data_1V8K
# 
_entry.id   1V8K 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1V8K         
RCSB  RCSB006341   
WWPDB D_1000006341 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1V8J 
_pdbx_database_related.details        'Complexed with Mg-ADP' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1V8K 
_pdbx_database_status.recvd_initial_deposition_date   2004-01-09 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ogawa, T.'    1 
'Nitta, R.'    2 
'Okada, Y.'    3 
'Hirokawa, N.' 4 
# 
_citation.id                        primary 
_citation.title                     
;A common mechanism for microtubule destabilizers-M type kinesins stabilize curling of the protofilament using the class-specific neck and loops.
;
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            116 
_citation.page_first                591 
_citation.page_last                 602 
_citation.year                      2004 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   14980225 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(04)00129-1' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ogawa, T.'    1 
primary 'Nitta, R.'    2 
primary 'Okada, Y.'    3 
primary 'Hirokawa, N.' 4 
# 
_cell.entry_id           1V8K 
_cell.length_a           61.068 
_cell.length_b           191.475 
_cell.length_c           74.627 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1V8K 
_symmetry.space_group_name_H-M             'C 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                21 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Kinesin-like protein KIF2C'                  46802.711 1   ? ? 'RESIDUES 1-403' ? 
2 non-polymer syn 'MAGNESIUM ION'                               24.305    1   ? ? ?                ? 
3 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196   1   ? ? ?                ? 
4 water       nat water                                         18.015    111 ? ? ?                ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Mitotic centromere-associated kinesin, MCAK' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SVRRKSCIVKEMEKMKNKREEKRAQNSELRIKRAQEYDSSFPNWEFARMIKEFRVTMECSPLTVTDPIEEHRICVCVRKR
PLNKQELAKKEIDVISVPSKCLLLVHEPKLKVDLTKYLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFA
YGQTGSGKTHTMGGDLSGKSQNASKGIYAMASRDVFLLKNQPRYRNLNLEVYVTFFEIYNGKVFDLLNKKAKLRVLEDSR
QQVQVVGLQEYLVTCADDVIKMINMGSACRTSGQTFANSNSSRSHACFQILLRTKGRLHGKFSLVDLAGNERGADTSSAD
RQTRMEGAEINKSLLALKECIRALGQNKAHTPFRESKLTQVLRDSFIGENSRTCMIAMISPGISSCEYTLNTLRYADRVK
ELSHHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SVRRKSCIVKEMEKMKNKREEKRAQNSELRIKRAQEYDSSFPNWEFARMIKEFRVTMECSPLTVTDPIEEHRICVCVRKR
PLNKQELAKKEIDVISVPSKCLLLVHEPKLKVDLTKYLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFA
YGQTGSGKTHTMGGDLSGKSQNASKGIYAMASRDVFLLKNQPRYRNLNLEVYVTFFEIYNGKVFDLLNKKAKLRVLEDSR
QQVQVVGLQEYLVTCADDVIKMINMGSACRTSGQTFANSNSSRSHACFQILLRTKGRLHGKFSLVDLAGNERGADTSSAD
RQTRMEGAEINKSLLALKECIRALGQNKAHTPFRESKLTQVLRDSFIGENSRTCMIAMISPGISSCEYTLNTLRYADRVK
ELSHHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   VAL n 
1 3   ARG n 
1 4   ARG n 
1 5   LYS n 
1 6   SER n 
1 7   CYS n 
1 8   ILE n 
1 9   VAL n 
1 10  LYS n 
1 11  GLU n 
1 12  MET n 
1 13  GLU n 
1 14  LYS n 
1 15  MET n 
1 16  LYS n 
1 17  ASN n 
1 18  LYS n 
1 19  ARG n 
1 20  GLU n 
1 21  GLU n 
1 22  LYS n 
1 23  ARG n 
1 24  ALA n 
1 25  GLN n 
1 26  ASN n 
1 27  SER n 
1 28  GLU n 
1 29  LEU n 
1 30  ARG n 
1 31  ILE n 
1 32  LYS n 
1 33  ARG n 
1 34  ALA n 
1 35  GLN n 
1 36  GLU n 
1 37  TYR n 
1 38  ASP n 
1 39  SER n 
1 40  SER n 
1 41  PHE n 
1 42  PRO n 
1 43  ASN n 
1 44  TRP n 
1 45  GLU n 
1 46  PHE n 
1 47  ALA n 
1 48  ARG n 
1 49  MET n 
1 50  ILE n 
1 51  LYS n 
1 52  GLU n 
1 53  PHE n 
1 54  ARG n 
1 55  VAL n 
1 56  THR n 
1 57  MET n 
1 58  GLU n 
1 59  CYS n 
1 60  SER n 
1 61  PRO n 
1 62  LEU n 
1 63  THR n 
1 64  VAL n 
1 65  THR n 
1 66  ASP n 
1 67  PRO n 
1 68  ILE n 
1 69  GLU n 
1 70  GLU n 
1 71  HIS n 
1 72  ARG n 
1 73  ILE n 
1 74  CYS n 
1 75  VAL n 
1 76  CYS n 
1 77  VAL n 
1 78  ARG n 
1 79  LYS n 
1 80  ARG n 
1 81  PRO n 
1 82  LEU n 
1 83  ASN n 
1 84  LYS n 
1 85  GLN n 
1 86  GLU n 
1 87  LEU n 
1 88  ALA n 
1 89  LYS n 
1 90  LYS n 
1 91  GLU n 
1 92  ILE n 
1 93  ASP n 
1 94  VAL n 
1 95  ILE n 
1 96  SER n 
1 97  VAL n 
1 98  PRO n 
1 99  SER n 
1 100 LYS n 
1 101 CYS n 
1 102 LEU n 
1 103 LEU n 
1 104 LEU n 
1 105 VAL n 
1 106 HIS n 
1 107 GLU n 
1 108 PRO n 
1 109 LYS n 
1 110 LEU n 
1 111 LYS n 
1 112 VAL n 
1 113 ASP n 
1 114 LEU n 
1 115 THR n 
1 116 LYS n 
1 117 TYR n 
1 118 LEU n 
1 119 GLU n 
1 120 ASN n 
1 121 GLN n 
1 122 ALA n 
1 123 PHE n 
1 124 CYS n 
1 125 PHE n 
1 126 ASP n 
1 127 PHE n 
1 128 ALA n 
1 129 PHE n 
1 130 ASP n 
1 131 GLU n 
1 132 THR n 
1 133 ALA n 
1 134 SER n 
1 135 ASN n 
1 136 GLU n 
1 137 VAL n 
1 138 VAL n 
1 139 TYR n 
1 140 ARG n 
1 141 PHE n 
1 142 THR n 
1 143 ALA n 
1 144 ARG n 
1 145 PRO n 
1 146 LEU n 
1 147 VAL n 
1 148 GLN n 
1 149 THR n 
1 150 ILE n 
1 151 PHE n 
1 152 GLU n 
1 153 GLY n 
1 154 GLY n 
1 155 LYS n 
1 156 ALA n 
1 157 THR n 
1 158 CYS n 
1 159 PHE n 
1 160 ALA n 
1 161 TYR n 
1 162 GLY n 
1 163 GLN n 
1 164 THR n 
1 165 GLY n 
1 166 SER n 
1 167 GLY n 
1 168 LYS n 
1 169 THR n 
1 170 HIS n 
1 171 THR n 
1 172 MET n 
1 173 GLY n 
1 174 GLY n 
1 175 ASP n 
1 176 LEU n 
1 177 SER n 
1 178 GLY n 
1 179 LYS n 
1 180 SER n 
1 181 GLN n 
1 182 ASN n 
1 183 ALA n 
1 184 SER n 
1 185 LYS n 
1 186 GLY n 
1 187 ILE n 
1 188 TYR n 
1 189 ALA n 
1 190 MET n 
1 191 ALA n 
1 192 SER n 
1 193 ARG n 
1 194 ASP n 
1 195 VAL n 
1 196 PHE n 
1 197 LEU n 
1 198 LEU n 
1 199 LYS n 
1 200 ASN n 
1 201 GLN n 
1 202 PRO n 
1 203 ARG n 
1 204 TYR n 
1 205 ARG n 
1 206 ASN n 
1 207 LEU n 
1 208 ASN n 
1 209 LEU n 
1 210 GLU n 
1 211 VAL n 
1 212 TYR n 
1 213 VAL n 
1 214 THR n 
1 215 PHE n 
1 216 PHE n 
1 217 GLU n 
1 218 ILE n 
1 219 TYR n 
1 220 ASN n 
1 221 GLY n 
1 222 LYS n 
1 223 VAL n 
1 224 PHE n 
1 225 ASP n 
1 226 LEU n 
1 227 LEU n 
1 228 ASN n 
1 229 LYS n 
1 230 LYS n 
1 231 ALA n 
1 232 LYS n 
1 233 LEU n 
1 234 ARG n 
1 235 VAL n 
1 236 LEU n 
1 237 GLU n 
1 238 ASP n 
1 239 SER n 
1 240 ARG n 
1 241 GLN n 
1 242 GLN n 
1 243 VAL n 
1 244 GLN n 
1 245 VAL n 
1 246 VAL n 
1 247 GLY n 
1 248 LEU n 
1 249 GLN n 
1 250 GLU n 
1 251 TYR n 
1 252 LEU n 
1 253 VAL n 
1 254 THR n 
1 255 CYS n 
1 256 ALA n 
1 257 ASP n 
1 258 ASP n 
1 259 VAL n 
1 260 ILE n 
1 261 LYS n 
1 262 MET n 
1 263 ILE n 
1 264 ASN n 
1 265 MET n 
1 266 GLY n 
1 267 SER n 
1 268 ALA n 
1 269 CYS n 
1 270 ARG n 
1 271 THR n 
1 272 SER n 
1 273 GLY n 
1 274 GLN n 
1 275 THR n 
1 276 PHE n 
1 277 ALA n 
1 278 ASN n 
1 279 SER n 
1 280 ASN n 
1 281 SER n 
1 282 SER n 
1 283 ARG n 
1 284 SER n 
1 285 HIS n 
1 286 ALA n 
1 287 CYS n 
1 288 PHE n 
1 289 GLN n 
1 290 ILE n 
1 291 LEU n 
1 292 LEU n 
1 293 ARG n 
1 294 THR n 
1 295 LYS n 
1 296 GLY n 
1 297 ARG n 
1 298 LEU n 
1 299 HIS n 
1 300 GLY n 
1 301 LYS n 
1 302 PHE n 
1 303 SER n 
1 304 LEU n 
1 305 VAL n 
1 306 ASP n 
1 307 LEU n 
1 308 ALA n 
1 309 GLY n 
1 310 ASN n 
1 311 GLU n 
1 312 ARG n 
1 313 GLY n 
1 314 ALA n 
1 315 ASP n 
1 316 THR n 
1 317 SER n 
1 318 SER n 
1 319 ALA n 
1 320 ASP n 
1 321 ARG n 
1 322 GLN n 
1 323 THR n 
1 324 ARG n 
1 325 MET n 
1 326 GLU n 
1 327 GLY n 
1 328 ALA n 
1 329 GLU n 
1 330 ILE n 
1 331 ASN n 
1 332 LYS n 
1 333 SER n 
1 334 LEU n 
1 335 LEU n 
1 336 ALA n 
1 337 LEU n 
1 338 LYS n 
1 339 GLU n 
1 340 CYS n 
1 341 ILE n 
1 342 ARG n 
1 343 ALA n 
1 344 LEU n 
1 345 GLY n 
1 346 GLN n 
1 347 ASN n 
1 348 LYS n 
1 349 ALA n 
1 350 HIS n 
1 351 THR n 
1 352 PRO n 
1 353 PHE n 
1 354 ARG n 
1 355 GLU n 
1 356 SER n 
1 357 LYS n 
1 358 LEU n 
1 359 THR n 
1 360 GLN n 
1 361 VAL n 
1 362 LEU n 
1 363 ARG n 
1 364 ASP n 
1 365 SER n 
1 366 PHE n 
1 367 ILE n 
1 368 GLY n 
1 369 GLU n 
1 370 ASN n 
1 371 SER n 
1 372 ARG n 
1 373 THR n 
1 374 CYS n 
1 375 MET n 
1 376 ILE n 
1 377 ALA n 
1 378 MET n 
1 379 ILE n 
1 380 SER n 
1 381 PRO n 
1 382 GLY n 
1 383 ILE n 
1 384 SER n 
1 385 SER n 
1 386 CYS n 
1 387 GLU n 
1 388 TYR n 
1 389 THR n 
1 390 LEU n 
1 391 ASN n 
1 392 THR n 
1 393 LEU n 
1 394 ARG n 
1 395 TYR n 
1 396 ALA n 
1 397 ASP n 
1 398 ARG n 
1 399 VAL n 
1 400 LYS n 
1 401 GLU n 
1 402 LEU n 
1 403 SER n 
1 404 HIS n 
1 405 HIS n 
1 406 HIS n 
1 407 HIS n 
1 408 HIS n 
1 409 HIS n 
1 410 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 KIF2C 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET21b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KIF2C_MOUSE 
_struct_ref.pdbx_db_accession          Q922S8 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SVRRKSCIVKEMEKMKNKREEKRAQNSELRIKRAQEYDSSFPNWEFARMIKEFRVTMECSPLTVTDPIEEHRICVCVRKR
PLNKQELAKKEIDVISVPSKCLLLVHEPKLKVDLTKYLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFA
YGQTGSGKTHTMGGDLSGKSQNASKGIYAMASRDVFLLKNQPRYRNLNLEVYVTFFEIYNGKVFDLLNKKAKLRVLEDSR
QQVQVVGLQEYLVTCADDVIKMINMGSACRTSGQTFANSNSSRSHACFQILLRTKGRLHGKFSLVDLAGNERGADTSSAD
RQTRMEGAEINKSLLALKECIRALGQNKAHTPFRESKLTQVLRDSFIGENSRTCMIAMISPGISSCEYTLNTLRYADRVK
ELS
;
_struct_ref.pdbx_align_begin           183 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1V8K 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 403 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q922S8 
_struct_ref_seq.db_align_beg                  183 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  585 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       403 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1V8K HIS A 404 ? UNP Q922S8 ? ? 'EXPRESSION TAG' 404 1 
1 1V8K HIS A 405 ? UNP Q922S8 ? ? 'EXPRESSION TAG' 405 2 
1 1V8K HIS A 406 ? UNP Q922S8 ? ? 'EXPRESSION TAG' 406 3 
1 1V8K HIS A 407 ? UNP Q922S8 ? ? 'EXPRESSION TAG' 407 4 
1 1V8K HIS A 408 ? UNP Q922S8 ? ? 'EXPRESSION TAG' 408 5 
1 1V8K HIS A 409 ? UNP Q922S8 ? ? 'EXPRESSION TAG' 409 6 
1 1V8K HIS A 410 ? UNP Q922S8 ? ? 'EXPRESSION TAG' 410 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ANP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ? 'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                         ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1V8K 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.81 
_exptl_crystal.density_percent_sol   55.88 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            297.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'potassium sodium tartrate tetrahydrate, MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 297.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           95.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210' 
_diffrn_detector.pdbx_collection_date   2003-06-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double flat Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9800 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE AR-NW12A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   AR-NW12A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9800 
# 
_reflns.entry_id                     1V8K 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             47.9 
_reflns.d_resolution_high            2.24 
_reflns.number_obs                   20584 
_reflns.number_all                   21219 
_reflns.percent_possible_obs         96.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        32.2 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.25 
_reflns_shell.d_res_low              2.39 
_reflns_shell.percent_possible_all   86.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1V8K 
_refine.ls_number_reflns_obs                     20437 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               979129.57 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             23.94 
_refine.ls_d_res_high                            2.25 
_refine.ls_percent_reflns_obs                    96.2 
_refine.ls_R_factor_obs                          0.215 
_refine.ls_R_factor_all                          0.238 
_refine.ls_R_factor_R_work                       0.215 
_refine.ls_R_factor_R_free                       0.252 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.8 
_refine.ls_number_reflns_R_free                  2004 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               51.6 
_refine.aniso_B[1][1]                            -0.84 
_refine.aniso_B[2][2]                            -15.81 
_refine.aniso_B[3][3]                            16.65 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.379531 
_refine.solvent_model_param_bsol                 58.4229 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1V8K 
_refine_analyze.Luzzati_coordinate_error_obs    0.27 
_refine_analyze.Luzzati_sigma_a_obs             0.26 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.33 
_refine_analyze.Luzzati_sigma_a_free            0.33 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2630 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         32 
_refine_hist.number_atoms_solvent             111 
_refine_hist.number_atoms_total               2773 
_refine_hist.d_res_high                       2.25 
_refine_hist.d_res_low                        23.94 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.009 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.7   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 24.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.27  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        3.17  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       4.57  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        5.24  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       6.80  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.25 
_refine_ls_shell.d_res_low                        2.39 
_refine_ls_shell.number_reflns_R_work             2715 
_refine_ls_shell.R_factor_R_work                  0.265 
_refine_ls_shell.percent_reflns_obs               86.6 
_refine_ls_shell.R_factor_R_free                  0.292 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            9.7 
_refine_ls_shell.number_reflns_R_free             290 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP   'X-RAY DIFFRACTION' 
2 ANP.PARAM         ANP.TOP       'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP       'X-RAY DIFFRACTION' 
4 WATER_REP.PARAM   WATER_REP.TOP 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1V8K 
_struct.title                     
'The Crystal Structure of the Minimal Functional Domain of the Microtubule Destabilizer KIF2C Complexed with Mg-AMPPNP' 
_struct.pdbx_descriptor           'Kinesin-like protein KIF2C' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1V8K 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            'Kinesin-Like Protein, Microtubule Destabilizer, STRUCTURAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 43  ? GLU A 58  ? ASN A 43  GLU A 58  1 ? 16 
HELX_P HELX_P2  2  ASN A 83  ? LYS A 89  ? ASN A 83  LYS A 89  1 ? 7  
HELX_P HELX_P3  3  SER A 134 ? THR A 142 ? SER A 134 THR A 142 1 ? 9  
HELX_P HELX_P4  4  ALA A 143 ? PRO A 145 ? ALA A 143 PRO A 145 5 ? 3  
HELX_P HELX_P5  5  LEU A 146 ? GLU A 152 ? LEU A 146 GLU A 152 1 ? 7  
HELX_P HELX_P6  6  GLY A 167 ? GLY A 174 ? GLY A 167 GLY A 174 1 ? 8  
HELX_P HELX_P7  7  ASN A 182 ? LYS A 185 ? ASN A 182 LYS A 185 5 ? 4  
HELX_P HELX_P8  8  GLY A 186 ? ASN A 200 ? GLY A 186 ASN A 200 1 ? 15 
HELX_P HELX_P9  9  GLN A 201 ? ASN A 206 ? GLN A 201 ASN A 206 1 ? 6  
HELX_P HELX_P10 10 CYS A 255 ? CYS A 269 ? CYS A 255 CYS A 269 1 ? 15 
HELX_P HELX_P11 11 GLU A 326 ? GLY A 345 ? GLU A 326 GLY A 345 1 ? 20 
HELX_P HELX_P12 12 SER A 356 ? LEU A 362 ? SER A 356 LEU A 362 1 ? 7  
HELX_P HELX_P13 13 ARG A 363 ? GLY A 368 ? ARG A 363 GLY A 368 1 ? 6  
HELX_P HELX_P14 14 GLY A 382 ? SER A 384 ? GLY A 382 SER A 384 5 ? 3  
HELX_P HELX_P15 15 SER A 385 ? GLU A 401 ? SER A 385 GLU A 401 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MG . MG ? ? ? 1_555 C ANP .   O1B ? ? A MG 501 A ANP 500 1_555 ? ? ? ? ? ? ? 2.124 ? 
metalc2 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .   O   ? ? A MG 501 A HOH 668 1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc3 metalc ? ? B MG . MG ? ? ? 1_555 C ANP .   O2G ? ? A MG 501 A ANP 500 1_555 ? ? ? ? ? ? ? 2.253 ? 
metalc4 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .   O   ? ? A MG 501 A HOH 667 1_555 ? ? ? ? ? ? ? 2.228 ? 
metalc5 metalc ? ? B MG . MG ? ? ? 1_555 A THR 169 OG1 ? ? A MG 501 A THR 169 1_555 ? ? ? ? ? ? ? 2.086 ? 
metalc6 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .   O   ? ? A MG 501 A HOH 673 1_555 ? ? ? ? ? ? ? 2.273 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 10 ? 
B ? 8  ? 
C ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? parallel      
A 2 3  ? parallel      
A 3 4  ? parallel      
A 4 5  ? parallel      
A 5 6  ? anti-parallel 
A 6 7  ? anti-parallel 
A 7 8  ? anti-parallel 
A 8 9  ? anti-parallel 
A 9 10 ? anti-parallel 
B 1 2  ? parallel      
B 2 3  ? parallel      
B 3 4  ? parallel      
B 4 5  ? parallel      
B 5 6  ? anti-parallel 
B 6 7  ? anti-parallel 
B 7 8  ? anti-parallel 
C 1 2  ? anti-parallel 
C 2 3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  PHE A 127 ? PHE A 129 ? PHE A 127 PHE A 129 
A 2  ILE A 73  ? LYS A 79  ? ILE A 73  LYS A 79  
A 3  SER A 371 ? ILE A 379 ? SER A 371 ILE A 379 
A 4  LYS A 155 ? GLY A 162 ? LYS A 155 GLY A 162 
A 5  LEU A 298 ? ASP A 306 ? LEU A 298 ASP A 306 
A 6  HIS A 285 ? ARG A 293 ? HIS A 285 ARG A 293 
A 7  GLU A 210 ? TYR A 219 ? GLU A 210 TYR A 219 
A 8  LYS A 222 ? ASP A 225 ? LYS A 222 ASP A 225 
A 9  LYS A 232 ? GLU A 237 ? LYS A 232 GLU A 237 
A 10 VAL A 243 ? VAL A 246 ? VAL A 243 VAL A 246 
B 1  PHE A 127 ? PHE A 129 ? PHE A 127 PHE A 129 
B 2  ILE A 73  ? LYS A 79  ? ILE A 73  LYS A 79  
B 3  SER A 371 ? ILE A 379 ? SER A 371 ILE A 379 
B 4  LYS A 155 ? GLY A 162 ? LYS A 155 GLY A 162 
B 5  LEU A 298 ? ASP A 306 ? LEU A 298 ASP A 306 
B 6  HIS A 285 ? ARG A 293 ? HIS A 285 ARG A 293 
B 7  GLU A 210 ? TYR A 219 ? GLU A 210 TYR A 219 
B 8  TYR A 251 ? VAL A 253 ? TYR A 251 VAL A 253 
C 1  ILE A 95  ? SER A 96  ? ILE A 95  SER A 96  
C 2  LEU A 102 ? LEU A 110 ? LEU A 102 LEU A 110 
C 3  LYS A 116 ? CYS A 124 ? LYS A 116 CYS A 124 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  O PHE A 129 ? O PHE A 129 N VAL A 77  ? N VAL A 77  
A 2 3  N CYS A 76  ? N CYS A 76  O ALA A 377 ? O ALA A 377 
A 3 4  O MET A 378 ? O MET A 378 N TYR A 161 ? N TYR A 161 
A 4 5  N CYS A 158 ? N CYS A 158 O VAL A 305 ? O VAL A 305 
A 5 6  O HIS A 299 ? O HIS A 299 N LEU A 292 ? N LEU A 292 
A 6 7  O ARG A 293 ? O ARG A 293 N GLU A 210 ? N GLU A 210 
A 7 8  N TYR A 219 ? N TYR A 219 O LYS A 222 ? O LYS A 222 
A 8 9  N VAL A 223 ? N VAL A 223 O LEU A 233 ? O LEU A 233 
A 9 10 N LEU A 236 ? N LEU A 236 O GLN A 244 ? O GLN A 244 
B 1 2  O PHE A 129 ? O PHE A 129 N VAL A 77  ? N VAL A 77  
B 2 3  N CYS A 76  ? N CYS A 76  O ALA A 377 ? O ALA A 377 
B 3 4  O MET A 378 ? O MET A 378 N TYR A 161 ? N TYR A 161 
B 4 5  N CYS A 158 ? N CYS A 158 O VAL A 305 ? O VAL A 305 
B 5 6  O HIS A 299 ? O HIS A 299 N LEU A 292 ? N LEU A 292 
B 6 7  O ARG A 293 ? O ARG A 293 N GLU A 210 ? N GLU A 210 
B 7 8  N VAL A 213 ? N VAL A 213 O TYR A 251 ? O TYR A 251 
C 1 2  N SER A 96  ? N SER A 96  O LEU A 104 ? O LEU A 104 
C 2 3  N LEU A 103 ? N LEU A 103 O PHE A 123 ? O PHE A 123 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 501'  
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE ANP A 500' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  THR A 169 ? THR A 169 . ? 1_555 ? 
2  AC1 5  ANP C .   ? ANP A 500 . ? 1_555 ? 
3  AC1 5  HOH D .   ? HOH A 667 . ? 1_555 ? 
4  AC1 5  HOH D .   ? HOH A 668 . ? 1_555 ? 
5  AC1 5  HOH D .   ? HOH A 673 . ? 1_555 ? 
6  AC2 17 ARG A 78  ? ARG A 78  . ? 1_555 ? 
7  AC2 17 THR A 164 ? THR A 164 . ? 1_555 ? 
8  AC2 17 GLY A 165 ? GLY A 165 . ? 1_555 ? 
9  AC2 17 SER A 166 ? SER A 166 . ? 1_555 ? 
10 AC2 17 GLY A 167 ? GLY A 167 . ? 1_555 ? 
11 AC2 17 LYS A 168 ? LYS A 168 . ? 1_555 ? 
12 AC2 17 THR A 169 ? THR A 169 . ? 1_555 ? 
13 AC2 17 HIS A 170 ? HIS A 170 . ? 1_555 ? 
14 AC2 17 LEU A 176 ? LEU A 176 . ? 1_555 ? 
15 AC2 17 SER A 281 ? SER A 281 . ? 1_555 ? 
16 AC2 17 SER A 282 ? SER A 282 . ? 1_555 ? 
17 AC2 17 MG  B .   ? MG  A 501 . ? 1_555 ? 
18 AC2 17 HOH D .   ? HOH A 608 . ? 1_555 ? 
19 AC2 17 HOH D .   ? HOH A 667 . ? 1_555 ? 
20 AC2 17 HOH D .   ? HOH A 673 . ? 1_555 ? 
21 AC2 17 HOH D .   ? HOH A 682 . ? 1_555 ? 
22 AC2 17 HOH D .   ? HOH A 705 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1V8K 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1V8K 
_atom_sites.fract_transf_matrix[1][1]   0.016375 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005223 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013400 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PRO A 1 42  ? -83.219 85.813  -28.610 1.00 75.33 ? 42  PRO A N     1 
ATOM   2    C  CA    . PRO A 1 42  ? -82.766 86.956  -29.444 1.00 76.73 ? 42  PRO A CA    1 
ATOM   3    C  C     . PRO A 1 42  ? -81.246 86.925  -29.599 1.00 74.45 ? 42  PRO A C     1 
ATOM   4    O  O     . PRO A 1 42  ? -80.723 86.497  -30.631 1.00 76.92 ? 42  PRO A O     1 
ATOM   5    C  CB    . PRO A 1 42  ? -83.221 88.226  -28.736 1.00 77.98 ? 42  PRO A CB    1 
ATOM   6    C  CG    . PRO A 1 42  ? -84.438 87.714  -27.958 1.00 73.67 ? 42  PRO A CG    1 
ATOM   7    C  CD    . PRO A 1 42  ? -84.038 86.304  -27.487 1.00 74.36 ? 42  PRO A CD    1 
ATOM   8    N  N     . ASN A 1 43  ? -80.548 87.390  -28.567 1.00 66.26 ? 43  ASN A N     1 
ATOM   9    C  CA    . ASN A 1 43  ? -79.088 87.401  -28.545 1.00 58.13 ? 43  ASN A CA    1 
ATOM   10   C  C     . ASN A 1 43  ? -78.639 86.623  -27.315 1.00 53.31 ? 43  ASN A C     1 
ATOM   11   O  O     . ASN A 1 43  ? -77.718 87.031  -26.608 1.00 54.42 ? 43  ASN A O     1 
ATOM   12   C  CB    . ASN A 1 43  ? -78.560 88.835  -28.465 1.00 54.50 ? 43  ASN A CB    1 
ATOM   13   C  CG    . ASN A 1 43  ? -78.725 89.593  -29.767 1.00 56.84 ? 43  ASN A CG    1 
ATOM   14   O  OD1   . ASN A 1 43  ? -78.150 89.220  -30.789 1.00 61.26 ? 43  ASN A OD1   1 
ATOM   15   N  ND2   . ASN A 1 43  ? -79.505 90.667  -29.735 1.00 57.19 ? 43  ASN A ND2   1 
ATOM   16   N  N     . TRP A 1 44  ? -79.293 85.495  -27.068 1.00 54.56 ? 44  TRP A N     1 
ATOM   17   C  CA    . TRP A 1 44  ? -78.972 84.683  -25.910 1.00 49.41 ? 44  TRP A CA    1 
ATOM   18   C  C     . TRP A 1 44  ? -77.518 84.238  -25.856 1.00 43.13 ? 44  TRP A C     1 
ATOM   19   O  O     . TRP A 1 44  ? -76.939 84.145  -24.771 1.00 49.91 ? 44  TRP A O     1 
ATOM   20   C  CB    . TRP A 1 44  ? -79.884 83.455  -25.843 1.00 51.04 ? 44  TRP A CB    1 
ATOM   21   C  CG    . TRP A 1 44  ? -79.641 82.463  -26.914 1.00 55.14 ? 44  TRP A CG    1 
ATOM   22   C  CD1   . TRP A 1 44  ? -80.124 82.498  -28.196 1.00 57.59 ? 44  TRP A CD1   1 
ATOM   23   C  CD2   . TRP A 1 44  ? -78.833 81.289  -26.826 1.00 59.16 ? 44  TRP A CD2   1 
ATOM   24   N  NE1   . TRP A 1 44  ? -79.667 81.414  -28.907 1.00 55.89 ? 44  TRP A NE1   1 
ATOM   25   C  CE2   . TRP A 1 44  ? -78.869 80.648  -28.085 1.00 61.50 ? 44  TRP A CE2   1 
ATOM   26   C  CE3   . TRP A 1 44  ? -78.079 80.701  -25.794 1.00 60.62 ? 44  TRP A CE3   1 
ATOM   27   C  CZ2   . TRP A 1 44  ? -78.178 79.464  -28.356 1.00 65.81 ? 44  TRP A CZ2   1 
ATOM   28   C  CZ3   . TRP A 1 44  ? -77.388 79.519  -26.058 1.00 63.76 ? 44  TRP A CZ3   1 
ATOM   29   C  CH2   . TRP A 1 44  ? -77.447 78.911  -27.328 1.00 69.54 ? 44  TRP A CH2   1 
ATOM   30   N  N     . GLU A 1 45  ? -76.926 83.961  -27.013 1.00 41.35 ? 45  GLU A N     1 
ATOM   31   C  CA    . GLU A 1 45  ? -75.534 83.517  -27.057 1.00 41.88 ? 45  GLU A CA    1 
ATOM   32   C  C     . GLU A 1 45  ? -74.616 84.577  -26.480 1.00 41.02 ? 45  GLU A C     1 
ATOM   33   O  O     . GLU A 1 45  ? -73.745 84.276  -25.683 1.00 38.36 ? 45  GLU A O     1 
ATOM   34   C  CB    . GLU A 1 45  ? -75.117 83.208  -28.490 1.00 49.25 ? 45  GLU A CB    1 
ATOM   35   C  CG    . GLU A 1 45  ? -75.695 81.924  -29.043 1.00 62.11 ? 45  GLU A CG    1 
ATOM   36   C  CD    . GLU A 1 45  ? -75.447 81.785  -30.532 1.00 70.01 ? 45  GLU A CD    1 
ATOM   37   O  OE1   . GLU A 1 45  ? -76.243 82.335  -31.327 1.00 69.90 ? 45  GLU A OE1   1 
ATOM   38   O  OE2   . GLU A 1 45  ? -74.445 81.139  -30.905 1.00 75.13 ? 45  GLU A OE2   1 
ATOM   39   N  N     . PHE A 1 46  ? -74.802 85.816  -26.906 1.00 37.26 ? 46  PHE A N     1 
ATOM   40   C  CA    . PHE A 1 46  ? -74.005 86.914  -26.400 1.00 37.24 ? 46  PHE A CA    1 
ATOM   41   C  C     . PHE A 1 46  ? -74.281 87.086  -24.901 1.00 36.31 ? 46  PHE A C     1 
ATOM   42   O  O     . PHE A 1 46  ? -73.365 87.355  -24.132 1.00 33.35 ? 46  PHE A O     1 
ATOM   43   C  CB    . PHE A 1 46  ? -74.356 88.216  -27.130 1.00 37.70 ? 46  PHE A CB    1 
ATOM   44   C  CG    . PHE A 1 46  ? -73.814 88.298  -28.531 1.00 38.11 ? 46  PHE A CG    1 
ATOM   45   C  CD1   . PHE A 1 46  ? -72.465 88.031  -28.789 1.00 32.05 ? 46  PHE A CD1   1 
ATOM   46   C  CD2   . PHE A 1 46  ? -74.644 88.645  -29.593 1.00 32.84 ? 46  PHE A CD2   1 
ATOM   47   C  CE1   . PHE A 1 46  ? -71.950 88.124  -30.086 1.00 34.51 ? 46  PHE A CE1   1 
ATOM   48   C  CE2   . PHE A 1 46  ? -74.137 88.741  -30.890 1.00 30.13 ? 46  PHE A CE2   1 
ATOM   49   C  CZ    . PHE A 1 46  ? -72.788 88.474  -31.138 1.00 33.57 ? 46  PHE A CZ    1 
ATOM   50   N  N     . ALA A 1 47  ? -75.548 86.947  -24.507 1.00 34.82 ? 47  ALA A N     1 
ATOM   51   C  CA    . ALA A 1 47  ? -75.946 87.086  -23.107 1.00 36.08 ? 47  ALA A CA    1 
ATOM   52   C  C     . ALA A 1 47  ? -75.224 86.048  -22.250 1.00 35.50 ? 47  ALA A C     1 
ATOM   53   O  O     . ALA A 1 47  ? -74.812 86.332  -21.124 1.00 35.18 ? 47  ALA A O     1 
ATOM   54   C  CB    . ALA A 1 47  ? -77.460 86.921  -22.972 1.00 34.83 ? 47  ALA A CB    1 
ATOM   55   N  N     . ARG A 1 48  ? -75.061 84.849  -22.795 1.00 36.80 ? 48  ARG A N     1 
ATOM   56   C  CA    . ARG A 1 48  ? -74.383 83.784  -22.082 1.00 37.37 ? 48  ARG A CA    1 
ATOM   57   C  C     . ARG A 1 48  ? -72.897 84.088  -21.883 1.00 36.63 ? 48  ARG A C     1 
ATOM   58   O  O     . ARG A 1 48  ? -72.347 83.890  -20.794 1.00 34.76 ? 48  ARG A O     1 
ATOM   59   C  CB    . ARG A 1 48  ? -74.553 82.462  -22.829 1.00 41.23 ? 48  ARG A CB    1 
ATOM   60   C  CG    . ARG A 1 48  ? -73.856 81.287  -22.159 1.00 51.10 ? 48  ARG A CG    1 
ATOM   61   C  CD    . ARG A 1 48  ? -74.196 79.968  -22.827 1.00 59.76 ? 48  ARG A CD    1 
ATOM   62   N  NE    . ARG A 1 48  ? -73.784 79.937  -24.227 1.00 75.23 ? 48  ARG A NE    1 
ATOM   63   C  CZ    . ARG A 1 48  ? -74.066 78.945  -25.068 1.00 80.43 ? 48  ARG A CZ    1 
ATOM   64   N  NH1   . ARG A 1 48  ? -74.762 77.893  -24.652 1.00 81.79 ? 48  ARG A NH1   1 
ATOM   65   N  NH2   . ARG A 1 48  ? -73.658 79.008  -26.331 1.00 80.31 ? 48  ARG A NH2   1 
ATOM   66   N  N     . MET A 1 49  ? -72.248 84.571  -22.938 1.00 34.53 ? 49  MET A N     1 
ATOM   67   C  CA    . MET A 1 49  ? -70.835 84.898  -22.877 1.00 37.73 ? 49  MET A CA    1 
ATOM   68   C  C     . MET A 1 49  ? -70.586 86.010  -21.867 1.00 38.82 ? 49  MET A C     1 
ATOM   69   O  O     . MET A 1 49  ? -69.594 86.023  -21.150 1.00 39.98 ? 49  MET A O     1 
ATOM   70   C  CB    . MET A 1 49  ? -70.389 85.348  -24.269 1.00 34.49 ? 49  MET A CB    1 
ATOM   71   C  CG    . MET A 1 49  ? -70.398 84.204  -25.285 1.00 43.00 ? 49  MET A CG    1 
ATOM   72   S  SD    . MET A 1 49  ? -69.652 84.678  -26.851 1.00 44.02 ? 49  MET A SD    1 
ATOM   73   C  CE    . MET A 1 49  ? -71.052 85.582  -27.528 1.00 43.35 ? 49  MET A CE    1 
ATOM   74   N  N     . ILE A 1 50  ? -71.502 86.972  -21.828 1.00 34.69 ? 50  ILE A N     1 
ATOM   75   C  CA    . ILE A 1 50  ? -71.387 88.098  -20.911 1.00 33.85 ? 50  ILE A CA    1 
ATOM   76   C  C     . ILE A 1 50  ? -71.596 87.673  -19.448 1.00 34.13 ? 50  ILE A C     1 
ATOM   77   O  O     . ILE A 1 50  ? -70.901 88.142  -18.544 1.00 30.19 ? 50  ILE A O     1 
ATOM   78   C  CB    . ILE A 1 50  ? -72.406 89.178  -21.254 1.00 35.48 ? 50  ILE A CB    1 
ATOM   79   C  CG1   . ILE A 1 50  ? -72.037 89.821  -22.590 1.00 30.37 ? 50  ILE A CG1   1 
ATOM   80   C  CG2   . ILE A 1 50  ? -72.466 90.219  -20.134 1.00 33.40 ? 50  ILE A CG2   1 
ATOM   81   C  CD1   . ILE A 1 50  ? -73.051 90.826  -23.102 1.00 28.11 ? 50  ILE A CD1   1 
ATOM   82   N  N     . LYS A 1 51  ? -72.556 86.789  -19.236 1.00 33.38 ? 51  LYS A N     1 
ATOM   83   C  CA    . LYS A 1 51  ? -72.857 86.289  -17.906 1.00 32.55 ? 51  LYS A CA    1 
ATOM   84   C  C     . LYS A 1 51  ? -71.678 85.472  -17.397 1.00 34.49 ? 51  LYS A C     1 
ATOM   85   O  O     . LYS A 1 51  ? -71.300 85.581  -16.241 1.00 34.09 ? 51  LYS A O     1 
ATOM   86   C  CB    . LYS A 1 51  ? -74.121 85.423  -17.932 1.00 36.80 ? 51  LYS A CB    1 
ATOM   87   C  CG    . LYS A 1 51  ? -74.485 84.865  -16.572 1.00 53.45 ? 51  LYS A CG    1 
ATOM   88   C  CD    . LYS A 1 51  ? -75.737 84.017  -16.607 1.00 61.71 ? 51  LYS A CD    1 
ATOM   89   C  CE    . LYS A 1 51  ? -75.877 83.263  -15.297 1.00 70.85 ? 51  LYS A CE    1 
ATOM   90   N  NZ    . LYS A 1 51  ? -75.590 84.165  -14.137 1.00 73.56 ? 51  LYS A NZ    1 
ATOM   91   N  N     . GLU A 1 52  ? -71.085 84.656  -18.261 1.00 28.57 ? 52  GLU A N     1 
ATOM   92   C  CA    . GLU A 1 52  ? -69.928 83.867  -17.875 1.00 33.03 ? 52  GLU A CA    1 
ATOM   93   C  C     . GLU A 1 52  ? -68.775 84.771  -17.454 1.00 35.87 ? 52  GLU A C     1 
ATOM   94   O  O     . GLU A 1 52  ? -68.017 84.470  -16.541 1.00 31.05 ? 52  GLU A O     1 
ATOM   95   C  CB    . GLU A 1 52  ? -69.511 83.013  -19.073 1.00 40.96 ? 52  GLU A CB    1 
ATOM   96   C  CG    . GLU A 1 52  ? -70.157 81.627  -19.054 1.00 61.26 ? 52  GLU A CG    1 
ATOM   97   C  CD    . GLU A 1 52  ? -70.052 81.008  -20.429 1.00 70.52 ? 52  GLU A CD    1 
ATOM   98   O  OE1   . GLU A 1 52  ? -69.149 81.372  -21.169 1.00 79.17 ? 52  GLU A OE1   1 
ATOM   99   O  OE2   . GLU A 1 52  ? -70.883 80.159  -20.752 1.00 75.53 ? 52  GLU A OE2   1 
ATOM   100  N  N     . PHE A 1 53  ? -68.608 85.882  -18.168 1.00 36.50 ? 53  PHE A N     1 
ATOM   101  C  CA    . PHE A 1 53  ? -67.522 86.823  -17.895 1.00 34.28 ? 53  PHE A CA    1 
ATOM   102  C  C     . PHE A 1 53  ? -67.778 87.478  -16.531 1.00 32.06 ? 53  PHE A C     1 
ATOM   103  O  O     . PHE A 1 53  ? -66.864 87.669  -15.724 1.00 35.48 ? 53  PHE A O     1 
ATOM   104  C  CB    . PHE A 1 53  ? -67.466 87.899  -19.002 1.00 32.95 ? 53  PHE A CB    1 
ATOM   105  C  CG    . PHE A 1 53  ? -66.274 88.822  -18.914 1.00 31.24 ? 53  PHE A CG    1 
ATOM   106  C  CD1   . PHE A 1 53  ? -66.160 89.746  -17.882 1.00 27.52 ? 53  PHE A CD1   1 
ATOM   107  C  CD2   . PHE A 1 53  ? -65.271 88.780  -19.884 1.00 27.89 ? 53  PHE A CD2   1 
ATOM   108  C  CE1   . PHE A 1 53  ? -65.067 90.618  -17.814 1.00 29.13 ? 53  PHE A CE1   1 
ATOM   109  C  CE2   . PHE A 1 53  ? -64.177 89.644  -19.830 1.00 32.91 ? 53  PHE A CE2   1 
ATOM   110  C  CZ    . PHE A 1 53  ? -64.072 90.565  -18.798 1.00 28.49 ? 53  PHE A CZ    1 
ATOM   111  N  N     . ARG A 1 54  ? -69.027 87.845  -16.295 1.00 31.44 ? 54  ARG A N     1 
ATOM   112  C  CA    . ARG A 1 54  ? -69.416 88.479  -15.036 1.00 33.36 ? 54  ARG A CA    1 
ATOM   113  C  C     . ARG A 1 54  ? -69.274 87.526  -13.851 1.00 33.95 ? 54  ARG A C     1 
ATOM   114  O  O     . ARG A 1 54  ? -68.752 87.908  -12.807 1.00 35.38 ? 54  ARG A O     1 
ATOM   115  C  CB    . ARG A 1 54  ? -70.849 88.995  -15.130 1.00 30.74 ? 54  ARG A CB    1 
ATOM   116  C  CG    . ARG A 1 54  ? -70.947 90.261  -15.947 1.00 38.70 ? 54  ARG A CG    1 
ATOM   117  C  CD    . ARG A 1 54  ? -72.307 90.887  -15.825 1.00 39.17 ? 54  ARG A CD    1 
ATOM   118  N  NE    . ARG A 1 54  ? -72.397 92.135  -16.577 1.00 36.05 ? 54  ARG A NE    1 
ATOM   119  C  CZ    . ARG A 1 54  ? -73.429 92.440  -17.354 1.00 40.93 ? 54  ARG A CZ    1 
ATOM   120  N  NH1   . ARG A 1 54  ? -74.437 91.581  -17.465 1.00 32.86 ? 54  ARG A NH1   1 
ATOM   121  N  NH2   . ARG A 1 54  ? -73.455 93.586  -18.017 1.00 32.72 ? 54  ARG A NH2   1 
ATOM   122  N  N     . VAL A 1 55  ? -69.723 86.290  -14.029 1.00 35.22 ? 55  VAL A N     1 
ATOM   123  C  CA    . VAL A 1 55  ? -69.631 85.274  -12.993 1.00 38.25 ? 55  VAL A CA    1 
ATOM   124  C  C     . VAL A 1 55  ? -68.174 85.051  -12.588 1.00 43.14 ? 55  VAL A C     1 
ATOM   125  O  O     . VAL A 1 55  ? -67.847 85.010  -11.401 1.00 43.69 ? 55  VAL A O     1 
ATOM   126  C  CB    . VAL A 1 55  ? -70.246 83.960  -13.487 1.00 38.94 ? 55  VAL A CB    1 
ATOM   127  C  CG1   . VAL A 1 55  ? -69.865 82.802  -12.576 1.00 38.53 ? 55  VAL A CG1   1 
ATOM   128  C  CG2   . VAL A 1 55  ? -71.760 84.105  -13.532 1.00 42.76 ? 55  VAL A CG2   1 
ATOM   129  N  N     . THR A 1 56  ? -67.302 84.910  -13.579 1.00 40.96 ? 56  THR A N     1 
ATOM   130  C  CA    . THR A 1 56  ? -65.886 84.704  -13.334 1.00 39.72 ? 56  THR A CA    1 
ATOM   131  C  C     . THR A 1 56  ? -65.307 85.932  -12.642 1.00 45.77 ? 56  THR A C     1 
ATOM   132  O  O     . THR A 1 56  ? -64.451 85.822  -11.770 1.00 42.42 ? 56  THR A O     1 
ATOM   133  C  CB    . THR A 1 56  ? -65.141 84.473  -14.667 1.00 40.02 ? 56  THR A CB    1 
ATOM   134  O  OG1   . THR A 1 56  ? -65.706 83.332  -15.331 1.00 36.58 ? 56  THR A OG1   1 
ATOM   135  C  CG2   . THR A 1 56  ? -63.660 84.239  -14.428 1.00 43.56 ? 56  THR A CG2   1 
ATOM   136  N  N     . MET A 1 57  ? -65.793 87.102  -13.030 1.00 47.15 ? 57  MET A N     1 
ATOM   137  C  CA    . MET A 1 57  ? -65.315 88.378  -12.488 1.00 52.55 ? 57  MET A CA    1 
ATOM   138  C  C     . MET A 1 57  ? -65.688 88.573  -11.008 1.00 56.09 ? 57  MET A C     1 
ATOM   139  O  O     . MET A 1 57  ? -65.069 89.338  -10.280 1.00 59.04 ? 57  MET A O     1 
ATOM   140  C  CB    . MET A 1 57  ? -65.913 89.506  -13.329 1.00 52.30 ? 57  MET A CB    1 
ATOM   141  C  CG    . MET A 1 57  ? -64.843 90.343  -14.033 1.00 47.30 ? 57  MET A CG    1 
ATOM   142  S  SD    . MET A 1 57  ? -65.304 92.076  -14.157 1.00 63.08 ? 57  MET A SD    1 
ATOM   143  C  CE    . MET A 1 57  ? -67.018 91.841  -14.648 1.00 44.14 ? 57  MET A CE    1 
ATOM   144  N  N     . GLU A 1 58  ? -66.737 87.892  -10.552 1.00 65.07 ? 58  GLU A N     1 
ATOM   145  C  CA    . GLU A 1 58  ? -67.203 88.041  -9.177  1.00 73.12 ? 58  GLU A CA    1 
ATOM   146  C  C     . GLU A 1 58  ? -67.037 86.788  -8.329  1.00 77.63 ? 58  GLU A C     1 
ATOM   147  O  O     . GLU A 1 58  ? -67.770 86.592  -7.360  1.00 84.86 ? 58  GLU A O     1 
ATOM   148  C  CB    . GLU A 1 58  ? -68.676 88.457  -9.169  1.00 73.90 ? 58  GLU A CB    1 
ATOM   149  C  CG    . GLU A 1 58  ? -68.957 89.759  -9.903  1.00 80.44 ? 58  GLU A CG    1 
ATOM   150  C  CD    . GLU A 1 58  ? -70.433 90.105  -9.926  1.00 84.86 ? 58  GLU A CD    1 
ATOM   151  O  OE1   . GLU A 1 58  ? -71.232 89.260  -10.385 1.00 84.86 ? 58  GLU A OE1   1 
ATOM   152  O  OE2   . GLU A 1 58  ? -70.793 91.220  -9.488  1.00 84.86 ? 58  GLU A OE2   1 
ATOM   153  N  N     . CYS A 1 59  ? -66.079 85.941  -8.688  1.00 78.39 ? 59  CYS A N     1 
ATOM   154  C  CA    . CYS A 1 59  ? -65.838 84.715  -7.936  1.00 79.03 ? 59  CYS A CA    1 
ATOM   155  C  C     . CYS A 1 59  ? -64.769 84.882  -6.867  1.00 79.12 ? 59  CYS A C     1 
ATOM   156  O  O     . CYS A 1 59  ? -63.864 85.711  -6.988  1.00 76.43 ? 59  CYS A O     1 
ATOM   157  C  CB    . CYS A 1 59  ? -65.430 83.577  -8.873  1.00 79.55 ? 59  CYS A CB    1 
ATOM   158  S  SG    . CYS A 1 59  ? -66.778 82.477  -9.360  1.00 82.50 ? 59  CYS A SG    1 
ATOM   159  N  N     . SER A 1 60  ? -64.886 84.081  -5.815  1.00 80.64 ? 60  SER A N     1 
ATOM   160  C  CA    . SER A 1 60  ? -63.930 84.108  -4.718  1.00 82.55 ? 60  SER A CA    1 
ATOM   161  C  C     . SER A 1 60  ? -62.940 82.964  -4.894  1.00 82.93 ? 60  SER A C     1 
ATOM   162  O  O     . SER A 1 60  ? -63.285 81.915  -5.438  1.00 84.86 ? 60  SER A O     1 
ATOM   163  C  CB    . SER A 1 60  ? -64.653 83.946  -3.381  1.00 83.37 ? 60  SER A CB    1 
ATOM   164  O  OG    . SER A 1 60  ? -63.724 83.796  -2.322  1.00 84.86 ? 60  SER A OG    1 
ATOM   165  N  N     . PRO A 1 61  ? -61.691 83.151  -4.443  1.00 82.04 ? 61  PRO A N     1 
ATOM   166  C  CA    . PRO A 1 61  ? -60.678 82.100  -4.569  1.00 80.34 ? 61  PRO A CA    1 
ATOM   167  C  C     . PRO A 1 61  ? -61.204 80.749  -4.081  1.00 81.39 ? 61  PRO A C     1 
ATOM   168  O  O     . PRO A 1 61  ? -60.750 79.694  -4.528  1.00 81.38 ? 61  PRO A O     1 
ATOM   169  C  CB    . PRO A 1 61  ? -59.541 82.625  -3.703  1.00 79.02 ? 61  PRO A CB    1 
ATOM   170  C  CG    . PRO A 1 61  ? -59.637 84.103  -3.917  1.00 81.53 ? 61  PRO A CG    1 
ATOM   171  C  CD    . PRO A 1 61  ? -61.124 84.355  -3.812  1.00 81.98 ? 61  PRO A CD    1 
ATOM   172  N  N     . LEU A 1 62  ? -62.170 80.790  -3.167  1.00 81.53 ? 62  LEU A N     1 
ATOM   173  C  CA    . LEU A 1 62  ? -62.760 79.574  -2.618  1.00 83.66 ? 62  LEU A CA    1 
ATOM   174  C  C     . LEU A 1 62  ? -63.714 78.914  -3.608  1.00 83.92 ? 62  LEU A C     1 
ATOM   175  O  O     . LEU A 1 62  ? -64.574 78.129  -3.213  1.00 84.86 ? 62  LEU A O     1 
ATOM   176  C  CB    . LEU A 1 62  ? -63.520 79.879  -1.319  1.00 84.86 ? 62  LEU A CB    1 
ATOM   177  C  CG    . LEU A 1 62  ? -62.754 80.437  -0.114  1.00 84.86 ? 62  LEU A CG    1 
ATOM   178  C  CD1   . LEU A 1 62  ? -62.343 81.885  -0.368  1.00 84.86 ? 62  LEU A CD1   1 
ATOM   179  C  CD2   . LEU A 1 62  ? -63.643 80.355  1.116   1.00 84.86 ? 62  LEU A CD2   1 
ATOM   180  N  N     . THR A 1 63  ? -63.559 79.233  -4.890  1.00 84.86 ? 63  THR A N     1 
ATOM   181  C  CA    . THR A 1 63  ? -64.412 78.662  -5.928  1.00 84.07 ? 63  THR A CA    1 
ATOM   182  C  C     . THR A 1 63  ? -63.803 77.384  -6.494  1.00 83.88 ? 63  THR A C     1 
ATOM   183  O  O     . THR A 1 63  ? -64.435 76.330  -6.482  1.00 84.86 ? 63  THR A O     1 
ATOM   184  C  CB    . THR A 1 63  ? -64.636 79.657  -7.085  1.00 84.86 ? 63  THR A CB    1 
ATOM   185  O  OG1   . THR A 1 63  ? -65.212 80.868  -6.575  1.00 84.86 ? 63  THR A OG1   1 
ATOM   186  C  CG2   . THR A 1 63  ? -65.576 79.059  -8.126  1.00 84.86 ? 63  THR A CG2   1 
ATOM   187  N  N     . VAL A 1 64  ? -62.576 77.480  -6.992  1.00 83.09 ? 64  VAL A N     1 
ATOM   188  C  CA    . VAL A 1 64  ? -61.895 76.318  -7.555  1.00 84.86 ? 64  VAL A CA    1 
ATOM   189  C  C     . VAL A 1 64  ? -61.342 75.468  -6.417  1.00 84.86 ? 64  VAL A C     1 
ATOM   190  O  O     . VAL A 1 64  ? -61.189 74.251  -6.544  1.00 84.86 ? 64  VAL A O     1 
ATOM   191  C  CB    . VAL A 1 64  ? -60.717 76.734  -8.463  1.00 84.86 ? 64  VAL A CB    1 
ATOM   192  C  CG1   . VAL A 1 64  ? -61.197 77.697  -9.541  1.00 84.86 ? 64  VAL A CG1   1 
ATOM   193  C  CG2   . VAL A 1 64  ? -59.620 77.365  -7.625  1.00 84.86 ? 64  VAL A CG2   1 
ATOM   194  N  N     . THR A 1 65  ? -61.031 76.129  -5.307  1.00 84.64 ? 65  THR A N     1 
ATOM   195  C  CA    . THR A 1 65  ? -60.498 75.454  -4.134  1.00 83.37 ? 65  THR A CA    1 
ATOM   196  C  C     . THR A 1 65  ? -61.646 75.133  -3.189  1.00 84.86 ? 65  THR A C     1 
ATOM   197  O  O     . THR A 1 65  ? -61.474 75.140  -1.969  1.00 84.86 ? 65  THR A O     1 
ATOM   198  C  CB    . THR A 1 65  ? -59.491 76.348  -3.391  1.00 84.01 ? 65  THR A CB    1 
ATOM   199  O  OG1   . THR A 1 65  ? -60.150 77.540  -2.945  1.00 83.72 ? 65  THR A OG1   1 
ATOM   200  C  CG2   . THR A 1 65  ? -58.343 76.732  -4.310  1.00 84.86 ? 65  THR A CG2   1 
ATOM   201  N  N     . ASP A 1 66  ? -62.817 74.856  -3.757  1.00 83.35 ? 66  ASP A N     1 
ATOM   202  C  CA    . ASP A 1 66  ? -63.989 74.545  -2.953  1.00 84.04 ? 66  ASP A CA    1 
ATOM   203  C  C     . ASP A 1 66  ? -64.336 73.065  -2.935  1.00 84.86 ? 66  ASP A C     1 
ATOM   204  O  O     . ASP A 1 66  ? -65.124 72.594  -3.756  1.00 82.74 ? 66  ASP A O     1 
ATOM   205  C  CB    . ASP A 1 66  ? -65.200 75.343  -3.440  1.00 82.51 ? 66  ASP A CB    1 
ATOM   206  C  CG    . ASP A 1 66  ? -66.476 74.988  -2.688  1.00 84.86 ? 66  ASP A CG    1 
ATOM   207  O  OD1   . ASP A 1 66  ? -66.388 74.674  -1.483  1.00 82.94 ? 66  ASP A OD1   1 
ATOM   208  O  OD2   . ASP A 1 66  ? -67.568 75.035  -3.295  1.00 83.74 ? 66  ASP A OD2   1 
ATOM   209  N  N     . PRO A 1 67  ? -63.746 72.308  -1.994  1.00 84.79 ? 67  PRO A N     1 
ATOM   210  C  CA    . PRO A 1 67  ? -64.031 70.874  -1.901  1.00 84.86 ? 67  PRO A CA    1 
ATOM   211  C  C     . PRO A 1 67  ? -65.543 70.689  -1.824  1.00 84.86 ? 67  PRO A C     1 
ATOM   212  O  O     . PRO A 1 67  ? -66.274 71.656  -1.616  1.00 84.86 ? 67  PRO A O     1 
ATOM   213  C  CB    . PRO A 1 67  ? -63.321 70.473  -0.614  1.00 84.86 ? 67  PRO A CB    1 
ATOM   214  C  CG    . PRO A 1 67  ? -62.129 71.379  -0.610  1.00 81.93 ? 67  PRO A CG    1 
ATOM   215  C  CD    . PRO A 1 67  ? -62.743 72.707  -0.991  1.00 83.22 ? 67  PRO A CD    1 
ATOM   216  N  N     . ILE A 1 68  ? -66.005 69.454  -1.988  1.00 84.86 ? 68  ILE A N     1 
ATOM   217  C  CA    . ILE A 1 68  ? -67.435 69.146  -1.967  1.00 84.69 ? 68  ILE A CA    1 
ATOM   218  C  C     . ILE A 1 68  ? -68.105 69.872  -3.133  1.00 82.01 ? 68  ILE A C     1 
ATOM   219  O  O     . ILE A 1 68  ? -69.321 70.041  -3.173  1.00 84.86 ? 68  ILE A O     1 
ATOM   220  C  CB    . ILE A 1 68  ? -68.118 69.559  -0.618  1.00 84.86 ? 68  ILE A CB    1 
ATOM   221  C  CG1   . ILE A 1 68  ? -68.597 71.011  -0.667  1.00 83.87 ? 68  ILE A CG1   1 
ATOM   222  C  CG2   . ILE A 1 68  ? -67.142 69.376  0.541   1.00 84.86 ? 68  ILE A CG2   1 
ATOM   223  C  CD1   . ILE A 1 68  ? -69.441 71.405  0.515   1.00 84.86 ? 68  ILE A CD1   1 
ATOM   224  N  N     . GLU A 1 69  ? -67.285 70.306  -4.081  1.00 84.71 ? 69  GLU A N     1 
ATOM   225  C  CA    . GLU A 1 69  ? -67.760 71.000  -5.273  1.00 84.86 ? 69  GLU A CA    1 
ATOM   226  C  C     . GLU A 1 69  ? -66.883 70.637  -6.461  1.00 83.52 ? 69  GLU A C     1 
ATOM   227  O  O     . GLU A 1 69  ? -65.655 70.609  -6.356  1.00 82.10 ? 69  GLU A O     1 
ATOM   228  C  CB    . GLU A 1 69  ? -67.753 72.512  -5.060  1.00 84.86 ? 69  GLU A CB    1 
ATOM   229  C  CG    . GLU A 1 69  ? -69.075 73.050  -4.560  1.00 84.86 ? 69  GLU A CG    1 
ATOM   230  C  CD    . GLU A 1 69  ? -70.216 72.673  -5.477  1.00 84.78 ? 69  GLU A CD    1 
ATOM   231  O  OE1   . GLU A 1 69  ? -70.094 72.902  -6.699  1.00 84.86 ? 69  GLU A OE1   1 
ATOM   232  O  OE2   . GLU A 1 69  ? -71.233 72.149  -4.976  1.00 84.86 ? 69  GLU A OE2   1 
ATOM   233  N  N     . GLU A 1 70  ? -67.524 70.360  -7.591  1.00 81.12 ? 70  GLU A N     1 
ATOM   234  C  CA    . GLU A 1 70  ? -66.812 69.969  -8.798  1.00 78.02 ? 70  GLU A CA    1 
ATOM   235  C  C     . GLU A 1 70  ? -66.422 71.116  -9.718  1.00 75.88 ? 70  GLU A C     1 
ATOM   236  O  O     . GLU A 1 70  ? -67.249 71.939  -10.111 1.00 76.43 ? 70  GLU A O     1 
ATOM   237  C  CB    . GLU A 1 70  ? -67.641 68.949  -9.581  1.00 80.07 ? 70  GLU A CB    1 
ATOM   238  C  CG    . GLU A 1 70  ? -67.779 67.606  -8.889  1.00 80.59 ? 70  GLU A CG    1 
ATOM   239  C  CD    . GLU A 1 70  ? -68.647 66.643  -9.667  1.00 80.61 ? 70  GLU A CD    1 
ATOM   240  O  OE1   . GLU A 1 70  ? -69.872 66.873  -9.742  1.00 81.46 ? 70  GLU A OE1   1 
ATOM   241  O  OE2   . GLU A 1 70  ? -68.101 65.661  -10.211 1.00 84.86 ? 70  GLU A OE2   1 
ATOM   242  N  N     . HIS A 1 71  ? -65.139 71.152  -10.049 1.00 73.81 ? 71  HIS A N     1 
ATOM   243  C  CA    . HIS A 1 71  ? -64.580 72.153  -10.946 1.00 72.36 ? 71  HIS A CA    1 
ATOM   244  C  C     . HIS A 1 71  ? -63.453 71.439  -11.671 1.00 69.76 ? 71  HIS A C     1 
ATOM   245  O  O     . HIS A 1 71  ? -62.284 71.574  -11.312 1.00 70.15 ? 71  HIS A O     1 
ATOM   246  C  CB    . HIS A 1 71  ? -64.045 73.351  -10.158 1.00 70.91 ? 71  HIS A CB    1 
ATOM   247  C  CG    . HIS A 1 71  ? -63.866 73.082  -8.701  1.00 70.18 ? 71  HIS A CG    1 
ATOM   248  N  ND1   . HIS A 1 71  ? -64.564 73.769  -7.725  1.00 70.59 ? 71  HIS A ND1   1 
ATOM   249  C  CD2   . HIS A 1 71  ? -63.082 72.196  -8.040  1.00 70.45 ? 71  HIS A CD2   1 
ATOM   250  C  CE1   . HIS A 1 71  ? -64.217 73.317  -6.537  1.00 66.62 ? 71  HIS A CE1   1 
ATOM   251  N  NE2   . HIS A 1 71  ? -63.316 72.360  -6.699  1.00 67.87 ? 71  HIS A NE2   1 
ATOM   252  N  N     . ARG A 1 72  ? -63.825 70.661  -12.684 1.00 64.11 ? 72  ARG A N     1 
ATOM   253  C  CA    . ARG A 1 72  ? -62.869 69.883  -13.460 1.00 61.49 ? 72  ARG A CA    1 
ATOM   254  C  C     . ARG A 1 72  ? -61.908 70.703  -14.306 1.00 53.43 ? 72  ARG A C     1 
ATOM   255  O  O     . ARG A 1 72  ? -60.865 70.209  -14.714 1.00 48.44 ? 72  ARG A O     1 
ATOM   256  C  CB    . ARG A 1 72  ? -63.613 68.876  -14.344 1.00 66.27 ? 72  ARG A CB    1 
ATOM   257  C  CG    . ARG A 1 72  ? -64.726 69.471  -15.188 1.00 69.93 ? 72  ARG A CG    1 
ATOM   258  C  CD    . ARG A 1 72  ? -65.700 68.380  -15.609 1.00 79.05 ? 72  ARG A CD    1 
ATOM   259  N  NE    . ARG A 1 72  ? -66.236 67.674  -14.446 1.00 81.93 ? 72  ARG A NE    1 
ATOM   260  C  CZ    . ARG A 1 72  ? -67.167 66.726  -14.501 1.00 84.86 ? 72  ARG A CZ    1 
ATOM   261  N  NH1   . ARG A 1 72  ? -67.679 66.360  -15.670 1.00 84.86 ? 72  ARG A NH1   1 
ATOM   262  N  NH2   . ARG A 1 72  ? -67.589 66.143  -13.385 1.00 84.86 ? 72  ARG A NH2   1 
ATOM   263  N  N     . ILE A 1 73  ? -62.243 71.958  -14.558 1.00 41.16 ? 73  ILE A N     1 
ATOM   264  C  CA    . ILE A 1 73  ? -61.359 72.776  -15.354 1.00 43.30 ? 73  ILE A CA    1 
ATOM   265  C  C     . ILE A 1 73  ? -61.168 74.156  -14.773 1.00 42.05 ? 73  ILE A C     1 
ATOM   266  O  O     . ILE A 1 73  ? -62.127 74.875  -14.501 1.00 42.44 ? 73  ILE A O     1 
ATOM   267  C  CB    . ILE A 1 73  ? -61.835 72.897  -16.839 1.00 45.90 ? 73  ILE A CB    1 
ATOM   268  C  CG1   . ILE A 1 73  ? -61.191 74.098  -17.490 1.00 39.08 ? 73  ILE A CG1   1 
ATOM   269  C  CG2   . ILE A 1 73  ? -63.325 73.055  -16.918 1.00 54.47 ? 73  ILE A CG2   1 
ATOM   270  C  CD1   . ILE A 1 73  ? -61.935 74.495  -18.727 1.00 60.62 ? 73  ILE A CD1   1 
ATOM   271  N  N     . CYS A 1 74  ? -59.905 74.517  -14.583 1.00 32.53 ? 74  CYS A N     1 
ATOM   272  C  CA    . CYS A 1 74  ? -59.557 75.813  -14.039 1.00 34.45 ? 74  CYS A CA    1 
ATOM   273  C  C     . CYS A 1 74  ? -58.588 76.468  -15.019 1.00 32.91 ? 74  CYS A C     1 
ATOM   274  O  O     . CYS A 1 74  ? -57.640 75.841  -15.467 1.00 31.77 ? 74  CYS A O     1 
ATOM   275  C  CB    . CYS A 1 74  ? -58.897 75.624  -12.660 1.00 33.05 ? 74  CYS A CB    1 
ATOM   276  S  SG    . CYS A 1 74  ? -58.306 77.141  -11.910 1.00 40.92 ? 74  CYS A SG    1 
ATOM   277  N  N     . VAL A 1 75  ? -58.817 77.728  -15.337 1.00 30.56 ? 75  VAL A N     1 
ATOM   278  C  CA    . VAL A 1 75  ? -57.940 78.419  -16.275 1.00 33.20 ? 75  VAL A CA    1 
ATOM   279  C  C     . VAL A 1 75  ? -57.393 79.687  -15.667 1.00 28.68 ? 75  VAL A C     1 
ATOM   280  O  O     . VAL A 1 75  ? -58.143 80.534  -15.217 1.00 32.93 ? 75  VAL A O     1 
ATOM   281  C  CB    . VAL A 1 75  ? -58.687 78.793  -17.622 1.00 33.21 ? 75  VAL A CB    1 
ATOM   282  C  CG1   . VAL A 1 75  ? -57.698 79.436  -18.617 1.00 28.57 ? 75  VAL A CG1   1 
ATOM   283  C  CG2   . VAL A 1 75  ? -59.312 77.546  -18.233 1.00 28.78 ? 75  VAL A CG2   1 
ATOM   284  N  N     . CYS A 1 76  ? -56.074 79.820  -15.684 1.00 29.38 ? 76  CYS A N     1 
ATOM   285  C  CA    . CYS A 1 76  ? -55.435 81.006  -15.126 1.00 27.36 ? 76  CYS A CA    1 
ATOM   286  C  C     . CYS A 1 76  ? -54.459 81.666  -16.104 1.00 31.41 ? 76  CYS A C     1 
ATOM   287  O  O     . CYS A 1 76  ? -54.040 81.083  -17.098 1.00 26.05 ? 76  CYS A O     1 
ATOM   288  C  CB    . CYS A 1 76  ? -54.671 80.620  -13.842 1.00 29.23 ? 76  CYS A CB    1 
ATOM   289  S  SG    . CYS A 1 76  ? -55.711 79.801  -12.572 1.00 37.83 ? 76  CYS A SG    1 
ATOM   290  N  N     . VAL A 1 77  ? -54.089 82.899  -15.813 1.00 24.43 ? 77  VAL A N     1 
ATOM   291  C  CA    . VAL A 1 77  ? -53.133 83.560  -16.652 1.00 28.03 ? 77  VAL A CA    1 
ATOM   292  C  C     . VAL A 1 77  ? -52.072 84.150  -15.730 1.00 28.50 ? 77  VAL A C     1 
ATOM   293  O  O     . VAL A 1 77  ? -52.385 84.595  -14.622 1.00 28.70 ? 77  VAL A O     1 
ATOM   294  C  CB    . VAL A 1 77  ? -53.809 84.674  -17.514 1.00 25.15 ? 77  VAL A CB    1 
ATOM   295  C  CG1   . VAL A 1 77  ? -54.376 85.774  -16.626 1.00 24.60 ? 77  VAL A CG1   1 
ATOM   296  C  CG2   . VAL A 1 77  ? -52.796 85.257  -18.478 1.00 28.14 ? 77  VAL A CG2   1 
ATOM   297  N  N     . ARG A 1 78  ? -50.819 84.131  -16.177 1.00 24.97 ? 78  ARG A N     1 
ATOM   298  C  CA    . ARG A 1 78  ? -49.725 84.705  -15.406 1.00 30.20 ? 78  ARG A CA    1 
ATOM   299  C  C     . ARG A 1 78  ? -48.845 85.601  -16.253 1.00 29.75 ? 78  ARG A C     1 
ATOM   300  O  O     . ARG A 1 78  ? -48.241 85.143  -17.229 1.00 29.78 ? 78  ARG A O     1 
ATOM   301  C  CB    . ARG A 1 78  ? -48.833 83.607  -14.800 1.00 26.36 ? 78  ARG A CB    1 
ATOM   302  C  CG    . ARG A 1 78  ? -47.576 84.177  -14.156 1.00 31.42 ? 78  ARG A CG    1 
ATOM   303  C  CD    . ARG A 1 78  ? -46.617 83.099  -13.685 1.00 31.07 ? 78  ARG A CD    1 
ATOM   304  N  NE    . ARG A 1 78  ? -45.651 83.656  -12.733 1.00 26.44 ? 78  ARG A NE    1 
ATOM   305  C  CZ    . ARG A 1 78  ? -44.718 82.935  -12.113 1.00 34.70 ? 78  ARG A CZ    1 
ATOM   306  N  NH1   . ARG A 1 78  ? -44.621 81.652  -12.361 1.00 24.32 ? 78  ARG A NH1   1 
ATOM   307  N  NH2   . ARG A 1 78  ? -43.909 83.485  -11.217 1.00 27.69 ? 78  ARG A NH2   1 
ATOM   308  N  N     . LYS A 1 79  ? -48.759 86.868  -15.868 1.00 27.42 ? 79  LYS A N     1 
ATOM   309  C  CA    . LYS A 1 79  ? -47.898 87.826  -16.533 1.00 28.82 ? 79  LYS A CA    1 
ATOM   310  C  C     . LYS A 1 79  ? -46.520 87.800  -15.867 1.00 30.58 ? 79  LYS A C     1 
ATOM   311  O  O     . LYS A 1 79  ? -46.433 87.864  -14.634 1.00 29.97 ? 79  LYS A O     1 
ATOM   312  C  CB    . LYS A 1 79  ? -48.458 89.235  -16.384 1.00 33.06 ? 79  LYS A CB    1 
ATOM   313  C  CG    . LYS A 1 79  ? -47.474 90.326  -16.764 1.00 31.45 ? 79  LYS A CG    1 
ATOM   314  C  CD    . LYS A 1 79  ? -47.933 91.696  -16.287 1.00 26.49 ? 79  LYS A CD    1 
ATOM   315  C  CE    . LYS A 1 79  ? -46.944 92.758  -16.665 1.00 25.77 ? 79  LYS A CE    1 
ATOM   316  N  NZ    . LYS A 1 79  ? -47.337 94.116  -16.165 1.00 30.36 ? 79  LYS A NZ    1 
ATOM   317  N  N     . ARG A 1 80  ? -45.454 87.708  -16.670 1.00 34.84 ? 80  ARG A N     1 
ATOM   318  C  CA    . ARG A 1 80  ? -44.098 87.722  -16.146 1.00 32.70 ? 80  ARG A CA    1 
ATOM   319  C  C     . ARG A 1 80  ? -43.624 89.148  -16.302 1.00 34.63 ? 80  ARG A C     1 
ATOM   320  O  O     . ARG A 1 80  ? -44.125 89.888  -17.144 1.00 31.42 ? 80  ARG A O     1 
ATOM   321  C  CB    . ARG A 1 80  ? -43.174 86.769  -16.919 1.00 32.96 ? 80  ARG A CB    1 
ATOM   322  C  CG    . ARG A 1 80  ? -42.748 87.227  -18.320 1.00 38.19 ? 80  ARG A CG    1 
ATOM   323  C  CD    . ARG A 1 80  ? -41.511 86.447  -18.779 1.00 30.77 ? 80  ARG A CD    1 
ATOM   324  N  NE    . ARG A 1 80  ? -41.160 86.642  -20.193 1.00 25.28 ? 80  ARG A NE    1 
ATOM   325  C  CZ    . ARG A 1 80  ? -40.792 87.791  -20.753 1.00 33.63 ? 80  ARG A CZ    1 
ATOM   326  N  NH1   . ARG A 1 80  ? -40.719 88.903  -20.045 1.00 28.99 ? 80  ARG A NH1   1 
ATOM   327  N  NH2   . ARG A 1 80  ? -40.459 87.815  -22.042 1.00 34.88 ? 80  ARG A NH2   1 
ATOM   328  N  N     . PRO A 1 81  ? -42.673 89.583  -15.467 1.00 41.15 ? 81  PRO A N     1 
ATOM   329  C  CA    . PRO A 1 81  ? -42.225 90.966  -15.628 1.00 41.49 ? 81  PRO A CA    1 
ATOM   330  C  C     . PRO A 1 81  ? -41.322 91.119  -16.852 1.00 37.73 ? 81  PRO A C     1 
ATOM   331  O  O     . PRO A 1 81  ? -40.857 90.137  -17.418 1.00 36.68 ? 81  PRO A O     1 
ATOM   332  C  CB    . PRO A 1 81  ? -41.469 91.231  -14.324 1.00 38.18 ? 81  PRO A CB    1 
ATOM   333  C  CG    . PRO A 1 81  ? -40.850 89.896  -14.047 1.00 40.17 ? 81  PRO A CG    1 
ATOM   334  C  CD    . PRO A 1 81  ? -41.973 88.924  -14.350 1.00 38.65 ? 81  PRO A CD    1 
ATOM   335  N  N     . LEU A 1 82  ? -41.081 92.356  -17.255 1.00 38.62 ? 82  LEU A N     1 
ATOM   336  C  CA    . LEU A 1 82  ? -40.192 92.616  -18.370 1.00 42.90 ? 82  LEU A CA    1 
ATOM   337  C  C     . LEU A 1 82  ? -38.800 92.213  -17.896 1.00 39.98 ? 82  LEU A C     1 
ATOM   338  O  O     . LEU A 1 82  ? -38.443 92.485  -16.746 1.00 37.60 ? 82  LEU A O     1 
ATOM   339  C  CB    . LEU A 1 82  ? -40.200 94.103  -18.706 1.00 40.74 ? 82  LEU A CB    1 
ATOM   340  C  CG    . LEU A 1 82  ? -41.423 94.639  -19.443 1.00 36.92 ? 82  LEU A CG    1 
ATOM   341  C  CD1   . LEU A 1 82  ? -41.363 96.151  -19.470 1.00 45.49 ? 82  LEU A CD1   1 
ATOM   342  C  CD2   . LEU A 1 82  ? -41.459 94.073  -20.869 1.00 34.28 ? 82  LEU A CD2   1 
ATOM   343  N  N     . ASN A 1 83  ? -38.015 91.558  -18.751 1.00 41.10 ? 83  ASN A N     1 
ATOM   344  C  CA    . ASN A 1 83  ? -36.672 91.168  -18.343 1.00 42.84 ? 83  ASN A CA    1 
ATOM   345  C  C     . ASN A 1 83  ? -35.653 92.247  -18.680 1.00 41.93 ? 83  ASN A C     1 
ATOM   346  O  O     . ASN A 1 83  ? -36.006 93.312  -19.184 1.00 43.32 ? 83  ASN A O     1 
ATOM   347  C  CB    . ASN A 1 83  ? -36.266 89.825  -18.960 1.00 39.36 ? 83  ASN A CB    1 
ATOM   348  C  CG    . ASN A 1 83  ? -36.341 89.819  -20.464 1.00 41.47 ? 83  ASN A CG    1 
ATOM   349  O  OD1   . ASN A 1 83  ? -35.889 90.753  -21.120 1.00 46.12 ? 83  ASN A OD1   1 
ATOM   350  N  ND2   . ASN A 1 83  ? -36.897 88.752  -21.022 1.00 37.13 ? 83  ASN A ND2   1 
ATOM   351  N  N     . LYS A 1 84  ? -34.387 91.982  -18.380 1.00 46.96 ? 84  LYS A N     1 
ATOM   352  C  CA    . LYS A 1 84  ? -33.322 92.954  -18.631 1.00 48.59 ? 84  LYS A CA    1 
ATOM   353  C  C     . LYS A 1 84  ? -33.260 93.396  -20.085 1.00 41.52 ? 84  LYS A C     1 
ATOM   354  O  O     . LYS A 1 84  ? -33.267 94.588  -20.392 1.00 44.36 ? 84  LYS A O     1 
ATOM   355  C  CB    . LYS A 1 84  ? -31.967 92.362  -18.232 1.00 53.70 ? 84  LYS A CB    1 
ATOM   356  C  CG    . LYS A 1 84  ? -31.828 92.027  -16.754 1.00 55.00 ? 84  LYS A CG    1 
ATOM   357  C  CD    . LYS A 1 84  ? -31.806 93.281  -15.904 1.00 59.90 ? 84  LYS A CD    1 
ATOM   358  C  CE    . LYS A 1 84  ? -31.586 92.924  -14.445 1.00 66.67 ? 84  LYS A CE    1 
ATOM   359  N  NZ    . LYS A 1 84  ? -30.386 92.051  -14.281 1.00 63.71 ? 84  LYS A NZ    1 
ATOM   360  N  N     . GLN A 1 85  ? -33.192 92.418  -20.976 1.00 45.10 ? 85  GLN A N     1 
ATOM   361  C  CA    . GLN A 1 85  ? -33.109 92.672  -22.407 1.00 48.63 ? 85  GLN A CA    1 
ATOM   362  C  C     . GLN A 1 85  ? -34.245 93.571  -22.887 1.00 51.48 ? 85  GLN A C     1 
ATOM   363  O  O     . GLN A 1 85  ? -34.014 94.563  -23.581 1.00 49.76 ? 85  GLN A O     1 
ATOM   364  C  CB    . GLN A 1 85  ? -33.130 91.342  -23.156 1.00 52.63 ? 85  GLN A CB    1 
ATOM   365  C  CG    . GLN A 1 85  ? -32.075 90.353  -22.669 1.00 59.86 ? 85  GLN A CG    1 
ATOM   366  C  CD    . GLN A 1 85  ? -32.240 89.990  -21.194 1.00 68.34 ? 85  GLN A CD    1 
ATOM   367  O  OE1   . GLN A 1 85  ? -33.154 89.253  -20.810 1.00 65.36 ? 85  GLN A OE1   1 
ATOM   368  N  NE2   . GLN A 1 85  ? -31.356 90.522  -20.360 1.00 73.73 ? 85  GLN A NE2   1 
ATOM   369  N  N     . GLU A 1 86  ? -35.471 93.229  -22.504 1.00 50.06 ? 86  GLU A N     1 
ATOM   370  C  CA    . GLU A 1 86  ? -36.634 94.012  -22.906 1.00 49.50 ? 86  GLU A CA    1 
ATOM   371  C  C     . GLU A 1 86  ? -36.593 95.430  -22.345 1.00 45.13 ? 86  GLU A C     1 
ATOM   372  O  O     . GLU A 1 86  ? -36.888 96.390  -23.055 1.00 44.91 ? 86  GLU A O     1 
ATOM   373  C  CB    . GLU A 1 86  ? -37.914 93.292  -22.474 1.00 44.51 ? 86  GLU A CB    1 
ATOM   374  C  CG    . GLU A 1 86  ? -38.040 91.901  -23.084 1.00 40.39 ? 86  GLU A CG    1 
ATOM   375  C  CD    . GLU A 1 86  ? -39.092 91.056  -22.408 1.00 38.74 ? 86  GLU A CD    1 
ATOM   376  O  OE1   . GLU A 1 86  ? -39.263 91.221  -21.182 1.00 43.17 ? 86  GLU A OE1   1 
ATOM   377  O  OE2   . GLU A 1 86  ? -39.734 90.203  -23.073 1.00 34.63 ? 86  GLU A OE2   1 
ATOM   378  N  N     . LEU A 1 87  ? -36.230 95.575  -21.075 1.00 44.72 ? 87  LEU A N     1 
ATOM   379  C  CA    . LEU A 1 87  ? -36.148 96.908  -20.480 1.00 49.32 ? 87  LEU A CA    1 
ATOM   380  C  C     . LEU A 1 87  ? -35.075 97.723  -21.198 1.00 53.99 ? 87  LEU A C     1 
ATOM   381  O  O     . LEU A 1 87  ? -35.271 98.908  -21.490 1.00 56.34 ? 87  LEU A O     1 
ATOM   382  C  CB    . LEU A 1 87  ? -35.804 96.813  -18.991 1.00 46.91 ? 87  LEU A CB    1 
ATOM   383  C  CG    . LEU A 1 87  ? -36.866 96.261  -18.034 1.00 45.41 ? 87  LEU A CG    1 
ATOM   384  C  CD1   . LEU A 1 87  ? -36.245 95.981  -16.668 1.00 46.06 ? 87  LEU A CD1   1 
ATOM   385  C  CD2   . LEU A 1 87  ? -37.999 97.261  -17.910 1.00 38.70 ? 87  LEU A CD2   1 
ATOM   386  N  N     . ALA A 1 88  ? -33.941 97.082  -21.478 1.00 53.26 ? 88  ALA A N     1 
ATOM   387  C  CA    . ALA A 1 88  ? -32.829 97.738  -22.169 1.00 52.73 ? 88  ALA A CA    1 
ATOM   388  C  C     . ALA A 1 88  ? -33.265 98.219  -23.552 1.00 54.41 ? 88  ALA A C     1 
ATOM   389  O  O     . ALA A 1 88  ? -32.936 99.335  -23.957 1.00 52.83 ? 88  ALA A O     1 
ATOM   390  C  CB    . ALA A 1 88  ? -31.645 96.778  -22.294 1.00 52.87 ? 88  ALA A CB    1 
ATOM   391  N  N     . LYS A 1 89  ? -33.995 97.371  -24.277 1.00 52.19 ? 89  LYS A N     1 
ATOM   392  C  CA    . LYS A 1 89  ? -34.494 97.742  -25.601 1.00 54.14 ? 89  LYS A CA    1 
ATOM   393  C  C     . LYS A 1 89  ? -35.660 98.709  -25.443 1.00 52.40 ? 89  LYS A C     1 
ATOM   394  O  O     . LYS A 1 89  ? -36.306 99.082  -26.421 1.00 56.62 ? 89  LYS A O     1 
ATOM   395  C  CB    . LYS A 1 89  ? -34.987 96.517  -26.372 1.00 63.01 ? 89  LYS A CB    1 
ATOM   396  C  CG    . LYS A 1 89  ? -33.902 95.636  -26.960 1.00 66.83 ? 89  LYS A CG    1 
ATOM   397  C  CD    . LYS A 1 89  ? -34.528 94.563  -27.836 1.00 73.97 ? 89  LYS A CD    1 
ATOM   398  C  CE    . LYS A 1 89  ? -33.480 93.680  -28.493 1.00 80.10 ? 89  LYS A CE    1 
ATOM   399  N  NZ    . LYS A 1 89  ? -34.104 92.658  -29.385 1.00 83.86 ? 89  LYS A NZ    1 
ATOM   400  N  N     . LYS A 1 90  ? -35.931 99.102  -24.204 1.00 52.41 ? 90  LYS A N     1 
ATOM   401  C  CA    . LYS A 1 90  ? -37.026 100.016 -23.911 1.00 57.12 ? 90  LYS A CA    1 
ATOM   402  C  C     . LYS A 1 90  ? -38.384 99.480  -24.374 1.00 55.96 ? 90  LYS A C     1 
ATOM   403  O  O     . LYS A 1 90  ? -39.183 100.218 -24.950 1.00 57.59 ? 90  LYS A O     1 
ATOM   404  C  CB    . LYS A 1 90  ? -36.760 101.377 -24.557 1.00 61.88 ? 90  LYS A CB    1 
ATOM   405  C  CG    . LYS A 1 90  ? -35.473 102.038 -24.101 1.00 68.15 ? 90  LYS A CG    1 
ATOM   406  C  CD    . LYS A 1 90  ? -35.284 103.385 -24.773 1.00 75.59 ? 90  LYS A CD    1 
ATOM   407  C  CE    . LYS A 1 90  ? -34.005 104.065 -24.318 1.00 78.10 ? 90  LYS A CE    1 
ATOM   408  N  NZ    . LYS A 1 90  ? -33.865 105.419 -24.925 1.00 82.22 ? 90  LYS A NZ    1 
ATOM   409  N  N     . GLU A 1 91  ? -38.635 98.195  -24.139 1.00 53.02 ? 91  GLU A N     1 
ATOM   410  C  CA    . GLU A 1 91  ? -39.914 97.592  -24.505 1.00 48.84 ? 91  GLU A CA    1 
ATOM   411  C  C     . GLU A 1 91  ? -40.966 98.145  -23.563 1.00 47.29 ? 91  GLU A C     1 
ATOM   412  O  O     . GLU A 1 91  ? -40.720 98.285  -22.362 1.00 49.32 ? 91  GLU A O     1 
ATOM   413  C  CB    . GLU A 1 91  ? -39.876 96.074  -24.343 1.00 45.08 ? 91  GLU A CB    1 
ATOM   414  C  CG    . GLU A 1 91  ? -39.405 95.303  -25.564 1.00 49.35 ? 91  GLU A CG    1 
ATOM   415  C  CD    . GLU A 1 91  ? -40.482 95.155  -26.630 1.00 53.20 ? 91  GLU A CD    1 
ATOM   416  O  OE1   . GLU A 1 91  ? -41.506 94.482  -26.374 1.00 50.34 ? 91  GLU A OE1   1 
ATOM   417  O  OE2   . GLU A 1 91  ? -40.297 95.714  -27.731 1.00 53.42 ? 91  GLU A OE2   1 
ATOM   418  N  N     . ILE A 1 92  ? -42.136 98.468  -24.102 1.00 45.50 ? 92  ILE A N     1 
ATOM   419  C  CA    . ILE A 1 92  ? -43.216 98.990  -23.282 1.00 40.23 ? 92  ILE A CA    1 
ATOM   420  C  C     . ILE A 1 92  ? -43.995 97.807  -22.745 1.00 35.26 ? 92  ILE A C     1 
ATOM   421  O  O     . ILE A 1 92  ? -44.190 96.811  -23.452 1.00 30.13 ? 92  ILE A O     1 
ATOM   422  C  CB    . ILE A 1 92  ? -44.170 99.866  -24.093 1.00 42.33 ? 92  ILE A CB    1 
ATOM   423  C  CG1   . ILE A 1 92  ? -43.387 100.976 -24.790 1.00 39.35 ? 92  ILE A CG1   1 
ATOM   424  C  CG2   . ILE A 1 92  ? -45.237 100.453 -23.177 1.00 48.10 ? 92  ILE A CG2   1 
ATOM   425  C  CD1   . ILE A 1 92  ? -42.592 101.840 -23.861 1.00 37.36 ? 92  ILE A CD1   1 
ATOM   426  N  N     . ASP A 1 93  ? -44.402 97.908  -21.479 1.00 33.65 ? 93  ASP A N     1 
ATOM   427  C  CA    . ASP A 1 93  ? -45.182 96.867  -20.804 1.00 36.40 ? 93  ASP A CA    1 
ATOM   428  C  C     . ASP A 1 93  ? -46.636 97.207  -21.152 1.00 37.33 ? 93  ASP A C     1 
ATOM   429  O  O     . ASP A 1 93  ? -47.126 98.277  -20.793 1.00 31.96 ? 93  ASP A O     1 
ATOM   430  C  CB    . ASP A 1 93  ? -44.956 96.973  -19.287 1.00 34.98 ? 93  ASP A CB    1 
ATOM   431  C  CG    . ASP A 1 93  ? -45.738 95.938  -18.493 1.00 41.36 ? 93  ASP A CG    1 
ATOM   432  O  OD1   . ASP A 1 93  ? -46.638 95.278  -19.054 1.00 39.84 ? 93  ASP A OD1   1 
ATOM   433  O  OD2   . ASP A 1 93  ? -45.450 95.789  -17.283 1.00 35.05 ? 93  ASP A OD2   1 
ATOM   434  N  N     . VAL A 1 94  ? -47.320 96.317  -21.859 1.00 33.76 ? 94  VAL A N     1 
ATOM   435  C  CA    . VAL A 1 94  ? -48.698 96.603  -22.259 1.00 31.88 ? 94  VAL A CA    1 
ATOM   436  C  C     . VAL A 1 94  ? -49.715 95.718  -21.550 1.00 35.06 ? 94  VAL A C     1 
ATOM   437  O  O     . VAL A 1 94  ? -50.837 95.525  -22.037 1.00 35.23 ? 94  VAL A O     1 
ATOM   438  C  CB    . VAL A 1 94  ? -48.896 96.429  -23.803 1.00 30.32 ? 94  VAL A CB    1 
ATOM   439  C  CG1   . VAL A 1 94  ? -48.013 97.410  -24.569 1.00 31.86 ? 94  VAL A CG1   1 
ATOM   440  C  CG2   . VAL A 1 94  ? -48.579 95.026  -24.200 1.00 24.67 ? 94  VAL A CG2   1 
ATOM   441  N  N     . ILE A 1 95  ? -49.330 95.174  -20.404 1.00 30.46 ? 95  ILE A N     1 
ATOM   442  C  CA    . ILE A 1 95  ? -50.232 94.302  -19.652 1.00 30.02 ? 95  ILE A CA    1 
ATOM   443  C  C     . ILE A 1 95  ? -50.512 94.851  -18.244 1.00 32.03 ? 95  ILE A C     1 
ATOM   444  O  O     . ILE A 1 95  ? -49.604 95.330  -17.559 1.00 34.54 ? 95  ILE A O     1 
ATOM   445  C  CB    . ILE A 1 95  ? -49.637 92.896  -19.506 1.00 30.98 ? 95  ILE A CB    1 
ATOM   446  C  CG1   . ILE A 1 95  ? -49.186 92.359  -20.876 1.00 25.86 ? 95  ILE A CG1   1 
ATOM   447  C  CG2   . ILE A 1 95  ? -50.654 91.964  -18.862 1.00 31.66 ? 95  ILE A CG2   1 
ATOM   448  C  CD1   . ILE A 1 95  ? -50.315 92.238  -21.957 1.00 19.60 ? 95  ILE A CD1   1 
ATOM   449  N  N     . SER A 1 96  ? -51.776 94.799  -17.830 1.00 27.04 ? 96  SER A N     1 
ATOM   450  C  CA    . SER A 1 96  ? -52.184 95.241  -16.493 1.00 26.74 ? 96  SER A CA    1 
ATOM   451  C  C     . SER A 1 96  ? -53.094 94.160  -15.933 1.00 30.96 ? 96  SER A C     1 
ATOM   452  O  O     . SER A 1 96  ? -53.834 93.513  -16.680 1.00 26.78 ? 96  SER A O     1 
ATOM   453  C  CB    . SER A 1 96  ? -52.956 96.550  -16.533 1.00 29.56 ? 96  SER A CB    1 
ATOM   454  O  OG    . SER A 1 96  ? -52.122 97.654  -16.817 1.00 34.23 ? 96  SER A OG    1 
ATOM   455  N  N     . VAL A 1 97  ? -53.009 93.926  -14.626 1.00 30.59 ? 97  VAL A N     1 
ATOM   456  C  CA    . VAL A 1 97  ? -53.875 92.948  -13.978 1.00 37.83 ? 97  VAL A CA    1 
ATOM   457  C  C     . VAL A 1 97  ? -54.344 93.675  -12.718 1.00 37.54 ? 97  VAL A C     1 
ATOM   458  O  O     . VAL A 1 97  ? -53.773 93.540  -11.643 1.00 39.71 ? 97  VAL A O     1 
ATOM   459  C  CB    . VAL A 1 97  ? -53.113 91.616  -13.723 1.00 37.37 ? 97  VAL A CB    1 
ATOM   460  C  CG1   . VAL A 1 97  ? -51.641 91.865  -13.719 1.00 49.08 ? 97  VAL A CG1   1 
ATOM   461  C  CG2   . VAL A 1 97  ? -53.580 90.955  -12.466 1.00 34.85 ? 97  VAL A CG2   1 
ATOM   462  N  N     . PRO A 1 98  ? -55.389 94.507  -12.875 1.00 38.01 ? 98  PRO A N     1 
ATOM   463  C  CA    . PRO A 1 98  ? -56.037 95.338  -11.863 1.00 39.86 ? 98  PRO A CA    1 
ATOM   464  C  C     . PRO A 1 98  ? -56.777 94.608  -10.743 1.00 40.82 ? 98  PRO A C     1 
ATOM   465  O  O     . PRO A 1 98  ? -57.110 95.216  -9.735  1.00 39.89 ? 98  PRO A O     1 
ATOM   466  C  CB    . PRO A 1 98  ? -56.961 96.223  -12.701 1.00 40.31 ? 98  PRO A CB    1 
ATOM   467  C  CG    . PRO A 1 98  ? -57.423 95.289  -13.747 1.00 36.67 ? 98  PRO A CG    1 
ATOM   468  C  CD    . PRO A 1 98  ? -56.135 94.578  -14.147 1.00 33.52 ? 98  PRO A CD    1 
ATOM   469  N  N     . SER A 1 99  ? -57.036 93.320  -10.924 1.00 42.01 ? 99  SER A N     1 
ATOM   470  C  CA    . SER A 1 99  ? -57.723 92.536  -9.916  1.00 38.22 ? 99  SER A CA    1 
ATOM   471  C  C     . SER A 1 99  ? -57.253 91.101  -10.041 1.00 38.46 ? 99  SER A C     1 
ATOM   472  O  O     . SER A 1 99  ? -56.515 90.767  -10.966 1.00 38.21 ? 99  SER A O     1 
ATOM   473  C  CB    . SER A 1 99  ? -59.238 92.636  -10.096 1.00 38.08 ? 99  SER A CB    1 
ATOM   474  O  OG    . SER A 1 99  ? -59.681 91.922  -11.230 1.00 42.94 ? 99  SER A OG    1 
ATOM   475  N  N     . LYS A 1 100 ? -57.684 90.243  -9.127  1.00 39.05 ? 100 LYS A N     1 
ATOM   476  C  CA    . LYS A 1 100 ? -57.241 88.856  -9.135  1.00 39.79 ? 100 LYS A CA    1 
ATOM   477  C  C     . LYS A 1 100 ? -57.855 87.961  -10.205 1.00 35.02 ? 100 LYS A C     1 
ATOM   478  O  O     . LYS A 1 100 ? -57.525 86.777  -10.295 1.00 35.97 ? 100 LYS A O     1 
ATOM   479  C  CB    . LYS A 1 100 ? -57.455 88.242  -7.737  1.00 42.83 ? 100 LYS A CB    1 
ATOM   480  C  CG    . LYS A 1 100 ? -56.550 88.869  -6.657  1.00 53.30 ? 100 LYS A CG    1 
ATOM   481  C  CD    . LYS A 1 100 ? -56.531 88.071  -5.344  1.00 61.57 ? 100 LYS A CD    1 
ATOM   482  C  CE    . LYS A 1 100 ? -57.857 88.138  -4.581  1.00 70.70 ? 100 LYS A CE    1 
ATOM   483  N  NZ    . LYS A 1 100 ? -58.969 87.404  -5.257  1.00 75.10 ? 100 LYS A NZ    1 
ATOM   484  N  N     . CYS A 1 101 ? -58.739 88.523  -11.023 1.00 30.63 ? 101 CYS A N     1 
ATOM   485  C  CA    . CYS A 1 101 ? -59.396 87.751  -12.078 1.00 37.71 ? 101 CYS A CA    1 
ATOM   486  C  C     . CYS A 1 101 ? -59.435 88.509  -13.421 1.00 35.88 ? 101 CYS A C     1 
ATOM   487  O  O     . CYS A 1 101 ? -59.898 87.982  -14.427 1.00 39.44 ? 101 CYS A O     1 
ATOM   488  C  CB    . CYS A 1 101 ? -60.835 87.421  -11.656 1.00 44.11 ? 101 CYS A CB    1 
ATOM   489  S  SG    . CYS A 1 101 ? -60.995 86.291  -10.244 1.00 65.54 ? 101 CYS A SG    1 
ATOM   490  N  N     . LEU A 1 102 ? -58.964 89.746  -13.420 1.00 29.60 ? 102 LEU A N     1 
ATOM   491  C  CA    . LEU A 1 102 ? -58.974 90.569  -14.615 1.00 33.66 ? 102 LEU A CA    1 
ATOM   492  C  C     . LEU A 1 102 ? -57.591 90.883  -15.181 1.00 30.30 ? 102 LEU A C     1 
ATOM   493  O  O     . LEU A 1 102 ? -56.703 91.341  -14.456 1.00 31.63 ? 102 LEU A O     1 
ATOM   494  C  CB    . LEU A 1 102 ? -59.669 91.896  -14.325 1.00 29.96 ? 102 LEU A CB    1 
ATOM   495  C  CG    . LEU A 1 102 ? -61.074 92.131  -14.869 1.00 46.76 ? 102 LEU A CG    1 
ATOM   496  C  CD1   . LEU A 1 102 ? -61.416 93.601  -14.702 1.00 37.34 ? 102 LEU A CD1   1 
ATOM   497  C  CD2   . LEU A 1 102 ? -61.145 91.752  -16.346 1.00 40.05 ? 102 LEU A CD2   1 
ATOM   498  N  N     . LEU A 1 103 ? -57.406 90.633  -16.477 1.00 30.73 ? 103 LEU A N     1 
ATOM   499  C  CA    . LEU A 1 103 ? -56.140 90.962  -17.143 1.00 28.88 ? 103 LEU A CA    1 
ATOM   500  C  C     . LEU A 1 103 ? -56.488 91.913  -18.272 1.00 30.54 ? 103 LEU A C     1 
ATOM   501  O  O     . LEU A 1 103 ? -57.435 91.668  -19.030 1.00 28.86 ? 103 LEU A O     1 
ATOM   502  C  CB    . LEU A 1 103 ? -55.460 89.709  -17.689 1.00 36.16 ? 103 LEU A CB    1 
ATOM   503  C  CG    . LEU A 1 103 ? -54.048 89.966  -18.250 1.00 40.98 ? 103 LEU A CG    1 
ATOM   504  C  CD1   . LEU A 1 103 ? -53.215 88.726  -18.106 1.00 42.03 ? 103 LEU A CD1   1 
ATOM   505  C  CD2   . LEU A 1 103 ? -54.120 90.397  -19.711 1.00 35.26 ? 103 LEU A CD2   1 
ATOM   506  N  N     . LEU A 1 104 ? -55.752 93.016  -18.349 1.00 24.71 ? 104 LEU A N     1 
ATOM   507  C  CA    . LEU A 1 104 ? -55.947 94.039  -19.369 1.00 28.61 ? 104 LEU A CA    1 
ATOM   508  C  C     . LEU A 1 104 ? -54.791 94.089  -20.372 1.00 29.83 ? 104 LEU A C     1 
ATOM   509  O  O     . LEU A 1 104 ? -53.619 94.086  -19.987 1.00 29.14 ? 104 LEU A O     1 
ATOM   510  C  CB    . LEU A 1 104 ? -56.067 95.425  -18.724 1.00 24.82 ? 104 LEU A CB    1 
ATOM   511  C  CG    . LEU A 1 104 ? -57.441 96.051  -18.446 1.00 34.49 ? 104 LEU A CG    1 
ATOM   512  C  CD1   . LEU A 1 104 ? -58.421 95.018  -17.969 1.00 31.14 ? 104 LEU A CD1   1 
ATOM   513  C  CD2   . LEU A 1 104 ? -57.291 97.165  -17.443 1.00 29.24 ? 104 LEU A CD2   1 
ATOM   514  N  N     . VAL A 1 105 ? -55.128 94.119  -21.665 1.00 30.65 ? 105 VAL A N     1 
ATOM   515  C  CA    . VAL A 1 105 ? -54.104 94.242  -22.712 1.00 29.66 ? 105 VAL A CA    1 
ATOM   516  C  C     . VAL A 1 105 ? -54.290 95.623  -23.316 1.00 29.57 ? 105 VAL A C     1 
ATOM   517  O  O     . VAL A 1 105 ? -55.345 95.922  -23.867 1.00 29.31 ? 105 VAL A O     1 
ATOM   518  C  CB    . VAL A 1 105 ? -54.271 93.201  -23.832 1.00 32.90 ? 105 VAL A CB    1 
ATOM   519  C  CG1   . VAL A 1 105 ? -53.242 93.487  -24.955 1.00 26.90 ? 105 VAL A CG1   1 
ATOM   520  C  CG2   . VAL A 1 105 ? -54.057 91.810  -23.288 1.00 26.72 ? 105 VAL A CG2   1 
ATOM   521  N  N     . HIS A 1 106 ? -53.281 96.471  -23.180 1.00 25.25 ? 106 HIS A N     1 
ATOM   522  C  CA    . HIS A 1 106 ? -53.324 97.821  -23.722 1.00 28.25 ? 106 HIS A CA    1 
ATOM   523  C  C     . HIS A 1 106 ? -52.739 97.744  -25.153 1.00 32.59 ? 106 HIS A C     1 
ATOM   524  O  O     . HIS A 1 106 ? -51.582 98.133  -25.393 1.00 30.99 ? 106 HIS A O     1 
ATOM   525  C  CB    . HIS A 1 106 ? -52.457 98.744  -22.868 1.00 22.78 ? 106 HIS A CB    1 
ATOM   526  C  CG    . HIS A 1 106 ? -52.809 98.719  -21.414 1.00 27.67 ? 106 HIS A CG    1 
ATOM   527  N  ND1   . HIS A 1 106 ? -53.978 99.267  -20.930 1.00 27.87 ? 106 HIS A ND1   1 
ATOM   528  C  CD2   . HIS A 1 106 ? -52.203 98.118  -20.362 1.00 31.04 ? 106 HIS A CD2   1 
ATOM   529  C  CE1   . HIS A 1 106 ? -54.082 98.992  -19.641 1.00 26.04 ? 106 HIS A CE1   1 
ATOM   530  N  NE2   . HIS A 1 106 ? -53.024 98.295  -19.273 1.00 24.93 ? 106 HIS A NE2   1 
ATOM   531  N  N     . GLU A 1 107 ? -53.545 97.236  -26.085 1.00 30.70 ? 107 GLU A N     1 
ATOM   532  C  CA    . GLU A 1 107 ? -53.113 97.067  -27.466 1.00 31.69 ? 107 GLU A CA    1 
ATOM   533  C  C     . GLU A 1 107 ? -52.899 98.342  -28.239 1.00 35.09 ? 107 GLU A C     1 
ATOM   534  O  O     . GLU A 1 107 ? -53.826 99.117  -28.434 1.00 32.52 ? 107 GLU A O     1 
ATOM   535  C  CB    . GLU A 1 107 ? -54.102 96.198  -28.232 1.00 26.62 ? 107 GLU A CB    1 
ATOM   536  C  CG    . GLU A 1 107 ? -53.734 96.071  -29.710 1.00 37.77 ? 107 GLU A CG    1 
ATOM   537  C  CD    . GLU A 1 107 ? -54.644 95.129  -30.467 1.00 33.85 ? 107 GLU A CD    1 
ATOM   538  O  OE1   . GLU A 1 107 ? -55.815 94.981  -30.058 1.00 33.85 ? 107 GLU A OE1   1 
ATOM   539  O  OE2   . GLU A 1 107 ? -54.191 94.546  -31.480 1.00 39.70 ? 107 GLU A OE2   1 
ATOM   540  N  N     . PRO A 1 108 ? -51.658 98.576  -28.691 1.00 33.84 ? 108 PRO A N     1 
ATOM   541  C  CA    . PRO A 1 108 ? -51.272 99.764  -29.464 1.00 36.10 ? 108 PRO A CA    1 
ATOM   542  C  C     . PRO A 1 108 ? -51.903 99.673  -30.867 1.00 34.94 ? 108 PRO A C     1 
ATOM   543  O  O     . PRO A 1 108 ? -51.861 98.630  -31.503 1.00 37.67 ? 108 PRO A O     1 
ATOM   544  C  CB    . PRO A 1 108 ? -49.746 99.656  -29.527 1.00 36.94 ? 108 PRO A CB    1 
ATOM   545  C  CG    . PRO A 1 108 ? -49.402 98.748  -28.382 1.00 44.01 ? 108 PRO A CG    1 
ATOM   546  C  CD    . PRO A 1 108 ? -50.487 97.727  -28.438 1.00 35.72 ? 108 PRO A CD    1 
ATOM   547  N  N     . LYS A 1 109 ? -52.496 100.753 -31.346 1.00 31.93 ? 109 LYS A N     1 
ATOM   548  C  CA    . LYS A 1 109 ? -53.112 100.702 -32.667 1.00 33.54 ? 109 LYS A CA    1 
ATOM   549  C  C     . LYS A 1 109 ? -52.986 102.028 -33.375 1.00 29.49 ? 109 LYS A C     1 
ATOM   550  O  O     . LYS A 1 109 ? -52.724 103.052 -32.745 1.00 28.68 ? 109 LYS A O     1 
ATOM   551  C  CB    . LYS A 1 109 ? -54.591 100.325 -32.557 1.00 36.53 ? 109 LYS A CB    1 
ATOM   552  C  CG    . LYS A 1 109 ? -54.838 99.042  -31.798 1.00 38.25 ? 109 LYS A CG    1 
ATOM   553  C  CD    . LYS A 1 109 ? -56.272 98.566  -31.931 1.00 40.38 ? 109 LYS A CD    1 
ATOM   554  C  CE    . LYS A 1 109 ? -56.517 97.956  -33.291 1.00 36.92 ? 109 LYS A CE    1 
ATOM   555  N  NZ    . LYS A 1 109 ? -57.346 96.731  -33.194 1.00 55.71 ? 109 LYS A NZ    1 
ATOM   556  N  N     . LEU A 1 110 ? -53.152 102.004 -34.698 1.00 35.17 ? 110 LEU A N     1 
ATOM   557  C  CA    . LEU A 1 110 ? -53.081 103.233 -35.496 1.00 34.85 ? 110 LEU A CA    1 
ATOM   558  C  C     . LEU A 1 110 ? -54.354 103.370 -36.296 1.00 35.27 ? 110 LEU A C     1 
ATOM   559  O  O     . LEU A 1 110 ? -54.829 102.403 -36.878 1.00 35.33 ? 110 LEU A O     1 
ATOM   560  C  CB    . LEU A 1 110 ? -51.919 103.185 -36.483 1.00 35.59 ? 110 LEU A CB    1 
ATOM   561  C  CG    . LEU A 1 110 ? -50.475 103.055 -36.019 1.00 47.97 ? 110 LEU A CG    1 
ATOM   562  C  CD1   . LEU A 1 110 ? -49.574 102.905 -37.250 1.00 40.66 ? 110 LEU A CD1   1 
ATOM   563  C  CD2   . LEU A 1 110 ? -50.085 104.276 -35.209 1.00 36.11 ? 110 LEU A CD2   1 
ATOM   564  N  N     . LYS A 1 111 ? -54.921 104.562 -36.308 1.00 38.15 ? 111 LYS A N     1 
ATOM   565  C  CA    . LYS A 1 111 ? -56.107 104.804 -37.110 1.00 34.17 ? 111 LYS A CA    1 
ATOM   566  C  C     . LYS A 1 111 ? -55.585 104.864 -38.553 1.00 34.66 ? 111 LYS A C     1 
ATOM   567  O  O     . LYS A 1 111 ? -54.361 104.899 -38.783 1.00 28.84 ? 111 LYS A O     1 
ATOM   568  C  CB    . LYS A 1 111 ? -56.737 106.150 -36.754 1.00 32.53 ? 111 LYS A CB    1 
ATOM   569  C  CG    . LYS A 1 111 ? -57.532 106.156 -35.462 1.00 37.81 ? 111 LYS A CG    1 
ATOM   570  C  CD    . LYS A 1 111 ? -58.188 107.503 -35.250 1.00 44.24 ? 111 LYS A CD    1 
ATOM   571  C  CE    . LYS A 1 111 ? -59.030 107.492 -33.985 1.00 58.70 ? 111 LYS A CE    1 
ATOM   572  N  NZ    . LYS A 1 111 ? -59.821 108.744 -33.828 1.00 61.81 ? 111 LYS A NZ    1 
ATOM   573  N  N     . VAL A 1 112 ? -56.499 104.893 -39.519 1.00 30.22 ? 112 VAL A N     1 
ATOM   574  C  CA    . VAL A 1 112 ? -56.092 104.945 -40.917 1.00 36.40 ? 112 VAL A CA    1 
ATOM   575  C  C     . VAL A 1 112 ? -55.185 106.138 -41.163 1.00 35.80 ? 112 VAL A C     1 
ATOM   576  O  O     . VAL A 1 112 ? -54.209 106.033 -41.904 1.00 34.11 ? 112 VAL A O     1 
ATOM   577  C  CB    . VAL A 1 112 ? -57.318 105.021 -41.869 1.00 43.20 ? 112 VAL A CB    1 
ATOM   578  C  CG1   . VAL A 1 112 ? -58.181 106.221 -41.520 1.00 49.85 ? 112 VAL A CG1   1 
ATOM   579  C  CG2   . VAL A 1 112 ? -56.847 105.115 -43.314 1.00 45.46 ? 112 VAL A CG2   1 
ATOM   580  N  N     . ASP A 1 113 ? -55.493 107.262 -40.523 1.00 34.94 ? 113 ASP A N     1 
ATOM   581  C  CA    . ASP A 1 113 ? -54.694 108.464 -40.689 1.00 35.66 ? 113 ASP A CA    1 
ATOM   582  C  C     . ASP A 1 113 ? -53.420 108.478 -39.842 1.00 33.84 ? 113 ASP A C     1 
ATOM   583  O  O     . ASP A 1 113 ? -52.808 109.520 -39.673 1.00 30.99 ? 113 ASP A O     1 
ATOM   584  C  CB    . ASP A 1 113 ? -55.548 109.700 -40.397 1.00 37.79 ? 113 ASP A CB    1 
ATOM   585  C  CG    . ASP A 1 113 ? -55.746 109.951 -38.903 1.00 44.33 ? 113 ASP A CG    1 
ATOM   586  O  OD1   . ASP A 1 113 ? -55.486 109.029 -38.091 1.00 40.97 ? 113 ASP A OD1   1 
ATOM   587  O  OD2   . ASP A 1 113 ? -56.175 111.074 -38.551 1.00 50.12 ? 113 ASP A OD2   1 
ATOM   588  N  N     . LEU A 1 114 ? -53.034 107.313 -39.322 1.00 39.11 ? 114 LEU A N     1 
ATOM   589  C  CA    . LEU A 1 114 ? -51.815 107.153 -38.513 1.00 34.65 ? 114 LEU A CA    1 
ATOM   590  C  C     . LEU A 1 114 ? -51.873 107.636 -37.040 1.00 38.48 ? 114 LEU A C     1 
ATOM   591  O  O     . LEU A 1 114 ? -50.848 107.664 -36.356 1.00 38.59 ? 114 LEU A O     1 
ATOM   592  C  CB    . LEU A 1 114 ? -50.634 107.825 -39.230 1.00 36.35 ? 114 LEU A CB    1 
ATOM   593  C  CG    . LEU A 1 114 ? -50.378 107.350 -40.667 1.00 34.21 ? 114 LEU A CG    1 
ATOM   594  C  CD1   . LEU A 1 114 ? -49.136 108.031 -41.221 1.00 38.34 ? 114 LEU A CD1   1 
ATOM   595  C  CD2   . LEU A 1 114 ? -50.204 105.857 -40.687 1.00 32.41 ? 114 LEU A CD2   1 
ATOM   596  N  N     . THR A 1 115 ? -53.060 108.012 -36.565 1.00 37.76 ? 115 THR A N     1 
ATOM   597  C  CA    . THR A 1 115 ? -53.238 108.466 -35.186 1.00 38.91 ? 115 THR A CA    1 
ATOM   598  C  C     . THR A 1 115 ? -53.080 107.295 -34.210 1.00 37.56 ? 115 THR A C     1 
ATOM   599  O  O     . THR A 1 115 ? -53.660 106.228 -34.410 1.00 33.66 ? 115 THR A O     1 
ATOM   600  C  CB    . THR A 1 115 ? -54.635 109.081 -34.971 1.00 46.24 ? 115 THR A CB    1 
ATOM   601  O  OG1   . THR A 1 115 ? -54.803 110.204 -35.847 1.00 46.94 ? 115 THR A OG1   1 
ATOM   602  C  CG2   . THR A 1 115 ? -54.798 109.557 -33.510 1.00 35.86 ? 115 THR A CG2   1 
ATOM   603  N  N     . LYS A 1 116 ? -52.283 107.498 -33.164 1.00 34.13 ? 116 LYS A N     1 
ATOM   604  C  CA    . LYS A 1 116 ? -52.052 106.454 -32.159 1.00 34.49 ? 116 LYS A CA    1 
ATOM   605  C  C     . LYS A 1 116 ? -53.141 106.404 -31.080 1.00 30.92 ? 116 LYS A C     1 
ATOM   606  O  O     . LYS A 1 116 ? -53.565 107.433 -30.588 1.00 31.55 ? 116 LYS A O     1 
ATOM   607  C  CB    . LYS A 1 116 ? -50.713 106.688 -31.468 1.00 28.18 ? 116 LYS A CB    1 
ATOM   608  C  CG    . LYS A 1 116 ? -49.488 106.457 -32.324 1.00 32.92 ? 116 LYS A CG    1 
ATOM   609  C  CD    . LYS A 1 116 ? -48.230 106.666 -31.498 1.00 35.30 ? 116 LYS A CD    1 
ATOM   610  C  CE    . LYS A 1 116 ? -46.976 106.377 -32.304 1.00 36.79 ? 116 LYS A CE    1 
ATOM   611  N  NZ    . LYS A 1 116 ? -46.749 107.448 -33.307 1.00 43.59 ? 116 LYS A NZ    1 
ATOM   612  N  N     . TYR A 1 117 ? -53.605 105.207 -30.745 1.00 29.76 ? 117 TYR A N     1 
ATOM   613  C  CA    . TYR A 1 117 ? -54.593 105.041 -29.680 1.00 27.25 ? 117 TYR A CA    1 
ATOM   614  C  C     . TYR A 1 117 ? -54.439 103.663 -29.097 1.00 27.95 ? 117 TYR A C     1 
ATOM   615  O  O     . TYR A 1 117 ? -53.642 102.847 -29.564 1.00 28.91 ? 117 TYR A O     1 
ATOM   616  C  CB    . TYR A 1 117 ? -56.046 105.257 -30.168 1.00 26.39 ? 117 TYR A CB    1 
ATOM   617  C  CG    . TYR A 1 117 ? -56.601 104.178 -31.082 1.00 33.23 ? 117 TYR A CG    1 
ATOM   618  C  CD1   . TYR A 1 117 ? -56.316 104.171 -32.462 1.00 30.81 ? 117 TYR A CD1   1 
ATOM   619  C  CD2   . TYR A 1 117 ? -57.426 103.185 -30.578 1.00 27.25 ? 117 TYR A CD2   1 
ATOM   620  C  CE1   . TYR A 1 117 ? -56.855 103.190 -33.305 1.00 28.28 ? 117 TYR A CE1   1 
ATOM   621  C  CE2   . TYR A 1 117 ? -57.966 102.203 -31.403 1.00 26.51 ? 117 TYR A CE2   1 
ATOM   622  C  CZ    . TYR A 1 117 ? -57.677 102.215 -32.777 1.00 32.52 ? 117 TYR A CZ    1 
ATOM   623  O  OH    . TYR A 1 117 ? -58.228 101.255 -33.600 1.00 31.64 ? 117 TYR A OH    1 
ATOM   624  N  N     . LEU A 1 118 ? -55.228 103.422 -28.059 1.00 33.24 ? 118 LEU A N     1 
ATOM   625  C  CA    . LEU A 1 118 ? -55.214 102.149 -27.341 1.00 30.77 ? 118 LEU A CA    1 
ATOM   626  C  C     . LEU A 1 118 ? -56.512 101.405 -27.389 1.00 30.15 ? 118 LEU A C     1 
ATOM   627  O  O     . LEU A 1 118 ? -57.561 101.996 -27.148 1.00 27.92 ? 118 LEU A O     1 
ATOM   628  C  CB    . LEU A 1 118 ? -54.851 102.357 -25.847 1.00 27.21 ? 118 LEU A CB    1 
ATOM   629  C  CG    . LEU A 1 118 ? -53.440 102.912 -25.556 1.00 30.10 ? 118 LEU A CG    1 
ATOM   630  C  CD1   . LEU A 1 118 ? -53.172 102.988 -24.050 1.00 29.56 ? 118 LEU A CD1   1 
ATOM   631  C  CD2   . LEU A 1 118 ? -52.455 101.948 -26.177 1.00 29.35 ? 118 LEU A CD2   1 
ATOM   632  N  N     . GLU A 1 119 ? -56.462 100.129 -27.762 1.00 27.26 ? 119 GLU A N     1 
ATOM   633  C  CA    . GLU A 1 119 ? -57.648 99.381  -27.613 1.00 33.25 ? 119 GLU A CA    1 
ATOM   634  C  C     . GLU A 1 119 ? -57.358 98.482  -26.474 1.00 34.39 ? 119 GLU A C     1 
ATOM   635  O  O     . GLU A 1 119 ? -56.650 97.491  -26.596 1.00 36.42 ? 119 GLU A O     1 
ATOM   636  C  CB    . GLU A 1 119 ? -57.860 98.556  -28.882 1.00 29.90 ? 119 GLU A CB    1 
ATOM   637  C  CG    . GLU A 1 119 ? -58.760 97.344  -28.641 1.00 46.03 ? 119 GLU A CG    1 
ATOM   638  C  CD    . GLU A 1 119 ? -60.045 97.512  -29.419 1.00 54.56 ? 119 GLU A CD    1 
ATOM   639  O  OE1   . GLU A 1 119 ? -60.164 98.485  -30.151 1.00 63.48 ? 119 GLU A OE1   1 
ATOM   640  O  OE2   . GLU A 1 119 ? -60.924 96.662  -29.285 1.00 59.06 ? 119 GLU A OE2   1 
ATOM   641  N  N     . ASN A 1 120 ? -57.890 98.886  -25.326 1.00 30.53 ? 120 ASN A N     1 
ATOM   642  C  CA    . ASN A 1 120 ? -57.662 98.177  -24.076 1.00 25.57 ? 120 ASN A CA    1 
ATOM   643  C  C     . ASN A 1 120 ? -58.657 97.058  -23.958 1.00 28.93 ? 120 ASN A C     1 
ATOM   644  O  O     . ASN A 1 120 ? -59.833 97.285  -23.793 1.00 33.58 ? 120 ASN A O     1 
ATOM   645  C  CB    . ASN A 1 120 ? -57.788 99.173  -22.923 1.00 25.10 ? 120 ASN A CB    1 
ATOM   646  C  CG    . ASN A 1 120 ? -56.776 100.250 -23.002 1.00 29.17 ? 120 ASN A CG    1 
ATOM   647  O  OD1   . ASN A 1 120 ? -55.591 99.990  -22.998 1.00 24.84 ? 120 ASN A OD1   1 
ATOM   648  N  ND2   . ASN A 1 120 ? -57.229 101.476 -23.067 1.00 29.33 ? 120 ASN A ND2   1 
ATOM   649  N  N     . GLN A 1 121 ? -58.169 95.837  -24.078 1.00 29.29 ? 121 GLN A N     1 
ATOM   650  C  CA    . GLN A 1 121 ? -59.023 94.671  -24.004 1.00 32.14 ? 121 GLN A CA    1 
ATOM   651  C  C     . GLN A 1 121 ? -58.960 93.998  -22.644 1.00 32.49 ? 121 GLN A C     1 
ATOM   652  O  O     . GLN A 1 121 ? -57.896 93.949  -22.017 1.00 32.60 ? 121 GLN A O     1 
ATOM   653  C  CB    . GLN A 1 121 ? -58.639 93.671  -25.091 1.00 31.54 ? 121 GLN A CB    1 
ATOM   654  C  CG    . GLN A 1 121 ? -58.919 94.185  -26.510 1.00 31.65 ? 121 GLN A CG    1 
ATOM   655  C  CD    . GLN A 1 121 ? -58.483 93.194  -27.549 1.00 35.06 ? 121 GLN A CD    1 
ATOM   656  O  OE1   . GLN A 1 121 ? -58.925 92.044  -27.549 1.00 41.51 ? 121 GLN A OE1   1 
ATOM   657  N  NE2   . GLN A 1 121 ? -57.616 93.617  -28.428 1.00 43.11 ? 121 GLN A NE2   1 
ATOM   658  N  N     . ALA A 1 122 ? -60.099 93.455  -22.215 1.00 31.51 ? 122 ALA A N     1 
ATOM   659  C  CA    . ALA A 1 122 ? -60.221 92.807  -20.915 1.00 28.44 ? 122 ALA A CA    1 
ATOM   660  C  C     . ALA A 1 122 ? -60.511 91.333  -21.016 1.00 28.47 ? 122 ALA A C     1 
ATOM   661  O  O     . ALA A 1 122 ? -61.349 90.915  -21.804 1.00 26.09 ? 122 ALA A O     1 
ATOM   662  C  CB    . ALA A 1 122 ? -61.332 93.504  -20.108 1.00 22.51 ? 122 ALA A CB    1 
ATOM   663  N  N     . PHE A 1 123 ? -59.801 90.543  -20.214 1.00 34.48 ? 123 PHE A N     1 
ATOM   664  C  CA    . PHE A 1 123 ? -59.988 89.101  -20.147 1.00 27.67 ? 123 PHE A CA    1 
ATOM   665  C  C     . PHE A 1 123 ? -60.152 88.739  -18.658 1.00 32.72 ? 123 PHE A C     1 
ATOM   666  O  O     . PHE A 1 123 ? -59.529 89.350  -17.784 1.00 31.81 ? 123 PHE A O     1 
ATOM   667  C  CB    . PHE A 1 123 ? -58.775 88.360  -20.738 1.00 24.16 ? 123 PHE A CB    1 
ATOM   668  C  CG    . PHE A 1 123 ? -58.511 88.689  -22.193 1.00 23.28 ? 123 PHE A CG    1 
ATOM   669  C  CD1   . PHE A 1 123 ? -57.878 89.871  -22.547 1.00 29.99 ? 123 PHE A CD1   1 
ATOM   670  C  CD2   . PHE A 1 123 ? -58.970 87.837  -23.208 1.00 24.02 ? 123 PHE A CD2   1 
ATOM   671  C  CE1   . PHE A 1 123 ? -57.722 90.227  -23.893 1.00 25.64 ? 123 PHE A CE1   1 
ATOM   672  C  CE2   . PHE A 1 123 ? -58.819 88.187  -24.564 1.00 21.56 ? 123 PHE A CE2   1 
ATOM   673  C  CZ    . PHE A 1 123 ? -58.192 89.379  -24.900 1.00 21.02 ? 123 PHE A CZ    1 
ATOM   674  N  N     . CYS A 1 124 ? -60.976 87.743  -18.370 1.00 31.06 ? 124 CYS A N     1 
ATOM   675  C  CA    . CYS A 1 124 ? -61.210 87.354  -16.999 1.00 34.13 ? 124 CYS A CA    1 
ATOM   676  C  C     . CYS A 1 124 ? -60.856 85.902  -16.852 1.00 27.81 ? 124 CYS A C     1 
ATOM   677  O  O     . CYS A 1 124 ? -61.199 85.099  -17.699 1.00 26.25 ? 124 CYS A O     1 
ATOM   678  C  CB    . CYS A 1 124 ? -62.691 87.573  -16.625 1.00 34.42 ? 124 CYS A CB    1 
ATOM   679  S  SG    . CYS A 1 124 ? -63.816 86.449  -17.466 1.00 60.99 ? 124 CYS A SG    1 
ATOM   680  N  N     . PHE A 1 125 ? -60.147 85.562  -15.779 1.00 29.02 ? 125 PHE A N     1 
ATOM   681  C  CA    . PHE A 1 125 ? -59.775 84.182  -15.532 1.00 30.52 ? 125 PHE A CA    1 
ATOM   682  C  C     . PHE A 1 125 ? -60.093 83.810  -14.083 1.00 28.50 ? 125 PHE A C     1 
ATOM   683  O  O     . PHE A 1 125 ? -60.326 84.673  -13.258 1.00 26.23 ? 125 PHE A O     1 
ATOM   684  C  CB    . PHE A 1 125 ? -58.281 84.005  -15.804 1.00 29.70 ? 125 PHE A CB    1 
ATOM   685  C  CG    . PHE A 1 125 ? -57.917 84.210  -17.239 1.00 38.29 ? 125 PHE A CG    1 
ATOM   686  C  CD1   . PHE A 1 125 ? -58.106 83.189  -18.164 1.00 44.01 ? 125 PHE A CD1   1 
ATOM   687  C  CD2   . PHE A 1 125 ? -57.467 85.450  -17.686 1.00 40.89 ? 125 PHE A CD2   1 
ATOM   688  C  CE1   . PHE A 1 125 ? -57.868 83.404  -19.512 1.00 48.33 ? 125 PHE A CE1   1 
ATOM   689  C  CE2   . PHE A 1 125 ? -57.226 85.673  -19.035 1.00 32.61 ? 125 PHE A CE2   1 
ATOM   690  C  CZ    . PHE A 1 125 ? -57.427 84.645  -19.947 1.00 40.99 ? 125 PHE A CZ    1 
ATOM   691  N  N     . ASP A 1 126 ? -60.088 82.523  -13.787 1.00 28.76 ? 126 ASP A N     1 
ATOM   692  C  CA    . ASP A 1 126 ? -60.335 82.067  -12.429 1.00 30.03 ? 126 ASP A CA    1 
ATOM   693  C  C     . ASP A 1 126 ? -59.323 82.783  -11.538 1.00 33.86 ? 126 ASP A C     1 
ATOM   694  O  O     . ASP A 1 126 ? -59.648 83.236  -10.437 1.00 36.11 ? 126 ASP A O     1 
ATOM   695  C  CB    . ASP A 1 126 ? -60.169 80.553  -12.363 1.00 27.19 ? 126 ASP A CB    1 
ATOM   696  C  CG    . ASP A 1 126 ? -61.348 79.820  -12.986 1.00 34.18 ? 126 ASP A CG    1 
ATOM   697  O  OD1   . ASP A 1 126 ? -62.496 80.183  -12.658 1.00 45.48 ? 126 ASP A OD1   1 
ATOM   698  O  OD2   . ASP A 1 126 ? -61.148 78.877  -13.787 1.00 31.03 ? 126 ASP A OD2   1 
ATOM   699  N  N     . PHE A 1 127 ? -58.099 82.914  -12.041 1.00 35.43 ? 127 PHE A N     1 
ATOM   700  C  CA    . PHE A 1 127 ? -57.035 83.605  -11.325 1.00 32.43 ? 127 PHE A CA    1 
ATOM   701  C  C     . PHE A 1 127 ? -56.079 84.254  -12.324 1.00 33.77 ? 127 PHE A C     1 
ATOM   702  O  O     . PHE A 1 127 ? -55.606 83.606  -13.254 1.00 32.56 ? 127 PHE A O     1 
ATOM   703  C  CB    . PHE A 1 127 ? -56.230 82.625  -10.465 1.00 36.00 ? 127 PHE A CB    1 
ATOM   704  C  CG    . PHE A 1 127 ? -57.045 81.885  -9.442  1.00 48.82 ? 127 PHE A CG    1 
ATOM   705  C  CD1   . PHE A 1 127 ? -57.522 82.532  -8.302  1.00 54.45 ? 127 PHE A CD1   1 
ATOM   706  C  CD2   . PHE A 1 127 ? -57.295 80.521  -9.596  1.00 45.72 ? 127 PHE A CD2   1 
ATOM   707  C  CE1   . PHE A 1 127 ? -58.246 81.829  -7.331  1.00 53.75 ? 127 PHE A CE1   1 
ATOM   708  C  CE2   . PHE A 1 127 ? -58.014 79.814  -8.637  1.00 51.13 ? 127 PHE A CE2   1 
ATOM   709  C  CZ    . PHE A 1 127 ? -58.486 80.467  -7.497  1.00 48.68 ? 127 PHE A CZ    1 
ATOM   710  N  N     . ALA A 1 128 ? -55.810 85.531  -12.117 1.00 26.55 ? 128 ALA A N     1 
ATOM   711  C  CA    . ALA A 1 128 ? -54.896 86.294  -12.935 1.00 30.39 ? 128 ALA A CA    1 
ATOM   712  C  C     . ALA A 1 128 ? -53.759 86.744  -12.021 1.00 28.50 ? 128 ALA A C     1 
ATOM   713  O  O     . ALA A 1 128 ? -54.009 87.438  -11.035 1.00 34.43 ? 128 ALA A O     1 
ATOM   714  C  CB    . ALA A 1 128 ? -55.607 87.506  -13.508 1.00 27.58 ? 128 ALA A CB    1 
ATOM   715  N  N     . PHE A 1 129 ? -52.526 86.355  -12.352 1.00 30.70 ? 129 PHE A N     1 
ATOM   716  C  CA    . PHE A 1 129 ? -51.331 86.701  -11.571 1.00 27.44 ? 129 PHE A CA    1 
ATOM   717  C  C     . PHE A 1 129 ? -50.502 87.800  -12.221 1.00 28.94 ? 129 PHE A C     1 
ATOM   718  O  O     . PHE A 1 129 ? -50.209 87.719  -13.418 1.00 27.77 ? 129 PHE A O     1 
ATOM   719  C  CB    . PHE A 1 129 ? -50.447 85.464  -11.426 1.00 32.46 ? 129 PHE A CB    1 
ATOM   720  C  CG    . PHE A 1 129 ? -51.151 84.267  -10.851 1.00 35.04 ? 129 PHE A CG    1 
ATOM   721  C  CD1   . PHE A 1 129 ? -51.342 84.141  -9.467  1.00 36.36 ? 129 PHE A CD1   1 
ATOM   722  C  CD2   . PHE A 1 129 ? -51.619 83.261  -11.687 1.00 25.75 ? 129 PHE A CD2   1 
ATOM   723  C  CE1   . PHE A 1 129 ? -51.975 83.018  -8.932  1.00 30.40 ? 129 PHE A CE1   1 
ATOM   724  C  CE2   . PHE A 1 129 ? -52.257 82.134  -11.172 1.00 31.90 ? 129 PHE A CE2   1 
ATOM   725  C  CZ    . PHE A 1 129 ? -52.443 82.011  -9.784  1.00 33.41 ? 129 PHE A CZ    1 
ATOM   726  N  N     . ASP A 1 130 ? -50.092 88.814  -11.453 1.00 29.26 ? 130 ASP A N     1 
ATOM   727  C  CA    . ASP A 1 130 ? -49.283 89.880  -12.018 1.00 30.84 ? 130 ASP A CA    1 
ATOM   728  C  C     . ASP A 1 130 ? -47.786 89.586  -11.931 1.00 29.39 ? 130 ASP A C     1 
ATOM   729  O  O     . ASP A 1 130 ? -47.375 88.527  -11.474 1.00 32.75 ? 130 ASP A O     1 
ATOM   730  C  CB    . ASP A 1 130 ? -49.603 91.256  -11.389 1.00 40.55 ? 130 ASP A CB    1 
ATOM   731  C  CG    . ASP A 1 130 ? -49.188 91.367  -9.929  1.00 44.25 ? 130 ASP A CG    1 
ATOM   732  O  OD1   . ASP A 1 130 ? -48.238 90.672  -9.508  1.00 58.05 ? 130 ASP A OD1   1 
ATOM   733  O  OD2   . ASP A 1 130 ? -49.809 92.179  -9.208  1.00 52.82 ? 130 ASP A OD2   1 
ATOM   734  N  N     . GLU A 1 131 ? -46.971 90.526  -12.392 1.00 33.26 ? 131 GLU A N     1 
ATOM   735  C  CA    . GLU A 1 131 ? -45.526 90.312  -12.419 1.00 34.44 ? 131 GLU A CA    1 
ATOM   736  C  C     . GLU A 1 131 ? -44.860 90.152  -11.054 1.00 35.81 ? 131 GLU A C     1 
ATOM   737  O  O     . GLU A 1 131 ? -43.692 89.761  -10.979 1.00 37.76 ? 131 GLU A O     1 
ATOM   738  C  CB    . GLU A 1 131 ? -44.826 91.438  -13.189 1.00 37.73 ? 131 GLU A CB    1 
ATOM   739  C  CG    . GLU A 1 131 ? -44.848 92.784  -12.502 1.00 46.55 ? 131 GLU A CG    1 
ATOM   740  C  CD    . GLU A 1 131 ? -46.095 93.580  -12.797 1.00 57.16 ? 131 GLU A CD    1 
ATOM   741  O  OE1   . GLU A 1 131 ? -47.201 93.000  -12.772 1.00 61.38 ? 131 GLU A OE1   1 
ATOM   742  O  OE2   . GLU A 1 131 ? -45.968 94.796  -13.046 1.00 69.97 ? 131 GLU A OE2   1 
ATOM   743  N  N     . THR A 1 132 ? -45.587 90.447  -9.978  1.00 32.15 ? 132 THR A N     1 
ATOM   744  C  CA    . THR A 1 132 ? -44.993 90.313  -8.649  1.00 32.37 ? 132 THR A CA    1 
ATOM   745  C  C     . THR A 1 132 ? -45.308 88.987  -8.004  1.00 40.12 ? 132 THR A C     1 
ATOM   746  O  O     . THR A 1 132 ? -44.806 88.705  -6.921  1.00 43.56 ? 132 THR A O     1 
ATOM   747  C  CB    . THR A 1 132 ? -45.449 91.428  -7.697  1.00 33.62 ? 132 THR A CB    1 
ATOM   748  O  OG1   . THR A 1 132 ? -46.844 91.283  -7.421  1.00 38.14 ? 132 THR A OG1   1 
ATOM   749  C  CG2   . THR A 1 132 ? -45.194 92.781  -8.308  1.00 33.01 ? 132 THR A CG2   1 
ATOM   750  N  N     . ALA A 1 133 ? -46.119 88.164  -8.666  1.00 35.14 ? 133 ALA A N     1 
ATOM   751  C  CA    . ALA A 1 133 ? -46.486 86.859  -8.129  1.00 38.95 ? 133 ALA A CA    1 
ATOM   752  C  C     . ALA A 1 133 ? -45.365 85.847  -8.265  1.00 36.65 ? 133 ALA A C     1 
ATOM   753  O  O     . ALA A 1 133 ? -44.830 85.642  -9.364  1.00 37.77 ? 133 ALA A O     1 
ATOM   754  C  CB    . ALA A 1 133 ? -47.734 86.340  -8.825  1.00 38.86 ? 133 ALA A CB    1 
ATOM   755  N  N     . SER A 1 134 ? -45.025 85.177  -7.160  1.00 34.73 ? 134 SER A N     1 
ATOM   756  C  CA    . SER A 1 134 ? -43.947 84.193  -7.183  1.00 36.28 ? 134 SER A CA    1 
ATOM   757  C  C     . SER A 1 134 ? -44.505 82.843  -7.584  1.00 34.57 ? 134 SER A C     1 
ATOM   758  O  O     . SER A 1 134 ? -45.716 82.662  -7.629  1.00 31.85 ? 134 SER A O     1 
ATOM   759  C  CB    . SER A 1 134 ? -43.281 84.098  -5.797  1.00 36.07 ? 134 SER A CB    1 
ATOM   760  O  OG    . SER A 1 134 ? -44.184 83.598  -4.816  1.00 42.60 ? 134 SER A OG    1 
ATOM   761  N  N     . ASN A 1 135 ? -43.626 81.888  -7.863  1.00 32.51 ? 135 ASN A N     1 
ATOM   762  C  CA    . ASN A 1 135 ? -44.065 80.552  -8.242  1.00 39.89 ? 135 ASN A CA    1 
ATOM   763  C  C     . ASN A 1 135 ? -44.912 79.876  -7.163  1.00 38.88 ? 135 ASN A C     1 
ATOM   764  O  O     . ASN A 1 135 ? -45.833 79.101  -7.471  1.00 39.31 ? 135 ASN A O     1 
ATOM   765  C  CB    . ASN A 1 135 ? -42.857 79.656  -8.559  1.00 34.64 ? 135 ASN A CB    1 
ATOM   766  C  CG    . ASN A 1 135 ? -42.238 79.950  -9.924  1.00 38.89 ? 135 ASN A CG    1 
ATOM   767  O  OD1   . ASN A 1 135 ? -42.642 80.882  -10.617 1.00 37.74 ? 135 ASN A OD1   1 
ATOM   768  N  ND2   . ASN A 1 135 ? -41.248 79.155  -10.306 1.00 33.59 ? 135 ASN A ND2   1 
ATOM   769  N  N     . GLU A 1 136 ? -44.597 80.149  -5.897  1.00 39.53 ? 136 GLU A N     1 
ATOM   770  C  CA    . GLU A 1 136 ? -45.335 79.538  -4.788  1.00 39.54 ? 136 GLU A CA    1 
ATOM   771  C  C     . GLU A 1 136 ? -46.763 80.060  -4.769  1.00 38.00 ? 136 GLU A C     1 
ATOM   772  O  O     . GLU A 1 136 ? -47.705 79.305  -4.537  1.00 32.76 ? 136 GLU A O     1 
ATOM   773  C  CB    . GLU A 1 136 ? -44.639 79.827  -3.454  1.00 42.23 ? 136 GLU A CB    1 
ATOM   774  C  CG    . GLU A 1 136 ? -45.238 79.053  -2.287  1.00 63.74 ? 136 GLU A CG    1 
ATOM   775  C  CD    . GLU A 1 136 ? -44.398 79.139  -1.025  1.00 76.83 ? 136 GLU A CD    1 
ATOM   776  O  OE1   . GLU A 1 136 ? -44.835 78.595  0.014   1.00 84.86 ? 136 GLU A OE1   1 
ATOM   777  O  OE2   . GLU A 1 136 ? -43.302 79.745  -1.070  1.00 79.77 ? 136 GLU A OE2   1 
ATOM   778  N  N     . VAL A 1 137 ? -46.922 81.353  -5.010  1.00 34.76 ? 137 VAL A N     1 
ATOM   779  C  CA    . VAL A 1 137 ? -48.248 81.947  -5.065  1.00 34.35 ? 137 VAL A CA    1 
ATOM   780  C  C     . VAL A 1 137 ? -49.032 81.328  -6.239  1.00 34.67 ? 137 VAL A C     1 
ATOM   781  O  O     . VAL A 1 137 ? -50.178 80.910  -6.069  1.00 32.78 ? 137 VAL A O     1 
ATOM   782  C  CB    . VAL A 1 137 ? -48.157 83.466  -5.261  1.00 38.34 ? 137 VAL A CB    1 
ATOM   783  C  CG1   . VAL A 1 137 ? -49.536 84.048  -5.504  1.00 34.60 ? 137 VAL A CG1   1 
ATOM   784  C  CG2   . VAL A 1 137 ? -47.539 84.101  -4.033  1.00 38.68 ? 137 VAL A CG2   1 
ATOM   785  N  N     . VAL A 1 138 ? -48.407 81.260  -7.422  1.00 31.59 ? 138 VAL A N     1 
ATOM   786  C  CA    . VAL A 1 138 ? -49.045 80.681  -8.610  1.00 28.11 ? 138 VAL A CA    1 
ATOM   787  C  C     . VAL A 1 138 ? -49.412 79.237  -8.330  1.00 33.52 ? 138 VAL A C     1 
ATOM   788  O  O     . VAL A 1 138 ? -50.541 78.803  -8.588  1.00 31.10 ? 138 VAL A O     1 
ATOM   789  C  CB    . VAL A 1 138 ? -48.085 80.756  -9.865  1.00 31.41 ? 138 VAL A CB    1 
ATOM   790  C  CG1   . VAL A 1 138 ? -48.661 79.969  -11.038 1.00 25.44 ? 138 VAL A CG1   1 
ATOM   791  C  CG2   . VAL A 1 138 ? -47.867 82.215  -10.268 1.00 24.53 ? 138 VAL A CG2   1 
ATOM   792  N  N     . TYR A 1 139 ? -48.459 78.485  -7.798  1.00 34.35 ? 139 TYR A N     1 
ATOM   793  C  CA    . TYR A 1 139 ? -48.702 77.085  -7.481  1.00 34.47 ? 139 TYR A CA    1 
ATOM   794  C  C     . TYR A 1 139 ? -49.891 76.887  -6.538  1.00 34.70 ? 139 TYR A C     1 
ATOM   795  O  O     . TYR A 1 139 ? -50.694 75.966  -6.709  1.00 39.07 ? 139 TYR A O     1 
ATOM   796  C  CB    . TYR A 1 139 ? -47.454 76.474  -6.846  1.00 32.97 ? 139 TYR A CB    1 
ATOM   797  C  CG    . TYR A 1 139 ? -47.713 75.141  -6.179  1.00 32.79 ? 139 TYR A CG    1 
ATOM   798  C  CD1   . TYR A 1 139 ? -47.974 74.008  -6.936  1.00 29.38 ? 139 TYR A CD1   1 
ATOM   799  C  CD2   . TYR A 1 139 ? -47.735 75.024  -4.775  1.00 29.04 ? 139 TYR A CD2   1 
ATOM   800  C  CE1   . TYR A 1 139 ? -48.256 72.797  -6.335  1.00 32.51 ? 139 TYR A CE1   1 
ATOM   801  C  CE2   . TYR A 1 139 ? -48.018 73.805  -4.160  1.00 28.64 ? 139 TYR A CE2   1 
ATOM   802  C  CZ    . TYR A 1 139 ? -48.279 72.698  -4.942  1.00 34.92 ? 139 TYR A CZ    1 
ATOM   803  O  OH    . TYR A 1 139 ? -48.566 71.481  -4.367  1.00 30.67 ? 139 TYR A OH    1 
ATOM   804  N  N     . ARG A 1 140 ? -49.992 77.754  -5.535  1.00 37.68 ? 140 ARG A N     1 
ATOM   805  C  CA    . ARG A 1 140 ? -51.058 77.664  -4.547  1.00 41.12 ? 140 ARG A CA    1 
ATOM   806  C  C     . ARG A 1 140 ? -52.460 77.704  -5.142  1.00 39.55 ? 140 ARG A C     1 
ATOM   807  O  O     . ARG A 1 140 ? -53.365 77.034  -4.653  1.00 38.82 ? 140 ARG A O     1 
ATOM   808  C  CB    . ARG A 1 140 ? -50.910 78.793  -3.525  1.00 49.91 ? 140 ARG A CB    1 
ATOM   809  C  CG    . ARG A 1 140 ? -51.834 78.669  -2.318  1.00 62.11 ? 140 ARG A CG    1 
ATOM   810  C  CD    . ARG A 1 140 ? -51.664 79.845  -1.360  1.00 70.55 ? 140 ARG A CD    1 
ATOM   811  N  NE    . ARG A 1 140 ? -50.259 80.121  -1.053  1.00 81.66 ? 140 ARG A NE    1 
ATOM   812  C  CZ    . ARG A 1 140 ? -49.409 79.235  -0.537  1.00 84.86 ? 140 ARG A CZ    1 
ATOM   813  N  NH1   . ARG A 1 140 ? -49.809 77.997  -0.262  1.00 84.86 ? 140 ARG A NH1   1 
ATOM   814  N  NH2   . ARG A 1 140 ? -48.154 79.590  -0.297  1.00 84.86 ? 140 ARG A NH2   1 
ATOM   815  N  N     . PHE A 1 141 ? -52.643 78.488  -6.199  1.00 39.52 ? 141 PHE A N     1 
ATOM   816  C  CA    . PHE A 1 141 ? -53.956 78.605  -6.821  1.00 39.20 ? 141 PHE A CA    1 
ATOM   817  C  C     . PHE A 1 141 ? -54.159 77.823  -8.116  1.00 41.21 ? 141 PHE A C     1 
ATOM   818  O  O     . PHE A 1 141 ? -55.191 77.973  -8.778  1.00 43.15 ? 141 PHE A O     1 
ATOM   819  C  CB    . PHE A 1 141 ? -54.266 80.072  -7.057  1.00 35.50 ? 141 PHE A CB    1 
ATOM   820  C  CG    . PHE A 1 141 ? -54.410 80.848  -5.799  1.00 40.66 ? 141 PHE A CG    1 
ATOM   821  C  CD1   . PHE A 1 141 ? -55.532 80.671  -4.991  1.00 46.11 ? 141 PHE A CD1   1 
ATOM   822  C  CD2   . PHE A 1 141 ? -53.402 81.708  -5.377  1.00 41.87 ? 141 PHE A CD2   1 
ATOM   823  C  CE1   . PHE A 1 141 ? -55.643 81.333  -3.773  1.00 52.07 ? 141 PHE A CE1   1 
ATOM   824  C  CE2   . PHE A 1 141 ? -53.501 82.376  -4.159  1.00 47.03 ? 141 PHE A CE2   1 
ATOM   825  C  CZ    . PHE A 1 141 ? -54.628 82.187  -3.355  1.00 47.73 ? 141 PHE A CZ    1 
ATOM   826  N  N     . THR A 1 142 ? -53.201 76.979  -8.476  1.00 35.29 ? 142 THR A N     1 
ATOM   827  C  CA    . THR A 1 142 ? -53.335 76.213  -9.709  1.00 31.12 ? 142 THR A CA    1 
ATOM   828  C  C     . THR A 1 142 ? -53.222 74.722  -9.494  1.00 34.70 ? 142 THR A C     1 
ATOM   829  O  O     . THR A 1 142 ? -54.227 74.008  -9.472  1.00 36.75 ? 142 THR A O     1 
ATOM   830  C  CB    . THR A 1 142 ? -52.293 76.691  -10.779 1.00 32.29 ? 142 THR A CB    1 
ATOM   831  O  OG1   . THR A 1 142 ? -50.958 76.582  -10.266 1.00 30.75 ? 142 THR A OG1   1 
ATOM   832  C  CG2   . THR A 1 142 ? -52.535 78.124  -11.127 1.00 22.91 ? 142 THR A CG2   1 
ATOM   833  N  N     . ALA A 1 143 ? -52.008 74.232  -9.309  1.00 36.41 ? 143 ALA A N     1 
ATOM   834  C  CA    . ALA A 1 143 ? -51.833 72.798  -9.119  1.00 33.34 ? 143 ALA A CA    1 
ATOM   835  C  C     . ALA A 1 143 ? -52.126 72.284  -7.699  1.00 30.80 ? 143 ALA A C     1 
ATOM   836  O  O     . ALA A 1 143 ? -52.555 71.143  -7.530  1.00 35.24 ? 143 ALA A O     1 
ATOM   837  C  CB    . ALA A 1 143 ? -50.427 72.403  -9.535  1.00 25.62 ? 143 ALA A CB    1 
ATOM   838  N  N     . ARG A 1 144 ? -51.891 73.114  -6.683  1.00 30.91 ? 144 ARG A N     1 
ATOM   839  C  CA    . ARG A 1 144 ? -52.121 72.686  -5.298  1.00 35.38 ? 144 ARG A CA    1 
ATOM   840  C  C     . ARG A 1 144 ? -53.504 72.075  -5.079  1.00 38.33 ? 144 ARG A C     1 
ATOM   841  O  O     . ARG A 1 144 ? -53.625 70.999  -4.493  1.00 36.73 ? 144 ARG A O     1 
ATOM   842  C  CB    . ARG A 1 144 ? -51.908 73.860  -4.346  1.00 35.46 ? 144 ARG A CB    1 
ATOM   843  C  CG    . ARG A 1 144 ? -51.887 73.465  -2.880  1.00 39.02 ? 144 ARG A CG    1 
ATOM   844  C  CD    . ARG A 1 144 ? -51.202 74.540  -2.064  1.00 42.53 ? 144 ARG A CD    1 
ATOM   845  N  NE    . ARG A 1 144 ? -51.062 74.161  -0.664  1.00 59.33 ? 144 ARG A NE    1 
ATOM   846  C  CZ    . ARG A 1 144 ? -51.942 74.459  0.288   1.00 63.60 ? 144 ARG A CZ    1 
ATOM   847  N  NH1   . ARG A 1 144 ? -53.039 75.149  -0.004  1.00 68.53 ? 144 ARG A NH1   1 
ATOM   848  N  NH2   . ARG A 1 144 ? -51.719 74.070  1.538   1.00 68.45 ? 144 ARG A NH2   1 
ATOM   849  N  N     . PRO A 1 145 ? -54.565 72.742  -5.566  1.00 39.50 ? 145 PRO A N     1 
ATOM   850  C  CA    . PRO A 1 145 ? -55.925 72.223  -5.402  1.00 39.99 ? 145 PRO A CA    1 
ATOM   851  C  C     . PRO A 1 145 ? -56.192 70.920  -6.156  1.00 44.99 ? 145 PRO A C     1 
ATOM   852  O  O     . PRO A 1 145 ? -57.269 70.344  -6.034  1.00 52.36 ? 145 PRO A O     1 
ATOM   853  C  CB    . PRO A 1 145 ? -56.794 73.359  -5.922  1.00 35.69 ? 145 PRO A CB    1 
ATOM   854  C  CG    . PRO A 1 145 ? -55.961 74.568  -5.714  1.00 31.99 ? 145 PRO A CG    1 
ATOM   855  C  CD    . PRO A 1 145 ? -54.598 74.107  -6.117  1.00 38.15 ? 145 PRO A CD    1 
ATOM   856  N  N     . LEU A 1 146 ? -55.222 70.448  -6.936  1.00 45.56 ? 146 LEU A N     1 
ATOM   857  C  CA    . LEU A 1 146 ? -55.421 69.216  -7.694  1.00 42.82 ? 146 LEU A CA    1 
ATOM   858  C  C     . LEU A 1 146 ? -54.762 68.002  -7.064  1.00 42.98 ? 146 LEU A C     1 
ATOM   859  O  O     . LEU A 1 146 ? -55.088 66.861  -7.402  1.00 41.94 ? 146 LEU A O     1 
ATOM   860  C  CB    . LEU A 1 146 ? -54.906 69.379  -9.132  1.00 46.73 ? 146 LEU A CB    1 
ATOM   861  C  CG    . LEU A 1 146 ? -55.639 70.355  -10.054 1.00 46.21 ? 146 LEU A CG    1 
ATOM   862  C  CD1   . LEU A 1 146 ? -55.070 70.233  -11.456 1.00 45.63 ? 146 LEU A CD1   1 
ATOM   863  C  CD2   . LEU A 1 146 ? -57.114 70.038  -10.077 1.00 52.10 ? 146 LEU A CD2   1 
ATOM   864  N  N     . VAL A 1 147 ? -53.829 68.236  -6.152  1.00 41.15 ? 147 VAL A N     1 
ATOM   865  C  CA    . VAL A 1 147 ? -53.145 67.129  -5.497  1.00 44.16 ? 147 VAL A CA    1 
ATOM   866  C  C     . VAL A 1 147 ? -54.134 66.199  -4.810  1.00 45.31 ? 147 VAL A C     1 
ATOM   867  O  O     . VAL A 1 147 ? -54.061 64.980  -4.955  1.00 46.68 ? 147 VAL A O     1 
ATOM   868  C  CB    . VAL A 1 147 ? -52.142 67.637  -4.448  1.00 42.11 ? 147 VAL A CB    1 
ATOM   869  C  CG1   . VAL A 1 147 ? -51.503 66.457  -3.732  1.00 41.58 ? 147 VAL A CG1   1 
ATOM   870  C  CG2   . VAL A 1 147 ? -51.078 68.493  -5.116  1.00 37.74 ? 147 VAL A CG2   1 
ATOM   871  N  N     . GLN A 1 148 ? -55.067 66.779  -4.065  1.00 47.33 ? 148 GLN A N     1 
ATOM   872  C  CA    . GLN A 1 148 ? -56.061 65.989  -3.349  1.00 50.12 ? 148 GLN A CA    1 
ATOM   873  C  C     . GLN A 1 148 ? -56.826 65.069  -4.295  1.00 49.22 ? 148 GLN A C     1 
ATOM   874  O  O     . GLN A 1 148 ? -57.221 63.952  -3.926  1.00 49.38 ? 148 GLN A O     1 
ATOM   875  C  CB    . GLN A 1 148 ? -57.029 66.923  -2.619  1.00 54.33 ? 148 GLN A CB    1 
ATOM   876  C  CG    . GLN A 1 148 ? -58.092 66.212  -1.803  1.00 60.31 ? 148 GLN A CG    1 
ATOM   877  C  CD    . GLN A 1 148 ? -58.831 67.166  -0.901  1.00 63.45 ? 148 GLN A CD    1 
ATOM   878  O  OE1   . GLN A 1 148 ? -58.250 67.727  0.027   1.00 68.98 ? 148 GLN A OE1   1 
ATOM   879  N  NE2   . GLN A 1 148 ? -60.115 67.370  -1.173  1.00 69.28 ? 148 GLN A NE2   1 
ATOM   880  N  N     . THR A 1 149 ? -57.024 65.543  -5.521  1.00 44.70 ? 149 THR A N     1 
ATOM   881  C  CA    . THR A 1 149 ? -57.736 64.776  -6.539  1.00 42.91 ? 149 THR A CA    1 
ATOM   882  C  C     . THR A 1 149 ? -57.114 63.404  -6.790  1.00 47.36 ? 149 THR A C     1 
ATOM   883  O  O     . THR A 1 149 ? -57.835 62.428  -7.003  1.00 44.55 ? 149 THR A O     1 
ATOM   884  C  CB    . THR A 1 149 ? -57.799 65.562  -7.876  1.00 43.62 ? 149 THR A CB    1 
ATOM   885  O  OG1   . THR A 1 149 ? -58.561 66.762  -7.686  1.00 52.22 ? 149 THR A OG1   1 
ATOM   886  C  CG2   . THR A 1 149 ? -58.447 64.716  -8.976  1.00 38.15 ? 149 THR A CG2   1 
ATOM   887  N  N     . ILE A 1 150 ? -55.785 63.317  -6.770  1.00 45.13 ? 150 ILE A N     1 
ATOM   888  C  CA    . ILE A 1 150 ? -55.133 62.026  -7.001  1.00 46.31 ? 150 ILE A CA    1 
ATOM   889  C  C     . ILE A 1 150 ? -55.247 61.126  -5.775  1.00 43.60 ? 150 ILE A C     1 
ATOM   890  O  O     . ILE A 1 150 ? -55.288 59.901  -5.905  1.00 43.69 ? 150 ILE A O     1 
ATOM   891  C  CB    . ILE A 1 150 ? -53.631 62.171  -7.380  1.00 40.97 ? 150 ILE A CB    1 
ATOM   892  C  CG1   . ILE A 1 150 ? -52.838 62.760  -6.212  1.00 39.29 ? 150 ILE A CG1   1 
ATOM   893  C  CG2   . ILE A 1 150 ? -53.491 63.043  -8.627  1.00 44.57 ? 150 ILE A CG2   1 
ATOM   894  C  CD1   . ILE A 1 150 ? -51.339 62.864  -6.474  1.00 40.20 ? 150 ILE A CD1   1 
ATOM   895  N  N     . PHE A 1 151 ? -55.289 61.723  -4.584  1.00 40.00 ? 151 PHE A N     1 
ATOM   896  C  CA    . PHE A 1 151 ? -55.439 60.921  -3.368  1.00 43.01 ? 151 PHE A CA    1 
ATOM   897  C  C     . PHE A 1 151 ? -56.873 60.409  -3.285  1.00 42.01 ? 151 PHE A C     1 
ATOM   898  O  O     . PHE A 1 151 ? -57.136 59.370  -2.687  1.00 43.47 ? 151 PHE A O     1 
ATOM   899  C  CB    . PHE A 1 151 ? -55.071 61.727  -2.117  1.00 43.20 ? 151 PHE A CB    1 
ATOM   900  C  CG    . PHE A 1 151 ? -53.592 61.772  -1.853  1.00 46.62 ? 151 PHE A CG    1 
ATOM   901  C  CD1   . PHE A 1 151 ? -52.776 62.688  -2.511  1.00 48.23 ? 151 PHE A CD1   1 
ATOM   902  C  CD2   . PHE A 1 151 ? -53.005 60.873  -0.966  1.00 47.09 ? 151 PHE A CD2   1 
ATOM   903  C  CE1   . PHE A 1 151 ? -51.391 62.705  -2.292  1.00 39.15 ? 151 PHE A CE1   1 
ATOM   904  C  CE2   . PHE A 1 151 ? -51.629 60.880  -0.742  1.00 42.00 ? 151 PHE A CE2   1 
ATOM   905  C  CZ    . PHE A 1 151 ? -50.820 61.798  -1.401  1.00 42.25 ? 151 PHE A CZ    1 
ATOM   906  N  N     . GLU A 1 152 ? -57.797 61.131  -3.912  1.00 41.71 ? 152 GLU A N     1 
ATOM   907  C  CA    . GLU A 1 152 ? -59.192 60.705  -3.940  1.00 36.79 ? 152 GLU A CA    1 
ATOM   908  C  C     . GLU A 1 152 ? -59.361 59.723  -5.096  1.00 40.48 ? 152 GLU A C     1 
ATOM   909  O  O     . GLU A 1 152 ? -60.482 59.364  -5.461  1.00 43.17 ? 152 GLU A O     1 
ATOM   910  C  CB    . GLU A 1 152 ? -60.123 61.906  -4.136  1.00 39.42 ? 152 GLU A CB    1 
ATOM   911  C  CG    . GLU A 1 152 ? -59.899 63.027  -3.126  1.00 47.94 ? 152 GLU A CG    1 
ATOM   912  C  CD    . GLU A 1 152 ? -60.846 64.201  -3.313  1.00 52.20 ? 152 GLU A CD    1 
ATOM   913  O  OE1   . GLU A 1 152 ? -61.134 64.555  -4.478  1.00 49.03 ? 152 GLU A OE1   1 
ATOM   914  O  OE2   . GLU A 1 152 ? -61.289 64.786  -2.295  1.00 52.51 ? 152 GLU A OE2   1 
ATOM   915  N  N     . GLY A 1 153 ? -58.237 59.305  -5.678  1.00 37.89 ? 153 GLY A N     1 
ATOM   916  C  CA    . GLY A 1 153 ? -58.261 58.351  -6.777  1.00 41.50 ? 153 GLY A CA    1 
ATOM   917  C  C     . GLY A 1 153 ? -58.561 58.886  -8.171  1.00 45.31 ? 153 GLY A C     1 
ATOM   918  O  O     . GLY A 1 153 ? -58.981 58.128  -9.051  1.00 46.63 ? 153 GLY A O     1 
ATOM   919  N  N     . GLY A 1 154 ? -58.350 60.180  -8.384  1.00 40.85 ? 154 GLY A N     1 
ATOM   920  C  CA    . GLY A 1 154 ? -58.605 60.751  -9.695  1.00 40.52 ? 154 GLY A CA    1 
ATOM   921  C  C     . GLY A 1 154 ? -57.348 60.963  -10.530 1.00 43.83 ? 154 GLY A C     1 
ATOM   922  O  O     . GLY A 1 154 ? -56.254 60.497  -10.186 1.00 38.41 ? 154 GLY A O     1 
ATOM   923  N  N     . LYS A 1 155 ? -57.513 61.663  -11.646 1.00 42.32 ? 155 LYS A N     1 
ATOM   924  C  CA    . LYS A 1 155 ? -56.409 61.959  -12.545 1.00 43.63 ? 155 LYS A CA    1 
ATOM   925  C  C     . LYS A 1 155 ? -56.421 63.448  -12.787 1.00 46.89 ? 155 LYS A C     1 
ATOM   926  O  O     . LYS A 1 155 ? -57.418 63.999  -13.252 1.00 41.07 ? 155 LYS A O     1 
ATOM   927  C  CB    . LYS A 1 155 ? -56.586 61.201  -13.859 1.00 47.72 ? 155 LYS A CB    1 
ATOM   928  C  CG    . LYS A 1 155 ? -56.455 59.699  -13.700 1.00 51.00 ? 155 LYS A CG    1 
ATOM   929  C  CD    . LYS A 1 155 ? -57.065 58.963  -14.872 1.00 60.08 ? 155 LYS A CD    1 
ATOM   930  C  CE    . LYS A 1 155 ? -56.920 57.457  -14.718 1.00 58.56 ? 155 LYS A CE    1 
ATOM   931  N  NZ    . LYS A 1 155 ? -55.489 57.055  -14.748 1.00 63.10 ? 155 LYS A NZ    1 
ATOM   932  N  N     . ALA A 1 156 ? -55.313 64.098  -12.446 1.00 41.29 ? 156 ALA A N     1 
ATOM   933  C  CA    . ALA A 1 156 ? -55.190 65.537  -12.614 1.00 41.13 ? 156 ALA A CA    1 
ATOM   934  C  C     . ALA A 1 156 ? -54.089 65.896  -13.604 1.00 41.04 ? 156 ALA A C     1 
ATOM   935  O  O     . ALA A 1 156 ? -53.103 65.178  -13.751 1.00 42.70 ? 156 ALA A O     1 
ATOM   936  C  CB    . ALA A 1 156 ? -54.904 66.206  -11.255 1.00 34.63 ? 156 ALA A CB    1 
ATOM   937  N  N     . THR A 1 157 ? -54.273 67.021  -14.277 1.00 36.71 ? 157 THR A N     1 
ATOM   938  C  CA    . THR A 1 157 ? -53.298 67.507  -15.242 1.00 34.57 ? 157 THR A CA    1 
ATOM   939  C  C     . THR A 1 157 ? -53.223 68.998  -15.085 1.00 33.66 ? 157 THR A C     1 
ATOM   940  O  O     . THR A 1 157 ? -54.235 69.651  -14.844 1.00 33.61 ? 157 THR A O     1 
ATOM   941  C  CB    . THR A 1 157 ? -53.711 67.197  -16.715 1.00 38.12 ? 157 THR A CB    1 
ATOM   942  O  OG1   . THR A 1 157 ? -55.049 67.662  -16.955 1.00 44.54 ? 157 THR A OG1   1 
ATOM   943  C  CG2   . THR A 1 157 ? -53.627 65.712  -16.997 1.00 39.11 ? 157 THR A CG2   1 
ATOM   944  N  N     . CYS A 1 158 ? -52.014 69.529  -15.193 1.00 31.50 ? 158 CYS A N     1 
ATOM   945  C  CA    . CYS A 1 158 ? -51.778 70.961  -15.101 1.00 32.13 ? 158 CYS A CA    1 
ATOM   946  C  C     . CYS A 1 158 ? -50.887 71.316  -16.310 1.00 34.84 ? 158 CYS A C     1 
ATOM   947  O  O     . CYS A 1 158 ? -49.823 70.727  -16.500 1.00 34.30 ? 158 CYS A O     1 
ATOM   948  C  CB    . CYS A 1 158 ? -51.061 71.303  -13.784 1.00 32.20 ? 158 CYS A CB    1 
ATOM   949  S  SG    . CYS A 1 158 ? -50.770 73.060  -13.550 1.00 41.03 ? 158 CYS A SG    1 
ATOM   950  N  N     . PHE A 1 159 ? -51.321 72.277  -17.117 1.00 34.50 ? 159 PHE A N     1 
ATOM   951  C  CA    . PHE A 1 159 ? -50.567 72.649  -18.313 1.00 33.46 ? 159 PHE A CA    1 
ATOM   952  C  C     . PHE A 1 159 ? -50.089 74.070  -18.252 1.00 36.05 ? 159 PHE A C     1 
ATOM   953  O  O     . PHE A 1 159 ? -50.830 74.945  -17.841 1.00 30.75 ? 159 PHE A O     1 
ATOM   954  C  CB    . PHE A 1 159 ? -51.426 72.528  -19.591 1.00 28.36 ? 159 PHE A CB    1 
ATOM   955  C  CG    . PHE A 1 159 ? -52.012 71.175  -19.821 1.00 31.51 ? 159 PHE A CG    1 
ATOM   956  C  CD1   . PHE A 1 159 ? -53.262 70.861  -19.327 1.00 32.72 ? 159 PHE A CD1   1 
ATOM   957  C  CD2   . PHE A 1 159 ? -51.325 70.218  -20.556 1.00 37.53 ? 159 PHE A CD2   1 
ATOM   958  C  CE1   . PHE A 1 159 ? -53.823 69.609  -19.552 1.00 30.70 ? 159 PHE A CE1   1 
ATOM   959  C  CE2   . PHE A 1 159 ? -51.875 68.964  -20.789 1.00 39.77 ? 159 PHE A CE2   1 
ATOM   960  C  CZ    . PHE A 1 159 ? -53.135 68.662  -20.285 1.00 37.59 ? 159 PHE A CZ    1 
ATOM   961  N  N     . ALA A 1 160 ? -48.846 74.282  -18.678 1.00 30.16 ? 160 ALA A N     1 
ATOM   962  C  CA    . ALA A 1 160 ? -48.297 75.588  -18.811 1.00 29.12 ? 160 ALA A CA    1 
ATOM   963  C  C     . ALA A 1 160 ? -48.311 75.891  -20.273 1.00 32.40 ? 160 ALA A C     1 
ATOM   964  O  O     . ALA A 1 160 ? -47.702 75.203  -21.083 1.00 31.07 ? 160 ALA A O     1 
ATOM   965  C  CB    . ALA A 1 160 ? -46.857 75.559  -18.298 1.00 23.68 ? 160 ALA A CB    1 
ATOM   966  N  N     . TYR A 1 161 ? -49.056 76.920  -20.654 1.00 33.00 ? 161 TYR A N     1 
ATOM   967  C  CA    . TYR A 1 161 ? -49.265 77.264  -22.060 1.00 33.07 ? 161 TYR A CA    1 
ATOM   968  C  C     . TYR A 1 161 ? -48.922 78.718  -22.360 1.00 34.71 ? 161 TYR A C     1 
ATOM   969  O  O     . TYR A 1 161 ? -49.152 79.597  -21.531 1.00 29.84 ? 161 TYR A O     1 
ATOM   970  C  CB    . TYR A 1 161 ? -50.737 76.968  -22.394 1.00 34.71 ? 161 TYR A CB    1 
ATOM   971  C  CG    . TYR A 1 161 ? -51.202 77.386  -23.756 1.00 37.76 ? 161 TYR A CG    1 
ATOM   972  C  CD1   . TYR A 1 161 ? -51.644 78.684  -23.988 1.00 33.85 ? 161 TYR A CD1   1 
ATOM   973  C  CD2   . TYR A 1 161 ? -51.165 76.491  -24.834 1.00 41.52 ? 161 TYR A CD2   1 
ATOM   974  C  CE1   . TYR A 1 161 ? -52.034 79.096  -25.257 1.00 42.02 ? 161 TYR A CE1   1 
ATOM   975  C  CE2   . TYR A 1 161 ? -51.553 76.892  -26.123 1.00 41.92 ? 161 TYR A CE2   1 
ATOM   976  C  CZ    . TYR A 1 161 ? -51.981 78.202  -26.322 1.00 38.47 ? 161 TYR A CZ    1 
ATOM   977  O  OH    . TYR A 1 161 ? -52.331 78.662  -27.571 1.00 41.88 ? 161 TYR A OH    1 
ATOM   978  N  N     . GLY A 1 162 ? -48.356 78.968  -23.546 1.00 31.07 ? 162 GLY A N     1 
ATOM   979  C  CA    . GLY A 1 162 ? -48.014 80.325  -23.928 1.00 30.86 ? 162 GLY A CA    1 
ATOM   980  C  C     . GLY A 1 162 ? -46.889 80.430  -24.937 1.00 33.50 ? 162 GLY A C     1 
ATOM   981  O  O     . GLY A 1 162 ? -46.371 79.428  -25.400 1.00 36.23 ? 162 GLY A O     1 
ATOM   982  N  N     . GLN A 1 163 ? -46.503 81.654  -25.263 1.00 32.60 ? 163 GLN A N     1 
ATOM   983  C  CA    . GLN A 1 163 ? -45.452 81.873  -26.247 1.00 33.88 ? 163 GLN A CA    1 
ATOM   984  C  C     . GLN A 1 163 ? -44.055 81.546  -25.734 1.00 37.73 ? 163 GLN A C     1 
ATOM   985  O  O     . GLN A 1 163 ? -43.816 81.449  -24.525 1.00 35.52 ? 163 GLN A O     1 
ATOM   986  C  CB    . GLN A 1 163 ? -45.454 83.327  -26.722 1.00 28.34 ? 163 GLN A CB    1 
ATOM   987  C  CG    . GLN A 1 163 ? -44.517 84.190  -25.938 1.00 32.33 ? 163 GLN A CG    1 
ATOM   988  C  CD    . GLN A 1 163 ? -44.355 85.589  -26.490 1.00 39.51 ? 163 GLN A CD    1 
ATOM   989  O  OE1   . GLN A 1 163 ? -45.205 86.453  -26.300 1.00 35.42 ? 163 GLN A OE1   1 
ATOM   990  N  NE2   . GLN A 1 163 ? -43.244 85.820  -27.172 1.00 39.18 ? 163 GLN A NE2   1 
ATOM   991  N  N     . THR A 1 164 ? -43.134 81.390  -26.682 1.00 37.68 ? 164 THR A N     1 
ATOM   992  C  CA    . THR A 1 164 ? -41.743 81.112  -26.384 1.00 36.06 ? 164 THR A CA    1 
ATOM   993  C  C     . THR A 1 164 ? -41.228 82.228  -25.474 1.00 34.46 ? 164 THR A C     1 
ATOM   994  O  O     . THR A 1 164 ? -41.414 83.416  -25.753 1.00 36.92 ? 164 THR A O     1 
ATOM   995  C  CB    . THR A 1 164 ? -40.915 81.040  -27.708 1.00 42.28 ? 164 THR A CB    1 
ATOM   996  O  OG1   . THR A 1 164 ? -41.273 79.848  -28.423 1.00 46.04 ? 164 THR A OG1   1 
ATOM   997  C  CG2   . THR A 1 164 ? -39.422 81.016  -27.431 1.00 37.79 ? 164 THR A CG2   1 
ATOM   998  N  N     . GLY A 1 165 ? -40.600 81.842  -24.365 1.00 29.30 ? 165 GLY A N     1 
ATOM   999  C  CA    . GLY A 1 165 ? -40.076 82.837  -23.436 1.00 26.66 ? 165 GLY A CA    1 
ATOM   1000 C  C     . GLY A 1 165 ? -41.094 83.482  -22.498 1.00 30.83 ? 165 GLY A C     1 
ATOM   1001 O  O     . GLY A 1 165 ? -40.788 84.478  -21.843 1.00 33.12 ? 165 GLY A O     1 
ATOM   1002 N  N     . SER A 1 166 ? -42.298 82.920  -22.413 1.00 26.48 ? 166 SER A N     1 
ATOM   1003 C  CA    . SER A 1 166 ? -43.354 83.506  -21.568 1.00 27.09 ? 166 SER A CA    1 
ATOM   1004 C  C     . SER A 1 166 ? -43.271 83.106  -20.073 1.00 34.05 ? 166 SER A C     1 
ATOM   1005 O  O     . SER A 1 166 ? -43.886 83.746  -19.218 1.00 30.59 ? 166 SER A O     1 
ATOM   1006 C  CB    . SER A 1 166 ? -44.739 83.156  -22.139 1.00 26.15 ? 166 SER A CB    1 
ATOM   1007 O  OG    . SER A 1 166 ? -44.954 81.752  -22.158 1.00 23.99 ? 166 SER A OG    1 
ATOM   1008 N  N     . GLY A 1 167 ? -42.523 82.046  -19.779 1.00 25.64 ? 167 GLY A N     1 
ATOM   1009 C  CA    . GLY A 1 167 ? -42.338 81.604  -18.412 1.00 30.63 ? 167 GLY A CA    1 
ATOM   1010 C  C     . GLY A 1 167 ? -42.819 80.210  -18.108 1.00 30.58 ? 167 GLY A C     1 
ATOM   1011 O  O     . GLY A 1 167 ? -42.956 79.834  -16.944 1.00 32.64 ? 167 GLY A O     1 
ATOM   1012 N  N     . LYS A 1 168 ? -43.063 79.421  -19.144 1.00 32.28 ? 168 LYS A N     1 
ATOM   1013 C  CA    . LYS A 1 168 ? -43.561 78.080  -18.936 1.00 28.55 ? 168 LYS A CA    1 
ATOM   1014 C  C     . LYS A 1 168 ? -42.634 77.174  -18.140 1.00 33.35 ? 168 LYS A C     1 
ATOM   1015 O  O     . LYS A 1 168 ? -43.053 76.558  -17.149 1.00 29.02 ? 168 LYS A O     1 
ATOM   1016 C  CB    . LYS A 1 168 ? -43.895 77.434  -20.282 1.00 25.50 ? 168 LYS A CB    1 
ATOM   1017 C  CG    . LYS A 1 168 ? -45.040 78.118  -21.045 1.00 23.99 ? 168 LYS A CG    1 
ATOM   1018 C  CD    . LYS A 1 168 ? -45.396 77.355  -22.342 1.00 21.89 ? 168 LYS A CD    1 
ATOM   1019 C  CE    . LYS A 1 168 ? -44.237 77.372  -23.365 1.00 25.91 ? 168 LYS A CE    1 
ATOM   1020 N  NZ    . LYS A 1 168 ? -43.784 78.780  -23.638 1.00 33.54 ? 168 LYS A NZ    1 
ATOM   1021 N  N     . THR A 1 169 ? -41.387 77.063  -18.590 1.00 38.30 ? 169 THR A N     1 
ATOM   1022 C  CA    . THR A 1 169 ? -40.394 76.211  -17.932 1.00 33.05 ? 169 THR A CA    1 
ATOM   1023 C  C     . THR A 1 169 ? -40.023 76.743  -16.541 1.00 34.80 ? 169 THR A C     1 
ATOM   1024 O  O     . THR A 1 169 ? -39.810 75.977  -15.608 1.00 33.63 ? 169 THR A O     1 
ATOM   1025 C  CB    . THR A 1 169 ? -39.127 76.115  -18.793 1.00 34.19 ? 169 THR A CB    1 
ATOM   1026 O  OG1   . THR A 1 169 ? -39.469 75.463  -20.010 1.00 31.82 ? 169 THR A OG1   1 
ATOM   1027 C  CG2   . THR A 1 169 ? -38.046 75.277  -18.123 1.00 34.69 ? 169 THR A CG2   1 
ATOM   1028 N  N     . HIS A 1 170 ? -39.932 78.060  -16.431 1.00 34.28 ? 170 HIS A N     1 
ATOM   1029 C  CA    . HIS A 1 170 ? -39.606 78.715  -15.179 1.00 36.47 ? 170 HIS A CA    1 
ATOM   1030 C  C     . HIS A 1 170 ? -40.626 78.364  -14.094 1.00 37.51 ? 170 HIS A C     1 
ATOM   1031 O  O     . HIS A 1 170 ? -40.265 78.137  -12.936 1.00 39.40 ? 170 HIS A O     1 
ATOM   1032 C  CB    . HIS A 1 170 ? -39.567 80.222  -15.403 1.00 29.70 ? 170 HIS A CB    1 
ATOM   1033 C  CG    . HIS A 1 170 ? -39.501 81.033  -14.145 1.00 38.82 ? 170 HIS A CG    1 
ATOM   1034 N  ND1   . HIS A 1 170 ? -40.626 81.389  -13.427 1.00 40.99 ? 170 HIS A ND1   1 
ATOM   1035 C  CD2   . HIS A 1 170 ? -38.453 81.603  -13.503 1.00 31.86 ? 170 HIS A CD2   1 
ATOM   1036 C  CE1   . HIS A 1 170 ? -40.273 82.145  -12.407 1.00 33.51 ? 170 HIS A CE1   1 
ATOM   1037 N  NE2   . HIS A 1 170 ? -38.959 82.291  -12.429 1.00 36.15 ? 170 HIS A NE2   1 
ATOM   1038 N  N     . THR A 1 171 ? -41.894 78.300  -14.489 1.00 35.24 ? 171 THR A N     1 
ATOM   1039 C  CA    . THR A 1 171 ? -42.987 77.994  -13.580 1.00 35.37 ? 171 THR A CA    1 
ATOM   1040 C  C     . THR A 1 171 ? -43.062 76.533  -13.176 1.00 33.61 ? 171 THR A C     1 
ATOM   1041 O  O     . THR A 1 171 ? -43.225 76.213  -12.001 1.00 31.86 ? 171 THR A O     1 
ATOM   1042 C  CB    . THR A 1 171 ? -44.339 78.409  -14.203 1.00 33.53 ? 171 THR A CB    1 
ATOM   1043 O  OG1   . THR A 1 171 ? -44.391 79.835  -14.309 1.00 35.83 ? 171 THR A OG1   1 
ATOM   1044 C  CG2   . THR A 1 171 ? -45.512 77.934  -13.351 1.00 33.52 ? 171 THR A CG2   1 
ATOM   1045 N  N     . MET A 1 172 ? -42.937 75.643  -14.145 1.00 35.23 ? 172 MET A N     1 
ATOM   1046 C  CA    . MET A 1 172 ? -43.045 74.205  -13.876 1.00 38.14 ? 172 MET A CA    1 
ATOM   1047 C  C     . MET A 1 172 ? -41.739 73.596  -13.334 1.00 43.48 ? 172 MET A C     1 
ATOM   1048 O  O     . MET A 1 172 ? -41.727 72.845  -12.367 1.00 43.31 ? 172 MET A O     1 
ATOM   1049 C  CB    . MET A 1 172 ? -43.445 73.506  -15.176 1.00 36.23 ? 172 MET A CB    1 
ATOM   1050 C  CG    . MET A 1 172 ? -44.687 74.128  -15.818 1.00 38.73 ? 172 MET A CG    1 
ATOM   1051 S  SD    . MET A 1 172 ? -46.067 74.233  -14.670 1.00 42.88 ? 172 MET A SD    1 
ATOM   1052 C  CE    . MET A 1 172 ? -46.524 72.493  -14.673 1.00 25.31 ? 172 MET A CE    1 
ATOM   1053 N  N     . GLY A 1 173 ? -40.602 73.928  -13.936 1.00 41.98 ? 173 GLY A N     1 
ATOM   1054 C  CA    . GLY A 1 173 ? -39.376 73.290  -13.498 1.00 44.48 ? 173 GLY A CA    1 
ATOM   1055 C  C     . GLY A 1 173 ? -38.446 73.986  -12.532 1.00 46.12 ? 173 GLY A C     1 
ATOM   1056 O  O     . GLY A 1 173 ? -37.591 73.340  -11.930 1.00 50.23 ? 173 GLY A O     1 
ATOM   1057 N  N     . GLY A 1 174 ? -38.597 75.287  -12.367 1.00 49.75 ? 174 GLY A N     1 
ATOM   1058 C  CA    . GLY A 1 174 ? -37.699 75.980  -11.478 1.00 56.80 ? 174 GLY A CA    1 
ATOM   1059 C  C     . GLY A 1 174 ? -37.176 77.184  -12.214 1.00 61.49 ? 174 GLY A C     1 
ATOM   1060 O  O     . GLY A 1 174 ? -37.083 77.202  -13.440 1.00 66.19 ? 174 GLY A O     1 
ATOM   1061 N  N     . ASP A 1 175 ? -36.796 78.179  -11.441 1.00 66.59 ? 175 ASP A N     1 
ATOM   1062 C  CA    . ASP A 1 175 ? -36.331 79.450  -11.948 1.00 74.53 ? 175 ASP A CA    1 
ATOM   1063 C  C     . ASP A 1 175 ? -35.103 79.466  -12.844 1.00 80.12 ? 175 ASP A C     1 
ATOM   1064 O  O     . ASP A 1 175 ? -33.959 79.349  -12.391 1.00 84.86 ? 175 ASP A O     1 
ATOM   1065 C  CB    . ASP A 1 175 ? -36.180 80.362  -10.747 1.00 77.24 ? 175 ASP A CB    1 
ATOM   1066 C  CG    . ASP A 1 175 ? -37.339 80.191  -9.780  1.00 82.06 ? 175 ASP A CG    1 
ATOM   1067 O  OD1   . ASP A 1 175 ? -37.751 79.029  -9.561  1.00 84.86 ? 175 ASP A OD1   1 
ATOM   1068 O  OD2   . ASP A 1 175 ? -37.845 81.194  -9.242  1.00 84.86 ? 175 ASP A OD2   1 
ATOM   1069 N  N     . LEU A 1 176 ? -35.392 79.631  -14.134 1.00 82.42 ? 176 LEU A N     1 
ATOM   1070 C  CA    . LEU A 1 176 ? -34.410 79.685  -15.208 1.00 82.03 ? 176 LEU A CA    1 
ATOM   1071 C  C     . LEU A 1 176 ? -35.118 79.235  -16.479 1.00 81.48 ? 176 LEU A C     1 
ATOM   1072 O  O     . LEU A 1 176 ? -36.103 78.498  -16.416 1.00 79.08 ? 176 LEU A O     1 
ATOM   1073 C  CB    . LEU A 1 176 ? -33.246 78.750  -14.914 1.00 83.12 ? 176 LEU A CB    1 
ATOM   1074 C  CG    . LEU A 1 176 ? -31.922 78.965  -15.655 1.00 84.86 ? 176 LEU A CG    1 
ATOM   1075 C  CD1   . LEU A 1 176 ? -31.922 78.210  -16.968 1.00 84.86 ? 176 LEU A CD1   1 
ATOM   1076 C  CD2   . LEU A 1 176 ? -31.647 80.442  -15.810 1.00 84.48 ? 176 LEU A CD2   1 
ATOM   1077 N  N     . GLN A 1 181 ? -33.717 75.829  -13.654 1.00 77.97 ? 181 GLN A N     1 
ATOM   1078 C  CA    . GLN A 1 181 ? -32.479 75.562  -12.923 1.00 77.02 ? 181 GLN A CA    1 
ATOM   1079 C  C     . GLN A 1 181 ? -32.720 74.993  -11.538 1.00 71.51 ? 181 GLN A C     1 
ATOM   1080 O  O     . GLN A 1 181 ? -32.347 73.858  -11.251 1.00 68.16 ? 181 GLN A O     1 
ATOM   1081 C  CB    . GLN A 1 181 ? -31.661 76.837  -12.779 1.00 80.60 ? 181 GLN A CB    1 
ATOM   1082 C  CG    . GLN A 1 181 ? -30.842 77.170  -13.981 1.00 82.28 ? 181 GLN A CG    1 
ATOM   1083 C  CD    . GLN A 1 181 ? -29.522 76.474  -14.017 1.00 84.86 ? 181 GLN A CD    1 
ATOM   1084 O  OE1   . GLN A 1 181 ? -29.111 75.852  -13.039 1.00 84.86 ? 181 GLN A OE1   1 
ATOM   1085 N  NE2   . GLN A 1 181 ? -28.827 76.584  -15.144 1.00 84.86 ? 181 GLN A NE2   1 
ATOM   1086 N  N     . ASN A 1 182 ? -33.326 75.803  -10.677 1.00 69.01 ? 182 ASN A N     1 
ATOM   1087 C  CA    . ASN A 1 182 ? -33.620 75.382  -9.316  1.00 70.93 ? 182 ASN A CA    1 
ATOM   1088 C  C     . ASN A 1 182 ? -34.944 74.626  -9.263  1.00 67.55 ? 182 ASN A C     1 
ATOM   1089 O  O     . ASN A 1 182 ? -36.016 75.225  -9.188  1.00 67.65 ? 182 ASN A O     1 
ATOM   1090 C  CB    . ASN A 1 182 ? -33.678 76.595  -8.389  1.00 75.56 ? 182 ASN A CB    1 
ATOM   1091 C  CG    . ASN A 1 182 ? -33.846 76.204  -6.935  1.00 80.33 ? 182 ASN A CG    1 
ATOM   1092 O  OD1   . ASN A 1 182 ? -33.985 77.060  -6.061  1.00 83.78 ? 182 ASN A OD1   1 
ATOM   1093 N  ND2   . ASN A 1 182 ? -33.829 74.900  -6.667  1.00 84.47 ? 182 ASN A ND2   1 
ATOM   1094 N  N     . ALA A 1 183 ? -34.854 73.302  -9.293  1.00 63.03 ? 183 ALA A N     1 
ATOM   1095 C  CA    . ALA A 1 183 ? -36.028 72.440  -9.271  1.00 63.69 ? 183 ALA A CA    1 
ATOM   1096 C  C     . ALA A 1 183 ? -36.993 72.722  -8.125  1.00 66.21 ? 183 ALA A C     1 
ATOM   1097 O  O     . ALA A 1 183 ? -38.204 72.816  -8.338  1.00 66.32 ? 183 ALA A O     1 
ATOM   1098 C  CB    . ALA A 1 183 ? -35.591 70.981  -9.228  1.00 60.93 ? 183 ALA A CB    1 
ATOM   1099 N  N     . SER A 1 184 ? -36.452 72.862  -6.917  1.00 64.04 ? 184 SER A N     1 
ATOM   1100 C  CA    . SER A 1 184 ? -37.254 73.108  -5.716  1.00 62.22 ? 184 SER A CA    1 
ATOM   1101 C  C     . SER A 1 184 ? -38.243 74.267  -5.823  1.00 61.68 ? 184 SER A C     1 
ATOM   1102 O  O     . SER A 1 184 ? -39.314 74.233  -5.210  1.00 60.48 ? 184 SER A O     1 
ATOM   1103 C  CB    . SER A 1 184 ? -36.333 73.356  -4.518  1.00 64.10 ? 184 SER A CB    1 
ATOM   1104 O  OG    . SER A 1 184 ? -35.609 74.567  -4.675  1.00 62.33 ? 184 SER A OG    1 
ATOM   1105 N  N     . LYS A 1 185 ? -37.888 75.288  -6.597  1.00 58.24 ? 185 LYS A N     1 
ATOM   1106 C  CA    . LYS A 1 185 ? -38.751 76.454  -6.745  1.00 53.86 ? 185 LYS A CA    1 
ATOM   1107 C  C     . LYS A 1 185 ? -39.834 76.337  -7.819  1.00 48.11 ? 185 LYS A C     1 
ATOM   1108 O  O     . LYS A 1 185 ? -40.563 77.295  -8.065  1.00 40.96 ? 185 LYS A O     1 
ATOM   1109 C  CB    . LYS A 1 185 ? -37.897 77.699  -6.996  1.00 57.88 ? 185 LYS A CB    1 
ATOM   1110 C  CG    . LYS A 1 185 ? -36.940 78.019  -5.855  1.00 61.72 ? 185 LYS A CG    1 
ATOM   1111 C  CD    . LYS A 1 185 ? -36.095 79.255  -6.133  1.00 68.65 ? 185 LYS A CD    1 
ATOM   1112 C  CE    . LYS A 1 185 ? -36.909 80.542  -6.043  1.00 74.31 ? 185 LYS A CE    1 
ATOM   1113 N  NZ    . LYS A 1 185 ? -37.417 80.805  -4.666  1.00 79.91 ? 185 LYS A NZ    1 
ATOM   1114 N  N     . GLY A 1 186 ? -39.954 75.164  -8.434  1.00 40.67 ? 186 GLY A N     1 
ATOM   1115 C  CA    . GLY A 1 186 ? -40.962 74.974  -9.459  1.00 37.26 ? 186 GLY A CA    1 
ATOM   1116 C  C     . GLY A 1 186 ? -42.151 74.133  -9.031  1.00 38.84 ? 186 GLY A C     1 
ATOM   1117 O  O     . GLY A 1 186 ? -42.103 73.430  -8.024  1.00 38.32 ? 186 GLY A O     1 
ATOM   1118 N  N     . ILE A 1 187 ? -43.221 74.187  -9.819  1.00 36.66 ? 187 ILE A N     1 
ATOM   1119 C  CA    . ILE A 1 187 ? -44.440 73.441  -9.532  1.00 37.70 ? 187 ILE A CA    1 
ATOM   1120 C  C     . ILE A 1 187 ? -44.257 71.932  -9.428  1.00 39.94 ? 187 ILE A C     1 
ATOM   1121 O  O     . ILE A 1 187 ? -44.953 71.275  -8.645  1.00 39.80 ? 187 ILE A O     1 
ATOM   1122 C  CB    . ILE A 1 187 ? -45.545 73.769  -10.593 1.00 34.60 ? 187 ILE A CB    1 
ATOM   1123 C  CG1   . ILE A 1 187 ? -46.126 75.148  -10.314 1.00 32.43 ? 187 ILE A CG1   1 
ATOM   1124 C  CG2   . ILE A 1 187 ? -46.639 72.720  -10.585 1.00 28.31 ? 187 ILE A CG2   1 
ATOM   1125 C  CD1   . ILE A 1 187 ? -47.277 75.519  -11.214 1.00 34.71 ? 187 ILE A CD1   1 
ATOM   1126 N  N     . TYR A 1 188 ? -43.347 71.355  -10.208 1.00 40.65 ? 188 TYR A N     1 
ATOM   1127 C  CA    . TYR A 1 188 ? -43.154 69.909  -10.113 1.00 38.24 ? 188 TYR A CA    1 
ATOM   1128 C  C     . TYR A 1 188 ? -42.756 69.566  -8.673  1.00 35.06 ? 188 TYR A C     1 
ATOM   1129 O  O     . TYR A 1 188 ? -43.266 68.619  -8.072  1.00 35.80 ? 188 TYR A O     1 
ATOM   1130 C  CB    . TYR A 1 188 ? -42.014 69.401  -11.012 1.00 35.25 ? 188 TYR A CB    1 
ATOM   1131 C  CG    . TYR A 1 188 ? -42.128 69.620  -12.508 1.00 39.57 ? 188 TYR A CG    1 
ATOM   1132 C  CD1   . TYR A 1 188 ? -43.356 69.555  -13.167 1.00 34.38 ? 188 TYR A CD1   1 
ATOM   1133 C  CD2   . TYR A 1 188 ? -40.978 69.853  -13.274 1.00 31.73 ? 188 TYR A CD2   1 
ATOM   1134 C  CE1   . TYR A 1 188 ? -43.441 69.724  -14.553 1.00 36.15 ? 188 TYR A CE1   1 
ATOM   1135 C  CE2   . TYR A 1 188 ? -41.045 70.017  -14.655 1.00 31.93 ? 188 TYR A CE2   1 
ATOM   1136 C  CZ    . TYR A 1 188 ? -42.280 69.955  -15.293 1.00 40.21 ? 188 TYR A CZ    1 
ATOM   1137 O  OH    . TYR A 1 188 ? -42.350 70.145  -16.661 1.00 37.04 ? 188 TYR A OH    1 
ATOM   1138 N  N     . ALA A 1 189 ? -41.800 70.332  -8.157  1.00 34.02 ? 189 ALA A N     1 
ATOM   1139 C  CA    . ALA A 1 189 ? -41.262 70.138  -6.819  1.00 34.13 ? 189 ALA A CA    1 
ATOM   1140 C  C     . ALA A 1 189 ? -42.308 70.420  -5.750  1.00 39.74 ? 189 ALA A C     1 
ATOM   1141 O  O     . ALA A 1 189 ? -42.593 69.568  -4.913  1.00 42.07 ? 189 ALA A O     1 
ATOM   1142 C  CB    . ALA A 1 189 ? -40.057 71.041  -6.622  1.00 27.57 ? 189 ALA A CB    1 
ATOM   1143 N  N     . MET A 1 190 ? -42.881 71.616  -5.795  1.00 38.70 ? 190 MET A N     1 
ATOM   1144 C  CA    . MET A 1 190 ? -43.892 72.012  -4.836  1.00 39.74 ? 190 MET A CA    1 
ATOM   1145 C  C     . MET A 1 190 ? -45.031 71.018  -4.750  1.00 39.08 ? 190 MET A C     1 
ATOM   1146 O  O     . MET A 1 190 ? -45.489 70.691  -3.653  1.00 49.31 ? 190 MET A O     1 
ATOM   1147 C  CB    . MET A 1 190 ? -44.415 73.401  -5.183  1.00 39.10 ? 190 MET A CB    1 
ATOM   1148 C  CG    . MET A 1 190 ? -43.356 74.463  -5.037  1.00 36.02 ? 190 MET A CG    1 
ATOM   1149 S  SD    . MET A 1 190 ? -43.983 76.094  -5.272  1.00 39.45 ? 190 MET A SD    1 
ATOM   1150 C  CE    . MET A 1 190 ? -42.567 76.938  -5.882  1.00 44.28 ? 190 MET A CE    1 
ATOM   1151 N  N     . ALA A 1 191 ? -45.480 70.517  -5.897  1.00 38.69 ? 191 ALA A N     1 
ATOM   1152 C  CA    . ALA A 1 191 ? -46.572 69.550  -5.929  1.00 38.58 ? 191 ALA A CA    1 
ATOM   1153 C  C     . ALA A 1 191 ? -46.157 68.259  -5.248  1.00 43.80 ? 191 ALA A C     1 
ATOM   1154 O  O     . ALA A 1 191 ? -46.961 67.615  -4.564  1.00 36.26 ? 191 ALA A O     1 
ATOM   1155 C  CB    . ALA A 1 191 ? -46.989 69.263  -7.381  1.00 37.42 ? 191 ALA A CB    1 
ATOM   1156 N  N     . SER A 1 192 ? -44.903 67.875  -5.465  1.00 43.43 ? 192 SER A N     1 
ATOM   1157 C  CA    . SER A 1 192 ? -44.350 66.659  -4.878  1.00 46.40 ? 192 SER A CA    1 
ATOM   1158 C  C     . SER A 1 192 ? -44.318 66.808  -3.359  1.00 46.20 ? 192 SER A C     1 
ATOM   1159 O  O     . SER A 1 192 ? -44.683 65.893  -2.621  1.00 47.25 ? 192 SER A O     1 
ATOM   1160 C  CB    . SER A 1 192 ? -42.928 66.428  -5.394  1.00 43.50 ? 192 SER A CB    1 
ATOM   1161 O  OG    . SER A 1 192 ? -42.938 66.068  -6.762  1.00 52.98 ? 192 SER A OG    1 
ATOM   1162 N  N     . ARG A 1 193 ? -43.869 67.979  -2.919  1.00 48.05 ? 193 ARG A N     1 
ATOM   1163 C  CA    . ARG A 1 193 ? -43.776 68.310  -1.510  1.00 48.19 ? 193 ARG A CA    1 
ATOM   1164 C  C     . ARG A 1 193 ? -45.115 68.101  -0.806  1.00 49.64 ? 193 ARG A C     1 
ATOM   1165 O  O     . ARG A 1 193 ? -45.155 67.552  0.293   1.00 53.09 ? 193 ARG A O     1 
ATOM   1166 C  CB    . ARG A 1 193 ? -43.333 69.761  -1.349  1.00 53.31 ? 193 ARG A CB    1 
ATOM   1167 C  CG    . ARG A 1 193 ? -43.185 70.207  0.093   1.00 66.39 ? 193 ARG A CG    1 
ATOM   1168 C  CD    . ARG A 1 193 ? -41.859 69.766  0.676   1.00 73.29 ? 193 ARG A CD    1 
ATOM   1169 N  NE    . ARG A 1 193 ? -40.748 70.505  0.082   1.00 80.34 ? 193 ARG A NE    1 
ATOM   1170 C  CZ    . ARG A 1 193 ? -39.473 70.333  0.418   1.00 84.79 ? 193 ARG A CZ    1 
ATOM   1171 N  NH1   . ARG A 1 193 ? -39.146 69.442  1.345   1.00 84.86 ? 193 ARG A NH1   1 
ATOM   1172 N  NH2   . ARG A 1 193 ? -38.527 71.054  -0.171  1.00 84.86 ? 193 ARG A NH2   1 
ATOM   1173 N  N     . ASP A 1 194 ? -46.207 68.532  -1.434  1.00 50.06 ? 194 ASP A N     1 
ATOM   1174 C  CA    . ASP A 1 194 ? -47.530 68.372  -0.840  1.00 46.69 ? 194 ASP A CA    1 
ATOM   1175 C  C     . ASP A 1 194 ? -48.060 66.956  -0.961  1.00 43.18 ? 194 ASP A C     1 
ATOM   1176 O  O     . ASP A 1 194 ? -48.967 66.562  -0.227  1.00 47.26 ? 194 ASP A O     1 
ATOM   1177 C  CB    . ASP A 1 194 ? -48.529 69.346  -1.465  1.00 44.49 ? 194 ASP A CB    1 
ATOM   1178 C  CG    . ASP A 1 194 ? -48.239 70.787  -1.098  1.00 55.47 ? 194 ASP A CG    1 
ATOM   1179 O  OD1   . ASP A 1 194 ? -47.408 71.011  -0.191  1.00 54.25 ? 194 ASP A OD1   1 
ATOM   1180 O  OD2   . ASP A 1 194 ? -48.846 71.697  -1.704  1.00 51.91 ? 194 ASP A OD2   1 
ATOM   1181 N  N     . VAL A 1 195 ? -47.506 66.182  -1.883  1.00 44.37 ? 195 VAL A N     1 
ATOM   1182 C  CA    . VAL A 1 195 ? -47.952 64.805  -2.055  1.00 45.41 ? 195 VAL A CA    1 
ATOM   1183 C  C     . VAL A 1 195 ? -47.427 63.956  -0.906  1.00 42.48 ? 195 VAL A C     1 
ATOM   1184 O  O     . VAL A 1 195 ? -48.095 63.038  -0.442  1.00 44.24 ? 195 VAL A O     1 
ATOM   1185 C  CB    . VAL A 1 195 ? -47.468 64.213  -3.411  1.00 44.40 ? 195 VAL A CB    1 
ATOM   1186 C  CG1   . VAL A 1 195 ? -47.581 62.695  -3.407  1.00 39.91 ? 195 VAL A CG1   1 
ATOM   1187 C  CG2   . VAL A 1 195 ? -48.323 64.784  -4.540  1.00 38.42 ? 195 VAL A CG2   1 
ATOM   1188 N  N     . PHE A 1 196 ? -46.220 64.261  -0.452  1.00 39.68 ? 196 PHE A N     1 
ATOM   1189 C  CA    . PHE A 1 196 ? -45.651 63.516  0.659   1.00 44.52 ? 196 PHE A CA    1 
ATOM   1190 C  C     . PHE A 1 196 ? -46.305 63.919  1.979   1.00 48.21 ? 196 PHE A C     1 
ATOM   1191 O  O     . PHE A 1 196 ? -46.461 63.094  2.874   1.00 50.06 ? 196 PHE A O     1 
ATOM   1192 C  CB    . PHE A 1 196 ? -44.141 63.723  0.707   1.00 40.81 ? 196 PHE A CB    1 
ATOM   1193 C  CG    . PHE A 1 196 ? -43.408 62.969  -0.364  1.00 45.22 ? 196 PHE A CG    1 
ATOM   1194 C  CD1   . PHE A 1 196 ? -43.522 61.587  -0.451  1.00 45.39 ? 196 PHE A CD1   1 
ATOM   1195 C  CD2   . PHE A 1 196 ? -42.647 63.641  -1.313  1.00 46.26 ? 196 PHE A CD2   1 
ATOM   1196 C  CE1   . PHE A 1 196 ? -42.890 60.885  -1.465  1.00 47.35 ? 196 PHE A CE1   1 
ATOM   1197 C  CE2   . PHE A 1 196 ? -42.009 62.945  -2.335  1.00 49.17 ? 196 PHE A CE2   1 
ATOM   1198 C  CZ    . PHE A 1 196 ? -42.133 61.569  -2.412  1.00 45.07 ? 196 PHE A CZ    1 
ATOM   1199 N  N     . LEU A 1 197 ? -46.702 65.183  2.081   1.00 52.65 ? 197 LEU A N     1 
ATOM   1200 C  CA    . LEU A 1 197 ? -47.360 65.691  3.274   1.00 50.58 ? 197 LEU A CA    1 
ATOM   1201 C  C     . LEU A 1 197 ? -48.747 65.070  3.420   1.00 52.53 ? 197 LEU A C     1 
ATOM   1202 O  O     . LEU A 1 197 ? -49.139 64.650  4.511   1.00 52.05 ? 197 LEU A O     1 
ATOM   1203 C  CB    . LEU A 1 197 ? -47.460 67.220  3.207   1.00 59.95 ? 197 LEU A CB    1 
ATOM   1204 C  CG    . LEU A 1 197 ? -46.230 68.009  3.693   1.00 67.49 ? 197 LEU A CG    1 
ATOM   1205 C  CD1   . LEU A 1 197 ? -44.950 67.362  3.191   1.00 71.41 ? 197 LEU A CD1   1 
ATOM   1206 C  CD2   . LEU A 1 197 ? -46.323 69.453  3.227   1.00 64.31 ? 197 LEU A CD2   1 
ATOM   1207 N  N     . LEU A 1 198 ? -49.485 64.990  2.317   1.00 51.89 ? 198 LEU A N     1 
ATOM   1208 C  CA    . LEU A 1 198 ? -50.825 64.414  2.347   1.00 51.57 ? 198 LEU A CA    1 
ATOM   1209 C  C     . LEU A 1 198 ? -50.840 62.914  2.589   1.00 55.01 ? 198 LEU A C     1 
ATOM   1210 O  O     . LEU A 1 198 ? -51.691 62.410  3.319   1.00 51.49 ? 198 LEU A O     1 
ATOM   1211 C  CB    . LEU A 1 198 ? -51.566 64.706  1.042   1.00 48.59 ? 198 LEU A CB    1 
ATOM   1212 C  CG    . LEU A 1 198 ? -52.530 65.894  1.018   1.00 50.49 ? 198 LEU A CG    1 
ATOM   1213 C  CD1   . LEU A 1 198 ? -51.793 67.173  1.368   1.00 48.96 ? 198 LEU A CD1   1 
ATOM   1214 C  CD2   . LEU A 1 198 ? -53.159 65.996  -0.369  1.00 49.80 ? 198 LEU A CD2   1 
ATOM   1215 N  N     . LYS A 1 199 ? -49.912 62.193  1.973   1.00 52.85 ? 199 LYS A N     1 
ATOM   1216 C  CA    . LYS A 1 199 ? -49.883 60.746  2.141   1.00 54.70 ? 199 LYS A CA    1 
ATOM   1217 C  C     . LYS A 1 199 ? -49.646 60.346  3.591   1.00 50.74 ? 199 LYS A C     1 
ATOM   1218 O  O     . LYS A 1 199 ? -50.018 59.251  4.001   1.00 45.45 ? 199 LYS A O     1 
ATOM   1219 C  CB    . LYS A 1 199 ? -48.813 60.105  1.239   1.00 54.43 ? 199 LYS A CB    1 
ATOM   1220 C  CG    . LYS A 1 199 ? -47.379 60.204  1.744   1.00 56.03 ? 199 LYS A CG    1 
ATOM   1221 C  CD    . LYS A 1 199 ? -46.396 59.614  0.734   1.00 60.38 ? 199 LYS A CD    1 
ATOM   1222 C  CE    . LYS A 1 199 ? -46.641 58.132  0.479   1.00 60.23 ? 199 LYS A CE    1 
ATOM   1223 N  NZ    . LYS A 1 199 ? -46.225 57.268  1.620   1.00 69.43 ? 199 LYS A NZ    1 
ATOM   1224 N  N     . ASN A 1 200 ? -49.025 61.235  4.360   1.00 57.46 ? 200 ASN A N     1 
ATOM   1225 C  CA    . ASN A 1 200 ? -48.753 60.958  5.763   1.00 61.53 ? 200 ASN A CA    1 
ATOM   1226 C  C     . ASN A 1 200 ? -49.881 61.445  6.674   1.00 62.68 ? 200 ASN A C     1 
ATOM   1227 O  O     . ASN A 1 200 ? -49.758 61.402  7.895   1.00 63.64 ? 200 ASN A O     1 
ATOM   1228 C  CB    . ASN A 1 200 ? -47.430 61.601  6.192   1.00 65.30 ? 200 ASN A CB    1 
ATOM   1229 C  CG    . ASN A 1 200 ? -46.240 61.048  5.432   1.00 77.55 ? 200 ASN A CG    1 
ATOM   1230 O  OD1   . ASN A 1 200 ? -46.202 59.864  5.084   1.00 81.55 ? 200 ASN A OD1   1 
ATOM   1231 N  ND2   . ASN A 1 200 ? -45.250 61.898  5.183   1.00 83.95 ? 200 ASN A ND2   1 
ATOM   1232 N  N     . GLN A 1 201 ? -50.974 61.918  6.081   1.00 56.72 ? 201 GLN A N     1 
ATOM   1233 C  CA    . GLN A 1 201 ? -52.109 62.385  6.862   1.00 54.69 ? 201 GLN A CA    1 
ATOM   1234 C  C     . GLN A 1 201 ? -53.000 61.187  7.176   1.00 57.92 ? 201 GLN A C     1 
ATOM   1235 O  O     . GLN A 1 201 ? -53.138 60.270  6.360   1.00 54.40 ? 201 GLN A O     1 
ATOM   1236 C  CB    . GLN A 1 201 ? -52.917 63.444  6.097   1.00 50.69 ? 201 GLN A CB    1 
ATOM   1237 C  CG    . GLN A 1 201 ? -52.194 64.768  5.853   1.00 44.85 ? 201 GLN A CG    1 
ATOM   1238 C  CD    . GLN A 1 201 ? -53.077 65.792  5.145   1.00 47.75 ? 201 GLN A CD    1 
ATOM   1239 O  OE1   . GLN A 1 201 ? -54.078 65.438  4.523   1.00 48.89 ? 201 GLN A OE1   1 
ATOM   1240 N  NE2   . GLN A 1 201 ? -52.702 67.062  5.228   1.00 47.68 ? 201 GLN A NE2   1 
ATOM   1241 N  N     . PRO A 1 202 ? -53.612 61.178  8.373   1.00 57.95 ? 202 PRO A N     1 
ATOM   1242 C  CA    . PRO A 1 202 ? -54.497 60.101  8.826   1.00 55.89 ? 202 PRO A CA    1 
ATOM   1243 C  C     . PRO A 1 202 ? -55.527 59.654  7.797   1.00 55.78 ? 202 PRO A C     1 
ATOM   1244 O  O     . PRO A 1 202 ? -55.731 58.457  7.594   1.00 57.15 ? 202 PRO A O     1 
ATOM   1245 C  CB    . PRO A 1 202 ? -55.139 60.689  10.083  1.00 60.45 ? 202 PRO A CB    1 
ATOM   1246 C  CG    . PRO A 1 202 ? -55.014 62.176  9.886   1.00 63.98 ? 202 PRO A CG    1 
ATOM   1247 C  CD    . PRO A 1 202 ? -53.634 62.295  9.329   1.00 57.37 ? 202 PRO A CD    1 
ATOM   1248 N  N     . ARG A 1 203 ? -56.175 60.613  7.144   1.00 56.39 ? 203 ARG A N     1 
ATOM   1249 C  CA    . ARG A 1 203 ? -57.181 60.277  6.139   1.00 56.91 ? 203 ARG A CA    1 
ATOM   1250 C  C     . ARG A 1 203 ? -56.609 59.464  4.981   1.00 56.32 ? 203 ARG A C     1 
ATOM   1251 O  O     . ARG A 1 203 ? -57.353 58.807  4.253   1.00 55.56 ? 203 ARG A O     1 
ATOM   1252 C  CB    . ARG A 1 203 ? -57.842 61.545  5.587   1.00 55.85 ? 203 ARG A CB    1 
ATOM   1253 C  CG    . ARG A 1 203 ? -56.881 62.557  4.989   1.00 55.02 ? 203 ARG A CG    1 
ATOM   1254 C  CD    . ARG A 1 203 ? -57.649 63.736  4.428   1.00 54.39 ? 203 ARG A CD    1 
ATOM   1255 N  NE    . ARG A 1 203 ? -56.782 64.842  4.037   1.00 49.94 ? 203 ARG A NE    1 
ATOM   1256 C  CZ    . ARG A 1 203 ? -57.232 65.996  3.554   1.00 51.97 ? 203 ARG A CZ    1 
ATOM   1257 N  NH1   . ARG A 1 203 ? -58.534 66.190  3.402   1.00 49.50 ? 203 ARG A NH1   1 
ATOM   1258 N  NH2   . ARG A 1 203 ? -56.388 66.963  3.230   1.00 46.94 ? 203 ARG A NH2   1 
ATOM   1259 N  N     . TYR A 1 204 ? -55.290 59.492  4.821   1.00 55.16 ? 204 TYR A N     1 
ATOM   1260 C  CA    . TYR A 1 204 ? -54.663 58.759  3.729   1.00 60.24 ? 204 TYR A CA    1 
ATOM   1261 C  C     . TYR A 1 204 ? -53.666 57.689  4.164   1.00 60.08 ? 204 TYR A C     1 
ATOM   1262 O  O     . TYR A 1 204 ? -53.382 56.768  3.402   1.00 61.56 ? 204 TYR A O     1 
ATOM   1263 C  CB    . TYR A 1 204 ? -53.996 59.747  2.761   1.00 56.35 ? 204 TYR A CB    1 
ATOM   1264 C  CG    . TYR A 1 204 ? -54.975 60.715  2.131   1.00 53.37 ? 204 TYR A CG    1 
ATOM   1265 C  CD1   . TYR A 1 204 ? -54.747 62.089  2.163   1.00 50.84 ? 204 TYR A CD1   1 
ATOM   1266 C  CD2   . TYR A 1 204 ? -56.152 60.259  1.542   1.00 52.63 ? 204 TYR A CD2   1 
ATOM   1267 C  CE1   . TYR A 1 204 ? -55.671 62.984  1.635   1.00 54.28 ? 204 TYR A CE1   1 
ATOM   1268 C  CE2   . TYR A 1 204 ? -57.084 61.146  1.010   1.00 55.88 ? 204 TYR A CE2   1 
ATOM   1269 C  CZ    . TYR A 1 204 ? -56.839 62.505  1.061   1.00 56.39 ? 204 TYR A CZ    1 
ATOM   1270 O  OH    . TYR A 1 204 ? -57.775 63.384  0.561   1.00 54.31 ? 204 TYR A OH    1 
ATOM   1271 N  N     . ARG A 1 205 ? -53.139 57.802  5.380   1.00 64.76 ? 205 ARG A N     1 
ATOM   1272 C  CA    . ARG A 1 205 ? -52.181 56.823  5.895   1.00 69.50 ? 205 ARG A CA    1 
ATOM   1273 C  C     . ARG A 1 205 ? -52.586 55.392  5.554   1.00 70.86 ? 205 ARG A C     1 
ATOM   1274 O  O     . ARG A 1 205 ? -51.816 54.636  4.968   1.00 67.20 ? 205 ARG A O     1 
ATOM   1275 C  CB    . ARG A 1 205 ? -52.075 56.925  7.417   1.00 74.35 ? 205 ARG A CB    1 
ATOM   1276 C  CG    . ARG A 1 205 ? -51.503 58.216  7.958   1.00 77.98 ? 205 ARG A CG    1 
ATOM   1277 C  CD    . ARG A 1 205 ? -51.707 58.265  9.466   1.00 78.92 ? 205 ARG A CD    1 
ATOM   1278 N  NE    . ARG A 1 205 ? -51.048 59.408  10.091  1.00 80.69 ? 205 ARG A NE    1 
ATOM   1279 C  CZ    . ARG A 1 205 ? -49.730 59.571  10.145  1.00 83.37 ? 205 ARG A CZ    1 
ATOM   1280 N  NH1   . ARG A 1 205 ? -48.923 58.663  9.607   1.00 82.47 ? 205 ARG A NH1   1 
ATOM   1281 N  NH2   . ARG A 1 205 ? -49.218 60.638  10.746  1.00 84.86 ? 205 ARG A NH2   1 
ATOM   1282 N  N     . ASN A 1 206 ? -53.805 55.031  5.936   1.00 73.45 ? 206 ASN A N     1 
ATOM   1283 C  CA    . ASN A 1 206 ? -54.322 53.689  5.713   1.00 76.52 ? 206 ASN A CA    1 
ATOM   1284 C  C     . ASN A 1 206 ? -54.458 53.285  4.248   1.00 77.06 ? 206 ASN A C     1 
ATOM   1285 O  O     . ASN A 1 206 ? -54.983 52.214  3.940   1.00 78.22 ? 206 ASN A O     1 
ATOM   1286 C  CB    . ASN A 1 206 ? -55.665 53.536  6.432   1.00 79.81 ? 206 ASN A CB    1 
ATOM   1287 C  CG    . ASN A 1 206 ? -55.575 53.891  7.908   1.00 81.47 ? 206 ASN A CG    1 
ATOM   1288 O  OD1   . ASN A 1 206 ? -54.740 53.353  8.637   1.00 81.51 ? 206 ASN A OD1   1 
ATOM   1289 N  ND2   . ASN A 1 206 ? -56.436 54.800  8.354   1.00 84.86 ? 206 ASN A ND2   1 
ATOM   1290 N  N     . LEU A 1 207 ? -53.990 54.139  3.345   1.00 76.90 ? 207 LEU A N     1 
ATOM   1291 C  CA    . LEU A 1 207 ? -54.050 53.829  1.921   1.00 76.18 ? 207 LEU A CA    1 
ATOM   1292 C  C     . LEU A 1 207 ? -52.847 52.973  1.553   1.00 75.26 ? 207 LEU A C     1 
ATOM   1293 O  O     . LEU A 1 207 ? -52.893 52.208  0.591   1.00 74.26 ? 207 LEU A O     1 
ATOM   1294 C  CB    . LEU A 1 207 ? -54.044 55.110  1.077   1.00 80.19 ? 207 LEU A CB    1 
ATOM   1295 C  CG    . LEU A 1 207 ? -55.368 55.839  0.817   1.00 82.52 ? 207 LEU A CG    1 
ATOM   1296 C  CD1   . LEU A 1 207 ? -56.272 54.963  -0.035  1.00 82.15 ? 207 LEU A CD1   1 
ATOM   1297 C  CD2   . LEU A 1 207 ? -56.046 56.190  2.130   1.00 83.85 ? 207 LEU A CD2   1 
ATOM   1298 N  N     . ASN A 1 208 ? -51.775 53.099  2.332   1.00 72.10 ? 208 ASN A N     1 
ATOM   1299 C  CA    . ASN A 1 208 ? -50.555 52.341  2.081   1.00 68.94 ? 208 ASN A CA    1 
ATOM   1300 C  C     . ASN A 1 208 ? -50.193 52.498  0.607   1.00 67.30 ? 208 ASN A C     1 
ATOM   1301 O  O     . ASN A 1 208 ? -50.193 51.534  -0.164  1.00 65.73 ? 208 ASN A O     1 
ATOM   1302 C  CB    . ASN A 1 208 ? -50.774 50.867  2.431   1.00 74.60 ? 208 ASN A CB    1 
ATOM   1303 C  CG    . ASN A 1 208 ? -50.917 50.638  3.930   1.00 80.58 ? 208 ASN A CG    1 
ATOM   1304 O  OD1   . ASN A 1 208 ? -51.465 49.624  4.365   1.00 84.86 ? 208 ASN A OD1   1 
ATOM   1305 N  ND2   . ASN A 1 208 ? -50.410 51.576  4.726   1.00 83.45 ? 208 ASN A ND2   1 
ATOM   1306 N  N     . LEU A 1 209 ? -49.900 53.737  0.228   1.00 63.73 ? 209 LEU A N     1 
ATOM   1307 C  CA    . LEU A 1 209 ? -49.546 54.071  -1.141  1.00 58.76 ? 209 LEU A CA    1 
ATOM   1308 C  C     . LEU A 1 209 ? -48.043 54.247  -1.302  1.00 55.78 ? 209 LEU A C     1 
ATOM   1309 O  O     . LEU A 1 209 ? -47.325 54.548  -0.347  1.00 55.00 ? 209 LEU A O     1 
ATOM   1310 C  CB    . LEU A 1 209 ? -50.228 55.378  -1.565  1.00 52.90 ? 209 LEU A CB    1 
ATOM   1311 C  CG    . LEU A 1 209 ? -51.751 55.504  -1.502  1.00 49.64 ? 209 LEU A CG    1 
ATOM   1312 C  CD1   . LEU A 1 209 ? -52.124 56.948  -1.764  1.00 51.70 ? 209 LEU A CD1   1 
ATOM   1313 C  CD2   . LEU A 1 209 ? -52.418 54.580  -2.508  1.00 48.83 ? 209 LEU A CD2   1 
ATOM   1314 N  N     . GLU A 1 210 ? -47.579 54.057  -2.530  1.00 51.42 ? 210 GLU A N     1 
ATOM   1315 C  CA    . GLU A 1 210 ? -46.177 54.238  -2.856  1.00 52.79 ? 210 GLU A CA    1 
ATOM   1316 C  C     . GLU A 1 210 ? -46.155 55.336  -3.922  1.00 45.42 ? 210 GLU A C     1 
ATOM   1317 O  O     . GLU A 1 210 ? -47.010 55.370  -4.810  1.00 44.23 ? 210 GLU A O     1 
ATOM   1318 C  CB    . GLU A 1 210 ? -45.591 52.933  -3.392  1.00 63.27 ? 210 GLU A CB    1 
ATOM   1319 C  CG    . GLU A 1 210 ? -44.161 52.699  -2.952  1.00 73.41 ? 210 GLU A CG    1 
ATOM   1320 C  CD    . GLU A 1 210 ? -44.011 52.715  -1.440  1.00 81.10 ? 210 GLU A CD    1 
ATOM   1321 O  OE1   . GLU A 1 210 ? -44.564 51.808  -0.781  1.00 84.86 ? 210 GLU A OE1   1 
ATOM   1322 O  OE2   . GLU A 1 210 ? -43.345 53.634  -0.912  1.00 84.86 ? 210 GLU A OE2   1 
ATOM   1323 N  N     . VAL A 1 211 ? -45.202 56.251  -3.816  1.00 45.10 ? 211 VAL A N     1 
ATOM   1324 C  CA    . VAL A 1 211 ? -45.101 57.349  -4.759  1.00 41.70 ? 211 VAL A CA    1 
ATOM   1325 C  C     . VAL A 1 211 ? -44.068 57.102  -5.854  1.00 44.13 ? 211 VAL A C     1 
ATOM   1326 O  O     . VAL A 1 211 ? -42.908 56.774  -5.578  1.00 41.02 ? 211 VAL A O     1 
ATOM   1327 C  CB    . VAL A 1 211 ? -44.758 58.660  -4.035  1.00 40.89 ? 211 VAL A CB    1 
ATOM   1328 C  CG1   . VAL A 1 211 ? -44.736 59.817  -5.020  1.00 40.70 ? 211 VAL A CG1   1 
ATOM   1329 C  CG2   . VAL A 1 211 ? -45.787 58.920  -2.943  1.00 36.51 ? 211 VAL A CG2   1 
ATOM   1330 N  N     . TYR A 1 212 ? -44.511 57.259  -7.102  1.00 43.32 ? 212 TYR A N     1 
ATOM   1331 C  CA    . TYR A 1 212 ? -43.644 57.066  -8.266  1.00 44.67 ? 212 TYR A CA    1 
ATOM   1332 C  C     . TYR A 1 212 ? -43.627 58.319  -9.126  1.00 43.75 ? 212 TYR A C     1 
ATOM   1333 O  O     . TYR A 1 212 ? -44.584 59.099  -9.144  1.00 39.43 ? 212 TYR A O     1 
ATOM   1334 C  CB    . TYR A 1 212 ? -44.115 55.864  -9.080  1.00 36.32 ? 212 TYR A CB    1 
ATOM   1335 C  CG    . TYR A 1 212 ? -43.898 54.553  -8.367  1.00 42.64 ? 212 TYR A CG    1 
ATOM   1336 C  CD1   . TYR A 1 212 ? -42.661 53.917  -8.406  1.00 41.27 ? 212 TYR A CD1   1 
ATOM   1337 C  CD2   . TYR A 1 212 ? -44.921 53.963  -7.621  1.00 43.56 ? 212 TYR A CD2   1 
ATOM   1338 C  CE1   . TYR A 1 212 ? -42.443 52.725  -7.724  1.00 49.83 ? 212 TYR A CE1   1 
ATOM   1339 C  CE2   . TYR A 1 212 ? -44.713 52.768  -6.932  1.00 50.41 ? 212 TYR A CE2   1 
ATOM   1340 C  CZ    . TYR A 1 212 ? -43.469 52.158  -6.990  1.00 50.86 ? 212 TYR A CZ    1 
ATOM   1341 O  OH    . TYR A 1 212 ? -43.249 50.979  -6.318  1.00 59.73 ? 212 TYR A OH    1 
ATOM   1342 N  N     . VAL A 1 213 ? -42.523 58.510  -9.829  1.00 42.82 ? 213 VAL A N     1 
ATOM   1343 C  CA    . VAL A 1 213 ? -42.347 59.678  -10.675 1.00 43.63 ? 213 VAL A CA    1 
ATOM   1344 C  C     . VAL A 1 213 ? -41.842 59.277  -12.065 1.00 42.72 ? 213 VAL A C     1 
ATOM   1345 O  O     . VAL A 1 213 ? -41.133 58.285  -12.208 1.00 38.72 ? 213 VAL A O     1 
ATOM   1346 C  CB    . VAL A 1 213 ? -41.340 60.651  -10.003 1.00 43.17 ? 213 VAL A CB    1 
ATOM   1347 C  CG1   . VAL A 1 213 ? -40.319 61.145  -11.007 1.00 45.57 ? 213 VAL A CG1   1 
ATOM   1348 C  CG2   . VAL A 1 213 ? -42.087 61.819  -9.378  1.00 34.76 ? 213 VAL A CG2   1 
ATOM   1349 N  N     . THR A 1 214 ? -42.238 60.040  -13.083 1.00 42.99 ? 214 THR A N     1 
ATOM   1350 C  CA    . THR A 1 214 ? -41.786 59.800  -14.461 1.00 42.53 ? 214 THR A CA    1 
ATOM   1351 C  C     . THR A 1 214 ? -41.547 61.156  -15.097 1.00 41.54 ? 214 THR A C     1 
ATOM   1352 O  O     . THR A 1 214 ? -42.146 62.152  -14.697 1.00 40.06 ? 214 THR A O     1 
ATOM   1353 C  CB    . THR A 1 214 ? -42.824 59.063  -15.333 1.00 45.08 ? 214 THR A CB    1 
ATOM   1354 O  OG1   . THR A 1 214 ? -43.935 59.930  -15.584 1.00 46.22 ? 214 THR A OG1   1 
ATOM   1355 C  CG2   . THR A 1 214 ? -43.298 57.788  -14.664 1.00 45.88 ? 214 THR A CG2   1 
ATOM   1356 N  N     . PHE A 1 215 ? -40.663 61.199  -16.087 1.00 37.96 ? 215 PHE A N     1 
ATOM   1357 C  CA    . PHE A 1 215 ? -40.363 62.454  -16.777 1.00 37.65 ? 215 PHE A CA    1 
ATOM   1358 C  C     . PHE A 1 215 ? -40.062 62.111  -18.242 1.00 41.77 ? 215 PHE A C     1 
ATOM   1359 O  O     . PHE A 1 215 ? -39.102 61.402  -18.533 1.00 46.39 ? 215 PHE A O     1 
ATOM   1360 C  CB    . PHE A 1 215 ? -39.151 63.127  -16.125 1.00 34.83 ? 215 PHE A CB    1 
ATOM   1361 C  CG    . PHE A 1 215 ? -39.084 64.618  -16.338 1.00 36.54 ? 215 PHE A CG    1 
ATOM   1362 C  CD1   . PHE A 1 215 ? -40.091 65.292  -17.016 1.00 35.42 ? 215 PHE A CD1   1 
ATOM   1363 C  CD2   . PHE A 1 215 ? -38.024 65.350  -15.824 1.00 37.85 ? 215 PHE A CD2   1 
ATOM   1364 C  CE1   . PHE A 1 215 ? -40.036 66.668  -17.195 1.00 36.12 ? 215 PHE A CE1   1 
ATOM   1365 C  CE2   . PHE A 1 215 ? -37.957 66.731  -15.996 1.00 44.09 ? 215 PHE A CE2   1 
ATOM   1366 C  CZ    . PHE A 1 215 ? -38.971 67.392  -16.675 1.00 36.38 ? 215 PHE A CZ    1 
ATOM   1367 N  N     . PHE A 1 216 ? -40.900 62.592  -19.158 1.00 36.01 ? 216 PHE A N     1 
ATOM   1368 C  CA    . PHE A 1 216 ? -40.696 62.315  -20.577 1.00 37.32 ? 216 PHE A CA    1 
ATOM   1369 C  C     . PHE A 1 216 ? -41.017 63.535  -21.414 1.00 40.63 ? 216 PHE A C     1 
ATOM   1370 O  O     . PHE A 1 216 ? -41.656 64.472  -20.936 1.00 34.59 ? 216 PHE A O     1 
ATOM   1371 C  CB    . PHE A 1 216 ? -41.545 61.114  -21.024 1.00 36.91 ? 216 PHE A CB    1 
ATOM   1372 C  CG    . PHE A 1 216 ? -43.032 61.324  -20.902 1.00 40.60 ? 216 PHE A CG    1 
ATOM   1373 C  CD1   . PHE A 1 216 ? -43.751 61.955  -21.919 1.00 44.73 ? 216 PHE A CD1   1 
ATOM   1374 C  CD2   . PHE A 1 216 ? -43.717 60.891  -19.768 1.00 37.30 ? 216 PHE A CD2   1 
ATOM   1375 C  CE1   . PHE A 1 216 ? -45.131 62.139  -21.811 1.00 43.93 ? 216 PHE A CE1   1 
ATOM   1376 C  CE2   . PHE A 1 216 ? -45.095 61.067  -19.647 1.00 41.95 ? 216 PHE A CE2   1 
ATOM   1377 C  CZ    . PHE A 1 216 ? -45.805 61.695  -20.664 1.00 47.18 ? 216 PHE A CZ    1 
ATOM   1378 N  N     . GLU A 1 217 ? -40.530 63.548  -22.654 1.00 39.66 ? 217 GLU A N     1 
ATOM   1379 C  CA    . GLU A 1 217 ? -40.797 64.667  -23.557 1.00 40.96 ? 217 GLU A CA    1 
ATOM   1380 C  C     . GLU A 1 217 ? -41.332 64.133  -24.869 1.00 42.88 ? 217 GLU A C     1 
ATOM   1381 O  O     . GLU A 1 217 ? -41.017 63.014  -25.270 1.00 45.25 ? 217 GLU A O     1 
ATOM   1382 C  CB    . GLU A 1 217 ? -39.535 65.494  -23.822 1.00 41.81 ? 217 GLU A CB    1 
ATOM   1383 C  CG    . GLU A 1 217 ? -38.397 64.729  -24.483 1.00 49.03 ? 217 GLU A CG    1 
ATOM   1384 C  CD    . GLU A 1 217 ? -37.415 65.645  -25.211 1.00 56.71 ? 217 GLU A CD    1 
ATOM   1385 O  OE1   . GLU A 1 217 ? -37.077 66.729  -24.689 1.00 52.38 ? 217 GLU A OE1   1 
ATOM   1386 O  OE2   . GLU A 1 217 ? -36.967 65.270  -26.312 1.00 54.65 ? 217 GLU A OE2   1 
ATOM   1387 N  N     . ILE A 1 218 ? -42.175 64.928  -25.514 1.00 43.11 ? 218 ILE A N     1 
ATOM   1388 C  CA    . ILE A 1 218 ? -42.746 64.546  -26.794 1.00 41.05 ? 218 ILE A CA    1 
ATOM   1389 C  C     . ILE A 1 218 ? -42.188 65.507  -27.836 1.00 47.36 ? 218 ILE A C     1 
ATOM   1390 O  O     . ILE A 1 218 ? -42.298 66.729  -27.706 1.00 42.16 ? 218 ILE A O     1 
ATOM   1391 C  CB    . ILE A 1 218 ? -44.291 64.607  -26.770 1.00 47.10 ? 218 ILE A CB    1 
ATOM   1392 C  CG1   . ILE A 1 218 ? -44.815 63.600  -25.742 1.00 45.08 ? 218 ILE A CG1   1 
ATOM   1393 C  CG2   . ILE A 1 218 ? -44.861 64.282  -28.164 1.00 39.82 ? 218 ILE A CG2   1 
ATOM   1394 C  CD1   . ILE A 1 218 ? -46.319 63.540  -25.634 1.00 51.46 ? 218 ILE A CD1   1 
ATOM   1395 N  N     . TYR A 1 219 ? -41.564 64.930  -28.856 1.00 52.06 ? 219 TYR A N     1 
ATOM   1396 C  CA    . TYR A 1 219 ? -40.944 65.688  -29.934 1.00 58.49 ? 219 TYR A CA    1 
ATOM   1397 C  C     . TYR A 1 219 ? -41.298 65.005  -31.253 1.00 62.54 ? 219 TYR A C     1 
ATOM   1398 O  O     . TYR A 1 219 ? -41.038 63.815  -31.434 1.00 62.92 ? 219 TYR A O     1 
ATOM   1399 C  CB    . TYR A 1 219 ? -39.430 65.696  -29.714 1.00 63.40 ? 219 TYR A CB    1 
ATOM   1400 C  CG    . TYR A 1 219 ? -38.624 66.563  -30.649 1.00 69.15 ? 219 TYR A CG    1 
ATOM   1401 C  CD1   . TYR A 1 219 ? -38.866 67.931  -30.751 1.00 72.50 ? 219 TYR A CD1   1 
ATOM   1402 C  CD2   . TYR A 1 219 ? -37.571 66.022  -31.387 1.00 74.50 ? 219 TYR A CD2   1 
ATOM   1403 C  CE1   . TYR A 1 219 ? -38.071 68.745  -31.563 1.00 77.08 ? 219 TYR A CE1   1 
ATOM   1404 C  CE2   . TYR A 1 219 ? -36.771 66.823  -32.199 1.00 77.07 ? 219 TYR A CE2   1 
ATOM   1405 C  CZ    . TYR A 1 219 ? -37.026 68.183  -32.281 1.00 79.55 ? 219 TYR A CZ    1 
ATOM   1406 O  OH    . TYR A 1 219 ? -36.228 68.979  -33.070 1.00 84.86 ? 219 TYR A OH    1 
ATOM   1407 N  N     . ASN A 1 220 ? -41.913 65.760  -32.156 1.00 67.52 ? 220 ASN A N     1 
ATOM   1408 C  CA    . ASN A 1 220 ? -42.320 65.243  -33.459 1.00 69.56 ? 220 ASN A CA    1 
ATOM   1409 C  C     . ASN A 1 220 ? -42.993 63.878  -33.409 1.00 68.61 ? 220 ASN A C     1 
ATOM   1410 O  O     . ASN A 1 220 ? -42.553 62.931  -34.066 1.00 70.48 ? 220 ASN A O     1 
ATOM   1411 C  CB    . ASN A 1 220 ? -41.121 65.193  -34.408 1.00 75.03 ? 220 ASN A CB    1 
ATOM   1412 C  CG    . ASN A 1 220 ? -40.862 66.526  -35.082 1.00 83.58 ? 220 ASN A CG    1 
ATOM   1413 O  OD1   . ASN A 1 220 ? -40.593 67.531  -34.420 1.00 84.86 ? 220 ASN A OD1   1 
ATOM   1414 N  ND2   . ASN A 1 220 ? -40.951 66.543  -36.409 1.00 84.86 ? 220 ASN A ND2   1 
ATOM   1415 N  N     . GLY A 1 221 ? -44.065 63.786  -32.629 1.00 67.98 ? 221 GLY A N     1 
ATOM   1416 C  CA    . GLY A 1 221 ? -44.804 62.542  -32.520 1.00 66.76 ? 221 GLY A CA    1 
ATOM   1417 C  C     . GLY A 1 221 ? -44.032 61.411  -31.874 1.00 64.51 ? 221 GLY A C     1 
ATOM   1418 O  O     . GLY A 1 221 ? -44.478 60.264  -31.889 1.00 70.77 ? 221 GLY A O     1 
ATOM   1419 N  N     . LYS A 1 222 ? -42.878 61.729  -31.299 1.00 62.19 ? 222 LYS A N     1 
ATOM   1420 C  CA    . LYS A 1 222 ? -42.051 60.722  -30.643 1.00 58.50 ? 222 LYS A CA    1 
ATOM   1421 C  C     . LYS A 1 222 ? -41.927 60.970  -29.135 1.00 55.99 ? 222 LYS A C     1 
ATOM   1422 O  O     . LYS A 1 222 ? -41.811 62.113  -28.688 1.00 51.04 ? 222 LYS A O     1 
ATOM   1423 C  CB    . LYS A 1 222 ? -40.648 60.709  -31.259 1.00 61.35 ? 222 LYS A CB    1 
ATOM   1424 C  CG    . LYS A 1 222 ? -40.596 60.400  -32.742 1.00 67.59 ? 222 LYS A CG    1 
ATOM   1425 C  CD    . LYS A 1 222 ? -41.035 58.978  -33.039 1.00 77.18 ? 222 LYS A CD    1 
ATOM   1426 C  CE    . LYS A 1 222 ? -40.658 58.577  -34.463 1.00 81.85 ? 222 LYS A CE    1 
ATOM   1427 N  NZ    . LYS A 1 222 ? -41.213 59.514  -35.480 1.00 84.71 ? 222 LYS A NZ    1 
ATOM   1428 N  N     . VAL A 1 223 ? -41.935 59.889  -28.362 1.00 48.36 ? 223 VAL A N     1 
ATOM   1429 C  CA    . VAL A 1 223 ? -41.805 59.977  -26.910 1.00 49.44 ? 223 VAL A CA    1 
ATOM   1430 C  C     . VAL A 1 223 ? -40.395 59.582  -26.477 1.00 49.94 ? 223 VAL A C     1 
ATOM   1431 O  O     . VAL A 1 223 ? -39.875 58.546  -26.892 1.00 54.13 ? 223 VAL A O     1 
ATOM   1432 C  CB    . VAL A 1 223 ? -42.805 59.039  -26.200 1.00 46.86 ? 223 VAL A CB    1 
ATOM   1433 C  CG1   . VAL A 1 223 ? -42.626 59.138  -24.693 1.00 45.79 ? 223 VAL A CG1   1 
ATOM   1434 C  CG2   . VAL A 1 223 ? -44.226 59.395  -26.599 1.00 47.69 ? 223 VAL A CG2   1 
ATOM   1435 N  N     . PHE A 1 224 ? -39.785 60.407  -25.634 1.00 45.91 ? 224 PHE A N     1 
ATOM   1436 C  CA    . PHE A 1 224 ? -38.433 60.142  -25.145 1.00 50.93 ? 224 PHE A CA    1 
ATOM   1437 C  C     . PHE A 1 224 ? -38.372 60.166  -23.621 1.00 51.64 ? 224 PHE A C     1 
ATOM   1438 O  O     . PHE A 1 224 ? -38.782 61.139  -22.993 1.00 49.27 ? 224 PHE A O     1 
ATOM   1439 C  CB    . PHE A 1 224 ? -37.468 61.182  -25.715 1.00 48.65 ? 224 PHE A CB    1 
ATOM   1440 C  CG    . PHE A 1 224 ? -37.358 61.146  -27.214 1.00 57.15 ? 224 PHE A CG    1 
ATOM   1441 C  CD1   . PHE A 1 224 ? -36.519 60.229  -27.844 1.00 55.26 ? 224 PHE A CD1   1 
ATOM   1442 C  CD2   . PHE A 1 224 ? -38.151 61.982  -28.001 1.00 53.29 ? 224 PHE A CD2   1 
ATOM   1443 C  CE1   . PHE A 1 224 ? -36.455 60.161  -29.235 1.00 54.67 ? 224 PHE A CE1   1 
ATOM   1444 C  CE2   . PHE A 1 224 ? -38.093 61.920  -29.390 1.00 56.33 ? 224 PHE A CE2   1 
ATOM   1445 C  CZ    . PHE A 1 224 ? -37.252 61.000  -30.007 1.00 53.97 ? 224 PHE A CZ    1 
ATOM   1446 N  N     . ASP A 1 225 ? -37.855 59.093  -23.030 1.00 53.44 ? 225 ASP A N     1 
ATOM   1447 C  CA    . ASP A 1 225 ? -37.741 59.009  -21.575 1.00 51.65 ? 225 ASP A CA    1 
ATOM   1448 C  C     . ASP A 1 225 ? -36.586 59.872  -21.080 1.00 48.75 ? 225 ASP A C     1 
ATOM   1449 O  O     . ASP A 1 225 ? -35.426 59.571  -21.345 1.00 53.81 ? 225 ASP A O     1 
ATOM   1450 C  CB    . ASP A 1 225 ? -37.504 57.563  -21.145 1.00 52.20 ? 225 ASP A CB    1 
ATOM   1451 C  CG    . ASP A 1 225 ? -37.850 57.327  -19.687 1.00 49.24 ? 225 ASP A CG    1 
ATOM   1452 O  OD1   . ASP A 1 225 ? -37.530 58.194  -18.841 1.00 48.35 ? 225 ASP A OD1   1 
ATOM   1453 O  OD2   . ASP A 1 225 ? -38.436 56.269  -19.388 1.00 53.22 ? 225 ASP A OD2   1 
ATOM   1454 N  N     . LEU A 1 226 ? -36.904 60.940  -20.354 1.00 46.87 ? 226 LEU A N     1 
ATOM   1455 C  CA    . LEU A 1 226 ? -35.878 61.839  -19.832 1.00 47.08 ? 226 LEU A CA    1 
ATOM   1456 C  C     . LEU A 1 226 ? -35.175 61.283  -18.600 1.00 48.65 ? 226 LEU A C     1 
ATOM   1457 O  O     . LEU A 1 226 ? -34.163 61.828  -18.162 1.00 50.38 ? 226 LEU A O     1 
ATOM   1458 C  CB    . LEU A 1 226 ? -36.489 63.195  -19.488 1.00 46.40 ? 226 LEU A CB    1 
ATOM   1459 C  CG    . LEU A 1 226 ? -37.202 63.930  -20.624 1.00 43.92 ? 226 LEU A CG    1 
ATOM   1460 C  CD1   . LEU A 1 226 ? -37.861 65.185  -20.088 1.00 46.27 ? 226 LEU A CD1   1 
ATOM   1461 C  CD2   . LEU A 1 226 ? -36.197 64.274  -21.714 1.00 42.52 ? 226 LEU A CD2   1 
ATOM   1462 N  N     . LEU A 1 227 ? -35.714 60.207  -18.035 1.00 50.76 ? 227 LEU A N     1 
ATOM   1463 C  CA    . LEU A 1 227 ? -35.115 59.592  -16.855 1.00 56.97 ? 227 LEU A CA    1 
ATOM   1464 C  C     . LEU A 1 227 ? -34.398 58.319  -17.267 1.00 61.01 ? 227 LEU A C     1 
ATOM   1465 O  O     . LEU A 1 227 ? -33.867 57.590  -16.426 1.00 59.81 ? 227 LEU A O     1 
ATOM   1466 C  CB    . LEU A 1 227 ? -36.183 59.262  -15.802 1.00 55.15 ? 227 LEU A CB    1 
ATOM   1467 C  CG    . LEU A 1 227 ? -37.010 60.409  -15.215 1.00 50.13 ? 227 LEU A CG    1 
ATOM   1468 C  CD1   . LEU A 1 227 ? -37.910 59.856  -14.123 1.00 51.19 ? 227 LEU A CD1   1 
ATOM   1469 C  CD2   . LEU A 1 227 ? -36.101 61.493  -14.661 1.00 50.80 ? 227 LEU A CD2   1 
ATOM   1470 N  N     . ASN A 1 228 ? -34.401 58.053  -18.569 1.00 64.46 ? 228 ASN A N     1 
ATOM   1471 C  CA    . ASN A 1 228 ? -33.738 56.878  -19.120 1.00 64.47 ? 228 ASN A CA    1 
ATOM   1472 C  C     . ASN A 1 228 ? -32.971 57.302  -20.370 1.00 62.33 ? 228 ASN A C     1 
ATOM   1473 O  O     . ASN A 1 228 ? -33.075 56.687  -21.432 1.00 58.96 ? 228 ASN A O     1 
ATOM   1474 C  CB    . ASN A 1 228 ? -34.763 55.789  -19.452 1.00 68.62 ? 228 ASN A CB    1 
ATOM   1475 C  CG    . ASN A 1 228 ? -34.117 54.431  -19.674 1.00 68.92 ? 228 ASN A CG    1 
ATOM   1476 O  OD1   . ASN A 1 228 ? -33.187 54.054  -18.963 1.00 67.38 ? 228 ASN A OD1   1 
ATOM   1477 N  ND2   . ASN A 1 228 ? -34.619 53.686  -20.649 1.00 69.44 ? 228 ASN A ND2   1 
ATOM   1478 N  N     . LYS A 1 229 ? -32.218 58.385  -20.212 1.00 61.73 ? 229 LYS A N     1 
ATOM   1479 C  CA    . LYS A 1 229 ? -31.382 58.963  -21.258 1.00 63.44 ? 229 LYS A CA    1 
ATOM   1480 C  C     . LYS A 1 229 ? -32.012 59.143  -22.638 1.00 62.48 ? 229 LYS A C     1 
ATOM   1481 O  O     . LYS A 1 229 ? -31.552 58.563  -23.620 1.00 62.93 ? 229 LYS A O     1 
ATOM   1482 C  CB    . LYS A 1 229 ? -30.090 58.151  -21.382 1.00 65.16 ? 229 LYS A CB    1 
ATOM   1483 C  CG    . LYS A 1 229 ? -29.221 58.204  -20.137 1.00 71.55 ? 229 LYS A CG    1 
ATOM   1484 C  CD    . LYS A 1 229 ? -27.956 57.380  -20.304 1.00 78.73 ? 229 LYS A CD    1 
ATOM   1485 C  CE    . LYS A 1 229 ? -27.056 57.503  -19.086 1.00 80.54 ? 229 LYS A CE    1 
ATOM   1486 N  NZ    . LYS A 1 229 ? -27.728 57.018  -17.849 1.00 84.86 ? 229 LYS A NZ    1 
ATOM   1487 N  N     . LYS A 1 230 ? -33.059 59.958  -22.709 1.00 60.53 ? 230 LYS A N     1 
ATOM   1488 C  CA    . LYS A 1 230 ? -33.721 60.236  -23.976 1.00 55.80 ? 230 LYS A CA    1 
ATOM   1489 C  C     . LYS A 1 230 ? -34.122 58.996  -24.762 1.00 54.74 ? 230 LYS A C     1 
ATOM   1490 O  O     . LYS A 1 230 ? -34.424 59.091  -25.950 1.00 59.05 ? 230 LYS A O     1 
ATOM   1491 C  CB    . LYS A 1 230 ? -32.812 61.105  -24.846 1.00 55.37 ? 230 LYS A CB    1 
ATOM   1492 C  CG    . LYS A 1 230 ? -32.810 62.579  -24.489 1.00 56.73 ? 230 LYS A CG    1 
ATOM   1493 C  CD    . LYS A 1 230 ? -34.020 63.269  -25.092 1.00 63.86 ? 230 LYS A CD    1 
ATOM   1494 C  CE    . LYS A 1 230 ? -34.005 64.755  -24.817 1.00 67.18 ? 230 LYS A CE    1 
ATOM   1495 N  NZ    . LYS A 1 230 ? -32.733 65.389  -25.259 1.00 66.08 ? 230 LYS A NZ    1 
ATOM   1496 N  N     . ALA A 1 231 ? -34.122 57.837  -24.114 1.00 53.79 ? 231 ALA A N     1 
ATOM   1497 C  CA    . ALA A 1 231 ? -34.501 56.606  -24.794 1.00 55.09 ? 231 ALA A CA    1 
ATOM   1498 C  C     . ALA A 1 231 ? -35.858 56.767  -25.476 1.00 56.73 ? 231 ALA A C     1 
ATOM   1499 O  O     . ALA A 1 231 ? -36.851 57.108  -24.829 1.00 56.90 ? 231 ALA A O     1 
ATOM   1500 C  CB    . ALA A 1 231 ? -34.551 55.460  -23.805 1.00 52.70 ? 231 ALA A CB    1 
ATOM   1501 N  N     . LYS A 1 232 ? -35.897 56.526  -26.784 1.00 59.13 ? 232 LYS A N     1 
ATOM   1502 C  CA    . LYS A 1 232 ? -37.136 56.644  -27.546 1.00 58.30 ? 232 LYS A CA    1 
ATOM   1503 C  C     . LYS A 1 232 ? -38.073 55.500  -27.196 1.00 61.44 ? 232 LYS A C     1 
ATOM   1504 O  O     . LYS A 1 232 ? -37.681 54.335  -27.235 1.00 66.10 ? 232 LYS A O     1 
ATOM   1505 C  CB    . LYS A 1 232 ? -36.834 56.639  -29.048 1.00 61.23 ? 232 LYS A CB    1 
ATOM   1506 C  CG    . LYS A 1 232 ? -38.070 56.552  -29.941 1.00 52.92 ? 232 LYS A CG    1 
ATOM   1507 C  CD    . LYS A 1 232 ? -37.778 57.063  -31.345 1.00 65.59 ? 232 LYS A CD    1 
ATOM   1508 C  CE    . LYS A 1 232 ? -36.654 56.284  -32.018 1.00 72.82 ? 232 LYS A CE    1 
ATOM   1509 N  NZ    . LYS A 1 232 ? -36.332 56.835  -33.368 1.00 81.44 ? 232 LYS A NZ    1 
ATOM   1510 N  N     . LEU A 1 233 ? -39.315 55.831  -26.861 1.00 56.10 ? 233 LEU A N     1 
ATOM   1511 C  CA    . LEU A 1 233 ? -40.284 54.808  -26.487 1.00 54.74 ? 233 LEU A CA    1 
ATOM   1512 C  C     . LEU A 1 233 ? -41.380 54.622  -27.523 1.00 54.84 ? 233 LEU A C     1 
ATOM   1513 O  O     . LEU A 1 233 ? -41.615 55.486  -28.360 1.00 61.20 ? 233 LEU A O     1 
ATOM   1514 C  CB    . LEU A 1 233 ? -40.918 55.157  -25.131 1.00 49.75 ? 233 LEU A CB    1 
ATOM   1515 C  CG    . LEU A 1 233 ? -39.933 55.610  -24.047 1.00 51.52 ? 233 LEU A CG    1 
ATOM   1516 C  CD1   . LEU A 1 233 ? -40.696 55.960  -22.782 1.00 58.31 ? 233 LEU A CD1   1 
ATOM   1517 C  CD2   . LEU A 1 233 ? -38.911 54.513  -23.778 1.00 50.31 ? 233 LEU A CD2   1 
ATOM   1518 N  N     . ARG A 1 234 ? -42.050 53.479  -27.446 1.00 58.15 ? 234 ARG A N     1 
ATOM   1519 C  CA    . ARG A 1 234 ? -43.141 53.138  -28.351 1.00 59.66 ? 234 ARG A CA    1 
ATOM   1520 C  C     . ARG A 1 234 ? -44.491 53.370  -27.677 1.00 59.15 ? 234 ARG A C     1 
ATOM   1521 O  O     . ARG A 1 234 ? -44.656 53.101  -26.484 1.00 60.28 ? 234 ARG A O     1 
ATOM   1522 C  CB    . ARG A 1 234 ? -43.029 51.669  -28.762 1.00 61.74 ? 234 ARG A CB    1 
ATOM   1523 C  CG    . ARG A 1 234 ? -41.950 51.391  -29.789 1.00 67.36 ? 234 ARG A CG    1 
ATOM   1524 C  CD    . ARG A 1 234 ? -42.444 51.743  -31.178 1.00 69.93 ? 234 ARG A CD    1 
ATOM   1525 N  NE    . ARG A 1 234 ? -43.506 50.838  -31.611 1.00 73.03 ? 234 ARG A NE    1 
ATOM   1526 C  CZ    . ARG A 1 234 ? -43.338 49.535  -31.810 1.00 75.35 ? 234 ARG A CZ    1 
ATOM   1527 N  NH1   . ARG A 1 234 ? -42.148 48.979  -31.618 1.00 72.54 ? 234 ARG A NH1   1 
ATOM   1528 N  NH2   . ARG A 1 234 ? -44.360 48.785  -32.204 1.00 73.90 ? 234 ARG A NH2   1 
ATOM   1529 N  N     . VAL A 1 235 ? -45.454 53.873  -28.441 1.00 54.82 ? 235 VAL A N     1 
ATOM   1530 C  CA    . VAL A 1 235 ? -46.790 54.127  -27.920 1.00 51.73 ? 235 VAL A CA    1 
ATOM   1531 C  C     . VAL A 1 235 ? -47.788 53.257  -28.678 1.00 53.47 ? 235 VAL A C     1 
ATOM   1532 O  O     . VAL A 1 235 ? -47.910 53.361  -29.894 1.00 52.88 ? 235 VAL A O     1 
ATOM   1533 C  CB    . VAL A 1 235 ? -47.179 55.602  -28.087 1.00 50.56 ? 235 VAL A CB    1 
ATOM   1534 C  CG1   . VAL A 1 235 ? -48.586 55.827  -27.577 1.00 49.72 ? 235 VAL A CG1   1 
ATOM   1535 C  CG2   . VAL A 1 235 ? -46.197 56.483  -27.341 1.00 49.50 ? 235 VAL A CG2   1 
ATOM   1536 N  N     . LEU A 1 236 ? -48.491 52.392  -27.953 1.00 55.37 ? 236 LEU A N     1 
ATOM   1537 C  CA    . LEU A 1 236 ? -49.471 51.494  -28.549 1.00 56.26 ? 236 LEU A CA    1 
ATOM   1538 C  C     . LEU A 1 236 ? -50.865 51.733  -27.998 1.00 60.80 ? 236 LEU A C     1 
ATOM   1539 O  O     . LEU A 1 236 ? -51.028 52.230  -26.885 1.00 62.11 ? 236 LEU A O     1 
ATOM   1540 C  CB    . LEU A 1 236 ? -49.080 50.039  -28.296 1.00 55.57 ? 236 LEU A CB    1 
ATOM   1541 C  CG    . LEU A 1 236 ? -48.086 49.369  -29.244 1.00 58.61 ? 236 LEU A CG    1 
ATOM   1542 C  CD1   . LEU A 1 236 ? -46.799 50.172  -29.336 1.00 58.19 ? 236 LEU A CD1   1 
ATOM   1543 C  CD2   . LEU A 1 236 ? -47.816 47.962  -28.744 1.00 61.04 ? 236 LEU A CD2   1 
ATOM   1544 N  N     . GLU A 1 237 ? -51.872 51.358  -28.778 1.00 65.43 ? 237 GLU A N     1 
ATOM   1545 C  CA    . GLU A 1 237 ? -53.254 51.539  -28.375 1.00 74.32 ? 237 GLU A CA    1 
ATOM   1546 C  C     . GLU A 1 237 ? -54.114 50.410  -28.919 1.00 77.20 ? 237 GLU A C     1 
ATOM   1547 O  O     . GLU A 1 237 ? -54.355 50.336  -30.128 1.00 81.18 ? 237 GLU A O     1 
ATOM   1548 C  CB    . GLU A 1 237 ? -53.757 52.918  -28.866 1.00 75.21 ? 237 GLU A CB    1 
ATOM   1549 C  CG    . GLU A 1 237 ? -55.193 52.971  -29.411 1.00 79.52 ? 237 GLU A CG    1 
ATOM   1550 C  CD    . GLU A 1 237 ? -55.626 54.373  -29.857 1.00 83.56 ? 237 GLU A CD    1 
ATOM   1551 O  OE1   . GLU A 1 237 ? -54.765 55.174  -30.293 1.00 84.86 ? 237 GLU A OE1   1 
ATOM   1552 O  OE2   . GLU A 1 237 ? -56.840 54.667  -29.785 1.00 84.86 ? 237 GLU A OE2   1 
ATOM   1553 N  N     . ASP A 1 238 ? -54.550 49.519  -28.026 1.00 80.60 ? 238 ASP A N     1 
ATOM   1554 C  CA    . ASP A 1 238 ? -55.404 48.418  -28.444 1.00 83.38 ? 238 ASP A CA    1 
ATOM   1555 C  C     . ASP A 1 238 ? -56.678 48.931  -29.107 1.00 84.56 ? 238 ASP A C     1 
ATOM   1556 O  O     . ASP A 1 238 ? -56.706 50.070  -29.604 1.00 84.86 ? 238 ASP A O     1 
ATOM   1557 C  CB    . ASP A 1 238 ? -55.750 47.489  -27.265 1.00 82.72 ? 238 ASP A CB    1 
ATOM   1558 C  CG    . ASP A 1 238 ? -56.289 48.226  -26.068 1.00 81.52 ? 238 ASP A CG    1 
ATOM   1559 O  OD1   . ASP A 1 238 ? -57.205 49.058  -26.235 1.00 79.27 ? 238 ASP A OD1   1 
ATOM   1560 O  OD2   . ASP A 1 238 ? -55.796 47.971  -24.951 1.00 82.28 ? 238 ASP A OD2   1 
ATOM   1561 N  N     . SER A 1 239 ? -57.722 48.098  -29.060 1.00 84.86 ? 239 SER A N     1 
ATOM   1562 C  CA    . SER A 1 239 ? -59.030 48.368  -29.648 1.00 84.75 ? 239 SER A CA    1 
ATOM   1563 C  C     . SER A 1 239 ? -60.015 48.932  -28.656 1.00 84.86 ? 239 SER A C     1 
ATOM   1564 O  O     . SER A 1 239 ? -60.980 49.627  -29.000 1.00 84.86 ? 239 SER A O     1 
ATOM   1565 C  CB    . SER A 1 239 ? -59.517 47.064  -30.270 1.00 84.86 ? 239 SER A CB    1 
ATOM   1566 O  OG    . SER A 1 239 ? -59.481 47.126  -31.680 1.00 84.86 ? 239 SER A OG    1 
ATOM   1567 N  N     . ARG A 1 240 ? -59.750 48.575  -27.410 1.00 84.86 ? 240 ARG A N     1 
ATOM   1568 C  CA    . ARG A 1 240 ? -60.485 49.084  -26.310 1.00 84.86 ? 240 ARG A CA    1 
ATOM   1569 C  C     . ARG A 1 240 ? -60.083 50.513  -26.206 1.00 84.86 ? 240 ARG A C     1 
ATOM   1570 O  O     . ARG A 1 240 ? -60.669 51.297  -25.471 1.00 84.55 ? 240 ARG A O     1 
ATOM   1571 C  CB    . ARG A 1 240 ? -60.052 48.325  -25.055 1.00 84.86 ? 240 ARG A CB    1 
ATOM   1572 C  CG    . ARG A 1 240 ? -61.229 47.660  -24.342 1.00 84.73 ? 240 ARG A CG    1 
ATOM   1573 C  CD    . ARG A 1 240 ? -60.862 47.219  -22.922 1.00 84.86 ? 240 ARG A CD    1 
ATOM   1574 N  NE    . ARG A 1 240 ? -60.848 45.757  -22.823 1.00 84.86 ? 240 ARG A NE    1 
ATOM   1575 C  CZ    . ARG A 1 240 ? -61.108 45.219  -21.619 1.00 84.86 ? 240 ARG A CZ    1 
ATOM   1576 N  NH1   . ARG A 1 240 ? -61.355 46.000  -20.582 1.00 84.86 ? 240 ARG A NH1   1 
ATOM   1577 N  NH2   . ARG A 1 240 ? -61.165 43.891  -21.488 1.00 84.86 ? 240 ARG A NH2   1 
ATOM   1578 N  N     . GLN A 1 241 ? -59.043 50.862  -26.956 1.00 84.86 ? 241 GLN A N     1 
ATOM   1579 C  CA    . GLN A 1 241 ? -58.458 52.238  -27.026 1.00 83.25 ? 241 GLN A CA    1 
ATOM   1580 C  C     . GLN A 1 241 ? -57.604 52.709  -25.795 1.00 82.33 ? 241 GLN A C     1 
ATOM   1581 O  O     . GLN A 1 241 ? -57.105 53.826  -25.743 1.00 83.95 ? 241 GLN A O     1 
ATOM   1582 C  CB    . GLN A 1 241 ? -59.601 53.224  -27.273 1.00 84.86 ? 241 GLN A CB    1 
ATOM   1583 C  CG    . GLN A 1 241 ? -60.899 52.525  -27.679 1.00 84.86 ? 241 GLN A CG    1 
ATOM   1584 C  CD    . GLN A 1 241 ? -61.641 53.382  -28.678 1.00 84.86 ? 241 GLN A CD    1 
ATOM   1585 O  OE1   . GLN A 1 241 ? -61.127 54.326  -29.254 1.00 84.86 ? 241 GLN A OE1   1 
ATOM   1586 N  NE2   . GLN A 1 241 ? -62.929 53.023  -28.850 1.00 84.86 ? 241 GLN A NE2   1 
ATOM   1587 N  N     . GLN A 1 242 ? -57.368 51.952  -24.716 1.00 79.19 ? 242 GLN A N     1 
ATOM   1588 C  CA    . GLN A 1 242 ? -56.455 52.703  -23.863 1.00 78.76 ? 242 GLN A CA    1 
ATOM   1589 C  C     . GLN A 1 242 ? -55.032 52.706  -24.427 1.00 74.02 ? 242 GLN A C     1 
ATOM   1590 O  O     . GLN A 1 242 ? -54.602 51.795  -25.121 1.00 70.79 ? 242 GLN A O     1 
ATOM   1591 C  CB    . GLN A 1 242 ? -56.464 52.064  -22.474 1.00 80.72 ? 242 GLN A CB    1 
ATOM   1592 C  CG    . GLN A 1 242 ? -57.101 50.674  -22.474 1.00 80.22 ? 242 GLN A CG    1 
ATOM   1593 C  CD    . GLN A 1 242 ? -58.073 50.568  -21.323 1.00 84.86 ? 242 GLN A CD    1 
ATOM   1594 O  OE1   . GLN A 1 242 ? -59.283 50.562  -21.474 1.00 84.86 ? 242 GLN A OE1   1 
ATOM   1595 N  NE2   . GLN A 1 242 ? -57.479 50.492  -20.115 1.00 84.86 ? 242 GLN A NE2   1 
ATOM   1596 N  N     . VAL A 1 243 ? -54.308 53.802  -24.137 1.00 70.38 ? 243 VAL A N     1 
ATOM   1597 C  CA    . VAL A 1 243 ? -52.938 53.909  -24.625 1.00 66.68 ? 243 VAL A CA    1 
ATOM   1598 C  C     . VAL A 1 243 ? -51.930 53.409  -23.588 1.00 63.45 ? 243 VAL A C     1 
ATOM   1599 O  O     . VAL A 1 243 ? -52.178 53.415  -22.389 1.00 68.02 ? 243 VAL A O     1 
ATOM   1600 C  CB    . VAL A 1 243 ? -52.662 55.377  -24.954 1.00 66.90 ? 243 VAL A CB    1 
ATOM   1601 C  CG1   . VAL A 1 243 ? -51.156 55.623  -25.013 1.00 66.91 ? 243 VAL A CG1   1 
ATOM   1602 C  CG2   . VAL A 1 243 ? -53.279 55.733  -26.294 1.00 66.48 ? 243 VAL A CG2   1 
ATOM   1603 N  N     . GLN A 1 244 ? -50.769 52.929  -24.006 1.00 60.15 ? 244 GLN A N     1 
ATOM   1604 C  CA    . GLN A 1 244 ? -49.734 52.519  -23.076 1.00 58.79 ? 244 GLN A CA    1 
ATOM   1605 C  C     . GLN A 1 244 ? -48.427 52.952  -23.696 1.00 54.19 ? 244 GLN A C     1 
ATOM   1606 O  O     . GLN A 1 244 ? -48.241 52.863  -24.909 1.00 48.01 ? 244 GLN A O     1 
ATOM   1607 C  CB    . GLN A 1 244 ? -49.731 51.007  -22.825 1.00 63.99 ? 244 GLN A CB    1 
ATOM   1608 C  CG    . GLN A 1 244 ? -49.992 50.158  -24.032 1.00 67.83 ? 244 GLN A CG    1 
ATOM   1609 C  CD    . GLN A 1 244 ? -51.116 49.176  -23.776 1.00 76.15 ? 244 GLN A CD    1 
ATOM   1610 O  OE1   . GLN A 1 244 ? -51.775 48.712  -24.706 1.00 78.65 ? 244 GLN A OE1   1 
ATOM   1611 N  NE2   . GLN A 1 244 ? -51.341 48.852  -22.504 1.00 80.48 ? 244 GLN A NE2   1 
ATOM   1612 N  N     . VAL A 1 245 ? -47.540 53.469  -22.859 1.00 54.05 ? 245 VAL A N     1 
ATOM   1613 C  CA    . VAL A 1 245 ? -46.243 53.915  -23.314 1.00 50.04 ? 245 VAL A CA    1 
ATOM   1614 C  C     . VAL A 1 245 ? -45.267 52.851  -22.827 1.00 54.12 ? 245 VAL A C     1 
ATOM   1615 O  O     . VAL A 1 245 ? -44.888 52.808  -21.655 1.00 59.38 ? 245 VAL A O     1 
ATOM   1616 C  CB    . VAL A 1 245 ? -45.902 55.291  -22.722 1.00 43.87 ? 245 VAL A CB    1 
ATOM   1617 C  CG1   . VAL A 1 245 ? -44.698 55.873  -23.417 1.00 41.82 ? 245 VAL A CG1   1 
ATOM   1618 C  CG2   . VAL A 1 245 ? -47.081 56.226  -22.876 1.00 43.01 ? 245 VAL A CG2   1 
ATOM   1619 N  N     . VAL A 1 246 ? -44.888 51.973  -23.745 1.00 54.98 ? 246 VAL A N     1 
ATOM   1620 C  CA    . VAL A 1 246 ? -43.986 50.876  -23.451 1.00 52.85 ? 246 VAL A CA    1 
ATOM   1621 C  C     . VAL A 1 246 ? -42.572 51.351  -23.112 1.00 53.12 ? 246 VAL A C     1 
ATOM   1622 O  O     . VAL A 1 246 ? -41.972 52.131  -23.851 1.00 53.34 ? 246 VAL A O     1 
ATOM   1623 C  CB    . VAL A 1 246 ? -43.954 49.907  -24.649 1.00 48.88 ? 246 VAL A CB    1 
ATOM   1624 C  CG1   . VAL A 1 246 ? -43.271 48.609  -24.266 1.00 48.44 ? 246 VAL A CG1   1 
ATOM   1625 C  CG2   . VAL A 1 246 ? -45.377 49.639  -25.120 1.00 45.17 ? 246 VAL A CG2   1 
ATOM   1626 N  N     . GLY A 1 247 ? -42.063 50.898  -21.965 1.00 54.47 ? 247 GLY A N     1 
ATOM   1627 C  CA    . GLY A 1 247 ? -40.719 51.254  -21.543 1.00 47.92 ? 247 GLY A CA    1 
ATOM   1628 C  C     . GLY A 1 247 ? -40.527 52.487  -20.680 1.00 48.72 ? 247 GLY A C     1 
ATOM   1629 O  O     . GLY A 1 247 ? -39.420 52.715  -20.189 1.00 49.08 ? 247 GLY A O     1 
ATOM   1630 N  N     . LEU A 1 248 ? -41.566 53.296  -20.499 1.00 45.92 ? 248 LEU A N     1 
ATOM   1631 C  CA    . LEU A 1 248 ? -41.432 54.496  -19.671 1.00 43.02 ? 248 LEU A CA    1 
ATOM   1632 C  C     . LEU A 1 248 ? -40.956 54.061  -18.280 1.00 41.59 ? 248 LEU A C     1 
ATOM   1633 O  O     . LEU A 1 248 ? -41.521 53.150  -17.672 1.00 42.67 ? 248 LEU A O     1 
ATOM   1634 C  CB    . LEU A 1 248 ? -42.773 55.230  -19.576 1.00 46.15 ? 248 LEU A CB    1 
ATOM   1635 C  CG    . LEU A 1 248 ? -42.756 56.605  -18.898 1.00 47.76 ? 248 LEU A CG    1 
ATOM   1636 C  CD1   . LEU A 1 248 ? -41.777 57.527  -19.595 1.00 50.14 ? 248 LEU A CD1   1 
ATOM   1637 C  CD2   . LEU A 1 248 ? -44.146 57.194  -18.924 1.00 45.74 ? 248 LEU A CD2   1 
ATOM   1638 N  N     . GLN A 1 249 ? -39.906 54.701  -17.784 1.00 40.51 ? 249 GLN A N     1 
ATOM   1639 C  CA    . GLN A 1 249 ? -39.353 54.334  -16.484 1.00 45.89 ? 249 GLN A CA    1 
ATOM   1640 C  C     . GLN A 1 249 ? -39.992 55.059  -15.298 1.00 48.51 ? 249 GLN A C     1 
ATOM   1641 O  O     . GLN A 1 249 ? -39.993 56.290  -15.230 1.00 44.86 ? 249 GLN A O     1 
ATOM   1642 C  CB    . GLN A 1 249 ? -37.845 54.600  -16.461 1.00 51.03 ? 249 GLN A CB    1 
ATOM   1643 C  CG    . GLN A 1 249 ? -37.039 53.516  -15.775 1.00 66.80 ? 249 GLN A CG    1 
ATOM   1644 C  CD    . GLN A 1 249 ? -36.836 52.300  -16.659 1.00 74.42 ? 249 GLN A CD    1 
ATOM   1645 O  OE1   . GLN A 1 249 ? -37.796 51.722  -17.171 1.00 76.78 ? 249 GLN A OE1   1 
ATOM   1646 N  NE2   . GLN A 1 249 ? -35.580 51.905  -16.842 1.00 77.22 ? 249 GLN A NE2   1 
ATOM   1647 N  N     . GLU A 1 250 ? -40.536 54.277  -14.371 1.00 45.89 ? 250 GLU A N     1 
ATOM   1648 C  CA    . GLU A 1 250 ? -41.140 54.815  -13.154 1.00 41.62 ? 250 GLU A CA    1 
ATOM   1649 C  C     . GLU A 1 250 ? -40.117 54.710  -12.021 1.00 45.01 ? 250 GLU A C     1 
ATOM   1650 O  O     . GLU A 1 250 ? -39.571 53.639  -11.775 1.00 42.67 ? 250 GLU A O     1 
ATOM   1651 C  CB    . GLU A 1 250 ? -42.381 54.012  -12.770 1.00 45.42 ? 250 GLU A CB    1 
ATOM   1652 C  CG    . GLU A 1 250 ? -43.584 54.239  -13.662 1.00 44.03 ? 250 GLU A CG    1 
ATOM   1653 C  CD    . GLU A 1 250 ? -44.855 53.717  -13.031 1.00 50.15 ? 250 GLU A CD    1 
ATOM   1654 O  OE1   . GLU A 1 250 ? -44.973 53.834  -11.793 1.00 47.00 ? 250 GLU A OE1   1 
ATOM   1655 O  OE2   . GLU A 1 250 ? -45.736 53.206  -13.758 1.00 47.47 ? 250 GLU A OE2   1 
ATOM   1656 N  N     . TYR A 1 251 ? -39.842 55.820  -11.347 1.00 46.35 ? 251 TYR A N     1 
ATOM   1657 C  CA    . TYR A 1 251 ? -38.892 55.792  -10.238 1.00 49.73 ? 251 TYR A CA    1 
ATOM   1658 C  C     . TYR A 1 251 ? -39.564 56.016  -8.890  1.00 52.32 ? 251 TYR A C     1 
ATOM   1659 O  O     . TYR A 1 251 ? -40.368 56.936  -8.724  1.00 50.34 ? 251 TYR A O     1 
ATOM   1660 C  CB    . TYR A 1 251 ? -37.796 56.839  -10.430 1.00 50.83 ? 251 TYR A CB    1 
ATOM   1661 C  CG    . TYR A 1 251 ? -36.776 56.461  -11.476 1.00 61.52 ? 251 TYR A CG    1 
ATOM   1662 C  CD1   . TYR A 1 251 ? -37.115 56.428  -12.826 1.00 61.84 ? 251 TYR A CD1   1 
ATOM   1663 C  CD2   . TYR A 1 251 ? -35.465 56.145  -11.116 1.00 66.33 ? 251 TYR A CD2   1 
ATOM   1664 C  CE1   . TYR A 1 251 ? -36.175 56.092  -13.795 1.00 66.05 ? 251 TYR A CE1   1 
ATOM   1665 C  CE2   . TYR A 1 251 ? -34.515 55.807  -12.079 1.00 69.25 ? 251 TYR A CE2   1 
ATOM   1666 C  CZ    . TYR A 1 251 ? -34.878 55.785  -13.418 1.00 68.40 ? 251 TYR A CZ    1 
ATOM   1667 O  OH    . TYR A 1 251 ? -33.943 55.466  -14.378 1.00 75.20 ? 251 TYR A OH    1 
ATOM   1668 N  N     . LEU A 1 252 ? -39.222 55.164  -7.929  1.00 48.45 ? 252 LEU A N     1 
ATOM   1669 C  CA    . LEU A 1 252 ? -39.771 55.256  -6.582  1.00 43.85 ? 252 LEU A CA    1 
ATOM   1670 C  C     . LEU A 1 252 ? -39.140 56.424  -5.839  1.00 45.56 ? 252 LEU A C     1 
ATOM   1671 O  O     . LEU A 1 252 ? -37.918 56.565  -5.806  1.00 44.96 ? 252 LEU A O     1 
ATOM   1672 C  CB    . LEU A 1 252 ? -39.493 53.963  -5.811  1.00 47.93 ? 252 LEU A CB    1 
ATOM   1673 C  CG    . LEU A 1 252 ? -39.986 53.932  -4.362  1.00 53.33 ? 252 LEU A CG    1 
ATOM   1674 C  CD1   . LEU A 1 252 ? -41.505 53.815  -4.346  1.00 42.77 ? 252 LEU A CD1   1 
ATOM   1675 C  CD2   . LEU A 1 252 ? -39.362 52.755  -3.634  1.00 51.44 ? 252 LEU A CD2   1 
ATOM   1676 N  N     . VAL A 1 253 ? -39.978 57.276  -5.265  1.00 43.43 ? 253 VAL A N     1 
ATOM   1677 C  CA    . VAL A 1 253 ? -39.495 58.407  -4.494  1.00 42.83 ? 253 VAL A CA    1 
ATOM   1678 C  C     . VAL A 1 253 ? -40.143 58.330  -3.113  1.00 41.47 ? 253 VAL A C     1 
ATOM   1679 O  O     . VAL A 1 253 ? -41.305 57.945  -2.979  1.00 38.57 ? 253 VAL A O     1 
ATOM   1680 C  CB    . VAL A 1 253 ? -39.834 59.754  -5.175  1.00 41.85 ? 253 VAL A CB    1 
ATOM   1681 C  CG1   . VAL A 1 253 ? -39.042 59.881  -6.466  1.00 41.62 ? 253 VAL A CG1   1 
ATOM   1682 C  CG2   . VAL A 1 253 ? -41.326 59.849  -5.458  1.00 40.47 ? 253 VAL A CG2   1 
ATOM   1683 N  N     . THR A 1 254 ? -39.376 58.673  -2.085  1.00 46.64 ? 254 THR A N     1 
ATOM   1684 C  CA    . THR A 1 254 ? -39.870 58.615  -0.711  1.00 50.27 ? 254 THR A CA    1 
ATOM   1685 C  C     . THR A 1 254 ? -39.602 59.941  -0.027  1.00 53.21 ? 254 THR A C     1 
ATOM   1686 O  O     . THR A 1 254 ? -39.931 60.133  1.142   1.00 57.35 ? 254 THR A O     1 
ATOM   1687 C  CB    . THR A 1 254 ? -39.149 57.507  0.086   1.00 51.99 ? 254 THR A CB    1 
ATOM   1688 O  OG1   . THR A 1 254 ? -37.764 57.851  0.244   1.00 44.82 ? 254 THR A OG1   1 
ATOM   1689 C  CG2   . THR A 1 254 ? -39.239 56.180  -0.645  1.00 48.90 ? 254 THR A CG2   1 
ATOM   1690 N  N     . CYS A 1 255 ? -39.024 60.864  -0.780  1.00 56.23 ? 255 CYS A N     1 
ATOM   1691 C  CA    . CYS A 1 255 ? -38.664 62.161  -0.246  1.00 58.98 ? 255 CYS A CA    1 
ATOM   1692 C  C     . CYS A 1 255 ? -38.673 63.230  -1.340  1.00 60.92 ? 255 CYS A C     1 
ATOM   1693 O  O     . CYS A 1 255 ? -38.427 62.934  -2.510  1.00 59.79 ? 255 CYS A O     1 
ATOM   1694 C  CB    . CYS A 1 255 ? -37.272 62.036  0.383   1.00 54.93 ? 255 CYS A CB    1 
ATOM   1695 S  SG    . CYS A 1 255 ? -36.368 63.558  0.556   1.00 77.20 ? 255 CYS A SG    1 
ATOM   1696 N  N     . ALA A 1 256 ? -38.959 64.470  -0.962  1.00 60.87 ? 256 ALA A N     1 
ATOM   1697 C  CA    . ALA A 1 256 ? -38.979 65.561  -1.925  1.00 60.93 ? 256 ALA A CA    1 
ATOM   1698 C  C     . ALA A 1 256 ? -37.600 65.712  -2.557  1.00 63.40 ? 256 ALA A C     1 
ATOM   1699 O  O     . ALA A 1 256 ? -37.484 66.105  -3.718  1.00 64.51 ? 256 ALA A O     1 
ATOM   1700 C  CB    . ALA A 1 256 ? -39.388 66.858  -1.246  1.00 65.17 ? 256 ALA A CB    1 
ATOM   1701 N  N     . ASP A 1 257 ? -36.556 65.411  -1.791  1.00 60.32 ? 257 ASP A N     1 
ATOM   1702 C  CA    . ASP A 1 257 ? -35.194 65.502  -2.303  1.00 59.89 ? 257 ASP A CA    1 
ATOM   1703 C  C     . ASP A 1 257 ? -35.026 64.472  -3.402  1.00 58.13 ? 257 ASP A C     1 
ATOM   1704 O  O     . ASP A 1 257 ? -34.256 64.675  -4.337  1.00 63.65 ? 257 ASP A O     1 
ATOM   1705 C  CB    . ASP A 1 257 ? -34.165 65.247  -1.195  1.00 67.49 ? 257 ASP A CB    1 
ATOM   1706 C  CG    . ASP A 1 257 ? -34.011 66.431  -0.264  1.00 76.52 ? 257 ASP A CG    1 
ATOM   1707 O  OD1   . ASP A 1 257 ? -33.595 67.508  -0.744  1.00 83.23 ? 257 ASP A OD1   1 
ATOM   1708 O  OD2   . ASP A 1 257 ? -34.308 66.287  0.944   1.00 81.11 ? 257 ASP A OD2   1 
ATOM   1709 N  N     . ASP A 1 258 ? -35.736 63.355  -3.282  1.00 51.45 ? 258 ASP A N     1 
ATOM   1710 C  CA    . ASP A 1 258 ? -35.672 62.324  -4.309  1.00 51.74 ? 258 ASP A CA    1 
ATOM   1711 C  C     . ASP A 1 258 ? -36.205 62.940  -5.610  1.00 53.40 ? 258 ASP A C     1 
ATOM   1712 O  O     . ASP A 1 258 ? -35.508 62.977  -6.632  1.00 48.94 ? 258 ASP A O     1 
ATOM   1713 C  CB    . ASP A 1 258 ? -36.534 61.119  -3.920  1.00 55.02 ? 258 ASP A CB    1 
ATOM   1714 C  CG    . ASP A 1 258 ? -35.925 60.301  -2.803  1.00 61.26 ? 258 ASP A CG    1 
ATOM   1715 O  OD1   . ASP A 1 258 ? -34.812 60.647  -2.357  1.00 62.28 ? 258 ASP A OD1   1 
ATOM   1716 O  OD2   . ASP A 1 258 ? -36.559 59.310  -2.378  1.00 55.06 ? 258 ASP A OD2   1 
ATOM   1717 N  N     . VAL A 1 259 ? -37.439 63.439  -5.544  1.00 49.93 ? 259 VAL A N     1 
ATOM   1718 C  CA    . VAL A 1 259 ? -38.097 64.062  -6.683  1.00 43.86 ? 259 VAL A CA    1 
ATOM   1719 C  C     . VAL A 1 259 ? -37.243 65.144  -7.318  1.00 40.67 ? 259 VAL A C     1 
ATOM   1720 O  O     . VAL A 1 259 ? -37.188 65.254  -8.536  1.00 44.33 ? 259 VAL A O     1 
ATOM   1721 C  CB    . VAL A 1 259 ? -39.437 64.687  -6.274  1.00 43.36 ? 259 VAL A CB    1 
ATOM   1722 C  CG1   . VAL A 1 259 ? -40.053 65.424  -7.454  1.00 39.91 ? 259 VAL A CG1   1 
ATOM   1723 C  CG2   . VAL A 1 259 ? -40.371 63.607  -5.783  1.00 38.80 ? 259 VAL A CG2   1 
ATOM   1724 N  N     . ILE A 1 260 ? -36.581 65.947  -6.495  1.00 42.67 ? 260 ILE A N     1 
ATOM   1725 C  CA    . ILE A 1 260 ? -35.744 67.023  -6.998  1.00 44.33 ? 260 ILE A CA    1 
ATOM   1726 C  C     . ILE A 1 260 ? -34.555 66.467  -7.762  1.00 53.09 ? 260 ILE A C     1 
ATOM   1727 O  O     . ILE A 1 260 ? -34.026 67.117  -8.662  1.00 54.38 ? 260 ILE A O     1 
ATOM   1728 C  CB    . ILE A 1 260 ? -35.254 67.919  -5.847  1.00 46.71 ? 260 ILE A CB    1 
ATOM   1729 C  CG1   . ILE A 1 260 ? -36.443 68.689  -5.267  1.00 51.70 ? 260 ILE A CG1   1 
ATOM   1730 C  CG2   . ILE A 1 260 ? -34.181 68.885  -6.337  1.00 47.88 ? 260 ILE A CG2   1 
ATOM   1731 C  CD1   . ILE A 1 260 ? -36.085 69.619  -4.113  1.00 54.04 ? 260 ILE A CD1   1 
ATOM   1732 N  N     . LYS A 1 261 ? -34.135 65.258  -7.414  1.00 53.78 ? 261 LYS A N     1 
ATOM   1733 C  CA    . LYS A 1 261 ? -33.013 64.654  -8.112  1.00 54.07 ? 261 LYS A CA    1 
ATOM   1734 C  C     . LYS A 1 261 ? -33.444 64.169  -9.494  1.00 49.32 ? 261 LYS A C     1 
ATOM   1735 O  O     . LYS A 1 261 ? -32.669 64.234  -10.451 1.00 46.23 ? 261 LYS A O     1 
ATOM   1736 C  CB    . LYS A 1 261 ? -32.423 63.499  -7.291  1.00 60.72 ? 261 LYS A CB    1 
ATOM   1737 C  CG    . LYS A 1 261 ? -31.454 63.970  -6.210  1.00 61.71 ? 261 LYS A CG    1 
ATOM   1738 C  CD    . LYS A 1 261 ? -30.764 62.815  -5.493  1.00 74.25 ? 261 LYS A CD    1 
ATOM   1739 C  CE    . LYS A 1 261 ? -31.691 62.106  -4.513  1.00 80.01 ? 261 LYS A CE    1 
ATOM   1740 N  NZ    . LYS A 1 261 ? -30.971 61.060  -3.725  1.00 81.23 ? 261 LYS A NZ    1 
ATOM   1741 N  N     . MET A 1 262 ? -34.680 63.693  -9.601  1.00 46.77 ? 262 MET A N     1 
ATOM   1742 C  CA    . MET A 1 262 ? -35.180 63.211  -10.877 1.00 48.14 ? 262 MET A CA    1 
ATOM   1743 C  C     . MET A 1 262 ? -35.531 64.381  -11.801 1.00 52.56 ? 262 MET A C     1 
ATOM   1744 O  O     . MET A 1 262 ? -35.411 64.268  -13.024 1.00 51.29 ? 262 MET A O     1 
ATOM   1745 C  CB    . MET A 1 262 ? -36.393 62.301  -10.672 1.00 45.85 ? 262 MET A CB    1 
ATOM   1746 C  CG    . MET A 1 262 ? -36.100 61.046  -9.865  1.00 52.93 ? 262 MET A CG    1 
ATOM   1747 S  SD    . MET A 1 262 ? -34.584 60.200  -10.359 1.00 61.76 ? 262 MET A SD    1 
ATOM   1748 C  CE    . MET A 1 262 ? -35.115 59.367  -11.846 1.00 63.69 ? 262 MET A CE    1 
ATOM   1749 N  N     . ILE A 1 263 ? -35.948 65.505  -11.222 1.00 48.42 ? 263 ILE A N     1 
ATOM   1750 C  CA    . ILE A 1 263 ? -36.281 66.683  -12.014 1.00 49.22 ? 263 ILE A CA    1 
ATOM   1751 C  C     . ILE A 1 263 ? -34.999 67.281  -12.605 1.00 51.27 ? 263 ILE A C     1 
ATOM   1752 O  O     . ILE A 1 263 ? -34.971 67.659  -13.774 1.00 48.89 ? 263 ILE A O     1 
ATOM   1753 C  CB    . ILE A 1 263 ? -36.992 67.762  -11.164 1.00 49.09 ? 263 ILE A CB    1 
ATOM   1754 C  CG1   . ILE A 1 263 ? -38.334 67.235  -10.650 1.00 42.36 ? 263 ILE A CG1   1 
ATOM   1755 C  CG2   . ILE A 1 263 ? -37.211 69.015  -11.986 1.00 36.77 ? 263 ILE A CG2   1 
ATOM   1756 C  CD1   . ILE A 1 263 ? -39.056 68.211  -9.713  1.00 38.84 ? 263 ILE A CD1   1 
ATOM   1757 N  N     . ASN A 1 264 ? -33.942 67.374  -11.798 1.00 55.10 ? 264 ASN A N     1 
ATOM   1758 C  CA    . ASN A 1 264 ? -32.673 67.914  -12.284 1.00 55.65 ? 264 ASN A CA    1 
ATOM   1759 C  C     . ASN A 1 264 ? -32.144 67.025  -13.414 1.00 59.00 ? 264 ASN A C     1 
ATOM   1760 O  O     . ASN A 1 264 ? -31.720 67.508  -14.464 1.00 61.49 ? 264 ASN A O     1 
ATOM   1761 C  CB    . ASN A 1 264 ? -31.621 67.959  -11.169 1.00 55.13 ? 264 ASN A CB    1 
ATOM   1762 C  CG    . ASN A 1 264 ? -31.938 68.975  -10.092 1.00 55.86 ? 264 ASN A CG    1 
ATOM   1763 O  OD1   . ASN A 1 264 ? -32.446 70.066  -10.369 1.00 57.89 ? 264 ASN A OD1   1 
ATOM   1764 N  ND2   . ASN A 1 264 ? -31.613 68.631  -8.851  1.00 56.95 ? 264 ASN A ND2   1 
ATOM   1765 N  N     . MET A 1 265 ? -32.168 65.719  -13.176 1.00 54.75 ? 265 MET A N     1 
ATOM   1766 C  CA    . MET A 1 265 ? -31.701 64.746  -14.148 1.00 55.02 ? 265 MET A CA    1 
ATOM   1767 C  C     . MET A 1 265 ? -32.450 64.892  -15.469 1.00 59.27 ? 265 MET A C     1 
ATOM   1768 O  O     . MET A 1 265 ? -31.838 65.005  -16.534 1.00 62.20 ? 265 MET A O     1 
ATOM   1769 C  CB    . MET A 1 265 ? -31.902 63.333  -13.602 1.00 56.25 ? 265 MET A CB    1 
ATOM   1770 C  CG    . MET A 1 265 ? -31.514 62.233  -14.567 1.00 61.48 ? 265 MET A CG    1 
ATOM   1771 S  SD    . MET A 1 265 ? -31.979 60.599  -13.983 1.00 65.60 ? 265 MET A SD    1 
ATOM   1772 C  CE    . MET A 1 265 ? -30.611 60.263  -12.866 1.00 63.86 ? 265 MET A CE    1 
ATOM   1773 N  N     . GLY A 1 266 ? -33.777 64.887  -15.387 1.00 59.55 ? 266 GLY A N     1 
ATOM   1774 C  CA    . GLY A 1 266 ? -34.602 65.005  -16.573 1.00 57.74 ? 266 GLY A CA    1 
ATOM   1775 C  C     . GLY A 1 266 ? -34.436 66.316  -17.318 1.00 54.28 ? 266 GLY A C     1 
ATOM   1776 O  O     . GLY A 1 266 ? -34.339 66.324  -18.545 1.00 56.39 ? 266 GLY A O     1 
ATOM   1777 N  N     . SER A 1 267 ? -34.405 67.424  -16.587 1.00 50.80 ? 267 SER A N     1 
ATOM   1778 C  CA    . SER A 1 267 ? -34.257 68.730  -17.207 1.00 55.33 ? 267 SER A CA    1 
ATOM   1779 C  C     . SER A 1 267 ? -32.874 68.890  -17.821 1.00 58.52 ? 267 SER A C     1 
ATOM   1780 O  O     . SER A 1 267 ? -32.687 69.654  -18.767 1.00 58.41 ? 267 SER A O     1 
ATOM   1781 C  CB    . SER A 1 267 ? -34.493 69.837  -16.178 1.00 57.23 ? 267 SER A CB    1 
ATOM   1782 O  OG    . SER A 1 267 ? -35.819 69.790  -15.674 1.00 60.64 ? 267 SER A OG    1 
ATOM   1783 N  N     . ALA A 1 268 ? -31.905 68.164  -17.277 1.00 60.56 ? 268 ALA A N     1 
ATOM   1784 C  CA    . ALA A 1 268 ? -30.539 68.237  -17.770 1.00 61.97 ? 268 ALA A CA    1 
ATOM   1785 C  C     . ALA A 1 268 ? -30.399 67.626  -19.162 1.00 62.46 ? 268 ALA A C     1 
ATOM   1786 O  O     . ALA A 1 268 ? -29.516 68.014  -19.925 1.00 63.91 ? 268 ALA A O     1 
ATOM   1787 C  CB    . ALA A 1 268 ? -29.591 67.541  -16.795 1.00 60.82 ? 268 ALA A CB    1 
ATOM   1788 N  N     . CYS A 1 269 ? -31.266 66.676  -19.500 1.00 62.70 ? 269 CYS A N     1 
ATOM   1789 C  CA    . CYS A 1 269 ? -31.177 66.051  -20.813 1.00 67.67 ? 269 CYS A CA    1 
ATOM   1790 C  C     . CYS A 1 269 ? -32.426 66.242  -21.668 1.00 69.11 ? 269 CYS A C     1 
ATOM   1791 O  O     . CYS A 1 269 ? -32.809 65.351  -22.418 1.00 71.91 ? 269 CYS A O     1 
ATOM   1792 C  CB    . CYS A 1 269 ? -30.868 64.554  -20.670 1.00 67.83 ? 269 CYS A CB    1 
ATOM   1793 S  SG    . CYS A 1 269 ? -32.295 63.472  -20.415 1.00 71.77 ? 269 CYS A SG    1 
ATOM   1794 N  N     . ARG A 1 270 ? -33.057 67.407  -21.562 1.00 70.93 ? 270 ARG A N     1 
ATOM   1795 C  CA    . ARG A 1 270 ? -34.257 67.686  -22.343 1.00 70.58 ? 270 ARG A CA    1 
ATOM   1796 C  C     . ARG A 1 270 ? -33.916 68.456  -23.615 1.00 73.33 ? 270 ARG A C     1 
ATOM   1797 O  O     . ARG A 1 270 ? -33.004 69.287  -23.624 1.00 72.16 ? 270 ARG A O     1 
ATOM   1798 C  CB    . ARG A 1 270 ? -35.258 68.503  -21.528 1.00 66.43 ? 270 ARG A CB    1 
ATOM   1799 C  CG    . ARG A 1 270 ? -36.562 68.765  -22.265 1.00 62.21 ? 270 ARG A CG    1 
ATOM   1800 C  CD    . ARG A 1 270 ? -37.286 69.954  -21.681 1.00 62.39 ? 270 ARG A CD    1 
ATOM   1801 N  NE    . ARG A 1 270 ? -38.548 70.230  -22.362 1.00 59.73 ? 270 ARG A NE    1 
ATOM   1802 C  CZ    . ARG A 1 270 ? -39.349 71.245  -22.054 1.00 59.58 ? 270 ARG A CZ    1 
ATOM   1803 N  NH1   . ARG A 1 270 ? -39.014 72.081  -21.078 1.00 54.71 ? 270 ARG A NH1   1 
ATOM   1804 N  NH2   . ARG A 1 270 ? -40.487 71.423  -22.711 1.00 61.98 ? 270 ARG A NH2   1 
ATOM   1805 N  N     . THR A 1 271 ? -34.660 68.181  -24.683 1.00 75.98 ? 271 THR A N     1 
ATOM   1806 C  CA    . THR A 1 271 ? -34.448 68.845  -25.964 1.00 77.58 ? 271 THR A CA    1 
ATOM   1807 C  C     . THR A 1 271 ? -35.097 70.226  -25.957 1.00 77.15 ? 271 THR A C     1 
ATOM   1808 O  O     . THR A 1 271 ? -34.472 71.217  -26.332 1.00 79.72 ? 271 THR A O     1 
ATOM   1809 C  CB    . THR A 1 271 ? -35.048 68.023  -27.124 1.00 79.32 ? 271 THR A CB    1 
ATOM   1810 O  OG1   . THR A 1 271 ? -34.502 66.698  -27.107 1.00 79.00 ? 271 THR A OG1   1 
ATOM   1811 C  CG2   . THR A 1 271 ? -34.728 68.680  -28.462 1.00 81.56 ? 271 THR A CG2   1 
ATOM   1812 N  N     . ASN A 1 280 ? -32.369 77.339  -22.359 1.00 84.86 ? 280 ASN A N     1 
ATOM   1813 C  CA    . ASN A 1 280 ? -33.531 76.491  -22.574 1.00 84.86 ? 280 ASN A CA    1 
ATOM   1814 C  C     . ASN A 1 280 ? -34.255 76.872  -23.853 1.00 84.49 ? 280 ASN A C     1 
ATOM   1815 O  O     . ASN A 1 280 ? -33.854 77.819  -24.548 1.00 83.35 ? 280 ASN A O     1 
ATOM   1816 C  CB    . ASN A 1 280 ? -34.476 76.585  -21.372 1.00 84.30 ? 280 ASN A CB    1 
ATOM   1817 C  CG    . ASN A 1 280 ? -34.582 75.274  -20.619 1.00 84.86 ? 280 ASN A CG    1 
ATOM   1818 O  OD1   . ASN A 1 280 ? -35.278 74.352  -21.051 1.00 84.86 ? 280 ASN A OD1   1 
ATOM   1819 N  ND2   . ASN A 1 280 ? -33.884 75.179  -19.492 1.00 84.86 ? 280 ASN A ND2   1 
ATOM   1820 N  N     . SER A 1 281 ? -35.313 76.117  -24.142 1.00 84.86 ? 281 SER A N     1 
ATOM   1821 C  CA    . SER A 1 281 ? -36.147 76.325  -25.308 1.00 84.00 ? 281 SER A CA    1 
ATOM   1822 C  C     . SER A 1 281 ? -37.167 75.220  -25.499 1.00 84.86 ? 281 SER A C     1 
ATOM   1823 O  O     . SER A 1 281 ? -36.943 74.091  -25.086 1.00 84.86 ? 281 SER A O     1 
ATOM   1824 C  CB    . SER A 1 281 ? -35.313 76.452  -26.552 1.00 84.57 ? 281 SER A CB    1 
ATOM   1825 O  OG    . SER A 1 281 ? -35.724 77.609  -27.208 1.00 84.86 ? 281 SER A OG    1 
ATOM   1826 N  N     . SER A 1 282 ? -38.297 75.545  -26.121 1.00 84.86 ? 282 SER A N     1 
ATOM   1827 C  CA    . SER A 1 282 ? -39.358 74.563  -26.286 1.00 84.06 ? 282 SER A CA    1 
ATOM   1828 C  C     . SER A 1 282 ? -38.909 73.414  -27.187 1.00 83.02 ? 282 SER A C     1 
ATOM   1829 O  O     . SER A 1 282 ? -38.023 72.638  -26.853 1.00 84.86 ? 282 SER A O     1 
ATOM   1830 C  CB    . SER A 1 282 ? -40.568 75.266  -26.902 1.00 84.86 ? 282 SER A CB    1 
ATOM   1831 O  OG    . SER A 1 282 ? -40.566 75.057  -28.315 1.00 84.86 ? 282 SER A OG    1 
ATOM   1832 N  N     . ARG A 1 283 ? -39.522 73.274  -28.367 1.00 81.76 ? 283 ARG A N     1 
ATOM   1833 C  CA    . ARG A 1 283 ? -39.396 72.283  -29.422 1.00 76.63 ? 283 ARG A CA    1 
ATOM   1834 C  C     . ARG A 1 283 ? -40.069 70.974  -29.020 1.00 71.69 ? 283 ARG A C     1 
ATOM   1835 O  O     . ARG A 1 283 ? -40.839 70.386  -29.769 1.00 68.04 ? 283 ARG A O     1 
ATOM   1836 C  CB    . ARG A 1 283 ? -37.907 72.046  -29.678 1.00 78.73 ? 283 ARG A CB    1 
ATOM   1837 C  CG    . ARG A 1 283 ? -37.021 73.023  -28.905 1.00 79.15 ? 283 ARG A CG    1 
ATOM   1838 C  CD    . ARG A 1 283 ? -35.860 73.547  -29.758 1.00 83.63 ? 283 ARG A CD    1 
ATOM   1839 N  NE    . ARG A 1 283 ? -35.066 72.433  -30.287 1.00 84.86 ? 283 ARG A NE    1 
ATOM   1840 C  CZ    . ARG A 1 283 ? -34.989 72.311  -31.624 1.00 84.86 ? 283 ARG A CZ    1 
ATOM   1841 N  NH1   . ARG A 1 283 ? -35.607 73.178  -32.408 1.00 84.86 ? 283 ARG A NH1   1 
ATOM   1842 N  NH2   . ARG A 1 283 ? -34.283 71.309  -32.157 1.00 84.86 ? 283 ARG A NH2   1 
ATOM   1843 N  N     . SER A 1 284 ? -40.046 70.676  -27.711 1.00 63.26 ? 284 SER A N     1 
ATOM   1844 C  CA    . SER A 1 284 ? -40.844 69.571  -27.208 1.00 57.86 ? 284 SER A CA    1 
ATOM   1845 C  C     . SER A 1 284 ? -41.908 70.071  -26.237 1.00 48.69 ? 284 SER A C     1 
ATOM   1846 O  O     . SER A 1 284 ? -41.957 71.240  -25.876 1.00 54.80 ? 284 SER A O     1 
ATOM   1847 C  CB    . SER A 1 284 ? -39.909 68.592  -26.497 1.00 54.10 ? 284 SER A CB    1 
ATOM   1848 O  OG    . SER A 1 284 ? -38.956 69.324  -25.726 1.00 68.86 ? 284 SER A OG    1 
ATOM   1849 N  N     . HIS A 1 285 ? -42.712 69.026  -25.921 1.00 47.37 ? 285 HIS A N     1 
ATOM   1850 C  CA    . HIS A 1 285 ? -43.627 68.925  -24.791 1.00 46.96 ? 285 HIS A CA    1 
ATOM   1851 C  C     . HIS A 1 285 ? -42.966 68.244  -23.591 1.00 44.12 ? 285 HIS A C     1 
ATOM   1852 O  O     . HIS A 1 285 ? -42.524 67.104  -23.656 1.00 45.93 ? 285 HIS A O     1 
ATOM   1853 C  CB    . HIS A 1 285 ? -44.850 68.123  -25.237 1.00 46.15 ? 285 HIS A CB    1 
ATOM   1854 C  CG    . HIS A 1 285 ? -45.664 68.943  -26.204 1.00 46.24 ? 285 HIS A CG    1 
ATOM   1855 N  ND1   . HIS A 1 285 ? -46.485 68.398  -27.135 1.00 49.72 ? 285 HIS A ND1   1 
ATOM   1856 C  CD2   . HIS A 1 285 ? -45.724 70.336  -26.319 1.00 44.44 ? 285 HIS A CD2   1 
ATOM   1857 C  CE1   . HIS A 1 285 ? -47.028 69.440  -27.794 1.00 42.14 ? 285 HIS A CE1   1 
ATOM   1858 N  NE2   . HIS A 1 285 ? -46.590 70.612  -27.328 1.00 46.74 ? 285 HIS A NE2   1 
ATOM   1859 N  N     . ALA A 1 286 ? -42.877 68.952  -22.450 1.00 40.67 ? 286 ALA A N     1 
ATOM   1860 C  CA    . ALA A 1 286 ? -42.368 68.259  -21.273 1.00 39.15 ? 286 ALA A CA    1 
ATOM   1861 C  C     . ALA A 1 286 ? -43.503 67.797  -20.357 1.00 40.32 ? 286 ALA A C     1 
ATOM   1862 O  O     . ALA A 1 286 ? -44.484 68.492  -20.128 1.00 40.60 ? 286 ALA A O     1 
ATOM   1863 C  CB    . ALA A 1 286 ? -41.447 69.217  -20.516 1.00 43.65 ? 286 ALA A CB    1 
ATOM   1864 N  N     . CYS A 1 287 ? -43.361 66.555  -19.859 1.00 36.65 ? 287 CYS A N     1 
ATOM   1865 C  CA    . CYS A 1 287 ? -44.381 66.017  -18.966 1.00 36.61 ? 287 CYS A CA    1 
ATOM   1866 C  C     . CYS A 1 287 ? -43.759 65.200  -17.832 1.00 43.08 ? 287 CYS A C     1 
ATOM   1867 O  O     . CYS A 1 287 ? -43.197 64.132  -18.037 1.00 41.97 ? 287 CYS A O     1 
ATOM   1868 C  CB    . CYS A 1 287 ? -45.320 65.136  -19.790 1.00 37.35 ? 287 CYS A CB    1 
ATOM   1869 S  SG    . CYS A 1 287 ? -46.642 64.421  -18.787 1.00 42.15 ? 287 CYS A SG    1 
ATOM   1870 N  N     . PHE A 1 288 ? -43.900 65.797  -16.649 1.00 39.38 ? 288 PHE A N     1 
ATOM   1871 C  CA    . PHE A 1 288 ? -43.418 65.203  -15.406 1.00 38.73 ? 288 PHE A CA    1 
ATOM   1872 C  C     . PHE A 1 288 ? -44.649 64.642  -14.699 1.00 40.54 ? 288 PHE A C     1 
ATOM   1873 O  O     . PHE A 1 288 ? -45.616 65.365  -14.472 1.00 41.04 ? 288 PHE A O     1 
ATOM   1874 C  CB    . PHE A 1 288 ? -42.770 66.275  -14.534 1.00 35.71 ? 288 PHE A CB    1 
ATOM   1875 C  CG    . PHE A 1 288 ? -42.302 65.769  -13.208 1.00 38.29 ? 288 PHE A CG    1 
ATOM   1876 C  CD1   . PHE A 1 288 ? -41.071 65.131  -13.090 1.00 47.34 ? 288 PHE A CD1   1 
ATOM   1877 C  CD2   . PHE A 1 288 ? -43.121 65.875  -12.080 1.00 39.02 ? 288 PHE A CD2   1 
ATOM   1878 C  CE1   . PHE A 1 288 ? -40.653 64.614  -11.866 1.00 48.96 ? 288 PHE A CE1   1 
ATOM   1879 C  CE2   . PHE A 1 288 ? -42.712 65.360  -10.848 1.00 39.28 ? 288 PHE A CE2   1 
ATOM   1880 C  CZ    . PHE A 1 288 ? -41.481 64.725  -10.744 1.00 43.48 ? 288 PHE A CZ    1 
ATOM   1881 N  N     . GLN A 1 289 ? -44.623 63.360  -14.360 1.00 39.47 ? 289 GLN A N     1 
ATOM   1882 C  CA    . GLN A 1 289 ? -45.762 62.734  -13.693 1.00 40.09 ? 289 GLN A CA    1 
ATOM   1883 C  C     . GLN A 1 289 ? -45.516 62.254  -12.258 1.00 42.51 ? 289 GLN A C     1 
ATOM   1884 O  O     . GLN A 1 289 ? -44.413 61.827  -11.909 1.00 45.94 ? 289 GLN A O     1 
ATOM   1885 C  CB    . GLN A 1 289 ? -46.235 61.526  -14.494 1.00 36.14 ? 289 GLN A CB    1 
ATOM   1886 C  CG    . GLN A 1 289 ? -46.768 61.826  -15.881 1.00 36.99 ? 289 GLN A CG    1 
ATOM   1887 C  CD    . GLN A 1 289 ? -47.330 60.588  -16.523 1.00 39.35 ? 289 GLN A CD    1 
ATOM   1888 O  OE1   . GLN A 1 289 ? -48.439 60.603  -17.044 1.00 40.52 ? 289 GLN A OE1   1 
ATOM   1889 N  NE2   . GLN A 1 289 ? -46.572 59.499  -16.480 1.00 43.05 ? 289 GLN A NE2   1 
ATOM   1890 N  N     . ILE A 1 290 ? -46.569 62.308  -11.442 1.00 43.32 ? 290 ILE A N     1 
ATOM   1891 C  CA    . ILE A 1 290 ? -46.514 61.828  -10.061 1.00 38.14 ? 290 ILE A CA    1 
ATOM   1892 C  C     . ILE A 1 290 ? -47.617 60.797  -9.963  1.00 38.94 ? 290 ILE A C     1 
ATOM   1893 O  O     . ILE A 1 290 ? -48.793 61.134  -10.060 1.00 37.61 ? 290 ILE A O     1 
ATOM   1894 C  CB    . ILE A 1 290 ? -46.789 62.944  -9.018  1.00 42.29 ? 290 ILE A CB    1 
ATOM   1895 C  CG1   . ILE A 1 290 ? -45.729 64.039  -9.119  1.00 41.70 ? 290 ILE A CG1   1 
ATOM   1896 C  CG2   . ILE A 1 290 ? -46.738 62.352  -7.601  1.00 38.02 ? 290 ILE A CG2   1 
ATOM   1897 C  CD1   . ILE A 1 290 ? -46.031 65.255  -8.268  1.00 41.32 ? 290 ILE A CD1   1 
ATOM   1898 N  N     . LEU A 1 291 ? -47.231 59.539  -9.791  1.00 41.81 ? 291 LEU A N     1 
ATOM   1899 C  CA    . LEU A 1 291 ? -48.192 58.448  -9.694  1.00 39.53 ? 291 LEU A CA    1 
ATOM   1900 C  C     . LEU A 1 291 ? -48.284 57.861  -8.285  1.00 40.46 ? 291 LEU A C     1 
ATOM   1901 O  O     . LEU A 1 291 ? -47.277 57.753  -7.577  1.00 42.17 ? 291 LEU A O     1 
ATOM   1902 C  CB    . LEU A 1 291 ? -47.811 57.314  -10.652 1.00 44.40 ? 291 LEU A CB    1 
ATOM   1903 C  CG    . LEU A 1 291 ? -47.738 57.548  -12.163 1.00 44.01 ? 291 LEU A CG    1 
ATOM   1904 C  CD1   . LEU A 1 291 ? -46.526 58.386  -12.519 1.00 50.57 ? 291 LEU A CD1   1 
ATOM   1905 C  CD2   . LEU A 1 291 ? -47.654 56.198  -12.850 1.00 46.68 ? 291 LEU A CD2   1 
ATOM   1906 N  N     . LEU A 1 292 ? -49.496 57.464  -7.905  1.00 40.20 ? 292 LEU A N     1 
ATOM   1907 C  CA    . LEU A 1 292 ? -49.744 56.851  -6.605  1.00 45.41 ? 292 LEU A CA    1 
ATOM   1908 C  C     . LEU A 1 292 ? -50.182 55.411  -6.837  1.00 43.72 ? 292 LEU A C     1 
ATOM   1909 O  O     . LEU A 1 292 ? -51.127 55.158  -7.580  1.00 37.83 ? 292 LEU A O     1 
ATOM   1910 C  CB    . LEU A 1 292 ? -50.834 57.620  -5.842  1.00 46.66 ? 292 LEU A CB    1 
ATOM   1911 C  CG    . LEU A 1 292 ? -50.498 59.064  -5.448  1.00 47.65 ? 292 LEU A CG    1 
ATOM   1912 C  CD1   . LEU A 1 292 ? -51.680 59.698  -4.725  1.00 38.31 ? 292 LEU A CD1   1 
ATOM   1913 C  CD2   . LEU A 1 292 ? -49.259 59.076  -4.565  1.00 39.56 ? 292 LEU A CD2   1 
ATOM   1914 N  N     . ARG A 1 293 ? -49.483 54.466  -6.216  1.00 45.64 ? 293 ARG A N     1 
ATOM   1915 C  CA    . ARG A 1 293 ? -49.811 53.050  -6.366  1.00 47.93 ? 293 ARG A CA    1 
ATOM   1916 C  C     . ARG A 1 293 ? -49.903 52.354  -5.013  1.00 43.71 ? 293 ARG A C     1 
ATOM   1917 O  O     . ARG A 1 293 ? -49.196 52.708  -4.064  1.00 45.52 ? 293 ARG A O     1 
ATOM   1918 C  CB    . ARG A 1 293 ? -48.752 52.333  -7.214  1.00 45.26 ? 293 ARG A CB    1 
ATOM   1919 C  CG    . ARG A 1 293 ? -48.708 52.762  -8.663  1.00 53.24 ? 293 ARG A CG    1 
ATOM   1920 C  CD    . ARG A 1 293 ? -47.497 52.164  -9.389  1.00 54.26 ? 293 ARG A CD    1 
ATOM   1921 N  NE    . ARG A 1 293 ? -47.457 52.598  -10.780 1.00 48.07 ? 293 ARG A NE    1 
ATOM   1922 C  CZ    . ARG A 1 293 ? -48.299 52.173  -11.713 1.00 48.00 ? 293 ARG A CZ    1 
ATOM   1923 N  NH1   . ARG A 1 293 ? -49.237 51.291  -11.400 1.00 44.90 ? 293 ARG A NH1   1 
ATOM   1924 N  NH2   . ARG A 1 293 ? -48.218 52.649  -12.950 1.00 41.02 ? 293 ARG A NH2   1 
ATOM   1925 N  N     . THR A 1 294 ? -50.757 51.343  -4.939  1.00 55.22 ? 294 THR A N     1 
ATOM   1926 C  CA    . THR A 1 294 ? -50.935 50.603  -3.703  1.00 61.08 ? 294 THR A CA    1 
ATOM   1927 C  C     . THR A 1 294 ? -50.657 49.110  -3.852  1.00 61.09 ? 294 THR A C     1 
ATOM   1928 O  O     . THR A 1 294 ? -49.776 48.565  -3.182  1.00 70.42 ? 294 THR A O     1 
ATOM   1929 C  CB    . THR A 1 294 ? -52.366 50.801  -3.152  1.00 57.65 ? 294 THR A CB    1 
ATOM   1930 O  OG1   . THR A 1 294 ? -52.571 49.937  -2.027  1.00 66.41 ? 294 THR A OG1   1 
ATOM   1931 C  CG2   . THR A 1 294 ? -53.399 50.490  -4.227  1.00 60.14 ? 294 THR A CG2   1 
ATOM   1932 N  N     . LYS A 1 295 ? -51.392 48.449  -4.738  1.00 59.71 ? 295 LYS A N     1 
ATOM   1933 C  CA    . LYS A 1 295 ? -51.234 47.009  -4.922  1.00 65.72 ? 295 LYS A CA    1 
ATOM   1934 C  C     . LYS A 1 295 ? -51.480 46.559  -6.358  1.00 67.33 ? 295 LYS A C     1 
ATOM   1935 O  O     . LYS A 1 295 ? -52.557 46.051  -6.684  1.00 66.69 ? 295 LYS A O     1 
ATOM   1936 C  CB    . LYS A 1 295 ? -52.204 46.288  -3.995  1.00 67.93 ? 295 LYS A CB    1 
ATOM   1937 C  CG    . LYS A 1 295 ? -53.416 47.145  -3.645  1.00 71.28 ? 295 LYS A CG    1 
ATOM   1938 C  CD    . LYS A 1 295 ? -54.470 46.374  -2.883  1.00 75.09 ? 295 LYS A CD    1 
ATOM   1939 C  CE    . LYS A 1 295 ? -55.316 45.545  -3.828  1.00 78.34 ? 295 LYS A CE    1 
ATOM   1940 N  NZ    . LYS A 1 295 ? -56.368 44.796  -3.091  1.00 84.86 ? 295 LYS A NZ    1 
ATOM   1941 N  N     . GLY A 1 296 ? -50.472 46.728  -7.207  1.00 66.92 ? 296 GLY A N     1 
ATOM   1942 C  CA    . GLY A 1 296 ? -50.621 46.348  -8.599  1.00 69.88 ? 296 GLY A CA    1 
ATOM   1943 C  C     . GLY A 1 296 ? -51.460 47.376  -9.338  1.00 74.07 ? 296 GLY A C     1 
ATOM   1944 O  O     . GLY A 1 296 ? -51.329 47.540  -10.553 1.00 75.11 ? 296 GLY A O     1 
ATOM   1945 N  N     . ARG A 1 297 ? -52.313 48.084  -8.597  1.00 71.02 ? 297 ARG A N     1 
ATOM   1946 C  CA    . ARG A 1 297 ? -53.188 49.093  -9.182  1.00 68.97 ? 297 ARG A CA    1 
ATOM   1947 C  C     . ARG A 1 297 ? -52.698 50.532  -9.039  1.00 64.01 ? 297 ARG A C     1 
ATOM   1948 O  O     . ARG A 1 297 ? -51.958 50.876  -8.114  1.00 63.55 ? 297 ARG A O     1 
ATOM   1949 C  CB    . ARG A 1 297 ? -54.595 48.982  -8.580  1.00 72.79 ? 297 ARG A CB    1 
ATOM   1950 C  CG    . ARG A 1 297 ? -54.671 48.183  -7.281  1.00 81.27 ? 297 ARG A CG    1 
ATOM   1951 C  CD    . ARG A 1 297 ? -55.976 48.446  -6.532  1.00 83.07 ? 297 ARG A CD    1 
ATOM   1952 N  NE    . ARG A 1 297 ? -55.956 49.735  -5.841  1.00 82.81 ? 297 ARG A NE    1 
ATOM   1953 C  CZ    . ARG A 1 297 ? -56.890 50.674  -5.967  1.00 84.86 ? 297 ARG A CZ    1 
ATOM   1954 N  NH1   . ARG A 1 297 ? -57.931 50.476  -6.766  1.00 84.86 ? 297 ARG A NH1   1 
ATOM   1955 N  NH2   . ARG A 1 297 ? -56.782 51.814  -5.295  1.00 80.70 ? 297 ARG A NH2   1 
ATOM   1956 N  N     . LEU A 1 298 ? -53.114 51.368  -9.983  1.00 58.87 ? 298 LEU A N     1 
ATOM   1957 C  CA    . LEU A 1 298 ? -52.767 52.779  -9.972  1.00 51.42 ? 298 LEU A CA    1 
ATOM   1958 C  C     . LEU A 1 298 ? -53.863 53.446  -9.160  1.00 46.75 ? 298 LEU A C     1 
ATOM   1959 O  O     . LEU A 1 298 ? -55.047 53.291  -9.463  1.00 50.22 ? 298 LEU A O     1 
ATOM   1960 C  CB    . LEU A 1 298 ? -52.771 53.343  -11.397 1.00 46.28 ? 298 LEU A CB    1 
ATOM   1961 C  CG    . LEU A 1 298 ? -52.600 54.853  -11.558 1.00 41.59 ? 298 LEU A CG    1 
ATOM   1962 C  CD1   . LEU A 1 298 ? -51.169 55.250  -11.223 1.00 38.70 ? 298 LEU A CD1   1 
ATOM   1963 C  CD2   . LEU A 1 298 ? -52.940 55.248  -12.985 1.00 46.31 ? 298 LEU A CD2   1 
ATOM   1964 N  N     . HIS A 1 299 ? -53.485 54.175  -8.120  1.00 45.72 ? 299 HIS A N     1 
ATOM   1965 C  CA    . HIS A 1 299 ? -54.490 54.841  -7.307  1.00 50.71 ? 299 HIS A CA    1 
ATOM   1966 C  C     . HIS A 1 299 ? -54.878 56.163  -7.957  1.00 51.56 ? 299 HIS A C     1 
ATOM   1967 O  O     . HIS A 1 299 ? -56.048 56.404  -8.255  1.00 52.42 ? 299 HIS A O     1 
ATOM   1968 C  CB    . HIS A 1 299 ? -53.958 55.096  -5.891  1.00 49.69 ? 299 HIS A CB    1 
ATOM   1969 C  CG    . HIS A 1 299 ? -54.970 55.709  -4.976  1.00 53.30 ? 299 HIS A CG    1 
ATOM   1970 N  ND1   . HIS A 1 299 ? -56.173 55.103  -4.687  1.00 57.07 ? 299 HIS A ND1   1 
ATOM   1971 C  CD2   . HIS A 1 299 ? -54.977 56.892  -4.315  1.00 58.69 ? 299 HIS A CD2   1 
ATOM   1972 C  CE1   . HIS A 1 299 ? -56.880 55.886  -3.892  1.00 56.07 ? 299 HIS A CE1   1 
ATOM   1973 N  NE2   . HIS A 1 299 ? -56.176 56.978  -3.652  1.00 57.57 ? 299 HIS A NE2   1 
ATOM   1974 N  N     . GLY A 1 300 ? -53.880 57.010  -8.177  1.00 50.01 ? 300 GLY A N     1 
ATOM   1975 C  CA    . GLY A 1 300 ? -54.111 58.306  -8.785  1.00 48.20 ? 300 GLY A CA    1 
ATOM   1976 C  C     . GLY A 1 300 ? -52.868 58.775  -9.515  1.00 51.06 ? 300 GLY A C     1 
ATOM   1977 O  O     . GLY A 1 300 ? -51.765 58.302  -9.235  1.00 46.44 ? 300 GLY A O     1 
ATOM   1978 N  N     . LYS A 1 301 ? -53.039 59.710  -10.446 1.00 47.65 ? 301 LYS A N     1 
ATOM   1979 C  CA    . LYS A 1 301 ? -51.916 60.218  -11.219 1.00 40.87 ? 301 LYS A CA    1 
ATOM   1980 C  C     . LYS A 1 301 ? -52.056 61.701  -11.528 1.00 40.75 ? 301 LYS A C     1 
ATOM   1981 O  O     . LYS A 1 301 ? -53.133 62.166  -11.879 1.00 32.62 ? 301 LYS A O     1 
ATOM   1982 C  CB    . LYS A 1 301 ? -51.791 59.417  -12.520 1.00 40.70 ? 301 LYS A CB    1 
ATOM   1983 C  CG    . LYS A 1 301 ? -50.662 59.877  -13.438 1.00 49.89 ? 301 LYS A CG    1 
ATOM   1984 C  CD    . LYS A 1 301 ? -50.429 58.887  -14.578 1.00 50.26 ? 301 LYS A CD    1 
ATOM   1985 C  CE    . LYS A 1 301 ? -51.660 58.729  -15.466 1.00 58.76 ? 301 LYS A CE    1 
ATOM   1986 N  NZ    . LYS A 1 301 ? -51.420 57.733  -16.546 1.00 56.83 ? 301 LYS A NZ    1 
ATOM   1987 N  N     . PHE A 1 302 ? -50.956 62.434  -11.385 1.00 39.87 ? 302 PHE A N     1 
ATOM   1988 C  CA    . PHE A 1 302 ? -50.927 63.870  -11.654 1.00 39.32 ? 302 PHE A CA    1 
ATOM   1989 C  C     . PHE A 1 302 ? -49.888 64.112  -12.758 1.00 40.82 ? 302 PHE A C     1 
ATOM   1990 O  O     . PHE A 1 302 ? -48.700 63.822  -12.575 1.00 40.08 ? 302 PHE A O     1 
ATOM   1991 C  CB    . PHE A 1 302 ? -50.501 64.639  -10.398 1.00 40.61 ? 302 PHE A CB    1 
ATOM   1992 C  CG    . PHE A 1 302 ? -50.847 66.106  -10.420 1.00 39.61 ? 302 PHE A CG    1 
ATOM   1993 C  CD1   . PHE A 1 302 ? -51.263 66.733  -11.595 1.00 36.82 ? 302 PHE A CD1   1 
ATOM   1994 C  CD2   . PHE A 1 302 ? -50.765 66.860  -9.254  1.00 42.67 ? 302 PHE A CD2   1 
ATOM   1995 C  CE1   . PHE A 1 302 ? -51.574 68.098  -11.611 1.00 33.40 ? 302 PHE A CE1   1 
ATOM   1996 C  CE2   . PHE A 1 302 ? -51.072 68.217  -9.255  1.00 42.42 ? 302 PHE A CE2   1 
ATOM   1997 C  CZ    . PHE A 1 302 ? -51.488 68.837  -10.440 1.00 44.08 ? 302 PHE A CZ    1 
ATOM   1998 N  N     . SER A 1 303 ? -50.331 64.639  -13.898 1.00 40.22 ? 303 SER A N     1 
ATOM   1999 C  CA    . SER A 1 303 ? -49.418 64.905  -15.014 1.00 37.81 ? 303 SER A CA    1 
ATOM   2000 C  C     . SER A 1 303 ? -49.210 66.392  -15.176 1.00 36.66 ? 303 SER A C     1 
ATOM   2001 O  O     . SER A 1 303 ? -50.137 67.123  -15.504 1.00 34.44 ? 303 SER A O     1 
ATOM   2002 C  CB    . SER A 1 303 ? -49.970 64.305  -16.310 1.00 33.72 ? 303 SER A CB    1 
ATOM   2003 O  OG    . SER A 1 303 ? -50.036 62.893  -16.223 1.00 43.30 ? 303 SER A OG    1 
ATOM   2004 N  N     . LEU A 1 304 ? -47.982 66.836  -14.933 1.00 39.62 ? 304 LEU A N     1 
ATOM   2005 C  CA    . LEU A 1 304 ? -47.636 68.243  -15.032 1.00 34.39 ? 304 LEU A CA    1 
ATOM   2006 C  C     . LEU A 1 304 ? -46.976 68.457  -16.405 1.00 38.39 ? 304 LEU A C     1 
ATOM   2007 O  O     . LEU A 1 304 ? -45.928 67.896  -16.694 1.00 31.36 ? 304 LEU A O     1 
ATOM   2008 C  CB    . LEU A 1 304 ? -46.667 68.618  -13.897 1.00 33.18 ? 304 LEU A CB    1 
ATOM   2009 C  CG    . LEU A 1 304 ? -47.086 68.405  -12.429 1.00 42.27 ? 304 LEU A CG    1 
ATOM   2010 C  CD1   . LEU A 1 304 ? -48.296 69.255  -12.092 1.00 37.66 ? 304 LEU A CD1   1 
ATOM   2011 C  CD2   . LEU A 1 304 ? -47.379 66.942  -12.180 1.00 39.65 ? 304 LEU A CD2   1 
ATOM   2012 N  N     . VAL A 1 305 ? -47.581 69.294  -17.238 1.00 35.29 ? 305 VAL A N     1 
ATOM   2013 C  CA    . VAL A 1 305 ? -47.060 69.498  -18.583 1.00 35.55 ? 305 VAL A CA    1 
ATOM   2014 C  C     . VAL A 1 305 ? -46.507 70.872  -18.921 1.00 36.59 ? 305 VAL A C     1 
ATOM   2015 O  O     . VAL A 1 305 ? -47.169 71.886  -18.748 1.00 32.71 ? 305 VAL A O     1 
ATOM   2016 C  CB    . VAL A 1 305 ? -48.144 69.133  -19.632 1.00 34.21 ? 305 VAL A CB    1 
ATOM   2017 C  CG1   . VAL A 1 305 ? -47.555 69.202  -21.037 1.00 32.67 ? 305 VAL A CG1   1 
ATOM   2018 C  CG2   . VAL A 1 305 ? -48.691 67.724  -19.353 1.00 35.75 ? 305 VAL A CG2   1 
ATOM   2019 N  N     . ASP A 1 306 ? -45.271 70.874  -19.409 1.00 34.14 ? 306 ASP A N     1 
ATOM   2020 C  CA    . ASP A 1 306 ? -44.572 72.088  -19.833 1.00 37.14 ? 306 ASP A CA    1 
ATOM   2021 C  C     . ASP A 1 306 ? -44.683 72.082  -21.371 1.00 37.94 ? 306 ASP A C     1 
ATOM   2022 O  O     . ASP A 1 306 ? -43.885 71.434  -22.063 1.00 39.51 ? 306 ASP A O     1 
ATOM   2023 C  CB    . ASP A 1 306 ? -43.103 71.996  -19.412 1.00 34.08 ? 306 ASP A CB    1 
ATOM   2024 C  CG    . ASP A 1 306 ? -42.320 73.199  -19.805 1.00 35.46 ? 306 ASP A CG    1 
ATOM   2025 O  OD1   . ASP A 1 306 ? -42.919 74.096  -20.432 1.00 31.27 ? 306 ASP A OD1   1 
ATOM   2026 O  OD2   . ASP A 1 306 ? -41.112 73.259  -19.483 1.00 33.60 ? 306 ASP A OD2   1 
ATOM   2027 N  N     . LEU A 1 307 ? -45.675 72.785  -21.904 1.00 37.77 ? 307 LEU A N     1 
ATOM   2028 C  CA    . LEU A 1 307 ? -45.900 72.786  -23.347 1.00 38.05 ? 307 LEU A CA    1 
ATOM   2029 C  C     . LEU A 1 307 ? -44.873 73.562  -24.164 1.00 39.34 ? 307 LEU A C     1 
ATOM   2030 O  O     . LEU A 1 307 ? -44.143 74.412  -23.642 1.00 42.66 ? 307 LEU A O     1 
ATOM   2031 C  CB    . LEU A 1 307 ? -47.311 73.306  -23.654 1.00 31.62 ? 307 LEU A CB    1 
ATOM   2032 C  CG    . LEU A 1 307 ? -48.482 72.451  -23.148 1.00 41.20 ? 307 LEU A CG    1 
ATOM   2033 C  CD1   . LEU A 1 307 ? -49.775 73.198  -23.338 1.00 26.71 ? 307 LEU A CD1   1 
ATOM   2034 C  CD2   . LEU A 1 307 ? -48.535 71.118  -23.881 1.00 33.29 ? 307 LEU A CD2   1 
ATOM   2035 N  N     . ALA A 1 308 ? -44.813 73.249  -25.457 1.00 41.43 ? 308 ALA A N     1 
ATOM   2036 C  CA    . ALA A 1 308 ? -43.897 73.941  -26.364 1.00 39.01 ? 308 ALA A CA    1 
ATOM   2037 C  C     . ALA A 1 308 ? -44.526 75.284  -26.740 1.00 37.32 ? 308 ALA A C     1 
ATOM   2038 O  O     . ALA A 1 308 ? -45.740 75.436  -26.658 1.00 40.09 ? 308 ALA A O     1 
ATOM   2039 C  CB    . ALA A 1 308 ? -43.665 73.091  -27.607 1.00 39.95 ? 308 ALA A CB    1 
ATOM   2040 N  N     . GLY A 1 309 ? -43.708 76.256  -27.134 1.00 37.15 ? 309 GLY A N     1 
ATOM   2041 C  CA    . GLY A 1 309 ? -44.230 77.563  -27.513 1.00 33.11 ? 309 GLY A CA    1 
ATOM   2042 C  C     . GLY A 1 309 ? -45.406 77.439  -28.470 1.00 38.86 ? 309 GLY A C     1 
ATOM   2043 O  O     . GLY A 1 309 ? -45.388 76.612  -29.392 1.00 36.41 ? 309 GLY A O     1 
ATOM   2044 N  N     . ASN A 1 310 ? -46.427 78.263  -28.259 1.00 38.93 ? 310 ASN A N     1 
ATOM   2045 C  CA    . ASN A 1 310 ? -47.632 78.202  -29.071 1.00 36.91 ? 310 ASN A CA    1 
ATOM   2046 C  C     . ASN A 1 310 ? -47.571 79.072  -30.325 1.00 41.44 ? 310 ASN A C     1 
ATOM   2047 O  O     . ASN A 1 310 ? -48.407 78.936  -31.219 1.00 45.52 ? 310 ASN A O     1 
ATOM   2048 C  CB    . ASN A 1 310 ? -48.852 78.575  -28.216 1.00 31.03 ? 310 ASN A CB    1 
ATOM   2049 C  CG    . ASN A 1 310 ? -48.894 80.032  -27.863 1.00 33.28 ? 310 ASN A CG    1 
ATOM   2050 O  OD1   . ASN A 1 310 ? -47.884 80.725  -27.911 1.00 27.24 ? 310 ASN A OD1   1 
ATOM   2051 N  ND2   . ASN A 1 310 ? -50.077 80.517  -27.495 1.00 26.35 ? 310 ASN A ND2   1 
ATOM   2052 N  N     . GLU A 1 311 ? -46.584 79.961  -30.389 1.00 47.95 ? 311 GLU A N     1 
ATOM   2053 C  CA    . GLU A 1 311 ? -46.421 80.830  -31.550 1.00 56.05 ? 311 GLU A CA    1 
ATOM   2054 C  C     . GLU A 1 311 ? -45.537 80.174  -32.612 1.00 59.26 ? 311 GLU A C     1 
ATOM   2055 O  O     . GLU A 1 311 ? -46.031 79.686  -33.629 1.00 57.57 ? 311 GLU A O     1 
ATOM   2056 C  CB    . GLU A 1 311 ? -45.812 82.172  -31.132 1.00 57.76 ? 311 GLU A CB    1 
ATOM   2057 C  CG    . GLU A 1 311 ? -44.878 82.097  -29.923 1.00 69.15 ? 311 GLU A CG    1 
ATOM   2058 C  CD    . GLU A 1 311 ? -43.735 81.119  -30.103 1.00 70.76 ? 311 GLU A CD    1 
ATOM   2059 O  OE1   . GLU A 1 311 ? -42.859 81.371  -30.954 1.00 76.89 ? 311 GLU A OE1   1 
ATOM   2060 O  OE2   . GLU A 1 311 ? -43.713 80.095  -29.392 1.00 68.45 ? 311 GLU A OE2   1 
ATOM   2061 N  N     . ARG A 1 324 ? -38.337 72.535  -40.894 1.00 84.86 ? 324 ARG A N     1 
ATOM   2062 C  CA    . ARG A 1 324 ? -38.719 73.077  -39.594 1.00 84.86 ? 324 ARG A CA    1 
ATOM   2063 C  C     . ARG A 1 324 ? -40.236 73.244  -39.456 1.00 84.86 ? 324 ARG A C     1 
ATOM   2064 O  O     . ARG A 1 324 ? -40.721 73.950  -38.574 1.00 84.51 ? 324 ARG A O     1 
ATOM   2065 C  CB    . ARG A 1 324 ? -37.995 74.415  -39.352 1.00 84.86 ? 324 ARG A CB    1 
ATOM   2066 C  CG    . ARG A 1 324 ? -38.716 75.365  -38.407 1.00 84.86 ? 324 ARG A CG    1 
ATOM   2067 C  CD    . ARG A 1 324 ? -37.800 76.352  -37.720 1.00 84.86 ? 324 ARG A CD    1 
ATOM   2068 N  NE    . ARG A 1 324 ? -38.578 77.290  -36.914 1.00 84.86 ? 324 ARG A NE    1 
ATOM   2069 C  CZ    . ARG A 1 324 ? -38.053 78.227  -36.131 1.00 84.86 ? 324 ARG A CZ    1 
ATOM   2070 N  NH1   . ARG A 1 324 ? -36.734 78.358  -36.040 1.00 84.86 ? 324 ARG A NH1   1 
ATOM   2071 N  NH2   . ARG A 1 324 ? -38.848 79.039  -35.445 1.00 84.86 ? 324 ARG A NH2   1 
ATOM   2072 N  N     . MET A 1 325 ? -40.993 72.575  -40.317 1.00 84.86 ? 325 MET A N     1 
ATOM   2073 C  CA    . MET A 1 325 ? -42.445 72.678  -40.251 1.00 84.86 ? 325 MET A CA    1 
ATOM   2074 C  C     . MET A 1 325 ? -43.012 71.773  -39.156 1.00 84.86 ? 325 MET A C     1 
ATOM   2075 O  O     . MET A 1 325 ? -44.039 71.117  -39.346 1.00 84.86 ? 325 MET A O     1 
ATOM   2076 C  CB    . MET A 1 325 ? -43.072 72.315  -41.600 1.00 84.86 ? 325 MET A CB    1 
ATOM   2077 C  CG    . MET A 1 325 ? -44.524 72.756  -41.729 1.00 84.86 ? 325 MET A CG    1 
ATOM   2078 S  SD    . MET A 1 325 ? -45.366 72.080  -43.172 1.00 84.86 ? 325 MET A SD    1 
ATOM   2079 C  CE    . MET A 1 325 ? -46.298 70.739  -42.418 1.00 81.37 ? 325 MET A CE    1 
ATOM   2080 N  N     . GLU A 1 326 ? -42.332 71.736  -38.012 1.00 84.86 ? 326 GLU A N     1 
ATOM   2081 C  CA    . GLU A 1 326 ? -42.776 70.929  -36.881 1.00 82.52 ? 326 GLU A CA    1 
ATOM   2082 C  C     . GLU A 1 326 ? -43.871 71.680  -36.131 1.00 81.97 ? 326 GLU A C     1 
ATOM   2083 O  O     . GLU A 1 326 ? -44.561 71.114  -35.283 1.00 83.27 ? 326 GLU A O     1 
ATOM   2084 C  CB    . GLU A 1 326 ? -41.599 70.614  -35.944 1.00 83.21 ? 326 GLU A CB    1 
ATOM   2085 C  CG    . GLU A 1 326 ? -40.749 71.816  -35.531 1.00 83.77 ? 326 GLU A CG    1 
ATOM   2086 C  CD    . GLU A 1 326 ? -39.496 71.412  -34.757 1.00 84.86 ? 326 GLU A CD    1 
ATOM   2087 O  OE1   . GLU A 1 326 ? -38.799 70.469  -35.194 1.00 84.86 ? 326 GLU A OE1   1 
ATOM   2088 O  OE2   . GLU A 1 326 ? -39.198 72.042  -33.720 1.00 84.86 ? 326 GLU A OE2   1 
ATOM   2089 N  N     . GLY A 1 327 ? -44.028 72.960  -36.456 1.00 79.39 ? 327 GLY A N     1 
ATOM   2090 C  CA    . GLY A 1 327 ? -45.054 73.763  -35.819 1.00 76.17 ? 327 GLY A CA    1 
ATOM   2091 C  C     . GLY A 1 327 ? -46.416 73.175  -36.125 1.00 73.58 ? 327 GLY A C     1 
ATOM   2092 O  O     . GLY A 1 327 ? -47.411 73.491  -35.471 1.00 72.04 ? 327 GLY A O     1 
ATOM   2093 N  N     . ALA A 1 328 ? -46.453 72.310  -37.132 1.00 72.11 ? 328 ALA A N     1 
ATOM   2094 C  CA    . ALA A 1 328 ? -47.685 71.656  -37.539 1.00 71.57 ? 328 ALA A CA    1 
ATOM   2095 C  C     . ALA A 1 328 ? -48.071 70.618  -36.497 1.00 69.66 ? 328 ALA A C     1 
ATOM   2096 O  O     . ALA A 1 328 ? -49.250 70.437  -36.189 1.00 71.91 ? 328 ALA A O     1 
ATOM   2097 C  CB    . ALA A 1 328 ? -47.495 70.990  -38.893 1.00 75.66 ? 328 ALA A CB    1 
ATOM   2098 N  N     . GLU A 1 329 ? -47.067 69.929  -35.967 1.00 66.06 ? 329 GLU A N     1 
ATOM   2099 C  CA    . GLU A 1 329 ? -47.293 68.911  -34.950 1.00 64.29 ? 329 GLU A CA    1 
ATOM   2100 C  C     . GLU A 1 329 ? -47.661 69.625  -33.647 1.00 57.17 ? 329 GLU A C     1 
ATOM   2101 O  O     . GLU A 1 329 ? -48.526 69.177  -32.901 1.00 57.22 ? 329 GLU A O     1 
ATOM   2102 C  CB    . GLU A 1 329 ? -46.027 68.074  -34.748 1.00 69.71 ? 329 GLU A CB    1 
ATOM   2103 C  CG    . GLU A 1 329 ? -46.244 66.779  -33.976 1.00 74.89 ? 329 GLU A CG    1 
ATOM   2104 C  CD    . GLU A 1 329 ? -46.665 65.623  -34.868 1.00 79.70 ? 329 GLU A CD    1 
ATOM   2105 O  OE1   . GLU A 1 329 ? -45.851 65.202  -35.718 1.00 81.21 ? 329 GLU A OE1   1 
ATOM   2106 O  OE2   . GLU A 1 329 ? -47.805 65.132  -34.721 1.00 84.86 ? 329 GLU A OE2   1 
ATOM   2107 N  N     . ILE A 1 330 ? -47.002 70.749  -33.393 1.00 52.89 ? 330 ILE A N     1 
ATOM   2108 C  CA    . ILE A 1 330 ? -47.256 71.531  -32.194 1.00 55.25 ? 330 ILE A CA    1 
ATOM   2109 C  C     . ILE A 1 330 ? -48.645 72.145  -32.216 1.00 53.84 ? 330 ILE A C     1 
ATOM   2110 O  O     . ILE A 1 330 ? -49.335 72.179  -31.198 1.00 53.53 ? 330 ILE A O     1 
ATOM   2111 C  CB    . ILE A 1 330 ? -46.218 72.661  -32.035 1.00 52.37 ? 330 ILE A CB    1 
ATOM   2112 C  CG1   . ILE A 1 330 ? -44.840 72.052  -31.774 1.00 50.51 ? 330 ILE A CG1   1 
ATOM   2113 C  CG2   . ILE A 1 330 ? -46.625 73.591  -30.900 1.00 53.29 ? 330 ILE A CG2   1 
ATOM   2114 C  CD1   . ILE A 1 330 ? -43.763 73.072  -31.481 1.00 50.77 ? 330 ILE A CD1   1 
ATOM   2115 N  N     . ASN A 1 331 ? -49.061 72.628  -33.378 1.00 57.36 ? 331 ASN A N     1 
ATOM   2116 C  CA    . ASN A 1 331 ? -50.373 73.240  -33.497 1.00 57.61 ? 331 ASN A CA    1 
ATOM   2117 C  C     . ASN A 1 331 ? -51.483 72.191  -33.442 1.00 56.48 ? 331 ASN A C     1 
ATOM   2118 O  O     . ASN A 1 331 ? -52.563 72.452  -32.917 1.00 55.87 ? 331 ASN A O     1 
ATOM   2119 C  CB    . ASN A 1 331 ? -50.457 74.043  -34.798 1.00 63.55 ? 331 ASN A CB    1 
ATOM   2120 C  CG    . ASN A 1 331 ? -51.661 74.964  -34.838 1.00 69.82 ? 331 ASN A CG    1 
ATOM   2121 O  OD1   . ASN A 1 331 ? -52.803 74.512  -34.944 1.00 72.03 ? 331 ASN A OD1   1 
ATOM   2122 N  ND2   . ASN A 1 331 ? -51.411 76.266  -34.741 1.00 72.34 ? 331 ASN A ND2   1 
ATOM   2123 N  N     . LYS A 1 332 ? -51.217 71.002  -33.973 1.00 56.35 ? 332 LYS A N     1 
ATOM   2124 C  CA    . LYS A 1 332 ? -52.222 69.946  -33.970 1.00 55.47 ? 332 LYS A CA    1 
ATOM   2125 C  C     . LYS A 1 332 ? -52.431 69.453  -32.547 1.00 50.81 ? 332 LYS A C     1 
ATOM   2126 O  O     . LYS A 1 332 ? -53.553 69.153  -32.143 1.00 55.48 ? 332 LYS A O     1 
ATOM   2127 C  CB    . LYS A 1 332 ? -51.794 68.767  -34.856 1.00 64.21 ? 332 LYS A CB    1 
ATOM   2128 C  CG    . LYS A 1 332 ? -50.720 67.874  -34.240 1.00 73.07 ? 332 LYS A CG    1 
ATOM   2129 C  CD    . LYS A 1 332 ? -50.523 66.567  -35.009 1.00 76.48 ? 332 LYS A CD    1 
ATOM   2130 C  CE    . LYS A 1 332 ? -49.915 66.795  -36.388 1.00 84.61 ? 332 LYS A CE    1 
ATOM   2131 N  NZ    . LYS A 1 332 ? -49.604 65.507  -37.076 1.00 84.86 ? 332 LYS A NZ    1 
ATOM   2132 N  N     . SER A 1 333 ? -51.335 69.360  -31.797 1.00 50.18 ? 333 SER A N     1 
ATOM   2133 C  CA    . SER A 1 333 ? -51.382 68.910  -30.411 1.00 44.49 ? 333 SER A CA    1 
ATOM   2134 C  C     . SER A 1 333 ? -52.137 69.936  -29.576 1.00 39.04 ? 333 SER A C     1 
ATOM   2135 O  O     . SER A 1 333 ? -52.969 69.574  -28.752 1.00 41.58 ? 333 SER A O     1 
ATOM   2136 C  CB    . SER A 1 333 ? -49.966 68.713  -29.868 1.00 44.40 ? 333 SER A CB    1 
ATOM   2137 O  OG    . SER A 1 333 ? -49.200 69.892  -30.019 1.00 59.86 ? 333 SER A OG    1 
ATOM   2138 N  N     . LEU A 1 334 ? -51.868 71.213  -29.804 1.00 40.09 ? 334 LEU A N     1 
ATOM   2139 C  CA    . LEU A 1 334 ? -52.561 72.256  -29.066 1.00 37.54 ? 334 LEU A CA    1 
ATOM   2140 C  C     . LEU A 1 334 ? -54.041 72.285  -29.431 1.00 42.50 ? 334 LEU A C     1 
ATOM   2141 O  O     . LEU A 1 334 ? -54.898 72.538  -28.583 1.00 42.87 ? 334 LEU A O     1 
ATOM   2142 C  CB    . LEU A 1 334 ? -51.913 73.614  -29.328 1.00 40.59 ? 334 LEU A CB    1 
ATOM   2143 C  CG    . LEU A 1 334 ? -50.466 73.715  -28.826 1.00 51.48 ? 334 LEU A CG    1 
ATOM   2144 C  CD1   . LEU A 1 334 ? -49.925 75.112  -29.080 1.00 60.16 ? 334 LEU A CD1   1 
ATOM   2145 C  CD2   . LEU A 1 334 ? -50.408 73.395  -27.339 1.00 53.48 ? 334 LEU A CD2   1 
ATOM   2146 N  N     . LEU A 1 335 ? -54.357 72.021  -30.695 1.00 49.61 ? 335 LEU A N     1 
ATOM   2147 C  CA    . LEU A 1 335 ? -55.751 72.005  -31.121 1.00 48.45 ? 335 LEU A CA    1 
ATOM   2148 C  C     . LEU A 1 335 ? -56.400 70.784  -30.488 1.00 49.51 ? 335 LEU A C     1 
ATOM   2149 O  O     . LEU A 1 335 ? -57.538 70.836  -30.021 1.00 54.82 ? 335 LEU A O     1 
ATOM   2150 C  CB    . LEU A 1 335 ? -55.846 71.922  -32.646 1.00 53.43 ? 335 LEU A CB    1 
ATOM   2151 C  CG    . LEU A 1 335 ? -55.344 73.134  -33.442 1.00 57.56 ? 335 LEU A CG    1 
ATOM   2152 C  CD1   . LEU A 1 335 ? -55.422 72.828  -34.932 1.00 57.90 ? 335 LEU A CD1   1 
ATOM   2153 C  CD2   . LEU A 1 335 ? -56.179 74.363  -33.104 1.00 55.11 ? 335 LEU A CD2   1 
ATOM   2154 N  N     . ALA A 1 336 ? -55.661 69.682  -30.473 1.00 47.16 ? 336 ALA A N     1 
ATOM   2155 C  CA    . ALA A 1 336 ? -56.142 68.441  -29.881 1.00 46.96 ? 336 ALA A CA    1 
ATOM   2156 C  C     . ALA A 1 336 ? -56.312 68.609  -28.363 1.00 46.25 ? 336 ALA A C     1 
ATOM   2157 O  O     . ALA A 1 336 ? -57.296 68.150  -27.781 1.00 42.12 ? 336 ALA A O     1 
ATOM   2158 C  CB    . ALA A 1 336 ? -55.160 67.315  -30.172 1.00 48.15 ? 336 ALA A CB    1 
ATOM   2159 N  N     . LEU A 1 337 ? -55.347 69.261  -27.724 1.00 41.36 ? 337 LEU A N     1 
ATOM   2160 C  CA    . LEU A 1 337 ? -55.428 69.480  -26.288 1.00 45.79 ? 337 LEU A CA    1 
ATOM   2161 C  C     . LEU A 1 337 ? -56.717 70.216  -25.933 1.00 48.82 ? 337 LEU A C     1 
ATOM   2162 O  O     . LEU A 1 337 ? -57.470 69.785  -25.058 1.00 48.72 ? 337 LEU A O     1 
ATOM   2163 C  CB    . LEU A 1 337 ? -54.223 70.289  -25.792 1.00 43.79 ? 337 LEU A CB    1 
ATOM   2164 C  CG    . LEU A 1 337 ? -54.200 70.503  -24.272 1.00 45.16 ? 337 LEU A CG    1 
ATOM   2165 C  CD1   . LEU A 1 337 ? -54.224 69.150  -23.571 1.00 38.54 ? 337 LEU A CD1   1 
ATOM   2166 C  CD2   . LEU A 1 337 ? -52.965 71.290  -23.870 1.00 36.04 ? 337 LEU A CD2   1 
ATOM   2167 N  N     . LYS A 1 338 ? -56.975 71.318  -26.627 1.00 52.13 ? 338 LYS A N     1 
ATOM   2168 C  CA    . LYS A 1 338 ? -58.165 72.115  -26.367 1.00 58.15 ? 338 LYS A CA    1 
ATOM   2169 C  C     . LYS A 1 338 ? -59.444 71.288  -26.386 1.00 62.67 ? 338 LYS A C     1 
ATOM   2170 O  O     . LYS A 1 338 ? -60.249 71.356  -25.456 1.00 65.68 ? 338 LYS A O     1 
ATOM   2171 C  CB    . LYS A 1 338 ? -58.255 73.259  -27.378 1.00 58.58 ? 338 LYS A CB    1 
ATOM   2172 C  CG    . LYS A 1 338 ? -59.339 74.287  -27.072 1.00 65.38 ? 338 LYS A CG    1 
ATOM   2173 C  CD    . LYS A 1 338 ? -59.030 75.641  -27.711 1.00 63.68 ? 338 LYS A CD    1 
ATOM   2174 C  CE    . LYS A 1 338 ? -58.918 75.550  -29.230 1.00 69.01 ? 338 LYS A CE    1 
ATOM   2175 N  NZ    . LYS A 1 338 ? -58.476 76.840  -29.840 1.00 73.21 ? 338 LYS A NZ    1 
ATOM   2176 N  N     . GLU A 1 339 ? -59.626 70.489  -27.430 1.00 63.80 ? 339 GLU A N     1 
ATOM   2177 C  CA    . GLU A 1 339 ? -60.826 69.673  -27.545 1.00 62.05 ? 339 GLU A CA    1 
ATOM   2178 C  C     . GLU A 1 339 ? -60.909 68.561  -26.502 1.00 60.30 ? 339 GLU A C     1 
ATOM   2179 O  O     . GLU A 1 339 ? -62.000 68.148  -26.116 1.00 63.84 ? 339 GLU A O     1 
ATOM   2180 C  CB    . GLU A 1 339 ? -60.911 69.114  -28.965 1.00 65.33 ? 339 GLU A CB    1 
ATOM   2181 C  CG    . GLU A 1 339 ? -60.998 70.225  -30.008 1.00 75.08 ? 339 GLU A CG    1 
ATOM   2182 C  CD    . GLU A 1 339 ? -62.345 70.931  -29.996 1.00 82.05 ? 339 GLU A CD    1 
ATOM   2183 O  OE1   . GLU A 1 339 ? -63.349 70.267  -30.330 1.00 84.78 ? 339 GLU A OE1   1 
ATOM   2184 O  OE2   . GLU A 1 339 ? -62.405 72.135  -29.655 1.00 83.59 ? 339 GLU A OE2   1 
ATOM   2185 N  N     . CYS A 1 340 ? -59.764 68.074  -26.041 1.00 55.30 ? 340 CYS A N     1 
ATOM   2186 C  CA    . CYS A 1 340 ? -59.756 67.034  -25.017 1.00 51.90 ? 340 CYS A CA    1 
ATOM   2187 C  C     . CYS A 1 340 ? -60.189 67.629  -23.671 1.00 50.46 ? 340 CYS A C     1 
ATOM   2188 O  O     . CYS A 1 340 ? -60.972 67.023  -22.935 1.00 46.99 ? 340 CYS A O     1 
ATOM   2189 C  CB    . CYS A 1 340 ? -58.361 66.418  -24.886 1.00 53.34 ? 340 CYS A CB    1 
ATOM   2190 S  SG    . CYS A 1 340 ? -57.955 65.244  -26.195 1.00 69.53 ? 340 CYS A SG    1 
ATOM   2191 N  N     . ILE A 1 341 ? -59.674 68.814  -23.362 1.00 45.71 ? 341 ILE A N     1 
ATOM   2192 C  CA    . ILE A 1 341 ? -60.007 69.498  -22.122 1.00 51.36 ? 341 ILE A CA    1 
ATOM   2193 C  C     . ILE A 1 341 ? -61.481 69.895  -22.128 1.00 59.17 ? 341 ILE A C     1 
ATOM   2194 O  O     . ILE A 1 341 ? -62.173 69.760  -21.119 1.00 59.39 ? 341 ILE A O     1 
ATOM   2195 C  CB    . ILE A 1 341 ? -59.144 70.753  -21.938 1.00 50.99 ? 341 ILE A CB    1 
ATOM   2196 C  CG1   . ILE A 1 341 ? -57.684 70.342  -21.745 1.00 48.88 ? 341 ILE A CG1   1 
ATOM   2197 C  CG2   . ILE A 1 341 ? -59.646 71.561  -20.751 1.00 50.24 ? 341 ILE A CG2   1 
ATOM   2198 C  CD1   . ILE A 1 341 ? -56.726 71.502  -21.592 1.00 49.80 ? 341 ILE A CD1   1 
ATOM   2199 N  N     . ARG A 1 342 ? -61.962 70.391  -23.262 1.00 64.48 ? 342 ARG A N     1 
ATOM   2200 C  CA    . ARG A 1 342 ? -63.361 70.774  -23.377 1.00 70.35 ? 342 ARG A CA    1 
ATOM   2201 C  C     . ARG A 1 342 ? -64.234 69.533  -23.306 1.00 73.29 ? 342 ARG A C     1 
ATOM   2202 O  O     . ARG A 1 342 ? -65.351 69.580  -22.782 1.00 77.10 ? 342 ARG A O     1 
ATOM   2203 C  CB    . ARG A 1 342 ? -63.595 71.532  -24.688 1.00 73.68 ? 342 ARG A CB    1 
ATOM   2204 C  CG    . ARG A 1 342 ? -63.476 73.041  -24.519 1.00 78.23 ? 342 ARG A CG    1 
ATOM   2205 C  CD    . ARG A 1 342 ? -63.354 73.815  -25.833 1.00 80.91 ? 342 ARG A CD    1 
ATOM   2206 N  NE    . ARG A 1 342 ? -64.631 74.110  -26.486 1.00 84.86 ? 342 ARG A NE    1 
ATOM   2207 C  CZ    . ARG A 1 342 ? -65.787 74.293  -25.852 1.00 84.86 ? 342 ARG A CZ    1 
ATOM   2208 N  NH1   . ARG A 1 342 ? -65.854 74.201  -24.534 1.00 82.01 ? 342 ARG A NH1   1 
ATOM   2209 N  NH2   . ARG A 1 342 ? -66.880 74.599  -26.536 1.00 84.86 ? 342 ARG A NH2   1 
ATOM   2210 N  N     . ALA A 1 343 ? -63.729 68.415  -23.809 1.00 73.02 ? 343 ALA A N     1 
ATOM   2211 C  CA    . ALA A 1 343 ? -64.521 67.207  -23.751 1.00 72.26 ? 343 ALA A CA    1 
ATOM   2212 C  C     . ALA A 1 343 ? -64.602 66.717  -22.308 1.00 74.07 ? 343 ALA A C     1 
ATOM   2213 O  O     . ALA A 1 343 ? -65.433 65.870  -21.975 1.00 78.44 ? 343 ALA A O     1 
ATOM   2214 C  CB    . ALA A 1 343 ? -63.921 66.155  -24.628 1.00 74.42 ? 343 ALA A CB    1 
ATOM   2215 N  N     . LEU A 1 344 ? -63.737 67.256  -21.452 1.00 75.84 ? 344 LEU A N     1 
ATOM   2216 C  CA    . LEU A 1 344 ? -63.712 66.871  -20.045 1.00 76.57 ? 344 LEU A CA    1 
ATOM   2217 C  C     . LEU A 1 344 ? -64.926 67.427  -19.317 1.00 79.49 ? 344 LEU A C     1 
ATOM   2218 O  O     . LEU A 1 344 ? -65.518 66.756  -18.472 1.00 77.56 ? 344 LEU A O     1 
ATOM   2219 C  CB    . LEU A 1 344 ? -62.435 67.378  -19.371 1.00 75.60 ? 344 LEU A CB    1 
ATOM   2220 C  CG    . LEU A 1 344 ? -62.392 67.203  -17.850 1.00 74.96 ? 344 LEU A CG    1 
ATOM   2221 C  CD1   . LEU A 1 344 ? -62.619 65.744  -17.500 1.00 80.67 ? 344 LEU A CD1   1 
ATOM   2222 C  CD2   . LEU A 1 344 ? -61.061 67.681  -17.307 1.00 72.62 ? 344 LEU A CD2   1 
ATOM   2223 N  N     . GLY A 1 345 ? -65.293 68.659  -19.649 1.00 81.28 ? 345 GLY A N     1 
ATOM   2224 C  CA    . GLY A 1 345 ? -66.447 69.269  -19.017 1.00 83.91 ? 345 GLY A CA    1 
ATOM   2225 C  C     . GLY A 1 345 ? -67.714 69.021  -19.819 1.00 84.86 ? 345 GLY A C     1 
ATOM   2226 O  O     . GLY A 1 345 ? -68.468 69.954  -20.116 1.00 84.86 ? 345 GLY A O     1 
ATOM   2227 N  N     . GLN A 1 346 ? -67.952 67.762  -20.174 1.00 84.44 ? 346 GLN A N     1 
ATOM   2228 C  CA    . GLN A 1 346 ? -69.138 67.409  -20.946 1.00 84.64 ? 346 GLN A CA    1 
ATOM   2229 C  C     . GLN A 1 346 ? -69.242 65.904  -21.168 1.00 84.86 ? 346 GLN A C     1 
ATOM   2230 O  O     . GLN A 1 346 ? -68.293 65.160  -20.920 1.00 84.86 ? 346 GLN A O     1 
ATOM   2231 C  CB    . GLN A 1 346 ? -69.118 68.137  -22.289 1.00 84.32 ? 346 GLN A CB    1 
ATOM   2232 N  N     . PHE A 1 353 ? -61.567 65.169  -33.156 1.00 84.86 ? 353 PHE A N     1 
ATOM   2233 C  CA    . PHE A 1 353 ? -60.251 65.315  -32.545 1.00 84.86 ? 353 PHE A CA    1 
ATOM   2234 C  C     . PHE A 1 353 ? -59.229 65.876  -33.536 1.00 84.86 ? 353 PHE A C     1 
ATOM   2235 O  O     . PHE A 1 353 ? -58.929 67.063  -33.554 1.00 84.86 ? 353 PHE A O     1 
ATOM   2236 C  CB    . PHE A 1 353 ? -59.800 63.939  -32.052 1.00 84.86 ? 353 PHE A CB    1 
ATOM   2237 C  CG    . PHE A 1 353 ? -60.526 63.588  -30.787 1.00 84.45 ? 353 PHE A CG    1 
ATOM   2238 C  CD1   . PHE A 1 353 ? -61.768 62.969  -30.857 1.00 84.62 ? 353 PHE A CD1   1 
ATOM   2239 C  CD2   . PHE A 1 353 ? -59.955 63.875  -29.558 1.00 84.86 ? 353 PHE A CD2   1 
ATOM   2240 C  CE1   . PHE A 1 353 ? -62.437 62.633  -29.689 1.00 84.86 ? 353 PHE A CE1   1 
ATOM   2241 C  CE2   . PHE A 1 353 ? -60.632 63.532  -28.390 1.00 84.86 ? 353 PHE A CE2   1 
ATOM   2242 C  CZ    . PHE A 1 353 ? -61.872 62.910  -28.451 1.00 84.86 ? 353 PHE A CZ    1 
ATOM   2243 N  N     . ARG A 1 354 ? -58.696 64.872  -34.234 1.00 82.70 ? 354 ARG A N     1 
ATOM   2244 C  CA    . ARG A 1 354 ? -57.507 64.896  -34.991 1.00 81.04 ? 354 ARG A CA    1 
ATOM   2245 C  C     . ARG A 1 354 ? -56.450 64.743  -33.969 1.00 79.59 ? 354 ARG A C     1 
ATOM   2246 O  O     . ARG A 1 354 ? -55.821 65.702  -33.541 1.00 82.05 ? 354 ARG A O     1 
ATOM   2247 C  CB    . ARG A 1 354 ? -57.392 66.267  -35.659 1.00 76.78 ? 354 ARG A CB    1 
ATOM   2248 N  N     . GLU A 1 355 ? -56.294 63.506  -33.540 1.00 76.54 ? 355 GLU A N     1 
ATOM   2249 C  CA    . GLU A 1 355 ? -55.324 63.133  -32.517 1.00 70.90 ? 355 GLU A CA    1 
ATOM   2250 C  C     . GLU A 1 355 ? -53.910 63.608  -32.674 1.00 67.49 ? 355 GLU A C     1 
ATOM   2251 O  O     . GLU A 1 355 ? -53.516 64.102  -33.734 1.00 70.26 ? 355 GLU A O     1 
ATOM   2252 C  CB    . GLU A 1 355 ? -55.253 61.605  -32.387 1.00 71.81 ? 355 GLU A CB    1 
ATOM   2253 C  CG    . GLU A 1 355 ? -56.225 61.001  -31.423 1.00 73.45 ? 355 GLU A CG    1 
ATOM   2254 C  CD    . GLU A 1 355 ? -56.136 61.676  -30.068 1.00 75.68 ? 355 GLU A CD    1 
ATOM   2255 O  OE1   . GLU A 1 355 ? -55.001 61.778  -29.534 1.00 74.84 ? 355 GLU A OE1   1 
ATOM   2256 O  OE2   . GLU A 1 355 ? -57.180 62.164  -29.555 1.00 78.98 ? 355 GLU A OE2   1 
ATOM   2257 N  N     . SER A 1 356 ? -53.173 63.513  -31.568 1.00 62.56 ? 356 SER A N     1 
ATOM   2258 C  CA    . SER A 1 356 ? -51.754 63.817  -31.571 1.00 54.30 ? 356 SER A CA    1 
ATOM   2259 C  C     . SER A 1 356 ? -51.136 62.945  -30.482 1.00 49.23 ? 356 SER A C     1 
ATOM   2260 O  O     . SER A 1 356 ? -51.834 62.261  -29.722 1.00 48.64 ? 356 SER A O     1 
ATOM   2261 C  CB    . SER A 1 356 ? -51.374 65.277  -31.333 1.00 58.79 ? 356 SER A CB    1 
ATOM   2262 O  OG    . SER A 1 356 ? -51.727 65.661  -30.055 1.00 60.56 ? 356 SER A OG    1 
ATOM   2263 N  N     . LYS A 1 357 ? -49.814 62.925  -30.426 1.00 45.65 ? 357 LYS A N     1 
ATOM   2264 C  CA    . LYS A 1 357 ? -49.095 62.116  -29.447 1.00 46.63 ? 357 LYS A CA    1 
ATOM   2265 C  C     . LYS A 1 357 ? -49.436 62.557  -28.023 1.00 45.01 ? 357 LYS A C     1 
ATOM   2266 O  O     . LYS A 1 357 ? -49.844 61.742  -27.190 1.00 47.83 ? 357 LYS A O     1 
ATOM   2267 C  CB    . LYS A 1 357 ? -47.588 62.243  -29.682 1.00 50.80 ? 357 LYS A CB    1 
ATOM   2268 C  CG    . LYS A 1 357 ? -46.849 60.923  -29.669 1.00 55.53 ? 357 LYS A CG    1 
ATOM   2269 C  CD    . LYS A 1 357 ? -47.599 59.873  -30.495 1.00 64.30 ? 357 LYS A CD    1 
ATOM   2270 C  CE    . LYS A 1 357 ? -46.981 58.504  -30.355 1.00 66.03 ? 357 LYS A CE    1 
ATOM   2271 N  NZ    . LYS A 1 357 ? -47.634 57.535  -31.286 1.00 64.81 ? 357 LYS A NZ    1 
ATOM   2272 N  N     . LEU A 1 358 ? -49.280 63.850  -27.761 1.00 47.00 ? 358 LEU A N     1 
ATOM   2273 C  CA    . LEU A 1 358 ? -49.570 64.408  -26.452 1.00 43.85 ? 358 LEU A CA    1 
ATOM   2274 C  C     . LEU A 1 358 ? -50.923 63.973  -25.894 1.00 40.82 ? 358 LEU A C     1 
ATOM   2275 O  O     . LEU A 1 358 ? -51.001 63.454  -24.776 1.00 41.90 ? 358 LEU A O     1 
ATOM   2276 C  CB    . LEU A 1 358 ? -49.515 65.935  -26.517 1.00 46.69 ? 358 LEU A CB    1 
ATOM   2277 C  CG    . LEU A 1 358 ? -49.853 66.700  -25.231 1.00 47.70 ? 358 LEU A CG    1 
ATOM   2278 C  CD1   . LEU A 1 358 ? -48.724 66.539  -24.215 1.00 41.33 ? 358 LEU A CD1   1 
ATOM   2279 C  CD2   . LEU A 1 358 ? -50.073 68.167  -25.554 1.00 47.87 ? 358 LEU A CD2   1 
ATOM   2280 N  N     . THR A 1 359 ? -51.980 64.170  -26.678 1.00 42.77 ? 359 THR A N     1 
ATOM   2281 C  CA    . THR A 1 359 ? -53.327 63.835  -26.238 1.00 45.77 ? 359 THR A CA    1 
ATOM   2282 C  C     . THR A 1 359 ? -53.608 62.352  -26.224 1.00 47.85 ? 359 THR A C     1 
ATOM   2283 O  O     . THR A 1 359 ? -54.573 61.897  -25.614 1.00 52.58 ? 359 THR A O     1 
ATOM   2284 C  CB    . THR A 1 359 ? -54.388 64.551  -27.102 1.00 45.41 ? 359 THR A CB    1 
ATOM   2285 O  OG1   . THR A 1 359 ? -54.142 64.295  -28.493 1.00 47.70 ? 359 THR A OG1   1 
ATOM   2286 C  CG2   . THR A 1 359 ? -54.338 66.046  -26.850 1.00 45.51 ? 359 THR A CG2   1 
ATOM   2287 N  N     . GLN A 1 360 ? -52.758 61.594  -26.898 1.00 52.91 ? 360 GLN A N     1 
ATOM   2288 C  CA    . GLN A 1 360 ? -52.907 60.153  -26.943 1.00 49.27 ? 360 GLN A CA    1 
ATOM   2289 C  C     . GLN A 1 360 ? -52.356 59.601  -25.631 1.00 46.04 ? 360 GLN A C     1 
ATOM   2290 O  O     . GLN A 1 360 ? -52.973 58.761  -24.977 1.00 47.17 ? 360 GLN A O     1 
ATOM   2291 C  CB    . GLN A 1 360 ? -52.114 59.589  -28.129 1.00 54.43 ? 360 GLN A CB    1 
ATOM   2292 C  CG    . GLN A 1 360 ? -52.014 58.075  -28.156 1.00 59.65 ? 360 GLN A CG    1 
ATOM   2293 C  CD    . GLN A 1 360 ? -51.256 57.558  -29.360 1.00 60.67 ? 360 GLN A CD    1 
ATOM   2294 O  OE1   . GLN A 1 360 ? -50.134 57.992  -29.638 1.00 62.24 ? 360 GLN A OE1   1 
ATOM   2295 N  NE2   . GLN A 1 360 ? -51.863 56.618  -30.082 1.00 62.62 ? 360 GLN A NE2   1 
ATOM   2296 N  N     . VAL A 1 361 ? -51.184 60.095  -25.256 1.00 43.70 ? 361 VAL A N     1 
ATOM   2297 C  CA    . VAL A 1 361 ? -50.516 59.674  -24.035 1.00 46.27 ? 361 VAL A CA    1 
ATOM   2298 C  C     . VAL A 1 361 ? -51.284 60.086  -22.778 1.00 46.12 ? 361 VAL A C     1 
ATOM   2299 O  O     . VAL A 1 361 ? -51.307 59.352  -21.792 1.00 51.58 ? 361 VAL A O     1 
ATOM   2300 C  CB    . VAL A 1 361 ? -49.095 60.267  -23.974 1.00 45.35 ? 361 VAL A CB    1 
ATOM   2301 C  CG1   . VAL A 1 361 ? -48.485 60.032  -22.599 1.00 46.60 ? 361 VAL A CG1   1 
ATOM   2302 C  CG2   . VAL A 1 361 ? -48.230 59.635  -25.064 1.00 40.59 ? 361 VAL A CG2   1 
ATOM   2303 N  N     . LEU A 1 362 ? -51.908 61.258  -22.819 1.00 46.94 ? 362 LEU A N     1 
ATOM   2304 C  CA    . LEU A 1 362 ? -52.665 61.759  -21.681 1.00 44.61 ? 362 LEU A CA    1 
ATOM   2305 C  C     . LEU A 1 362 ? -54.160 61.449  -21.792 1.00 46.21 ? 362 LEU A C     1 
ATOM   2306 O  O     . LEU A 1 362 ? -54.957 61.953  -20.993 1.00 42.26 ? 362 LEU A O     1 
ATOM   2307 C  CB    . LEU A 1 362 ? -52.465 63.269  -21.560 1.00 46.66 ? 362 LEU A CB    1 
ATOM   2308 C  CG    . LEU A 1 362 ? -51.039 63.773  -21.322 1.00 47.65 ? 362 LEU A CG    1 
ATOM   2309 C  CD1   . LEU A 1 362 ? -51.026 65.291  -21.345 1.00 50.74 ? 362 LEU A CD1   1 
ATOM   2310 C  CD2   . LEU A 1 362 ? -50.518 63.252  -19.991 1.00 40.49 ? 362 LEU A CD2   1 
ATOM   2311 N  N     . ARG A 1 363 ? -54.529 60.617  -22.770 1.00 45.21 ? 363 ARG A N     1 
ATOM   2312 C  CA    . ARG A 1 363 ? -55.931 60.253  -23.018 1.00 52.17 ? 363 ARG A CA    1 
ATOM   2313 C  C     . ARG A 1 363 ? -56.695 59.830  -21.757 1.00 54.18 ? 363 ARG A C     1 
ATOM   2314 O  O     . ARG A 1 363 ? -57.765 60.377  -21.466 1.00 53.15 ? 363 ARG A O     1 
ATOM   2315 C  CB    . ARG A 1 363 ? -56.011 59.158  -24.124 1.00 54.54 ? 363 ARG A CB    1 
ATOM   2316 C  CG    . ARG A 1 363 ? -57.383 58.441  -24.312 1.00 57.95 ? 363 ARG A CG    1 
ATOM   2317 C  CD    . ARG A 1 363 ? -57.753 58.061  -25.788 1.00 66.81 ? 363 ARG A CD    1 
ATOM   2318 N  NE    . ARG A 1 363 ? -56.639 58.115  -26.741 1.00 72.94 ? 363 ARG A NE    1 
ATOM   2319 C  CZ    . ARG A 1 363 ? -56.770 58.303  -28.055 1.00 77.03 ? 363 ARG A CZ    1 
ATOM   2320 N  NH1   . ARG A 1 363 ? -57.970 58.456  -28.605 1.00 83.46 ? 363 ARG A NH1   1 
ATOM   2321 N  NH2   . ARG A 1 363 ? -55.689 58.364  -28.824 1.00 82.59 ? 363 ARG A NH2   1 
ATOM   2322 N  N     . ASP A 1 364 ? -56.145 58.883  -20.999 1.00 50.24 ? 364 ASP A N     1 
ATOM   2323 C  CA    . ASP A 1 364 ? -56.813 58.402  -19.787 1.00 56.35 ? 364 ASP A CA    1 
ATOM   2324 C  C     . ASP A 1 364 ? -57.044 59.470  -18.714 1.00 58.12 ? 364 ASP A C     1 
ATOM   2325 O  O     . ASP A 1 364 ? -57.796 59.245  -17.767 1.00 61.63 ? 364 ASP A O     1 
ATOM   2326 C  CB    . ASP A 1 364 ? -56.041 57.224  -19.180 1.00 58.91 ? 364 ASP A CB    1 
ATOM   2327 C  CG    . ASP A 1 364 ? -54.616 57.583  -18.820 1.00 66.61 ? 364 ASP A CG    1 
ATOM   2328 O  OD1   . ASP A 1 364 ? -53.863 58.004  -19.724 1.00 71.96 ? 364 ASP A OD1   1 
ATOM   2329 O  OD2   . ASP A 1 364 ? -54.247 57.441  -17.635 1.00 68.47 ? 364 ASP A OD2   1 
ATOM   2330 N  N     . SER A 1 365 ? -56.415 60.631  -18.864 1.00 57.24 ? 365 SER A N     1 
ATOM   2331 C  CA    . SER A 1 365 ? -56.576 61.701  -17.891 1.00 54.14 ? 365 SER A CA    1 
ATOM   2332 C  C     . SER A 1 365 ? -57.674 62.687  -18.261 1.00 53.53 ? 365 SER A C     1 
ATOM   2333 O  O     . SER A 1 365 ? -57.873 63.690  -17.575 1.00 53.23 ? 365 SER A O     1 
ATOM   2334 C  CB    . SER A 1 365 ? -55.257 62.444  -17.707 1.00 53.25 ? 365 SER A CB    1 
ATOM   2335 O  OG    . SER A 1 365 ? -54.312 61.617  -17.058 1.00 55.65 ? 365 SER A OG    1 
ATOM   2336 N  N     . PHE A 1 366 ? -58.388 62.405  -19.344 1.00 56.38 ? 366 PHE A N     1 
ATOM   2337 C  CA    . PHE A 1 366 ? -59.476 63.274  -19.783 1.00 60.46 ? 366 PHE A CA    1 
ATOM   2338 C  C     . PHE A 1 366 ? -60.782 62.490  -19.896 1.00 61.26 ? 366 PHE A C     1 
ATOM   2339 O  O     . PHE A 1 366 ? -61.865 63.072  -19.899 1.00 62.21 ? 366 PHE A O     1 
ATOM   2340 C  CB    . PHE A 1 366 ? -59.157 63.890  -21.152 1.00 59.81 ? 366 PHE A CB    1 
ATOM   2341 C  CG    . PHE A 1 366 ? -57.881 64.676  -21.189 1.00 62.74 ? 366 PHE A CG    1 
ATOM   2342 C  CD1   . PHE A 1 366 ? -57.695 65.767  -20.347 1.00 61.47 ? 366 PHE A CD1   1 
ATOM   2343 C  CD2   . PHE A 1 366 ? -56.867 64.331  -22.077 1.00 60.64 ? 366 PHE A CD2   1 
ATOM   2344 C  CE1   . PHE A 1 366 ? -56.516 66.501  -20.384 1.00 62.88 ? 366 PHE A CE1   1 
ATOM   2345 C  CE2   . PHE A 1 366 ? -55.681 65.058  -22.123 1.00 66.34 ? 366 PHE A CE2   1 
ATOM   2346 C  CZ    . PHE A 1 366 ? -55.506 66.148  -21.276 1.00 66.84 ? 366 PHE A CZ    1 
ATOM   2347 N  N     . ILE A 1 367 ? -60.669 61.169  -19.980 1.00 63.98 ? 367 ILE A N     1 
ATOM   2348 C  CA    . ILE A 1 367 ? -61.831 60.300  -20.138 1.00 68.47 ? 367 ILE A CA    1 
ATOM   2349 C  C     . ILE A 1 367 ? -62.574 59.934  -18.850 1.00 66.33 ? 367 ILE A C     1 
ATOM   2350 O  O     . ILE A 1 367 ? -63.784 59.693  -18.875 1.00 67.00 ? 367 ILE A O     1 
ATOM   2351 C  CB    . ILE A 1 367 ? -61.432 58.991  -20.875 1.00 70.91 ? 367 ILE A CB    1 
ATOM   2352 C  CG1   . ILE A 1 367 ? -62.679 58.166  -21.196 1.00 76.22 ? 367 ILE A CG1   1 
ATOM   2353 C  CG2   . ILE A 1 367 ? -60.474 58.175  -20.019 1.00 73.02 ? 367 ILE A CG2   1 
ATOM   2354 C  CD1   . ILE A 1 367 ? -62.389 56.895  -21.968 1.00 82.85 ? 367 ILE A CD1   1 
ATOM   2355 N  N     . GLY A 1 368 ? -61.861 59.886  -17.729 1.00 66.18 ? 368 GLY A N     1 
ATOM   2356 C  CA    . GLY A 1 368 ? -62.507 59.534  -16.474 1.00 67.33 ? 368 GLY A CA    1 
ATOM   2357 C  C     . GLY A 1 368 ? -63.438 60.617  -15.955 1.00 69.08 ? 368 GLY A C     1 
ATOM   2358 O  O     . GLY A 1 368 ? -63.322 61.783  -16.338 1.00 69.40 ? 368 GLY A O     1 
ATOM   2359 N  N     . GLU A 1 369 ? -64.367 60.238  -15.082 1.00 69.90 ? 369 GLU A N     1 
ATOM   2360 C  CA    . GLU A 1 369 ? -65.303 61.204  -14.511 1.00 70.43 ? 369 GLU A CA    1 
ATOM   2361 C  C     . GLU A 1 369 ? -64.674 61.901  -13.305 1.00 68.49 ? 369 GLU A C     1 
ATOM   2362 O  O     . GLU A 1 369 ? -65.067 63.007  -12.936 1.00 69.86 ? 369 GLU A O     1 
ATOM   2363 C  CB    . GLU A 1 369 ? -66.600 60.507  -14.105 1.00 72.55 ? 369 GLU A CB    1 
ATOM   2364 C  CG    . GLU A 1 369 ? -67.281 59.788  -15.260 1.00 80.35 ? 369 GLU A CG    1 
ATOM   2365 C  CD    . GLU A 1 369 ? -68.613 59.173  -14.874 1.00 84.86 ? 369 GLU A CD    1 
ATOM   2366 O  OE1   . GLU A 1 369 ? -69.537 59.927  -14.494 1.00 84.86 ? 369 GLU A OE1   1 
ATOM   2367 O  OE2   . GLU A 1 369 ? -68.735 57.933  -14.954 1.00 84.86 ? 369 GLU A OE2   1 
ATOM   2368 N  N     . ASN A 1 370 ? -63.690 61.243  -12.699 1.00 65.43 ? 370 ASN A N     1 
ATOM   2369 C  CA    . ASN A 1 370 ? -62.983 61.797  -11.551 1.00 60.22 ? 370 ASN A CA    1 
ATOM   2370 C  C     . ASN A 1 370 ? -61.649 62.343  -12.043 1.00 57.44 ? 370 ASN A C     1 
ATOM   2371 O  O     . ASN A 1 370 ? -60.585 61.860  -11.657 1.00 60.13 ? 370 ASN A O     1 
ATOM   2372 C  CB    . ASN A 1 370 ? -62.745 60.711  -10.496 1.00 59.51 ? 370 ASN A CB    1 
ATOM   2373 C  CG    . ASN A 1 370 ? -62.048 61.240  -9.245  1.00 62.06 ? 370 ASN A CG    1 
ATOM   2374 O  OD1   . ASN A 1 370 ? -61.669 60.467  -8.363  1.00 65.78 ? 370 ASN A OD1   1 
ATOM   2375 N  ND2   . ASN A 1 370 ? -61.882 62.557  -9.163  1.00 60.49 ? 370 ASN A ND2   1 
ATOM   2376 N  N     . SER A 1 371 ? -61.712 63.349  -12.906 1.00 52.88 ? 371 SER A N     1 
ATOM   2377 C  CA    . SER A 1 371 ? -60.505 63.955  -13.453 1.00 49.92 ? 371 SER A CA    1 
ATOM   2378 C  C     . SER A 1 371 ? -60.633 65.469  -13.488 1.00 49.29 ? 371 SER A C     1 
ATOM   2379 O  O     . SER A 1 371 ? -61.685 66.004  -13.831 1.00 49.41 ? 371 SER A O     1 
ATOM   2380 C  CB    . SER A 1 371 ? -60.234 63.415  -14.863 1.00 51.63 ? 371 SER A CB    1 
ATOM   2381 O  OG    . SER A 1 371 ? -61.349 63.608  -15.720 1.00 56.90 ? 371 SER A OG    1 
ATOM   2382 N  N     . ARG A 1 372 ? -59.557 66.153  -13.113 1.00 46.95 ? 372 ARG A N     1 
ATOM   2383 C  CA    . ARG A 1 372 ? -59.529 67.610  -13.096 1.00 44.99 ? 372 ARG A CA    1 
ATOM   2384 C  C     . ARG A 1 372 ? -58.313 68.132  -13.844 1.00 44.35 ? 372 ARG A C     1 
ATOM   2385 O  O     . ARG A 1 372 ? -57.292 67.455  -13.948 1.00 41.05 ? 372 ARG A O     1 
ATOM   2386 C  CB    . ARG A 1 372 ? -59.483 68.135  -11.655 1.00 40.77 ? 372 ARG A CB    1 
ATOM   2387 C  CG    . ARG A 1 372 ? -60.787 67.992  -10.896 1.00 56.45 ? 372 ARG A CG    1 
ATOM   2388 C  CD    . ARG A 1 372 ? -60.676 68.544  -9.480  1.00 58.99 ? 372 ARG A CD    1 
ATOM   2389 N  NE    . ARG A 1 372 ? -60.288 69.951  -9.454  1.00 62.62 ? 372 ARG A NE    1 
ATOM   2390 C  CZ    . ARG A 1 372 ? -60.225 70.687  -8.348  1.00 61.85 ? 372 ARG A CZ    1 
ATOM   2391 N  NH1   . ARG A 1 372 ? -60.524 70.147  -7.175  1.00 68.58 ? 372 ARG A NH1   1 
ATOM   2392 N  NH2   . ARG A 1 372 ? -59.870 71.962  -8.412  1.00 60.43 ? 372 ARG A NH2   1 
ATOM   2393 N  N     . THR A 1 373 ? -58.414 69.353  -14.347 1.00 36.80 ? 373 THR A N     1 
ATOM   2394 C  CA    . THR A 1 373 ? -57.306 69.936  -15.075 1.00 39.94 ? 373 THR A CA    1 
ATOM   2395 C  C     . THR A 1 373 ? -57.207 71.417  -14.785 1.00 42.53 ? 373 THR A C     1 
ATOM   2396 O  O     . THR A 1 373 ? -58.192 72.059  -14.439 1.00 36.54 ? 373 THR A O     1 
ATOM   2397 C  CB    . THR A 1 373 ? -57.466 69.737  -16.622 1.00 38.22 ? 373 THR A CB    1 
ATOM   2398 O  OG1   . THR A 1 373 ? -56.334 70.301  -17.300 1.00 44.16 ? 373 THR A OG1   1 
ATOM   2399 C  CG2   . THR A 1 373 ? -58.728 70.434  -17.125 1.00 45.85 ? 373 THR A CG2   1 
ATOM   2400 N  N     . CYS A 1 374 ? -56.003 71.952  -14.907 1.00 37.03 ? 374 CYS A N     1 
ATOM   2401 C  CA    . CYS A 1 374 ? -55.794 73.375  -14.707 1.00 39.77 ? 374 CYS A CA    1 
ATOM   2402 C  C     . CYS A 1 374 ? -54.900 73.833  -15.850 1.00 37.29 ? 374 CYS A C     1 
ATOM   2403 O  O     . CYS A 1 374 ? -53.926 73.178  -16.186 1.00 37.19 ? 374 CYS A O     1 
ATOM   2404 C  CB    . CYS A 1 374 ? -55.106 73.674  -13.362 1.00 37.16 ? 374 CYS A CB    1 
ATOM   2405 S  SG    . CYS A 1 374 ? -54.668 75.435  -13.163 1.00 38.87 ? 374 CYS A SG    1 
ATOM   2406 N  N     . MET A 1 375 ? -55.238 74.965  -16.438 1.00 35.65 ? 375 MET A N     1 
ATOM   2407 C  CA    . MET A 1 375 ? -54.461 75.506  -17.539 1.00 36.51 ? 375 MET A CA    1 
ATOM   2408 C  C     . MET A 1 375 ? -53.905 76.831  -17.098 1.00 37.26 ? 375 MET A C     1 
ATOM   2409 O  O     . MET A 1 375 ? -54.658 77.680  -16.638 1.00 37.24 ? 375 MET A O     1 
ATOM   2410 C  CB    . MET A 1 375 ? -55.374 75.708  -18.761 1.00 41.80 ? 375 MET A CB    1 
ATOM   2411 C  CG    . MET A 1 375 ? -54.874 76.714  -19.809 1.00 57.11 ? 375 MET A CG    1 
ATOM   2412 S  SD    . MET A 1 375 ? -53.881 75.978  -21.128 1.00 65.85 ? 375 MET A SD    1 
ATOM   2413 C  CE    . MET A 1 375 ? -55.122 75.065  -22.010 1.00 63.43 ? 375 MET A CE    1 
ATOM   2414 N  N     . ILE A 1 376 ? -52.590 77.008  -17.211 1.00 34.27 ? 376 ILE A N     1 
ATOM   2415 C  CA    . ILE A 1 376 ? -51.983 78.288  -16.858 1.00 33.35 ? 376 ILE A CA    1 
ATOM   2416 C  C     . ILE A 1 376 ? -51.423 78.924  -18.132 1.00 32.68 ? 376 ILE A C     1 
ATOM   2417 O  O     . ILE A 1 376 ? -50.510 78.394  -18.752 1.00 31.38 ? 376 ILE A O     1 
ATOM   2418 C  CB    . ILE A 1 376 ? -50.792 78.150  -15.865 1.00 30.48 ? 376 ILE A CB    1 
ATOM   2419 C  CG1   . ILE A 1 376 ? -51.175 77.301  -14.651 1.00 31.47 ? 376 ILE A CG1   1 
ATOM   2420 C  CG2   . ILE A 1 376 ? -50.374 79.531  -15.398 1.00 30.34 ? 376 ILE A CG2   1 
ATOM   2421 C  CD1   . ILE A 1 376 ? -49.950 76.926  -13.786 1.00 24.71 ? 376 ILE A CD1   1 
ATOM   2422 N  N     . ALA A 1 377 ? -51.964 80.070  -18.500 1.00 29.65 ? 377 ALA A N     1 
ATOM   2423 C  CA    . ALA A 1 377 ? -51.534 80.794  -19.679 1.00 28.17 ? 377 ALA A CA    1 
ATOM   2424 C  C     . ALA A 1 377 ? -50.458 81.799  -19.312 1.00 30.08 ? 377 ALA A C     1 
ATOM   2425 O  O     . ALA A 1 377 ? -50.722 82.732  -18.556 1.00 32.04 ? 377 ALA A O     1 
ATOM   2426 C  CB    . ALA A 1 377 ? -52.732 81.517  -20.300 1.00 27.03 ? 377 ALA A CB    1 
ATOM   2427 N  N     . MET A 1 378 ? -49.253 81.624  -19.868 1.00 24.51 ? 378 MET A N     1 
ATOM   2428 C  CA    . MET A 1 378 ? -48.128 82.522  -19.602 1.00 27.51 ? 378 MET A CA    1 
ATOM   2429 C  C     . MET A 1 378 ? -48.116 83.647  -20.625 1.00 23.47 ? 378 MET A C     1 
ATOM   2430 O  O     . MET A 1 378 ? -48.317 83.400  -21.796 1.00 27.18 ? 378 MET A O     1 
ATOM   2431 C  CB    . MET A 1 378 ? -46.805 81.756  -19.697 1.00 27.90 ? 378 MET A CB    1 
ATOM   2432 C  CG    . MET A 1 378 ? -46.766 80.455  -18.916 1.00 37.53 ? 378 MET A CG    1 
ATOM   2433 S  SD    . MET A 1 378 ? -47.001 80.656  -17.108 1.00 47.93 ? 378 MET A SD    1 
ATOM   2434 C  CE    . MET A 1 378 ? -47.289 78.961  -16.680 1.00 33.13 ? 378 MET A CE    1 
ATOM   2435 N  N     . ILE A 1 379 ? -47.836 84.868  -20.187 1.00 25.39 ? 379 ILE A N     1 
ATOM   2436 C  CA    . ILE A 1 379 ? -47.835 86.025  -21.059 1.00 28.86 ? 379 ILE A CA    1 
ATOM   2437 C  C     . ILE A 1 379 ? -46.577 86.870  -20.909 1.00 29.83 ? 379 ILE A C     1 
ATOM   2438 O  O     . ILE A 1 379 ? -46.182 87.197  -19.778 1.00 29.12 ? 379 ILE A O     1 
ATOM   2439 C  CB    . ILE A 1 379 ? -49.042 86.959  -20.743 1.00 36.54 ? 379 ILE A CB    1 
ATOM   2440 C  CG1   . ILE A 1 379 ? -50.362 86.181  -20.780 1.00 29.29 ? 379 ILE A CG1   1 
ATOM   2441 C  CG2   . ILE A 1 379 ? -49.073 88.113  -21.719 1.00 36.24 ? 379 ILE A CG2   1 
ATOM   2442 C  CD1   . ILE A 1 379 ? -50.723 85.588  -22.124 1.00 35.20 ? 379 ILE A CD1   1 
ATOM   2443 N  N     . SER A 1 380 ? -45.950 87.231  -22.041 1.00 31.52 ? 380 SER A N     1 
ATOM   2444 C  CA    . SER A 1 380 ? -44.835 88.101  -22.012 1.00 35.72 ? 380 SER A CA    1 
ATOM   2445 C  C     . SER A 1 380 ? -45.414 89.454  -22.209 1.00 30.38 ? 380 SER A C     1 
ATOM   2446 O  O     . SER A 1 380 ? -46.100 89.727  -23.186 1.00 35.49 ? 380 SER A O     1 
ATOM   2447 C  CB    . SER A 1 380 ? -43.921 87.747  -23.186 1.00 30.72 ? 380 SER A CB    1 
ATOM   2448 O  OG    . SER A 1 380 ? -43.490 86.392  -23.056 1.00 34.26 ? 380 SER A OG    1 
ATOM   2449 N  N     . PRO A 1 381 ? -45.190 90.365  -21.259 1.00 33.27 ? 381 PRO A N     1 
ATOM   2450 C  CA    . PRO A 1 381 ? -45.744 91.742  -21.142 1.00 31.45 ? 381 PRO A CA    1 
ATOM   2451 C  C     . PRO A 1 381 ? -45.311 92.758  -22.251 1.00 35.61 ? 381 PRO A C     1 
ATOM   2452 O  O     . PRO A 1 381 ? -45.845 93.853  -22.370 1.00 33.59 ? 381 PRO A O     1 
ATOM   2453 C  CB    . PRO A 1 381 ? -45.335 92.271  -19.775 1.00 34.12 ? 381 PRO A CB    1 
ATOM   2454 C  CG    . PRO A 1 381 ? -44.075 91.523  -19.355 1.00 32.49 ? 381 PRO A CG    1 
ATOM   2455 C  CD    . PRO A 1 381 ? -44.128 90.208  -20.273 1.00 29.94 ? 381 PRO A CD    1 
ATOM   2456 N  N     . GLY A 1 382 ? -44.286 92.450  -23.039 1.00 37.48 ? 382 GLY A N     1 
ATOM   2457 C  CA    . GLY A 1 382 ? -43.793 93.414  -24.018 1.00 33.61 ? 382 GLY A CA    1 
ATOM   2458 C  C     . GLY A 1 382 ? -44.696 93.801  -25.181 1.00 33.97 ? 382 GLY A C     1 
ATOM   2459 O  O     . GLY A 1 382 ? -45.429 92.985  -25.715 1.00 28.00 ? 382 GLY A O     1 
ATOM   2460 N  N     . ILE A 1 383 ? -44.639 95.066  -25.566 1.00 32.51 ? 383 ILE A N     1 
ATOM   2461 C  CA    . ILE A 1 383 ? -45.427 95.558  -26.691 1.00 33.33 ? 383 ILE A CA    1 
ATOM   2462 C  C     . ILE A 1 383 ? -45.160 94.735  -27.958 1.00 35.64 ? 383 ILE A C     1 
ATOM   2463 O  O     . ILE A 1 383 ? -46.078 94.440  -28.716 1.00 35.22 ? 383 ILE A O     1 
ATOM   2464 C  CB    . ILE A 1 383 ? -45.118 97.032  -26.990 1.00 40.56 ? 383 ILE A CB    1 
ATOM   2465 C  CG1   . ILE A 1 383 ? -45.974 97.504  -28.175 1.00 38.80 ? 383 ILE A CG1   1 
ATOM   2466 C  CG2   . ILE A 1 383 ? -43.632 97.205  -27.278 1.00 36.52 ? 383 ILE A CG2   1 
ATOM   2467 C  CD1   . ILE A 1 383 ? -46.058 99.008  -28.318 1.00 33.03 ? 383 ILE A CD1   1 
ATOM   2468 N  N     . SER A 1 384 ? -43.911 94.337  -28.166 1.00 32.39 ? 384 SER A N     1 
ATOM   2469 C  CA    . SER A 1 384 ? -43.558 93.547  -29.334 1.00 36.71 ? 384 SER A CA    1 
ATOM   2470 C  C     . SER A 1 384 ? -44.198 92.172  -29.350 1.00 34.40 ? 384 SER A C     1 
ATOM   2471 O  O     . SER A 1 384 ? -44.244 91.517  -30.398 1.00 35.12 ? 384 SER A O     1 
ATOM   2472 C  CB    . SER A 1 384 ? -42.039 93.394  -29.424 1.00 36.99 ? 384 SER A CB    1 
ATOM   2473 O  OG    . SER A 1 384 ? -41.424 94.658  -29.599 1.00 51.63 ? 384 SER A OG    1 
ATOM   2474 N  N     . SER A 1 385 ? -44.681 91.708  -28.198 1.00 33.50 ? 385 SER A N     1 
ATOM   2475 C  CA    . SER A 1 385 ? -45.311 90.381  -28.138 1.00 37.16 ? 385 SER A CA    1 
ATOM   2476 C  C     . SER A 1 385 ? -46.841 90.452  -28.054 1.00 29.82 ? 385 SER A C     1 
ATOM   2477 O  O     . SER A 1 385 ? -47.509 89.454  -27.824 1.00 29.84 ? 385 SER A O     1 
ATOM   2478 C  CB    . SER A 1 385 ? -44.769 89.601  -26.940 1.00 37.68 ? 385 SER A CB    1 
ATOM   2479 O  OG    . SER A 1 385 ? -43.352 89.669  -26.885 1.00 50.55 ? 385 SER A OG    1 
ATOM   2480 N  N     . CYS A 1 386 ? -47.397 91.632  -28.263 1.00 31.72 ? 386 CYS A N     1 
ATOM   2481 C  CA    . CYS A 1 386 ? -48.845 91.807  -28.175 1.00 30.99 ? 386 CYS A CA    1 
ATOM   2482 C  C     . CYS A 1 386 ? -49.702 90.846  -29.018 1.00 30.81 ? 386 CYS A C     1 
ATOM   2483 O  O     . CYS A 1 386 ? -50.760 90.388  -28.567 1.00 36.01 ? 386 CYS A O     1 
ATOM   2484 C  CB    . CYS A 1 386 ? -49.203 93.253  -28.506 1.00 36.99 ? 386 CYS A CB    1 
ATOM   2485 S  SG    . CYS A 1 386 ? -50.861 93.729  -27.958 1.00 42.40 ? 386 CYS A SG    1 
ATOM   2486 N  N     . GLU A 1 387 ? -49.258 90.501  -30.225 1.00 31.27 ? 387 GLU A N     1 
ATOM   2487 C  CA    . GLU A 1 387 ? -50.047 89.600  -31.059 1.00 34.94 ? 387 GLU A CA    1 
ATOM   2488 C  C     . GLU A 1 387 ? -49.935 88.177  -30.542 1.00 31.27 ? 387 GLU A C     1 
ATOM   2489 O  O     . GLU A 1 387 ? -50.849 87.361  -30.680 1.00 31.25 ? 387 GLU A O     1 
ATOM   2490 C  CB    . GLU A 1 387 ? -49.587 89.696  -32.527 1.00 35.05 ? 387 GLU A CB    1 
ATOM   2491 C  CG    . GLU A 1 387 ? -48.134 89.302  -32.763 1.00 55.67 ? 387 GLU A CG    1 
ATOM   2492 C  CD    . GLU A 1 387 ? -47.151 90.188  -32.012 1.00 60.22 ? 387 GLU A CD    1 
ATOM   2493 O  OE1   . GLU A 1 387 ? -47.149 91.419  -32.242 1.00 64.52 ? 387 GLU A OE1   1 
ATOM   2494 O  OE2   . GLU A 1 387 ? -46.378 89.650  -31.191 1.00 64.26 ? 387 GLU A OE2   1 
ATOM   2495 N  N     . TYR A 1 388 ? -48.805 87.858  -29.936 1.00 29.16 ? 388 TYR A N     1 
ATOM   2496 C  CA    . TYR A 1 388 ? -48.638 86.520  -29.400 1.00 30.54 ? 388 TYR A CA    1 
ATOM   2497 C  C     . TYR A 1 388 ? -49.500 86.346  -28.142 1.00 27.56 ? 388 TYR A C     1 
ATOM   2498 O  O     . TYR A 1 388 ? -50.036 85.275  -27.880 1.00 27.36 ? 388 TYR A O     1 
ATOM   2499 C  CB    . TYR A 1 388 ? -47.171 86.271  -29.074 1.00 34.46 ? 388 TYR A CB    1 
ATOM   2500 C  CG    . TYR A 1 388 ? -46.283 86.224  -30.297 1.00 42.99 ? 388 TYR A CG    1 
ATOM   2501 C  CD1   . TYR A 1 388 ? -46.668 85.504  -31.428 1.00 45.39 ? 388 TYR A CD1   1 
ATOM   2502 C  CD2   . TYR A 1 388 ? -45.058 86.887  -30.325 1.00 50.43 ? 388 TYR A CD2   1 
ATOM   2503 C  CE1   . TYR A 1 388 ? -45.862 85.444  -32.557 1.00 48.53 ? 388 TYR A CE1   1 
ATOM   2504 C  CE2   . TYR A 1 388 ? -44.237 86.833  -31.459 1.00 55.11 ? 388 TYR A CE2   1 
ATOM   2505 C  CZ    . TYR A 1 388 ? -44.652 86.109  -32.567 1.00 52.64 ? 388 TYR A CZ    1 
ATOM   2506 O  OH    . TYR A 1 388 ? -43.863 86.048  -33.685 1.00 61.55 ? 388 TYR A OH    1 
ATOM   2507 N  N     . THR A 1 389 ? -49.604 87.422  -27.379 1.00 25.42 ? 389 THR A N     1 
ATOM   2508 C  CA    . THR A 1 389 ? -50.381 87.489  -26.155 1.00 27.91 ? 389 THR A CA    1 
ATOM   2509 C  C     . THR A 1 389 ? -51.866 87.288  -26.447 1.00 25.64 ? 389 THR A C     1 
ATOM   2510 O  O     . THR A 1 389 ? -52.513 86.422  -25.860 1.00 28.31 ? 389 THR A O     1 
ATOM   2511 C  CB    . THR A 1 389 ? -50.132 88.862  -25.480 1.00 31.24 ? 389 THR A CB    1 
ATOM   2512 O  OG1   . THR A 1 389 ? -48.776 88.897  -25.008 1.00 25.69 ? 389 THR A OG1   1 
ATOM   2513 C  CG2   . THR A 1 389 ? -51.109 89.116  -24.317 1.00 30.47 ? 389 THR A CG2   1 
ATOM   2514 N  N     . LEU A 1 390 ? -52.399 88.077  -27.375 1.00 27.25 ? 390 LEU A N     1 
ATOM   2515 C  CA    . LEU A 1 390 ? -53.810 87.978  -27.755 1.00 31.00 ? 390 LEU A CA    1 
ATOM   2516 C  C     . LEU A 1 390 ? -54.132 86.565  -28.205 1.00 30.31 ? 390 LEU A C     1 
ATOM   2517 O  O     . LEU A 1 390 ? -55.187 86.018  -27.856 1.00 31.36 ? 390 LEU A O     1 
ATOM   2518 C  CB    . LEU A 1 390 ? -54.129 89.010  -28.848 1.00 24.94 ? 390 LEU A CB    1 
ATOM   2519 C  CG    . LEU A 1 390 ? -54.843 90.323  -28.498 1.00 42.26 ? 390 LEU A CG    1 
ATOM   2520 C  CD1   . LEU A 1 390 ? -55.033 90.495  -26.983 1.00 31.81 ? 390 LEU A CD1   1 
ATOM   2521 C  CD2   . LEU A 1 390 ? -54.057 91.475  -29.097 1.00 21.18 ? 390 LEU A CD2   1 
ATOM   2522 N  N     . ASN A 1 391 ? -53.213 85.951  -28.948 1.00 32.31 ? 391 ASN A N     1 
ATOM   2523 C  CA    . ASN A 1 391 ? -53.383 84.573  -29.406 1.00 28.34 ? 391 ASN A CA    1 
ATOM   2524 C  C     . ASN A 1 391 ? -53.465 83.629  -28.199 1.00 26.85 ? 391 ASN A C     1 
ATOM   2525 O  O     . ASN A 1 391 ? -54.275 82.694  -28.157 1.00 21.16 ? 391 ASN A O     1 
ATOM   2526 C  CB    . ASN A 1 391 ? -52.187 84.160  -30.289 1.00 28.86 ? 391 ASN A CB    1 
ATOM   2527 C  CG    . ASN A 1 391 ? -52.213 82.693  -30.679 1.00 29.95 ? 391 ASN A CG    1 
ATOM   2528 O  OD1   . ASN A 1 391 ? -51.219 81.977  -30.533 1.00 31.76 ? 391 ASN A OD1   1 
ATOM   2529 N  ND2   . ASN A 1 391 ? -53.343 82.235  -31.176 1.00 22.53 ? 391 ASN A ND2   1 
ATOM   2530 N  N     . THR A 1 392 ? -52.577 83.836  -27.233 1.00 27.33 ? 392 THR A N     1 
ATOM   2531 C  CA    . THR A 1 392 ? -52.585 82.991  -26.032 1.00 31.20 ? 392 THR A CA    1 
ATOM   2532 C  C     . THR A 1 392 ? -53.880 83.171  -25.229 1.00 29.63 ? 392 THR A C     1 
ATOM   2533 O  O     . THR A 1 392 ? -54.503 82.213  -24.820 1.00 35.37 ? 392 THR A O     1 
ATOM   2534 C  CB    . THR A 1 392 ? -51.405 83.332  -25.111 1.00 29.57 ? 392 THR A CB    1 
ATOM   2535 O  OG1   . THR A 1 392 ? -50.177 83.030  -25.785 1.00 34.91 ? 392 THR A OG1   1 
ATOM   2536 C  CG2   . THR A 1 392 ? -51.499 82.513  -23.822 1.00 28.02 ? 392 THR A CG2   1 
ATOM   2537 N  N     . LEU A 1 393 ? -54.276 84.416  -25.029 1.00 28.91 ? 393 LEU A N     1 
ATOM   2538 C  CA    . LEU A 1 393 ? -55.485 84.728  -24.289 1.00 29.08 ? 393 LEU A CA    1 
ATOM   2539 C  C     . LEU A 1 393 ? -56.755 84.182  -24.921 1.00 33.55 ? 393 LEU A C     1 
ATOM   2540 O  O     . LEU A 1 393 ? -57.628 83.650  -24.213 1.00 33.96 ? 393 LEU A O     1 
ATOM   2541 C  CB    . LEU A 1 393 ? -55.595 86.241  -24.122 1.00 27.11 ? 393 LEU A CB    1 
ATOM   2542 C  CG    . LEU A 1 393 ? -54.527 86.860  -23.211 1.00 28.49 ? 393 LEU A CG    1 
ATOM   2543 C  CD1   . LEU A 1 393 ? -54.605 88.356  -23.290 1.00 23.19 ? 393 LEU A CD1   1 
ATOM   2544 C  CD2   . LEU A 1 393 ? -54.723 86.372  -21.756 1.00 27.92 ? 393 LEU A CD2   1 
ATOM   2545 N  N     . ARG A 1 394 ? -56.876 84.295  -26.247 1.00 29.85 ? 394 ARG A N     1 
ATOM   2546 C  CA    . ARG A 1 394 ? -58.081 83.796  -26.913 1.00 33.20 ? 394 ARG A CA    1 
ATOM   2547 C  C     . ARG A 1 394 ? -58.159 82.301  -26.893 1.00 28.67 ? 394 ARG A C     1 
ATOM   2548 O  O     . ARG A 1 394 ? -59.248 81.740  -26.856 1.00 32.82 ? 394 ARG A O     1 
ATOM   2549 C  CB    . ARG A 1 394 ? -58.182 84.331  -28.342 1.00 34.75 ? 394 ARG A CB    1 
ATOM   2550 C  CG    . ARG A 1 394 ? -58.578 85.800  -28.384 1.00 44.08 ? 394 ARG A CG    1 
ATOM   2551 C  CD    . ARG A 1 394 ? -59.978 86.038  -27.801 1.00 37.46 ? 394 ARG A CD    1 
ATOM   2552 N  NE    . ARG A 1 394 ? -60.408 87.433  -27.957 1.00 39.21 ? 394 ARG A NE    1 
ATOM   2553 C  CZ    . ARG A 1 394 ? -61.625 87.890  -27.659 1.00 41.48 ? 394 ARG A CZ    1 
ATOM   2554 N  NH1   . ARG A 1 394 ? -62.550 87.071  -27.180 1.00 44.19 ? 394 ARG A NH1   1 
ATOM   2555 N  NH2   . ARG A 1 394 ? -61.930 89.168  -27.857 1.00 40.73 ? 394 ARG A NH2   1 
ATOM   2556 N  N     . TYR A 1 395 ? -57.014 81.638  -26.905 1.00 31.72 ? 395 TYR A N     1 
ATOM   2557 C  CA    . TYR A 1 395 ? -57.007 80.180  -26.826 1.00 35.50 ? 395 TYR A CA    1 
ATOM   2558 C  C     . TYR A 1 395 ? -57.525 79.809  -25.421 1.00 37.06 ? 395 TYR A C     1 
ATOM   2559 O  O     . TYR A 1 395 ? -58.297 78.863  -25.238 1.00 36.66 ? 395 TYR A O     1 
ATOM   2560 C  CB    . TYR A 1 395 ? -55.575 79.670  -26.977 1.00 35.25 ? 395 TYR A CB    1 
ATOM   2561 C  CG    . TYR A 1 395 ? -55.401 78.183  -26.734 1.00 34.55 ? 395 TYR A CG    1 
ATOM   2562 C  CD1   . TYR A 1 395 ? -55.513 77.267  -27.782 1.00 33.79 ? 395 TYR A CD1   1 
ATOM   2563 C  CD2   . TYR A 1 395 ? -55.110 77.688  -25.449 1.00 28.93 ? 395 TYR A CD2   1 
ATOM   2564 C  CE1   . TYR A 1 395 ? -55.336 75.895  -27.563 1.00 36.88 ? 395 TYR A CE1   1 
ATOM   2565 C  CE2   . TYR A 1 395 ? -54.936 76.316  -25.223 1.00 29.43 ? 395 TYR A CE2   1 
ATOM   2566 C  CZ    . TYR A 1 395 ? -55.045 75.430  -26.281 1.00 39.10 ? 395 TYR A CZ    1 
ATOM   2567 O  OH    . TYR A 1 395 ? -54.834 74.085  -26.071 1.00 40.14 ? 395 TYR A OH    1 
ATOM   2568 N  N     . ALA A 1 396 ? -57.054 80.567  -24.433 1.00 39.69 ? 396 ALA A N     1 
ATOM   2569 C  CA    . ALA A 1 396 ? -57.404 80.368  -23.033 1.00 38.64 ? 396 ALA A CA    1 
ATOM   2570 C  C     . ALA A 1 396 ? -58.899 80.568  -22.817 1.00 44.67 ? 396 ALA A C     1 
ATOM   2571 O  O     . ALA A 1 396 ? -59.531 79.813  -22.081 1.00 39.45 ? 396 ALA A O     1 
ATOM   2572 C  CB    . ALA A 1 396 ? -56.604 81.342  -22.167 1.00 37.26 ? 396 ALA A CB    1 
ATOM   2573 N  N     . ASP A 1 397 ? -59.456 81.587  -23.468 1.00 43.08 ? 397 ASP A N     1 
ATOM   2574 C  CA    . ASP A 1 397 ? -60.877 81.883  -23.363 1.00 46.11 ? 397 ASP A CA    1 
ATOM   2575 C  C     . ASP A 1 397 ? -61.712 80.701  -23.785 1.00 47.86 ? 397 ASP A C     1 
ATOM   2576 O  O     . ASP A 1 397 ? -62.704 80.359  -23.142 1.00 52.25 ? 397 ASP A O     1 
ATOM   2577 C  CB    . ASP A 1 397 ? -61.271 83.040  -24.270 1.00 49.56 ? 397 ASP A CB    1 
ATOM   2578 C  CG    . ASP A 1 397 ? -60.858 84.369  -23.728 1.00 49.95 ? 397 ASP A CG    1 
ATOM   2579 O  OD1   . ASP A 1 397 ? -61.197 85.388  -24.365 1.00 61.25 ? 397 ASP A OD1   1 
ATOM   2580 O  OD2   . ASP A 1 397 ? -60.191 84.400  -22.673 1.00 57.27 ? 397 ASP A OD2   1 
ATOM   2581 N  N     . ARG A 1 398 ? -61.320 80.081  -24.884 1.00 44.51 ? 398 ARG A N     1 
ATOM   2582 C  CA    . ARG A 1 398 ? -62.092 78.967  -25.391 1.00 51.33 ? 398 ARG A CA    1 
ATOM   2583 C  C     . ARG A 1 398 ? -61.999 77.734  -24.509 1.00 50.15 ? 398 ARG A C     1 
ATOM   2584 O  O     . ARG A 1 398 ? -62.907 76.897  -24.490 1.00 51.77 ? 398 ARG A O     1 
ATOM   2585 C  CB    . ARG A 1 398 ? -61.642 78.631  -26.809 1.00 54.97 ? 398 ARG A CB    1 
ATOM   2586 C  CG    . ARG A 1 398 ? -62.586 77.703  -27.529 1.00 68.73 ? 398 ARG A CG    1 
ATOM   2587 C  CD    . ARG A 1 398 ? -63.304 78.410  -28.667 1.00 77.15 ? 398 ARG A CD    1 
ATOM   2588 N  NE    . ARG A 1 398 ? -63.993 77.435  -29.505 1.00 80.73 ? 398 ARG A NE    1 
ATOM   2589 C  CZ    . ARG A 1 398 ? -63.389 76.671  -30.410 1.00 84.47 ? 398 ARG A CZ    1 
ATOM   2590 N  NH1   . ARG A 1 398 ? -62.080 76.776  -30.609 1.00 84.86 ? 398 ARG A NH1   1 
ATOM   2591 N  NH2   . ARG A 1 398 ? -64.091 75.781  -31.098 1.00 84.86 ? 398 ARG A NH2   1 
ATOM   2592 N  N     . VAL A 1 399 ? -60.896 77.622  -23.780 1.00 49.42 ? 399 VAL A N     1 
ATOM   2593 C  CA    . VAL A 1 399 ? -60.679 76.483  -22.899 1.00 51.91 ? 399 VAL A CA    1 
ATOM   2594 C  C     . VAL A 1 399 ? -61.585 76.590  -21.678 1.00 51.69 ? 399 VAL A C     1 
ATOM   2595 O  O     . VAL A 1 399 ? -62.294 75.645  -21.336 1.00 55.26 ? 399 VAL A O     1 
ATOM   2596 C  CB    . VAL A 1 399 ? -59.210 76.420  -22.445 1.00 55.74 ? 399 VAL A CB    1 
ATOM   2597 C  CG1   . VAL A 1 399 ? -59.027 75.361  -21.373 1.00 50.85 ? 399 VAL A CG1   1 
ATOM   2598 C  CG2   . VAL A 1 399 ? -58.319 76.105  -23.639 1.00 54.77 ? 399 VAL A CG2   1 
ATOM   2599 N  N     . LYS A 1 400 ? -61.559 77.750  -21.032 1.00 53.20 ? 400 LYS A N     1 
ATOM   2600 C  CA    . LYS A 1 400 ? -62.380 77.984  -19.856 1.00 62.35 ? 400 LYS A CA    1 
ATOM   2601 C  C     . LYS A 1 400 ? -63.843 78.060  -20.275 1.00 65.06 ? 400 LYS A C     1 
ATOM   2602 O  O     . LYS A 1 400 ? -64.745 77.907  -19.452 1.00 63.26 ? 400 LYS A O     1 
ATOM   2603 C  CB    . LYS A 1 400 ? -62.002 79.303  -19.189 1.00 63.07 ? 400 LYS A CB    1 
ATOM   2604 C  CG    . LYS A 1 400 ? -62.547 80.513  -19.915 1.00 63.56 ? 400 LYS A CG    1 
ATOM   2605 C  CD    . LYS A 1 400 ? -62.241 81.799  -19.175 1.00 72.53 ? 400 LYS A CD    1 
ATOM   2606 C  CE    . LYS A 1 400 ? -62.444 83.018  -20.062 1.00 72.39 ? 400 LYS A CE    1 
ATOM   2607 N  NZ    . LYS A 1 400 ? -61.147 83.511  -20.587 1.00 68.54 ? 400 LYS A NZ    1 
ATOM   2608 N  N     . GLU A 1 401 ? -64.061 78.313  -21.561 1.00 70.00 ? 401 GLU A N     1 
ATOM   2609 C  CA    . GLU A 1 401 ? -65.392 78.422  -22.120 1.00 75.41 ? 401 GLU A CA    1 
ATOM   2610 C  C     . GLU A 1 401 ? -66.209 77.163  -21.840 1.00 81.16 ? 401 GLU A C     1 
ATOM   2611 O  O     . GLU A 1 401 ? -67.437 77.157  -21.947 1.00 80.71 ? 401 GLU A O     1 
ATOM   2612 C  CB    . GLU A 1 401 ? -65.357 78.657  -23.644 1.00 77.71 ? 401 GLU A CB    1 
ATOM   2613 C  CG    . GLU A 1 401 ? -66.460 79.661  -24.011 1.00 82.19 ? 401 GLU A CG    1 
ATOM   2614 C  CD    . GLU A 1 401 ? -66.931 79.596  -25.485 1.00 84.38 ? 401 GLU A CD    1 
ATOM   2615 O  OE1   . GLU A 1 401 ? -66.338 78.922  -26.390 1.00 80.17 ? 401 GLU A OE1   1 
ATOM   2616 O  OE2   . GLU A 1 401 ? -68.049 80.129  -25.703 1.00 84.86 ? 401 GLU A OE2   1 
ATOM   2617 N  N     . LEU A 1 402 ? -65.530 76.074  -21.510 1.00 83.48 ? 402 LEU A N     1 
ATOM   2618 C  CA    . LEU A 1 402 ? -66.251 74.849  -21.252 1.00 84.86 ? 402 LEU A CA    1 
ATOM   2619 C  C     . LEU A 1 402 ? -66.543 74.633  -19.779 1.00 84.86 ? 402 LEU A C     1 
ATOM   2620 O  O     . LEU A 1 402 ? -66.864 73.538  -19.339 1.00 84.86 ? 402 LEU A O     1 
ATOM   2621 C  CB    . LEU A 1 402 ? -65.511 73.645  -21.850 1.00 84.86 ? 402 LEU A CB    1 
ATOM   2622 C  CG    . LEU A 1 402 ? -66.419 72.426  -22.123 1.00 84.86 ? 402 LEU A CG    1 
ATOM   2623 C  CD1   . LEU A 1 402 ? -66.559 71.627  -20.884 1.00 84.86 ? 402 LEU A CD1   1 
ATOM   2624 C  CD2   . LEU A 1 402 ? -67.787 72.887  -22.621 1.00 84.86 ? 402 LEU A CD2   1 
ATOM   2625 N  N     . SER A 1 403 ? -66.424 75.689  -18.996 1.00 84.81 ? 403 SER A N     1 
ATOM   2626 C  CA    . SER A 1 403 ? -66.693 75.568  -17.577 1.00 83.42 ? 403 SER A CA    1 
ATOM   2627 C  C     . SER A 1 403 ? -67.909 76.419  -17.207 1.00 84.68 ? 403 SER A C     1 
ATOM   2628 O  O     . SER A 1 403 ? -69.013 75.901  -17.037 1.00 84.86 ? 403 SER A O     1 
ATOM   2629 C  CB    . SER A 1 403 ? -65.482 76.013  -16.764 1.00 84.49 ? 403 SER A CB    1 
ATOM   2630 O  OG    . SER A 1 403 ? -65.178 77.360  -17.038 1.00 84.86 ? 403 SER A OG    1 
HETATM 2631 MG MG    . MG  B 2 .   ? -39.709 76.309  -21.902 1.00 41.49 ? 501 MG  A MG    1 
HETATM 2632 P  PG    . ANP C 3 .   ? -39.683 78.419  -24.428 1.00 54.67 ? 500 ANP A PG    1 
HETATM 2633 O  O1G   . ANP C 3 .   ? -38.900 79.123  -25.500 1.00 59.36 ? 500 ANP A O1G   1 
HETATM 2634 O  O2G   . ANP C 3 .   ? -39.029 77.176  -23.867 1.00 48.14 ? 500 ANP A O2G   1 
HETATM 2635 O  O3G   . ANP C 3 .   ? -41.173 78.063  -24.940 1.00 48.48 ? 500 ANP A O3G   1 
HETATM 2636 P  PB    . ANP C 3 .   ? -40.826 79.268  -21.888 1.00 34.08 ? 500 ANP A PB    1 
HETATM 2637 O  O1B   . ANP C 3 .   ? -40.356 78.148  -21.060 1.00 31.05 ? 500 ANP A O1B   1 
HETATM 2638 O  O2B   . ANP C 3 .   ? -41.634 80.410  -21.474 1.00 43.12 ? 500 ANP A O2B   1 
HETATM 2639 N  N3B   . ANP C 3 .   ? -39.915 79.478  -23.204 1.00 34.11 ? 500 ANP A N3B   1 
HETATM 2640 P  PA    . ANP C 3 .   ? -38.955 79.683  -19.708 1.00 43.99 ? 500 ANP A PA    1 
HETATM 2641 O  O1A   . ANP C 3 .   ? -37.507 79.380  -19.826 1.00 43.39 ? 500 ANP A O1A   1 
HETATM 2642 O  O2A   . ANP C 3 .   ? -39.602 79.962  -18.412 1.00 35.36 ? 500 ANP A O2A   1 
HETATM 2643 O  O3A   . ANP C 3 .   ? -39.724 80.133  -21.034 1.00 29.25 ? 500 ANP A O3A   1 
HETATM 2644 O  "O5'" . ANP C 3 .   ? -38.309 81.142  -19.403 1.00 29.87 ? 500 ANP A "O5'" 1 
HETATM 2645 C  "C5'" . ANP C 3 .   ? -38.467 82.380  -20.111 1.00 43.26 ? 500 ANP A "C5'" 1 
HETATM 2646 C  "C4'" . ANP C 3 .   ? -37.248 83.229  -19.594 1.00 38.21 ? 500 ANP A "C4'" 1 
HETATM 2647 O  "O4'" . ANP C 3 .   ? -37.700 84.338  -18.718 1.00 46.59 ? 500 ANP A "O4'" 1 
HETATM 2648 C  "C3'" . ANP C 3 .   ? -36.204 82.560  -18.673 1.00 42.67 ? 500 ANP A "C3'" 1 
HETATM 2649 O  "O3'" . ANP C 3 .   ? -34.928 83.155  -18.859 1.00 57.18 ? 500 ANP A "O3'" 1 
HETATM 2650 C  "C2'" . ANP C 3 .   ? -36.798 82.746  -17.272 1.00 49.05 ? 500 ANP A "C2'" 1 
HETATM 2651 O  "O2'" . ANP C 3 .   ? -35.772 82.670  -16.252 1.00 54.95 ? 500 ANP A "O2'" 1 
HETATM 2652 C  "C1'" . ANP C 3 .   ? -37.451 84.112  -17.346 1.00 40.77 ? 500 ANP A "C1'" 1 
HETATM 2653 N  N9    . ANP C 3 .   ? -38.738 84.182  -16.576 1.00 42.82 ? 500 ANP A N9    1 
HETATM 2654 C  C8    . ANP C 3 .   ? -39.932 83.615  -16.889 1.00 34.29 ? 500 ANP A C8    1 
HETATM 2655 N  N7    . ANP C 3 .   ? -40.874 83.877  -16.003 1.00 30.44 ? 500 ANP A N7    1 
HETATM 2656 C  C5    . ANP C 3 .   ? -40.307 84.651  -15.052 1.00 36.50 ? 500 ANP A C5    1 
HETATM 2657 C  C6    . ANP C 3 .   ? -40.855 85.230  -13.869 1.00 38.19 ? 500 ANP A C6    1 
HETATM 2658 N  N6    . ANP C 3 .   ? -42.044 85.138  -13.445 1.00 36.09 ? 500 ANP A N6    1 
HETATM 2659 N  N1    . ANP C 3 .   ? -39.917 85.965  -13.157 1.00 41.95 ? 500 ANP A N1    1 
HETATM 2660 C  C2    . ANP C 3 .   ? -38.586 86.124  -13.549 1.00 41.36 ? 500 ANP A C2    1 
HETATM 2661 N  N3    . ANP C 3 .   ? -38.086 85.588  -14.647 1.00 39.39 ? 500 ANP A N3    1 
HETATM 2662 C  C4    . ANP C 3 .   ? -38.980 84.857  -15.376 1.00 34.41 ? 500 ANP A C4    1 
HETATM 2663 O  O     . HOH D 4 .   ? -47.282 86.496  -24.545 1.00 27.53 ? 600 HOH A O     1 
HETATM 2664 O  O     . HOH D 4 .   ? -48.017 83.985  -24.487 1.00 22.83 ? 601 HOH A O     1 
HETATM 2665 O  O     . HOH D 4 .   ? -41.203 85.925  -24.927 1.00 34.43 ? 602 HOH A O     1 
HETATM 2666 O  O     . HOH D 4 .   ? -48.019 76.762  -25.524 1.00 31.86 ? 603 HOH A O     1 
HETATM 2667 O  O     . HOH D 4 .   ? -49.017 83.141  -29.222 1.00 31.97 ? 604 HOH A O     1 
HETATM 2668 O  O     . HOH D 4 .   ? -45.506 84.021  -16.939 1.00 28.17 ? 605 HOH A O     1 
HETATM 2669 O  O     . HOH D 4 .   ? -59.216 105.153 -38.746 1.00 46.81 ? 606 HOH A O     1 
HETATM 2670 O  O     . HOH D 4 .   ? -47.590 91.010  -24.813 1.00 30.39 ? 607 HOH A O     1 
HETATM 2671 O  O     . HOH D 4 .   ? -43.742 83.333  -15.403 1.00 41.82 ? 608 HOH A O     1 
HETATM 2672 O  O     . HOH D 4 .   ? -56.515 105.378 -26.602 1.00 42.07 ? 609 HOH A O     1 
HETATM 2673 O  O     . HOH D 4 .   ? -61.354 91.376  -26.188 1.00 29.34 ? 610 HOH A O     1 
HETATM 2674 O  O     . HOH D 4 .   ? -53.032 103.554 -42.546 1.00 35.01 ? 611 HOH A O     1 
HETATM 2675 O  O     . HOH D 4 .   ? -39.923 71.831  -9.959  1.00 40.28 ? 612 HOH A O     1 
HETATM 2676 O  O     . HOH D 4 .   ? -64.901 85.145  -20.086 1.00 71.62 ? 613 HOH A O     1 
HETATM 2677 O  O     . HOH D 4 .   ? -56.621 74.881  -9.858  1.00 41.42 ? 614 HOH A O     1 
HETATM 2678 O  O     . HOH D 4 .   ? -52.557 62.389  -15.171 1.00 36.03 ? 615 HOH A O     1 
HETATM 2679 O  O     . HOH D 4 .   ? -44.856 77.332  -34.579 1.00 55.56 ? 616 HOH A O     1 
HETATM 2680 O  O     . HOH D 4 .   ? -51.065 88.625  -8.749  1.00 36.01 ? 617 HOH A O     1 
HETATM 2681 O  O     . HOH D 4 .   ? -62.448 86.612  -20.888 1.00 34.38 ? 618 HOH A O     1 
HETATM 2682 O  O     . HOH D 4 .   ? -65.109 82.453  -18.228 1.00 56.24 ? 619 HOH A O     1 
HETATM 2683 O  O     . HOH D 4 .   ? -45.643 86.474  -12.386 1.00 32.34 ? 620 HOH A O     1 
HETATM 2684 O  O     . HOH D 4 .   ? -50.874 110.021 -32.799 1.00 47.37 ? 621 HOH A O     1 
HETATM 2685 O  O     . HOH D 4 .   ? -39.569 58.669  -16.941 1.00 44.97 ? 622 HOH A O     1 
HETATM 2686 O  O     . HOH D 4 .   ? -31.666 60.227  -18.119 1.00 51.37 ? 623 HOH A O     1 
HETATM 2687 O  O     . HOH D 4 .   ? -45.852 86.809  -4.611  1.00 51.55 ? 624 HOH A O     1 
HETATM 2688 O  O     . HOH D 4 .   ? -48.274 106.905 -35.931 1.00 49.23 ? 625 HOH A O     1 
HETATM 2689 O  O     . HOH D 4 .   ? -39.162 88.091  -16.705 1.00 41.50 ? 626 HOH A O     1 
HETATM 2690 O  O     . HOH D 4 .   ? -38.588 66.060  2.132   1.00 76.64 ? 627 HOH A O     1 
HETATM 2691 O  O     . HOH D 4 .   ? -56.898 65.637  -16.163 1.00 44.72 ? 628 HOH A O     1 
HETATM 2692 O  O     . HOH D 4 .   ? -64.465 81.992  -22.102 1.00 52.61 ? 629 HOH A O     1 
HETATM 2693 O  O     . HOH D 4 .   ? -33.765 89.448  -17.209 1.00 50.35 ? 630 HOH A O     1 
HETATM 2694 O  O     . HOH D 4 .   ? -61.904 89.909  -24.415 1.00 42.74 ? 631 HOH A O     1 
HETATM 2695 O  O     . HOH D 4 .   ? -55.942 82.275  -30.568 1.00 39.94 ? 632 HOH A O     1 
HETATM 2696 O  O     . HOH D 4 .   ? -50.815 67.753  6.898   1.00 74.05 ? 633 HOH A O     1 
HETATM 2697 O  O     . HOH D 4 .   ? -45.851 100.651 -20.084 1.00 61.57 ? 634 HOH A O     1 
HETATM 2698 O  O     . HOH D 4 .   ? -59.703 72.139  -12.005 1.00 43.10 ? 635 HOH A O     1 
HETATM 2699 O  O     . HOH D 4 .   ? -51.872 93.235  -31.519 1.00 66.23 ? 636 HOH A O     1 
HETATM 2700 O  O     . HOH D 4 .   ? -43.294 100.187 -19.627 1.00 51.26 ? 637 HOH A O     1 
HETATM 2701 O  O     . HOH D 4 .   ? -39.269 89.675  -25.703 1.00 58.73 ? 638 HOH A O     1 
HETATM 2702 O  O     . HOH D 4 .   ? -36.382 71.518  -19.171 1.00 67.99 ? 639 HOH A O     1 
HETATM 2703 O  O     . HOH D 4 .   ? -40.291 86.994  -10.227 1.00 61.81 ? 640 HOH A O     1 
HETATM 2704 O  O     . HOH D 4 .   ? -67.076 85.290  -21.968 1.00 39.13 ? 641 HOH A O     1 
HETATM 2705 O  O     . HOH D 4 .   ? -50.268 94.986  -13.470 1.00 48.25 ? 642 HOH A O     1 
HETATM 2706 O  O     . HOH D 4 .   ? -62.390 87.372  -23.825 1.00 50.98 ? 643 HOH A O     1 
HETATM 2707 O  O     . HOH D 4 .   ? -40.020 71.509  -17.726 1.00 41.07 ? 644 HOH A O     1 
HETATM 2708 O  O     . HOH D 4 .   ? -40.444 82.179  -7.701  1.00 58.63 ? 645 HOH A O     1 
HETATM 2709 O  O     . HOH D 4 .   ? -29.576 90.390  -18.701 1.00 82.47 ? 646 HOH A O     1 
HETATM 2710 O  O     . HOH D 4 .   ? -52.679 102.902 -39.645 1.00 42.90 ? 647 HOH A O     1 
HETATM 2711 O  O     . HOH D 4 .   ? -53.609 89.377  -9.238  1.00 46.56 ? 648 HOH A O     1 
HETATM 2712 O  O     . HOH D 4 .   ? -60.808 103.603 -33.558 1.00 65.81 ? 649 HOH A O     1 
HETATM 2713 O  O     . HOH D 4 .   ? -58.395 94.344  -32.038 1.00 71.53 ? 650 HOH A O     1 
HETATM 2714 O  O     . HOH D 4 .   ? -50.668 56.087  1.939   1.00 65.58 ? 651 HOH A O     1 
HETATM 2715 O  O     . HOH D 4 .   ? -43.563 91.736  -33.064 1.00 67.87 ? 652 HOH A O     1 
HETATM 2716 O  O     . HOH D 4 .   ? -56.828 104.472 -23.651 1.00 38.72 ? 653 HOH A O     1 
HETATM 2717 O  O     . HOH D 4 .   ? -49.659 58.577  -18.200 1.00 57.42 ? 654 HOH A O     1 
HETATM 2718 O  O     . HOH D 4 .   ? -41.112 83.857  -10.069 1.00 49.72 ? 655 HOH A O     1 
HETATM 2719 O  O     . HOH D 4 .   ? -37.306 54.120  -20.714 1.00 54.55 ? 656 HOH A O     1 
HETATM 2720 O  O     . HOH D 4 .   ? -43.135 77.744  2.060   1.00 82.01 ? 657 HOH A O     1 
HETATM 2721 O  O     . HOH D 4 .   ? -53.147 99.401  -35.809 1.00 46.59 ? 658 HOH A O     1 
HETATM 2722 O  O     . HOH D 4 .   ? -59.340 74.047  -9.621  1.00 80.75 ? 659 HOH A O     1 
HETATM 2723 O  O     . HOH D 4 .   ? -40.430 51.123  -26.377 1.00 68.16 ? 660 HOH A O     1 
HETATM 2724 O  O     . HOH D 4 .   ? -65.269 73.306  -14.626 1.00 49.48 ? 661 HOH A O     1 
HETATM 2725 O  O     . HOH D 4 .   ? -57.427 91.367  -30.737 1.00 60.55 ? 662 HOH A O     1 
HETATM 2726 O  O     . HOH D 4 .   ? -54.846 90.166  -32.670 1.00 49.79 ? 663 HOH A O     1 
HETATM 2727 O  O     . HOH D 4 .   ? -52.860 100.507 -38.866 1.00 51.16 ? 664 HOH A O     1 
HETATM 2728 O  O     . HOH D 4 .   ? -58.730 110.441 -35.844 1.00 84.86 ? 665 HOH A O     1 
HETATM 2729 O  O     . HOH D 4 .   ? -41.745 80.836  -4.910  1.00 55.97 ? 666 HOH A O     1 
HETATM 2730 O  O     . HOH D 4 .   ? -38.684 74.483  -22.662 1.00 43.36 ? 667 HOH A O     1 
HETATM 2731 O  O     . HOH D 4 .   ? -41.458 75.150  -22.272 1.00 39.99 ? 668 HOH A O     1 
HETATM 2732 O  O     . HOH D 4 .   ? -35.937 74.056  -15.624 1.00 60.84 ? 669 HOH A O     1 
HETATM 2733 O  O     . HOH D 4 .   ? -43.364 56.397  -1.900  1.00 58.00 ? 670 HOH A O     1 
HETATM 2734 O  O     . HOH D 4 .   ? -33.238 68.626  2.564   1.00 79.96 ? 671 HOH A O     1 
HETATM 2735 O  O     . HOH D 4 .   ? -61.065 105.959 -31.118 1.00 66.81 ? 672 HOH A O     1 
HETATM 2736 O  O     . HOH D 4 .   ? -37.660 77.077  -21.288 1.00 44.62 ? 673 HOH A O     1 
HETATM 2737 O  O     . HOH D 4 .   ? -77.870 83.965  -29.975 1.00 55.25 ? 674 HOH A O     1 
HETATM 2738 O  O     . HOH D 4 .   ? -81.554 87.635  -26.165 1.00 84.01 ? 675 HOH A O     1 
HETATM 2739 O  O     . HOH D 4 .   ? -73.815 81.537  -33.776 1.00 81.35 ? 676 HOH A O     1 
HETATM 2740 O  O     . HOH D 4 .   ? -75.868 88.262  -19.878 1.00 45.56 ? 677 HOH A O     1 
HETATM 2741 O  O     . HOH D 4 .   ? -66.286 82.923  -25.739 1.00 84.30 ? 678 HOH A O     1 
HETATM 2742 O  O     . HOH D 4 .   ? -62.213 91.823  -11.197 1.00 62.17 ? 679 HOH A O     1 
HETATM 2743 O  O     . HOH D 4 .   ? -42.336 90.797  -23.861 1.00 30.76 ? 680 HOH A O     1 
HETATM 2744 O  O     . HOH D 4 .   ? -44.460 97.469  -15.191 1.00 75.39 ? 681 HOH A O     1 
HETATM 2745 O  O     . HOH D 4 .   ? -37.881 86.793  -19.235 1.00 41.91 ? 682 HOH A O     1 
HETATM 2746 O  O     . HOH D 4 .   ? -36.948 100.831 -19.729 1.00 75.78 ? 683 HOH A O     1 
HETATM 2747 O  O     . HOH D 4 .   ? -56.018 98.288  -9.627  1.00 83.78 ? 684 HOH A O     1 
HETATM 2748 O  O     . HOH D 4 .   ? -57.332 100.472 -36.304 1.00 57.74 ? 685 HOH A O     1 
HETATM 2749 O  O     . HOH D 4 .   ? -58.529 89.589  -28.857 1.00 43.71 ? 686 HOH A O     1 
HETATM 2750 O  O     . HOH D 4 .   ? -60.389 67.671  -4.333  1.00 70.85 ? 687 HOH A O     1 
HETATM 2751 O  O     . HOH D 4 .   ? -31.963 72.229  -8.268  1.00 70.38 ? 688 HOH A O     1 
HETATM 2752 O  O     . HOH D 4 .   ? -44.946 73.161  -1.450  1.00 58.70 ? 689 HOH A O     1 
HETATM 2753 O  O     . HOH D 4 .   ? -45.233 55.414  -31.451 1.00 83.76 ? 690 HOH A O     1 
HETATM 2754 O  O     . HOH D 4 .   ? -37.466 71.850  -16.486 1.00 54.28 ? 691 HOH A O     1 
HETATM 2755 O  O     . HOH D 4 .   ? -31.950 71.481  -21.020 1.00 76.23 ? 692 HOH A O     1 
HETATM 2756 O  O     . HOH D 4 .   ? -33.155 74.778  -28.044 1.00 75.51 ? 693 HOH A O     1 
HETATM 2757 O  O     . HOH D 4 .   ? -42.970 77.107  -32.507 1.00 61.03 ? 694 HOH A O     1 
HETATM 2758 O  O     . HOH D 4 .   ? -47.303 76.410  -33.987 1.00 79.12 ? 695 HOH A O     1 
HETATM 2759 O  O     . HOH D 4 .   ? -37.827 85.660  -21.902 1.00 51.10 ? 696 HOH A O     1 
HETATM 2760 O  O     . HOH D 4 .   ? -40.132 99.985  -20.269 1.00 74.19 ? 697 HOH A O     1 
HETATM 2761 O  O     . HOH D 4 .   ? -55.711 92.819  -32.781 1.00 61.14 ? 698 HOH A O     1 
HETATM 2762 O  O     . HOH D 4 .   ? -47.558 96.881  -13.534 1.00 76.15 ? 699 HOH A O     1 
HETATM 2763 O  O     . HOH D 4 .   ? -41.314 87.315  -7.636  1.00 77.67 ? 700 HOH A O     1 
HETATM 2764 O  O     . HOH D 4 .   ? -32.586 59.214  -28.392 1.00 84.69 ? 701 HOH A O     1 
HETATM 2765 O  O     . HOH D 4 .   ? -48.335 48.399  -6.731  1.00 74.36 ? 702 HOH A O     1 
HETATM 2766 O  O     . HOH D 4 .   ? -37.203 74.597  -42.697 1.00 81.05 ? 703 HOH A O     1 
HETATM 2767 O  O     . HOH D 4 .   ? -47.936 65.893  -29.710 1.00 60.36 ? 704 HOH A O     1 
HETATM 2768 O  O     . HOH D 4 .   ? -37.228 80.960  -24.531 1.00 61.57 ? 705 HOH A O     1 
HETATM 2769 O  O     . HOH D 4 .   ? -59.119 102.345 -38.053 1.00 84.86 ? 706 HOH A O     1 
HETATM 2770 O  O     . HOH D 4 .   ? -30.335 69.225  -23.871 1.00 84.86 ? 707 HOH A O     1 
HETATM 2771 O  O     . HOH D 4 .   ? -40.514 72.737  -2.323  1.00 84.86 ? 708 HOH A O     1 
HETATM 2772 O  O     . HOH D 4 .   ? -32.961 72.853  -25.721 1.00 75.74 ? 709 HOH A O     1 
HETATM 2773 O  O     . HOH D 4 .   ? -31.755 77.320  -26.411 1.00 68.09 ? 710 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   ?   ?   ?   A . n 
A 1 2   VAL 2   2   ?   ?   ?   A . n 
A 1 3   ARG 3   3   ?   ?   ?   A . n 
A 1 4   ARG 4   4   ?   ?   ?   A . n 
A 1 5   LYS 5   5   ?   ?   ?   A . n 
A 1 6   SER 6   6   ?   ?   ?   A . n 
A 1 7   CYS 7   7   ?   ?   ?   A . n 
A 1 8   ILE 8   8   ?   ?   ?   A . n 
A 1 9   VAL 9   9   ?   ?   ?   A . n 
A 1 10  LYS 10  10  ?   ?   ?   A . n 
A 1 11  GLU 11  11  ?   ?   ?   A . n 
A 1 12  MET 12  12  ?   ?   ?   A . n 
A 1 13  GLU 13  13  ?   ?   ?   A . n 
A 1 14  LYS 14  14  ?   ?   ?   A . n 
A 1 15  MET 15  15  ?   ?   ?   A . n 
A 1 16  LYS 16  16  ?   ?   ?   A . n 
A 1 17  ASN 17  17  ?   ?   ?   A . n 
A 1 18  LYS 18  18  ?   ?   ?   A . n 
A 1 19  ARG 19  19  ?   ?   ?   A . n 
A 1 20  GLU 20  20  ?   ?   ?   A . n 
A 1 21  GLU 21  21  ?   ?   ?   A . n 
A 1 22  LYS 22  22  ?   ?   ?   A . n 
A 1 23  ARG 23  23  ?   ?   ?   A . n 
A 1 24  ALA 24  24  ?   ?   ?   A . n 
A 1 25  GLN 25  25  ?   ?   ?   A . n 
A 1 26  ASN 26  26  ?   ?   ?   A . n 
A 1 27  SER 27  27  ?   ?   ?   A . n 
A 1 28  GLU 28  28  ?   ?   ?   A . n 
A 1 29  LEU 29  29  ?   ?   ?   A . n 
A 1 30  ARG 30  30  ?   ?   ?   A . n 
A 1 31  ILE 31  31  ?   ?   ?   A . n 
A 1 32  LYS 32  32  ?   ?   ?   A . n 
A 1 33  ARG 33  33  ?   ?   ?   A . n 
A 1 34  ALA 34  34  ?   ?   ?   A . n 
A 1 35  GLN 35  35  ?   ?   ?   A . n 
A 1 36  GLU 36  36  ?   ?   ?   A . n 
A 1 37  TYR 37  37  ?   ?   ?   A . n 
A 1 38  ASP 38  38  ?   ?   ?   A . n 
A 1 39  SER 39  39  ?   ?   ?   A . n 
A 1 40  SER 40  40  ?   ?   ?   A . n 
A 1 41  PHE 41  41  ?   ?   ?   A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  ASN 43  43  43  ASN ASN A . n 
A 1 44  TRP 44  44  44  TRP TRP A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  ARG 48  48  48  ARG ARG A . n 
A 1 49  MET 49  49  49  MET MET A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  GLU 52  52  52  GLU GLU A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  MET 57  57  57  MET MET A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  CYS 59  59  59  CYS CYS A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  PRO 67  67  67  PRO PRO A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  GLU 70  70  70  GLU GLU A . n 
A 1 71  HIS 71  71  71  HIS HIS A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  CYS 74  74  74  CYS CYS A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  CYS 76  76  76  CYS CYS A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  PRO 81  81  81  PRO PRO A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  ILE 95  95  95  ILE ILE A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 CYS 101 101 101 CYS CYS A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 VAL 105 105 105 VAL VAL A . n 
A 1 106 HIS 106 106 106 HIS HIS A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 THR 115 115 115 THR THR A . n 
A 1 116 LYS 116 116 116 LYS LYS A . n 
A 1 117 TYR 117 117 117 TYR TYR A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 ASN 120 120 120 ASN ASN A . n 
A 1 121 GLN 121 121 121 GLN GLN A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 CYS 124 124 124 CYS CYS A . n 
A 1 125 PHE 125 125 125 PHE PHE A . n 
A 1 126 ASP 126 126 126 ASP ASP A . n 
A 1 127 PHE 127 127 127 PHE PHE A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 SER 134 134 134 SER SER A . n 
A 1 135 ASN 135 135 135 ASN ASN A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 VAL 137 137 137 VAL VAL A . n 
A 1 138 VAL 138 138 138 VAL VAL A . n 
A 1 139 TYR 139 139 139 TYR TYR A . n 
A 1 140 ARG 140 140 140 ARG ARG A . n 
A 1 141 PHE 141 141 141 PHE PHE A . n 
A 1 142 THR 142 142 142 THR THR A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 GLN 148 148 148 GLN GLN A . n 
A 1 149 THR 149 149 149 THR THR A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 PHE 151 151 151 PHE PHE A . n 
A 1 152 GLU 152 152 152 GLU GLU A . n 
A 1 153 GLY 153 153 153 GLY GLY A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 ALA 156 156 156 ALA ALA A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 CYS 158 158 158 CYS CYS A . n 
A 1 159 PHE 159 159 159 PHE PHE A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 TYR 161 161 161 TYR TYR A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 GLN 163 163 163 GLN GLN A . n 
A 1 164 THR 164 164 164 THR THR A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 LYS 168 168 168 LYS LYS A . n 
A 1 169 THR 169 169 169 THR THR A . n 
A 1 170 HIS 170 170 170 HIS HIS A . n 
A 1 171 THR 171 171 171 THR THR A . n 
A 1 172 MET 172 172 172 MET MET A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 SER 177 177 ?   ?   ?   A . n 
A 1 178 GLY 178 178 ?   ?   ?   A . n 
A 1 179 LYS 179 179 ?   ?   ?   A . n 
A 1 180 SER 180 180 ?   ?   ?   A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 ASN 182 182 182 ASN ASN A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 LYS 185 185 185 LYS LYS A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 TYR 188 188 188 TYR TYR A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 MET 190 190 190 MET MET A . n 
A 1 191 ALA 191 191 191 ALA ALA A . n 
A 1 192 SER 192 192 192 SER SER A . n 
A 1 193 ARG 193 193 193 ARG ARG A . n 
A 1 194 ASP 194 194 194 ASP ASP A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 PHE 196 196 196 PHE PHE A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 LYS 199 199 199 LYS LYS A . n 
A 1 200 ASN 200 200 200 ASN ASN A . n 
A 1 201 GLN 201 201 201 GLN GLN A . n 
A 1 202 PRO 202 202 202 PRO PRO A . n 
A 1 203 ARG 203 203 203 ARG ARG A . n 
A 1 204 TYR 204 204 204 TYR TYR A . n 
A 1 205 ARG 205 205 205 ARG ARG A . n 
A 1 206 ASN 206 206 206 ASN ASN A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 GLU 210 210 210 GLU GLU A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 TYR 212 212 212 TYR TYR A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 PHE 215 215 215 PHE PHE A . n 
A 1 216 PHE 216 216 216 PHE PHE A . n 
A 1 217 GLU 217 217 217 GLU GLU A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 TYR 219 219 219 TYR TYR A . n 
A 1 220 ASN 220 220 220 ASN ASN A . n 
A 1 221 GLY 221 221 221 GLY GLY A . n 
A 1 222 LYS 222 222 222 LYS LYS A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
A 1 224 PHE 224 224 224 PHE PHE A . n 
A 1 225 ASP 225 225 225 ASP ASP A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 ASN 228 228 228 ASN ASN A . n 
A 1 229 LYS 229 229 229 LYS LYS A . n 
A 1 230 LYS 230 230 230 LYS LYS A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 LYS 232 232 232 LYS LYS A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 ARG 234 234 234 ARG ARG A . n 
A 1 235 VAL 235 235 235 VAL VAL A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 ASP 238 238 238 ASP ASP A . n 
A 1 239 SER 239 239 239 SER SER A . n 
A 1 240 ARG 240 240 240 ARG ARG A . n 
A 1 241 GLN 241 241 241 GLN GLN A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 VAL 243 243 243 VAL VAL A . n 
A 1 244 GLN 244 244 244 GLN GLN A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLY 247 247 247 GLY GLY A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLN 249 249 249 GLN GLN A . n 
A 1 250 GLU 250 250 250 GLU GLU A . n 
A 1 251 TYR 251 251 251 TYR TYR A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 VAL 253 253 253 VAL VAL A . n 
A 1 254 THR 254 254 254 THR THR A . n 
A 1 255 CYS 255 255 255 CYS CYS A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 ASP 257 257 257 ASP ASP A . n 
A 1 258 ASP 258 258 258 ASP ASP A . n 
A 1 259 VAL 259 259 259 VAL VAL A . n 
A 1 260 ILE 260 260 260 ILE ILE A . n 
A 1 261 LYS 261 261 261 LYS LYS A . n 
A 1 262 MET 262 262 262 MET MET A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 ASN 264 264 264 ASN ASN A . n 
A 1 265 MET 265 265 265 MET MET A . n 
A 1 266 GLY 266 266 266 GLY GLY A . n 
A 1 267 SER 267 267 267 SER SER A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 CYS 269 269 269 CYS CYS A . n 
A 1 270 ARG 270 270 270 ARG ARG A . n 
A 1 271 THR 271 271 271 THR THR A . n 
A 1 272 SER 272 272 ?   ?   ?   A . n 
A 1 273 GLY 273 273 ?   ?   ?   A . n 
A 1 274 GLN 274 274 ?   ?   ?   A . n 
A 1 275 THR 275 275 ?   ?   ?   A . n 
A 1 276 PHE 276 276 ?   ?   ?   A . n 
A 1 277 ALA 277 277 ?   ?   ?   A . n 
A 1 278 ASN 278 278 ?   ?   ?   A . n 
A 1 279 SER 279 279 ?   ?   ?   A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 SER 282 282 282 SER SER A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 HIS 285 285 285 HIS HIS A . n 
A 1 286 ALA 286 286 286 ALA ALA A . n 
A 1 287 CYS 287 287 287 CYS CYS A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 GLN 289 289 289 GLN GLN A . n 
A 1 290 ILE 290 290 290 ILE ILE A . n 
A 1 291 LEU 291 291 291 LEU LEU A . n 
A 1 292 LEU 292 292 292 LEU LEU A . n 
A 1 293 ARG 293 293 293 ARG ARG A . n 
A 1 294 THR 294 294 294 THR THR A . n 
A 1 295 LYS 295 295 295 LYS LYS A . n 
A 1 296 GLY 296 296 296 GLY GLY A . n 
A 1 297 ARG 297 297 297 ARG ARG A . n 
A 1 298 LEU 298 298 298 LEU LEU A . n 
A 1 299 HIS 299 299 299 HIS HIS A . n 
A 1 300 GLY 300 300 300 GLY GLY A . n 
A 1 301 LYS 301 301 301 LYS LYS A . n 
A 1 302 PHE 302 302 302 PHE PHE A . n 
A 1 303 SER 303 303 303 SER SER A . n 
A 1 304 LEU 304 304 304 LEU LEU A . n 
A 1 305 VAL 305 305 305 VAL VAL A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 LEU 307 307 307 LEU LEU A . n 
A 1 308 ALA 308 308 308 ALA ALA A . n 
A 1 309 GLY 309 309 309 GLY GLY A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 GLU 311 311 311 GLU GLU A . n 
A 1 312 ARG 312 312 ?   ?   ?   A . n 
A 1 313 GLY 313 313 ?   ?   ?   A . n 
A 1 314 ALA 314 314 ?   ?   ?   A . n 
A 1 315 ASP 315 315 ?   ?   ?   A . n 
A 1 316 THR 316 316 ?   ?   ?   A . n 
A 1 317 SER 317 317 ?   ?   ?   A . n 
A 1 318 SER 318 318 ?   ?   ?   A . n 
A 1 319 ALA 319 319 ?   ?   ?   A . n 
A 1 320 ASP 320 320 ?   ?   ?   A . n 
A 1 321 ARG 321 321 ?   ?   ?   A . n 
A 1 322 GLN 322 322 ?   ?   ?   A . n 
A 1 323 THR 323 323 ?   ?   ?   A . n 
A 1 324 ARG 324 324 324 ARG ARG A . n 
A 1 325 MET 325 325 325 MET MET A . n 
A 1 326 GLU 326 326 326 GLU GLU A . n 
A 1 327 GLY 327 327 327 GLY GLY A . n 
A 1 328 ALA 328 328 328 ALA ALA A . n 
A 1 329 GLU 329 329 329 GLU GLU A . n 
A 1 330 ILE 330 330 330 ILE ILE A . n 
A 1 331 ASN 331 331 331 ASN ASN A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 SER 333 333 333 SER SER A . n 
A 1 334 LEU 334 334 334 LEU LEU A . n 
A 1 335 LEU 335 335 335 LEU LEU A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 LEU 337 337 337 LEU LEU A . n 
A 1 338 LYS 338 338 338 LYS LYS A . n 
A 1 339 GLU 339 339 339 GLU GLU A . n 
A 1 340 CYS 340 340 340 CYS CYS A . n 
A 1 341 ILE 341 341 341 ILE ILE A . n 
A 1 342 ARG 342 342 342 ARG ARG A . n 
A 1 343 ALA 343 343 343 ALA ALA A . n 
A 1 344 LEU 344 344 344 LEU LEU A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 GLN 346 346 346 GLN ALA A . n 
A 1 347 ASN 347 347 ?   ?   ?   A . n 
A 1 348 LYS 348 348 ?   ?   ?   A . n 
A 1 349 ALA 349 349 ?   ?   ?   A . n 
A 1 350 HIS 350 350 ?   ?   ?   A . n 
A 1 351 THR 351 351 ?   ?   ?   A . n 
A 1 352 PRO 352 352 ?   ?   ?   A . n 
A 1 353 PHE 353 353 353 PHE PHE A . n 
A 1 354 ARG 354 354 354 ARG ALA A . n 
A 1 355 GLU 355 355 355 GLU GLU A . n 
A 1 356 SER 356 356 356 SER SER A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 THR 359 359 359 THR THR A . n 
A 1 360 GLN 360 360 360 GLN GLN A . n 
A 1 361 VAL 361 361 361 VAL VAL A . n 
A 1 362 LEU 362 362 362 LEU LEU A . n 
A 1 363 ARG 363 363 363 ARG ARG A . n 
A 1 364 ASP 364 364 364 ASP ASP A . n 
A 1 365 SER 365 365 365 SER SER A . n 
A 1 366 PHE 366 366 366 PHE PHE A . n 
A 1 367 ILE 367 367 367 ILE ILE A . n 
A 1 368 GLY 368 368 368 GLY GLY A . n 
A 1 369 GLU 369 369 369 GLU GLU A . n 
A 1 370 ASN 370 370 370 ASN ASN A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ARG 372 372 372 ARG ARG A . n 
A 1 373 THR 373 373 373 THR THR A . n 
A 1 374 CYS 374 374 374 CYS CYS A . n 
A 1 375 MET 375 375 375 MET MET A . n 
A 1 376 ILE 376 376 376 ILE ILE A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 MET 378 378 378 MET MET A . n 
A 1 379 ILE 379 379 379 ILE ILE A . n 
A 1 380 SER 380 380 380 SER SER A . n 
A 1 381 PRO 381 381 381 PRO PRO A . n 
A 1 382 GLY 382 382 382 GLY GLY A . n 
A 1 383 ILE 383 383 383 ILE ILE A . n 
A 1 384 SER 384 384 384 SER SER A . n 
A 1 385 SER 385 385 385 SER SER A . n 
A 1 386 CYS 386 386 386 CYS CYS A . n 
A 1 387 GLU 387 387 387 GLU GLU A . n 
A 1 388 TYR 388 388 388 TYR TYR A . n 
A 1 389 THR 389 389 389 THR THR A . n 
A 1 390 LEU 390 390 390 LEU LEU A . n 
A 1 391 ASN 391 391 391 ASN ASN A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 LEU 393 393 393 LEU LEU A . n 
A 1 394 ARG 394 394 394 ARG ARG A . n 
A 1 395 TYR 395 395 395 TYR TYR A . n 
A 1 396 ALA 396 396 396 ALA ALA A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 ARG 398 398 398 ARG ARG A . n 
A 1 399 VAL 399 399 399 VAL VAL A . n 
A 1 400 LYS 400 400 400 LYS LYS A . n 
A 1 401 GLU 401 401 401 GLU GLU A . n 
A 1 402 LEU 402 402 402 LEU LEU A . n 
A 1 403 SER 403 403 403 SER SER A . n 
A 1 404 HIS 404 404 ?   ?   ?   A . n 
A 1 405 HIS 405 405 ?   ?   ?   A . n 
A 1 406 HIS 406 406 ?   ?   ?   A . n 
A 1 407 HIS 407 407 ?   ?   ?   A . n 
A 1 408 HIS 408 408 ?   ?   ?   A . n 
A 1 409 HIS 409 409 ?   ?   ?   A . n 
A 1 410 HIS 410 410 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   501 501 MG  MG  A . 
C 3 ANP 1   500 500 ANP ANP A . 
D 4 HOH 1   600 600 HOH HOH A . 
D 4 HOH 2   601 601 HOH HOH A . 
D 4 HOH 3   602 602 HOH HOH A . 
D 4 HOH 4   603 603 HOH HOH A . 
D 4 HOH 5   604 604 HOH HOH A . 
D 4 HOH 6   605 605 HOH HOH A . 
D 4 HOH 7   606 606 HOH HOH A . 
D 4 HOH 8   607 607 HOH HOH A . 
D 4 HOH 9   608 608 HOH HOH A . 
D 4 HOH 10  609 609 HOH HOH A . 
D 4 HOH 11  610 610 HOH HOH A . 
D 4 HOH 12  611 611 HOH HOH A . 
D 4 HOH 13  612 612 HOH HOH A . 
D 4 HOH 14  613 613 HOH HOH A . 
D 4 HOH 15  614 614 HOH HOH A . 
D 4 HOH 16  615 615 HOH HOH A . 
D 4 HOH 17  616 616 HOH HOH A . 
D 4 HOH 18  617 617 HOH HOH A . 
D 4 HOH 19  618 618 HOH HOH A . 
D 4 HOH 20  619 619 HOH HOH A . 
D 4 HOH 21  620 620 HOH HOH A . 
D 4 HOH 22  621 621 HOH HOH A . 
D 4 HOH 23  622 622 HOH HOH A . 
D 4 HOH 24  623 623 HOH HOH A . 
D 4 HOH 25  624 624 HOH HOH A . 
D 4 HOH 26  625 625 HOH HOH A . 
D 4 HOH 27  626 626 HOH HOH A . 
D 4 HOH 28  627 627 HOH HOH A . 
D 4 HOH 29  628 628 HOH HOH A . 
D 4 HOH 30  629 629 HOH HOH A . 
D 4 HOH 31  630 630 HOH HOH A . 
D 4 HOH 32  631 631 HOH HOH A . 
D 4 HOH 33  632 632 HOH HOH A . 
D 4 HOH 34  633 633 HOH HOH A . 
D 4 HOH 35  634 634 HOH HOH A . 
D 4 HOH 36  635 635 HOH HOH A . 
D 4 HOH 37  636 636 HOH HOH A . 
D 4 HOH 38  637 637 HOH HOH A . 
D 4 HOH 39  638 638 HOH HOH A . 
D 4 HOH 40  639 639 HOH HOH A . 
D 4 HOH 41  640 640 HOH HOH A . 
D 4 HOH 42  641 641 HOH HOH A . 
D 4 HOH 43  642 642 HOH HOH A . 
D 4 HOH 44  643 643 HOH HOH A . 
D 4 HOH 45  644 644 HOH HOH A . 
D 4 HOH 46  645 645 HOH HOH A . 
D 4 HOH 47  646 646 HOH HOH A . 
D 4 HOH 48  647 647 HOH HOH A . 
D 4 HOH 49  648 648 HOH HOH A . 
D 4 HOH 50  649 649 HOH HOH A . 
D 4 HOH 51  650 650 HOH HOH A . 
D 4 HOH 52  651 651 HOH HOH A . 
D 4 HOH 53  652 652 HOH HOH A . 
D 4 HOH 54  653 653 HOH HOH A . 
D 4 HOH 55  654 654 HOH HOH A . 
D 4 HOH 56  655 655 HOH HOH A . 
D 4 HOH 57  656 656 HOH HOH A . 
D 4 HOH 58  657 657 HOH HOH A . 
D 4 HOH 59  658 658 HOH HOH A . 
D 4 HOH 60  659 659 HOH HOH A . 
D 4 HOH 61  660 660 HOH HOH A . 
D 4 HOH 62  661 661 HOH HOH A . 
D 4 HOH 63  662 662 HOH HOH A . 
D 4 HOH 64  663 663 HOH HOH A . 
D 4 HOH 65  664 664 HOH HOH A . 
D 4 HOH 66  665 665 HOH HOH A . 
D 4 HOH 67  666 666 HOH HOH A . 
D 4 HOH 68  667 667 HOH HOH A . 
D 4 HOH 69  668 668 HOH HOH A . 
D 4 HOH 70  669 669 HOH HOH A . 
D 4 HOH 71  670 670 HOH HOH A . 
D 4 HOH 72  671 671 HOH HOH A . 
D 4 HOH 73  672 672 HOH HOH A . 
D 4 HOH 74  673 673 HOH HOH A . 
D 4 HOH 75  674 674 HOH HOH A . 
D 4 HOH 76  675 675 HOH HOH A . 
D 4 HOH 77  676 676 HOH HOH A . 
D 4 HOH 78  677 677 HOH HOH A . 
D 4 HOH 79  678 678 HOH HOH A . 
D 4 HOH 80  679 679 HOH HOH A . 
D 4 HOH 81  680 680 HOH HOH A . 
D 4 HOH 82  681 681 HOH HOH A . 
D 4 HOH 83  682 682 HOH HOH A . 
D 4 HOH 84  683 683 HOH HOH A . 
D 4 HOH 85  684 684 HOH HOH A . 
D 4 HOH 86  685 685 HOH HOH A . 
D 4 HOH 87  686 686 HOH HOH A . 
D 4 HOH 88  687 687 HOH HOH A . 
D 4 HOH 89  688 688 HOH HOH A . 
D 4 HOH 90  689 689 HOH HOH A . 
D 4 HOH 91  690 690 HOH HOH A . 
D 4 HOH 92  691 691 HOH HOH A . 
D 4 HOH 93  692 692 HOH HOH A . 
D 4 HOH 94  693 693 HOH HOH A . 
D 4 HOH 95  694 694 HOH HOH A . 
D 4 HOH 96  695 695 HOH HOH A . 
D 4 HOH 97  696 696 HOH HOH A . 
D 4 HOH 98  697 697 HOH HOH A . 
D 4 HOH 99  698 698 HOH HOH A . 
D 4 HOH 100 699 699 HOH HOH A . 
D 4 HOH 101 700 700 HOH HOH A . 
D 4 HOH 102 701 701 HOH HOH A . 
D 4 HOH 103 702 702 HOH HOH A . 
D 4 HOH 104 703 703 HOH HOH A . 
D 4 HOH 105 704 704 HOH HOH A . 
D 4 HOH 106 705 705 HOH HOH A . 
D 4 HOH 107 706 706 HOH HOH A . 
D 4 HOH 108 707 707 HOH HOH A . 
D 4 HOH 109 708 708 HOH HOH A . 
D 4 HOH 110 709 709 HOH HOH A . 
D 4 HOH 111 710 710 HOH HOH A . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS  monomeric  1 
2 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1       A,B,C,D 
2 1,2,3,4 A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 13580 ? 
2 MORE         -113  ? 
2 'SSA (A^2)'  56000 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000    0.0000000000 1.0000000000 
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_365 -x-2,-y+1,z -1.0000000000 0.0000000000 0.0000000000 -122.1360000000 0.0000000000 
-1.0000000000 0.0000000000 191.4750000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
3 'crystal symmetry operation' 3_355 -x-2,y,-z   -1.0000000000 0.0000000000 0.0000000000 -122.1360000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000   0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_565 x,-y+1,-z   1.0000000000  0.0000000000 0.0000000000 0.0000000000    0.0000000000 
-1.0000000000 0.0000000000 191.4750000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O1B ? C ANP .   ? A ANP 500 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O   ? D HOH .   ? A HOH 668 ? 1_555 106.8 ? 
2  O1B ? C ANP .   ? A ANP 500 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O2G ? C ANP .   ? A ANP 500 ? 1_555 96.0  ? 
3  O   ? D HOH .   ? A HOH 668 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O2G ? C ANP .   ? A ANP 500 ? 1_555 107.8 ? 
4  O1B ? C ANP .   ? A ANP 500 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O   ? D HOH .   ? A HOH 667 ? 1_555 170.2 ? 
5  O   ? D HOH .   ? A HOH 668 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O   ? D HOH .   ? A HOH 667 ? 1_555 82.7  ? 
6  O2G ? C ANP .   ? A ANP 500 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O   ? D HOH .   ? A HOH 667 ? 1_555 83.1  ? 
7  O1B ? C ANP .   ? A ANP 500 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 OG1 ? A THR 169 ? A THR 169 ? 1_555 91.5  ? 
8  O   ? D HOH .   ? A HOH 668 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 OG1 ? A THR 169 ? A THR 169 ? 1_555 91.8  ? 
9  O2G ? C ANP .   ? A ANP 500 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 OG1 ? A THR 169 ? A THR 169 ? 1_555 155.8 ? 
10 O   ? D HOH .   ? A HOH 667 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 OG1 ? A THR 169 ? A THR 169 ? 1_555 85.6  ? 
11 O1B ? C ANP .   ? A ANP 500 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O   ? D HOH .   ? A HOH 673 ? 1_555 82.8  ? 
12 O   ? D HOH .   ? A HOH 668 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O   ? D HOH .   ? A HOH 673 ? 1_555 166.1 ? 
13 O2G ? C ANP .   ? A ANP 500 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O   ? D HOH .   ? A HOH 673 ? 1_555 80.4  ? 
14 O   ? D HOH .   ? A HOH 667 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O   ? D HOH .   ? A HOH 673 ? 1_555 87.4  ? 
15 OG1 ? A THR 169 ? A THR 169 ? 1_555 MG ? B MG . ? A MG 501 ? 1_555 O   ? D HOH .   ? A HOH 673 ? 1_555 77.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-03-02 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       1.0 ? 1 
HKL-2000  'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
CNS       phasing          .   ? 4 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OE2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    GLU 
_pdbx_validate_symm_contact.auth_seq_id_1     119 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OE2 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    GLU 
_pdbx_validate_symm_contact.auth_seq_id_2     119 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_365 
_pdbx_validate_symm_contact.dist              1.87 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             C 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             SER 
_pdbx_validate_rmsd_angle.auth_seq_id_1              380 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             N 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_2              381 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             PRO 
_pdbx_validate_rmsd_angle.auth_seq_id_3              381 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                128.65 
_pdbx_validate_rmsd_angle.angle_target_value         119.30 
_pdbx_validate_rmsd_angle.angle_deviation            9.35 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.50 
_pdbx_validate_rmsd_angle.linker_flag                Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 62  ? ? -75.37  20.92   
2  1 THR A 65  ? ? -94.78  32.86   
3  1 THR A 142 ? ? -124.20 -76.90  
4  1 ASP A 175 ? ? -59.93  103.61  
5  1 ASN A 206 ? ? -63.02  5.61    
6  1 LYS A 230 ? ? 51.80   15.06   
7  1 ASP A 238 ? ? -58.17  -155.30 
8  1 SER A 281 ? ? 172.35  151.96  
9  1 SER A 282 ? ? -64.94  -114.13 
10 1 ARG A 283 ? ? 74.95   -32.06  
11 1 THR A 294 ? ? -122.28 -58.87  
12 1 MET A 325 ? ? -80.29  41.03   
13 1 ARG A 354 ? ? 79.78   78.03   
14 1 GLU A 355 ? ? -49.61  164.48  
15 1 ASN A 370 ? ? -101.51 63.44   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 346 ? CG  ? A GLN 346 CG  
2  1 Y 1 A GLN 346 ? CD  ? A GLN 346 CD  
3  1 Y 1 A GLN 346 ? OE1 ? A GLN 346 OE1 
4  1 Y 1 A GLN 346 ? NE2 ? A GLN 346 NE2 
5  1 Y 1 A ARG 354 ? CG  ? A ARG 354 CG  
6  1 Y 1 A ARG 354 ? CD  ? A ARG 354 CD  
7  1 Y 1 A ARG 354 ? NE  ? A ARG 354 NE  
8  1 Y 1 A ARG 354 ? CZ  ? A ARG 354 CZ  
9  1 Y 1 A ARG 354 ? NH1 ? A ARG 354 NH1 
10 1 Y 1 A ARG 354 ? NH2 ? A ARG 354 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 1   ? A SER 1   
2  1 Y 1 A VAL 2   ? A VAL 2   
3  1 Y 1 A ARG 3   ? A ARG 3   
4  1 Y 1 A ARG 4   ? A ARG 4   
5  1 Y 1 A LYS 5   ? A LYS 5   
6  1 Y 1 A SER 6   ? A SER 6   
7  1 Y 1 A CYS 7   ? A CYS 7   
8  1 Y 1 A ILE 8   ? A ILE 8   
9  1 Y 1 A VAL 9   ? A VAL 9   
10 1 Y 1 A LYS 10  ? A LYS 10  
11 1 Y 1 A GLU 11  ? A GLU 11  
12 1 Y 1 A MET 12  ? A MET 12  
13 1 Y 1 A GLU 13  ? A GLU 13  
14 1 Y 1 A LYS 14  ? A LYS 14  
15 1 Y 1 A MET 15  ? A MET 15  
16 1 Y 1 A LYS 16  ? A LYS 16  
17 1 Y 1 A ASN 17  ? A ASN 17  
18 1 Y 1 A LYS 18  ? A LYS 18  
19 1 Y 1 A ARG 19  ? A ARG 19  
20 1 Y 1 A GLU 20  ? A GLU 20  
21 1 Y 1 A GLU 21  ? A GLU 21  
22 1 Y 1 A LYS 22  ? A LYS 22  
23 1 Y 1 A ARG 23  ? A ARG 23  
24 1 Y 1 A ALA 24  ? A ALA 24  
25 1 Y 1 A GLN 25  ? A GLN 25  
26 1 Y 1 A ASN 26  ? A ASN 26  
27 1 Y 1 A SER 27  ? A SER 27  
28 1 Y 1 A GLU 28  ? A GLU 28  
29 1 Y 1 A LEU 29  ? A LEU 29  
30 1 Y 1 A ARG 30  ? A ARG 30  
31 1 Y 1 A ILE 31  ? A ILE 31  
32 1 Y 1 A LYS 32  ? A LYS 32  
33 1 Y 1 A ARG 33  ? A ARG 33  
34 1 Y 1 A ALA 34  ? A ALA 34  
35 1 Y 1 A GLN 35  ? A GLN 35  
36 1 Y 1 A GLU 36  ? A GLU 36  
37 1 Y 1 A TYR 37  ? A TYR 37  
38 1 Y 1 A ASP 38  ? A ASP 38  
39 1 Y 1 A SER 39  ? A SER 39  
40 1 Y 1 A SER 40  ? A SER 40  
41 1 Y 1 A PHE 41  ? A PHE 41  
42 1 Y 1 A SER 177 ? A SER 177 
43 1 Y 1 A GLY 178 ? A GLY 178 
44 1 Y 1 A LYS 179 ? A LYS 179 
45 1 Y 1 A SER 180 ? A SER 180 
46 1 Y 1 A SER 272 ? A SER 272 
47 1 Y 1 A GLY 273 ? A GLY 273 
48 1 Y 1 A GLN 274 ? A GLN 274 
49 1 Y 1 A THR 275 ? A THR 275 
50 1 Y 1 A PHE 276 ? A PHE 276 
51 1 Y 1 A ALA 277 ? A ALA 277 
52 1 Y 1 A ASN 278 ? A ASN 278 
53 1 Y 1 A SER 279 ? A SER 279 
54 1 Y 1 A ARG 312 ? A ARG 312 
55 1 Y 1 A GLY 313 ? A GLY 313 
56 1 Y 1 A ALA 314 ? A ALA 314 
57 1 Y 1 A ASP 315 ? A ASP 315 
58 1 Y 1 A THR 316 ? A THR 316 
59 1 Y 1 A SER 317 ? A SER 317 
60 1 Y 1 A SER 318 ? A SER 318 
61 1 Y 1 A ALA 319 ? A ALA 319 
62 1 Y 1 A ASP 320 ? A ASP 320 
63 1 Y 1 A ARG 321 ? A ARG 321 
64 1 Y 1 A GLN 322 ? A GLN 322 
65 1 Y 1 A THR 323 ? A THR 323 
66 1 Y 1 A ASN 347 ? A ASN 347 
67 1 Y 1 A LYS 348 ? A LYS 348 
68 1 Y 1 A ALA 349 ? A ALA 349 
69 1 Y 1 A HIS 350 ? A HIS 350 
70 1 Y 1 A THR 351 ? A THR 351 
71 1 Y 1 A PRO 352 ? A PRO 352 
72 1 Y 1 A HIS 404 ? A HIS 404 
73 1 Y 1 A HIS 405 ? A HIS 405 
74 1 Y 1 A HIS 406 ? A HIS 406 
75 1 Y 1 A HIS 407 ? A HIS 407 
76 1 Y 1 A HIS 408 ? A HIS 408 
77 1 Y 1 A HIS 409 ? A HIS 409 
78 1 Y 1 A HIS 410 ? A HIS 410 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'                               MG  
3 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ANP 
4 water                                         HOH 
#