data_1V2J
# 
_entry.id   1V2J 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1V2J         
RCSB  RCSB006125   
WWPDB D_1000006125 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1V2K 'the same protein with variant X(triple.Glu)bT.D2' unspecified 
PDB 1V2L 'the same protein with variant X(triple.Glu)bT.D1' unspecified 
PDB 1V2M 'the same protein with variant X(triple.Glu)bT.A1' unspecified 
PDB 1V2N 'the same protein with variant X(99/175/190)bT'    unspecified 
PDB 1V2O 'the same protein with variant X(SSYI)bT.B4'       unspecified 
PDB 1V2P 'the same protein with variant X(SSYI)bT.A4'       unspecified 
PDB 1V2Q 'the same protein with variant X(SSWI)bT.B4'       unspecified 
PDB 1V2R 'the same protein with variant X(SSRI)bT.B4'       unspecified 
PDB 1V2S 'the same protein with variant X(SSFI.Glu)bT.D1'   unspecified 
PDB 1V2T 'the same protein with variant X(SSFI.Glu)bT.B4'   unspecified 
PDB 1V2U 'the same protein with variant X(SSAI)bT.D1'       unspecified 
PDB 1V2V 'the same protein with variant X(SSAI)bT.C1'       unspecified 
PDB 1V2W 'the same protein with variant X(SSAI)bT.B4'       unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1V2J 
_pdbx_database_status.recvd_initial_deposition_date   2003-10-17 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rauh, D.'     1 
'Klebe, G.'    2 
'Stubbs, M.T.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Understanding protein-ligand interactions: the price of protein flexibility' J.Mol.Biol. 335 1325 1341 2004 JMOBAK UK 
0022-2836 0070 ? 14729347 10.1016/j.jmb.2003.11.041                                      
1       'ZZ made EZ: influence of inhibitor configuration on enzyme selectivity.' J.Mol.Biol. 330 761  770  2003 JMOBAK UK 
0022-2836 0070 ? ?        '10.1016/S0022-2836(03)00617-X'                                
2       'Trypsin mutants for structure-based drug design: expression, refolding and crystallisation.' Biol.Chem.  383 1309 1314 
2002 ?      GE 1431-6730 ?    ? ?        ?                                                              
3       'Reconstructing the Binding Site of Factor Xa in Trypsin Reveals Ligand-Induced Structural Plasticity.' J.Mol.Biol. 325 
963  977  2003 JMOBAK UK 0022-2836 0070 ? ?        '10.1016/S0022-2836(02)01337-2'                                
4       'pH-dependent binding modes observed in trypsin crystals: lessons for structure-based drug design.' Chembiochem 3   246  
249  2002 ?      GE 1439-4227 ?    ? ?        '10.1002/1439-7633(20020301)3:2/3<246::AID-CBIC246>3.0.CO;2-#' 
5       
;Structural and functional analyses of benzamidine-based inhibitors in complex with trypsin: implications for the inhibition of factor Xa, tPA, and urokinase.
;
J.Med.Chem. 41  5445 5456 1998 JMCMAR US 0022-2623 0151 ? ?        10.1021/jm981068g                                              
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rauh, D.'         1  
primary 'Klebe, G.'        2  
primary 'Stubbs, M.T.'     3  
1       'Rauh, D.'         4  
1       'Klebe, G.'        5  
1       'Sturzebecher, J.' 6  
1       'Stubbs, M.T.'     7  
2       'Rauh, D.'         8  
2       'Reyda, S.'        9  
2       'Klebe, G.'        10 
2       'Stubbs, M.T.'     11 
3       'Reyda, S.'        12 
3       'Sohn, C.'         13 
3       'Klebe, G.'        14 
3       'Rall, K.'         15 
3       'Ullmann, D.'      16 
3       'Jakubke, H.D.'    17 
3       'Stubbs, M.T.'     18 
4       'Stubbs, M.T.'     19 
4       'Reyda, S.'        20 
4       'Dullweber, F.'    21 
4       'Moller, M.'       22 
4       'Klebe, G.'        23 
4       'Dorsch, D.'       24 
4       'Mederski, W.W.'   25 
4       'Wurziger, H.'     26 
5       'Renatus, M.'      27 
5       'Bode, W.'         28 
5       'Huber, R.'        29 
5       'Sturzebecher, J.' 30 
5       'Stubbs, M.T.'     31 
# 
_cell.entry_id           1V2J 
_cell.length_a           61.100 
_cell.length_b           70.340 
_cell.length_c           64.150 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1V2J 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Trypsin       23323.326 1  3.4.21.4 'Y172S, P173S, G174R, Q175I' ? ? 
2 non-polymer syn 'SULFATE ION' 96.063    1  ?        ?                            ? ? 
3 non-polymer syn 'CALCIUM ION' 40.078    1  ?        ?                            ? ? 
4 non-polymer syn BENZAMIDINE   120.152   1  ?        ?                            ? ? 
5 water       nat water         18.015    51 ?        ?                            ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Beta-trypsin 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSRIITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSRIITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
_entity_poly.pdbx_strand_id                 T 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   VAL n 
1 3   GLY n 
1 4   GLY n 
1 5   TYR n 
1 6   THR n 
1 7   CYS n 
1 8   GLY n 
1 9   ALA n 
1 10  ASN n 
1 11  THR n 
1 12  VAL n 
1 13  PRO n 
1 14  TYR n 
1 15  GLN n 
1 16  VAL n 
1 17  SER n 
1 18  LEU n 
1 19  ASN n 
1 20  SER n 
1 21  GLY n 
1 22  TYR n 
1 23  HIS n 
1 24  PHE n 
1 25  CYS n 
1 26  GLY n 
1 27  GLY n 
1 28  SER n 
1 29  LEU n 
1 30  ILE n 
1 31  ASN n 
1 32  SER n 
1 33  GLN n 
1 34  TRP n 
1 35  VAL n 
1 36  VAL n 
1 37  SER n 
1 38  ALA n 
1 39  ALA n 
1 40  HIS n 
1 41  CYS n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  GLY n 
1 46  ILE n 
1 47  GLN n 
1 48  VAL n 
1 49  ARG n 
1 50  LEU n 
1 51  GLY n 
1 52  GLU n 
1 53  ASP n 
1 54  ASN n 
1 55  ILE n 
1 56  ASN n 
1 57  VAL n 
1 58  VAL n 
1 59  GLU n 
1 60  GLY n 
1 61  ASN n 
1 62  GLU n 
1 63  GLN n 
1 64  PHE n 
1 65  ILE n 
1 66  SER n 
1 67  ALA n 
1 68  SER n 
1 69  LYS n 
1 70  SER n 
1 71  ILE n 
1 72  VAL n 
1 73  HIS n 
1 74  PRO n 
1 75  SER n 
1 76  TYR n 
1 77  ASN n 
1 78  SER n 
1 79  ASN n 
1 80  THR n 
1 81  LEU n 
1 82  ASN n 
1 83  ASN n 
1 84  ASP n 
1 85  ILE n 
1 86  MET n 
1 87  LEU n 
1 88  ILE n 
1 89  LYS n 
1 90  LEU n 
1 91  LYS n 
1 92  SER n 
1 93  ALA n 
1 94  ALA n 
1 95  SER n 
1 96  LEU n 
1 97  ASN n 
1 98  SER n 
1 99  ARG n 
1 100 VAL n 
1 101 ALA n 
1 102 SER n 
1 103 ILE n 
1 104 SER n 
1 105 LEU n 
1 106 PRO n 
1 107 THR n 
1 108 SER n 
1 109 CYS n 
1 110 ALA n 
1 111 SER n 
1 112 ALA n 
1 113 GLY n 
1 114 THR n 
1 115 GLN n 
1 116 CYS n 
1 117 LEU n 
1 118 ILE n 
1 119 SER n 
1 120 GLY n 
1 121 TRP n 
1 122 GLY n 
1 123 ASN n 
1 124 THR n 
1 125 LYS n 
1 126 SER n 
1 127 SER n 
1 128 GLY n 
1 129 THR n 
1 130 SER n 
1 131 TYR n 
1 132 PRO n 
1 133 ASP n 
1 134 VAL n 
1 135 LEU n 
1 136 LYS n 
1 137 CYS n 
1 138 LEU n 
1 139 LYS n 
1 140 ALA n 
1 141 PRO n 
1 142 ILE n 
1 143 LEU n 
1 144 SER n 
1 145 ASP n 
1 146 SER n 
1 147 SER n 
1 148 CYS n 
1 149 LYS n 
1 150 SER n 
1 151 ALA n 
1 152 SER n 
1 153 SER n 
1 154 ARG n 
1 155 ILE n 
1 156 ILE n 
1 157 THR n 
1 158 SER n 
1 159 ASN n 
1 160 MET n 
1 161 PHE n 
1 162 CYS n 
1 163 ALA n 
1 164 GLY n 
1 165 TYR n 
1 166 LEU n 
1 167 GLU n 
1 168 GLY n 
1 169 GLY n 
1 170 LYS n 
1 171 ASP n 
1 172 SER n 
1 173 CYS n 
1 174 GLN n 
1 175 GLY n 
1 176 ASP n 
1 177 SER n 
1 178 GLY n 
1 179 GLY n 
1 180 PRO n 
1 181 VAL n 
1 182 VAL n 
1 183 CYS n 
1 184 SER n 
1 185 GLY n 
1 186 LYS n 
1 187 LEU n 
1 188 GLN n 
1 189 GLY n 
1 190 ILE n 
1 191 VAL n 
1 192 SER n 
1 193 TRP n 
1 194 GLY n 
1 195 SER n 
1 196 GLY n 
1 197 CYS n 
1 198 ALA n 
1 199 GLN n 
1 200 LYS n 
1 201 ASN n 
1 202 LYS n 
1 203 PRO n 
1 204 GLY n 
1 205 VAL n 
1 206 TYR n 
1 207 THR n 
1 208 LYS n 
1 209 VAL n 
1 210 CYS n 
1 211 ASN n 
1 212 TYR n 
1 213 VAL n 
1 214 SER n 
1 215 TRP n 
1 216 ILE n 
1 217 LYS n 
1 218 GLN n 
1 219 THR n 
1 220 ILE n 
1 221 ALA n 
1 222 SER n 
1 223 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               cattle 
_entity_src_gen.gene_src_genus                     Bos 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    PANCREAS 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bos taurus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9913 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET3A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TRY1_BOVIN 
_struct_ref.pdbx_db_accession          P00760 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT
LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM
FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
_struct_ref.pdbx_align_begin           21 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1V2J 
_struct_ref_seq.pdbx_strand_id                T 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 223 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00760 
_struct_ref_seq.db_align_beg                  21 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  243 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       16 
_struct_ref_seq.pdbx_auth_seq_align_end       245 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1V2J SER T 152 ? UNP P00760 TYR 172 ENGINEERED 172 1 
1 1V2J SER T 153 ? UNP P00760 PRO 173 ENGINEERED 173 2 
1 1V2J ARG T 154 ? UNP P00760 GLY 174 ENGINEERED 174 3 
1 1V2J ILE T 155 ? UNP P00760 GLN 175 ENGINEERED 175 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
BEN non-polymer         . BENZAMIDINE     ? 'C7 H8 N2'       120.152 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1V2J 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.91 
_exptl_crystal.density_percent_sol   57.35 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_details    'ammonium sulphate, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           287.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2002-08-02 
_diffrn_detector.details                'NI FILTER' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1V2J 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.d_resolution_high            1.44 
_reflns.d_resolution_low             43.88 
_reflns.number_obs                   30102 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1V2J 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.216 
_refine.ls_R_factor_R_free                       0.241 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_d_res_high                            1.90 
_refine.ls_d_res_low                             10.0 
_refine.ls_number_reflns_obs                     22037 
_refine.ls_number_reflns_R_free                  2218 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1628 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             51 
_refine_hist.number_atoms_total               1694 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        10.0 
# 
_struct.entry_id                  1V2J 
_struct.title                     'BENZAMIDINE IN COMPLEX WITH BOVINE TRYPSIN VARIANT X(SSRI)bT.C1' 
_struct.pdbx_descriptor           'Trypsin (E.C.3.4.21.4)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1V2J 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'SERINE PROTEASE, HYDROLASE, SERINE PROTEINASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 38  ? TYR A 42  ? ALA T 55  TYR T 59  5 ? 5  
HELX_P HELX_P2 2 SER A 144 ? SER A 152 ? SER T 164 SER T 172 1 ? 9  
HELX_P HELX_P3 3 TYR A 212 ? SER A 222 ? TYR T 234 SER T 244 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 7   SG ? ? ? 1_555 A CYS 137 SG  ? ? T CYS 22  T CYS 157 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf2 disulf ? ? A CYS 25  SG ? ? ? 1_555 A CYS 41  SG  ? ? T CYS 42  T CYS 58  1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf3 disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 210 SG  ? ? T CYS 128 T CYS 232 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf4 disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 183 SG  ? ? T CYS 136 T CYS 201 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf5 disulf ? ? A CYS 148 SG ? ? ? 1_555 A CYS 162 SG  ? ? T CYS 168 T CYS 182 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf6 disulf ? ? A CYS 173 SG ? ? ? 1_555 A CYS 197 SG  ? ? T CYS 191 T CYS 220 1_555 ? ? ? ? ? ? ? 2.028 ? 
metalc1 metalc ? ? C CA  .   CA ? ? ? 1_555 A GLU 52  OE1 ? ? T CA  480 T GLU 70  1_555 ? ? ? ? ? ? ? 2.465 ? 
metalc2 metalc ? ? C CA  .   CA ? ? ? 1_555 A ASN 54  O   ? ? T CA  480 T ASN 72  1_555 ? ? ? ? ? ? ? 2.512 ? 
metalc3 metalc ? ? C CA  .   CA ? ? ? 1_555 A VAL 57  O   ? ? T CA  480 T VAL 75  1_555 ? ? ? ? ? ? ? 2.450 ? 
metalc4 metalc ? ? C CA  .   CA ? ? ? 1_555 A GLU 62  OE2 ? ? T CA  480 T GLU 80  1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc5 metalc ? ? C CA  .   CA ? ? ? 1_555 E HOH .   O   ? ? T CA  480 T HOH 711 1_555 ? ? ? ? ? ? ? 2.666 ? 
metalc6 metalc ? ? C CA  .   CA ? ? ? 1_555 E HOH .   O   ? ? T CA  480 T HOH 714 1_555 ? ? ? ? ? ? ? 2.696 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 5   ? THR A 6   ? TYR T 20  THR T 21  
A 2 LYS A 136 ? PRO A 141 ? LYS T 156 PRO T 161 
A 3 GLN A 115 ? GLY A 120 ? GLN T 135 GLY T 140 
A 4 PRO A 180 ? CYS A 183 ? PRO T 198 CYS T 201 
A 5 LYS A 186 ? TRP A 193 ? LYS T 204 TRP T 215 
A 6 GLY A 204 ? LYS A 208 ? GLY T 226 LYS T 230 
A 7 MET A 160 ? ALA A 163 ? MET T 180 ALA T 183 
B 1 GLN A 15  ? ASN A 19  ? GLN T 30  ASN T 34  
B 2 HIS A 23  ? ASN A 31  ? HIS T 40  ASN T 48  
B 3 TRP A 34  ? SER A 37  ? TRP T 51  SER T 54  
B 4 MET A 86  ? LEU A 90  ? MET T 104 LEU T 108 
B 5 GLN A 63  ? VAL A 72  ? GLN T 81  VAL T 90  
B 6 GLN A 47  ? LEU A 50  ? GLN T 64  LEU T 67  
B 7 GLN A 15  ? ASN A 19  ? GLN T 30  ASN T 34  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 5   ? N TYR T 20  O CYS A 137 ? O CYS T 157 
A 2 3 O LEU A 138 ? O LEU T 158 N ILE A 118 ? N ILE T 138 
A 3 4 N LEU A 117 ? N LEU T 137 O VAL A 182 ? O VAL T 200 
A 4 5 N CYS A 183 ? N CYS T 201 O LYS A 186 ? O LYS T 204 
A 5 6 N TRP A 193 ? N TRP T 215 O VAL A 205 ? O VAL T 227 
A 6 7 O TYR A 206 ? O TYR T 228 N PHE A 161 ? N PHE T 181 
B 1 2 N LEU A 18  ? N LEU T 33  O CYS A 25  ? O CYS T 42  
B 2 3 N SER A 28  ? N SER T 45  O VAL A 36  ? O VAL T 53  
B 3 4 N VAL A 35  ? N VAL T 52  O ILE A 88  ? O ILE T 106 
B 4 5 O LEU A 87  ? O LEU T 105 N ILE A 71  ? N ILE T 89  
B 5 6 O ILE A 65  ? O ILE T 83  N VAL A 48  ? N VAL T 65  
B 6 7 O GLN A 47  ? O GLN T 64  N ASN A 19  ? N ASN T 34  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 T 600' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA T 480'  
AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE BEN T 1'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 BEN D .   ? BEN T 1   . ? 1_555 ? 
2  AC1 5 HIS A 40  ? HIS T 57  . ? 1_555 ? 
3  AC1 5 GLN A 174 ? GLN T 192 . ? 1_555 ? 
4  AC1 5 GLY A 175 ? GLY T 193 . ? 1_555 ? 
5  AC1 5 SER A 177 ? SER T 195 . ? 1_555 ? 
6  AC2 6 GLU A 52  ? GLU T 70  . ? 1_555 ? 
7  AC2 6 ASN A 54  ? ASN T 72  . ? 1_555 ? 
8  AC2 6 VAL A 57  ? VAL T 75  . ? 1_555 ? 
9  AC2 6 GLU A 62  ? GLU T 80  . ? 1_555 ? 
10 AC2 6 HOH E .   ? HOH T 711 . ? 1_555 ? 
11 AC2 6 HOH E .   ? HOH T 714 . ? 1_555 ? 
12 AC3 7 ASP A 171 ? ASP T 189 . ? 1_555 ? 
13 AC3 7 SER A 172 ? SER T 190 . ? 1_555 ? 
14 AC3 7 GLN A 174 ? GLN T 192 . ? 1_555 ? 
15 AC3 7 SER A 177 ? SER T 195 . ? 1_555 ? 
16 AC3 7 GLY A 196 ? GLY T 219 . ? 1_555 ? 
17 AC3 7 GLY A 204 ? GLY T 226 . ? 1_555 ? 
18 AC3 7 SO4 B .   ? SO4 T 600 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1V2J 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1V2J 
_atom_sites.fract_transf_matrix[1][1]   0.016367 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014217 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015588 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ILE A 1 1   ? -3.410  8.769   11.154 1.00 19.25 ? 16   ILE T N   1 
ATOM   2    C  CA  . ILE A 1 1   ? -3.682  10.227  11.012 1.00 18.27 ? 16   ILE T CA  1 
ATOM   3    C  C   . ILE A 1 1   ? -5.138  10.455  10.624 1.00 18.13 ? 16   ILE T C   1 
ATOM   4    O  O   . ILE A 1 1   ? -5.588  9.959   9.594  1.00 19.44 ? 16   ILE T O   1 
ATOM   5    C  CB  . ILE A 1 1   ? -2.814  10.862  9.915  1.00 17.72 ? 16   ILE T CB  1 
ATOM   6    C  CG1 . ILE A 1 1   ? -1.324  10.633  10.206 1.00 18.73 ? 16   ILE T CG1 1 
ATOM   7    C  CG2 . ILE A 1 1   ? -3.142  12.350  9.809  1.00 16.68 ? 16   ILE T CG2 1 
ATOM   8    C  CD1 . ILE A 1 1   ? -0.807  11.344  11.451 1.00 18.06 ? 16   ILE T CD1 1 
ATOM   9    N  N   . VAL A 1 2   ? -5.865  11.203  11.447 1.00 18.73 ? 17   VAL T N   1 
ATOM   10   C  CA  . VAL A 1 2   ? -7.268  11.507  11.173 1.00 21.03 ? 17   VAL T CA  1 
ATOM   11   C  C   . VAL A 1 2   ? -7.395  12.936  10.659 1.00 21.74 ? 17   VAL T C   1 
ATOM   12   O  O   . VAL A 1 2   ? -6.843  13.865  11.250 1.00 22.52 ? 17   VAL T O   1 
ATOM   13   C  CB  . VAL A 1 2   ? -8.151  11.384  12.445 1.00 21.42 ? 17   VAL T CB  1 
ATOM   14   C  CG1 . VAL A 1 2   ? -9.594  11.747  12.112 1.00 19.80 ? 17   VAL T CG1 1 
ATOM   15   C  CG2 . VAL A 1 2   ? -8.072  9.982   13.009 1.00 22.30 ? 17   VAL T CG2 1 
ATOM   16   N  N   . GLY A 1 3   ? -8.116  13.107  9.553  1.00 22.24 ? 18   GLY T N   1 
ATOM   17   C  CA  . GLY A 1 3   ? -8.319  14.433  8.995  1.00 23.44 ? 18   GLY T CA  1 
ATOM   18   C  C   . GLY A 1 3   ? -7.107  15.019  8.299  1.00 23.62 ? 18   GLY T C   1 
ATOM   19   O  O   . GLY A 1 3   ? -7.036  16.228  8.076  1.00 23.35 ? 18   GLY T O   1 
ATOM   20   N  N   . GLY A 1 4   ? -6.152  14.162  7.950  1.00 23.93 ? 19   GLY T N   1 
ATOM   21   C  CA  . GLY A 1 4   ? -4.955  14.634  7.282  1.00 23.84 ? 19   GLY T CA  1 
ATOM   22   C  C   . GLY A 1 4   ? -5.054  14.516  5.773  1.00 24.38 ? 19   GLY T C   1 
ATOM   23   O  O   . GLY A 1 4   ? -6.150  14.399  5.214  1.00 23.65 ? 19   GLY T O   1 
ATOM   24   N  N   . TYR A 1 5   ? -3.905  14.552  5.108  1.00 22.54 ? 20   TYR T N   1 
ATOM   25   C  CA  . TYR A 1 5   ? -3.866  14.443  3.658  1.00 23.67 ? 20   TYR T CA  1 
ATOM   26   C  C   . TYR A 1 5   ? -2.735  13.519  3.221  1.00 23.88 ? 20   TYR T C   1 
ATOM   27   O  O   . TYR A 1 5   ? -1.852  13.179  4.012  1.00 21.44 ? 20   TYR T O   1 
ATOM   28   C  CB  . TYR A 1 5   ? -3.670  15.823  3.023  1.00 22.69 ? 20   TYR T CB  1 
ATOM   29   C  CG  . TYR A 1 5   ? -2.420  16.542  3.484  1.00 23.90 ? 20   TYR T CG  1 
ATOM   30   C  CD1 . TYR A 1 5   ? -2.393  17.232  4.695  1.00 24.92 ? 20   TYR T CD1 1 
ATOM   31   C  CD2 . TYR A 1 5   ? -1.256  16.507  2.722  1.00 23.61 ? 20   TYR T CD2 1 
ATOM   32   C  CE1 . TYR A 1 5   ? -1.237  17.871  5.137  1.00 24.60 ? 20   TYR T CE1 1 
ATOM   33   C  CE2 . TYR A 1 5   ? -0.095  17.138  3.153  1.00 24.82 ? 20   TYR T CE2 1 
ATOM   34   C  CZ  . TYR A 1 5   ? -0.090  17.817  4.361  1.00 25.21 ? 20   TYR T CZ  1 
ATOM   35   O  OH  . TYR A 1 5   ? 1.066   18.424  4.798  1.00 23.20 ? 20   TYR T OH  1 
ATOM   36   N  N   . THR A 1 6   ? -2.776  13.106  1.961  1.00 23.52 ? 21   THR T N   1 
ATOM   37   C  CA  . THR A 1 6   ? -1.742  12.242  1.419  1.00 23.86 ? 21   THR T CA  1 
ATOM   38   C  C   . THR A 1 6   ? -0.492  13.100  1.261  1.00 23.30 ? 21   THR T C   1 
ATOM   39   O  O   . THR A 1 6   ? -0.529  14.143  0.616  1.00 24.52 ? 21   THR T O   1 
ATOM   40   C  CB  . THR A 1 6   ? -2.170  11.673  0.057  1.00 24.40 ? 21   THR T CB  1 
ATOM   41   O  OG1 . THR A 1 6   ? -3.342  10.868  0.237  1.00 23.01 ? 21   THR T OG1 1 
ATOM   42   C  CG2 . THR A 1 6   ? -1.056  10.824  -0.552 1.00 23.45 ? 21   THR T CG2 1 
ATOM   43   N  N   . CYS A 1 7   ? 0.610   12.663  1.860  1.00 21.82 ? 22   CYS T N   1 
ATOM   44   C  CA  . CYS A 1 7   ? 1.862   13.415  1.807  1.00 21.97 ? 22   CYS T CA  1 
ATOM   45   C  C   . CYS A 1 7   ? 2.494   13.527  0.424  1.00 22.48 ? 22   CYS T C   1 
ATOM   46   O  O   . CYS A 1 7   ? 2.985   14.586  0.034  1.00 22.72 ? 22   CYS T O   1 
ATOM   47   C  CB  . CYS A 1 7   ? 2.914   12.773  2.705  1.00 20.26 ? 22   CYS T CB  1 
ATOM   48   S  SG  . CYS A 1 7   ? 2.532   12.457  4.455  1.00 21.40 ? 22   CYS T SG  1 
ATOM   49   N  N   . GLY A 1 8   ? 2.506   12.415  -0.296 1.00 23.00 ? 23   GLY T N   1 
ATOM   50   C  CA  . GLY A 1 8   ? 3.139   12.379  -1.598 1.00 24.36 ? 23   GLY T CA  1 
ATOM   51   C  C   . GLY A 1 8   ? 4.373   11.511  -1.425 1.00 25.52 ? 23   GLY T C   1 
ATOM   52   O  O   . GLY A 1 8   ? 5.095   11.636  -0.430 1.00 26.00 ? 23   GLY T O   1 
ATOM   53   N  N   . ALA A 1 9   ? 4.618   10.625  -2.381 1.00 25.54 ? 24   ALA T N   1 
ATOM   54   C  CA  . ALA A 1 9   ? 5.759   9.716   -2.312 1.00 24.66 ? 24   ALA T CA  1 
ATOM   55   C  C   . ALA A 1 9   ? 7.087   10.342  -1.908 1.00 23.99 ? 24   ALA T C   1 
ATOM   56   O  O   . ALA A 1 9   ? 7.596   11.243  -2.574 1.00 23.90 ? 24   ALA T O   1 
ATOM   57   C  CB  . ALA A 1 9   ? 5.920   8.996   -3.643 1.00 27.62 ? 24   ALA T CB  1 
ATOM   58   N  N   . ASN A 1 10  ? 7.638   9.856   -0.799 1.00 23.89 ? 25   ASN T N   1 
ATOM   59   C  CA  . ASN A 1 10  ? 8.930   10.309  -0.288 1.00 22.44 ? 25   ASN T CA  1 
ATOM   60   C  C   . ASN A 1 10  ? 9.072   11.803  0.009  1.00 21.89 ? 25   ASN T C   1 
ATOM   61   O  O   . ASN A 1 10  ? 10.174  12.348  -0.059 1.00 20.44 ? 25   ASN T O   1 
ATOM   62   C  CB  . ASN A 1 10  ? 10.031  9.874   -1.257 1.00 23.40 ? 25   ASN T CB  1 
ATOM   63   C  CG  . ASN A 1 10  ? 9.951   8.401   -1.594 1.00 25.22 ? 25   ASN T CG  1 
ATOM   64   O  OD1 . ASN A 1 10  ? 10.094  7.544   -0.721 1.00 28.29 ? 25   ASN T OD1 1 
ATOM   65   N  ND2 . ASN A 1 10  ? 9.708   8.096   -2.863 1.00 24.13 ? 25   ASN T ND2 1 
ATOM   66   N  N   . THR A 1 11  ? 7.970   12.464  0.347  1.00 21.32 ? 26   THR T N   1 
ATOM   67   C  CA  . THR A 1 11  ? 8.028   13.884  0.672  1.00 21.58 ? 26   THR T CA  1 
ATOM   68   C  C   . THR A 1 11  ? 8.442   14.065  2.133  1.00 20.41 ? 26   THR T C   1 
ATOM   69   O  O   . THR A 1 11  ? 8.745   15.171  2.571  1.00 18.65 ? 26   THR T O   1 
ATOM   70   C  CB  . THR A 1 11  ? 6.671   14.569  0.427  1.00 22.87 ? 26   THR T CB  1 
ATOM   71   O  OG1 . THR A 1 11  ? 5.655   13.894  1.171  1.00 25.49 ? 26   THR T OG1 1 
ATOM   72   C  CG2 . THR A 1 11  ? 6.317   14.522  -1.058 1.00 23.97 ? 26   THR T CG2 1 
ATOM   73   N  N   . VAL A 1 12  ? 8.443   12.963  2.880  1.00 20.98 ? 27   VAL T N   1 
ATOM   74   C  CA  . VAL A 1 12  ? 8.853   12.957  4.290  1.00 19.77 ? 27   VAL T CA  1 
ATOM   75   C  C   . VAL A 1 12  ? 9.938   11.875  4.364  1.00 19.88 ? 27   VAL T C   1 
ATOM   76   O  O   . VAL A 1 12  ? 9.736   10.813  4.944  1.00 19.41 ? 27   VAL T O   1 
ATOM   77   C  CB  . VAL A 1 12  ? 7.681   12.576  5.211  1.00 19.68 ? 27   VAL T CB  1 
ATOM   78   C  CG1 . VAL A 1 12  ? 8.053   12.836  6.659  1.00 20.19 ? 27   VAL T CG1 1 
ATOM   79   C  CG2 . VAL A 1 12  ? 6.431   13.362  4.820  1.00 18.58 ? 27   VAL T CG2 1 
ATOM   80   N  N   . PRO A 1 13  ? 11.118  12.158  3.783  1.00 19.91 ? 28   PRO T N   1 
ATOM   81   C  CA  . PRO A 1 13  ? 12.296  11.286  3.702  1.00 17.63 ? 28   PRO T CA  1 
ATOM   82   C  C   . PRO A 1 13  ? 12.837  10.665  4.987  1.00 16.41 ? 28   PRO T C   1 
ATOM   83   O  O   . PRO A 1 13  ? 13.523  9.649   4.936  1.00 14.95 ? 28   PRO T O   1 
ATOM   84   C  CB  . PRO A 1 13  ? 13.327  12.174  3.002  1.00 18.57 ? 28   PRO T CB  1 
ATOM   85   C  CG  . PRO A 1 13  ? 13.005  13.516  3.531  1.00 19.89 ? 28   PRO T CG  1 
ATOM   86   C  CD  . PRO A 1 13  ? 11.486  13.544  3.431  1.00 20.39 ? 28   PRO T CD  1 
ATOM   87   N  N   . TYR A 1 14  ? 12.526  11.263  6.132  1.00 16.15 ? 29   TYR T N   1 
ATOM   88   C  CA  . TYR A 1 14  ? 13.000  10.749  7.413  1.00 15.28 ? 29   TYR T CA  1 
ATOM   89   C  C   . TYR A 1 14  ? 11.973  9.833   8.093  1.00 16.13 ? 29   TYR T C   1 
ATOM   90   O  O   . TYR A 1 14  ? 12.248  9.267   9.152  1.00 16.58 ? 29   TYR T O   1 
ATOM   91   C  CB  . TYR A 1 14  ? 13.357  11.923  8.330  1.00 14.15 ? 29   TYR T CB  1 
ATOM   92   C  CG  . TYR A 1 14  ? 12.239  12.929  8.456  1.00 16.03 ? 29   TYR T CG  1 
ATOM   93   C  CD1 . TYR A 1 14  ? 11.174  12.705  9.325  1.00 13.46 ? 29   TYR T CD1 1 
ATOM   94   C  CD2 . TYR A 1 14  ? 12.208  14.072  7.652  1.00 16.41 ? 29   TYR T CD2 1 
ATOM   95   C  CE1 . TYR A 1 14  ? 10.103  13.582  9.393  1.00 15.97 ? 29   TYR T CE1 1 
ATOM   96   C  CE2 . TYR A 1 14  ? 11.133  14.962  7.711  1.00 17.36 ? 29   TYR T CE2 1 
ATOM   97   C  CZ  . TYR A 1 14  ? 10.082  14.703  8.588  1.00 16.95 ? 29   TYR T CZ  1 
ATOM   98   O  OH  . TYR A 1 14  ? 8.994   15.545  8.642  1.00 15.87 ? 29   TYR T OH  1 
ATOM   99   N  N   . GLN A 1 15  ? 10.795  9.691   7.488  1.00 15.07 ? 30   GLN T N   1 
ATOM   100  C  CA  . GLN A 1 15  ? 9.752   8.838   8.053  1.00 15.07 ? 30   GLN T CA  1 
ATOM   101  C  C   . GLN A 1 15  ? 10.139  7.372   7.911  1.00 16.60 ? 30   GLN T C   1 
ATOM   102  O  O   . GLN A 1 15  ? 10.530  6.910   6.835  1.00 15.16 ? 30   GLN T O   1 
ATOM   103  C  CB  . GLN A 1 15  ? 8.401   9.076   7.365  1.00 14.87 ? 30   GLN T CB  1 
ATOM   104  C  CG  . GLN A 1 15  ? 7.289   8.097   7.798  1.00 16.10 ? 30   GLN T CG  1 
ATOM   105  C  CD  . GLN A 1 15  ? 6.699   8.398   9.175  1.00 16.92 ? 30   GLN T CD  1 
ATOM   106  O  OE1 . GLN A 1 15  ? 6.528   7.500   10.007 1.00 19.64 ? 30   GLN T OE1 1 
ATOM   107  N  NE2 . GLN A 1 15  ? 6.369   9.655   9.412  1.00 14.47 ? 30   GLN T NE2 1 
ATOM   108  N  N   . VAL A 1 16  ? 10.016  6.646   9.014  1.00 16.68 ? 31   VAL T N   1 
ATOM   109  C  CA  . VAL A 1 16  ? 10.352  5.241   9.057  1.00 17.82 ? 31   VAL T CA  1 
ATOM   110  C  C   . VAL A 1 16  ? 9.143   4.420   9.493  1.00 17.72 ? 31   VAL T C   1 
ATOM   111  O  O   . VAL A 1 16  ? 8.291   4.901   10.239 1.00 18.97 ? 31   VAL T O   1 
ATOM   112  C  CB  . VAL A 1 16  ? 11.509  5.011   10.064 1.00 20.10 ? 31   VAL T CB  1 
ATOM   113  C  CG1 . VAL A 1 16  ? 11.657  3.549   10.372 1.00 23.23 ? 31   VAL T CG1 1 
ATOM   114  C  CG2 . VAL A 1 16  ? 12.809  5.565   9.498  1.00 21.72 ? 31   VAL T CG2 1 
ATOM   115  N  N   . SER A 1 17  ? 9.062   3.188   9.006  1.00 17.13 ? 32   SER T N   1 
ATOM   116  C  CA  . SER A 1 17  ? 7.993   2.281   9.405  1.00 16.86 ? 32   SER T CA  1 
ATOM   117  C  C   . SER A 1 17  ? 8.650   1.101   10.113 1.00 16.31 ? 32   SER T C   1 
ATOM   118  O  O   . SER A 1 17  ? 9.579   0.496   9.573  1.00 15.54 ? 32   SER T O   1 
ATOM   119  C  CB  . SER A 1 17  ? 7.211   1.766   8.191  1.00 17.70 ? 32   SER T CB  1 
ATOM   120  O  OG  . SER A 1 17  ? 6.392   0.661   8.559  1.00 15.78 ? 32   SER T OG  1 
ATOM   121  N  N   . LEU A 1 18  ? 8.191   0.798   11.328 1.00 14.61 ? 33   LEU T N   1 
ATOM   122  C  CA  . LEU A 1 18  ? 8.716   -0.337  12.085 1.00 15.61 ? 33   LEU T CA  1 
ATOM   123  C  C   . LEU A 1 18  ? 7.841   -1.522  11.711 1.00 17.08 ? 33   LEU T C   1 
ATOM   124  O  O   . LEU A 1 18  ? 6.617   -1.473  11.852 1.00 16.09 ? 33   LEU T O   1 
ATOM   125  C  CB  . LEU A 1 18  ? 8.652   -0.064  13.589 1.00 14.86 ? 33   LEU T CB  1 
ATOM   126  C  CG  . LEU A 1 18  ? 9.423   1.173   14.056 1.00 16.75 ? 33   LEU T CG  1 
ATOM   127  C  CD1 . LEU A 1 18  ? 9.501   1.165   15.574 1.00 17.03 ? 33   LEU T CD1 1 
ATOM   128  C  CD2 . LEU A 1 18  ? 10.826  1.185   13.453 1.00 17.34 ? 33   LEU T CD2 1 
ATOM   129  N  N   . ASN A 1 19  ? 8.478   -2.590  11.243 1.00 17.36 ? 34   ASN T N   1 
ATOM   130  C  CA  . ASN A 1 19  ? 7.758   -3.762  10.765 1.00 17.40 ? 34   ASN T CA  1 
ATOM   131  C  C   . ASN A 1 19  ? 8.129   -5.069  11.461 1.00 18.57 ? 34   ASN T C   1 
ATOM   132  O  O   . ASN A 1 19  ? 9.304   -5.364  11.667 1.00 17.68 ? 34   ASN T O   1 
ATOM   133  C  CB  . ASN A 1 19  ? 8.008   -3.872  9.250  1.00 17.20 ? 34   ASN T CB  1 
ATOM   134  C  CG  . ASN A 1 19  ? 7.233   -4.996  8.596  1.00 21.01 ? 34   ASN T CG  1 
ATOM   135  O  OD1 . ASN A 1 19  ? 7.537   -6.174  8.791  1.00 17.95 ? 34   ASN T OD1 1 
ATOM   136  N  ND2 . ASN A 1 19  ? 6.226   -4.634  7.799  1.00 19.05 ? 34   ASN T ND2 1 
ATOM   137  N  N   . SER A 1 20  ? 7.106   -5.837  11.829 1.00 19.30 ? 37   SER T N   1 
ATOM   138  C  CA  . SER A 1 20  ? 7.284   -7.139  12.469 1.00 20.50 ? 37   SER T CA  1 
ATOM   139  C  C   . SER A 1 20  ? 6.326   -8.105  11.773 1.00 20.87 ? 37   SER T C   1 
ATOM   140  O  O   . SER A 1 20  ? 5.612   -8.871  12.421 1.00 23.98 ? 37   SER T O   1 
ATOM   141  C  CB  . SER A 1 20  ? 6.945   -7.070  13.966 1.00 20.85 ? 37   SER T CB  1 
ATOM   142  O  OG  . SER A 1 20  ? 5.563   -6.825  14.169 1.00 21.23 ? 37   SER T OG  1 
ATOM   143  N  N   . GLY A 1 21  ? 6.314   -8.060  10.445 1.00 19.35 ? 38   GLY T N   1 
ATOM   144  C  CA  . GLY A 1 21  ? 5.422   -8.913  9.685  1.00 19.33 ? 38   GLY T CA  1 
ATOM   145  C  C   . GLY A 1 21  ? 4.218   -8.082  9.301  1.00 19.09 ? 38   GLY T C   1 
ATOM   146  O  O   . GLY A 1 21  ? 3.303   -8.546  8.616  1.00 19.60 ? 38   GLY T O   1 
ATOM   147  N  N   . TYR A 1 22  ? 4.245   -6.833  9.760  1.00 17.88 ? 39   TYR T N   1 
ATOM   148  C  CA  . TYR A 1 22  ? 3.204   -5.849  9.509  1.00 17.92 ? 39   TYR T CA  1 
ATOM   149  C  C   . TYR A 1 22  ? 3.667   -4.538  10.139 1.00 17.95 ? 39   TYR T C   1 
ATOM   150  O  O   . TYR A 1 22  ? 4.528   -4.536  11.017 1.00 18.74 ? 39   TYR T O   1 
ATOM   151  C  CB  . TYR A 1 22  ? 1.875   -6.277  10.144 1.00 19.43 ? 39   TYR T CB  1 
ATOM   152  C  CG  . TYR A 1 22  ? 1.949   -6.510  11.637 1.00 22.12 ? 39   TYR T CG  1 
ATOM   153  C  CD1 . TYR A 1 22  ? 2.521   -7.672  12.152 1.00 22.54 ? 39   TYR T CD1 1 
ATOM   154  C  CD2 . TYR A 1 22  ? 1.462   -5.562  12.538 1.00 23.38 ? 39   TYR T CD2 1 
ATOM   155  C  CE1 . TYR A 1 22  ? 2.609   -7.887  13.524 1.00 25.21 ? 39   TYR T CE1 1 
ATOM   156  C  CE2 . TYR A 1 22  ? 1.548   -5.766  13.917 1.00 25.60 ? 39   TYR T CE2 1 
ATOM   157  C  CZ  . TYR A 1 22  ? 2.125   -6.933  14.400 1.00 25.18 ? 39   TYR T CZ  1 
ATOM   158  O  OH  . TYR A 1 22  ? 2.236   -7.142  15.753 1.00 26.83 ? 39   TYR T OH  1 
ATOM   159  N  N   . HIS A 1 23  ? 3.103   -3.427  9.681  1.00 16.41 ? 40   HIS T N   1 
ATOM   160  C  CA  . HIS A 1 23  ? 3.439   -2.109  10.218 1.00 16.19 ? 40   HIS T CA  1 
ATOM   161  C  C   . HIS A 1 23  ? 2.806   -1.959  11.600 1.00 16.36 ? 40   HIS T C   1 
ATOM   162  O  O   . HIS A 1 23  ? 1.609   -2.196  11.758 1.00 17.42 ? 40   HIS T O   1 
ATOM   163  C  CB  . HIS A 1 23  ? 2.893   -1.017  9.299  1.00 15.43 ? 40   HIS T CB  1 
ATOM   164  C  CG  . HIS A 1 23  ? 2.969   0.354   9.890  1.00 18.24 ? 40   HIS T CG  1 
ATOM   165  N  ND1 . HIS A 1 23  ? 4.131   1.096   9.898  1.00 15.78 ? 40   HIS T ND1 1 
ATOM   166  C  CD2 . HIS A 1 23  ? 2.047   1.087   10.559 1.00 16.86 ? 40   HIS T CD2 1 
ATOM   167  C  CE1 . HIS A 1 23  ? 3.921   2.226   10.550 1.00 19.30 ? 40   HIS T CE1 1 
ATOM   168  N  NE2 . HIS A 1 23  ? 2.666   2.244   10.962 1.00 19.06 ? 40   HIS T NE2 1 
ATOM   169  N  N   . PHE A 1 24  ? 3.592   -1.571  12.601 1.00 15.74 ? 41   PHE T N   1 
ATOM   170  C  CA  . PHE A 1 24  ? 3.035   -1.411  13.944 1.00 17.64 ? 41   PHE T CA  1 
ATOM   171  C  C   . PHE A 1 24  ? 3.361   -0.070  14.593 1.00 17.00 ? 41   PHE T C   1 
ATOM   172  O  O   . PHE A 1 24  ? 2.707   0.331   15.552 1.00 17.49 ? 41   PHE T O   1 
ATOM   173  C  CB  . PHE A 1 24  ? 3.460   -2.585  14.858 1.00 15.40 ? 41   PHE T CB  1 
ATOM   174  C  CG  . PHE A 1 24  ? 4.917   -2.587  15.242 1.00 16.50 ? 41   PHE T CG  1 
ATOM   175  C  CD1 . PHE A 1 24  ? 5.355   -1.909  16.378 1.00 14.46 ? 41   PHE T CD1 1 
ATOM   176  C  CD2 . PHE A 1 24  ? 5.853   -3.278  14.473 1.00 15.84 ? 41   PHE T CD2 1 
ATOM   177  C  CE1 . PHE A 1 24  ? 6.701   -1.919  16.739 1.00 16.49 ? 41   PHE T CE1 1 
ATOM   178  C  CE2 . PHE A 1 24  ? 7.195   -3.292  14.825 1.00 15.28 ? 41   PHE T CE2 1 
ATOM   179  C  CZ  . PHE A 1 24  ? 7.622   -2.610  15.963 1.00 17.54 ? 41   PHE T CZ  1 
ATOM   180  N  N   . CYS A 1 25  ? 4.357   0.632   14.061 1.00 16.34 ? 42   CYS T N   1 
ATOM   181  C  CA  . CYS A 1 25  ? 4.744   1.939   14.602 1.00 17.28 ? 42   CYS T CA  1 
ATOM   182  C  C   . CYS A 1 25  ? 5.567   2.740   13.611 1.00 15.98 ? 42   CYS T C   1 
ATOM   183  O  O   . CYS A 1 25  ? 6.066   2.202   12.635 1.00 15.88 ? 42   CYS T O   1 
ATOM   184  C  CB  . CYS A 1 25  ? 5.573   1.780   15.877 1.00 15.27 ? 42   CYS T CB  1 
ATOM   185  S  SG  . CYS A 1 25  ? 4.643   1.586   17.425 1.00 16.60 ? 42   CYS T SG  1 
ATOM   186  N  N   . GLY A 1 26  ? 5.704   4.034   13.885 1.00 16.70 ? 43   GLY T N   1 
ATOM   187  C  CA  . GLY A 1 26  ? 6.499   4.894   13.035 1.00 15.59 ? 43   GLY T CA  1 
ATOM   188  C  C   . GLY A 1 26  ? 7.806   5.201   13.739 1.00 15.70 ? 43   GLY T C   1 
ATOM   189  O  O   . GLY A 1 26  ? 8.026   4.755   14.870 1.00 13.12 ? 43   GLY T O   1 
ATOM   190  N  N   . GLY A 1 27  ? 8.672   5.961   13.073 1.00 15.49 ? 44   GLY T N   1 
ATOM   191  C  CA  . GLY A 1 27  ? 9.953   6.325   13.656 1.00 15.37 ? 44   GLY T CA  1 
ATOM   192  C  C   . GLY A 1 27  ? 10.590  7.423   12.826 1.00 14.46 ? 44   GLY T C   1 
ATOM   193  O  O   . GLY A 1 27  ? 10.056  7.786   11.779 1.00 12.36 ? 44   GLY T O   1 
ATOM   194  N  N   . SER A 1 28  ? 11.721  7.953   13.289 1.00 14.25 ? 45   SER T N   1 
ATOM   195  C  CA  . SER A 1 28  ? 12.427  9.017   12.579 1.00 15.37 ? 45   SER T CA  1 
ATOM   196  C  C   . SER A 1 28  ? 13.910  8.713   12.431 1.00 16.35 ? 45   SER T C   1 
ATOM   197  O  O   . SER A 1 28  ? 14.583  8.365   13.401 1.00 17.16 ? 45   SER T O   1 
ATOM   198  C  CB  . SER A 1 28  ? 12.269  10.351  13.315 1.00 15.97 ? 45   SER T CB  1 
ATOM   199  O  OG  . SER A 1 28  ? 10.938  10.820  13.241 1.00 19.87 ? 45   SER T OG  1 
ATOM   200  N  N   . LEU A 1 29  ? 14.419  8.849   11.212 1.00 16.33 ? 46   LEU T N   1 
ATOM   201  C  CA  . LEU A 1 29  ? 15.832  8.603   10.954 1.00 16.55 ? 46   LEU T CA  1 
ATOM   202  C  C   . LEU A 1 29  ? 16.601  9.854   11.380 1.00 17.16 ? 46   LEU T C   1 
ATOM   203  O  O   . LEU A 1 29  ? 16.358  10.927  10.837 1.00 19.35 ? 46   LEU T O   1 
ATOM   204  C  CB  . LEU A 1 29  ? 16.051  8.348   9.463  1.00 15.40 ? 46   LEU T CB  1 
ATOM   205  C  CG  . LEU A 1 29  ? 17.438  7.872   9.029  1.00 17.59 ? 46   LEU T CG  1 
ATOM   206  C  CD1 . LEU A 1 29  ? 17.719  6.500   9.644  1.00 16.88 ? 46   LEU T CD1 1 
ATOM   207  C  CD2 . LEU A 1 29  ? 17.500  7.808   7.504  1.00 16.10 ? 46   LEU T CD2 1 
ATOM   208  N  N   . ILE A 1 30  ? 17.512  9.730   12.345 1.00 17.28 ? 47   ILE T N   1 
ATOM   209  C  CA  . ILE A 1 30  ? 18.280  10.900  12.784 1.00 20.16 ? 47   ILE T CA  1 
ATOM   210  C  C   . ILE A 1 30  ? 19.711  10.898  12.249 1.00 20.61 ? 47   ILE T C   1 
ATOM   211  O  O   . ILE A 1 30  ? 20.409  11.903  12.327 1.00 21.67 ? 47   ILE T O   1 
ATOM   212  C  CB  . ILE A 1 30  ? 18.302  11.050  14.323 1.00 20.42 ? 47   ILE T CB  1 
ATOM   213  C  CG1 . ILE A 1 30  ? 18.889  9.802   14.970 1.00 21.43 ? 47   ILE T CG1 1 
ATOM   214  C  CG2 . ILE A 1 30  ? 16.892  11.333  14.832 1.00 19.90 ? 47   ILE T CG2 1 
ATOM   215  C  CD1 . ILE A 1 30  ? 19.255  10.006  16.416 1.00 21.39 ? 47   ILE T CD1 1 
ATOM   216  N  N   . ASN A 1 31  ? 20.143  9.754   11.730 1.00 22.21 ? 48   ASN T N   1 
ATOM   217  C  CA  . ASN A 1 31  ? 21.448  9.611   11.092 1.00 22.96 ? 48   ASN T CA  1 
ATOM   218  C  C   . ASN A 1 31  ? 21.463  8.288   10.333 1.00 23.52 ? 48   ASN T C   1 
ATOM   219  O  O   . ASN A 1 31  ? 20.492  7.530   10.385 1.00 22.47 ? 48   ASN T O   1 
ATOM   220  C  CB  . ASN A 1 31  ? 22.625  9.732   12.083 1.00 23.37 ? 48   ASN T CB  1 
ATOM   221  C  CG  . ASN A 1 31  ? 22.668  8.627   13.110 1.00 24.65 ? 48   ASN T CG  1 
ATOM   222  O  OD1 . ASN A 1 31  ? 22.727  7.448   12.777 1.00 24.22 ? 48   ASN T OD1 1 
ATOM   223  N  ND2 . ASN A 1 31  ? 22.661  9.011   14.381 1.00 26.50 ? 48   ASN T ND2 1 
ATOM   224  N  N   . SER A 1 32  ? 22.549  8.012   9.622  1.00 22.37 ? 49   SER T N   1 
ATOM   225  C  CA  . SER A 1 32  ? 22.634  6.803   8.807  1.00 23.37 ? 49   SER T CA  1 
ATOM   226  C  C   . SER A 1 32  ? 22.397  5.480   9.526  1.00 22.56 ? 49   SER T C   1 
ATOM   227  O  O   . SER A 1 32  ? 22.013  4.495   8.893  1.00 22.46 ? 49   SER T O   1 
ATOM   228  C  CB  . SER A 1 32  ? 23.989  6.748   8.102  1.00 24.40 ? 49   SER T CB  1 
ATOM   229  O  OG  . SER A 1 32  ? 25.018  6.466   9.035  1.00 27.30 ? 49   SER T OG  1 
ATOM   230  N  N   . GLN A 1 33  ? 22.609  5.449   10.838 1.00 21.95 ? 50   GLN T N   1 
ATOM   231  C  CA  . GLN A 1 33  ? 22.432  4.207   11.583 1.00 22.47 ? 50   GLN T CA  1 
ATOM   232  C  C   . GLN A 1 33  ? 21.515  4.239   12.795 1.00 20.37 ? 50   GLN T C   1 
ATOM   233  O  O   . GLN A 1 33  ? 21.456  3.260   13.536 1.00 19.09 ? 50   GLN T O   1 
ATOM   234  C  CB  . GLN A 1 33  ? 23.787  3.676   12.045 1.00 26.41 ? 50   GLN T CB  1 
ATOM   235  C  CG  . GLN A 1 33  ? 24.440  2.710   11.088 1.00 33.88 ? 50   GLN T CG  1 
ATOM   236  C  CD  . GLN A 1 33  ? 25.601  1.980   11.732 1.00 37.56 ? 50   GLN T CD  1 
ATOM   237  O  OE1 . GLN A 1 33  ? 26.598  2.596   12.118 1.00 38.46 ? 50   GLN T OE1 1 
ATOM   238  N  NE2 . GLN A 1 33  ? 25.473  0.660   11.865 1.00 39.24 ? 50   GLN T NE2 1 
ATOM   239  N  N   . TRP A 1 34  ? 20.813  5.345   13.013 1.00 19.60 ? 51   TRP T N   1 
ATOM   240  C  CA  . TRP A 1 34  ? 19.940  5.432   14.180 1.00 18.91 ? 51   TRP T CA  1 
ATOM   241  C  C   . TRP A 1 34  ? 18.563  6.012   13.896 1.00 18.53 ? 51   TRP T C   1 
ATOM   242  O  O   . TRP A 1 34  ? 18.414  6.978   13.146 1.00 19.18 ? 51   TRP T O   1 
ATOM   243  C  CB  . TRP A 1 34  ? 20.606  6.251   15.298 1.00 17.59 ? 51   TRP T CB  1 
ATOM   244  C  CG  . TRP A 1 34  ? 21.806  5.595   15.924 1.00 19.46 ? 51   TRP T CG  1 
ATOM   245  C  CD1 . TRP A 1 34  ? 23.096  5.644   15.477 1.00 19.12 ? 51   TRP T CD1 1 
ATOM   246  C  CD2 . TRP A 1 34  ? 21.826  4.803   17.119 1.00 18.48 ? 51   TRP T CD2 1 
ATOM   247  N  NE1 . TRP A 1 34  ? 23.918  4.938   16.321 1.00 18.13 ? 51   TRP T NE1 1 
ATOM   248  C  CE2 . TRP A 1 34  ? 23.166  4.410   17.337 1.00 20.10 ? 51   TRP T CE2 1 
ATOM   249  C  CE3 . TRP A 1 34  ? 20.841  4.387   18.027 1.00 19.91 ? 51   TRP T CE3 1 
ATOM   250  C  CZ2 . TRP A 1 34  ? 23.550  3.622   18.431 1.00 18.92 ? 51   TRP T CZ2 1 
ATOM   251  C  CZ3 . TRP A 1 34  ? 21.221  3.604   19.115 1.00 20.57 ? 51   TRP T CZ3 1 
ATOM   252  C  CH2 . TRP A 1 34  ? 22.569  3.230   19.306 1.00 21.25 ? 51   TRP T CH2 1 
ATOM   253  N  N   . VAL A 1 35  ? 17.561  5.403   14.520 1.00 18.11 ? 52   VAL T N   1 
ATOM   254  C  CA  . VAL A 1 35  ? 16.178  5.822   14.387 1.00 17.77 ? 52   VAL T CA  1 
ATOM   255  C  C   . VAL A 1 35  ? 15.659  6.120   15.783 1.00 16.62 ? 52   VAL T C   1 
ATOM   256  O  O   . VAL A 1 35  ? 16.063  5.476   16.749 1.00 18.34 ? 52   VAL T O   1 
ATOM   257  C  CB  . VAL A 1 35  ? 15.309  4.697   13.766 1.00 18.21 ? 52   VAL T CB  1 
ATOM   258  C  CG1 . VAL A 1 35  ? 13.827  5.013   13.938 1.00 18.74 ? 52   VAL T CG1 1 
ATOM   259  C  CG2 . VAL A 1 35  ? 15.643  4.537   12.296 1.00 16.64 ? 52   VAL T CG2 1 
ATOM   260  N  N   . VAL A 1 36  ? 14.789  7.115   15.895 1.00 16.53 ? 53   VAL T N   1 
ATOM   261  C  CA  . VAL A 1 36  ? 14.196  7.444   17.178 1.00 17.03 ? 53   VAL T CA  1 
ATOM   262  C  C   . VAL A 1 36  ? 12.707  7.109   17.060 1.00 15.97 ? 53   VAL T C   1 
ATOM   263  O  O   . VAL A 1 36  ? 12.084  7.366   16.029 1.00 13.59 ? 53   VAL T O   1 
ATOM   264  C  CB  . VAL A 1 36  ? 14.383  8.940   17.533 1.00 17.31 ? 53   VAL T CB  1 
ATOM   265  C  CG1 . VAL A 1 36  ? 13.680  9.813   16.511 1.00 21.44 ? 53   VAL T CG1 1 
ATOM   266  C  CG2 . VAL A 1 36  ? 13.844  9.211   18.929 1.00 19.56 ? 53   VAL T CG2 1 
ATOM   267  N  N   . SER A 1 37  ? 12.149  6.518   18.109 1.00 14.84 ? 54   SER T N   1 
ATOM   268  C  CA  . SER A 1 37  ? 10.739  6.140   18.108 1.00 13.93 ? 54   SER T CA  1 
ATOM   269  C  C   . SER A 1 37  ? 10.221  6.191   19.549 1.00 13.33 ? 54   SER T C   1 
ATOM   270  O  O   . SER A 1 37  ? 10.879  6.747   20.421 1.00 12.52 ? 54   SER T O   1 
ATOM   271  C  CB  . SER A 1 37  ? 10.586  4.727   17.529 1.00 12.30 ? 54   SER T CB  1 
ATOM   272  O  OG  . SER A 1 37  ? 9.232   4.313   17.500 1.00 13.36 ? 54   SER T OG  1 
ATOM   273  N  N   . ALA A 1 38  ? 9.053   5.602   19.793 1.00 12.84 ? 55   ALA T N   1 
ATOM   274  C  CA  . ALA A 1 38  ? 8.465   5.600   21.128 1.00 14.26 ? 55   ALA T CA  1 
ATOM   275  C  C   . ALA A 1 38  ? 8.820   4.333   21.896 1.00 14.49 ? 55   ALA T C   1 
ATOM   276  O  O   . ALA A 1 38  ? 8.848   3.240   21.331 1.00 14.53 ? 55   ALA T O   1 
ATOM   277  C  CB  . ALA A 1 38  ? 6.949   5.736   21.030 1.00 11.07 ? 55   ALA T CB  1 
ATOM   278  N  N   . ALA A 1 39  ? 9.093   4.474   23.189 1.00 14.94 ? 56   ALA T N   1 
ATOM   279  C  CA  . ALA A 1 39  ? 9.420   3.303   23.998 1.00 14.69 ? 56   ALA T CA  1 
ATOM   280  C  C   . ALA A 1 39  ? 8.270   2.282   24.009 1.00 15.59 ? 56   ALA T C   1 
ATOM   281  O  O   . ALA A 1 39  ? 8.522   1.077   24.013 1.00 14.49 ? 56   ALA T O   1 
ATOM   282  C  CB  . ALA A 1 39  ? 9.765   3.720   25.421 1.00 13.03 ? 56   ALA T CB  1 
ATOM   283  N  N   . HIS A 1 40  ? 7.013   2.735   23.993 1.00 14.74 ? 57   HIS T N   1 
ATOM   284  C  CA  . HIS A 1 40  ? 5.924   1.763   24.025 1.00 17.66 ? 57   HIS T CA  1 
ATOM   285  C  C   . HIS A 1 40  ? 5.778   0.980   22.722 1.00 19.43 ? 57   HIS T C   1 
ATOM   286  O  O   . HIS A 1 40  ? 4.908   0.111   22.609 1.00 19.04 ? 57   HIS T O   1 
ATOM   287  C  CB  . HIS A 1 40  ? 4.580   2.401   24.440 1.00 15.83 ? 57   HIS T CB  1 
ATOM   288  C  CG  . HIS A 1 40  ? 3.871   3.143   23.347 1.00 15.59 ? 57   HIS T CG  1 
ATOM   289  N  ND1 . HIS A 1 40  ? 4.028   4.498   23.140 1.00 15.13 ? 57   HIS T ND1 1 
ATOM   290  C  CD2 . HIS A 1 40  ? 2.944   2.732   22.449 1.00 13.97 ? 57   HIS T CD2 1 
ATOM   291  C  CE1 . HIS A 1 40  ? 3.225   4.889   22.166 1.00 13.49 ? 57   HIS T CE1 1 
ATOM   292  N  NE2 . HIS A 1 40  ? 2.557   3.836   21.730 1.00 14.37 ? 57   HIS T NE2 1 
ATOM   293  N  N   . CYS A 1 41  ? 6.641   1.281   21.749 1.00 17.36 ? 58   CYS T N   1 
ATOM   294  C  CA  . CYS A 1 41  ? 6.646   0.571   20.471 1.00 17.73 ? 58   CYS T CA  1 
ATOM   295  C  C   . CYS A 1 41  ? 7.683   -0.546  20.531 1.00 19.40 ? 58   CYS T C   1 
ATOM   296  O  O   . CYS A 1 41  ? 7.876   -1.277  19.556 1.00 21.94 ? 58   CYS T O   1 
ATOM   297  C  CB  . CYS A 1 41  ? 7.027   1.496   19.315 1.00 15.02 ? 58   CYS T CB  1 
ATOM   298  S  SG  . CYS A 1 41  ? 5.749   2.659   18.750 1.00 18.53 ? 58   CYS T SG  1 
ATOM   299  N  N   . TYR A 1 42  ? 8.358   -0.672  21.671 1.00 19.18 ? 59   TYR T N   1 
ATOM   300  C  CA  . TYR A 1 42  ? 9.385   -1.693  21.815 1.00 20.54 ? 59   TYR T CA  1 
ATOM   301  C  C   . TYR A 1 42  ? 8.887   -3.101  21.529 1.00 20.46 ? 59   TYR T C   1 
ATOM   302  O  O   . TYR A 1 42  ? 7.800   -3.502  21.950 1.00 18.00 ? 59   TYR T O   1 
ATOM   303  C  CB  . TYR A 1 42  ? 10.004  -1.690  23.212 1.00 21.73 ? 59   TYR T CB  1 
ATOM   304  C  CG  . TYR A 1 42  ? 10.982  -2.834  23.376 1.00 24.50 ? 59   TYR T CG  1 
ATOM   305  C  CD1 . TYR A 1 42  ? 12.260  -2.766  22.827 1.00 24.30 ? 59   TYR T CD1 1 
ATOM   306  C  CD2 . TYR A 1 42  ? 10.598  -4.019  24.003 1.00 26.85 ? 59   TYR T CD2 1 
ATOM   307  C  CE1 . TYR A 1 42  ? 13.135  -3.854  22.896 1.00 27.88 ? 59   TYR T CE1 1 
ATOM   308  C  CE2 . TYR A 1 42  ? 11.459  -5.113  24.072 1.00 27.63 ? 59   TYR T CE2 1 
ATOM   309  C  CZ  . TYR A 1 42  ? 12.726  -5.022  23.517 1.00 28.52 ? 59   TYR T CZ  1 
ATOM   310  O  OH  . TYR A 1 42  ? 13.575  -6.102  23.579 1.00 28.58 ? 59   TYR T OH  1 
ATOM   311  N  N   . LYS A 1 43  ? 9.729   -3.854  20.840 1.00 20.86 ? 60   LYS T N   1 
ATOM   312  C  CA  . LYS A 1 43  ? 9.432   -5.223  20.468 1.00 22.89 ? 60   LYS T CA  1 
ATOM   313  C  C   . LYS A 1 43  ? 10.738  -5.838  19.992 1.00 23.06 ? 60   LYS T C   1 
ATOM   314  O  O   . LYS A 1 43  ? 11.627  -5.127  19.525 1.00 22.45 ? 60   LYS T O   1 
ATOM   315  C  CB  . LYS A 1 43  ? 8.415   -5.211  19.332 1.00 25.03 ? 60   LYS T CB  1 
ATOM   316  C  CG  . LYS A 1 43  ? 7.992   -6.554  18.827 1.00 28.97 ? 60   LYS T CG  1 
ATOM   317  C  CD  . LYS A 1 43  ? 7.019   -6.382  17.674 1.00 29.37 ? 60   LYS T CD  1 
ATOM   318  C  CE  . LYS A 1 43  ? 5.811   -5.568  18.096 1.00 29.04 ? 60   LYS T CE  1 
ATOM   319  N  NZ  . LYS A 1 43  ? 4.764   -5.591  17.042 1.00 31.02 ? 60   LYS T NZ  1 
ATOM   320  N  N   . SER A 1 44  ? 10.868  -7.151  20.123 1.00 24.32 ? 61   SER T N   1 
ATOM   321  C  CA  . SER A 1 44  ? 12.071  -7.820  19.651 1.00 26.41 ? 61   SER T CA  1 
ATOM   322  C  C   . SER A 1 44  ? 11.837  -8.145  18.178 1.00 25.71 ? 61   SER T C   1 
ATOM   323  O  O   . SER A 1 44  ? 10.694  -8.200  17.724 1.00 28.27 ? 61   SER T O   1 
ATOM   324  C  CB  . SER A 1 44  ? 12.312  -9.106  20.446 1.00 28.00 ? 61   SER T CB  1 
ATOM   325  O  OG  . SER A 1 44  ? 11.227  -10.006 20.293 1.00 31.97 ? 61   SER T OG  1 
ATOM   326  N  N   . GLY A 1 45  ? 12.912  -8.335  17.427 1.00 26.50 ? 62   GLY T N   1 
ATOM   327  C  CA  . GLY A 1 45  ? 12.774  -8.663  16.018 1.00 26.53 ? 62   GLY T CA  1 
ATOM   328  C  C   . GLY A 1 45  ? 12.094  -7.585  15.198 1.00 26.85 ? 62   GLY T C   1 
ATOM   329  O  O   . GLY A 1 45  ? 11.057  -7.823  14.576 1.00 29.54 ? 62   GLY T O   1 
ATOM   330  N  N   . ILE A 1 46  ? 12.668  -6.390  15.199 1.00 23.61 ? 63   ILE T N   1 
ATOM   331  C  CA  . ILE A 1 46  ? 12.106  -5.291  14.438 1.00 21.78 ? 63   ILE T CA  1 
ATOM   332  C  C   . ILE A 1 46  ? 12.889  -5.095  13.147 1.00 20.18 ? 63   ILE T C   1 
ATOM   333  O  O   . ILE A 1 46  ? 14.120  -5.166  13.143 1.00 19.54 ? 63   ILE T O   1 
ATOM   334  C  CB  . ILE A 1 46  ? 12.157  -3.963  15.236 1.00 22.04 ? 63   ILE T CB  1 
ATOM   335  C  CG1 . ILE A 1 46  ? 11.209  -4.031  16.436 1.00 22.33 ? 63   ILE T CG1 1 
ATOM   336  C  CG2 . ILE A 1 46  ? 11.803  -2.793  14.330 1.00 21.92 ? 63   ILE T CG2 1 
ATOM   337  C  CD1 . ILE A 1 46  ? 11.197  -2.772  17.279 1.00 20.78 ? 63   ILE T CD1 1 
ATOM   338  N  N   . GLN A 1 47  ? 12.170  -4.883  12.052 1.00 16.74 ? 64   GLN T N   1 
ATOM   339  C  CA  . GLN A 1 47  ? 12.805  -4.600  10.771 1.00 18.11 ? 64   GLN T CA  1 
ATOM   340  C  C   . GLN A 1 47  ? 12.420  -3.157  10.434 1.00 17.54 ? 64   GLN T C   1 
ATOM   341  O  O   . GLN A 1 47  ? 11.235  -2.815  10.399 1.00 16.89 ? 64   GLN T O   1 
ATOM   342  C  CB  . GLN A 1 47  ? 12.302  -5.533  9.671  1.00 16.73 ? 64   GLN T CB  1 
ATOM   343  C  CG  . GLN A 1 47  ? 12.929  -5.229  8.320  1.00 20.03 ? 64   GLN T CG  1 
ATOM   344  C  CD  . GLN A 1 47  ? 12.336  -6.049  7.197  1.00 20.43 ? 64   GLN T CD  1 
ATOM   345  O  OE1 . GLN A 1 47  ? 11.189  -5.841  6.790  1.00 21.25 ? 64   GLN T OE1 1 
ATOM   346  N  NE2 . GLN A 1 47  ? 13.111  -6.997  6.696  1.00 19.60 ? 64   GLN T NE2 1 
ATOM   347  N  N   . VAL A 1 48  ? 13.416  -2.308  10.217 1.00 14.89 ? 65   VAL T N   1 
ATOM   348  C  CA  . VAL A 1 48  ? 13.150  -0.914  9.893  1.00 16.10 ? 65   VAL T CA  1 
ATOM   349  C  C   . VAL A 1 48  ? 12.999  -0.735  8.386  1.00 16.75 ? 65   VAL T C   1 
ATOM   350  O  O   . VAL A 1 48  ? 13.825  -1.211  7.602  1.00 16.04 ? 65   VAL T O   1 
ATOM   351  C  CB  . VAL A 1 48  ? 14.281  0.003   10.405 1.00 16.03 ? 65   VAL T CB  1 
ATOM   352  C  CG1 . VAL A 1 48  ? 14.028  1.435   9.973  1.00 16.48 ? 65   VAL T CG1 1 
ATOM   353  C  CG2 . VAL A 1 48  ? 14.366  -0.083  11.922 1.00 15.87 ? 65   VAL T CG2 1 
ATOM   354  N  N   . ARG A 1 49  ? 11.938  -0.050  7.979  1.00 15.91 ? 66   ARG T N   1 
ATOM   355  C  CA  . ARG A 1 49  ? 11.704  0.169   6.559  1.00 15.88 ? 66   ARG T CA  1 
ATOM   356  C  C   . ARG A 1 49  ? 11.744  1.647   6.217  1.00 16.34 ? 66   ARG T C   1 
ATOM   357  O  O   . ARG A 1 49  ? 10.879  2.420   6.638  1.00 13.84 ? 66   ARG T O   1 
ATOM   358  C  CB  . ARG A 1 49  ? 10.374  -0.468  6.155  1.00 15.61 ? 66   ARG T CB  1 
ATOM   359  C  CG  . ARG A 1 49  ? 10.360  -1.969  6.431  1.00 15.30 ? 66   ARG T CG  1 
ATOM   360  C  CD  . ARG A 1 49  ? 9.132   -2.664  5.852  1.00 17.02 ? 66   ARG T CD  1 
ATOM   361  N  NE  . ARG A 1 49  ? 9.326   -4.116  5.816  1.00 15.61 ? 66   ARG T NE  1 
ATOM   362  C  CZ  . ARG A 1 49  ? 8.527   -4.967  5.176  1.00 16.99 ? 66   ARG T CZ  1 
ATOM   363  N  NH1 . ARG A 1 49  ? 7.464   -4.519  4.518  1.00 17.78 ? 66   ARG T NH1 1 
ATOM   364  N  NH2 . ARG A 1 49  ? 8.811   -6.262  5.161  1.00 15.30 ? 66   ARG T NH2 1 
ATOM   365  N  N   . LEU A 1 50  ? 12.781  2.021   5.464  1.00 15.42 ? 67   LEU T N   1 
ATOM   366  C  CA  . LEU A 1 50  ? 13.023  3.392   5.029  1.00 16.32 ? 67   LEU T CA  1 
ATOM   367  C  C   . LEU A 1 50  ? 12.540  3.595   3.585  1.00 17.42 ? 67   LEU T C   1 
ATOM   368  O  O   . LEU A 1 50  ? 12.351  2.626   2.838  1.00 16.32 ? 67   LEU T O   1 
ATOM   369  C  CB  . LEU A 1 50  ? 14.528  3.709   5.073  1.00 17.57 ? 67   LEU T CB  1 
ATOM   370  C  CG  . LEU A 1 50  ? 15.424  3.571   6.312  1.00 18.68 ? 67   LEU T CG  1 
ATOM   371  C  CD1 . LEU A 1 50  ? 14.973  4.534   7.363  1.00 23.39 ? 67   LEU T CD1 1 
ATOM   372  C  CD2 . LEU A 1 50  ? 15.421  2.154   6.835  1.00 21.40 ? 67   LEU T CD2 1 
ATOM   373  N  N   . GLY A 1 51  ? 12.359  4.858   3.204  1.00 14.13 ? 69   GLY T N   1 
ATOM   374  C  CA  . GLY A 1 51  ? 11.929  5.190   1.852  1.00 16.92 ? 69   GLY T CA  1 
ATOM   375  C  C   . GLY A 1 51  ? 10.579  4.636   1.424  1.00 16.77 ? 69   GLY T C   1 
ATOM   376  O  O   . GLY A 1 51  ? 10.345  4.401   0.241  1.00 16.29 ? 69   GLY T O   1 
ATOM   377  N  N   . GLU A 1 52  ? 9.686   4.449   2.388  1.00 17.51 ? 70   GLU T N   1 
ATOM   378  C  CA  . GLU A 1 52  ? 8.347   3.915   2.135  1.00 18.59 ? 70   GLU T CA  1 
ATOM   379  C  C   . GLU A 1 52  ? 7.279   4.959   1.816  1.00 18.92 ? 70   GLU T C   1 
ATOM   380  O  O   . GLU A 1 52  ? 7.355   6.100   2.267  1.00 18.75 ? 70   GLU T O   1 
ATOM   381  C  CB  . GLU A 1 52  ? 7.859   3.137   3.367  1.00 16.85 ? 70   GLU T CB  1 
ATOM   382  C  CG  . GLU A 1 52  ? 8.530   1.793   3.591  1.00 19.59 ? 70   GLU T CG  1 
ATOM   383  C  CD  . GLU A 1 52  ? 7.982   0.746   2.657  1.00 20.01 ? 70   GLU T CD  1 
ATOM   384  O  OE1 . GLU A 1 52  ? 7.722   1.117   1.505  1.00 19.63 ? 70   GLU T OE1 1 
ATOM   385  O  OE2 . GLU A 1 52  ? 7.817   -0.427  3.056  1.00 19.30 ? 70   GLU T OE2 1 
ATOM   386  N  N   . ASP A 1 53  ? 6.294   4.551   1.020  1.00 19.12 ? 71   ASP T N   1 
ATOM   387  C  CA  . ASP A 1 53  ? 5.130   5.382   0.736  1.00 18.60 ? 71   ASP T CA  1 
ATOM   388  C  C   . ASP A 1 53  ? 3.982   4.397   0.876  1.00 19.51 ? 71   ASP T C   1 
ATOM   389  O  O   . ASP A 1 53  ? 3.303   4.383   1.898  1.00 21.95 ? 71   ASP T O   1 
ATOM   390  C  CB  . ASP A 1 53  ? 5.121   5.996   -0.660 1.00 18.57 ? 71   ASP T CB  1 
ATOM   391  C  CG  . ASP A 1 53  ? 3.972   6.984   -0.829 1.00 21.59 ? 71   ASP T CG  1 
ATOM   392  O  OD1 . ASP A 1 53  ? 3.730   7.771   0.118  1.00 20.70 ? 71   ASP T OD1 1 
ATOM   393  O  OD2 . ASP A 1 53  ? 3.304   6.981   -1.881 1.00 23.12 ? 71   ASP T OD2 1 
ATOM   394  N  N   . ASN A 1 54  ? 3.779   3.556   -0.135 1.00 18.49 ? 72   ASN T N   1 
ATOM   395  C  CA  . ASN A 1 54  ? 2.735   2.533   -0.072 1.00 19.90 ? 72   ASN T CA  1 
ATOM   396  C  C   . ASN A 1 54  ? 3.361   1.355   0.669  1.00 20.89 ? 72   ASN T C   1 
ATOM   397  O  O   . ASN A 1 54  ? 4.100   0.600   0.065  1.00 19.67 ? 72   ASN T O   1 
ATOM   398  C  CB  . ASN A 1 54  ? 2.348   2.064   -1.474 1.00 20.36 ? 72   ASN T CB  1 
ATOM   399  C  CG  . ASN A 1 54  ? 1.202   1.068   -1.459 1.00 19.67 ? 72   ASN T CG  1 
ATOM   400  O  OD1 . ASN A 1 54  ? 1.149   0.173   -0.617 1.00 19.11 ? 72   ASN T OD1 1 
ATOM   401  N  ND2 . ASN A 1 54  ? 0.282   1.215   -2.403 1.00 21.04 ? 72   ASN T ND2 1 
ATOM   402  N  N   . ILE A 1 55  ? 3.061   1.175   1.952  1.00 19.82 ? 73   ILE T N   1 
ATOM   403  C  CA  . ILE A 1 55  ? 3.674   0.076   2.703  1.00 22.18 ? 73   ILE T CA  1 
ATOM   404  C  C   . ILE A 1 55  ? 3.284   -1.356  2.336  1.00 21.97 ? 73   ILE T C   1 
ATOM   405  O  O   . ILE A 1 55  ? 3.851   -2.302  2.879  1.00 20.70 ? 73   ILE T O   1 
ATOM   406  C  CB  . ILE A 1 55  ? 3.474   0.245   4.235  1.00 22.37 ? 73   ILE T CB  1 
ATOM   407  C  CG1 . ILE A 1 55  ? 2.005   0.496   4.556  1.00 22.93 ? 73   ILE T CG1 1 
ATOM   408  C  CG2 . ILE A 1 55  ? 4.352   1.371   4.751  1.00 19.99 ? 73   ILE T CG2 1 
ATOM   409  C  CD1 . ILE A 1 55  ? 1.729   0.583   6.050  1.00 25.60 ? 73   ILE T CD1 1 
ATOM   410  N  N   . ASN A 1 56  ? 2.340   -1.528  1.412  1.00 23.78 ? 74   ASN T N   1 
ATOM   411  C  CA  . ASN A 1 56  ? 1.918   -2.875  1.020  1.00 25.00 ? 74   ASN T CA  1 
ATOM   412  C  C   . ASN A 1 56  ? 2.476   -3.358  -0.317 1.00 25.26 ? 74   ASN T C   1 
ATOM   413  O  O   . ASN A 1 56  ? 2.289   -4.517  -0.687 1.00 27.41 ? 74   ASN T O   1 
ATOM   414  C  CB  . ASN A 1 56  ? 0.392   -2.958  0.984  1.00 26.40 ? 74   ASN T CB  1 
ATOM   415  C  CG  . ASN A 1 56  ? -0.226  -2.799  2.355  1.00 30.08 ? 74   ASN T CG  1 
ATOM   416  O  OD1 . ASN A 1 56  ? 0.087   -3.554  3.277  1.00 31.64 ? 74   ASN T OD1 1 
ATOM   417  N  ND2 . ASN A 1 56  ? -1.106  -1.815  2.500  1.00 31.28 ? 74   ASN T ND2 1 
ATOM   418  N  N   . VAL A 1 57  ? 3.167   -2.480  -1.034 1.00 24.61 ? 75   VAL T N   1 
ATOM   419  C  CA  . VAL A 1 57  ? 3.726   -2.836  -2.334 1.00 24.17 ? 75   VAL T CA  1 
ATOM   420  C  C   . VAL A 1 57  ? 5.146   -2.326  -2.491 1.00 24.31 ? 75   VAL T C   1 
ATOM   421  O  O   . VAL A 1 57  ? 5.412   -1.186  -2.153 1.00 23.14 ? 75   VAL T O   1 
ATOM   422  C  CB  . VAL A 1 57  ? 2.906   -2.208  -3.481 1.00 25.58 ? 75   VAL T CB  1 
ATOM   423  C  CG1 . VAL A 1 57  ? 3.512   -2.603  -4.825 1.00 25.71 ? 75   VAL T CG1 1 
ATOM   424  C  CG2 . VAL A 1 57  ? 1.448   -2.636  -3.386 1.00 24.06 ? 75   VAL T CG2 1 
ATOM   425  N  N   . VAL A 1 58  ? 6.049   -3.151  -3.021 1.00 23.06 ? 76   VAL T N   1 
ATOM   426  C  CA  . VAL A 1 58  ? 7.428   -2.718  -3.242 1.00 23.69 ? 76   VAL T CA  1 
ATOM   427  C  C   . VAL A 1 58  ? 7.406   -1.839  -4.491 1.00 23.90 ? 76   VAL T C   1 
ATOM   428  O  O   . VAL A 1 58  ? 7.146   -2.326  -5.590 1.00 25.88 ? 76   VAL T O   1 
ATOM   429  C  CB  . VAL A 1 58  ? 8.375   -3.924  -3.477 1.00 21.37 ? 76   VAL T CB  1 
ATOM   430  C  CG1 . VAL A 1 58  ? 9.788   -3.433  -3.741 1.00 22.43 ? 76   VAL T CG1 1 
ATOM   431  C  CG2 . VAL A 1 58  ? 8.352   -4.848  -2.265 1.00 22.19 ? 76   VAL T CG2 1 
ATOM   432  N  N   . GLU A 1 59  ? 7.679   -0.548  -4.318 1.00 23.91 ? 77   GLU T N   1 
ATOM   433  C  CA  . GLU A 1 59  ? 7.647   0.413   -5.427 1.00 23.41 ? 77   GLU T CA  1 
ATOM   434  C  C   . GLU A 1 59  ? 9.015   0.889   -5.896 1.00 24.11 ? 77   GLU T C   1 
ATOM   435  O  O   . GLU A 1 59  ? 9.132   1.513   -6.952 1.00 23.24 ? 77   GLU T O   1 
ATOM   436  C  CB  . GLU A 1 59  ? 6.851   1.658   -5.021 1.00 23.74 ? 77   GLU T CB  1 
ATOM   437  C  CG  . GLU A 1 59  ? 5.442   1.412   -4.538 1.00 23.90 ? 77   GLU T CG  1 
ATOM   438  C  CD  . GLU A 1 59  ? 4.761   2.695   -4.097 1.00 25.60 ? 77   GLU T CD  1 
ATOM   439  O  OE1 . GLU A 1 59  ? 5.172   3.269   -3.061 1.00 25.02 ? 77   GLU T OE1 1 
ATOM   440  O  OE2 . GLU A 1 59  ? 3.820   3.138   -4.790 1.00 23.52 ? 77   GLU T OE2 1 
ATOM   441  N  N   . GLY A 1 60  ? 10.041  0.605   -5.105 1.00 22.90 ? 78   GLY T N   1 
ATOM   442  C  CA  . GLY A 1 60  ? 11.376  1.058   -5.433 1.00 24.41 ? 78   GLY T CA  1 
ATOM   443  C  C   . GLY A 1 60  ? 11.683  2.159   -4.433 1.00 24.69 ? 78   GLY T C   1 
ATOM   444  O  O   . GLY A 1 60  ? 10.771  2.850   -3.983 1.00 24.11 ? 78   GLY T O   1 
ATOM   445  N  N   . ASN A 1 61  ? 12.954  2.314   -4.079 1.00 25.04 ? 79   ASN T N   1 
ATOM   446  C  CA  . ASN A 1 61  ? 13.396  3.320   -3.112 1.00 22.71 ? 79   ASN T CA  1 
ATOM   447  C  C   . ASN A 1 61  ? 13.360  2.819   -1.666 1.00 21.91 ? 79   ASN T C   1 
ATOM   448  O  O   . ASN A 1 61  ? 13.862  3.493   -0.771 1.00 21.23 ? 79   ASN T O   1 
ATOM   449  C  CB  . ASN A 1 61  ? 12.555  4.601   -3.206 1.00 23.81 ? 79   ASN T CB  1 
ATOM   450  C  CG  . ASN A 1 61  ? 12.634  5.257   -4.570 1.00 25.81 ? 79   ASN T CG  1 
ATOM   451  O  OD1 . ASN A 1 61  ? 13.717  5.400   -5.147 1.00 23.72 ? 79   ASN T OD1 1 
ATOM   452  N  ND2 . ASN A 1 61  ? 11.482  5.677   -5.088 1.00 23.96 ? 79   ASN T ND2 1 
ATOM   453  N  N   . GLU A 1 62  ? 12.764  1.652   -1.429 1.00 20.67 ? 80   GLU T N   1 
ATOM   454  C  CA  . GLU A 1 62  ? 12.706  1.111   -0.075 1.00 19.23 ? 80   GLU T CA  1 
ATOM   455  C  C   . GLU A 1 62  ? 14.025  0.479   0.326  1.00 19.02 ? 80   GLU T C   1 
ATOM   456  O  O   . GLU A 1 62  ? 14.757  -0.052  -0.509 1.00 18.00 ? 80   GLU T O   1 
ATOM   457  C  CB  . GLU A 1 62  ? 11.624  0.030   0.068  1.00 20.23 ? 80   GLU T CB  1 
ATOM   458  C  CG  . GLU A 1 62  ? 10.224  0.471   -0.266 1.00 19.29 ? 80   GLU T CG  1 
ATOM   459  C  CD  . GLU A 1 62  ? 9.806   0.022   -1.645 1.00 19.27 ? 80   GLU T CD  1 
ATOM   460  O  OE1 . GLU A 1 62  ? 10.688  -0.225  -2.492 1.00 17.99 ? 80   GLU T OE1 1 
ATOM   461  O  OE2 . GLU A 1 62  ? 8.594   -0.073  -1.889 1.00 17.50 ? 80   GLU T OE2 1 
ATOM   462  N  N   . GLN A 1 63  ? 14.321  0.555   1.617  1.00 17.67 ? 81   GLN T N   1 
ATOM   463  C  CA  . GLN A 1 63  ? 15.512  -0.059  2.184  1.00 18.80 ? 81   GLN T CA  1 
ATOM   464  C  C   . GLN A 1 63  ? 15.037  -0.768  3.443  1.00 18.95 ? 81   GLN T C   1 
ATOM   465  O  O   . GLN A 1 63  ? 14.534  -0.125  4.371  1.00 18.83 ? 81   GLN T O   1 
ATOM   466  C  CB  . GLN A 1 63  ? 16.563  0.988   2.552  1.00 18.83 ? 81   GLN T CB  1 
ATOM   467  C  CG  . GLN A 1 63  ? 17.290  1.599   1.373  1.00 20.11 ? 81   GLN T CG  1 
ATOM   468  C  CD  . GLN A 1 63  ? 18.245  2.704   1.793  1.00 22.40 ? 81   GLN T CD  1 
ATOM   469  O  OE1 . GLN A 1 63  ? 19.080  2.518   2.682  1.00 21.98 ? 81   GLN T OE1 1 
ATOM   470  N  NE2 . GLN A 1 63  ? 18.131  3.860   1.150  1.00 23.29 ? 81   GLN T NE2 1 
ATOM   471  N  N   . PHE A 1 64  ? 15.154  -2.091  3.459  1.00 17.60 ? 82   PHE T N   1 
ATOM   472  C  CA  . PHE A 1 64  ? 14.751  -2.869  4.622  1.00 18.00 ? 82   PHE T CA  1 
ATOM   473  C  C   . PHE A 1 64  ? 16.017  -3.189  5.399  1.00 18.30 ? 82   PHE T C   1 
ATOM   474  O  O   . PHE A 1 64  ? 16.937  -3.809  4.868  1.00 19.79 ? 82   PHE T O   1 
ATOM   475  C  CB  . PHE A 1 64  ? 14.058  -4.171  4.205  1.00 16.03 ? 82   PHE T CB  1 
ATOM   476  C  CG  . PHE A 1 64  ? 12.724  -3.973  3.528  1.00 16.19 ? 82   PHE T CG  1 
ATOM   477  C  CD1 . PHE A 1 64  ? 12.159  -2.703  3.405  1.00 16.40 ? 82   PHE T CD1 1 
ATOM   478  C  CD2 . PHE A 1 64  ? 12.030  -5.063  3.014  1.00 16.54 ? 82   PHE T CD2 1 
ATOM   479  C  CE1 . PHE A 1 64  ? 10.923  -2.524  2.778  1.00 15.60 ? 82   PHE T CE1 1 
ATOM   480  C  CE2 . PHE A 1 64  ? 10.787  -4.892  2.382  1.00 16.69 ? 82   PHE T CE2 1 
ATOM   481  C  CZ  . PHE A 1 64  ? 10.239  -3.626  2.265  1.00 12.89 ? 82   PHE T CZ  1 
ATOM   482  N  N   . ILE A 1 65  ? 16.060  -2.763  6.655  1.00 17.20 ? 83   ILE T N   1 
ATOM   483  C  CA  . ILE A 1 65  ? 17.225  -2.988  7.503  1.00 15.91 ? 83   ILE T CA  1 
ATOM   484  C  C   . ILE A 1 65  ? 16.770  -3.443  8.883  1.00 17.05 ? 83   ILE T C   1 
ATOM   485  O  O   . ILE A 1 65  ? 15.931  -2.794  9.514  1.00 15.02 ? 83   ILE T O   1 
ATOM   486  C  CB  . ILE A 1 65  ? 18.046  -1.692  7.670  1.00 16.76 ? 83   ILE T CB  1 
ATOM   487  C  CG1 . ILE A 1 65  ? 18.446  -1.145  6.293  1.00 17.16 ? 83   ILE T CG1 1 
ATOM   488  C  CG2 . ILE A 1 65  ? 19.275  -1.963  8.526  1.00 15.93 ? 83   ILE T CG2 1 
ATOM   489  C  CD1 . ILE A 1 65  ? 19.082  0.238   6.339  1.00 14.57 ? 83   ILE T CD1 1 
ATOM   490  N  N   . SER A 1 66  ? 17.319  -4.561  9.344  1.00 17.04 ? 84   SER T N   1 
ATOM   491  C  CA  . SER A 1 66  ? 16.971  -5.083  10.657 1.00 19.86 ? 84   SER T CA  1 
ATOM   492  C  C   . SER A 1 66  ? 17.587  -4.226  11.754 1.00 19.92 ? 84   SER T C   1 
ATOM   493  O  O   . SER A 1 66  ? 18.611  -3.574  11.554 1.00 19.06 ? 84   SER T O   1 
ATOM   494  C  CB  . SER A 1 66  ? 17.465  -6.525  10.812 1.00 21.78 ? 84   SER T CB  1 
ATOM   495  O  OG  . SER A 1 66  ? 16.762  -7.407  9.950  1.00 26.96 ? 84   SER T OG  1 
ATOM   496  N  N   . ALA A 1 67  ? 16.941  -4.225  12.913 1.00 19.80 ? 85   ALA T N   1 
ATOM   497  C  CA  . ALA A 1 67  ? 17.422  -3.481  14.063 1.00 21.72 ? 85   ALA T CA  1 
ATOM   498  C  C   . ALA A 1 67  ? 18.465  -4.361  14.742 1.00 21.97 ? 85   ALA T C   1 
ATOM   499  O  O   . ALA A 1 67  ? 18.223  -5.551  14.948 1.00 22.23 ? 85   ALA T O   1 
ATOM   500  C  CB  . ALA A 1 67  ? 16.266  -3.213  15.019 1.00 20.63 ? 85   ALA T CB  1 
ATOM   501  N  N   . SER A 1 68  ? 19.627  -3.802  15.070 1.00 22.97 ? 86   SER T N   1 
ATOM   502  C  CA  . SER A 1 68  ? 20.652  -4.592  15.746 1.00 24.75 ? 86   SER T CA  1 
ATOM   503  C  C   . SER A 1 68  ? 20.426  -4.473  17.253 1.00 25.87 ? 86   SER T C   1 
ATOM   504  O  O   . SER A 1 68  ? 20.809  -5.353  18.018 1.00 26.07 ? 86   SER T O   1 
ATOM   505  C  CB  . SER A 1 68  ? 22.064  -4.116  15.375 1.00 24.62 ? 86   SER T CB  1 
ATOM   506  O  OG  . SER A 1 68  ? 22.339  -2.830  15.891 1.00 30.57 ? 86   SER T OG  1 
ATOM   507  N  N   . LYS A 1 69  ? 19.798  -3.380  17.674 1.00 25.20 ? 87   LYS T N   1 
ATOM   508  C  CA  . LYS A 1 69  ? 19.491  -3.186  19.087 1.00 27.42 ? 87   LYS T CA  1 
ATOM   509  C  C   . LYS A 1 69  ? 18.501  -2.049  19.328 1.00 24.89 ? 87   LYS T C   1 
ATOM   510  O  O   . LYS A 1 69  ? 18.494  -1.048  18.614 1.00 26.16 ? 87   LYS T O   1 
ATOM   511  C  CB  . LYS A 1 69  ? 20.776  -2.963  19.900 1.00 30.21 ? 87   LYS T CB  1 
ATOM   512  C  CG  . LYS A 1 69  ? 21.611  -1.759  19.509 1.00 33.46 ? 87   LYS T CG  1 
ATOM   513  C  CD  . LYS A 1 69  ? 22.930  -1.745  20.288 1.00 35.63 ? 87   LYS T CD  1 
ATOM   514  C  CE  . LYS A 1 69  ? 22.679  -1.752  21.796 1.00 37.56 ? 87   LYS T CE  1 
ATOM   515  N  NZ  . LYS A 1 69  ? 23.931  -1.866  22.599 1.00 37.15 ? 87   LYS T NZ  1 
ATOM   516  N  N   . SER A 1 70  ? 17.644  -2.227  20.327 1.00 22.17 ? 88   SER T N   1 
ATOM   517  C  CA  . SER A 1 70  ? 16.651  -1.221  20.669 1.00 21.53 ? 88   SER T CA  1 
ATOM   518  C  C   . SER A 1 70  ? 16.908  -0.753  22.092 1.00 20.77 ? 88   SER T C   1 
ATOM   519  O  O   . SER A 1 70  ? 16.932  -1.559  23.024 1.00 21.48 ? 88   SER T O   1 
ATOM   520  C  CB  . SER A 1 70  ? 15.246  -1.803  20.550 1.00 22.10 ? 88   SER T CB  1 
ATOM   521  O  OG  . SER A 1 70  ? 14.988  -2.202  19.219 1.00 27.30 ? 88   SER T OG  1 
ATOM   522  N  N   . ILE A 1 71  ? 17.099  0.551   22.256 1.00 18.78 ? 89   ILE T N   1 
ATOM   523  C  CA  . ILE A 1 71  ? 17.386  1.120   23.565 1.00 17.84 ? 89   ILE T CA  1 
ATOM   524  C  C   . ILE A 1 71  ? 16.246  1.971   24.126 1.00 18.20 ? 89   ILE T C   1 
ATOM   525  O  O   . ILE A 1 71  ? 16.096  3.145   23.781 1.00 16.11 ? 89   ILE T O   1 
ATOM   526  C  CB  . ILE A 1 71  ? 18.687  1.966   23.512 1.00 19.84 ? 89   ILE T CB  1 
ATOM   527  C  CG1 . ILE A 1 71  ? 19.857  1.085   23.053 1.00 22.30 ? 89   ILE T CG1 1 
ATOM   528  C  CG2 . ILE A 1 71  ? 18.988  2.560   24.886 1.00 17.54 ? 89   ILE T CG2 1 
ATOM   529  C  CD1 . ILE A 1 71  ? 21.196  1.814   22.936 1.00 22.13 ? 89   ILE T CD1 1 
ATOM   530  N  N   . VAL A 1 72  ? 15.440  1.362   24.991 1.00 18.11 ? 90   VAL T N   1 
ATOM   531  C  CA  . VAL A 1 72  ? 14.328  2.052   25.634 1.00 18.92 ? 90   VAL T CA  1 
ATOM   532  C  C   . VAL A 1 72  ? 14.886  2.933   26.755 1.00 19.69 ? 90   VAL T C   1 
ATOM   533  O  O   . VAL A 1 72  ? 15.858  2.561   27.418 1.00 22.03 ? 90   VAL T O   1 
ATOM   534  C  CB  . VAL A 1 72  ? 13.328  1.035   26.229 1.00 19.25 ? 90   VAL T CB  1 
ATOM   535  C  CG1 . VAL A 1 72  ? 12.291  1.748   27.092 1.00 18.92 ? 90   VAL T CG1 1 
ATOM   536  C  CG2 . VAL A 1 72  ? 12.643  0.273   25.098 1.00 19.95 ? 90   VAL T CG2 1 
ATOM   537  N  N   . HIS A 1 73  ? 14.287  4.102   26.966 1.00 17.85 ? 91   HIS T N   1 
ATOM   538  C  CA  . HIS A 1 73  ? 14.762  4.991   28.018 1.00 16.55 ? 91   HIS T CA  1 
ATOM   539  C  C   . HIS A 1 73  ? 14.639  4.295   29.375 1.00 16.41 ? 91   HIS T C   1 
ATOM   540  O  O   . HIS A 1 73  ? 13.579  3.771   29.718 1.00 15.07 ? 91   HIS T O   1 
ATOM   541  C  CB  . HIS A 1 73  ? 13.965  6.295   28.011 1.00 14.94 ? 91   HIS T CB  1 
ATOM   542  C  CG  . HIS A 1 73  ? 14.600  7.389   28.812 1.00 13.89 ? 91   HIS T CG  1 
ATOM   543  N  ND1 . HIS A 1 73  ? 14.573  7.416   30.190 1.00 14.33 ? 91   HIS T ND1 1 
ATOM   544  C  CD2 . HIS A 1 73  ? 15.316  8.472   28.428 1.00 15.04 ? 91   HIS T CD2 1 
ATOM   545  C  CE1 . HIS A 1 73  ? 15.248  8.468   30.621 1.00 16.43 ? 91   HIS T CE1 1 
ATOM   546  N  NE2 . HIS A 1 73  ? 15.708  9.126   29.571 1.00 16.65 ? 91   HIS T NE2 1 
ATOM   547  N  N   . PRO A 1 74  ? 15.729  4.278   30.164 1.00 17.08 ? 92   PRO T N   1 
ATOM   548  C  CA  . PRO A 1 74  ? 15.755  3.641   31.486 1.00 16.89 ? 92   PRO T CA  1 
ATOM   549  C  C   . PRO A 1 74  ? 14.648  4.080   32.445 1.00 17.54 ? 92   PRO T C   1 
ATOM   550  O  O   . PRO A 1 74  ? 14.215  3.298   33.291 1.00 15.72 ? 92   PRO T O   1 
ATOM   551  C  CB  . PRO A 1 74  ? 17.147  3.995   32.009 1.00 18.24 ? 92   PRO T CB  1 
ATOM   552  C  CG  . PRO A 1 74  ? 17.963  4.041   30.755 1.00 20.01 ? 92   PRO T CG  1 
ATOM   553  C  CD  . PRO A 1 74  ? 17.055  4.828   29.832 1.00 16.70 ? 92   PRO T CD  1 
ATOM   554  N  N   . SER A 1 75  ? 14.189  5.322   32.313 1.00 18.82 ? 93   SER T N   1 
ATOM   555  C  CA  . SER A 1 75  ? 13.143  5.829   33.193 1.00 19.53 ? 93   SER T CA  1 
ATOM   556  C  C   . SER A 1 75  ? 11.754  5.781   32.572 1.00 20.10 ? 93   SER T C   1 
ATOM   557  O  O   . SER A 1 75  ? 10.818  6.399   33.078 1.00 21.51 ? 93   SER T O   1 
ATOM   558  C  CB  . SER A 1 75  ? 13.468  7.259   33.634 1.00 22.28 ? 93   SER T CB  1 
ATOM   559  O  OG  . SER A 1 75  ? 14.652  7.288   34.413 1.00 20.12 ? 93   SER T OG  1 
ATOM   560  N  N   . TYR A 1 76  ? 11.617  5.044   31.478 1.00 20.42 ? 94   TYR T N   1 
ATOM   561  C  CA  . TYR A 1 76  ? 10.324  4.908   30.824 1.00 20.66 ? 94   TYR T CA  1 
ATOM   562  C  C   . TYR A 1 76  ? 9.338   4.208   31.764 1.00 23.26 ? 94   TYR T C   1 
ATOM   563  O  O   . TYR A 1 76  ? 9.665   3.199   32.386 1.00 23.47 ? 94   TYR T O   1 
ATOM   564  C  CB  . TYR A 1 76  ? 10.476  4.098   29.532 1.00 20.05 ? 94   TYR T CB  1 
ATOM   565  C  CG  . TYR A 1 76  ? 9.172   3.569   28.977 1.00 18.01 ? 94   TYR T CG  1 
ATOM   566  C  CD1 . TYR A 1 76  ? 8.162   4.437   28.554 1.00 18.02 ? 94   TYR T CD1 1 
ATOM   567  C  CD2 . TYR A 1 76  ? 8.942   2.196   28.889 1.00 20.28 ? 94   TYR T CD2 1 
ATOM   568  C  CE1 . TYR A 1 76  ? 6.957   3.948   28.052 1.00 18.45 ? 94   TYR T CE1 1 
ATOM   569  C  CE2 . TYR A 1 76  ? 7.737   1.694   28.393 1.00 19.75 ? 94   TYR T CE2 1 
ATOM   570  C  CZ  . TYR A 1 76  ? 6.753   2.576   27.976 1.00 20.42 ? 94   TYR T CZ  1 
ATOM   571  O  OH  . TYR A 1 76  ? 5.569   2.086   27.477 1.00 22.60 ? 94   TYR T OH  1 
ATOM   572  N  N   . ASN A 1 77  ? 8.136   4.758   31.880 1.00 24.76 ? 95   ASN T N   1 
ATOM   573  C  CA  . ASN A 1 77  ? 7.107   4.168   32.730 1.00 26.25 ? 95   ASN T CA  1 
ATOM   574  C  C   . ASN A 1 77  ? 5.943   3.824   31.817 1.00 26.82 ? 95   ASN T C   1 
ATOM   575  O  O   . ASN A 1 77  ? 5.346   4.713   31.211 1.00 26.90 ? 95   ASN T O   1 
ATOM   576  C  CB  . ASN A 1 77  ? 6.654   5.164   33.802 1.00 29.53 ? 95   ASN T CB  1 
ATOM   577  C  CG  . ASN A 1 77  ? 5.580   4.589   34.716 1.00 28.95 ? 95   ASN T CG  1 
ATOM   578  O  OD1 . ASN A 1 77  ? 4.552   4.095   34.253 1.00 30.28 ? 95   ASN T OD1 1 
ATOM   579  N  ND2 . ASN A 1 77  ? 5.817   4.655   36.021 1.00 31.07 ? 95   ASN T ND2 1 
ATOM   580  N  N   . SER A 1 78  ? 5.619   2.538   31.728 1.00 28.07 ? 96   SER T N   1 
ATOM   581  C  CA  . SER A 1 78  ? 4.542   2.071   30.854 1.00 30.36 ? 96   SER T CA  1 
ATOM   582  C  C   . SER A 1 78  ? 3.125   2.438   31.286 1.00 31.76 ? 96   SER T C   1 
ATOM   583  O  O   . SER A 1 78  ? 2.190   2.347   30.489 1.00 31.06 ? 96   SER T O   1 
ATOM   584  C  CB  . SER A 1 78  ? 4.640   0.554   30.673 1.00 31.09 ? 96   SER T CB  1 
ATOM   585  O  OG  . SER A 1 78  ? 4.625   -0.113  31.921 1.00 32.68 ? 96   SER T OG  1 
ATOM   586  N  N   . ASN A 1 79  ? 2.960   2.855   32.536 1.00 30.90 ? 97   ASN T N   1 
ATOM   587  C  CA  . ASN A 1 79  ? 1.639   3.223   33.030 1.00 32.60 ? 97   ASN T CA  1 
ATOM   588  C  C   . ASN A 1 79  ? 1.306   4.675   32.709 1.00 31.30 ? 97   ASN T C   1 
ATOM   589  O  O   . ASN A 1 79  ? 0.182   4.994   32.325 1.00 32.93 ? 97   ASN T O   1 
ATOM   590  C  CB  . ASN A 1 79  ? 1.565   2.991   34.541 1.00 35.05 ? 97   ASN T CB  1 
ATOM   591  C  CG  . ASN A 1 79  ? 1.692   1.523   34.911 1.00 38.07 ? 97   ASN T CG  1 
ATOM   592  O  OD1 . ASN A 1 79  ? 1.997   1.185   36.056 1.00 40.48 ? 97   ASN T OD1 1 
ATOM   593  N  ND2 . ASN A 1 79  ? 1.446   0.641   33.944 1.00 39.16 ? 97   ASN T ND2 1 
ATOM   594  N  N   . THR A 1 80  ? 2.290   5.554   32.852 1.00 30.08 ? 98   THR T N   1 
ATOM   595  C  CA  . THR A 1 80  ? 2.085   6.971   32.587 1.00 29.15 ? 98   THR T CA  1 
ATOM   596  C  C   . THR A 1 80  ? 2.600   7.390   31.213 1.00 27.99 ? 98   THR T C   1 
ATOM   597  O  O   . THR A 1 80  ? 2.234   8.449   30.702 1.00 28.29 ? 98   THR T O   1 
ATOM   598  C  CB  . THR A 1 80  ? 2.801   7.821   33.638 1.00 29.13 ? 98   THR T CB  1 
ATOM   599  O  OG1 . THR A 1 80  ? 4.207   7.556   33.582 1.00 28.99 ? 98   THR T OG1 1 
ATOM   600  C  CG2 . THR A 1 80  ? 2.287   7.484   35.030 1.00 30.56 ? 98   THR T CG2 1 
ATOM   601  N  N   . LEU A 1 81  ? 3.443   6.547   30.625 1.00 25.89 ? 99   LEU T N   1 
ATOM   602  C  CA  . LEU A 1 81  ? 4.052   6.813   29.324 1.00 25.31 ? 99   LEU T CA  1 
ATOM   603  C  C   . LEU A 1 81  ? 5.031   7.975   29.415 1.00 22.82 ? 99   LEU T C   1 
ATOM   604  O  O   . LEU A 1 81  ? 5.363   8.616   28.425 1.00 22.72 ? 99   LEU T O   1 
ATOM   605  C  CB  . LEU A 1 81  ? 2.988   7.085   28.252 1.00 26.25 ? 99   LEU T CB  1 
ATOM   606  C  CG  . LEU A 1 81  ? 2.172   5.851   27.850 1.00 28.09 ? 99   LEU T CG  1 
ATOM   607  C  CD1 . LEU A 1 81  ? 1.313   6.172   26.644 1.00 28.87 ? 99   LEU T CD1 1 
ATOM   608  C  CD2 . LEU A 1 81  ? 3.108   4.697   27.524 1.00 28.63 ? 99   LEU T CD2 1 
ATOM   609  N  N   . ASN A 1 82  ? 5.493   8.244   30.627 1.00 22.89 ? 100  ASN T N   1 
ATOM   610  C  CA  . ASN A 1 82  ? 6.467   9.299   30.831 1.00 21.89 ? 100  ASN T CA  1 
ATOM   611  C  C   . ASN A 1 82  ? 7.781   8.766   30.241 1.00 19.54 ? 100  ASN T C   1 
ATOM   612  O  O   . ASN A 1 82  ? 8.068   7.574   30.346 1.00 20.44 ? 100  ASN T O   1 
ATOM   613  C  CB  . ASN A 1 82  ? 6.604   9.586   32.328 1.00 23.92 ? 100  ASN T CB  1 
ATOM   614  C  CG  . ASN A 1 82  ? 7.543   10.728  32.615 1.00 25.64 ? 100  ASN T CG  1 
ATOM   615  O  OD1 . ASN A 1 82  ? 7.463   11.780  31.987 1.00 27.63 ? 100  ASN T OD1 1 
ATOM   616  N  ND2 . ASN A 1 82  ? 8.438   10.533  33.575 1.00 29.41 ? 100  ASN T ND2 1 
ATOM   617  N  N   . ASN A 1 83  ? 8.566   9.637   29.615 1.00 17.23 ? 101  ASN T N   1 
ATOM   618  C  CA  . ASN A 1 83  ? 9.825   9.230   28.988 1.00 17.08 ? 101  ASN T CA  1 
ATOM   619  C  C   . ASN A 1 83  ? 9.566   8.168   27.915 1.00 15.87 ? 101  ASN T C   1 
ATOM   620  O  O   . ASN A 1 83  ? 10.260  7.155   27.843 1.00 14.93 ? 101  ASN T O   1 
ATOM   621  C  CB  . ASN A 1 83  ? 10.805  8.662   30.025 1.00 16.29 ? 101  ASN T CB  1 
ATOM   622  C  CG  . ASN A 1 83  ? 11.125  9.642   31.130 1.00 15.71 ? 101  ASN T CG  1 
ATOM   623  O  OD1 . ASN A 1 83  ? 10.882  9.364   32.304 1.00 20.85 ? 101  ASN T OD1 1 
ATOM   624  N  ND2 . ASN A 1 83  ? 11.673  10.790  30.767 1.00 15.10 ? 101  ASN T ND2 1 
ATOM   625  N  N   . ASP A 1 84  ? 8.556   8.397   27.087 1.00 15.72 ? 102  ASP T N   1 
ATOM   626  C  CA  . ASP A 1 84  ? 8.221   7.453   26.031 1.00 15.78 ? 102  ASP T CA  1 
ATOM   627  C  C   . ASP A 1 84  ? 9.124   7.708   24.821 1.00 15.98 ? 102  ASP T C   1 
ATOM   628  O  O   . ASP A 1 84  ? 8.722   8.339   23.846 1.00 16.46 ? 102  ASP T O   1 
ATOM   629  C  CB  . ASP A 1 84  ? 6.745   7.609   25.657 1.00 16.62 ? 102  ASP T CB  1 
ATOM   630  C  CG  . ASP A 1 84  ? 6.253   6.508   24.743 1.00 16.84 ? 102  ASP T CG  1 
ATOM   631  O  OD1 . ASP A 1 84  ? 6.936   5.466   24.636 1.00 17.22 ? 102  ASP T OD1 1 
ATOM   632  O  OD2 . ASP A 1 84  ? 5.172   6.681   24.141 1.00 17.70 ? 102  ASP T OD2 1 
ATOM   633  N  N   . ILE A 1 85  ? 10.361  7.226   24.904 1.00 16.17 ? 103  ILE T N   1 
ATOM   634  C  CA  . ILE A 1 85  ? 11.324  7.408   23.826 1.00 14.90 ? 103  ILE T CA  1 
ATOM   635  C  C   . ILE A 1 85  ? 12.269  6.213   23.746 1.00 15.49 ? 103  ILE T C   1 
ATOM   636  O  O   . ILE A 1 85  ? 12.684  5.653   24.764 1.00 15.61 ? 103  ILE T O   1 
ATOM   637  C  CB  . ILE A 1 85  ? 12.119  8.726   24.017 1.00 14.07 ? 103  ILE T CB  1 
ATOM   638  C  CG1 . ILE A 1 85  ? 13.161  8.887   22.905 1.00 16.57 ? 103  ILE T CG1 1 
ATOM   639  C  CG2 . ILE A 1 85  ? 12.752  8.761   25.405 1.00 14.04 ? 103  ILE T CG2 1 
ATOM   640  C  CD1 . ILE A 1 85  ? 13.863  10.255  22.903 1.00 14.67 ? 103  ILE T CD1 1 
ATOM   641  N  N   . MET A 1 86  ? 12.605  5.827   22.524 1.00 15.16 ? 104  MET T N   1 
ATOM   642  C  CA  . MET A 1 86  ? 13.469  4.679   22.295 1.00 17.10 ? 104  MET T CA  1 
ATOM   643  C  C   . MET A 1 86  ? 14.399  4.926   21.111 1.00 17.63 ? 104  MET T C   1 
ATOM   644  O  O   . MET A 1 86  ? 14.019  5.586   20.142 1.00 15.82 ? 104  MET T O   1 
ATOM   645  C  CB  . MET A 1 86  ? 12.585  3.451   22.041 1.00 16.89 ? 104  MET T CB  1 
ATOM   646  C  CG  . MET A 1 86  ? 13.257  2.256   21.411 1.00 20.91 ? 104  MET T CG  1 
ATOM   647  S  SD  . MET A 1 86  ? 12.048  0.937   21.096 1.00 22.34 ? 104  MET T SD  1 
ATOM   648  C  CE  . MET A 1 86  ? 11.403  1.396   19.495 1.00 18.08 ? 104  MET T CE  1 
ATOM   649  N  N   . LEU A 1 87  ? 15.621  4.409   21.209 1.00 17.92 ? 105  LEU T N   1 
ATOM   650  C  CA  . LEU A 1 87  ? 16.603  4.540   20.137 1.00 19.49 ? 105  LEU T CA  1 
ATOM   651  C  C   . LEU A 1 87  ? 16.802  3.169   19.502 1.00 20.36 ? 105  LEU T C   1 
ATOM   652  O  O   . LEU A 1 87  ? 16.907  2.165   20.201 1.00 18.39 ? 105  LEU T O   1 
ATOM   653  C  CB  . LEU A 1 87  ? 17.938  5.057   20.683 1.00 20.09 ? 105  LEU T CB  1 
ATOM   654  C  CG  . LEU A 1 87  ? 18.132  6.576   20.746 1.00 23.32 ? 105  LEU T CG  1 
ATOM   655  C  CD1 . LEU A 1 87  ? 16.868  7.254   21.229 1.00 28.00 ? 105  LEU T CD1 1 
ATOM   656  C  CD2 . LEU A 1 87  ? 19.298  6.898   21.664 1.00 23.32 ? 105  LEU T CD2 1 
ATOM   657  N  N   . ILE A 1 88  ? 16.831  3.128   18.175 1.00 19.23 ? 106  ILE T N   1 
ATOM   658  C  CA  . ILE A 1 88  ? 17.024  1.876   17.462 1.00 19.30 ? 106  ILE T CA  1 
ATOM   659  C  C   . ILE A 1 88  ? 18.263  1.980   16.586 1.00 19.00 ? 106  ILE T C   1 
ATOM   660  O  O   . ILE A 1 88  ? 18.354  2.868   15.742 1.00 18.77 ? 106  ILE T O   1 
ATOM   661  C  CB  . ILE A 1 88  ? 15.810  1.548   16.565 1.00 19.49 ? 106  ILE T CB  1 
ATOM   662  C  CG1 . ILE A 1 88  ? 14.560  1.369   17.427 1.00 19.47 ? 106  ILE T CG1 1 
ATOM   663  C  CG2 . ILE A 1 88  ? 16.077  0.279   15.763 1.00 19.19 ? 106  ILE T CG2 1 
ATOM   664  C  CD1 . ILE A 1 88  ? 13.298  1.184   16.625 1.00 20.79 ? 106  ILE T CD1 1 
ATOM   665  N  N   . LYS A 1 89  ? 19.222  1.085   16.797 1.00 19.34 ? 107  LYS T N   1 
ATOM   666  C  CA  . LYS A 1 89  ? 20.437  1.086   15.988 1.00 20.69 ? 107  LYS T CA  1 
ATOM   667  C  C   . LYS A 1 89  ? 20.260  0.083   14.847 1.00 19.91 ? 107  LYS T C   1 
ATOM   668  O  O   . LYS A 1 89  ? 19.862  -1.062  15.070 1.00 19.29 ? 107  LYS T O   1 
ATOM   669  C  CB  . LYS A 1 89  ? 21.658  0.702   16.833 1.00 20.86 ? 107  LYS T CB  1 
ATOM   670  C  CG  . LYS A 1 89  ? 22.981  0.928   16.106 1.00 23.60 ? 107  LYS T CG  1 
ATOM   671  C  CD  . LYS A 1 89  ? 24.178  0.428   16.903 1.00 22.60 ? 107  LYS T CD  1 
ATOM   672  C  CE  . LYS A 1 89  ? 25.474  0.767   16.179 1.00 25.34 ? 107  LYS T CE  1 
ATOM   673  N  NZ  . LYS A 1 89  ? 26.661  0.133   16.817 1.00 27.01 ? 107  LYS T NZ  1 
ATOM   674  N  N   . LEU A 1 90  ? 20.549  0.519   13.626 1.00 20.74 ? 108  LEU T N   1 
ATOM   675  C  CA  . LEU A 1 90  ? 20.410  -0.340  12.458 1.00 21.81 ? 108  LEU T CA  1 
ATOM   676  C  C   . LEU A 1 90  ? 21.613  -1.269  12.293 1.00 23.06 ? 108  LEU T C   1 
ATOM   677  O  O   . LEU A 1 90  ? 22.757  -0.879  12.544 1.00 22.80 ? 108  LEU T O   1 
ATOM   678  C  CB  . LEU A 1 90  ? 20.233  0.512   11.198 1.00 21.94 ? 108  LEU T CB  1 
ATOM   679  C  CG  . LEU A 1 90  ? 19.012  1.443   11.173 1.00 24.05 ? 108  LEU T CG  1 
ATOM   680  C  CD1 . LEU A 1 90  ? 18.990  2.252   9.887  1.00 23.48 ? 108  LEU T CD1 1 
ATOM   681  C  CD2 . LEU A 1 90  ? 17.743  0.619   11.301 1.00 25.65 ? 108  LEU T CD2 1 
ATOM   682  N  N   . LYS A 1 91  ? 21.344  -2.502  11.876 1.00 22.68 ? 109  LYS T N   1 
ATOM   683  C  CA  . LYS A 1 91  ? 22.395  -3.491  11.673 1.00 26.05 ? 109  LYS T CA  1 
ATOM   684  C  C   . LYS A 1 91  ? 23.436  -2.957  10.690 1.00 25.36 ? 109  LYS T C   1 
ATOM   685  O  O   . LYS A 1 91  ? 24.631  -3.213  10.834 1.00 25.24 ? 109  LYS T O   1 
ATOM   686  C  CB  . LYS A 1 91  ? 21.788  -4.794  11.148 1.00 28.24 ? 109  LYS T CB  1 
ATOM   687  C  CG  . LYS A 1 91  ? 22.744  -5.978  11.184 1.00 34.18 ? 109  LYS T CG  1 
ATOM   688  C  CD  . LYS A 1 91  ? 22.032  -7.286  10.853 1.00 38.94 ? 109  LYS T CD  1 
ATOM   689  C  CE  . LYS A 1 91  ? 20.926  -7.598  11.864 1.00 43.01 ? 109  LYS T CE  1 
ATOM   690  N  NZ  . LYS A 1 91  ? 21.429  -7.769  13.264 1.00 45.52 ? 109  LYS T NZ  1 
ATOM   691  N  N   . SER A 1 92  ? 22.962  -2.216  9.693  1.00 24.89 ? 110  SER T N   1 
ATOM   692  C  CA  . SER A 1 92  ? 23.818  -1.605  8.679  1.00 25.83 ? 110  SER T CA  1 
ATOM   693  C  C   . SER A 1 92  ? 23.369  -0.178  8.450  1.00 24.26 ? 110  SER T C   1 
ATOM   694  O  O   . SER A 1 92  ? 22.197  0.151   8.647  1.00 25.25 ? 110  SER T O   1 
ATOM   695  C  CB  . SER A 1 92  ? 23.732  -2.363  7.356  1.00 26.22 ? 110  SER T CB  1 
ATOM   696  O  OG  . SER A 1 92  ? 24.427  -3.592  7.434  1.00 34.80 ? 110  SER T OG  1 
ATOM   697  N  N   . ALA A 1 93  ? 24.296  0.670   8.029  1.00 22.34 ? 111  ALA T N   1 
ATOM   698  C  CA  . ALA A 1 93  ? 23.966  2.058   7.770  1.00 22.15 ? 111  ALA T CA  1 
ATOM   699  C  C   . ALA A 1 93  ? 23.063  2.143   6.552  1.00 21.87 ? 111  ALA T C   1 
ATOM   700  O  O   . ALA A 1 93  ? 23.246  1.416   5.578  1.00 23.19 ? 111  ALA T O   1 
ATOM   701  C  CB  . ALA A 1 93  ? 25.231  2.866   7.537  1.00 21.61 ? 111  ALA T CB  1 
ATOM   702  N  N   . ALA A 1 94  ? 22.081  3.029   6.613  1.00 21.03 ? 112  ALA T N   1 
ATOM   703  C  CA  . ALA A 1 94  ? 21.169  3.213   5.500  1.00 20.72 ? 112  ALA T CA  1 
ATOM   704  C  C   . ALA A 1 94  ? 21.866  4.051   4.441  1.00 21.48 ? 112  ALA T C   1 
ATOM   705  O  O   . ALA A 1 94  ? 22.763  4.837   4.743  1.00 19.56 ? 112  ALA T O   1 
ATOM   706  C  CB  . ALA A 1 94  ? 19.906  3.924   5.971  1.00 22.63 ? 112  ALA T CB  1 
ATOM   707  N  N   . SER A 1 95  ? 21.461  3.878   3.192  1.00 21.94 ? 113  SER T N   1 
ATOM   708  C  CA  . SER A 1 95  ? 22.045  4.664   2.122  1.00 24.08 ? 113  SER T CA  1 
ATOM   709  C  C   . SER A 1 95  ? 21.205  5.932   1.987  1.00 24.29 ? 113  SER T C   1 
ATOM   710  O  O   . SER A 1 95  ? 20.049  5.888   1.560  1.00 26.07 ? 113  SER T O   1 
ATOM   711  C  CB  . SER A 1 95  ? 22.038  3.876   0.818  1.00 23.06 ? 113  SER T CB  1 
ATOM   712  O  OG  . SER A 1 95  ? 22.578  4.658   -0.224 1.00 31.50 ? 113  SER T OG  1 
ATOM   713  N  N   . LEU A 1 96  ? 21.789  7.061   2.369  1.00 23.50 ? 114  LEU T N   1 
ATOM   714  C  CA  . LEU A 1 96  ? 21.089  8.335   2.312  1.00 23.93 ? 114  LEU T CA  1 
ATOM   715  C  C   . LEU A 1 96  ? 21.040  8.921   0.904  1.00 25.54 ? 114  LEU T C   1 
ATOM   716  O  O   . LEU A 1 96  ? 22.030  8.912   0.171  1.00 25.39 ? 114  LEU T O   1 
ATOM   717  C  CB  . LEU A 1 96  ? 21.751  9.335   3.267  1.00 22.41 ? 114  LEU T CB  1 
ATOM   718  C  CG  . LEU A 1 96  ? 21.861  8.894   4.732  1.00 24.94 ? 114  LEU T CG  1 
ATOM   719  C  CD1 . LEU A 1 96  ? 22.647  9.928   5.519  1.00 24.69 ? 114  LEU T CD1 1 
ATOM   720  C  CD2 . LEU A 1 96  ? 20.469  8.718   5.331  1.00 25.21 ? 114  LEU T CD2 1 
ATOM   721  N  N   . ASN A 1 97  ? 19.872  9.426   0.531  1.00 24.82 ? 115  ASN T N   1 
ATOM   722  C  CA  . ASN A 1 97  ? 19.692  10.035  -0.773 1.00 26.32 ? 115  ASN T CA  1 
ATOM   723  C  C   . ASN A 1 97  ? 18.550  11.037  -0.707 1.00 27.39 ? 115  ASN T C   1 
ATOM   724  O  O   . ASN A 1 97  ? 18.213  11.543  0.363  1.00 27.68 ? 115  ASN T O   1 
ATOM   725  C  CB  . ASN A 1 97  ? 19.403  8.969   -1.834 1.00 26.69 ? 115  ASN T CB  1 
ATOM   726  C  CG  . ASN A 1 97  ? 18.251  8.064   -1.453 1.00 27.33 ? 115  ASN T CG  1 
ATOM   727  O  OD1 . ASN A 1 97  ? 17.136  8.526   -1.211 1.00 28.88 ? 115  ASN T OD1 1 
ATOM   728  N  ND2 . ASN A 1 97  ? 18.514  6.764   -1.399 1.00 28.79 ? 115  ASN T ND2 1 
ATOM   729  N  N   . SER A 1 98  ? 17.953  11.310  -1.855 1.00 28.26 ? 116  SER T N   1 
ATOM   730  C  CA  . SER A 1 98  ? 16.859  12.261  -1.940 1.00 30.85 ? 116  SER T CA  1 
ATOM   731  C  C   . SER A 1 98  ? 15.577  11.741  -1.282 1.00 30.97 ? 116  SER T C   1 
ATOM   732  O  O   . SER A 1 98  ? 14.772  12.519  -0.766 1.00 30.25 ? 116  SER T O   1 
ATOM   733  C  CB  . SER A 1 98  ? 16.594  12.585  -3.414 1.00 33.10 ? 116  SER T CB  1 
ATOM   734  O  OG  . SER A 1 98  ? 15.601  13.584  -3.550 1.00 39.56 ? 116  SER T OG  1 
ATOM   735  N  N   . ARG A 1 99  ? 15.395  10.425  -1.285 1.00 29.20 ? 117  ARG T N   1 
ATOM   736  C  CA  . ARG A 1 99  ? 14.185  9.836   -0.723 1.00 29.43 ? 117  ARG T CA  1 
ATOM   737  C  C   . ARG A 1 99  ? 14.329  9.255   0.679  1.00 27.08 ? 117  ARG T C   1 
ATOM   738  O  O   . ARG A 1 99  ? 13.338  8.887   1.314  1.00 25.67 ? 117  ARG T O   1 
ATOM   739  C  CB  . ARG A 1 99  ? 13.653  8.783   -1.693 1.00 31.91 ? 117  ARG T CB  1 
ATOM   740  C  CG  . ARG A 1 99  ? 13.468  9.352   -3.089 1.00 38.07 ? 117  ARG T CG  1 
ATOM   741  C  CD  . ARG A 1 99  ? 12.770  8.394   -4.023 1.00 43.89 ? 117  ARG T CD  1 
ATOM   742  N  NE  . ARG A 1 99  ? 12.567  8.992   -5.343 1.00 49.19 ? 117  ARG T NE  1 
ATOM   743  C  CZ  . ARG A 1 99  ? 13.552  9.347   -6.165 1.00 52.47 ? 117  ARG T CZ  1 
ATOM   744  N  NH1 . ARG A 1 99  ? 14.820  9.164   -5.812 1.00 53.95 ? 117  ARG T NH1 1 
ATOM   745  N  NH2 . ARG A 1 99  ? 13.272  9.888   -7.343 1.00 54.04 ? 117  ARG T NH2 1 
ATOM   746  N  N   . VAL A 1 100 ? 15.563  9.176   1.159  1.00 24.15 ? 118  VAL T N   1 
ATOM   747  C  CA  . VAL A 1 100 ? 15.835  8.663   2.493  1.00 23.54 ? 118  VAL T CA  1 
ATOM   748  C  C   . VAL A 1 100 ? 16.868  9.576   3.124  1.00 24.57 ? 118  VAL T C   1 
ATOM   749  O  O   . VAL A 1 100 ? 18.057  9.509   2.797  1.00 25.56 ? 118  VAL T O   1 
ATOM   750  C  CB  . VAL A 1 100 ? 16.389  7.222   2.458  1.00 22.02 ? 118  VAL T CB  1 
ATOM   751  C  CG1 . VAL A 1 100 ? 16.712  6.752   3.872  1.00 20.93 ? 118  VAL T CG1 1 
ATOM   752  C  CG2 . VAL A 1 100 ? 15.369  6.294   1.824  1.00 20.88 ? 118  VAL T CG2 1 
ATOM   753  N  N   . ALA A 1 101 ? 16.400  10.442  4.016  1.00 22.78 ? 119  ALA T N   1 
ATOM   754  C  CA  . ALA A 1 101 ? 17.271  11.393  4.693  1.00 22.59 ? 119  ALA T CA  1 
ATOM   755  C  C   . ALA A 1 101 ? 16.921  11.488  6.167  1.00 22.47 ? 119  ALA T C   1 
ATOM   756  O  O   . ALA A 1 101 ? 15.798  11.176  6.574  1.00 22.01 ? 119  ALA T O   1 
ATOM   757  C  CB  . ALA A 1 101 ? 17.150  12.763  4.048  1.00 20.31 ? 119  ALA T CB  1 
ATOM   758  N  N   . SER A 1 102 ? 17.891  11.933  6.960  1.00 21.58 ? 120  SER T N   1 
ATOM   759  C  CA  . SER A 1 102 ? 17.703  12.076  8.396  1.00 21.43 ? 120  SER T CA  1 
ATOM   760  C  C   . SER A 1 102 ? 17.114  13.441  8.704  1.00 21.82 ? 120  SER T C   1 
ATOM   761  O  O   . SER A 1 102 ? 17.121  14.338  7.860  1.00 18.80 ? 120  SER T O   1 
ATOM   762  C  CB  . SER A 1 102 ? 19.043  11.917  9.116  1.00 22.65 ? 120  SER T CB  1 
ATOM   763  O  OG  . SER A 1 102 ? 19.944  12.938  8.727  1.00 23.10 ? 120  SER T OG  1 
ATOM   764  N  N   . ILE A 1 103 ? 16.591  13.591  9.916  1.00 22.71 ? 121  ILE T N   1 
ATOM   765  C  CA  . ILE A 1 103 ? 16.006  14.855  10.346 1.00 21.76 ? 121  ILE T CA  1 
ATOM   766  C  C   . ILE A 1 103 ? 16.861  15.324  11.528 1.00 22.02 ? 121  ILE T C   1 
ATOM   767  O  O   . ILE A 1 103 ? 17.391  14.499  12.274 1.00 19.84 ? 121  ILE T O   1 
ATOM   768  C  CB  . ILE A 1 103 ? 14.505  14.653  10.734 1.00 23.57 ? 121  ILE T CB  1 
ATOM   769  C  CG1 . ILE A 1 103 ? 13.788  16.006  10.831 1.00 24.28 ? 121  ILE T CG1 1 
ATOM   770  C  CG2 . ILE A 1 103 ? 14.393  13.838  12.015 1.00 20.80 ? 121  ILE T CG2 1 
ATOM   771  C  CD1 . ILE A 1 103 ? 14.131  16.810  12.056 1.00 27.40 ? 121  ILE T CD1 1 
ATOM   772  N  N   . SER A 1 104 ? 17.026  16.639  11.673 1.00 22.27 ? 122  SER T N   1 
ATOM   773  C  CA  . SER A 1 104 ? 17.852  17.206  12.743 1.00 23.02 ? 122  SER T CA  1 
ATOM   774  C  C   . SER A 1 104 ? 17.196  17.269  14.115 1.00 22.53 ? 122  SER T C   1 
ATOM   775  O  O   . SER A 1 104 ? 15.984  17.437  14.234 1.00 22.13 ? 122  SER T O   1 
ATOM   776  C  CB  . SER A 1 104 ? 18.304  18.623  12.373 1.00 24.48 ? 122  SER T CB  1 
ATOM   777  O  OG  . SER A 1 104 ? 19.060  18.627  11.177 1.00 30.85 ? 122  SER T OG  1 
ATOM   778  N  N   . LEU A 1 105 ? 18.017  17.135  15.151 1.00 21.74 ? 123  LEU T N   1 
ATOM   779  C  CA  . LEU A 1 105 ? 17.534  17.222  16.520 1.00 23.17 ? 123  LEU T CA  1 
ATOM   780  C  C   . LEU A 1 105 ? 17.466  18.715  16.856 1.00 25.05 ? 123  LEU T C   1 
ATOM   781  O  O   . LEU A 1 105 ? 18.239  19.517  16.321 1.00 24.81 ? 123  LEU T O   1 
ATOM   782  C  CB  . LEU A 1 105 ? 18.491  16.488  17.466 1.00 23.42 ? 123  LEU T CB  1 
ATOM   783  C  CG  . LEU A 1 105 ? 18.483  14.964  17.299 1.00 23.90 ? 123  LEU T CG  1 
ATOM   784  C  CD1 . LEU A 1 105 ? 19.628  14.331  18.074 1.00 24.88 ? 123  LEU T CD1 1 
ATOM   785  C  CD2 . LEU A 1 105 ? 17.142  14.418  17.776 1.00 24.57 ? 123  LEU T CD2 1 
ATOM   786  N  N   . PRO A 1 106 ? 16.540  19.110  17.742 1.00 25.14 ? 124  PRO T N   1 
ATOM   787  C  CA  . PRO A 1 106 ? 16.397  20.518  18.119 1.00 25.99 ? 124  PRO T CA  1 
ATOM   788  C  C   . PRO A 1 106 ? 17.492  21.040  19.048 1.00 27.67 ? 124  PRO T C   1 
ATOM   789  O  O   . PRO A 1 106 ? 18.117  20.276  19.784 1.00 27.05 ? 124  PRO T O   1 
ATOM   790  C  CB  . PRO A 1 106 ? 15.023  20.549  18.775 1.00 25.07 ? 124  PRO T CB  1 
ATOM   791  C  CG  . PRO A 1 106 ? 14.997  19.231  19.496 1.00 26.83 ? 124  PRO T CG  1 
ATOM   792  C  CD  . PRO A 1 106 ? 15.562  18.270  18.460 1.00 25.91 ? 124  PRO T CD  1 
ATOM   793  N  N   . THR A 1 107 ? 17.728  22.348  18.990 1.00 29.51 ? 125  THR T N   1 
ATOM   794  C  CA  . THR A 1 107 ? 18.723  22.992  19.844 1.00 31.27 ? 125  THR T CA  1 
ATOM   795  C  C   . THR A 1 107 ? 17.966  23.737  20.939 1.00 31.16 ? 125  THR T C   1 
ATOM   796  O  O   . THR A 1 107 ? 18.536  24.137  21.955 1.00 33.40 ? 125  THR T O   1 
ATOM   797  C  CB  . THR A 1 107 ? 19.592  23.994  19.054 1.00 32.59 ? 125  THR T CB  1 
ATOM   798  O  OG1 . THR A 1 107 ? 18.748  24.882  18.311 1.00 34.50 ? 125  THR T OG1 1 
ATOM   799  C  CG2 . THR A 1 107 ? 20.518  23.258  18.097 1.00 32.35 ? 125  THR T CG2 1 
ATOM   800  N  N   . SER A 1 108 ? 16.669  23.920  20.718 1.00 29.73 ? 127  SER T N   1 
ATOM   801  C  CA  . SER A 1 108 ? 15.811  24.585  21.687 1.00 29.54 ? 127  SER T CA  1 
ATOM   802  C  C   . SER A 1 108 ? 14.398  24.047  21.520 1.00 28.43 ? 127  SER T C   1 
ATOM   803  O  O   . SER A 1 108 ? 14.044  23.535  20.459 1.00 28.26 ? 127  SER T O   1 
ATOM   804  C  CB  . SER A 1 108 ? 15.828  26.103  21.476 1.00 29.95 ? 127  SER T CB  1 
ATOM   805  O  OG  . SER A 1 108 ? 15.396  26.445  20.170 1.00 32.78 ? 127  SER T OG  1 
ATOM   806  N  N   . CYS A 1 109 ? 13.597  24.152  22.572 1.00 26.62 ? 128  CYS T N   1 
ATOM   807  C  CA  . CYS A 1 109 ? 12.224  23.672  22.529 1.00 27.23 ? 128  CYS T CA  1 
ATOM   808  C  C   . CYS A 1 109 ? 11.358  24.611  21.694 1.00 27.65 ? 128  CYS T C   1 
ATOM   809  O  O   . CYS A 1 109 ? 11.674  25.791  21.549 1.00 29.09 ? 128  CYS T O   1 
ATOM   810  C  CB  . CYS A 1 109 ? 11.662  23.575  23.948 1.00 25.62 ? 128  CYS T CB  1 
ATOM   811  S  SG  . CYS A 1 109 ? 12.580  22.453  25.053 1.00 27.64 ? 128  CYS T SG  1 
ATOM   812  N  N   . ALA A 1 110 ? 10.273  24.081  21.138 1.00 26.51 ? 129  ALA T N   1 
ATOM   813  C  CA  . ALA A 1 110 ? 9.364   24.883  20.330 1.00 27.50 ? 129  ALA T CA  1 
ATOM   814  C  C   . ALA A 1 110 ? 8.317   25.519  21.239 1.00 27.99 ? 129  ALA T C   1 
ATOM   815  O  O   . ALA A 1 110 ? 7.963   24.961  22.277 1.00 28.12 ? 129  ALA T O   1 
ATOM   816  C  CB  . ALA A 1 110 ? 8.689   24.013  19.282 1.00 26.81 ? 129  ALA T CB  1 
ATOM   817  N  N   . SER A 1 111 ? 7.820   26.686  20.847 1.00 28.14 ? 130  SER T N   1 
ATOM   818  C  CA  . SER A 1 111 ? 6.822   27.386  21.647 1.00 28.42 ? 130  SER T CA  1 
ATOM   819  C  C   . SER A 1 111 ? 5.409   27.116  21.150 1.00 26.38 ? 130  SER T C   1 
ATOM   820  O  O   . SER A 1 111 ? 5.217   26.672  20.020 1.00 25.51 ? 130  SER T O   1 
ATOM   821  C  CB  . SER A 1 111 ? 7.090   28.890  21.612 1.00 31.05 ? 130  SER T CB  1 
ATOM   822  O  OG  . SER A 1 111 ? 6.993   29.390  20.287 1.00 35.65 ? 130  SER T OG  1 
ATOM   823  N  N   . ALA A 1 112 ? 4.426   27.390  22.004 1.00 24.93 ? 132  ALA T N   1 
ATOM   824  C  CA  . ALA A 1 112 ? 3.025   27.199  21.650 1.00 22.99 ? 132  ALA T CA  1 
ATOM   825  C  C   . ALA A 1 112 ? 2.727   27.988  20.376 1.00 23.16 ? 132  ALA T C   1 
ATOM   826  O  O   . ALA A 1 112 ? 3.312   29.048  20.136 1.00 21.92 ? 132  ALA T O   1 
ATOM   827  C  CB  . ALA A 1 112 ? 2.128   27.680  22.785 1.00 21.77 ? 132  ALA T CB  1 
ATOM   828  N  N   . GLY A 1 113 ? 1.820   27.470  19.555 1.00 22.70 ? 133  GLY T N   1 
ATOM   829  C  CA  . GLY A 1 113 ? 1.480   28.156  18.323 1.00 23.54 ? 133  GLY T CA  1 
ATOM   830  C  C   . GLY A 1 113 ? 2.378   27.789  17.158 1.00 22.97 ? 133  GLY T C   1 
ATOM   831  O  O   . GLY A 1 113 ? 2.064   28.107  16.012 1.00 25.02 ? 133  GLY T O   1 
ATOM   832  N  N   . THR A 1 114 ? 3.500   27.129  17.435 1.00 22.45 ? 134  THR T N   1 
ATOM   833  C  CA  . THR A 1 114 ? 4.410   26.729  16.361 1.00 22.14 ? 134  THR T CA  1 
ATOM   834  C  C   . THR A 1 114 ? 3.726   25.645  15.529 1.00 21.31 ? 134  THR T C   1 
ATOM   835  O  O   . THR A 1 114 ? 3.196   24.677  16.076 1.00 19.46 ? 134  THR T O   1 
ATOM   836  C  CB  . THR A 1 114 ? 5.741   26.175  16.922 1.00 23.31 ? 134  THR T CB  1 
ATOM   837  O  OG1 . THR A 1 114 ? 6.434   27.211  17.628 1.00 23.94 ? 134  THR T OG1 1 
ATOM   838  C  CG2 . THR A 1 114 ? 6.625   25.663  15.795 1.00 21.95 ? 134  THR T CG2 1 
ATOM   839  N  N   . GLN A 1 115 ? 3.730   25.808  14.211 1.00 21.77 ? 135  GLN T N   1 
ATOM   840  C  CA  . GLN A 1 115 ? 3.086   24.832  13.334 1.00 23.73 ? 135  GLN T CA  1 
ATOM   841  C  C   . GLN A 1 115 ? 4.025   23.656  13.062 1.00 21.39 ? 135  GLN T C   1 
ATOM   842  O  O   . GLN A 1 115 ? 5.213   23.849  12.797 1.00 21.74 ? 135  GLN T O   1 
ATOM   843  C  CB  . GLN A 1 115 ? 2.681   25.490  12.012 1.00 25.56 ? 135  GLN T CB  1 
ATOM   844  C  CG  . GLN A 1 115 ? 1.506   24.807  11.324 1.00 34.02 ? 135  GLN T CG  1 
ATOM   845  C  CD  . GLN A 1 115 ? 0.166   25.115  11.994 1.00 36.62 ? 135  GLN T CD  1 
ATOM   846  O  OE1 . GLN A 1 115 ? -0.873  24.556  11.623 1.00 39.52 ? 135  GLN T OE1 1 
ATOM   847  N  NE2 . GLN A 1 115 ? 0.185   26.015  12.974 1.00 37.61 ? 135  GLN T NE2 1 
ATOM   848  N  N   . CYS A 1 116 ? 3.496   22.439  13.128 1.00 19.73 ? 136  CYS T N   1 
ATOM   849  C  CA  . CYS A 1 116 ? 4.321   21.252  12.905 1.00 20.26 ? 136  CYS T CA  1 
ATOM   850  C  C   . CYS A 1 116 ? 3.713   20.255  11.929 1.00 19.16 ? 136  CYS T C   1 
ATOM   851  O  O   . CYS A 1 116 ? 2.508   20.272  11.674 1.00 19.89 ? 136  CYS T O   1 
ATOM   852  C  CB  . CYS A 1 116 ? 4.572   20.531  14.230 1.00 19.16 ? 136  CYS T CB  1 
ATOM   853  S  SG  . CYS A 1 116 ? 5.196   21.563  15.590 1.00 20.77 ? 136  CYS T SG  1 
ATOM   854  N  N   . LEU A 1 117 ? 4.561   19.379  11.396 1.00 17.95 ? 137  LEU T N   1 
ATOM   855  C  CA  . LEU A 1 117 ? 4.126   18.348  10.466 1.00 18.47 ? 137  LEU T CA  1 
ATOM   856  C  C   . LEU A 1 117 ? 4.207   16.994  11.159 1.00 17.89 ? 137  LEU T C   1 
ATOM   857  O  O   . LEU A 1 117 ? 5.269   16.592  11.639 1.00 18.50 ? 137  LEU T O   1 
ATOM   858  C  CB  . LEU A 1 117 ? 5.006   18.321  9.208  1.00 17.76 ? 137  LEU T CB  1 
ATOM   859  C  CG  . LEU A 1 117 ? 4.602   17.258  8.175  1.00 21.54 ? 137  LEU T CG  1 
ATOM   860  C  CD1 . LEU A 1 117 ? 3.222   17.593  7.601  1.00 20.58 ? 137  LEU T CD1 1 
ATOM   861  C  CD2 . LEU A 1 117 ? 5.634   17.187  7.055  1.00 18.74 ? 137  LEU T CD2 1 
ATOM   862  N  N   . ILE A 1 118 ? 3.071   16.312  11.220 1.00 16.03 ? 138  ILE T N   1 
ATOM   863  C  CA  . ILE A 1 118 ? 2.965   14.993  11.832 1.00 17.74 ? 138  ILE T CA  1 
ATOM   864  C  C   . ILE A 1 118 ? 2.595   14.044  10.697 1.00 18.00 ? 138  ILE T C   1 
ATOM   865  O  O   . ILE A 1 118 ? 1.776   14.389  9.843  1.00 17.39 ? 138  ILE T O   1 
ATOM   866  C  CB  . ILE A 1 118 ? 1.848   14.968  12.892 1.00 17.32 ? 138  ILE T CB  1 
ATOM   867  C  CG1 . ILE A 1 118 ? 2.058   16.116  13.884 1.00 17.27 ? 138  ILE T CG1 1 
ATOM   868  C  CG2 . ILE A 1 118 ? 1.839   13.630  13.611 1.00 17.92 ? 138  ILE T CG2 1 
ATOM   869  C  CD1 . ILE A 1 118 ? 0.869   16.384  14.763 1.00 15.77 ? 138  ILE T CD1 1 
ATOM   870  N  N   . SER A 1 119 ? 3.192   12.857  10.676 1.00 17.36 ? 139  SER T N   1 
ATOM   871  C  CA  . SER A 1 119 ? 2.903   11.909  9.611  1.00 16.81 ? 139  SER T CA  1 
ATOM   872  C  C   . SER A 1 119 ? 2.926   10.467  10.082 1.00 16.36 ? 139  SER T C   1 
ATOM   873  O  O   . SER A 1 119 ? 3.496   10.152  11.128 1.00 15.95 ? 139  SER T O   1 
ATOM   874  C  CB  . SER A 1 119 ? 3.906   12.092  8.470  1.00 16.26 ? 139  SER T CB  1 
ATOM   875  O  OG  . SER A 1 119 ? 5.234   12.063  8.960  1.00 16.73 ? 139  SER T OG  1 
ATOM   876  N  N   . GLY A 1 120 ? 2.304   9.591   9.298  1.00 16.68 ? 140  GLY T N   1 
ATOM   877  C  CA  . GLY A 1 120 ? 2.263   8.185   9.650  1.00 16.06 ? 140  GLY T CA  1 
ATOM   878  C  C   . GLY A 1 120 ? 1.267   7.359   8.854  1.00 17.21 ? 140  GLY T C   1 
ATOM   879  O  O   . GLY A 1 120 ? 0.508   7.885   8.031  1.00 17.99 ? 140  GLY T O   1 
ATOM   880  N  N   . TRP A 1 121 ? 1.280   6.055   9.107  1.00 15.05 ? 141  TRP T N   1 
ATOM   881  C  CA  . TRP A 1 121 ? 0.392   5.107   8.448  1.00 17.04 ? 141  TRP T CA  1 
ATOM   882  C  C   . TRP A 1 121 ? -0.657  4.599   9.439  1.00 17.47 ? 141  TRP T C   1 
ATOM   883  O  O   . TRP A 1 121 ? -1.201  3.511   9.271  1.00 18.76 ? 141  TRP T O   1 
ATOM   884  C  CB  . TRP A 1 121 ? 1.197   3.918   7.912  1.00 18.44 ? 141  TRP T CB  1 
ATOM   885  C  CG  . TRP A 1 121 ? 2.075   4.230   6.740  1.00 17.72 ? 141  TRP T CG  1 
ATOM   886  C  CD1 . TRP A 1 121 ? 1.705   4.277   5.425  1.00 19.43 ? 141  TRP T CD1 1 
ATOM   887  C  CD2 . TRP A 1 121 ? 3.475   4.536   6.774  1.00 17.28 ? 141  TRP T CD2 1 
ATOM   888  N  NE1 . TRP A 1 121 ? 2.791   4.592   4.636  1.00 16.36 ? 141  TRP T NE1 1 
ATOM   889  C  CE2 . TRP A 1 121 ? 3.888   4.756   5.438  1.00 16.47 ? 141  TRP T CE2 1 
ATOM   890  C  CE3 . TRP A 1 121 ? 4.421   4.645   7.803  1.00 14.11 ? 141  TRP T CE3 1 
ATOM   891  C  CZ2 . TRP A 1 121 ? 5.207   5.080   5.103  1.00 15.80 ? 141  TRP T CZ2 1 
ATOM   892  C  CZ3 . TRP A 1 121 ? 5.732   4.968   7.473  1.00 15.73 ? 141  TRP T CZ3 1 
ATOM   893  C  CH2 . TRP A 1 121 ? 6.113   5.181   6.131  1.00 16.22 ? 141  TRP T CH2 1 
ATOM   894  N  N   . GLY A 1 122 ? -0.939  5.388   10.469 1.00 17.54 ? 142  GLY T N   1 
ATOM   895  C  CA  . GLY A 1 122 ? -1.912  4.977   11.462 1.00 18.55 ? 142  GLY T CA  1 
ATOM   896  C  C   . GLY A 1 122 ? -3.366  5.089   11.035 1.00 18.51 ? 142  GLY T C   1 
ATOM   897  O  O   . GLY A 1 122 ? -3.678  5.544   9.933  1.00 17.11 ? 142  GLY T O   1 
ATOM   898  N  N   . ASN A 1 123 ? -4.251  4.666   11.932 1.00 19.71 ? 143  ASN T N   1 
ATOM   899  C  CA  . ASN A 1 123 ? -5.695  4.699   11.713 1.00 20.89 ? 143  ASN T CA  1 
ATOM   900  C  C   . ASN A 1 123 ? -6.135  6.083   11.238 1.00 21.70 ? 143  ASN T C   1 
ATOM   901  O  O   . ASN A 1 123 ? -5.689  7.098   11.776 1.00 19.66 ? 143  ASN T O   1 
ATOM   902  C  CB  . ASN A 1 123 ? -6.397  4.340   13.025 1.00 21.23 ? 143  ASN T CB  1 
ATOM   903  C  CG  . ASN A 1 123 ? -7.885  4.121   12.858 1.00 21.98 ? 143  ASN T CG  1 
ATOM   904  O  OD1 . ASN A 1 123 ? -8.415  4.164   11.751 1.00 23.98 ? 143  ASN T OD1 1 
ATOM   905  N  ND2 . ASN A 1 123 ? -8.567  3.879   13.966 1.00 22.64 ? 143  ASN T ND2 1 
ATOM   906  N  N   . THR A 1 124 ? -7.011  6.128   10.235 1.00 22.05 ? 144  THR T N   1 
ATOM   907  C  CA  . THR A 1 124 ? -7.482  7.403   9.700  1.00 23.87 ? 144  THR T CA  1 
ATOM   908  C  C   . THR A 1 124 ? -8.892  7.784   10.141 1.00 26.64 ? 144  THR T C   1 
ATOM   909  O  O   . THR A 1 124 ? -9.424  8.803   9.698  1.00 26.36 ? 144  THR T O   1 
ATOM   910  C  CB  . THR A 1 124 ? -7.466  7.417   8.156  1.00 24.90 ? 144  THR T CB  1 
ATOM   911  O  OG1 . THR A 1 124 ? -8.451  6.502   7.659  1.00 26.40 ? 144  THR T OG1 1 
ATOM   912  C  CG2 . THR A 1 124 ? -6.089  7.023   7.629  1.00 24.48 ? 144  THR T CG2 1 
ATOM   913  N  N   . LYS A 1 125 ? -9.498  6.982   11.009 1.00 28.90 ? 145  LYS T N   1 
ATOM   914  C  CA  . LYS A 1 125 ? -10.848 7.278   11.466 1.00 31.62 ? 145  LYS T CA  1 
ATOM   915  C  C   . LYS A 1 125 ? -10.990 7.438   12.974 1.00 32.68 ? 145  LYS T C   1 
ATOM   916  O  O   . LYS A 1 125 ? -10.351 6.733   13.757 1.00 31.81 ? 145  LYS T O   1 
ATOM   917  C  CB  . LYS A 1 125 ? -11.815 6.207   10.956 1.00 33.82 ? 145  LYS T CB  1 
ATOM   918  C  CG  . LYS A 1 125 ? -11.991 6.247   9.441  1.00 37.14 ? 145  LYS T CG  1 
ATOM   919  C  CD  . LYS A 1 125 ? -13.072 5.293   8.971  1.00 42.67 ? 145  LYS T CD  1 
ATOM   920  C  CE  . LYS A 1 125 ? -13.367 5.494   7.489  1.00 45.72 ? 145  LYS T CE  1 
ATOM   921  N  NZ  . LYS A 1 125 ? -14.474 4.610   7.008  1.00 47.78 ? 145  LYS T NZ  1 
ATOM   922  N  N   . SER A 1 126 ? -11.837 8.385   13.367 1.00 34.64 ? 146  SER T N   1 
ATOM   923  C  CA  . SER A 1 126 ? -12.095 8.668   14.771 1.00 37.59 ? 146  SER T CA  1 
ATOM   924  C  C   . SER A 1 126 ? -12.878 7.517   15.387 1.00 38.55 ? 146  SER T C   1 
ATOM   925  O  O   . SER A 1 126 ? -12.634 7.123   16.525 1.00 38.92 ? 146  SER T O   1 
ATOM   926  C  CB  . SER A 1 126 ? -12.899 9.960   14.902 1.00 38.78 ? 146  SER T CB  1 
ATOM   927  O  OG  . SER A 1 126 ? -12.241 11.026  14.244 1.00 43.19 ? 146  SER T OG  1 
ATOM   928  N  N   . SER A 1 127 ? -13.827 6.992   14.621 1.00 40.47 ? 147  SER T N   1 
ATOM   929  C  CA  . SER A 1 127 ? -14.655 5.877   15.062 1.00 42.71 ? 147  SER T CA  1 
ATOM   930  C  C   . SER A 1 127 ? -14.471 4.728   14.080 1.00 42.94 ? 147  SER T C   1 
ATOM   931  O  O   . SER A 1 127 ? -14.652 4.896   12.875 1.00 43.80 ? 147  SER T O   1 
ATOM   932  C  CB  . SER A 1 127 ? -16.126 6.293   15.109 1.00 43.21 ? 147  SER T CB  1 
ATOM   933  O  OG  . SER A 1 127 ? -16.328 7.319   16.066 1.00 46.84 ? 147  SER T OG  1 
ATOM   934  N  N   . GLY A 1 128 ? -14.112 3.560   14.595 1.00 42.45 ? 148  GLY T N   1 
ATOM   935  C  CA  . GLY A 1 128 ? -13.897 2.430   13.717 1.00 42.50 ? 148  GLY T CA  1 
ATOM   936  C  C   . GLY A 1 128 ? -12.435 2.386   13.322 1.00 42.94 ? 148  GLY T C   1 
ATOM   937  O  O   . GLY A 1 128 ? -11.621 3.141   13.855 1.00 43.16 ? 148  GLY T O   1 
ATOM   938  N  N   . THR A 1 129 ? -12.100 1.517   12.377 1.00 42.36 ? 149  THR T N   1 
ATOM   939  C  CA  . THR A 1 129 ? -10.721 1.375   11.943 1.00 41.86 ? 149  THR T CA  1 
ATOM   940  C  C   . THR A 1 129 ? -10.560 1.389   10.429 1.00 41.31 ? 149  THR T C   1 
ATOM   941  O  O   . THR A 1 129 ? -11.399 0.868   9.697  1.00 42.67 ? 149  THR T O   1 
ATOM   942  C  CB  . THR A 1 129 ? -10.125 0.068   12.492 1.00 42.65 ? 149  THR T CB  1 
ATOM   943  O  OG1 . THR A 1 129 ? -10.117 0.117   13.924 1.00 43.61 ? 149  THR T OG1 1 
ATOM   944  C  CG2 . THR A 1 129 ? -8.712  -0.130  11.990 1.00 42.79 ? 149  THR T CG2 1 
ATOM   945  N  N   . SER A 1 130 ? -9.473  2.000   9.967  1.00 38.78 ? 150  SER T N   1 
ATOM   946  C  CA  . SER A 1 130 ? -9.177  2.069   8.543  1.00 36.36 ? 150  SER T CA  1 
ATOM   947  C  C   . SER A 1 130 ? -7.723  2.489   8.343  1.00 34.85 ? 150  SER T C   1 
ATOM   948  O  O   . SER A 1 130 ? -7.371  3.657   8.516  1.00 33.19 ? 150  SER T O   1 
ATOM   949  C  CB  . SER A 1 130 ? -10.107 3.063   7.847  1.00 36.39 ? 150  SER T CB  1 
ATOM   950  O  OG  . SER A 1 130 ? -9.852  3.090   6.453  1.00 35.92 ? 150  SER T OG  1 
ATOM   951  N  N   . TYR A 1 131 ? -6.884  1.524   7.979  1.00 33.28 ? 151  TYR T N   1 
ATOM   952  C  CA  . TYR A 1 131 ? -5.465  1.779   7.763  1.00 32.02 ? 151  TYR T CA  1 
ATOM   953  C  C   . TYR A 1 131 ? -5.149  2.045   6.298  1.00 30.70 ? 151  TYR T C   1 
ATOM   954  O  O   . TYR A 1 131 ? -5.530  1.280   5.414  1.00 30.78 ? 151  TYR T O   1 
ATOM   955  C  CB  . TYR A 1 131 ? -4.646  0.600   8.291  1.00 32.93 ? 151  TYR T CB  1 
ATOM   956  C  CG  . TYR A 1 131 ? -4.628  0.544   9.801  1.00 34.44 ? 151  TYR T CG  1 
ATOM   957  C  CD1 . TYR A 1 131 ? -3.781  1.374   10.534 1.00 35.39 ? 151  TYR T CD1 1 
ATOM   958  C  CD2 . TYR A 1 131 ? -5.505  -0.285  10.501 1.00 35.52 ? 151  TYR T CD2 1 
ATOM   959  C  CE1 . TYR A 1 131 ? -3.809  1.387   11.927 1.00 37.12 ? 151  TYR T CE1 1 
ATOM   960  C  CE2 . TYR A 1 131 ? -5.543  -0.280  11.896 1.00 36.59 ? 151  TYR T CE2 1 
ATOM   961  C  CZ  . TYR A 1 131 ? -4.692  0.561   12.601 1.00 36.91 ? 151  TYR T CZ  1 
ATOM   962  O  OH  . TYR A 1 131 ? -4.729  0.588   13.978 1.00 38.71 ? 151  TYR T OH  1 
ATOM   963  N  N   . PRO A 1 132 ? -4.446  3.152   6.023  1.00 28.63 ? 152  PRO T N   1 
ATOM   964  C  CA  . PRO A 1 132 ? -4.084  3.520   4.655  1.00 26.53 ? 152  PRO T CA  1 
ATOM   965  C  C   . PRO A 1 132 ? -2.893  2.736   4.110  1.00 25.46 ? 152  PRO T C   1 
ATOM   966  O  O   . PRO A 1 132 ? -2.170  2.076   4.858  1.00 23.29 ? 152  PRO T O   1 
ATOM   967  C  CB  . PRO A 1 132 ? -3.783  5.008   4.781  1.00 26.20 ? 152  PRO T CB  1 
ATOM   968  C  CG  . PRO A 1 132 ? -3.128  5.078   6.126  1.00 26.50 ? 152  PRO T CG  1 
ATOM   969  C  CD  . PRO A 1 132 ? -4.029  4.200   6.976  1.00 27.38 ? 152  PRO T CD  1 
ATOM   970  N  N   . ASP A 1 133 ? -2.709  2.809   2.797  1.00 24.73 ? 153  ASP T N   1 
ATOM   971  C  CA  . ASP A 1 133 ? -1.595  2.146   2.134  1.00 24.92 ? 153  ASP T CA  1 
ATOM   972  C  C   . ASP A 1 133 ? -0.433  3.127   2.063  1.00 22.78 ? 153  ASP T C   1 
ATOM   973  O  O   . ASP A 1 133 ? 0.724   2.756   2.247  1.00 23.53 ? 153  ASP T O   1 
ATOM   974  C  CB  . ASP A 1 133 ? -1.966  1.750   0.703  1.00 27.98 ? 153  ASP T CB  1 
ATOM   975  C  CG  . ASP A 1 133 ? -3.036  0.682   0.644  1.00 30.99 ? 153  ASP T CG  1 
ATOM   976  O  OD1 . ASP A 1 133 ? -2.897  -0.347  1.338  1.00 31.10 ? 153  ASP T OD1 1 
ATOM   977  O  OD2 . ASP A 1 133 ? -4.014  0.866   -0.114 1.00 36.45 ? 153  ASP T OD2 1 
ATOM   978  N  N   . VAL A 1 134 ? -0.759  4.385   1.783  1.00 22.30 ? 154  VAL T N   1 
ATOM   979  C  CA  . VAL A 1 134 ? 0.249   5.427   1.644  1.00 20.55 ? 154  VAL T CA  1 
ATOM   980  C  C   . VAL A 1 134 ? 0.347   6.321   2.867  1.00 19.72 ? 154  VAL T C   1 
ATOM   981  O  O   . VAL A 1 134 ? -0.562  6.362   3.696  1.00 19.67 ? 154  VAL T O   1 
ATOM   982  C  CB  . VAL A 1 134 ? -0.029  6.300   0.406  1.00 21.63 ? 154  VAL T CB  1 
ATOM   983  C  CG1 . VAL A 1 134 ? -0.049  5.431   -0.837 1.00 22.33 ? 154  VAL T CG1 1 
ATOM   984  C  CG2 . VAL A 1 134 ? -1.350  7.037   0.569  1.00 22.74 ? 154  VAL T CG2 1 
ATOM   985  N  N   . LEU A 1 135 ? 1.458   7.041   2.961  1.00 18.31 ? 155  LEU T N   1 
ATOM   986  C  CA  . LEU A 1 135 ? 1.725   7.923   4.091  1.00 18.79 ? 155  LEU T CA  1 
ATOM   987  C  C   . LEU A 1 135 ? 0.787   9.123   4.167  1.00 19.21 ? 155  LEU T C   1 
ATOM   988  O  O   . LEU A 1 135 ? 0.544   9.805   3.171  1.00 19.69 ? 155  LEU T O   1 
ATOM   989  C  CB  . LEU A 1 135 ? 3.179   8.409   4.032  1.00 17.29 ? 155  LEU T CB  1 
ATOM   990  C  CG  . LEU A 1 135 ? 3.744   9.117   5.265  1.00 17.82 ? 155  LEU T CG  1 
ATOM   991  C  CD1 . LEU A 1 135 ? 3.828   8.133   6.431  1.00 16.02 ? 155  LEU T CD1 1 
ATOM   992  C  CD2 . LEU A 1 135 ? 5.134   9.667   4.939  1.00 19.37 ? 155  LEU T CD2 1 
ATOM   993  N  N   . LYS A 1 136 ? 0.262   9.374   5.362  1.00 18.90 ? 156  LYS T N   1 
ATOM   994  C  CA  . LYS A 1 136 ? -0.634  10.502  5.585  1.00 19.67 ? 156  LYS T CA  1 
ATOM   995  C  C   . LYS A 1 136 ? 0.083   11.606  6.361  1.00 19.82 ? 156  LYS T C   1 
ATOM   996  O  O   . LYS A 1 136 ? 0.954   11.331  7.200  1.00 19.54 ? 156  LYS T O   1 
ATOM   997  C  CB  . LYS A 1 136 ? -1.878  10.042  6.336  1.00 17.43 ? 156  LYS T CB  1 
ATOM   998  C  CG  . LYS A 1 136 ? -2.730  9.073   5.538  1.00 19.90 ? 156  LYS T CG  1 
ATOM   999  C  CD  . LYS A 1 136 ? -3.296  9.746   4.300  1.00 22.29 ? 156  LYS T CD  1 
ATOM   1000 C  CE  . LYS A 1 136 ? -4.128  8.776   3.478  1.00 26.28 ? 156  LYS T CE  1 
ATOM   1001 N  NZ  . LYS A 1 136 ? -4.825  9.467   2.361  1.00 26.57 ? 156  LYS T NZ  1 
ATOM   1002 N  N   . CYS A 1 137 ? -0.285  12.851  6.064  1.00 20.14 ? 157  CYS T N   1 
ATOM   1003 C  CA  . CYS A 1 137 ? 0.309   14.030  6.687  1.00 18.80 ? 157  CYS T CA  1 
ATOM   1004 C  C   . CYS A 1 137 ? -0.719  14.913  7.378  1.00 19.67 ? 157  CYS T C   1 
ATOM   1005 O  O   . CYS A 1 137 ? -1.877  14.967  6.967  1.00 19.15 ? 157  CYS T O   1 
ATOM   1006 C  CB  . CYS A 1 137 ? 1.063   14.850  5.628  1.00 19.64 ? 157  CYS T CB  1 
ATOM   1007 S  SG  . CYS A 1 137 ? 2.765   14.258  5.369  1.00 21.23 ? 157  CYS T SG  1 
ATOM   1008 N  N   . LEU A 1 138 ? -0.285  15.600  8.431  1.00 17.90 ? 158  LEU T N   1 
ATOM   1009 C  CA  . LEU A 1 138 ? -1.151  16.512  9.177  1.00 18.91 ? 158  LEU T CA  1 
ATOM   1010 C  C   . LEU A 1 138 ? -0.342  17.678  9.729  1.00 19.62 ? 158  LEU T C   1 
ATOM   1011 O  O   . LEU A 1 138 ? 0.699   17.481  10.368 1.00 19.27 ? 158  LEU T O   1 
ATOM   1012 C  CB  . LEU A 1 138 ? -1.836  15.794  10.346 1.00 19.92 ? 158  LEU T CB  1 
ATOM   1013 C  CG  . LEU A 1 138 ? -2.637  16.707  11.289 1.00 20.81 ? 158  LEU T CG  1 
ATOM   1014 C  CD1 . LEU A 1 138 ? -3.806  17.318  10.532 1.00 21.74 ? 158  LEU T CD1 1 
ATOM   1015 C  CD2 . LEU A 1 138 ? -3.145  15.915  12.488 1.00 21.54 ? 158  LEU T CD2 1 
ATOM   1016 N  N   . LYS A 1 139 ? -0.821  18.888  9.470  1.00 20.65 ? 159  LYS T N   1 
ATOM   1017 C  CA  . LYS A 1 139 ? -0.178  20.097  9.968  1.00 22.45 ? 159  LYS T CA  1 
ATOM   1018 C  C   . LYS A 1 139 ? -0.914  20.450  11.255 1.00 21.08 ? 159  LYS T C   1 
ATOM   1019 O  O   . LYS A 1 139 ? -2.134  20.569  11.259 1.00 20.67 ? 159  LYS T O   1 
ATOM   1020 C  CB  . LYS A 1 139 ? -0.320  21.228  8.950  1.00 26.14 ? 159  LYS T CB  1 
ATOM   1021 C  CG  . LYS A 1 139 ? 0.317   20.906  7.607  1.00 31.40 ? 159  LYS T CG  1 
ATOM   1022 C  CD  . LYS A 1 139 ? -0.206  21.805  6.489  1.00 35.84 ? 159  LYS T CD  1 
ATOM   1023 C  CE  . LYS A 1 139 ? 0.391   21.397  5.142  1.00 38.46 ? 159  LYS T CE  1 
ATOM   1024 N  NZ  . LYS A 1 139 ? -0.131  22.200  3.994  1.00 40.98 ? 159  LYS T NZ  1 
ATOM   1025 N  N   . ALA A 1 140 ? -0.178  20.606  12.347 1.00 19.25 ? 160  ALA T N   1 
ATOM   1026 C  CA  . ALA A 1 140 ? -0.805  20.920  13.620 1.00 19.91 ? 160  ALA T CA  1 
ATOM   1027 C  C   . ALA A 1 140 ? 0.042   21.854  14.470 1.00 20.18 ? 160  ALA T C   1 
ATOM   1028 O  O   . ALA A 1 140 ? 1.271   21.836  14.406 1.00 19.69 ? 160  ALA T O   1 
ATOM   1029 C  CB  . ALA A 1 140 ? -1.084  19.636  14.385 1.00 18.76 ? 160  ALA T CB  1 
ATOM   1030 N  N   . PRO A 1 141 ? -0.614  22.702  15.272 1.00 20.92 ? 161  PRO T N   1 
ATOM   1031 C  CA  . PRO A 1 141 ? 0.119   23.634  16.127 1.00 20.77 ? 161  PRO T CA  1 
ATOM   1032 C  C   . PRO A 1 141 ? 0.360   23.055  17.520 1.00 20.15 ? 161  PRO T C   1 
ATOM   1033 O  O   . PRO A 1 141 ? -0.382  22.195  17.982 1.00 18.95 ? 161  PRO T O   1 
ATOM   1034 C  CB  . PRO A 1 141 ? -0.803  24.845  16.165 1.00 22.42 ? 161  PRO T CB  1 
ATOM   1035 C  CG  . PRO A 1 141 ? -2.154  24.195  16.222 1.00 20.43 ? 161  PRO T CG  1 
ATOM   1036 C  CD  . PRO A 1 141 ? -2.042  23.074  15.197 1.00 20.87 ? 161  PRO T CD  1 
ATOM   1037 N  N   . ILE A 1 142 ? 1.420   23.513  18.171 1.00 21.66 ? 162  ILE T N   1 
ATOM   1038 C  CA  . ILE A 1 142 ? 1.725   23.071  19.523 1.00 21.44 ? 162  ILE T CA  1 
ATOM   1039 C  C   . ILE A 1 142 ? 0.847   23.938  20.424 1.00 22.34 ? 162  ILE T C   1 
ATOM   1040 O  O   . ILE A 1 142 ? 0.770   25.150  20.233 1.00 21.69 ? 162  ILE T O   1 
ATOM   1041 C  CB  . ILE A 1 142 ? 3.213   23.303  19.857 1.00 20.92 ? 162  ILE T CB  1 
ATOM   1042 C  CG1 . ILE A 1 142 ? 4.076   22.359  19.012 1.00 19.74 ? 162  ILE T CG1 1 
ATOM   1043 C  CG2 . ILE A 1 142 ? 3.455   23.116  21.356 1.00 18.01 ? 162  ILE T CG2 1 
ATOM   1044 C  CD1 . ILE A 1 142 ? 5.565   22.550  19.198 1.00 18.96 ? 162  ILE T CD1 1 
ATOM   1045 N  N   . LEU A 1 143 ? 0.176   23.320  21.390 1.00 22.20 ? 163  LEU T N   1 
ATOM   1046 C  CA  . LEU A 1 143 ? -0.704  24.062  22.281 1.00 22.04 ? 163  LEU T CA  1 
ATOM   1047 C  C   . LEU A 1 143 ? 0.016   24.594  23.510 1.00 24.04 ? 163  LEU T C   1 
ATOM   1048 O  O   . LEU A 1 143 ? 1.111   24.147  23.843 1.00 21.93 ? 163  LEU T O   1 
ATOM   1049 C  CB  . LEU A 1 143 ? -1.876  23.175  22.703 1.00 20.92 ? 163  LEU T CB  1 
ATOM   1050 C  CG  . LEU A 1 143 ? -2.628  22.537  21.531 1.00 21.91 ? 163  LEU T CG  1 
ATOM   1051 C  CD1 . LEU A 1 143 ? -3.947  21.953  22.016 1.00 22.09 ? 163  LEU T CD1 1 
ATOM   1052 C  CD2 . LEU A 1 143 ? -2.885  23.585  20.461 1.00 22.64 ? 163  LEU T CD2 1 
ATOM   1053 N  N   . SER A 1 144 ? -0.603  25.563  24.177 1.00 25.73 ? 164  SER T N   1 
ATOM   1054 C  CA  . SER A 1 144 ? -0.020  26.143  25.379 1.00 28.56 ? 164  SER T CA  1 
ATOM   1055 C  C   . SER A 1 144 ? -0.052  25.100  26.497 1.00 28.76 ? 164  SER T C   1 
ATOM   1056 O  O   . SER A 1 144 ? -0.898  24.203  26.499 1.00 25.35 ? 164  SER T O   1 
ATOM   1057 C  CB  . SER A 1 144 ? -0.808  27.388  25.809 1.00 29.26 ? 164  SER T CB  1 
ATOM   1058 O  OG  . SER A 1 144 ? -2.122  27.044  26.231 1.00 28.30 ? 164  SER T OG  1 
ATOM   1059 N  N   . ASP A 1 145 ? 0.870   25.222  27.445 1.00 31.00 ? 165  ASP T N   1 
ATOM   1060 C  CA  . ASP A 1 145 ? 0.933   24.292  28.559 1.00 34.67 ? 165  ASP T CA  1 
ATOM   1061 C  C   . ASP A 1 145 ? -0.346  24.302  29.387 1.00 35.42 ? 165  ASP T C   1 
ATOM   1062 O  O   . ASP A 1 145 ? -0.813  23.250  29.824 1.00 34.44 ? 165  ASP T O   1 
ATOM   1063 C  CB  . ASP A 1 145 ? 2.139   24.618  29.440 1.00 38.78 ? 165  ASP T CB  1 
ATOM   1064 C  CG  . ASP A 1 145 ? 3.438   24.078  28.866 1.00 42.80 ? 165  ASP T CG  1 
ATOM   1065 O  OD1 . ASP A 1 145 ? 4.516   24.571  29.265 1.00 44.85 ? 165  ASP T OD1 1 
ATOM   1066 O  OD2 . ASP A 1 145 ? 3.378   23.151  28.024 1.00 43.76 ? 165  ASP T OD2 1 
ATOM   1067 N  N   . SER A 1 146 ? -0.922  25.483  29.590 1.00 37.16 ? 166  SER T N   1 
ATOM   1068 C  CA  . SER A 1 146 ? -2.149  25.585  30.376 1.00 39.03 ? 166  SER T CA  1 
ATOM   1069 C  C   . SER A 1 146 ? -3.274  24.770  29.749 1.00 38.85 ? 166  SER T C   1 
ATOM   1070 O  O   . SER A 1 146 ? -3.982  24.037  30.441 1.00 38.94 ? 166  SER T O   1 
ATOM   1071 C  CB  . SER A 1 146 ? -2.578  27.051  30.526 1.00 40.43 ? 166  SER T CB  1 
ATOM   1072 O  OG  . SER A 1 146 ? -2.809  27.662  29.269 1.00 44.30 ? 166  SER T OG  1 
ATOM   1073 N  N   . SER A 1 147 ? -3.430  24.891  28.435 1.00 38.26 ? 167  SER T N   1 
ATOM   1074 C  CA  . SER A 1 147 ? -4.468  24.157  27.727 1.00 37.81 ? 167  SER T CA  1 
ATOM   1075 C  C   . SER A 1 147 ? -4.184  22.657  27.781 1.00 37.38 ? 167  SER T C   1 
ATOM   1076 O  O   . SER A 1 147 ? -5.095  21.848  27.949 1.00 36.71 ? 167  SER T O   1 
ATOM   1077 C  CB  . SER A 1 147 ? -4.541  24.623  26.270 1.00 39.47 ? 167  SER T CB  1 
ATOM   1078 O  OG  . SER A 1 147 ? -4.798  26.015  26.196 1.00 40.02 ? 167  SER T OG  1 
ATOM   1079 N  N   . CYS A 1 148 ? -2.914  22.295  27.641 1.00 36.85 ? 168  CYS T N   1 
ATOM   1080 C  CA  . CYS A 1 148 ? -2.492  20.895  27.672 1.00 38.30 ? 168  CYS T CA  1 
ATOM   1081 C  C   . CYS A 1 148 ? -2.826  20.259  29.027 1.00 40.65 ? 168  CYS T C   1 
ATOM   1082 O  O   . CYS A 1 148 ? -3.327  19.134  29.088 1.00 39.42 ? 168  CYS T O   1 
ATOM   1083 C  CB  . CYS A 1 148 ? -0.985  20.821  27.410 1.00 35.04 ? 168  CYS T CB  1 
ATOM   1084 S  SG  . CYS A 1 148 ? -0.278  19.212  26.921 1.00 33.90 ? 168  CYS T SG  1 
ATOM   1085 N  N   . LYS A 1 149 ? -2.549  20.987  30.108 1.00 43.73 ? 169  LYS T N   1 
ATOM   1086 C  CA  . LYS A 1 149 ? -2.811  20.499  31.461 1.00 46.67 ? 169  LYS T CA  1 
ATOM   1087 C  C   . LYS A 1 149 ? -4.305  20.424  31.773 1.00 48.19 ? 169  LYS T C   1 
ATOM   1088 O  O   . LYS A 1 149 ? -4.744  19.540  32.508 1.00 49.19 ? 169  LYS T O   1 
ATOM   1089 C  CB  . LYS A 1 149 ? -2.121  21.398  32.490 1.00 47.70 ? 169  LYS T CB  1 
ATOM   1090 C  CG  . LYS A 1 149 ? -0.612  21.488  32.324 1.00 49.34 ? 169  LYS T CG  1 
ATOM   1091 C  CD  . LYS A 1 149 ? -0.012  22.521  33.268 1.00 50.32 ? 169  LYS T CD  1 
ATOM   1092 C  CE  . LYS A 1 149 ? 1.467   22.732  32.983 1.00 51.65 ? 169  LYS T CE  1 
ATOM   1093 N  NZ  . LYS A 1 149 ? 2.069   23.752  33.888 1.00 52.74 ? 169  LYS T NZ  1 
ATOM   1094 N  N   . SER A 1 150 ? -5.081  21.353  31.221 1.00 49.80 ? 170  SER T N   1 
ATOM   1095 C  CA  . SER A 1 150 ? -6.527  21.370  31.441 1.00 51.52 ? 170  SER T CA  1 
ATOM   1096 C  C   . SER A 1 150 ? -7.225  20.271  30.646 1.00 52.77 ? 170  SER T C   1 
ATOM   1097 O  O   . SER A 1 150 ? -8.364  19.907  30.943 1.00 52.84 ? 170  SER T O   1 
ATOM   1098 C  CB  . SER A 1 150 ? -7.117  22.729  31.052 1.00 50.85 ? 170  SER T CB  1 
ATOM   1099 O  OG  . SER A 1 150 ? -6.780  23.727  31.999 1.00 51.14 ? 170  SER T OG  1 
ATOM   1100 N  N   . ALA A 1 151 ? -6.541  19.749  29.632 1.00 54.43 ? 171  ALA T N   1 
ATOM   1101 C  CA  . ALA A 1 151 ? -7.093  18.686  28.799 1.00 56.20 ? 171  ALA T CA  1 
ATOM   1102 C  C   . ALA A 1 151 ? -6.995  17.356  29.540 1.00 57.51 ? 171  ALA T C   1 
ATOM   1103 O  O   . ALA A 1 151 ? -7.899  16.522  29.470 1.00 57.56 ? 171  ALA T O   1 
ATOM   1104 C  CB  . ALA A 1 151 ? -6.331  18.611  27.478 1.00 55.73 ? 171  ALA T CB  1 
ATOM   1105 N  N   . SER A 1 152 ? -5.888  17.174  30.253 1.00 58.92 ? 172  SER T N   1 
ATOM   1106 C  CA  . SER A 1 152 ? -5.642  15.963  31.025 1.00 60.71 ? 172  SER T CA  1 
ATOM   1107 C  C   . SER A 1 152 ? -4.564  16.270  32.063 1.00 61.18 ? 172  SER T C   1 
ATOM   1108 O  O   . SER A 1 152 ? -3.500  16.782  31.720 1.00 62.02 ? 172  SER T O   1 
ATOM   1109 C  CB  . SER A 1 152 ? -5.175  14.837  30.099 1.00 61.43 ? 172  SER T CB  1 
ATOM   1110 O  OG  . SER A 1 152 ? -5.064  13.614  30.801 1.00 63.32 ? 172  SER T OG  1 
ATOM   1111 N  N   . SER A 1 153 ? -4.838  15.965  33.328 1.00 61.36 ? 173  SER T N   1 
ATOM   1112 C  CA  . SER A 1 153 ? -3.883  16.237  34.402 1.00 61.42 ? 173  SER T CA  1 
ATOM   1113 C  C   . SER A 1 153 ? -2.913  15.080  34.655 1.00 60.71 ? 173  SER T C   1 
ATOM   1114 O  O   . SER A 1 153 ? -2.404  14.912  35.766 1.00 61.01 ? 173  SER T O   1 
ATOM   1115 C  CB  . SER A 1 153 ? -4.634  16.572  35.697 1.00 62.19 ? 173  SER T CB  1 
ATOM   1116 O  OG  . SER A 1 153 ? -5.460  15.495  36.111 1.00 62.74 ? 173  SER T OG  1 
ATOM   1117 N  N   . ARG A 1 154 ? -2.644  14.297  33.617 1.00 59.58 ? 174  ARG T N   1 
ATOM   1118 C  CA  . ARG A 1 154 ? -1.740  13.157  33.727 1.00 58.23 ? 174  ARG T CA  1 
ATOM   1119 C  C   . ARG A 1 154 ? -0.481  13.373  32.891 1.00 57.20 ? 174  ARG T C   1 
ATOM   1120 O  O   . ARG A 1 154 ? 0.351   12.476  32.761 1.00 57.92 ? 174  ARG T O   1 
ATOM   1121 C  CB  . ARG A 1 154 ? -2.464  11.897  33.259 1.00 58.17 ? 174  ARG T CB  1 
ATOM   1122 C  CG  . ARG A 1 154 ? -2.946  11.994  31.825 1.00 59.15 ? 174  ARG T CG  1 
ATOM   1123 C  CD  . ARG A 1 154 ? -4.109  11.054  31.548 1.00 59.98 ? 174  ARG T CD  1 
ATOM   1124 N  NE  . ARG A 1 154 ? -3.760  9.651   31.749 1.00 61.30 ? 174  ARG T NE  1 
ATOM   1125 C  CZ  . ARG A 1 154 ? -4.585  8.639   31.501 1.00 62.37 ? 174  ARG T CZ  1 
ATOM   1126 N  NH1 . ARG A 1 154 ? -5.808  8.876   31.040 1.00 63.24 ? 174  ARG T NH1 1 
ATOM   1127 N  NH2 . ARG A 1 154 ? -4.190  7.390   31.718 1.00 62.78 ? 174  ARG T NH2 1 
ATOM   1128 N  N   . ILE A 1 155 ? -0.345  14.568  32.327 1.00 55.09 ? 175  ILE T N   1 
ATOM   1129 C  CA  . ILE A 1 155 ? 0.812   14.883  31.499 1.00 52.90 ? 175  ILE T CA  1 
ATOM   1130 C  C   . ILE A 1 155 ? 1.879   15.605  32.310 1.00 51.61 ? 175  ILE T C   1 
ATOM   1131 O  O   . ILE A 1 155 ? 1.577   16.254  33.308 1.00 50.93 ? 175  ILE T O   1 
ATOM   1132 C  CB  . ILE A 1 155 ? 0.426   15.791  30.293 1.00 52.50 ? 175  ILE T CB  1 
ATOM   1133 C  CG1 . ILE A 1 155 ? 0.288   17.251  30.740 1.00 53.04 ? 175  ILE T CG1 1 
ATOM   1134 C  CG2 . ILE A 1 155 ? -0.879  15.320  29.680 1.00 52.18 ? 175  ILE T CG2 1 
ATOM   1135 C  CD1 . ILE A 1 155 ? -0.757  17.500  31.811 1.00 54.03 ? 175  ILE T CD1 1 
ATOM   1136 N  N   . ILE A 1 156 ? 3.129   15.475  31.885 1.00 50.60 ? 176  ILE T N   1 
ATOM   1137 C  CA  . ILE A 1 156 ? 4.231   16.158  32.543 1.00 50.61 ? 176  ILE T CA  1 
ATOM   1138 C  C   . ILE A 1 156 ? 4.842   17.059  31.480 1.00 50.50 ? 176  ILE T C   1 
ATOM   1139 O  O   . ILE A 1 156 ? 5.750   16.663  30.756 1.00 50.71 ? 176  ILE T O   1 
ATOM   1140 C  CB  . ILE A 1 156 ? 5.291   15.166  33.096 1.00 51.10 ? 176  ILE T CB  1 
ATOM   1141 C  CG1 . ILE A 1 156 ? 5.744   14.184  32.011 1.00 50.56 ? 176  ILE T CG1 1 
ATOM   1142 C  CG2 . ILE A 1 156 ? 4.708   14.404  34.276 1.00 51.14 ? 176  ILE T CG2 1 
ATOM   1143 C  CD1 . ILE A 1 156 ? 4.783   13.052  31.772 1.00 51.95 ? 176  ILE T CD1 1 
ATOM   1144 N  N   . THR A 1 157 ? 4.309   18.275  31.385 1.00 50.87 ? 177  THR T N   1 
ATOM   1145 C  CA  . THR A 1 157 ? 4.742   19.264  30.396 1.00 49.86 ? 177  THR T CA  1 
ATOM   1146 C  C   . THR A 1 157 ? 6.251   19.408  30.250 1.00 47.89 ? 177  THR T C   1 
ATOM   1147 O  O   . THR A 1 157 ? 6.733   20.129  29.372 1.00 48.40 ? 177  THR T O   1 
ATOM   1148 C  CB  . THR A 1 157 ? 4.126   20.656  30.694 1.00 51.10 ? 177  THR T CB  1 
ATOM   1149 O  OG1 . THR A 1 157 ? 4.466   21.063  32.026 1.00 49.98 ? 177  THR T OG1 1 
ATOM   1150 C  CG2 . THR A 1 157 ? 2.610   20.601  30.557 1.00 52.38 ? 177  THR T CG2 1 
ATOM   1151 N  N   . SER A 1 158 ? 6.996   18.727  31.113 1.00 44.54 ? 178  SER T N   1 
ATOM   1152 C  CA  . SER A 1 158 ? 8.444   18.773  31.042 1.00 40.53 ? 178  SER T CA  1 
ATOM   1153 C  C   . SER A 1 158 ? 8.935   17.710  30.057 1.00 36.86 ? 178  SER T C   1 
ATOM   1154 O  O   . SER A 1 158 ? 9.970   17.884  29.410 1.00 37.11 ? 178  SER T O   1 
ATOM   1155 C  CB  . SER A 1 158 ? 9.050   18.554  32.433 1.00 41.08 ? 178  SER T CB  1 
ATOM   1156 O  OG  . SER A 1 158 ? 8.448   17.454  33.091 1.00 43.98 ? 178  SER T OG  1 
ATOM   1157 N  N   . ASN A 1 159 ? 8.184   16.617  29.934 1.00 31.00 ? 179  ASN T N   1 
ATOM   1158 C  CA  . ASN A 1 159 ? 8.548   15.537  29.017 1.00 28.66 ? 179  ASN T CA  1 
ATOM   1159 C  C   . ASN A 1 159 ? 7.474   15.291  27.959 1.00 25.44 ? 179  ASN T C   1 
ATOM   1160 O  O   . ASN A 1 159 ? 7.632   14.429  27.097 1.00 25.36 ? 179  ASN T O   1 
ATOM   1161 C  CB  . ASN A 1 159 ? 8.795   14.237  29.785 1.00 27.93 ? 179  ASN T CB  1 
ATOM   1162 C  CG  . ASN A 1 159 ? 9.862   14.383  30.845 1.00 30.61 ? 179  ASN T CG  1 
ATOM   1163 O  OD1 . ASN A 1 159 ? 10.927  14.953  30.598 1.00 28.92 ? 179  ASN T OD1 1 
ATOM   1164 N  ND2 . ASN A 1 159 ? 9.588   13.857  32.034 1.00 30.34 ? 179  ASN T ND2 1 
ATOM   1165 N  N   . MET A 1 160 ? 6.383   16.042  28.032 1.00 22.86 ? 180  MET T N   1 
ATOM   1166 C  CA  . MET A 1 160 ? 5.295   15.896  27.075 1.00 23.28 ? 180  MET T CA  1 
ATOM   1167 C  C   . MET A 1 160 ? 4.774   17.255  26.632 1.00 21.62 ? 180  MET T C   1 
ATOM   1168 O  O   . MET A 1 160 ? 5.015   18.271  27.286 1.00 21.14 ? 180  MET T O   1 
ATOM   1169 C  CB  . MET A 1 160 ? 4.126   15.127  27.699 1.00 20.60 ? 180  MET T CB  1 
ATOM   1170 C  CG  . MET A 1 160 ? 4.466   13.778  28.293 1.00 22.90 ? 180  MET T CG  1 
ATOM   1171 S  SD  . MET A 1 160 ? 2.997   13.045  29.056 1.00 24.54 ? 180  MET T SD  1 
ATOM   1172 C  CE  . MET A 1 160 ? 3.593   11.404  29.479 1.00 23.82 ? 180  MET T CE  1 
ATOM   1173 N  N   . PHE A 1 161 ? 4.071   17.268  25.506 1.00 21.40 ? 181  PHE T N   1 
ATOM   1174 C  CA  . PHE A 1 161 ? 3.449   18.491  25.023 1.00 20.28 ? 181  PHE T CA  1 
ATOM   1175 C  C   . PHE A 1 161 ? 2.254   18.094  24.174 1.00 21.62 ? 181  PHE T C   1 
ATOM   1176 O  O   . PHE A 1 161 ? 2.202   16.976  23.647 1.00 20.05 ? 181  PHE T O   1 
ATOM   1177 C  CB  . PHE A 1 161 ? 4.448   19.379  24.251 1.00 18.76 ? 181  PHE T CB  1 
ATOM   1178 C  CG  . PHE A 1 161 ? 4.819   18.877  22.880 1.00 18.83 ? 181  PHE T CG  1 
ATOM   1179 C  CD1 . PHE A 1 161 ? 3.967   19.067  21.793 1.00 15.83 ? 181  PHE T CD1 1 
ATOM   1180 C  CD2 . PHE A 1 161 ? 6.052   18.272  22.663 1.00 17.16 ? 181  PHE T CD2 1 
ATOM   1181 C  CE1 . PHE A 1 161 ? 4.337   18.667  20.509 1.00 17.27 ? 181  PHE T CE1 1 
ATOM   1182 C  CE2 . PHE A 1 161 ? 6.433   17.867  21.379 1.00 18.96 ? 181  PHE T CE2 1 
ATOM   1183 C  CZ  . PHE A 1 161 ? 5.570   18.069  20.299 1.00 17.98 ? 181  PHE T CZ  1 
ATOM   1184 N  N   . CYS A 1 162 ? 1.277   18.991  24.089 1.00 20.64 ? 182  CYS T N   1 
ATOM   1185 C  CA  . CYS A 1 162 ? 0.073   18.748  23.308 1.00 22.32 ? 182  CYS T CA  1 
ATOM   1186 C  C   . CYS A 1 162 ? 0.160   19.504  22.002 1.00 22.12 ? 182  CYS T C   1 
ATOM   1187 O  O   . CYS A 1 162 ? 0.776   20.569  21.927 1.00 22.27 ? 182  CYS T O   1 
ATOM   1188 C  CB  . CYS A 1 162 ? -1.175  19.247  24.036 1.00 26.34 ? 182  CYS T CB  1 
ATOM   1189 S  SG  . CYS A 1 162 ? -1.618  18.447  25.603 1.00 31.42 ? 182  CYS T SG  1 
ATOM   1190 N  N   . ALA A 1 163 ? -0.473  18.948  20.977 1.00 20.38 ? 183  ALA T N   1 
ATOM   1191 C  CA  . ALA A 1 163 ? -0.518  19.564  19.661 1.00 19.62 ? 183  ALA T CA  1 
ATOM   1192 C  C   . ALA A 1 163 ? -1.818  19.089  19.032 1.00 20.12 ? 183  ALA T C   1 
ATOM   1193 O  O   . ALA A 1 163 ? -2.288  17.989  19.332 1.00 18.49 ? 183  ALA T O   1 
ATOM   1194 C  CB  . ALA A 1 163 ? 0.678   19.119  18.818 1.00 18.69 ? 183  ALA T CB  1 
ATOM   1195 N  N   . GLY A 1 164 ? -2.415  19.915  18.182 1.00 19.27 ? 184  GLY T N   1 
ATOM   1196 C  CA  . GLY A 1 164 ? -3.646  19.493  17.548 1.00 19.55 ? 184  GLY T CA  1 
ATOM   1197 C  C   . GLY A 1 164 ? -4.761  20.514  17.544 1.00 20.90 ? 184  GLY T C   1 
ATOM   1198 O  O   . GLY A 1 164 ? -4.520  21.718  17.644 1.00 21.33 ? 184  GLY T O   1 
ATOM   1199 N  N   . TYR A 1 165 A -5.991  20.019  17.440 1.00 21.55 ? 184  TYR T N   1 
ATOM   1200 C  CA  . TYR A 1 165 A -7.162  20.876  17.378 1.00 23.37 ? 184  TYR T CA  1 
ATOM   1201 C  C   . TYR A 1 165 A -8.201  20.517  18.431 1.00 25.40 ? 184  TYR T C   1 
ATOM   1202 O  O   . TYR A 1 165 A -8.777  19.428  18.409 1.00 25.89 ? 184  TYR T O   1 
ATOM   1203 C  CB  . TYR A 1 165 A -7.773  20.780  15.983 1.00 22.99 ? 184  TYR T CB  1 
ATOM   1204 C  CG  . TYR A 1 165 A -6.788  21.120  14.890 1.00 21.71 ? 184  TYR T CG  1 
ATOM   1205 C  CD1 . TYR A 1 165 A -5.807  20.206  14.493 1.00 21.46 ? 184  TYR T CD1 1 
ATOM   1206 C  CD2 . TYR A 1 165 A -6.798  22.376  14.291 1.00 21.48 ? 184  TYR T CD2 1 
ATOM   1207 C  CE1 . TYR A 1 165 A -4.858  20.542  13.527 1.00 20.22 ? 184  TYR T CE1 1 
ATOM   1208 C  CE2 . TYR A 1 165 A -5.858  22.723  13.328 1.00 22.59 ? 184  TYR T CE2 1 
ATOM   1209 C  CZ  . TYR A 1 165 A -4.890  21.803  12.951 1.00 21.63 ? 184  TYR T CZ  1 
ATOM   1210 O  OH  . TYR A 1 165 A -3.962  22.163  12.001 1.00 22.59 ? 184  TYR T OH  1 
ATOM   1211 N  N   . LEU A 1 166 ? -8.441  21.445  19.350 1.00 24.75 ? 185  LEU T N   1 
ATOM   1212 C  CA  . LEU A 1 166 ? -9.407  21.217  20.412 1.00 25.70 ? 185  LEU T CA  1 
ATOM   1213 C  C   . LEU A 1 166 ? -10.816 20.994  19.868 1.00 26.61 ? 185  LEU T C   1 
ATOM   1214 O  O   . LEU A 1 166 ? -11.633 20.346  20.518 1.00 26.93 ? 185  LEU T O   1 
ATOM   1215 C  CB  . LEU A 1 166 ? -9.392  22.388  21.396 1.00 24.74 ? 185  LEU T CB  1 
ATOM   1216 C  CG  . LEU A 1 166 ? -8.057  22.606  22.118 1.00 25.63 ? 185  LEU T CG  1 
ATOM   1217 C  CD1 . LEU A 1 166 ? -8.170  23.799  23.049 1.00 24.59 ? 185  LEU T CD1 1 
ATOM   1218 C  CD2 . LEU A 1 166 ? -7.674  21.349  22.904 1.00 25.06 ? 185  LEU T CD2 1 
ATOM   1219 N  N   . GLU A 1 167 ? -11.097 21.509  18.673 1.00 27.55 ? 186  GLU T N   1 
ATOM   1220 C  CA  . GLU A 1 167 ? -12.421 21.333  18.082 1.00 29.90 ? 186  GLU T CA  1 
ATOM   1221 C  C   . GLU A 1 167 ? -12.603 19.918  17.541 1.00 30.82 ? 186  GLU T C   1 
ATOM   1222 O  O   . GLU A 1 167 ? -13.684 19.562  17.074 1.00 32.27 ? 186  GLU T O   1 
ATOM   1223 C  CB  . GLU A 1 167 ? -12.664 22.340  16.949 1.00 31.78 ? 186  GLU T CB  1 
ATOM   1224 C  CG  . GLU A 1 167 ? -11.797 22.125  15.718 1.00 34.22 ? 186  GLU T CG  1 
ATOM   1225 C  CD  . GLU A 1 167 ? -10.522 22.940  15.744 1.00 35.14 ? 186  GLU T CD  1 
ATOM   1226 O  OE1 . GLU A 1 167 ? -9.898  23.045  16.822 1.00 36.68 ? 186  GLU T OE1 1 
ATOM   1227 O  OE2 . GLU A 1 167 ? -10.137 23.467  14.676 1.00 37.22 ? 186  GLU T OE2 1 
ATOM   1228 N  N   . GLY A 1 168 ? -11.541 19.117  17.601 1.00 29.28 ? 187  GLY T N   1 
ATOM   1229 C  CA  . GLY A 1 168 ? -11.612 17.747  17.120 1.00 28.59 ? 187  GLY T CA  1 
ATOM   1230 C  C   . GLY A 1 168 ? -11.600 17.618  15.605 1.00 27.11 ? 187  GLY T C   1 
ATOM   1231 O  O   . GLY A 1 168 ? -11.666 18.619  14.894 1.00 28.90 ? 187  GLY T O   1 
ATOM   1232 N  N   . GLY A 1 169 ? -11.504 16.385  15.111 1.00 25.88 ? 188  GLY T N   1 
ATOM   1233 C  CA  . GLY A 1 169 ? -11.499 16.153  13.675 1.00 25.22 ? 188  GLY T CA  1 
ATOM   1234 C  C   . GLY A 1 169 ? -10.149 15.960  12.997 1.00 24.83 ? 188  GLY T C   1 
ATOM   1235 O  O   . GLY A 1 169 ? -10.092 15.424  11.897 1.00 24.97 ? 188  GLY T O   1 
ATOM   1236 N  N   . LYS A 1 170 A -9.066  16.396  13.637 1.00 25.30 ? 188  LYS T N   1 
ATOM   1237 C  CA  . LYS A 1 170 A -7.714  16.268  13.079 1.00 23.50 ? 188  LYS T CA  1 
ATOM   1238 C  C   . LYS A 1 170 A -6.773  15.847  14.202 1.00 22.49 ? 188  LYS T C   1 
ATOM   1239 O  O   . LYS A 1 170 A -6.624  16.570  15.185 1.00 22.34 ? 188  LYS T O   1 
ATOM   1240 C  CB  . LYS A 1 170 A -7.259  17.607  12.499 1.00 25.33 ? 188  LYS T CB  1 
ATOM   1241 C  CG  . LYS A 1 170 A -8.153  18.144  11.393 1.00 29.34 ? 188  LYS T CG  1 
ATOM   1242 C  CD  . LYS A 1 170 A -7.782  19.571  11.010 1.00 32.42 ? 188  LYS T CD  1 
ATOM   1243 C  CE  . LYS A 1 170 A -6.351  19.664  10.515 1.00 35.70 ? 188  LYS T CE  1 
ATOM   1244 N  NZ  . LYS A 1 170 A -5.982  21.055  10.103 1.00 39.00 ? 188  LYS T NZ  1 
ATOM   1245 N  N   . ASP A 1 171 ? -6.116  14.700  14.048 1.00 21.16 ? 189  ASP T N   1 
ATOM   1246 C  CA  . ASP A 1 171 ? -5.248  14.192  15.110 1.00 19.67 ? 189  ASP T CA  1 
ATOM   1247 C  C   . ASP A 1 171 ? -4.430  12.998  14.616 1.00 19.64 ? 189  ASP T C   1 
ATOM   1248 O  O   . ASP A 1 171 ? -4.676  12.478  13.527 1.00 18.64 ? 189  ASP T O   1 
ATOM   1249 C  CB  . ASP A 1 171 ? -6.158  13.761  16.269 1.00 17.06 ? 189  ASP T CB  1 
ATOM   1250 C  CG  . ASP A 1 171 ? -5.407  13.438  17.541 1.00 19.25 ? 189  ASP T CG  1 
ATOM   1251 O  OD1 . ASP A 1 171 ? -4.226  13.811  17.670 1.00 20.01 ? 189  ASP T OD1 1 
ATOM   1252 O  OD2 . ASP A 1 171 ? -6.025  12.821  18.435 1.00 20.02 ? 189  ASP T OD2 1 
ATOM   1253 N  N   . SER A 1 172 ? -3.442  12.579  15.403 1.00 19.33 ? 190  SER T N   1 
ATOM   1254 C  CA  . SER A 1 172 ? -2.670  11.395  15.045 1.00 19.57 ? 190  SER T CA  1 
ATOM   1255 C  C   . SER A 1 172 ? -3.487  10.286  15.705 1.00 20.73 ? 190  SER T C   1 
ATOM   1256 O  O   . SER A 1 172 ? -4.429  10.586  16.444 1.00 21.05 ? 190  SER T O   1 
ATOM   1257 C  CB  . SER A 1 172 ? -1.241  11.463  15.596 1.00 17.69 ? 190  SER T CB  1 
ATOM   1258 O  OG  . SER A 1 172 ? -1.212  11.669  16.992 1.00 19.92 ? 190  SER T OG  1 
ATOM   1259 N  N   . CYS A 1 173 ? -3.160  9.021   15.457 1.00 20.71 ? 191  CYS T N   1 
ATOM   1260 C  CA  . CYS A 1 173 ? -3.959  7.934   16.025 1.00 21.46 ? 191  CYS T CA  1 
ATOM   1261 C  C   . CYS A 1 173 ? -3.172  6.621   16.132 1.00 22.43 ? 191  CYS T C   1 
ATOM   1262 O  O   . CYS A 1 173 ? -1.964  6.588   15.876 1.00 21.27 ? 191  CYS T O   1 
ATOM   1263 C  CB  . CYS A 1 173 ? -5.208  7.753   15.143 1.00 21.93 ? 191  CYS T CB  1 
ATOM   1264 S  SG  . CYS A 1 173 ? -6.618  6.838   15.847 1.00 23.36 ? 191  CYS T SG  1 
ATOM   1265 N  N   . GLN A 1 174 ? -3.859  5.553   16.537 1.00 22.34 ? 192  GLN T N   1 
ATOM   1266 C  CA  . GLN A 1 174 ? -3.249  4.225   16.666 1.00 23.67 ? 192  GLN T CA  1 
ATOM   1267 C  C   . GLN A 1 174 ? -2.457  3.903   15.402 1.00 20.59 ? 192  GLN T C   1 
ATOM   1268 O  O   . GLN A 1 174 ? -2.985  4.006   14.298 1.00 21.70 ? 192  GLN T O   1 
ATOM   1269 C  CB  . GLN A 1 174 ? -4.334  3.154   16.836 1.00 26.31 ? 192  GLN T CB  1 
ATOM   1270 C  CG  . GLN A 1 174 ? -4.491  2.583   18.237 1.00 36.21 ? 192  GLN T CG  1 
ATOM   1271 C  CD  . GLN A 1 174 ? -5.108  3.565   19.221 1.00 41.04 ? 192  GLN T CD  1 
ATOM   1272 O  OE1 . GLN A 1 174 ? -6.153  4.172   18.946 1.00 43.51 ? 192  GLN T OE1 1 
ATOM   1273 N  NE2 . GLN A 1 174 ? -4.472  3.716   20.386 1.00 42.58 ? 192  GLN T NE2 1 
ATOM   1274 N  N   . GLY A 1 175 ? -1.201  3.504   15.558 1.00 19.30 ? 193  GLY T N   1 
ATOM   1275 C  CA  . GLY A 1 175 ? -0.398  3.181   14.392 1.00 18.55 ? 193  GLY T CA  1 
ATOM   1276 C  C   . GLY A 1 175 ? 0.569   4.281   13.994 1.00 19.41 ? 193  GLY T C   1 
ATOM   1277 O  O   . GLY A 1 175 ? 1.526   4.031   13.261 1.00 20.90 ? 193  GLY T O   1 
ATOM   1278 N  N   . ASP A 1 176 ? 0.314   5.503   14.461 1.00 18.86 ? 194  ASP T N   1 
ATOM   1279 C  CA  . ASP A 1 176 ? 1.188   6.636   14.175 1.00 16.25 ? 194  ASP T CA  1 
ATOM   1280 C  C   . ASP A 1 176 ? 2.272   6.724   15.257 1.00 16.51 ? 194  ASP T C   1 
ATOM   1281 O  O   . ASP A 1 176 ? 3.293   7.391   15.076 1.00 15.40 ? 194  ASP T O   1 
ATOM   1282 C  CB  . ASP A 1 176 ? 0.393   7.952   14.154 1.00 16.53 ? 194  ASP T CB  1 
ATOM   1283 C  CG  . ASP A 1 176 ? -0.534  8.073   12.947 1.00 16.79 ? 194  ASP T CG  1 
ATOM   1284 O  OD1 . ASP A 1 176 ? -0.112  7.707   11.832 1.00 16.72 ? 194  ASP T OD1 1 
ATOM   1285 O  OD2 . ASP A 1 176 ? -1.679  8.558   13.110 1.00 15.55 ? 194  ASP T OD2 1 
ATOM   1286 N  N   . SER A 1 177 ? 2.043   6.046   16.380 1.00 17.48 ? 195  SER T N   1 
ATOM   1287 C  CA  . SER A 1 177 ? 2.981   6.066   17.503 1.00 17.03 ? 195  SER T CA  1 
ATOM   1288 C  C   . SER A 1 177 ? 4.433   5.852   17.099 1.00 16.70 ? 195  SER T C   1 
ATOM   1289 O  O   . SER A 1 177 ? 4.738   5.024   16.240 1.00 15.50 ? 195  SER T O   1 
ATOM   1290 C  CB  . SER A 1 177 ? 2.588   5.021   18.548 1.00 17.49 ? 195  SER T CB  1 
ATOM   1291 O  OG  . SER A 1 177 ? 1.375   5.376   19.183 1.00 22.11 ? 195  SER T OG  1 
ATOM   1292 N  N   . GLY A 1 178 ? 5.322   6.606   17.739 1.00 15.07 ? 196  GLY T N   1 
ATOM   1293 C  CA  . GLY A 1 178 ? 6.738   6.512   17.442 1.00 15.21 ? 196  GLY T CA  1 
ATOM   1294 C  C   . GLY A 1 178 ? 7.114   7.429   16.298 1.00 15.81 ? 196  GLY T C   1 
ATOM   1295 O  O   . GLY A 1 178 ? 8.300   7.693   16.063 1.00 15.06 ? 196  GLY T O   1 
ATOM   1296 N  N   . GLY A 1 179 ? 6.092   7.922   15.598 1.00 14.22 ? 197  GLY T N   1 
ATOM   1297 C  CA  . GLY A 1 179 ? 6.294   8.798   14.459 1.00 15.97 ? 197  GLY T CA  1 
ATOM   1298 C  C   . GLY A 1 179 ? 6.812   10.185  14.790 1.00 14.83 ? 197  GLY T C   1 
ATOM   1299 O  O   . GLY A 1 179 ? 6.841   10.583  15.956 1.00 15.51 ? 197  GLY T O   1 
ATOM   1300 N  N   . PRO A 1 180 ? 7.208   10.956  13.767 1.00 15.95 ? 198  PRO T N   1 
ATOM   1301 C  CA  . PRO A 1 180 ? 7.737   12.306  13.955 1.00 16.41 ? 198  PRO T CA  1 
ATOM   1302 C  C   . PRO A 1 180 ? 6.764   13.471  14.008 1.00 17.68 ? 198  PRO T C   1 
ATOM   1303 O  O   . PRO A 1 180 ? 5.679   13.444  13.420 1.00 16.90 ? 198  PRO T O   1 
ATOM   1304 C  CB  . PRO A 1 180 ? 8.687   12.457  12.781 1.00 15.98 ? 198  PRO T CB  1 
ATOM   1305 C  CG  . PRO A 1 180 ? 7.923   11.793  11.687 1.00 17.62 ? 198  PRO T CG  1 
ATOM   1306 C  CD  . PRO A 1 180 ? 7.341   10.540  12.356 1.00 15.78 ? 198  PRO T CD  1 
ATOM   1307 N  N   . VAL A 1 181 ? 7.192   14.493  14.736 1.00 17.80 ? 199  VAL T N   1 
ATOM   1308 C  CA  . VAL A 1 181 ? 6.484   15.755  14.855 1.00 18.38 ? 199  VAL T CA  1 
ATOM   1309 C  C   . VAL A 1 181 ? 7.627   16.714  14.537 1.00 19.63 ? 199  VAL T C   1 
ATOM   1310 O  O   . VAL A 1 181 ? 8.516   16.928  15.364 1.00 18.07 ? 199  VAL T O   1 
ATOM   1311 C  CB  . VAL A 1 181 ? 5.983   16.028  16.280 1.00 18.44 ? 199  VAL T CB  1 
ATOM   1312 C  CG1 . VAL A 1 181 ? 5.414   17.446  16.354 1.00 19.77 ? 199  VAL T CG1 1 
ATOM   1313 C  CG2 . VAL A 1 181 ? 4.918   15.005  16.665 1.00 17.03 ? 199  VAL T CG2 1 
ATOM   1314 N  N   . VAL A 1 182 ? 7.623   17.253  13.324 1.00 19.42 ? 200  VAL T N   1 
ATOM   1315 C  CA  . VAL A 1 182 ? 8.679   18.157  12.899 1.00 19.50 ? 200  VAL T CA  1 
ATOM   1316 C  C   . VAL A 1 182 ? 8.187   19.588  12.766 1.00 20.53 ? 200  VAL T C   1 
ATOM   1317 O  O   . VAL A 1 182 ? 7.158   19.850  12.138 1.00 18.16 ? 200  VAL T O   1 
ATOM   1318 C  CB  . VAL A 1 182 ? 9.292   17.688  11.549 1.00 18.48 ? 200  VAL T CB  1 
ATOM   1319 C  CG1 . VAL A 1 182 ? 10.283  18.726  11.023 1.00 17.50 ? 200  VAL T CG1 1 
ATOM   1320 C  CG2 . VAL A 1 182 ? 9.995   16.353  11.745 1.00 17.03 ? 200  VAL T CG2 1 
ATOM   1321 N  N   . CYS A 1 183 ? 8.923   20.512  13.379 1.00 21.85 ? 201  CYS T N   1 
ATOM   1322 C  CA  . CYS A 1 183 ? 8.578   21.928  13.320 1.00 23.31 ? 201  CYS T CA  1 
ATOM   1323 C  C   . CYS A 1 183 ? 9.850   22.709  12.993 1.00 25.55 ? 201  CYS T C   1 
ATOM   1324 O  O   . CYS A 1 183 ? 10.863  22.581  13.684 1.00 23.60 ? 201  CYS T O   1 
ATOM   1325 C  CB  . CYS A 1 183 ? 8.012   22.413  14.660 1.00 22.93 ? 201  CYS T CB  1 
ATOM   1326 S  SG  . CYS A 1 183 ? 7.185   21.151  15.679 1.00 21.45 ? 201  CYS T SG  1 
ATOM   1327 N  N   . SER A 1 184 ? 9.794   23.502  11.927 1.00 28.39 ? 202  SER T N   1 
ATOM   1328 C  CA  . SER A 1 184 ? 10.932  24.310  11.491 1.00 30.35 ? 202  SER T CA  1 
ATOM   1329 C  C   . SER A 1 184 ? 12.128  23.456  11.079 1.00 29.36 ? 202  SER T C   1 
ATOM   1330 O  O   . SER A 1 184 ? 13.272  23.888  11.196 1.00 31.66 ? 202  SER T O   1 
ATOM   1331 C  CB  . SER A 1 184 ? 11.363  25.271  12.602 1.00 33.08 ? 202  SER T CB  1 
ATOM   1332 O  OG  . SER A 1 184 ? 10.289  26.100  13.006 1.00 37.73 ? 202  SER T OG  1 
ATOM   1333 N  N   . GLY A 1 185 ? 11.864  22.245  10.605 1.00 27.53 ? 203  GLY T N   1 
ATOM   1334 C  CA  . GLY A 1 185 ? 12.950  21.377  10.178 1.00 25.87 ? 203  GLY T CA  1 
ATOM   1335 C  C   . GLY A 1 185 ? 13.658  20.631  11.294 1.00 24.36 ? 203  GLY T C   1 
ATOM   1336 O  O   . GLY A 1 185 ? 14.692  19.997  11.066 1.00 25.08 ? 203  GLY T O   1 
ATOM   1337 N  N   . LYS A 1 186 ? 13.106  20.699  12.500 1.00 23.63 ? 204  LYS T N   1 
ATOM   1338 C  CA  . LYS A 1 186 ? 13.694  20.020  13.648 1.00 23.15 ? 204  LYS T CA  1 
ATOM   1339 C  C   . LYS A 1 186 ? 12.681  19.038  14.232 1.00 22.26 ? 204  LYS T C   1 
ATOM   1340 O  O   . LYS A 1 186 ? 11.486  19.333  14.279 1.00 21.57 ? 204  LYS T O   1 
ATOM   1341 C  CB  . LYS A 1 186 ? 14.069  21.039  14.729 1.00 25.41 ? 204  LYS T CB  1 
ATOM   1342 C  CG  . LYS A 1 186 ? 14.917  22.198  14.243 1.00 27.44 ? 204  LYS T CG  1 
ATOM   1343 C  CD  . LYS A 1 186 ? 16.290  21.725  13.821 1.00 30.08 ? 204  LYS T CD  1 
ATOM   1344 C  CE  . LYS A 1 186 ? 17.139  22.871  13.310 1.00 32.72 ? 204  LYS T CE  1 
ATOM   1345 N  NZ  . LYS A 1 186 ? 18.510  22.391  12.981 1.00 35.48 ? 204  LYS T NZ  1 
ATOM   1346 N  N   . LEU A 1 187 ? 13.159  17.881  14.680 1.00 20.88 ? 209  LEU T N   1 
ATOM   1347 C  CA  . LEU A 1 187 ? 12.289  16.877  15.289 1.00 19.93 ? 209  LEU T CA  1 
ATOM   1348 C  C   . LEU A 1 187 ? 11.975  17.332  16.718 1.00 19.87 ? 209  LEU T C   1 
ATOM   1349 O  O   . LEU A 1 187 ? 12.838  17.283  17.593 1.00 21.59 ? 209  LEU T O   1 
ATOM   1350 C  CB  . LEU A 1 187 ? 12.996  15.520  15.316 1.00 19.44 ? 209  LEU T CB  1 
ATOM   1351 C  CG  . LEU A 1 187 ? 12.249  14.348  15.968 1.00 19.09 ? 209  LEU T CG  1 
ATOM   1352 C  CD1 . LEU A 1 187 ? 11.004  14.017  15.166 1.00 15.21 ? 209  LEU T CD1 1 
ATOM   1353 C  CD2 . LEU A 1 187 ? 13.174  13.137  16.043 1.00 17.82 ? 209  LEU T CD2 1 
ATOM   1354 N  N   . GLN A 1 188 ? 10.747  17.779  16.959 1.00 18.35 ? 210  GLN T N   1 
ATOM   1355 C  CA  . GLN A 1 188 ? 10.380  18.254  18.291 1.00 18.96 ? 210  GLN T CA  1 
ATOM   1356 C  C   . GLN A 1 188 ? 9.528   17.280  19.082 1.00 17.50 ? 210  GLN T C   1 
ATOM   1357 O  O   . GLN A 1 188 ? 9.448   17.383  20.303 1.00 18.11 ? 210  GLN T O   1 
ATOM   1358 C  CB  . GLN A 1 188 ? 9.639   19.596  18.204 1.00 19.16 ? 210  GLN T CB  1 
ATOM   1359 C  CG  . GLN A 1 188 ? 10.475  20.765  17.675 1.00 25.74 ? 210  GLN T CG  1 
ATOM   1360 C  CD  . GLN A 1 188 ? 11.471  21.317  18.687 1.00 26.08 ? 210  GLN T CD  1 
ATOM   1361 O  OE1 . GLN A 1 188 ? 12.262  22.205  18.369 1.00 30.50 ? 210  GLN T OE1 1 
ATOM   1362 N  NE2 . GLN A 1 188 ? 11.432  20.804  19.904 1.00 27.08 ? 210  GLN T NE2 1 
ATOM   1363 N  N   . GLY A 1 189 ? 8.889   16.339  18.396 1.00 17.26 ? 211  GLY T N   1 
ATOM   1364 C  CA  . GLY A 1 189 ? 8.043   15.396  19.100 1.00 16.10 ? 211  GLY T CA  1 
ATOM   1365 C  C   . GLY A 1 189 ? 7.991   14.001  18.517 1.00 16.28 ? 211  GLY T C   1 
ATOM   1366 O  O   . GLY A 1 189 ? 8.439   13.753  17.391 1.00 16.28 ? 211  GLY T O   1 
ATOM   1367 N  N   . ILE A 1 190 ? 7.452   13.088  19.318 1.00 13.95 ? 212  ILE T N   1 
ATOM   1368 C  CA  . ILE A 1 190 ? 7.281   11.688  18.952 1.00 13.70 ? 212  ILE T CA  1 
ATOM   1369 C  C   . ILE A 1 190 ? 5.835   11.381  19.301 1.00 13.83 ? 212  ILE T C   1 
ATOM   1370 O  O   . ILE A 1 190 ? 5.386   11.694  20.411 1.00 13.86 ? 212  ILE T O   1 
ATOM   1371 C  CB  . ILE A 1 190 ? 8.179   10.757  19.793 1.00 13.14 ? 212  ILE T CB  1 
ATOM   1372 C  CG1 . ILE A 1 190 ? 9.646   11.137  19.607 1.00 12.34 ? 212  ILE T CG1 1 
ATOM   1373 C  CG2 . ILE A 1 190 ? 7.922   9.291   19.411 1.00 11.44 ? 212  ILE T CG2 1 
ATOM   1374 C  CD1 . ILE A 1 190 ? 10.573  10.444  20.591 1.00 13.92 ? 212  ILE T CD1 1 
ATOM   1375 N  N   . VAL A 1 191 ? 5.100   10.792  18.362 1.00 14.44 ? 213  VAL T N   1 
ATOM   1376 C  CA  . VAL A 1 191 ? 3.705   10.466  18.617 1.00 13.98 ? 213  VAL T CA  1 
ATOM   1377 C  C   . VAL A 1 191 ? 3.683   9.481   19.791 1.00 15.58 ? 213  VAL T C   1 
ATOM   1378 O  O   . VAL A 1 191 ? 4.243   8.383   19.705 1.00 14.62 ? 213  VAL T O   1 
ATOM   1379 C  CB  . VAL A 1 191 ? 3.037   9.843   17.361 1.00 13.14 ? 213  VAL T CB  1 
ATOM   1380 C  CG1 . VAL A 1 191 ? 1.572   9.527   17.649 1.00 12.59 ? 213  VAL T CG1 1 
ATOM   1381 C  CG2 . VAL A 1 191 ? 3.141   10.812  16.178 1.00 10.43 ? 213  VAL T CG2 1 
ATOM   1382 N  N   . SER A 1 192 ? 3.048   9.880   20.889 1.00 14.83 ? 214  SER T N   1 
ATOM   1383 C  CA  . SER A 1 192 ? 3.003   9.037   22.073 1.00 16.46 ? 214  SER T CA  1 
ATOM   1384 C  C   . SER A 1 192 ? 1.618   8.501   22.442 1.00 16.78 ? 214  SER T C   1 
ATOM   1385 O  O   . SER A 1 192 ? 1.378   7.298   22.373 1.00 15.85 ? 214  SER T O   1 
ATOM   1386 C  CB  . SER A 1 192 ? 3.594   9.793   23.262 1.00 15.67 ? 214  SER T CB  1 
ATOM   1387 O  OG  . SER A 1 192 ? 3.763   8.924   24.367 1.00 20.78 ? 214  SER T OG  1 
ATOM   1388 N  N   . TRP A 1 193 ? 0.710   9.378   22.852 1.00 19.83 ? 215  TRP T N   1 
ATOM   1389 C  CA  . TRP A 1 193 ? -0.629  8.924   23.219 1.00 21.64 ? 215  TRP T CA  1 
ATOM   1390 C  C   . TRP A 1 193 ? -1.722  9.978   23.087 1.00 23.56 ? 215  TRP T C   1 
ATOM   1391 O  O   . TRP A 1 193 ? -1.490  11.088  22.603 1.00 22.80 ? 215  TRP T O   1 
ATOM   1392 C  CB  . TRP A 1 193 ? -0.637  8.372   24.653 1.00 23.13 ? 215  TRP T CB  1 
ATOM   1393 C  CG  . TRP A 1 193 ? -0.253  9.366   25.717 1.00 24.33 ? 215  TRP T CG  1 
ATOM   1394 C  CD1 . TRP A 1 193 ? 1.011   9.766   26.052 1.00 26.98 ? 215  TRP T CD1 1 
ATOM   1395 C  CD2 . TRP A 1 193 ? -1.142  10.074  26.594 1.00 25.94 ? 215  TRP T CD2 1 
ATOM   1396 N  NE1 . TRP A 1 193 ? 0.966   10.676  27.084 1.00 27.29 ? 215  TRP T NE1 1 
ATOM   1397 C  CE2 . TRP A 1 193 ? -0.343  10.884  27.435 1.00 26.98 ? 215  TRP T CE2 1 
ATOM   1398 C  CE3 . TRP A 1 193 ? -2.536  10.104  26.750 1.00 26.63 ? 215  TRP T CE3 1 
ATOM   1399 C  CZ2 . TRP A 1 193 ? -0.894  11.716  28.423 1.00 28.43 ? 215  TRP T CZ2 1 
ATOM   1400 C  CZ3 . TRP A 1 193 ? -3.085  10.932  27.733 1.00 26.69 ? 215  TRP T CZ3 1 
ATOM   1401 C  CH2 . TRP A 1 193 ? -2.261  11.726  28.555 1.00 28.15 ? 215  TRP T CH2 1 
ATOM   1402 N  N   . GLY A 1 194 ? -2.921  9.600   23.523 1.00 24.99 ? 216  GLY T N   1 
ATOM   1403 C  CA  . GLY A 1 194 ? -4.070  10.482  23.471 1.00 26.43 ? 216  GLY T CA  1 
ATOM   1404 C  C   . GLY A 1 194 ? -5.309  9.714   23.894 1.00 27.43 ? 216  GLY T C   1 
ATOM   1405 O  O   . GLY A 1 194 ? -5.293  8.486   23.931 1.00 27.51 ? 216  GLY T O   1 
ATOM   1406 N  N   . SER A 1 195 ? -6.378  10.430  24.222 1.00 27.35 ? 217  SER T N   1 
ATOM   1407 C  CA  . SER A 1 195 ? -7.625  9.800   24.640 1.00 27.71 ? 217  SER T CA  1 
ATOM   1408 C  C   . SER A 1 195 ? -8.509  9.649   23.408 1.00 26.11 ? 217  SER T C   1 
ATOM   1409 O  O   . SER A 1 195 ? -9.206  10.582  23.021 1.00 25.67 ? 217  SER T O   1 
ATOM   1410 C  CB  . SER A 1 195 ? -8.323  10.670  25.688 1.00 29.41 ? 217  SER T CB  1 
ATOM   1411 O  OG  . SER A 1 195 ? -9.533  10.069  26.114 1.00 35.55 ? 217  SER T OG  1 
ATOM   1412 N  N   . GLY A 1 196 ? -8.485  8.470   22.798 1.00 25.65 ? 219  GLY T N   1 
ATOM   1413 C  CA  . GLY A 1 196 ? -9.262  8.262   21.587 1.00 26.50 ? 219  GLY T CA  1 
ATOM   1414 C  C   . GLY A 1 196 ? -8.485  8.913   20.451 1.00 25.47 ? 219  GLY T C   1 
ATOM   1415 O  O   . GLY A 1 196 ? -7.261  8.991   20.519 1.00 26.40 ? 219  GLY T O   1 
ATOM   1416 N  N   . CYS A 1 197 ? -9.178  9.378   19.416 1.00 24.95 ? 220  CYS T N   1 
ATOM   1417 C  CA  . CYS A 1 197 ? -8.528  10.043  18.285 1.00 25.01 ? 220  CYS T CA  1 
ATOM   1418 C  C   . CYS A 1 197 ? -9.416  11.133  17.711 1.00 25.28 ? 220  CYS T C   1 
ATOM   1419 O  O   . CYS A 1 197 ? -10.600 10.915  17.477 1.00 26.40 ? 220  CYS T O   1 
ATOM   1420 C  CB  . CYS A 1 197 ? -8.210  9.048   17.166 1.00 23.05 ? 220  CYS T CB  1 
ATOM   1421 S  SG  . CYS A 1 197 ? -6.987  7.781   17.604 1.00 22.16 ? 220  CYS T SG  1 
ATOM   1422 N  N   . ALA A 1 198 ? -8.831  12.304  17.483 1.00 26.25 ? 221  ALA T N   1 
ATOM   1423 C  CA  . ALA A 1 198 ? -9.543  13.439  16.916 1.00 26.57 ? 221  ALA T CA  1 
ATOM   1424 C  C   . ALA A 1 198 ? -10.827 13.787  17.665 1.00 28.04 ? 221  ALA T C   1 
ATOM   1425 O  O   . ALA A 1 198 ? -11.807 14.226  17.061 1.00 26.45 ? 221  ALA T O   1 
ATOM   1426 C  CB  . ALA A 1 198 ? -9.849  13.171  15.453 1.00 25.38 ? 221  ALA T CB  1 
ATOM   1427 N  N   . GLN A 1 199 A -10.814 13.591  18.980 1.00 29.92 ? 221  GLN T N   1 
ATOM   1428 C  CA  . GLN A 1 199 A -11.976 13.894  19.808 1.00 31.93 ? 221  GLN T CA  1 
ATOM   1429 C  C   . GLN A 1 199 A -11.938 15.339  20.288 1.00 32.80 ? 221  GLN T C   1 
ATOM   1430 O  O   . GLN A 1 199 A -10.870 15.936  20.435 1.00 31.50 ? 221  GLN T O   1 
ATOM   1431 C  CB  . GLN A 1 199 A -12.029 12.963  21.024 1.00 34.02 ? 221  GLN T CB  1 
ATOM   1432 C  CG  . GLN A 1 199 A -12.198 11.502  20.673 1.00 36.12 ? 221  GLN T CG  1 
ATOM   1433 C  CD  . GLN A 1 199 A -13.471 11.247  19.898 1.00 39.39 ? 221  GLN T CD  1 
ATOM   1434 O  OE1 . GLN A 1 199 A -14.573 11.377  20.436 1.00 41.44 ? 221  GLN T OE1 1 
ATOM   1435 N  NE2 . GLN A 1 199 A -13.330 10.891  18.622 1.00 38.98 ? 221  GLN T NE2 1 
ATOM   1436 N  N   . LYS A 1 200 ? -13.119 15.890  20.532 1.00 33.84 ? 222  LYS T N   1 
ATOM   1437 C  CA  . LYS A 1 200 ? -13.257 17.256  21.008 1.00 33.81 ? 222  LYS T CA  1 
ATOM   1438 C  C   . LYS A 1 200 ? -12.542 17.390  22.349 1.00 33.41 ? 222  LYS T C   1 
ATOM   1439 O  O   . LYS A 1 200 ? -12.655 16.516  23.206 1.00 33.72 ? 222  LYS T O   1 
ATOM   1440 C  CB  . LYS A 1 200 ? -14.745 17.583  21.174 1.00 36.39 ? 222  LYS T CB  1 
ATOM   1441 C  CG  . LYS A 1 200 ? -15.063 18.971  21.706 1.00 40.76 ? 222  LYS T CG  1 
ATOM   1442 C  CD  . LYS A 1 200 ? -15.183 19.996  20.586 1.00 44.80 ? 222  LYS T CD  1 
ATOM   1443 C  CE  . LYS A 1 200 ? -15.662 21.347  21.126 1.00 46.90 ? 222  LYS T CE  1 
ATOM   1444 N  NZ  . LYS A 1 200 ? -15.841 22.371  20.050 1.00 46.51 ? 222  LYS T NZ  1 
ATOM   1445 N  N   . ASN A 1 201 ? -11.795 18.477  22.514 1.00 32.98 ? 223  ASN T N   1 
ATOM   1446 C  CA  . ASN A 1 201 ? -11.078 18.766  23.751 1.00 34.36 ? 223  ASN T CA  1 
ATOM   1447 C  C   . ASN A 1 201 ? -10.037 17.738  24.182 1.00 34.25 ? 223  ASN T C   1 
ATOM   1448 O  O   . ASN A 1 201 ? -9.553  17.783  25.314 1.00 34.31 ? 223  ASN T O   1 
ATOM   1449 C  CB  . ASN A 1 201 ? -12.082 18.973  24.890 1.00 37.08 ? 223  ASN T CB  1 
ATOM   1450 C  CG  . ASN A 1 201 ? -13.210 19.919  24.507 1.00 41.28 ? 223  ASN T CG  1 
ATOM   1451 O  OD1 . ASN A 1 201 ? -12.973 21.055  24.087 1.00 42.36 ? 223  ASN T OD1 1 
ATOM   1452 N  ND2 . ASN A 1 201 ? -14.447 19.450  24.646 1.00 42.27 ? 223  ASN T ND2 1 
ATOM   1453 N  N   . LYS A 1 202 ? -9.691  16.811  23.296 1.00 32.34 ? 224  LYS T N   1 
ATOM   1454 C  CA  . LYS A 1 202 ? -8.694  15.802  23.633 1.00 32.07 ? 224  LYS T CA  1 
ATOM   1455 C  C   . LYS A 1 202 ? -7.576  15.785  22.594 1.00 30.14 ? 224  LYS T C   1 
ATOM   1456 O  O   . LYS A 1 202 ? -7.551  14.940  21.699 1.00 30.63 ? 224  LYS T O   1 
ATOM   1457 C  CB  . LYS A 1 202 ? -9.351  14.423  23.734 1.00 33.83 ? 224  LYS T CB  1 
ATOM   1458 C  CG  . LYS A 1 202 ? -10.223 14.249  24.975 1.00 39.46 ? 224  LYS T CG  1 
ATOM   1459 C  CD  . LYS A 1 202 ? -9.400  14.463  26.243 1.00 43.22 ? 224  LYS T CD  1 
ATOM   1460 C  CE  . LYS A 1 202 ? -10.245 14.334  27.501 1.00 44.96 ? 224  LYS T CE  1 
ATOM   1461 N  NZ  . LYS A 1 202 ? -9.437  14.573  28.733 1.00 45.47 ? 224  LYS T NZ  1 
ATOM   1462 N  N   . PRO A 1 203 ? -6.632  16.730  22.703 1.00 27.67 ? 225  PRO T N   1 
ATOM   1463 C  CA  . PRO A 1 203 ? -5.522  16.799  21.753 1.00 26.27 ? 225  PRO T CA  1 
ATOM   1464 C  C   . PRO A 1 203 ? -4.510  15.675  21.960 1.00 23.92 ? 225  PRO T C   1 
ATOM   1465 O  O   . PRO A 1 203 ? -4.480  15.035  23.016 1.00 22.09 ? 225  PRO T O   1 
ATOM   1466 C  CB  . PRO A 1 203 ? -4.932  18.176  22.027 1.00 25.97 ? 225  PRO T CB  1 
ATOM   1467 C  CG  . PRO A 1 203 ? -5.109  18.303  23.506 1.00 26.66 ? 225  PRO T CG  1 
ATOM   1468 C  CD  . PRO A 1 203 ? -6.516  17.788  23.724 1.00 26.76 ? 225  PRO T CD  1 
ATOM   1469 N  N   . GLY A 1 204 ? -3.687  15.438  20.945 1.00 21.60 ? 226  GLY T N   1 
ATOM   1470 C  CA  . GLY A 1 204 ? -2.677  14.403  21.055 1.00 19.04 ? 226  GLY T CA  1 
ATOM   1471 C  C   . GLY A 1 204 ? -1.560  14.819  21.994 1.00 18.69 ? 226  GLY T C   1 
ATOM   1472 O  O   . GLY A 1 204 ? -1.289  16.010  22.168 1.00 17.76 ? 226  GLY T O   1 
ATOM   1473 N  N   . VAL A 1 205 ? -0.913  13.838  22.615 1.00 17.27 ? 227  VAL T N   1 
ATOM   1474 C  CA  . VAL A 1 205 ? 0.184   14.120  23.530 1.00 17.26 ? 227  VAL T CA  1 
ATOM   1475 C  C   . VAL A 1 205 ? 1.441   13.529  22.914 1.00 16.21 ? 227  VAL T C   1 
ATOM   1476 O  O   . VAL A 1 205 ? 1.439   12.386  22.448 1.00 14.76 ? 227  VAL T O   1 
ATOM   1477 C  CB  . VAL A 1 205 ? -0.059  13.490  24.923 1.00 18.63 ? 227  VAL T CB  1 
ATOM   1478 C  CG1 . VAL A 1 205 ? 1.030   13.927  25.893 1.00 18.34 ? 227  VAL T CG1 1 
ATOM   1479 C  CG2 . VAL A 1 205 ? -1.419  13.898  25.442 1.00 18.47 ? 227  VAL T CG2 1 
ATOM   1480 N  N   . TYR A 1 206 ? 2.516   14.306  22.925 1.00 17.37 ? 228  TYR T N   1 
ATOM   1481 C  CA  . TYR A 1 206 ? 3.767   13.878  22.322 1.00 16.78 ? 228  TYR T CA  1 
ATOM   1482 C  C   . TYR A 1 206 ? 4.971   13.976  23.244 1.00 17.49 ? 228  TYR T C   1 
ATOM   1483 O  O   . TYR A 1 206 ? 4.996   14.789  24.168 1.00 19.05 ? 228  TYR T O   1 
ATOM   1484 C  CB  . TYR A 1 206 ? 4.033   14.718  21.072 1.00 15.38 ? 228  TYR T CB  1 
ATOM   1485 C  CG  . TYR A 1 206 ? 2.892   14.697  20.090 1.00 14.39 ? 228  TYR T CG  1 
ATOM   1486 C  CD1 . TYR A 1 206 ? 1.755   15.478  20.293 1.00 15.96 ? 228  TYR T CD1 1 
ATOM   1487 C  CD2 . TYR A 1 206 ? 2.924   13.855  18.983 1.00 13.33 ? 228  TYR T CD2 1 
ATOM   1488 C  CE1 . TYR A 1 206 ? 0.678   15.418  19.412 1.00 17.00 ? 228  TYR T CE1 1 
ATOM   1489 C  CE2 . TYR A 1 206 ? 1.860   13.785  18.102 1.00 17.07 ? 228  TYR T CE2 1 
ATOM   1490 C  CZ  . TYR A 1 206 ? 0.739   14.567  18.322 1.00 15.84 ? 228  TYR T CZ  1 
ATOM   1491 O  OH  . TYR A 1 206 ? -0.319  14.476  17.454 1.00 17.85 ? 228  TYR T OH  1 
ATOM   1492 N  N   . THR A 1 207 ? 5.975   13.149  22.974 1.00 17.37 ? 229  THR T N   1 
ATOM   1493 C  CA  . THR A 1 207 ? 7.198   13.159  23.766 1.00 17.31 ? 229  THR T CA  1 
ATOM   1494 C  C   . THR A 1 207 ? 7.974   14.418  23.389 1.00 17.49 ? 229  THR T C   1 
ATOM   1495 O  O   . THR A 1 207 ? 8.206   14.681  22.209 1.00 17.70 ? 229  THR T O   1 
ATOM   1496 C  CB  . THR A 1 207 ? 8.068   11.916  23.479 1.00 16.71 ? 229  THR T CB  1 
ATOM   1497 O  OG1 . THR A 1 207 ? 7.321   10.732  23.780 1.00 16.17 ? 229  THR T OG1 1 
ATOM   1498 C  CG2 . THR A 1 207 ? 9.332   11.937  24.340 1.00 15.23 ? 229  THR T CG2 1 
ATOM   1499 N  N   . LYS A 1 208 ? 8.369   15.193  24.395 1.00 18.49 ? 230  LYS T N   1 
ATOM   1500 C  CA  . LYS A 1 208 ? 9.093   16.447  24.174 1.00 19.58 ? 230  LYS T CA  1 
ATOM   1501 C  C   . LYS A 1 208 ? 10.579  16.196  23.912 1.00 20.11 ? 230  LYS T C   1 
ATOM   1502 O  O   . LYS A 1 208 ? 11.407  16.227  24.823 1.00 21.47 ? 230  LYS T O   1 
ATOM   1503 C  CB  . LYS A 1 208 ? 8.897   17.350  25.394 1.00 19.77 ? 230  LYS T CB  1 
ATOM   1504 C  CG  . LYS A 1 208 ? 9.349   18.792  25.231 1.00 23.03 ? 230  LYS T CG  1 
ATOM   1505 C  CD  . LYS A 1 208 ? 8.903   19.592  26.449 1.00 23.24 ? 230  LYS T CD  1 
ATOM   1506 C  CE  . LYS A 1 208 ? 9.154   21.080  26.297 1.00 25.90 ? 230  LYS T CE  1 
ATOM   1507 N  NZ  . LYS A 1 208 ? 8.530   21.830  27.432 1.00 26.15 ? 230  LYS T NZ  1 
ATOM   1508 N  N   . VAL A 1 209 ? 10.907  15.969  22.647 1.00 18.75 ? 231  VAL T N   1 
ATOM   1509 C  CA  . VAL A 1 209 ? 12.273  15.665  22.233 1.00 18.82 ? 231  VAL T CA  1 
ATOM   1510 C  C   . VAL A 1 209 ? 13.385  16.623  22.680 1.00 20.45 ? 231  VAL T C   1 
ATOM   1511 O  O   . VAL A 1 209 ? 14.499  16.179  22.953 1.00 17.86 ? 231  VAL T O   1 
ATOM   1512 C  CB  . VAL A 1 209 ? 12.345  15.503  20.694 1.00 17.11 ? 231  VAL T CB  1 
ATOM   1513 C  CG1 . VAL A 1 209 ? 13.750  15.103  20.271 1.00 15.36 ? 231  VAL T CG1 1 
ATOM   1514 C  CG2 . VAL A 1 209 ? 11.338  14.449  20.238 1.00 15.26 ? 231  VAL T CG2 1 
ATOM   1515 N  N   . CYS A 1 210 ? 13.094  17.919  22.772 1.00 20.59 ? 232  CYS T N   1 
ATOM   1516 C  CA  . CYS A 1 210 ? 14.117  18.889  23.165 1.00 22.60 ? 232  CYS T CA  1 
ATOM   1517 C  C   . CYS A 1 210 ? 14.729  18.607  24.538 1.00 23.76 ? 232  CYS T C   1 
ATOM   1518 O  O   . CYS A 1 210 ? 15.866  18.992  24.803 1.00 24.33 ? 232  CYS T O   1 
ATOM   1519 C  CB  . CYS A 1 210 ? 13.546  20.316  23.121 1.00 22.40 ? 232  CYS T CB  1 
ATOM   1520 S  SG  . CYS A 1 210 ? 12.174  20.620  24.280 1.00 23.80 ? 232  CYS T SG  1 
ATOM   1521 N  N   . ASN A 1 211 ? 13.990  17.928  25.410 1.00 23.92 ? 233  ASN T N   1 
ATOM   1522 C  CA  . ASN A 1 211 ? 14.517  17.617  26.735 1.00 25.83 ? 233  ASN T CA  1 
ATOM   1523 C  C   . ASN A 1 211 ? 15.204  16.256  26.802 1.00 24.45 ? 233  ASN T C   1 
ATOM   1524 O  O   . ASN A 1 211 ? 15.480  15.747  27.890 1.00 24.45 ? 233  ASN T O   1 
ATOM   1525 C  CB  . ASN A 1 211 ? 13.406  17.688  27.785 1.00 29.14 ? 233  ASN T CB  1 
ATOM   1526 C  CG  . ASN A 1 211 ? 12.824  19.080  27.909 1.00 33.28 ? 233  ASN T CG  1 
ATOM   1527 O  OD1 . ASN A 1 211 ? 13.558  20.070  27.932 1.00 36.39 ? 233  ASN T OD1 1 
ATOM   1528 N  ND2 . ASN A 1 211 ? 11.505  19.168  27.988 1.00 35.65 ? 233  ASN T ND2 1 
ATOM   1529 N  N   . TYR A 1 212 ? 15.489  15.678  25.639 1.00 22.24 ? 234  TYR T N   1 
ATOM   1530 C  CA  . TYR A 1 212 ? 16.153  14.377  25.572 1.00 20.59 ? 234  TYR T CA  1 
ATOM   1531 C  C   . TYR A 1 212 ? 17.382  14.409  24.674 1.00 21.79 ? 234  TYR T C   1 
ATOM   1532 O  O   . TYR A 1 212 ? 18.052  13.394  24.508 1.00 23.47 ? 234  TYR T O   1 
ATOM   1533 C  CB  . TYR A 1 212 ? 15.181  13.312  25.049 1.00 19.30 ? 234  TYR T CB  1 
ATOM   1534 C  CG  . TYR A 1 212 ? 14.052  12.984  26.000 1.00 18.66 ? 234  TYR T CG  1 
ATOM   1535 C  CD1 . TYR A 1 212 ? 14.280  12.217  27.142 1.00 18.38 ? 234  TYR T CD1 1 
ATOM   1536 C  CD2 . TYR A 1 212 ? 12.764  13.466  25.775 1.00 18.94 ? 234  TYR T CD2 1 
ATOM   1537 C  CE1 . TYR A 1 212 ? 13.254  11.940  28.040 1.00 19.49 ? 234  TYR T CE1 1 
ATOM   1538 C  CE2 . TYR A 1 212 ? 11.728  13.195  26.667 1.00 18.79 ? 234  TYR T CE2 1 
ATOM   1539 C  CZ  . TYR A 1 212 ? 11.981  12.434  27.796 1.00 18.47 ? 234  TYR T CZ  1 
ATOM   1540 O  OH  . TYR A 1 212 ? 10.970  12.181  28.690 1.00 20.59 ? 234  TYR T OH  1 
ATOM   1541 N  N   . VAL A 1 213 ? 17.683  15.570  24.100 1.00 21.96 ? 235  VAL T N   1 
ATOM   1542 C  CA  . VAL A 1 213 ? 18.825  15.694  23.198 1.00 21.81 ? 235  VAL T CA  1 
ATOM   1543 C  C   . VAL A 1 213 ? 20.141  15.202  23.796 1.00 20.99 ? 235  VAL T C   1 
ATOM   1544 O  O   . VAL A 1 213 ? 20.867  14.441  23.153 1.00 19.79 ? 235  VAL T O   1 
ATOM   1545 C  CB  . VAL A 1 213 ? 18.989  17.157  22.697 1.00 23.08 ? 235  VAL T CB  1 
ATOM   1546 C  CG1 . VAL A 1 213 ? 20.279  17.304  21.894 1.00 23.81 ? 235  VAL T CG1 1 
ATOM   1547 C  CG2 . VAL A 1 213 ? 17.804  17.533  21.818 1.00 22.52 ? 235  VAL T CG2 1 
ATOM   1548 N  N   . SER A 1 214 ? 20.441  15.624  25.021 1.00 22.00 ? 236  SER T N   1 
ATOM   1549 C  CA  . SER A 1 214 ? 21.677  15.217  25.694 1.00 22.01 ? 236  SER T CA  1 
ATOM   1550 C  C   . SER A 1 214 ? 21.756  13.701  25.822 1.00 21.02 ? 236  SER T C   1 
ATOM   1551 O  O   . SER A 1 214 ? 22.793  13.100  25.551 1.00 18.61 ? 236  SER T O   1 
ATOM   1552 C  CB  . SER A 1 214 ? 21.755  15.831  27.091 1.00 22.93 ? 236  SER T CB  1 
ATOM   1553 O  OG  . SER A 1 214 ? 21.618  17.240  27.036 1.00 31.97 ? 236  SER T OG  1 
ATOM   1554 N  N   . TRP A 1 215 ? 20.656  13.091  26.251 1.00 20.78 ? 237  TRP T N   1 
ATOM   1555 C  CA  . TRP A 1 215 ? 20.604  11.643  26.410 1.00 20.71 ? 237  TRP T CA  1 
ATOM   1556 C  C   . TRP A 1 215 ? 20.842  10.961  25.060 1.00 20.57 ? 237  TRP T C   1 
ATOM   1557 O  O   . TRP A 1 215 ? 21.663  10.048  24.957 1.00 21.21 ? 237  TRP T O   1 
ATOM   1558 C  CB  . TRP A 1 215 ? 19.245  11.233  26.980 1.00 21.82 ? 237  TRP T CB  1 
ATOM   1559 C  CG  . TRP A 1 215 ? 19.093  9.762   27.191 1.00 21.16 ? 237  TRP T CG  1 
ATOM   1560 C  CD1 . TRP A 1 215 ? 19.616  9.015   28.210 1.00 23.48 ? 237  TRP T CD1 1 
ATOM   1561 C  CD2 . TRP A 1 215 ? 18.367  8.854   26.359 1.00 20.98 ? 237  TRP T CD2 1 
ATOM   1562 N  NE1 . TRP A 1 215 ? 19.255  7.694   28.064 1.00 22.55 ? 237  TRP T NE1 1 
ATOM   1563 C  CE2 . TRP A 1 215 ? 18.488  7.568   26.936 1.00 21.29 ? 237  TRP T CE2 1 
ATOM   1564 C  CE3 . TRP A 1 215 ? 17.622  9.002   25.181 1.00 18.99 ? 237  TRP T CE3 1 
ATOM   1565 C  CZ2 . TRP A 1 215 ? 17.893  6.438   26.374 1.00 18.50 ? 237  TRP T CZ2 1 
ATOM   1566 C  CZ3 . TRP A 1 215 ? 17.028  7.876   24.622 1.00 19.83 ? 237  TRP T CZ3 1 
ATOM   1567 C  CH2 . TRP A 1 215 ? 17.167  6.611   25.220 1.00 20.78 ? 237  TRP T CH2 1 
ATOM   1568 N  N   . ILE A 1 216 ? 20.124  11.416  24.032 1.00 20.68 ? 238  ILE T N   1 
ATOM   1569 C  CA  . ILE A 1 216 ? 20.246  10.870  22.682 1.00 19.85 ? 238  ILE T CA  1 
ATOM   1570 C  C   . ILE A 1 216 ? 21.713  10.789  22.263 1.00 20.74 ? 238  ILE T C   1 
ATOM   1571 O  O   . ILE A 1 216 ? 22.214  9.727   21.893 1.00 20.60 ? 238  ILE T O   1 
ATOM   1572 C  CB  . ILE A 1 216 ? 19.543  11.762  21.618 1.00 20.75 ? 238  ILE T CB  1 
ATOM   1573 C  CG1 . ILE A 1 216 ? 18.070  11.991  21.967 1.00 21.21 ? 238  ILE T CG1 1 
ATOM   1574 C  CG2 . ILE A 1 216 ? 19.678  11.119  20.242 1.00 16.26 ? 238  ILE T CG2 1 
ATOM   1575 C  CD1 . ILE A 1 216 ? 17.214  10.776  21.897 1.00 25.20 ? 238  ILE T CD1 1 
ATOM   1576 N  N   . LYS A 1 217 ? 22.387  11.930  22.313 1.00 21.37 ? 239  LYS T N   1 
ATOM   1577 C  CA  . LYS A 1 217 ? 23.785  12.014  21.918 1.00 24.31 ? 239  LYS T CA  1 
ATOM   1578 C  C   . LYS A 1 217 ? 24.717  11.147  22.753 1.00 24.37 ? 239  LYS T C   1 
ATOM   1579 O  O   . LYS A 1 217 ? 25.597  10.482  22.205 1.00 24.11 ? 239  LYS T O   1 
ATOM   1580 C  CB  . LYS A 1 217 ? 24.245  13.474  21.952 1.00 24.72 ? 239  LYS T CB  1 
ATOM   1581 C  CG  . LYS A 1 217 ? 23.562  14.350  20.912 1.00 27.25 ? 239  LYS T CG  1 
ATOM   1582 C  CD  . LYS A 1 217 ? 24.083  15.780  20.976 1.00 30.56 ? 239  LYS T CD  1 
ATOM   1583 C  CE  . LYS A 1 217 ? 23.558  16.619  19.821 1.00 32.53 ? 239  LYS T CE  1 
ATOM   1584 N  NZ  . LYS A 1 217 ? 24.092  18.014  19.866 1.00 37.01 ? 239  LYS T NZ  1 
ATOM   1585 N  N   . GLN A 1 218 ? 24.530  11.145  24.069 1.00 24.69 ? 240  GLN T N   1 
ATOM   1586 C  CA  . GLN A 1 218 ? 25.378  10.335  24.937 1.00 25.92 ? 240  GLN T CA  1 
ATOM   1587 C  C   . GLN A 1 218 ? 25.156  8.851   24.684 1.00 24.40 ? 240  GLN T C   1 
ATOM   1588 O  O   . GLN A 1 218 ? 26.101  8.063   24.666 1.00 23.22 ? 240  GLN T O   1 
ATOM   1589 C  CB  . GLN A 1 218 ? 25.103  10.639  26.416 1.00 29.76 ? 240  GLN T CB  1 
ATOM   1590 C  CG  . GLN A 1 218 ? 25.448  12.057  26.839 1.00 38.60 ? 240  GLN T CG  1 
ATOM   1591 C  CD  . GLN A 1 218 ? 25.471  12.233  28.352 1.00 44.44 ? 240  GLN T CD  1 
ATOM   1592 O  OE1 . GLN A 1 218 ? 24.518  11.876  29.048 1.00 46.64 ? 240  GLN T OE1 1 
ATOM   1593 N  NE2 . GLN A 1 218 ? 26.564  12.795  28.867 1.00 46.61 ? 240  GLN T NE2 1 
ATOM   1594 N  N   . THR A 1 219 ? 23.902  8.465   24.489 1.00 22.45 ? 241  THR T N   1 
ATOM   1595 C  CA  . THR A 1 219 ? 23.592  7.067   24.251 1.00 22.88 ? 241  THR T CA  1 
ATOM   1596 C  C   . THR A 1 219 ? 24.152  6.596   22.912 1.00 23.65 ? 241  THR T C   1 
ATOM   1597 O  O   . THR A 1 219 ? 24.765  5.535   22.829 1.00 23.40 ? 241  THR T O   1 
ATOM   1598 C  CB  . THR A 1 219 ? 22.076  6.824   24.303 1.00 22.60 ? 241  THR T CB  1 
ATOM   1599 O  OG1 . THR A 1 219 ? 21.586  7.190   25.601 1.00 25.06 ? 241  THR T OG1 1 
ATOM   1600 C  CG2 . THR A 1 219 ? 21.764  5.362   24.054 1.00 21.61 ? 241  THR T CG2 1 
ATOM   1601 N  N   . ILE A 1 220 ? 23.955  7.389   21.866 1.00 23.19 ? 242  ILE T N   1 
ATOM   1602 C  CA  . ILE A 1 220 ? 24.462  7.016   20.553 1.00 24.61 ? 242  ILE T CA  1 
ATOM   1603 C  C   . ILE A 1 220 ? 25.989  6.947   20.553 1.00 25.07 ? 242  ILE T C   1 
ATOM   1604 O  O   . ILE A 1 220 ? 26.574  6.039   19.967 1.00 24.88 ? 242  ILE T O   1 
ATOM   1605 C  CB  . ILE A 1 220 ? 24.005  8.019   19.479 1.00 25.79 ? 242  ILE T CB  1 
ATOM   1606 C  CG1 . ILE A 1 220 ? 22.485  7.944   19.319 1.00 25.74 ? 242  ILE T CG1 1 
ATOM   1607 C  CG2 . ILE A 1 220 ? 24.690  7.719   18.156 1.00 25.65 ? 242  ILE T CG2 1 
ATOM   1608 C  CD1 . ILE A 1 220 ? 21.936  8.929   18.314 1.00 27.67 ? 242  ILE T CD1 1 
ATOM   1609 N  N   . ALA A 1 221 ? 26.624  7.904   21.220 1.00 24.79 ? 243  ALA T N   1 
ATOM   1610 C  CA  . ALA A 1 221 ? 28.080  7.958   21.287 1.00 26.37 ? 243  ALA T CA  1 
ATOM   1611 C  C   . ALA A 1 221 ? 28.711  6.748   21.964 1.00 26.31 ? 243  ALA T C   1 
ATOM   1612 O  O   . ALA A 1 221 ? 29.824  6.359   21.620 1.00 26.02 ? 243  ALA T O   1 
ATOM   1613 C  CB  . ALA A 1 221 ? 28.520  9.226   21.996 1.00 26.85 ? 243  ALA T CB  1 
ATOM   1614 N  N   . SER A 1 222 ? 28.007  6.149   22.920 1.00 25.24 ? 244  SER T N   1 
ATOM   1615 C  CA  . SER A 1 222 ? 28.549  4.996   23.626 1.00 25.26 ? 244  SER T CA  1 
ATOM   1616 C  C   . SER A 1 222 ? 28.101  3.643   23.083 1.00 24.61 ? 244  SER T C   1 
ATOM   1617 O  O   . SER A 1 222 ? 28.474  2.606   23.626 1.00 25.71 ? 244  SER T O   1 
ATOM   1618 C  CB  . SER A 1 222 ? 28.225  5.095   25.123 1.00 26.81 ? 244  SER T CB  1 
ATOM   1619 O  OG  . SER A 1 222 ? 26.856  5.371   25.345 1.00 29.06 ? 244  SER T OG  1 
ATOM   1620 N  N   . ASN A 1 223 ? 27.321  3.647   22.006 1.00 23.43 ? 245  ASN T N   1 
ATOM   1621 C  CA  . ASN A 1 223 ? 26.847  2.398   21.416 1.00 24.01 ? 245  ASN T CA  1 
ATOM   1622 C  C   . ASN A 1 223 ? 27.199  2.282   19.936 1.00 24.91 ? 245  ASN T C   1 
ATOM   1623 O  O   . ASN A 1 223 ? 26.446  1.623   19.190 1.00 25.10 ? 245  ASN T O   1 
ATOM   1624 C  CB  . ASN A 1 223 ? 25.330  2.273   21.605 1.00 23.21 ? 245  ASN T CB  1 
ATOM   1625 C  CG  . ASN A 1 223 ? 24.955  1.877   23.016 1.00 22.22 ? 245  ASN T CG  1 
ATOM   1626 O  OD1 . ASN A 1 223 ? 25.121  0.724   23.410 1.00 25.23 ? 245  ASN T OD1 1 
ATOM   1627 N  ND2 . ASN A 1 223 ? 24.464  2.835   23.792 1.00 22.10 ? 245  ASN T ND2 1 
ATOM   1628 O  OXT . ASN A 1 223 ? 28.248  2.833   19.546 1.00 29.74 ? 245  ASN T OXT 1 
HETATM 1629 S  S   . SO4 B 2 .   ? -0.391  2.512   19.538 1.00 39.88 ? 600  SO4 T S   1 
HETATM 1630 O  O1  . SO4 B 2 .   ? -0.319  3.236   20.820 1.00 41.26 ? 600  SO4 T O1  1 
HETATM 1631 O  O2  . SO4 B 2 .   ? 0.769   1.609   19.434 1.00 43.22 ? 600  SO4 T O2  1 
HETATM 1632 O  O3  . SO4 B 2 .   ? -1.642  1.739   19.486 1.00 41.20 ? 600  SO4 T O3  1 
HETATM 1633 O  O4  . SO4 B 2 .   ? -0.360  3.462   18.405 1.00 42.55 ? 600  SO4 T O4  1 
HETATM 1634 CA CA  . CA  C 3 .   ? 6.521   0.121   -0.403 1.00 23.46 ? 480  CA  T CA  1 
HETATM 1635 C  C1  . BEN D 4 .   ? -3.181  9.069   19.677 1.00 22.58 ? 1    BEN T C1  1 
HETATM 1636 C  C2  . BEN D 4 .   ? -1.799  8.830   19.245 1.00 23.52 ? 1    BEN T C2  1 
HETATM 1637 C  C3  . BEN D 4 .   ? -1.197  7.513   19.384 1.00 24.13 ? 1    BEN T C3  1 
HETATM 1638 C  C4  . BEN D 4 .   ? -1.966  6.419   19.958 1.00 22.61 ? 1    BEN T C4  1 
HETATM 1639 C  C5  . BEN D 4 .   ? -3.329  6.641   20.388 1.00 25.57 ? 1    BEN T C5  1 
HETATM 1640 C  C6  . BEN D 4 .   ? -3.937  7.957   20.251 1.00 22.79 ? 1    BEN T C6  1 
HETATM 1641 C  C   . BEN D 4 .   ? -3.825  10.462  19.531 1.00 24.25 ? 1    BEN T C   1 
HETATM 1642 N  N1  . BEN D 4 .   ? -5.129  10.593  19.688 1.00 23.50 ? 1    BEN T N1  1 
HETATM 1643 N  N2  . BEN D 4 .   ? -3.069  11.513  19.249 1.00 23.78 ? 1    BEN T N2  1 
HETATM 1644 O  O   . HOH E 5 .   ? 10.098  9.922   15.764 1.00 17.32 ? 406  HOH T O   1 
HETATM 1645 O  O   . HOH E 5 .   ? 4.877   10.749  26.375 1.00 29.39 ? 408  HOH T O   1 
HETATM 1646 O  O   . HOH E 5 .   ? 3.155   5.254   11.421 1.00 15.01 ? 410  HOH T O   1 
HETATM 1647 O  O   . HOH E 5 .   ? 1.943   9.673   0.648  1.00 17.59 ? 412  HOH T O   1 
HETATM 1648 O  O   . HOH E 5 .   ? -8.908  12.477  20.802 1.00 23.64 ? 415  HOH T O   1 
HETATM 1649 O  O   . HOH E 5 .   ? -0.038  11.727  19.943 1.00 18.10 ? 416  HOH T O   1 
HETATM 1650 O  O   . HOH E 5 .   ? -5.769  11.319  7.364  1.00 33.40 ? 429  HOH T O   1 
HETATM 1651 O  O   . HOH E 5 .   ? -2.461  7.647   8.538  1.00 17.89 ? 430  HOH T O   1 
HETATM 1652 O  O   . HOH E 5 .   ? 5.674   -1.798  7.247  1.00 15.56 ? 457  HOH T O   1 
HETATM 1653 O  O   . HOH E 5 .   ? -3.262  19.659  7.857  1.00 31.24 ? 470  HOH T O   1 
HETATM 1654 O  O   . HOH E 5 .   ? 1.578   21.549  25.424 1.00 26.07 ? 473  HOH T O   1 
HETATM 1655 O  O   . HOH E 5 .   ? 10.686  8.385   1.773  1.00 26.97 ? 516  HOH T O   1 
HETATM 1656 O  O   . HOH E 5 .   ? -7.887  15.526  19.177 1.00 37.20 ? 562  HOH T O   1 
HETATM 1657 O  O   . HOH E 5 .   ? 6.030   8.437   1.299  1.00 20.31 ? 604  HOH T O   1 
HETATM 1658 O  O   . HOH E 5 .   ? 4.318   -6.177  6.204  1.00 29.96 ? 700  HOH T O   1 
HETATM 1659 O  O   . HOH E 5 .   ? 4.271   7.777   12.356 1.00 14.26 ? 701  HOH T O   1 
HETATM 1660 O  O   . HOH E 5 .   ? 7.218   11.480  27.618 1.00 20.49 ? 703  HOH T O   1 
HETATM 1661 O  O   . HOH E 5 .   ? -2.560  15.757  17.605 1.00 18.23 ? 704  HOH T O   1 
HETATM 1662 O  O   . HOH E 5 .   ? -5.831  17.036  17.769 1.00 22.69 ? 705  HOH T O   1 
HETATM 1663 O  O   . HOH E 5 .   ? 9.113   3.323   -2.014 1.00 16.12 ? 706  HOH T O   1 
HETATM 1664 O  O   . HOH E 5 .   ? 6.235   -2.009  4.326  1.00 18.29 ? 707  HOH T O   1 
HETATM 1665 O  O   . HOH E 5 .   ? 9.670   4.533   5.383  1.00 21.66 ? 708  HOH T O   1 
HETATM 1666 O  O   . HOH E 5 .   ? 9.200   7.730   3.852  1.00 22.14 ? 709  HOH T O   1 
HETATM 1667 O  O   . HOH E 5 .   ? 7.107   -2.196  0.778  1.00 23.27 ? 711  HOH T O   1 
HETATM 1668 O  O   . HOH E 5 .   ? 6.866   2.533   -1.557 1.00 18.80 ? 714  HOH T O   1 
HETATM 1669 O  O   . HOH E 5 .   ? 1.377   -3.779  7.517  1.00 32.40 ? 715  HOH T O   1 
HETATM 1670 O  O   . HOH E 5 .   ? 12.553  7.112   4.853  1.00 30.97 ? 716  HOH T O   1 
HETATM 1671 O  O   . HOH E 5 .   ? 7.864   10.157  2.636  1.00 19.10 ? 717  HOH T O   1 
HETATM 1672 O  O   . HOH E 5 .   ? 1.307   8.681   -2.120 1.00 26.84 ? 718  HOH T O   1 
HETATM 1673 O  O   . HOH E 5 .   ? 6.931   14.847  9.955  1.00 17.35 ? 721  HOH T O   1 
HETATM 1674 O  O   . HOH E 5 .   ? 10.719  19.164  21.675 1.00 19.24 ? 722  HOH T O   1 
HETATM 1675 O  O   . HOH E 5 .   ? -5.351  13.870  0.271  1.00 32.32 ? 736  HOH T O   1 
HETATM 1676 O  O   . HOH E 5 .   ? -4.974  24.391  17.498 1.00 32.18 ? 746  HOH T O   1 
HETATM 1677 O  O   . HOH E 5 .   ? 2.940   27.727  26.496 1.00 44.39 ? 764  HOH T O   1 
HETATM 1678 O  O   . HOH E 5 .   ? 6.253   -4.549  1.085  1.00 34.20 ? 769  HOH T O   1 
HETATM 1679 O  O   . HOH E 5 .   ? 11.720  23.748  15.850 1.00 28.13 ? 772  HOH T O   1 
HETATM 1680 O  O   . HOH E 5 .   ? 26.615  11.424  19.672 1.00 35.31 ? 781  HOH T O   1 
HETATM 1681 O  O   . HOH E 5 .   ? 9.060   18.141  7.329  1.00 35.98 ? 783  HOH T O   1 
HETATM 1682 O  O   . HOH E 5 .   ? 17.104  11.814  30.114 1.00 30.00 ? 784  HOH T O   1 
HETATM 1683 O  O   . HOH E 5 .   ? 5.109   -0.387  26.965 1.00 30.03 ? 785  HOH T O   1 
HETATM 1684 O  O   . HOH E 5 .   ? 16.572  4.447   -1.092 1.00 27.27 ? 793  HOH T O   1 
HETATM 1685 O  O   . HOH E 5 .   ? 6.104   -9.508  16.490 1.00 35.49 ? 829  HOH T O   1 
HETATM 1686 O  O   . HOH E 5 .   ? 8.371   -9.368  17.677 1.00 29.19 ? 834  HOH T O   1 
HETATM 1687 O  O   . HOH E 5 .   ? 14.205  -4.884  18.878 1.00 33.05 ? 1213 HOH T O   1 
HETATM 1688 O  O   . HOH E 5 .   ? 19.935  14.395  13.145 1.00 30.85 ? 1228 HOH T O   1 
HETATM 1689 O  O   . HOH E 5 .   ? -1.416  1.430   7.707  1.00 31.77 ? 1240 HOH T O   1 
HETATM 1690 O  O   . HOH E 5 .   ? 7.745   -0.904  25.848 1.00 30.85 ? 1245 HOH T O   1 
HETATM 1691 O  O   . HOH E 5 .   ? 18.690  14.576  27.895 1.00 31.00 ? 1250 HOH T O   1 
HETATM 1692 O  O   . HOH E 5 .   ? 19.573  -5.929  7.784  1.00 22.40 ? 1354 HOH T O   1 
HETATM 1693 O  O   . HOH E 5 .   ? 15.995  -1.566  25.790 1.00 26.01 ? 4014 HOH T O   1 
HETATM 1694 O  O   . HOH E 5 .   ? 3.467   27.834  28.850 1.00 70.23 ? 4018 HOH T O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ILE 1   16  16  ILE ILE T . n 
A 1 2   VAL 2   17  17  VAL VAL T . n 
A 1 3   GLY 3   18  18  GLY GLY T . n 
A 1 4   GLY 4   19  19  GLY GLY T . n 
A 1 5   TYR 5   20  20  TYR TYR T . n 
A 1 6   THR 6   21  21  THR THR T . n 
A 1 7   CYS 7   22  22  CYS CYS T . n 
A 1 8   GLY 8   23  23  GLY GLY T . n 
A 1 9   ALA 9   24  24  ALA ALA T . n 
A 1 10  ASN 10  25  25  ASN ASN T . n 
A 1 11  THR 11  26  26  THR THR T . n 
A 1 12  VAL 12  27  27  VAL VAL T . n 
A 1 13  PRO 13  28  28  PRO PRO T . n 
A 1 14  TYR 14  29  29  TYR TYR T . n 
A 1 15  GLN 15  30  30  GLN GLN T . n 
A 1 16  VAL 16  31  31  VAL VAL T . n 
A 1 17  SER 17  32  32  SER SER T . n 
A 1 18  LEU 18  33  33  LEU LEU T . n 
A 1 19  ASN 19  34  34  ASN ASN T . n 
A 1 20  SER 20  37  37  SER SER T . n 
A 1 21  GLY 21  38  38  GLY GLY T . n 
A 1 22  TYR 22  39  39  TYR TYR T . n 
A 1 23  HIS 23  40  40  HIS HIS T . n 
A 1 24  PHE 24  41  41  PHE PHE T . n 
A 1 25  CYS 25  42  42  CYS CYS T . n 
A 1 26  GLY 26  43  43  GLY GLY T . n 
A 1 27  GLY 27  44  44  GLY GLY T . n 
A 1 28  SER 28  45  45  SER SER T . n 
A 1 29  LEU 29  46  46  LEU LEU T . n 
A 1 30  ILE 30  47  47  ILE ILE T . n 
A 1 31  ASN 31  48  48  ASN ASN T . n 
A 1 32  SER 32  49  49  SER SER T . n 
A 1 33  GLN 33  50  50  GLN GLN T . n 
A 1 34  TRP 34  51  51  TRP TRP T . n 
A 1 35  VAL 35  52  52  VAL VAL T . n 
A 1 36  VAL 36  53  53  VAL VAL T . n 
A 1 37  SER 37  54  54  SER SER T . n 
A 1 38  ALA 38  55  55  ALA ALA T . n 
A 1 39  ALA 39  56  56  ALA ALA T . n 
A 1 40  HIS 40  57  57  HIS HIS T . n 
A 1 41  CYS 41  58  58  CYS CYS T . n 
A 1 42  TYR 42  59  59  TYR TYR T . n 
A 1 43  LYS 43  60  60  LYS LYS T . n 
A 1 44  SER 44  61  61  SER SER T . n 
A 1 45  GLY 45  62  62  GLY GLY T . n 
A 1 46  ILE 46  63  63  ILE ILE T . n 
A 1 47  GLN 47  64  64  GLN GLN T . n 
A 1 48  VAL 48  65  65  VAL VAL T . n 
A 1 49  ARG 49  66  66  ARG ARG T . n 
A 1 50  LEU 50  67  67  LEU LEU T . n 
A 1 51  GLY 51  69  69  GLY GLY T . n 
A 1 52  GLU 52  70  70  GLU GLU T . n 
A 1 53  ASP 53  71  71  ASP ASP T . n 
A 1 54  ASN 54  72  72  ASN ASN T . n 
A 1 55  ILE 55  73  73  ILE ILE T . n 
A 1 56  ASN 56  74  74  ASN ASN T . n 
A 1 57  VAL 57  75  75  VAL VAL T . n 
A 1 58  VAL 58  76  76  VAL VAL T . n 
A 1 59  GLU 59  77  77  GLU GLU T . n 
A 1 60  GLY 60  78  78  GLY GLY T . n 
A 1 61  ASN 61  79  79  ASN ASN T . n 
A 1 62  GLU 62  80  80  GLU GLU T . n 
A 1 63  GLN 63  81  81  GLN GLN T . n 
A 1 64  PHE 64  82  82  PHE PHE T . n 
A 1 65  ILE 65  83  83  ILE ILE T . n 
A 1 66  SER 66  84  84  SER SER T . n 
A 1 67  ALA 67  85  85  ALA ALA T . n 
A 1 68  SER 68  86  86  SER SER T . n 
A 1 69  LYS 69  87  87  LYS LYS T . n 
A 1 70  SER 70  88  88  SER SER T . n 
A 1 71  ILE 71  89  89  ILE ILE T . n 
A 1 72  VAL 72  90  90  VAL VAL T . n 
A 1 73  HIS 73  91  91  HIS HIS T . n 
A 1 74  PRO 74  92  92  PRO PRO T . n 
A 1 75  SER 75  93  93  SER SER T . n 
A 1 76  TYR 76  94  94  TYR TYR T . n 
A 1 77  ASN 77  95  95  ASN ASN T . n 
A 1 78  SER 78  96  96  SER SER T . n 
A 1 79  ASN 79  97  97  ASN ASN T . n 
A 1 80  THR 80  98  98  THR THR T . n 
A 1 81  LEU 81  99  99  LEU LEU T . n 
A 1 82  ASN 82  100 100 ASN ASN T . n 
A 1 83  ASN 83  101 101 ASN ASN T . n 
A 1 84  ASP 84  102 102 ASP ASP T . n 
A 1 85  ILE 85  103 103 ILE ILE T . n 
A 1 86  MET 86  104 104 MET MET T . n 
A 1 87  LEU 87  105 105 LEU LEU T . n 
A 1 88  ILE 88  106 106 ILE ILE T . n 
A 1 89  LYS 89  107 107 LYS LYS T . n 
A 1 90  LEU 90  108 108 LEU LEU T . n 
A 1 91  LYS 91  109 109 LYS LYS T . n 
A 1 92  SER 92  110 110 SER SER T . n 
A 1 93  ALA 93  111 111 ALA ALA T . n 
A 1 94  ALA 94  112 112 ALA ALA T . n 
A 1 95  SER 95  113 113 SER SER T . n 
A 1 96  LEU 96  114 114 LEU LEU T . n 
A 1 97  ASN 97  115 115 ASN ASN T . n 
A 1 98  SER 98  116 116 SER SER T . n 
A 1 99  ARG 99  117 117 ARG ARG T . n 
A 1 100 VAL 100 118 118 VAL VAL T . n 
A 1 101 ALA 101 119 119 ALA ALA T . n 
A 1 102 SER 102 120 120 SER SER T . n 
A 1 103 ILE 103 121 121 ILE ILE T . n 
A 1 104 SER 104 122 122 SER SER T . n 
A 1 105 LEU 105 123 123 LEU LEU T . n 
A 1 106 PRO 106 124 124 PRO PRO T . n 
A 1 107 THR 107 125 125 THR THR T . n 
A 1 108 SER 108 127 127 SER SER T . n 
A 1 109 CYS 109 128 128 CYS CYS T . n 
A 1 110 ALA 110 129 129 ALA ALA T . n 
A 1 111 SER 111 130 130 SER SER T . n 
A 1 112 ALA 112 132 132 ALA ALA T . n 
A 1 113 GLY 113 133 133 GLY GLY T . n 
A 1 114 THR 114 134 134 THR THR T . n 
A 1 115 GLN 115 135 135 GLN GLN T . n 
A 1 116 CYS 116 136 136 CYS CYS T . n 
A 1 117 LEU 117 137 137 LEU LEU T . n 
A 1 118 ILE 118 138 138 ILE ILE T . n 
A 1 119 SER 119 139 139 SER SER T . n 
A 1 120 GLY 120 140 140 GLY GLY T . n 
A 1 121 TRP 121 141 141 TRP TRP T . n 
A 1 122 GLY 122 142 142 GLY GLY T . n 
A 1 123 ASN 123 143 143 ASN ASN T . n 
A 1 124 THR 124 144 144 THR THR T . n 
A 1 125 LYS 125 145 145 LYS LYS T . n 
A 1 126 SER 126 146 146 SER SER T . n 
A 1 127 SER 127 147 147 SER SER T . n 
A 1 128 GLY 128 148 148 GLY GLY T . n 
A 1 129 THR 129 149 149 THR THR T . n 
A 1 130 SER 130 150 150 SER SER T . n 
A 1 131 TYR 131 151 151 TYR TYR T . n 
A 1 132 PRO 132 152 152 PRO PRO T . n 
A 1 133 ASP 133 153 153 ASP ASP T . n 
A 1 134 VAL 134 154 154 VAL VAL T . n 
A 1 135 LEU 135 155 155 LEU LEU T . n 
A 1 136 LYS 136 156 156 LYS LYS T . n 
A 1 137 CYS 137 157 157 CYS CYS T . n 
A 1 138 LEU 138 158 158 LEU LEU T . n 
A 1 139 LYS 139 159 159 LYS LYS T . n 
A 1 140 ALA 140 160 160 ALA ALA T . n 
A 1 141 PRO 141 161 161 PRO PRO T . n 
A 1 142 ILE 142 162 162 ILE ILE T . n 
A 1 143 LEU 143 163 163 LEU LEU T . n 
A 1 144 SER 144 164 164 SER SER T . n 
A 1 145 ASP 145 165 165 ASP ASP T . n 
A 1 146 SER 146 166 166 SER SER T . n 
A 1 147 SER 147 167 167 SER SER T . n 
A 1 148 CYS 148 168 168 CYS CYS T . n 
A 1 149 LYS 149 169 169 LYS LYS T . n 
A 1 150 SER 150 170 170 SER SER T . n 
A 1 151 ALA 151 171 171 ALA ALA T . n 
A 1 152 SER 152 172 172 SER SER T . n 
A 1 153 SER 153 173 173 SER SER T . n 
A 1 154 ARG 154 174 174 ARG ARG T . n 
A 1 155 ILE 155 175 175 ILE ILE T . n 
A 1 156 ILE 156 176 176 ILE ILE T . n 
A 1 157 THR 157 177 177 THR THR T . n 
A 1 158 SER 158 178 178 SER SER T . n 
A 1 159 ASN 159 179 179 ASN ASN T . n 
A 1 160 MET 160 180 180 MET MET T . n 
A 1 161 PHE 161 181 181 PHE PHE T . n 
A 1 162 CYS 162 182 182 CYS CYS T . n 
A 1 163 ALA 163 183 183 ALA ALA T . n 
A 1 164 GLY 164 184 184 GLY GLY T . n 
A 1 165 TYR 165 184 184 TYR TYR T A n 
A 1 166 LEU 166 185 185 LEU LEU T . n 
A 1 167 GLU 167 186 186 GLU GLU T . n 
A 1 168 GLY 168 187 187 GLY GLY T . n 
A 1 169 GLY 169 188 188 GLY GLY T . n 
A 1 170 LYS 170 188 188 LYS LYS T A n 
A 1 171 ASP 171 189 189 ASP ASP T . n 
A 1 172 SER 172 190 190 SER SER T . n 
A 1 173 CYS 173 191 191 CYS CYS T . n 
A 1 174 GLN 174 192 192 GLN GLN T . n 
A 1 175 GLY 175 193 193 GLY GLY T . n 
A 1 176 ASP 176 194 194 ASP ASP T . n 
A 1 177 SER 177 195 195 SER SER T . n 
A 1 178 GLY 178 196 196 GLY GLY T . n 
A 1 179 GLY 179 197 197 GLY GLY T . n 
A 1 180 PRO 180 198 198 PRO PRO T . n 
A 1 181 VAL 181 199 199 VAL VAL T . n 
A 1 182 VAL 182 200 200 VAL VAL T . n 
A 1 183 CYS 183 201 201 CYS CYS T . n 
A 1 184 SER 184 202 202 SER SER T . n 
A 1 185 GLY 185 203 203 GLY GLY T . n 
A 1 186 LYS 186 204 204 LYS LYS T . n 
A 1 187 LEU 187 209 209 LEU LEU T . n 
A 1 188 GLN 188 210 210 GLN GLN T . n 
A 1 189 GLY 189 211 211 GLY GLY T . n 
A 1 190 ILE 190 212 212 ILE ILE T . n 
A 1 191 VAL 191 213 213 VAL VAL T . n 
A 1 192 SER 192 214 214 SER SER T . n 
A 1 193 TRP 193 215 215 TRP TRP T . n 
A 1 194 GLY 194 216 216 GLY GLY T . n 
A 1 195 SER 195 217 217 SER SER T . n 
A 1 196 GLY 196 219 219 GLY GLY T . n 
A 1 197 CYS 197 220 220 CYS CYS T . n 
A 1 198 ALA 198 221 221 ALA ALA T . n 
A 1 199 GLN 199 221 221 GLN GLN T A n 
A 1 200 LYS 200 222 222 LYS LYS T . n 
A 1 201 ASN 201 223 223 ASN ASN T . n 
A 1 202 LYS 202 224 224 LYS LYS T . n 
A 1 203 PRO 203 225 225 PRO PRO T . n 
A 1 204 GLY 204 226 226 GLY GLY T . n 
A 1 205 VAL 205 227 227 VAL VAL T . n 
A 1 206 TYR 206 228 228 TYR TYR T . n 
A 1 207 THR 207 229 229 THR THR T . n 
A 1 208 LYS 208 230 230 LYS LYS T . n 
A 1 209 VAL 209 231 231 VAL VAL T . n 
A 1 210 CYS 210 232 232 CYS CYS T . n 
A 1 211 ASN 211 233 233 ASN ASN T . n 
A 1 212 TYR 212 234 234 TYR TYR T . n 
A 1 213 VAL 213 235 235 VAL VAL T . n 
A 1 214 SER 214 236 236 SER SER T . n 
A 1 215 TRP 215 237 237 TRP TRP T . n 
A 1 216 ILE 216 238 238 ILE ILE T . n 
A 1 217 LYS 217 239 239 LYS LYS T . n 
A 1 218 GLN 218 240 240 GLN GLN T . n 
A 1 219 THR 219 241 241 THR THR T . n 
A 1 220 ILE 220 242 242 ILE ILE T . n 
A 1 221 ALA 221 243 243 ALA ALA T . n 
A 1 222 SER 222 244 244 SER SER T . n 
A 1 223 ASN 223 245 245 ASN ASN T . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? A GLU 52 ? T GLU 70  ? 1_555 CA ? C CA . ? T CA 480 ? 1_555 O   ? A ASN 54 ? T ASN 72  ? 1_555 104.4 ? 
2  OE1 ? A GLU 52 ? T GLU 70  ? 1_555 CA ? C CA . ? T CA 480 ? 1_555 O   ? A VAL 57 ? T VAL 75  ? 1_555 171.6 ? 
3  O   ? A ASN 54 ? T ASN 72  ? 1_555 CA ? C CA . ? T CA 480 ? 1_555 O   ? A VAL 57 ? T VAL 75  ? 1_555 78.4  ? 
4  OE1 ? A GLU 52 ? T GLU 70  ? 1_555 CA ? C CA . ? T CA 480 ? 1_555 OE2 ? A GLU 62 ? T GLU 80  ? 1_555 94.9  ? 
5  O   ? A ASN 54 ? T ASN 72  ? 1_555 CA ? C CA . ? T CA 480 ? 1_555 OE2 ? A GLU 62 ? T GLU 80  ? 1_555 154.7 ? 
6  O   ? A VAL 57 ? T VAL 75  ? 1_555 CA ? C CA . ? T CA 480 ? 1_555 OE2 ? A GLU 62 ? T GLU 80  ? 1_555 84.9  ? 
7  OE1 ? A GLU 52 ? T GLU 70  ? 1_555 CA ? C CA . ? T CA 480 ? 1_555 O   ? E HOH .  ? T HOH 711 ? 1_555 84.3  ? 
8  O   ? A ASN 54 ? T ASN 72  ? 1_555 CA ? C CA . ? T CA 480 ? 1_555 O   ? E HOH .  ? T HOH 711 ? 1_555 107.2 ? 
9  O   ? A VAL 57 ? T VAL 75  ? 1_555 CA ? C CA . ? T CA 480 ? 1_555 O   ? E HOH .  ? T HOH 711 ? 1_555 87.3  ? 
10 OE2 ? A GLU 62 ? T GLU 80  ? 1_555 CA ? C CA . ? T CA 480 ? 1_555 O   ? E HOH .  ? T HOH 711 ? 1_555 90.8  ? 
11 OE1 ? A GLU 52 ? T GLU 70  ? 1_555 CA ? C CA . ? T CA 480 ? 1_555 O   ? E HOH .  ? T HOH 714 ? 1_555 84.7  ? 
12 O   ? A ASN 54 ? T ASN 72  ? 1_555 CA ? C CA . ? T CA 480 ? 1_555 O   ? E HOH .  ? T HOH 714 ? 1_555 91.9  ? 
13 O   ? A VAL 57 ? T VAL 75  ? 1_555 CA ? C CA . ? T CA 480 ? 1_555 O   ? E HOH .  ? T HOH 714 ? 1_555 103.3 ? 
14 OE2 ? A GLU 62 ? T GLU 80  ? 1_555 CA ? C CA . ? T CA 480 ? 1_555 O   ? E HOH .  ? T HOH 714 ? 1_555 73.5  ? 
15 O   ? E HOH .  ? T HOH 711 ? 1_555 CA ? C CA . ? T CA 480 ? 1_555 O   ? E HOH .  ? T HOH 714 ? 1_555 159.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-06-01 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CrystalClear 'data collection' . ? 1 
CrystalClear 'data reduction'  . ? 2 
CNS          refinement        . ? 3 
CrystalClear 'data scaling'    . ? 4 
CNS          phasing           . ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP T 71  ? ? -135.38 -77.47  
2 1 ASN T 79  ? ? 88.32   -9.79   
3 1 ASN T 115 ? ? -154.67 -156.54 
4 1 SER T 150 ? ? -165.19 104.72  
5 1 THR T 177 ? ? -45.28  -6.26   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 'CALCIUM ION' CA  
4 BENZAMIDINE   BEN 
5 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1  600  600  SO4 SO4 T . 
C 3 CA  1  480  480  CA  CA  T . 
D 4 BEN 1  1    1    BEN BEN T . 
E 5 HOH 1  406  406  HOH TIP T . 
E 5 HOH 2  408  408  HOH TIP T . 
E 5 HOH 3  410  410  HOH TIP T . 
E 5 HOH 4  412  412  HOH TIP T . 
E 5 HOH 5  415  415  HOH TIP T . 
E 5 HOH 6  416  416  HOH TIP T . 
E 5 HOH 7  429  429  HOH TIP T . 
E 5 HOH 8  430  430  HOH TIP T . 
E 5 HOH 9  457  457  HOH TIP T . 
E 5 HOH 10 470  470  HOH TIP T . 
E 5 HOH 11 473  473  HOH TIP T . 
E 5 HOH 12 516  516  HOH TIP T . 
E 5 HOH 13 562  562  HOH TIP T . 
E 5 HOH 14 604  604  HOH TIP T . 
E 5 HOH 15 700  700  HOH TIP T . 
E 5 HOH 16 701  701  HOH TIP T . 
E 5 HOH 17 703  703  HOH TIP T . 
E 5 HOH 18 704  704  HOH TIP T . 
E 5 HOH 19 705  705  HOH TIP T . 
E 5 HOH 20 706  706  HOH TIP T . 
E 5 HOH 21 707  707  HOH TIP T . 
E 5 HOH 22 708  708  HOH TIP T . 
E 5 HOH 23 709  709  HOH TIP T . 
E 5 HOH 24 711  711  HOH TIP T . 
E 5 HOH 25 714  714  HOH TIP T . 
E 5 HOH 26 715  715  HOH TIP T . 
E 5 HOH 27 716  716  HOH TIP T . 
E 5 HOH 28 717  717  HOH TIP T . 
E 5 HOH 29 718  718  HOH TIP T . 
E 5 HOH 30 721  721  HOH TIP T . 
E 5 HOH 31 722  722  HOH TIP T . 
E 5 HOH 32 736  736  HOH TIP T . 
E 5 HOH 33 746  746  HOH TIP T . 
E 5 HOH 34 764  764  HOH TIP T . 
E 5 HOH 35 769  769  HOH TIP T . 
E 5 HOH 36 772  772  HOH TIP T . 
E 5 HOH 37 781  781  HOH TIP T . 
E 5 HOH 38 783  783  HOH TIP T . 
E 5 HOH 39 784  784  HOH TIP T . 
E 5 HOH 40 785  785  HOH TIP T . 
E 5 HOH 41 793  793  HOH TIP T . 
E 5 HOH 42 829  829  HOH TIP T . 
E 5 HOH 43 834  834  HOH TIP T . 
E 5 HOH 44 1213 1213 HOH TIP T . 
E 5 HOH 45 1228 1228 HOH TIP T . 
E 5 HOH 46 1240 1240 HOH TIP T . 
E 5 HOH 47 1245 1245 HOH TIP T . 
E 5 HOH 48 1250 1250 HOH TIP T . 
E 5 HOH 49 1354 1354 HOH TIP T . 
E 5 HOH 50 4014 4014 HOH TIP T . 
E 5 HOH 51 4018 4018 HOH TIP T . 
#