASN A 1 545 ? 92.118  14.698  89.796  1.00 94.06 ? 545 ASN A CG  1 
ATOM   4276 O  OD1 . ASN A 1 545 ? 92.236  14.501  88.590  1.00 95.41 ? 545 ASN A OD1 1 
ATOM   4277 N  ND2 . ASN A 1 545 ? 92.750  13.969  90.706  1.00 93.15 ? 545 ASN A ND2 1 
ATOM   4278 N  N   . GLU A 1 546 ? 89.052  17.270  91.817  1.00 92.70 ? 546 GLU A N   1 
ATOM   4279 C  CA  . GLU A 1 546 ? 88.574  18.214  92.831  1.00 91.71 ? 546 GLU A CA  1 
ATOM   4280 C  C   . GLU A 1 546 ? 87.896  17.506  94.010  1.00 92.18 ? 546 GLU A C   1 
ATOM   4281 O  O   . GLU A 1 546 ? 88.241  17.768  95.159  1.00 92.42 ? 546 GLU A O   1 
ATOM   4282 C  CB  . GLU A 1 546 ? 87.622  19.241  92.189  1.00 90.25 ? 546 GLU A CB  1 
ATOM   4283 C  CG  . GLU A 1 546 ? 86.687  19.975  93.156  1.00 87.11 ? 546 GLU A CG  1 
ATOM   4284 C  CD  . GLU A 1 546 ? 85.302  20.236  92.562  1.00 84.82 ? 546 GLU A CD  1 
ATOM   4285 O  OE1 . GLU A 1 546 ? 84.841  19.445  91.710  1.00 83.23 ? 546 GLU A OE1 1 
ATOM   4286 O  OE2 . GLU A 1 546 ? 84.659  21.230  92.957  1.00 84.26 ? 546 GLU A OE2 1 
ATOM   4287 N  N   . GLN A 1 547 ? 86.969  16.589  93.728  1.00 92.82 ? 547 GLN A N   1 
ATOM   4288 C  CA  . GLN A 1 547 ? 86.284  15.849  94.795  1.00 93.40 ? 547 GLN A CA  1 
ATOM   4289 C  C   . GLN A 1 547 ? 87.138  14.744  95.430  1.00 93.75 ? 547 GLN A C   1 
ATOM   4290 O  O   . GLN A 1 547 ? 87.243  14.686  96.658  1.00 93.76 ? 547 GLN A O   1 
ATOM   4291 C  CB  . GLN A 1 547 ? 84.927  15.288  94.324  1.00 92.87 ? 547 GLN A CB  1 
ATOM   4292 C  CG  . GLN A 1 547 ? 84.275  14.223  95.252  1.00 91.28 ? 547 GLN A CG  1 
ATOM   4293 C  CD  . GLN A 1 547 ? 83.971  14.690  96.689  1.00 90.47 ? 547 GLN A CD  1 
ATOM   4294 O  OE1 . GLN A 1 547 ? 84.566  15.642  97.204  1.00 90.52 ? 547 GLN A OE1 1 
ATOM   4295 N  NE2 . GLN A 1 547 ? 83.061  13.982  97.346  1.00 89.44 ? 547 GLN A NE2 1 
ATOM   4296 N  N   . VAL A 1 548 ? 87.761  13.884  94.618  1.00 93.62 ? 548 VAL A N   1 
ATOM   4297 C  CA  . VAL A 1 548 ? 88.597  12.806  95.163  1.00 93.40 ? 548 VAL A CA  1 
ATOM   4298 C  C   . VAL A 1 548 ? 89.734  13.386  96.013  1.00 93.97 ? 548 VAL A C   1 
ATOM   4299 O  O   . VAL A 1 548 ? 90.309  12.708  96.871  1.00 93.08 ? 548 VAL A O   1 
ATOM   4300 C  CB  . VAL A 1 548 ? 89.136  11.844  94.059  1.00 92.27 ? 548 VAL A CB  1 
ATOM   4301 C  CG1 . VAL A 1 548 ? 88.025  10.966  93.551  1.00 91.59 ? 548 VAL A CG1 1 
ATOM   4302 C  CG2 . VAL A 1 548 ? 89.753  12.607  92.908  1.00 91.40 ? 548 VAL A CG2 1 
ATOM   4303 N  N   . ASP A 1 549 ? 90.014  14.667  95.782  1.00 94.48 ? 549 ASP A N   1 
ATOM   4304 C  CA  . ASP A 1 549 ? 91.029  15.404  96.522  1.00 95.24 ? 549 ASP A CA  1 
ATOM   4305 C  C   . ASP A 1 549 ? 90.312  16.129  97.675  1.00 95.70 ? 549 ASP A C   1 
ATOM   4306 O  O   . ASP A 1 549 ? 90.899  16.330  98.740  1.00 96.09 ? 549 ASP A O   1 
ATOM   4307 C  CB  . ASP A 1 549 ? 91.730  16.434  95.617  1.00 95.28 ? 549 ASP A CB  1 
ATOM   4308 C  CG  . ASP A 1 549 ? 92.282  15.830  94.318  1.00 94.86 ? 549 ASP A CG  1 
ATOM   4309 O  OD1 . ASP A 1 549 ? 92.352  14.590  94.184  1.00 95.46 ? 549 ASP A OD1 1 
ATOM   4310 O  OD2 . ASP A 1 549 ? 92.643  16.615  93.413  1.00 95.85 ? 549 ASP A OD2 1 
ATOM   4311 N  N   . LYS A 1 550 ? 89.047  16.516  97.451  1.00 96.58 ? 550 LYS A N   1 
ATOM   4312 C  CA  . LYS A 1 550 ? 88.225  17.206  98.463  1.00 96.51 ? 550 LYS A CA  1 
ATOM   4313 C  C   . LYS A 1 550 ? 87.740  16.277  99.572  1.00 96.86 ? 550 LYS A C   1 
ATOM   4314 O  O   . LYS A 1 550 ? 87.236  16.738  100.599 1.00 96.88 ? 550 LYS A O   1 
ATOM   4315 C  CB  . LYS A 1 550 ? 87.013  17.928  97.843  1.00 96.39 ? 550 LYS A CB  1 
ATOM   4316 C  CG  . LYS A 1 550 ? 87.137  19.463  97.799  1.00 95.02 ? 550 LYS A CG  1 
ATOM   4317 C  CD  . LYS A 1 550 ? 87.494  20.064  99.170  1.00 91.91 ? 550 LYS A CD  1 
ATOM   4318 C  CE  . LYS A 1 550 ? 87.683  21.579  99.085  1.00 90.56 ? 550 LYS A CE  1 
ATOM   4319 N  NZ  . LYS A 1 550 ? 88.468  22.138  100.224 1.00 87.71 ? 550 LYS A NZ  1 
ATOM   4320 N  N   . LEU A 1 551 ? 87.832  14.971  99.337  1.00 96.29 ? 551 LEU A N   1 
ATOM   4321 C  CA  . LEU A 1 551 ? 87.456  13.997  100.352 1.00 96.26 ? 551 LEU A CA  1 
ATOM   4322 C  C   . LEU A 1 551 ? 88.628  13.866  101.337 1.00 97.04 ? 551 LEU A C   1 
ATOM   4323 O  O   . LEU A 1 551 ? 88.421  13.546  102.513 1.00 97.13 ? 551 LEU A O   1 
ATOM   4324 C  CB  . LEU A 1 551 ? 87.127  12.643  99.723  1.00 94.81 ? 551 LEU A CB  1 
ATOM   4325 C  CG  . LEU A 1 551 ? 85.784  12.567  99.000  1.00 94.19 ? 551 LEU A CG  1 
ATOM   4326 C  CD1 . LEU A 1 551 ? 85.638  11.197  98.336  1.00 92.96 ? 551 LEU A CD1 1 
ATOM   4327 C  CD2 . LEU A 1 551 ? 84.637  12.845  99.982  1.00 92.83 ? 551 LEU A CD2 1 
ATOM   4328 N  N   . VAL A 1 552 ? 89.837  14.197  100.865 1.00 97.98 ? 552 VAL A N   1 
ATOM   4329 C  CA  . VAL A 1 552 ? 91.080  14.142  101.661 1.00 98.77 ? 552 VAL A CA  1 
ATOM   4330 C  C   . VAL A 1 552 ? 90.976  14.858  103.029 1.00 98.61 ? 552 VAL A C   1 
ATOM   4331 O  O   . VAL A 1 552 ? 91.745  14.564  103.957 1.00 98.86 ? 552 VAL A O   1 
ATOM   4332 C  CB  . VAL A 1 552 ? 92.310  14.694  100.831 1.00 99.49 ? 552 VAL A CB  1 
ATOM   4333 C  CG1 . VAL A 1 552 ? 93.593  14.697  101.670 1.00 99.37 ? 552 VAL A CG1 1 
ATOM   4334 C  CG2 . VAL A 1 552 ? 92.530  13.849  99.561  1.00 99.90 ? 552 VAL A CG2 1 
ATOM   4335 N  N   . SER A 1 553 ? 89.993  15.751  103.160 1.00 98.39 ? 553 SER A N   1 
ATOM   4336 C  CA  . SER A 1 553 ? 89.755  16.496  104.402 1.00 98.14 ? 553 SER A CA  1 
ATOM   4337 C  C   . SER A 1 553 ? 89.569  15.599  105.639 1.00 97.73 ? 553 SER A C   1 
ATOM   4338 O  O   . SER A 1 553 ? 89.890  16.002  106.758 1.00 97.59 ? 553 SER A O   1 
ATOM   4339 C  CB  . SER A 1 553 ? 88.536  17.419  104.246 1.00 98.23 ? 553 SER A CB  1 
ATOM   4340 O  OG  . SER A 1 553 ? 88.761  18.428  103.272 1.00 99.17 ? 553 SER A OG  1 
ATOM   4341 N  N   . ALA A 1 554 ? 89.077  14.379  105.426 1.00 97.12 ? 554 ALA A N   1 
ATOM   4342 C  CA  . ALA A 1 554 ? 88.853  13.420  106.516 1.00 96.36 ? 554 ALA A CA  1 
ATOM   4343 C  C   . ALA A 1 554 ? 90.136  13.033  107.277 1.00 95.61 ? 554 ALA A C   1 
ATOM   4344 O  O   . ALA A 1 554 ? 90.068  12.361  108.306 1.00 94.93 ? 554 ALA A O   1 
ATOM   4345 C  CB  . ALA A 1 554 ? 88.148  12.167  105.985 1.00 95.39 ? 554 ALA A CB  1 
ATOM   4346 N  N   . GLY A 1 555 ? 91.293  13.402  106.733 1.00 95.60 ? 555 GLY A N   1 
ATOM   4347 C  CA  . GLY A 1 555 ? 92.553  13.105  107.388 1.00 96.09 ? 555 GLY A CA  1 
ATOM   4348 C  C   . GLY A 1 555 ? 93.047  14.355  108.086 1.00 97.45 ? 555 GLY A C   1 
ATOM   4349 O  O   . GLY A 1 555 ? 93.540  14.294  109.211 1.00 97.16 ? 555 GLY A O   1 
ATOM   4350 N  N   . ILE A 1 556 ? 92.912  15.487  107.404 1.00 98.53 ? 556 ILE A N   1 
ATOM   4351 C  CA  . ILE A 1 556 ? 93.317  16.800  107.912 1.00 99.90 ? 556 ILE A CA  1 
ATOM   4352 C  C   . ILE A 1 556 ? 92.839  17.843  106.888 1.00 99.90 ? 556 ILE A C   1 
ATOM   4353 O  O   . ILE A 1 556 ? 91.983  17.533  106.058 1.00 99.90 ? 556 ILE A O   1 
ATOM   4354 C  CB  . ILE A 1 556 ? 94.841  16.866  108.092 1.00 98.48 ? 556 ILE A CB  1 
ATOM   4355 N  N   . ARG A 1 557 ? 93.385  19.060  106.933 1.00 99.90 ? 557 ARG A N   1 
ATOM   4356 C  CA  . ARG A 1 557 ? 92.993  20.124  105.992 1.00 99.90 ? 557 ARG A CA  1 
ATOM   4357 C  C   . ARG A 1 557 ? 94.122  21.143  105.760 1.00 99.90 ? 557 ARG A C   1 
ATOM   4358 O  O   . ARG A 1 557 ? 94.900  21.424  106.680 1.00 99.90 ? 557 ARG A O   1 
ATOM   4359 C  CB  . ARG A 1 557 ? 91.714  20.839  106.476 1.00 99.90 ? 557 ARG A CB  1 
ATOM   4360 N  N   . LYS A 1 558 ? 94.211  21.677  104.537 1.00 99.90 ? 558 LYS A N   1 
ATOM   4361 C  CA  . LYS A 1 558 ? 95.234  22.657  104.154 1.00 99.90 ? 558 LYS A CA  1 
ATOM   4362 C  C   . LYS A 1 558 ? 94.952  23.272  102.777 1.00 99.90 ? 558 LYS A C   1 
ATOM   4363 O  O   . LYS A 1 558 ? 94.176  22.675  101.987 1.00 99.90 ? 558 LYS A O   1 
ATOM   4364 C  CB  . LYS A 1 558 ? 96.624  22.011  104.164 1.00 99.90 ? 558 LYS A CB  1 
ATOM   4365 O  OXT . LYS A 1 558 ? 95.530  24.347  102.501 1.00 99.90 ? 558 LYS A OXT 1 
ATOM   4366 N  N   . PRO B 2 1   ? 154.441 6.710   47.285  1.00 99.90 ? 1   PRO B N   1 
ATOM   4367 C  CA  . PRO B 2 1   ? 155.771 6.119   47.584  1.00 99.90 ? 1   PRO B CA  1 
ATOM   4368 C  C   . PRO B 2 1   ? 156.776 7.238   47.918  1.00 99.90 ? 1   PRO B C   1 
ATOM   4369 O  O   . PRO B 2 1   ? 156.368 8.245   48.496  1.00 99.90 ? 1   PRO B O   1 
ATOM   4370 C  CB  . PRO B 2 1   ? 156.182 5.304   46.358  1.00 99.90 ? 1   PRO B CB  1 
ATOM   4371 C  CG  . PRO B 2 1   ? 155.349 5.968   45.248  1.00 99.90 ? 1   PRO B CG  1 
ATOM   4372 C  CD  . PRO B 2 1   ? 154.008 6.312   45.921  1.00 99.90 ? 1   PRO B CD  1 
ATOM   4373 N  N   . ILE B 2 2   ? 158.047 7.081   47.516  1.00 99.90 ? 2   ILE B N   1 
ATOM   4374 C  CA  . ILE B 2 2   ? 159.147 8.050   47.776  1.00 99.90 ? 2   ILE B CA  1 
ATOM   4375 C  C   . ILE B 2 2   ? 158.890 9.584   47.655  1.00 99.90 ? 2   ILE B C   1 
ATOM   4376 O  O   . ILE B 2 2   ? 159.727 10.386  48.083  1.00 99.90 ? 2   ILE B O   1 
ATOM   4377 C  CB  . ILE B 2 2   ? 160.461 7.651   46.964  1.00 99.90 ? 2   ILE B CB  1 
ATOM   4378 C  CG1 . ILE B 2 2   ? 160.859 6.196   47.276  1.00 99.90 ? 2   ILE B CG1 1 
ATOM   4379 C  CG2 . ILE B 2 2   ? 161.660 8.575   47.316  1.00 99.90 ? 2   ILE B CG2 1 
ATOM   4380 C  CD1 . ILE B 2 2   ? 162.162 5.738   46.609  1.00 99.90 ? 2   ILE B CD1 1 
ATOM   4381 N  N   . SER B 2 3   ? 157.757 9.995   47.086  1.00 99.90 ? 3   SER B N   1 
ATOM   4382 C  CA  . SER B 2 3   ? 157.440 11.425  46.963  1.00 99.90 ? 3   SER B CA  1 
ATOM   4383 C  C   . SER B 2 3   ? 156.364 11.857  47.969  1.00 99.90 ? 3   SER B C   1 
ATOM   4384 O  O   . SER B 2 3   ? 155.206 11.415  47.878  1.00 99.90 ? 3   SER B O   1 
ATOM   4385 C  CB  . SER B 2 3   ? 156.946 11.739  45.559  1.00 99.90 ? 3   SER B CB  1 
ATOM   4386 O  OG  . SER B 2 3   ? 155.838 10.929  45.224  1.00 99.90 ? 3   SER B OG  1 
ATOM   4387 N  N   . PRO B 2 4   ? 156.737 12.700  48.959  1.00 99.90 ? 4   PRO B N   1 
ATOM   4388 C  CA  . PRO B 2 4   ? 155.768 13.155  49.955  1.00 99.90 ? 4   PRO B CA  1 
ATOM   4389 C  C   . PRO B 2 4   ? 155.392 14.633  49.838  1.00 99.90 ? 4   PRO B C   1 
ATOM   4390 O  O   . PRO B 2 4   ? 155.310 15.218  48.746  1.00 99.90 ? 4   PRO B O   1 
ATOM   4391 C  CB  . PRO B 2 4   ? 156.526 12.910  51.257  1.00 99.90 ? 4   PRO B CB  1 
ATOM   4392 C  CG  . PRO B 2 4   ? 157.929 13.382  50.900  1.00 99.90 ? 4   PRO B CG  1 
ATOM   4393 C  CD  . PRO B 2 4   ? 158.118 13.001  49.408  1.00 99.90 ? 4   PRO B CD  1 
ATOM   4394 N  N   . ILE B 2 5   ? 155.182 15.216  51.009  1.00 99.90 ? 5   ILE B N   1 
ATOM   4395 C  CA  . ILE B 2 5   ? 154.823 16.604  51.208  1.00 99.89 ? 5   ILE B CA  1 
ATOM   4396 C  C   . ILE B 2 5   ? 155.520 16.897  52.557  1.00 98.73 ? 5   ILE B C   1 
ATOM   4397 O  O   . ILE B 2 5   ? 156.341 16.088  53.034  1.00 97.97 ? 5   ILE B O   1 
ATOM   4398 C  CB  . ILE B 2 5   ? 153.255 16.728  51.326  1.00 99.35 ? 5   ILE B CB  1 
ATOM   4399 C  CG1 . ILE B 2 5   ? 152.594 16.088  50.097  1.00 98.99 ? 5   ILE B CG1 1 
ATOM   4400 C  CG2 . ILE B 2 5   ? 152.807 18.179  51.455  1.00 98.48 ? 5   ILE B CG2 1 
ATOM   4401 C  CD1 . ILE B 2 5   ? 151.088 16.065  50.130  1.00 97.51 ? 5   ILE B CD1 1 
ATOM   4402 N  N   . GLU B 2 6   ? 155.258 18.073  53.119  1.00 97.78 ? 6   GLU B N   1 
ATOM   4403 C  CA  . GLU B 2 6   ? 155.812 18.454  54.411  1.00 96.36 ? 6   GLU B CA  1 
ATOM   4404 C  C   . GLU B 2 6   ? 154.809 17.946  55.450  1.00 95.72 ? 6   GLU B C   1 
ATOM   4405 O  O   . GLU B 2 6   ? 153.863 17.233  55.099  1.00 95.47 ? 6   GLU B O   1 
ATOM   4406 C  CB  . GLU B 2 6   ? 155.967 19.981  54.497  1.00 95.94 ? 6   GLU B CB  1 
ATOM   4407 C  CG  . GLU B 2 6   ? 154.668 20.810  54.333  1.00 96.12 ? 6   GLU B CG  1 
ATOM   4408 C  CD  . GLU B 2 6   ? 153.895 21.028  55.640  1.00 96.26 ? 6   GLU B CD  1 
ATOM   4409 O  OE1 . GLU B 2 6   ? 154.391 21.765  56.519  1.00 96.29 ? 6   GLU B OE1 1 
ATOM   4410 O  OE2 . GLU B 2 6   ? 152.784 20.474  55.787  1.00 95.32 ? 6   GLU B OE2 1 
ATOM   4411 N  N   . THR B 2 7   ? 155.007 18.305  56.716  1.00 94.19 ? 7   THR B N   1 
ATOM   4412 C  CA  . THR B 2 7   ? 154.086 17.882  57.769  1.00 92.40 ? 7   THR B CA  1 
ATOM   4413 C  C   . THR B 2 7   ? 153.680 19.026  58.683  1.00 90.33 ? 7   THR B C   1 
ATOM   4414 O  O   . THR B 2 7   ? 154.525 19.624  59.356  1.00 88.39 ? 7   THR B O   1 
ATOM   4415 C  CB  . THR B 2 7   ? 154.675 16.749  58.670  1.00 92.77 ? 7   THR B CB  1 
ATOM   4416 O  OG1 . THR B 2 7   ? 155.765 17.259  59.454  1.00 93.51 ? 7   THR B OG1 1 
ATOM   4417 C  CG2 . THR B 2 7   ? 155.158 15.571  57.820  1.00 92.62 ? 7   THR B CG2 1 
ATOM   4418 N  N   . VAL B 2 8   ? 152.398 19.367  58.671  1.00 89.54 ? 8   VAL B N   1 
ATOM   4419 C  CA  . VAL B 2 8   ? 151.926 20.403  59.568  1.00 89.49 ? 8   VAL B CA  1 
ATOM   4420 C  C   . VAL B 2 8   ? 152.241 19.750  60.913  1.00 89.78 ? 8   VAL B C   1 
ATOM   4421 O  O   . VAL B 2 8   ? 151.722 18.673  61.213  1.00 90.62 ? 8   VAL B O   1 
ATOM   4422 C  CB  . VAL B 2 8   ? 150.407 20.615  59.438  1.00 87.87 ? 8   VAL B CB  1 
ATOM   4423 C  CG1 . VAL B 2 8   ? 149.965 21.753  60.343  1.00 86.66 ? 8   VAL B CG1 1 
ATOM   4424 C  CG2 . VAL B 2 8   ? 150.038 20.902  57.989  1.00 86.60 ? 8   VAL B CG2 1 
ATOM   4425 N  N   . PRO B 2 9   ? 153.185 20.322  61.678  1.00 90.32 ? 9   PRO B N   1 
ATOM   4426 C  CA  . PRO B 2 9   ? 153.575 19.775  62.987  1.00 91.27 ? 9   PRO B CA  1 
ATOM   4427 C  C   . PRO B 2 9   ? 152.414 19.761  63.990  1.00 90.96 ? 9   PRO B C   1 
ATOM   4428 O  O   . PRO B 2 9   ? 152.131 20.766  64.649  1.00 91.37 ? 9   PRO B O   1 
ATOM   4429 C  CB  . PRO B 2 9   ? 154.702 20.713  63.417  1.00 91.05 ? 9   PRO B CB  1 
ATOM   4430 C  CG  . PRO B 2 9   ? 154.271 22.025  62.816  1.00 91.42 ? 9   PRO B CG  1 
ATOM   4431 C  CD  . PRO B 2 9   ? 153.831 21.625  61.435  1.00 90.63 ? 9   PRO B CD  1 
ATOM   4432 N  N   . VAL B 2 10  ? 151.758 18.608  64.102  1.00 90.65 ? 10  VAL B N   1 
ATOM   4433 C  CA  . VAL B 2 10  ? 150.599 18.429  64.989  1.00 89.91 ? 10  VAL B CA  1 
ATOM   4434 C  C   . VAL B 2 10  ? 150.893 18.181  66.473  1.00 88.30 ? 10  VAL B C   1 
ATOM   4435 O  O   . VAL B 2 10  ? 151.915 17.588  66.843  1.00 87.69 ? 10  VAL B O   1 
ATOM   4436 C  CB  . VAL B 2 10  ? 149.661 17.288  64.467  1.00 90.58 ? 10  VAL B CB  1 
ATOM   4437 C  CG1 . VAL B 2 10  ? 148.409 17.176  65.330  1.00 90.78 ? 10  VAL B CG1 1 
ATOM   4438 C  CG2 . VAL B 2 10  ? 149.269 17.538  63.015  1.00 90.59 ? 10  VAL B CG2 1 
ATOM   4439 N  N   . LYS B 2 11  ? 149.935 18.584  67.304  1.00 87.56 ? 11  LYS B N   1 
ATOM   4440 C  CA  . LYS B 2 11  ? 150.029 18.424  68.738  1.00 87.23 ? 11  LYS B CA  1 
ATOM   4441 C  C   . LYS B 2 11  ? 148.635 18.365  69.360  1.00 88.26 ? 11  LYS B C   1 
ATOM   4442 O  O   . LYS B 2 11  ? 147.690 18.993  68.873  1.00 88.11 ? 11  LYS B O   1 
ATOM   4443 C  CB  . LYS B 2 11  ? 150.813 19.588  69.344  1.00 87.34 ? 11  LYS B CB  1 
ATOM   4444 C  CG  . LYS B 2 11  ? 151.374 19.286  70.718  1.00 87.37 ? 11  LYS B CG  1 
ATOM   4445 C  CD  . LYS B 2 11  ? 152.359 18.125  70.648  1.00 87.35 ? 11  LYS B CD  1 
ATOM   4446 C  CE  . LYS B 2 11  ? 152.768 17.669  72.030  1.00 86.71 ? 11  LYS B CE  1 
ATOM   4447 N  NZ  . LYS B 2 11  ? 153.857 16.662  71.968  1.00 86.47 ? 11  LYS B NZ  1 
ATOM   4448 N  N   . LEU B 2 12  ? 148.516 17.556  70.406  1.00 88.84 ? 12  LEU B N   1 
ATOM   4449 C  CA  . LEU B 2 12  ? 147.278 17.387  71.164  1.00 89.27 ? 12  LEU B CA  1 
ATOM   4450 C  C   . LEU B 2 12  ? 147.000 18.670  71.941  1.00 90.14 ? 12  LEU B C   1 
ATOM   4451 O  O   . LEU B 2 12  ? 147.902 19.499  72.123  1.00 90.81 ? 12  LEU B O   1 
ATOM   4452 C  CB  . LEU B 2 12  ? 147.465 16.264  72.187  1.00 89.03 ? 12  LEU B CB  1 
ATOM   4453 C  CG  . LEU B 2 12  ? 147.013 14.836  71.925  1.00 88.14 ? 12  LEU B CG  1 
ATOM   4454 C  CD1 . LEU B 2 12  ? 147.894 13.882  72.704  1.00 88.19 ? 12  LEU B CD1 1 
ATOM   4455 C  CD2 . LEU B 2 12  ? 145.584 14.685  72.363  1.00 88.22 ? 12  LEU B CD2 1 
ATOM   4456 N  N   . LYS B 2 13  ? 145.767 18.828  72.420  1.00 90.32 ? 13  LYS B N   1 
ATOM   4457 C  CA  . LYS B 2 13  ? 145.414 19.997  73.228  1.00 90.24 ? 13  LYS B CA  1 
ATOM   4458 C  C   . LYS B 2 13  ? 146.155 19.834  74.579  1.00 89.99 ? 13  LYS B C   1 
ATOM   4459 O  O   . LYS B 2 13  ? 145.877 18.902  75.340  1.00 90.28 ? 13  LYS B O   1 
ATOM   4460 C  CB  . LYS B 2 13  ? 143.891 20.067  73.430  1.00 90.03 ? 13  LYS B CB  1 
ATOM   4461 N  N   . PRO B 2 14  ? 147.083 20.761  74.900  1.00 88.88 ? 14  PRO B N   1 
ATOM   4462 C  CA  . PRO B 2 14  ? 147.914 20.797  76.114  1.00 87.65 ? 14  PRO B CA  1 
ATOM   4463 C  C   . PRO B 2 14  ? 147.258 20.353  77.417  1.00 86.22 ? 14  PRO B C   1 
ATOM   4464 O  O   . PRO B 2 14  ? 146.219 20.888  77.824  1.00 85.39 ? 14  PRO B O   1 
ATOM   4465 C  CB  . PRO B 2 14  ? 148.356 22.257  76.181  1.00 88.43 ? 14  PRO B CB  1 
ATOM   4466 C  CG  . PRO B 2 14  ? 147.229 22.983  75.488  1.00 89.10 ? 14  PRO B CG  1 
ATOM   4467 C  CD  . PRO B 2 14  ? 147.053 22.099  74.285  1.00 89.34 ? 14  PRO B CD  1 
ATOM   4468 N  N   . GLY B 2 15  ? 147.910 19.390  78.069  1.00 84.95 ? 15  GLY B N   1 
ATOM   4469 C  CA  . GLY B 2 15  ? 147.431 18.842  79.327  1.00 82.33 ? 15  GLY B CA  1 
ATOM   4470 C  C   . GLY B 2 15  ? 146.797 17.464  79.182  1.00 80.44 ? 15  GLY B C   1 
ATOM   4471 O  O   . GLY B 2 15  ? 146.788 16.686  80.136  1.00 80.69 ? 15  GLY B O   1 
ATOM   4472 N  N   . MET B 2 16  ? 146.300 17.143  77.988  1.00 78.88 ? 16  MET B N   1 
ATOM   4473 C  CA  . MET B 2 16  ? 145.652 15.855  77.745  1.00 76.32 ? 16  MET B CA  1 
ATOM   4474 C  C   . MET B 2 16  ? 146.623 14.793  77.271  1.00 73.60 ? 16  MET B C   1 
ATOM   4475 O  O   . MET B 2 16  ? 147.720 15.105  76.799  1.00 73.14 ? 16  MET B O   1 
ATOM   4476 C  CB  . MET B 2 16  ? 144.520 15.992  76.718  1.00 77.85 ? 16  MET B CB  1 
ATOM   4477 C  CG  . MET B 2 16  ? 143.339 16.849  77.168  1.00 78.80 ? 16  MET B CG  1 
ATOM   4478 S  SD  . MET B 2 16  ? 142.682 16.461  78.827  1.00 80.72 ? 16  MET B SD  1 
ATOM   4479 C  CE  . MET B 2 16  ? 142.612 14.666  78.845  1.00 79.62 ? 16  MET B CE  1 
ATOM   4480 N  N   . ASP B 2 17  ? 146.205 13.537  77.401  1.00 69.43 ? 17  ASP B N   1 
ATOM   4481 C  CA  . ASP B 2 17  ? 147.017 12.405  76.981  1.00 65.54 ? 17  ASP B CA  1 
ATOM   4482 C  C   . ASP B 2 17  ? 146.321 11.705  75.804  1.00 62.31 ? 17  ASP B C   1 
ATOM   4483 O  O   . ASP B 2 17  ? 145.140 11.940  75.577  1.00 61.78 ? 17  ASP B O   1 
ATOM   4484 C  CB  . ASP B 2 17  ? 147.222 11.441  78.155  1.00 64.19 ? 17  ASP B CB  1 
ATOM   4485 C  CG  . ASP B 2 17  ? 148.344 10.453  77.905  1.00 62.57 ? 17  ASP B CG  1 
ATOM   4486 O  OD1 . ASP B 2 17  ? 149.342 10.835  77.251  1.00 60.31 ? 17  ASP B OD1 1 
ATOM   4487 O  OD2 . ASP B 2 17  ? 148.216 9.296   78.355  1.00 61.82 ? 17  ASP B OD2 1 
ATOM   4488 N  N   . GLY B 2 18  ? 147.057 10.892  75.042  1.00 58.36 ? 18  GLY B N   1 
ATOM   4489 C  CA  . GLY B 2 18  ? 146.471 10.194  73.906  1.00 53.81 ? 18  GLY B CA  1 
ATOM   4490 C  C   . GLY B 2 18  ? 145.274 9.331   74.279  1.00 52.24 ? 18  GLY B C   1 
ATOM   4491 O  O   . GLY B 2 18  ? 145.190 8.889   75.430  1.00 51.13 ? 18  GLY B O   1 
ATOM   4492 N  N   . PRO B 2 19  ? 144.321 9.082   73.346  1.00 50.61 ? 19  PRO B N   1 
ATOM   4493 C  CA  . PRO B 2 19  ? 143.154 8.255   73.679  1.00 48.20 ? 19  PRO B CA  1 
ATOM   4494 C  C   . PRO B 2 19  ? 143.475 6.776   73.858  1.00 46.64 ? 19  PRO B C   1 
ATOM   4495 O  O   . PRO B 2 19  ? 144.350 6.200   73.196  1.00 45.57 ? 19  PRO B O   1 
ATOM   4496 C  CB  . PRO B 2 19  ? 142.190 8.519   72.515  1.00 47.70 ? 19  PRO B CB  1 
ATOM   4497 C  CG  . PRO B 2 19  ? 143.101 8.746   71.371  1.00 49.18 ? 19  PRO B CG  1 
ATOM   4498 C  CD  . PRO B 2 19  ? 144.214 9.601   71.967  1.00 50.25 ? 19  PRO B CD  1 
ATOM   4499 N  N   . LYS B 2 20  ? 142.790 6.188   74.819  1.00 45.43 ? 20  LYS B N   1 
ATOM   4500 C  CA  . LYS B 2 20  ? 142.967 4.798   75.131  1.00 45.34 ? 20  LYS B CA  1 
ATOM   4501 C  C   . LYS B 2 20  ? 141.585 4.210   75.221  1.00 46.82 ? 20  LYS B C   1 
ATOM   4502 O  O   . LYS B 2 20  ? 141.024 4.016   76.301  1.00 44.81 ? 20  LYS B O   1 
ATOM   4503 C  CB  . LYS B 2 20  ? 143.716 4.637   76.445  1.00 44.30 ? 20  LYS B CB  1 
ATOM   4504 C  CG  . LYS B 2 20  ? 145.206 4.820   76.326  1.00 42.77 ? 20  LYS B CG  1 
ATOM   4505 C  CD  . LYS B 2 20  ? 145.615 6.247   76.515  1.00 40.80 ? 20  LYS B CD  1 
ATOM   4506 C  CE  . LYS B 2 20  ? 147.018 6.303   77.090  1.00 43.78 ? 20  LYS B CE  1 
ATOM   4507 N  NZ  . LYS B 2 20  ? 147.170 5.497   78.369  1.00 44.08 ? 20  LYS B NZ  1 
ATOM   4508 N  N   . VAL B 2 21  ? 141.007 4.004   74.053  1.00 50.24 ? 21  VAL B N   1 
ATOM   4509 C  CA  . VAL B 2 21  ? 139.676 3.450   73.975  1.00 53.87 ? 21  VAL B CA  1 
ATOM   4510 C  C   . VAL B 2 21  ? 139.785 1.937   73.876  1.00 54.31 ? 21  VAL B C   1 
ATOM   4511 O  O   . VAL B 2 21  ? 140.844 1.411   73.522  1.00 54.86 ? 21  VAL B O   1 
ATOM   4512 C  CB  . VAL B 2 21  ? 138.917 4.014   72.770  1.00 55.32 ? 21  VAL B CB  1 
ATOM   4513 C  CG1 . VAL B 2 21  ? 137.433 4.093   73.100  1.00 56.76 ? 21  VAL B CG1 1 
ATOM   4514 C  CG2 . VAL B 2 21  ? 139.456 5.397   72.398  1.00 55.57 ? 21  VAL B CG2 1 
ATOM   4515 N  N   . LYS B 2 22  ? 138.702 1.246   74.211  1.00 55.72 ? 22  LYS B N   1 
ATOM   4516 C  CA  . LYS B 2 22  ? 138.701 -0.224  74.181  1.00 57.46 ? 22  LYS B CA  1 
ATOM   4517 C  C   . LYS B 2 22  ? 137.991 -0.721  72.920  1.00 56.47 ? 22  LYS B C   1 
ATOM   4518 O  O   . LYS B 2 22  ? 136.838 -0.370  72.657  1.00 56.61 ? 22  LYS B O   1 
ATOM   4519 C  CB  . LYS B 2 22  ? 137.973 -0.771  75.413  1.00 59.59 ? 22  LYS B CB  1 
ATOM   4520 C  CG  . LYS B 2 22  ? 138.782 -0.619  76.703  1.00 63.54 ? 22  LYS B CG  1 
ATOM   4521 C  CD  . LYS B 2 22  ? 138.731 -1.864  77.592  1.00 65.97 ? 22  LYS B CD  1 
ATOM   4522 C  CE  . LYS B 2 22  ? 139.599 -1.738  78.847  1.00 20.00 ? 22  LYS B CE  1 
ATOM   4523 N  NZ  . LYS B 2 22  ? 141.010 -1.455  78.544  1.00 20.00 ? 22  LYS B NZ  1 
ATOM   4524 N  N   . GLN B 2 23  ? 138.703 -1.567  72.180  1.00 54.12 ? 23  GLN B N   1 
ATOM   4525 C  CA  . GLN B 2 23  ? 138.179 -2.111  70.942  1.00 51.34 ? 23  GLN B CA  1 
ATOM   4526 C  C   . GLN B 2 23  ? 137.042 -3.103  71.125  1.00 49.52 ? 23  GLN B C   1 
ATOM   4527 O  O   . GLN B 2 23  ? 137.197 -4.191  71.688  1.00 48.06 ? 23  GLN B O   1 
ATOM   4528 C  CB  . GLN B 2 23  ? 139.314 -2.674  70.073  1.00 49.79 ? 23  GLN B CB  1 
ATOM   4529 C  CG  . GLN B 2 23  ? 138.885 -3.254  68.722  1.00 45.81 ? 23  GLN B CG  1 
ATOM   4530 C  CD  . GLN B 2 23  ? 137.847 -2.420  67.971  1.00 42.64 ? 23  GLN B CD  1 
ATOM   4531 O  OE1 . GLN B 2 23  ? 137.792 -1.192  68.075  1.00 40.37 ? 23  GLN B OE1 1 
ATOM   4532 N  NE2 . GLN B 2 23  ? 137.003 -3.104  67.225  1.00 40.55 ? 23  GLN B NE2 1 
ATOM   4533 N  N   . TRP B 2 24  ? 135.880 -2.669  70.664  1.00 49.49 ? 24  TRP B N   1 
ATOM   4534 C  CA  . TRP B 2 24  ? 134.679 -3.462  70.731  1.00 50.12 ? 24  TRP B CA  1 
ATOM   4535 C  C   . TRP B 2 24  ? 134.846 -4.692  69.904  1.00 47.00 ? 24  TRP B C   1 
ATOM   4536 O  O   . TRP B 2 24  ? 135.598 -4.714  68.933  1.00 46.04 ? 24  TRP B O   1 
ATOM   4537 C  CB  . TRP B 2 24  ? 133.500 -2.684  70.182  1.00 55.86 ? 24  TRP B CB  1 
ATOM   4538 C  CG  . TRP B 2 24  ? 133.196 -1.489  70.985  1.00 65.14 ? 24  TRP B CG  1 
ATOM   4539 C  CD1 . TRP B 2 24  ? 133.453 -0.188  70.654  1.00 66.73 ? 24  TRP B CD1 1 
ATOM   4540 C  CD2 . TRP B 2 24  ? 132.552 -1.460  72.271  1.00 70.28 ? 24  TRP B CD2 1 
ATOM   4541 N  NE1 . TRP B 2 24  ? 133.003 0.650   71.652  1.00 71.02 ? 24  TRP B NE1 1 
ATOM   4542 C  CE2 . TRP B 2 24  ? 132.441 -0.102  72.653  1.00 72.72 ? 24  TRP B CE2 1 
ATOM   4543 C  CE3 . TRP B 2 24  ? 132.047 -2.455  73.133  1.00 72.10 ? 24  TRP B CE3 1 
ATOM   4544 C  CZ2 . TRP B 2 24  ? 131.845 0.298   73.872  1.00 74.23 ? 24  TRP B CZ2 1 
ATOM   4545 C  CZ3 . TRP B 2 24  ? 131.453 -2.058  74.349  1.00 73.46 ? 24  TRP B CZ3 1 
ATOM   4546 C  CH2 . TRP B 2 24  ? 131.357 -0.691  74.701  1.00 74.65 ? 24  TRP B CH2 1 
ATOM   4547 N  N   . PRO B 2 25  ? 134.265 -5.783  70.369  1.00 44.98 ? 25  PRO B N   1 
ATOM   4548 C  CA  . PRO B 2 25  ? 134.410 -6.980  69.562  1.00 43.08 ? 25  PRO B CA  1 
ATOM   4549 C  C   . PRO B 2 25  ? 133.450 -6.886  68.374  1.00 41.28 ? 25  PRO B C   1 
ATOM   4550 O  O   . PRO B 2 25  ? 132.335 -6.336  68.479  1.00 36.45 ? 25  PRO B O   1 
ATOM   4551 C  CB  . PRO B 2 25  ? 134.073 -8.099  70.549  1.00 44.28 ? 25  PRO B CB  1 
ATOM   4552 C  CG  . PRO B 2 25  ? 133.189 -7.429  71.552  1.00 44.84 ? 25  PRO B CG  1 
ATOM   4553 C  CD  . PRO B 2 25  ? 133.851 -6.110  71.741  1.00 45.34 ? 25  PRO B CD  1 
ATOM   4554 N  N   . LEU B 2 26  ? 133.957 -7.370  67.237  1.00 41.15 ? 26  LEU B N   1 
ATOM   4555 C  CA  . LEU B 2 26  ? 133.261 -7.378  65.948  1.00 40.43 ? 26  LEU B CA  1 
ATOM   4556 C  C   . LEU B 2 26  ? 133.177 -8.808  65.448  1.00 39.06 ? 26  LEU B C   1 
ATOM   4557 O  O   . LEU B 2 26  ? 133.899 -9.673  65.936  1.00 37.59 ? 26  LEU B O   1 
ATOM   4558 C  CB  . LEU B 2 26  ? 134.086 -6.595  64.936  1.00 41.16 ? 26  LEU B CB  1 
ATOM   4559 C  CG  . LEU B 2 26  ? 134.892 -5.456  65.551  1.00 42.96 ? 26  LEU B CG  1 
ATOM   4560 C  CD1 . LEU B 2 26  ? 135.998 -5.026  64.606  1.00 43.65 ? 26  LEU B CD1 1 
ATOM   4561 C  CD2 . LEU B 2 26  ? 133.954 -4.296  65.903  1.00 43.46 ? 26  LEU B CD2 1 
ATOM   4562 N  N   . THR B 2 27  ? 132.341 -9.053  64.446  1.00 38.13 ? 27  THR B N   1 
ATOM   4563 C  CA  . THR B 2 27  ? 132.222 -10.410 63.923  1.00 38.59 ? 27  THR B CA  1 
ATOM   4564 C  C   . THR B 2 27  ? 133.482 -10.882 63.184  1.00 38.88 ? 27  THR B C   1 
ATOM   4565 O  O   . THR B 2 27  ? 134.368 -10.081 62.860  1.00 37.25 ? 27  THR B O   1 
ATOM   4566 C  CB  . THR B 2 27  ? 130.962 -10.581 63.025  1.00 37.80 ? 27  THR B CB  1 
ATOM   4567 O  OG1 . THR B 2 27  ? 130.960 -11.883 62.421  1.00 39.07 ? 27  THR B OG1 1 
ATOM   4568 C  CG2 . THR B 2 27  ? 130.920 -9.548  61.947  1.00 36.67 ? 27  THR B CG2 1 
ATOM   4569 N  N   . GLU B 2 28  ? 133.569 -12.196 62.965  1.00 39.89 ? 28  GLU B N   1 
ATOM   4570 C  CA  . GLU B 2 28  ? 134.694 -12.800 62.248  1.00 40.65 ? 28  GLU B CA  1 
ATOM   4571 C  C   . GLU B 2 28  ? 134.630 -12.229 60.850  1.00 40.85 ? 28  GLU B C   1 
ATOM   4572 O  O   . GLU B 2 28  ? 135.619 -11.704 60.338  1.00 41.33 ? 28  GLU B O   1 
ATOM   4573 C  CB  . GLU B 2 28  ? 134.548 -14.321 62.157  1.00 40.79 ? 28  GLU B CB  1 
ATOM   4574 C  CG  . GLU B 2 28  ? 135.771 -15.004 61.544  1.00 40.00 ? 28  GLU B CG  1 
ATOM   4575 C  CD  . GLU B 2 28  ? 135.588 -16.502 61.366  1.00 40.33 ? 28  GLU B CD  1 
ATOM   4576 O  OE1 . GLU B 2 28  ? 134.523 -16.906 60.847  1.00 38.08 ? 28  GLU B OE1 1 
ATOM   4577 O  OE2 . GLU B 2 28  ? 136.518 -17.268 61.734  1.00 41.26 ? 28  GLU B OE2 1 
ATOM   4578 N  N   . GLU B 2 29  ? 133.445 -12.336 60.248  1.00 40.44 ? 29  GLU B N   1 
ATOM   4579 C  CA  . GLU B 2 29  ? 133.185 -11.802 58.920  1.00 40.63 ? 29  GLU B CA  1 
ATOM   4580 C  C   . GLU B 2 29  ? 133.716 -10.338 58.815  1.00 39.86 ? 29  GLU B C   1 
ATOM   4581 O  O   . GLU B 2 29  ? 134.265 -9.933  57.777  1.00 39.01 ? 29  GLU B O   1 
ATOM   4582 C  CB  . GLU B 2 29  ? 131.677 -11.878 58.641  1.00 42.17 ? 29  GLU B CB  1 
ATOM   4583 C  CG  . GLU B 2 29  ? 131.224 -10.999 57.484  1.00 45.35 ? 29  GLU B CG  1 
ATOM   4584 C  CD  . GLU B 2 29  ? 129.719 -10.995 57.262  1.00 47.10 ? 29  GLU B CD  1 
ATOM   4585 O  OE1 . GLU B 2 29  ? 129.017 -10.141 57.860  1.00 46.96 ? 29  GLU B OE1 1 
ATOM   4586 O  OE2 . GLU B 2 29  ? 129.250 -11.822 56.448  1.00 48.45 ? 29  GLU B OE2 1 
ATOM   4587 N  N   . LYS B 2 30  ? 133.549 -9.561  59.889  1.00 38.69 ? 30  LYS B N   1 
ATOM   4588 C  CA  . LYS B 2 30  ? 134.047 -8.188  59.932  1.00 36.79 ? 30  LYS B CA  1 
ATOM   4589 C  C   . LYS B 2 30  ? 135.564 -8.193  60.055  1.00 34.57 ? 30  LYS B C   1 
ATOM   4590 O  O   . LYS B 2 30  ? 136.244 -7.551  59.258  1.00 34.54 ? 30  LYS B O   1 
ATOM   4591 C  CB  . LYS B 2 30  ? 133.456 -7.392  61.108  1.00 38.99 ? 30  LYS B CB  1 
ATOM   4592 C  CG  . LYS B 2 30  ? 132.096 -6.732  60.844  1.00 40.48 ? 30  LYS B CG  1 
ATOM   4593 C  CD  . LYS B 2 30  ? 131.783 -5.641  61.875  1.00 41.72 ? 30  LYS B CD  1 
ATOM   4594 C  CE  . LYS B 2 30  ? 130.283 -5.308  61.957  1.00 43.93 ? 30  LYS B CE  1 
ATOM   4595 N  NZ  . LYS B 2 30  ? 129.613 -4.797  60.707  1.00 42.19 ? 30  LYS B NZ  1 
ATOM   4596 N  N   . ILE B 2 31  ? 136.088 -8.924  61.040  1.00 31.46 ? 31  ILE B N   1 
ATOM   4597 C  CA  . ILE B 2 31  ? 137.534 -9.003  61.249  1.00 29.79 ? 31  ILE B CA  1 
ATOM   4598 C  C   . ILE B 2 31  ? 138.233 -9.320  59.940  1.00 29.06 ? 31  ILE B C   1 
ATOM   4599 O  O   . ILE B 2 31  ? 139.077 -8.560  59.492  1.00 26.47 ? 31  ILE B O   1 
ATOM   4600 C  CB  . ILE B 2 31  ? 137.926 -10.069 62.305  1.00 29.06 ? 31  ILE B CB  1 
ATOM   4601 C  CG1 . ILE B 2 31  ? 137.367 -9.677  63.663  1.00 27.86 ? 31  ILE B CG1 1 
ATOM   4602 C  CG2 . ILE B 2 31  ? 139.461 -10.202 62.414  1.00 28.65 ? 31  ILE B CG2 1 
ATOM   4603 C  CD1 . ILE B 2 31  ? 137.899 -10.513 64.776  1.00 25.99 ? 31  ILE B CD1 1 
ATOM   4604 N  N   . LYS B 2 32  ? 137.848 -10.428 59.324  1.00 30.55 ? 32  LYS B N   1 
ATOM   4605 C  CA  . LYS B 2 32  ? 138.414 -10.852 58.055  1.00 34.95 ? 32  LYS B CA  1 
ATOM   4606 C  C   . LYS B 2 32  ? 138.527 -9.693  57.082  1.00 34.59 ? 32  LYS B C   1 
ATOM   4607 O  O   . LYS B 2 32  ? 139.552 -9.520  56.419  1.00 36.51 ? 32  LYS B O   1 
ATOM   4608 C  CB  . LYS B 2 32  ? 137.549 -11.945 57.436  1.00 39.91 ? 32  LYS B CB  1 
ATOM   4609 C  CG  . LYS B 2 32  ? 137.777 -13.322 58.033  1.00 47.76 ? 32  LYS B CG  1 
ATOM   4610 C  CD  . LYS B 2 32  ? 136.711 -14.320 57.559  1.00 53.88 ? 32  LYS B CD  1 
ATOM   4611 C  CE  . LYS B 2 32  ? 136.890 -15.733 58.186  1.00 57.82 ? 32  LYS B CE  1 
ATOM   4612 N  NZ  . LYS B 2 32  ? 135.622 -16.582 58.152  1.00 60.82 ? 32  LYS B NZ  1 
ATOM   4613 N  N   . ALA B 2 33  ? 137.461 -8.912  56.978  1.00 33.28 ? 33  ALA B N   1 
ATOM   4614 C  CA  . ALA B 2 33  ? 137.469 -7.765  56.094  1.00 31.65 ? 33  ALA B CA  1 
ATOM   4615 C  C   . ALA B 2 33  ? 138.643 -6.907  56.540  1.00 29.69 ? 33  ALA B C   1 
ATOM   4616 O  O   . ALA B 2 33  ? 139.626 -6.756  55.825  1.00 28.70 ? 33  ALA B O   1 
ATOM   4617 C  CB  . ALA B 2 33  ? 136.164 -6.992  56.227  1.00 31.16 ? 33  ALA B CB  1 
ATOM   4618 N  N   . LEU B 2 34  ? 138.591 -6.488  57.793  1.00 30.54 ? 34  LEU B N   1 
ATOM   4619 C  CA  . LEU B 2 34  ? 139.612 -5.635  58.378  1.00 31.75 ? 34  LEU B CA  1 
ATOM   4620 C  C   . LEU B 2 34  ? 141.027 -6.172  58.275  1.00 31.67 ? 34  LEU B C   1 
ATOM   4621 O  O   . LEU B 2 34  ? 141.977 -5.388  58.183  1.00 31.31 ? 34  LEU B O   1 
ATOM   4622 C  CB  . LEU B 2 34  ? 139.244 -5.305  59.820  1.00 33.20 ? 34  LEU B CB  1 
ATOM   4623 C  CG  . LEU B 2 34  ? 137.827 -4.714  59.875  1.00 34.01 ? 34  LEU B CG  1 
ATOM   4624 C  CD1 . LEU B 2 34  ? 137.306 -4.671  61.305  1.00 35.54 ? 34  LEU B CD1 1 
ATOM   4625 C  CD2 . LEU B 2 34  ? 137.799 -3.329  59.208  1.00 34.16 ? 34  LEU B CD2 1 
ATOM   4626 N  N   . VAL B 2 35  ? 141.191 -7.491  58.301  1.00 33.02 ? 35  VAL B N   1 
ATOM   4627 C  CA  . VAL B 2 35  ? 142.532 -8.031  58.146  1.00 34.94 ? 35  VAL B CA  1 
ATOM   4628 C  C   . VAL B 2 35  ? 142.935 -7.571  56.736  1.00 37.35 ? 35  VAL B C   1 
ATOM   4629 O  O   . VAL B 2 35  ? 143.880 -6.786  56.587  1.00 36.76 ? 35  VAL B O   1 
ATOM   4630 C  CB  . VAL B 2 35  ? 142.624 -9.607  58.300  1.00 33.47 ? 35  VAL B CB  1 
ATOM   4631 C  CG1 . VAL B 2 35  ? 141.704 -10.102 59.385  1.00 34.24 ? 35  VAL B CG1 1 
ATOM   4632 C  CG2 . VAL B 2 35  ? 142.370 -10.343 56.993  1.00 33.11 ? 35  VAL B CG2 1 
ATOM   4633 N  N   . GLU B 2 36  ? 142.085 -7.890  55.755  1.00 38.75 ? 36  GLU B N   1 
ATOM   4634 C  CA  . GLU B 2 36  ? 142.318 -7.539  54.360  1.00 41.46 ? 36  GLU B CA  1 
ATOM   4635 C  C   . GLU B 2 36  ? 142.621 -6.055  54.172  1.00 40.31 ? 36  GLU B C   1 
ATOM   4636 O  O   . GLU B 2 36  ? 143.738 -5.667  53.787  1.00 39.32 ? 36  GLU B O   1 
ATOM   4637 C  CB  . GLU B 2 36  ? 141.111 -7.934  53.507  1.00 46.19 ? 36  GLU B CB  1 
ATOM   4638 C  CG  . GLU B 2 36  ? 140.879 -9.451  53.406  1.00 56.01 ? 36  GLU B CG  1 
ATOM   4639 C  CD  . GLU B 2 36  ? 140.258 -9.892  52.055  1.00 61.61 ? 36  GLU B CD  1 
ATOM   4640 O  OE1 . GLU B 2 36  ? 139.481 -9.109  51.440  1.00 63.68 ? 36  GLU B OE1 1 
ATOM   4641 O  OE2 . GLU B 2 36  ? 140.554 -11.033 51.609  1.00 65.52 ? 36  GLU B OE2 1 
ATOM   4642 N  N   . ILE B 2 37  ? 141.626 -5.233  54.472  1.00 39.60 ? 37  ILE B N   1 
ATOM   4643 C  CA  . ILE B 2 37  ? 141.732 -3.787  54.363  1.00 40.11 ? 37  ILE B CA  1 
ATOM   4644 C  C   . ILE B 2 37  ? 143.046 -3.205  54.864  1.00 40.00 ? 37  ILE B C   1 
ATOM   4645 O  O   . ILE B 2 37  ? 143.819 -2.612  54.105  1.00 40.64 ? 37  ILE B O   1 
ATOM   4646 C  CB  . ILE B 2 37  ? 140.605 -3.118  55.151  1.00 40.97 ? 37  ILE B CB  1 
ATOM   4647 C  CG1 . ILE B 2 37  ? 139.281 -3.333  54.429  1.00 42.86 ? 37  ILE B CG1 1 
ATOM   4648 C  CG2 . ILE B 2 37  ? 140.901 -1.631  55.393  1.00 40.38 ? 37  ILE B CG2 1 
ATOM   4649 C  CD1 . ILE B 2 37  ? 138.066 -3.120  55.325  1.00 44.97 ? 37  ILE B CD1 1 
ATOM   4650 N  N   . CYS B 2 38  ? 143.305 -3.375  56.147  1.00 40.48 ? 38  CYS B N   1 
ATOM   4651 C  CA  . CYS B 2 38  ? 144.501 -2.800  56.714  1.00 41.34 ? 38  CYS B CA  1 
ATOM   4652 C  C   . CYS B 2 38  ? 145.827 -3.363  56.238  1.00 43.67 ? 38  CYS B C   1 
ATOM   4653 O  O   . CYS B 2 38  ? 146.862 -2.688  56.350  1.00 42.55 ? 38  CYS B O   1 
ATOM   4654 C  CB  . CYS B 2 38  ? 144.388 -2.743  58.230  1.00 38.69 ? 38  CYS B CB  1 
ATOM   4655 S  SG  . CYS B 2 38  ? 143.367 -1.349  58.759  1.00 30.18 ? 38  CYS B SG  1 
ATOM   4656 N  N   . THR B 2 39  ? 145.798 -4.565  55.666  1.00 46.78 ? 39  THR B N   1 
ATOM   4657 C  CA  . THR B 2 39  ? 147.021 -5.176  55.153  1.00 50.20 ? 39  THR B CA  1 
ATOM   4658 C  C   . THR B 2 39  ? 147.423 -4.466  53.861  1.00 51.87 ? 39  THR B C   1 
ATOM   4659 O  O   . THR B 2 39  ? 148.603 -4.172  53.633  1.00 50.62 ? 39  THR B O   1 
ATOM   4660 C  CB  . THR B 2 39  ? 146.859 -6.684  54.920  1.00 50.36 ? 39  THR B CB  1 
ATOM   4661 O  OG1 . THR B 2 39  ? 146.320 -7.286  56.106  1.00 51.60 ? 39  THR B OG1 1 
ATOM   4662 C  CG2 . THR B 2 39  ? 148.222 -7.317  54.622  1.00 50.01 ? 39  THR B CG2 1 
ATOM   4663 N  N   . GLU B 2 40  ? 146.429 -4.164  53.033  1.00 55.60 ? 40  GLU B N   1 
ATOM   4664 C  CA  . GLU B 2 40  ? 146.667 -3.432  51.794  1.00 58.85 ? 40  GLU B CA  1 
ATOM   4665 C  C   . GLU B 2 40  ? 147.273 -2.079  52.172  1.00 59.29 ? 40  GLU B C   1 
ATOM   4666 O  O   . GLU B 2 40  ? 148.148 -1.579  51.487  1.00 58.94 ? 40  GLU B O   1 
ATOM   4667 C  CB  . GLU B 2 40  ? 145.347 -3.202  51.045  1.00 62.09 ? 40  GLU B CB  1 
ATOM   4668 C  CG  . GLU B 2 40  ? 145.037 -4.227  49.957  1.00 68.87 ? 40  GLU B CG  1 
ATOM   4669 C  CD  . GLU B 2 40  ? 145.824 -3.992  48.655  1.00 72.97 ? 40  GLU B CD  1 
ATOM   4670 O  OE1 . GLU B 2 40  ? 145.953 -2.813  48.242  1.00 75.28 ? 40  GLU B OE1 1 
ATOM   4671 O  OE2 . GLU B 2 40  ? 146.291 -4.987  48.036  1.00 74.56 ? 40  GLU B OE2 1 
ATOM   4672 N  N   . MET B 2 41  ? 146.799 -1.497  53.271  1.00 60.38 ? 41  MET B N   1 
ATOM   4673 C  CA  . MET B 2 41  ? 147.287 -0.205  53.744  1.00 60.38 ? 41  MET B CA  1 
ATOM   4674 C  C   . MET B 2 41  ? 148.713 -0.323  54.298  1.00 59.93 ? 41  MET B C   1 
ATOM   4675 O  O   . MET B 2 41  ? 149.442 0.666   54.355  1.00 57.64 ? 41  MET B O   1 
ATOM   4676 C  CB  . MET B 2 41  ? 146.318 0.373   54.781  1.00 61.76 ? 41  MET B CB  1 
ATOM   4677 C  CG  . MET B 2 41  ? 144.852 0.395   54.318  1.00 63.32 ? 41  MET B CG  1 
ATOM   4678 S  SD  . MET B 2 41  ? 143.665 1.103   55.511  1.00 65.88 ? 41  MET B SD  1 
ATOM   4679 C  CE  . MET B 2 41  ? 142.677 2.226   54.436  1.00 63.68 ? 41  MET B CE  1 
ATOM   4680 N  N   . GLU B 2 42  ? 149.079 -1.523  54.744  1.00 61.19 ? 42  GLU B N   1 
ATOM   4681 C  CA  . GLU B 2 42  ? 150.429 -1.798  55.240  1.00 63.40 ? 42  GLU B CA  1 
ATOM   4682 C  C   . GLU B 2 42  ? 151.243 -1.845  53.962  1.00 62.40 ? 42  GLU B C   1 
ATOM   4683 O  O   . GLU B 2 42  ? 152.385 -1.381  53.895  1.00 62.65 ? 42  GLU B O   1 
ATOM   4684 C  CB  . GLU B 2 42  ? 150.492 -3.172  55.927  1.00 66.10 ? 42  GLU B CB  1 
ATOM   4685 C  CG  . GLU B 2 42  ? 151.921 -3.734  56.145  1.00 70.78 ? 42  GLU B CG  1 
ATOM   4686 C  CD  . GLU B 2 42  ? 151.936 -5.183  56.679  1.00 74.23 ? 42  GLU B CD  1 
ATOM   4687 O  OE1 . GLU B 2 42  ? 151.086 -5.999  56.235  1.00 74.43 ? 42  GLU B OE1 1 
ATOM   4688 O  OE2 . GLU B 2 42  ? 152.804 -5.506  57.536  1.00 74.91 ? 42  GLU B OE2 1 
ATOM   4689 N  N   . LYS B 2 43  ? 150.621 -2.436  52.951  1.00 61.50 ? 43  LYS B N   1 
ATOM   4690 C  CA  . LYS B 2 43  ? 151.207 -2.565  51.632  1.00 61.53 ? 43  LYS B CA  1 
ATOM   4691 C  C   . LYS B 2 43  ? 151.470 -1.136  51.129  1.00 59.94 ? 43  LYS B C   1 
ATOM   4692 O  O   . LYS B 2 43  ? 152.615 -0.719  50.992  1.00 61.12 ? 43  LYS B O   1 
ATOM   4693 C  CB  . LYS B 2 43  ? 150.209 -3.316  50.717  1.00 62.75 ? 43  LYS B CB  1 
ATOM   4694 C  CG  . LYS B 2 43  ? 150.695 -3.788  49.323  1.00 62.64 ? 43  LYS B CG  1 
ATOM   4695 C  CD  . LYS B 2 43  ? 149.724 -4.839  48.729  1.00 61.77 ? 43  LYS B CD  1 
ATOM   4696 C  CE  . LYS B 2 43  ? 150.034 -5.191  47.273  1.00 61.85 ? 43  LYS B CE  1 
ATOM   4697 N  NZ  . LYS B 2 43  ? 149.086 -6.213  46.735  1.00 61.68 ? 43  LYS B NZ  1 
ATOM   4698 N  N   . GLU B 2 44  ? 150.414 -0.340  51.022  1.00 57.90 ? 44  GLU B N   1 
ATOM   4699 C  CA  . GLU B 2 44  ? 150.529 1.027   50.529  1.00 54.95 ? 44  GLU B CA  1 
ATOM   4700 C  C   . GLU B 2 44  ? 151.011 2.017   51.590  1.00 53.39 ? 44  GLU B C   1 
ATOM   4701 O  O   . GLU B 2 44  ? 150.701 3.205   51.516  1.00 52.87 ? 44  GLU B O   1 
ATOM   4702 C  CB  . GLU B 2 44  ? 149.192 1.461   49.924  1.00 53.88 ? 44  GLU B CB  1 
ATOM   4703 C  CG  . GLU B 2 44  ? 148.770 0.551   48.777  1.00 55.10 ? 44  GLU B CG  1 
ATOM   4704 C  CD  . GLU B 2 44  ? 147.382 0.842   48.220  1.00 56.50 ? 44  GLU B CD  1 
ATOM   4705 O  OE1 . GLU B 2 44  ? 146.423 0.967   49.011  1.00 56.63 ? 44  GLU B OE1 1 
ATOM   4706 O  OE2 . GLU B 2 44  ? 147.244 0.908   46.975  1.00 57.56 ? 44  GLU B OE2 1 
ATOM   4707 N  N   . GLY B 2 45  ? 151.727 1.501   52.592  1.00 52.06 ? 45  GLY B N   1 
ATOM   4708 C  CA  . GLY B 2 45  ? 152.284 2.304   53.682  1.00 51.68 ? 45  GLY B CA  1 
ATOM   4709 C  C   . GLY B 2 45  ? 151.481 3.416   54.354  1.00 50.35 ? 45  GLY B C   1 
ATOM   4710 O  O   . GLY B 2 45  ? 152.023 4.176   55.169  1.00 49.02 ? 45  GLY B O   1 
ATOM   4711 N  N   . LYS B 2 46  ? 150.195 3.506   54.034  1.00 48.98 ? 46  LYS B N   1 
ATOM   4712 C  CA  . LYS B 2 46  ? 149.326 4.535   54.590  1.00 47.01 ? 46  LYS B CA  1 
ATOM   4713 C  C   . LYS B 2 46  ? 149.227 4.335   56.094  1.00 47.12 ? 46  LYS B C   1 
ATOM   4714 O  O   . LYS B 2 46  ? 149.044 5.296   56.848  1.00 45.11 ? 46  LYS B O   1 
ATOM   4715 C  CB  . LYS B 2 46  ? 147.943 4.466   53.939  1.00 45.58 ? 46  LYS B CB  1 
ATOM   4716 C  CG  . LYS B 2 46  ? 147.759 3.265   53.039  1.00 44.72 ? 46  LYS B CG  1 
ATOM   4717 C  CD  . LYS B 2 46  ? 146.372 3.197   52.438  1.00 45.67 ? 46  LYS B CD  1 
ATOM   4718 C  CE  . LYS B 2 46  ? 146.122 4.303   51.398  1.00 45.57 ? 46  LYS B CE  1 
ATOM   4719 N  NZ  . LYS B 2 46  ? 144.808 4.152   50.670  1.00 42.76 ? 46  LYS B NZ  1 
ATOM   4720 N  N   . ILE B 2 47  ? 149.342 3.068   56.501  1.00 48.87 ? 47  ILE B N   1 
ATOM   4721 C  CA  . ILE B 2 47  ? 149.288 2.634   57.905  1.00 49.00 ? 47  ILE B CA  1 
ATOM   4722 C  C   . ILE B 2 47  ? 150.405 1.586   58.124  1.00 48.14 ? 47  ILE B C   1 
ATOM   4723 O  O   . ILE B 2 47  ? 150.877 0.966   57.161  1.00 46.91 ? 47  ILE B O   1 
ATOM   4724 C  CB  . ILE B 2 47  ? 147.927 1.974   58.249  1.00 49.16 ? 47  ILE B CB  1 
ATOM   4725 C  CG1 . ILE B 2 47  ? 147.846 0.586   57.606  1.00 49.89 ? 47  ILE B CG1 1 
ATOM   4726 C  CG2 . ILE B 2 47  ? 146.765 2.855   57.785  1.00 47.57 ? 47  ILE B CG2 1 
ATOM   4727 C  CD1 . ILE B 2 47  ? 146.779 -0.290  58.174  1.00 50.54 ? 47  ILE B CD1 1 
ATOM   4728 N  N   . SER B 2 48  ? 150.796 1.371   59.381  1.00 48.30 ? 48  SER B N   1 
ATOM   4729 C  CA  . SER B 2 48  ? 151.862 0.415   59.723  1.00 49.74 ? 48  SER B CA  1 
ATOM   4730 C  C   . SER B 2 48  ? 151.695 -0.286  61.085  1.00 50.05 ? 48  SER B C   1 
ATOM   4731 O  O   . SER B 2 48  ? 151.171 0.297   62.035  1.00 51.75 ? 48  SER B O   1 
ATOM   4732 C  CB  . SER B 2 48  ? 153.223 1.124   59.726  1.00 49.73 ? 48  SER B CB  1 
ATOM   4733 O  OG  . SER B 2 48  ? 153.411 1.927   58.573  1.00 52.24 ? 48  SER B OG  1 
ATOM   4734 N  N   . LYS B 2 49  ? 152.201 -1.516  61.180  1.00 50.10 ? 49  LYS B N   1 
ATOM   4735 C  CA  . LYS B 2 49  ? 152.145 -2.330  62.405  1.00 49.26 ? 49  LYS B CA  1 
ATOM   4736 C  C   . LYS B 2 49  ? 153.062 -1.742  63.500  1.00 46.51 ? 49  LYS B C   1 
ATOM   4737 O  O   . LYS B 2 49  ? 154.198 -1.356  63.216  1.00 45.90 ? 49  LYS B O   1 
ATOM   4738 C  CB  . LYS B 2 49  ? 152.527 -3.791  62.046  1.00 51.20 ? 49  LYS B CB  1 
ATOM   4739 C  CG  . LYS B 2 49  ? 153.550 -4.512  62.969  1.00 55.08 ? 49  LYS B CG  1 
ATOM   4740 C  CD  . LYS B 2 49  ? 154.152 -5.775  62.299  1.00 57.74 ? 49  LYS B CD  1 
ATOM   4741 C  CE  . LYS B 2 49  ? 153.221 -7.003  62.374  1.00 59.98 ? 49  LYS B CE  1 
ATOM   4742 N  NZ  . LYS B 2 49  ? 152.976 -7.728  61.070  1.00 60.90 ? 49  LYS B NZ  1 
ATOM   4743 N  N   . ILE B 2 50  ? 152.565 -1.634  64.733  1.00 44.00 ? 50  ILE B N   1 
ATOM   4744 C  CA  . ILE B 2 50  ? 153.383 -1.094  65.827  1.00 41.39 ? 50  ILE B CA  1 
ATOM   4745 C  C   . ILE B 2 50  ? 153.706 -2.059  66.969  1.00 40.64 ? 50  ILE B C   1 
ATOM   4746 O  O   . ILE B 2 50  ? 153.366 -3.243  66.929  1.00 38.50 ? 50  ILE B O   1 
ATOM   4747 C  CB  . ILE B 2 50  ? 152.822 0.229   66.436  1.00 40.09 ? 50  ILE B CB  1 
ATOM   4748 C  CG1 . ILE B 2 50  ? 151.387 0.506   65.980  1.00 37.61 ? 50  ILE B CG1 1 
ATOM   4749 C  CG2 . ILE B 2 50  ? 153.774 1.379   66.171  1.00 38.52 ? 50  ILE B CG2 1 
ATOM   4750 C  CD1 . ILE B 2 50  ? 150.329 -0.093  66.893  1.00 34.74 ? 50  ILE B CD1 1 
ATOM   4751 N  N   . GLY B 2 51  ? 154.402 -1.531  67.970  1.00 41.27 ? 51  GLY B N   1 
ATOM   4752 C  CA  . GLY B 2 51  ? 154.791 -2.324  69.117  1.00 44.22 ? 51  GLY B CA  1 
ATOM   4753 C  C   . GLY B 2 51  ? 154.329 -1.743  70.441  1.00 46.07 ? 51  GLY B C   1 
ATOM   4754 O  O   . GLY B 2 51  ? 153.772 -0.636  70.469  1.00 44.67 ? 51  GLY B O   1 
ATOM   4755 N  N   . PRO B 2 52  ? 154.653 -2.430  71.566  1.00 49.23 ? 52  PRO B N   1 
ATOM   4756 C  CA  . PRO B 2 52  ? 154.333 -2.113  72.972  1.00 51.64 ? 52  PRO B CA  1 
ATOM   4757 C  C   . PRO B 2 52  ? 154.803 -0.774  73.562  1.00 54.02 ? 52  PRO B C   1 
ATOM   4758 O  O   . PRO B 2 52  ? 154.348 -0.375  74.633  1.00 55.67 ? 52  PRO B O   1 
ATOM   4759 C  CB  . PRO B 2 52  ? 154.904 -3.314  73.741  1.00 51.29 ? 52  PRO B CB  1 
ATOM   4760 C  CG  . PRO B 2 52  ? 156.040 -3.754  72.904  1.00 50.86 ? 52  PRO B CG  1 
ATOM   4761 C  CD  . PRO B 2 52  ? 155.501 -3.638  71.495  1.00 50.22 ? 52  PRO B CD  1 
ATOM   4762 N  N   . GLU B 2 53  ? 155.715 -0.082  72.895  1.00 54.62 ? 53  GLU B N   1 
ATOM   4763 C  CA  . GLU B 2 53  ? 156.141 1.207   73.400  1.00 54.76 ? 53  GLU B CA  1 
ATOM   4764 C  C   . GLU B 2 53  ? 154.935 2.145   73.290  1.00 53.80 ? 53  GLU B C   1 
ATOM   4765 O  O   . GLU B 2 53  ? 154.968 3.258   73.795  1.00 53.31 ? 53  GLU B O   1 
ATOM   4766 C  CB  . GLU B 2 53  ? 157.343 1.741   72.602  1.00 58.55 ? 53  GLU B CB  1 
ATOM   4767 C  CG  . GLU B 2 53  ? 157.066 2.233   71.156  1.00 62.24 ? 53  GLU B CG  1 
ATOM   4768 C  CD  . GLU B 2 53  ? 156.853 1.114   70.131  1.00 64.46 ? 53  GLU B CD  1 
ATOM   4769 O  OE1 . GLU B 2 53  ? 157.338 -0.015  70.367  1.00 65.07 ? 53  GLU B OE1 1 
ATOM   4770 O  OE2 . GLU B 2 53  ? 156.207 1.368   69.082  1.00 65.27 ? 53  GLU B OE2 1 
ATOM   4771 N  N   . ASN B 2 54  ? 153.876 1.661   72.632  1.00 52.71 ? 54  ASN B N   1 
ATOM   4772 C  CA  . ASN B 2 54  ? 152.620 2.401   72.417  1.00 53.33 ? 54  ASN B CA  1 
ATOM   4773 C  C   . ASN B 2 54  ? 151.394 1.783   73.140  1.00 51.68 ? 54  ASN B C   1 
ATOM   4774 O  O   . ASN B 2 54  ? 151.083 0.601   72.965  1.00 50.97 ? 54  ASN B O   1 
ATOM   4775 C  CB  . ASN B 2 54  ? 152.341 2.488   70.907  1.00 56.98 ? 54  ASN B CB  1 
ATOM   4776 C  CG  . ASN B 2 54  ? 150.997 3.166   70.586  1.00 60.46 ? 54  ASN B CG  1 
ATOM   4777 O  OD1 . ASN B 2 54  ? 150.201 3.489   71.468  1.00 62.81 ? 54  ASN B OD1 1 
ATOM   4778 N  ND2 . ASN B 2 54  ? 150.749 3.384   69.301  1.00 61.57 ? 54  ASN B ND2 1 
ATOM   4779 N  N   . PRO B 2 55  ? 150.691 2.589   73.971  1.00 50.14 ? 55  PRO B N   1 
ATOM   4780 C  CA  . PRO B 2 55  ? 149.494 2.186   74.736  1.00 47.63 ? 55  PRO B CA  1 
ATOM   4781 C  C   . PRO B 2 55  ? 148.135 2.666   74.235  1.00 45.09 ? 55  PRO B C   1 
ATOM   4782 O  O   . PRO B 2 55  ? 147.101 2.129   74.636  1.00 45.30 ? 55  PRO B O   1 
ATOM   4783 C  CB  . PRO B 2 55  ? 149.780 2.789   76.109  1.00 47.65 ? 55  PRO B CB  1 
ATOM   4784 C  CG  . PRO B 2 55  ? 150.393 4.093   75.744  1.00 48.74 ? 55  PRO B CG  1 
ATOM   4785 C  CD  . PRO B 2 55  ? 151.265 3.829   74.521  1.00 49.43 ? 55  PRO B CD  1 
ATOM   4786 N  N   . TYR B 2 56  ? 148.135 3.690   73.382  1.00 43.01 ? 56  TYR B N   1 
ATOM   4787 C  CA  . TYR B 2 56  ? 146.896 4.266   72.844  1.00 40.28 ? 56  TYR B CA  1 
ATOM   4788 C  C   . TYR B 2 56  ? 146.108 3.323   71.970  1.00 36.45 ? 56  TYR B C   1 
ATOM   4789 O  O   . TYR B 2 56  ? 146.612 2.304   71.511  1.00 35.48 ? 56  TYR B O   1 
ATOM   4790 C  CB  . TYR B 2 56  ? 147.176 5.511   72.008  1.00 41.59 ? 56  TYR B CB  1 
ATOM   4791 C  CG  . TYR B 2 56  ? 148.186 6.422   72.605  1.00 44.45 ? 56  TYR B CG  1 
ATOM   4792 C  CD1 . TYR B 2 56  ? 148.114 6.797   73.945  1.00 45.85 ? 56  TYR B CD1 1 
ATOM   4793 C  CD2 . TYR B 2 56  ? 149.212 6.928   71.831  1.00 45.74 ? 56  TYR B CD2 1 
ATOM   4794 C  CE1 . TYR B 2 56  ? 149.057 7.681   74.505  1.00 46.71 ? 56  TYR B CE1 1 
ATOM   4795 C  CE2 . TYR B 2 56  ? 150.156 7.799   72.367  1.00 47.67 ? 56  TYR B CE2 1 
ATOM   4796 C  CZ  . TYR B 2 56  ? 150.078 8.177   73.704  1.00 47.15 ? 56  TYR B CZ  1 
ATOM   4797 O  OH  . TYR B 2 56  ? 151.017 9.056   74.214  1.00 43.94 ? 56  TYR B OH  1 
ATOM   4798 N  N   . ASN B 2 57  ? 144.879 3.725   71.690  1.00 32.50 ? 57  ASN B N   1 
ATOM   4799 C  CA  . ASN B 2 57  ? 143.999 2.959   70.830  1.00 29.86 ? 57  ASN B CA  1 
ATOM   4800 C  C   . ASN B 2 57  ? 142.695 3.683   70.587  1.00 28.87 ? 57  ASN B C   1 
ATOM   4801 O  O   . ASN B 2 57  ? 142.147 4.371   71.455  1.00 26.12 ? 57  ASN B O   1 
ATOM   4802 C  CB  . ASN B 2 57  ? 143.708 1.545   71.357  1.00 28.56 ? 57  ASN B CB  1 
ATOM   4803 C  CG  . ASN B 2 57  ? 142.955 0.690   70.332  1.00 27.47 ? 57  ASN B CG  1 
ATOM   4804 O  OD1 . ASN B 2 57  ? 143.393 0.551   69.200  1.00 27.78 ? 57  ASN B OD1 1 
ATOM   4805 N  ND2 . ASN B 2 57  ? 141.829 0.117   70.731  1.00 28.59 ? 57  ASN B ND2 1 
ATOM   4806 N  N   . THR B 2 58  ? 142.161 3.454   69.408  1.00 29.59 ? 58  THR B N   1 
ATOM   4807 C  CA  . THR B 2 58  ? 140.928 4.070   69.014  1.00 31.36 ? 58  THR B CA  1 
ATOM   4808 C  C   . THR B 2 58  ? 140.155 3.040   68.198  1.00 31.46 ? 58  THR B C   1 
ATOM   4809 O  O   . THR B 2 58  ? 140.711 2.364   67.351  1.00 30.89 ? 58  THR B O   1 
ATOM   4810 C  CB  . THR B 2 58  ? 141.256 5.375   68.248  1.00 33.32 ? 58  THR B CB  1 
ATOM   4811 O  OG1 . THR B 2 58  ? 142.175 6.141   69.060  1.00 32.44 ? 58  THR B OG1 1 
ATOM   4812 C  CG2 . THR B 2 58  ? 139.985 6.217   67.971  1.00 32.86 ? 58  THR B CG2 1 
ATOM   4813 N  N   . PRO B 2 59  ? 138.881 2.836   68.536  1.00 32.84 ? 59  PRO B N   1 
ATOM   4814 C  CA  . PRO B 2 59  ? 137.935 1.898   67.913  1.00 33.01 ? 59  PRO B CA  1 
ATOM   4815 C  C   . PRO B 2 59  ? 137.861 1.942   66.407  1.00 32.54 ? 59  PRO B C   1 
ATOM   4816 O  O   . PRO B 2 59  ? 138.070 2.972   65.800  1.00 31.34 ? 59  PRO B O   1 
ATOM   4817 C  CB  . PRO B 2 59  ? 136.592 2.315   68.511  1.00 34.73 ? 59  PRO B CB  1 
ATOM   4818 C  CG  . PRO B 2 59  ? 136.970 2.882   69.840  1.00 33.59 ? 59  PRO B CG  1 
ATOM   4819 C  CD  . PRO B 2 59  ? 138.207 3.666   69.550  1.00 32.34 ? 59  PRO B CD  1 
ATOM   4820 N  N   . VAL B 2 60  ? 137.488 0.820   65.824  1.00 35.58 ? 60  VAL B N   1 
ATOM   4821 C  CA  . VAL B 2 60  ? 137.356 0.704   64.377  1.00 41.13 ? 60  VAL B CA  1 
ATOM   4822 C  C   . VAL B 2 60  ? 136.211 -0.265  64.102  1.00 44.01 ? 60  VAL B C   1 
ATOM   4823 O  O   . VAL B 2 60  ? 135.933 -1.132  64.932  1.00 45.60 ? 60  VAL B O   1 
ATOM   4824 C  CB  . VAL B 2 60  ? 138.662 0.186   63.713  1.00 41.63 ? 60  VAL B CB  1 
ATOM   4825 C  CG1 . VAL B 2 60  ? 139.751 -0.058  64.776  1.00 43.35 ? 60  VAL B CG1 1 
ATOM   4826 C  CG2 . VAL B 2 60  ? 138.398 -1.085  62.890  1.00 41.37 ? 60  VAL B CG2 1 
ATOM   4827 N  N   . PHE B 2 61  ? 135.564 -0.138  62.947  1.00 47.57 ? 61  PHE B N   1 
ATOM   4828 C  CA  . PHE B 2 61  ? 134.434 -1.000  62.606  1.00 51.81 ? 61  PHE B CA  1 
ATOM   4829 C  C   . PHE B 2 61  ? 134.448 -1.262  61.125  1.00 52.72 ? 61  PHE B C   1 
ATOM   4830 O  O   . PHE B 2 61  ? 134.916 -0.431  60.348  1.00 54.48 ? 61  PHE B O   1 
ATOM   4831 C  CB  . PHE B 2 61  ? 133.094 -0.305  62.943  1.00 53.88 ? 61  PHE B CB  1 
ATOM   4832 C  CG  . PHE B 2 61  ? 133.100 0.413   64.263  1.00 55.56 ? 61  PHE B CG  1 
ATOM   4833 C  CD1 . PHE B 2 61  ? 133.700 1.667   64.383  1.00 56.96 ? 61  PHE B CD1 1 
ATOM   4834 C  CD2 . PHE B 2 61  ? 132.593 -0.198  65.404  1.00 56.02 ? 61  PHE B CD2 1 
ATOM   4835 C  CE1 . PHE B 2 61  ? 133.807 2.293   65.621  1.00 57.40 ? 61  PHE B CE1 1 
ATOM   4836 C  CE2 . PHE B 2 61  ? 132.693 0.423   66.653  1.00 57.03 ? 61  PHE B CE2 1 
ATOM   4837 C  CZ  . PHE B 2 61  ? 133.303 1.669   66.762  1.00 57.05 ? 61  PHE B CZ  1 
ATOM   4838 N  N   . ALA B 2 62  ? 133.951 -2.424  60.734  1.00 54.14 ? 62  ALA B N   1 
ATOM   4839 C  CA  . ALA B 2 62  ? 133.858 -2.755  59.319  1.00 56.20 ? 62  ALA B CA  1 
ATOM   4840 C  C   . ALA B 2 62  ? 132.470 -2.267  58.916  1.00 56.81 ? 62  ALA B C   1 
ATOM   4841 O  O   . ALA B 2 62  ? 131.553 -2.297  59.731  1.00 56.46 ? 62  ALA B O   1 
ATOM   4842 C  CB  . ALA B 2 62  ? 133.986 -4.258  59.112  1.00 55.54 ? 62  ALA B CB  1 
ATOM   4843 N  N   . ILE B 2 63  ? 132.326 -1.752  57.701  1.00 58.05 ? 63  ILE B N   1 
ATOM   4844 C  CA  . ILE B 2 63  ? 131.027 -1.265  57.238  1.00 59.90 ? 63  ILE B CA  1 
ATOM   4845 C  C   . ILE B 2 63  ? 130.906 -1.461  55.730  1.00 61.07 ? 63  ILE B C   1 
ATOM   4846 O  O   . ILE B 2 63  ? 131.875 -1.272  55.006  1.00 61.43 ? 63  ILE B O   1 
ATOM   4847 C  CB  . ILE B 2 63  ? 130.798 0.245   57.634  1.00 60.04 ? 63  ILE B CB  1 
ATOM   4848 C  CG1 . ILE B 2 63  ? 130.804 1.170   56.410  1.00 60.06 ? 63  ILE B CG1 1 
ATOM   4849 C  CG2 . ILE B 2 63  ? 131.899 0.729   58.608  1.00 60.50 ? 63  ILE B CG2 1 
ATOM   4850 C  CD1 . ILE B 2 63  ? 130.617 2.650   56.752  1.00 59.71 ? 63  ILE B CD1 1 
ATOM   4851 N  N   . LYS B 2 64  ? 129.748 -1.920  55.265  1.00 63.36 ? 64  LYS B N   1 
ATOM   4852 C  CA  . LYS B 2 64  ? 129.527 -2.119  53.825  1.00 65.53 ? 64  LYS B CA  1 
ATOM   4853 C  C   . LYS B 2 64  ? 128.985 -0.792  53.260  1.00 67.65 ? 64  LYS B C   1 
ATOM   4854 O  O   . LYS B 2 64  ? 127.799 -0.481  53.379  1.00 68.02 ? 64  LYS B O   1 
ATOM   4855 C  CB  . LYS B 2 64  ? 128.551 -3.281  53.579  1.00 63.83 ? 64  LYS B CB  1 
ATOM   4856 C  CG  . LYS B 2 64  ? 129.082 -4.648  53.991  1.00 61.65 ? 64  LYS B CG  1 
ATOM   4857 C  CD  . LYS B 2 64  ? 128.007 -5.733  53.907  1.00 61.54 ? 64  LYS B CD  1 
ATOM   4858 C  CE  . LYS B 2 64  ? 128.534 -7.086  54.418  1.00 60.78 ? 64  LYS B CE  1 
ATOM   4859 N  NZ  . LYS B 2 64  ? 127.577 -8.243  54.344  1.00 60.98 ? 64  LYS B NZ  1 
ATOM   4860 N  N   . LYS B 2 65  ? 129.867 -0.009  52.654  1.00 70.16 ? 65  LYS B N   1 
ATOM   4861 C  CA  . LYS B 2 65  ? 129.492 1.294   52.136  1.00 72.98 ? 65  LYS B CA  1 
ATOM   4862 C  C   . LYS B 2 65  ? 128.725 1.339   50.825  1.00 75.17 ? 65  LYS B C   1 
ATOM   4863 O  O   . LYS B 2 65  ? 128.798 0.424   50.011  1.00 74.99 ? 65  LYS B O   1 
ATOM   4864 C  CB  . LYS B 2 65  ? 130.728 2.195   52.033  1.00 73.72 ? 65  LYS B CB  1 
ATOM   4865 C  CG  . LYS B 2 65  ? 130.395 3.671   52.016  1.00 74.67 ? 65  LYS B CG  1 
ATOM   4866 C  CD  . LYS B 2 65  ? 129.481 4.001   53.190  1.00 74.30 ? 65  LYS B CD  1 
ATOM   4867 C  CE  . LYS B 2 65  ? 128.917 5.408   53.108  1.00 75.07 ? 65  LYS B CE  1 
ATOM   4868 N  NZ  . LYS B 2 65  ? 129.539 6.314   54.115  1.00 74.76 ? 65  LYS B NZ  1 
ATOM   4869 N  N   . LYS B 2 66  ? 127.989 2.436   50.652  1.00 77.41 ? 66  LYS B N   1 
ATOM   4870 C  CA  . LYS B 2 66  ? 127.201 2.717   49.465  1.00 80.57 ? 66  LYS B CA  1 
ATOM   4871 C  C   . LYS B 2 66  ? 126.335 1.550   48.981  1.00 81.84 ? 66  LYS B C   1 
ATOM   4872 O  O   . LYS B 2 66  ? 126.437 1.132   47.828  1.00 81.48 ? 66  LYS B O   1 
ATOM   4873 C  CB  . LYS B 2 66  ? 128.122 3.203   48.346  1.00 82.35 ? 66  LYS B CB  1 
ATOM   4874 C  CG  . LYS B 2 66  ? 127.373 3.778   47.180  1.00 85.01 ? 66  LYS B CG  1 
ATOM   4875 C  CD  . LYS B 2 66  ? 128.126 3.615   45.876  1.00 86.08 ? 66  LYS B CD  1 
ATOM   4876 C  CE  . LYS B 2 66  ? 127.122 3.628   44.730  1.00 88.58 ? 66  LYS B CE  1 
ATOM   4877 N  NZ  . LYS B 2 66  ? 127.755 3.910   43.417  1.00 89.76 ? 66  LYS B NZ  1 
ATOM   4878 N  N   . ASP B 2 67  ? 125.490 1.035   49.871  1.00 84.70 ? 67  ASP B N   1 
ATOM   4879 C  CA  . ASP B 2 67  ? 124.571 -0.068  49.586  1.00 87.32 ? 67  ASP B CA  1 
ATOM   4880 C  C   . ASP B 2 67  ? 125.278 -1.427  49.584  1.00 88.00 ? 67  ASP B C   1 
ATOM   4881 O  O   . ASP B 2 67  ? 125.568 -1.988  48.520  1.00 88.83 ? 67  ASP B O   1 
ATOM   4882 C  CB  . ASP B 2 67  ? 123.814 0.173   48.256  1.00 89.42 ? 67  ASP B CB  1 
ATOM   4883 C  CG  . ASP B 2 67  ? 122.601 -0.756  48.063  1.00 90.80 ? 67  ASP B CG  1 
ATOM   4884 O  OD1 . ASP B 2 67  ? 122.312 -1.611  48.926  1.00 91.02 ? 67  ASP B OD1 1 
ATOM   4885 O  OD2 . ASP B 2 67  ? 121.910 -0.610  47.032  1.00 92.99 ? 67  ASP B OD2 1 
ATOM   4886 N  N   . SER B 2 68  ? 125.550 -1.940  50.786  1.00 88.22 ? 68  SER B N   1 
ATOM   4887 C  CA  . SER B 2 68  ? 126.189 -3.248  51.001  1.00 88.56 ? 68  SER B CA  1 
ATOM   4888 C  C   . SER B 2 68  ? 127.292 -3.682  50.026  1.00 88.22 ? 68  SER B C   1 
ATOM   4889 O  O   . SER B 2 68  ? 127.467 -4.881  49.762  1.00 89.06 ? 68  SER B O   1 
ATOM   4890 C  CB  . SER B 2 68  ? 125.131 -4.362  51.133  1.00 87.72 ? 68  SER B CB  1 
ATOM   4891 O  OG  . SER B 2 68  ? 124.438 -4.284  52.365  1.00 86.07 ? 68  SER B OG  1 
ATOM   4892 N  N   . THR B 2 69  ? 128.035 -2.710  49.503  1.00 87.07 ? 69  THR B N   1 
ATOM   4893 C  CA  . THR B 2 69  ? 129.138 -2.980  48.593  1.00 85.14 ? 69  THR B CA  1 
ATOM   4894 C  C   . THR B 2 69  ? 130.224 -3.595  49.478  1.00 83.38 ? 69  THR B C   1 
ATOM   4895 O  O   . THR B 2 69  ? 130.072 -3.653  50.712  1.00 83.24 ? 69  THR B O   1 
ATOM   4896 C  CB  . THR B 2 69  ? 129.649 -1.658  47.973  1.00 85.90 ? 69  THR B CB  1 
ATOM   4897 O  OG1 . THR B 2 69  ? 128.569 -1.021  47.280  1.00 86.95 ? 69  THR B OG1 1 
ATOM   4898 C  CG2 . THR B 2 69  ? 130.797 -1.903  46.999  1.00 86.27 ? 69  THR B CG2 1 
ATOM   4899 N  N   . LYS B 2 70  ? 131.300 -4.089  48.877  1.00 80.68 ? 70  LYS B N   1 
ATOM   4900 C  CA  . LYS B 2 70  ? 132.364 -4.649  49.684  1.00 78.20 ? 70  LYS B CA  1 
ATOM   4901 C  C   . LYS B 2 70  ? 132.759 -3.659  50.776  1.00 75.55 ? 70  LYS B C   1 
ATOM   4902 O  O   . LYS B 2 70  ? 132.703 -2.436  50.598  1.00 76.29 ? 70  LYS B O   1 
ATOM   4903 C  CB  . LYS B 2 70  ? 133.561 -5.040  48.826  1.00 79.44 ? 70  LYS B CB  1 
ATOM   4904 C  CG  . LYS B 2 70  ? 133.507 -6.490  48.386  1.00 81.40 ? 70  LYS B CG  1 
ATOM   4905 C  CD  . LYS B 2 70  ? 134.718 -7.253  48.912  1.00 81.61 ? 70  LYS B CD  1 
ATOM   4906 C  CE  . LYS B 2 70  ? 134.448 -8.744  48.991  1.00 81.39 ? 70  LYS B CE  1 
ATOM   4907 N  NZ  . LYS B 2 70  ? 133.558 -9.053  50.136  1.00 81.92 ? 70  LYS B NZ  1 
ATOM   4908 N  N   . TRP B 2 71  ? 133.076 -4.228  51.925  1.00 71.49 ? 71  TRP B N   1 
ATOM   4909 C  CA  . TRP B 2 71  ? 133.455 -3.542  53.154  1.00 67.63 ? 71  TRP B CA  1 
ATOM   4910 C  C   . TRP B 2 71  ? 134.308 -2.272  53.111  1.00 63.13 ? 71  TRP B C   1 
ATOM   4911 O  O   . TRP B 2 71  ? 135.057 -2.042  52.159  1.00 61.72 ? 71  TRP B O   1 
ATOM   4912 C  CB  . TRP B 2 71  ? 134.125 -4.559  54.067  1.00 72.45 ? 71  TRP B CB  1 
ATOM   4913 C  CG  . TRP B 2 71  ? 133.294 -5.761  54.261  1.00 75.73 ? 71  TRP B CG  1 
ATOM   4914 C  CD1 . TRP B 2 71  ? 133.081 -6.777  53.363  1.00 76.62 ? 71  TRP B CD1 1 
ATOM   4915 C  CD2 . TRP B 2 71  ? 132.530 -6.072  55.410  1.00 77.53 ? 71  TRP B CD2 1 
ATOM   4916 N  NE1 . TRP B 2 71  ? 132.218 -7.698  53.894  1.00 77.35 ? 71  TRP B NE1 1 
ATOM   4917 C  CE2 . TRP B 2 71  ? 131.867 -7.288  55.151  1.00 78.26 ? 71  TRP B CE2 1 
ATOM   4918 C  CE3 . TRP B 2 71  ? 132.334 -5.438  56.641  1.00 78.37 ? 71  TRP B CE3 1 
ATOM   4919 C  CZ2 . TRP B 2 71  ? 131.016 -7.889  56.093  1.00 79.73 ? 71  TRP B CZ2 1 
ATOM   4920 C  CZ3 . TRP B 2 71  ? 131.499 -6.029  57.571  1.00 79.56 ? 71  TRP B CZ3 1 
ATOM   4921 C  CH2 . TRP B 2 71  ? 130.848 -7.244  57.292  1.00 79.92 ? 71  TRP B CH2 1 
ATOM   4922 N  N   . ARG B 2 72  ? 134.244 -1.517  54.216  1.00 58.39 ? 72  ARG B N   1 
ATOM   4923 C  CA  . ARG B 2 72  ? 134.965 -0.255  54.448  1.00 51.80 ? 72  ARG B CA  1 
ATOM   4924 C  C   . ARG B 2 72  ? 135.370 -0.151  55.927  1.00 46.60 ? 72  ARG B C   1 
ATOM   4925 O  O   . ARG B 2 72  ? 134.590 -0.497  56.816  1.00 43.51 ? 72  ARG B O   1 
ATOM   4926 C  CB  . ARG B 2 72  ? 134.084 0.952   54.088  1.00 52.54 ? 72  ARG B CB  1 
ATOM   4927 C  CG  . ARG B 2 72  ? 133.870 1.138   52.593  1.00 54.82 ? 72  ARG B CG  1 
ATOM   4928 C  CD  . ARG B 2 72  ? 135.172 1.501   51.888  1.00 56.00 ? 72  ARG B CD  1 
ATOM   4929 N  NE  . ARG B 2 72  ? 135.105 1.337   50.433  1.00 55.38 ? 72  ARG B NE  1 
ATOM   4930 C  CZ  . ARG B 2 72  ? 136.170 1.173   49.656  1.00 54.59 ? 72  ARG B CZ  1 
ATOM   4931 N  NH1 . ARG B 2 72  ? 137.389 1.153   50.183  1.00 54.68 ? 72  ARG B NH1 1 
ATOM   4932 N  NH2 . ARG B 2 72  ? 136.016 1.009   48.354  1.00 56.15 ? 72  ARG B NH2 1 
ATOM   4933 N  N   . LYS B 2 73  ? 136.600 0.287   56.176  1.00 41.67 ? 73  LYS B N   1 
ATOM   4934 C  CA  . LYS B 2 73  ? 137.105 0.440   57.538  1.00 37.90 ? 73  LYS B CA  1 
ATOM   4935 C  C   . LYS B 2 73  ? 136.614 1.742   58.110  1.00 37.98 ? 73  LYS B C   1 
ATOM   4936 O  O   . LYS B 2 73  ? 136.567 2.752   57.408  1.00 38.34 ? 73  LYS B O   1 
ATOM   4937 C  CB  . LYS B 2 73  ? 138.629 0.466   57.563  1.00 34.71 ? 73  LYS B CB  1 
ATOM   4938 C  CG  . LYS B 2 73  ? 139.199 1.183   58.773  1.00 29.08 ? 73  LYS B CG  1 
ATOM   4939 C  CD  . LYS B 2 73  ? 140.689 1.153   58.715  1.00 26.46 ? 73  LYS B CD  1 
ATOM   4940 C  CE  . LYS B 2 73  ? 141.302 1.803   59.922  1.00 22.57 ? 73  LYS B CE  1 
ATOM   4941 N  NZ  . LYS B 2 73  ? 142.751 1.494   59.968  1.00 19.16 ? 73  LYS B NZ  1 
ATOM   4942 N  N   . LEU B 2 74  ? 136.368 1.751   59.413  1.00 37.76 ? 74  LEU B N   1 
ATOM   4943 C  CA  . LEU B 2 74  ? 135.886 2.957   60.052  1.00 36.09 ? 74  LEU B CA  1 
ATOM   4944 C  C   . LEU B 2 74  ? 136.418 3.139   61.447  1.00 33.38 ? 74  LEU B C   1 
ATOM   4945 O  O   . LEU B 2 74  ? 136.025 2.431   62.354  1.00 31.86 ? 74  LEU B O   1 
ATOM   4946 C  CB  . LEU B 2 74  ? 134.360 2.953   60.092  1.00 34.84 ? 74  LEU B CB  1 
ATOM   4947 C  CG  . LEU B 2 74  ? 133.759 4.348   60.298  1.00 36.15 ? 74  LEU B CG  1 
ATOM   4948 C  CD1 . LEU B 2 74  ? 132.262 4.259   60.030  1.00 37.57 ? 74  LEU B CD1 1 
ATOM   4949 C  CD2 . LEU B 2 74  ? 134.054 4.937   61.699  1.00 32.67 ? 74  LEU B CD2 1 
ATOM   4950 N  N   . VAL B 2 75  ? 137.268 4.124   61.644  1.00 32.39 ? 75  VAL B N   1 
ATOM   4951 C  CA  . VAL B 2 75  ? 137.748 4.331   62.984  1.00 34.92 ? 75  VAL B CA  1 
ATOM   4952 C  C   . VAL B 2 75  ? 136.881 5.295   63.757  1.00 37.39 ? 75  VAL B C   1 
ATOM   4953 O  O   . VAL B 2 75  ? 136.471 6.358   63.248  1.00 38.22 ? 75  VAL B O   1 
ATOM   4954 C  CB  . VAL B 2 75  ? 139.183 4.816   63.041  1.00 34.75 ? 75  VAL B CB  1 
ATOM   4955 C  CG1 . VAL B 2 75  ? 139.582 5.092   64.516  1.00 31.94 ? 75  VAL B CG1 1 
ATOM   4956 C  CG2 . VAL B 2 75  ? 140.098 3.765   62.415  1.00 33.75 ? 75  VAL B CG2 1 
ATOM   4957 N  N   . ASP B 2 76  ? 136.553 4.877   64.975  1.00 38.58 ? 76  ASP B N   1 
ATOM   4958 C  CA  . ASP B 2 76  ? 135.763 5.686   65.873  1.00 39.15 ? 76  ASP B CA  1 
ATOM   4959 C  C   . ASP B 2 76  ? 136.712 6.695   66.453  1.00 37.71 ? 76  ASP B C   1 
ATOM   4960 O  O   . ASP B 2 76  ? 137.271 6.528   67.540  1.00 35.04 ? 76  ASP B O   1 
ATOM   4961 C  CB  . ASP B 2 76  ? 135.163 4.852   66.984  1.00 42.08 ? 76  ASP B CB  1 
ATOM   4962 C  CG  . ASP B 2 76  ? 134.250 5.660   67.860  1.00 44.77 ? 76  ASP B CG  1 
ATOM   4963 O  OD1 . ASP B 2 76  ? 133.177 6.082   67.348  1.00 45.16 ? 76  ASP B OD1 1 
ATOM   4964 O  OD2 . ASP B 2 76  ? 134.637 5.909   69.031  1.00 47.22 ? 76  ASP B OD2 1 
ATOM   4965 N  N   . PHE B 2 77  ? 136.861 7.771   65.711  1.00 38.48 ? 77  PHE B N   1 
ATOM   4966 C  CA  . PHE B 2 77  ? 137.764 8.811   66.107  1.00 40.96 ? 77  PHE B CA  1 
ATOM   4967 C  C   . PHE B 2 77  ? 137.281 9.783   67.151  1.00 41.51 ? 77  PHE B C   1 
ATOM   4968 O  O   . PHE B 2 77  ? 138.052 10.654  67.576  1.00 42.26 ? 77  PHE B O   1 
ATOM   4969 C  CB  . PHE B 2 77  ? 138.222 9.557   64.874  1.00 42.03 ? 77  PHE B CB  1 
ATOM   4970 C  CG  . PHE B 2 77  ? 139.532 9.073   64.343  1.00 42.48 ? 77  PHE B CG  1 
ATOM   4971 C  CD1 . PHE B 2 77  ? 140.667 9.103   65.147  1.00 41.44 ? 77  PHE B CD1 1 
ATOM   4972 C  CD2 . PHE B 2 77  ? 139.634 8.612   63.036  1.00 41.92 ? 77  PHE B CD2 1 
ATOM   4973 C  CE1 . PHE B 2 77  ? 141.881 8.687   64.653  1.00 42.35 ? 77  PHE B CE1 1 
ATOM   4974 C  CE2 . PHE B 2 77  ? 140.835 8.196   62.524  1.00 42.33 ? 77  PHE B CE2 1 
ATOM   4975 C  CZ  . PHE B 2 77  ? 141.970 8.231   63.333  1.00 43.76 ? 77  PHE B CZ  1 
ATOM   4976 N  N   . ARG B 2 78  ? 136.051 9.584   67.620  1.00 41.84 ? 78  ARG B N   1 
ATOM   4977 C  CA  . ARG B 2 78  ? 135.445 10.462  68.612  1.00 41.87 ? 78  ARG B CA  1 
ATOM   4978 C  C   . ARG B 2 78  ? 136.397 11.072  69.653  1.00 40.95 ? 78  ARG B C   1 
ATOM   4979 O  O   . ARG B 2 78  ? 136.584 12.286  69.664  1.00 39.92 ? 78  ARG B O   1 
ATOM   4980 C  CB  . ARG B 2 78  ? 134.211 9.797   69.255  1.00 42.03 ? 78  ARG B CB  1 
ATOM   4981 C  CG  . ARG B 2 78  ? 132.898 10.034  68.456  1.00 42.07 ? 78  ARG B CG  1 
ATOM   4982 C  CD  . ARG B 2 78  ? 131.639 9.514   69.156  1.00 41.15 ? 78  ARG B CD  1 
ATOM   4983 N  NE  . ARG B 2 78  ? 131.611 8.052   69.217  1.00 42.66 ? 78  ARG B NE  1 
ATOM   4984 C  CZ  . ARG B 2 78  ? 130.505 7.307   69.265  1.00 41.94 ? 78  ARG B CZ  1 
ATOM   4985 N  NH1 . ARG B 2 78  ? 129.307 7.873   69.267  1.00 40.52 ? 78  ARG B NH1 1 
ATOM   4986 N  NH2 . ARG B 2 78  ? 130.599 5.982   69.302  1.00 42.63 ? 78  ARG B NH2 1 
ATOM   4987 N  N   . GLU B 2 79  ? 137.075 10.242  70.440  1.00 42.45 ? 79  GLU B N   1 
ATOM   4988 C  CA  . GLU B 2 79  ? 138.010 10.744  71.459  1.00 44.96 ? 79  GLU B CA  1 
ATOM   4989 C  C   . GLU B 2 79  ? 139.202 11.594  70.976  1.00 44.19 ? 79  GLU B C   1 
ATOM   4990 O  O   . GLU B 2 79  ? 139.307 12.763  71.337  1.00 45.10 ? 79  GLU B O   1 
ATOM   4991 C  CB  . GLU B 2 79  ? 138.529 9.603   72.334  1.00 47.88 ? 79  GLU B CB  1 
ATOM   4992 C  CG  . GLU B 2 79  ? 139.149 10.075  73.643  1.00 51.14 ? 79  GLU B CG  1 
ATOM   4993 C  CD  . GLU B 2 79  ? 138.128 10.693  74.603  1.00 53.74 ? 79  GLU B CD  1 
ATOM   4994 O  OE1 . GLU B 2 79  ? 136.908 10.700  74.294  1.00 54.42 ? 79  GLU B OE1 1 
ATOM   4995 O  OE2 . GLU B 2 79  ? 138.547 11.161  75.688  1.00 56.56 ? 79  GLU B OE2 1 
ATOM   4996 N  N   . LEU B 2 80  ? 140.098 11.018  70.182  1.00 42.45 ? 80  LEU B N   1 
ATOM   4997 C  CA  . LEU B 2 80  ? 141.254 11.764  69.700  1.00 41.61 ? 80  LEU B CA  1 
ATOM   4998 C  C   . LEU B 2 80  ? 140.878 13.173  69.266  1.00 41.71 ? 80  LEU B C   1 
ATOM   4999 O  O   . LEU B 2 80  ? 141.452 14.156  69.729  1.00 41.01 ? 80  LEU B O   1 
ATOM   5000 C  CB  . LEU B 2 80  ? 141.901 11.057  68.514  1.00 42.14 ? 80  LEU B CB  1 
ATOM   5001 C  CG  . LEU B 2 80  ? 143.189 11.738  68.029  1.00 42.19 ? 80  LEU B CG  1 
ATOM   5002 C  CD1 . LEU B 2 80  ? 144.264 11.654  69.121  1.00 43.01 ? 80  LEU B CD1 1 
ATOM   5003 C  CD2 . LEU B 2 80  ? 143.683 11.101  66.749  1.00 42.01 ? 80  LEU B CD2 1 
ATOM   5004 N  N   . ASN B 2 81  ? 139.914 13.260  68.363  1.00 41.41 ? 81  ASN B N   1 
ATOM   5005 C  CA  . ASN B 2 81  ? 139.453 14.536  67.853  1.00 41.36 ? 81  ASN B CA  1 
ATOM   5006 C  C   . ASN B 2 81  ? 139.191 15.441  69.001  1.00 42.64 ? 81  ASN B C   1 
ATOM   5007 O  O   . ASN B 2 81  ? 139.791 16.506  69.096  1.00 43.43 ? 81  ASN B O   1 
ATOM   5008 C  CB  . ASN B 2 81  ? 138.193 14.321  67.055  1.00 40.75 ? 81  ASN B CB  1 
ATOM   5009 C  CG  . ASN B 2 81  ? 138.418 13.370  65.932  1.00 38.70 ? 81  ASN B CG  1 
ATOM   5010 O  OD1 . ASN B 2 81  ? 139.486 12.765  65.847  1.00 36.73 ? 81  ASN B OD1 1 
ATOM   5011 N  ND2 . ASN B 2 81  ? 137.439 13.232  65.049  1.00 39.28 ? 81  ASN B ND2 1 
ATOM   5012 N  N   . LYS B 2 82  ? 138.358 14.964  69.917  1.00 45.64 ? 82  LYS B N   1 
ATOM   5013 C  CA  . LYS B 2 82  ? 138.022 15.716  71.117  1.00 49.67 ? 82  LYS B CA  1 
ATOM   5014 C  C   . LYS B 2 82  ? 139.294 16.053  71.920  1.00 52.35 ? 82  LYS B C   1 
ATOM   5015 O  O   . LYS B 2 82  ? 139.328 17.031  72.667  1.00 53.39 ? 82  LYS B O   1 
ATOM   5016 C  CB  . LYS B 2 82  ? 137.054 14.919  72.007  1.00 49.24 ? 82  LYS B CB  1 
ATOM   5017 C  CG  . LYS B 2 82  ? 135.666 14.651  71.402  1.00 50.50 ? 82  LYS B CG  1 
ATOM   5018 C  CD  . LYS B 2 82  ? 134.655 14.097  72.445  1.00 50.41 ? 82  LYS B CD  1 
ATOM   5019 C  CE  . LYS B 2 82  ? 134.947 12.654  72.873  1.00 49.40 ? 82  LYS B CE  1 
ATOM   5020 N  NZ  . LYS B 2 82  ? 134.099 12.163  73.989  1.00 44.95 ? 82  LYS B NZ  1 
ATOM   5021 N  N   . ARG B 2 83  ? 140.339 15.248  71.764  1.00 54.15 ? 83  ARG B N   1 
ATOM   5022 C  CA  . ARG B 2 83  ? 141.586 15.475  72.489  1.00 56.24 ? 83  ARG B CA  1 
ATOM   5023 C  C   . ARG B 2 83  ? 142.582 16.357  71.740  1.00 57.48 ? 83  ARG B C   1 
ATOM   5024 O  O   . ARG B 2 83  ? 143.616 16.755  72.286  1.00 58.55 ? 83  ARG B O   1 
ATOM   5025 C  CB  . ARG B 2 83  ? 142.244 14.139  72.805  1.00 57.30 ? 83  ARG B CB  1 
ATOM   5026 C  CG  . ARG B 2 83  ? 141.274 13.088  73.248  1.00 57.84 ? 83  ARG B CG  1 
ATOM   5027 C  CD  . ARG B 2 83  ? 142.003 11.902  73.753  1.00 57.71 ? 83  ARG B CD  1 
ATOM   5028 N  NE  . ARG B 2 83  ? 142.657 12.227  75.012  1.00 57.98 ? 83  ARG B NE  1 
ATOM   5029 C  CZ  . ARG B 2 83  ? 142.291 11.730  76.187  1.00 58.37 ? 83  ARG B CZ  1 
ATOM   5030 N  NH1 . ARG B 2 83  ? 141.270 10.884  76.262  1.00 59.15 ? 83  ARG B NH1 1 
ATOM   5031 N  NH2 . ARG B 2 83  ? 142.977 12.039  77.280  1.00 58.82 ? 83  ARG B NH2 1 
ATOM   5032 N  N   . THR B 2 84  ? 142.296 16.647  70.484  1.00 57.94 ? 84  THR B N   1 
ATOM   5033 C  CA  . THR B 2 84  ? 143.201 17.466  69.713  1.00 58.64 ? 84  THR B CA  1 
ATOM   5034 C  C   . THR B 2 84  ? 142.404 18.508  69.011  1.00 60.37 ? 84  THR B C   1 
ATOM   5035 O  O   . THR B 2 84  ? 142.429 19.692  69.366  1.00 60.46 ? 84  THR B O   1 
ATOM   5036 C  CB  . THR B 2 84  ? 143.892 16.634  68.643  1.00 57.83 ? 84  THR B CB  1 
ATOM   5037 O  OG1 . THR B 2 84  ? 142.937 15.746  68.038  1.00 56.85 ? 84  THR B OG1 1 
ATOM   5038 C  CG2 . THR B 2 84  ? 144.995 15.843  69.247  1.00 57.06 ? 84  THR B CG2 1 
ATOM   5039 N  N   . GLN B 2 85  ? 141.619 18.012  68.066  1.00 62.93 ? 85  GLN B N   1 
ATOM   5040 C  CA  . GLN B 2 85  ? 140.799 18.825  67.218  1.00 65.78 ? 85  GLN B CA  1 
ATOM   5041 C  C   . GLN B 2 85  ? 140.076 19.968  67.901  1.00 67.91 ? 85  GLN B C   1 
ATOM   5042 O  O   . GLN B 2 85  ? 139.799 20.975  67.256  1.00 68.11 ? 85  GLN B O   1 
ATOM   5043 C  CB  . GLN B 2 85  ? 139.843 17.945  66.424  1.00 66.15 ? 85  GLN B CB  1 
ATOM   5044 C  CG  . GLN B 2 85  ? 138.993 18.718  65.452  1.00 67.50 ? 85  GLN B CG  1 
ATOM   5045 C  CD  . GLN B 2 85  ? 137.686 19.156  66.048  1.00 68.33 ? 85  GLN B CD  1 
ATOM   5046 O  OE1 . GLN B 2 85  ? 137.261 18.643  67.087  1.00 69.78 ? 85  GLN B OE1 1 
ATOM   5047 N  NE2 . GLN B 2 85  ? 137.020 20.091  65.384  1.00 70.04 ? 85  GLN B NE2 1 
ATOM   5048 N  N   . ASP B 2 86  ? 139.799 19.869  69.193  1.00 70.10 ? 86  ASP B N   1 
ATOM   5049 C  CA  . ASP B 2 86  ? 139.113 20.989  69.805  1.00 74.09 ? 86  ASP B CA  1 
ATOM   5050 C  C   . ASP B 2 86  ? 139.943 22.274  69.867  1.00 76.40 ? 86  ASP B C   1 
ATOM   5051 O  O   . ASP B 2 86  ? 139.600 23.239  69.181  1.00 76.30 ? 86  ASP B O   1 
ATOM   5052 C  CB  . ASP B 2 86  ? 138.497 20.642  71.149  1.00 75.04 ? 86  ASP B CB  1 
ATOM   5053 C  CG  . ASP B 2 86  ? 137.244 21.460  71.424  1.00 76.12 ? 86  ASP B CG  1 
ATOM   5054 O  OD1 . ASP B 2 86  ? 136.309 21.423  70.590  1.00 75.19 ? 86  ASP B OD1 1 
ATOM   5055 O  OD2 . ASP B 2 86  ? 137.203 22.161  72.457  1.00 78.35 ? 86  ASP B OD2 1 
ATOM   5056 N  N   . PHE B 2 87  ? 141.038 22.311  70.632  1.00 79.38 ? 87  PHE B N   1 
ATOM   5057 C  CA  . PHE B 2 87  ? 141.842 23.545  70.651  1.00 81.21 ? 87  PHE B CA  1 
ATOM   5058 C  C   . PHE B 2 87  ? 142.420 23.701  69.260  1.00 81.87 ? 87  PHE B C   1 
ATOM   5059 O  O   . PHE B 2 87  ? 142.962 24.748  68.897  1.00 81.91 ? 87  PHE B O   1 
ATOM   5060 C  CB  . PHE B 2 87  ? 142.995 23.532  71.655  1.00 82.59 ? 87  PHE B CB  1 
ATOM   5061 C  CG  . PHE B 2 87  ? 143.856 24.784  71.589  1.00 84.47 ? 87  PHE B CG  1 
ATOM   5062 C  CD1 . PHE B 2 87  ? 143.341 26.021  71.992  1.00 84.05 ? 87  PHE B CD1 1 
ATOM   5063 C  CD2 . PHE B 2 87  ? 145.159 24.740  71.074  1.00 84.12 ? 87  PHE B CD2 1 
ATOM   5064 C  CE1 . PHE B 2 87  ? 144.107 27.188  71.885  1.00 83.67 ? 87  PHE B CE1 1 
ATOM   5065 C  CE2 . PHE B 2 87  ? 145.933 25.906  70.962  1.00 83.63 ? 87  PHE B CE2 1 
ATOM   5066 C  CZ  . PHE B 2 87  ? 145.405 27.129  71.367  1.00 82.65 ? 87  PHE B CZ  1 
ATOM   5067 N  N   . TRP B 2 88  ? 142.346 22.621  68.501  1.00 82.61 ? 88  TRP B N   1 
ATOM   5068 C  CA  . TRP B 2 88  ? 142.815 22.648  67.151  1.00 83.94 ? 88  TRP B CA  1 
ATOM   5069 C  C   . TRP B 2 88  ? 141.824 23.383  66.255  1.00 84.91 ? 88  TRP B C   1 
ATOM   5070 O  O   . TRP B 2 88  ? 142.240 24.033  65.285  1.00 85.77 ? 88  TRP B O   1 
ATOM   5071 C  CB  . TRP B 2 88  ? 143.071 21.238  66.673  1.00 83.74 ? 88  TRP B CB  1 
ATOM   5072 C  CG  . TRP B 2 88  ? 144.496 21.006  66.485  1.00 84.18 ? 88  TRP B CG  1 
ATOM   5073 C  CD1 . TRP B 2 88  ? 145.469 20.999  67.449  1.00 83.73 ? 88  TRP B CD1 1 
ATOM   5074 C  CD2 . TRP B 2 88  ? 145.151 20.793  65.239  1.00 84.39 ? 88  TRP B CD2 1 
ATOM   5075 N  NE1 . TRP B 2 88  ? 146.699 20.797  66.867  1.00 83.61 ? 88  TRP B NE1 1 
ATOM   5076 C  CE2 . TRP B 2 88  ? 146.531 20.666  65.511  1.00 83.60 ? 88  TRP B CE2 1 
ATOM   5077 C  CE3 . TRP B 2 88  ? 144.702 20.693  63.909  1.00 84.12 ? 88  TRP B CE3 1 
ATOM   5078 C  CZ2 . TRP B 2 88  ? 147.470 20.444  64.500  1.00 83.70 ? 88  TRP B CZ2 1 
ATOM   5079 C  CZ3 . TRP B 2 88  ? 145.630 20.472  62.909  1.00 83.50 ? 88  TRP B CZ3 1 
ATOM   5080 C  CH2 . TRP B 2 88  ? 147.000 20.348  63.208  1.00 83.94 ? 88  TRP B CH2 1 
ATOM   5081 N  N   . GLU B 2 89  ? 140.530 23.343  66.600  1.00 85.43 ? 89  GLU B N   1 
ATOM   5082 C  CA  . GLU B 2 89  ? 139.523 24.043  65.800  1.00 86.34 ? 89  GLU B CA  1 
ATOM   5083 C  C   . GLU B 2 89  ? 139.520 25.550  66.108  1.00 87.05 ? 89  GLU B C   1 
ATOM   5084 O  O   . GLU B 2 89  ? 138.640 26.302  65.656  1.00 87.03 ? 89  GLU B O   1 
ATOM   5085 C  CB  . GLU B 2 89  ? 138.119 23.391  65.882  1.00 86.18 ? 89  GLU B CB  1 
ATOM   5086 C  CG  . GLU B 2 89  ? 137.382 23.432  67.222  1.00 86.57 ? 89  GLU B CG  1 
ATOM   5087 C  CD  . GLU B 2 89  ? 135.988 22.776  67.161  1.00 86.79 ? 89  GLU B CD  1 
ATOM   5088 O  OE1 . GLU B 2 89  ? 135.124 23.232  66.373  1.00 87.28 ? 89  GLU B OE1 1 
ATOM   5089 O  OE2 . GLU B 2 89  ? 135.752 21.802  67.911  1.00 86.28 ? 89  GLU B OE2 1 
ATOM   5090 N  N   . VAL B 2 90  ? 140.547 25.969  66.856  1.00 87.69 ? 90  VAL B N   1 
ATOM   5091 C  CA  . VAL B 2 90  ? 140.797 27.370  67.227  1.00 88.01 ? 90  VAL B CA  1 
ATOM   5092 C  C   . VAL B 2 90  ? 141.859 27.914  66.244  1.00 87.62 ? 90  VAL B C   1 
ATOM   5093 O  O   . VAL B 2 90  ? 142.036 29.132  66.112  1.00 87.24 ? 90  VAL B O   1 
ATOM   5094 C  CB  . VAL B 2 90  ? 141.329 27.503  68.699  1.00 87.91 ? 90  VAL B CB  1 
ATOM   5095 C  CG1 . VAL B 2 90  ? 141.649 28.964  69.032  1.00 88.18 ? 90  VAL B CG1 1 
ATOM   5096 C  CG2 . VAL B 2 90  ? 140.312 26.952  69.693  1.00 87.82 ? 90  VAL B CG2 1 
ATOM   5097 N  N   . GLN B 2 91  ? 142.581 27.000  65.586  1.00 86.30 ? 91  GLN B N   1 
ATOM   5098 C  CA  . GLN B 2 91  ? 143.599 27.366  64.596  1.00 84.78 ? 91  GLN B CA  1 
ATOM   5099 C  C   . GLN B 2 91  ? 143.004 27.136  63.217  1.00 83.87 ? 91  GLN B C   1 
ATOM   5100 O  O   . GLN B 2 91  ? 142.519 28.064  62.567  1.00 82.98 ? 91  GLN B O   1 
ATOM   5101 C  CB  . GLN B 2 91  ? 144.874 26.504  64.733  1.00 84.77 ? 91  GLN B CB  1 
ATOM   5102 C  CG  . GLN B 2 91  ? 146.155 27.059  64.012  1.00 84.15 ? 91  GLN B CG  1 
ATOM   5103 C  CD  . GLN B 2 91  ? 146.104 27.069  62.466  1.00 82.77 ? 91  GLN B CD  1 
ATOM   5104 O  OE1 . GLN B 2 91  ? 146.565 26.135  61.814  1.00 82.34 ? 91  GLN B OE1 1 
ATOM   5105 N  NE2 . GLN B 2 91  ? 145.585 28.147  61.890  1.00 82.33 ? 91  GLN B NE2 1 
ATOM   5106 N  N   . LEU B 2 92  ? 143.018 25.877  62.796  1.00 83.67 ? 92  LEU B N   1 
ATOM   5107 C  CA  . LEU B 2 92  ? 142.511 25.484  61.489  1.00 84.09 ? 92  LEU B CA  1 
ATOM   5108 C  C   . LEU B 2 92  ? 140.991 25.539  61.344  1.00 84.61 ? 92  LEU B C   1 
ATOM   5109 O  O   . LEU B 2 92  ? 140.425 24.848  60.491  1.00 84.72 ? 92  LEU B O   1 
ATOM   5110 C  CB  . LEU B 2 92  ? 143.010 24.081  61.144  1.00 83.46 ? 92  LEU B CB  1 
ATOM   5111 C  CG  . LEU B 2 92  ? 144.384 24.009  60.496  1.00 83.72 ? 92  LEU B CG  1 
ATOM   5112 C  CD1 . LEU B 2 92  ? 144.819 22.559  60.359  1.00 83.23 ? 92  LEU B CD1 1 
ATOM   5113 C  CD2 . LEU B 2 92  ? 144.323 24.701  59.139  1.00 83.30 ? 92  LEU B CD2 1 
ATOM   5114 N  N   . GLY B 2 93  ? 140.345 26.391  62.139  1.00 84.14 ? 93  GLY B N   1 
ATOM   5115 C  CA  . GLY B 2 93  ? 138.897 26.514  62.114  1.00 84.38 ? 93  GLY B CA  1 
ATOM   5116 C  C   . GLY B 2 93  ? 138.195 26.506  60.765  1.00 84.84 ? 93  GLY B C   1 
ATOM   5117 O  O   . GLY B 2 93  ? 138.032 27.560  60.145  1.00 83.69 ? 93  GLY B O   1 
ATOM   5118 N  N   . ILE B 2 94  ? 137.818 25.313  60.293  1.00 86.53 ? 94  ILE B N   1 
ATOM   5119 C  CA  . ILE B 2 94  ? 137.085 25.164  59.028  1.00 88.25 ? 94  ILE B CA  1 
ATOM   5120 C  C   . ILE B 2 94  ? 135.732 25.883  59.290  1.00 89.50 ? 94  ILE B C   1 
ATOM   5121 O  O   . ILE B 2 94  ? 135.007 25.544  60.237  1.00 90.66 ? 94  ILE B O   1 
ATOM   5122 C  CB  . ILE B 2 94  ? 136.858 23.652  58.652  1.00 87.21 ? 94  ILE B CB  1 
ATOM   5123 C  CG1 . ILE B 2 94  ? 138.179 22.861  58.728  1.00 87.22 ? 94  ILE B CG1 1 
ATOM   5124 C  CG2 . ILE B 2 94  ? 136.263 23.546  57.245  1.00 87.19 ? 94  ILE B CG2 1 
ATOM   5125 C  CD1 . ILE B 2 94  ? 138.075 21.383  58.319  1.00 85.68 ? 94  ILE B CD1 1 
ATOM   5126 N  N   . PRO B 2 95  ? 135.404 26.909  58.476  1.00 89.36 ? 95  PRO B N   1 
ATOM   5127 C  CA  . PRO B 2 95  ? 134.192 27.750  58.539  1.00 88.81 ? 95  PRO B CA  1 
ATOM   5128 C  C   . PRO B 2 95  ? 132.822 27.141  58.251  1.00 86.56 ? 95  PRO B C   1 
ATOM   5129 O  O   . PRO B 2 95  ? 132.705 26.227  57.429  1.00 87.04 ? 95  PRO B O   1 
ATOM   5130 C  CB  . PRO B 2 95  ? 134.481 28.849  57.502  1.00 89.40 ? 95  PRO B CB  1 
ATOM   5131 C  CG  . PRO B 2 95  ? 135.983 28.805  57.308  1.00 90.36 ? 95  PRO B CG  1 
ATOM   5132 C  CD  . PRO B 2 95  ? 136.259 27.333  57.355  1.00 90.00 ? 95  PRO B CD  1 
ATOM   5133 N  N   . HIS B 2 96  ? 131.784 27.673  58.905  1.00 83.72 ? 96  HIS B N   1 
ATOM   5134 C  CA  . HIS B 2 96  ? 130.436 27.207  58.617  1.00 80.82 ? 96  HIS B CA  1 
ATOM   5135 C  C   . HIS B 2 96  ? 129.529 28.302  58.093  1.00 78.28 ? 96  HIS B C   1 
ATOM   5136 O  O   . HIS B 2 96  ? 129.159 29.223  58.824  1.00 76.83 ? 96  HIS B O   1 
ATOM   5137 C  CB  . HIS B 2 96  ? 129.722 26.502  59.776  1.00 80.46 ? 96  HIS B CB  1 
ATOM   5138 C  CG  . HIS B 2 96  ? 128.339 26.025  59.409  1.00 80.87 ? 96  HIS B CG  1 
ATOM   5139 N  ND1 . HIS B 2 96  ? 127.249 26.872  59.347  1.00 79.15 ? 96  HIS B ND1 1 
ATOM   5140 C  CD2 . HIS B 2 96  ? 127.890 24.811  59.003  1.00 79.41 ? 96  HIS B CD2 1 
ATOM   5141 C  CE1 . HIS B 2 96  ? 126.194 26.202  58.917  1.00 78.46 ? 96  HIS B CE1 1 
ATOM   5142 N  NE2 . HIS B 2 96  ? 126.554 24.949  58.703  1.00 78.25 ? 96  HIS B NE2 1 
ATOM   5143 N  N   . PRO B 2 97  ? 129.146 28.184  56.810  1.00 76.36 ? 97  PRO B N   1 
ATOM   5144 C  CA  . PRO B 2 97  ? 128.273 29.057  56.024  1.00 74.46 ? 97  PRO B CA  1 
ATOM   5145 C  C   . PRO B 2 97  ? 126.793 28.775  56.337  1.00 72.41 ? 97  PRO B C   1 
ATOM   5146 O  O   . PRO B 2 97  ? 126.286 27.691  56.042  1.00 72.24 ? 97  PRO B O   1 
ATOM   5147 C  CB  . PRO B 2 97  ? 128.617 28.657  54.587  1.00 75.44 ? 97  PRO B CB  1 
ATOM   5148 C  CG  . PRO B 2 97  ? 128.945 27.198  54.716  1.00 75.06 ? 97  PRO B CG  1 
ATOM   5149 C  CD  . PRO B 2 97  ? 129.821 27.208  55.930  1.00 75.92 ? 97  PRO B CD  1 
ATOM   5150 N  N   . ALA B 2 98  ? 126.112 29.753  56.925  1.00 69.53 ? 98  ALA B N   1 
ATOM   5151 C  CA  . ALA B 2 98  ? 124.701 29.617  57.286  1.00 67.04 ? 98  ALA B CA  1 
ATOM   5152 C  C   . ALA B 2 98  ? 123.755 29.276  56.134  1.00 65.12 ? 98  ALA B C   1 
ATOM   5153 O  O   . ALA B 2 98  ? 123.194 28.183  56.074  1.00 65.02 ? 98  ALA B O   1 
ATOM   5154 C  CB  . ALA B 2 98  ? 124.219 30.881  57.978  1.00 67.54 ? 98  ALA B CB  1 
ATOM   5155 N  N   . GLY B 2 99  ? 123.602 30.222  55.218  1.00 62.68 ? 99  GLY B N   1 
ATOM   5156 C  CA  . GLY B 2 99  ? 122.707 30.077  54.082  1.00 60.34 ? 99  GLY B CA  1 
ATOM   5157 C  C   . GLY B 2 99  ? 122.502 28.762  53.361  1.00 59.94 ? 99  GLY B C   1 
ATOM   5158 O  O   . GLY B 2 99  ? 121.535 28.627  52.621  1.00 58.13 ? 99  GLY B O   1 
ATOM   5159 N  N   . LEU B 2 100 ? 123.379 27.788  53.565  1.00 61.71 ? 100 LEU B N   1 
ATOM   5160 C  CA  . LEU B 2 100 ? 123.244 26.512  52.869  1.00 62.45 ? 100 LEU B CA  1 
ATOM   5161 C  C   . LEU B 2 100 ? 121.881 25.888  53.118  1.00 62.38 ? 100 LEU B C   1 
ATOM   5162 O  O   . LEU B 2 100 ? 121.168 25.530  52.177  1.00 61.58 ? 100 LEU B O   1 
ATOM   5163 C  CB  . LEU B 2 100 ? 124.356 25.528  53.272  1.00 62.97 ? 100 LEU B CB  1 
ATOM   5164 C  CG  . LEU B 2 100 ? 124.382 24.231  52.437  1.00 63.71 ? 100 LEU B CG  1 
ATOM   5165 C  CD1 . LEU B 2 100 ? 124.691 24.564  50.987  1.00 63.93 ? 100 LEU B CD1 1 
ATOM   5166 C  CD2 . LEU B 2 100 ? 125.404 23.234  52.969  1.00 64.30 ? 100 LEU B CD2 1 
ATOM   5167 N  N   . LYS B 2 101 ? 121.528 25.762  54.391  1.00 62.78 ? 101 LYS B N   1 
ATOM   5168 C  CA  . LYS B 2 101 ? 120.250 25.188  54.766  1.00 63.44 ? 101 LYS B CA  1 
ATOM   5169 C  C   . LYS B 2 101 ? 119.177 25.893  53.934  1.00 63.75 ? 101 LYS B C   1 
ATOM   5170 O  O   . LYS B 2 101 ? 118.212 25.275  53.474  1.00 62.96 ? 101 LYS B O   1 
ATOM   5171 C  CB  . LYS B 2 101 ? 120.017 25.392  56.274  1.00 63.97 ? 101 LYS B CB  1 
ATOM   5172 C  CG  . LYS B 2 101 ? 120.110 26.848  56.743  1.00 62.59 ? 101 LYS B CG  1 
ATOM   5173 C  CD  . LYS B 2 101 ? 121.154 27.025  57.830  1.00 59.81 ? 101 LYS B CD  1 
ATOM   5174 C  CE  . LYS B 2 101 ? 121.176 28.466  58.351  1.00 59.55 ? 101 LYS B CE  1 
ATOM   5175 N  NZ  . LYS B 2 101 ? 122.218 28.717  59.401  1.00 55.42 ? 101 LYS B NZ  1 
ATOM   5176 N  N   . LYS B 2 102 ? 119.428 27.172  53.664  1.00 63.49 ? 102 LYS B N   1 
ATOM   5177 C  CA  . LYS B 2 102 ? 118.513 27.992  52.898  1.00 63.87 ? 102 LYS B CA  1 
ATOM   5178 C  C   . LYS B 2 102 ? 118.471 27.556  51.431  1.00 63.20 ? 102 LYS B C   1 
ATOM   5179 O  O   . LYS B 2 102 ? 117.456 27.731  50.764  1.00 63.38 ? 102 LYS B O   1 
ATOM   5180 C  CB  . LYS B 2 102 ? 118.900 29.467  53.032  1.00 64.61 ? 102 LYS B CB  1 
ATOM   5181 C  CG  . LYS B 2 102 ? 119.199 29.914  54.475  1.00 64.39 ? 102 LYS B CG  1 
ATOM   5182 C  CD  . LYS B 2 102 ? 119.747 31.352  54.511  1.00 65.86 ? 102 LYS B CD  1 
ATOM   5183 C  CE  . LYS B 2 102 ? 120.257 31.760  55.906  1.00 65.32 ? 102 LYS B CE  1 
ATOM   5184 N  NZ  . LYS B 2 102 ? 121.026 33.049  55.885  1.00 65.25 ? 102 LYS B NZ  1 
ATOM   5185 N  N   . LYS B 2 103 ? 119.578 27.029  50.919  1.00 63.69 ? 103 LYS B N   1 
ATOM   5186 C  CA  . LYS B 2 103 ? 119.616 26.555  49.535  1.00 64.52 ? 103 LYS B CA  1 
ATOM   5187 C  C   . LYS B 2 103 ? 118.603 25.432  49.303  1.00 64.59 ? 103 LYS B C   1 
ATOM   5188 O  O   . LYS B 2 103 ? 118.206 24.734  50.243  1.00 64.01 ? 103 LYS B O   1 
ATOM   5189 C  CB  . LYS B 2 103 ? 121.017 26.076  49.150  1.00 64.63 ? 103 LYS B CB  1 
ATOM   5190 C  CG  . LYS B 2 103 ? 121.959 27.178  48.669  1.00 66.07 ? 103 LYS B CG  1 
ATOM   5191 C  CD  . LYS B 2 103 ? 121.612 27.666  47.257  1.00 66.73 ? 103 LYS B CD  1 
ATOM   5192 C  CE  . LYS B 2 103 ? 122.721 28.544  46.647  1.00 67.70 ? 103 LYS B CE  1 
ATOM   5193 N  NZ  . LYS B 2 103 ? 122.476 28.931  45.217  1.00 66.87 ? 103 LYS B NZ  1 
ATOM   5194 N  N   . LYS B 2 104 ? 118.220 25.249  48.039  1.00 63.88 ? 104 LYS B N   1 
ATOM   5195 C  CA  . LYS B 2 104 ? 117.242 24.233  47.652  1.00 63.34 ? 104 LYS B CA  1 
ATOM   5196 C  C   . LYS B 2 104 ? 117.716 22.784  47.726  1.00 61.85 ? 104 LYS B C   1 
ATOM   5197 O  O   . LYS B 2 104 ? 117.001 21.920  48.236  1.00 62.92 ? 104 LYS B O   1 
ATOM   5198 C  CB  . LYS B 2 104 ? 116.679 24.495  46.242  1.00 64.97 ? 104 LYS B CB  1 
ATOM   5199 C  CG  . LYS B 2 104 ? 115.819 23.330  45.733  1.00 68.33 ? 104 LYS B CG  1 
ATOM   5200 C  CD  . LYS B 2 104 ? 115.175 23.540  44.365  1.00 71.82 ? 104 LYS B CD  1 
ATOM   5201 C  CE  . LYS B 2 104 ? 114.306 22.308  44.012  1.00 74.52 ? 104 LYS B CE  1 
ATOM   5202 N  NZ  . LYS B 2 104 ? 113.520 22.403  42.738  1.00 75.23 ? 104 LYS B NZ  1 
ATOM   5203 N  N   . SER B 2 105 ? 118.892 22.501  47.185  1.00 59.85 ? 105 SER B N   1 
ATOM   5204 C  CA  . SER B 2 105 ? 119.380 21.134  47.192  1.00 58.02 ? 105 SER B CA  1 
ATOM   5205 C  C   . SER B 2 105 ? 120.872 21.032  47.461  1.00 57.23 ? 105 SER B C   1 
ATOM   5206 O  O   . SER B 2 105 ? 121.691 21.723  46.835  1.00 57.45 ? 105 SER B O   1 
ATOM   5207 C  CB  . SER B 2 105 ? 119.056 20.469  45.850  1.00 58.20 ? 105 SER B CB  1 
ATOM   5208 O  OG  . SER B 2 105 ? 117.718 20.713  45.448  1.00 56.87 ? 105 SER B OG  1 
ATOM   5209 N  N   . VAL B 2 106 ? 121.232 20.143  48.372  1.00 55.10 ? 106 VAL B N   1 
ATOM   5210 C  CA  . VAL B 2 106 ? 122.627 19.950  48.701  1.00 54.33 ? 106 VAL B CA  1 
ATOM   5211 C  C   . VAL B 2 106 ? 122.956 18.478  48.630  1.00 53.99 ? 106 VAL B C   1 
ATOM   5212 O  O   . VAL B 2 106 ? 122.143 17.640  49.027  1.00 54.18 ? 106 VAL B O   1 
ATOM   5213 C  CB  . VAL B 2 106 ? 122.941 20.446  50.104  1.00 53.54 ? 106 VAL B CB  1 
ATOM   5214 C  CG1 . VAL B 2 106 ? 124.433 20.284  50.402  1.00 52.77 ? 106 VAL B CG1 1 
ATOM   5215 C  CG2 . VAL B 2 106 ? 122.496 21.893  50.247  1.00 53.56 ? 106 VAL B CG2 1 
ATOM   5216 N  N   . THR B 2 107 ? 124.133 18.170  48.094  1.00 53.37 ? 107 THR B N   1 
ATOM   5217 C  CA  . THR B 2 107 ? 124.575 16.797  47.967  1.00 50.38 ? 107 THR B CA  1 
ATOM   5218 C  C   . THR B 2 107 ? 125.825 16.623  48.787  1.00 49.48 ? 107 THR B C   1 
ATOM   5219 O  O   . THR B 2 107 ? 126.498 17.599  49.149  1.00 48.35 ? 107 THR B O   1 
ATOM   5220 C  CB  . THR B 2 107 ? 124.873 16.450  46.507  1.00 48.66 ? 107 THR B CB  1 
ATOM   5221 O  OG1 . THR B 2 107 ? 123.823 16.983  45.685  1.00 44.99 ? 107 THR B OG1 1 
ATOM   5222 C  CG2 . THR B 2 107 ? 124.943 14.930  46.326  1.00 48.87 ? 107 THR B CG2 1 
ATOM   5223 N  N   . VAL B 2 108 ? 126.114 15.375  49.092  1.00 49.19 ? 108 VAL B N   1 
ATOM   5224 C  CA  . VAL B 2 108 ? 127.277 15.080  49.853  1.00 50.39 ? 108 VAL B CA  1 
ATOM   5225 C  C   . VAL B 2 108 ? 128.147 14.204  49.029  1.00 50.26 ? 108 VAL B C   1 
ATOM   5226 O  O   . VAL B 2 108 ? 127.671 13.244  48.373  1.00 49.00 ? 108 VAL B O   1 
ATOM   5227 C  CB  . VAL B 2 108 ? 126.969 14.318  51.118  1.00 51.42 ? 108 VAL B CB  1 
ATOM   5228 C  CG1 . VAL B 2 108 ? 128.168 14.385  52.042  1.00 49.29 ? 108 VAL B CG1 1 
ATOM   5229 C  CG2 . VAL B 2 108 ? 125.701 14.847  51.756  1.00 51.86 ? 108 VAL B CG2 1 
ATOM   5230 N  N   . LEU B 2 109 ? 129.436 14.511  49.121  1.00 50.89 ? 109 LEU B N   1 
ATOM   5231 C  CA  . LEU B 2 109 ? 130.481 13.788  48.410  1.00 51.08 ? 109 LEU B CA  1 
ATOM   5232 C  C   . LEU B 2 109 ? 131.595 13.488  49.375  1.00 50.37 ? 109 LEU B C   1 
ATOM   5233 O  O   . LEU B 2 109 ? 132.068 14.367  50.057  1.00 48.32 ? 109 LEU B O   1 
ATOM   5234 C  CB  . LEU B 2 109 ? 131.044 14.635  47.270  1.00 51.33 ? 109 LEU B CB  1 
ATOM   5235 C  CG  . LEU B 2 109 ? 130.049 15.238  46.260  1.00 51.93 ? 109 LEU B CG  1 
ATOM   5236 C  CD1 . LEU B 2 109 ? 130.812 16.005  45.213  1.00 53.03 ? 109 LEU B CD1 1 
ATOM   5237 C  CD2 . LEU B 2 109 ? 129.207 14.168  45.596  1.00 51.75 ? 109 LEU B CD2 1 
ATOM   5238 N  N   . ASP B 2 110 ? 131.959 12.228  49.501  1.00 52.06 ? 110 ASP B N   1 
ATOM   5239 C  CA  . ASP B 2 110 ? 133.027 11.898  50.410  1.00 55.02 ? 110 ASP B CA  1 
ATOM   5240 C  C   . ASP B 2 110 ? 134.339 12.231  49.738  1.00 56.71 ? 110 ASP B C   1 
ATOM   5241 O  O   . ASP B 2 110 ? 134.679 11.687  48.676  1.00 58.88 ? 110 ASP B O   1 
ATOM   5242 C  CB  . ASP B 2 110 ? 133.003 10.422  50.820  1.00 57.04 ? 110 ASP B CB  1 
ATOM   5243 C  CG  . ASP B 2 110 ? 134.052 10.097  51.896  1.00 57.48 ? 110 ASP B CG  1 
ATOM   5244 O  OD1 . ASP B 2 110 ? 133.957 10.681  52.995  1.00 56.46 ? 110 ASP B OD1 1 
ATOM   5245 O  OD2 . ASP B 2 110 ? 134.993 9.308   51.643  1.00 57.33 ? 110 ASP B OD2 1 
ATOM   5246 N  N   . VAL B 2 111 ? 135.029 13.194  50.326  1.00 56.95 ? 111 VAL B N   1 
ATOM   5247 C  CA  . VAL B 2 111 ? 136.325 13.625  49.851  1.00 56.59 ? 111 VAL B CA  1 
ATOM   5248 C  C   . VAL B 2 111 ? 137.383 13.102  50.852  1.00 56.38 ? 111 VAL B C   1 
ATOM   5249 O  O   . VAL B 2 111 ? 138.155 13.871  51.428  1.00 56.13 ? 111 VAL B O   1 
ATOM   5250 C  CB  . VAL B 2 111 ? 136.328 15.161  49.754  1.00 55.84 ? 111 VAL B CB  1 
ATOM   5251 C  CG1 . VAL B 2 111 ? 137.630 15.647  49.158  1.00 56.66 ? 111 VAL B CG1 1 
ATOM   5252 C  CG2 . VAL B 2 111 ? 135.154 15.616  48.889  1.00 52.85 ? 111 VAL B CG2 1 
ATOM   5253 N  N   . GLY B 2 112 ? 137.379 11.790  51.079  1.00 55.29 ? 112 GLY B N   1 
ATOM   5254 C  CA  . GLY B 2 112 ? 138.301 11.193  52.023  1.00 55.02 ? 112 GLY B CA  1 
ATOM   5255 C  C   . GLY B 2 112 ? 139.538 10.530  51.466  1.00 56.95 ? 112 GLY B C   1 
ATOM   5256 O  O   . GLY B 2 112 ? 140.611 10.662  52.065  1.00 55.25 ? 112 GLY B O   1 
ATOM   5257 N  N   . ASP B 2 113 ? 139.406 9.826   50.338  1.00 58.36 ? 113 ASP B N   1 
ATOM   5258 C  CA  . ASP B 2 113 ? 140.538 9.130   49.696  1.00 59.30 ? 113 ASP B CA  1 
ATOM   5259 C  C   . ASP B 2 113 ? 141.727 10.051  49.479  1.00 59.49 ? 113 ASP B C   1 
ATOM   5260 O  O   . ASP B 2 113 ? 142.849 9.599   49.247  1.00 58.69 ? 113 ASP B O   1 
ATOM   5261 C  CB  . ASP B 2 113 ? 140.119 8.481   48.364  1.00 60.54 ? 113 ASP B CB  1 
ATOM   5262 C  CG  . ASP B 2 113 ? 139.203 7.266   48.553  1.00 61.95 ? 113 ASP B CG  1 
ATOM   5263 O  OD1 . ASP B 2 113 ? 139.513 6.404   49.400  1.00 62.01 ? 113 ASP B OD1 1 
ATOM   5264 O  OD2 . ASP B 2 113 ? 138.169 7.181   47.854  1.00 61.55 ? 113 ASP B OD2 1 
ATOM   5265 N  N   . ALA B 2 114 ? 141.444 11.348  49.585  1.00 60.95 ? 114 ALA B N   1 
ATOM   5266 C  CA  . ALA B 2 114 ? 142.411 12.427  49.451  1.00 60.92 ? 114 ALA B CA  1 
ATOM   5267 C  C   . ALA B 2 114 ? 143.534 12.328  50.499  1.00 61.94 ? 114 ALA B C   1 
ATOM   5268 O  O   . ALA B 2 114 ? 144.678 11.989  50.172  1.00 62.55 ? 114 ALA B O   1 
ATOM   5269 C  CB  . ALA B 2 114 ? 141.684 13.770  49.586  1.00 59.49 ? 114 ALA B CB  1 
ATOM   5270 N  N   . TYR B 2 115 ? 143.172 12.582  51.757  1.00 61.52 ? 115 TYR B N   1 
ATOM   5271 C  CA  . TYR B 2 115 ? 144.069 12.563  52.925  1.00 61.04 ? 115 TYR B CA  1 
ATOM   5272 C  C   . TYR B 2 115 ? 145.167 11.511  52.898  1.00 60.55 ? 115 TYR B C   1 
ATOM   5273 O  O   . TYR B 2 115 ? 146.254 11.724  53.433  1.00 59.56 ? 115 TYR B O   1 
ATOM   5274 C  CB  . TYR B 2 115 ? 143.254 12.320  54.186  1.00 61.43 ? 115 TYR B CB  1 
ATOM   5275 C  CG  . TYR B 2 115 ? 142.119 13.273  54.386  1.00 61.32 ? 115 TYR B CG  1 
ATOM   5276 C  CD1 . TYR B 2 115 ? 141.062 13.336  53.472  1.00 62.15 ? 115 TYR B CD1 1 
ATOM   5277 C  CD2 . TYR B 2 115 ? 142.088 14.108  55.485  1.00 60.75 ? 115 TYR B CD2 1 
ATOM   5278 C  CE1 . TYR B 2 115 ? 140.009 14.216  53.652  1.00 61.91 ? 115 TYR B CE1 1 
ATOM   5279 C  CE2 . TYR B 2 115 ? 141.042 14.983  55.675  1.00 61.00 ? 115 TYR B CE2 1 
ATOM   5280 C  CZ  . TYR B 2 115 ? 140.007 15.044  54.759  1.00 60.69 ? 115 TYR B CZ  1 
ATOM   5281 O  OH  . TYR B 2 115 ? 139.005 15.971  54.931  1.00 60.00 ? 115 TYR B OH  1 
ATOM   5282 N  N   . PHE B 2 116 ? 144.846 10.367  52.306  1.00 61.69 ? 116 PHE B N   1 
ATOM   5283 C  CA  . PHE B 2 116 ? 145.744 9.224   52.165  1.00 62.52 ? 116 PHE B CA  1 
ATOM   5284 C  C   . PHE B 2 116 ? 147.073 9.534   51.470  1.00 61.82 ? 116 PHE B C   1 
ATOM   5285 O  O   . PHE B 2 116 ? 147.787 8.620   51.045  1.00 60.82 ? 116 PHE B O   1 
ATOM   5286 C  CB  . PHE B 2 116 ? 145.040 8.135   51.357  1.00 65.53 ? 116 PHE B CB  1 
ATOM   5287 C  CG  . PHE B 2 116 ? 143.990 7.368   52.121  1.00 68.12 ? 116 PHE B CG  1 
ATOM   5288 C  CD1 . PHE B 2 116 ? 144.097 7.171   53.506  1.00 69.32 ? 116 PHE B CD1 1 
ATOM   5289 C  CD2 . PHE B 2 116 ? 142.931 6.764   51.433  1.00 68.66 ? 116 PHE B CD2 1 
ATOM   5290 C  CE1 . PHE B 2 116 ? 143.160 6.378   54.197  1.00 68.99 ? 116 PHE B CE1 1 
ATOM   5291 C  CE2 . PHE B 2 116 ? 141.993 5.973   52.108  1.00 69.21 ? 116 PHE B CE2 1 
ATOM   5292 C  CZ  . PHE B 2 116 ? 142.108 5.775   53.493  1.00 69.10 ? 116 PHE B CZ  1 
ATOM   5293 N  N   . SER B 2 117 ? 147.393 10.811  51.329  1.00 61.09 ? 117 SER B N   1 
ATOM   5294 C  CA  . SER B 2 117 ? 148.614 11.222  50.673  1.00 59.72 ? 117 SER B CA  1 
ATOM   5295 C  C   . SER B 2 117 ? 149.526 11.940  51.643  1.00 59.50 ? 117 SER B C   1 
ATOM   5296 O  O   . SER B 2 117 ? 150.652 11.496  51.913  1.00 58.88 ? 117 SER B O   1 
ATOM   5297 C  CB  . SER B 2 117 ? 148.250 12.176  49.547  1.00 59.52 ? 117 SER B CB  1 
ATOM   5298 O  OG  . SER B 2 117 ? 147.461 13.238  50.068  1.00 58.85 ? 117 SER B OG  1 
ATOM   5299 N  N   . VAL B 2 118 ? 149.028 13.071  52.136  1.00 57.95 ? 118 VAL B N   1 
ATOM   5300 C  CA  . VAL B 2 118 ? 149.763 13.911  53.057  1.00 58.14 ? 118 VAL B CA  1 
ATOM   5301 C  C   . VAL B 2 118 ? 150.154 13.123  54.282  1.00 59.56 ? 118 VAL B C   1 
ATOM   5302 O  O   . VAL B 2 118 ? 149.300 12.539  54.944  1.00 59.33 ? 118 VAL B O   1 
ATOM   5303 C  CB  . VAL B 2 118 ? 148.926 15.110  53.510  1.00 58.12 ? 118 VAL B CB  1 
ATOM   5304 C  CG1 . VAL B 2 118 ? 149.776 16.071  54.343  1.00 58.19 ? 118 VAL B CG1 1 
ATOM   5305 C  CG2 . VAL B 2 118 ? 148.342 15.813  52.313  1.00 58.57 ? 118 VAL B CG2 1 
ATOM   5306 N  N   . PRO B 2 119 ? 151.466 13.038  54.557  1.00 60.68 ? 119 PRO B N   1 
ATOM   5307 C  CA  . PRO B 2 119 ? 152.026 12.318  55.705  1.00 61.11 ? 119 PRO B CA  1 
ATOM   5308 C  C   . PRO B 2 119 ? 151.625 13.014  57.000  1.00 61.22 ? 119 PRO B C   1 
ATOM   5309 O  O   . PRO B 2 119 ? 150.972 14.064  56.975  1.00 60.87 ? 119 PRO B O   1 
ATOM   5310 C  CB  . PRO B 2 119 ? 153.535 12.424  55.463  1.00 60.56 ? 119 PRO B CB  1 
ATOM   5311 C  CG  . PRO B 2 119 ? 153.631 12.484  53.978  1.00 61.05 ? 119 PRO B CG  1 
ATOM   5312 C  CD  . PRO B 2 119 ? 152.546 13.486  53.664  1.00 60.90 ? 119 PRO B CD  1 
ATOM   5313 N  N   . LEU B 2 120 ? 152.041 12.450  58.129  1.00 60.79 ? 120 LEU B N   1 
ATOM   5314 C  CA  . LEU B 2 120 ? 151.703 13.030  59.415  1.00 61.04 ? 120 LEU B CA  1 
ATOM   5315 C  C   . LEU B 2 120 ? 152.935 13.188  60.293  1.00 60.41 ? 120 LEU B C   1 
ATOM   5316 O  O   . LEU B 2 120 ? 153.841 12.354  60.245  1.00 60.19 ? 120 LEU B O   1 
ATOM   5317 C  CB  . LEU B 2 120 ? 150.672 12.153  60.124  1.00 62.40 ? 120 LEU B CB  1 
ATOM   5318 C  CG  . LEU B 2 120 ? 149.970 12.812  61.314  1.00 64.20 ? 120 LEU B CG  1 
ATOM   5319 C  CD1 . LEU B 2 120 ? 148.885 13.737  60.782  1.00 65.28 ? 120 LEU B CD1 1 
ATOM   5320 C  CD2 . LEU B 2 120 ? 149.370 11.769  62.256  1.00 64.92 ? 120 LEU B CD2 1 
ATOM   5321 N  N   . ASP B 2 121 ? 152.962 14.263  61.086  1.00 60.17 ? 121 ASP B N   1 
ATOM   5322 C  CA  . ASP B 2 121 ? 154.072 14.535  61.999  1.00 60.46 ? 121 ASP B CA  1 
ATOM   5323 C  C   . ASP B 2 121 ? 154.383 13.274  62.795  1.00 60.47 ? 121 ASP B C   1 
ATOM   5324 O  O   . ASP B 2 121 ? 153.543 12.766  63.544  1.00 60.86 ? 121 ASP B O   1 
ATOM   5325 C  CB  . ASP B 2 121 ? 153.737 15.695  62.949  1.00 59.16 ? 121 ASP B CB  1 
ATOM   5326 N  N   . GLU B 2 122 ? 155.589 12.760  62.594  1.00 60.98 ? 122 GLU B N   1 
ATOM   5327 C  CA  . GLU B 2 122 ? 156.055 11.554  63.263  1.00 61.07 ? 122 GLU B CA  1 
ATOM   5328 C  C   . GLU B 2 122 ? 155.796 11.467  64.765  1.00 59.58 ? 122 GLU B C   1 
ATOM   5329 O  O   . GLU B 2 122 ? 155.853 10.393  65.340  1.00 59.16 ? 122 GLU B O   1 
ATOM   5330 C  CB  . GLU B 2 122 ? 157.538 11.326  62.957  1.00 62.66 ? 122 GLU B CB  1 
ATOM   5331 C  CG  . GLU B 2 122 ? 158.376 12.604  62.818  1.00 64.84 ? 122 GLU B CG  1 
ATOM   5332 C  CD  . GLU B 2 122 ? 159.749 12.364  62.171  1.00 66.31 ? 122 GLU B CD  1 
ATOM   5333 O  OE1 . GLU B 2 122 ? 159.904 11.372  61.416  1.00 66.18 ? 122 GLU B OE1 1 
ATOM   5334 O  OE2 . GLU B 2 122 ? 160.672 13.178  62.415  1.00 66.15 ? 122 GLU B OE2 1 
ATOM   5335 N  N   . ASP B 2 123 ? 155.466 12.572  65.407  1.00 59.10 ? 123 ASP B N   1 
ATOM   5336 C  CA  . ASP B 2 123 ? 155.214 12.496  66.831  1.00 59.96 ? 123 ASP B CA  1 
ATOM   5337 C  C   . ASP B 2 123 ? 153.730 12.492  67.194  1.00 59.49 ? 123 ASP B C   1 
ATOM   5338 O  O   . ASP B 2 123 ? 153.362 12.556  68.369  1.00 58.56 ? 123 ASP B O   1 
ATOM   5339 C  CB  . ASP B 2 123 ? 156.000 13.584  67.563  1.00 61.86 ? 123 ASP B CB  1 
ATOM   5340 C  CG  . ASP B 2 123 ? 157.513 13.357  67.487  1.00 64.24 ? 123 ASP B CG  1 
ATOM   5341 O  OD1 . ASP B 2 123 ? 158.038 12.552  68.294  1.00 65.32 ? 123 ASP B OD1 1 
ATOM   5342 O  OD2 . ASP B 2 123 ? 158.171 13.967  66.610  1.00 65.46 ? 123 ASP B OD2 1 
ATOM   5343 N  N   . PHE B 2 124 ? 152.878 12.361  66.183  1.00 58.89 ? 124 PHE B N   1 
ATOM   5344 C  CA  . PHE B 2 124 ? 151.443 12.334  66.422  1.00 57.74 ? 124 PHE B CA  1 
ATOM   5345 C  C   . PHE B 2 124 ? 150.800 11.028  65.982  1.00 56.60 ? 124 PHE B C   1 
ATOM   5346 O  O   . PHE B 2 124 ? 149.784 10.615  66.545  1.00 56.70 ? 124 PHE B O   1 
ATOM   5347 C  CB  . PHE B 2 124 ? 150.745 13.513  65.751  1.00 58.84 ? 124 PHE B CB  1 
ATOM   5348 C  CG  . PHE B 2 124 ? 149.342 13.733  66.238  1.00 59.90 ? 124 PHE B CG  1 
ATOM   5349 C  CD1 . PHE B 2 124 ? 149.110 14.377  67.451  1.00 60.19 ? 124 PHE B CD1 1 
ATOM   5350 C  CD2 . PHE B 2 124 ? 148.251 13.277  65.493  1.00 61.07 ? 124 PHE B CD2 1 
ATOM   5351 C  CE1 . PHE B 2 124 ? 147.810 14.564  67.916  1.00 60.82 ? 124 PHE B CE1 1 
ATOM   5352 C  CE2 . PHE B 2 124 ? 146.944 13.455  65.945  1.00 60.70 ? 124 PHE B CE2 1 
ATOM   5353 C  CZ  . PHE B 2 124 ? 146.721 14.098  67.156  1.00 61.90 ? 124 PHE B CZ  1 
ATOM   5354 N  N   . ARG B 2 125 ? 151.377 10.376  64.976  1.00 54.40 ? 125 ARG B N   1 
ATOM   5355 C  CA  . ARG B 2 125 ? 150.841 9.098   64.521  1.00 51.20 ? 125 ARG B CA  1 
ATOM   5356 C  C   . ARG B 2 125 ? 150.652 8.250   65.769  1.00 49.17 ? 125 ARG B C   1 
ATOM   5357 O  O   . ARG B 2 125 ? 149.753 7.421   65.844  1.00 47.96 ? 125 ARG B O   1 
ATOM   5358 C  CB  . ARG B 2 125 ? 151.842 8.384   63.619  1.00 51.41 ? 125 ARG B CB  1 
ATOM   5359 C  CG  . ARG B 2 125 ? 152.245 9.124   62.361  1.00 51.79 ? 125 ARG B CG  1 
ATOM   5360 C  CD  . ARG B 2 125 ? 153.269 8.299   61.559  1.00 50.69 ? 125 ARG B CD  1 
ATOM   5361 N  NE  . ARG B 2 125 ? 153.415 8.771   60.185  1.00 46.25 ? 125 ARG B NE  1 
ATOM   5362 C  CZ  . ARG B 2 125 ? 154.517 9.311   59.690  1.00 44.27 ? 125 ARG B CZ  1 
ATOM   5363 N  NH1 . ARG B 2 125 ? 155.603 9.458   60.444  1.00 42.80 ? 125 ARG B NH1 1 
ATOM   5364 N  NH2 . ARG B 2 125 ? 154.515 9.727   58.437  1.00 45.23 ? 125 ARG B NH2 1 
ATOM   5365 N  N   . LYS B 2 126 ? 151.526 8.467   66.750  1.00 46.75 ? 126 LYS B N   1 
ATOM   5366 C  CA  . LYS B 2 126 ? 151.483 7.746   68.006  1.00 45.65 ? 126 LYS B CA  1 
ATOM   5367 C  C   . LYS B 2 126 ? 150.041 7.516   68.465  1.00 44.12 ? 126 LYS B C   1 
ATOM   5368 O  O   . LYS B 2 126 ? 149.648 6.409   68.841  1.00 43.26 ? 126 LYS B O   1 
ATOM   5369 C  CB  . LYS B 2 126 ? 152.261 8.519   69.063  1.00 45.74 ? 126 LYS B CB  1 
ATOM   5370 C  CG  . LYS B 2 126 ? 153.008 7.588   69.985  1.00 49.56 ? 126 LYS B CG  1 
ATOM   5371 C  CD  . LYS B 2 126 ? 153.614 8.284   71.192  1.00 52.07 ? 126 LYS B CD  1 
ATOM   5372 C  CE  . LYS B 2 126 ? 154.067 7.250   72.232  1.00 53.06 ? 126 LYS B CE  1 
ATOM   5373 N  NZ  . LYS B 2 126 ? 154.605 7.879   73.473  1.00 52.65 ? 126 LYS B NZ  1 
ATOM   5374 N  N   . TYR B 2 127 ? 149.232 8.547   68.290  1.00 43.32 ? 127 TYR B N   1 
ATOM   5375 C  CA  . TYR B 2 127 ? 147.841 8.527   68.686  1.00 41.68 ? 127 TYR B CA  1 
ATOM   5376 C  C   . TYR B 2 127 ? 146.958 7.785   67.758  1.00 40.35 ? 127 TYR B C   1 
ATOM   5377 O  O   . TYR B 2 127 ? 145.985 7.208   68.223  1.00 39.95 ? 127 TYR B O   1 
ATOM   5378 C  CB  . TYR B 2 127 ? 147.361 9.945   68.857  1.00 42.42 ? 127 TYR B CB  1 
ATOM   5379 C  CG  . TYR B 2 127 ? 148.382 10.656  69.666  1.00 43.37 ? 127 TYR B CG  1 
ATOM   5380 C  CD1 . TYR B 2 127 ? 148.610 10.278  70.973  1.00 43.90 ? 127 TYR B CD1 1 
ATOM   5381 C  CD2 . TYR B 2 127 ? 149.228 11.593  69.093  1.00 44.03 ? 127 TYR B CD2 1 
ATOM   5382 C  CE1 . TYR B 2 127 ? 149.650 10.801  71.688  1.00 45.82 ? 127 TYR B CE1 1 
ATOM   5383 C  CE2 . TYR B 2 127 ? 150.281 12.128  69.800  1.00 45.73 ? 127 TYR B CE2 1 
ATOM   5384 C  CZ  . TYR B 2 127 ? 150.485 11.724  71.107  1.00 47.05 ? 127 TYR B CZ  1 
ATOM   5385 O  OH  . TYR B 2 127 ? 151.510 12.242  71.867  1.00 50.16 ? 127 TYR B OH  1 
ATOM   5386 N  N   . THR B 2 128 ? 147.316 7.745   66.468  1.00 40.12 ? 128 THR B N   1 
ATOM   5387 C  CA  . THR B 2 128 ? 146.528 7.015   65.455  1.00 40.25 ? 128 THR B CA  1 
ATOM   5388 C  C   . THR B 2 128 ? 146.450 5.524   65.768  1.00 39.91 ? 128 THR B C   1 
ATOM   5389 O  O   . THR B 2 128 ? 146.059 4.719   64.918  1.00 39.99 ? 128 THR B O   1 
ATOM   5390 C  CB  . THR B 2 128 ? 147.078 7.146   63.991  1.00 40.12 ? 128 THR B CB  1 
ATOM   5391 O  OG1 . THR B 2 128 ? 148.466 6.802   63.943  1.00 41.80 ? 128 THR B OG1 1 
ATOM   5392 C  CG2 . THR B 2 128 ? 146.867 8.525   63.437  1.00 39.28 ? 128 THR B CG2 1 
ATOM   5393 N  N   . ALA B 2 129 ? 146.925 5.158   66.952  1.00 39.19 ? 129 ALA B N   1 
ATOM   5394 C  CA  . ALA B 2 129 ? 146.895 3.789   67.416  1.00 37.87 ? 129 ALA B CA  1 
ATOM   5395 C  C   . ALA B 2 129 ? 145.482 3.204   67.335  1.00 36.21 ? 129 ALA B C   1 
ATOM   5396 O  O   . ALA B 2 129 ? 144.514 3.779   67.842  1.00 33.72 ? 129 ALA B O   1 
ATOM   5397 C  CB  . ALA B 2 129 ? 147.427 3.717   68.852  1.00 37.42 ? 129 ALA B CB  1 
ATOM   5398 N  N   . PHE B 2 130 ? 145.375 2.098   66.610  1.00 36.52 ? 130 PHE B N   1 
ATOM   5399 C  CA  . PHE B 2 130 ? 144.125 1.373   66.466  1.00 36.40 ? 130 PHE B CA  1 
ATOM   5400 C  C   . PHE B 2 130 ? 144.470 -0.106  66.458  1.00 35.73 ? 130 PHE B C   1 
ATOM   5401 O  O   . PHE B 2 130 ? 145.550 -0.507  65.993  1.00 33.33 ? 130 PHE B O   1 
ATOM   5402 C  CB  . PHE B 2 130 ? 143.349 1.788   65.199  1.00 36.32 ? 130 PHE B CB  1 
ATOM   5403 C  CG  . PHE B 2 130 ? 144.045 1.459   63.906  1.00 37.75 ? 130 PHE B CG  1 
ATOM   5404 C  CD1 . PHE B 2 130 ? 144.966 2.344   63.346  1.00 38.94 ? 130 PHE B CD1 1 
ATOM   5405 C  CD2 . PHE B 2 130 ? 143.756 0.276   63.220  1.00 38.07 ? 130 PHE B CD2 1 
ATOM   5406 C  CE1 . PHE B 2 130 ? 145.583 2.057   62.118  1.00 39.94 ? 130 PHE B CE1 1 
ATOM   5407 C  CE2 . PHE B 2 130 ? 144.372 -0.021  61.988  1.00 37.74 ? 130 PHE B CE2 1 
ATOM   5408 C  CZ  . PHE B 2 130 ? 145.280 0.867   61.439  1.00 38.71 ? 130 PHE B CZ  1 
ATOM   5409 N  N   . THR B 2 131 ? 143.604 -0.904  67.065  1.00 35.52 ? 131 THR B N   1 
ATOM   5410 C  CA  . THR B 2 131 ? 143.815 -2.332  67.106  1.00 36.10 ? 131 THR B CA  1 
ATOM   5411 C  C   . THR B 2 131 ? 142.644 -3.004  66.442  1.00 38.87 ? 131 THR B C   1 
ATOM   5412 O  O   . THR B 2 131 ? 141.541 -2.459  66.414  1.00 38.68 ? 131 THR B O   1 
ATOM   5413 C  CB  . THR B 2 131 ? 143.889 -2.873  68.543  1.00 32.35 ? 131 THR B CB  1 
ATOM   5414 O  OG1 . THR B 2 131 ? 144.835 -2.142  69.292  1.00 29.66 ? 131 THR B OG1 1 
ATOM   5415 C  CG2 . THR B 2 131 ? 144.304 -4.331  68.535  1.00 29.17 ? 131 THR B CG2 1 
ATOM   5416 N  N   . ILE B 2 132 ? 142.934 -4.138  65.818  1.00 43.22 ? 132 ILE B N   1 
ATOM   5417 C  CA  . ILE B 2 132 ? 141.919 -4.971  65.199  1.00 46.93 ? 132 ILE B CA  1 
ATOM   5418 C  C   . ILE B 2 132 ? 142.020 -6.259  66.034  1.00 48.85 ? 132 ILE B C   1 
ATOM   5419 O  O   . ILE B 2 132 ? 143.118 -6.790  66.308  1.00 45.43 ? 132 ILE B O   1 
ATOM   5420 C  CB  . ILE B 2 132 ? 142.111 -5.182  63.668  1.00 47.67 ? 132 ILE B CB  1 
ATOM   5421 C  CG1 . ILE B 2 132 ? 141.227 -6.326  63.158  1.00 48.67 ? 132 ILE B CG1 1 
ATOM   5422 C  CG2 . ILE B 2 132 ? 143.561 -5.361  63.317  1.00 47.99 ? 132 ILE B CG2 1 
ATOM   5423 C  CD1 . ILE B 2 132 ? 141.585 -6.820  61.771  1.00 50.53 ? 132 ILE B CD1 1 
ATOM   5424 N  N   . PRO B 2 133 ? 140.857 -6.691  66.557  1.00 52.16 ? 133 PRO B N   1 
ATOM   5425 C  CA  . PRO B 2 133 ? 140.526 -7.843  67.410  1.00 54.44 ? 133 PRO B CA  1 
ATOM   5426 C  C   . PRO B 2 133 ? 140.782 -9.266  66.912  1.00 55.17 ? 133 PRO B C   1 
ATOM   5427 O  O   . PRO B 2 133 ? 140.456 -9.619  65.770  1.00 55.92 ? 133 PRO B O   1 
ATOM   5428 C  CB  . PRO B 2 133 ? 139.015 -7.672  67.662  1.00 54.81 ? 133 PRO B CB  1 
ATOM   5429 C  CG  . PRO B 2 133 ? 138.708 -6.238  67.257  1.00 54.70 ? 133 PRO B CG  1 
ATOM   5430 C  CD  . PRO B 2 133 ? 139.613 -6.030  66.110  1.00 53.40 ? 133 PRO B CD  1 
ATOM   5431 N  N   . SER B 2 134 ? 141.299 -10.100 67.811  1.00 55.92 ? 134 SER B N   1 
ATOM   5432 C  CA  . SER B 2 134 ? 141.541 -11.509 67.531  1.00 57.05 ? 134 SER B CA  1 
ATOM   5433 C  C   . SER B 2 134 ? 140.359 -12.214 68.220  1.00 56.45 ? 134 SER B C   1 
ATOM   5434 O  O   . SER B 2 134 ? 140.247 -12.182 69.454  1.00 56.77 ? 134 SER B O   1 
ATOM   5435 C  CB  . SER B 2 134 ? 142.856 -11.959 68.156  1.00 57.91 ? 134 SER B CB  1 
ATOM   5436 O  OG  . SER B 2 134 ? 142.839 -11.766 69.552  1.00 57.91 ? 134 SER B OG  1 
ATOM   5437 N  N   . ILE B 2 135 ? 139.452 -12.791 67.432  1.00 54.96 ? 135 ILE B N   1 
ATOM   5438 C  CA  . ILE B 2 135 ? 138.282 -13.466 67.984  1.00 53.64 ? 135 ILE B CA  1 
ATOM   5439 C  C   . ILE B 2 135 ? 138.564 -14.185 69.294  1.00 53.32 ? 135 ILE B C   1 
ATOM   5440 O  O   . ILE B 2 135 ? 139.591 -14.859 69.437  1.00 53.72 ? 135 ILE B O   1 
ATOM   5441 C  CB  . ILE B 2 135 ? 137.710 -14.501 67.008  1.00 53.54 ? 135 ILE B CB  1 
ATOM   5442 C  CG1 . ILE B 2 135 ? 137.215 -13.820 65.734  1.00 53.84 ? 135 ILE B CG1 1 
ATOM   5443 C  CG2 . ILE B 2 135 ? 136.558 -15.261 67.657  1.00 54.40 ? 135 ILE B CG2 1 
ATOM   5444 C  CD1 . ILE B 2 135 ? 136.588 -14.777 64.772  1.00 51.36 ? 135 ILE B CD1 1 
ATOM   5445 N  N   . ASN B 2 136 ? 137.708 -13.944 70.279  1.00 53.12 ? 136 ASN B N   1 
ATOM   5446 C  CA  . ASN B 2 136 ? 137.831 -14.593 71.572  1.00 53.67 ? 136 ASN B CA  1 
ATOM   5447 C  C   . ASN B 2 136 ? 139.181 -14.355 72.288  1.00 52.93 ? 136 ASN B C   1 
ATOM   5448 O  O   . ASN B 2 136 ? 139.650 -15.203 73.043  1.00 52.65 ? 136 ASN B O   1 
ATOM   5449 C  CB  . ASN B 2 136 ? 137.551 -16.086 71.365  1.00 54.97 ? 136 ASN B CB  1 
ATOM   5450 C  CG  . ASN B 2 136 ? 137.344 -16.838 72.659  1.00 57.25 ? 136 ASN B CG  1 
ATOM   5451 O  OD1 . ASN B 2 136 ? 136.508 -16.465 73.487  1.00 58.62 ? 136 ASN B OD1 1 
ATOM   5452 N  ND2 . ASN B 2 136 ? 138.105 -17.915 72.842  1.00 56.26 ? 136 ASN B ND2 1 
ATOM   5453 N  N   . ASN B 2 137 ? 139.789 -13.193 72.040  1.00 52.65 ? 137 ASN B N   1 
ATOM   5454 C  CA  . ASN B 2 137 ? 141.071 -12.778 72.649  1.00 52.18 ? 137 ASN B CA  1 
ATOM   5455 C  C   . ASN B 2 137 ? 142.124 -13.869 72.618  1.00 50.89 ? 137 ASN B C   1 
ATOM   5456 O  O   . ASN B 2 137 ? 142.949 -13.968 73.536  1.00 49.01 ? 137 ASN B O   1 
ATOM   5457 C  CB  . ASN B 2 137 ? 140.877 -12.343 74.110  1.00 54.20 ? 137 ASN B CB  1 
ATOM   5458 C  CG  . ASN B 2 137 ? 139.866 -11.205 74.270  1.00 55.23 ? 137 ASN B CG  1 
ATOM   5459 O  OD1 . ASN B 2 137 ? 139.903 -10.210 73.550  1.00 56.78 ? 137 ASN B OD1 1 
ATOM   5460 N  ND2 . ASN B 2 137 ? 138.980 -11.341 75.241  1.00 55.31 ? 137 ASN B ND2 1 
ATOM   5461 N  N   . GLU B 2 138 ? 142.102 -14.688 71.571  1.00 50.74 ? 138 GLU B N   1 
ATOM   5462 C  CA  . GLU B 2 138 ? 143.053 -15.789 71.446  1.00 51.23 ? 138 GLU B CA  1 
ATOM   5463 C  C   . GLU B 2 138 ? 144.432 -15.305 70.979  1.00 51.43 ? 138 GLU B C   1 
ATOM   5464 O  O   . GLU B 2 138 ? 145.474 -15.834 71.393  1.00 50.44 ? 138 GLU B O   1 
ATOM   5465 C  CB  . GLU B 2 138 ? 142.490 -16.862 70.505  1.00 51.07 ? 138 GLU B CB  1 
ATOM   5466 C  CG  . GLU B 2 138 ? 141.303 -17.629 71.100  1.00 50.58 ? 138 GLU B CG  1 
ATOM   5467 C  CD  . GLU B 2 138 ? 140.702 -18.679 70.160  1.00 49.53 ? 138 GLU B CD  1 
ATOM   5468 O  OE1 . GLU B 2 138 ? 140.385 -18.334 69.001  1.00 49.43 ? 138 GLU B OE1 1 
ATOM   5469 O  OE2 . GLU B 2 138 ? 140.511 -19.841 70.587  1.00 47.94 ? 138 GLU B OE2 1 
ATOM   5470 N  N   . THR B 2 139 ? 144.427 -14.293 70.122  1.00 50.93 ? 139 THR B N   1 
ATOM   5471 C  CA  . THR B 2 139 ? 145.657 -13.722 69.603  1.00 51.31 ? 139 THR B CA  1 
ATOM   5472 C  C   . THR B 2 139 ? 145.806 -12.320 70.212  1.00 50.29 ? 139 THR B C   1 
ATOM   5473 O  O   . THR B 2 139 ? 144.857 -11.797 70.800  1.00 49.04 ? 139 THR B O   1 
ATOM   5474 C  CB  . THR B 2 139 ? 145.584 -13.696 68.063  1.00 52.65 ? 139 THR B CB  1 
ATOM   5475 O  OG1 . THR B 2 139 ? 144.724 -14.764 67.628  1.00 53.20 ? 139 THR B OG1 1 
ATOM   5476 C  CG2 . THR B 2 139 ? 146.966 -13.914 67.451  1.00 53.45 ? 139 THR B CG2 1 
ATOM   5477 N  N   . PRO B 2 140 ? 147.019 -11.728 70.161  1.00 50.21 ? 140 PRO B N   1 
ATOM   5478 C  CA  . PRO B 2 140 ? 147.140 -10.389 70.750  1.00 51.28 ? 140 PRO B CA  1 
ATOM   5479 C  C   . PRO B 2 140 ? 146.547 -9.209  69.966  1.00 52.29 ? 140 PRO B C   1 
ATOM   5480 O  O   . PRO B 2 140 ? 146.715 -8.053  70.367  1.00 54.24 ? 140 PRO B O   1 
ATOM   5481 C  CB  . PRO B 2 140 ? 148.652 -10.243 70.958  1.00 50.32 ? 140 PRO B CB  1 
ATOM   5482 C  CG  . PRO B 2 140 ? 149.227 -11.140 69.905  1.00 50.44 ? 140 PRO B CG  1 
ATOM   5483 C  CD  . PRO B 2 140 ? 148.355 -12.312 69.930  1.00 49.98 ? 140 PRO B CD  1 
ATOM   5484 N  N   . GLY B 2 141 ? 145.834 -9.487  68.879  1.00 51.92 ? 141 GLY B N   1 
ATOM   5485 C  CA  . GLY B 2 141 ? 145.232 -8.411  68.108  1.00 51.35 ? 141 GLY B CA  1 
ATOM   5486 C  C   . GLY B 2 141 ? 146.223 -7.668  67.235  1.00 51.45 ? 141 GLY B C   1 
ATOM   5487 O  O   . GLY B 2 141 ? 147.359 -7.380  67.638  1.00 50.94 ? 141 GLY B O   1 
ATOM   5488 N  N   . ILE B 2 142 ? 145.782 -7.318  66.035  1.00 51.62 ? 142 ILE B N   1 
ATOM   5489 C  CA  . ILE B 2 142 ? 146.664 -6.625  65.111  1.00 52.22 ? 142 ILE B CA  1 
ATOM   5490 C  C   . ILE B 2 142 ? 146.695 -5.135  65.413  1.00 51.95 ? 142 ILE B C   1 
ATOM   5491 O  O   . ILE B 2 142 ? 145.673 -4.450  65.306  1.00 51.89 ? 142 ILE B O   1 
ATOM   5492 C  CB  . ILE B 2 142 ? 146.231 -6.807  63.627  1.00 54.00 ? 142 ILE B CB  1 
ATOM   5493 C  CG1 . ILE B 2 142 ? 145.735 -8.234  63.345  1.00 54.55 ? 142 ILE B CG1 1 
ATOM   5494 C  CG2 . ILE B 2 142 ? 147.406 -6.483  62.709  1.00 54.06 ? 142 ILE B CG2 1 
ATOM   5495 C  CD1 . ILE B 2 142 ? 145.284 -8.470  61.889  1.00 54.43 ? 142 ILE B CD1 1 
ATOM   5496 N  N   . ARG B 2 143 ? 147.861 -4.629  65.798  1.00 52.07 ? 143 ARG B N   1 
ATOM   5497 C  CA  . ARG B 2 143 ? 147.996 -3.202  66.085  1.00 52.24 ? 143 ARG B CA  1 
ATOM   5498 C  C   . ARG B 2 143 ? 148.782 -2.396  65.056  1.00 51.00 ? 143 ARG B C   1 
ATOM   5499 O  O   . ARG B 2 143 ? 149.995 -2.572  64.895  1.00 49.38 ? 143 ARG B O   1 
ATOM   5500 C  CB  . ARG B 2 143 ? 148.545 -2.986  67.489  1.00 53.52 ? 143 ARG B CB  1 
ATOM   5501 C  CG  . ARG B 2 143 ? 147.464 -3.150  68.509  1.00 54.15 ? 143 ARG B CG  1 
ATOM   5502 C  CD  . ARG B 2 143 ? 147.990 -3.103  69.903  1.00 57.17 ? 143 ARG B CD  1 
ATOM   5503 N  NE  . ARG B 2 143 ? 148.507 -1.807  70.353  1.00 59.14 ? 143 ARG B NE  1 
ATOM   5504 C  CZ  . ARG B 2 143 ? 147.855 -0.648  70.288  1.00 59.71 ? 143 ARG B CZ  1 
ATOM   5505 N  NH1 . ARG B 2 143 ? 146.640 -0.577  69.759  1.00 57.40 ? 143 ARG B NH1 1 
ATOM   5506 N  NH2 . ARG B 2 143 ? 148.376 0.419   70.880  1.00 59.87 ? 143 ARG B NH2 1 
ATOM   5507 N  N   . TYR B 2 144 ? 148.065 -1.513  64.365  1.00 50.01 ? 144 TYR B N   1 
ATOM   5508 C  CA  . TYR B 2 144 ? 148.644 -0.657  63.343  1.00 47.93 ? 144 TYR B CA  1 
ATOM   5509 C  C   . TYR B 2 144 ? 148.719 0.775   63.820  1.00 47.09 ? 144 TYR B C   1 
ATOM   5510 O  O   . TYR B 2 144 ? 148.311 1.118   64.930  1.00 46.57 ? 144 TYR B O   1 
ATOM   5511 C  CB  . TYR B 2 144 ? 147.800 -0.659  62.079  1.00 47.80 ? 144 TYR B CB  1 
ATOM   5512 C  CG  . TYR B 2 144 ? 147.800 -1.928  61.286  1.00 49.77 ? 144 TYR B CG  1 
ATOM   5513 C  CD1 . TYR B 2 144 ? 148.996 -2.496  60.837  1.00 52.13 ? 144 TYR B CD1 1 
ATOM   5514 C  CD2 . TYR B 2 144 ? 146.595 -2.531  60.914  1.00 51.44 ? 144 TYR B CD2 1 
ATOM   5515 C  CE1 . TYR B 2 144 ? 148.997 -3.638  60.019  1.00 53.58 ? 144 TYR B CE1 1 
ATOM   5516 C  CE2 . TYR B 2 144 ? 146.574 -3.672  60.101  1.00 52.95 ? 144 TYR B CE2 1 
ATOM   5517 C  CZ  . TYR B 2 144 ? 147.777 -4.222  59.646  1.00 53.85 ? 144 TYR B CZ  1 
ATOM   5518 O  OH  . TYR B 2 144 ? 147.758 -5.313  58.791  1.00 51.05 ? 144 TYR B OH  1 
ATOM   5519 N  N   . GLN B 2 145 ? 149.209 1.611   62.925  1.00 46.52 ? 145 GLN B N   1 
ATOM   5520 C  CA  . GLN B 2 145 ? 149.351 3.028   63.160  1.00 47.00 ? 145 GLN B CA  1 
ATOM   5521 C  C   . GLN B 2 145 ? 148.958 3.673   61.830  1.00 45.13 ? 145 GLN B C   1 
ATOM   5522 O  O   . GLN B 2 145 ? 148.606 2.989   60.866  1.00 43.47 ? 145 GLN B O   1 
ATOM   5523 C  CB  . GLN B 2 145 ? 150.808 3.348   63.524  1.00 49.44 ? 145 GLN B CB  1 
ATOM   5524 C  CG  . GLN B 2 145 ? 151.028 4.678   64.261  1.00 52.55 ? 145 GLN B CG  1 
ATOM   5525 C  CD  . GLN B 2 145 ? 152.317 4.679   65.092  1.00 54.79 ? 145 GLN B CD  1 
ATOM   5526 O  OE1 . GLN B 2 145 ? 153.238 3.908   64.829  1.00 56.29 ? 145 GLN B OE1 1 
ATOM   5527 N  NE2 . GLN B 2 145 ? 152.365 5.516   66.123  1.00 54.75 ? 145 GLN B NE2 1 
ATOM   5528 N  N   . TYR B 2 146 ? 148.966 4.989   61.790  1.00 44.46 ? 146 TYR B N   1 
ATOM   5529 C  CA  . TYR B 2 146 ? 148.624 5.683   60.575  1.00 42.64 ? 146 TYR B CA  1 
ATOM   5530 C  C   . TYR B 2 146 ? 149.856 6.455   60.184  1.00 39.31 ? 146 TYR B C   1 
ATOM   5531 O  O   . TYR B 2 146 ? 150.597 6.932   61.049  1.00 37.37 ? 146 TYR B O   1 
ATOM   5532 C  CB  . TYR B 2 146 ? 147.460 6.623   60.819  1.00 45.76 ? 146 TYR B CB  1 
ATOM   5533 C  CG  . TYR B 2 146 ? 146.163 6.092   60.298  1.00 49.24 ? 146 TYR B CG  1 
ATOM   5534 C  CD1 . TYR B 2 146 ? 145.811 6.286   58.962  1.00 50.80 ? 146 TYR B CD1 1 
ATOM   5535 C  CD2 . TYR B 2 146 ? 145.268 5.424   61.134  1.00 49.04 ? 146 TYR B CD2 1 
ATOM   5536 C  CE1 . TYR B 2 146 ? 144.591 5.837   58.464  1.00 51.94 ? 146 TYR B CE1 1 
ATOM   5537 C  CE2 . TYR B 2 146 ? 144.042 4.968   60.645  1.00 51.40 ? 146 TYR B CE2 1 
ATOM   5538 C  CZ  . TYR B 2 146 ? 143.710 5.185   59.304  1.00 52.71 ? 146 TYR B CZ  1 
ATOM   5539 O  OH  . TYR B 2 146 ? 142.489 4.798   58.795  1.00 54.36 ? 146 TYR B OH  1 
ATOM   5540 N  N   . ASN B 2 147 ? 150.092 6.542   58.884  1.00 35.20 ? 147 ASN B N   1 
ATOM   5541 C  CA  . ASN B 2 147 ? 151.258 7.245   58.379  1.00 30.77 ? 147 ASN B CA  1 
ATOM   5542 C  C   . ASN B 2 147 ? 150.848 8.515   57.646  1.00 28.24 ? 147 ASN B C   1 
ATOM   5543 O  O   . ASN B 2 147 ? 151.632 9.465   57.547  1.00 25.71 ? 147 ASN B O   1 
ATOM   5544 C  CB  . ASN B 2 147 ? 152.096 6.320   57.478  1.00 28.61 ? 147 ASN B CB  1 
ATOM   5545 C  CG  . ASN B 2 147 ? 152.560 5.067   58.197  1.00 23.66 ? 147 ASN B CG  1 
ATOM   5546 O  OD1 . ASN B 2 147 ? 151.771 4.172   58.431  1.00 19.92 ? 147 ASN B OD1 1 
ATOM   5547 N  ND2 . ASN B 2 147 ? 153.823 5.030   58.606  1.00 20.18 ? 147 ASN B ND2 1 
ATOM   5548 N  N   . VAL B 2 148 ? 149.626 8.518   57.116  1.00 27.09 ? 148 VAL B N   1 
ATOM   5549 C  CA  . VAL B 2 148 ? 149.111 9.692   56.409  1.00 23.55 ? 148 VAL B CA  1 
ATOM   5550 C  C   . VAL B 2 148 ? 147.961 10.362  57.171  1.00 22.99 ? 148 VAL B C   1 
ATOM   5551 O  O   . VAL B 2 148 ? 147.971 10.432  58.405  1.00 17.94 ? 148 VAL B O   1 
ATOM   5552 C  CB  . VAL B 2 148 ? 148.693 9.382   54.929  1.00 20.79 ? 148 VAL B CB  1 
ATOM   5553 C  CG1 . VAL B 2 148 ? 149.896 8.875   54.140  1.00 18.04 ? 148 VAL B CG1 1 
ATOM   5554 C  CG2 . VAL B 2 148 ? 147.511 8.420   54.884  1.00 18.29 ? 148 VAL B CG2 1 
ATOM   5555 N  N   . LEU B 2 149 ? 147.004 10.906  56.435  1.00 23.46 ? 149 LEU B N   1 
ATOM   5556 C  CA  . LEU B 2 149 ? 145.896 11.553  57.080  1.00 24.29 ? 149 LEU B CA  1 
ATOM   5557 C  C   . LEU B 2 149 ? 144.718 10.608  57.193  1.00 24.50 ? 149 LEU B C   1 
ATOM   5558 O  O   . LEU B 2 149 ? 144.270 10.049  56.185  1.00 24.27 ? 149 LEU B O   1 
ATOM   5559 C  CB  . LEU B 2 149 ? 145.526 12.854  56.357  1.00 24.84 ? 149 LEU B CB  1 
ATOM   5560 C  CG  . LEU B 2 149 ? 146.415 14.065  56.688  1.00 24.90 ? 149 LEU B CG  1 
ATOM   5561 C  CD1 . LEU B 2 149 ? 145.844 15.311  56.017  1.00 24.33 ? 149 LEU B CD1 1 
ATOM   5562 C  CD2 . LEU B 2 149 ? 146.538 14.263  58.214  1.00 21.80 ? 149 LEU B CD2 1 
ATOM   5563 N  N   . PRO B 2 150 ? 144.309 10.300  58.445  1.00 25.19 ? 150 PRO B N   1 
ATOM   5564 C  CA  . PRO B 2 150 ? 143.198 9.420   58.829  1.00 24.45 ? 150 PRO B CA  1 
ATOM   5565 C  C   . PRO B 2 150 ? 141.811 10.049  58.645  1.00 24.80 ? 150 PRO B C   1 
ATOM   5566 O  O   . PRO B 2 150 ? 141.470 11.062  59.264  1.00 19.70 ? 150 PRO B O   1 
ATOM   5567 C  CB  . PRO B 2 150 ? 143.512 9.098   60.286  1.00 24.86 ? 150 PRO B CB  1 
ATOM   5568 C  CG  . PRO B 2 150 ? 144.270 10.292  60.758  1.00 23.61 ? 150 PRO B CG  1 
ATOM   5569 C  CD  . PRO B 2 150 ? 145.169 10.583  59.612  1.00 24.34 ? 150 PRO B CD  1 
ATOM   5570 N  N   . GLN B 2 151 ? 141.015 9.391   57.805  1.00 27.90 ? 151 GLN B N   1 
ATOM   5571 C  CA  . GLN B 2 151 ? 139.669 9.830   57.450  1.00 31.13 ? 151 GLN B CA  1 
ATOM   5572 C  C   . GLN B 2 151 ? 138.793 10.292  58.592  1.00 32.46 ? 151 GLN B C   1 
ATOM   5573 O  O   . GLN B 2 151 ? 138.091 11.296  58.490  1.00 33.61 ? 151 GLN B O   1 
ATOM   5574 C  CB  . GLN B 2 151 ? 138.934 8.733   56.698  1.00 32.92 ? 151 GLN B CB  1 
ATOM   5575 C  CG  . GLN B 2 151 ? 139.535 8.371   55.364  1.00 37.38 ? 151 GLN B CG  1 
ATOM   5576 C  CD  . GLN B 2 151 ? 138.520 7.681   54.450  1.00 41.64 ? 151 GLN B CD  1 
ATOM   5577 O  OE1 . GLN B 2 151 ? 137.307 7.672   54.733  1.00 43.17 ? 151 GLN B OE1 1 
ATOM   5578 N  NE2 . GLN B 2 151 ? 139.001 7.130   53.330  1.00 42.23 ? 151 GLN B NE2 1 
ATOM   5579 N  N   . GLY B 2 152 ? 138.793 9.544   59.678  1.00 33.92 ? 152 GLY B N   1 
ATOM   5580 C  CA  . GLY B 2 152 ? 137.947 9.959   60.774  1.00 35.74 ? 152 GLY B CA  1 
ATOM   5581 C  C   . GLY B 2 152 ? 138.480 11.162  61.532  1.00 37.32 ? 152 GLY B C   1 
ATOM   5582 O  O   . GLY B 2 152 ? 137.692 11.960  62.072  1.00 35.09 ? 152 GLY B O   1 
ATOM   5583 N  N   . TRP B 2 153 ? 139.808 11.314  61.549  1.00 38.38 ? 153 TRP B N   1 
ATOM   5584 C  CA  . TRP B 2 153 ? 140.423 12.399  62.293  1.00 40.44 ? 153 TRP B CA  1 
ATOM   5585 C  C   . TRP B 2 153 ? 140.085 13.760  61.804  1.00 42.67 ? 153 TRP B C   1 
ATOM   5586 O  O   . TRP B 2 153 ? 140.447 14.127  60.692  1.00 44.18 ? 153 TRP B O   1 
ATOM   5587 C  CB  . TRP B 2 153 ? 141.925 12.290  62.351  1.00 40.50 ? 153 TRP B CB  1 
ATOM   5588 C  CG  . TRP B 2 153 ? 142.504 13.233  63.365  1.00 42.05 ? 153 TRP B CG  1 
ATOM   5589 C  CD1 . TRP B 2 153 ? 142.063 13.455  64.653  1.00 41.68 ? 153 TRP B CD1 1 
ATOM   5590 C  CD2 . TRP B 2 153 ? 143.669 14.034  63.200  1.00 43.40 ? 153 TRP B CD2 1 
ATOM   5591 N  NE1 . TRP B 2 153 ? 142.897 14.336  65.295  1.00 42.81 ? 153 TRP B NE1 1 
ATOM   5592 C  CE2 . TRP B 2 153 ? 143.892 14.708  64.426  1.00 44.45 ? 153 TRP B CE2 1 
ATOM   5593 C  CE3 . TRP B 2 153 ? 144.554 14.250  62.135  1.00 42.32 ? 153 TRP B CE3 1 
ATOM   5594 C  CZ2 . TRP B 2 153 ? 144.964 15.578  64.610  1.00 43.60 ? 153 TRP B CZ2 1 
ATOM   5595 C  CZ3 . TRP B 2 153 ? 145.613 15.110  62.319  1.00 42.95 ? 153 TRP B CZ3 1 
ATOM   5596 C  CH2 . TRP B 2 153 ? 145.812 15.765  63.547  1.00 42.98 ? 153 TRP B CH2 1 
ATOM   5597 N  N   . LYS B 2 154 ? 139.529 14.549  62.719  1.00 45.53 ? 154 LYS B N   1 
ATOM   5598 C  CA  . LYS B 2 154 ? 139.107 15.921  62.449  1.00 45.74 ? 154 LYS B CA  1 
ATOM   5599 C  C   . LYS B 2 154 ? 140.291 16.866  62.185  1.00 45.08 ? 154 LYS B C   1 
ATOM   5600 O  O   . LYS B 2 154 ? 140.132 17.911  61.538  1.00 45.10 ? 154 LYS B O   1 
ATOM   5601 C  CB  . LYS B 2 154 ? 138.212 16.438  63.586  1.00 45.57 ? 154 LYS B CB  1 
ATOM   5602 C  CG  . LYS B 2 154 ? 136.791 15.871  63.595  1.00 45.90 ? 154 LYS B CG  1 
ATOM   5603 C  CD  . LYS B 2 154 ? 135.899 16.630  64.572  1.00 45.34 ? 154 LYS B CD  1 
ATOM   5604 C  CE  . LYS B 2 154 ? 134.410 16.417  64.284  1.00 44.48 ? 154 LYS B CE  1 
ATOM   5605 N  NZ  . LYS B 2 154 ? 133.528 17.389  65.011  1.00 43.27 ? 154 LYS B NZ  1 
ATOM   5606 N  N   . GLY B 2 155 ? 141.483 16.458  62.622  1.00 43.02 ? 155 GLY B N   1 
ATOM   5607 C  CA  . GLY B 2 155 ? 142.670 17.264  62.394  1.00 40.70 ? 155 GLY B CA  1 
ATOM   5608 C  C   . GLY B 2 155 ? 143.176 17.168  60.963  1.00 37.21 ? 155 GLY B C   1 
ATOM   5609 O  O   . GLY B 2 155 ? 143.907 18.040  60.487  1.00 38.60 ? 155 GLY B O   1 
ATOM   5610 N  N   . SER B 2 156 ? 142.750 16.123  60.265  1.00 34.15 ? 156 SER B N   1 
ATOM   5611 C  CA  . SER B 2 156 ? 143.144 15.898  58.884  1.00 29.29 ? 156 SER B CA  1 
ATOM   5612 C  C   . SER B 2 156 ? 142.472 16.824  57.833  1.00 26.54 ? 156 SER B C   1 
ATOM   5613 O  O   . SER B 2 156 ? 143.179 17.474  57.056  1.00 23.87 ? 156 SER B O   1 
ATOM   5614 C  CB  . SER B 2 156 ? 142.990 14.403  58.542  1.00 29.06 ? 156 SER B CB  1 
ATOM   5615 O  OG  . SER B 2 156 ? 143.766 13.583  59.418  1.00 23.50 ? 156 SER B OG  1 
ATOM   5616 N  N   . PRO B 2 157 ? 141.118 16.943  57.833  1.00 24.86 ? 157 PRO B N   1 
ATOM   5617 C  CA  . PRO B 2 157 ? 140.391 17.802  56.867  1.00 25.48 ? 157 PRO B CA  1 
ATOM   5618 C  C   . PRO B 2 157 ? 140.862 19.232  56.981  1.00 25.89 ? 157 PRO B C   1 
ATOM   5619 O  O   . PRO B 2 157 ? 141.019 19.954  55.977  1.00 24.66 ? 157 PRO B O   1 
ATOM   5620 C  CB  . PRO B 2 157 ? 138.923 17.681  57.311  1.00 24.79 ? 157 PRO B CB  1 
ATOM   5621 C  CG  . PRO B 2 157 ? 139.038 17.366  58.761  1.00 24.63 ? 157 PRO B CG  1 
ATOM   5622 C  CD  . PRO B 2 157 ? 140.181 16.386  58.817  1.00 22.51 ? 157 PRO B CD  1 
ATOM   5623 N  N   . ALA B 2 158 ? 141.056 19.604  58.244  1.00 24.83 ? 158 ALA B N   1 
ATOM   5624 C  CA  . ALA B 2 158 ? 141.539 20.886  58.642  1.00 24.93 ? 158 ALA B CA  1 
ATOM   5625 C  C   . ALA B 2 158 ? 142.830 21.068  57.872  1.00 26.75 ? 158 ALA B C   1 
ATOM   5626 O  O   . ALA B 2 158 ? 142.975 21.988  57.069  1.00 29.05 ? 158 ALA B O   1 
ATOM   5627 C  CB  . ALA B 2 158 ? 141.815 20.850  60.101  1.00 24.53 ? 158 ALA B CB  1 
ATOM   5628 N  N   . ILE B 2 159 ? 143.751 20.139  58.052  1.00 27.28 ? 159 ILE B N   1 
ATOM   5629 C  CA  . ILE B 2 159 ? 145.006 20.247  57.334  1.00 29.21 ? 159 ILE B CA  1 
ATOM   5630 C  C   . ILE B 2 159 ? 144.763 20.366  55.824  1.00 28.29 ? 159 ILE B C   1 
ATOM   5631 O  O   . ILE B 2 159 ? 145.016 21.414  55.216  1.00 23.86 ? 159 ILE B O   1 
ATOM   5632 C  CB  . ILE B 2 159 ? 145.954 19.056  57.676  1.00 31.21 ? 159 ILE B CB  1 
ATOM   5633 C  CG1 . ILE B 2 159 ? 146.524 19.249  59.088  1.00 31.11 ? 159 ILE B CG1 1 
ATOM   5634 C  CG2 . ILE B 2 159 ? 147.100 18.954  56.662  1.00 31.76 ? 159 ILE B CG2 1 
ATOM   5635 C  CD1 . ILE B 2 159 ? 147.564 18.222  59.499  1.00 31.13 ? 159 ILE B CD1 1 
ATOM   5636 N  N   . PHE B 2 160 ? 144.152 19.334  55.260  1.00 31.18 ? 160 PHE B N   1 
ATOM   5637 C  CA  . PHE B 2 160 ? 143.888 19.313  53.841  1.00 35.56 ? 160 PHE B CA  1 
ATOM   5638 C  C   . PHE B 2 160 ? 143.228 20.562  53.283  1.00 37.93 ? 160 PHE B C   1 
ATOM   5639 O  O   . PHE B 2 160 ? 143.242 20.760  52.059  1.00 37.87 ? 160 PHE B O   1 
ATOM   5640 C  CB  . PHE B 2 160 ? 143.063 18.099  53.459  1.00 37.22 ? 160 PHE B CB  1 
ATOM   5641 C  CG  . PHE B 2 160 ? 142.765 18.024  51.986  1.00 40.43 ? 160 PHE B CG  1 
ATOM   5642 C  CD1 . PHE B 2 160 ? 143.757 17.680  51.078  1.00 40.89 ? 160 PHE B CD1 1 
ATOM   5643 C  CD2 . PHE B 2 160 ? 141.498 18.325  51.496  1.00 41.55 ? 160 PHE B CD2 1 
ATOM   5644 C  CE1 . PHE B 2 160 ? 143.488 17.636  49.706  1.00 40.64 ? 160 PHE B CE1 1 
ATOM   5645 C  CE2 . PHE B 2 160 ? 141.235 18.279  50.125  1.00 40.43 ? 160 PHE B CE2 1 
ATOM   5646 C  CZ  . PHE B 2 160 ? 142.221 17.938  49.235  1.00 39.67 ? 160 PHE B CZ  1 
ATOM   5647 N  N   . GLN B 2 161 ? 142.645 21.389  54.152  1.00 40.60 ? 161 GLN B N   1 
ATOM   5648 C  CA  . GLN B 2 161 ? 141.990 22.620  53.706  1.00 43.79 ? 161 GLN B CA  1 
ATOM   5649 C  C   . GLN B 2 161 ? 142.777 23.297  52.578  1.00 45.87 ? 161 GLN B C   1 
ATOM   5650 O  O   . GLN B 2 161 ? 142.229 23.602  51.507  1.00 44.43 ? 161 GLN B O   1 
ATOM   5651 C  CB  . GLN B 2 161 ? 141.803 23.596  54.867  1.00 42.22 ? 161 GLN B CB  1 
ATOM   5652 C  CG  . GLN B 2 161 ? 140.641 23.244  55.763  1.00 43.13 ? 161 GLN B CG  1 
ATOM   5653 C  CD  . GLN B 2 161 ? 140.401 24.291  56.837  1.00 44.92 ? 161 GLN B CD  1 
ATOM   5654 O  OE1 . GLN B 2 161 ? 141.030 24.281  57.898  1.00 43.24 ? 161 GLN B OE1 1 
ATOM   5655 N  NE2 . GLN B 2 161 ? 139.476 25.202  56.567  1.00 47.02 ? 161 GLN B NE2 1 
ATOM   5656 N  N   . SER B 2 162 ? 144.077 23.453  52.810  1.00 49.05 ? 162 SER B N   1 
ATOM   5657 C  CA  . SER B 2 162 ? 144.986 24.063  51.841  1.00 50.54 ? 162 SER B CA  1 
ATOM   5658 C  C   . SER B 2 162 ? 144.625 23.684  50.388  1.00 49.67 ? 162 SER B C   1 
ATOM   5659 O  O   . SER B 2 162 ? 143.941 24.446  49.690  1.00 47.02 ? 162 SER B O   1 
ATOM   5660 C  CB  . SER B 2 162 ? 146.445 23.658  52.166  1.00 52.70 ? 162 SER B CB  1 
ATOM   5661 O  OG  . SER B 2 162 ? 146.886 24.159  53.431  1.00 52.95 ? 162 SER B OG  1 
ATOM   5662 N  N   . SER B 2 163 ? 145.021 22.483  49.967  1.00 49.58 ? 163 SER B N   1 
ATOM   5663 C  CA  . SER B 2 163 ? 144.743 22.029  48.610  1.00 49.77 ? 163 SER B CA  1 
ATOM   5664 C  C   . SER B 2 163 ? 143.273 22.178  48.298  1.00 49.07 ? 163 SER B C   1 
ATOM   5665 O  O   . SER B 2 163 ? 142.926 22.904  47.370  1.00 49.33 ? 163 SER B O   1 
ATOM   5666 C  CB  . SER B 2 163 ? 145.166 20.571  48.399  1.00 49.78 ? 163 SER B CB  1 
ATOM   5667 O  OG  . SER B 2 163 ? 146.568 20.402  48.526  1.00 50.69 ? 163 SER B OG  1 
ATOM   5668 N  N   . MET B 2 164 ? 142.420 21.535  49.098  1.00 48.66 ? 164 MET B N   1 
ATOM   5669 C  CA  . MET B 2 164 ? 140.969 21.586  48.891  1.00 49.13 ? 164 MET B CA  1 
ATOM   5670 C  C   . MET B 2 164 ? 140.518 22.953  48.365  1.00 47.74 ? 164 MET B C   1 
ATOM   5671 O  O   . MET B 2 164 ? 139.825 23.057  47.333  1.00 43.51 ? 164 MET B O   1 
ATOM   5672 C  CB  . MET B 2 164 ? 140.221 21.282  50.201  1.00 51.02 ? 164 MET B CB  1 
ATOM   5673 C  CG  . MET B 2 164 ? 138.987 20.335  50.059  1.00 53.00 ? 164 MET B CG  1 
ATOM   5674 S  SD  . MET B 2 164 ? 138.259 20.059  48.380  1.00 53.46 ? 164 MET B SD  1 
ATOM   5675 C  CE  . MET B 2 164 ? 139.298 18.742  47.659  1.00 51.57 ? 164 MET B CE  1 
ATOM   5676 N  N   . THR B 2 165 ? 140.992 23.988  49.060  1.00 47.32 ? 165 THR B N   1 
ATOM   5677 C  CA  . THR B 2 165 ? 140.683 25.373  48.745  1.00 45.92 ? 165 THR B CA  1 
ATOM   5678 C  C   . THR B 2 165 ? 140.868 25.627  47.265  1.00 44.48 ? 165 THR B C   1 
ATOM   5679 O  O   . THR B 2 165 ? 139.898 25.822  46.539  1.00 44.74 ? 165 THR B O   1 
ATOM   5680 C  CB  . THR B 2 165 ? 141.561 26.343  49.577  1.00 45.62 ? 165 THR B CB  1 
ATOM   5681 O  OG1 . THR B 2 165 ? 141.195 26.253  50.961  1.00 45.23 ? 165 THR B OG1 1 
ATOM   5682 C  CG2 . THR B 2 165 ? 141.373 27.781  49.120  1.00 45.57 ? 165 THR B CG2 1 
ATOM   5683 N  N   . LYS B 2 166 ? 142.102 25.546  46.800  1.00 42.85 ? 166 LYS B N   1 
ATOM   5684 C  CA  . LYS B 2 166 ? 142.350 25.778  45.395  1.00 43.52 ? 166 LYS B CA  1 
ATOM   5685 C  C   . LYS B 2 166 ? 141.619 24.764  44.533  1.00 42.86 ? 166 LYS B C   1 
ATOM   5686 O  O   . LYS B 2 166 ? 141.089 25.112  43.481  1.00 39.81 ? 166 LYS B O   1 
ATOM   5687 C  CB  . LYS B 2 166 ? 143.844 25.728  45.064  1.00 45.46 ? 166 LYS B CB  1 
ATOM   5688 C  CG  . LYS B 2 166 ? 144.124 26.244  43.644  1.00 49.23 ? 166 LYS B CG  1 
ATOM   5689 C  CD  . LYS B 2 166 ? 145.478 25.832  43.093  1.00 51.21 ? 166 LYS B CD  1 
ATOM   5690 C  CE  . LYS B 2 166 ? 145.424 25.718  41.563  1.00 53.17 ? 166 LYS B CE  1 
ATOM   5691 N  NZ  . LYS B 2 166 ? 144.489 24.638  41.064  1.00 51.10 ? 166 LYS B NZ  1 
ATOM   5692 N  N   . ILE B 2 167 ? 141.552 23.523  45.009  1.00 43.57 ? 167 ILE B N   1 
ATOM   5693 C  CA  . ILE B 2 167 ? 140.898 22.446  44.266  1.00 44.11 ? 167 ILE B CA  1 
ATOM   5694 C  C   . ILE B 2 167 ? 139.526 22.910  43.809  1.00 42.97 ? 167 ILE B C   1 
ATOM   5695 O  O   . ILE B 2 167 ? 139.074 22.600  42.702  1.00 41.47 ? 167 ILE B O   1 
ATOM   5696 C  CB  . ILE B 2 167 ? 140.689 21.156  45.134  1.00 44.72 ? 167 ILE B CB  1 
ATOM   5697 C  CG1 . ILE B 2 167 ? 142.013 20.647  45.725  1.00 44.57 ? 167 ILE B CG1 1 
ATOM   5698 C  CG2 . ILE B 2 167 ? 140.039 20.047  44.283  1.00 46.34 ? 167 ILE B CG2 1 
ATOM   5699 C  CD1 . ILE B 2 167 ? 143.062 20.177  44.699  1.00 44.21 ? 167 ILE B CD1 1 
ATOM   5700 N  N   . LEU B 2 168 ? 138.898 23.698  44.671  1.00 43.22 ? 168 LEU B N   1 
ATOM   5701 C  CA  . LEU B 2 168 ? 137.565 24.206  44.442  1.00 42.06 ? 168 LEU B CA  1 
ATOM   5702 C  C   . LEU B 2 168 ? 137.493 25.584  43.889  1.00 41.95 ? 168 LEU B C   1 
ATOM   5703 O  O   . LEU B 2 168 ? 136.699 25.840  42.998  1.00 40.63 ? 168 LEU B O   1 
ATOM   5704 C  CB  . LEU B 2 168 ? 136.805 24.164  45.744  1.00 40.73 ? 168 LEU B CB  1 
ATOM   5705 C  CG  . LEU B 2 168 ? 136.673 22.694  46.054  1.00 38.85 ? 168 LEU B CG  1 
ATOM   5706 C  CD1 . LEU B 2 168 ? 136.715 22.504  47.539  1.00 40.02 ? 168 LEU B CD1 1 
ATOM   5707 C  CD2 . LEU B 2 168 ? 135.416 22.165  45.381  1.00 35.06 ? 168 LEU B CD2 1 
ATOM   5708 N  N   . GLU B 2 169 ? 138.294 26.468  44.466  1.00 43.08 ? 169 GLU B N   1 
ATOM   5709 C  CA  . GLU B 2 169 ? 138.369 27.872  44.095  1.00 46.56 ? 169 GLU B CA  1 
ATOM   5710 C  C   . GLU B 2 169 ? 137.952 28.179  42.646  1.00 48.17 ? 169 GLU B C   1 
ATOM   5711 O  O   . GLU B 2 169 ? 137.073 29.015  42.422  1.00 46.80 ? 169 GLU B O   1 
ATOM   5712 C  CB  . GLU B 2 169 ? 139.761 28.396  44.418  1.00 46.98 ? 169 GLU B CB  1 
ATOM   5713 C  CG  . GLU B 2 169 ? 140.031 29.784  43.919  1.00 50.08 ? 169 GLU B CG  1 
ATOM   5714 C  CD  . GLU B 2 169 ? 141.385 30.298  44.341  1.00 50.55 ? 169 GLU B CD  1 
ATOM   5715 O  OE1 . GLU B 2 169 ? 142.181 29.513  44.899  1.00 49.27 ? 169 GLU B OE1 1 
ATOM   5716 O  OE2 . GLU B 2 169 ? 141.652 31.498  44.113  1.00 53.97 ? 169 GLU B OE2 1 
ATOM   5717 N  N   . PRO B 2 170 ? 138.565 27.501  41.649  1.00 49.57 ? 170 PRO B N   1 
ATOM   5718 C  CA  . PRO B 2 170 ? 138.217 27.721  40.243  1.00 50.88 ? 170 PRO B CA  1 
ATOM   5719 C  C   . PRO B 2 170 ? 136.790 27.260  40.000  1.00 52.35 ? 170 PRO B C   1 
ATOM   5720 O  O   . PRO B 2 170 ? 136.002 27.978  39.409  1.00 52.08 ? 170 PRO B O   1 
ATOM   5721 C  CB  . PRO B 2 170 ? 139.194 26.817  39.509  1.00 50.90 ? 170 PRO B CB  1 
ATOM   5722 C  CG  . PRO B 2 170 ? 139.466 25.718  40.512  1.00 49.94 ? 170 PRO B CG  1 
ATOM   5723 C  CD  . PRO B 2 170 ? 139.680 26.545  41.739  1.00 49.39 ? 170 PRO B CD  1 
ATOM   5724 N  N   . PHE B 2 171 ? 136.446 26.067  40.479  1.00 55.18 ? 171 PHE B N   1 
ATOM   5725 C  CA  . PHE B 2 171 ? 135.085 25.571  40.301  1.00 58.14 ? 171 PHE B CA  1 
ATOM   5726 C  C   . PHE B 2 171 ? 134.149 26.582  40.939  1.00 58.45 ? 171 PHE B C   1 
ATOM   5727 O  O   . PHE B 2 171 ? 133.037 26.833  40.465  1.00 58.00 ? 171 PHE B O   1 
ATOM   5728 C  CB  . PHE B 2 171 ? 134.877 24.224  40.985  1.00 58.97 ? 171 PHE B CB  1 
ATOM   5729 C  CG  . PHE B 2 171 ? 133.571 23.568  40.611  1.00 60.89 ? 171 PHE B CG  1 
ATOM   5730 C  CD1 . PHE B 2 171 ? 132.384 23.931  41.245  1.00 60.85 ? 171 PHE B CD1 1 
ATOM   5731 C  CD2 . PHE B 2 171 ? 133.517 22.627  39.576  1.00 61.58 ? 171 PHE B CD2 1 
ATOM   5732 C  CE1 . PHE B 2 171 ? 131.162 23.366  40.852  1.00 60.98 ? 171 PHE B CE1 1 
ATOM   5733 C  CE2 . PHE B 2 171 ? 132.300 22.059  39.176  1.00 61.09 ? 171 PHE B CE2 1 
ATOM   5734 C  CZ  . PHE B 2 171 ? 131.121 22.428  39.815  1.00 61.30 ? 171 PHE B CZ  1 
ATOM   5735 N  N   . LYS B 2 172 ? 134.623 27.159  42.029  1.00 59.25 ? 172 LYS B N   1 
ATOM   5736 C  CA  . LYS B 2 172 ? 133.861 28.150  42.734  1.00 60.38 ? 172 LYS B CA  1 
ATOM   5737 C  C   . LYS B 2 172 ? 133.832 29.421  41.902  1.00 61.02 ? 172 LYS B C   1 
ATOM   5738 O  O   . LYS B 2 172 ? 132.809 30.099  41.850  1.00 61.68 ? 172 LYS B O   1 
ATOM   5739 C  CB  . LYS B 2 172 ? 134.474 28.424  44.102  1.00 60.10 ? 172 LYS B CB  1 
ATOM   5740 C  CG  . LYS B 2 172 ? 134.485 27.229  45.014  1.00 58.76 ? 172 LYS B CG  1 
ATOM   5741 C  CD  . LYS B 2 172 ? 134.417 27.658  46.470  1.00 59.64 ? 172 LYS B CD  1 
ATOM   5742 C  CE  . LYS B 2 172 ? 135.647 28.445  46.925  1.00 61.37 ? 172 LYS B CE  1 
ATOM   5743 N  NZ  . LYS B 2 172 ? 135.518 28.881  48.353  1.00 59.76 ? 172 LYS B NZ  1 
ATOM   5744 N  N   . LYS B 2 173 ? 134.937 29.730  41.228  1.00 61.50 ? 173 LYS B N   1 
ATOM   5745 C  CA  . LYS B 2 173 ? 134.992 30.935  40.402  1.00 63.93 ? 173 LYS B CA  1 
ATOM   5746 C  C   . LYS B 2 173 ? 133.989 30.861  39.233  1.00 64.53 ? 173 LYS B C   1 
ATOM   5747 O  O   . LYS B 2 173 ? 133.535 31.884  38.739  1.00 63.97 ? 173 LYS B O   1 
ATOM   5748 C  CB  . LYS B 2 173 ? 136.412 31.200  39.875  1.00 65.61 ? 173 LYS B CB  1 
ATOM   5749 C  CG  . LYS B 2 173 ? 137.499 31.532  40.919  1.00 67.57 ? 173 LYS B CG  1 
ATOM   5750 C  CD  . LYS B 2 173 ? 138.843 31.884  40.222  1.00 69.10 ? 173 LYS B CD  1 
ATOM   5751 C  CE  . LYS B 2 173 ? 138.822 33.324  39.660  1.00 69.91 ? 173 LYS B CE  1 
ATOM   5752 N  NZ  . LYS B 2 173 ? 139.422 33.546  38.305  1.00 68.19 ? 173 LYS B NZ  1 
ATOM   5753 N  N   . GLN B 2 174 ? 133.675 29.656  38.770  1.00 66.06 ? 174 GLN B N   1 
ATOM   5754 C  CA  . GLN B 2 174 ? 132.708 29.482  37.686  1.00 67.53 ? 174 GLN B CA  1 
ATOM   5755 C  C   . GLN B 2 174 ? 131.307 29.358  38.261  1.00 67.67 ? 174 GLN B C   1 
ATOM   5756 O  O   . GLN B 2 174 ? 130.317 29.691  37.607  1.00 67.60 ? 174 GLN B O   1 
ATOM   5757 C  CB  . GLN B 2 174 ? 133.022 28.223  36.873  1.00 69.65 ? 174 GLN B CB  1 
ATOM   5758 C  CG  . GLN B 2 174 ? 133.937 28.443  35.670  1.00 72.96 ? 174 GLN B CG  1 
ATOM   5759 C  CD  . GLN B 2 174 ? 135.401 28.692  36.037  1.00 74.19 ? 174 GLN B CD  1 
ATOM   5760 O  OE1 . GLN B 2 174 ? 135.719 29.072  37.163  1.00 75.69 ? 174 GLN B OE1 1 
ATOM   5761 N  NE2 . GLN B 2 174 ? 136.296 28.486  35.073  1.00 74.15 ? 174 GLN B NE2 1 
ATOM   5762 N  N   . ASN B 2 175 ? 131.241 28.857  39.490  1.00 68.97 ? 175 ASN B N   1 
ATOM   5763 C  CA  . ASN B 2 175 ? 129.980 28.645  40.192  1.00 69.10 ? 175 ASN B CA  1 
ATOM   5764 C  C   . ASN B 2 175 ? 130.131 29.268  41.567  1.00 69.55 ? 175 ASN B C   1 
ATOM   5765 O  O   . ASN B 2 175 ? 130.738 28.678  42.462  1.00 67.86 ? 175 ASN B O   1 
ATOM   5766 C  CB  . ASN B 2 175 ? 129.713 27.150  40.294  1.00 68.15 ? 175 ASN B CB  1 
ATOM   5767 C  CG  . ASN B 2 175 ? 129.934 26.445  38.977  1.00 68.13 ? 175 ASN B CG  1 
ATOM   5768 O  OD1 . ASN B 2 175 ? 129.078 26.484  38.088  1.00 67.87 ? 175 ASN B OD1 1 
ATOM   5769 N  ND2 . ASN B 2 175 ? 131.119 25.867  38.808  1.00 67.51 ? 175 ASN B ND2 1 
ATOM   5770 N  N   . PRO B 2 176 ? 129.602 30.495  41.734  1.00 70.73 ? 176 PRO B N   1 
ATOM   5771 C  CA  . PRO B 2 176 ? 129.611 31.335  42.949  1.00 71.56 ? 176 PRO B CA  1 
ATOM   5772 C  C   . PRO B 2 176 ? 128.586 31.084  44.085  1.00 71.45 ? 176 PRO B C   1 
ATOM   5773 O  O   . PRO B 2 176 ? 128.933 31.042  45.278  1.00 71.68 ? 176 PRO B O   1 
ATOM   5774 C  CB  . PRO B 2 176 ? 129.451 32.738  42.367  1.00 71.36 ? 176 PRO B CB  1 
ATOM   5775 C  CG  . PRO B 2 176 ? 128.499 32.497  41.215  1.00 70.58 ? 176 PRO B CG  1 
ATOM   5776 C  CD  . PRO B 2 176 ? 129.029 31.228  40.584  1.00 70.07 ? 176 PRO B CD  1 
ATOM   5777 N  N   . ASP B 2 177 ? 127.317 30.981  43.710  1.00 70.97 ? 177 ASP B N   1 
ATOM   5778 C  CA  . ASP B 2 177 ? 126.238 30.773  44.670  1.00 68.54 ? 177 ASP B CA  1 
ATOM   5779 C  C   . ASP B 2 177 ? 126.305 29.353  45.194  1.00 66.65 ? 177 ASP B C   1 
ATOM   5780 O  O   . ASP B 2 177 ? 125.872 29.064  46.306  1.00 65.69 ? 177 ASP B O   1 
ATOM   5781 C  CB  . ASP B 2 177 ? 124.912 31.039  43.974  1.00 69.52 ? 177 ASP B CB  1 
ATOM   5782 C  CG  . ASP B 2 177 ? 124.978 32.255  43.079  1.00 69.92 ? 177 ASP B CG  1 
ATOM   5783 O  OD1 . ASP B 2 177 ? 125.333 33.347  43.580  1.00 71.33 ? 177 ASP B OD1 1 
ATOM   5784 O  OD2 . ASP B 2 177 ? 124.717 32.109  41.868  1.00 70.74 ? 177 ASP B OD2 1 
ATOM   5785 N  N   . ILE B 2 178 ? 126.819 28.470  44.343  1.00 64.22 ? 178 ILE B N   1 
ATOM   5786 C  CA  . ILE B 2 178 ? 127.012 27.076  44.681  1.00 62.47 ? 178 ILE B CA  1 
ATOM   5787 C  C   . ILE B 2 178 ? 127.882 27.075  45.927  1.00 59.56 ? 178 ILE B C   1 
ATOM   5788 O  O   . ILE B 2 178 ? 129.104 27.300  45.889  1.00 59.39 ? 178 ILE B O   1 
ATOM   5789 C  CB  . ILE B 2 178 ? 127.695 26.316  43.503  1.00 65.26 ? 178 ILE B CB  1 
ATOM   5790 C  CG1 . ILE B 2 178 ? 126.656 25.458  42.793  1.00 66.52 ? 178 ILE B CG1 1 
ATOM   5791 C  CG2 . ILE B 2 178 ? 128.874 25.422  43.976  1.00 65.52 ? 178 ILE B CG2 1 
ATOM   5792 C  CD1 . ILE B 2 178 ? 126.144 24.309  43.661  1.00 67.45 ? 178 ILE B CD1 1 
ATOM   5793 N  N   . VAL B 2 179 ? 127.232 26.956  47.062  1.00 55.49 ? 179 VAL B N   1 
ATOM   5794 C  CA  . VAL B 2 179 ? 128.016 26.959  48.248  1.00 50.67 ? 179 VAL B CA  1 
ATOM   5795 C  C   . VAL B 2 179 ? 128.466 25.563  48.463  1.00 49.06 ? 179 VAL B C   1 
ATOM   5796 O  O   . VAL B 2 179 ? 127.797 24.605  48.101  1.00 47.43 ? 179 VAL B O   1 
ATOM   5797 C  CB  . VAL B 2 179 ? 127.264 27.451  49.422  1.00 48.94 ? 179 VAL B CB  1 
ATOM   5798 C  CG1 . VAL B 2 179 ? 128.206 27.521  50.606  1.00 48.38 ? 179 VAL B CG1 1 
ATOM   5799 C  CG2 . VAL B 2 179 ? 126.695 28.814  49.101  1.00 49.68 ? 179 VAL B CG2 1 
ATOM   5800 N  N   . ILE B 2 180 ? 129.677 25.460  48.945  1.00 48.89 ? 180 ILE B N   1 
ATOM   5801 C  CA  . ILE B 2 180 ? 130.235 24.179  49.216  1.00 49.71 ? 180 ILE B CA  1 
ATOM   5802 C  C   . ILE B 2 180 ? 130.642 24.237  50.672  1.00 49.07 ? 180 ILE B C   1 
ATOM   5803 O  O   . ILE B 2 180 ? 130.948 25.307  51.212  1.00 46.53 ? 180 ILE B O   1 
ATOM   5804 C  CB  . ILE B 2 180 ? 131.448 23.913  48.323  1.00 50.79 ? 180 ILE B CB  1 
ATOM   5805 C  CG1 . ILE B 2 180 ? 131.098 24.232  46.873  1.00 51.66 ? 180 ILE B CG1 1 
ATOM   5806 C  CG2 . ILE B 2 180 ? 131.859 22.457  48.422  1.00 52.15 ? 180 ILE B CG2 1 
ATOM   5807 C  CD1 . ILE B 2 180 ? 132.218 23.939  45.885  1.00 53.07 ? 180 ILE B CD1 1 
ATOM   5808 N  N   . CYS B 2 181 ? 130.604 23.088  51.319  1.00 49.13 ? 181 CYS B N   1 
ATOM   5809 C  CA  . CYS B 2 181 ? 130.972 23.038  52.694  1.00 49.89 ? 181 CYS B CA  1 
ATOM   5810 C  C   . CYS B 2 181 ? 131.630 21.713  52.979  1.00 50.71 ? 181 CYS B C   1 
ATOM   5811 O  O   . CYS B 2 181 ? 131.154 20.647  52.544  1.00 48.10 ? 181 CYS B O   1 
ATOM   5812 C  CB  . CYS B 2 181 ? 129.755 23.257  53.578  1.00 50.71 ? 181 CYS B CB  1 
ATOM   5813 S  SG  . CYS B 2 181 ? 130.225 23.936  55.178  1.00 51.58 ? 181 CYS B SG  1 
ATOM   5814 N  N   . GLN B 2 182 ? 132.775 21.827  53.653  1.00 52.76 ? 182 GLN B N   1 
ATOM   5815 C  CA  . GLN B 2 182 ? 133.615 20.708  54.051  1.00 54.19 ? 182 GLN B CA  1 
ATOM   5816 C  C   . GLN B 2 182 ? 133.453 20.405  55.527  1.00 54.28 ? 182 GLN B C   1 
ATOM   5817 O  O   . GLN B 2 182 ? 133.622 21.283  56.382  1.00 52.86 ? 182 GLN B O   1 
ATOM   5818 C  CB  . GLN B 2 182 ? 135.110 21.002  53.771  1.00 56.67 ? 182 GLN B CB  1 
ATOM   5819 C  CG  . GLN B 2 182 ? 136.109 20.127  54.588  1.00 62.89 ? 182 GLN B CG  1 
ATOM   5820 C  CD  . GLN B 2 182 ? 137.603 20.517  54.448  1.00 66.14 ? 182 GLN B CD  1 
ATOM   5821 O  OE1 . GLN B 2 182 ? 137.969 21.693  54.498  1.00 67.85 ? 182 GLN B OE1 1 
ATOM   5822 N  NE2 . GLN B 2 182 ? 138.465 19.511  54.318  1.00 67.71 ? 182 GLN B NE2 1 
ATOM   5823 N  N   . TYR B 2 183 ? 133.033 19.181  55.814  1.00 55.16 ? 183 TYR B N   1 
ATOM   5824 C  CA  . TYR B 2 183 ? 132.942 18.729  57.188  1.00 55.84 ? 183 TYR B CA  1 
ATOM   5825 C  C   . TYR B 2 183 ? 133.592 17.383  57.152  1.00 55.90 ? 183 TYR B C   1 
ATOM   5826 O  O   . TYR B 2 183 ? 133.044 16.431  56.582  1.00 54.62 ? 183 TYR B O   1 
ATOM   5827 C  CB  . TYR B 2 183 ? 131.531 18.573  57.694  1.00 56.55 ? 183 TYR B CB  1 
ATOM   5828 C  CG  . TYR B 2 183 ? 131.542 18.237  59.157  1.00 56.74 ? 183 TYR B CG  1 
ATOM   5829 C  CD1 . TYR B 2 183 ? 132.607 18.642  59.975  1.00 56.69 ? 183 TYR B CD1 1 
ATOM   5830 C  CD2 . TYR B 2 183 ? 130.492 17.531  59.734  1.00 57.22 ? 183 TYR B CD2 1 
ATOM   5831 C  CE1 . TYR B 2 183 ? 132.613 18.351  61.331  1.00 58.28 ? 183 TYR B CE1 1 
ATOM   5832 C  CE2 . TYR B 2 183 ? 130.487 17.233  61.085  1.00 57.54 ? 183 TYR B CE2 1 
ATOM   5833 C  CZ  . TYR B 2 183 ? 131.539 17.646  61.882  1.00 58.56 ? 183 TYR B CZ  1 
ATOM   5834 O  OH  . TYR B 2 183 ? 131.487 17.370  63.233  1.00 59.16 ? 183 TYR B OH  1 
ATOM   5835 N  N   . MET B 2 184 ? 134.779 17.321  57.742  1.00 56.97 ? 184 MET B N   1 
ATOM   5836 C  CA  . MET B 2 184 ? 135.577 16.102  57.749  1.00 57.17 ? 184 MET B CA  1 
ATOM   5837 C  C   . MET B 2 184 ? 135.790 15.685  56.283  1.00 54.63 ? 184 MET B C   1 
ATOM   5838 O  O   . MET B 2 184 ? 136.275 16.518  55.509  1.00 55.55 ? 184 MET B O   1 
ATOM   5839 C  CB  . MET B 2 184 ? 134.933 15.053  58.645  1.00 59.97 ? 184 MET B CB  1 
ATOM   5840 C  CG  . MET B 2 184 ? 135.006 15.505  60.102  1.00 62.40 ? 184 MET B CG  1 
ATOM   5841 S  SD  . MET B 2 184 ? 133.715 14.830  61.120  1.00 66.10 ? 184 MET B SD  1 
ATOM   5842 C  CE  . MET B 2 184 ? 134.570 13.436  61.893  1.00 66.11 ? 184 MET B CE  1 
ATOM   5843 N  N   . ASP B 2 185 ? 135.406 14.481  55.857  1.00 51.32 ? 185 ASP B N   1 
ATOM   5844 C  CA  . ASP B 2 185 ? 135.628 14.120  54.448  1.00 47.88 ? 185 ASP B CA  1 
ATOM   5845 C  C   . ASP B 2 185 ? 134.396 14.108  53.571  1.00 44.74 ? 185 ASP B C   1 
ATOM   5846 O  O   . ASP B 2 185 ? 134.323 13.330  52.651  1.00 43.38 ? 185 ASP B O   1 
ATOM   5847 C  CB  . ASP B 2 185 ? 136.372 12.774  54.290  1.00 50.00 ? 185 ASP B CB  1 
ATOM   5848 C  CG  . ASP B 2 185 ? 136.219 11.849  55.491  1.00 51.75 ? 185 ASP B CG  1 
ATOM   5849 O  OD1 . ASP B 2 185 ? 136.785 12.181  56.549  1.00 53.42 ? 185 ASP B OD1 1 
ATOM   5850 O  OD2 . ASP B 2 185 ? 135.588 10.777  55.358  1.00 50.40 ? 185 ASP B OD2 1 
ATOM   5851 N  N   . ASP B 2 186 ? 133.445 14.986  53.836  1.00 42.68 ? 186 ASP B N   1 
ATOM   5852 C  CA  . ASP B 2 186 ? 132.237 15.019  53.054  1.00 40.18 ? 186 ASP B CA  1 
ATOM   5853 C  C   . ASP B 2 186 ? 131.963 16.391  52.534  1.00 40.59 ? 186 ASP B C   1 
ATOM   5854 O  O   . ASP B 2 186 ? 132.065 17.384  53.261  1.00 40.49 ? 186 ASP B O   1 
ATOM   5855 C  CB  . ASP B 2 186 ? 131.094 14.522  53.884  1.00 38.68 ? 186 ASP B CB  1 
ATOM   5856 C  CG  . ASP B 2 186 ? 131.354 13.154  54.420  1.00 37.36 ? 186 ASP B CG  1 
ATOM   5857 O  OD1 . ASP B 2 186 ? 132.003 13.047  55.484  1.00 34.49 ? 186 ASP B OD1 1 
ATOM   5858 O  OD2 . ASP B 2 186 ? 130.958 12.187  53.740  1.00 38.79 ? 186 ASP B OD2 1 
ATOM   5859 N  N   . LEU B 2 187 ? 131.534 16.440  51.286  1.00 42.34 ? 187 LEU B N   1 
ATOM   5860 C  CA  . LEU B 2 187 ? 131.306 17.705  50.645  1.00 44.84 ? 187 LEU B CA  1 
ATOM   5861 C  C   . LEU B 2 187 ? 129.859 17.976  50.443  1.00 46.78 ? 187 LEU B C   1 
ATOM   5862 O  O   . LEU B 2 187 ? 129.143 17.184  49.841  1.00 46.40 ? 187 LEU B O   1 
ATOM   5863 C  CB  . LEU B 2 187 ? 132.034 17.746  49.309  1.00 45.76 ? 187 LEU B CB  1 
ATOM   5864 C  CG  . LEU B 2 187 ? 132.596 19.119  48.924  1.00 46.49 ? 187 LEU B CG  1 
ATOM   5865 C  CD1 . LEU B 2 187 ? 133.294 19.775  50.112  1.00 46.58 ? 187 LEU B CD1 1 
ATOM   5866 C  CD2 . LEU B 2 187 ? 133.563 18.967  47.754  1.00 45.21 ? 187 LEU B CD2 1 
ATOM   5867 N  N   . TYR B 2 188 ? 129.437 19.111  50.963  1.00 49.17 ? 188 TYR B N   1 
ATOM   5868 C  CA  . TYR B 2 188 ? 128.065 19.523  50.845  1.00 52.57 ? 188 TYR B CA  1 
ATOM   5869 C  C   . TYR B 2 188 ? 128.081 20.751  50.008  1.00 51.60 ? 188 TYR B C   1 
ATOM   5870 O  O   . TYR B 2 188 ? 128.666 21.768  50.374  1.00 51.29 ? 188 TYR B O   1 
ATOM   5871 C  CB  . TYR B 2 188 ? 127.498 19.813  52.207  1.00 58.19 ? 188 TYR B CB  1 
ATOM   5872 C  CG  . TYR B 2 188 ? 127.697 18.640  53.100  1.00 64.94 ? 188 TYR B CG  1 
ATOM   5873 C  CD1 . TYR B 2 188 ? 128.939 18.397  53.688  1.00 68.12 ? 188 TYR B CD1 1 
ATOM   5874 C  CD2 . TYR B 2 188 ? 126.674 17.716  53.300  1.00 67.26 ? 188 TYR B CD2 1 
ATOM   5875 C  CE1 . TYR B 2 188 ? 129.158 17.248  54.452  1.00 71.01 ? 188 TYR B CE1 1 
ATOM   5876 C  CE2 . TYR B 2 188 ? 126.882 16.569  54.068  1.00 69.87 ? 188 TYR B CE2 1 
ATOM   5877 C  CZ  . TYR B 2 188 ? 128.126 16.333  54.632  1.00 71.00 ? 188 TYR B CZ  1 
ATOM   5878 O  OH  . TYR B 2 188 ? 128.348 15.158  55.331  1.00 72.25 ? 188 TYR B OH  1 
ATOM   5879 N  N   . VAL B 2 189 ? 127.475 20.634  48.847  1.00 50.30 ? 189 VAL B N   1 
ATOM   5880 C  CA  . VAL B 2 189 ? 127.454 21.742  47.942  1.00 49.27 ? 189 VAL B CA  1 
ATOM   5881 C  C   . VAL B 2 189 ? 126.030 22.065  47.657  1.00 48.12 ? 189 VAL B C   1 
ATOM   5882 O  O   . VAL B 2 189 ? 125.279 21.225  47.137  1.00 45.77 ? 189 VAL B O   1 
ATOM   5883 C  CB  . VAL B 2 189 ? 128.150 21.381  46.650  1.00 50.75 ? 189 VAL B CB  1 
ATOM   5884 C  CG1 . VAL B 2 189 ? 128.363 22.629  45.816  1.00 50.24 ? 189 VAL B CG1 1 
ATOM   5885 C  CG2 . VAL B 2 189 ? 129.473 20.671  46.961  1.00 49.94 ? 189 VAL B CG2 1 
ATOM   5886 N  N   . GLY B 2 190 ? 125.657 23.282  48.010  1.00 47.33 ? 190 GLY B N   1 
ATOM   5887 C  CA  . GLY B 2 190 ? 124.296 23.713  47.799  1.00 49.18 ? 190 GLY B CA  1 
ATOM   5888 C  C   . GLY B 2 190 ? 124.008 24.683  46.673  1.00 49.05 ? 190 GLY B C   1 
ATOM   5889 O  O   . GLY B 2 190 ? 124.788 25.607  46.389  1.00 47.73 ? 190 GLY B O   1 
ATOM   5890 N  N   . SER B 2 191 ? 122.829 24.488  46.093  1.00 51.34 ? 191 SER B N   1 
ATOM   5891 C  CA  . SER B 2 191 ? 122.325 25.301  44.997  1.00 53.62 ? 191 SER B CA  1 
ATOM   5892 C  C   . SER B 2 191 ? 120.790 25.320  44.979  1.00 56.58 ? 191 SER B C   1 
ATOM   5893 O  O   . SER B 2 191 ? 120.133 24.487  45.613  1.00 56.49 ? 191 SER B O   1 
ATOM   5894 C  CB  . SER B 2 191 ? 122.830 24.759  43.658  1.00 51.86 ? 191 SER B CB  1 
ATOM   5895 O  OG  . SER B 2 191 ? 122.531 23.384  43.536  1.00 48.93 ? 191 SER B OG  1 
ATOM   5896 N  N   . ASP B 2 192 ? 120.237 26.304  44.274  1.00 59.19 ? 192 ASP B N   1 
ATOM   5897 C  CA  . ASP B 2 192 ? 118.792 26.445  44.096  1.00 61.66 ? 192 ASP B CA  1 
ATOM   5898 C  C   . ASP B 2 192 ? 118.539 26.020  42.654  1.00 63.71 ? 192 ASP B C   1 
ATOM   5899 O  O   . ASP B 2 192 ? 117.541 26.403  42.041  1.00 63.80 ? 192 ASP B O   1 
ATOM   5900 C  CB  . ASP B 2 192 ? 118.339 27.906  44.282  1.00 60.84 ? 192 ASP B CB  1 
ATOM   5901 C  CG  . ASP B 2 192 ? 118.611 28.445  45.683  1.00 59.30 ? 192 ASP B CG  1 
ATOM   5902 O  OD1 . ASP B 2 192 ? 118.521 27.682  46.667  1.00 57.71 ? 192 ASP B OD1 1 
ATOM   5903 O  OD2 . ASP B 2 192 ? 118.898 29.655  45.788  1.00 59.25 ? 192 ASP B OD2 1 
ATOM   5904 N  N   . LEU B 2 193 ? 119.479 25.234  42.132  1.00 66.93 ? 193 LEU B N   1 
ATOM   5905 C  CA  . LEU B 2 193 ? 119.457 24.742  40.764  1.00 69.37 ? 193 LEU B CA  1 
ATOM   5906 C  C   . LEU B 2 193 ? 118.463 23.647  40.545  1.00 69.85 ? 193 LEU B C   1 
ATOM   5907 O  O   . LEU B 2 193 ? 118.343 22.741  41.370  1.00 70.46 ? 193 LEU B O   1 
ATOM   5908 C  CB  . LEU B 2 193 ? 120.822 24.202  40.350  1.00 70.11 ? 193 LEU B CB  1 
ATOM   5909 C  CG  . LEU B 2 193 ? 121.500 25.066  39.293  1.00 71.99 ? 193 LEU B CG  1 
ATOM   5910 C  CD1 . LEU B 2 193 ? 122.627 24.269  38.647  1.00 72.05 ? 193 LEU B CD1 1 
ATOM   5911 C  CD2 . LEU B 2 193 ? 120.481 25.527  38.251  1.00 70.03 ? 193 LEU B CD2 1 
ATOM   5912 N  N   . GLU B 2 194 ? 117.841 23.665  39.376  1.00 70.25 ? 194 GLU B N   1 
ATOM   5913 C  CA  . GLU B 2 194 ? 116.872 22.648  39.071  1.00 70.69 ? 194 GLU B CA  1 
ATOM   5914 C  C   . GLU B 2 194 ? 117.592 21.315  39.049  1.00 69.17 ? 194 GLU B C   1 
ATOM   5915 O  O   . GLU B 2 194 ? 118.779 21.234  38.722  1.00 66.13 ? 194 GLU B O   1 
ATOM   5916 C  CB  . GLU B 2 194 ? 116.198 22.919  37.738  1.00 73.62 ? 194 GLU B CB  1 
ATOM   5917 C  CG  . GLU B 2 194 ? 114.834 22.235  37.610  1.00 78.29 ? 194 GLU B CG  1 
ATOM   5918 C  CD  . GLU B 2 194 ? 114.730 21.327  36.387  1.00 80.89 ? 194 GLU B CD  1 
ATOM   5919 O  OE1 . GLU B 2 194 ? 115.674 20.525  36.167  1.00 81.91 ? 194 GLU B OE1 1 
ATOM   5920 O  OE2 . GLU B 2 194 ? 113.706 21.417  35.654  1.00 81.13 ? 194 GLU B OE2 1 
ATOM   5921 N  N   . ILE B 2 195 ? 116.848 20.296  39.457  1.00 69.41 ? 195 ILE B N   1 
ATOM   5922 C  CA  . ILE B 2 195 ? 117.290 18.911  39.548  1.00 69.87 ? 195 ILE B CA  1 
ATOM   5923 C  C   . ILE B 2 195 ? 118.501 18.582  38.678  1.00 68.53 ? 195 ILE B C   1 
ATOM   5924 O  O   . ILE B 2 195 ? 119.620 18.535  39.176  1.00 66.84 ? 195 ILE B O   1 
ATOM   5925 C  CB  . ILE B 2 195 ? 116.108 17.923  39.220  1.00 70.99 ? 195 ILE B CB  1 
ATOM   5926 C  CG1 . ILE B 2 195 ? 114.936 18.121  40.198  1.00 72.52 ? 195 ILE B CG1 1 
ATOM   5927 C  CG2 . ILE B 2 195 ? 116.585 16.472  39.289  1.00 70.72 ? 195 ILE B CG2 1 
ATOM   5928 C  CD1 . ILE B 2 195 ? 113.853 19.086  39.709  1.00 75.25 ? 195 ILE B CD1 1 
ATOM   5929 N  N   . GLY B 2 196 ? 118.265 18.424  37.374  1.00 68.51 ? 196 GLY B N   1 
ATOM   5930 C  CA  . GLY B 2 196 ? 119.318 18.079  36.429  1.00 67.88 ? 196 GLY B CA  1 
ATOM   5931 C  C   . GLY B 2 196 ? 120.442 19.089  36.287  1.00 67.39 ? 196 GLY B C   1 
ATOM   5932 O  O   . GLY B 2 196 ? 121.594 18.700  36.062  1.00 67.01 ? 196 GLY B O   1 
ATOM   5933 N  N   . GLN B 2 197 ? 120.115 20.376  36.393  1.00 66.97 ? 197 GLN B N   1 
ATOM   5934 C  CA  . GLN B 2 197 ? 121.125 21.419  36.288  1.00 65.63 ? 197 GLN B CA  1 
ATOM   5935 C  C   . GLN B 2 197 ? 122.044 21.120  37.450  1.00 63.95 ? 197 GLN B C   1 
ATOM   5936 O  O   . GLN B 2 197 ? 123.223 20.834  37.268  1.00 63.02 ? 197 GLN B O   1 
ATOM   5937 C  CB  . GLN B 2 197 ? 120.482 22.794  36.438  1.00 65.53 ? 197 GLN B CB  1 
ATOM   5938 N  N   . HIS B 2 198 ? 121.453 21.110  38.636  1.00 61.63 ? 198 HIS B N   1 
ATOM   5939 C  CA  . HIS B 2 198 ? 122.160 20.804  39.851  1.00 60.89 ? 198 HIS B CA  1 
ATOM   5940 C  C   . HIS B 2 198 ? 122.974 19.520  39.597  1.00 58.90 ? 198 HIS B C   1 
ATOM   5941 O  O   . HIS B 2 198 ? 124.194 19.554  39.614  1.00 57.30 ? 198 HIS B O   1 
ATOM   5942 C  CB  . HIS B 2 198 ? 121.131 20.620  40.987  1.00 61.29 ? 198 HIS B CB  1 
ATOM   5943 C  CG  . HIS B 2 198 ? 121.730 20.165  42.285  1.00 63.28 ? 198 HIS B CG  1 
ATOM   5944 N  ND1 . HIS B 2 198 ? 121.833 20.989  43.386  1.00 63.81 ? 198 HIS B ND1 1 
ATOM   5945 C  CD2 . HIS B 2 198 ? 122.295 18.987  42.642  1.00 63.95 ? 198 HIS B CD2 1 
ATOM   5946 C  CE1 . HIS B 2 198 ? 122.446 20.339  44.364  1.00 64.38 ? 198 HIS B CE1 1 
ATOM   5947 N  NE2 . HIS B 2 198 ? 122.736 19.125  43.937  1.00 64.60 ? 198 HIS B NE2 1 
ATOM   5948 N  N   . ARG B 2 199 ? 122.277 18.425  39.290  1.00 58.45 ? 199 ARG B N   1 
ATOM   5949 C  CA  . ARG B 2 199 ? 122.861 17.103  39.031  1.00 57.25 ? 199 ARG B CA  1 
ATOM   5950 C  C   . ARG B 2 199 ? 124.111 17.121  38.172  1.00 56.37 ? 199 ARG B C   1 
ATOM   5951 O  O   . ARG B 2 199 ? 125.195 16.714  38.598  1.00 55.38 ? 199 ARG B O   1 
ATOM   5952 C  CB  . ARG B 2 199 ? 121.805 16.165  38.401  1.00 55.33 ? 199 ARG B CB  1 
ATOM   5953 N  N   . THR B 2 200 ? 123.943 17.555  36.936  1.00 56.60 ? 200 THR B N   1 
ATOM   5954 C  CA  . THR B 2 200 ? 125.056 17.625  36.006  1.00 56.87 ? 200 THR B CA  1 
ATOM   5955 C  C   . THR B 2 200 ? 126.124 18.545  36.613  1.00 54.53 ? 200 THR B C   1 
ATOM   5956 O  O   . THR B 2 200 ? 127.280 18.150  36.794  1.00 52.67 ? 200 THR B O   1 
ATOM   5957 C  CB  . THR B 2 200 ? 124.547 18.100  34.613  1.00 58.78 ? 200 THR B CB  1 
ATOM   5958 O  OG1 . THR B 2 200 ? 123.918 16.997  33.939  1.00 59.35 ? 200 THR B OG1 1 
ATOM   5959 C  CG2 . THR B 2 200 ? 125.686 18.646  33.753  1.00 60.24 ? 200 THR B CG2 1 
ATOM   5960 N  N   . LYS B 2 201 ? 125.688 19.731  37.014  1.00 51.38 ? 201 LYS B N   1 
ATOM   5961 C  CA  . LYS B 2 201 ? 126.530 20.725  37.651  1.00 50.39 ? 201 LYS B CA  1 
ATOM   5962 C  C   . LYS B 2 201 ? 127.372 19.996  38.722  1.00 48.82 ? 201 LYS B C   1 
ATOM   5963 O  O   . LYS B 2 201 ? 128.510 20.374  39.026  1.00 48.07 ? 201 LYS B O   1 
ATOM   5964 C  CB  . LYS B 2 201 ? 125.589 21.770  38.269  1.00 52.19 ? 201 LYS B CB  1 
ATOM   5965 C  CG  . LYS B 2 201 ? 126.201 22.932  38.997  1.00 55.06 ? 201 LYS B CG  1 
ATOM   5966 C  CD  . LYS B 2 201 ? 127.035 23.797  38.083  1.00 58.80 ? 201 LYS B CD  1 
ATOM   5967 C  CE  . LYS B 2 201 ? 126.227 24.499  37.007  1.00 59.52 ? 201 LYS B CE  1 
ATOM   5968 N  NZ  . LYS B 2 201 ? 127.172 25.004  35.962  1.00 61.61 ? 201 LYS B NZ  1 
ATOM   5969 N  N   . ILE B 2 202 ? 126.825 18.897  39.230  1.00 47.39 ? 202 ILE B N   1 
ATOM   5970 C  CA  . ILE B 2 202 ? 127.496 18.106  40.238  1.00 46.02 ? 202 ILE B CA  1 
ATOM   5971 C  C   . ILE B 2 202 ? 128.645 17.292  39.683  1.00 46.38 ? 202 ILE B C   1 
ATOM   5972 O  O   . ILE B 2 202 ? 129.802 17.496  40.078  1.00 46.65 ? 202 ILE B O   1 
ATOM   5973 C  CB  . ILE B 2 202 ? 126.521 17.165  40.951  1.00 44.54 ? 202 ILE B CB  1 
ATOM   5974 C  CG1 . ILE B 2 202 ? 125.398 17.978  41.598  1.00 44.04 ? 202 ILE B CG1 1 
ATOM   5975 C  CG2 . ILE B 2 202 ? 127.262 16.279  41.950  1.00 44.07 ? 202 ILE B CG2 1 
ATOM   5976 C  CD1 . ILE B 2 202 ? 125.860 19.206  42.365  1.00 41.86 ? 202 ILE B CD1 1 
ATOM   5977 N  N   . GLU B 2 203 ? 128.334 16.372  38.768  1.00 46.88 ? 203 GLU B N   1 
ATOM   5978 C  CA  . GLU B 2 203 ? 129.364 15.509  38.175  1.00 46.04 ? 203 GLU B CA  1 
ATOM   5979 C  C   . GLU B 2 203 ? 130.439 16.404  37.600  1.00 44.84 ? 203 GLU B C   1 
ATOM   5980 O  O   . GLU B 2 203 ? 131.620 16.054  37.557  1.00 42.98 ? 203 GLU B O   1 
ATOM   5981 C  CB  . GLU B 2 203 ? 128.790 14.587  37.090  1.00 46.87 ? 203 GLU B CB  1 
ATOM   5982 C  CG  . GLU B 2 203 ? 129.498 13.220  37.072  1.00 46.28 ? 203 GLU B CG  1 
ATOM   5983 C  CD  . GLU B 2 203 ? 129.375 12.470  35.757  1.00 46.03 ? 203 GLU B CD  1 
ATOM   5984 O  OE1 . GLU B 2 203 ? 128.291 12.525  35.135  1.00 46.19 ? 203 GLU B OE1 1 
ATOM   5985 O  OE2 . GLU B 2 203 ? 130.370 11.813  35.360  1.00 44.29 ? 203 GLU B OE2 1 
ATOM   5986 N  N   . GLU B 2 204 ? 129.997 17.590  37.210  1.00 45.11 ? 204 GLU B N   1 
ATOM   5987 C  CA  . GLU B 2 204 ? 130.845 18.627  36.679  1.00 45.44 ? 204 GLU B CA  1 
ATOM   5988 C  C   . GLU B 2 204 ? 131.968 18.766  37.685  1.00 43.69 ? 204 GLU B C   1 
ATOM   5989 O  O   . GLU B 2 204 ? 133.136 18.508  37.368  1.00 43.70 ? 204 GLU B O   1 
ATOM   5990 C  CB  . GLU B 2 204 ? 130.021 19.894  36.620  1.00 47.38 ? 204 GLU B CB  1 
ATOM   5991 C  CG  . GLU B 2 204 ? 130.730 21.136  36.203  1.00 50.66 ? 204 GLU B CG  1 
ATOM   5992 C  CD  . GLU B 2 204 ? 129.781 22.322  36.191  1.00 52.41 ? 204 GLU B CD  1 
ATOM   5993 O  OE1 . GLU B 2 204 ? 128.800 22.296  35.408  1.00 53.17 ? 204 GLU B OE1 1 
ATOM   5994 O  OE2 . GLU B 2 204 ? 129.995 23.263  36.984  1.00 52.56 ? 204 GLU B OE2 1 
ATOM   5995 N  N   . LEU B 2 205 ? 131.585 19.048  38.924  1.00 41.73 ? 205 LEU B N   1 
ATOM   5996 C  CA  . LEU B 2 205 ? 132.543 19.183  40.001  1.00 41.45 ? 205 LEU B CA  1 
ATOM   5997 C  C   . LEU B 2 205 ? 133.301 17.908  40.255  1.00 40.62 ? 205 LEU B C   1 
ATOM   5998 O  O   . LEU B 2 205 ? 134.509 17.919  40.476  1.00 38.39 ? 205 LEU B O   1 
ATOM   5999 C  CB  . LEU B 2 205 ? 131.849 19.597  41.283  1.00 40.28 ? 205 LEU B CB  1 
ATOM   6000 C  CG  . LEU B 2 205 ? 132.805 19.776  42.467  1.00 40.27 ? 205 LEU B CG  1 
ATOM   6001 C  CD1 . LEU B 2 205 ? 134.222 20.223  42.062  1.00 40.39 ? 205 LEU B CD1 1 
ATOM   6002 C  CD2 . LEU B 2 205 ? 132.191 20.786  43.390  1.00 40.75 ? 205 LEU B CD2 1 
ATOM   6003 N  N   . ARG B 2 206 ? 132.570 16.815  40.273  1.00 42.36 ? 206 ARG B N   1 
ATOM   6004 C  CA  . ARG B 2 206 ? 133.167 15.526  40.513  1.00 46.91 ? 206 ARG B CA  1 
ATOM   6005 C  C   . ARG B 2 206 ? 134.387 15.311  39.621  1.00 46.94 ? 206 ARG B C   1 
ATOM   6006 O  O   . ARG B 2 206 ? 135.481 14.932  40.081  1.00 45.71 ? 206 ARG B O   1 
ATOM   6007 C  CB  . ARG B 2 206 ? 132.128 14.441  40.242  1.00 52.04 ? 206 ARG B CB  1 
ATOM   6008 C  CG  . ARG B 2 206 ? 130.919 14.452  41.193  1.00 56.37 ? 206 ARG B CG  1 
ATOM   6009 C  CD  . ARG B 2 206 ? 130.051 13.178  41.055  1.00 60.91 ? 206 ARG B CD  1 
ATOM   6010 N  NE  . ARG B 2 206 ? 130.770 11.954  41.417  1.00 64.62 ? 206 ARG B NE  1 
ATOM   6011 C  CZ  . ARG B 2 206 ? 131.514 11.236  40.575  1.00 67.80 ? 206 ARG B CZ  1 
ATOM   6012 N  NH1 . ARG B 2 206 ? 131.639 11.605  39.302  1.00 69.62 ? 206 ARG B NH1 1 
ATOM   6013 N  NH2 . ARG B 2 206 ? 132.188 10.180  41.019  1.00 70.22 ? 206 ARG B NH2 1 
ATOM   6014 N  N   . GLN B 2 207 ? 134.192 15.607  38.344  1.00 48.31 ? 207 GLN B N   1 
ATOM   6015 C  CA  . GLN B 2 207 ? 135.227 15.443  37.336  1.00 48.96 ? 207 GLN B CA  1 
ATOM   6016 C  C   . GLN B 2 207 ? 136.355 16.423  37.565  1.00 45.98 ? 207 GLN B C   1 
ATOM   6017 O  O   . GLN B 2 207 ? 137.504 16.026  37.702  1.00 42.83 ? 207 GLN B O   1 
ATOM   6018 C  CB  . GLN B 2 207 ? 134.591 15.581  35.954  1.00 52.80 ? 207 GLN B CB  1 
ATOM   6019 C  CG  . GLN B 2 207 ? 133.548 14.476  35.727  1.00 57.61 ? 207 GLN B CG  1 
ATOM   6020 C  CD  . GLN B 2 207 ? 132.509 14.787  34.648  1.00 60.09 ? 207 GLN B CD  1 
ATOM   6021 O  OE1 . GLN B 2 207 ? 132.025 13.880  33.959  1.00 61.14 ? 207 GLN B OE1 1 
ATOM   6022 N  NE2 . GLN B 2 207 ? 132.135 16.058  34.522  1.00 60.42 ? 207 GLN B NE2 1 
ATOM   6023 N  N   . HIS B 2 208 ? 135.994 17.695  37.668  1.00 45.21 ? 208 HIS B N   1 
ATOM   6024 C  CA  . HIS B 2 208 ? 136.940 18.764  37.932  1.00 45.94 ? 208 HIS B CA  1 
ATOM   6025 C  C   . HIS B 2 208 ? 137.830 18.296  39.070  1.00 46.30 ? 208 HIS B C   1 
ATOM   6026 O  O   . HIS B 2 208 ? 139.065 18.339  38.976  1.00 45.89 ? 208 HIS B O   1 
ATOM   6027 C  CB  . HIS B 2 208 ? 136.168 20.020  38.357  1.00 48.37 ? 208 HIS B CB  1 
ATOM   6028 C  CG  . HIS B 2 208 ? 136.953 20.967  39.218  1.00 52.61 ? 208 HIS B CG  1 
ATOM   6029 N  ND1 . HIS B 2 208 ? 138.206 21.437  38.877  1.00 53.97 ? 208 HIS B ND1 1 
ATOM   6030 C  CD2 . HIS B 2 208 ? 136.643 21.564  40.394  1.00 53.08 ? 208 HIS B CD2 1 
ATOM   6031 C  CE1 . HIS B 2 208 ? 138.631 22.283  39.800  1.00 53.45 ? 208 HIS B CE1 1 
ATOM   6032 N  NE2 . HIS B 2 208 ? 137.699 22.379  40.731  1.00 53.49 ? 208 HIS B NE2 1 
ATOM   6033 N  N   . LEU B 2 209 ? 137.171 17.836  40.132  1.00 46.00 ? 209 LEU B N   1 
ATOM   6034 C  CA  . LEU B 2 209 ? 137.809 17.328  41.336  1.00 44.49 ? 209 LEU B CA  1 
ATOM   6035 C  C   . LEU B 2 209 ? 138.817 16.282  40.974  1.00 43.76 ? 209 LEU B C   1 
ATOM   6036 O  O   . LEU B 2 209 ? 140.010 16.430  41.228  1.00 44.75 ? 209 LEU B O   1 
ATOM   6037 C  CB  . LEU B 2 209 ? 136.769 16.662  42.214  1.00 44.85 ? 209 LEU B CB  1 
ATOM   6038 C  CG  . LEU B 2 209 ? 136.062 17.523  43.239  1.00 44.89 ? 209 LEU B CG  1 
ATOM   6039 C  CD1 . LEU B 2 209 ? 134.732 16.868  43.556  1.00 44.71 ? 209 LEU B CD1 1 
ATOM   6040 C  CD2 . LEU B 2 209 ? 136.952 17.668  44.489  1.00 45.24 ? 209 LEU B CD2 1 
ATOM   6041 N  N   . LEU B 2 210 ? 138.319 15.212  40.381  1.00 42.51 ? 210 LEU B N   1 
ATOM   6042 C  CA  . LEU B 2 210 ? 139.173 14.125  39.990  1.00 42.95 ? 210 LEU B CA  1 
ATOM   6043 C  C   . LEU B 2 210 ? 140.400 14.623  39.224  1.00 43.11 ? 210 LEU B C   1 
ATOM   6044 O  O   . LEU B 2 210 ? 141.531 14.221  39.504  1.00 41.14 ? 210 LEU B O   1 
ATOM   6045 C  CB  . LEU B 2 210 ? 138.368 13.121  39.182  1.00 43.87 ? 210 LEU B CB  1 
ATOM   6046 C  CG  . LEU B 2 210 ? 139.014 11.736  39.139  1.00 45.34 ? 210 LEU B CG  1 
ATOM   6047 C  CD1 . LEU B 2 210 ? 139.726 11.415  40.443  1.00 43.57 ? 210 LEU B CD1 1 
ATOM   6048 C  CD2 . LEU B 2 210 ? 137.967 10.688  38.812  1.00 45.93 ? 210 LEU B CD2 1 
ATOM   6049 N  N   . ARG B 2 211 ? 140.177 15.565  38.321  1.00 44.70 ? 211 ARG B N   1 
ATOM   6050 C  CA  . ARG B 2 211 ? 141.256 16.136  37.536  1.00 46.25 ? 211 ARG B CA  1 
ATOM   6051 C  C   . ARG B 2 211 ? 142.325 16.724  38.431  1.00 48.68 ? 211 ARG B C   1 
ATOM   6052 O  O   . ARG B 2 211 ? 143.515 16.453  38.268  1.00 48.29 ? 211 ARG B O   1 
ATOM   6053 C  CB  . ARG B 2 211 ? 140.742 17.255  36.625  1.00 44.79 ? 211 ARG B CB  1 
ATOM   6054 C  CG  . ARG B 2 211 ? 139.811 16.826  35.513  1.00 42.56 ? 211 ARG B CG  1 
ATOM   6055 C  CD  . ARG B 2 211 ? 139.419 18.047  34.724  1.00 41.18 ? 211 ARG B CD  1 
ATOM   6056 N  NE  . ARG B 2 211 ? 138.071 17.976  34.166  1.00 41.00 ? 211 ARG B NE  1 
ATOM   6057 C  CZ  . ARG B 2 211 ? 137.198 18.984  34.185  1.00 40.88 ? 211 ARG B CZ  1 
ATOM   6058 N  NH1 . ARG B 2 211 ? 137.515 20.153  34.747  1.00 40.28 ? 211 ARG B NH1 1 
ATOM   6059 N  NH2 . ARG B 2 211 ? 136.018 18.841  33.593  1.00 41.45 ? 211 ARG B NH2 1 
ATOM   6060 N  N   . TRP B 2 212 ? 141.900 17.483  39.424  1.00 53.06 ? 212 TRP B N   1 
ATOM   6061 C  CA  . TRP B 2 212 ? 142.873 18.137  40.274  1.00 58.13 ? 212 TRP B CA  1 
ATOM   6062 C  C   . TRP B 2 212 ? 143.616 17.445  41.398  1.00 57.73 ? 212 TRP B C   1 
ATOM   6063 O  O   . TRP B 2 212 ? 144.291 18.101  42.191  1.00 56.87 ? 212 TRP B O   1 
ATOM   6064 C  CB  . TRP B 2 212 ? 142.386 19.530  40.675  1.00 64.40 ? 212 TRP B CB  1 
ATOM   6065 C  CG  . TRP B 2 212 ? 142.823 20.524  39.627  1.00 72.51 ? 212 TRP B CG  1 
ATOM   6066 C  CD1 . TRP B 2 212 ? 142.032 21.163  38.705  1.00 74.32 ? 212 TRP B CD1 1 
ATOM   6067 C  CD2 . TRP B 2 212 ? 144.178 20.905  39.329  1.00 75.49 ? 212 TRP B CD2 1 
ATOM   6068 N  NE1 . TRP B 2 212 ? 142.817 21.909  37.849  1.00 75.49 ? 212 TRP B NE1 1 
ATOM   6069 C  CE2 . TRP B 2 212 ? 144.133 21.771  38.209  1.00 76.16 ? 212 TRP B CE2 1 
ATOM   6070 C  CE3 . TRP B 2 212 ? 145.428 20.597  39.898  1.00 76.67 ? 212 TRP B CE3 1 
ATOM   6071 C  CZ2 . TRP B 2 212 ? 145.289 22.330  37.645  1.00 76.70 ? 212 TRP B CZ2 1 
ATOM   6072 C  CZ3 . TRP B 2 212 ? 146.577 21.153  39.338  1.00 77.16 ? 212 TRP B CZ3 1 
ATOM   6073 C  CH2 . TRP B 2 212 ? 146.497 22.011  38.222  1.00 78.04 ? 212 TRP B CH2 1 
ATOM   6074 N  N   . GLY B 2 213 ? 143.576 16.125  41.437  1.00 57.63 ? 213 GLY B N   1 
ATOM   6075 C  CA  . GLY B 2 213 ? 144.324 15.464  42.485  1.00 60.15 ? 213 GLY B CA  1 
ATOM   6076 C  C   . GLY B 2 213 ? 143.861 14.077  42.831  1.00 61.68 ? 213 GLY B C   1 
ATOM   6077 O  O   . GLY B 2 213 ? 144.027 13.636  43.973  1.00 60.69 ? 213 GLY B O   1 
ATOM   6078 N  N   . LEU B 2 214 ? 143.376 13.363  41.819  1.00 63.96 ? 214 LEU B N   1 
ATOM   6079 C  CA  . LEU B 2 214 ? 142.847 12.010  41.985  1.00 67.46 ? 214 LEU B CA  1 
ATOM   6080 C  C   . LEU B 2 214 ? 141.934 12.004  43.209  1.00 69.28 ? 214 LEU B C   1 
ATOM   6081 O  O   . LEU B 2 214 ? 141.993 11.144  44.105  1.00 69.71 ? 214 LEU B O   1 
ATOM   6082 C  CB  . LEU B 2 214 ? 143.941 10.931  42.057  1.00 67.59 ? 214 LEU B CB  1 
ATOM   6083 C  CG  . LEU B 2 214 ? 143.391 9.494   41.928  1.00 67.73 ? 214 LEU B CG  1 
ATOM   6084 C  CD1 . LEU B 2 214 ? 142.793 9.249   40.539  1.00 66.67 ? 214 LEU B CD1 1 
ATOM   6085 C  CD2 . LEU B 2 214 ? 144.480 8.486   42.242  1.00 68.31 ? 214 LEU B CD2 1 
ATOM   6086 N  N   . THR B 2 215 ? 141.160 13.073  43.272  1.00 71.03 ? 215 THR B N   1 
ATOM   6087 C  CA  . THR B 2 215 ? 140.185 13.245  44.308  1.00 72.73 ? 215 THR B CA  1 
ATOM   6088 C  C   . THR B 2 215 ? 138.978 12.615  43.606  1.00 75.08 ? 215 THR B C   1 
ATOM   6089 O  O   . THR B 2 215 ? 138.232 13.289  42.889  1.00 75.75 ? 215 THR B O   1 
ATOM   6090 C  CB  . THR B 2 215 ? 140.004 14.745  44.612  1.00 71.15 ? 215 THR B CB  1 
ATOM   6091 O  OG1 . THR B 2 215 ? 140.046 15.481  43.389  1.00 68.11 ? 215 THR B OG1 1 
ATOM   6092 C  CG2 . THR B 2 215 ? 141.131 15.240  45.505  1.00 69.75 ? 215 THR B CG2 1 
ATOM   6093 N  N   . THR B 2 216 ? 138.933 11.286  43.669  1.00 77.67 ? 216 THR B N   1 
ATOM   6094 C  CA  . THR B 2 216 ? 137.878 10.488  43.047  1.00 80.93 ? 216 THR B CA  1 
ATOM   6095 C  C   . THR B 2 216 ? 136.647 10.404  43.965  1.00 83.46 ? 216 THR B C   1 
ATOM   6096 O  O   . THR B 2 216 ? 136.790 10.251  45.191  1.00 84.21 ? 216 THR B O   1 
ATOM   6097 C  CB  . THR B 2 216 ? 138.396 9.041   42.732  1.00 79.59 ? 216 THR B CB  1 
ATOM   6098 O  OG1 . THR B 2 216 ? 139.749 9.107   42.253  1.00 77.61 ? 216 THR B OG1 1 
ATOM   6099 C  CG2 . THR B 2 216 ? 137.520 8.352   41.666  1.00 77.87 ? 216 THR B CG2 1 
ATOM   6100 N  N   . PRO B 2 217 ? 135.431 10.611  43.396  1.00 85.56 ? 217 PRO B N   1 
ATOM   6101 C  CA  . PRO B 2 217 ? 134.164 10.553  44.143  1.00 87.46 ? 217 PRO B CA  1 
ATOM   6102 C  C   . PRO B 2 217 ? 133.458 9.204   43.944  1.00 88.67 ? 217 PRO B C   1 
ATOM   6103 O  O   . PRO B 2 217 ? 134.038 8.262   43.387  1.00 89.11 ? 217 PRO B O   1 
ATOM   6104 C  CB  . PRO B 2 217 ? 133.340 11.694  43.519  1.00 86.01 ? 217 PRO B CB  1 
ATOM   6105 C  CG  . PRO B 2 217 ? 134.296 12.399  42.550  1.00 86.09 ? 217 PRO B CG  1 
ATOM   6106 C  CD  . PRO B 2 217 ? 135.222 11.307  42.120  1.00 85.85 ? 217 PRO B CD  1 
ATOM   6107 N  N   . ASP B 2 218 ? 132.202 9.118   44.381  1.00 90.16 ? 218 ASP B N   1 
ATOM   6108 C  CA  . ASP B 2 218 ? 131.413 7.895   44.244  1.00 91.79 ? 218 ASP B CA  1 
ATOM   6109 C  C   . ASP B 2 218 ? 130.384 8.063   43.131  1.00 93.26 ? 218 ASP B C   1 
ATOM   6110 O  O   . ASP B 2 218 ? 129.586 9.009   43.154  1.00 93.47 ? 218 ASP B O   1 
ATOM   6111 C  CB  . ASP B 2 218 ? 130.709 7.548   45.566  1.00 90.63 ? 218 ASP B CB  1 
ATOM   6112 C  CG  . ASP B 2 218 ? 131.332 6.344   46.270  1.00 89.76 ? 218 ASP B CG  1 
ATOM   6113 O  OD1 . ASP B 2 218 ? 132.488 5.985   45.953  1.00 88.21 ? 218 ASP B OD1 1 
ATOM   6114 O  OD2 . ASP B 2 218 ? 130.662 5.753   47.149  1.00 89.65 ? 218 ASP B OD2 1 
ATOM   6115 N  N   . LYS B 2 219 ? 130.430 7.164   42.145  1.00 95.44 ? 219 LYS B N   1 
ATOM   6116 C  CA  . LYS B 2 219 ? 129.505 7.194   41.007  1.00 98.16 ? 219 LYS B CA  1 
ATOM   6117 C  C   . LYS B 2 219 ? 128.121 6.679   41.461  1.00 99.64 ? 219 LYS B C   1 
ATOM   6118 O  O   . LYS B 2 219 ? 127.806 5.498   41.298  1.00 99.90 ? 219 LYS B O   1 
ATOM   6119 C  CB  . LYS B 2 219 ? 130.071 6.344   39.850  1.00 97.23 ? 219 LYS B CB  1 
ATOM   6120 C  CG  . LYS B 2 219 ? 129.914 6.974   38.456  1.00 97.87 ? 219 LYS B CG  1 
ATOM   6121 C  CD  . LYS B 2 219 ? 130.515 6.101   37.358  1.00 97.79 ? 219 LYS B CD  1 
ATOM   6122 C  CE  . LYS B 2 219 ? 130.382 6.762   35.993  1.00 97.95 ? 219 LYS B CE  1 
ATOM   6123 N  NZ  . LYS B 2 219 ? 130.870 5.885   34.886  1.00 98.05 ? 219 LYS B NZ  1 
ATOM   6124 N  N   . LYS B 2 220 ? 127.314 7.580   42.035  1.00 99.90 ? 220 LYS B N   1 
ATOM   6125 C  CA  . LYS B 2 220 ? 125.976 7.266   42.563  1.00 99.90 ? 220 LYS B CA  1 
ATOM   6126 C  C   . LYS B 2 220 ? 124.888 6.851   41.567  1.00 99.90 ? 220 LYS B C   1 
ATOM   6127 O  O   . LYS B 2 220 ? 123.996 6.069   41.917  1.00 99.90 ? 220 LYS B O   1 
ATOM   6128 C  CB  . LYS B 2 220 ? 125.470 8.420   43.445  1.00 99.90 ? 220 LYS B CB  1 
ATOM   6129 N  N   . HIS B 2 221 ? 124.911 7.408   40.356  1.00 99.90 ? 221 HIS B N   1 
ATOM   6130 C  CA  . HIS B 2 221 ? 123.904 7.063   39.345  1.00 99.90 ? 221 HIS B CA  1 
ATOM   6131 C  C   . HIS B 2 221 ? 124.457 7.026   37.931  1.00 99.90 ? 221 HIS B C   1 
ATOM   6132 O  O   . HIS B 2 221 ? 124.851 8.057   37.375  1.00 99.90 ? 221 HIS B O   1 
ATOM   6133 C  CB  . HIS B 2 221 ? 122.712 8.027   39.398  1.00 99.90 ? 221 HIS B CB  1 
ATOM   6134 C  CG  . HIS B 2 221 ? 121.959 7.973   40.689  1.00 99.90 ? 221 HIS B CG  1 
ATOM   6135 N  ND1 . HIS B 2 221 ? 122.129 8.907   41.690  1.00 99.90 ? 221 HIS B ND1 1 
ATOM   6136 C  CD2 . HIS B 2 221 ? 121.069 7.071   41.163  1.00 99.90 ? 221 HIS B CD2 1 
ATOM   6137 C  CE1 . HIS B 2 221 ? 121.377 8.581   42.725  1.00 99.90 ? 221 HIS B CE1 1 
ATOM   6138 N  NE2 . HIS B 2 221 ? 120.724 7.471   42.433  1.00 99.90 ? 221 HIS B NE2 1 
ATOM   6139 N  N   . GLN B 2 222 ? 124.525 5.821   37.376  1.00 99.90 ? 222 GLN B N   1 
ATOM   6140 C  CA  . GLN B 2 222 ? 125.005 5.625   36.015  1.00 99.90 ? 222 GLN B CA  1 
ATOM   6141 C  C   . GLN B 2 222 ? 123.841 6.029   35.102  1.00 99.90 ? 222 GLN B C   1 
ATOM   6142 O  O   . GLN B 2 222 ? 122.943 6.771   35.519  1.00 99.90 ? 222 GLN B O   1 
ATOM   6143 C  CB  . GLN B 2 222 ? 125.369 4.147   35.801  1.00 99.90 ? 222 GLN B CB  1 
ATOM   6144 N  N   . LYS B 2 223 ? 123.875 5.571   33.851  1.00 99.90 ? 223 LYS B N   1 
ATOM   6145 C  CA  . LYS B 2 223 ? 122.785 5.833   32.904  1.00 99.90 ? 223 LYS B CA  1 
ATOM   6146 C  C   . LYS B 2 223 ? 121.680 4.807   33.238  1.00 99.90 ? 223 LYS B C   1 
ATOM   6147 O  O   . LYS B 2 223 ? 120.602 4.791   32.622  1.00 99.90 ? 223 LYS B O   1 
ATOM   6148 C  CB  . LYS B 2 223 ? 123.274 5.647   31.454  1.00 99.90 ? 223 LYS B CB  1 
ATOM   6149 N  N   . GLU B 2 224 ? 121.978 3.960   34.231  1.00 99.90 ? 224 GLU B N   1 
ATOM   6150 C  CA  . GLU B 2 224 ? 121.099 2.897   34.708  1.00 99.90 ? 224 GLU B CA  1 
ATOM   6151 C  C   . GLU B 2 224 ? 120.012 3.335   35.696  1.00 99.90 ? 224 GLU B C   1 
ATOM   6152 O  O   . GLU B 2 224 ? 120.187 4.271   36.487  1.00 99.90 ? 224 GLU B O   1 
ATOM   6153 C  CB  . GLU B 2 224 ? 121.951 1.769   35.324  1.00 99.90 ? 224 GLU B CB  1 
ATOM   6154 N  N   . PRO B 2 225 ? 118.895 2.620   35.648  1.00 99.90 ? 225 PRO B N   1 
ATOM   6155 C  CA  . PRO B 2 225 ? 117.768 2.870   36.527  1.00 99.90 ? 225 PRO B CA  1 
ATOM   6156 C  C   . PRO B 2 225 ? 117.753 1.695   37.508  1.00 99.90 ? 225 PRO B C   1 
ATOM   6157 O  O   . PRO B 2 225 ? 117.931 0.540   37.102  1.00 99.90 ? 225 PRO B O   1 
ATOM   6158 C  CB  . PRO B 2 225 ? 116.477 2.914   35.716  1.00 99.90 ? 225 PRO B CB  1 
ATOM   6159 N  N   . PRO B 2 226 ? 117.588 1.990   38.793  1.00 99.90 ? 226 PRO B N   1 
ATOM   6160 C  CA  . PRO B 2 226 ? 117.563 0.951   39.821  1.00 99.90 ? 226 PRO B CA  1 
ATOM   6161 C  C   . PRO B 2 226 ? 116.751 1.443   41.016  1.00 99.90 ? 226 PRO B C   1 
ATOM   6162 O  O   . PRO B 2 226 ? 116.298 2.590   41.033  1.00 99.90 ? 226 PRO B O   1 
ATOM   6163 C  CB  . PRO B 2 226 ? 118.999 0.609   40.257  1.00 99.90 ? 226 PRO B CB  1 
ATOM   6164 N  N   . PHE B 2 227 ? 116.533 0.565   41.991  1.00 99.90 ? 227 PHE B N   1 
ATOM   6165 C  CA  . PHE B 2 227 ? 115.804 0.941   43.198  1.00 99.90 ? 227 PHE B CA  1 
ATOM   6166 C  C   . PHE B 2 227 ? 116.807 1.424   44.263  1.00 99.90 ? 227 PHE B C   1 
ATOM   6167 O  O   . PHE B 2 227 ? 116.565 1.275   45.466  1.00 99.90 ? 227 PHE B O   1 
ATOM   6168 C  CB  . PHE B 2 227 ? 114.968 -0.245  43.721  1.00 99.90 ? 227 PHE B CB  1 
ATOM   6169 N  N   . LEU B 2 228 ? 117.935 1.982   43.804  1.00 99.90 ? 228 LEU B N   1 
ATOM   6170 C  CA  . LEU B 2 228 ? 118.995 2.505   44.679  1.00 99.90 ? 228 LEU B CA  1 
ATOM   6171 C  C   . LEU B 2 228 ? 118.594 3.869   45.281  1.00 99.90 ? 228 LEU B C   1 
ATOM   6172 O  O   . LEU B 2 228 ? 117.624 4.490   44.828  1.00 99.90 ? 228 LEU B O   1 
ATOM   6173 C  CB  . LEU B 2 228 ? 120.324 2.623   43.903  1.00 99.90 ? 228 LEU B CB  1 
ATOM   6174 N  N   . TRP B 2 229 ? 119.339 4.336   46.286  1.00 99.90 ? 229 TRP B N   1 
ATOM   6175 C  CA  . TRP B 2 229 ? 119.037 5.609   46.948  1.00 99.90 ? 229 TRP B CA  1 
ATOM   6176 C  C   . TRP B 2 229 ? 118.924 6.778   45.975  1.00 99.90 ? 229 TRP B C   1 
ATOM   6177 O  O   . TRP B 2 229 ? 119.719 6.891   45.031  1.00 99.90 ? 229 TRP B O   1 
ATOM   6178 C  CB  . TRP B 2 229 ? 120.089 5.916   48.021  1.00 99.90 ? 229 TRP B CB  1 
ATOM   6179 N  N   . MET B 2 230 ? 117.953 7.659   46.221  1.00 99.90 ? 230 MET B N   1 
ATOM   6180 C  CA  . MET B 2 230 ? 117.747 8.846   45.388  1.00 99.90 ? 230 MET B CA  1 
ATOM   6181 C  C   . MET B 2 230 ? 118.836 9.882   45.717  1.00 99.90 ? 230 MET B C   1 
ATOM   6182 O  O   . MET B 2 230 ? 118.629 11.094  45.601  1.00 99.90 ? 230 MET B O   1 
ATOM   6183 C  CB  . MET B 2 230 ? 116.346 9.432   45.619  1.00 99.90 ? 230 MET B CB  1 
ATOM   6184 N  N   . GLY B 2 231 ? 119.994 9.365   46.131  1.00 99.90 ? 231 GLY B N   1 
ATOM   6185 C  CA  . GLY B 2 231 ? 121.141 10.175  46.476  1.00 99.90 ? 231 GLY B CA  1 
ATOM   6186 C  C   . GLY B 2 231 ? 120.994 10.983  47.742  1.00 99.90 ? 231 GLY B C   1 
ATOM   6187 O  O   . GLY B 2 231 ? 119.918 11.062  48.352  1.00 99.90 ? 231 GLY B O   1 
ATOM   6188 N  N   . TYR B 2 232 ? 122.126 11.519  48.180  1.00 99.90 ? 232 TYR B N   1 
ATOM   6189 C  CA  . TYR B 2 232 ? 122.160 12.373  49.349  1.00 99.68 ? 232 TYR B CA  1 
ATOM   6190 C  C   . TYR B 2 232 ? 121.980 13.783  48.787  1.00 97.44 ? 232 TYR B C   1 
ATOM   6191 O  O   . TYR B 2 232 ? 122.926 14.576  48.727  1.00 97.37 ? 232 TYR B O   1 
ATOM   6192 C  CB  . TYR B 2 232 ? 123.484 12.198  50.107  1.00 99.90 ? 232 TYR B CB  1 
ATOM   6193 C  CG  . TYR B 2 232 ? 123.538 10.904  50.896  1.00 99.90 ? 232 TYR B CG  1 
ATOM   6194 C  CD1 . TYR B 2 232 ? 122.801 10.755  52.078  1.00 99.90 ? 232 TYR B CD1 1 
ATOM   6195 C  CD2 . TYR B 2 232 ? 124.308 9.826   50.459  1.00 99.90 ? 232 TYR B CD2 1 
ATOM   6196 C  CE1 . TYR B 2 232 ? 122.830 9.560   52.809  1.00 99.90 ? 232 TYR B CE1 1 
ATOM   6197 C  CE2 . TYR B 2 232 ? 124.344 8.625   51.182  1.00 99.90 ? 232 TYR B CE2 1 
ATOM   6198 C  CZ  . TYR B 2 232 ? 123.606 8.501   52.355  1.00 99.90 ? 232 TYR B CZ  1 
ATOM   6199 O  OH  . TYR B 2 232 ? 123.667 7.330   53.081  1.00 99.90 ? 232 TYR B OH  1 
ATOM   6200 N  N   . GLU B 2 233 ? 120.778 14.013  48.258  1.00 93.56 ? 233 GLU B N   1 
ATOM   6201 C  CA  . GLU B 2 233 ? 120.380 15.282  47.663  1.00 89.56 ? 233 GLU B CA  1 
ATOM   6202 C  C   . GLU B 2 233 ? 119.191 15.769  48.470  1.00 87.14 ? 233 GLU B C   1 
ATOM   6203 O  O   . GLU B 2 233 ? 118.023 15.598  48.098  1.00 86.23 ? 233 GLU B O   1 
ATOM   6204 C  CB  . GLU B 2 233 ? 119.981 15.080  46.210  1.00 90.40 ? 233 GLU B CB  1 
ATOM   6205 C  CG  . GLU B 2 233 ? 121.042 14.387  45.394  1.00 91.79 ? 233 GLU B CG  1 
ATOM   6206 C  CD  . GLU B 2 233 ? 120.453 13.361  44.458  1.00 93.36 ? 233 GLU B CD  1 
ATOM   6207 O  OE1 . GLU B 2 233 ? 119.279 13.529  44.054  1.00 94.18 ? 233 GLU B OE1 1 
ATOM   6208 O  OE2 . GLU B 2 233 ? 121.156 12.378  44.137  1.00 93.76 ? 233 GLU B OE2 1 
ATOM   6209 N  N   . LEU B 2 234 ? 119.516 16.389  49.590  1.00 83.69 ? 234 LEU B N   1 
ATOM   6210 C  CA  . LEU B 2 234 ? 118.526 16.883  50.514  1.00 80.65 ? 234 LEU B CA  1 
ATOM   6211 C  C   . LEU B 2 234 ? 117.971 18.200  50.036  1.00 79.69 ? 234 LEU B C   1 
ATOM   6212 O  O   . LEU B 2 234 ? 118.554 18.866  49.184  1.00 77.69 ? 234 LEU B O   1 
ATOM   6213 C  CB  . LEU B 2 234 ? 119.171 17.033  51.878  1.00 79.43 ? 234 LEU B CB  1 
ATOM   6214 C  CG  . LEU B 2 234 ? 120.173 15.892  52.055  1.00 78.41 ? 234 LEU B CG  1 
ATOM   6215 C  CD1 . LEU B 2 234 ? 121.153 16.219  53.136  1.00 78.56 ? 234 LEU B CD1 1 
ATOM   6216 C  CD2 . LEU B 2 234 ? 119.464 14.574  52.304  1.00 77.62 ? 234 LEU B CD2 1 
ATOM   6217 N  N   . HIS B 2 235 ? 116.818 18.557  50.579  1.00 80.73 ? 235 HIS B N   1 
ATOM   6218 C  CA  . HIS B 2 235 ? 116.162 19.800  50.221  1.00 81.46 ? 235 HIS B CA  1 
ATOM   6219 C  C   . HIS B 2 235 ? 115.778 20.520  51.523  1.00 81.97 ? 235 HIS B C   1 
ATOM   6220 O  O   . HIS B 2 235 ? 114.599 20.615  51.870  1.00 81.57 ? 235 HIS B O   1 
ATOM   6221 C  CB  . HIS B 2 235 ? 114.952 19.489  49.334  1.00 82.19 ? 235 HIS B CB  1 
ATOM   6222 C  CG  . HIS B 2 235 ? 115.306 18.768  48.060  1.00 82.98 ? 235 HIS B CG  1 
ATOM   6223 N  ND1 . HIS B 2 235 ? 115.847 17.497  48.042  1.00 83.02 ? 235 HIS B ND1 1 
ATOM   6224 C  CD2 . HIS B 2 235 ? 115.182 19.138  46.762  1.00 82.90 ? 235 HIS B CD2 1 
ATOM   6225 C  CE1 . HIS B 2 235 ? 116.034 17.114  46.791  1.00 82.05 ? 235 HIS B CE1 1 
ATOM   6226 N  NE2 . HIS B 2 235 ? 115.640 18.091  45.994  1.00 81.95 ? 235 HIS B NE2 1 
ATOM   6227 N  N   . PRO B 2 236 ? 116.793 21.061  52.244  1.00 82.94 ? 236 PRO B N   1 
ATOM   6228 C  CA  . PRO B 2 236 ? 116.715 21.787  53.519  1.00 82.99 ? 236 PRO B CA  1 
ATOM   6229 C  C   . PRO B 2 236 ? 115.841 23.018  53.496  1.00 82.86 ? 236 PRO B C   1 
ATOM   6230 O  O   . PRO B 2 236 ? 115.577 23.611  54.540  1.00 83.13 ? 236 PRO B O   1 
ATOM   6231 C  CB  . PRO B 2 236 ? 118.169 22.156  53.793  1.00 83.63 ? 236 PRO B CB  1 
ATOM   6232 C  CG  . PRO B 2 236 ? 118.704 22.389  52.435  1.00 83.84 ? 236 PRO B CG  1 
ATOM   6233 C  CD  . PRO B 2 236 ? 118.159 21.177  51.699  1.00 84.31 ? 236 PRO B CD  1 
ATOM   6234 N  N   . ASP B 2 237 ? 115.408 23.434  52.312  1.00 82.70 ? 237 ASP B N   1 
ATOM   6235 C  CA  . ASP B 2 237 ? 114.527 24.576  52.262  1.00 83.11 ? 237 ASP B CA  1 
ATOM   6236 C  C   . ASP B 2 237 ? 113.168 24.084  52.761  1.00 84.26 ? 237 ASP B C   1 
ATOM   6237 O  O   . ASP B 2 237 ? 112.230 24.865  52.925  1.00 83.85 ? 237 ASP B O   1 
ATOM   6238 C  CB  . ASP B 2 237 ? 114.438 25.145  50.855  1.00 81.77 ? 237 ASP B CB  1 
ATOM   6239 C  CG  . ASP B 2 237 ? 114.298 26.649  50.863  1.00 80.57 ? 237 ASP B CG  1 
ATOM   6240 O  OD1 . ASP B 2 237 ? 114.781 27.288  51.828  1.00 78.86 ? 237 ASP B OD1 1 
ATOM   6241 O  OD2 . ASP B 2 237 ? 113.703 27.192  49.912  1.00 80.47 ? 237 ASP B OD2 1 
ATOM   6242 N  N   . LYS B 2 238 ? 113.102 22.773  53.008  1.00 86.19 ? 238 LYS B N   1 
ATOM   6243 C  CA  . LYS B 2 238 ? 111.925 22.073  53.517  1.00 88.40 ? 238 LYS B CA  1 
ATOM   6244 C  C   . LYS B 2 238 ? 112.230 21.513  54.915  1.00 89.17 ? 238 LYS B C   1 
ATOM   6245 O  O   . LYS B 2 238 ? 113.001 20.561  55.064  1.00 88.13 ? 238 LYS B O   1 
ATOM   6246 C  CB  . LYS B 2 238 ? 111.553 20.921  52.582  1.00 90.37 ? 238 LYS B CB  1 
ATOM   6247 C  CG  . LYS B 2 238 ? 111.228 21.366  51.175  1.00 93.51 ? 238 LYS B CG  1 
ATOM   6248 C  CD  . LYS B 2 238 ? 111.194 20.187  50.229  1.00 95.99 ? 238 LYS B CD  1 
ATOM   6249 C  CE  . LYS B 2 238 ? 110.867 20.628  48.809  1.00 98.22 ? 238 LYS B CE  1 
ATOM   6250 N  NZ  . LYS B 2 238 ? 110.899 19.483  47.844  1.00 99.84 ? 238 LYS B NZ  1 
ATOM   6251 N  N   . TRP B 2 239 ? 111.638 22.137  55.928  1.00 91.08 ? 239 TRP B N   1 
ATOM   6252 C  CA  . TRP B 2 239 ? 111.804 21.747  57.326  1.00 93.32 ? 239 TRP B CA  1 
ATOM   6253 C  C   . TRP B 2 239 ? 110.738 22.509  58.133  1.00 92.97 ? 239 TRP B C   1 
ATOM   6254 O  O   . TRP B 2 239 ? 110.595 23.720  57.988  1.00 92.76 ? 239 TRP B O   1 
ATOM   6255 C  CB  . TRP B 2 239 ? 113.215 22.119  57.822  1.00 96.64 ? 239 TRP B CB  1 
ATOM   6256 C  CG  . TRP B 2 239 ? 113.483 23.609  57.865  1.00 99.90 ? 239 TRP B CG  1 
ATOM   6257 C  CD1 . TRP B 2 239 ? 113.552 24.462  56.788  1.00 99.90 ? 239 TRP B CD1 1 
ATOM   6258 C  CD2 . TRP B 2 239 ? 113.657 24.423  59.031  1.00 99.90 ? 239 TRP B CD2 1 
ATOM   6259 N  NE1 . TRP B 2 239 ? 113.749 25.759  57.222  1.00 99.90 ? 239 TRP B NE1 1 
ATOM   6260 C  CE2 . TRP B 2 239 ? 113.819 25.761  58.590  1.00 99.90 ? 239 TRP B CE2 1 
ATOM   6261 C  CE3 . TRP B 2 239 ? 113.687 24.161  60.407  1.00 99.90 ? 239 TRP B CE3 1 
ATOM   6262 C  CZ2 . TRP B 2 239 ? 114.011 26.840  59.491  1.00 99.90 ? 239 TRP B CZ2 1 
ATOM   6263 C  CZ3 . TRP B 2 239 ? 113.874 25.221  61.296  1.00 99.90 ? 239 TRP B CZ3 1 
ATOM   6264 C  CH2 . TRP B 2 239 ? 114.034 26.539  60.830  1.00 99.90 ? 239 TRP B CH2 1 
ATOM   6265 N  N   . THR B 2 240 ? 109.947 21.802  58.931  1.00 93.16 ? 240 THR B N   1 
ATOM   6266 C  CA  . THR B 2 240 ? 108.913 22.454  59.730  1.00 93.35 ? 240 THR B CA  1 
ATOM   6267 C  C   . THR B 2 240 ? 108.621 21.678  61.003  1.00 93.64 ? 240 THR B C   1 
ATOM   6268 O  O   . THR B 2 240 ? 109.064 20.539  61.172  1.00 94.07 ? 240 THR B O   1 
ATOM   6269 C  CB  . THR B 2 240 ? 107.578 22.641  58.949  1.00 93.09 ? 240 THR B CB  1 
ATOM   6270 O  OG1 . THR B 2 240 ? 107.356 21.527  58.073  1.00 92.07 ? 240 THR B OG1 1 
ATOM   6271 C  CG2 . THR B 2 240 ? 107.570 23.946  58.171  1.00 92.80 ? 240 THR B CG2 1 
ATOM   6272 N  N   . VAL B 2 241 ? 107.866 22.313  61.891  1.00 93.17 ? 241 VAL B N   1 
ATOM   6273 C  CA  . VAL B 2 241 ? 107.481 21.733  63.169  1.00 92.54 ? 241 VAL B CA  1 
ATOM   6274 C  C   . VAL B 2 241 ? 105.945 21.706  63.205  1.00 92.68 ? 241 VAL B C   1 
ATOM   6275 O  O   . VAL B 2 241 ? 105.336 21.561  64.264  1.00 92.23 ? 241 VAL B O   1 
ATOM   6276 C  CB  . VAL B 2 241 ? 108.033 22.614  64.331  1.00 91.53 ? 241 VAL B CB  1 
ATOM   6277 C  CG1 . VAL B 2 241 ? 107.805 21.957  65.664  1.00 92.77 ? 241 VAL B CG1 1 
ATOM   6278 C  CG2 . VAL B 2 241 ? 109.521 22.892  64.133  1.00 90.33 ? 241 VAL B CG2 1 
ATOM   6279 N  N   . GLN B 2 242 ? 105.330 21.797  62.029  1.00 93.02 ? 242 GLN B N   1 
ATOM   6280 C  CA  . GLN B 2 242 ? 103.871 21.814  61.903  1.00 94.12 ? 242 GLN B CA  1 
ATOM   6281 C  C   . GLN B 2 242 ? 103.013 20.772  62.640  1.00 93.92 ? 242 GLN B C   1 
ATOM   6282 O  O   . GLN B 2 242 ? 102.210 21.151  63.495  1.00 94.14 ? 242 GLN B O   1 
ATOM   6283 C  CB  . GLN B 2 242 ? 103.464 21.864  60.426  1.00 95.81 ? 242 GLN B CB  1 
ATOM   6284 C  CG  . GLN B 2 242 ? 103.895 23.115  59.672  1.00 99.16 ? 242 GLN B CG  1 
ATOM   6285 C  CD  . GLN B 2 242 ? 103.366 23.128  58.243  1.00 99.90 ? 242 GLN B CD  1 
ATOM   6286 O  OE1 . GLN B 2 242 ? 104.105 23.407  57.293  1.00 99.90 ? 242 GLN B OE1 1 
ATOM   6287 N  NE2 . GLN B 2 242 ? 102.086 22.800  58.082  1.00 99.90 ? 242 GLN B NE2 1 
ATOM   6288 N  N   . PRO B 2 243 ? 103.145 19.459  62.307  1.00 94.09 ? 243 PRO B N   1 
ATOM   6289 C  CA  . PRO B 2 243 ? 102.370 18.373  62.938  1.00 93.76 ? 243 PRO B CA  1 
ATOM   6290 C  C   . PRO B 2 243 ? 102.484 18.151  64.449  1.00 92.18 ? 243 PRO B C   1 
ATOM   6291 O  O   . PRO B 2 243 ? 103.233 17.296  64.921  1.00 91.40 ? 243 PRO B O   1 
ATOM   6292 C  CB  . PRO B 2 243 ? 102.811 17.120  62.163  1.00 94.04 ? 243 PRO B CB  1 
ATOM   6293 C  CG  . PRO B 2 243 ? 104.202 17.437  61.788  1.00 95.22 ? 243 PRO B CG  1 
ATOM   6294 C  CD  . PRO B 2 243 ? 104.117 18.885  61.351  1.00 95.18 ? 243 PRO B CD  1 
ATOM   6295 N  N   . ILE B 2 244 ? 101.693 18.931  65.171  1.00 90.03 ? 244 ILE B N   1 
ATOM   6296 C  CA  . ILE B 2 244 ? 101.558 18.920  66.623  1.00 86.60 ? 244 ILE B CA  1 
ATOM   6297 C  C   . ILE B 2 244 ? 100.203 19.624  66.707  1.00 85.34 ? 244 ILE B C   1 
ATOM   6298 O  O   . ILE B 2 244 ? 100.028 20.621  67.402  1.00 84.25 ? 244 ILE B O   1 
ATOM   6299 C  CB  . ILE B 2 244 ? 102.644 19.777  67.325  1.00 85.78 ? 244 ILE B CB  1 
ATOM   6300 C  CG1 . ILE B 2 244 ? 104.052 19.298  66.938  1.00 84.55 ? 244 ILE B CG1 1 
ATOM   6301 C  CG2 . ILE B 2 244 ? 102.471 19.679  68.832  1.00 84.76 ? 244 ILE B CG2 1 
ATOM   6302 C  CD1 . ILE B 2 244 ? 105.175 20.196  67.418  1.00 81.66 ? 244 ILE B CD1 1 
ATOM   6303 N  N   . VAL B 2 245 ? 99.288  19.132  65.875  1.00 85.20 ? 245 VAL B N   1 
ATOM   6304 C  CA  . VAL B 2 245 ? 97.932  19.654  65.737  1.00 85.41 ? 245 VAL B CA  1 
ATOM   6305 C  C   . VAL B 2 245 ? 97.004  19.097  66.796  1.00 86.14 ? 245 VAL B C   1 
ATOM   6306 O  O   . VAL B 2 245 ? 97.154  17.947  67.216  1.00 86.10 ? 245 VAL B O   1 
ATOM   6307 C  CB  . VAL B 2 245 ? 97.323  19.226  64.382  1.00 84.41 ? 245 VAL B CB  1 
ATOM   6308 C  CG1 . VAL B 2 245 ? 95.984  19.924  64.153  1.00 83.17 ? 245 VAL B CG1 1 
ATOM   6309 C  CG2 . VAL B 2 245 ? 98.299  19.506  63.255  1.00 83.19 ? 245 VAL B CG2 1 
ATOM   6310 N  N   . LEU B 2 246 ? 96.015  19.894  67.187  1.00 86.48 ? 246 LEU B N   1 
ATOM   6311 C  CA  . LEU B 2 246 ? 95.038  19.450  68.173  1.00 86.58 ? 246 LEU B CA  1 
ATOM   6312 C  C   . LEU B 2 246 ? 94.057  18.565  67.396  1.00 87.58 ? 246 LEU B C   1 
ATOM   6313 O  O   . LEU B 2 246 ? 93.691  18.880  66.258  1.00 88.12 ? 246 LEU B O   1 
ATOM   6314 C  CB  . LEU B 2 246 ? 94.327  20.654  68.795  1.00 85.06 ? 246 LEU B CB  1 
ATOM   6315 C  CG  . LEU B 2 246 ? 95.225  21.859  69.112  1.00 84.83 ? 246 LEU B CG  1 
ATOM   6316 C  CD1 . LEU B 2 246 ? 94.527  22.745  70.112  1.00 83.68 ? 246 LEU B CD1 1 
ATOM   6317 C  CD2 . LEU B 2 246 ? 96.565  21.418  69.673  1.00 84.06 ? 246 LEU B CD2 1 
ATOM   6318 N  N   . PRO B 2 247 ? 93.642  17.429  67.981  1.00 88.52 ? 247 PRO B N   1 
ATOM   6319 C  CA  . PRO B 2 247 ? 92.711  16.553  67.269  1.00 88.96 ? 247 PRO B CA  1 
ATOM   6320 C  C   . PRO B 2 247 ? 91.401  17.270  67.008  1.00 90.78 ? 247 PRO B C   1 
ATOM   6321 O  O   . PRO B 2 247 ? 90.893  17.990  67.871  1.00 91.92 ? 247 PRO B O   1 
ATOM   6322 C  CB  . PRO B 2 247 ? 92.524  15.391  68.246  1.00 88.08 ? 247 PRO B CB  1 
ATOM   6323 C  CG  . PRO B 2 247 ? 92.617  16.069  69.573  1.00 87.46 ? 247 PRO B CG  1 
ATOM   6324 C  CD  . PRO B 2 247 ? 93.804  16.988  69.380  1.00 88.62 ? 247 PRO B CD  1 
ATOM   6325 N  N   . GLU B 2 248 ? 90.870  17.114  65.806  1.00 91.91 ? 248 GLU B N   1 
ATOM   6326 C  CA  . GLU B 2 248 ? 89.603  17.750  65.481  1.00 94.38 ? 248 GLU B CA  1 
ATOM   6327 C  C   . GLU B 2 248 ? 88.460  16.828  65.930  1.00 95.97 ? 248 GLU B C   1 
ATOM   6328 O  O   . GLU B 2 248 ? 87.809  16.167  65.100  1.00 96.47 ? 248 GLU B O   1 
ATOM   6329 C  CB  . GLU B 2 248 ? 89.512  18.015  63.983  1.00 95.29 ? 248 GLU B CB  1 
ATOM   6330 C  CG  . GLU B 2 248 ? 88.221  18.692  63.566  1.00 97.74 ? 248 GLU B CG  1 
ATOM   6331 C  CD  . GLU B 2 248 ? 87.872  18.408  62.126  1.00 99.38 ? 248 GLU B CD  1 
ATOM   6332 O  OE1 . GLU B 2 248 ? 87.177  17.393  61.877  1.00 99.90 ? 248 GLU B OE1 1 
ATOM   6333 O  OE2 . GLU B 2 248 ? 88.300  19.198  61.251  1.00 99.90 ? 248 GLU B OE2 1 
ATOM   6334 N  N   . LYS B 2 249 ? 88.232  16.771  67.246  1.00 97.26 ? 249 LYS B N   1 
ATOM   6335 C  CA  . LYS B 2 249 ? 87.185  15.921  67.828  1.00 97.25 ? 249 LYS B CA  1 
ATOM   6336 C  C   . LYS B 2 249 ? 85.827  16.589  67.873  1.00 97.35 ? 249 LYS B C   1 
ATOM   6337 O  O   . LYS B 2 249 ? 85.446  17.163  68.894  1.00 96.99 ? 249 LYS B O   1 
ATOM   6338 C  CB  . LYS B 2 249 ? 87.556  15.463  69.247  1.00 96.02 ? 249 LYS B CB  1 
ATOM   6339 C  CG  . LYS B 2 249 ? 88.688  14.454  69.318  1.00 94.55 ? 249 LYS B CG  1 
ATOM   6340 C  CD  . LYS B 2 249 ? 88.281  13.106  68.751  1.00 92.72 ? 249 LYS B CD  1 
ATOM   6341 C  CE  . LYS B 2 249 ? 89.466  12.162  68.743  1.00 92.03 ? 249 LYS B CE  1 
ATOM   6342 N  NZ  . LYS B 2 249 ? 89.026  10.766  68.541  1.00 91.55 ? 249 LYS B NZ  1 
ATOM   6343 N  N   . ASP B 2 250 ? 85.109  16.538  66.756  1.00 98.24 ? 250 ASP B N   1 
ATOM   6344 C  CA  . ASP B 2 250 ? 83.770  17.112  66.695  1.00 98.51 ? 250 ASP B CA  1 
ATOM   6345 C  C   . ASP B 2 250 ? 82.962  16.396  67.783  1.00 98.06 ? 250 ASP B C   1 
ATOM   6346 O  O   . ASP B 2 250 ? 82.178  17.015  68.507  1.00 99.77 ? 250 ASP B O   1 
ATOM   6347 C  CB  . ASP B 2 250 ? 83.155  16.930  65.298  1.00 98.65 ? 250 ASP B CB  1 
ATOM   6348 C  CG  . ASP B 2 250 ? 83.513  15.595  64.660  1.00 98.76 ? 250 ASP B CG  1 
ATOM   6349 O  OD1 . ASP B 2 250 ? 84.666  15.432  64.194  1.00 98.96 ? 250 ASP B OD1 1 
ATOM   6350 O  OD2 . ASP B 2 250 ? 82.635  14.712  64.605  1.00 98.66 ? 250 ASP B OD2 1 
ATOM   6351 N  N   . SER B 2 251 ? 83.211  15.096  67.929  1.00 96.33 ? 251 SER B N   1 
ATOM   6352 C  CA  . SER B 2 251 ? 82.561  14.303  68.964  1.00 93.61 ? 251 SER B CA  1 
ATOM   6353 C  C   . SER B 2 251 ? 83.451  14.433  70.205  1.00 92.81 ? 251 SER B C   1 
ATOM   6354 O  O   . SER B 2 251 ? 84.363  13.625  70.420  1.00 92.55 ? 251 SER B O   1 
ATOM   6355 C  CB  . SER B 2 251 ? 82.455  12.832  68.542  1.00 93.26 ? 251 SER B CB  1 
ATOM   6356 O  OG  . SER B 2 251 ? 81.708  12.681  67.346  1.00 91.20 ? 251 SER B OG  1 
ATOM   6357 N  N   . TRP B 2 252 ? 83.269  15.533  70.933  1.00 90.99 ? 252 TRP B N   1 
ATOM   6358 C  CA  . TRP B 2 252 ? 84.029  15.798  72.158  1.00 88.82 ? 252 TRP B CA  1 
ATOM   6359 C  C   . TRP B 2 252 ? 83.486  14.870  73.265  1.00 85.22 ? 252 TRP B C   1 
ATOM   6360 O  O   . TRP B 2 252 ? 82.273  14.751  73.441  1.00 84.72 ? 252 TRP B O   1 
ATOM   6361 C  CB  . TRP B 2 252 ? 83.891  17.281  72.566  1.00 91.78 ? 252 TRP B CB  1 
ATOM   6362 C  CG  . TRP B 2 252 ? 84.698  18.292  71.733  1.00 94.26 ? 252 TRP B CG  1 
ATOM   6363 C  CD1 . TRP B 2 252 ? 84.204  19.363  71.013  1.00 94.75 ? 252 TRP B CD1 1 
ATOM   6364 C  CD2 . TRP B 2 252 ? 86.130  18.364  71.619  1.00 95.34 ? 252 TRP B CD2 1 
ATOM   6365 N  NE1 . TRP B 2 252 ? 85.246  20.090  70.474  1.00 95.41 ? 252 TRP B NE1 1 
ATOM   6366 C  CE2 . TRP B 2 252 ? 86.433  19.501  70.828  1.00 95.48 ? 252 TRP B CE2 1 
ATOM   6367 C  CE3 . TRP B 2 252 ? 87.188  17.580  72.111  1.00 95.60 ? 252 TRP B CE3 1 
ATOM   6368 C  CZ2 . TRP B 2 252 ? 87.746  19.869  70.522  1.00 96.51 ? 252 TRP B CZ2 1 
ATOM   6369 C  CZ3 . TRP B 2 252 ? 88.489  17.945  71.806  1.00 95.74 ? 252 TRP B CZ3 1 
ATOM   6370 C  CH2 . TRP B 2 252 ? 88.756  19.081  71.017  1.00 96.17 ? 252 TRP B CH2 1 
ATOM   6371 N  N   . THR B 2 253 ? 84.379  14.240  74.020  1.00 80.43 ? 253 THR B N   1 
ATOM   6372 C  CA  . THR B 2 253 ? 83.991  13.297  75.063  1.00 75.54 ? 253 THR B CA  1 
ATOM   6373 C  C   . THR B 2 253 ? 84.765  13.608  76.334  1.00 73.09 ? 253 THR B C   1 
ATOM   6374 O  O   . THR B 2 253 ? 85.882  14.109  76.256  1.00 72.43 ? 253 THR B O   1 
ATOM   6375 C  CB  . THR B 2 253 ? 84.275  11.855  74.562  1.00 75.47 ? 253 THR B CB  1 
ATOM   6376 O  OG1 . THR B 2 253 ? 83.209  11.414  73.717  1.00 75.15 ? 253 THR B OG1 1 
ATOM   6377 C  CG2 . THR B 2 253 ? 84.476  10.892  75.670  1.00 74.59 ? 253 THR B CG2 1 
ATOM   6378 N  N   . VAL B 2 254 ? 84.179  13.317  77.494  1.00 70.92 ? 254 VAL B N   1 
ATOM   6379 C  CA  . VAL B 2 254 ? 84.832  13.590  78.781  1.00 69.77 ? 254 VAL B CA  1 
ATOM   6380 C  C   . VAL B 2 254 ? 86.283  13.140  78.704  1.00 67.16 ? 254 VAL B C   1 
ATOM   6381 O  O   . VAL B 2 254 ? 87.209  13.896  78.990  1.00 66.21 ? 254 VAL B O   1 
ATOM   6382 C  CB  . VAL B 2 254 ? 84.134  12.849  79.957  1.00 71.57 ? 254 VAL B CB  1 
ATOM   6383 C  CG1 . VAL B 2 254 ? 84.812  13.199  81.293  1.00 71.76 ? 254 VAL B CG1 1 
ATOM   6384 C  CG2 . VAL B 2 254 ? 82.646  13.205  80.000  1.00 71.61 ? 254 VAL B CG2 1 
ATOM   6385 N  N   . ASN B 2 255 ? 86.450  11.909  78.248  1.00 64.58 ? 255 ASN B N   1 
ATOM   6386 C  CA  . ASN B 2 255 ? 87.746  11.284  78.070  1.00 61.34 ? 255 ASN B CA  1 
ATOM   6387 C  C   . ASN B 2 255 ? 88.624  12.207  77.216  1.00 59.00 ? 255 ASN B C   1 
ATOM   6388 O  O   . ASN B 2 255 ? 89.670  12.705  77.647  1.00 57.43 ? 255 ASN B O   1 
ATOM   6389 C  CB  . ASN B 2 255 ? 87.507  9.956   77.344  1.00 61.50 ? 255 ASN B CB  1 
ATOM   6390 C  CG  . ASN B 2 255 ? 88.753  9.129   77.195  1.00 62.16 ? 255 ASN B CG  1 
ATOM   6391 O  OD1 . ASN B 2 255 ? 89.392  8.762   78.179  1.00 61.40 ? 255 ASN B OD1 1 
ATOM   6392 N  ND2 . ASN B 2 255 ? 89.080  8.780   75.959  1.00 61.11 ? 255 ASN B ND2 1 
ATOM   6393 N  N   . ASP B 2 256 ? 88.091  12.515  76.042  1.00 56.82 ? 256 ASP B N   1 
ATOM   6394 C  CA  . ASP B 2 256 ? 88.740  13.336  75.027  1.00 54.59 ? 256 ASP B CA  1 
ATOM   6395 C  C   . ASP B 2 256 ? 89.191  14.688  75.517  1.00 52.03 ? 256 ASP B C   1 
ATOM   6396 O  O   . ASP B 2 256 ? 90.344  15.059  75.328  1.00 49.41 ? 256 ASP B O   1 
ATOM   6397 C  CB  . ASP B 2 256 ? 87.802  13.516  73.832  1.00 56.46 ? 256 ASP B CB  1 
ATOM   6398 C  CG  . ASP B 2 256 ? 87.274  12.186  73.282  1.00 57.83 ? 256 ASP B CG  1 
ATOM   6399 O  OD1 . ASP B 2 256 ? 87.463  11.124  73.934  1.00 57.66 ? 256 ASP B OD1 1 
ATOM   6400 O  OD2 . ASP B 2 256 ? 86.644  12.213  72.195  1.00 58.08 ? 256 ASP B OD2 1 
ATOM   6401 N  N   . ILE B 2 257 ? 88.271  15.438  76.105  1.00 50.58 ? 257 ILE B N   1 
ATOM   6402 C  CA  . ILE B 2 257 ? 88.614  16.750  76.611  1.00 51.47 ? 257 ILE B CA  1 
ATOM   6403 C  C   . ILE B 2 257 ? 89.748  16.609  77.614  1.00 51.83 ? 257 ILE B C   1 
ATOM   6404 O  O   . ILE B 2 257 ? 90.650  17.440  77.671  1.00 49.98 ? 257 ILE B O   1 
ATOM   6405 C  CB  . ILE B 2 257 ? 87.394  17.501  77.251  1.00 51.38 ? 257 ILE B CB  1 
ATOM   6406 C  CG1 . ILE B 2 257 ? 87.887  18.696  78.090  1.00 51.78 ? 257 ILE B CG1 1 
ATOM   6407 C  CG2 . ILE B 2 257 ? 86.526  16.561  78.079  1.00 51.47 ? 257 ILE B CG2 1 
ATOM   6408 C  CD1 . ILE B 2 257 ? 86.806  19.426  78.849  1.00 51.77 ? 257 ILE B CD1 1 
ATOM   6409 N  N   . GLN B 2 258 ? 89.723  15.530  78.376  1.00 53.22 ? 258 GLN B N   1 
ATOM   6410 C  CA  . GLN B 2 258 ? 90.757  15.319  79.356  1.00 56.77 ? 258 GLN B CA  1 
ATOM   6411 C  C   . GLN B 2 258 ? 92.083  15.161  78.648  1.00 58.74 ? 258 GLN B C   1 
ATOM   6412 O  O   . GLN B 2 258 ? 93.057  15.861  78.951  1.00 58.73 ? 258 GLN B O   1 
ATOM   6413 C  CB  . GLN B 2 258 ? 90.470  14.067  80.153  1.00 59.27 ? 258 GLN B CB  1 
ATOM   6414 C  CG  . GLN B 2 258 ? 89.218  14.127  80.968  1.00 64.09 ? 258 GLN B CG  1 
ATOM   6415 C  CD  . GLN B 2 258 ? 89.043  12.877  81.798  1.00 67.63 ? 258 GLN B CD  1 
ATOM   6416 O  OE1 . GLN B 2 258 ? 89.887  12.559  82.645  1.00 68.76 ? 258 GLN B OE1 1 
ATOM   6417 N  NE2 . GLN B 2 258 ? 87.977  12.129  81.529  1.00 68.74 ? 258 GLN B NE2 1 
ATOM   6418 N  N   . LYS B 2 259 ? 92.107  14.212  77.716  1.00 59.76 ? 259 LYS B N   1 
ATOM   6419 C  CA  . LYS B 2 259 ? 93.296  13.895  76.922  1.00 59.56 ? 259 LYS B CA  1 
ATOM   6420 C  C   . LYS B 2 259 ? 93.828  15.195  76.349  1.00 58.34 ? 259 LYS B C   1 
ATOM   6421 O  O   . LYS B 2 259 ? 95.020  15.533  76.458  1.00 57.50 ? 259 LYS B O   1 
ATOM   6422 C  CB  . LYS B 2 259 ? 92.884  12.967  75.786  1.00 60.27 ? 259 LYS B CB  1 
ATOM   6423 C  CG  . LYS B 2 259 ? 92.286  11.668  76.261  1.00 60.82 ? 259 LYS B CG  1 
ATOM   6424 C  CD  . LYS B 2 259 ? 91.941  10.799  75.078  1.00 61.68 ? 259 LYS B CD  1 
ATOM   6425 C  CE  . LYS B 2 259 ? 92.108  9.327   75.416  1.00 63.24 ? 259 LYS B CE  1 
ATOM   6426 N  NZ  . LYS B 2 259 ? 91.808  8.459   74.239  1.00 63.85 ? 259 LYS B NZ  1 
ATOM   6427 N  N   . LEU B 2 260 ? 92.881  15.907  75.755  1.00 57.53 ? 260 LEU B N   1 
ATOM   6428 C  CA  . LEU B 2 260 ? 93.065  17.204  75.151  1.00 56.42 ? 260 LEU B CA  1 
ATOM   6429 C  C   . LEU B 2 260 ? 93.906  17.993  76.150  1.00 55.48 ? 260 LEU B C   1 
ATOM   6430 O  O   . LEU B 2 260 ? 95.122  18.151  75.987  1.00 54.07 ? 260 LEU B O   1 
ATOM   6431 C  CB  . LEU B 2 260 ? 91.659  17.805  75.010  1.00 56.37 ? 260 LEU B CB  1 
ATOM   6432 C  CG  . LEU B 2 260 ? 91.265  19.125  74.357  1.00 56.61 ? 260 LEU B CG  1 
ATOM   6433 C  CD1 . LEU B 2 260 ? 91.585  19.087  72.877  1.00 56.96 ? 260 LEU B CD1 1 
ATOM   6434 C  CD2 . LEU B 2 260 ? 89.773  19.347  74.553  1.00 55.40 ? 260 LEU B CD2 1 
ATOM   6435 N  N   . VAL B 2 261 ? 93.252  18.346  77.248  1.00 55.25 ? 261 VAL B N   1 
ATOM   6436 C  CA  . VAL B 2 261 ? 93.829  19.093  78.350  1.00 55.77 ? 261 VAL B CA  1 
ATOM   6437 C  C   . VAL B 2 261 ? 95.224  18.616  78.716  1.00 56.00 ? 261 VAL B C   1 
ATOM   6438 O  O   . VAL B 2 261 ? 96.147  19.421  78.865  1.00 54.61 ? 261 VAL B O   1 
ATOM   6439 C  CB  . VAL B 2 261 ? 92.914  18.976  79.587  1.00 56.24 ? 261 VAL B CB  1 
ATOM   6440 C  CG1 . VAL B 2 261 ? 93.536  19.674  80.791  1.00 55.62 ? 261 VAL B CG1 1 
ATOM   6441 C  CG2 . VAL B 2 261 ? 91.531  19.552  79.270  1.00 55.53 ? 261 VAL B CG2 1 
ATOM   6442 N  N   . GLY B 2 262 ? 95.362  17.305  78.873  1.00 56.78 ? 262 GLY B N   1 
ATOM   6443 C  CA  . GLY B 2 262 ? 96.640  16.724  79.226  1.00 59.29 ? 262 GLY B CA  1 
ATOM   6444 C  C   . GLY B 2 262 ? 97.741  17.212  78.309  1.00 60.71 ? 262 GLY B C   1 
ATOM   6445 O  O   . GLY B 2 262 ? 98.717  17.823  78.772  1.00 60.97 ? 262 GLY B O   1 
ATOM   6446 N  N   . LYS B 2 263 ? 97.574  16.987  77.007  1.00 61.36 ? 263 LYS B N   1 
ATOM   6447 C  CA  . LYS B 2 263 ? 98.573  17.423  76.046  1.00 60.60 ? 263 LYS B CA  1 
ATOM   6448 C  C   . LYS B 2 263 ? 98.825  18.920  76.241  1.00 59.10 ? 263 LYS B C   1 
ATOM   6449 O  O   . LYS B 2 263 ? 99.970  19.369  76.309  1.00 57.78 ? 263 LYS B O   1 
ATOM   6450 C  CB  . LYS B 2 263 ? 98.103  17.167  74.614  1.00 62.97 ? 263 LYS B CB  1 
ATOM   6451 C  CG  . LYS B 2 263 ? 99.025  17.816  73.570  1.00 67.41 ? 263 LYS B CG  1 
ATOM   6452 C  CD  . LYS B 2 263 ? 98.586  17.578  72.123  1.00 69.12 ? 263 LYS B CD  1 
ATOM   6453 C  CE  . LYS B 2 263 ? 98.838  16.138  71.648  1.00 70.72 ? 263 LYS B CE  1 
ATOM   6454 N  NZ  . LYS B 2 263 ? 98.347  15.906  70.243  1.00 71.91 ? 263 LYS B NZ  1 
ATOM   6455 N  N   . LEU B 2 264 ? 97.738  19.665  76.386  1.00 58.07 ? 264 LEU B N   1 
ATOM   6456 C  CA  . LEU B 2 264 ? 97.781  21.106  76.572  1.00 57.77 ? 264 LEU B CA  1 
ATOM   6457 C  C   . LEU B 2 264 ? 98.533  21.466  77.815  1.00 58.82 ? 264 LEU B C   1 
ATOM   6458 O  O   . LEU B 2 264 ? 99.207  22.494  77.865  1.00 58.32 ? 264 LEU B O   1 
ATOM   6459 C  CB  . LEU B 2 264 ? 96.370  21.647  76.721  1.00 57.65 ? 264 LEU B CB  1 
ATOM   6460 C  CG  . LEU B 2 264 ? 95.397  21.016  75.733  1.00 59.00 ? 264 LEU B CG  1 
ATOM   6461 C  CD1 . LEU B 2 264 ? 93.998  21.509  75.962  1.00 59.99 ? 264 LEU B CD1 1 
ATOM   6462 C  CD2 . LEU B 2 264 ? 95.844  21.319  74.331  1.00 60.38 ? 264 LEU B CD2 1 
ATOM   6463 N  N   . ASN B 2 265 ? 98.415  20.620  78.829  1.00 60.26 ? 265 ASN B N   1 
ATOM   6464 C  CA  . ASN B 2 265 ? 99.080  20.890  80.089  1.00 62.32 ? 265 ASN B CA  1 
ATOM   6465 C  C   . ASN B 2 265 ? 100.593 20.818  79.992  1.00 61.94 ? 265 ASN B C   1 
ATOM   6466 O  O   . ASN B 2 265 ? 101.289 21.713  80.480  1.00 61.53 ? 265 ASN B O   1 
ATOM   6467 C  CB  . ASN B 2 265 ? 98.588  19.972  81.196  1.00 65.10 ? 265 ASN B CB  1 
ATOM   6468 C  CG  . ASN B 2 265 ? 99.094  20.412  82.559  1.00 67.78 ? 265 ASN B CG  1 
ATOM   6469 O  OD1 . ASN B 2 265 ? 98.667  21.444  83.082  1.00 69.58 ? 265 ASN B OD1 1 
ATOM   6470 N  ND2 . ASN B 2 265 ? 100.037 19.660  83.122  1.00 69.67 ? 265 ASN B ND2 1 
ATOM   6471 N  N   . TRP B 2 266 ? 101.121 19.749  79.402  1.00 62.99 ? 266 TRP B N   1 
ATOM   6472 C  CA  . TRP B 2 266 ? 102.568 19.679  79.265  1.00 64.47 ? 266 TRP B CA  1 
ATOM   6473 C  C   . TRP B 2 266 ? 102.959 20.634  78.153  1.00 64.37 ? 266 TRP B C   1 
ATOM   6474 O  O   . TRP B 2 266 ? 104.015 21.274  78.207  1.00 63.64 ? 266 TRP B O   1 
ATOM   6475 C  CB  . TRP B 2 266 ? 103.072 18.271  78.952  1.00 65.48 ? 266 TRP B CB  1 
ATOM   6476 C  CG  . TRP B 2 266 ? 104.568 18.088  79.262  1.00 66.05 ? 266 TRP B CG  1 
ATOM   6477 C  CD1 . TRP B 2 266 ? 105.373 17.077  78.817  1.00 65.78 ? 266 TRP B CD1 1 
ATOM   6478 C  CD2 . TRP B 2 266 ? 105.392 18.891  80.142  1.00 66.38 ? 266 TRP B CD2 1 
ATOM   6479 N  NE1 . TRP B 2 266 ? 106.629 17.187  79.370  1.00 66.57 ? 266 TRP B NE1 1 
ATOM   6480 C  CE2 . TRP B 2 266 ? 106.670 18.287  80.186  1.00 66.75 ? 266 TRP B CE2 1 
ATOM   6481 C  CE3 . TRP B 2 266 ? 105.166 20.052  80.902  1.00 65.56 ? 266 TRP B CE3 1 
ATOM   6482 C  CZ2 . TRP B 2 266 ? 107.720 18.799  80.961  1.00 66.73 ? 266 TRP B CZ2 1 
ATOM   6483 C  CZ3 . TRP B 2 266 ? 106.206 20.561  81.671  1.00 65.07 ? 266 TRP B CZ3 1 
ATOM   6484 C  CH2 . TRP B 2 266 ? 107.469 19.933  81.696  1.00 66.83 ? 266 TRP B CH2 1 
ATOM   6485 N  N   . ALA B 2 267 ? 102.062 20.768  77.179  1.00 63.98 ? 267 ALA B N   1 
ATOM   6486 C  CA  . ALA B 2 267 ? 102.269 21.665  76.058  1.00 63.92 ? 267 ALA B CA  1 
ATOM   6487 C  C   . ALA B 2 267 ? 102.469 23.084  76.586  1.00 64.80 ? 267 ALA B C   1 
ATOM   6488 O  O   . ALA B 2 267 ? 103.057 23.920  75.914  1.00 63.92 ? 267 ALA B O   1 
ATOM   6489 C  CB  . ALA B 2 267 ? 101.087 21.609  75.117  1.00 62.42 ? 267 ALA B CB  1 
ATOM   6490 N  N   . SER B 2 268 ? 102.022 23.338  77.811  1.00 68.00 ? 268 SER B N   1 
ATOM   6491 C  CA  . SER B 2 268 ? 102.184 24.653  78.423  1.00 71.59 ? 268 SER B CA  1 
ATOM   6492 C  C   . SER B 2 268 ? 103.669 25.008  78.591  1.00 72.50 ? 268 SER B C   1 
ATOM   6493 O  O   . SER B 2 268 ? 104.043 26.188  78.613  1.00 72.91 ? 268 SER B O   1 
ATOM   6494 C  CB  . SER B 2 268 ? 101.480 24.701  79.783  1.00 72.27 ? 268 SER B CB  1 
ATOM   6495 O  OG  . SER B 2 268 ? 101.427 26.029  80.286  1.00 74.75 ? 268 SER B OG  1 
ATOM   6496 N  N   . GLN B 2 269 ? 104.518 23.989  78.675  1.00 73.03 ? 269 GLN B N   1 
ATOM   6497 C  CA  . GLN B 2 269 ? 105.947 24.207  78.842  1.00 73.77 ? 269 GLN B CA  1 
ATOM   6498 C  C   . GLN B 2 269 ? 106.665 24.650  77.561  1.00 74.35 ? 269 GLN B C   1 
ATOM   6499 O  O   . GLN B 2 269 ? 107.750 25.237  77.620  1.00 73.74 ? 269 GLN B O   1 
ATOM   6500 C  CB  . GLN B 2 269 ? 106.594 22.946  79.395  1.00 74.06 ? 269 GLN B CB  1 
ATOM   6501 C  CG  . GLN B 2 269 ? 107.726 23.232  80.349  1.00 76.14 ? 269 GLN B CG  1 
ATOM   6502 C  CD  . GLN B 2 269 ? 107.261 23.902  81.630  1.00 77.48 ? 269 GLN B CD  1 
ATOM   6503 O  OE1 . GLN B 2 269 ? 106.584 24.935  81.607  1.00 78.82 ? 269 GLN B OE1 1 
ATOM   6504 N  NE2 . GLN B 2 269 ? 107.630 23.316  82.764  1.00 78.61 ? 269 GLN B NE2 1 
ATOM   6505 N  N   . ILE B 2 270 ? 106.045 24.382  76.412  1.00 76.01 ? 270 ILE B N   1 
ATOM   6506 C  CA  . ILE B 2 270 ? 106.605 24.732  75.106  1.00 76.86 ? 270 ILE B CA  1 
ATOM   6507 C  C   . ILE B 2 270 ? 105.945 25.976  74.499  1.00 78.20 ? 270 ILE B C   1 
ATOM   6508 O  O   . ILE B 2 270 ? 106.298 26.415  73.404  1.00 77.50 ? 270 ILE B O   1 
ATOM   6509 C  CB  . ILE B 2 270 ? 106.475 23.546  74.158  1.00 75.38 ? 270 ILE B CB  1 
ATOM   6510 N  N   . TYR B 2 271 ? 104.982 26.539  75.213  1.00 79.54 ? 271 TYR B N   1 
ATOM   6511 C  CA  . TYR B 2 271 ? 104.274 27.716  74.742  1.00 82.46 ? 271 TYR B CA  1 
ATOM   6512 C  C   . TYR B 2 271 ? 103.643 28.454  75.906  1.00 84.08 ? 271 TYR B C   1 
ATOM   6513 O  O   . TYR B 2 271 ? 102.418 28.476  76.037  1.00 83.88 ? 271 TYR B O   1 
ATOM   6514 C  CB  . TYR B 2 271 ? 103.186 27.315  73.745  1.00 83.40 ? 271 TYR B CB  1 
ATOM   6515 C  CG  . TYR B 2 271 ? 103.661 27.222  72.321  1.00 84.83 ? 271 TYR B CG  1 
ATOM   6516 C  CD1 . TYR B 2 271 ? 103.836 28.375  71.559  1.00 85.71 ? 271 TYR B CD1 1 
ATOM   6517 C  CD2 . TYR B 2 271 ? 103.924 25.988  71.731  1.00 85.14 ? 271 TYR B CD2 1 
ATOM   6518 C  CE1 . TYR B 2 271 ? 104.260 28.310  70.247  1.00 87.61 ? 271 TYR B CE1 1 
ATOM   6519 C  CE2 . TYR B 2 271 ? 104.349 25.903  70.415  1.00 87.17 ? 271 TYR B CE2 1 
ATOM   6520 C  CZ  . TYR B 2 271 ? 104.516 27.074  69.672  1.00 88.23 ? 271 TYR B CZ  1 
ATOM   6521 O  OH  . TYR B 2 271 ? 104.937 27.020  68.359  1.00 89.23 ? 271 TYR B OH  1 
ATOM   6522 N  N   . PRO B 2 272 ? 104.469 29.080  76.763  1.00 85.81 ? 272 PRO B N   1 
ATOM   6523 C  CA  . PRO B 2 272 ? 103.990 29.832  77.932  1.00 86.77 ? 272 PRO B CA  1 
ATOM   6524 C  C   . PRO B 2 272 ? 103.118 31.012  77.499  1.00 87.61 ? 272 PRO B C   1 
ATOM   6525 O  O   . PRO B 2 272 ? 103.519 32.176  77.559  1.00 88.49 ? 272 PRO B O   1 
ATOM   6526 C  CB  . PRO B 2 272 ? 105.288 30.279  78.611  1.00 86.26 ? 272 PRO B CB  1 
ATOM   6527 C  CG  . PRO B 2 272 ? 106.247 30.402  77.457  1.00 86.51 ? 272 PRO B CG  1 
ATOM   6528 C  CD  . PRO B 2 272 ? 105.935 29.170  76.642  1.00 85.71 ? 272 PRO B CD  1 
ATOM   6529 N  N   . GLY B 2 273 ? 101.912 30.673  77.066  1.00 89.02 ? 273 GLY B N   1 
ATOM   6530 C  CA  . GLY B 2 273 ? 100.935 31.636  76.594  1.00 90.58 ? 273 GLY B CA  1 
ATOM   6531 C  C   . GLY B 2 273 ? 99.616  30.891  76.621  1.00 90.56 ? 273 GLY B C   1 
ATOM   6532 O  O   . GLY B 2 273 ? 98.544  31.491  76.711  1.00 90.87 ? 273 GLY B O   1 
ATOM   6533 N  N   . ILE B 2 274 ? 99.718  29.568  76.505  1.00 90.51 ? 274 ILE B N   1 
ATOM   6534 C  CA  . ILE B 2 274 ? 98.574  28.676  76.547  1.00 89.84 ? 274 ILE B CA  1 
ATOM   6535 C  C   . ILE B 2 274 ? 98.069  28.525  77.984  1.00 91.36 ? 274 ILE B C   1 
ATOM   6536 O  O   . ILE B 2 274 ? 98.852  28.397  78.935  1.00 91.97 ? 274 ILE B O   1 
ATOM   6537 C  CB  . ILE B 2 274 ? 98.936  27.278  76.002  1.00 87.97 ? 274 ILE B CB  1 
ATOM   6538 C  CG1 . ILE B 2 274 ? 97.756  26.322  76.178  1.00 86.61 ? 274 ILE B CG1 1 
ATOM   6539 C  CG2 . ILE B 2 274 ? 100.154 26.736  76.721  1.00 87.46 ? 274 ILE B CG2 1 
ATOM   6540 C  CD1 . ILE B 2 274 ? 98.095  24.876  75.923  1.00 85.24 ? 274 ILE B CD1 1 
ATOM   6541 N  N   . LYS B 2 275 ? 96.750  28.568  78.123  1.00 92.42 ? 275 LYS B N   1 
ATOM   6542 C  CA  . LYS B 2 275 ? 96.073  28.422  79.402  1.00 92.63 ? 275 LYS B CA  1 
ATOM   6543 C  C   . LYS B 2 275 ? 94.911  27.512  79.072  1.00 92.84 ? 275 LYS B C   1 
ATOM   6544 O  O   . LYS B 2 275 ? 94.149  27.781  78.145  1.00 92.83 ? 275 LYS B O   1 
ATOM   6545 C  CB  . LYS B 2 275 ? 95.566  29.776  79.906  1.00 93.10 ? 275 LYS B CB  1 
ATOM   6546 C  CG  . LYS B 2 275 ? 94.842  30.611  78.852  1.00 94.51 ? 275 LYS B CG  1 
ATOM   6547 C  CD  . LYS B 2 275 ? 94.269  31.901  79.431  1.00 96.99 ? 275 LYS B CD  1 
ATOM   6548 C  CE  . LYS B 2 275 ? 95.335  32.735  80.155  1.00 99.45 ? 275 LYS B CE  1 
ATOM   6549 N  NZ  . LYS B 2 275 ? 94.862  34.114  80.526  1.00 99.90 ? 275 LYS B NZ  1 
ATOM   6550 N  N   . VAL B 2 276 ? 94.798  26.413  79.800  1.00 93.74 ? 276 VAL B N   1 
ATOM   6551 C  CA  . VAL B 2 276 ? 93.735  25.446  79.547  1.00 94.57 ? 276 VAL B CA  1 
ATOM   6552 C  C   . VAL B 2 276 ? 92.581  25.484  80.561  1.00 94.11 ? 276 VAL B C   1 
ATOM   6553 O  O   . VAL B 2 276 ? 91.486  24.993  80.281  1.00 94.15 ? 276 VAL B O   1 
ATOM   6554 C  CB  . VAL B 2 276 ? 94.340  24.005  79.424  1.00 95.49 ? 276 VAL B CB  1 
ATOM   6555 C  CG1 . VAL B 2 276 ? 95.183  23.656  80.652  1.00 95.79 ? 276 VAL B CG1 1 
ATOM   6556 C  CG2 . VAL B 2 276 ? 93.246  22.977  79.225  1.00 96.05 ? 276 VAL B CG2 1 
ATOM   6557 N  N   . ARG B 2 277 ? 92.813  26.155  81.687  1.00 93.79 ? 277 ARG B N   1 
ATOM   6558 C  CA  . ARG B 2 277 ? 91.854  26.285  82.795  1.00 93.63 ? 277 ARG B CA  1 
ATOM   6559 C  C   . ARG B 2 277 ? 90.340  26.190  82.522  1.00 93.00 ? 277 ARG B C   1 
ATOM   6560 O  O   . ARG B 2 277 ? 89.682  25.257  82.982  1.00 91.90 ? 277 ARG B O   1 
ATOM   6561 C  CB  . ARG B 2 277 ? 92.145  27.578  83.564  1.00 94.63 ? 277 ARG B CB  1 
ATOM   6562 C  CG  . ARG B 2 277 ? 93.561  27.696  84.123  1.00 95.05 ? 277 ARG B CG  1 
ATOM   6563 C  CD  . ARG B 2 277 ? 93.747  29.077  84.714  1.00 95.47 ? 277 ARG B CD  1 
ATOM   6564 N  NE  . ARG B 2 277 ? 95.022  29.258  85.401  1.00 95.40 ? 277 ARG B NE  1 
ATOM   6565 C  CZ  . ARG B 2 277 ? 95.125  29.647  86.669  1.00 94.65 ? 277 ARG B CZ  1 
ATOM   6566 N  NH1 . ARG B 2 277 ? 94.035  29.882  87.387  1.00 94.11 ? 277 ARG B NH1 1 
ATOM   6567 N  NH2 . ARG B 2 277 ? 96.316  29.863  87.204  1.00 94.56 ? 277 ARG B NH2 1 
ATOM   6568 N  N   . GLN B 2 278 ? 89.788  27.171  81.809  1.00 93.24 ? 278 GLN B N   1 
ATOM   6569 C  CA  . GLN B 2 278 ? 88.351  27.209  81.496  1.00 93.10 ? 278 GLN B CA  1 
ATOM   6570 C  C   . GLN B 2 278 ? 87.853  25.938  80.818  1.00 92.65 ? 278 GLN B C   1 
ATOM   6571 O  O   . GLN B 2 278 ? 86.651  25.653  80.802  1.00 92.01 ? 278 GLN B O   1 
ATOM   6572 C  CB  . GLN B 2 278 ? 88.034  28.419  80.636  1.00 94.47 ? 278 GLN B CB  1 
ATOM   6573 N  N   . LEU B 2 279 ? 88.780  25.213  80.207  1.00 91.72 ? 279 LEU B N   1 
ATOM   6574 C  CA  . LEU B 2 279 ? 88.458  23.963  79.547  1.00 90.17 ? 279 LEU B CA  1 
ATOM   6575 C  C   . LEU B 2 279 ? 88.451  22.884  80.627  1.00 87.74 ? 279 LEU B C   1 
ATOM   6576 O  O   . LEU B 2 279 ? 87.594  21.991  80.633  1.00 87.63 ? 279 LEU B O   1 
ATOM   6577 C  CB  . LEU B 2 279 ? 89.512  23.629  78.497  1.00 91.52 ? 279 LEU B CB  1 
ATOM   6578 C  CG  . LEU B 2 279 ? 89.105  22.377  77.719  1.00 93.57 ? 279 LEU B CG  1 
ATOM   6579 C  CD1 . LEU B 2 279 ? 88.010  22.761  76.722  1.00 93.40 ? 279 LEU B CD1 1 
ATOM   6580 C  CD2 . LEU B 2 279 ? 90.294  21.759  77.008  1.00 93.57 ? 279 LEU B CD2 1 
ATOM   6581 N  N   . SER B 2 280 ? 89.415  22.974  81.540  1.00 84.73 ? 280 SER B N   1 
ATOM   6582 C  CA  . SER B 2 280 ? 89.529  22.029  82.639  1.00 81.73 ? 280 SER B CA  1 
ATOM   6583 C  C   . SER B 2 280 ? 88.165  21.977  83.319  1.00 80.28 ? 280 SER B C   1 
ATOM   6584 O  O   . SER B 2 280 ? 87.693  20.907  83.717  1.00 79.36 ? 280 SER B O   1 
ATOM   6585 C  CB  . SER B 2 280 ? 90.605  22.508  83.619  1.00 81.97 ? 280 SER B CB  1 
ATOM   6586 O  OG  . SER B 2 280 ? 91.801  22.858  82.930  1.00 79.19 ? 280 SER B OG  1 
ATOM   6587 N  N   . LYS B 2 281 ? 87.507  23.135  83.360  1.00 78.56 ? 281 LYS B N   1 
ATOM   6588 C  CA  . LYS B 2 281 ? 86.188  23.278  83.958  1.00 77.51 ? 281 LYS B CA  1 
ATOM   6589 C  C   . LYS B 2 281 ? 85.142  22.426  83.247  1.00 76.29 ? 281 LYS B C   1 
ATOM   6590 O  O   . LYS B 2 281 ? 84.271  21.847  83.894  1.00 76.13 ? 281 LYS B O   1 
ATOM   6591 C  CB  . LYS B 2 281 ? 85.764  24.744  83.950  1.00 77.68 ? 281 LYS B CB  1 
ATOM   6592 N  N   . LEU B 2 282 ? 85.259  22.309  81.925  1.00 75.92 ? 282 LEU B N   1 
ATOM   6593 C  CA  . LEU B 2 282 ? 84.316  21.540  81.102  1.00 75.25 ? 282 LEU B CA  1 
ATOM   6594 C  C   . LEU B 2 282 ? 84.314  20.039  81.408  1.00 74.89 ? 282 LEU B C   1 
ATOM   6595 O  O   . LEU B 2 282 ? 83.407  19.296  81.005  1.00 73.96 ? 282 LEU B O   1 
ATOM   6596 C  CB  . LEU B 2 282 ? 84.581  21.805  79.610  1.00 74.81 ? 282 LEU B CB  1 
ATOM   6597 C  CG  . LEU B 2 282 ? 83.614  21.338  78.512  1.00 73.46 ? 282 LEU B CG  1 
ATOM   6598 C  CD1 . LEU B 2 282 ? 82.174  21.655  78.869  1.00 72.67 ? 282 LEU B CD1 1 
ATOM   6599 C  CD2 . LEU B 2 282 ? 83.986  22.018  77.200  1.00 72.61 ? 282 LEU B CD2 1 
ATOM   6600 N  N   . LEU B 2 283 ? 85.320  19.596  82.146  1.00 76.05 ? 283 LEU B N   1 
ATOM   6601 C  CA  . LEU B 2 283 ? 85.417  18.194  82.518  1.00 78.19 ? 283 LEU B CA  1 
ATOM   6602 C  C   . LEU B 2 283 ? 85.504  18.063  84.039  1.00 79.12 ? 283 LEU B C   1 
ATOM   6603 O  O   . LEU B 2 283 ? 85.939  17.034  84.564  1.00 79.41 ? 283 LEU B O   1 
ATOM   6604 C  CB  . LEU B 2 283 ? 86.653  17.563  81.873  1.00 78.86 ? 283 LEU B CB  1 
ATOM   6605 C  CG  . LEU B 2 283 ? 87.982  17.975  82.530  1.00 79.69 ? 283 LEU B CG  1 
ATOM   6606 C  CD1 . LEU B 2 283 ? 88.618  16.775  83.200  1.00 80.04 ? 283 LEU B CD1 1 
ATOM   6607 C  CD2 . LEU B 2 283 ? 88.933  18.577  81.528  1.00 79.66 ? 283 LEU B CD2 1 
ATOM   6608 N  N   . ARG B 2 284 ? 85.103  19.108  84.755  1.00 79.22 ? 284 ARG B N   1 
ATOM   6609 C  CA  . ARG B 2 284 ? 85.147  19.055  86.208  1.00 79.32 ? 284 ARG B CA  1 
ATOM   6610 C  C   . ARG B 2 284 ? 84.212  18.014  86.814  1.00 79.05 ? 284 ARG B C   1 
ATOM   6611 O  O   . ARG B 2 284 ? 84.201  17.800  88.023  1.00 78.73 ? 284 ARG B O   1 
ATOM   6612 C  CB  . ARG B 2 284 ? 84.910  20.433  86.837  1.00 80.98 ? 284 ARG B CB  1 
ATOM   6613 C  CG  . ARG B 2 284 ? 86.155  21.322  86.856  1.00 82.58 ? 284 ARG B CG  1 
ATOM   6614 C  CD  . ARG B 2 284 ? 86.028  22.517  87.806  1.00 85.29 ? 284 ARG B CD  1 
ATOM   6615 N  NE  . ARG B 2 284 ? 86.366  22.207  89.203  1.00 87.16 ? 284 ARG B NE  1 
ATOM   6616 C  CZ  . ARG B 2 284 ? 86.135  23.022  90.233  1.00 87.79 ? 284 ARG B CZ  1 
ATOM   6617 N  NH1 . ARG B 2 284 ? 85.553  24.190  90.032  1.00 88.27 ? 284 ARG B NH1 1 
ATOM   6618 N  NH2 . ARG B 2 284 ? 86.522  22.697  91.460  1.00 87.58 ? 284 ARG B NH2 1 
ATOM   6619 N  N   . GLY B 2 285 ? 83.424  17.363  85.975  1.00 78.48 ? 285 GLY B N   1 
ATOM   6620 C  CA  . GLY B 2 285 ? 82.521  16.344  86.473  1.00 78.44 ? 285 GLY B CA  1 
ATOM   6621 C  C   . GLY B 2 285 ? 83.212  15.023  86.784  1.00 77.72 ? 285 GLY B C   1 
ATOM   6622 O  O   . GLY B 2 285 ? 84.434  14.903  86.645  1.00 78.19 ? 285 GLY B O   1 
ATOM   6623 N  N   . THR B 2 286 ? 82.437  14.056  87.265  1.00 77.29 ? 286 THR B N   1 
ATOM   6624 C  CA  . THR B 2 286 ? 82.943  12.724  87.589  1.00 77.18 ? 286 THR B CA  1 
ATOM   6625 C  C   . THR B 2 286 ? 82.099  11.781  86.744  1.00 77.59 ? 286 THR B C   1 
ATOM   6626 O  O   . THR B 2 286 ? 81.615  10.751  87.214  1.00 76.87 ? 286 THR B O   1 
ATOM   6627 C  CB  . THR B 2 286 ? 82.792  12.382  89.114  1.00 76.66 ? 286 THR B CB  1 
ATOM   6628 O  OG1 . THR B 2 286 ? 81.417  12.484  89.515  1.00 76.88 ? 286 THR B OG1 1 
ATOM   6629 C  CG2 . THR B 2 286 ? 83.638  13.327  89.972  1.00 75.68 ? 286 THR B CG2 1 
ATOM   6630 N  N   . LYS B 2 287 ? 81.944  12.149  85.477  1.00 78.75 ? 287 LYS B N   1 
ATOM   6631 C  CA  . LYS B 2 287 ? 81.129  11.389  84.542  1.00 79.86 ? 287 LYS B CA  1 
ATOM   6632 C  C   . LYS B 2 287 ? 81.737  10.179  83.862  1.00 79.68 ? 287 LYS B C   1 
ATOM   6633 O  O   . LYS B 2 287 ? 82.845  9.730   84.159  1.00 78.79 ? 287 LYS B O   1 
ATOM   6634 C  CB  . LYS B 2 287 ? 80.582  12.304  83.449  1.00 80.02 ? 287 LYS B CB  1 
ATOM   6635 C  CG  . LYS B 2 287 ? 79.728  13.423  83.943  1.00 81.22 ? 287 LYS B CG  1 
ATOM   6636 C  CD  . LYS B 2 287 ? 80.535  14.690  84.061  1.00 82.02 ? 287 LYS B CD  1 
ATOM   6637 C  CE  . LYS B 2 287 ? 79.612  15.888  83.973  1.00 83.07 ? 287 LYS B CE  1 
ATOM   6638 N  NZ  . LYS B 2 287 ? 78.796  15.855  82.714  1.00 84.08 ? 287 LYS B NZ  1 
ATOM   6639 N  N   . ALA B 2 288 ? 80.932  9.626   82.962  1.00 81.01 ? 288 ALA B N   1 
ATOM   6640 C  CA  . ALA B 2 288 ? 81.314  8.483   82.161  1.00 82.18 ? 288 ALA B CA  1 
ATOM   6641 C  C   . ALA B 2 288 ? 82.296  9.027   81.132  1.00 82.21 ? 288 ALA B C   1 
ATOM   6642 O  O   . ALA B 2 288 ? 82.065  10.081  80.531  1.00 83.39 ? 288 ALA B O   1 
ATOM   6643 C  CB  . ALA B 2 288 ? 80.084  7.888   81.476  1.00 81.49 ? 288 ALA B CB  1 
ATOM   6644 N  N   . LEU B 2 289 ? 83.408  8.328   80.962  1.00 82.24 ? 289 LEU B N   1 
ATOM   6645 C  CA  . LEU B 2 289 ? 84.427  8.749   80.022  1.00 81.50 ? 289 LEU B CA  1 
ATOM   6646 C  C   . LEU B 2 289 ? 83.880  9.082   78.664  1.00 80.35 ? 289 LEU B C   1 
ATOM   6647 O  O   . LEU B 2 289 ? 84.089  10.180  78.164  1.00 79.48 ? 289 LEU B O   1 
ATOM   6648 C  CB  . LEU B 2 289 ? 85.492  7.677   79.891  1.00 82.54 ? 289 LEU B CB  1 
ATOM   6649 C  CG  . LEU B 2 289 ? 86.469  7.752   81.055  1.00 83.75 ? 289 LEU B CG  1 
ATOM   6650 C  CD1 . LEU B 2 289 ? 87.438  6.581   81.014  1.00 83.78 ? 289 LEU B CD1 1 
ATOM   6651 C  CD2 . LEU B 2 289 ? 87.195  9.099   80.991  1.00 83.10 ? 289 LEU B CD2 1 
ATOM   6652 N  N   . THR B 2 290 ? 83.141  8.142   78.096  1.00 79.47 ? 290 THR B N   1 
ATOM   6653 C  CA  . THR B 2 290 ? 82.572  8.308   76.774  1.00 78.71 ? 290 THR B CA  1 
ATOM   6654 C  C   . THR B 2 290 ? 81.312  9.187   76.777  1.00 79.76 ? 290 THR B C   1 
ATOM   6655 O  O   . THR B 2 290 ? 80.206  8.716   76.518  1.00 79.75 ? 290 THR B O   1 
ATOM   6656 C  CB  . THR B 2 290 ? 82.310  6.922   76.140  1.00 76.92 ? 290 THR B CB  1 
ATOM   6657 O  OG1 . THR B 2 290 ? 82.386  5.915   77.160  1.00 74.07 ? 290 THR B OG1 1 
ATOM   6658 C  CG2 . THR B 2 290 ? 83.357  6.615   75.076  1.00 74.37 ? 290 THR B CG2 1 
ATOM   6659 N  N   . GLU B 2 291 ? 81.486  10.477  77.053  1.00 81.18 ? 291 GLU B N   1 
ATOM   6660 C  CA  . GLU B 2 291 ? 80.352  11.391  77.077  1.00 82.42 ? 291 GLU B CA  1 
ATOM   6661 C  C   . GLU B 2 291 ? 80.650  12.745  76.454  1.00 83.06 ? 291 GLU B C   1 
ATOM   6662 O  O   . GLU B 2 291 ? 81.643  13.389  76.780  1.00 82.39 ? 291 GLU B O   1 
ATOM   6663 C  CB  . GLU B 2 291 ? 79.844  11.562  78.499  1.00 82.49 ? 291 GLU B CB  1 
ATOM   6664 C  CG  . GLU B 2 291 ? 78.449  12.117  78.572  1.00 83.84 ? 291 GLU B CG  1 
ATOM   6665 C  CD  . GLU B 2 291 ? 77.765  11.710  79.844  1.00 84.64 ? 291 GLU B CD  1 
ATOM   6666 O  OE1 . GLU B 2 291 ? 78.325  11.990  80.926  1.00 84.55 ? 291 GLU B OE1 1 
ATOM   6667 O  OE2 . GLU B 2 291 ? 76.682  11.086  79.760  1.00 86.30 ? 291 GLU B OE2 1 
ATOM   6668 N  N   . VAL B 2 292 ? 79.727  13.189  75.609  1.00 84.25 ? 292 VAL B N   1 
ATOM   6669 C  CA  . VAL B 2 292 ? 79.826  14.447  74.864  1.00 85.91 ? 292 VAL B CA  1 
ATOM   6670 C  C   . VAL B 2 292 ? 79.532  15.730  75.664  1.00 87.94 ? 292 VAL B C   1 
ATOM   6671 O  O   . VAL B 2 292 ? 78.387  15.950  76.062  1.00 89.24 ? 292 VAL B O   1 
ATOM   6672 C  CB  . VAL B 2 292 ? 78.856  14.406  73.654  1.00 85.15 ? 292 VAL B CB  1 
ATOM   6673 C  CG1 . VAL B 2 292 ? 79.171  15.531  72.665  1.00 84.33 ? 292 VAL B CG1 1 
ATOM   6674 C  CG2 . VAL B 2 292 ? 78.896  13.030  72.988  1.00 84.64 ? 292 VAL B CG2 1 
ATOM   6675 N  N   . ILE B 2 293 ? 80.535  16.597  75.852  1.00 89.58 ? 293 ILE B N   1 
ATOM   6676 C  CA  . ILE B 2 293 ? 80.344  17.863  76.597  1.00 90.47 ? 293 ILE B CA  1 
ATOM   6677 C  C   . ILE B 2 293 ? 80.954  19.126  75.897  1.00 91.61 ? 293 ILE B C   1 
ATOM   6678 O  O   . ILE B 2 293 ? 81.750  19.847  76.508  1.00 92.30 ? 293 ILE B O   1 
ATOM   6679 C  CB  . ILE B 2 293 ? 80.959  17.778  78.059  1.00 91.74 ? 293 ILE B CB  1 
ATOM   6680 C  CG1 . ILE B 2 293 ? 80.981  16.331  78.597  1.00 91.14 ? 293 ILE B CG1 1 
ATOM   6681 C  CG2 . ILE B 2 293 ? 80.191  18.713  79.012  1.00 91.60 ? 293 ILE B CG2 1 
ATOM   6682 C  CD1 . ILE B 2 293 ? 79.621  15.751  79.006  1.00 90.55 ? 293 ILE B CD1 1 
ATOM   6683 N  N   . PRO B 2 294 ? 80.524  19.460  74.654  1.00 90.74 ? 294 PRO B N   1 
ATOM   6684 C  CA  . PRO B 2 294 ? 81.103  20.640  73.988  1.00 89.94 ? 294 PRO B CA  1 
ATOM   6685 C  C   . PRO B 2 294 ? 80.825  21.995  74.645  1.00 90.96 ? 294 PRO B C   1 
ATOM   6686 O  O   . PRO B 2 294 ? 81.739  22.766  74.944  1.00 90.65 ? 294 PRO B O   1 
ATOM   6687 C  CB  . PRO B 2 294 ? 80.495  20.569  72.583  1.00 89.13 ? 294 PRO B CB  1 
ATOM   6688 C  CG  . PRO B 2 294 ? 79.161  19.960  72.822  1.00 88.86 ? 294 PRO B CG  1 
ATOM   6689 C  CD  . PRO B 2 294 ? 79.478  18.851  73.809  1.00 89.32 ? 294 PRO B CD  1 
ATOM   6690 N  N   . LEU B 2 295 ? 79.546  22.229  74.899  1.00 92.61 ? 295 LEU B N   1 
ATOM   6691 C  CA  . LEU B 2 295 ? 78.996  23.452  75.478  1.00 94.21 ? 295 LEU B CA  1 
ATOM   6692 C  C   . LEU B 2 295 ? 79.764  24.779  75.656  1.00 94.90 ? 295 LEU B C   1 
ATOM   6693 O  O   . LEU B 2 295 ? 79.585  25.697  74.841  1.00 94.36 ? 295 LEU B O   1 
ATOM   6694 C  CB  . LEU B 2 295 ? 78.217  23.140  76.766  1.00 93.53 ? 295 LEU B CB  1 
ATOM   6695 C  CG  . LEU B 2 295 ? 77.270  24.298  77.126  1.00 93.99 ? 295 LEU B CG  1 
ATOM   6696 C  CD1 . LEU B 2 295 ? 76.197  24.457  76.027  1.00 93.13 ? 295 LEU B CD1 1 
ATOM   6697 C  CD2 . LEU B 2 295 ? 76.647  24.093  78.501  1.00 93.99 ? 295 LEU B CD2 1 
ATOM   6698 N  N   . THR B 2 296 ? 80.554  24.896  76.732  1.00 95.48 ? 296 THR B N   1 
ATOM   6699 C  CA  . THR B 2 296 ? 81.255  26.143  77.070  1.00 95.37 ? 296 THR B CA  1 
ATOM   6700 C  C   . THR B 2 296 ? 81.746  27.029  75.940  1.00 95.34 ? 296 THR B C   1 
ATOM   6701 O  O   . THR B 2 296 ? 82.874  26.896  75.451  1.00 94.29 ? 296 THR B O   1 
ATOM   6702 C  CB  . THR B 2 296 ? 82.383  25.958  78.121  1.00 95.92 ? 296 THR B CB  1 
ATOM   6703 O  OG1 . THR B 2 296 ? 81.922  25.097  79.167  1.00 97.39 ? 296 THR B OG1 1 
ATOM   6704 C  CG2 . THR B 2 296 ? 82.764  27.321  78.755  1.00 94.25 ? 296 THR B CG2 1 
ATOM   6705 N  N   . GLU B 2 297 ? 80.874  27.968  75.580  1.00 95.42 ? 297 GLU B N   1 
ATOM   6706 C  CA  . GLU B 2 297 ? 81.126  28.960  74.545  1.00 95.34 ? 297 GLU B CA  1 
ATOM   6707 C  C   . GLU B 2 297 ? 82.457  29.621  74.881  1.00 94.84 ? 297 GLU B C   1 
ATOM   6708 O  O   . GLU B 2 297 ? 83.358  29.724  74.045  1.00 94.55 ? 297 GLU B O   1 
ATOM   6709 C  CB  . GLU B 2 297 ? 80.011  30.010  74.578  1.00 95.98 ? 297 GLU B CB  1 
ATOM   6710 C  CG  . GLU B 2 297 ? 78.914  29.819  73.535  1.00 96.75 ? 297 GLU B CG  1 
ATOM   6711 C  CD  . GLU B 2 297 ? 79.095  30.710  72.304  1.00 97.04 ? 297 GLU B CD  1 
ATOM   6712 O  OE1 . GLU B 2 297 ? 80.172  31.337  72.149  1.00 97.28 ? 297 GLU B OE1 1 
ATOM   6713 O  OE2 . GLU B 2 297 ? 78.143  30.791  71.494  1.00 97.61 ? 297 GLU B OE2 1 
ATOM   6714 N  N   . GLU B 2 298 ? 82.586  29.974  76.155  1.00 94.32 ? 298 GLU B N   1 
ATOM   6715 C  CA  . GLU B 2 298 ? 83.769  30.616  76.692  1.00 93.40 ? 298 GLU B CA  1 
ATOM   6716 C  C   . GLU B 2 298 ? 84.997  29.697  76.555  1.00 91.39 ? 298 GLU B C   1 
ATOM   6717 O  O   . GLU B 2 298 ? 86.117  30.174  76.363  1.00 90.66 ? 298 GLU B O   1 
ATOM   6718 C  CB  . GLU B 2 298 ? 83.466  31.009  78.147  1.00 94.74 ? 298 GLU B CB  1 
ATOM   6719 C  CG  . GLU B 2 298 ? 84.576  31.688  78.908  1.00 97.90 ? 298 GLU B CG  1 
ATOM   6720 C  CD  . GLU B 2 298 ? 85.548  30.688  79.496  1.00 99.90 ? 298 GLU B CD  1 
ATOM   6721 O  OE1 . GLU B 2 298 ? 85.085  29.707  80.137  1.00 99.90 ? 298 GLU B OE1 1 
ATOM   6722 O  OE2 . GLU B 2 298 ? 86.770  30.875  79.288  1.00 99.90 ? 298 GLU B OE2 1 
ATOM   6723 N  N   . ALA B 2 299 ? 84.769  28.384  76.554  1.00 90.27 ? 299 ALA B N   1 
ATOM   6724 C  CA  . ALA B 2 299 ? 85.859  27.412  76.436  1.00 89.48 ? 299 ALA B CA  1 
ATOM   6725 C  C   . ALA B 2 299 ? 86.383  27.157  75.021  1.00 87.85 ? 299 ALA B C   1 
ATOM   6726 O  O   . ALA B 2 299 ? 87.595  27.091  74.823  1.00 87.28 ? 299 ALA B O   1 
ATOM   6727 C  CB  . ALA B 2 299 ? 85.480  26.093  77.095  1.00 90.75 ? 299 ALA B CB  1 
ATOM   6728 N  N   . GLU B 2 300 ? 85.497  26.974  74.044  1.00 86.46 ? 300 GLU B N   1 
ATOM   6729 C  CA  . GLU B 2 300 ? 85.956  26.733  72.674  1.00 85.31 ? 300 GLU B CA  1 
ATOM   6730 C  C   . GLU B 2 300 ? 86.756  27.926  72.174  1.00 84.78 ? 300 GLU B C   1 
ATOM   6731 O  O   . GLU B 2 300 ? 87.554  27.800  71.232  1.00 84.62 ? 300 GLU B O   1 
ATOM   6732 C  CB  . GLU B 2 300 ? 84.795  26.437  71.739  1.00 83.66 ? 300 GLU B CB  1 
ATOM   6733 C  CG  . GLU B 2 300 ? 84.223  25.054  71.924  1.00 83.17 ? 300 GLU B CG  1 
ATOM   6734 C  CD  . GLU B 2 300 ? 82.884  24.900  71.245  1.00 83.70 ? 300 GLU B CD  1 
ATOM   6735 O  OE1 . GLU B 2 300 ? 82.713  25.454  70.139  1.00 83.05 ? 300 GLU B OE1 1 
ATOM   6736 O  OE2 . GLU B 2 300 ? 81.992  24.244  71.826  1.00 84.33 ? 300 GLU B OE2 1 
ATOM   6737 N  N   . LEU B 2 301 ? 86.523  29.081  72.804  1.00 84.22 ? 301 LEU B N   1 
ATOM   6738 C  CA  . LEU B 2 301 ? 87.253  30.308  72.493  1.00 83.44 ? 301 LEU B CA  1 
ATOM   6739 C  C   . LEU B 2 301 ? 88.698  30.002  72.864  1.00 82.20 ? 301 LEU B C   1 
ATOM   6740 O  O   . LEU B 2 301 ? 89.631  30.518  72.247  1.00 82.47 ? 301 LEU B O   1 
ATOM   6741 C  CB  . LEU B 2 301 ? 86.707  31.489  73.305  1.00 84.09 ? 301 LEU B CB  1 
ATOM   6742 C  CG  . LEU B 2 301 ? 85.619  32.369  72.657  1.00 84.95 ? 301 LEU B CG  1 
ATOM   6743 C  CD1 . LEU B 2 301 ? 84.642  31.544  71.820  1.00 84.16 ? 301 LEU B CD1 1 
ATOM   6744 C  CD2 . LEU B 2 301 ? 84.868  33.163  73.738  1.00 84.18 ? 301 LEU B CD2 1 
ATOM   6745 N  N   . GLU B 2 302 ? 88.866  29.133  73.861  1.00 79.99 ? 302 GLU B N   1 
ATOM   6746 C  CA  . GLU B 2 302 ? 90.186  28.678  74.284  1.00 78.24 ? 302 GLU B CA  1 
ATOM   6747 C  C   . GLU B 2 302 ? 90.708  27.629  73.297  1.00 77.40 ? 302 GLU B C   1 
ATOM   6748 O  O   . GLU B 2 302 ? 91.884  27.657  72.928  1.00 76.87 ? 302 GLU B O   1 
ATOM   6749 C  CB  . GLU B 2 302 ? 90.154  28.098  75.703  1.00 76.88 ? 302 GLU B CB  1 
ATOM   6750 C  CG  . GLU B 2 302 ? 90.071  29.153  76.777  1.00 75.54 ? 302 GLU B CG  1 
ATOM   6751 C  CD  . GLU B 2 302 ? 91.066  30.276  76.544  1.00 74.29 ? 302 GLU B CD  1 
ATOM   6752 O  OE1 . GLU B 2 302 ? 92.261  30.092  76.865  1.00 72.42 ? 302 GLU B OE1 1 
ATOM   6753 O  OE2 . GLU B 2 302 ? 90.649  31.331  76.014  1.00 73.12 ? 302 GLU B OE2 1 
ATOM   6754 N  N   . LEU B 2 303 ? 89.830  26.722  72.860  1.00 76.66 ? 303 LEU B N   1 
ATOM   6755 C  CA  . LEU B 2 303 ? 90.201  25.673  71.904  1.00 75.77 ? 303 LEU B CA  1 
ATOM   6756 C  C   . LEU B 2 303 ? 90.877  26.332  70.722  1.00 75.61 ? 303 LEU B C   1 
ATOM   6757 O  O   . LEU B 2 303 ? 92.071  26.158  70.496  1.00 74.65 ? 303 LEU B O   1 
ATOM   6758 C  CB  . LEU B 2 303 ? 88.967  24.910  71.396  1.00 75.50 ? 303 LEU B CB  1 
ATOM   6759 C  CG  . LEU B 2 303 ? 89.241  23.778  70.391  1.00 74.16 ? 303 LEU B CG  1 
ATOM   6760 C  CD1 . LEU B 2 303 ? 89.884  22.622  71.140  1.00 72.09 ? 303 LEU B CD1 1 
ATOM   6761 C  CD2 . LEU B 2 303 ? 87.957  23.317  69.695  1.00 71.86 ? 303 LEU B CD2 1 
ATOM   6762 N  N   . ALA B 2 304 ? 90.106  27.139  70.011  1.00 75.97 ? 304 ALA B N   1 
ATOM   6763 C  CA  . ALA B 2 304 ? 90.608  27.844  68.852  1.00 77.83 ? 304 ALA B CA  1 
ATOM   6764 C  C   . ALA B 2 304 ? 91.889  28.658  69.138  1.00 79.66 ? 304 ALA B C   1 
ATOM   6765 O  O   . ALA B 2 304 ? 92.935  28.393  68.536  1.00 79.04 ? 304 ALA B O   1 
ATOM   6766 C  CB  . ALA B 2 304 ? 89.516  28.734  68.300  1.00 78.18 ? 304 ALA B CB  1 
ATOM   6767 N  N   . GLU B 2 305 ? 91.805  29.620  70.062  1.00 81.48 ? 305 GLU B N   1 
ATOM   6768 C  CA  . GLU B 2 305 ? 92.935  30.490  70.442  1.00 83.46 ? 305 GLU B CA  1 
ATOM   6769 C  C   . GLU B 2 305 ? 94.298  29.783  70.512  1.00 84.98 ? 305 GLU B C   1 
ATOM   6770 O  O   . GLU B 2 305 ? 95.276  30.187  69.860  1.00 85.74 ? 305 GLU B O   1 
ATOM   6771 C  CB  . GLU B 2 305 ? 92.649  31.139  71.799  1.00 82.58 ? 305 GLU B CB  1 
ATOM   6772 C  CG  . GLU B 2 305 ? 93.884  31.662  72.545  1.00 82.24 ? 305 GLU B CG  1 
ATOM   6773 C  CD  . GLU B 2 305 ? 93.679  31.688  74.056  1.00 82.30 ? 305 GLU B CD  1 
ATOM   6774 O  OE1 . GLU B 2 305 ? 92.693  32.300  74.514  1.00 81.85 ? 305 GLU B OE1 1 
ATOM   6775 O  OE2 . GLU B 2 305 ? 94.494  31.088  74.792  1.00 83.02 ? 305 GLU B OE2 1 
ATOM   6776 N  N   . ASN B 2 306 ? 94.363  28.753  71.346  1.00 86.11 ? 306 ASN B N   1 
ATOM   6777 C  CA  . ASN B 2 306 ? 95.586  27.991  71.521  1.00 86.53 ? 306 ASN B CA  1 
ATOM   6778 C  C   . ASN B 2 306 ? 95.803  27.051  70.330  1.00 86.25 ? 306 ASN B C   1 
ATOM   6779 O  O   . ASN B 2 306 ? 96.940  26.833  69.903  1.00 85.88 ? 306 ASN B O   1 
ATOM   6780 C  CB  . ASN B 2 306 ? 95.553  27.223  72.853  1.00 87.02 ? 306 ASN B CB  1 
ATOM   6781 C  CG  . ASN B 2 306 ? 95.621  28.151  74.081  1.00 86.96 ? 306 ASN B CG  1 
ATOM   6782 O  OD1 . ASN B 2 306 ? 96.595  28.886  74.276  1.00 85.84 ? 306 ASN B OD1 1 
ATOM   6783 N  ND2 . ASN B 2 306 ? 94.589  28.097  74.921  1.00 86.96 ? 306 ASN B ND2 1 
ATOM   6784 N  N   . ARG B 2 307 ? 94.705  26.561  69.754  1.00 85.72 ? 307 ARG B N   1 
ATOM   6785 C  CA  . ARG B 2 307 ? 94.740  25.661  68.593  1.00 86.36 ? 307 ARG B CA  1 
ATOM   6786 C  C   . ARG B 2 307 ? 95.639  26.199  67.481  1.00 86.38 ? 307 ARG B C   1 
ATOM   6787 O  O   . ARG B 2 307 ? 96.223  25.443  66.685  1.00 86.16 ? 307 ARG B O   1 
ATOM   6788 C  CB  . ARG B 2 307 ? 93.322  25.466  68.068  1.00 85.27 ? 307 ARG B CB  1 
ATOM   6789 C  CG  . ARG B 2 307 ? 93.201  24.629  66.836  1.00 85.06 ? 307 ARG B CG  1 
ATOM   6790 C  CD  . ARG B 2 307 ? 91.839  23.975  66.824  1.00 87.04 ? 307 ARG B CD  1 
ATOM   6791 N  NE  . ARG B 2 307 ? 91.732  22.979  67.887  1.00 87.77 ? 307 ARG B NE  1 
ATOM   6792 C  CZ  . ARG B 2 307 ? 91.161  21.786  67.743  1.00 88.98 ? 307 ARG B CZ  1 
ATOM   6793 N  NH1 . ARG B 2 307 ? 90.629  21.430  66.578  1.00 89.21 ? 307 ARG B NH1 1 
ATOM   6794 N  NH2 . ARG B 2 307 ? 91.166  20.925  68.752  1.00 88.34 ? 307 ARG B NH2 1 
ATOM   6795 N  N   . GLU B 2 308 ? 95.712  27.522  67.417  1.00 86.74 ? 308 GLU B N   1 
ATOM   6796 C  CA  . GLU B 2 308 ? 96.541  28.183  66.439  1.00 85.72 ? 308 GLU B CA  1 
ATOM   6797 C  C   . GLU B 2 308 ? 97.768  28.764  67.103  1.00 84.91 ? 308 GLU B C   1 
ATOM   6798 O  O   . GLU B 2 308 ? 98.747  29.046  66.419  1.00 85.38 ? 308 GLU B O   1 
ATOM   6799 C  CB  . GLU B 2 308 ? 95.768  29.285  65.752  1.00 85.55 ? 308 GLU B CB  1 
ATOM   6800 C  CG  . GLU B 2 308 ? 96.389  29.704  64.453  1.00 85.15 ? 308 GLU B CG  1 
ATOM   6801 C  CD  . GLU B 2 308 ? 95.343  30.159  63.486  1.00 84.89 ? 308 GLU B CD  1 
ATOM   6802 O  OE1 . GLU B 2 308 ? 95.007  31.360  63.522  1.00 83.63 ? 308 GLU B OE1 1 
ATOM   6803 O  OE2 . GLU B 2 308 ? 94.829  29.305  62.726  1.00 84.26 ? 308 GLU B OE2 1 
ATOM   6804 N  N   . ILE B 2 309 ? 97.728  28.909  68.430  1.00 84.70 ? 309 ILE B N   1 
ATOM   6805 C  CA  . ILE B 2 309 ? 98.858  29.441  69.199  1.00 84.44 ? 309 ILE B CA  1 
ATOM   6806 C  C   . ILE B 2 309 ? 100.117 28.631  68.854  1.00 84.34 ? 309 ILE B C   1 
ATOM   6807 O  O   . ILE B 2 309 ? 101.244 29.036  69.142  1.00 83.03 ? 309 ILE B O   1 
ATOM   6808 C  CB  . ILE B 2 309 ? 98.583  29.390  70.730  1.00 84.53 ? 309 ILE B CB  1 
ATOM   6809 C  CG1 . ILE B 2 309 ? 99.140  30.648  71.406  1.00 85.58 ? 309 ILE B CG1 1 
ATOM   6810 C  CG2 . ILE B 2 309 ? 99.220  28.136  71.363  1.00 85.66 ? 309 ILE B CG2 1 
ATOM   6811 C  CD1 . ILE B 2 309 ? 98.878  30.732  72.907  1.00 85.66 ? 309 ILE B CD1 1 
ATOM   6812 N  N   . LEU B 2 310 ? 99.880  27.458  68.273  1.00 84.37 ? 310 LEU B N   1 
ATOM   6813 C  CA  . LEU B 2 310 ? 100.918 26.546  67.817  1.00 85.47 ? 310 LEU B CA  1 
ATOM   6814 C  C   . LEU B 2 310 ? 101.694 27.179  66.655  1.00 85.94 ? 310 LEU B C   1 
ATOM   6815 O  O   . LEU B 2 310 ? 102.919 27.358  66.706  1.00 86.24 ? 310 LEU B O   1 
ATOM   6816 C  CB  . LEU B 2 310 ? 100.254 25.271  67.290  1.00 85.06 ? 310 LEU B CB  1 
ATOM   6817 C  CG  . LEU B 2 310 ? 99.472  24.382  68.245  1.00 84.04 ? 310 LEU B CG  1 
ATOM   6818 C  CD1 . LEU B 2 310 ? 98.608  23.423  67.444  1.00 84.53 ? 310 LEU B CD1 1 
ATOM   6819 C  CD2 . LEU B 2 310 ? 100.453 23.636  69.128  1.00 83.85 ? 310 LEU B CD2 1 
ATOM   6820 N  N   . LYS B 2 311 ? 100.945 27.488  65.599  1.00 86.15 ? 311 LYS B N   1 
ATOM   6821 C  CA  . LYS B 2 311 ? 101.466 28.071  64.364  1.00 84.83 ? 311 LYS B CA  1 
ATOM   6822 C  C   . LYS B 2 311 ? 102.386 29.290  64.552  1.00 84.36 ? 311 LYS B C   1 
ATOM   6823 O  O   . LYS B 2 311 ? 103.303 29.512  63.759  1.00 83.74 ? 311 LYS B O   1 
ATOM   6824 C  CB  . LYS B 2 311 ? 100.292 28.370  63.425  1.00 83.49 ? 311 LYS B CB  1 
ATOM   6825 C  CG  . LYS B 2 311 ? 99.359  27.173  63.287  1.00 81.51 ? 311 LYS B CG  1 
ATOM   6826 C  CD  . LYS B 2 311 ? 98.305  27.408  62.245  1.00 80.92 ? 311 LYS B CD  1 
ATOM   6827 C  CE  . LYS B 2 311 ? 97.489  26.155  61.989  1.00 80.39 ? 311 LYS B CE  1 
ATOM   6828 N  NZ  . LYS B 2 311 ? 96.871  26.212  60.629  1.00 78.80 ? 311 LYS B NZ  1 
ATOM   6829 N  N   . GLU B 2 312 ? 102.133 30.076  65.592  1.00 84.54 ? 312 GLU B N   1 
ATOM   6830 C  CA  . GLU B 2 312 ? 102.962 31.233  65.892  1.00 84.16 ? 312 GLU B CA  1 
ATOM   6831 C  C   . GLU B 2 312 ? 103.928 30.787  66.978  1.00 83.55 ? 312 GLU B C   1 
ATOM   6832 O  O   . GLU B 2 312 ? 103.607 30.872  68.164  1.00 83.37 ? 312 GLU B O   1 
ATOM   6833 C  CB  . GLU B 2 312 ? 102.117 32.391  66.429  1.00 85.78 ? 312 GLU B CB  1 
ATOM   6834 C  CG  . GLU B 2 312 ? 100.866 32.708  65.617  1.00 87.70 ? 312 GLU B CG  1 
ATOM   6835 C  CD  . GLU B 2 312 ? 99.584  32.315  66.337  1.00 88.21 ? 312 GLU B CD  1 
ATOM   6836 O  OE1 . GLU B 2 312 ? 99.550  32.432  67.583  1.00 88.11 ? 312 GLU B OE1 1 
ATOM   6837 O  OE2 . GLU B 2 312 ? 98.614  31.895  65.660  1.00 87.77 ? 312 GLU B OE2 1 
ATOM   6838 N  N   . PRO B 2 313 ? 105.114 30.286  66.588  1.00 83.58 ? 313 PRO B N   1 
ATOM   6839 C  CA  . PRO B 2 313 ? 106.118 29.824  67.555  1.00 83.31 ? 313 PRO B CA  1 
ATOM   6840 C  C   . PRO B 2 313 ? 106.631 30.914  68.497  1.00 83.49 ? 313 PRO B C   1 
ATOM   6841 O  O   . PRO B 2 313 ? 106.345 32.098  68.320  1.00 82.57 ? 313 PRO B O   1 
ATOM   6842 C  CB  . PRO B 2 313 ? 107.216 29.247  66.662  1.00 83.13 ? 313 PRO B CB  1 
ATOM   6843 C  CG  . PRO B 2 313 ? 107.106 30.068  65.424  1.00 83.50 ? 313 PRO B CG  1 
ATOM   6844 C  CD  . PRO B 2 313 ? 105.616 30.148  65.211  1.00 83.52 ? 313 PRO B CD  1 
ATOM   6845 N  N   . VAL B 2 314 ? 107.460 30.506  69.449  1.00 83.80 ? 314 VAL B N   1 
ATOM   6846 C  CA  . VAL B 2 314 ? 107.976 31.413  70.470  1.00 84.70 ? 314 VAL B CA  1 
ATOM   6847 C  C   . VAL B 2 314 ? 109.347 32.066  70.235  1.00 85.29 ? 314 VAL B C   1 
ATOM   6848 O  O   . VAL B 2 314 ? 109.765 32.276  69.094  1.00 84.63 ? 314 VAL B O   1 
ATOM   6849 C  CB  . VAL B 2 314 ? 107.989 30.682  71.842  1.00 85.01 ? 314 VAL B CB  1 
ATOM   6850 C  CG1 . VAL B 2 314 ? 106.571 30.296  72.243  1.00 84.93 ? 314 VAL B CG1 1 
ATOM   6851 C  CG2 . VAL B 2 314 ? 108.872 29.432  71.774  1.00 84.85 ? 314 VAL B CG2 1 
ATOM   6852 N  N   . HIS B 2 315 ? 109.980 32.478  71.340  1.00 86.52 ? 315 HIS B N   1 
ATOM   6853 C  CA  . HIS B 2 315 ? 111.321 33.073  71.327  1.00 87.13 ? 315 HIS B CA  1 
ATOM   6854 C  C   . HIS B 2 315 ? 112.320 31.955  71.063  1.00 87.59 ? 315 HIS B C   1 
ATOM   6855 O  O   . HIS B 2 315 ? 113.403 32.217  70.547  1.00 87.80 ? 315 HIS B O   1 
ATOM   6856 C  CB  . HIS B 2 315 ? 111.694 33.701  72.694  1.00 87.80 ? 315 HIS B CB  1 
ATOM   6857 C  CG  . HIS B 2 315 ? 113.121 33.438  73.117  1.00 88.64 ? 315 HIS B CG  1 
ATOM   6858 N  ND1 . HIS B 2 315 ? 113.461 32.498  74.070  1.00 88.75 ? 315 HIS B ND1 1 
ATOM   6859 C  CD2 . HIS B 2 315 ? 114.298 33.930  72.650  1.00 88.83 ? 315 HIS B CD2 1 
ATOM   6860 C  CE1 . HIS B 2 315 ? 114.778 32.416  74.166  1.00 88.04 ? 315 HIS B CE1 1 
ATOM   6861 N  NE2 . HIS B 2 315 ? 115.308 33.275  73.314  1.00 88.76 ? 315 HIS B NE2 1 
ATOM   6862 N  N   . GLY B 2 316 ? 111.990 30.758  71.566  1.00 87.04 ? 316 GLY B N   1 
ATOM   6863 C  CA  . GLY B 2 316 ? 112.831 29.571  71.451  1.00 84.56 ? 316 GLY B CA  1 
ATOM   6864 C  C   . GLY B 2 316 ? 113.586 29.343  70.155  1.00 82.43 ? 316 GLY B C   1 
ATOM   6865 O  O   . GLY B 2 316 ? 113.358 28.352  69.461  1.00 83.69 ? 316 GLY B O   1 
ATOM   6866 N  N   . VAL B 2 317 ? 114.504 30.258  69.860  1.00 80.20 ? 317 VAL B N   1 
ATOM   6867 C  CA  . VAL B 2 317 ? 115.347 30.237  68.674  1.00 76.73 ? 317 VAL B CA  1 
ATOM   6868 C  C   . VAL B 2 317 ? 116.499 31.171  69.040  1.00 74.26 ? 317 VAL B C   1 
ATOM   6869 O  O   . VAL B 2 317 ? 116.379 32.395  68.974  1.00 74.60 ? 317 VAL B O   1 
ATOM   6870 C  CB  . VAL B 2 317 ? 114.661 30.818  67.387  1.00 77.44 ? 317 VAL B CB  1 
ATOM   6871 C  CG1 . VAL B 2 317 ? 115.306 30.205  66.150  1.00 77.42 ? 317 VAL B CG1 1 
ATOM   6872 C  CG2 . VAL B 2 317 ? 113.137 30.616  67.379  1.00 77.32 ? 317 VAL B CG2 1 
ATOM   6873 N  N   . TYR B 2 318 ? 117.557 30.584  69.567  1.00 70.73 ? 318 TYR B N   1 
ATOM   6874 C  CA  . TYR B 2 318 ? 118.747 31.314  69.949  1.00 67.90 ? 318 TYR B CA  1 
ATOM   6875 C  C   . TYR B 2 318 ? 119.805 30.227  69.932  1.00 67.09 ? 318 TYR B C   1 
ATOM   6876 O  O   . TYR B 2 318 ? 120.100 29.577  70.943  1.00 66.65 ? 318 TYR B O   1 
ATOM   6877 C  CB  . TYR B 2 318 ? 118.595 31.950  71.337  1.00 66.84 ? 318 TYR B CB  1 
ATOM   6878 C  CG  . TYR B 2 318 ? 119.907 32.158  72.060  1.00 66.93 ? 318 TYR B CG  1 
ATOM   6879 C  CD1 . TYR B 2 318 ? 121.060 32.548  71.370  1.00 66.48 ? 318 TYR B CD1 1 
ATOM   6880 C  CD2 . TYR B 2 318 ? 120.016 31.889  73.423  1.00 65.66 ? 318 TYR B CD2 1 
ATOM   6881 C  CE1 . TYR B 2 318 ? 122.283 32.655  72.016  1.00 66.67 ? 318 TYR B CE1 1 
ATOM   6882 C  CE2 . TYR B 2 318 ? 121.236 31.997  74.083  1.00 65.70 ? 318 TYR B CE2 1 
ATOM   6883 C  CZ  . TYR B 2 318 ? 122.363 32.379  73.372  1.00 66.58 ? 318 TYR B CZ  1 
ATOM   6884 O  OH  . TYR B 2 318 ? 123.567 32.512  74.023  1.00 66.94 ? 318 TYR B OH  1 
ATOM   6885 N  N   . TYR B 2 319 ? 120.299 29.958  68.737  1.00 64.74 ? 319 TYR B N   1 
ATOM   6886 C  CA  . TYR B 2 319 ? 121.309 28.946  68.584  1.00 62.80 ? 319 TYR B CA  1 
ATOM   6887 C  C   . TYR B 2 319 ? 122.575 29.382  69.304  1.00 61.73 ? 319 TYR B C   1 
ATOM   6888 O  O   . TYR B 2 319 ? 123.317 30.213  68.807  1.00 62.71 ? 319 TYR B O   1 
ATOM   6889 C  CB  . TYR B 2 319 ? 121.586 28.700  67.112  1.00 61.52 ? 319 TYR B CB  1 
ATOM   6890 C  CG  . TYR B 2 319 ? 122.827 27.883  66.887  1.00 61.96 ? 319 TYR B CG  1 
ATOM   6891 C  CD1 . TYR B 2 319 ? 123.023 26.674  67.546  1.00 60.61 ? 319 TYR B CD1 1 
ATOM   6892 C  CD2 . TYR B 2 319 ? 123.807 28.312  65.995  1.00 63.48 ? 319 TYR B CD2 1 
ATOM   6893 C  CE1 . TYR B 2 319 ? 124.169 25.907  67.316  1.00 61.45 ? 319 TYR B CE1 1 
ATOM   6894 C  CE2 . TYR B 2 319 ? 124.953 27.551  65.754  1.00 63.11 ? 319 TYR B CE2 1 
ATOM   6895 C  CZ  . TYR B 2 319 ? 125.127 26.353  66.415  1.00 61.66 ? 319 TYR B CZ  1 
ATOM   6896 O  OH  . TYR B 2 319 ? 126.240 25.599  66.140  1.00 60.31 ? 319 TYR B OH  1 
ATOM   6897 N  N   . ASP B 2 320 ? 122.764 28.852  70.505  1.00 60.45 ? 320 ASP B N   1 
ATOM   6898 C  CA  . ASP B 2 320 ? 123.928 29.115  71.344  1.00 58.20 ? 320 ASP B CA  1 
ATOM   6899 C  C   . ASP B 2 320 ? 125.118 28.218  70.928  1.00 57.10 ? 320 ASP B C   1 
ATOM   6900 O  O   . ASP B 2 320 ? 125.346 27.162  71.518  1.00 56.02 ? 320 ASP B O   1 
ATOM   6901 C  CB  . ASP B 2 320 ? 123.536 28.820  72.791  1.00 58.51 ? 320 ASP B CB  1 
ATOM   6902 C  CG  . ASP B 2 320 ? 124.585 29.255  73.787  1.00 58.62 ? 320 ASP B CG  1 
ATOM   6903 O  OD1 . ASP B 2 320 ? 125.791 29.055  73.530  1.00 56.97 ? 320 ASP B OD1 1 
ATOM   6904 O  OD2 . ASP B 2 320 ? 124.190 29.789  74.847  1.00 58.08 ? 320 ASP B OD2 1 
ATOM   6905 N  N   . PRO B 2 321 ? 125.980 28.710  70.024  1.00 55.60 ? 321 PRO B N   1 
ATOM   6906 C  CA  . PRO B 2 321 ? 127.158 27.996  69.509  1.00 55.00 ? 321 PRO B CA  1 
ATOM   6907 C  C   . PRO B 2 321 ? 128.119 27.503  70.579  1.00 53.83 ? 321 PRO B C   1 
ATOM   6908 O  O   . PRO B 2 321 ? 129.088 26.811  70.275  1.00 52.96 ? 321 PRO B O   1 
ATOM   6909 C  CB  . PRO B 2 321 ? 127.826 29.042  68.618  1.00 55.72 ? 321 PRO B CB  1 
ATOM   6910 C  CG  . PRO B 2 321 ? 126.681 29.944  68.225  1.00 55.50 ? 321 PRO B CG  1 
ATOM   6911 C  CD  . PRO B 2 321 ? 125.973 30.093  69.526  1.00 55.28 ? 321 PRO B CD  1 
ATOM   6912 N  N   . SER B 2 322 ? 127.912 27.961  71.805  1.00 53.29 ? 322 SER B N   1 
ATOM   6913 C  CA  . SER B 2 322 ? 128.739 27.536  72.918  1.00 54.29 ? 322 SER B CA  1 
ATOM   6914 C  C   . SER B 2 322 ? 128.175 26.205  73.393  1.00 54.03 ? 322 SER B C   1 
ATOM   6915 O  O   . SER B 2 322 ? 128.886 25.194  73.487  1.00 53.81 ? 322 SER B O   1 
ATOM   6916 C  CB  . SER B 2 322 ? 128.666 28.565  74.058  1.00 54.72 ? 322 SER B CB  1 
ATOM   6917 O  OG  . SER B 2 322 ? 129.157 28.054  75.300  1.00 55.18 ? 322 SER B OG  1 
ATOM   6918 N  N   . LYS B 2 323 ? 126.871 26.212  73.639  1.00 54.03 ? 323 LYS B N   1 
ATOM   6919 C  CA  . LYS B 2 323 ? 126.202 25.035  74.133  1.00 53.70 ? 323 LYS B CA  1 
ATOM   6920 C  C   . LYS B 2 323 ? 126.130 24.015  73.036  1.00 52.22 ? 323 LYS B C   1 
ATOM   6921 O  O   . LYS B 2 323 ? 126.295 24.326  71.858  1.00 50.44 ? 323 LYS B O   1 
ATOM   6922 C  CB  . LYS B 2 323 ? 124.769 25.346  74.592  1.00 56.20 ? 323 LYS B CB  1 
ATOM   6923 C  CG  . LYS B 2 323 ? 124.581 26.574  75.467  1.00 60.16 ? 323 LYS B CG  1 
ATOM   6924 C  CD  . LYS B 2 323 ? 125.423 26.539  76.747  1.00 63.31 ? 323 LYS B CD  1 
ATOM   6925 C  CE  . LYS B 2 323 ? 125.029 27.661  77.739  1.00 64.39 ? 323 LYS B CE  1 
ATOM   6926 N  NZ  . LYS B 2 323 ? 123.660 27.512  78.360  1.00 63.16 ? 323 LYS B NZ  1 
ATOM   6927 N  N   . ASP B 2 324 ? 125.870 22.787  73.452  1.00 51.69 ? 324 ASP B N   1 
ATOM   6928 C  CA  . ASP B 2 324 ? 125.716 21.687  72.537  1.00 49.13 ? 324 ASP B CA  1 
ATOM   6929 C  C   . ASP B 2 324 ? 124.214 21.435  72.246  1.00 46.91 ? 324 ASP B C   1 
ATOM   6930 O  O   . ASP B 2 324 ? 123.320 21.681  73.076  1.00 44.05 ? 324 ASP B O   1 
ATOM   6931 C  CB  . ASP B 2 324 ? 126.405 20.439  73.109  1.00 49.37 ? 324 ASP B CB  1 
ATOM   6932 C  CG  . ASP B 2 324 ? 126.409 19.269  72.134  1.00 51.16 ? 324 ASP B CG  1 
ATOM   6933 O  OD1 . ASP B 2 324 ? 127.078 19.352  71.079  1.00 53.03 ? 324 ASP B OD1 1 
ATOM   6934 O  OD2 . ASP B 2 324 ? 125.732 18.261  72.422  1.00 52.09 ? 324 ASP B OD2 1 
ATOM   6935 N  N   . LEU B 2 325 ? 123.965 20.970  71.032  1.00 45.01 ? 325 LEU B N   1 
ATOM   6936 C  CA  . LEU B 2 325 ? 122.633 20.642  70.546  1.00 43.91 ? 325 LEU B CA  1 
ATOM   6937 C  C   . LEU B 2 325 ? 122.280 19.199  70.942  1.00 41.26 ? 325 LEU B C   1 
ATOM   6938 O  O   . LEU B 2 325 ? 123.109 18.296  70.826  1.00 40.40 ? 325 LEU B O   1 
ATOM   6939 C  CB  . LEU B 2 325 ? 122.604 20.798  69.020  1.00 47.69 ? 325 LEU B CB  1 
ATOM   6940 C  CG  . LEU B 2 325 ? 123.476 19.906  68.102  1.00 50.90 ? 325 LEU B CG  1 
ATOM   6941 C  CD1 . LEU B 2 325 ? 123.406 20.431  66.632  1.00 51.06 ? 325 LEU B CD1 1 
ATOM   6942 C  CD2 . LEU B 2 325 ? 124.946 19.824  68.585  1.00 50.43 ? 325 LEU B CD2 1 
ATOM   6943 N  N   . ILE B 2 326 ? 121.058 18.979  71.416  1.00 38.75 ? 326 ILE B N   1 
ATOM   6944 C  CA  . ILE B 2 326 ? 120.644 17.645  71.830  1.00 34.42 ? 326 ILE B CA  1 
ATOM   6945 C  C   . ILE B 2 326 ? 119.506 17.137  70.982  1.00 32.28 ? 326 ILE B C   1 
ATOM   6946 O  O   . ILE B 2 326 ? 118.490 17.828  70.808  1.00 27.69 ? 326 ILE B O   1 
ATOM   6947 C  CB  . ILE B 2 326 ? 120.158 17.595  73.296  1.00 33.78 ? 326 ILE B CB  1 
ATOM   6948 C  CG1 . ILE B 2 326 ? 121.019 18.473  74.215  1.00 30.97 ? 326 ILE B CG1 1 
ATOM   6949 C  CG2 . ILE B 2 326 ? 120.109 16.156  73.760  1.00 33.05 ? 326 ILE B CG2 1 
ATOM   6950 C  CD1 . ILE B 2 326 ? 122.483 18.156  74.242  1.00 28.65 ? 326 ILE B CD1 1 
ATOM   6951 N  N   . ALA B 2 327 ? 119.720 15.940  70.437  1.00 32.57 ? 327 ALA B N   1 
ATOM   6952 C  CA  . ALA B 2 327 ? 118.744 15.242  69.612  1.00 33.84 ? 327 ALA B CA  1 
ATOM   6953 C  C   . ALA B 2 327 ? 118.023 14.284  70.538  1.00 35.98 ? 327 ALA B C   1 
ATOM   6954 O  O   . ALA B 2 327 ? 118.606 13.777  71.516  1.00 34.80 ? 327 ALA B O   1 
ATOM   6955 C  CB  . ALA B 2 327 ? 119.417 14.482  68.513  1.00 31.80 ? 327 ALA B CB  1 
ATOM   6956 N  N   . GLU B 2 328 ? 116.776 13.984  70.194  1.00 38.40 ? 328 GLU B N   1 
ATOM   6957 C  CA  . GLU B 2 328 ? 115.947 13.126  71.033  1.00 39.78 ? 328 GLU B CA  1 
ATOM   6958 C  C   . GLU B 2 328 ? 114.932 12.364  70.198  1.00 38.29 ? 328 GLU B C   1 
ATOM   6959 O  O   . GLU B 2 328 ? 114.145 12.983  69.490  1.00 37.62 ? 328 GLU B O   1 
ATOM   6960 C  CB  . GLU B 2 328 ? 115.211 14.034  72.002  1.00 41.87 ? 328 GLU B CB  1 
ATOM   6961 C  CG  . GLU B 2 328 ? 114.534 13.368  73.141  1.00 44.30 ? 328 GLU B CG  1 
ATOM   6962 C  CD  . GLU B 2 328 ? 113.932 14.394  74.051  1.00 46.88 ? 328 GLU B CD  1 
ATOM   6963 O  OE1 . GLU B 2 328 ? 114.701 15.192  74.636  1.00 47.58 ? 328 GLU B OE1 1 
ATOM   6964 O  OE2 . GLU B 2 328 ? 112.687 14.429  74.149  1.00 49.39 ? 328 GLU B OE2 1 
ATOM   6965 N  N   . ILE B 2 329 ? 114.928 11.036  70.299  1.00 37.71 ? 329 ILE B N   1 
ATOM   6966 C  CA  . ILE B 2 329 ? 113.989 10.257  69.514  1.00 38.08 ? 329 ILE B CA  1 
ATOM   6967 C  C   . ILE B 2 329 ? 112.847 9.508   70.170  1.00 37.91 ? 329 ILE B C   1 
ATOM   6968 O  O   . ILE B 2 329 ? 113.000 8.767   71.144  1.00 37.18 ? 329 ILE B O   1 
ATOM   6969 C  CB  . ILE B 2 329 ? 114.676 9.369   68.499  1.00 38.76 ? 329 ILE B CB  1 
ATOM   6970 C  CG1 . ILE B 2 329 ? 115.221 10.236  67.368  1.00 38.38 ? 329 ILE B CG1 1 
ATOM   6971 C  CG2 . ILE B 2 329 ? 113.683 8.397   67.887  1.00 39.96 ? 329 ILE B CG2 1 
ATOM   6972 C  CD1 . ILE B 2 329 ? 115.899 9.438   66.292  1.00 37.42 ? 329 ILE B CD1 1 
ATOM   6973 N  N   . GLN B 2 330 ? 111.719 9.636   69.484  1.00 38.34 ? 330 GLN B N   1 
ATOM   6974 C  CA  . GLN B 2 330 ? 110.438 9.095   69.854  1.00 38.41 ? 330 GLN B CA  1 
ATOM   6975 C  C   . GLN B 2 330 ? 110.002 8.073   68.793  1.00 39.67 ? 330 GLN B C   1 
ATOM   6976 O  O   . GLN B 2 330 ? 109.880 8.425   67.625  1.00 39.50 ? 330 GLN B O   1 
ATOM   6977 C  CB  . GLN B 2 330 ? 109.438 10.265  69.877  1.00 36.44 ? 330 GLN B CB  1 
ATOM   6978 C  CG  . GLN B 2 330 ? 110.050 11.681  70.120  1.00 33.62 ? 330 GLN B CG  1 
ATOM   6979 C  CD  . GLN B 2 330 ? 110.628 11.897  71.540  1.00 33.46 ? 330 GLN B CD  1 
ATOM   6980 O  OE1 . GLN B 2 330 ? 111.596 11.257  71.940  1.00 31.92 ? 330 GLN B OE1 1 
ATOM   6981 N  NE2 . GLN B 2 330 ? 110.050 12.841  72.279  1.00 33.43 ? 330 GLN B NE2 1 
ATOM   6982 N  N   . LYS B 2 331 ? 109.864 6.805   69.182  1.00 42.05 ? 331 LYS B N   1 
ATOM   6983 C  CA  . LYS B 2 331 ? 109.405 5.730   68.285  1.00 43.10 ? 331 LYS B CA  1 
ATOM   6984 C  C   . LYS B 2 331 ? 107.884 5.879   68.235  1.00 44.93 ? 331 LYS B C   1 
ATOM   6985 O  O   . LYS B 2 331 ? 107.200 5.455   69.153  1.00 44.00 ? 331 LYS B O   1 
ATOM   6986 C  CB  . LYS B 2 331 ? 109.770 4.384   68.897  1.00 41.44 ? 331 LYS B CB  1 
ATOM   6987 C  CG  . LYS B 2 331 ? 109.110 3.191   68.244  1.00 40.63 ? 331 LYS B CG  1 
ATOM   6988 C  CD  . LYS B 2 331 ? 109.402 1.941   69.081  1.00 41.25 ? 331 LYS B CD  1 
ATOM   6989 C  CE  . LYS B 2 331 ? 108.822 0.654   68.484  1.00 42.34 ? 331 LYS B CE  1 
ATOM   6990 N  NZ  . LYS B 2 331 ? 108.990 -0.555  69.365  1.00 39.00 ? 331 LYS B NZ  1 
ATOM   6991 N  N   . GLN B 2 332 ? 107.353 6.451   67.161  1.00 47.47 ? 332 GLN B N   1 
ATOM   6992 C  CA  . GLN B 2 332 ? 105.910 6.727   67.076  1.00 50.79 ? 332 GLN B CA  1 
ATOM   6993 C  C   . GLN B 2 332 ? 104.834 5.682   66.806  1.00 51.69 ? 332 GLN B C   1 
ATOM   6994 O  O   . GLN B 2 332 ? 103.764 5.715   67.428  1.00 52.84 ? 332 GLN B O   1 
ATOM   6995 C  CB  . GLN B 2 332 ? 105.653 7.939   66.178  1.00 52.53 ? 332 GLN B CB  1 
ATOM   6996 C  CG  . GLN B 2 332 ? 105.021 9.089   66.924  1.00 55.88 ? 332 GLN B CG  1 
ATOM   6997 C  CD  . GLN B 2 332 ? 105.702 9.312   68.270  1.00 58.87 ? 332 GLN B CD  1 
ATOM   6998 O  OE1 . GLN B 2 332 ? 105.197 8.879   69.314  1.00 61.22 ? 332 GLN B OE1 1 
ATOM   6999 N  NE2 . GLN B 2 332 ? 106.891 9.922   68.245  1.00 59.13 ? 332 GLN B NE2 1 
ATOM   7000 N  N   . GLY B 2 333 ? 105.055 4.838   65.812  1.00 52.19 ? 333 GLY B N   1 
ATOM   7001 C  CA  . GLY B 2 333 ? 104.074 3.826   65.487  1.00 52.50 ? 333 GLY B CA  1 
ATOM   7002 C  C   . GLY B 2 333 ? 104.838 2.853   64.658  1.00 54.61 ? 333 GLY B C   1 
ATOM   7003 O  O   . GLY B 2 333 ? 106.047 2.711   64.858  1.00 55.22 ? 333 GLY B O   1 
ATOM   7004 N  N   . GLN B 2 334 ? 104.169 2.194   63.722  1.00 57.57 ? 334 GLN B N   1 
ATOM   7005 C  CA  . GLN B 2 334 ? 104.861 1.246   62.845  1.00 60.47 ? 334 GLN B CA  1 
ATOM   7006 C  C   . GLN B 2 334 ? 105.686 2.079   61.850  1.00 59.69 ? 334 GLN B C   1 
ATOM   7007 O  O   . GLN B 2 334 ? 105.129 2.715   60.941  1.00 60.11 ? 334 GLN B O   1 
ATOM   7008 C  CB  . GLN B 2 334 ? 103.876 0.327   62.085  1.00 62.66 ? 334 GLN B CB  1 
ATOM   7009 C  CG  . GLN B 2 334 ? 103.024 -0.621  62.945  1.00 67.19 ? 334 GLN B CG  1 
ATOM   7010 C  CD  . GLN B 2 334 ? 101.737 0.024   63.473  1.00 71.00 ? 334 GLN B CD  1 
ATOM   7011 O  OE1 . GLN B 2 334 ? 101.587 1.247   63.445  1.00 73.38 ? 334 GLN B OE1 1 
ATOM   7012 N  NE2 . GLN B 2 334 ? 100.813 -0.798  63.975  1.00 72.21 ? 334 GLN B NE2 1 
ATOM   7013 N  N   . GLY B 2 335 ? 106.995 2.157   62.090  1.00 58.05 ? 335 GLY B N   1 
ATOM   7014 C  CA  . GLY B 2 335 ? 107.865 2.919   61.212  1.00 55.71 ? 335 GLY B CA  1 
ATOM   7015 C  C   . GLY B 2 335 ? 107.763 4.417   61.433  1.00 54.01 ? 335 GLY B C   1 
ATOM   7016 O  O   . GLY B 2 335 ? 108.363 5.199   60.691  1.00 53.58 ? 335 GLY B O   1 
ATOM   7017 N  N   . GLN B 2 336 ? 106.943 4.820   62.399  1.00 52.80 ? 336 GLN B N   1 
ATOM   7018 C  CA  . GLN B 2 336 ? 106.794 6.229   62.729  1.00 50.73 ? 336 GLN B CA  1 
ATOM   7019 C  C   . GLN B 2 336 ? 107.804 6.522   63.831  1.00 47.88 ? 336 GLN B C   1 
ATOM   7020 O  O   . GLN B 2 336 ? 107.987 5.731   64.773  1.00 46.09 ? 336 GLN B O   1 
ATOM   7021 C  CB  . GLN B 2 336 ? 105.369 6.544   63.188  1.00 53.43 ? 336 GLN B CB  1 
ATOM   7022 C  CG  . GLN B 2 336 ? 104.314 6.464   62.091  1.00 56.22 ? 336 GLN B CG  1 
ATOM   7023 C  CD  . GLN B 2 336 ? 104.584 7.422   60.928  1.00 58.51 ? 336 GLN B CD  1 
ATOM   7024 O  OE1 . GLN B 2 336 ? 105.496 7.197   60.131  1.00 59.89 ? 336 GLN B OE1 1 
ATOM   7025 N  NE2 . GLN B 2 336 ? 103.774 8.482   60.815  1.00 57.80 ? 336 GLN B NE2 1 
ATOM   7026 N  N   . TRP B 2 337 ? 108.504 7.632   63.676  1.00 44.87 ? 337 TRP B N   1 
ATOM   7027 C  CA  . TRP B 2 337 ? 109.524 8.018   64.625  1.00 42.40 ? 337 TRP B CA  1 
ATOM   7028 C  C   . TRP B 2 337 ? 109.620 9.510   64.664  1.00 41.50 ? 337 TRP B C   1 
ATOM   7029 O  O   . TRP B 2 337 ? 109.179 10.182  63.741  1.00 41.47 ? 337 TRP B O   1 
ATOM   7030 C  CB  . TRP B 2 337 ? 110.856 7.463   64.194  1.00 40.97 ? 337 TRP B CB  1 
ATOM   7031 C  CG  . TRP B 2 337 ? 110.994 6.033   64.418  1.00 37.87 ? 337 TRP B CG  1 
ATOM   7032 C  CD1 . TRP B 2 337 ? 110.593 5.026   63.593  1.00 36.96 ? 337 TRP B CD1 1 
ATOM   7033 C  CD2 . TRP B 2 337 ? 111.717 5.431   65.474  1.00 37.98 ? 337 TRP B CD2 1 
ATOM   7034 N  NE1 . TRP B 2 337 ? 111.046 3.830   64.061  1.00 36.11 ? 337 TRP B NE1 1 
ATOM   7035 C  CE2 . TRP B 2 337 ? 111.747 4.048   65.219  1.00 37.88 ? 337 TRP B CE2 1 
ATOM   7036 C  CE3 . TRP B 2 337 ? 112.364 5.929   66.614  1.00 36.47 ? 337 TRP B CE3 1 
ATOM   7037 C  CZ2 . TRP B 2 337 ? 112.406 3.147   66.064  1.00 38.24 ? 337 TRP B CZ2 1 
ATOM   7038 C  CZ3 . TRP B 2 337 ? 113.017 5.042   67.454  1.00 36.79 ? 337 TRP B CZ3 1 
ATOM   7039 C  CH2 . TRP B 2 337 ? 113.036 3.663   67.174  1.00 37.31 ? 337 TRP B CH2 1 
ATOM   7040 N  N   . THR B 2 338 ? 110.251 10.033  65.705  1.00 41.73 ? 338 THR B N   1 
ATOM   7041 C  CA  . THR B 2 338 ? 110.346 11.471  65.847  1.00 42.02 ? 338 THR B CA  1 
ATOM   7042 C  C   . THR B 2 338 ? 111.521 11.909  66.690  1.00 40.38 ? 338 THR B C   1 
ATOM   7043 O  O   . THR B 2 338 ? 112.135 11.119  67.390  1.00 36.30 ? 338 THR B O   1 
ATOM   7044 C  CB  . THR B 2 338 ? 109.041 12.052  66.441  1.00 43.68 ? 338 THR B CB  1 
ATOM   7045 O  OG1 . THR B 2 338 ? 107.922 11.465  65.763  1.00 42.00 ? 338 THR B OG1 1 
ATOM   7046 C  CG2 . THR B 2 338 ? 108.987 13.574  66.261  1.00 44.66 ? 338 THR B CG2 1 
ATOM   7047 N  N   . TYR B 2 339 ? 111.821 13.192  66.579  1.00 41.70 ? 339 TYR B N   1 
ATOM   7048 C  CA  . TYR B 2 339 ? 112.922 13.809  67.268  1.00 42.36 ? 339 TYR B CA  1 
ATOM   7049 C  C   . TYR B 2 339 ? 112.677 15.293  67.389  1.00 40.65 ? 339 TYR B C   1 
ATOM   7050 O  O   . TYR B 2 339 ? 111.723 15.862  66.827  1.00 35.68 ? 339 TYR B O   1 
ATOM   7051 C  CB  . TYR B 2 339 ? 114.197 13.635  66.452  1.00 47.35 ? 339 TYR B CB  1 
ATOM   7052 C  CG  . TYR B 2 339 ? 114.085 14.334  65.111  1.00 53.15 ? 339 TYR B CG  1 
ATOM   7053 C  CD1 . TYR B 2 339 ? 113.509 13.687  64.013  1.00 54.56 ? 339 TYR B CD1 1 
ATOM   7054 C  CD2 . TYR B 2 339 ? 114.471 15.669  64.958  1.00 56.25 ? 339 TYR B CD2 1 
ATOM   7055 C  CE1 . TYR B 2 339 ? 113.314 14.343  62.803  1.00 56.24 ? 339 TYR B CE1 1 
ATOM   7056 C  CE2 . TYR B 2 339 ? 114.276 16.341  63.750  1.00 58.39 ? 339 TYR B CE2 1 
ATOM   7057 C  CZ  . TYR B 2 339 ? 113.694 15.674  62.673  1.00 58.57 ? 339 TYR B CZ  1 
ATOM   7058 O  OH  . TYR B 2 339 ? 113.470 16.343  61.478  1.00 61.67 ? 339 TYR B OH  1 
ATOM   7059 N  N   . GLN B 2 340 ? 113.633 15.909  68.070  1.00 41.11 ? 340 GLN B N   1 
ATOM   7060 C  CA  . GLN B 2 340 ? 113.681 17.345  68.323  1.00 40.19 ? 340 GLN B CA  1 
ATOM   7061 C  C   . GLN B 2 340 ? 115.105 17.664  68.823  1.00 38.22 ? 340 GLN B C   1 
ATOM   7062 O  O   . GLN B 2 340 ? 115.688 16.897  69.617  1.00 37.44 ? 340 GLN B O   1 
ATOM   7063 C  CB  . GLN B 2 340 ? 112.667 17.793  69.413  1.00 40.43 ? 340 GLN B CB  1 
ATOM   7064 C  CG  . GLN B 2 340 ? 111.444 16.895  69.714  1.00 37.35 ? 340 GLN B CG  1 
ATOM   7065 C  CD  . GLN B 2 340 ? 111.769 15.746  70.678  1.00 35.29 ? 340 GLN B CD  1 
ATOM   7066 O  OE1 . GLN B 2 340 ? 112.601 15.881  71.581  1.00 30.90 ? 340 GLN B OE1 1 
ATOM   7067 N  NE2 . GLN B 2 340 ? 111.114 14.610  70.476  1.00 35.42 ? 340 GLN B NE2 1 
ATOM   7068 N  N   . ILE B 2 341 ? 115.680 18.749  68.311  1.00 35.04 ? 341 ILE B N   1 
ATOM   7069 C  CA  . ILE B 2 341 ? 116.999 19.170  68.755  1.00 31.78 ? 341 ILE B CA  1 
ATOM   7070 C  C   . ILE B 2 341 ? 116.822 20.536  69.369  1.00 29.84 ? 341 ILE B C   1 
ATOM   7071 O  O   . ILE B 2 341 ? 116.147 21.416  68.827  1.00 26.68 ? 341 ILE B O   1 
ATOM   7072 C  CB  . ILE B 2 341 ? 118.004 19.265  67.630  1.00 33.01 ? 341 ILE B CB  1 
ATOM   7073 C  CG1 . ILE B 2 341 ? 117.640 18.272  66.520  1.00 33.80 ? 341 ILE B CG1 1 
ATOM   7074 C  CG2 . ILE B 2 341 ? 119.420 19.031  68.190  1.00 29.12 ? 341 ILE B CG2 1 
ATOM   7075 C  CD1 . ILE B 2 341 ? 118.556 18.328  65.294  1.00 35.49 ? 341 ILE B CD1 1 
ATOM   7076 N  N   . TYR B 2 342 ? 117.457 20.720  70.500  1.00 29.44 ? 342 TYR B N   1 
ATOM   7077 C  CA  . TYR B 2 342 ? 117.325 21.952  71.224  1.00 30.19 ? 342 TYR B CA  1 
ATOM   7078 C  C   . TYR B 2 342 ? 118.575 22.010  71.997  1.00 29.90 ? 342 TYR B C   1 
ATOM   7079 O  O   . TYR B 2 342 ? 119.255 21.000  72.181  1.00 28.05 ? 342 TYR B O   1 
ATOM   7080 C  CB  . TYR B 2 342 ? 116.198 21.781  72.247  1.00 32.65 ? 342 TYR B CB  1 
ATOM   7081 C  CG  . TYR B 2 342 ? 116.335 20.476  73.004  1.00 35.37 ? 342 TYR B CG  1 
ATOM   7082 C  CD1 . TYR B 2 342 ? 117.266 20.341  74.045  1.00 38.03 ? 342 TYR B CD1 1 
ATOM   7083 C  CD2 . TYR B 2 342 ? 115.618 19.345  72.614  1.00 37.52 ? 342 TYR B CD2 1 
ATOM   7084 C  CE1 . TYR B 2 342 ? 117.493 19.106  74.676  1.00 39.96 ? 342 TYR B CE1 1 
ATOM   7085 C  CE2 . TYR B 2 342 ? 115.828 18.095  73.233  1.00 39.75 ? 342 TYR B CE2 1 
ATOM   7086 C  CZ  . TYR B 2 342 ? 116.771 17.984  74.264  1.00 40.51 ? 342 TYR B CZ  1 
ATOM   7087 O  OH  . TYR B 2 342 ? 117.015 16.768  74.873  1.00 37.38 ? 342 TYR B OH  1 
ATOM   7088 N  N   . GLN B 2 343 ? 118.896 23.182  72.474  1.00 30.65 ? 343 GLN B N   1 
ATOM   7089 C  CA  . GLN B 2 343 ? 120.035 23.230  73.336  1.00 33.74 ? 343 GLN B CA  1 
ATOM   7090 C  C   . GLN B 2 343 ? 119.402 23.313  74.714  1.00 35.82 ? 343 GLN B C   1 
ATOM   7091 O  O   . GLN B 2 343 ? 119.970 22.805  75.697  1.00 33.84 ? 343 GLN B O   1 
ATOM   7092 C  CB  . GLN B 2 343 ? 120.902 24.414  73.040  1.00 34.51 ? 343 GLN B CB  1 
ATOM   7093 C  CG  . GLN B 2 343 ? 121.889 24.095  71.965  1.00 31.61 ? 343 GLN B CG  1 
ATOM   7094 C  CD  . GLN B 2 343 ? 122.561 25.331  71.505  1.00 30.38 ? 343 GLN B CD  1 
ATOM   7095 O  OE1 . GLN B 2 343 ? 123.636 25.682  71.977  1.00 27.08 ? 343 GLN B OE1 1 
ATOM   7096 N  NE2 . GLN B 2 343 ? 121.897 26.051  70.613  1.00 31.43 ? 343 GLN B NE2 1 
ATOM   7097 N  N   . GLU B 2 344 ? 118.184 23.865  74.748  1.00 39.05 ? 344 GLU B N   1 
ATOM   7098 C  CA  . GLU B 2 344 ? 117.421 24.005  75.977  1.00 43.93 ? 344 GLU B CA  1 
ATOM   7099 C  C   . GLU B 2 344 ? 116.080 23.302  75.905  1.00 46.37 ? 344 GLU B C   1 
ATOM   7100 O  O   . GLU B 2 344 ? 115.427 23.335  74.873  1.00 46.57 ? 344 GLU B O   1 
ATOM   7101 C  CB  . GLU B 2 344 ? 117.291 25.464  76.373  1.00 44.86 ? 344 GLU B CB  1 
ATOM   7102 C  CG  . GLU B 2 344 ? 118.625 26.075  76.727  1.00 49.64 ? 344 GLU B CG  1 
ATOM   7103 C  CD  . GLU B 2 344 ? 119.534 25.093  77.475  1.00 52.81 ? 344 GLU B CD  1 
ATOM   7104 O  OE1 . GLU B 2 344 ? 119.039 24.397  78.402  1.00 52.78 ? 344 GLU B OE1 1 
ATOM   7105 O  OE2 . GLU B 2 344 ? 120.737 24.993  77.105  1.00 52.98 ? 344 GLU B OE2 1 
ATOM   7106 N  N   . PRO B 2 345 ? 115.657 22.652  77.003  1.00 48.55 ? 345 PRO B N   1 
ATOM   7107 C  CA  . PRO B 2 345 ? 114.400 21.904  77.206  1.00 49.99 ? 345 PRO B CA  1 
ATOM   7108 C  C   . PRO B 2 345 ? 113.208 22.170  76.286  1.00 50.20 ? 345 PRO B C   1 
ATOM   7109 O  O   . PRO B 2 345 ? 112.648 21.254  75.678  1.00 50.74 ? 345 PRO B O   1 
ATOM   7110 C  CB  . PRO B 2 345 ? 114.039 22.213  78.647  1.00 49.42 ? 345 PRO B CB  1 
ATOM   7111 C  CG  . PRO B 2 345 ? 115.382 22.112  79.295  1.00 50.19 ? 345 PRO B CG  1 
ATOM   7112 C  CD  . PRO B 2 345 ? 116.351 22.816  78.312  1.00 48.49 ? 345 PRO B CD  1 
ATOM   7113 N  N   . PHE B 2 346 ? 112.776 23.422  76.226  1.00 50.66 ? 346 PHE B N   1 
ATOM   7114 C  CA  . PHE B 2 346 ? 111.642 23.701  75.368  1.00 52.59 ? 346 PHE B CA  1 
ATOM   7115 C  C   . PHE B 2 346 ? 112.024 24.750  74.354  1.00 52.73 ? 346 PHE B C   1 
ATOM   7116 O  O   . PHE B 2 346 ? 111.220 25.261  73.576  1.00 51.74 ? 346 PHE B O   1 
ATOM   7117 C  CB  . PHE B 2 346 ? 110.389 24.010  76.203  1.00 53.04 ? 346 PHE B CB  1 
ATOM   7118 C  CG  . PHE B 2 346 ? 110.066 22.912  77.194  1.00 52.60 ? 346 PHE B CG  1 
ATOM   7119 C  CD1 . PHE B 2 346 ? 109.348 21.776  76.798  1.00 51.06 ? 346 PHE B CD1 1 
ATOM   7120 C  CD2 . PHE B 2 346 ? 110.636 22.932  78.473  1.00 52.26 ? 346 PHE B CD2 1 
ATOM   7121 C  CE1 . PHE B 2 346 ? 109.225 20.675  77.653  1.00 50.04 ? 346 PHE B CE1 1 
ATOM   7122 C  CE2 . PHE B 2 346 ? 110.520 21.837  79.334  1.00 51.07 ? 346 PHE B CE2 1 
ATOM   7123 C  CZ  . PHE B 2 346 ? 109.822 20.705  78.920  1.00 51.22 ? 346 PHE B CZ  1 
ATOM   7124 N  N   . LYS B 2 347 ? 113.333 24.917  74.300  1.00 53.53 ? 347 LYS B N   1 
ATOM   7125 C  CA  . LYS B 2 347 ? 114.007 25.833  73.412  1.00 55.90 ? 347 LYS B CA  1 
ATOM   7126 C  C   . LYS B 2 347 ? 114.598 24.932  72.338  1.00 56.13 ? 347 LYS B C   1 
ATOM   7127 O  O   . LYS B 2 347 ? 115.829 24.799  72.166  1.00 55.49 ? 347 LYS B O   1 
ATOM   7128 C  CB  . LYS B 2 347 ? 115.087 26.550  74.204  1.00 57.16 ? 347 LYS B CB  1 
ATOM   7129 C  CG  . LYS B 2 347 ? 114.502 27.240  75.425  1.00 59.53 ? 347 LYS B CG  1 
ATOM   7130 C  CD  . LYS B 2 347 ? 113.642 28.439  75.016  1.00 60.06 ? 347 LYS B CD  1 
ATOM   7131 C  CE  . LYS B 2 347 ? 112.515 28.700  76.011  1.00 60.15 ? 347 LYS B CE  1 
ATOM   7132 N  NZ  . LYS B 2 347 ? 111.344 27.803  75.780  1.00 59.39 ? 347 LYS B NZ  1 
ATOM   7133 N  N   . ASN B 2 348 ? 113.682 24.261  71.660  1.00 57.54 ? 348 ASN B N   1 
ATOM   7134 C  CA  . ASN B 2 348 ? 114.020 23.326  70.611  1.00 58.96 ? 348 ASN B CA  1 
ATOM   7135 C  C   . ASN B 2 348 ? 113.959 23.965  69.257  1.00 59.40 ? 348 ASN B C   1 
ATOM   7136 O  O   . ASN B 2 348 ? 112.888 24.146  68.666  1.00 58.44 ? 348 ASN B O   1 
ATOM   7137 C  CB  . ASN B 2 348 ? 113.133 22.086  70.680  1.00 59.22 ? 348 ASN B CB  1 
ATOM   7138 C  CG  . ASN B 2 348 ? 111.695 22.429  70.933  1.00 60.16 ? 348 ASN B CG  1 
ATOM   7139 O  OD1 . ASN B 2 348 ? 111.379 23.219  71.826  1.00 59.06 ? 348 ASN B OD1 1 
ATOM   7140 N  ND2 . ASN B 2 348 ? 110.805 21.840  70.154  1.00 60.88 ? 348 ASN B ND2 1 
ATOM   7141 N  N   . LEU B 2 349 ? 115.162 24.270  68.786  1.00 60.04 ? 349 LEU B N   1 
ATOM   7142 C  CA  . LEU B 2 349 ? 115.431 24.896  67.503  1.00 60.65 ? 349 LEU B CA  1 
ATOM   7143 C  C   . LEU B 2 349 ? 114.617 24.247  66.371  1.00 61.15 ? 349 LEU B C   1 
ATOM   7144 O  O   . LEU B 2 349 ? 114.063 24.951  65.523  1.00 61.20 ? 349 LEU B O   1 
ATOM   7145 C  CB  . LEU B 2 349 ? 116.936 24.812  67.237  1.00 60.93 ? 349 LEU B CB  1 
ATOM   7146 C  CG  . LEU B 2 349 ? 117.746 25.103  68.514  1.00 61.20 ? 349 LEU B CG  1 
ATOM   7147 C  CD1 . LEU B 2 349 ? 119.180 24.612  68.401  1.00 61.01 ? 349 LEU B CD1 1 
ATOM   7148 C  CD2 . LEU B 2 349 ? 117.693 26.579  68.849  1.00 60.20 ? 349 LEU B CD2 1 
ATOM   7149 N  N   . LYS B 2 350 ? 114.547 22.916  66.353  1.00 62.61 ? 350 LYS B N   1 
ATOM   7150 C  CA  . LYS B 2 350 ? 113.757 22.199  65.343  1.00 63.61 ? 350 LYS B CA  1 
ATOM   7151 C  C   . LYS B 2 350 ? 113.417 20.757  65.737  1.00 63.79 ? 350 LYS B C   1 
ATOM   7152 O  O   . LYS B 2 350 ? 114.219 20.049  66.365  1.00 63.39 ? 350 LYS B O   1 
ATOM   7153 C  CB  . LYS B 2 350 ? 114.436 22.193  63.956  1.00 64.04 ? 350 LYS B CB  1 
ATOM   7154 C  CG  . LYS B 2 350 ? 113.493 21.728  62.816  1.00 64.57 ? 350 LYS B CG  1 
ATOM   7155 C  CD  . LYS B 2 350 ? 114.103 20.649  61.905  1.00 66.04 ? 350 LYS B CD  1 
ATOM   7156 C  CE  . LYS B 2 350 ? 113.100 20.174  60.824  1.00 66.18 ? 350 LYS B CE  1 
ATOM   7157 N  NZ  . LYS B 2 350 ? 113.612 19.083  59.921  1.00 64.43 ? 350 LYS B NZ  1 
ATOM   7158 N  N   . THR B 2 351 ? 112.239 20.322  65.300  1.00 62.91 ? 351 THR B N   1 
ATOM   7159 C  CA  . THR B 2 351 ? 111.740 18.984  65.559  1.00 62.11 ? 351 THR B CA  1 
ATOM   7160 C  C   . THR B 2 351 ? 111.258 18.472  64.207  1.00 61.82 ? 351 THR B C   1 
ATOM   7161 O  O   . THR B 2 351 ? 110.999 19.268  63.306  1.00 60.28 ? 351 THR B O   1 
ATOM   7162 C  CB  . THR B 2 351 ? 110.526 19.023  66.536  1.00 62.75 ? 351 THR B CB  1 
ATOM   7163 O  OG1 . THR B 2 351 ? 109.367 19.536  65.864  1.00 61.72 ? 351 THR B OG1 1 
ATOM   7164 C  CG2 . THR B 2 351 ? 110.812 19.929  67.712  1.00 61.49 ? 351 THR B CG2 1 
ATOM   7165 N  N   . GLY B 2 352 ? 111.119 17.159  64.070  1.00 63.22 ? 352 GLY B N   1 
ATOM   7166 C  CA  . GLY B 2 352 ? 110.638 16.595  62.818  1.00 64.25 ? 352 GLY B CA  1 
ATOM   7167 C  C   . GLY B 2 352 ? 110.314 15.120  62.949  1.00 65.27 ? 352 GLY B C   1 
ATOM   7168 O  O   . GLY B 2 352 ? 110.688 14.480  63.935  1.00 63.59 ? 352 GLY B O   1 
ATOM   7169 N  N   . LYS B 2 353 ? 109.670 14.560  61.933  1.00 67.29 ? 353 LYS B N   1 
ATOM   7170 C  CA  . LYS B 2 353 ? 109.296 13.154  61.971  1.00 70.56 ? 353 LYS B CA  1 
ATOM   7171 C  C   . LYS B 2 353 ? 109.916 12.301  60.862  1.00 72.43 ? 353 LYS B C   1 
ATOM   7172 O  O   . LYS B 2 353 ? 110.092 12.767  59.739  1.00 73.76 ? 353 LYS B O   1 
ATOM   7173 C  CB  . LYS B 2 353 ? 107.765 13.025  61.939  1.00 70.66 ? 353 LYS B CB  1 
ATOM   7174 C  CG  . LYS B 2 353 ? 107.267 11.602  61.703  1.00 72.25 ? 353 LYS B CG  1 
ATOM   7175 C  CD  . LYS B 2 353 ? 105.770 11.458  61.908  1.00 73.49 ? 353 LYS B CD  1 
ATOM   7176 C  CE  . LYS B 2 353 ? 105.450 10.860  63.279  1.00 74.21 ? 353 LYS B CE  1 
ATOM   7177 N  NZ  . LYS B 2 353 ? 103.980 10.635  63.488  1.00 74.79 ? 353 LYS B NZ  1 
ATOM   7178 N  N   . TYR B 2 354 ? 110.269 11.062  61.198  1.00 74.33 ? 354 TYR B N   1 
ATOM   7179 C  CA  . TYR B 2 354 ? 110.830 10.117  60.237  1.00 76.00 ? 354 TYR B CA  1 
ATOM   7180 C  C   . TYR B 2 354 ? 109.768 9.062   59.980  1.00 76.50 ? 354 TYR B C   1 
ATOM   7181 O  O   . TYR B 2 354 ? 109.218 8.484   60.918  1.00 75.91 ? 354 TYR B O   1 
ATOM   7182 C  CB  . TYR B 2 354 ? 112.080 9.436   60.803  1.00 78.18 ? 354 TYR B CB  1 
ATOM   7183 C  CG  . TYR B 2 354 ? 112.739 8.399   59.887  1.00 81.29 ? 354 TYR B CG  1 
ATOM   7184 C  CD1 . TYR B 2 354 ? 112.550 8.421   58.501  1.00 82.01 ? 354 TYR B CD1 1 
ATOM   7185 C  CD2 . TYR B 2 354 ? 113.601 7.428   60.410  1.00 82.60 ? 354 TYR B CD2 1 
ATOM   7186 C  CE1 . TYR B 2 354 ? 113.207 7.510   57.668  1.00 82.41 ? 354 TYR B CE1 1 
ATOM   7187 C  CE2 . TYR B 2 354 ? 114.264 6.516   59.584  1.00 82.50 ? 354 TYR B CE2 1 
ATOM   7188 C  CZ  . TYR B 2 354 ? 114.063 6.565   58.219  1.00 82.80 ? 354 TYR B CZ  1 
ATOM   7189 O  OH  . TYR B 2 354 ? 114.731 5.683   57.402  1.00 84.22 ? 354 TYR B OH  1 
ATOM   7190 N  N   . ALA B 2 355 ? 109.511 8.794   58.709  1.00 77.49 ? 355 ALA B N   1 
ATOM   7191 C  CA  . ALA B 2 355 ? 108.520 7.808   58.316  1.00 79.49 ? 355 ALA B CA  1 
ATOM   7192 C  C   . ALA B 2 355 ? 109.120 6.821   57.316  1.00 80.87 ? 355 ALA B C   1 
ATOM   7193 O  O   . ALA B 2 355 ? 109.782 7.221   56.359  1.00 80.86 ? 355 ALA B O   1 
ATOM   7194 C  CB  . ALA B 2 355 ? 107.300 8.504   57.705  1.00 79.09 ? 355 ALA B CB  1 
ATOM   7195 N  N   . ARG B 2 356 ? 108.913 5.533   57.570  1.00 82.84 ? 356 ARG B N   1 
ATOM   7196 C  CA  . ARG B 2 356 ? 109.387 4.448   56.706  1.00 84.43 ? 356 ARG B CA  1 
ATOM   7197 C  C   . ARG B 2 356 ? 108.769 3.149   57.274  1.00 84.30 ? 356 ARG B C   1 
ATOM   7198 O  O   . ARG B 2 356 ? 109.428 2.379   57.983  1.00 84.19 ? 356 ARG B O   1 
ATOM   7199 C  CB  . ARG B 2 356 ? 110.931 4.396   56.682  1.00 85.84 ? 356 ARG B CB  1 
ATOM   7200 C  CG  . ARG B 2 356 ? 111.583 4.430   55.264  1.00 88.33 ? 356 ARG B CG  1 
ATOM   7201 C  CD  . ARG B 2 356 ? 112.128 5.830   54.834  1.00 90.31 ? 356 ARG B CD  1 
ATOM   7202 N  NE  . ARG B 2 356 ? 113.423 5.748   54.129  1.00 91.97 ? 356 ARG B NE  1 
ATOM   7203 C  CZ  . ARG B 2 356 ? 114.080 6.773   53.576  1.00 91.40 ? 356 ARG B CZ  1 
ATOM   7204 N  NH1 . ARG B 2 356 ? 113.579 8.003   53.616  1.00 90.52 ? 356 ARG B NH1 1 
ATOM   7205 N  NH2 . ARG B 2 356 ? 115.273 6.572   53.017  1.00 90.67 ? 356 ARG B NH2 1 
ATOM   7206 N  N   . MET B 2 357 ? 107.474 2.970   56.984  1.00 84.67 ? 357 MET B N   1 
ATOM   7207 C  CA  . MET B 2 357 ? 106.635 1.838   57.422  1.00 84.65 ? 357 MET B CA  1 
ATOM   7208 C  C   . MET B 2 357 ? 107.297 0.483   57.636  1.00 85.26 ? 357 MET B C   1 
ATOM   7209 O  O   . MET B 2 357 ? 107.640 -0.210  56.674  1.00 85.80 ? 357 MET B O   1 
ATOM   7210 C  CB  . MET B 2 357 ? 105.447 1.678   56.476  1.00 83.56 ? 357 MET B CB  1 
ATOM   7211 N  N   . ARG B 2 358 ? 107.412 0.092   58.903  1.00 85.41 ? 358 ARG B N   1 
ATOM   7212 C  CA  . ARG B 2 358 ? 108.008 -1.182  59.291  1.00 86.11 ? 358 ARG B CA  1 
ATOM   7213 C  C   . ARG B 2 358 ? 107.337 -2.343  58.541  1.00 86.90 ? 358 ARG B C   1 
ATOM   7214 O  O   . ARG B 2 358 ? 106.212 -2.735  58.865  1.00 87.42 ? 358 ARG B O   1 
ATOM   7215 C  CB  . ARG B 2 358 ? 107.876 -1.368  60.803  1.00 85.16 ? 358 ARG B CB  1 
ATOM   7216 N  N   . GLY B 2 359 ? 108.015 -2.844  57.507  1.00 87.51 ? 359 GLY B N   1 
ATOM   7217 C  CA  . GLY B 2 359 ? 107.493 -3.948  56.708  1.00 87.00 ? 359 GLY B CA  1 
ATOM   7218 C  C   . GLY B 2 359 ? 108.579 -4.683  55.928  1.00 87.01 ? 359 GLY B C   1 
ATOM   7219 O  O   . GLY B 2 359 ? 108.948 -5.805  56.293  1.00 87.34 ? 359 GLY B O   1 
ATOM   7220 N  N   . ALA B 2 360 ? 109.087 -4.047  54.863  1.00 86.78 ? 360 ALA B N   1 
ATOM   7221 C  CA  . ALA B 2 360 ? 110.156 -4.596  54.003  1.00 85.11 ? 360 ALA B CA  1 
ATOM   7222 C  C   . ALA B 2 360 ? 111.425 -4.772  54.832  1.00 83.47 ? 360 ALA B C   1 
ATOM   7223 O  O   . ALA B 2 360 ? 112.328 -5.537  54.487  1.00 81.74 ? 360 ALA B O   1 
ATOM   7224 C  CB  . ALA B 2 360 ? 110.429 -3.641  52.833  1.00 85.25 ? 360 ALA B CB  1 
ATOM   7225 N  N   . HIS B 2 361 ? 111.480 -3.976  55.894  1.00 83.18 ? 361 HIS B N   1 
ATOM   7226 C  CA  . HIS B 2 361 ? 112.551 -3.953  56.873  1.00 82.83 ? 361 HIS B CA  1 
ATOM   7227 C  C   . HIS B 2 361 ? 111.901 -3.240  58.061  1.00 81.69 ? 361 HIS B C   1 
ATOM   7228 O  O   . HIS B 2 361 ? 111.545 -2.067  57.980  1.00 81.51 ? 361 HIS B O   1 
ATOM   7229 C  CB  . HIS B 2 361 ? 113.741 -3.162  56.346  1.00 83.03 ? 361 HIS B CB  1 
ATOM   7230 N  N   . THR B 2 362 ? 111.627 -3.985  59.119  1.00 80.92 ? 362 THR B N   1 
ATOM   7231 C  CA  . THR B 2 362 ? 110.988 -3.393  60.279  1.00 79.91 ? 362 THR B CA  1 
ATOM   7232 C  C   . THR B 2 362 ? 111.930 -3.366  61.473  1.00 78.62 ? 362 THR B C   1 
ATOM   7233 O  O   . THR B 2 362 ? 111.511 -3.029  62.587  1.00 79.38 ? 362 THR B O   1 
ATOM   7234 C  CB  . THR B 2 362 ? 109.703 -4.152  60.619  1.00 79.34 ? 362 THR B CB  1 
ATOM   7235 N  N   . ASN B 2 363 ? 113.201 -3.700  61.244  1.00 76.77 ? 363 ASN B N   1 
ATOM   7236 C  CA  . ASN B 2 363 ? 114.184 -3.707  62.325  1.00 73.98 ? 363 ASN B CA  1 
ATOM   7237 C  C   . ASN B 2 363 ? 114.232 -2.313  62.925  1.00 71.67 ? 363 ASN B C   1 
ATOM   7238 O  O   . ASN B 2 363 ? 114.795 -1.402  62.318  1.00 70.82 ? 363 ASN B O   1 
ATOM   7239 C  CB  . ASN B 2 363 ? 115.555 -4.111  61.805  1.00 73.41 ? 363 ASN B CB  1 
ATOM   7240 N  N   . ASP B 2 364 ? 113.543 -2.138  64.056  1.00 69.79 ? 364 ASP B N   1 
ATOM   7241 C  CA  . ASP B 2 364 ? 113.484 -0.860  64.762  1.00 68.34 ? 364 ASP B CA  1 
ATOM   7242 C  C   . ASP B 2 364 ? 114.849 -0.264  64.612  1.00 67.45 ? 364 ASP B C   1 
ATOM   7243 O  O   . ASP B 2 364 ? 115.046 0.714   63.890  1.00 66.70 ? 364 ASP B O   1 
ATOM   7244 C  CB  . ASP B 2 364 ? 113.266 -1.059  66.267  1.00 67.93 ? 364 ASP B CB  1 
ATOM   7245 C  CG  . ASP B 2 364 ? 111.917 -1.611  66.605  1.00 66.35 ? 364 ASP B CG  1 
ATOM   7246 O  OD1 . ASP B 2 364 ? 110.914 -1.052  66.107  1.00 65.77 ? 364 ASP B OD1 1 
ATOM   7247 O  OD2 . ASP B 2 364 ? 111.876 -2.582  67.397  1.00 65.38 ? 364 ASP B OD2 1 
ATOM   7248 N  N   . VAL B 2 365 ? 115.795 -0.968  65.223  1.00 66.00 ? 365 VAL B N   1 
ATOM   7249 C  CA  . VAL B 2 365 ? 117.188 -0.602  65.228  1.00 64.43 ? 365 VAL B CA  1 
ATOM   7250 C  C   . VAL B 2 365 ? 117.587 0.040   63.919  1.00 62.53 ? 365 VAL B C   1 
ATOM   7251 O  O   . VAL B 2 365 ? 118.040 1.182   63.908  1.00 62.30 ? 365 VAL B O   1 
ATOM   7252 C  CB  . VAL B 2 365 ? 118.051 -1.838  65.499  1.00 65.14 ? 365 VAL B CB  1 
ATOM   7253 C  CG1 . VAL B 2 365 ? 119.515 -1.545  65.215  1.00 65.13 ? 365 VAL B CG1 1 
ATOM   7254 C  CG2 . VAL B 2 365 ? 117.873 -2.272  66.943  1.00 66.61 ? 365 VAL B CG2 1 
ATOM   7255 N  N   . LYS B 2 366 ? 117.329 -0.655  62.816  1.00 60.77 ? 366 LYS B N   1 
ATOM   7256 C  CA  . LYS B 2 366 ? 117.689 -0.120  61.515  1.00 59.90 ? 366 LYS B CA  1 
ATOM   7257 C  C   . LYS B 2 366 ? 117.076 1.255   61.330  1.00 57.82 ? 366 LYS B C   1 
ATOM   7258 O  O   . LYS B 2 366 ? 117.794 2.233   61.158  1.00 57.65 ? 366 LYS B O   1 
ATOM   7259 C  CB  . LYS B 2 366 ? 117.249 -1.050  60.378  1.00 62.24 ? 366 LYS B CB  1 
ATOM   7260 C  CG  . LYS B 2 366 ? 117.735 -0.605  58.995  1.00 63.24 ? 366 LYS B CG  1 
ATOM   7261 C  CD  . LYS B 2 366 ? 117.469 -1.657  57.929  1.00 62.95 ? 366 LYS B CD  1 
ATOM   7262 C  CE  . LYS B 2 366 ? 117.927 -1.174  56.555  1.00 64.47 ? 366 LYS B CE  1 
ATOM   7263 N  NZ  . LYS B 2 366 ? 117.467 -2.085  55.464  1.00 62.64 ? 366 LYS B NZ  1 
ATOM   7264 N  N   . GLN B 2 367 ? 115.753 1.331   61.417  1.00 55.19 ? 367 GLN B N   1 
ATOM   7265 C  CA  . GLN B 2 367 ? 115.055 2.598   61.249  1.00 52.21 ? 367 GLN B CA  1 
ATOM   7266 C  C   . GLN B 2 367 ? 115.620 3.653   62.189  1.00 50.53 ? 367 GLN B C   1 
ATOM   7267 O  O   . GLN B 2 367 ? 115.789 4.819   61.808  1.00 49.32 ? 367 GLN B O   1 
ATOM   7268 C  CB  . GLN B 2 367 ? 113.570 2.423   61.520  1.00 51.64 ? 367 GLN B CB  1 
ATOM   7269 C  CG  . GLN B 2 367 ? 112.873 1.536   60.538  1.00 48.02 ? 367 GLN B CG  1 
ATOM   7270 C  CD  . GLN B 2 367 ? 111.812 0.716   61.208  1.00 46.48 ? 367 GLN B CD  1 
ATOM   7271 O  OE1 . GLN B 2 367 ? 110.674 1.158   61.394  1.00 43.60 ? 367 GLN B OE1 1 
ATOM   7272 N  NE2 . GLN B 2 367 ? 112.188 -0.480  61.615  1.00 45.11 ? 367 GLN B NE2 1 
ATOM   7273 N  N   . LEU B 2 368 ? 115.933 3.229   63.407  1.00 47.43 ? 368 LEU B N   1 
ATOM   7274 C  CA  . LEU B 2 368 ? 116.488 4.130   64.399  1.00 45.16 ? 368 LEU B CA  1 
ATOM   7275 C  C   . LEU B 2 368 ? 117.804 4.646   63.834  1.00 42.80 ? 368 LEU B C   1 
ATOM   7276 O  O   . LEU B 2 368 ? 117.953 5.832   63.542  1.00 41.88 ? 368 LEU B O   1 
ATOM   7277 C  CB  . LEU B 2 368 ? 116.726 3.393   65.715  1.00 45.07 ? 368 LEU B CB  1 
ATOM   7278 C  CG  . LEU B 2 368 ? 117.129 4.347   66.833  1.00 46.55 ? 368 LEU B CG  1 
ATOM   7279 C  CD1 . LEU B 2 368 ? 116.093 5.451   66.969  1.00 45.21 ? 368 LEU B CD1 1 
ATOM   7280 C  CD2 . LEU B 2 368 ? 117.300 3.594   68.128  1.00 47.41 ? 368 LEU B CD2 1 
ATOM   7281 N  N   . THR B 2 369 ? 118.735 3.721   63.663  1.00 40.30 ? 369 THR B N   1 
ATOM   7282 C  CA  . THR B 2 369 ? 120.042 3.988   63.110  1.00 37.22 ? 369 THR B CA  1 
ATOM   7283 C  C   . THR B 2 369 ? 119.923 4.918   61.896  1.00 34.25 ? 369 THR B C   1 
ATOM   7284 O  O   . THR B 2 369 ? 120.602 5.942   61.817  1.00 31.30 ? 369 THR B O   1 
ATOM   7285 C  CB  . THR B 2 369 ? 120.702 2.625   62.754  1.00 38.44 ? 369 THR B CB  1 
ATOM   7286 O  OG1 . THR B 2 369 ? 122.062 2.629   63.179  1.00 41.55 ? 369 THR B OG1 1 
ATOM   7287 C  CG2 . THR B 2 369 ? 120.624 2.299   61.258  1.00 39.96 ? 369 THR B CG2 1 
ATOM   7288 N  N   . GLU B 2 370 ? 118.983 4.593   61.012  1.00 33.32 ? 370 GLU B N   1 
ATOM   7289 C  CA  . GLU B 2 370 ? 118.726 5.366   59.811  1.00 33.15 ? 370 GLU B CA  1 
ATOM   7290 C  C   . GLU B 2 370 ? 118.467 6.766   60.300  1.00 32.44 ? 370 GLU B C   1 
ATOM   7291 O  O   . GLU B 2 370 ? 119.320 7.661   60.176  1.00 31.83 ? 370 GLU B O   1 
ATOM   7292 C  CB  . GLU B 2 370 ? 117.481 4.849   59.103  1.00 34.84 ? 370 GLU B CB  1 
ATOM   7293 C  CG  . GLU B 2 370 ? 117.589 3.406   58.656  1.00 41.62 ? 370 GLU B CG  1 
ATOM   7294 C  CD  . GLU B 2 370 ? 117.480 3.221   57.144  1.00 46.43 ? 370 GLU B CD  1 
ATOM   7295 O  OE1 . GLU B 2 370 ? 117.145 4.202   56.427  1.00 49.16 ? 370 GLU B OE1 1 
ATOM   7296 O  OE2 . GLU B 2 370 ? 117.736 2.089   56.668  1.00 48.18 ? 370 GLU B OE2 1 
ATOM   7297 N  N   . ALA B 2 371 ? 117.307 6.912   60.937  1.00 31.41 ? 371 ALA B N   1 
ATOM   7298 C  CA  . ALA B 2 371 ? 116.861 8.173   61.514  1.00 29.41 ? 371 ALA B CA  1 
ATOM   7299 C  C   . ALA B 2 371 ? 118.039 9.008   62.034  1.00 28.22 ? 371 ALA B C   1 
ATOM   7300 O  O   . ALA B 2 371 ? 118.361 10.050  61.467  1.00 29.33 ? 371 ALA B O   1 
ATOM   7301 C  CB  . ALA B 2 371 ? 115.883 7.889   62.626  1.00 29.13 ? 371 ALA B CB  1 
ATOM   7302 N  N   . VAL B 2 372 ? 118.702 8.503   63.071  1.00 26.37 ? 372 VAL B N   1 
ATOM   7303 C  CA  . VAL B 2 372 ? 119.861 9.145   63.686  1.00 23.99 ? 372 VAL B CA  1 
ATOM   7304 C  C   . VAL B 2 372 ? 120.639 9.916   62.644  1.00 24.59 ? 372 VAL B C   1 
ATOM   7305 O  O   . VAL B 2 372 ? 120.637 11.154  62.609  1.00 22.25 ? 372 VAL B O   1 
ATOM   7306 C  CB  . VAL B 2 372 ? 120.845 8.082   64.216  1.00 22.12 ? 372 VAL B CB  1 
ATOM   7307 C  CG1 . VAL B 2 372 ? 122.085 8.742   64.809  1.00 17.84 ? 372 VAL B CG1 1 
ATOM   7308 C  CG2 . VAL B 2 372 ? 120.154 7.157   65.194  1.00 22.21 ? 372 VAL B CG2 1 
ATOM   7309 N  N   . GLN B 2 373 ? 121.224 9.141   61.740  1.00 24.99 ? 373 GLN B N   1 
ATOM   7310 C  CA  . GLN B 2 373 ? 122.038 9.676   60.685  1.00 25.95 ? 373 GLN B CA  1 
ATOM   7311 C  C   . GLN B 2 373 ? 121.269 10.725  59.915  1.00 24.25 ? 373 GLN B C   1 
ATOM   7312 O  O   . GLN B 2 373 ? 121.776 11.826  59.681  1.00 23.31 ? 373 GLN B O   1 
ATOM   7313 C  CB  . GLN B 2 373 ? 122.499 8.553   59.771  1.00 29.11 ? 373 GLN B CB  1 
ATOM   7314 C  CG  . GLN B 2 373 ? 123.429 7.535   60.431  1.00 33.37 ? 373 GLN B CG  1 
ATOM   7315 C  CD  . GLN B 2 373 ? 123.794 6.384   59.477  1.00 37.94 ? 373 GLN B CD  1 
ATOM   7316 O  OE1 . GLN B 2 373 ? 123.533 6.447   58.265  1.00 42.05 ? 373 GLN B OE1 1 
ATOM   7317 N  NE2 . GLN B 2 373 ? 124.387 5.328   60.021  1.00 38.58 ? 373 GLN B NE2 1 
ATOM   7318 N  N   . LYS B 2 374 ? 120.030 10.416  59.571  1.00 21.61 ? 374 LYS B N   1 
ATOM   7319 C  CA  . LYS B 2 374 ? 119.239 11.370  58.832  1.00 22.32 ? 374 LYS B CA  1 
ATOM   7320 C  C   . LYS B 2 374 ? 119.069 12.671  59.604  1.00 20.84 ? 374 LYS B C   1 
ATOM   7321 O  O   . LYS B 2 374 ? 118.897 13.743  59.022  1.00 16.93 ? 374 LYS B O   1 
ATOM   7322 C  CB  . LYS B 2 374 ? 117.891 10.788  58.490  1.00 23.84 ? 374 LYS B CB  1 
ATOM   7323 C  CG  . LYS B 2 374 ? 117.004 11.808  57.824  1.00 29.43 ? 374 LYS B CG  1 
ATOM   7324 C  CD  . LYS B 2 374 ? 115.722 11.203  57.276  1.00 34.14 ? 374 LYS B CD  1 
ATOM   7325 C  CE  . LYS B 2 374 ? 115.950 10.180  56.148  1.00 35.82 ? 374 LYS B CE  1 
ATOM   7326 N  NZ  . LYS B 2 374 ? 114.639 9.731   55.561  1.00 37.15 ? 374 LYS B NZ  1 
ATOM   7327 N  N   . ILE B 2 375 ? 119.145 12.575  60.922  1.00 23.76 ? 375 ILE B N   1 
ATOM   7328 C  CA  . ILE B 2 375 ? 119.016 13.746  61.772  1.00 26.40 ? 375 ILE B CA  1 
ATOM   7329 C  C   . ILE B 2 375 ? 120.348 14.423  61.735  1.00 25.12 ? 375 ILE B C   1 
ATOM   7330 O  O   . ILE B 2 375 ? 120.459 15.616  61.428  1.00 26.19 ? 375 ILE B O   1 
ATOM   7331 C  CB  . ILE B 2 375 ? 118.761 13.369  63.208  1.00 26.79 ? 375 ILE B CB  1 
ATOM   7332 C  CG1 . ILE B 2 375 ? 117.441 12.607  63.301  1.00 27.34 ? 375 ILE B CG1 1 
ATOM   7333 C  CG2 . ILE B 2 375 ? 118.754 14.625  64.068  1.00 28.22 ? 375 ILE B CG2 1 
ATOM   7334 C  CD1 . ILE B 2 375 ? 117.167 11.997  64.641  1.00 25.47 ? 375 ILE B CD1 1 
ATOM   7335 N  N   . THR B 2 376 ? 121.358 13.636  62.064  1.00 24.31 ? 376 THR B N   1 
ATOM   7336 C  CA  . THR B 2 376 ? 122.738 14.078  62.055  1.00 27.41 ? 376 THR B CA  1 
ATOM   7337 C  C   . THR B 2 376 ? 122.951 15.154  60.956  1.00 24.80 ? 376 THR B C   1 
ATOM   7338 O  O   . THR B 2 376 ? 123.356 16.298  61.213  1.00 24.07 ? 376 THR B O   1 
ATOM   7339 C  CB  . THR B 2 376 ? 123.622 12.850  61.773  1.00 27.67 ? 376 THR B CB  1 
ATOM   7340 O  OG1 . THR B 2 376 ? 123.108 11.729  62.508  1.00 26.65 ? 376 THR B OG1 1 
ATOM   7341 C  CG2 . THR B 2 376 ? 125.065 13.106  62.193  1.00 30.60 ? 376 THR B CG2 1 
ATOM   7342 N  N   . THR B 2 377 ? 122.575 14.794  59.745  1.00 23.42 ? 377 THR B N   1 
ATOM   7343 C  CA  . THR B 2 377 ? 122.693 15.683  58.615  1.00 23.53 ? 377 THR B CA  1 
ATOM   7344 C  C   . THR B 2 377 ? 122.184 17.076  58.940  1.00 21.24 ? 377 THR B C   1 
ATOM   7345 O  O   . THR B 2 377 ? 122.964 18.004  59.071  1.00 20.84 ? 377 THR B O   1 
ATOM   7346 C  CB  . THR B 2 377 ? 121.885 15.131  57.453  1.00 25.21 ? 377 THR B CB  1 
ATOM   7347 O  OG1 . THR B 2 377 ? 122.306 13.790  57.179  1.00 26.98 ? 377 THR B OG1 1 
ATOM   7348 C  CG2 . THR B 2 377 ? 122.094 15.972  56.227  1.00 25.24 ? 377 THR B CG2 1 
ATOM   7349 N  N   . GLU B 2 378 ? 120.872 17.184  59.089  1.00 19.39 ? 378 GLU B N   1 
ATOM   7350 C  CA  . GLU B 2 378 ? 120.173 18.429  59.384  1.00 18.51 ? 378 GLU B CA  1 
ATOM   7351 C  C   . GLU B 2 378 ? 121.045 19.325  60.168  1.00 14.96 ? 378 GLU B C   1 
ATOM   7352 O  O   . GLU B 2 378 ? 121.355 20.431  59.790  1.00 10.43 ? 378 GLU B O   1 
ATOM   7353 C  CB  . GLU B 2 378 ? 118.974 18.131  60.272  1.00 23.51 ? 378 GLU B CB  1 
ATOM   7354 C  CG  . GLU B 2 378 ? 118.331 16.804  59.990  1.00 31.93 ? 378 GLU B CG  1 
ATOM   7355 C  CD  . GLU B 2 378 ? 117.799 16.709  58.573  1.00 37.57 ? 378 GLU B CD  1 
ATOM   7356 O  OE1 . GLU B 2 378 ? 118.618 16.568  57.620  1.00 37.90 ? 378 GLU B OE1 1 
ATOM   7357 O  OE2 . GLU B 2 378 ? 116.550 16.774  58.427  1.00 39.40 ? 378 GLU B OE2 1 
ATOM   7358 N  N   . SER B 2 379 ? 121.404 18.785  61.307  1.00 16.18 ? 379 SER B N   1 
ATOM   7359 C  CA  . SER B 2 379 ? 122.238 19.410  62.289  1.00 18.60 ? 379 SER B CA  1 
ATOM   7360 C  C   . SER B 2 379 ? 123.469 19.984  61.637  1.00 21.27 ? 379 SER B C   1 
ATOM   7361 O  O   . SER B 2 379 ? 123.737 21.186  61.695  1.00 19.85 ? 379 SER B O   1 
ATOM   7362 C  CB  . SER B 2 379 ? 122.592 18.328  63.282  1.00 18.96 ? 379 SER B CB  1 
ATOM   7363 O  OG  . SER B 2 379 ? 121.457 17.478  63.455  1.00 14.62 ? 379 SER B OG  1 
ATOM   7364 N  N   . ILE B 2 380 ? 124.226 19.106  61.011  1.00 24.68 ? 380 ILE B N   1 
ATOM   7365 C  CA  . ILE B 2 380 ? 125.413 19.509  60.289  1.00 28.67 ? 380 ILE B CA  1 
ATOM   7366 C  C   . ILE B 2 380 ? 124.938 20.599  59.333  1.00 29.81 ? 380 ILE B C   1 
ATOM   7367 O  O   . ILE B 2 380 ? 125.222 21.776  59.530  1.00 28.73 ? 380 ILE B O   1 
ATOM   7368 C  CB  . ILE B 2 380 ? 125.966 18.322  59.510  1.00 30.05 ? 380 ILE B CB  1 
ATOM   7369 C  CG1 . ILE B 2 380 ? 126.224 17.159  60.476  1.00 32.12 ? 380 ILE B CG1 1 
ATOM   7370 C  CG2 . ILE B 2 380 ? 127.242 18.707  58.824  1.00 28.91 ? 380 ILE B CG2 1 
ATOM   7371 C  CD1 . ILE B 2 380 ? 126.236 15.786  59.808  1.00 33.00 ? 380 ILE B CD1 1 
ATOM   7372 N  N   . VAL B 2 381 ? 124.151 20.203  58.341  1.00 31.32 ? 381 VAL B N   1 
ATOM   7373 C  CA  . VAL B 2 381 ? 123.566 21.130  57.371  1.00 32.98 ? 381 VAL B CA  1 
ATOM   7374 C  C   . VAL B 2 381 ? 123.360 22.551  57.906  1.00 33.98 ? 381 VAL B C   1 
ATOM   7375 O  O   . VAL B 2 381 ? 123.796 23.553  57.320  1.00 34.78 ? 381 VAL B O   1 
ATOM   7376 C  CB  . VAL B 2 381 ? 122.158 20.664  57.018  1.00 32.78 ? 381 VAL B CB  1 
ATOM   7377 C  CG1 . VAL B 2 381 ? 121.442 21.699  56.144  1.00 32.15 ? 381 VAL B CG1 1 
ATOM   7378 C  CG2 . VAL B 2 381 ? 122.214 19.307  56.393  1.00 35.14 ? 381 VAL B CG2 1 
ATOM   7379 N  N   . ILE B 2 382 ? 122.729 22.615  59.064  1.00 32.94 ? 382 ILE B N   1 
ATOM   7380 C  CA  . ILE B 2 382 ? 122.382 23.878  59.636  1.00 30.29 ? 382 ILE B CA  1 
ATOM   7381 C  C   . ILE B 2 382 ? 123.427 24.547  60.486  1.00 30.06 ? 382 ILE B C   1 
ATOM   7382 O  O   . ILE B 2 382 ? 123.860 25.639  60.169  1.00 28.34 ? 382 ILE B O   1 
ATOM   7383 C  CB  . ILE B 2 382 ? 121.042 23.737  60.335  1.00 29.05 ? 382 ILE B CB  1 
ATOM   7384 C  CG1 . ILE B 2 382 ? 120.029 23.179  59.309  1.00 29.00 ? 382 ILE B CG1 1 
ATOM   7385 C  CG2 . ILE B 2 382 ? 120.602 25.081  60.871  1.00 26.94 ? 382 ILE B CG2 1 
ATOM   7386 C  CD1 . ILE B 2 382 ? 119.049 22.134  59.816  1.00 29.13 ? 382 ILE B CD1 1 
ATOM   7387 N  N   . TRP B 2 383 ? 123.861 23.888  61.541  1.00 32.74 ? 383 TRP B N   1 
ATOM   7388 C  CA  . TRP B 2 383 ? 124.849 24.477  62.436  1.00 35.51 ? 383 TRP B CA  1 
ATOM   7389 C  C   . TRP B 2 383 ? 126.185 23.913  62.099  1.00 37.77 ? 383 TRP B C   1 
ATOM   7390 O  O   . TRP B 2 383 ? 127.223 24.446  62.475  1.00 37.35 ? 383 TRP B O   1 
ATOM   7391 C  CB  . TRP B 2 383 ? 124.507 24.153  63.881  1.00 37.74 ? 383 TRP B CB  1 
ATOM   7392 C  CG  . TRP B 2 383 ? 123.123 24.488  64.137  1.00 40.05 ? 383 TRP B CG  1 
ATOM   7393 C  CD1 . TRP B 2 383 ? 122.648 25.670  64.578  1.00 40.20 ? 383 TRP B CD1 1 
ATOM   7394 C  CD2 . TRP B 2 383 ? 121.987 23.691  63.815  1.00 42.14 ? 383 TRP B CD2 1 
ATOM   7395 N  NE1 . TRP B 2 383 ? 121.285 25.679  64.546  1.00 42.01 ? 383 TRP B NE1 1 
ATOM   7396 C  CE2 . TRP B 2 383 ? 120.848 24.470  64.077  1.00 43.22 ? 383 TRP B CE2 1 
ATOM   7397 C  CE3 . TRP B 2 383 ? 121.822 22.394  63.313  1.00 43.07 ? 383 TRP B CE3 1 
ATOM   7398 C  CZ2 . TRP B 2 383 ? 119.550 23.998  63.854  1.00 44.66 ? 383 TRP B CZ2 1 
ATOM   7399 C  CZ3 . TRP B 2 383 ? 120.542 21.927  63.086  1.00 42.84 ? 383 TRP B CZ3 1 
ATOM   7400 C  CH2 . TRP B 2 383 ? 119.420 22.726  63.356  1.00 44.82 ? 383 TRP B CH2 1 
ATOM   7401 N  N   . GLY B 2 384 ? 126.156 22.820  61.370  1.00 39.78 ? 384 GLY B N   1 
ATOM   7402 C  CA  . GLY B 2 384 ? 127.393 22.206  60.984  1.00 44.48 ? 384 GLY B CA  1 
ATOM   7403 C  C   . GLY B 2 384 ? 127.915 21.500  62.191  1.00 47.52 ? 384 GLY B C   1 
ATOM   7404 O  O   . GLY B 2 384 ? 128.961 21.856  62.732  1.00 49.27 ? 384 GLY B O   1 
ATOM   7405 N  N   . LYS B 2 385 ? 127.107 20.598  62.715  1.00 50.66 ? 385 LYS B N   1 
ATOM   7406 C  CA  . LYS B 2 385 ? 127.561 19.833  63.843  1.00 54.26 ? 385 LYS B CA  1 
ATOM   7407 C  C   . LYS B 2 385 ? 126.646 18.726  64.261  1.00 55.31 ? 385 LYS B C   1 
ATOM   7408 O  O   . LYS B 2 385 ? 125.461 18.700  63.905  1.00 53.30 ? 385 LYS B O   1 
ATOM   7409 C  CB  . LYS B 2 385 ? 127.967 20.718  65.027  1.00 55.41 ? 385 LYS B CB  1 
ATOM   7410 C  CG  . LYS B 2 385 ? 127.073 21.896  65.310  1.00 56.35 ? 385 LYS B CG  1 
ATOM   7411 C  CD  . LYS B 2 385 ? 127.828 22.873  66.196  1.00 59.07 ? 385 LYS B CD  1 
ATOM   7412 C  CE  . LYS B 2 385 ? 128.435 22.176  67.432  1.00 61.06 ? 385 LYS B CE  1 
ATOM   7413 N  NZ  . LYS B 2 385 ? 129.098 23.093  68.440  1.00 61.67 ? 385 LYS B NZ  1 
ATOM   7414 N  N   . THR B 2 386 ? 127.278 17.764  64.928  1.00 58.06 ? 386 THR B N   1 
ATOM   7415 C  CA  . THR B 2 386 ? 126.652 16.563  65.453  1.00 60.89 ? 386 THR B CA  1 
ATOM   7416 C  C   . THR B 2 386 ? 126.065 16.764  66.847  1.00 60.15 ? 386 THR B C   1 
ATOM   7417 O  O   . THR B 2 386 ? 126.773 17.154  67.794  1.00 59.88 ? 386 THR B O   1 
ATOM   7418 C  CB  . THR B 2 386 ? 127.664 15.373  65.507  1.00 62.03 ? 386 THR B CB  1 
ATOM   7419 O  OG1 . THR B 2 386 ? 128.991 15.862  65.776  1.00 63.94 ? 386 THR B OG1 1 
ATOM   7420 C  CG2 . THR B 2 386 ? 127.655 14.596  64.191  1.00 62.67 ? 386 THR B CG2 1 
ATOM   7421 N  N   . PRO B 2 387 ? 124.752 16.506  66.981  1.00 59.27 ? 387 PRO B N   1 
ATOM   7422 C  CA  . PRO B 2 387 ? 124.070 16.655  68.265  1.00 59.22 ? 387 PRO B CA  1 
ATOM   7423 C  C   . PRO B 2 387 ? 124.459 15.550  69.255  1.00 58.98 ? 387 PRO B C   1 
ATOM   7424 O  O   . PRO B 2 387 ? 125.487 14.873  69.096  1.00 59.64 ? 387 PRO B O   1 
ATOM   7425 C  CB  . PRO B 2 387 ? 122.591 16.580  67.868  1.00 57.88 ? 387 PRO B CB  1 
ATOM   7426 C  CG  . PRO B 2 387 ? 122.598 15.670  66.690  1.00 57.57 ? 387 PRO B CG  1 
ATOM   7427 C  CD  . PRO B 2 387 ? 123.805 16.114  65.916  1.00 58.46 ? 387 PRO B CD  1 
ATOM   7428 N  N   . LYS B 2 388 ? 123.689 15.467  70.332  1.00 58.49 ? 388 LYS B N   1 
ATOM   7429 C  CA  . LYS B 2 388 ? 123.872 14.441  71.334  1.00 56.87 ? 388 LYS B CA  1 
ATOM   7430 C  C   . LYS B 2 388 ? 122.547 13.707  71.279  1.00 54.86 ? 388 LYS B C   1 
ATOM   7431 O  O   . LYS B 2 388 ? 121.493 14.261  71.620  1.00 53.64 ? 388 LYS B O   1 
ATOM   7432 C  CB  . LYS B 2 388 ? 124.091 15.057  72.702  1.00 58.78 ? 388 LYS B CB  1 
ATOM   7433 C  CG  . LYS B 2 388 ? 124.466 14.034  73.749  1.00 61.32 ? 388 LYS B CG  1 
ATOM   7434 C  CD  . LYS B 2 388 ? 125.094 14.688  74.984  1.00 63.64 ? 388 LYS B CD  1 
ATOM   7435 C  CE  . LYS B 2 388 ? 124.149 15.669  75.685  1.00 63.50 ? 388 LYS B CE  1 
ATOM   7436 N  NZ  . LYS B 2 388 ? 124.762 16.322  76.887  1.00 63.16 ? 388 LYS B NZ  1 
ATOM   7437 N  N   . PHE B 2 389 ? 122.596 12.484  70.778  1.00 52.09 ? 389 PHE B N   1 
ATOM   7438 C  CA  . PHE B 2 389 ? 121.395 11.698  70.626  1.00 49.51 ? 389 PHE B CA  1 
ATOM   7439 C  C   . PHE B 2 389 ? 120.918 10.945  71.845  1.00 48.59 ? 389 PHE B C   1 
ATOM   7440 O  O   . PHE B 2 389 ? 121.683 10.236  72.504  1.00 46.63 ? 389 PHE B O   1 
ATOM   7441 C  CB  . PHE B 2 389 ? 121.574 10.703  69.506  1.00 49.45 ? 389 PHE B CB  1 
ATOM   7442 C  CG  . PHE B 2 389 ? 121.495 11.296  68.136  1.00 50.14 ? 389 PHE B CG  1 
ATOM   7443 C  CD1 . PHE B 2 389 ? 120.270 11.395  67.488  1.00 48.51 ? 389 PHE B CD1 1 
ATOM   7444 C  CD2 . PHE B 2 389 ? 122.653 11.667  67.447  1.00 49.62 ? 389 PHE B CD2 1 
ATOM   7445 C  CE1 . PHE B 2 389 ? 120.198 11.824  66.155  1.00 49.22 ? 389 PHE B CE1 1 
ATOM   7446 C  CE2 . PHE B 2 389 ? 122.588 12.102  66.107  1.00 50.00 ? 389 PHE B CE2 1 
ATOM   7447 C  CZ  . PHE B 2 389 ? 121.357 12.185  65.464  1.00 48.80 ? 389 PHE B CZ  1 
ATOM   7448 N  N   . LYS B 2 390 ? 119.631 11.101  72.124  1.00 48.56 ? 390 LYS B N   1 
ATOM   7449 C  CA  . LYS B 2 390 ? 118.970 10.402  73.219  1.00 46.85 ? 390 LYS B CA  1 
ATOM   7450 C  C   . LYS B 2 390 ? 118.140 9.295   72.557  1.00 44.90 ? 390 LYS B C   1 
ATOM   7451 O  O   . LYS B 2 390 ? 117.037 9.515   72.024  1.00 42.27 ? 390 LYS B O   1 
ATOM   7452 C  CB  . LYS B 2 390 ? 118.106 11.360  74.023  1.00 47.14 ? 390 LYS B CB  1 
ATOM   7453 C  CG  . LYS B 2 390 ? 118.886 12.083  75.075  1.00 47.10 ? 390 LYS B CG  1 
ATOM   7454 C  CD  . LYS B 2 390 ? 118.065 13.221  75.634  1.00 49.66 ? 390 LYS B CD  1 
ATOM   7455 C  CE  . LYS B 2 390 ? 118.496 13.578  77.055  1.00 50.13 ? 390 LYS B CE  1 
ATOM   7456 N  NZ  . LYS B 2 390 ? 119.950 13.911  77.164  1.00 48.55 ? 390 LYS B NZ  1 
ATOM   7457 N  N   . LEU B 2 391 ? 118.764 8.126   72.523  1.00 41.95 ? 391 LEU B N   1 
ATOM   7458 C  CA  . LEU B 2 391 ? 118.236 6.929   71.914  1.00 40.14 ? 391 LEU B CA  1 
ATOM   7459 C  C   . LEU B 2 391 ? 117.257 6.122   72.734  1.00 38.46 ? 391 LEU B C   1 
ATOM   7460 O  O   . LEU B 2 391 ? 117.583 5.644   73.807  1.00 37.28 ? 391 LEU B O   1 
ATOM   7461 C  CB  . LEU B 2 391 ? 119.407 6.042   71.495  1.00 40.66 ? 391 LEU B CB  1 
ATOM   7462 C  CG  . LEU B 2 391 ? 120.359 6.846   70.613  1.00 41.77 ? 391 LEU B CG  1 
ATOM   7463 C  CD1 . LEU B 2 391 ? 121.700 6.158   70.414  1.00 41.83 ? 391 LEU B CD1 1 
ATOM   7464 C  CD2 . LEU B 2 391 ? 119.651 7.113   69.291  1.00 42.25 ? 391 LEU B CD2 1 
ATOM   7465 N  N   . PRO B 2 392 ? 116.030 5.958   72.231  1.00 38.08 ? 392 PRO B N   1 
ATOM   7466 C  CA  . PRO B 2 392 ? 115.057 5.171   72.984  1.00 38.13 ? 392 PRO B CA  1 
ATOM   7467 C  C   . PRO B 2 392 ? 115.336 3.675   72.708  1.00 38.28 ? 392 PRO B C   1 
ATOM   7468 O  O   . PRO B 2 392 ? 114.529 2.999   72.069  1.00 37.70 ? 392 PRO B O   1 
ATOM   7469 C  CB  . PRO B 2 392 ? 113.733 5.626   72.373  1.00 39.22 ? 392 PRO B CB  1 
ATOM   7470 C  CG  . PRO B 2 392 ? 114.113 5.810   70.919  1.00 38.07 ? 392 PRO B CG  1 
ATOM   7471 C  CD  . PRO B 2 392 ? 115.423 6.542   71.018  1.00 37.45 ? 392 PRO B CD  1 
ATOM   7472 N  N   . ILE B 2 393 ? 116.491 3.172   73.150  1.00 37.71 ? 393 ILE B N   1 
ATOM   7473 C  CA  . ILE B 2 393 ? 116.865 1.762   72.923  1.00 37.54 ? 393 ILE B CA  1 
ATOM   7474 C  C   . ILE B 2 393 ? 117.909 1.331   73.938  1.00 35.25 ? 393 ILE B C   1 
ATOM   7475 O  O   . ILE B 2 393 ? 118.469 2.175   74.632  1.00 31.94 ? 393 ILE B O   1 
ATOM   7476 C  CB  . ILE B 2 393 ? 117.488 1.544   71.497  1.00 41.00 ? 393 ILE B CB  1 
ATOM   7477 C  CG1 . ILE B 2 393 ? 117.725 0.050   71.222  1.00 41.48 ? 393 ILE B CG1 1 
ATOM   7478 C  CG2 . ILE B 2 393 ? 118.823 2.314   71.370  1.00 42.73 ? 393 ILE B CG2 1 
ATOM   7479 C  CD1 . ILE B 2 393 ? 118.391 -0.240  69.885  1.00 42.98 ? 393 ILE B CD1 1 
ATOM   7480 N  N   . GLN B 2 394 ? 118.177 0.027   74.011  1.00 35.07 ? 394 GLN B N   1 
ATOM   7481 C  CA  . GLN B 2 394 ? 119.174 -0.468  74.940  1.00 36.28 ? 394 GLN B CA  1 
ATOM   7482 C  C   . GLN B 2 394 ? 120.595 -0.222  74.464  1.00 35.32 ? 394 GLN B C   1 
ATOM   7483 O  O   . GLN B 2 394 ? 120.928 -0.448  73.293  1.00 32.56 ? 394 GLN B O   1 
ATOM   7484 C  CB  . GLN B 2 394 ? 119.000 -1.961  75.243  1.00 39.55 ? 394 GLN B CB  1 
ATOM   7485 C  CG  . GLN B 2 394 ? 120.053 -2.475  76.255  1.00 43.34 ? 394 GLN B CG  1 
ATOM   7486 C  CD  . GLN B 2 394 ? 119.871 -3.936  76.652  1.00 46.17 ? 394 GLN B CD  1 
ATOM   7487 O  OE1 . GLN B 2 394 ? 120.402 -4.841  76.002  1.00 47.09 ? 394 GLN B OE1 1 
ATOM   7488 N  NE2 . GLN B 2 394 ? 119.143 -4.167  77.743  1.00 47.34 ? 394 GLN B NE2 1 
ATOM   7489 N  N   . LYS B 2 395 ? 121.417 0.227   75.411  1.00 35.70 ? 395 LYS B N   1 
ATOM   7490 C  CA  . LYS B 2 395 ? 122.824 0.503   75.187  1.00 36.59 ? 395 LYS B CA  1 
ATOM   7491 C  C   . LYS B 2 395 ? 123.367 -0.716  74.509  1.00 36.44 ? 395 LYS B C   1 
ATOM   7492 O  O   . LYS B 2 395 ? 123.710 -0.704  73.339  1.00 37.94 ? 395 LYS B O   1 
ATOM   7493 C  CB  . LYS B 2 395 ? 123.550 0.699   76.534  1.00 38.13 ? 395 LYS B CB  1 
ATOM   7494 C  CG  . LYS B 2 395 ? 125.088 0.782   76.452  1.00 39.96 ? 395 LYS B CG  1 
ATOM   7495 C  CD  . LYS B 2 395 ? 125.726 1.358   77.739  1.00 42.82 ? 395 LYS B CD  1 
ATOM   7496 C  CE  . LYS B 2 395 ? 127.253 1.646   77.609  1.00 43.95 ? 395 LYS B CE  1 
ATOM   7497 N  NZ  . LYS B 2 395 ? 128.137 0.438   77.786  1.00 45.62 ? 395 LYS B NZ  1 
ATOM   7498 N  N   . GLU B 2 396 ? 123.288 -1.810  75.235  1.00 36.04 ? 396 GLU B N   1 
ATOM   7499 C  CA  . GLU B 2 396 ? 123.787 -3.072  74.763  1.00 35.00 ? 396 GLU B CA  1 
ATOM   7500 C  C   . GLU B 2 396 ? 123.204 -3.532  73.420  1.00 30.69 ? 396 GLU B C   1 
ATOM   7501 O  O   . GLU B 2 396 ? 123.968 -3.889  72.532  1.00 27.19 ? 396 GLU B O   1 
ATOM   7502 C  CB  . GLU B 2 396 ? 123.671 -4.083  75.913  1.00 41.42 ? 396 GLU B CB  1 
ATOM   7503 C  CG  . GLU B 2 396 ? 124.538 -3.659  77.164  1.00 45.94 ? 396 GLU B CG  1 
ATOM   7504 C  CD  . GLU B 2 396 ? 123.740 -3.466  78.480  1.00 49.35 ? 396 GLU B CD  1 
ATOM   7505 O  OE1 . GLU B 2 396 ? 122.644 -2.848  78.434  1.00 50.01 ? 396 GLU B OE1 1 
ATOM   7506 O  OE2 . GLU B 2 396 ? 124.229 -3.915  79.561  1.00 48.76 ? 396 GLU B OE2 1 
ATOM   7507 N  N   . THR B 2 397 ? 121.892 -3.415  73.232  1.00 28.21 ? 397 THR B N   1 
ATOM   7508 C  CA  . THR B 2 397 ? 121.274 -3.791  71.958  1.00 29.85 ? 397 THR B CA  1 
ATOM   7509 C  C   . THR B 2 397 ? 121.886 -2.965  70.829  1.00 31.69 ? 397 THR B C   1 
ATOM   7510 O  O   . THR B 2 397 ? 122.382 -3.505  69.833  1.00 30.31 ? 397 THR B O   1 
ATOM   7511 C  CB  . THR B 2 397 ? 119.750 -3.524  71.931  1.00 29.59 ? 397 THR B CB  1 
ATOM   7512 O  OG1 . THR B 2 397 ? 119.099 -4.333  72.910  1.00 30.85 ? 397 THR B OG1 1 
ATOM   7513 C  CG2 . THR B 2 397 ? 119.165 -3.844  70.542  1.00 28.00 ? 397 THR B CG2 1 
ATOM   7514 N  N   . TRP B 2 398 ? 121.800 -1.647  70.977  1.00 33.41 ? 398 TRP B N   1 
ATOM   7515 C  CA  . TRP B 2 398 ? 122.343 -0.714  69.998  1.00 34.58 ? 398 TRP B CA  1 
ATOM   7516 C  C   . TRP B 2 398 ? 123.851 -0.963  69.836  1.00 34.54 ? 398 TRP B C   1 
ATOM   7517 O  O   . TRP B 2 398 ? 124.352 -1.115  68.713  1.00 34.50 ? 398 TRP B O   1 
ATOM   7518 C  CB  . TRP B 2 398 ? 122.060 0.734   70.450  1.00 34.50 ? 398 TRP B CB  1 
ATOM   7519 C  CG  . TRP B 2 398 ? 122.729 1.825   69.607  1.00 34.59 ? 398 TRP B CG  1 
ATOM   7520 C  CD1 . TRP B 2 398 ? 123.958 2.403   69.824  1.00 33.21 ? 398 TRP B CD1 1 
ATOM   7521 C  CD2 . TRP B 2 398 ? 122.202 2.438   68.423  1.00 33.34 ? 398 TRP B CD2 1 
ATOM   7522 N  NE1 . TRP B 2 398 ? 124.218 3.324   68.850  1.00 32.58 ? 398 TRP B NE1 1 
ATOM   7523 C  CE2 . TRP B 2 398 ? 123.163 3.369   67.976  1.00 33.45 ? 398 TRP B CE2 1 
ATOM   7524 C  CE3 . TRP B 2 398 ? 121.011 2.292   67.692  1.00 34.06 ? 398 TRP B CE3 1 
ATOM   7525 C  CZ2 . TRP B 2 398 ? 122.971 4.149   66.832  1.00 32.75 ? 398 TRP B CZ2 1 
ATOM   7526 C  CZ3 . TRP B 2 398 ? 120.816 3.070   66.551  1.00 32.07 ? 398 TRP B CZ3 1 
ATOM   7527 C  CH2 . TRP B 2 398 ? 121.795 3.985   66.136  1.00 32.77 ? 398 TRP B CH2 1 
ATOM   7528 N  N   . GLU B 2 399 ? 124.539 -1.141  70.956  1.00 33.04 ? 399 GLU B N   1 
ATOM   7529 C  CA  . GLU B 2 399 ? 125.961 -1.370  70.944  1.00 34.68 ? 399 GLU B CA  1 
ATOM   7530 C  C   . GLU B 2 399 ? 126.320 -2.666  70.233  1.00 37.32 ? 399 GLU B C   1 
ATOM   7531 O  O   . GLU B 2 399 ? 127.476 -3.076  70.222  1.00 39.42 ? 399 GLU B O   1 
ATOM   7532 C  CB  . GLU B 2 399 ? 126.480 -1.435  72.367  1.00 34.90 ? 399 GLU B CB  1 
ATOM   7533 C  CG  . GLU B 2 399 ? 126.589 -0.097  73.073  1.00 35.28 ? 399 GLU B CG  1 
ATOM   7534 C  CD  . GLU B 2 399 ? 127.361 -0.191  74.398  1.00 34.41 ? 399 GLU B CD  1 
ATOM   7535 O  OE1 . GLU B 2 399 ? 127.268 -1.239  75.080  1.00 33.69 ? 399 GLU B OE1 1 
ATOM   7536 O  OE2 . GLU B 2 399 ? 128.065 0.785   74.753  1.00 33.85 ? 399 GLU B OE2 1 
ATOM   7537 N  N   . THR B 2 400 ? 125.353 -3.275  69.571  1.00 39.30 ? 400 THR B N   1 
ATOM   7538 C  CA  . THR B 2 400 ? 125.585 -4.539  68.905  1.00 41.62 ? 400 THR B CA  1 
ATOM   7539 C  C   . THR B 2 400 ? 125.032 -4.573  67.476  1.00 43.71 ? 400 THR B C   1 
ATOM   7540 O  O   . THR B 2 400 ? 125.148 -5.603  66.803  1.00 44.00 ? 400 THR B O   1 
ATOM   7541 C  CB  . THR B 2 400 ? 124.866 -5.637  69.750  1.00 41.57 ? 400 THR B CB  1 
ATOM   7542 O  OG1 . THR B 2 400 ? 125.393 -5.627  71.086  1.00 42.83 ? 400 THR B OG1 1 
ATOM   7543 C  CG2 . THR B 2 400 ? 125.007 -7.017  69.145  1.00 40.24 ? 400 THR B CG2 1 
ATOM   7544 N  N   . TRP B 2 401 ? 124.472 -3.459  66.989  1.00 45.05 ? 401 TRP B N   1 
ATOM   7545 C  CA  . TRP B 2 401 ? 123.824 -3.458  65.657  1.00 46.10 ? 401 TRP B CA  1 
ATOM   7546 C  C   . TRP B 2 401 ? 123.870 -2.243  64.725  1.00 46.00 ? 401 TRP B C   1 
ATOM   7547 O  O   . TRP B 2 401 ? 123.680 -2.391  63.507  1.00 45.76 ? 401 TRP B O   1 
ATOM   7548 C  CB  . TRP B 2 401 ? 122.344 -3.838  65.818  1.00 47.85 ? 401 TRP B CB  1 
ATOM   7549 C  CG  . TRP B 2 401 ? 122.148 -5.162  66.421  1.00 50.50 ? 401 TRP B CG  1 
ATOM   7550 C  CD1 . TRP B 2 401 ? 122.215 -5.483  67.749  1.00 51.42 ? 401 TRP B CD1 1 
ATOM   7551 C  CD2 . TRP B 2 401 ? 121.938 -6.378  65.719  1.00 52.14 ? 401 TRP B CD2 1 
ATOM   7552 N  NE1 . TRP B 2 401 ? 122.079 -6.833  67.914  1.00 53.24 ? 401 TRP B NE1 1 
ATOM   7553 C  CE2 . TRP B 2 401 ? 121.901 -7.411  66.681  1.00 53.72 ? 401 TRP B CE2 1 
ATOM   7554 C  CE3 . TRP B 2 401 ? 121.778 -6.699  64.363  1.00 51.07 ? 401 TRP B CE3 1 
ATOM   7555 C  CZ2 . TRP B 2 401 ? 121.709 -8.751  66.333  1.00 54.82 ? 401 TRP B CZ2 1 
ATOM   7556 C  CZ3 . TRP B 2 401 ? 121.590 -8.022  64.011  1.00 52.14 ? 401 TRP B CZ3 1 
ATOM   7557 C  CH2 . TRP B 2 401 ? 121.557 -9.038  64.993  1.00 54.49 ? 401 TRP B CH2 1 
ATOM   7558 N  N   . TRP B 2 402 ? 124.016 -1.042  65.279  1.00 45.19 ? 402 TRP B N   1 
ATOM   7559 C  CA  . TRP B 2 402 ? 124.063 0.165   64.456  1.00 43.19 ? 402 TRP B CA  1 
ATOM   7560 C  C   . TRP B 2 402 ? 125.084 -0.065  63.331  1.00 43.45 ? 402 TRP B C   1 
ATOM   7561 O  O   . TRP B 2 402 ? 124.767 0.071   62.151  1.00 42.21 ? 402 TRP B O   1 
ATOM   7562 C  CB  . TRP B 2 402 ? 124.442 1.351   65.334  1.00 41.18 ? 402 TRP B CB  1 
ATOM   7563 C  CG  . TRP B 2 402 ? 125.707 1.135   66.035  1.00 41.47 ? 402 TRP B CG  1 
ATOM   7564 C  CD1 . TRP B 2 402 ? 125.919 0.373   67.148  1.00 38.80 ? 402 TRP B CD1 1 
ATOM   7565 C  CD2 . TRP B 2 402 ? 126.978 1.645   65.644  1.00 42.51 ? 402 TRP B CD2 1 
ATOM   7566 N  NE1 . TRP B 2 402 ? 127.248 0.374   67.473  1.00 40.03 ? 402 TRP B NE1 1 
ATOM   7567 C  CE2 . TRP B 2 402 ? 127.928 1.148   66.566  1.00 42.22 ? 402 TRP B CE2 1 
ATOM   7568 C  CE3 . TRP B 2 402 ? 127.410 2.480   64.595  1.00 42.03 ? 402 TRP B CE3 1 
ATOM   7569 C  CZ2 . TRP B 2 402 ? 129.297 1.462   66.479  1.00 42.54 ? 402 TRP B CZ2 1 
ATOM   7570 C  CZ3 . TRP B 2 402 ? 128.761 2.794   64.505  1.00 42.30 ? 402 TRP B CZ3 1 
ATOM   7571 C  CH2 . TRP B 2 402 ? 129.693 2.283   65.446  1.00 43.19 ? 402 TRP B CH2 1 
ATOM   7572 N  N   . THR B 2 403 ? 126.243 -0.585  63.729  1.00 45.74 ? 403 THR B N   1 
ATOM   7573 C  CA  . THR B 2 403 ? 127.378 -0.933  62.863  1.00 48.41 ? 403 THR B CA  1 
ATOM   7574 C  C   . THR B 2 403 ? 127.001 -1.869  61.690  1.00 49.94 ? 403 THR B C   1 
ATOM   7575 O  O   . THR B 2 403 ? 127.811 -2.153  60.811  1.00 48.57 ? 403 THR B O   1 
ATOM   7576 C  CB  . THR B 2 403 ? 128.498 -1.590  63.742  1.00 49.03 ? 403 THR B CB  1 
ATOM   7577 O  OG1 . THR B 2 403 ? 129.591 -2.047  62.933  1.00 51.01 ? 403 THR B OG1 1 
ATOM   7578 C  CG2 . THR B 2 403 ? 127.935 -2.749  64.554  1.00 48.39 ? 403 THR B CG2 1 
ATOM   7579 N  N   . GLU B 2 404 ? 125.776 -2.373  61.701  1.00 51.66 ? 404 GLU B N   1 
ATOM   7580 C  CA  . GLU B 2 404 ? 125.314 -3.240  60.643  1.00 53.35 ? 404 GLU B CA  1 
ATOM   7581 C  C   . GLU B 2 404 ? 124.687 -2.388  59.545  1.00 52.73 ? 404 GLU B C   1 
ATOM   7582 O  O   . GLU B 2 404 ? 125.039 -2.510  58.375  1.00 53.30 ? 404 GLU B O   1 
ATOM   7583 C  CB  . GLU B 2 404 ? 124.298 -4.242  61.198  1.00 56.09 ? 404 GLU B CB  1 
ATOM   7584 C  CG  . GLU B 2 404 ? 123.402 -4.935  60.143  1.00 61.13 ? 404 GLU B CG  1 
ATOM   7585 C  CD  . GLU B 2 404 ? 124.132 -5.954  59.263  1.00 63.53 ? 404 GLU B CD  1 
ATOM   7586 O  OE1 . GLU B 2 404 ? 124.993 -6.695  59.798  1.00 65.07 ? 404 GLU B OE1 1 
ATOM   7587 O  OE2 . GLU B 2 404 ? 123.818 -6.027  58.041  1.00 63.95 ? 404 GLU B OE2 1 
ATOM   7588 N  N   . TYR B 2 405 ? 123.776 -1.503  59.921  1.00 52.04 ? 405 TYR B N   1 
ATOM   7589 C  CA  . TYR B 2 405 ? 123.109 -0.681  58.924  1.00 52.57 ? 405 TYR B CA  1 
ATOM   7590 C  C   . TYR B 2 405 ? 123.751 0.668   58.768  1.00 50.68 ? 405 TYR B C   1 
ATOM   7591 O  O   . TYR B 2 405 ? 123.415 1.424   57.848  1.00 49.20 ? 405 TYR B O   1 
ATOM   7592 C  CB  . TYR B 2 405 ? 121.666 -0.486  59.317  1.00 57.33 ? 405 TYR B CB  1 
ATOM   7593 C  CG  . TYR B 2 405 ? 121.149 -1.661  60.067  1.00 62.73 ? 405 TYR B CG  1 
ATOM   7594 C  CD1 . TYR B 2 405 ? 121.271 -1.725  61.454  1.00 64.93 ? 405 TYR B CD1 1 
ATOM   7595 C  CD2 . TYR B 2 405 ? 120.546 -2.722  59.395  1.00 65.93 ? 405 TYR B CD2 1 
ATOM   7596 C  CE1 . TYR B 2 405 ? 120.796 -2.822  62.160  1.00 69.10 ? 405 TYR B CE1 1 
ATOM   7597 C  CE2 . TYR B 2 405 ? 120.064 -3.828  60.083  1.00 69.67 ? 405 TYR B CE2 1 
ATOM   7598 C  CZ  . TYR B 2 405 ? 120.186 -3.877  61.471  1.00 70.66 ? 405 TYR B CZ  1 
ATOM   7599 O  OH  . TYR B 2 405 ? 119.671 -4.963  62.168  1.00 72.52 ? 405 TYR B OH  1 
ATOM   7600 N  N   . TRP B 2 406 ? 124.655 0.975   59.692  1.00 47.97 ? 406 TRP B N   1 
ATOM   7601 C  CA  . TRP B 2 406 ? 125.354 2.249   59.699  1.00 45.49 ? 406 TRP B CA  1 
ATOM   7602 C  C   . TRP B 2 406 ? 126.172 2.476   58.452  1.00 43.16 ? 406 TRP B C   1 
ATOM   7603 O  O   . TRP B 2 406 ? 127.202 1.837   58.244  1.00 42.49 ? 406 TRP B O   1 
ATOM   7604 C  CB  . TRP B 2 406 ? 126.262 2.375   60.912  1.00 45.75 ? 406 TRP B CB  1 
ATOM   7605 C  CG  . TRP B 2 406 ? 126.863 3.728   60.994  1.00 47.05 ? 406 TRP B CG  1 
ATOM   7606 C  CD1 . TRP B 2 406 ? 127.868 4.224   60.224  1.00 49.16 ? 406 TRP B CD1 1 
ATOM   7607 C  CD2 . TRP B 2 406 ? 126.474 4.787   61.870  1.00 48.41 ? 406 TRP B CD2 1 
ATOM   7608 N  NE1 . TRP B 2 406 ? 128.133 5.528   60.560  1.00 49.10 ? 406 TRP B NE1 1 
ATOM   7609 C  CE2 . TRP B 2 406 ? 127.289 5.900   61.569  1.00 48.34 ? 406 TRP B CE2 1 
ATOM   7610 C  CE3 . TRP B 2 406 ? 125.511 4.909   62.879  1.00 48.93 ? 406 TRP B CE3 1 
ATOM   7611 C  CZ2 . TRP B 2 406 ? 127.173 7.113   62.238  1.00 49.65 ? 406 TRP B CZ2 1 
ATOM   7612 C  CZ3 . TRP B 2 406 ? 125.394 6.118   63.543  1.00 49.29 ? 406 TRP B CZ3 1 
ATOM   7613 C  CH2 . TRP B 2 406 ? 126.222 7.205   63.219  1.00 49.60 ? 406 TRP B CH2 1 
ATOM   7614 N  N   . GLN B 2 407 ? 125.744 3.443   57.660  1.00 41.30 ? 407 GLN B N   1 
ATOM   7615 C  CA  . GLN B 2 407 ? 126.446 3.755   56.442  1.00 41.03 ? 407 GLN B CA  1 
ATOM   7616 C  C   . GLN B 2 407 ? 126.788 5.236   56.422  1.00 40.90 ? 407 GLN B C   1 
ATOM   7617 O  O   . GLN B 2 407 ? 126.305 5.976   55.572  1.00 41.68 ? 407 GLN B O   1 
ATOM   7618 C  CB  . GLN B 2 407 ? 125.581 3.398   55.230  1.00 42.64 ? 407 GLN B CB  1 
ATOM   7619 C  CG  . GLN B 2 407 ? 126.387 2.914   54.022  1.00 45.19 ? 407 GLN B CG  1 
ATOM   7620 C  CD  . GLN B 2 407 ? 125.694 3.164   52.687  1.00 46.98 ? 407 GLN B CD  1 
ATOM   7621 O  OE1 . GLN B 2 407 ? 125.031 2.284   52.146  1.00 49.18 ? 407 GLN B OE1 1 
ATOM   7622 N  NE2 . GLN B 2 407 ? 125.875 4.358   52.136  1.00 48.18 ? 407 GLN B NE2 1 
ATOM   7623 N  N   . ALA B 2 408 ? 127.573 5.679   57.395  1.00 40.17 ? 408 ALA B N   1 
ATOM   7624 C  CA  . ALA B 2 408 ? 127.993 7.078   57.470  1.00 38.96 ? 408 ALA B CA  1 
ATOM   7625 C  C   . ALA B 2 408 ? 129.468 7.098   57.822  1.00 38.85 ? 408 ALA B C   1 
ATOM   7626 O  O   . ALA B 2 408 ? 130.036 6.083   58.229  1.00 38.54 ? 408 ALA B O   1 
ATOM   7627 C  CB  . ALA B 2 408 ? 127.192 7.837   58.500  1.00 38.26 ? 408 ALA B CB  1 
ATOM   7628 N  N   . THR B 2 409 ? 130.087 8.256   57.686  1.00 38.33 ? 409 THR B N   1 
ATOM   7629 C  CA  . THR B 2 409 ? 131.511 8.357   57.950  1.00 39.10 ? 409 THR B CA  1 
ATOM   7630 C  C   . THR B 2 409 ? 131.849 8.683   59.382  1.00 39.49 ? 409 THR B C   1 
ATOM   7631 O  O   . THR B 2 409 ? 132.848 8.203   59.928  1.00 39.24 ? 409 THR B O   1 
ATOM   7632 C  CB  . THR B 2 409 ? 132.150 9.462   57.091  1.00 39.29 ? 409 THR B CB  1 
ATOM   7633 O  OG1 . THR B 2 409 ? 131.239 10.562  56.995  1.00 36.89 ? 409 THR B OG1 1 
ATOM   7634 C  CG2 . THR B 2 409 ? 132.519 8.940   55.713  1.00 38.84 ? 409 THR B CG2 1 
ATOM   7635 N  N   . TRP B 2 410 ? 131.067 9.598   59.933  1.00 39.37 ? 410 TRP B N   1 
ATOM   7636 C  CA  . TRP B 2 410 ? 131.267 10.092  61.284  1.00 38.38 ? 410 TRP B CA  1 
ATOM   7637 C  C   . TRP B 2 410 ? 130.349 9.373   62.223  1.00 37.36 ? 410 TRP B C   1 
ATOM   7638 O  O   . TRP B 2 410 ? 129.428 8.674   61.797  1.00 36.46 ? 410 TRP B O   1 
ATOM   7639 C  CB  . TRP B 2 410 ? 130.944 11.585  61.324  1.00 37.99 ? 410 TRP B CB  1 
ATOM   7640 C  CG  . TRP B 2 410 ? 129.947 11.968  60.287  1.00 38.23 ? 410 TRP B CG  1 
ATOM   7641 C  CD1 . TRP B 2 410 ? 130.156 12.796  59.236  1.00 39.03 ? 410 TRP B CD1 1 
ATOM   7642 C  CD2 . TRP B 2 410 ? 128.597 11.498  60.168  1.00 39.73 ? 410 TRP B CD2 1 
ATOM   7643 N  NE1 . TRP B 2 410 ? 129.026 12.875  58.460  1.00 39.37 ? 410 TRP B NE1 1 
ATOM   7644 C  CE2 . TRP B 2 410 ? 128.051 12.092  59.011  1.00 40.14 ? 410 TRP B CE2 1 
ATOM   7645 C  CE3 . TRP B 2 410 ? 127.794 10.638  60.927  1.00 41.32 ? 410 TRP B CE3 1 
ATOM   7646 C  CZ2 . TRP B 2 410 ? 126.736 11.859  58.592  1.00 41.72 ? 410 TRP B CZ2 1 
ATOM   7647 C  CZ3 . TRP B 2 410 ? 126.485 10.401  60.512  1.00 43.16 ? 410 TRP B CZ3 1 
ATOM   7648 C  CH2 . TRP B 2 410 ? 125.969 11.014  59.350  1.00 42.44 ? 410 TRP B CH2 1 
ATOM   7649 N  N   . ILE B 2 411 ? 130.635 9.505   63.506  1.00 36.51 ? 411 ILE B N   1 
ATOM   7650 C  CA  . ILE B 2 411 ? 129.781 8.905   64.489  1.00 37.19 ? 411 ILE B CA  1 
ATOM   7651 C  C   . ILE B 2 411 ? 129.613 9.905   65.603  1.00 36.45 ? 411 ILE B C   1 
ATOM   7652 O  O   . ILE B 2 411 ? 130.589 10.455  66.131  1.00 34.98 ? 411 ILE B O   1 
ATOM   7653 C  CB  . ILE B 2 411 ? 130.298 7.569   65.007  1.00 39.44 ? 411 ILE B CB  1 
ATOM   7654 C  CG1 . ILE B 2 411 ? 130.409 6.583   63.845  1.00 41.43 ? 411 ILE B CG1 1 
ATOM   7655 C  CG2 . ILE B 2 411 ? 129.286 6.981   65.984  1.00 40.07 ? 411 ILE B CG2 1 
ATOM   7656 C  CD1 . ILE B 2 411 ? 131.139 5.317   64.175  1.00 43.43 ? 411 ILE B CD1 1 
ATOM   7657 N  N   . PRO B 2 412 ? 128.361 10.313  65.813  1.00 36.29 ? 412 PRO B N   1 
ATOM   7658 C  CA  . PRO B 2 412 ? 127.997 11.276  66.851  1.00 37.20 ? 412 PRO B CA  1 
ATOM   7659 C  C   . PRO B 2 412 ? 127.923 10.606  68.213  1.00 37.74 ? 412 PRO B C   1 
ATOM   7660 O  O   . PRO B 2 412 ? 127.706 9.388   68.293  1.00 35.04 ? 412 PRO B O   1 
ATOM   7661 C  CB  . PRO B 2 412 ? 126.615 11.762  66.392  1.00 37.04 ? 412 PRO B CB  1 
ATOM   7662 C  CG  . PRO B 2 412 ? 126.075 10.574  65.620  1.00 35.73 ? 412 PRO B CG  1 
ATOM   7663 C  CD  . PRO B 2 412 ? 127.263 10.128  64.844  1.00 35.07 ? 412 PRO B CD  1 
ATOM   7664 N  N   . GLU B 2 413 ? 128.132 11.396  69.269  1.00 39.16 ? 413 GLU B N   1 
ATOM   7665 C  CA  . GLU B 2 413 ? 128.048 10.881  70.634  1.00 41.23 ? 413 GLU B CA  1 
ATOM   7666 C  C   . GLU B 2 413 ? 126.543 10.736  70.921  1.00 42.60 ? 413 GLU B C   1 
ATOM   7667 O  O   . GLU B 2 413 ? 125.712 11.595  70.569  1.00 41.87 ? 413 GLU B O   1 
ATOM   7668 C  CB  . GLU B 2 413 ? 128.732 11.821  71.620  1.00 40.69 ? 413 GLU B CB  1 
ATOM   7669 C  CG  . GLU B 2 413 ? 129.956 12.482  71.012  1.00 43.22 ? 413 GLU B CG  1 
ATOM   7670 C  CD  . GLU B 2 413 ? 131.197 12.366  71.873  1.00 44.44 ? 413 GLU B CD  1 
ATOM   7671 O  OE1 . GLU B 2 413 ? 131.079 12.536  73.109  1.00 44.04 ? 413 GLU B OE1 1 
ATOM   7672 O  OE2 . GLU B 2 413 ? 132.288 12.110  71.304  1.00 41.89 ? 413 GLU B OE2 1 
ATOM   7673 N  N   . TRP B 2 414 ? 126.192 9.629   71.546  1.00 43.01 ? 414 TRP B N   1 
ATOM   7674 C  CA  . TRP B 2 414 ? 124.804 9.332   71.799  1.00 41.85 ? 414 TRP B CA  1 
ATOM   7675 C  C   . TRP B 2 414 ? 124.674 8.738   73.161  1.00 43.69 ? 414 TRP B C   1 
ATOM   7676 O  O   . TRP B 2 414 ? 125.675 8.444   73.822  1.00 42.29 ? 414 TRP B O   1 
ATOM   7677 C  CB  . TRP B 2 414 ? 124.346 8.279   70.792  1.00 39.36 ? 414 TRP B CB  1 
ATOM   7678 C  CG  . TRP B 2 414 ? 125.339 7.144   70.658  1.00 34.84 ? 414 TRP B CG  1 
ATOM   7679 C  CD1 . TRP B 2 414 ? 126.120 6.613   71.650  1.00 34.72 ? 414 TRP B CD1 1 
ATOM   7680 C  CD2 . TRP B 2 414 ? 125.705 6.461   69.462  1.00 33.74 ? 414 TRP B CD2 1 
ATOM   7681 N  NE1 . TRP B 2 414 ? 126.953 5.660   71.148  1.00 33.82 ? 414 TRP B NE1 1 
ATOM   7682 C  CE2 . TRP B 2 414 ? 126.720 5.535   69.805  1.00 33.64 ? 414 TRP B CE2 1 
ATOM   7683 C  CE3 . TRP B 2 414 ? 125.278 6.534   68.129  1.00 33.06 ? 414 TRP B CE3 1 
ATOM   7684 C  CZ2 . TRP B 2 414 ? 127.315 4.682   68.862  1.00 32.13 ? 414 TRP B CZ2 1 
ATOM   7685 C  CZ3 . TRP B 2 414 ? 125.875 5.683   67.188  1.00 32.32 ? 414 TRP B CZ3 1 
ATOM   7686 C  CH2 . TRP B 2 414 ? 126.882 4.772   67.566  1.00 31.29 ? 414 TRP B CH2 1 
ATOM   7687 N  N   . GLU B 2 415 ? 123.424 8.510   73.538  1.00 47.30 ? 415 GLU B N   1 
ATOM   7688 C  CA  . GLU B 2 415 ? 123.085 7.882   74.800  1.00 51.15 ? 415 GLU B CA  1 
ATOM   7689 C  C   . GLU B 2 415 ? 121.686 7.328   74.686  1.00 51.50 ? 415 GLU B C   1 
ATOM   7690 O  O   . GLU B 2 415 ? 120.963 7.642   73.745  1.00 49.83 ? 415 GLU B O   1 
ATOM   7691 C  CB  . GLU B 2 415 ? 123.272 8.796   76.020  1.00 54.27 ? 415 GLU B CB  1 
ATOM   7692 C  CG  . GLU B 2 415 ? 122.351 9.984   76.164  1.00 58.01 ? 415 GLU B CG  1 
ATOM   7693 C  CD  . GLU B 2 415 ? 122.537 10.646  77.523  1.00 60.43 ? 415 GLU B CD  1 
ATOM   7694 O  OE1 . GLU B 2 415 ? 123.707 10.809  77.966  1.00 60.98 ? 415 GLU B OE1 1 
ATOM   7695 O  OE2 . GLU B 2 415 ? 121.513 10.978  78.160  1.00 61.03 ? 415 GLU B OE2 1 
ATOM   7696 N  N   . PHE B 2 416 ? 121.312 6.511   75.659  1.00 53.75 ? 416 PHE B N   1 
ATOM   7697 C  CA  . PHE B 2 416 ? 120.035 5.820   75.636  1.00 55.86 ? 416 PHE B CA  1 
ATOM   7698 C  C   . PHE B 2 416 ? 119.075 6.122   76.783  1.00 56.80 ? 416 PHE B C   1 
ATOM   7699 O  O   . PHE B 2 416 ? 119.474 6.143   77.949  1.00 55.22 ? 416 PHE B O   1 
ATOM   7700 C  CB  . PHE B 2 416 ? 120.325 4.310   75.540  1.00 55.84 ? 416 PHE B CB  1 
ATOM   7701 C  CG  . PHE B 2 416 ? 121.408 3.980   74.553  1.00 54.79 ? 416 PHE B CG  1 
ATOM   7702 C  CD1 . PHE B 2 416 ? 122.745 4.010   74.937  1.00 55.56 ? 416 PHE B CD1 1 
ATOM   7703 C  CD2 . PHE B 2 416 ? 121.104 3.780   73.213  1.00 55.42 ? 416 PHE B CD2 1 
ATOM   7704 C  CE1 . PHE B 2 416 ? 123.773 3.859   73.989  1.00 56.87 ? 416 PHE B CE1 1 
ATOM   7705 C  CE2 . PHE B 2 416 ? 122.118 3.627   72.262  1.00 55.99 ? 416 PHE B CE2 1 
ATOM   7706 C  CZ  . PHE B 2 416 ? 123.457 3.672   72.649  1.00 56.42 ? 416 PHE B CZ  1 
ATOM   7707 N  N   . VAL B 2 417 ? 117.819 6.393   76.430  1.00 60.60 ? 417 VAL B N   1 
ATOM   7708 C  CA  . VAL B 2 417 ? 116.786 6.661   77.419  1.00 64.38 ? 417 VAL B CA  1 
ATOM   7709 C  C   . VAL B 2 417 ? 115.987 5.415   77.779  1.00 67.71 ? 417 VAL B C   1 
ATOM   7710 O  O   . VAL B 2 417 ? 115.362 4.776   76.924  1.00 67.12 ? 417 VAL B O   1 
ATOM   7711 C  CB  . VAL B 2 417 ? 115.794 7.772   76.994  1.00 63.88 ? 417 VAL B CB  1 
ATOM   7712 C  CG1 . VAL B 2 417 ? 116.519 9.107   76.923  1.00 64.00 ? 417 VAL B CG1 1 
ATOM   7713 C  CG2 . VAL B 2 417 ? 115.096 7.420   75.666  1.00 63.58 ? 417 VAL B CG2 1 
ATOM   7714 N  N   . ASN B 2 418 ? 116.075 5.061   79.057  1.00 71.20 ? 418 ASN B N   1 
ATOM   7715 C  CA  . ASN B 2 418 ? 115.355 3.939   79.644  1.00 74.66 ? 418 ASN B CA  1 
ATOM   7716 C  C   . ASN B 2 418 ? 114.195 4.655   80.322  1.00 75.31 ? 418 ASN B C   1 
ATOM   7717 O  O   . ASN B 2 418 ? 113.606 4.177   81.291  1.00 76.31 ? 418 ASN B O   1 
ATOM   7718 C  CB  . ASN B 2 418 ? 116.221 3.254   80.700  1.00 75.73 ? 418 ASN B CB  1 
ATOM   7719 C  CG  . ASN B 2 418 ? 117.664 3.131   80.270  1.00 76.61 ? 418 ASN B CG  1 
ATOM   7720 O  OD1 . ASN B 2 418 ? 118.572 3.646   80.939  1.00 76.61 ? 418 ASN B OD1 1 
ATOM   7721 N  ND2 . ASN B 2 418 ? 117.885 2.490   79.122  1.00 76.63 ? 418 ASN B ND2 1 
ATOM   7722 N  N   . THR B 2 419 ? 113.915 5.841   79.799  1.00 76.40 ? 419 THR B N   1 
ATOM   7723 C  CA  . THR B 2 419 ? 112.880 6.703   80.292  1.00 78.13 ? 419 THR B CA  1 
ATOM   7724 C  C   . THR B 2 419 ? 111.861 6.853   79.179  1.00 77.00 ? 419 THR B C   1 
ATOM   7725 O  O   . THR B 2 419 ? 112.155 7.345   78.075  1.00 75.64 ? 419 THR B O   1 
ATOM   7726 C  CB  . THR B 2 419 ? 113.474 8.067   80.779  1.00 78.63 ? 419 THR B CB  1 
ATOM   7727 O  OG1 . THR B 2 419 ? 114.075 7.887   82.074  1.00 77.38 ? 419 THR B OG1 1 
ATOM   7728 C  CG2 . THR B 2 419 ? 112.403 9.166   80.851  1.00 79.31 ? 419 THR B CG2 1 
ATOM   7729 N  N   . PRO B 2 420 ? 110.714 6.213   79.391  1.00 77.56 ? 420 PRO B N   1 
ATOM   7730 C  CA  . PRO B 2 420 ? 109.586 6.226   78.466  1.00 79.43 ? 420 PRO B CA  1 
ATOM   7731 C  C   . PRO B 2 420 ? 109.044 7.645   78.249  1.00 79.24 ? 420 PRO B C   1 
ATOM   7732 O  O   . PRO B 2 420 ? 109.352 8.595   78.972  1.00 78.16 ? 420 PRO B O   1 
ATOM   7733 C  CB  . PRO B 2 420 ? 108.583 5.254   79.113  1.00 78.49 ? 420 PRO B CB  1 
ATOM   7734 C  CG  . PRO B 2 420 ? 109.031 5.145   80.549  1.00 78.21 ? 420 PRO B CG  1 
ATOM   7735 C  CD  . PRO B 2 420 ? 110.509 5.223   80.467  1.00 77.63 ? 420 PRO B CD  1 
ATOM   7736 N  N   . PRO B 2 421 ? 108.263 7.804   77.183  1.00 79.57 ? 421 PRO B N   1 
ATOM   7737 C  CA  . PRO B 2 421 ? 107.665 9.086   76.826  1.00 81.08 ? 421 PRO B CA  1 
ATOM   7738 C  C   . PRO B 2 421 ? 106.217 9.414   77.181  1.00 80.22 ? 421 PRO B C   1 
ATOM   7739 O  O   . PRO B 2 421 ? 105.253 8.859   76.625  1.00 79.78 ? 421 PRO B O   1 
ATOM   7740 C  CB  . PRO B 2 421 ? 107.872 9.095   75.320  1.00 81.95 ? 421 PRO B CB  1 
ATOM   7741 C  CG  . PRO B 2 421 ? 107.516 7.677   74.977  1.00 82.81 ? 421 PRO B CG  1 
ATOM   7742 C  CD  . PRO B 2 421 ? 108.164 6.848   76.074  1.00 81.70 ? 421 PRO B CD  1 
ATOM   7743 N  N   . LEU B 2 422 ? 106.068 10.312  78.152  1.00 79.62 ? 422 LEU B N   1 
ATOM   7744 C  CA  . LEU B 2 422 ? 104.737 10.802  78.499  1.00 79.52 ? 422 LEU B CA  1 
ATOM   7745 C  C   . LEU B 2 422 ? 104.461 11.646  77.257  1.00 78.72 ? 422 LEU B C   1 
ATOM   7746 O  O   . LEU B 2 422 ? 103.344 11.707  76.747  1.00 77.89 ? 422 LEU B O   1 
ATOM   7747 C  CB  . LEU B 2 422 ? 104.799 11.701  79.740  1.00 79.47 ? 422 LEU B CB  1 
ATOM   7748 C  CG  . LEU B 2 422 ? 104.987 10.978  81.080  1.00 78.21 ? 422 LEU B CG  1 
ATOM   7749 C  CD1 . LEU B 2 422 ? 105.666 11.873  82.091  1.00 77.28 ? 422 LEU B CD1 1 
ATOM   7750 C  CD2 . LEU B 2 422 ? 103.661 10.461  81.613  1.00 77.82 ? 422 LEU B CD2 1 
ATOM   7751 N  N   . VAL B 2 423 ? 105.570 12.165  76.725  1.00 78.87 ? 423 VAL B N   1 
ATOM   7752 C  CA  . VAL B 2 423 ? 105.669 12.997  75.536  1.00 79.31 ? 423 VAL B CA  1 
ATOM   7753 C  C   . VAL B 2 423 ? 105.073 12.271  74.347  1.00 79.65 ? 423 VAL B C   1 
ATOM   7754 O  O   . VAL B 2 423 ? 104.889 12.854  73.281  1.00 79.75 ? 423 VAL B O   1 
ATOM   7755 C  CB  . VAL B 2 423 ? 107.166 13.267  75.221  1.00 79.57 ? 423 VAL B CB  1 
ATOM   7756 C  CG1 . VAL B 2 423 ? 107.312 14.311  74.142  1.00 80.07 ? 423 VAL B CG1 1 
ATOM   7757 C  CG2 . VAL B 2 423 ? 107.920 13.672  76.486  1.00 79.72 ? 423 VAL B CG2 1 
ATOM   7758 N  N   . LYS B 2 424 ? 104.828 10.978  74.511  1.00 79.94 ? 424 LYS B N   1 
ATOM   7759 C  CA  . LYS B 2 424 ? 104.260 10.205  73.434  1.00 80.48 ? 424 LYS B CA  1 
ATOM   7760 C  C   . LYS B 2 424 ? 102.834 10.653  73.141  1.00 80.97 ? 424 LYS B C   1 
ATOM   7761 O  O   . LYS B 2 424 ? 101.909 10.378  73.919  1.00 80.23 ? 424 LYS B O   1 
ATOM   7762 C  CB  . LYS B 2 424 ? 104.286 8.715   73.758  1.00 81.20 ? 424 LYS B CB  1 
ATOM   7763 C  CG  . LYS B 2 424 ? 103.929 7.830   72.563  1.00 83.12 ? 424 LYS B CG  1 
ATOM   7764 C  CD  . LYS B 2 424 ? 103.915 6.345   72.938  1.00 86.43 ? 424 LYS B CD  1 
ATOM   7765 C  CE  . LYS B 2 424 ? 103.550 5.449   71.744  1.00 87.05 ? 424 LYS B CE  1 
ATOM   7766 N  NZ  . LYS B 2 424 ? 103.662 3.984   72.055  1.00 86.54 ? 424 LYS B NZ  1 
ATOM   7767 N  N   . LEU B 2 425 ? 102.704 11.449  72.081  1.00 81.25 ? 425 LEU B N   1 
ATOM   7768 C  CA  . LEU B 2 425 ? 101.425 11.941  71.582  1.00 81.71 ? 425 LEU B CA  1 
ATOM   7769 C  C   . LEU B 2 425 ? 101.448 11.654  70.079  1.00 84.00 ? 425 LEU B C   1 
ATOM   7770 O  O   . LEU B 2 425 ? 102.041 10.668  69.639  1.00 83.26 ? 425 LEU B O   1 
ATOM   7771 C  CB  . LEU B 2 425 ? 101.237 13.444  71.854  1.00 78.59 ? 425 LEU B CB  1 
ATOM   7772 C  CG  . LEU B 2 425 ? 102.424 14.378  72.078  1.00 76.33 ? 425 LEU B CG  1 
ATOM   7773 C  CD1 . LEU B 2 425 ? 102.125 15.730  71.501  1.00 76.43 ? 425 LEU B CD1 1 
ATOM   7774 C  CD2 . LEU B 2 425 ? 102.707 14.517  73.552  1.00 74.95 ? 425 LEU B CD2 1 
ATOM   7775 N  N   . TRP B 2 426 ? 100.711 12.430  69.299  1.00 87.79 ? 426 TRP B N   1 
ATOM   7776 C  CA  . TRP B 2 426 ? 100.737 12.231  67.855  1.00 91.57 ? 426 TRP B CA  1 
ATOM   7777 C  C   . TRP B 2 426 ? 101.899 13.005  67.276  1.00 92.14 ? 426 TRP B C   1 
ATOM   7778 O  O   . TRP B 2 426 ? 102.259 12.816  66.111  1.00 91.25 ? 426 TRP B O   1 
ATOM   7779 C  CB  . TRP B 2 426 ? 99.427  12.661  67.224  1.00 95.01 ? 426 TRP B CB  1 
ATOM   7780 C  CG  . TRP B 2 426 ? 98.336  11.741  67.616  1.00 99.72 ? 426 TRP B CG  1 
ATOM   7781 C  CD1 . TRP B 2 426 ? 97.504  11.864  68.706  1.00 99.90 ? 426 TRP B CD1 1 
ATOM   7782 C  CD2 . TRP B 2 426 ? 97.976  10.523  66.970  1.00 99.90 ? 426 TRP B CD2 1 
ATOM   7783 N  NE1 . TRP B 2 426 ? 96.650  10.793  68.769  1.00 99.90 ? 426 TRP B NE1 1 
ATOM   7784 C  CE2 . TRP B 2 426 ? 96.916  9.957   67.719  1.00 99.90 ? 426 TRP B CE2 1 
ATOM   7785 C  CE3 . TRP B 2 426 ? 98.443  9.851   65.827  1.00 99.90 ? 426 TRP B CE3 1 
ATOM   7786 C  CZ2 . TRP B 2 426 ? 96.310  8.735   67.358  1.00 99.90 ? 426 TRP B CZ2 1 
ATOM   7787 C  CZ3 . TRP B 2 426 ? 97.845  8.642   65.469  1.00 99.90 ? 426 TRP B CZ3 1 
ATOM   7788 C  CH2 . TRP B 2 426 ? 96.788  8.101   66.234  1.00 99.90 ? 426 TRP B CH2 1 
ATOM   7789 N  N   . TYR B 2 427 ? 102.410 13.939  68.081  1.00 93.39 ? 427 TYR B N   1 
ATOM   7790 C  CA  . TYR B 2 427 ? 103.570 14.745  67.718  1.00 94.21 ? 427 TYR B CA  1 
ATOM   7791 C  C   . TYR B 2 427 ? 104.758 13.843  68.032  1.00 94.69 ? 427 TYR B C   1 
ATOM   7792 O  O   . TYR B 2 427 ? 105.722 13.846  67.245  1.00 95.27 ? 427 TYR B O   1 
ATOM   7793 C  CB  . TYR B 2 427 ? 103.661 16.035  68.565  1.00 93.23 ? 427 TYR B CB  1 
ATOM   7794 C  CG  . TYR B 2 427 ? 105.028 16.258  69.227  1.00 92.54 ? 427 TYR B CG  1 
ATOM   7795 C  CD1 . TYR B 2 427 ? 105.319 15.704  70.484  1.00 91.57 ? 427 TYR B CD1 1 
ATOM   7796 C  CD2 . TYR B 2 427 ? 106.047 16.964  68.575  1.00 91.41 ? 427 TYR B CD2 1 
ATOM   7797 C  CE1 . TYR B 2 427 ? 106.581 15.838  71.065  1.00 89.66 ? 427 TYR B CE1 1 
ATOM   7798 C  CE2 . TYR B 2 427 ? 107.318 17.108  69.158  1.00 89.37 ? 427 TYR B CE2 1 
ATOM   7799 C  CZ  . TYR B 2 427 ? 107.569 16.536  70.399  1.00 88.58 ? 427 TYR B CZ  1 
ATOM   7800 O  OH  . TYR B 2 427 ? 108.806 16.657  70.985  1.00 86.36 ? 427 TYR B OH  1 
ATOM   7801 O  OXT . TYR B 2 427 ? 104.721 13.173  69.092  1.00 94.58 ? 427 TYR B OXT 1 
HETATM 7802 N  N1  . TBO C 3 .   ? 141.497 -25.398 71.596  1.00 69.19 ? 559 TBO A N1  1 
HETATM 7803 C  C1A . TBO C 3 .   ? 142.104 -25.844 72.816  1.00 69.08 ? 559 TBO A C1A 1 
HETATM 7804 C  C2  . TBO C 3 .   ? 142.455 -24.572 70.931  1.00 71.09 ? 559 TBO A C2  1 
HETATM 7805 S  S2  . TBO C 3 .   ? 142.255 -23.796 69.435  1.00 73.22 ? 559 TBO A S2  1 
HETATM 7806 N  N3  . TBO C 3 .   ? 143.612 -24.561 71.712  1.00 70.01 ? 559 TBO A N3  1 
HETATM 7807 C  C3A . TBO C 3 .   ? 143.327 -25.303 72.847  1.00 68.73 ? 559 TBO A C3A 1 
HETATM 7808 C  C4  . TBO C 3 .   ? 144.814 -23.942 71.226  1.00 69.10 ? 559 TBO A C4  1 
HETATM 7809 C  C5  . TBO C 3 .   ? 145.498 -23.034 72.184  1.00 66.93 ? 559 TBO A C5  1 
HETATM 7810 N  N6  . TBO C 3 .   ? 145.436 -23.342 73.597  1.00 65.53 ? 559 TBO A N6  1 
HETATM 7811 C  C7  . TBO C 3 .   ? 145.575 -24.742 73.876  1.00 66.54 ? 559 TBO A C7  1 
HETATM 7812 C  C7A . TBO C 3 .   ? 144.236 -25.403 73.908  1.00 67.69 ? 559 TBO A C7A 1 
HETATM 7813 C  C8  . TBO C 3 .   ? 143.845 -26.199 75.033  1.00 67.40 ? 559 TBO A C8  1 
HETATM 7814 CL CL8 . TBO C 3 .   ? 144.878 -26.346 76.426  1.00 67.92 ? 559 TBO A CL8 1 
HETATM 7815 C  C9  . TBO C 3 .   ? 142.587 -26.837 75.038  1.00 67.63 ? 559 TBO A C9  1 
HETATM 7816 C  C10 . TBO C 3 .   ? 141.709 -26.663 73.897  1.00 68.83 ? 559 TBO A C10 1 
HETATM 7817 C  C11 . TBO C 3 .   ? 146.901 -23.296 71.833  1.00 66.15 ? 559 TBO A C11 1 
HETATM 7818 C  C12 . TBO C 3 .   ? 145.880 -22.350 74.652  1.00 65.50 ? 559 TBO A C12 1 
HETATM 7819 C  C13 . TBO C 3 .   ? 144.759 -22.025 75.625  1.00 63.61 ? 559 TBO A C13 1 
HETATM 7820 C  C14 . TBO C 3 .   ? 144.782 -21.446 76.815  1.00 61.54 ? 559 TBO A C14 1 
HETATM 7821 C  C15 . TBO C 3 .   ? 143.378 -21.415 77.286  1.00 62.16 ? 559 TBO A C15 1 
HETATM 7822 C  C16 . TBO C 3 .   ? 146.053 -20.963 77.459  1.00 59.25 ? 559 TBO A C16 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   1   1   PRO PRO A . n 
A 1 2   ILE 2   2   2   ILE ILE A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   GLU 6   6   6   GLU GLU A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  LEU 12  12  12  LEU LEU A . n 
A 1 13  LYS 13  13  13  LYS LYS A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  PRO 19  19  19  PRO PRO A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  TRP 24  24  24  TRP TRP A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  THR 27  27  27  THR THR A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  ILE 31  31  31  ILE ILE A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  ILE 37  37  37  ILE ILE A . n 
A 1 38  CYS 38  38  38  CYS CYS A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  MET 41  41  41  MET MET A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  SER 48  48  48  SER SER A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TYR 56  56  56  TYR TYR A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  THR 58  58  58  THR THR A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  PHE 61  61  61  PHE PHE A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  LYS 64  64  64  LYS LYS A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  LYS 70  70  70  LYS LYS A . n 
A 1 71  TRP 71  71  71  TRP TRP A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  ARG 83  83  83  ARG ARG A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  PHE 87  87  87  PHE PHE A . n 
A 1 88  TRP 88  88  88  TRP TRP A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  GLY 93  93  93  GLY GLY A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  HIS 96  96  96  HIS HIS A . n 
A 1 97  PRO 97  97  97  PRO PRO A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 LYS 101 101 101 LYS LYS A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 TYR 115 115 115 TYR TYR A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 PRO 119 119 119 PRO PRO A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 ASP 121 121 121 ASP ASP A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 LYS 126 126 126 LYS LYS A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 PHE 130 130 130 PHE PHE A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 SER 134 134 134 SER SER A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 ASN 136 136 136 ASN ASN A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 PRO 140 140 140 PRO PRO A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 ASN 147 147 147 ASN ASN A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 TRP 153 153 153 TRP TRP A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 PHE 160 160 160 PHE PHE A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 MET 164 164 164 MET MET A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 PRO 170 170 170 PRO PRO A . n 
A 1 171 PHE 171 171 171 PHE PHE A . n 
A 1 172 LYS 172 172 172 LYS LYS A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 GLN 174 174 174 GLN GLN A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 PRO 176 176 176 PRO PRO A . n 
A 1 177 ASP 177 177 177 ASP ASP A . n 
A 1 178 ILE 178 178 178 ILE ILE A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 CYS 181 181 181 CYS CYS A . n 
A 1 182 GLN 182 182 182 GLN GLN A . n 
A 1 183 TYR 183 183 183 TYR TYR A . n 
A 1 184 MET 184 184 184 MET MET A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 ASP 186 186 186 ASP ASP A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 TYR 188 188 188 TYR TYR A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 ILE 195 195 195 ILE ILE A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLN 197 197 197 GLN GLN A . n 
A 1 198 HIS 198 198 198 HIS HIS A . n 
A 1 199 ARG 199 199 199 ARG ARG A . n 
A 1 200 THR 200 200 200 THR THR A . n 
A 1 201 LYS 201 201 201 LYS LYS A . n 
A 1 202 ILE 202 202 202 ILE ILE A . n 
A 1 203 GLU 203 203 203 GLU GLU A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 GLN 207 207 207 GLN GLN A . n 
A 1 208 HIS 208 208 208 HIS HIS A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 ARG 211 211 211 ARG ARG A . n 
A 1 212 TRP 212 212 212 TRP TRP A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 THR 215 215 215 THR THR A . n 
A 1 216 THR 216 216 216 THR THR A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 ASP 218 218 218 ASP ASP A . n 
A 1 219 LYS 219 219 219 LYS LYS A . n 
A 1 220 LYS 220 220 220 LYS LYS A . n 
A 1 221 HIS 221 221 221 HIS HIS A . n 
A 1 222 GLN 222 222 222 GLN GLN A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 GLU 224 224 224 GLU GLU A . n 
A 1 225 PRO 225 225 225 PRO PRO A . n 
A 1 226 PRO 226 226 226 PRO PRO A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 TRP 229 229 229 TRP TRP A . n 
A 1 230 MET 230 230 230 MET MET A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 TYR 232 232 232 TYR TYR A . n 
A 1 233 GLU 233 233 233 GLU GLU A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 HIS 235 235 235 HIS HIS A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 ASP 237 237 237 ASP ASP A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 TRP 239 239 239 TRP TRP A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 PRO 243 243 243 PRO PRO A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 PRO 247 247 247 PRO PRO A . n 
A 1 248 GLU 248 248 248 GLU GLU A . n 
A 1 249 LYS 249 249 249 LYS LYS A . n 
A 1 250 ASP 250 250 250 ASP ASP A . n 
A 1 251 SER 251 251 251 SER SER A . n 
A 1 252 TRP 252 252 252 TRP TRP A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 VAL 254 254 254 VAL VAL A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 ASP 256 256 256 ASP ASP A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 GLN 258 258 258 GLN GLN A . n 
A 1 259 LYS 259 259 259 LYS LYS A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 VAL 261 261 261 VAL VAL A . n 
A 1 262 GLY 262 262 262 GLY GLY A . n 
A 1 263 LYS 263 263 263 LYS LYS A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 TRP 266 266 266 TRP TRP A . n 
A 1 267 ALA 267 267 267 ALA ALA A . n 
A 1 268 SER 268 268 268 SER SER A . n 
A 1 269 GLN 269 269 269 GLN GLN A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 TYR 271 271 271 TYR TYR A . n 
A 1 272 PRO 272 272 272 PRO PRO A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 ILE 274 274 274 ILE ILE A . n 
A 1 275 LYS 275 275 275 LYS LYS A . n 
A 1 276 VAL 276 276 276 VAL VAL A . n 
A 1 277 ARG 277 277 277 ARG ARG A . n 
A 1 278 GLN 278 278 278 GLN GLN A . n 
A 1 279 LEU 279 279 279 LEU LEU A . n 
A 1 280 SER 280 280 280 SER SER A . n 
A 1 281 LYS 281 281 281 LYS LYS A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 LEU 283 283 283 LEU LEU A . n 
A 1 284 ARG 284 284 284 ARG ARG A . n 
A 1 285 GLY 285 285 285 GLY GLY A . n 
A 1 286 THR 286 286 286 THR THR A . n 
A 1 287 LYS 287 287 287 LYS LYS A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 VAL 292 292 292 VAL VAL A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 THR 296 296 296 THR THR A . n 
A 1 297 GLU 297 297 297 GLU GLU A . n 
A 1 298 GLU 298 298 298 GLU GLU A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 GLU 300 300 300 GLU GLU A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 GLU 302 302 302 GLU GLU A . n 
A 1 303 LEU 303 303 303 LEU LEU A . n 
A 1 304 ALA 304 304 304 ALA ALA A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 ASN 306 306 306 ASN ASN A . n 
A 1 307 ARG 307 307 307 ARG ARG A . n 
A 1 308 GLU 308 308 308 GLU GLU A . n 
A 1 309 ILE 309 309 309 ILE ILE A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 LYS 311 311 311 LYS LYS A . n 
A 1 312 GLU 312 312 312 GLU GLU A . n 
A 1 313 PRO 313 313 313 PRO PRO A . n 
A 1 314 VAL 314 314 314 VAL VAL A . n 
A 1 315 HIS 315 315 315 HIS HIS A . n 
A 1 316 GLY 316 316 316 GLY GLY A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 TYR 318 318 318 TYR TYR A . n 
A 1 319 TYR 319 319 319 TYR TYR A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PRO 321 321 321 PRO PRO A . n 
A 1 322 SER 322 322 322 SER SER A . n 
A 1 323 LYS 323 323 323 LYS LYS A . n 
A 1 324 ASP 324 324 324 ASP ASP A . n 
A 1 325 LEU 325 325 325 LEU LEU A . n 
A 1 326 ILE 326 326 326 ILE ILE A . n 
A 1 327 ALA 327 327 327 ALA ALA A . n 
A 1 328 GLU 328 328 328 GLU GLU A . n 
A 1 329 ILE 329 329 329 ILE ILE A . n 
A 1 330 GLN 330 330 330 GLN GLN A . n 
A 1 331 LYS 331 331 331 LYS LYS A . n 
A 1 332 GLN 332 332 332 GLN GLN A . n 
A 1 333 GLY 333 333 333 GLY GLY A . n 
A 1 334 GLN 334 334 334 GLN GLN A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 GLN 336 336 336 GLN GLN A . n 
A 1 337 TRP 337 337 337 TRP TRP A . n 
A 1 338 THR 338 338 338 THR THR A . n 
A 1 339 TYR 339 339 339 TYR TYR A . n 
A 1 340 GLN 340 340 340 GLN GLN A . n 
A 1 341 ILE 341 341 341 ILE ILE A . n 
A 1 342 TYR 342 342 342 TYR TYR A . n 
A 1 343 GLN 343 343 343 GLN GLN A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 PRO 345 345 345 PRO PRO A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 LYS 347 347 347 LYS LYS A . n 
A 1 348 ASN 348 348 348 ASN ASN A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 LYS 350 350 350 LYS LYS A . n 
A 1 351 THR 351 351 351 THR THR A . n 
A 1 352 GLY 352 352 352 GLY GLY A . n 
A 1 353 LYS 353 353 353 LYS LYS A . n 
A 1 354 TYR 354 354 354 TYR TYR A . n 
A 1 355 ALA 355 355 355 ALA ALA A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 MET 357 357 357 MET MET A . n 
A 1 358 ARG 358 358 358 ARG ARG A . n 
A 1 359 GLY 359 359 359 GLY GLY A . n 
A 1 360 ALA 360 360 360 ALA ALA A . n 
A 1 361 HIS 361 361 361 HIS HIS A . n 
A 1 362 THR 362 362 362 THR THR A . n 
A 1 363 ASN 363 363 363 ASN ASN A . n 
A 1 364 ASP 364 364 364 ASP ASP A . n 
A 1 365 VAL 365 365 365 VAL VAL A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 GLN 367 367 367 GLN GLN A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 THR 369 369 369 THR THR A . n 
A 1 370 GLU 370 370 370 GLU GLU A . n 
A 1 371 ALA 371 371 371 ALA ALA A . n 
A 1 372 VAL 372 372 372 VAL VAL A . n 
A 1 373 GLN 373 373 373 GLN GLN A . n 
A 1 374 LYS 374 374 374 LYS LYS A . n 
A 1 375 ILE 375 375 375 ILE ILE A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 THR 377 377 377 THR THR A . n 
A 1 378 GLU 378 378 378 GLU GLU A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 ILE 380 380 380 ILE ILE A . n 
A 1 381 VAL 381 381 381 VAL VAL A . n 
A 1 382 ILE 382 382 382 ILE ILE A . n 
A 1 383 TRP 383 383 383 TRP TRP A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 LYS 385 385 385 LYS LYS A . n 
A 1 386 THR 386 386 386 THR THR A . n 
A 1 387 PRO 387 387 387 PRO PRO A . n 
A 1 388 LYS 388 388 388 LYS LYS A . n 
A 1 389 PHE 389 389 389 PHE PHE A . n 
A 1 390 LYS 390 390 390 LYS LYS A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 ILE 393 393 393 ILE ILE A . n 
A 1 394 GLN 394 394 394 GLN GLN A . n 
A 1 395 LYS 395 395 395 LYS LYS A . n 
A 1 396 GLU 396 396 396 GLU GLU A . n 
A 1 397 THR 397 397 397 THR THR A . n 
A 1 398 TRP 398 398 398 TRP TRP A . n 
A 1 399 GLU 399 399 399 GLU GLU A . n 
A 1 400 THR 400 400 400 THR THR A . n 
A 1 401 TRP 401 401 401 TRP TRP A . n 
A 1 402 TRP 402 402 402 TRP TRP A . n 
A 1 403 THR 403 403 403 THR THR A . n 
A 1 404 GLU 404 404 404 GLU GLU A . n 
A 1 405 TYR 405 405 405 TYR TYR A . n 
A 1 406 TRP 406 406 406 TRP TRP A . n 
A 1 407 GLN 407 407 407 GLN GLN A . n 
A 1 408 ALA 408 408 408 ALA ALA A . n 
A 1 409 THR 409 409 409 THR THR A . n 
A 1 410 TRP 410 410 410 TRP TRP A . n 
A 1 411 ILE 411 411 411 ILE ILE A . n 
A 1 412 PRO 412 412 412 PRO PRO A . n 
A 1 413 GLU 413 413 413 GLU GLU A . n 
A 1 414 TRP 414 414 414 TRP TRP A . n 
A 1 415 GLU 415 415 415 GLU GLU A . n 
A 1 416 PHE 416 416 416 PHE PHE A . n 
A 1 417 VAL 417 417 417 VAL VAL A . n 
A 1 418 ASN 418 418 418 ASN ASN A . n 
A 1 419 THR 419 419 419 THR THR A . n 
A 1 420 PRO 420 420 420 PRO PRO A . n 
A 1 421 PRO 421 421 421 PRO PRO A . n 
A 1 422 LEU 422 422 422 LEU LEU A . n 
A 1 423 VAL 423 423 423 VAL VAL A . n 
A 1 424 LYS 424 424 424 LYS LYS A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 TRP 426 426 426 TRP TRP A . n 
A 1 427 TYR 427 427 427 TYR TYR A . n 
A 1 428 GLN 428 428 428 GLN GLN A . n 
A 1 429 LEU 429 429 429 LEU LEU A . n 
A 1 430 GLU 430 430 430 GLU GLU A . n 
A 1 431 LYS 431 431 431 LYS LYS A . n 
A 1 432 GLU 432 432 432 GLU GLU A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 ILE 434 434 434 ILE ILE A . n 
A 1 435 VAL 435 435 435 VAL VAL A . n 
A 1 436 GLY 436 436 436 GLY GLY A . n 
A 1 437 ALA 437 437 437 ALA ALA A . n 
A 1 438 GLU 438 438 438 GLU GLU A . n 
A 1 439 THR 439 439 439 THR THR A . n 
A 1 440 PHE 440 440 440 PHE PHE A . n 
A 1 441 TYR 441 441 441 TYR TYR A . n 
A 1 442 VAL 442 442 442 VAL VAL A . n 
A 1 443 ASP 443 443 443 ASP ASP A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 ALA 445 445 445 ALA ALA A . n 
A 1 446 ALA 446 446 446 ALA ALA A . n 
A 1 447 ASN 447 447 447 ASN ASN A . n 
A 1 448 ARG 448 448 448 ARG ARG A . n 
A 1 449 GLU 449 449 449 GLU GLU A . n 
A 1 450 THR 450 450 450 THR THR A . n 
A 1 451 LYS 451 451 451 LYS LYS A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 GLY 453 453 453 GLY GLY A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 ALA 455 455 455 ALA ALA A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 TYR 457 457 457 TYR TYR A . n 
A 1 458 VAL 458 458 458 VAL VAL A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ASN 460 460 460 ASN ASN A . n 
A 1 461 LYS 461 461 461 LYS LYS A . n 
A 1 462 GLY 462 462 462 GLY GLY A . n 
A 1 463 ARG 463 463 463 ARG ARG A . n 
A 1 464 GLN 464 464 464 GLN GLN A . n 
A 1 465 LYS 465 465 465 LYS LYS A . n 
A 1 466 VAL 466 466 466 VAL VAL A . n 
A 1 467 VAL 467 467 467 VAL VAL A . n 
A 1 468 PRO 468 468 468 PRO PRO A . n 
A 1 469 LEU 469 469 469 LEU LEU A . n 
A 1 470 THR 470 470 470 THR THR A . n 
A 1 471 ASN 471 471 471 ASN ASN A . n 
A 1 472 THR 472 472 472 THR THR A . n 
A 1 473 THR 473 473 473 THR THR A . n 
A 1 474 ASN 474 474 474 ASN ASN A . n 
A 1 475 GLN 475 475 475 GLN GLN A . n 
A 1 476 LYS 476 476 476 LYS LYS A . n 
A 1 477 THR 477 477 477 THR THR A . n 
A 1 478 GLU 478 478 478 GLU GLU A . n 
A 1 479 LEU 479 479 479 LEU LEU A . n 
A 1 480 GLN 480 480 480 GLN GLN A . n 
A 1 481 ALA 481 481 481 ALA ALA A . n 
A 1 482 ILE 482 482 482 ILE ILE A . n 
A 1 483 TYR 483 483 483 TYR TYR A . n 
A 1 484 LEU 484 484 484 LEU LEU A . n 
A 1 485 ALA 485 485 485 ALA ALA A . n 
A 1 486 LEU 486 486 486 LEU LEU A . n 
A 1 487 GLN 487 487 487 GLN GLN A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 SER 489 489 489 SER SER A . n 
A 1 490 GLY 490 490 490 GLY GLY A . n 
A 1 491 LEU 491 491 491 LEU LEU A . n 
A 1 492 GLU 492 492 492 GLU GLU A . n 
A 1 493 VAL 493 493 493 VAL VAL A . n 
A 1 494 ASN 494 494 494 ASN ASN A . n 
A 1 495 ILE 495 495 495 ILE ILE A . n 
A 1 496 VAL 496 496 496 VAL VAL A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 ASP 498 498 498 ASP ASP A . n 
A 1 499 SER 499 499 499 SER SER A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 TYR 501 501 501 TYR TYR A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 LEU 503 503 503 LEU LEU A . n 
A 1 504 GLY 504 504 504 GLY GLY A . n 
A 1 505 ILE 505 505 505 ILE ILE A . n 
A 1 506 ILE 506 506 506 ILE ILE A . n 
A 1 507 GLN 507 507 507 GLN GLN A . n 
A 1 508 ALA 508 508 508 ALA ALA A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 PRO 510 510 510 PRO PRO A . n 
A 1 511 ASP 511 511 511 ASP ASP A . n 
A 1 512 LYS 512 512 512 LYS LYS A . n 
A 1 513 SER 513 513 513 SER SER A . n 
A 1 514 GLU 514 514 514 GLU GLU A . n 
A 1 515 SER 515 515 515 SER SER A . n 
A 1 516 GLU 516 516 516 GLU GLU A . n 
A 1 517 LEU 517 517 517 LEU LEU A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 ASN 519 519 519 ASN ASN A . n 
A 1 520 GLN 520 520 520 GLN GLN A . n 
A 1 521 ILE 521 521 521 ILE ILE A . n 
A 1 522 ILE 522 522 522 ILE ILE A . n 
A 1 523 GLU 523 523 523 GLU GLU A . n 
A 1 524 GLN 524 524 524 GLN GLN A . n 
A 1 525 LEU 525 525 525 LEU LEU A . n 
A 1 526 ILE 526 526 526 ILE ILE A . n 
A 1 527 LYS 527 527 527 LYS LYS A . n 
A 1 528 LYS 528 528 528 LYS LYS A . n 
A 1 529 GLU 529 529 529 GLU GLU A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 VAL 531 531 531 VAL VAL A . n 
A 1 532 TYR 532 532 532 TYR TYR A . n 
A 1 533 LEU 533 533 533 LEU LEU A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 TRP 535 535 535 TRP TRP A . n 
A 1 536 VAL 536 536 536 VAL VAL A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 ALA 538 538 538 ALA ALA A . n 
A 1 539 HIS 539 539 539 HIS HIS A . n 
A 1 540 LYS 540 540 540 LYS LYS A . n 
A 1 541 GLY 541 541 541 GLY GLY A . n 
A 1 542 ILE 542 542 542 ILE ILE A . n 
A 1 543 GLY 543 543 543 GLY GLY A . n 
A 1 544 GLY 544 544 544 GLY GLY A . n 
A 1 545 ASN 545 545 545 ASN ASN A . n 
A 1 546 GLU 546 546 546 GLU GLU A . n 
A 1 547 GLN 547 547 547 GLN GLN A . n 
A 1 548 VAL 548 548 548 VAL VAL A . n 
A 1 549 ASP 549 549 549 ASP ASP A . n 
A 1 550 LYS 550 550 550 LYS LYS A . n 
A 1 551 LEU 551 551 551 LEU LEU A . n 
A 1 552 VAL 552 552 552 VAL VAL A . n 
A 1 553 SER 553 553 553 SER SER A . n 
A 1 554 ALA 554 554 554 ALA ALA A . n 
A 1 555 GLY 555 555 555 GLY GLY A . n 
A 1 556 ILE 556 556 556 ILE ILE A . n 
A 1 557 ARG 557 557 557 ARG ARG A . n 
A 1 558 LYS 558 558 558 LYS LYS A . n 
B 2 1   PRO 1   1   1   PRO PRO B . n 
B 2 2   ILE 2   2   2   ILE ILE B . n 
B 2 3   SER 3   3   3   SER SER B . n 
B 2 4   PRO 4   4   4   PRO PRO B . n 
B 2 5   ILE 5   5   5   ILE ILE B . n 
B 2 6   GLU 6   6   6   GLU GLU B . n 
B 2 7   THR 7   7   7   THR THR B . n 
B 2 8   VAL 8   8   8   VAL VAL B . n 
B 2 9   PRO 9   9   9   PRO PRO B . n 
B 2 10  VAL 10  10  10  VAL VAL B . n 
B 2 11  LYS 11  11  11  LYS LYS B . n 
B 2 12  LEU 12  12  12  LEU LEU B . n 
B 2 13  LYS 13  13  13  LYS LYS B . n 
B 2 14  PRO 14  14  14  PRO PRO B . n 
B 2 15  GLY 15  15  15  GLY GLY B . n 
B 2 16  MET 16  16  16  MET MET B . n 
B 2 17  ASP 17  17  17  ASP ASP B . n 
B 2 18  GLY 18  18  18  GLY GLY B . n 
B 2 19  PRO 19  19  19  PRO PRO B . n 
B 2 20  LYS 20  20  20  LYS LYS B . n 
B 2 21  VAL 21  21  21  VAL VAL B . n 
B 2 22  LYS 22  22  22  LYS LYS B . n 
B 2 23  GLN 23  23  23  GLN GLN B . n 
B 2 24  TRP 24  24  24  TRP TRP B . n 
B 2 25  PRO 25  25  25  PRO PRO B . n 
B 2 26  LEU 26  26  26  LEU LEU B . n 
B 2 27  THR 27  27  27  THR THR B . n 
B 2 28  GLU 28  28  28  GLU GLU B . n 
B 2 29  GLU 29  29  29  GLU GLU B . n 
B 2 30  LYS 30  30  30  LYS LYS B . n 
B 2 31  ILE 31  31  31  ILE ILE B . n 
B 2 32  LYS 32  32  32  LYS LYS B . n 
B 2 33  ALA 33  33  33  ALA ALA B . n 
B 2 34  LEU 34  34  34  LEU LEU B . n 
B 2 35  VAL 35  35  35  VAL VAL B . n 
B 2 36  GLU 36  36  36  GLU GLU B . n 
B 2 37  ILE 37  37  37  ILE ILE B . n 
B 2 38  CYS 38  38  38  CYS CYS B . n 
B 2 39  THR 39  39  39  THR THR B . n 
B 2 40  GLU 40  40  40  GLU GLU B . n 
B 2 41  MET 41  41  41  MET MET B . n 
B 2 42  GLU 42  42  42  GLU GLU B . n 
B 2 43  LYS 43  43  43  LYS LYS B . n 
B 2 44  GLU 44  44  44  GLU GLU B . n 
B 2 45  GLY 45  45  45  GLY GLY B . n 
B 2 46  LYS 46  46  46  LYS LYS B . n 
B 2 47  ILE 47  47  47  ILE ILE B . n 
B 2 48  SER 48  48  48  SER SER B . n 
B 2 49  LYS 49  49  49  LYS LYS B . n 
B 2 50  ILE 50  50  50  ILE ILE B . n 
B 2 51  GLY 51  51  51  GLY GLY B . n 
B 2 52  PRO 52  52  52  PRO PRO B . n 
B 2 53  GLU 53  53  53  GLU GLU B . n 
B 2 54  ASN 54  54  54  ASN ASN B . n 
B 2 55  PRO 55  55  55  PRO PRO B . n 
B 2 56  TYR 56  56  56  TYR TYR B . n 
B 2 57  ASN 57  57  57  ASN ASN B . n 
B 2 58  THR 58  58  58  THR THR B . n 
B 2 59  PRO 59  59  59  PRO PRO B . n 
B 2 60  VAL 60  60  60  VAL VAL B . n 
B 2 61  PHE 61  61  61  PHE PHE B . n 
B 2 62  ALA 62  62  62  ALA ALA B . n 
B 2 63  ILE 63  63  63  ILE ILE B . n 
B 2 64  LYS 64  64  64  LYS LYS B . n 
B 2 65  LYS 65  65  65  LYS LYS B . n 
B 2 66  LYS 66  66  66  LYS LYS B . n 
B 2 67  ASP 67  67  67  ASP ASP B . n 
B 2 68  SER 68  68  68  SER SER B . n 
B 2 69  THR 69  69  69  THR THR B . n 
B 2 70  LYS 70  70  70  LYS LYS B . n 
B 2 71  TRP 71  71  71  TRP TRP B . n 
B 2 72  ARG 72  72  72  ARG ARG B . n 
B 2 73  LYS 73  73  73  LYS LYS B . n 
B 2 74  LEU 74  74  74  LEU LEU B . n 
B 2 75  VAL 75  75  75  VAL VAL B . n 
B 2 76  ASP 76  76  76  ASP ASP B . n 
B 2 77  PHE 77  77  77  PHE PHE B . n 
B 2 78  ARG 78  78  78  ARG ARG B . n 
B 2 79  GLU 79  79  79  GLU GLU B . n 
B 2 80  LEU 80  80  80  LEU LEU B . n 
B 2 81  ASN 81  81  81  ASN ASN B . n 
B 2 82  LYS 82  82  82  LYS LYS B . n 
B 2 83  ARG 83  83  83  ARG ARG B . n 
B 2 84  THR 84  84  84  THR THR B . n 
B 2 85  GLN 85  85  85  GLN GLN B . n 
B 2 86  ASP 86  86  86  ASP ASP B . n 
B 2 87  PHE 87  87  87  PHE PHE B . n 
B 2 88  TRP 88  88  88  TRP TRP B . n 
B 2 89  GLU 89  89  89  GLU GLU B . n 
B 2 90  VAL 90  90  90  VAL VAL B . n 
B 2 91  GLN 91  91  91  GLN GLN B . n 
B 2 92  LEU 92  92  92  LEU LEU B . n 
B 2 93  GLY 93  93  93  GLY GLY B . n 
B 2 94  ILE 94  94  94  ILE ILE B . n 
B 2 95  PRO 95  95  95  PRO PRO B . n 
B 2 96  HIS 96  96  96  HIS HIS B . n 
B 2 97  PRO 97  97  97  PRO PRO B . n 
B 2 98  ALA 98  98  98  ALA ALA B . n 
B 2 99  GLY 99  99  99  GLY GLY B . n 
B 2 100 LEU 100 100 100 LEU LEU B . n 
B 2 101 LYS 101 101 101 LYS LYS B . n 
B 2 102 LYS 102 102 102 LYS LYS B . n 
B 2 103 LYS 103 103 103 LYS LYS B . n 
B 2 104 LYS 104 104 104 LYS LYS B . n 
B 2 105 SER 105 105 105 SER SER B . n 
B 2 106 VAL 106 106 106 VAL VAL B . n 
B 2 107 THR 107 107 107 THR THR B . n 
B 2 108 VAL 108 108 108 VAL VAL B . n 
B 2 109 LEU 109 109 109 LEU LEU B . n 
B 2 110 ASP 110 110 110 ASP ASP B . n 
B 2 111 VAL 111 111 111 VAL VAL B . n 
B 2 112 GLY 112 112 112 GLY GLY B . n 
B 2 113 ASP 113 113 113 ASP ASP B . n 
B 2 114 ALA 114 114 114 ALA ALA B . n 
B 2 115 TYR 115 115 115 TYR TYR B . n 
B 2 116 PHE 116 116 116 PHE PHE B . n 
B 2 117 SER 117 117 117 SER SER B . n 
B 2 118 VAL 118 118 118 VAL VAL B . n 
B 2 119 PRO 119 119 119 PRO PRO B . n 
B 2 120 LEU 120 120 120 LEU LEU B . n 
B 2 121 ASP 121 121 121 ASP ASP B . n 
B 2 122 GLU 122 122 122 GLU GLU B . n 
B 2 123 ASP 123 123 123 ASP ASP B . n 
B 2 124 PHE 124 124 124 PHE PHE B . n 
B 2 125 ARG 125 125 125 ARG ARG B . n 
B 2 126 LYS 126 126 126 LYS LYS B . n 
B 2 127 TYR 127 127 127 TYR TYR B . n 
B 2 128 THR 128 128 128 THR THR B . n 
B 2 129 ALA 129 129 129 ALA ALA B . n 
B 2 130 PHE 130 130 130 PHE PHE B . n 
B 2 131 THR 131 131 131 THR THR B . n 
B 2 132 ILE 132 132 132 ILE ILE B . n 
B 2 133 PRO 133 133 133 PRO PRO B . n 
B 2 134 SER 134 134 134 SER SER B . n 
B 2 135 ILE 135 135 135 ILE ILE B . n 
B 2 136 ASN 136 136 136 ASN ASN B . n 
B 2 137 ASN 137 137 137 ASN ASN B . n 
B 2 138 GLU 138 138 138 GLU GLU B . n 
B 2 139 THR 139 139 139 THR THR B . n 
B 2 140 PRO 140 140 140 PRO PRO B . n 
B 2 141 GLY 141 141 141 GLY GLY B . n 
B 2 142 ILE 142 142 142 ILE ILE B . n 
B 2 143 ARG 143 143 143 ARG ARG B . n 
B 2 144 TYR 144 144 144 TYR TYR B . n 
B 2 145 GLN 145 145 145 GLN GLN B . n 
B 2 146 TYR 146 146 146 TYR TYR B . n 
B 2 147 ASN 147 147 147 ASN ASN B . n 
B 2 148 VAL 148 148 148 VAL VAL B . n 
B 2 149 LEU 149 149 149 LEU LEU B . n 
B 2 150 PRO 150 150 150 PRO PRO B . n 
B 2 151 GLN 151 151 151 GLN GLN B . n 
B 2 152 GLY 152 152 152 GLY GLY B . n 
B 2 153 TRP 153 153 153 TRP TRP B . n 
B 2 154 LYS 154 154 154 LYS LYS B . n 
B 2 155 GLY 155 155 155 GLY GLY B . n 
B 2 156 SER 156 156 156 SER SER B . n 
B 2 157 PRO 157 157 157 PRO PRO B . n 
B 2 158 ALA 158 158 158 ALA ALA B . n 
B 2 159 ILE 159 159 159 ILE ILE B . n 
B 2 160 PHE 160 160 160 PHE PHE B . n 
B 2 161 GLN 161 161 161 GLN GLN B . n 
B 2 162 SER 162 162 162 SER SER B . n 
B 2 163 SER 163 163 163 SER SER B . n 
B 2 164 MET 164 164 164 MET MET B . n 
B 2 165 THR 165 165 165 THR THR B . n 
B 2 166 LYS 166 166 166 LYS LYS B . n 
B 2 167 ILE 167 167 167 ILE ILE B . n 
B 2 168 LEU 168 168 168 LEU LEU B . n 
B 2 169 GLU 169 169 169 GLU GLU B . n 
B 2 170 PRO 170 170 170 PRO PRO B . n 
B 2 171 PHE 171 171 171 PHE PHE B . n 
B 2 172 LYS 172 172 172 LYS LYS B . n 
B 2 173 LYS 173 173 173 LYS LYS B . n 
B 2 174 GLN 174 174 174 GLN GLN B . n 
B 2 175 ASN 175 175 175 ASN ASN B . n 
B 2 176 PRO 176 176 176 PRO PRO B . n 
B 2 177 ASP 177 177 177 ASP ASP B . n 
B 2 178 ILE 178 178 178 ILE ILE B . n 
B 2 179 VAL 179 179 179 VAL VAL B . n 
B 2 180 ILE 180 180 180 ILE ILE B . n 
B 2 181 CYS 181 181 181 CYS CYS B . n 
B 2 182 GLN 182 182 182 GLN GLN B . n 
B 2 183 TYR 183 183 183 TYR TYR B . n 
B 2 184 MET 184 184 184 MET MET B . n 
B 2 185 ASP 185 185 185 ASP ASP B . n 
B 2 186 ASP 186 186 186 ASP ASP B . n 
B 2 187 LEU 187 187 187 LEU LEU B . n 
B 2 188 TYR 188 188 188 TYR TYR B . n 
B 2 189 VAL 189 189 189 VAL VAL B . n 
B 2 190 GLY 190 190 190 GLY GLY B . n 
B 2 191 SER 191 191 191 SER SER B . n 
B 2 192 ASP 192 192 192 ASP ASP B . n 
B 2 193 LEU 193 193 193 LEU LEU B . n 
B 2 194 GLU 194 194 194 GLU GLU B . n 
B 2 195 ILE 195 195 195 ILE ILE B . n 
B 2 196 GLY 196 196 196 GLY GLY B . n 
B 2 197 GLN 197 197 197 GLN GLN B . n 
B 2 198 HIS 198 198 198 HIS HIS B . n 
B 2 199 ARG 199 199 199 ARG ARG B . n 
B 2 200 THR 200 200 200 THR THR B . n 
B 2 201 LYS 201 201 201 LYS LYS B . n 
B 2 202 ILE 202 202 202 ILE ILE B . n 
B 2 203 GLU 203 203 203 GLU GLU B . n 
B 2 204 GLU 204 204 204 GLU GLU B . n 
B 2 205 LEU 205 205 205 LEU LEU B . n 
B 2 206 ARG 206 206 206 ARG ARG B . n 
B 2 207 GLN 207 207 207 GLN GLN B . n 
B 2 208 HIS 208 208 208 HIS HIS B . n 
B 2 209 LEU 209 209 209 LEU LEU B . n 
B 2 210 LEU 210 210 210 LEU LEU B . n 
B 2 211 ARG 211 211 211 ARG ARG B . n 
B 2 212 TRP 212 212 212 TRP TRP B . n 
B 2 213 GLY 213 213 213 GLY GLY B . n 
B 2 214 LEU 214 214 214 LEU LEU B . n 
B 2 215 THR 215 215 215 THR THR B . n 
B 2 216 THR 216 216 216 THR THR B . n 
B 2 217 PRO 217 217 217 PRO PRO B . n 
B 2 218 ASP 218 218 218 ASP ASP B . n 
B 2 219 LYS 219 219 219 LYS LYS B . n 
B 2 220 LYS 220 220 220 LYS LYS B . n 
B 2 221 HIS 221 221 221 HIS HIS B . n 
B 2 222 GLN 222 222 222 GLN GLN B . n 
B 2 223 LYS 223 223 223 LYS LYS B . n 
B 2 224 GLU 224 224 224 GLU GLU B . n 
B 2 225 PRO 225 225 225 PRO PRO B . n 
B 2 226 PRO 226 226 226 PRO PRO B . n 
B 2 227 PHE 227 227 227 PHE PHE B . n 
B 2 228 LEU 228 228 228 LEU LEU B . n 
B 2 229 TRP 229 229 229 TRP TRP B . n 
B 2 230 MET 230 230 230 MET MET B . n 
B 2 231 GLY 231 231 231 GLY GLY B . n 
B 2 232 TYR 232 232 232 TYR TYR B . n 
B 2 233 GLU 233 233 233 GLU GLU B . n 
B 2 234 LEU 234 234 234 LEU LEU B . n 
B 2 235 HIS 235 235 235 HIS HIS B . n 
B 2 236 PRO 236 236 236 PRO PRO B . n 
B 2 237 ASP 237 237 237 ASP ASP B . n 
B 2 238 LYS 238 238 238 LYS LYS B . n 
B 2 239 TRP 239 239 239 TRP TRP B . n 
B 2 240 THR 240 240 240 THR THR B . n 
B 2 241 VAL 241 241 241 VAL VAL B . n 
B 2 242 GLN 242 242 242 GLN GLN B . n 
B 2 243 PRO 243 243 243 PRO PRO B . n 
B 2 244 ILE 244 244 244 ILE ILE B . n 
B 2 245 VAL 245 245 245 VAL VAL B . n 
B 2 246 LEU 246 246 246 LEU LEU B . n 
B 2 247 PRO 247 247 247 PRO PRO B . n 
B 2 248 GLU 248 248 248 GLU GLU B . n 
B 2 249 LYS 249 249 249 LYS LYS B . n 
B 2 250 ASP 250 250 250 ASP ASP B . n 
B 2 251 SER 251 251 251 SER SER B . n 
B 2 252 TRP 252 252 252 TRP TRP B . n 
B 2 253 THR 253 253 253 THR THR B . n 
B 2 254 VAL 254 254 254 VAL VAL B . n 
B 2 255 ASN 255 255 255 ASN ASN B . n 
B 2 256 ASP 256 256 256 ASP ASP B . n 
B 2 257 ILE 257 257 257 ILE ILE B . n 
B 2 258 GLN 258 258 258 GLN GLN B . n 
B 2 259 LYS 259 259 259 LYS LYS B . n 
B 2 260 LEU 260 260 260 LEU LEU B . n 
B 2 261 VAL 261 261 261 VAL VAL B . n 
B 2 262 GLY 262 262 262 GLY GLY B . n 
B 2 263 LYS 263 263 263 LYS LYS B . n 
B 2 264 LEU 264 264 264 LEU LEU B . n 
B 2 265 ASN 265 265 265 ASN ASN B . n 
B 2 266 TRP 266 266 266 TRP TRP B . n 
B 2 267 ALA 267 267 267 ALA ALA B . n 
B 2 268 SER 268 268 268 SER SER B . n 
B 2 269 GLN 269 269 269 GLN GLN B . n 
B 2 270 ILE 270 270 270 ILE ILE B . n 
B 2 271 TYR 271 271 271 TYR TYR B . n 
B 2 272 PRO 272 272 272 PRO PRO B . n 
B 2 273 GLY 273 273 273 GLY GLY B . n 
B 2 274 ILE 274 274 274 ILE ILE B . n 
B 2 275 LYS 275 275 275 LYS LYS B . n 
B 2 276 VAL 276 276 276 VAL VAL B . n 
B 2 277 ARG 277 277 277 ARG ARG B . n 
B 2 278 GLN 278 278 278 GLN GLN B . n 
B 2 279 LEU 279 279 279 LEU LEU B . n 
B 2 280 SER 280 280 280 SER SER B . n 
B 2 281 LYS 281 281 281 LYS LYS B . n 
B 2 282 LEU 282 282 282 LEU LEU B . n 
B 2 283 LEU 283 283 283 LEU LEU B . n 
B 2 284 ARG 284 284 284 ARG ARG B . n 
B 2 285 GLY 285 285 285 GLY GLY B . n 
B 2 286 THR 286 286 286 THR THR B . n 
B 2 287 LYS 287 287 287 LYS LYS B . n 
B 2 288 ALA 288 288 288 ALA ALA B . n 
B 2 289 LEU 289 289 289 LEU LEU B . n 
B 2 290 THR 290 290 290 THR THR B . n 
B 2 291 GLU 291 291 291 GLU GLU B . n 
B 2 292 VAL 292 292 292 VAL VAL B . n 
B 2 293 ILE 293 293 293 ILE ILE B . n 
B 2 294 PRO 294 294 294 PRO PRO B . n 
B 2 295 LEU 295 295 295 LEU LEU B . n 
B 2 296 THR 296 296 296 THR THR B . n 
B 2 297 GLU 297 297 297 GLU GLU B . n 
B 2 298 GLU 298 298 298 GLU GLU B . n 
B 2 299 ALA 299 299 299 ALA ALA B . n 
B 2 300 GLU 300 300 300 GLU GLU B . n 
B 2 301 LEU 301 301 301 LEU LEU B . n 
B 2 302 GLU 302 302 302 GLU GLU B . n 
B 2 303 LEU 303 303 303 LEU LEU B . n 
B 2 304 ALA 304 304 304 ALA ALA B . n 
B 2 305 GLU 305 305 305 GLU GLU B . n 
B 2 306 ASN 306 306 306 ASN ASN B . n 
B 2 307 ARG 307 307 307 ARG ARG B . n 
B 2 308 GLU 308 308 308 GLU GLU B . n 
B 2 309 ILE 309 309 309 ILE ILE B . n 
B 2 310 LEU 310 310 310 LEU LEU B . n 
B 2 311 LYS 311 311 311 LYS LYS B . n 
B 2 312 GLU 312 312 312 GLU GLU B . n 
B 2 313 PRO 313 313 313 PRO PRO B . n 
B 2 314 VAL 314 314 314 VAL VAL B . n 
B 2 315 HIS 315 315 315 HIS HIS B . n 
B 2 316 GLY 316 316 316 GLY GLY B . n 
B 2 317 VAL 317 317 317 VAL VAL B . n 
B 2 318 TYR 318 318 318 TYR TYR B . n 
B 2 319 TYR 319 319 319 TYR TYR B . n 
B 2 320 ASP 320 320 320 ASP ASP B . n 
B 2 321 PRO 321 321 321 PRO PRO B . n 
B 2 322 SER 322 322 322 SER SER B . n 
B 2 323 LYS 323 323 323 LYS LYS B . n 
B 2 324 ASP 324 324 324 ASP ASP B . n 
B 2 325 LEU 325 325 325 LEU LEU B . n 
B 2 326 ILE 326 326 326 ILE ILE B . n 
B 2 327 ALA 327 327 327 ALA ALA B . n 
B 2 328 GLU 328 328 328 GLU GLU B . n 
B 2 329 ILE 329 329 329 ILE ILE B . n 
B 2 330 GLN 330 330 330 GLN GLN B . n 
B 2 331 LYS 331 331 331 LYS LYS B . n 
B 2 332 GLN 332 332 332 GLN GLN B . n 
B 2 333 GLY 333 333 333 GLY GLY B . n 
B 2 334 GLN 334 334 334 GLN GLN B . n 
B 2 335 GLY 335 335 335 GLY GLY B . n 
B 2 336 GLN 336 336 336 GLN GLN B . n 
B 2 337 TRP 337 337 337 TRP TRP B . n 
B 2 338 THR 338 338 338 THR THR B . n 
B 2 339 TYR 339 339 339 TYR TYR B . n 
B 2 340 GLN 340 340 340 GLN GLN B . n 
B 2 341 ILE 341 341 341 ILE ILE B . n 
B 2 342 TYR 342 342 342 TYR TYR B . n 
B 2 343 GLN 343 343 343 GLN GLN B . n 
B 2 344 GLU 344 344 344 GLU GLU B . n 
B 2 345 PRO 345 345 345 PRO PRO B . n 
B 2 346 PHE 346 346 346 PHE PHE B . n 
B 2 347 LYS 347 347 347 LYS LYS B . n 
B 2 348 ASN 348 348 348 ASN ASN B . n 
B 2 349 LEU 349 349 349 LEU LEU B . n 
B 2 350 LYS 350 350 350 LYS LYS B . n 
B 2 351 THR 351 351 351 THR THR B . n 
B 2 352 GLY 352 352 352 GLY GLY B . n 
B 2 353 LYS 353 353 353 LYS LYS B . n 
B 2 354 TYR 354 354 354 TYR TYR B . n 
B 2 355 ALA 355 355 355 ALA ALA B . n 
B 2 356 ARG 356 356 356 ARG ARG B . n 
B 2 357 MET 357 357 357 MET MET B . n 
B 2 358 ARG 358 358 358 ARG ARG B . n 
B 2 359 GLY 359 359 359 GLY GLY B . n 
B 2 360 ALA 360 360 360 ALA ALA B . n 
B 2 361 HIS 361 361 361 HIS HIS B . n 
B 2 362 THR 362 362 362 THR THR B . n 
B 2 363 ASN 363 363 363 ASN ASN B . n 
B 2 364 ASP 364 364 364 ASP ASP B . n 
B 2 365 VAL 365 365 365 VAL VAL B . n 
B 2 366 LYS 366 366 366 LYS LYS B . n 
B 2 367 GLN 367 367 367 GLN GLN B . n 
B 2 368 LEU 368 368 368 LEU LEU B . n 
B 2 369 THR 369 369 369 THR THR B . n 
B 2 370 GLU 370 370 370 GLU GLU B . n 
B 2 371 ALA 371 371 371 ALA ALA B . n 
B 2 372 VAL 372 372 372 VAL VAL B . n 
B 2 373 GLN 373 373 373 GLN GLN B . n 
B 2 374 LYS 374 374 374 LYS LYS B . n 
B 2 375 ILE 375 375 375 ILE ILE B . n 
B 2 376 THR 376 376 376 THR THR B . n 
B 2 377 THR 377 377 377 THR THR B . n 
B 2 378 GLU 378 378 378 GLU GLU B . n 
B 2 379 SER 379 379 379 SER SER B . n 
B 2 380 ILE 380 380 380 ILE ILE B . n 
B 2 381 VAL 381 381 381 VAL VAL B . n 
B 2 382 ILE 382 382 382 ILE ILE B . n 
B 2 383 TRP 383 383 383 TRP TRP B . n 
B 2 384 GLY 384 384 384 GLY GLY B . n 
B 2 385 LYS 385 385 385 LYS LYS B . n 
B 2 386 THR 386 386 386 THR THR B . n 
B 2 387 PRO 387 387 387 PRO PRO B . n 
B 2 388 LYS 388 388 388 LYS LYS B . n 
B 2 389 PHE 389 389 389 PHE PHE B . n 
B 2 390 LYS 390 390 390 LYS LYS B . n 
B 2 391 LEU 391 391 391 LEU LEU B . n 
B 2 392 PRO 392 392 392 PRO PRO B . n 
B 2 393 ILE 393 393 393 ILE ILE B . n 
B 2 394 GLN 394 394 394 GLN GLN B . n 
B 2 395 LYS 395 395 395 LYS LYS B . n 
B 2 396 GLU 396 396 396 GLU GLU B . n 
B 2 397 THR 397 397 397 THR THR B . n 
B 2 398 TRP 398 398 398 TRP TRP B . n 
B 2 399 GLU 399 399 399 GLU GLU B . n 
B 2 400 THR 400 400 400 THR THR B . n 
B 2 401 TRP 401 401 401 TRP TRP B . n 
B 2 402 TRP 402 402 402 TRP TRP B . n 
B 2 403 THR 403 403 403 THR THR B . n 
B 2 404 GLU 404 404 404 GLU GLU B . n 
B 2 405 TYR 405 405 405 TYR TYR B . n 
B 2 406 TRP 406 406 406 TRP TRP B . n 
B 2 407 GLN 407 407 407 GLN GLN B . n 
B 2 408 ALA 408 408 408 ALA ALA B . n 
B 2 409 THR 409 409 409 THR THR B . n 
B 2 410 TRP 410 410 410 TRP TRP B . n 
B 2 411 ILE 411 411 411 ILE ILE B . n 
B 2 412 PRO 412 412 412 PRO PRO B . n 
B 2 413 GLU 413 413 413 GLU GLU B . n 
B 2 414 TRP 414 414 414 TRP TRP B . n 
B 2 415 GLU 415 415 415 GLU GLU B . n 
B 2 416 PHE 416 416 416 PHE PHE B . n 
B 2 417 VAL 417 417 417 VAL VAL B . n 
B 2 418 ASN 418 418 418 ASN ASN B . n 
B 2 419 THR 419 419 419 THR THR B . n 
B 2 420 PRO 420 420 420 PRO PRO B . n 
B 2 421 PRO 421 421 421 PRO PRO B . n 
B 2 422 LEU 422 422 422 LEU LEU B . n 
B 2 423 VAL 423 423 423 VAL VAL B . n 
B 2 424 LYS 424 424 424 LYS LYS B . n 
B 2 425 LEU 425 425 425 LEU LEU B . n 
B 2 426 TRP 426 426 426 TRP TRP B . n 
B 2 427 TYR 427 427 427 TYR TYR B . n 
# 
_pdbx_nonpoly_scheme.asym_id         C 
_pdbx_nonpoly_scheme.entity_id       3 
_pdbx_nonpoly_scheme.mon_id          TBO 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     559 
_pdbx_nonpoly_scheme.auth_seq_num    1 
_pdbx_nonpoly_scheme.pdb_mon_id      TBO 
_pdbx_nonpoly_scheme.auth_mon_id     TBO 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5620  ? 
1 MORE         -35   ? 
1 'SSA (A^2)'  48890 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-05-15 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
DENZO  'data reduction' . ? 3 
X-PLOR phasing          . ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C A ASN 175 ? ? N  A PRO 176 ? ? CA A PRO 176 ? ? 128.68 119.30 9.38  1.50 Y 
2 1 N A LYS 287 ? ? CA A LYS 287 ? ? C  A LYS 287 ? ? 129.68 111.00 18.68 2.70 N 
3 1 C B GLY 51  ? ? N  B PRO 52  ? ? CA B PRO 52  ? ? 128.97 119.30 9.67  1.50 Y 
4 1 C B HIS 96  ? ? N  B PRO 97  ? ? CA B PRO 97  ? ? 129.07 119.30 9.77  1.50 Y 
5 1 C B ILE 132 ? ? N  B PRO 133 ? ? CA B PRO 133 ? ? 132.13 119.30 12.83 1.50 Y 
6 1 C B GLU 344 ? ? N  B PRO 345 ? ? CA B PRO 345 ? ? 128.69 119.30 9.39  1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 PRO A 4   ? ? -76.76  27.35   
2   1 GLU A 6   ? ? -59.12  101.74  
3   1 GLU A 28  ? ? -47.43  -19.72  
4   1 PRO A 52  ? ? -51.95  -85.10  
5   1 ASN A 54  ? ? -165.75 105.70  
6   1 TYR A 56  ? ? -39.30  118.10  
7   1 ILE A 63  ? ? -165.25 -168.51 
8   1 LYS A 65  ? ? -104.18 -67.64  
9   1 LYS A 66  ? ? -105.48 -160.81 
10  1 ASP A 67  ? ? -45.07  -2.94   
11  1 VAL A 75  ? ? -162.09 116.03  
12  1 PHE A 77  ? ? -98.68  33.04   
13  1 PHE A 87  ? ? -107.85 -162.77 
14  1 VAL A 90  ? ? -29.73  -65.96  
15  1 LEU A 100 ? ? -54.32  171.39  
16  1 THR A 107 ? ? 175.08  161.27  
17  1 VAL A 111 ? ? -78.02  46.40   
18  1 ALA A 114 ? ? -24.08  -70.64  
19  1 SER A 134 ? ? -70.01  -88.05  
20  1 ILE A 135 ? ? -104.35 -140.54 
21  1 ASN A 137 ? ? -139.18 -54.24  
22  1 GLU A 138 ? ? -61.23  93.90   
23  1 SER A 156 ? ? -21.40  -60.37  
24  1 GLU A 169 ? ? -24.60  -75.74  
25  1 ASN A 175 ? ? -115.35 70.30   
26  1 MET A 184 ? ? 56.92   -141.02 
27  1 ASP A 185 ? ? -94.31  45.93   
28  1 ASP A 192 ? ? -100.45 58.92   
29  1 ILE A 195 ? ? -10.28  -62.40  
30  1 HIS A 221 ? ? 63.57   63.61   
31  1 PRO A 225 ? ? -36.01  -35.17  
32  1 MET A 230 ? ? 39.73   48.14   
33  1 PRO A 236 ? ? -48.28  -1.17   
34  1 ASP A 237 ? ? -143.61 -13.75  
35  1 PRO A 243 ? ? -63.02  95.46   
36  1 SER A 251 ? ? -73.16  49.97   
37  1 ILE A 274 ? ? -22.54  133.56  
38  1 VAL A 276 ? ? -150.15 -1.30   
39  1 ARG A 284 ? ? -38.22  -17.01  
40  1 LYS A 287 ? ? 5.76    -35.90  
41  1 PRO A 294 ? ? -60.07  69.51   
42  1 LEU A 295 ? ? -53.14  101.25  
43  1 PRO A 345 ? ? -35.24  117.71  
44  1 ILE A 382 ? ? -100.51 -71.93  
45  1 TYR A 405 ? ? -40.79  151.95  
46  1 PRO A 412 ? ? -65.73  -169.15 
47  1 PRO A 420 ? ? -58.82  -87.05  
48  1 TRP A 426 ? ? -71.98  -80.95  
49  1 GLN A 428 ? ? -168.65 104.82  
50  1 LEU A 429 ? ? -51.13  175.19  
51  1 ALA A 446 ? ? -173.75 145.13  
52  1 TYR A 457 ? ? -175.76 -168.32 
53  1 VAL A 467 ? ? -161.22 116.76  
54  1 ASN A 471 ? ? 75.48   65.35   
55  1 TYR A 501 ? ? -52.55  -77.92  
56  1 PRO A 510 ? ? -69.13  -159.38 
57  1 ASP A 511 ? ? 179.45  -177.22 
58  1 LYS A 512 ? ? 31.19   70.91   
59  1 LYS A 528 ? ? -66.61  -177.40 
60  1 PRO A 537 ? ? -56.54  103.36  
61  1 ILE A 556 ? ? -173.51 -162.43 
62  1 ILE B 2   ? ? -40.84  -12.03  
63  1 PRO B 4   ? ? -110.04 -144.47 
64  1 PRO B 9   ? ? -61.77  96.82   
65  1 PRO B 14  ? ? -37.37  125.67  
66  1 ASN B 57  ? ? -175.71 148.14  
67  1 PRO B 59  ? ? -48.59  153.11  
68  1 ASP B 67  ? ? 77.74   77.67   
69  1 SER B 68  ? ? 37.24   31.57   
70  1 TRP B 71  ? ? -37.10  160.19  
71  1 THR B 84  ? ? -133.08 -68.11  
72  1 GLN B 91  ? ? -102.64 -80.33  
73  1 LEU B 92  ? ? -71.63  25.92   
74  1 VAL B 111 ? ? -107.14 55.53   
75  1 TYR B 115 ? ? -35.56  -33.73  
76  1 PHE B 116 ? ? -55.75  13.82   
77  1 GLU B 122 ? ? -45.98  -15.36  
78  1 THR B 128 ? ? -61.17  8.70    
79  1 ILE B 135 ? ? -35.50  130.95  
80  1 VAL B 148 ? ? -112.04 -145.64 
81  1 PHE B 160 ? ? -49.44  -17.01  
82  1 SER B 162 ? ? -36.69  -79.52  
83  1 GLU B 169 ? ? -25.43  -54.07  
84  1 ILE B 178 ? ? -56.37  97.18   
85  1 MET B 184 ? ? 56.59   -122.75 
86  1 ILE B 195 ? ? -21.34  -77.05  
87  1 GLN B 222 ? ? -77.81  -160.40 
88  1 MET B 230 ? ? -75.24  29.27   
89  1 PRO B 243 ? ? -59.75  83.78   
90  1 ILE B 244 ? ? -160.27 47.71   
91  1 LEU B 260 ? ? -44.53  -71.69  
92  1 TYR B 271 ? ? -158.16 69.66   
93  1 PRO B 272 ? ? -62.26  73.54   
94  1 ARG B 277 ? ? -26.56  -67.33  
95  1 LEU B 295 ? ? 11.92   -82.29  
96  1 THR B 296 ? ? -33.77  92.27   
97  1 VAL B 314 ? ? -95.07  -157.09 
98  1 VAL B 317 ? ? -161.16 92.98   
99  1 TYR B 318 ? ? -157.52 82.17   
100 1 TYR B 319 ? ? -65.16  99.54   
101 1 PRO B 345 ? ? -20.01  -56.79  
102 1 LYS B 347 ? ? -104.69 61.60   
103 1 ARG B 356 ? ? -172.66 76.63   
104 1 MET B 357 ? ? -30.51  108.58  
105 1 ARG B 358 ? ? -53.03  101.99  
106 1 HIS B 361 ? ? -161.89 108.74  
107 1 ASN B 363 ? ? -58.42  99.64   
108 1 GLU B 370 ? ? -55.29  -70.96  
109 1 THR B 377 ? ? -46.09  -70.60  
110 1 GLU B 378 ? ? -29.97  -60.04  
111 1 VAL B 381 ? ? -27.24  -50.33  
112 1 PRO B 387 ? ? -72.19  -167.18 
113 1 GLU B 399 ? ? -63.35  9.87    
114 1 TRP B 401 ? ? -145.08 -26.25  
115 1 THR B 403 ? ? -53.61  -8.30   
116 1 LEU B 425 ? ? -130.78 -153.58 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLU 36  ? CG  ? A GLU 36  CG  
2   1 Y 1 A GLU 36  ? CD  ? A GLU 36  CD  
3   1 Y 1 A GLU 36  ? OE1 ? A GLU 36  OE1 
4   1 Y 1 A GLU 36  ? OE2 ? A GLU 36  OE2 
5   1 Y 1 A LYS 66  ? CG  ? A LYS 66  CG  
6   1 Y 1 A LYS 66  ? CD  ? A LYS 66  CD  
7   1 Y 1 A LYS 66  ? CE  ? A LYS 66  CE  
8   1 Y 1 A LYS 66  ? NZ  ? A LYS 66  NZ  
9   1 Y 1 A TRP 71  ? CG  ? A TRP 71  CG  
10  1 Y 1 A TRP 71  ? CD1 ? A TRP 71  CD1 
11  1 Y 1 A TRP 71  ? CD2 ? A TRP 71  CD2 
12  1 Y 1 A TRP 71  ? NE1 ? A TRP 71  NE1 
13  1 Y 1 A TRP 71  ? CE2 ? A TRP 71  CE2 
14  1 Y 1 A TRP 71  ? CE3 ? A TRP 71  CE3 
15  1 Y 1 A TRP 71  ? CZ2 ? A TRP 71  CZ2 
16  1 Y 1 A TRP 71  ? CZ3 ? A TRP 71  CZ3 
17  1 Y 1 A TRP 71  ? CH2 ? A TRP 71  CH2 
18  1 Y 1 A ARG 72  ? CG  ? A ARG 72  CG  
19  1 Y 1 A ARG 72  ? CD  ? A ARG 72  CD  
20  1 Y 1 A ARG 72  ? NE  ? A ARG 72  NE  
21  1 Y 1 A ARG 72  ? CZ  ? A ARG 72  CZ  
22  1 Y 1 A ARG 72  ? NH1 ? A ARG 72  NH1 
23  1 Y 1 A ARG 72  ? NH2 ? A ARG 72  NH2 
24  1 Y 1 A SER 134 ? OG  ? A SER 134 OG  
25  1 Y 1 A ILE 135 ? CG1 ? A ILE 135 CG1 
26  1 Y 1 A ILE 135 ? CG2 ? A ILE 135 CG2 
27  1 Y 1 A ILE 135 ? CD1 ? A ILE 135 CD1 
28  1 Y 1 A ASN 136 ? CG  ? A ASN 136 CG  
29  1 Y 1 A ASN 136 ? OD1 ? A ASN 136 OD1 
30  1 Y 1 A ASN 136 ? ND2 ? A ASN 136 ND2 
31  1 Y 1 A ASN 137 ? CG  ? A ASN 137 CG  
32  1 Y 1 A ASN 137 ? OD1 ? A ASN 137 OD1 
33  1 Y 1 A ASN 137 ? ND2 ? A ASN 137 ND2 
34  1 Y 1 A GLU 138 ? CG  ? A GLU 138 CG  
35  1 Y 1 A GLU 138 ? CD  ? A GLU 138 CD  
36  1 Y 1 A GLU 138 ? OE1 ? A GLU 138 OE1 
37  1 Y 1 A GLU 138 ? OE2 ? A GLU 138 OE2 
38  1 Y 1 A THR 139 ? OG1 ? A THR 139 OG1 
39  1 Y 1 A THR 139 ? CG2 ? A THR 139 CG2 
40  1 Y 1 A CYS 181 ? SG  ? A CYS 181 SG  
41  1 Y 1 A ASP 218 ? CG  ? A ASP 218 CG  
42  1 Y 1 A ASP 218 ? OD1 ? A ASP 218 OD1 
43  1 Y 1 A ASP 218 ? OD2 ? A ASP 218 OD2 
44  1 Y 1 A LYS 219 ? CG  ? A LYS 219 CG  
45  1 Y 1 A LYS 219 ? CD  ? A LYS 219 CD  
46  1 Y 1 A LYS 219 ? CE  ? A LYS 219 CE  
47  1 Y 1 A LYS 219 ? NZ  ? A LYS 219 NZ  
48  1 Y 1 A LYS 220 ? CG  ? A LYS 220 CG  
49  1 Y 1 A LYS 220 ? CD  ? A LYS 220 CD  
50  1 Y 1 A LYS 220 ? CE  ? A LYS 220 CE  
51  1 Y 1 A LYS 220 ? NZ  ? A LYS 220 NZ  
52  1 Y 1 A HIS 221 ? CG  ? A HIS 221 CG  
53  1 Y 1 A HIS 221 ? ND1 ? A HIS 221 ND1 
54  1 Y 1 A HIS 221 ? CD2 ? A HIS 221 CD2 
55  1 Y 1 A HIS 221 ? CE1 ? A HIS 221 CE1 
56  1 Y 1 A HIS 221 ? NE2 ? A HIS 221 NE2 
57  1 Y 1 A GLN 222 ? CG  ? A GLN 222 CG  
58  1 Y 1 A GLN 222 ? CD  ? A GLN 222 CD  
59  1 Y 1 A GLN 222 ? OE1 ? A GLN 222 OE1 
60  1 Y 1 A GLN 222 ? NE2 ? A GLN 222 NE2 
61  1 Y 1 A LYS 223 ? CG  ? A LYS 223 CG  
62  1 Y 1 A LYS 223 ? CD  ? A LYS 223 CD  
63  1 Y 1 A LYS 223 ? CE  ? A LYS 223 CE  
64  1 Y 1 A LYS 223 ? NZ  ? A LYS 223 NZ  
65  1 Y 1 A LYS 249 ? CG  ? A LYS 249 CG  
66  1 Y 1 A LYS 249 ? CD  ? A LYS 249 CD  
67  1 Y 1 A LYS 249 ? CE  ? A LYS 249 CE  
68  1 Y 1 A LYS 249 ? NZ  ? A LYS 249 NZ  
69  1 Y 1 A LYS 281 ? CG  ? A LYS 281 CG  
70  1 Y 1 A LYS 281 ? CD  ? A LYS 281 CD  
71  1 Y 1 A LYS 281 ? CE  ? A LYS 281 CE  
72  1 Y 1 A LYS 281 ? NZ  ? A LYS 281 NZ  
73  1 Y 1 A LEU 282 ? CG  ? A LEU 282 CG  
74  1 Y 1 A LEU 282 ? CD1 ? A LEU 282 CD1 
75  1 Y 1 A LEU 282 ? CD2 ? A LEU 282 CD2 
76  1 Y 1 A LEU 283 ? CG  ? A LEU 283 CG  
77  1 Y 1 A LEU 283 ? CD1 ? A LEU 283 CD1 
78  1 Y 1 A LEU 283 ? CD2 ? A LEU 283 CD2 
79  1 Y 1 A ARG 284 ? CG  ? A ARG 284 CG  
80  1 Y 1 A ARG 284 ? CD  ? A ARG 284 CD  
81  1 Y 1 A ARG 284 ? NE  ? A ARG 284 NE  
82  1 Y 1 A ARG 284 ? CZ  ? A ARG 284 CZ  
83  1 Y 1 A ARG 284 ? NH1 ? A ARG 284 NH1 
84  1 Y 1 A ARG 284 ? NH2 ? A ARG 284 NH2 
85  1 Y 1 A THR 286 ? OG1 ? A THR 286 OG1 
86  1 Y 1 A THR 286 ? CG2 ? A THR 286 CG2 
87  1 Y 1 A LYS 287 ? CG  ? A LYS 287 CG  
88  1 Y 1 A LYS 287 ? CD  ? A LYS 287 CD  
89  1 Y 1 A LYS 287 ? CE  ? A LYS 287 CE  
90  1 Y 1 A LYS 287 ? NZ  ? A LYS 287 NZ  
91  1 Y 1 A LEU 289 ? CG  ? A LEU 289 CG  
92  1 Y 1 A LEU 289 ? CD1 ? A LEU 289 CD1 
93  1 Y 1 A LEU 289 ? CD2 ? A LEU 289 CD2 
94  1 Y 1 A THR 290 ? OG1 ? A THR 290 OG1 
95  1 Y 1 A THR 290 ? CG2 ? A THR 290 CG2 
96  1 Y 1 A GLU 291 ? CG  ? A GLU 291 CG  
97  1 Y 1 A GLU 291 ? CD  ? A GLU 291 CD  
98  1 Y 1 A GLU 291 ? OE1 ? A GLU 291 OE1 
99  1 Y 1 A GLU 291 ? OE2 ? A GLU 291 OE2 
100 1 Y 1 A VAL 292 ? CG1 ? A VAL 292 CG1 
101 1 Y 1 A VAL 292 ? CG2 ? A VAL 292 CG2 
102 1 Y 1 A ILE 293 ? CG1 ? A ILE 293 CG1 
103 1 Y 1 A ILE 293 ? CG2 ? A ILE 293 CG2 
104 1 Y 1 A ILE 293 ? CD1 ? A ILE 293 CD1 
105 1 Y 1 A GLU 297 ? CG  ? A GLU 297 CG  
106 1 Y 1 A GLU 297 ? CD  ? A GLU 297 CD  
107 1 Y 1 A GLU 297 ? OE1 ? A GLU 297 OE1 
108 1 Y 1 A GLU 297 ? OE2 ? A GLU 297 OE2 
109 1 Y 1 A GLU 298 ? CG  ? A GLU 298 CG  
110 1 Y 1 A GLU 298 ? CD  ? A GLU 298 CD  
111 1 Y 1 A GLU 298 ? OE1 ? A GLU 298 OE1 
112 1 Y 1 A GLU 298 ? OE2 ? A GLU 298 OE2 
113 1 Y 1 A GLU 300 ? CG  ? A GLU 300 CG  
114 1 Y 1 A GLU 300 ? CD  ? A GLU 300 CD  
115 1 Y 1 A GLU 300 ? OE1 ? A GLU 300 OE1 
116 1 Y 1 A GLU 300 ? OE2 ? A GLU 300 OE2 
117 1 Y 1 A LEU 301 ? CG  ? A LEU 301 CG  
118 1 Y 1 A LEU 301 ? CD1 ? A LEU 301 CD1 
119 1 Y 1 A LEU 301 ? CD2 ? A LEU 301 CD2 
120 1 Y 1 A GLU 302 ? CG  ? A GLU 302 CG  
121 1 Y 1 A GLU 302 ? CD  ? A GLU 302 CD  
122 1 Y 1 A GLU 302 ? OE1 ? A GLU 302 OE1 
123 1 Y 1 A GLU 302 ? OE2 ? A GLU 302 OE2 
124 1 Y 1 A LYS 311 ? CG  ? A LYS 311 CG  
125 1 Y 1 A LYS 311 ? CD  ? A LYS 311 CD  
126 1 Y 1 A LYS 311 ? CE  ? A LYS 311 CE  
127 1 Y 1 A LYS 311 ? NZ  ? A LYS 311 NZ  
128 1 Y 1 A GLU 312 ? CG  ? A GLU 312 CG  
129 1 Y 1 A GLU 312 ? CD  ? A GLU 312 CD  
130 1 Y 1 A GLU 312 ? OE1 ? A GLU 312 OE1 
131 1 Y 1 A GLU 312 ? OE2 ? A GLU 312 OE2 
132 1 Y 1 A LYS 323 ? CG  ? A LYS 323 CG  
133 1 Y 1 A LYS 323 ? CD  ? A LYS 323 CD  
134 1 Y 1 A LYS 323 ? CE  ? A LYS 323 CE  
135 1 Y 1 A LYS 323 ? NZ  ? A LYS 323 NZ  
136 1 Y 1 A ARG 356 ? CG  ? A ARG 356 CG  
137 1 Y 1 A ARG 356 ? CD  ? A ARG 356 CD  
138 1 Y 1 A ARG 356 ? NE  ? A ARG 356 NE  
139 1 Y 1 A ARG 356 ? CZ  ? A ARG 356 CZ  
140 1 Y 1 A ARG 356 ? NH1 ? A ARG 356 NH1 
141 1 Y 1 A ARG 356 ? NH2 ? A ARG 356 NH2 
142 1 Y 1 A MET 357 ? CG  ? A MET 357 CG  
143 1 Y 1 A MET 357 ? SD  ? A MET 357 SD  
144 1 Y 1 A MET 357 ? CE  ? A MET 357 CE  
145 1 Y 1 A ARG 358 ? CG  ? A ARG 358 CG  
146 1 Y 1 A ARG 358 ? CD  ? A ARG 358 CD  
147 1 Y 1 A ARG 358 ? NE  ? A ARG 358 NE  
148 1 Y 1 A ARG 358 ? CZ  ? A ARG 358 CZ  
149 1 Y 1 A ARG 358 ? NH1 ? A ARG 358 NH1 
150 1 Y 1 A ARG 358 ? NH2 ? A ARG 358 NH2 
151 1 Y 1 A LYS 366 ? CG  ? A LYS 366 CG  
152 1 Y 1 A LYS 366 ? CD  ? A LYS 366 CD  
153 1 Y 1 A LYS 366 ? CE  ? A LYS 366 CE  
154 1 Y 1 A LYS 366 ? NZ  ? A LYS 366 NZ  
155 1 Y 1 A LYS 451 ? CG  ? A LYS 451 CG  
156 1 Y 1 A LYS 451 ? CD  ? A LYS 451 CD  
157 1 Y 1 A LYS 451 ? CE  ? A LYS 451 CE  
158 1 Y 1 A LYS 451 ? NZ  ? A LYS 451 NZ  
159 1 Y 1 A ILE 556 ? CG1 ? A ILE 556 CG1 
160 1 Y 1 A ILE 556 ? CG2 ? A ILE 556 CG2 
161 1 Y 1 A ILE 556 ? CD1 ? A ILE 556 CD1 
162 1 Y 1 A ARG 557 ? CG  ? A ARG 557 CG  
163 1 Y 1 A ARG 557 ? CD  ? A ARG 557 CD  
164 1 Y 1 A ARG 557 ? NE  ? A ARG 557 NE  
165 1 Y 1 A ARG 557 ? CZ  ? A ARG 557 CZ  
166 1 Y 1 A ARG 557 ? NH1 ? A ARG 557 NH1 
167 1 Y 1 A ARG 557 ? NH2 ? A ARG 557 NH2 
168 1 Y 1 A LYS 558 ? CG  ? A LYS 558 CG  
169 1 Y 1 A LYS 558 ? CD  ? A LYS 558 CD  
170 1 Y 1 A LYS 558 ? CE  ? A LYS 558 CE  
171 1 Y 1 A LYS 558 ? NZ  ? A LYS 558 NZ  
172 1 Y 1 B LYS 13  ? CG  ? B LYS 13  CG  
173 1 Y 1 B LYS 13  ? CD  ? B LYS 13  CD  
174 1 Y 1 B LYS 13  ? CE  ? B LYS 13  CE  
175 1 Y 1 B LYS 13  ? NZ  ? B LYS 13  NZ  
176 1 Y 1 B ASP 121 ? CG  ? B ASP 121 CG  
177 1 Y 1 B ASP 121 ? OD1 ? B ASP 121 OD1 
178 1 Y 1 B ASP 121 ? OD2 ? B ASP 121 OD2 
179 1 Y 1 B GLN 197 ? CG  ? B GLN 197 CG  
180 1 Y 1 B GLN 197 ? CD  ? B GLN 197 CD  
181 1 Y 1 B GLN 197 ? OE1 ? B GLN 197 OE1 
182 1 Y 1 B GLN 197 ? NE2 ? B GLN 197 NE2 
183 1 Y 1 B ARG 199 ? CG  ? B ARG 199 CG  
184 1 Y 1 B ARG 199 ? CD  ? B ARG 199 CD  
185 1 Y 1 B ARG 199 ? NE  ? B ARG 199 NE  
186 1 Y 1 B ARG 199 ? CZ  ? B ARG 199 CZ  
187 1 Y 1 B ARG 199 ? NH1 ? B ARG 199 NH1 
188 1 Y 1 B ARG 199 ? NH2 ? B ARG 199 NH2 
189 1 Y 1 B LYS 220 ? CG  ? B LYS 220 CG  
190 1 Y 1 B LYS 220 ? CD  ? B LYS 220 CD  
191 1 Y 1 B LYS 220 ? CE  ? B LYS 220 CE  
192 1 Y 1 B LYS 220 ? NZ  ? B LYS 220 NZ  
193 1 Y 1 B GLN 222 ? CG  ? B GLN 222 CG  
194 1 Y 1 B GLN 222 ? CD  ? B GLN 222 CD  
195 1 Y 1 B GLN 222 ? OE1 ? B GLN 222 OE1 
196 1 Y 1 B GLN 222 ? NE2 ? B GLN 222 NE2 
197 1 Y 1 B LYS 223 ? CG  ? B LYS 223 CG  
198 1 Y 1 B LYS 223 ? CD  ? B LYS 223 CD  
199 1 Y 1 B LYS 223 ? CE  ? B LYS 223 CE  
200 1 Y 1 B LYS 223 ? NZ  ? B LYS 223 NZ  
201 1 Y 1 B GLU 224 ? CG  ? B GLU 224 CG  
202 1 Y 1 B GLU 224 ? CD  ? B GLU 224 CD  
203 1 Y 1 B GLU 224 ? OE1 ? B GLU 224 OE1 
204 1 Y 1 B GLU 224 ? OE2 ? B GLU 224 OE2 
205 1 Y 1 B PRO 225 ? CG  ? B PRO 225 CG  
206 1 Y 1 B PRO 225 ? CD  ? B PRO 225 CD  
207 1 Y 1 B PRO 226 ? CG  ? B PRO 226 CG  
208 1 Y 1 B PRO 226 ? CD  ? B PRO 226 CD  
209 1 Y 1 B PHE 227 ? CG  ? B PHE 227 CG  
210 1 Y 1 B PHE 227 ? CD1 ? B PHE 227 CD1 
211 1 Y 1 B PHE 227 ? CD2 ? B PHE 227 CD2 
212 1 Y 1 B PHE 227 ? CE1 ? B PHE 227 CE1 
213 1 Y 1 B PHE 227 ? CE2 ? B PHE 227 CE2 
214 1 Y 1 B PHE 227 ? CZ  ? B PHE 227 CZ  
215 1 Y 1 B LEU 228 ? CG  ? B LEU 228 CG  
216 1 Y 1 B LEU 228 ? CD1 ? B LEU 228 CD1 
217 1 Y 1 B LEU 228 ? CD2 ? B LEU 228 CD2 
218 1 Y 1 B TRP 229 ? CG  ? B TRP 229 CG  
219 1 Y 1 B TRP 229 ? CD1 ? B TRP 229 CD1 
220 1 Y 1 B TRP 229 ? CD2 ? B TRP 229 CD2 
221 1 Y 1 B TRP 229 ? NE1 ? B TRP 229 NE1 
222 1 Y 1 B TRP 229 ? CE2 ? B TRP 229 CE2 
223 1 Y 1 B TRP 229 ? CE3 ? B TRP 229 CE3 
224 1 Y 1 B TRP 229 ? CZ2 ? B TRP 229 CZ2 
225 1 Y 1 B TRP 229 ? CZ3 ? B TRP 229 CZ3 
226 1 Y 1 B TRP 229 ? CH2 ? B TRP 229 CH2 
227 1 Y 1 B MET 230 ? CG  ? B MET 230 CG  
228 1 Y 1 B MET 230 ? SD  ? B MET 230 SD  
229 1 Y 1 B MET 230 ? CE  ? B MET 230 CE  
230 1 Y 1 B ILE 270 ? CG1 ? B ILE 270 CG1 
231 1 Y 1 B ILE 270 ? CG2 ? B ILE 270 CG2 
232 1 Y 1 B ILE 270 ? CD1 ? B ILE 270 CD1 
233 1 Y 1 B GLN 278 ? CG  ? B GLN 278 CG  
234 1 Y 1 B GLN 278 ? CD  ? B GLN 278 CD  
235 1 Y 1 B GLN 278 ? OE1 ? B GLN 278 OE1 
236 1 Y 1 B GLN 278 ? NE2 ? B GLN 278 NE2 
237 1 Y 1 B LYS 281 ? CG  ? B LYS 281 CG  
238 1 Y 1 B LYS 281 ? CD  ? B LYS 281 CD  
239 1 Y 1 B LYS 281 ? CE  ? B LYS 281 CE  
240 1 Y 1 B LYS 281 ? NZ  ? B LYS 281 NZ  
241 1 Y 1 B MET 357 ? CG  ? B MET 357 CG  
242 1 Y 1 B MET 357 ? SD  ? B MET 357 SD  
243 1 Y 1 B MET 357 ? CE  ? B MET 357 CE  
244 1 Y 1 B ARG 358 ? CG  ? B ARG 358 CG  
245 1 Y 1 B ARG 358 ? CD  ? B ARG 358 CD  
246 1 Y 1 B ARG 358 ? NE  ? B ARG 358 NE  
247 1 Y 1 B ARG 358 ? CZ  ? B ARG 358 CZ  
248 1 Y 1 B ARG 358 ? NH1 ? B ARG 358 NH1 
249 1 Y 1 B ARG 358 ? NH2 ? B ARG 358 NH2 
250 1 Y 1 B HIS 361 ? CG  ? B HIS 361 CG  
251 1 Y 1 B HIS 361 ? ND1 ? B HIS 361 ND1 
252 1 Y 1 B HIS 361 ? CD2 ? B HIS 361 CD2 
253 1 Y 1 B HIS 361 ? CE1 ? B HIS 361 CE1 
254 1 Y 1 B HIS 361 ? NE2 ? B HIS 361 NE2 
255 1 Y 1 B THR 362 ? OG1 ? B THR 362 OG1 
256 1 Y 1 B THR 362 ? CG2 ? B THR 362 CG2 
257 1 Y 1 B ASN 363 ? CG  ? B ASN 363 CG  
258 1 Y 1 B ASN 363 ? OD1 ? B ASN 363 OD1 
259 1 Y 1 B ASN 363 ? ND2 ? B ASN 363 ND2 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        
'5-CHLORO-8-METHYL-7-(3-METHYL-BUT-2-ENYL)-6,7,8,9-TETRAHYDRO-2H-2,7,9A-TRIAZA-BENZO[CD]AZULENE-1-THIONE' 
_pdbx_entity_nonpoly.comp_id     TBO 
#