data_1VA1
# 
_entry.id   1VA1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1VA1         
RCSB  RCSB006394   
WWPDB D_1000006394 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1VA2 'The same protein, Zinc Finger 2 domain' unspecified 
PDB 1VA3 'The same protein, Zinc Finger 3 domain' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1VA1 
_pdbx_database_status.recvd_initial_deposition_date   2004-02-07 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Oka, S.'       1 
'Shiraishi, Y.' 2 
'Yoshida, T.'   3 
'Ohkubo, T.'    4 
'Sugiura, Y.'   5 
'Kobayashi, Y.' 6 
# 
_citation.id                        primary 
_citation.title                     'NMR structure of transcription factor Sp1 DNA binding domain' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            43 
_citation.page_first                16027 
_citation.page_last                 16035 
_citation.year                      2004 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15609997 
_citation.pdbx_database_id_DOI      10.1021/bi048438p 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Oka, S.'       1 
primary 'Shiraishi, Y.' 2 
primary 'Yoshida, T.'   3 
primary 'Ohkubo, T.'    4 
primary 'Sugiura, Y.'   5 
primary 'Kobayashi, Y.' 6 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Transcription factor Sp1' 4308.053 1 ? ? 'Zinc finger 1' ? 
2 non-polymer syn 'ZINC ION'                 65.409   1 ? ? ?               ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGER 
_entity_poly.pdbx_seq_one_letter_code_can   MDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGER 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ASP n 
1 3  PRO n 
1 4  GLY n 
1 5  LYS n 
1 6  LYS n 
1 7  LYS n 
1 8  GLN n 
1 9  HIS n 
1 10 ILE n 
1 11 CYS n 
1 12 HIS n 
1 13 ILE n 
1 14 GLN n 
1 15 GLY n 
1 16 CYS n 
1 17 GLY n 
1 18 LYS n 
1 19 VAL n 
1 20 TYR n 
1 21 GLY n 
1 22 LYS n 
1 23 THR n 
1 24 SER n 
1 25 HIS n 
1 26 LEU n 
1 27 ARG n 
1 28 ALA n 
1 29 HIS n 
1 30 LEU n 
1 31 ARG n 
1 32 TRP n 
1 33 HIS n 
1 34 THR n 
1 35 GLY n 
1 36 GLU n 
1 37 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 SP1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pEVSp1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SP1_HUMAN 
_struct_ref.pdbx_db_accession          P08047 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   DPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGER 
_struct_ref.pdbx_align_begin           619 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1VA1 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 37 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P08047 
_struct_ref_seq.db_align_beg                  619 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  654 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       530 
_struct_ref_seq.pdbx_auth_seq_align_end       565 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1VA1 
_struct_ref_seq_dif.mon_id                       MET 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P08047 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'INITIATING METHIONINE' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_13C-separated_NOESY 
2 1 1 3D_15N-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  7.4 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '10mM Tris-d, 50mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1mM Sp1 DNA-Binding Domain U-15N/13C; 10mM Tris-d; 50mM NaCl; 1mM DTT' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.field_strength    600 
# 
_pdbx_nmr_refine.entry_id           1VA1 
_pdbx_nmr_refine.method             'torsion angle dynamics, simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1VA1 
_pdbx_nmr_details.text       'The structure was determined using triple-resonance NMR spectroscopy.' 
# 
_pdbx_nmr_ensemble.entry_id                                      1VA1 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             31 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1VA1 
_pdbx_nmr_representative.conformer_id         31 
_pdbx_nmr_representative.selection_criteria   'minimized average structure' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
CNS     1.1   'structure solution' ?                     1 
NMRPipe 2.1   processing           'F. Delaglio, et al.' 2 
NMRView 5.0.4 'data analysis'      'Bruce A. Johnson'    3 
CNS     1.1   refinement           ?                     4 
# 
_exptl.entry_id          1VA1 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1VA1 
_struct.title                     'Solution Structure of Transcription Factor Sp1 DNA Binding Domain (Zinc Finger 1)' 
_struct.pdbx_descriptor           'Transcription factor Sp1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   'minimized average' 
# 
_struct_keywords.entry_id        1VA1 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'C2H2 type Zinc finger, Transcription Factor, DNA-Binding Protein, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       LYS 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        22 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLY 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        35 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        LYS 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         550 
_struct_conf.end_auth_comp_id        GLY 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         563 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 11 SG  ? ? A ZN 100 A CYS 539 1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 16 SG  ? ? A ZN 100 A CYS 544 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 29 NE2 ? ? A ZN 100 A HIS 557 1_555 ? ? ? ? ? ? ? 2.011 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 33 NE2 ? ? A ZN 100 A HIS 561 1_555 ? ? ? ? ? ? ? 2.016 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS A 9  ? ILE A 10 ? HIS A 537 ILE A 538 
A 2 VAL A 19 ? TYR A 20 ? VAL A 547 TYR A 548 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   HIS 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    9 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    HIS 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     537 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    20 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     548 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 100' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 11 ? CYS A 539 . ? 1_555 ? 
2 AC1 4 CYS A 16 ? CYS A 544 . ? 1_555 ? 
3 AC1 4 HIS A 29 ? HIS A 557 . ? 1_555 ? 
4 AC1 4 HIS A 33 ? HIS A 561 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1VA1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1VA1 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . MET A 1 1  ? -5.228  -14.315 -8.533  1.00 0.00 ? 1   MET A N    1  
ATOM   2     C  CA   . MET A 1 1  ? -6.268  -14.355 -9.595  1.00 0.00 ? 1   MET A CA   1  
ATOM   3     C  C    . MET A 1 1  ? -6.256  -13.076 -10.427 1.00 0.00 ? 1   MET A C    1  
ATOM   4     O  O    . MET A 1 1  ? -6.489  -11.984 -9.908  1.00 0.00 ? 1   MET A O    1  
ATOM   5     C  CB   . MET A 1 1  ? -7.634  -14.540 -8.932  1.00 0.00 ? 1   MET A CB   1  
ATOM   6     C  CG   . MET A 1 1  ? -8.020  -13.399 -8.004  1.00 0.00 ? 1   MET A CG   1  
ATOM   7     S  SD   . MET A 1 1  ? -9.291  -13.870 -6.816  1.00 0.00 ? 1   MET A SD   1  
ATOM   8     C  CE   . MET A 1 1  ? -8.538  -13.330 -5.283  1.00 0.00 ? 1   MET A CE   1  
ATOM   9     H  H1   . MET A 1 1  ? -5.266  -13.377 -8.087  1.00 0.00 ? 1   MET A H1   1  
ATOM   10    H  H2   . MET A 1 1  ? -4.306  -14.479 -8.987  1.00 0.00 ? 1   MET A H2   1  
ATOM   11    H  H3   . MET A 1 1  ? -5.447  -15.065 -7.847  1.00 0.00 ? 1   MET A H3   1  
ATOM   12    H  HA   . MET A 1 1  ? -6.069  -15.197 -10.240 1.00 0.00 ? 1   MET A HA   1  
ATOM   13    H  HB2  . MET A 1 1  ? -8.387  -14.620 -9.702  1.00 0.00 ? 1   MET A HB2  1  
ATOM   14    H  HB3  . MET A 1 1  ? -7.622  -15.454 -8.357  1.00 0.00 ? 1   MET A HB3  1  
ATOM   15    H  HG2  . MET A 1 1  ? -7.142  -13.081 -7.463  1.00 0.00 ? 1   MET A HG2  1  
ATOM   16    H  HG3  . MET A 1 1  ? -8.390  -12.578 -8.601  1.00 0.00 ? 1   MET A HG3  1  
ATOM   17    H  HE1  . MET A 1 1  ? -9.251  -12.750 -4.716  1.00 0.00 ? 1   MET A HE1  1  
ATOM   18    H  HE2  . MET A 1 1  ? -7.672  -12.722 -5.502  1.00 0.00 ? 1   MET A HE2  1  
ATOM   19    H  HE3  . MET A 1 1  ? -8.236  -14.192 -4.707  1.00 0.00 ? 1   MET A HE3  1  
ATOM   20    N  N    . ASP A 1 2  ? -5.984  -13.220 -11.719 1.00 0.00 ? 530 ASP A N    1  
ATOM   21    C  CA   . ASP A 1 2  ? -5.942  -12.077 -12.624 1.00 0.00 ? 530 ASP A CA   1  
ATOM   22    C  C    . ASP A 1 2  ? -7.339  -11.491 -12.826 1.00 0.00 ? 530 ASP A C    1  
ATOM   23    O  O    . ASP A 1 2  ? -7.582  -10.327 -12.509 1.00 0.00 ? 530 ASP A O    1  
ATOM   24    C  CB   . ASP A 1 2  ? -5.345  -12.489 -13.972 1.00 0.00 ? 530 ASP A CB   1  
ATOM   25    C  CG   . ASP A 1 2  ? -4.083  -11.718 -14.306 1.00 0.00 ? 530 ASP A CG   1  
ATOM   26    O  OD1  . ASP A 1 2  ? -3.044  -11.971 -13.660 1.00 0.00 ? 530 ASP A OD1  1  
ATOM   27    O  OD2  . ASP A 1 2  ? -4.134  -10.860 -15.213 1.00 0.00 ? 530 ASP A OD2  1  
ATOM   28    H  H    . ASP A 1 2  ? -5.807  -14.117 -12.074 1.00 0.00 ? 530 ASP A H    1  
ATOM   29    H  HA   . ASP A 1 2  ? -5.311  -11.325 -12.176 1.00 0.00 ? 530 ASP A HA   1  
ATOM   30    H  HB2  . ASP A 1 2  ? -5.104  -13.541 -13.946 1.00 0.00 ? 530 ASP A HB2  1  
ATOM   31    H  HB3  . ASP A 1 2  ? -6.071  -12.311 -14.753 1.00 0.00 ? 530 ASP A HB3  1  
ATOM   32    N  N    . PRO A 1 3  ? -8.277  -12.293 -13.359 1.00 0.00 ? 531 PRO A N    1  
ATOM   33    C  CA   . PRO A 1 3  ? -9.652  -11.845 -13.601 1.00 0.00 ? 531 PRO A CA   1  
ATOM   34    C  C    . PRO A 1 3  ? -10.444 -11.679 -12.309 1.00 0.00 ? 531 PRO A C    1  
ATOM   35    O  O    . PRO A 1 3  ? -9.900  -11.820 -11.214 1.00 0.00 ? 531 PRO A O    1  
ATOM   36    C  CB   . PRO A 1 3  ? -10.245 -12.969 -14.452 1.00 0.00 ? 531 PRO A CB   1  
ATOM   37    C  CG   . PRO A 1 3  ? -9.464  -14.179 -14.076 1.00 0.00 ? 531 PRO A CG   1  
ATOM   38    C  CD   . PRO A 1 3  ? -8.073  -13.697 -13.767 1.00 0.00 ? 531 PRO A CD   1  
ATOM   39    H  HA   . PRO A 1 3  ? -9.673  -10.919 -14.157 1.00 0.00 ? 531 PRO A HA   1  
ATOM   40    H  HB2  . PRO A 1 3  ? -11.294 -13.085 -14.218 1.00 0.00 ? 531 PRO A HB2  1  
ATOM   41    H  HB3  . PRO A 1 3  ? -10.128 -12.733 -15.499 1.00 0.00 ? 531 PRO A HB3  1  
ATOM   42    H  HG2  . PRO A 1 3  ? -9.902  -14.643 -13.205 1.00 0.00 ? 531 PRO A HG2  1  
ATOM   43    H  HG3  . PRO A 1 3  ? -9.444  -14.874 -14.903 1.00 0.00 ? 531 PRO A HG3  1  
ATOM   44    H  HD2  . PRO A 1 3  ? -7.645  -14.274 -12.961 1.00 0.00 ? 531 PRO A HD2  1  
ATOM   45    H  HD3  . PRO A 1 3  ? -7.449  -13.755 -14.647 1.00 0.00 ? 531 PRO A HD3  1  
ATOM   46    N  N    . GLY A 1 4  ? -11.731 -11.377 -12.445 1.00 0.00 ? 532 GLY A N    1  
ATOM   47    C  CA   . GLY A 1 4  ? -12.577 -11.197 -11.280 1.00 0.00 ? 532 GLY A CA   1  
ATOM   48    C  C    . GLY A 1 4  ? -12.522 -9.782  -10.737 1.00 0.00 ? 532 GLY A C    1  
ATOM   49    O  O    . GLY A 1 4  ? -11.981 -8.883  -11.381 1.00 0.00 ? 532 GLY A O    1  
ATOM   50    H  H    . GLY A 1 4  ? -12.109 -11.276 -13.343 1.00 0.00 ? 532 GLY A H    1  
ATOM   51    H  HA2  . GLY A 1 4  ? -13.597 -11.427 -11.550 1.00 0.00 ? 532 GLY A HA2  1  
ATOM   52    H  HA3  . GLY A 1 4  ? -12.257 -11.880 -10.507 1.00 0.00 ? 532 GLY A HA3  1  
ATOM   53    N  N    . LYS A 1 5  ? -13.083 -9.585  -9.549  1.00 0.00 ? 533 LYS A N    1  
ATOM   54    C  CA   . LYS A 1 5  ? -13.096 -8.270  -8.918  1.00 0.00 ? 533 LYS A CA   1  
ATOM   55    C  C    . LYS A 1 5  ? -11.680 -7.813  -8.583  1.00 0.00 ? 533 LYS A C    1  
ATOM   56    O  O    . LYS A 1 5  ? -10.881 -8.580  -8.046  1.00 0.00 ? 533 LYS A O    1  
ATOM   57    C  CB   . LYS A 1 5  ? -13.949 -8.298  -7.649  1.00 0.00 ? 533 LYS A CB   1  
ATOM   58    C  CG   . LYS A 1 5  ? -14.666 -6.988  -7.369  1.00 0.00 ? 533 LYS A CG   1  
ATOM   59    C  CD   . LYS A 1 5  ? -14.985 -6.832  -5.890  1.00 0.00 ? 533 LYS A CD   1  
ATOM   60    C  CE   . LYS A 1 5  ? -16.359 -6.218  -5.676  1.00 0.00 ? 533 LYS A CE   1  
ATOM   61    N  NZ   . LYS A 1 5  ? -16.343 -5.175  -4.614  1.00 0.00 ? 533 LYS A NZ   1  
ATOM   62    H  H    . LYS A 1 5  ? -13.498 -10.341 -9.084  1.00 0.00 ? 533 LYS A H    1  
ATOM   63    H  HA   . LYS A 1 5  ? -13.530 -7.572  -9.618  1.00 0.00 ? 533 LYS A HA   1  
ATOM   64    H  HB2  . LYS A 1 5  ? -14.692 -9.076  -7.746  1.00 0.00 ? 533 LYS A HB2  1  
ATOM   65    H  HB3  . LYS A 1 5  ? -13.313 -8.523  -6.806  1.00 0.00 ? 533 LYS A HB3  1  
ATOM   66    H  HG2  . LYS A 1 5  ? -14.034 -6.169  -7.678  1.00 0.00 ? 533 LYS A HG2  1  
ATOM   67    H  HG3  . LYS A 1 5  ? -15.588 -6.965  -7.931  1.00 0.00 ? 533 LYS A HG3  1  
ATOM   68    H  HD2  . LYS A 1 5  ? -14.960 -7.805  -5.422  1.00 0.00 ? 533 LYS A HD2  1  
ATOM   69    H  HD3  . LYS A 1 5  ? -14.240 -6.193  -5.437  1.00 0.00 ? 533 LYS A HD3  1  
ATOM   70    H  HE2  . LYS A 1 5  ? -16.688 -5.770  -6.602  1.00 0.00 ? 533 LYS A HE2  1  
ATOM   71    H  HE3  . LYS A 1 5  ? -17.048 -7.000  -5.391  1.00 0.00 ? 533 LYS A HE3  1  
ATOM   72    H  HZ1  . LYS A 1 5  ? -15.539 -5.331  -3.972  1.00 0.00 ? 533 LYS A HZ1  1  
ATOM   73    H  HZ2  . LYS A 1 5  ? -17.224 -5.212  -4.063  1.00 0.00 ? 533 LYS A HZ2  1  
ATOM   74    H  HZ3  . LYS A 1 5  ? -16.254 -4.231  -5.041  1.00 0.00 ? 533 LYS A HZ3  1  
ATOM   75    N  N    . LYS A 1 6  ? -11.376 -6.560  -8.903  1.00 0.00 ? 534 LYS A N    1  
ATOM   76    C  CA   . LYS A 1 6  ? -10.057 -6.001  -8.635  1.00 0.00 ? 534 LYS A CA   1  
ATOM   77    C  C    . LYS A 1 6  ? -10.009 -5.355  -7.254  1.00 0.00 ? 534 LYS A C    1  
ATOM   78    O  O    . LYS A 1 6  ? -11.042 -4.987  -6.694  1.00 0.00 ? 534 LYS A O    1  
ATOM   79    C  CB   . LYS A 1 6  ? -9.689  -4.971  -9.705  1.00 0.00 ? 534 LYS A CB   1  
ATOM   80    C  CG   . LYS A 1 6  ? -9.015  -5.576  -10.926 1.00 0.00 ? 534 LYS A CG   1  
ATOM   81    C  CD   . LYS A 1 6  ? -10.011 -6.314  -11.805 1.00 0.00 ? 534 LYS A CD   1  
ATOM   82    C  CE   . LYS A 1 6  ? -10.667 -5.379  -12.809 1.00 0.00 ? 534 LYS A CE   1  
ATOM   83    N  NZ   . LYS A 1 6  ? -11.694 -4.511  -12.171 1.00 0.00 ? 534 LYS A NZ   1  
ATOM   84    H  H    . LYS A 1 6  ? -12.056 -5.997  -9.330  1.00 0.00 ? 534 LYS A H    1  
ATOM   85    H  HA   . LYS A 1 6  ? -9.342  -6.809  -8.667  1.00 0.00 ? 534 LYS A HA   1  
ATOM   86    H  HB2  . LYS A 1 6  ? -10.589 -4.469  -10.030 1.00 0.00 ? 534 LYS A HB2  1  
ATOM   87    H  HB3  . LYS A 1 6  ? -9.018  -4.243  -9.273  1.00 0.00 ? 534 LYS A HB3  1  
ATOM   88    H  HG2  . LYS A 1 6  ? -8.558  -4.785  -11.502 1.00 0.00 ? 534 LYS A HG2  1  
ATOM   89    H  HG3  . LYS A 1 6  ? -8.254  -6.270  -10.598 1.00 0.00 ? 534 LYS A HG3  1  
ATOM   90    H  HD2  . LYS A 1 6  ? -9.494  -7.095  -12.341 1.00 0.00 ? 534 LYS A HD2  1  
ATOM   91    H  HD3  . LYS A 1 6  ? -10.776 -6.749  -11.178 1.00 0.00 ? 534 LYS A HD3  1  
ATOM   92    H  HE2  . LYS A 1 6  ? -9.905  -4.755  -13.251 1.00 0.00 ? 534 LYS A HE2  1  
ATOM   93    H  HE3  . LYS A 1 6  ? -11.137 -5.973  -13.580 1.00 0.00 ? 534 LYS A HE3  1  
ATOM   94    H  HZ1  . LYS A 1 6  ? -12.425 -4.252  -12.865 1.00 0.00 ? 534 LYS A HZ1  1  
ATOM   95    H  HZ2  . LYS A 1 6  ? -11.253 -3.642  -11.808 1.00 0.00 ? 534 LYS A HZ2  1  
ATOM   96    H  HZ3  . LYS A 1 6  ? -12.146 -5.013  -11.380 1.00 0.00 ? 534 LYS A HZ3  1  
ATOM   97    N  N    . LYS A 1 7  ? -8.804  -5.222  -6.710  1.00 0.00 ? 535 LYS A N    1  
ATOM   98    C  CA   . LYS A 1 7  ? -8.621  -4.621  -5.394  1.00 0.00 ? 535 LYS A CA   1  
ATOM   99    C  C    . LYS A 1 7  ? -7.536  -3.550  -5.430  1.00 0.00 ? 535 LYS A C    1  
ATOM   100   O  O    . LYS A 1 7  ? -6.509  -3.715  -6.090  1.00 0.00 ? 535 LYS A O    1  
ATOM   101   C  CB   . LYS A 1 7  ? -8.261  -5.695  -4.365  1.00 0.00 ? 535 LYS A CB   1  
ATOM   102   C  CG   . LYS A 1 7  ? -8.930  -5.494  -3.016  1.00 0.00 ? 535 LYS A CG   1  
ATOM   103   C  CD   . LYS A 1 7  ? -8.733  -6.700  -2.111  1.00 0.00 ? 535 LYS A CD   1  
ATOM   104   C  CE   . LYS A 1 7  ? -9.712  -6.691  -0.949  1.00 0.00 ? 535 LYS A CE   1  
ATOM   105   N  NZ   . LYS A 1 7  ? -9.622  -7.935  -0.136  1.00 0.00 ? 535 LYS A NZ   1  
ATOM   106   H  H    . LYS A 1 7  ? -8.018  -5.535  -7.205  1.00 0.00 ? 535 LYS A H    1  
ATOM   107   H  HA   . LYS A 1 7  ? -9.555  -4.160  -5.108  1.00 0.00 ? 535 LYS A HA   1  
ATOM   108   H  HB2  . LYS A 1 7  ? -8.559  -6.659  -4.750  1.00 0.00 ? 535 LYS A HB2  1  
ATOM   109   H  HB3  . LYS A 1 7  ? -7.191  -5.692  -4.217  1.00 0.00 ? 535 LYS A HB3  1  
ATOM   110   H  HG2  . LYS A 1 7  ? -8.503  -4.625  -2.538  1.00 0.00 ? 535 LYS A HG2  1  
ATOM   111   H  HG3  . LYS A 1 7  ? -9.988  -5.339  -3.169  1.00 0.00 ? 535 LYS A HG3  1  
ATOM   112   H  HD2  . LYS A 1 7  ? -8.883  -7.599  -2.688  1.00 0.00 ? 535 LYS A HD2  1  
ATOM   113   H  HD3  . LYS A 1 7  ? -7.725  -6.684  -1.721  1.00 0.00 ? 535 LYS A HD3  1  
ATOM   114   H  HE2  . LYS A 1 7  ? -9.494  -5.843  -0.317  1.00 0.00 ? 535 LYS A HE2  1  
ATOM   115   H  HE3  . LYS A 1 7  ? -10.715 -6.598  -1.341  1.00 0.00 ? 535 LYS A HE3  1  
ATOM   116   H  HZ1  . LYS A 1 7  ? -10.092 -8.720  -0.631  1.00 0.00 ? 535 LYS A HZ1  1  
ATOM   117   H  HZ2  . LYS A 1 7  ? -10.084 -7.795  0.785   1.00 0.00 ? 535 LYS A HZ2  1  
ATOM   118   H  HZ3  . LYS A 1 7  ? -8.625  -8.186  0.023   1.00 0.00 ? 535 LYS A HZ3  1  
ATOM   119   N  N    . GLN A 1 8  ? -7.769  -2.453  -4.718  1.00 0.00 ? 536 GLN A N    1  
ATOM   120   C  CA   . GLN A 1 8  ? -6.811  -1.354  -4.669  1.00 0.00 ? 536 GLN A CA   1  
ATOM   121   C  C    . GLN A 1 8  ? -5.937  -1.450  -3.422  1.00 0.00 ? 536 GLN A C    1  
ATOM   122   O  O    . GLN A 1 8  ? -6.327  -2.053  -2.423  1.00 0.00 ? 536 GLN A O    1  
ATOM   123   C  CB   . GLN A 1 8  ? -7.542  -0.011  -4.692  1.00 0.00 ? 536 GLN A CB   1  
ATOM   124   C  CG   . GLN A 1 8  ? -8.337  0.228   -5.965  1.00 0.00 ? 536 GLN A CG   1  
ATOM   125   C  CD   . GLN A 1 8  ? -9.831  0.072   -5.759  1.00 0.00 ? 536 GLN A CD   1  
ATOM   126   O  OE1  . GLN A 1 8  ? -10.389 -1.005  -5.971  1.00 0.00 ? 536 GLN A OE1  1  
ATOM   127   N  NE2  . GLN A 1 8  ? -10.487 1.149   -5.343  1.00 0.00 ? 536 GLN A NE2  1  
ATOM   128   H  H    . GLN A 1 8  ? -8.606  -2.380  -4.213  1.00 0.00 ? 536 GLN A H    1  
ATOM   129   H  HA   . GLN A 1 8  ? -6.181  -1.426  -5.542  1.00 0.00 ? 536 GLN A HA   1  
ATOM   130   H  HB2  . GLN A 1 8  ? -8.223  0.030   -3.855  1.00 0.00 ? 536 GLN A HB2  1  
ATOM   131   H  HB3  . GLN A 1 8  ? -6.816  0.783   -4.592  1.00 0.00 ? 536 GLN A HB3  1  
ATOM   132   H  HG2  . GLN A 1 8  ? -8.141  1.231   -6.314  1.00 0.00 ? 536 GLN A HG2  1  
ATOM   133   H  HG3  . GLN A 1 8  ? -8.015  -0.481  -6.713  1.00 0.00 ? 536 GLN A HG3  1  
ATOM   134   H  HE21 . GLN A 1 8  ? -9.977  1.973   -5.195  1.00 0.00 ? 536 GLN A HE21 1  
ATOM   135   H  HE22 . GLN A 1 8  ? -11.454 1.076   -5.201  1.00 0.00 ? 536 GLN A HE22 1  
ATOM   136   N  N    . HIS A 1 9  ? -4.753  -0.849  -3.489  1.00 0.00 ? 537 HIS A N    1  
ATOM   137   C  CA   . HIS A 1 9  ? -3.823  -0.866  -2.365  1.00 0.00 ? 537 HIS A CA   1  
ATOM   138   C  C    . HIS A 1 9  ? -3.966  0.397   -1.523  1.00 0.00 ? 537 HIS A C    1  
ATOM   139   O  O    . HIS A 1 9  ? -3.467  1.460   -1.891  1.00 0.00 ? 537 HIS A O    1  
ATOM   140   C  CB   . HIS A 1 9  ? -2.385  -0.999  -2.868  1.00 0.00 ? 537 HIS A CB   1  
ATOM   141   C  CG   . HIS A 1 9  ? -2.115  -2.291  -3.574  1.00 0.00 ? 537 HIS A CG   1  
ATOM   142   N  ND1  . HIS A 1 9  ? -3.095  -3.188  -3.937  1.00 0.00 ? 537 HIS A ND1  1  
ATOM   143   C  CD2  . HIS A 1 9  ? -0.940  -2.834  -3.986  1.00 0.00 ? 537 HIS A CD2  1  
ATOM   144   C  CE1  . HIS A 1 9  ? -2.500  -4.224  -4.544  1.00 0.00 ? 537 HIS A CE1  1  
ATOM   145   N  NE2  . HIS A 1 9  ? -1.193  -4.058  -4.600  1.00 0.00 ? 537 HIS A NE2  1  
ATOM   146   H  H    . HIS A 1 9  ? -4.498  -0.384  -4.313  1.00 0.00 ? 537 HIS A H    1  
ATOM   147   H  HA   . HIS A 1 9  ? -4.061  -1.722  -1.752  1.00 0.00 ? 537 HIS A HA   1  
ATOM   148   H  HB2  . HIS A 1 9  ? -2.176  -0.195  -3.558  1.00 0.00 ? 537 HIS A HB2  1  
ATOM   149   H  HB3  . HIS A 1 9  ? -1.709  -0.930  -2.028  1.00 0.00 ? 537 HIS A HB3  1  
ATOM   150   H  HD1  . HIS A 1 9  ? -4.057  -3.086  -3.779  1.00 0.00 ? 537 HIS A HD1  1  
ATOM   151   H  HD2  . HIS A 1 9  ? 0.039   -2.395  -3.863  1.00 0.00 ? 537 HIS A HD2  1  
ATOM   152   H  HE1  . HIS A 1 9  ? -3.024  -5.083  -4.937  1.00 0.00 ? 537 HIS A HE1  1  
ATOM   153   N  N    . ILE A 1 10 ? -4.650  0.272   -0.390  1.00 0.00 ? 538 ILE A N    1  
ATOM   154   C  CA   . ILE A 1 10 ? -4.858  1.404   0.506   1.00 0.00 ? 538 ILE A CA   1  
ATOM   155   C  C    . ILE A 1 10 ? -4.099  1.216   1.815   1.00 0.00 ? 538 ILE A C    1  
ATOM   156   O  O    . ILE A 1 10 ? -3.939  0.094   2.295   1.00 0.00 ? 538 ILE A O    1  
ATOM   157   C  CB   . ILE A 1 10 ? -6.353  1.606   0.817   1.00 0.00 ? 538 ILE A CB   1  
ATOM   158   C  CG1  . ILE A 1 10 ? -7.172  1.599   -0.475  1.00 0.00 ? 538 ILE A CG1  1  
ATOM   159   C  CG2  . ILE A 1 10 ? -6.565  2.906   1.578   1.00 0.00 ? 538 ILE A CG2  1  
ATOM   160   C  CD1  . ILE A 1 10 ? -6.807  2.716   -1.428  1.00 0.00 ? 538 ILE A CD1  1  
ATOM   161   H  H    . ILE A 1 10 ? -5.024  -0.601  -0.151  1.00 0.00 ? 538 ILE A H    1  
ATOM   162   H  HA   . ILE A 1 10 ? -4.491  2.292   0.012   1.00 0.00 ? 538 ILE A HA   1  
ATOM   163   H  HB   . ILE A 1 10 ? -6.680  0.792   1.447   1.00 0.00 ? 538 ILE A HB   1  
ATOM   164   H  HG12 . ILE A 1 10 ? -7.016  0.662   -0.988  1.00 0.00 ? 538 ILE A HG12 1  
ATOM   165   H  HG13 . ILE A 1 10 ? -8.220  1.699   -0.230  1.00 0.00 ? 538 ILE A HG13 1  
ATOM   166   H  HG21 . ILE A 1 10 ? -7.503  3.350   1.278   1.00 0.00 ? 538 ILE A HG21 1  
ATOM   167   H  HG22 . ILE A 1 10 ? -5.757  3.588   1.359   1.00 0.00 ? 538 ILE A HG22 1  
ATOM   168   H  HG23 . ILE A 1 10 ? -6.587  2.703   2.639   1.00 0.00 ? 538 ILE A HG23 1  
ATOM   169   H  HD11 . ILE A 1 10 ? -7.679  3.003   -1.997  1.00 0.00 ? 538 ILE A HD11 1  
ATOM   170   H  HD12 . ILE A 1 10 ? -6.034  2.376   -2.101  1.00 0.00 ? 538 ILE A HD12 1  
ATOM   171   H  HD13 . ILE A 1 10 ? -6.448  3.565   -0.866  1.00 0.00 ? 538 ILE A HD13 1  
ATOM   172   N  N    . CYS A 1 11 ? -3.634  2.321   2.387   1.00 0.00 ? 539 CYS A N    1  
ATOM   173   C  CA   . CYS A 1 11 ? -2.892  2.278   3.641   1.00 0.00 ? 539 CYS A CA   1  
ATOM   174   C  C    . CYS A 1 11 ? -3.786  1.813   4.787   1.00 0.00 ? 539 CYS A C    1  
ATOM   175   O  O    . CYS A 1 11 ? -4.514  2.608   5.381   1.00 0.00 ? 539 CYS A O    1  
ATOM   176   C  CB   . CYS A 1 11 ? -2.307  3.657   3.959   1.00 0.00 ? 539 CYS A CB   1  
ATOM   177   S  SG   . CYS A 1 11 ? -0.527  3.651   4.272   1.00 0.00 ? 539 CYS A SG   1  
ATOM   178   H  H    . CYS A 1 11 ? -3.794  3.187   1.956   1.00 0.00 ? 539 CYS A H    1  
ATOM   179   H  HA   . CYS A 1 11 ? -2.083  1.573   3.523   1.00 0.00 ? 539 CYS A HA   1  
ATOM   180   H  HB2  . CYS A 1 11 ? -2.489  4.317   3.125   1.00 0.00 ? 539 CYS A HB2  1  
ATOM   181   H  HB3  . CYS A 1 11 ? -2.795  4.055   4.838   1.00 0.00 ? 539 CYS A HB3  1  
ATOM   182   N  N    . HIS A 1 12 ? -3.725  0.520   5.091   1.00 0.00 ? 540 HIS A N    1  
ATOM   183   C  CA   . HIS A 1 12 ? -4.529  -0.051  6.165   1.00 0.00 ? 540 HIS A CA   1  
ATOM   184   C  C    . HIS A 1 12 ? -4.213  0.621   7.498   1.00 0.00 ? 540 HIS A C    1  
ATOM   185   O  O    . HIS A 1 12 ? -5.073  0.724   8.372   1.00 0.00 ? 540 HIS A O    1  
ATOM   186   C  CB   . HIS A 1 12 ? -4.284  -1.557  6.269   1.00 0.00 ? 540 HIS A CB   1  
ATOM   187   C  CG   . HIS A 1 12 ? -5.243  -2.376  5.462   1.00 0.00 ? 540 HIS A CG   1  
ATOM   188   N  ND1  . HIS A 1 12 ? -5.196  -2.483  4.090   1.00 0.00 ? 540 HIS A ND1  1  
ATOM   189   C  CD2  . HIS A 1 12 ? -6.291  -3.141  5.862   1.00 0.00 ? 540 HIS A CD2  1  
ATOM   190   C  CE1  . HIS A 1 12 ? -6.196  -3.290  3.706   1.00 0.00 ? 540 HIS A CE1  1  
ATOM   191   N  NE2  . HIS A 1 12 ? -6.890  -3.716  4.744   1.00 0.00 ? 540 HIS A NE2  1  
ATOM   192   H  H    . HIS A 1 12 ? -3.125  -0.063  4.581   1.00 0.00 ? 540 HIS A H    1  
ATOM   193   H  HA   . HIS A 1 12 ? -5.569  0.120   5.928   1.00 0.00 ? 540 HIS A HA   1  
ATOM   194   H  HB2  . HIS A 1 12 ? -3.286  -1.777  5.921   1.00 0.00 ? 540 HIS A HB2  1  
ATOM   195   H  HB3  . HIS A 1 12 ? -4.374  -1.859  7.302   1.00 0.00 ? 540 HIS A HB3  1  
ATOM   196   H  HD1  . HIS A 1 12 ? -4.548  -2.047  3.499   1.00 0.00 ? 540 HIS A HD1  1  
ATOM   197   H  HD2  . HIS A 1 12 ? -6.618  -3.286  6.881   1.00 0.00 ? 540 HIS A HD2  1  
ATOM   198   H  HE1  . HIS A 1 12 ? -6.405  -3.557  2.681   1.00 0.00 ? 540 HIS A HE1  1  
ATOM   199   N  N    . ILE A 1 13 ? -2.973  1.076   7.646   1.00 0.00 ? 541 ILE A N    1  
ATOM   200   C  CA   . ILE A 1 13 ? -2.543  1.737   8.872   1.00 0.00 ? 541 ILE A CA   1  
ATOM   201   C  C    . ILE A 1 13 ? -3.348  3.008   9.123   1.00 0.00 ? 541 ILE A C    1  
ATOM   202   O  O    . ILE A 1 13 ? -3.479  3.856   8.240   1.00 0.00 ? 541 ILE A O    1  
ATOM   203   C  CB   . ILE A 1 13 ? -1.044  2.093   8.823   1.00 0.00 ? 541 ILE A CB   1  
ATOM   204   C  CG1  . ILE A 1 13 ? -0.220  0.874   8.400   1.00 0.00 ? 541 ILE A CG1  1  
ATOM   205   C  CG2  . ILE A 1 13 ? -0.579  2.613   10.176  1.00 0.00 ? 541 ILE A CG2  1  
ATOM   206   C  CD1  . ILE A 1 13 ? 0.419   1.021   7.036   1.00 0.00 ? 541 ILE A CD1  1  
ATOM   207   H  H    . ILE A 1 13 ? -2.331  0.964   6.914   1.00 0.00 ? 541 ILE A H    1  
ATOM   208   H  HA   . ILE A 1 13 ? -2.703  1.053   9.693   1.00 0.00 ? 541 ILE A HA   1  
ATOM   209   H  HB   . ILE A 1 13 ? -0.908  2.880   8.097   1.00 0.00 ? 541 ILE A HB   1  
ATOM   210   H  HG12 . ILE A 1 13 ? 0.569   0.712   9.119   1.00 0.00 ? 541 ILE A HG12 1  
ATOM   211   H  HG13 . ILE A 1 13 ? -0.860  0.004   8.374   1.00 0.00 ? 541 ILE A HG13 1  
ATOM   212   H  HG21 . ILE A 1 13 ? 0.495   2.732   10.165  1.00 0.00 ? 541 ILE A HG21 1  
ATOM   213   H  HG22 . ILE A 1 13 ? -0.856  1.910   10.947  1.00 0.00 ? 541 ILE A HG22 1  
ATOM   214   H  HG23 . ILE A 1 13 ? -1.045  3.567   10.374  1.00 0.00 ? 541 ILE A HG23 1  
ATOM   215   H  HD11 . ILE A 1 13 ? -0.019  0.308   6.354   1.00 0.00 ? 541 ILE A HD11 1  
ATOM   216   H  HD12 . ILE A 1 13 ? 1.481   0.840   7.115   1.00 0.00 ? 541 ILE A HD12 1  
ATOM   217   H  HD13 . ILE A 1 13 ? 0.251   2.022   6.666   1.00 0.00 ? 541 ILE A HD13 1  
ATOM   218   N  N    . GLN A 1 14 ? -3.884  3.132   10.332  1.00 0.00 ? 542 GLN A N    1  
ATOM   219   C  CA   . GLN A 1 14 ? -4.676  4.299   10.701  1.00 0.00 ? 542 GLN A CA   1  
ATOM   220   C  C    . GLN A 1 14 ? -3.828  5.566   10.665  1.00 0.00 ? 542 GLN A C    1  
ATOM   221   O  O    . GLN A 1 14 ? -2.995  5.792   11.543  1.00 0.00 ? 542 GLN A O    1  
ATOM   222   C  CB   . GLN A 1 14 ? -5.277  4.112   12.096  1.00 0.00 ? 542 GLN A CB   1  
ATOM   223   C  CG   . GLN A 1 14 ? -6.376  5.109   12.423  1.00 0.00 ? 542 GLN A CG   1  
ATOM   224   C  CD   . GLN A 1 14 ? -7.281  4.632   13.542  1.00 0.00 ? 542 GLN A CD   1  
ATOM   225   O  OE1  . GLN A 1 14 ? -7.212  5.129   14.666  1.00 0.00 ? 542 GLN A OE1  1  
ATOM   226   N  NE2  . GLN A 1 14 ? -8.136  3.662   13.239  1.00 0.00 ? 542 GLN A NE2  1  
ATOM   227   H  H    . GLN A 1 14 ? -3.743  2.423   10.992  1.00 0.00 ? 542 GLN A H    1  
ATOM   228   H  HA   . GLN A 1 14 ? -5.476  4.394   9.984   1.00 0.00 ? 542 GLN A HA   1  
ATOM   229   H  HB2  . GLN A 1 14 ? -5.690  3.117   12.167  1.00 0.00 ? 542 GLN A HB2  1  
ATOM   230   H  HB3  . GLN A 1 14 ? -4.492  4.220   12.830  1.00 0.00 ? 542 GLN A HB3  1  
ATOM   231   H  HG2  . GLN A 1 14 ? -5.922  6.042   12.721  1.00 0.00 ? 542 GLN A HG2  1  
ATOM   232   H  HG3  . GLN A 1 14 ? -6.975  5.268   11.538  1.00 0.00 ? 542 GLN A HG3  1  
ATOM   233   H  HE21 . GLN A 1 14 ? -8.135  3.313   12.323  1.00 0.00 ? 542 GLN A HE21 1  
ATOM   234   H  HE22 . GLN A 1 14 ? -8.733  3.335   13.944  1.00 0.00 ? 542 GLN A HE22 1  
ATOM   235   N  N    . GLY A 1 15 ? -4.046  6.390   9.646   1.00 0.00 ? 543 GLY A N    1  
ATOM   236   C  CA   . GLY A 1 15 ? -3.294  7.624   9.518   1.00 0.00 ? 543 GLY A CA   1  
ATOM   237   C  C    . GLY A 1 15 ? -3.242  8.129   8.089   1.00 0.00 ? 543 GLY A C    1  
ATOM   238   O  O    . GLY A 1 15 ? -3.579  9.281   7.818   1.00 0.00 ? 543 GLY A O    1  
ATOM   239   H  H    . GLY A 1 15 ? -4.724  6.159   8.977   1.00 0.00 ? 543 GLY A H    1  
ATOM   240   H  HA2  . GLY A 1 15 ? -3.755  8.380   10.138  1.00 0.00 ? 543 GLY A HA2  1  
ATOM   241   H  HA3  . GLY A 1 15 ? -2.285  7.456   9.865   1.00 0.00 ? 543 GLY A HA3  1  
ATOM   242   N  N    . CYS A 1 16 ? -2.817  7.265   7.173   1.00 0.00 ? 544 CYS A N    1  
ATOM   243   C  CA   . CYS A 1 16 ? -2.720  7.631   5.765   1.00 0.00 ? 544 CYS A CA   1  
ATOM   244   C  C    . CYS A 1 16 ? -4.072  7.496   5.072   1.00 0.00 ? 544 CYS A C    1  
ATOM   245   O  O    . CYS A 1 16 ? -5.102  7.327   5.725   1.00 0.00 ? 544 CYS A O    1  
ATOM   246   C  CB   . CYS A 1 16 ? -1.682  6.754   5.061   1.00 0.00 ? 544 CYS A CB   1  
ATOM   247   S  SG   . CYS A 1 16 ? -0.533  7.669   4.008   1.00 0.00 ? 544 CYS A SG   1  
ATOM   248   H  H    . CYS A 1 16 ? -2.561  6.360   7.450   1.00 0.00 ? 544 CYS A H    1  
ATOM   249   H  HA   . CYS A 1 16 ? -2.403  8.662   5.711   1.00 0.00 ? 544 CYS A HA   1  
ATOM   250   H  HB2  . CYS A 1 16 ? -1.099  6.232   5.805   1.00 0.00 ? 544 CYS A HB2  1  
ATOM   251   H  HB3  . CYS A 1 16 ? -2.193  6.034   4.441   1.00 0.00 ? 544 CYS A HB3  1  
ATOM   252   N  N    . GLY A 1 17 ? -4.060  7.571   3.744   1.00 0.00 ? 545 GLY A N    1  
ATOM   253   C  CA   . GLY A 1 17 ? -5.289  7.454   2.982   1.00 0.00 ? 545 GLY A CA   1  
ATOM   254   C  C    . GLY A 1 17 ? -5.065  7.656   1.497   1.00 0.00 ? 545 GLY A C    1  
ATOM   255   O  O    . GLY A 1 17 ? -5.885  8.273   0.816   1.00 0.00 ? 545 GLY A O    1  
ATOM   256   H  H    . GLY A 1 17 ? -3.209  7.706   3.278   1.00 0.00 ? 545 GLY A H    1  
ATOM   257   H  HA2  . GLY A 1 17 ? -5.708  6.472   3.142   1.00 0.00 ? 545 GLY A HA2  1  
ATOM   258   H  HA3  . GLY A 1 17 ? -5.990  8.196   3.334   1.00 0.00 ? 545 GLY A HA3  1  
ATOM   259   N  N    . LYS A 1 18 ? -3.949  7.138   0.995   1.00 0.00 ? 546 LYS A N    1  
ATOM   260   C  CA   . LYS A 1 18 ? -3.615  7.267   -0.418  1.00 0.00 ? 546 LYS A CA   1  
ATOM   261   C  C    . LYS A 1 18 ? -4.043  6.026   -1.196  1.00 0.00 ? 546 LYS A C    1  
ATOM   262   O  O    . LYS A 1 18 ? -4.718  5.147   -0.660  1.00 0.00 ? 546 LYS A O    1  
ATOM   263   C  CB   . LYS A 1 18 ? -2.112  7.499   -0.589  1.00 0.00 ? 546 LYS A CB   1  
ATOM   264   C  CG   . LYS A 1 18 ? -1.260  6.313   -0.165  1.00 0.00 ? 546 LYS A CG   1  
ATOM   265   C  CD   . LYS A 1 18 ? 0.112   6.757   0.316   1.00 0.00 ? 546 LYS A CD   1  
ATOM   266   C  CE   . LYS A 1 18 ? 0.918   7.389   -0.807  1.00 0.00 ? 546 LYS A CE   1  
ATOM   267   N  NZ   . LYS A 1 18 ? 2.213   7.939   -0.319  1.00 0.00 ? 546 LYS A NZ   1  
ATOM   268   H  H    . LYS A 1 18 ? -3.334  6.660   1.589   1.00 0.00 ? 546 LYS A H    1  
ATOM   269   H  HA   . LYS A 1 18 ? -4.148  8.121   -0.806  1.00 0.00 ? 546 LYS A HA   1  
ATOM   270   H  HB2  . LYS A 1 18 ? -1.907  7.709   -1.628  1.00 0.00 ? 546 LYS A HB2  1  
ATOM   271   H  HB3  . LYS A 1 18 ? -1.822  8.353   0.005   1.00 0.00 ? 546 LYS A HB3  1  
ATOM   272   H  HG2  . LYS A 1 18 ? -1.760  5.791   0.637   1.00 0.00 ? 546 LYS A HG2  1  
ATOM   273   H  HG3  . LYS A 1 18 ? -1.139  5.650   -1.009  1.00 0.00 ? 546 LYS A HG3  1  
ATOM   274   H  HD2  . LYS A 1 18 ? -0.012  7.480   1.108   1.00 0.00 ? 546 LYS A HD2  1  
ATOM   275   H  HD3  . LYS A 1 18 ? 0.646   5.896   0.691   1.00 0.00 ? 546 LYS A HD3  1  
ATOM   276   H  HE2  . LYS A 1 18 ? 1.116   6.639   -1.557  1.00 0.00 ? 546 LYS A HE2  1  
ATOM   277   H  HE3  . LYS A 1 18 ? 0.338   8.189   -1.243  1.00 0.00 ? 546 LYS A HE3  1  
ATOM   278   H  HZ1  . LYS A 1 18 ? 2.095   8.339   0.634   1.00 0.00 ? 546 LYS A HZ1  1  
ATOM   279   H  HZ2  . LYS A 1 18 ? 2.547   8.689   -0.958  1.00 0.00 ? 546 LYS A HZ2  1  
ATOM   280   H  HZ3  . LYS A 1 18 ? 2.930   7.186   -0.282  1.00 0.00 ? 546 LYS A HZ3  1  
ATOM   281   N  N    . VAL A 1 19 ? -3.645  5.961   -2.463  1.00 0.00 ? 547 VAL A N    1  
ATOM   282   C  CA   . VAL A 1 19 ? -3.986  4.829   -3.316  1.00 0.00 ? 547 VAL A CA   1  
ATOM   283   C  C    . VAL A 1 19 ? -2.746  4.270   -4.006  1.00 0.00 ? 547 VAL A C    1  
ATOM   284   O  O    . VAL A 1 19 ? -1.874  5.022   -4.440  1.00 0.00 ? 547 VAL A O    1  
ATOM   285   C  CB   . VAL A 1 19 ? -5.022  5.222   -4.386  1.00 0.00 ? 547 VAL A CB   1  
ATOM   286   C  CG1  . VAL A 1 19 ? -5.527  3.990   -5.121  1.00 0.00 ? 547 VAL A CG1  1  
ATOM   287   C  CG2  . VAL A 1 19 ? -6.176  5.987   -3.756  1.00 0.00 ? 547 VAL A CG2  1  
ATOM   288   H  H    . VAL A 1 19 ? -3.109  6.693   -2.833  1.00 0.00 ? 547 VAL A H    1  
ATOM   289   H  HA   . VAL A 1 19 ? -4.417  4.059   -2.692  1.00 0.00 ? 547 VAL A HA   1  
ATOM   290   H  HB   . VAL A 1 19 ? -4.539  5.869   -5.104  1.00 0.00 ? 547 VAL A HB   1  
ATOM   291   H  HG11 . VAL A 1 19 ? -4.755  3.237   -5.134  1.00 0.00 ? 547 VAL A HG11 1  
ATOM   292   H  HG12 . VAL A 1 19 ? -5.788  4.258   -6.134  1.00 0.00 ? 547 VAL A HG12 1  
ATOM   293   H  HG13 . VAL A 1 19 ? -6.400  3.603   -4.616  1.00 0.00 ? 547 VAL A HG13 1  
ATOM   294   H  HG21 . VAL A 1 19 ? -5.989  7.048   -3.831  1.00 0.00 ? 547 VAL A HG21 1  
ATOM   295   H  HG22 . VAL A 1 19 ? -6.266  5.711   -2.716  1.00 0.00 ? 547 VAL A HG22 1  
ATOM   296   H  HG23 . VAL A 1 19 ? -7.093  5.746   -4.273  1.00 0.00 ? 547 VAL A HG23 1  
ATOM   297   N  N    . TYR A 1 20 ? -2.674  2.946   -4.104  1.00 0.00 ? 548 TYR A N    1  
ATOM   298   C  CA   . TYR A 1 20 ? -1.540  2.288   -4.741  1.00 0.00 ? 548 TYR A CA   1  
ATOM   299   C  C    . TYR A 1 20 ? -2.008  1.159   -5.655  1.00 0.00 ? 548 TYR A C    1  
ATOM   300   O  O    . TYR A 1 20 ? -3.087  0.599   -5.463  1.00 0.00 ? 548 TYR A O    1  
ATOM   301   C  CB   . TYR A 1 20 ? -0.583  1.738   -3.682  1.00 0.00 ? 548 TYR A CB   1  
ATOM   302   C  CG   . TYR A 1 20 ? 0.515   2.705   -3.298  1.00 0.00 ? 548 TYR A CG   1  
ATOM   303   C  CD1  . TYR A 1 20 ? 1.528   3.027   -4.192  1.00 0.00 ? 548 TYR A CD1  1  
ATOM   304   C  CD2  . TYR A 1 20 ? 0.538   3.295   -2.040  1.00 0.00 ? 548 TYR A CD2  1  
ATOM   305   C  CE1  . TYR A 1 20 ? 2.533   3.909   -3.844  1.00 0.00 ? 548 TYR A CE1  1  
ATOM   306   C  CE2  . TYR A 1 20 ? 1.539   4.178   -1.685  1.00 0.00 ? 548 TYR A CE2  1  
ATOM   307   C  CZ   . TYR A 1 20 ? 2.534   4.482   -2.590  1.00 0.00 ? 548 TYR A CZ   1  
ATOM   308   O  OH   . TYR A 1 20 ? 3.533   5.361   -2.239  1.00 0.00 ? 548 TYR A OH   1  
ATOM   309   H  H    . TYR A 1 20 ? -3.401  2.400   -3.738  1.00 0.00 ? 548 TYR A H    1  
ATOM   310   H  HA   . TYR A 1 20 ? -1.021  3.024   -5.335  1.00 0.00 ? 548 TYR A HA   1  
ATOM   311   H  HB2  . TYR A 1 20 ? -1.142  1.500   -2.790  1.00 0.00 ? 548 TYR A HB2  1  
ATOM   312   H  HB3  . TYR A 1 20 ? -0.118  0.840   -4.060  1.00 0.00 ? 548 TYR A HB3  1  
ATOM   313   H  HD1  . TYR A 1 20 ? 1.524   2.577   -5.174  1.00 0.00 ? 548 TYR A HD1  1  
ATOM   314   H  HD2  . TYR A 1 20 ? -0.243  3.055   -1.333  1.00 0.00 ? 548 TYR A HD2  1  
ATOM   315   H  HE1  . TYR A 1 20 ? 3.312   4.147   -4.553  1.00 0.00 ? 548 TYR A HE1  1  
ATOM   316   H  HE2  . TYR A 1 20 ? 1.539   4.627   -0.702  1.00 0.00 ? 548 TYR A HE2  1  
ATOM   317   H  HH   . TYR A 1 20 ? 3.296   6.246   -2.527  1.00 0.00 ? 548 TYR A HH   1  
ATOM   318   N  N    . GLY A 1 21 ? -1.190  0.833   -6.650  1.00 0.00 ? 549 GLY A N    1  
ATOM   319   C  CA   . GLY A 1 21 ? -1.538  -0.226  -7.580  1.00 0.00 ? 549 GLY A CA   1  
ATOM   320   C  C    . GLY A 1 21 ? -0.572  -1.394  -7.527  1.00 0.00 ? 549 GLY A C    1  
ATOM   321   O  O    . GLY A 1 21 ? -0.950  -2.532  -7.807  1.00 0.00 ? 549 GLY A O    1  
ATOM   322   H  H    . GLY A 1 21 ? -0.343  1.316   -6.755  1.00 0.00 ? 549 GLY A H    1  
ATOM   323   H  HA2  . GLY A 1 21 ? -2.530  -0.584  -7.346  1.00 0.00 ? 549 GLY A HA2  1  
ATOM   324   H  HA3  . GLY A 1 21 ? -1.541  0.178   -8.582  1.00 0.00 ? 549 GLY A HA3  1  
ATOM   325   N  N    . LYS A 1 22 ? 0.678   -1.115  -7.169  1.00 0.00 ? 550 LYS A N    1  
ATOM   326   C  CA   . LYS A 1 22 ? 1.698   -2.154  -7.084  1.00 0.00 ? 550 LYS A CA   1  
ATOM   327   C  C    . LYS A 1 22 ? 2.065   -2.445  -5.632  1.00 0.00 ? 550 LYS A C    1  
ATOM   328   O  O    . LYS A 1 22 ? 2.221   -1.528  -4.825  1.00 0.00 ? 550 LYS A O    1  
ATOM   329   C  CB   . LYS A 1 22 ? 2.946   -1.737  -7.867  1.00 0.00 ? 550 LYS A CB   1  
ATOM   330   C  CG   . LYS A 1 22 ? 3.449   -2.806  -8.823  1.00 0.00 ? 550 LYS A CG   1  
ATOM   331   C  CD   . LYS A 1 22 ? 2.575   -2.900  -10.064 1.00 0.00 ? 550 LYS A CD   1  
ATOM   332   C  CE   . LYS A 1 22 ? 2.377   -4.343  -10.501 1.00 0.00 ? 550 LYS A CE   1  
ATOM   333   N  NZ   . LYS A 1 22 ? 3.004   -4.614  -11.824 1.00 0.00 ? 550 LYS A NZ   1  
ATOM   334   H  H    . LYS A 1 22 ? 0.920   -0.189  -6.959  1.00 0.00 ? 550 LYS A H    1  
ATOM   335   H  HA   . LYS A 1 22 ? 1.292   -3.052  -7.526  1.00 0.00 ? 550 LYS A HA   1  
ATOM   336   H  HB2  . LYS A 1 22 ? 2.717   -0.851  -8.440  1.00 0.00 ? 550 LYS A HB2  1  
ATOM   337   H  HB3  . LYS A 1 22 ? 3.737   -1.508  -7.168  1.00 0.00 ? 550 LYS A HB3  1  
ATOM   338   H  HG2  . LYS A 1 22 ? 4.457   -2.561  -9.123  1.00 0.00 ? 550 LYS A HG2  1  
ATOM   339   H  HG3  . LYS A 1 22 ? 3.444   -3.760  -8.316  1.00 0.00 ? 550 LYS A HG3  1  
ATOM   340   H  HD2  . LYS A 1 22 ? 1.611   -2.465  -9.847  1.00 0.00 ? 550 LYS A HD2  1  
ATOM   341   H  HD3  . LYS A 1 22 ? 3.046   -2.352  -10.866 1.00 0.00 ? 550 LYS A HD3  1  
ATOM   342   H  HE2  . LYS A 1 22 ? 2.820   -4.995  -9.763  1.00 0.00 ? 550 LYS A HE2  1  
ATOM   343   H  HE3  . LYS A 1 22 ? 1.317   -4.543  -10.567 1.00 0.00 ? 550 LYS A HE3  1  
ATOM   344   H  HZ1  . LYS A 1 22 ? 2.742   -3.870  -12.502 1.00 0.00 ? 550 LYS A HZ1  1  
ATOM   345   H  HZ2  . LYS A 1 22 ? 2.681   -5.532  -12.192 1.00 0.00 ? 550 LYS A HZ2  1  
ATOM   346   H  HZ3  . LYS A 1 22 ? 4.039   -4.636  -11.731 1.00 0.00 ? 550 LYS A HZ3  1  
ATOM   347   N  N    . THR A 1 23 ? 2.201   -3.727  -5.307  1.00 0.00 ? 551 THR A N    1  
ATOM   348   C  CA   . THR A 1 23 ? 2.550   -4.141  -3.953  1.00 0.00 ? 551 THR A CA   1  
ATOM   349   C  C    . THR A 1 23 ? 3.997   -3.784  -3.630  1.00 0.00 ? 551 THR A C    1  
ATOM   350   O  O    . THR A 1 23 ? 4.334   -3.498  -2.481  1.00 0.00 ? 551 THR A O    1  
ATOM   351   C  CB   . THR A 1 23 ? 2.334   -5.646  -3.785  1.00 0.00 ? 551 THR A CB   1  
ATOM   352   O  OG1  . THR A 1 23 ? 1.213   -6.078  -4.536  1.00 0.00 ? 551 THR A OG1  1  
ATOM   353   C  CG2  . THR A 1 23 ? 2.112   -6.063  -2.347  1.00 0.00 ? 551 THR A CG2  1  
ATOM   354   H  H    . THR A 1 23 ? 2.064   -4.411  -5.995  1.00 0.00 ? 551 THR A H    1  
ATOM   355   H  HA   . THR A 1 23 ? 1.902   -3.615  -3.268  1.00 0.00 ? 551 THR A HA   1  
ATOM   356   H  HB   . THR A 1 23 ? 3.207   -6.167  -4.150  1.00 0.00 ? 551 THR A HB   1  
ATOM   357   H  HG1  . THR A 1 23 ? 1.511   -6.579  -5.298  1.00 0.00 ? 551 THR A HG1  1  
ATOM   358   H  HG21 . THR A 1 23 ? 2.596   -5.357  -1.689  1.00 0.00 ? 551 THR A HG21 1  
ATOM   359   H  HG22 . THR A 1 23 ? 2.528   -7.047  -2.190  1.00 0.00 ? 551 THR A HG22 1  
ATOM   360   H  HG23 . THR A 1 23 ? 1.053   -6.081  -2.138  1.00 0.00 ? 551 THR A HG23 1  
ATOM   361   N  N    . SER A 1 24 ? 4.850   -3.802  -4.649  1.00 0.00 ? 552 SER A N    1  
ATOM   362   C  CA   . SER A 1 24 ? 6.261   -3.476  -4.469  1.00 0.00 ? 552 SER A CA   1  
ATOM   363   C  C    . SER A 1 24 ? 6.422   -2.083  -3.871  1.00 0.00 ? 552 SER A C    1  
ATOM   364   O  O    . SER A 1 24 ? 7.376   -1.817  -3.139  1.00 0.00 ? 552 SER A O    1  
ATOM   365   C  CB   . SER A 1 24 ? 7.001   -3.560  -5.806  1.00 0.00 ? 552 SER A CB   1  
ATOM   366   O  OG   . SER A 1 24 ? 8.405   -3.559  -5.612  1.00 0.00 ? 552 SER A OG   1  
ATOM   367   H  H    . SER A 1 24 ? 4.523   -4.036  -5.543  1.00 0.00 ? 552 SER A H    1  
ATOM   368   H  HA   . SER A 1 24 ? 6.684   -4.199  -3.787  1.00 0.00 ? 552 SER A HA   1  
ATOM   369   H  HB2  . SER A 1 24 ? 6.721   -4.470  -6.314  1.00 0.00 ? 552 SER A HB2  1  
ATOM   370   H  HB3  . SER A 1 24 ? 6.734   -2.710  -6.416  1.00 0.00 ? 552 SER A HB3  1  
ATOM   371   H  HG   . SER A 1 24 ? 8.655   -2.799  -5.082  1.00 0.00 ? 552 SER A HG   1  
ATOM   372   N  N    . HIS A 1 25 ? 5.479   -1.200  -4.183  1.00 0.00 ? 553 HIS A N    1  
ATOM   373   C  CA   . HIS A 1 25 ? 5.512   0.165   -3.672  1.00 0.00 ? 553 HIS A CA   1  
ATOM   374   C  C    . HIS A 1 25 ? 5.129   0.198   -2.197  1.00 0.00 ? 553 HIS A C    1  
ATOM   375   O  O    . HIS A 1 25 ? 5.566   1.076   -1.452  1.00 0.00 ? 553 HIS A O    1  
ATOM   376   C  CB   . HIS A 1 25 ? 4.568   1.058   -4.479  1.00 0.00 ? 553 HIS A CB   1  
ATOM   377   C  CG   . HIS A 1 25 ? 5.089   1.406   -5.838  1.00 0.00 ? 553 HIS A CG   1  
ATOM   378   N  ND1  . HIS A 1 25 ? 5.901   0.581   -6.584  1.00 0.00 ? 553 HIS A ND1  1  
ATOM   379   C  CD2  . HIS A 1 25 ? 4.899   2.521   -6.588  1.00 0.00 ? 553 HIS A CD2  1  
ATOM   380   C  CE1  . HIS A 1 25 ? 6.174   1.206   -7.738  1.00 0.00 ? 553 HIS A CE1  1  
ATOM   381   N  NE2  . HIS A 1 25 ? 5.588   2.387   -7.790  1.00 0.00 ? 553 HIS A NE2  1  
ATOM   382   H  H    . HIS A 1 25 ? 4.742   -1.473  -4.768  1.00 0.00 ? 553 HIS A H    1  
ATOM   383   H  HA   . HIS A 1 25 ? 6.522   0.534   -3.777  1.00 0.00 ? 553 HIS A HA   1  
ATOM   384   H  HB2  . HIS A 1 25 ? 3.624   0.549   -4.606  1.00 0.00 ? 553 HIS A HB2  1  
ATOM   385   H  HB3  . HIS A 1 25 ? 4.405   1.978   -3.938  1.00 0.00 ? 553 HIS A HB3  1  
ATOM   386   H  HD1  . HIS A 1 25 ? 6.223   -0.305  -6.318  1.00 0.00 ? 553 HIS A HD1  1  
ATOM   387   H  HD2  . HIS A 1 25 ? 4.308   3.381   -6.308  1.00 0.00 ? 553 HIS A HD2  1  
ATOM   388   H  HE1  . HIS A 1 25 ? 6.791   0.796   -8.523  1.00 0.00 ? 553 HIS A HE1  1  
ATOM   389   N  N    . LEU A 1 26 ? 4.312   -0.765  -1.778  1.00 0.00 ? 554 LEU A N    1  
ATOM   390   C  CA   . LEU A 1 26 ? 3.875   -0.845  -0.389  1.00 0.00 ? 554 LEU A CA   1  
ATOM   391   C  C    . LEU A 1 26 ? 5.075   -0.930  0.548   1.00 0.00 ? 554 LEU A C    1  
ATOM   392   O  O    . LEU A 1 26 ? 5.128   -0.246  1.569   1.00 0.00 ? 554 LEU A O    1  
ATOM   393   C  CB   . LEU A 1 26 ? 2.962   -2.058  -0.186  1.00 0.00 ? 554 LEU A CB   1  
ATOM   394   C  CG   . LEU A 1 26 ? 1.572   -1.736  0.364   1.00 0.00 ? 554 LEU A CG   1  
ATOM   395   C  CD1  . LEU A 1 26 ? 0.587   -1.515  -0.773  1.00 0.00 ? 554 LEU A CD1  1  
ATOM   396   C  CD2  . LEU A 1 26 ? 1.090   -2.850  1.281   1.00 0.00 ? 554 LEU A CD2  1  
ATOM   397   H  H    . LEU A 1 26 ? 3.998   -1.438  -2.417  1.00 0.00 ? 554 LEU A H    1  
ATOM   398   H  HA   . LEU A 1 26 ? 3.320   0.053   -0.165  1.00 0.00 ? 554 LEU A HA   1  
ATOM   399   H  HB2  . LEU A 1 26 ? 2.844   -2.557  -1.136  1.00 0.00 ? 554 LEU A HB2  1  
ATOM   400   H  HB3  . LEU A 1 26 ? 3.446   -2.739  0.500   1.00 0.00 ? 554 LEU A HB3  1  
ATOM   401   H  HG   . LEU A 1 26 ? 1.623   -0.824  0.943   1.00 0.00 ? 554 LEU A HG   1  
ATOM   402   H  HD11 . LEU A 1 26 ? 0.747   -2.260  -1.538  1.00 0.00 ? 554 LEU A HD11 1  
ATOM   403   H  HD12 . LEU A 1 26 ? 0.735   -0.531  -1.192  1.00 0.00 ? 554 LEU A HD12 1  
ATOM   404   H  HD13 . LEU A 1 26 ? -0.422  -1.597  -0.396  1.00 0.00 ? 554 LEU A HD13 1  
ATOM   405   H  HD21 . LEU A 1 26 ? 0.040   -2.712  1.494   1.00 0.00 ? 554 LEU A HD21 1  
ATOM   406   H  HD22 . LEU A 1 26 ? 1.650   -2.826  2.204   1.00 0.00 ? 554 LEU A HD22 1  
ATOM   407   H  HD23 . LEU A 1 26 ? 1.236   -3.804  0.796   1.00 0.00 ? 554 LEU A HD23 1  
ATOM   408   N  N    . ARG A 1 27 ? 6.036   -1.776  0.190   1.00 0.00 ? 555 ARG A N    1  
ATOM   409   C  CA   . ARG A 1 27 ? 7.237   -1.954  0.994   1.00 0.00 ? 555 ARG A CA   1  
ATOM   410   C  C    . ARG A 1 27 ? 7.987   -0.638  1.162   1.00 0.00 ? 555 ARG A C    1  
ATOM   411   O  O    . ARG A 1 27 ? 8.315   -0.237  2.279   1.00 0.00 ? 555 ARG A O    1  
ATOM   412   C  CB   . ARG A 1 27 ? 8.150   -2.997  0.348   1.00 0.00 ? 555 ARG A CB   1  
ATOM   413   C  CG   . ARG A 1 27 ? 8.423   -4.188  1.245   1.00 0.00 ? 555 ARG A CG   1  
ATOM   414   C  CD   . ARG A 1 27 ? 8.995   -5.359  0.462   1.00 0.00 ? 555 ARG A CD   1  
ATOM   415   N  NE   . ARG A 1 27 ? 10.021  -6.074  1.218   1.00 0.00 ? 555 ARG A NE   1  
ATOM   416   C  CZ   . ARG A 1 27 ? 11.281  -5.659  1.333   1.00 0.00 ? 555 ARG A CZ   1  
ATOM   417   N  NH1  . ARG A 1 27 ? 11.673  -4.534  0.748   1.00 0.00 ? 555 ARG A NH1  1  
ATOM   418   N  NH2  . ARG A 1 27 ? 12.151  -6.371  2.036   1.00 0.00 ? 555 ARG A NH2  1  
ATOM   419   H  H    . ARG A 1 27 ? 5.935   -2.294  -0.634  1.00 0.00 ? 555 ARG A H    1  
ATOM   420   H  HA   . ARG A 1 27 ? 6.934   -2.309  1.967   1.00 0.00 ? 555 ARG A HA   1  
ATOM   421   H  HB2  . ARG A 1 27 ? 7.685   -3.355  -0.560  1.00 0.00 ? 555 ARG A HB2  1  
ATOM   422   H  HB3  . ARG A 1 27 ? 9.094   -2.535  0.101   1.00 0.00 ? 555 ARG A HB3  1  
ATOM   423   H  HG2  . ARG A 1 27 ? 9.130   -3.895  2.007   1.00 0.00 ? 555 ARG A HG2  1  
ATOM   424   H  HG3  . ARG A 1 27 ? 7.496   -4.492  1.708   1.00 0.00 ? 555 ARG A HG3  1  
ATOM   425   H  HD2  . ARG A 1 27 ? 8.194   -6.043  0.227   1.00 0.00 ? 555 ARG A HD2  1  
ATOM   426   H  HD3  . ARG A 1 27 ? 9.430   -4.985  -0.453  1.00 0.00 ? 555 ARG A HD3  1  
ATOM   427   H  HE   . ARG A 1 27 ? 9.759   -6.908  1.661   1.00 0.00 ? 555 ARG A HE   1  
ATOM   428   H  HH11 . ARG A 1 27 ? 11.022  -3.992  0.217   1.00 0.00 ? 555 ARG A HH11 1  
ATOM   429   H  HH12 . ARG A 1 27 ? 12.621  -4.228  0.839   1.00 0.00 ? 555 ARG A HH12 1  
ATOM   430   H  HH21 . ARG A 1 27 ? 11.861  -7.219  2.480   1.00 0.00 ? 555 ARG A HH21 1  
ATOM   431   H  HH22 . ARG A 1 27 ? 13.098  -6.060  2.123   1.00 0.00 ? 555 ARG A HH22 1  
ATOM   432   N  N    . ALA A 1 28 ? 8.255   0.032   0.047   1.00 0.00 ? 556 ALA A N    1  
ATOM   433   C  CA   . ALA A 1 28 ? 8.966   1.302   0.078   1.00 0.00 ? 556 ALA A CA   1  
ATOM   434   C  C    . ALA A 1 28 ? 8.187   2.340   0.877   1.00 0.00 ? 556 ALA A C    1  
ATOM   435   O  O    . ALA A 1 28 ? 8.771   3.207   1.527   1.00 0.00 ? 556 ALA A O    1  
ATOM   436   C  CB   . ALA A 1 28 ? 9.222   1.802   -1.336  1.00 0.00 ? 556 ALA A CB   1  
ATOM   437   H  H    . ALA A 1 28 ? 7.969   -0.336  -0.816  1.00 0.00 ? 556 ALA A H    1  
ATOM   438   H  HA   . ALA A 1 28 ? 9.921   1.136   0.556   1.00 0.00 ? 556 ALA A HA   1  
ATOM   439   H  HB1  . ALA A 1 28 ? 10.189  1.457   -1.670  1.00 0.00 ? 556 ALA A HB1  1  
ATOM   440   H  HB2  . ALA A 1 28 ? 9.201   2.881   -1.346  1.00 0.00 ? 556 ALA A HB2  1  
ATOM   441   H  HB3  . ALA A 1 28 ? 8.456   1.421   -1.996  1.00 0.00 ? 556 ALA A HB3  1  
ATOM   442   N  N    . HIS A 1 29 ? 6.864   2.244   0.824   1.00 0.00 ? 557 HIS A N    1  
ATOM   443   C  CA   . HIS A 1 29 ? 6.001   3.168   1.540   1.00 0.00 ? 557 HIS A CA   1  
ATOM   444   C  C    . HIS A 1 29 ? 5.900   2.787   3.016   1.00 0.00 ? 557 HIS A C    1  
ATOM   445   O  O    . HIS A 1 29 ? 5.771   3.652   3.882   1.00 0.00 ? 557 HIS A O    1  
ATOM   446   C  CB   . HIS A 1 29 ? 4.608   3.194   0.905   1.00 0.00 ? 557 HIS A CB   1  
ATOM   447   C  CG   . HIS A 1 29 ? 3.612   4.006   1.674   1.00 0.00 ? 557 HIS A CG   1  
ATOM   448   N  ND1  . HIS A 1 29 ? 3.922   5.170   2.340   1.00 0.00 ? 557 HIS A ND1  1  
ATOM   449   C  CD2  . HIS A 1 29 ? 2.287   3.796   1.883   1.00 0.00 ? 557 HIS A CD2  1  
ATOM   450   C  CE1  . HIS A 1 29 ? 2.803   5.620   2.923   1.00 0.00 ? 557 HIS A CE1  1  
ATOM   451   N  NE2  . HIS A 1 29 ? 1.782   4.822   2.676   1.00 0.00 ? 557 HIS A NE2  1  
ATOM   452   H  H    . HIS A 1 29 ? 6.458   1.535   0.290   1.00 0.00 ? 557 HIS A H    1  
ATOM   453   H  HA   . HIS A 1 29 ? 6.439   4.148   1.463   1.00 0.00 ? 557 HIS A HA   1  
ATOM   454   H  HB2  . HIS A 1 29 ? 4.681   3.612   -0.088  1.00 0.00 ? 557 HIS A HB2  1  
ATOM   455   H  HB3  . HIS A 1 29 ? 4.233   2.183   0.837   1.00 0.00 ? 557 HIS A HB3  1  
ATOM   456   H  HD1  . HIS A 1 29 ? 4.805   5.594   2.382   1.00 0.00 ? 557 HIS A HD1  1  
ATOM   457   H  HD2  . HIS A 1 29 ? 1.708   2.968   1.501   1.00 0.00 ? 557 HIS A HD2  1  
ATOM   458   H  HE1  . HIS A 1 29 ? 2.745   6.520   3.518   1.00 0.00 ? 557 HIS A HE1  1  
ATOM   459   N  N    . LEU A 1 30 ? 5.952   1.488   3.293   1.00 0.00 ? 558 LEU A N    1  
ATOM   460   C  CA   . LEU A 1 30 ? 5.859   0.995   4.662   1.00 0.00 ? 558 LEU A CA   1  
ATOM   461   C  C    . LEU A 1 30 ? 7.049   1.460   5.496   1.00 0.00 ? 558 LEU A C    1  
ATOM   462   O  O    . LEU A 1 30 ? 6.901   1.801   6.670   1.00 0.00 ? 558 LEU A O    1  
ATOM   463   C  CB   . LEU A 1 30 ? 5.777   -0.534  4.671   1.00 0.00 ? 558 LEU A CB   1  
ATOM   464   C  CG   . LEU A 1 30 ? 4.622   -1.116  5.487   1.00 0.00 ? 558 LEU A CG   1  
ATOM   465   C  CD1  . LEU A 1 30 ? 3.397   -1.319  4.609   1.00 0.00 ? 558 LEU A CD1  1  
ATOM   466   C  CD2  . LEU A 1 30 ? 5.036   -2.427  6.139   1.00 0.00 ? 558 LEU A CD2  1  
ATOM   467   H  H    . LEU A 1 30 ? 6.051   0.845   2.560   1.00 0.00 ? 558 LEU A H    1  
ATOM   468   H  HA   . LEU A 1 30 ? 4.955   1.395   5.094   1.00 0.00 ? 558 LEU A HA   1  
ATOM   469   H  HB2  . LEU A 1 30 ? 5.675   -0.873  3.650   1.00 0.00 ? 558 LEU A HB2  1  
ATOM   470   H  HB3  . LEU A 1 30 ? 6.702   -0.924  5.070   1.00 0.00 ? 558 LEU A HB3  1  
ATOM   471   H  HG   . LEU A 1 30 ? 4.358   -0.421  6.271   1.00 0.00 ? 558 LEU A HG   1  
ATOM   472   H  HD11 . LEU A 1 30 ? 2.838   -2.173  4.963   1.00 0.00 ? 558 LEU A HD11 1  
ATOM   473   H  HD12 . LEU A 1 30 ? 3.709   -1.490  3.590   1.00 0.00 ? 558 LEU A HD12 1  
ATOM   474   H  HD13 . LEU A 1 30 ? 2.773   -0.438  4.652   1.00 0.00 ? 558 LEU A HD13 1  
ATOM   475   H  HD21 . LEU A 1 30 ? 4.251   -2.765  6.798   1.00 0.00 ? 558 LEU A HD21 1  
ATOM   476   H  HD22 . LEU A 1 30 ? 5.943   -2.276  6.706   1.00 0.00 ? 558 LEU A HD22 1  
ATOM   477   H  HD23 . LEU A 1 30 ? 5.209   -3.170  5.374   1.00 0.00 ? 558 LEU A HD23 1  
ATOM   478   N  N    . ARG A 1 31 ? 8.229   1.470   4.884   1.00 0.00 ? 559 ARG A N    1  
ATOM   479   C  CA   . ARG A 1 31 ? 9.443   1.892   5.574   1.00 0.00 ? 559 ARG A CA   1  
ATOM   480   C  C    . ARG A 1 31 ? 9.314   3.326   6.080   1.00 0.00 ? 559 ARG A C    1  
ATOM   481   O  O    . ARG A 1 31 ? 9.910   3.693   7.093   1.00 0.00 ? 559 ARG A O    1  
ATOM   482   C  CB   . ARG A 1 31 ? 10.655  1.768   4.647   1.00 0.00 ? 559 ARG A CB   1  
ATOM   483   C  CG   . ARG A 1 31 ? 10.615  2.715   3.458   1.00 0.00 ? 559 ARG A CG   1  
ATOM   484   C  CD   . ARG A 1 31 ? 11.867  3.575   3.384   1.00 0.00 ? 559 ARG A CD   1  
ATOM   485   N  NE   . ARG A 1 31 ? 12.141  4.255   4.648   1.00 0.00 ? 559 ARG A NE   1  
ATOM   486   C  CZ   . ARG A 1 31 ? 13.022  5.244   4.783   1.00 0.00 ? 559 ARG A CZ   1  
ATOM   487   N  NH1  . ARG A 1 31 ? 13.715  5.672   3.735   1.00 0.00 ? 559 ARG A NH1  1  
ATOM   488   N  NH2  . ARG A 1 31 ? 13.209  5.807   5.968   1.00 0.00 ? 559 ARG A NH2  1  
ATOM   489   H  H    . ARG A 1 31 ? 8.286   1.186   3.948   1.00 0.00 ? 559 ARG A H    1  
ATOM   490   H  HA   . ARG A 1 31 ? 9.584   1.238   6.422   1.00 0.00 ? 559 ARG A HA   1  
ATOM   491   H  HB2  . ARG A 1 31 ? 11.550  1.973   5.215   1.00 0.00 ? 559 ARG A HB2  1  
ATOM   492   H  HB3  . ARG A 1 31 ? 10.703  0.756   4.272   1.00 0.00 ? 559 ARG A HB3  1  
ATOM   493   H  HG2  . ARG A 1 31 ? 10.537  2.135   2.551   1.00 0.00 ? 559 ARG A HG2  1  
ATOM   494   H  HG3  . ARG A 1 31 ? 9.753   3.358   3.551   1.00 0.00 ? 559 ARG A HG3  1  
ATOM   495   H  HD2  . ARG A 1 31 ? 12.708  2.944   3.136   1.00 0.00 ? 559 ARG A HD2  1  
ATOM   496   H  HD3  . ARG A 1 31 ? 11.734  4.316   2.609   1.00 0.00 ? 559 ARG A HD3  1  
ATOM   497   H  HE   . ARG A 1 31 ? 11.643  3.958   5.438   1.00 0.00 ? 559 ARG A HE   1  
ATOM   498   H  HH11 . ARG A 1 31 ? 13.578  5.252   2.838   1.00 0.00 ? 559 ARG A HH11 1  
ATOM   499   H  HH12 . ARG A 1 31 ? 14.375  6.416   3.842   1.00 0.00 ? 559 ARG A HH12 1  
ATOM   500   H  HH21 . ARG A 1 31 ? 12.690  5.488   6.761   1.00 0.00 ? 559 ARG A HH21 1  
ATOM   501   H  HH22 . ARG A 1 31 ? 13.871  6.550   6.070   1.00 0.00 ? 559 ARG A HH22 1  
ATOM   502   N  N    . TRP A 1 32 ? 8.531   4.132   5.370   1.00 0.00 ? 560 TRP A N    1  
ATOM   503   C  CA   . TRP A 1 32 ? 8.324   5.525   5.749   1.00 0.00 ? 560 TRP A CA   1  
ATOM   504   C  C    . TRP A 1 32 ? 7.419   5.628   6.974   1.00 0.00 ? 560 TRP A C    1  
ATOM   505   O  O    . TRP A 1 32 ? 7.586   6.517   7.808   1.00 0.00 ? 560 TRP A O    1  
ATOM   506   C  CB   . TRP A 1 32 ? 7.719   6.309   4.582   1.00 0.00 ? 560 TRP A CB   1  
ATOM   507   C  CG   . TRP A 1 32 ? 8.469   7.564   4.257   1.00 0.00 ? 560 TRP A CG   1  
ATOM   508   C  CD1  . TRP A 1 32 ? 9.473   7.706   3.343   1.00 0.00 ? 560 TRP A CD1  1  
ATOM   509   C  CD2  . TRP A 1 32 ? 8.276   8.855   4.846   1.00 0.00 ? 560 TRP A CD2  1  
ATOM   510   N  NE1  . TRP A 1 32 ? 9.916   9.006   3.327   1.00 0.00 ? 560 TRP A NE1  1  
ATOM   511   C  CE2  . TRP A 1 32 ? 9.197   9.731   4.240   1.00 0.00 ? 560 TRP A CE2  1  
ATOM   512   C  CE3  . TRP A 1 32 ? 7.414   9.356   5.825   1.00 0.00 ? 560 TRP A CE3  1  
ATOM   513   C  CZ2  . TRP A 1 32 ? 9.279   11.079  4.583   1.00 0.00 ? 560 TRP A CZ2  1  
ATOM   514   C  CZ3  . TRP A 1 32 ? 7.497   10.694  6.164   1.00 0.00 ? 560 TRP A CZ3  1  
ATOM   515   C  CH2  . TRP A 1 32 ? 8.423   11.542  5.544   1.00 0.00 ? 560 TRP A CH2  1  
ATOM   516   H  H    . TRP A 1 32 ? 8.081   3.782   4.573   1.00 0.00 ? 560 TRP A H    1  
ATOM   517   H  HA   . TRP A 1 32 ? 9.288   5.948   5.993   1.00 0.00 ? 560 TRP A HA   1  
ATOM   518   H  HB2  . TRP A 1 32 ? 7.717   5.685   3.701   1.00 0.00 ? 560 TRP A HB2  1  
ATOM   519   H  HB3  . TRP A 1 32 ? 6.702   6.580   4.826   1.00 0.00 ? 560 TRP A HB3  1  
ATOM   520   H  HD1  . TRP A 1 32 ? 9.854   6.903   2.729   1.00 0.00 ? 560 TRP A HD1  1  
ATOM   521   H  HE1  . TRP A 1 32 ? 10.630  9.357   2.754   1.00 0.00 ? 560 TRP A HE1  1  
ATOM   522   H  HE3  . TRP A 1 32 ? 6.693   8.718   6.314   1.00 0.00 ? 560 TRP A HE3  1  
ATOM   523   H  HZ2  . TRP A 1 32 ? 9.988   11.746  4.114   1.00 0.00 ? 560 TRP A HZ2  1  
ATOM   524   H  HZ3  . TRP A 1 32 ? 6.839   11.099  6.919   1.00 0.00 ? 560 TRP A HZ3  1  
ATOM   525   H  HH2  . TRP A 1 32 ? 8.453   12.580  5.841   1.00 0.00 ? 560 TRP A HH2  1  
ATOM   526   N  N    . HIS A 1 33 ? 6.461   4.712   7.074   1.00 0.00 ? 561 HIS A N    1  
ATOM   527   C  CA   . HIS A 1 33 ? 5.530   4.701   8.196   1.00 0.00 ? 561 HIS A CA   1  
ATOM   528   C  C    . HIS A 1 33 ? 6.225   4.249   9.476   1.00 0.00 ? 561 HIS A C    1  
ATOM   529   O  O    . HIS A 1 33 ? 6.061   4.861   10.532  1.00 0.00 ? 561 HIS A O    1  
ATOM   530   C  CB   . HIS A 1 33 ? 4.346   3.779   7.895   1.00 0.00 ? 561 HIS A CB   1  
ATOM   531   C  CG   . HIS A 1 33 ? 3.233   4.457   7.158   1.00 0.00 ? 561 HIS A CG   1  
ATOM   532   N  ND1  . HIS A 1 33 ? 2.435   5.438   7.704   1.00 0.00 ? 561 HIS A ND1  1  
ATOM   533   C  CD2  . HIS A 1 33 ? 2.788   4.277   5.888   1.00 0.00 ? 561 HIS A CD2  1  
ATOM   534   C  CE1  . HIS A 1 33 ? 1.550   5.815   6.771   1.00 0.00 ? 561 HIS A CE1  1  
ATOM   535   N  NE2  . HIS A 1 33 ? 1.722   5.140   5.650   1.00 0.00 ? 561 HIS A NE2  1  
ATOM   536   H  H    . HIS A 1 33 ? 6.378   4.029   6.376   1.00 0.00 ? 561 HIS A H    1  
ATOM   537   H  HA   . HIS A 1 33 ? 5.165   5.707   8.334   1.00 0.00 ? 561 HIS A HA   1  
ATOM   538   H  HB2  . HIS A 1 33 ? 4.688   2.952   7.291   1.00 0.00 ? 561 HIS A HB2  1  
ATOM   539   H  HB3  . HIS A 1 33 ? 3.948   3.400   8.825   1.00 0.00 ? 561 HIS A HB3  1  
ATOM   540   H  HD1  . HIS A 1 33 ? 2.503   5.797   8.613   1.00 0.00 ? 561 HIS A HD1  1  
ATOM   541   H  HD2  . HIS A 1 33 ? 3.189   3.578   5.168   1.00 0.00 ? 561 HIS A HD2  1  
ATOM   542   H  HE1  . HIS A 1 33 ? 0.794   6.572   6.917   1.00 0.00 ? 561 HIS A HE1  1  
ATOM   543   N  N    . THR A 1 34 ? 7.002   3.176   9.375   1.00 0.00 ? 562 THR A N    1  
ATOM   544   C  CA   . THR A 1 34 ? 7.723   2.643   10.525  1.00 0.00 ? 562 THR A CA   1  
ATOM   545   C  C    . THR A 1 34 ? 8.960   3.482   10.828  1.00 0.00 ? 562 THR A C    1  
ATOM   546   O  O    . THR A 1 34 ? 9.234   3.807   11.983  1.00 0.00 ? 562 THR A O    1  
ATOM   547   C  CB   . THR A 1 34 ? 8.127   1.190   10.271  1.00 0.00 ? 562 THR A CB   1  
ATOM   548   O  OG1  . THR A 1 34 ? 9.147   1.117   9.291   1.00 0.00 ? 562 THR A OG1  1  
ATOM   549   C  CG2  . THR A 1 34 ? 6.978   0.322   9.805   1.00 0.00 ? 562 THR A CG2  1  
ATOM   550   H  H    . THR A 1 34 ? 7.093   2.732   8.506   1.00 0.00 ? 562 THR A H    1  
ATOM   551   H  HA   . THR A 1 34 ? 7.061   2.680   11.377  1.00 0.00 ? 562 THR A HA   1  
ATOM   552   H  HB   . THR A 1 34 ? 8.509   0.768   11.190  1.00 0.00 ? 562 THR A HB   1  
ATOM   553   H  HG1  . THR A 1 34 ? 9.958   1.488   9.644   1.00 0.00 ? 562 THR A HG1  1  
ATOM   554   H  HG21 . THR A 1 34 ? 6.047   0.735   10.163  1.00 0.00 ? 562 THR A HG21 1  
ATOM   555   H  HG22 . THR A 1 34 ? 7.101   -0.678  10.195  1.00 0.00 ? 562 THR A HG22 1  
ATOM   556   H  HG23 . THR A 1 34 ? 6.967   0.289   8.726   1.00 0.00 ? 562 THR A HG23 1  
ATOM   557   N  N    . GLY A 1 35 ? 9.704   3.829   9.783   1.00 0.00 ? 563 GLY A N    1  
ATOM   558   C  CA   . GLY A 1 35 ? 10.903  4.627   9.959   1.00 0.00 ? 563 GLY A CA   1  
ATOM   559   C  C    . GLY A 1 35 ? 10.594  6.093   10.194  1.00 0.00 ? 563 GLY A C    1  
ATOM   560   O  O    . GLY A 1 35 ? 10.770  6.922   9.302   1.00 0.00 ? 563 GLY A O    1  
ATOM   561   H  H    . GLY A 1 35 ? 9.436   3.541   8.885   1.00 0.00 ? 563 GLY A H    1  
ATOM   562   H  HA2  . GLY A 1 35 ? 11.455  4.246   10.805  1.00 0.00 ? 563 GLY A HA2  1  
ATOM   563   H  HA3  . GLY A 1 35 ? 11.515  4.537   9.073   1.00 0.00 ? 563 GLY A HA3  1  
ATOM   564   N  N    . GLU A 1 36 ? 10.134  6.412   11.399  1.00 0.00 ? 564 GLU A N    1  
ATOM   565   C  CA   . GLU A 1 36 ? 9.799   7.787   11.750  1.00 0.00 ? 564 GLU A CA   1  
ATOM   566   C  C    . GLU A 1 36 ? 10.479  8.197   13.053  1.00 0.00 ? 564 GLU A C    1  
ATOM   567   O  O    . GLU A 1 36 ? 11.064  9.276   13.147  1.00 0.00 ? 564 GLU A O    1  
ATOM   568   C  CB   . GLU A 1 36 ? 8.284   7.949   11.880  1.00 0.00 ? 564 GLU A CB   1  
ATOM   569   C  CG   . GLU A 1 36 ? 7.523   7.581   10.616  1.00 0.00 ? 564 GLU A CG   1  
ATOM   570   C  CD   . GLU A 1 36 ? 7.058   8.798   9.841   1.00 0.00 ? 564 GLU A CD   1  
ATOM   571   O  OE1  . GLU A 1 36 ? 7.833   9.773   9.746   1.00 0.00 ? 564 GLU A OE1  1  
ATOM   572   O  OE2  . GLU A 1 36 ? 5.919   8.777   9.329   1.00 0.00 ? 564 GLU A OE2  1  
ATOM   573   H  H    . GLU A 1 36 ? 10.015  5.706   12.069  1.00 0.00 ? 564 GLU A H    1  
ATOM   574   H  HA   . GLU A 1 36 ? 10.154  8.428   10.956  1.00 0.00 ? 564 GLU A HA   1  
ATOM   575   H  HB2  . GLU A 1 36 ? 7.933   7.316   12.682  1.00 0.00 ? 564 GLU A HB2  1  
ATOM   576   H  HB3  . GLU A 1 36 ? 8.062   8.978   12.121  1.00 0.00 ? 564 GLU A HB3  1  
ATOM   577   H  HG2  . GLU A 1 36 ? 8.168   6.994   9.981   1.00 0.00 ? 564 GLU A HG2  1  
ATOM   578   H  HG3  . GLU A 1 36 ? 6.658   6.995   10.890  1.00 0.00 ? 564 GLU A HG3  1  
ATOM   579   N  N    . ARG A 1 37 ? 10.396  7.329   14.056  1.00 0.00 ? 565 ARG A N    1  
ATOM   580   C  CA   . ARG A 1 37 ? 11.003  7.602   15.354  1.00 0.00 ? 565 ARG A CA   1  
ATOM   581   C  C    . ARG A 1 37 ? 11.714  6.364   15.892  1.00 0.00 ? 565 ARG A C    1  
ATOM   582   O  O    . ARG A 1 37 ? 12.032  6.344   17.100  1.00 0.00 ? 565 ARG A O    1  
ATOM   583   C  CB   . ARG A 1 37 ? 9.940   8.067   16.350  1.00 0.00 ? 565 ARG A CB   1  
ATOM   584   C  CG   . ARG A 1 37 ? 8.728   7.153   16.418  1.00 0.00 ? 565 ARG A CG   1  
ATOM   585   C  CD   . ARG A 1 37 ? 7.924   7.385   17.687  1.00 0.00 ? 565 ARG A CD   1  
ATOM   586   N  NE   . ARG A 1 37 ? 7.337   6.149   18.197  1.00 0.00 ? 565 ARG A NE   1  
ATOM   587   C  CZ   . ARG A 1 37 ? 6.348   6.110   19.088  1.00 0.00 ? 565 ARG A CZ   1  
ATOM   588   N  NH1  . ARG A 1 37 ? 5.834   7.235   19.569  1.00 0.00 ? 565 ARG A NH1  1  
ATOM   589   N  NH2  . ARG A 1 37 ? 5.873   4.942   19.499  1.00 0.00 ? 565 ARG A NH2  1  
ATOM   590   O  OXT  . ARG A 1 37 ? 11.946  5.425   15.102  1.00 0.00 ? 565 ARG A OXT  1  
ATOM   591   H  H    . ARG A 1 37 ? 9.916   6.486   13.921  1.00 0.00 ? 565 ARG A H    1  
ATOM   592   H  HA   . ARG A 1 37 ? 11.729  8.390   15.221  1.00 0.00 ? 565 ARG A HA   1  
ATOM   593   H  HB2  . ARG A 1 37 ? 10.382  8.116   17.334  1.00 0.00 ? 565 ARG A HB2  1  
ATOM   594   H  HB3  . ARG A 1 37 ? 9.604   9.054   16.066  1.00 0.00 ? 565 ARG A HB3  1  
ATOM   595   H  HG2  . ARG A 1 37 ? 8.096   7.345   15.564  1.00 0.00 ? 565 ARG A HG2  1  
ATOM   596   H  HG3  . ARG A 1 37 ? 9.062   6.126   16.396  1.00 0.00 ? 565 ARG A HG3  1  
ATOM   597   H  HD2  . ARG A 1 37 ? 8.577   7.800   18.440  1.00 0.00 ? 565 ARG A HD2  1  
ATOM   598   H  HD3  . ARG A 1 37 ? 7.132   8.087   17.473  1.00 0.00 ? 565 ARG A HD3  1  
ATOM   599   H  HE   . ARG A 1 37 ? 7.698   5.303   17.859  1.00 0.00 ? 565 ARG A HE   1  
ATOM   600   H  HH11 . ARG A 1 37 ? 6.188   8.118   19.263  1.00 0.00 ? 565 ARG A HH11 1  
ATOM   601   H  HH12 . ARG A 1 37 ? 5.091   7.199   20.237  1.00 0.00 ? 565 ARG A HH12 1  
ATOM   602   H  HH21 . ARG A 1 37 ? 6.257   4.091   19.140  1.00 0.00 ? 565 ARG A HH21 1  
ATOM   603   H  HH22 . ARG A 1 37 ? 5.130   4.912   20.168  1.00 0.00 ? 565 ARG A HH22 1  
HETATM 604   ZN ZN   . ZN  B 2 .  ? 0.587   5.652   4.064   1.00 0.00 ? 100 ZN  A ZN   1  
ATOM   605   N  N    . MET A 1 1  ? -4.637  -18.423 -7.676  1.00 0.00 ? 1   MET A N    2  
ATOM   606   C  CA   . MET A 1 1  ? -4.599  -17.002 -8.110  1.00 0.00 ? 1   MET A CA   2  
ATOM   607   C  C    . MET A 1 1  ? -5.954  -16.555 -8.651  1.00 0.00 ? 1   MET A C    2  
ATOM   608   O  O    . MET A 1 1  ? -6.388  -17.004 -9.712  1.00 0.00 ? 1   MET A O    2  
ATOM   609   C  CB   . MET A 1 1  ? -3.521  -16.850 -9.185  1.00 0.00 ? 1   MET A CB   2  
ATOM   610   C  CG   . MET A 1 1  ? -2.480  -15.792 -8.858  1.00 0.00 ? 1   MET A CG   2  
ATOM   611   S  SD   . MET A 1 1  ? -1.029  -15.891 -9.923  1.00 0.00 ? 1   MET A SD   2  
ATOM   612   C  CE   . MET A 1 1  ? -0.162  -14.396 -9.455  1.00 0.00 ? 1   MET A CE   2  
ATOM   613   H  H1   . MET A 1 1  ? -5.530  -18.575 -7.166  1.00 0.00 ? 1   MET A H1   2  
ATOM   614   H  H2   . MET A 1 1  ? -3.817  -18.586 -7.055  1.00 0.00 ? 1   MET A H2   2  
ATOM   615   H  H3   . MET A 1 1  ? -4.587  -19.016 -8.528  1.00 0.00 ? 1   MET A H3   2  
ATOM   616   H  HA   . MET A 1 1  ? -4.341  -16.390 -7.259  1.00 0.00 ? 1   MET A HA   2  
ATOM   617   H  HB2  . MET A 1 1  ? -3.014  -17.796 -9.306  1.00 0.00 ? 1   MET A HB2  2  
ATOM   618   H  HB3  . MET A 1 1  ? -3.992  -16.584 -10.120 1.00 0.00 ? 1   MET A HB3  2  
ATOM   619   H  HG2  . MET A 1 1  ? -2.929  -14.817 -8.976  1.00 0.00 ? 1   MET A HG2  2  
ATOM   620   H  HG3  . MET A 1 1  ? -2.167  -15.920 -7.832  1.00 0.00 ? 1   MET A HG3  2  
ATOM   621   H  HE1  . MET A 1 1  ? 0.217   -14.500 -8.449  1.00 0.00 ? 1   MET A HE1  2  
ATOM   622   H  HE2  . MET A 1 1  ? -0.841  -13.557 -9.499  1.00 0.00 ? 1   MET A HE2  2  
ATOM   623   H  HE3  . MET A 1 1  ? 0.661   -14.229 -10.134 1.00 0.00 ? 1   MET A HE3  2  
ATOM   624   N  N    . ASP A 1 2  ? -6.617  -15.670 -7.915  1.00 0.00 ? 530 ASP A N    2  
ATOM   625   C  CA   . ASP A 1 2  ? -7.923  -15.162 -8.320  1.00 0.00 ? 530 ASP A CA   2  
ATOM   626   C  C    . ASP A 1 2  ? -7.795  -14.236 -9.530  1.00 0.00 ? 530 ASP A C    2  
ATOM   627   O  O    . ASP A 1 2  ? -7.250  -13.138 -9.421  1.00 0.00 ? 530 ASP A O    2  
ATOM   628   C  CB   . ASP A 1 2  ? -8.584  -14.416 -7.159  1.00 0.00 ? 530 ASP A CB   2  
ATOM   629   C  CG   . ASP A 1 2  ? -10.069 -14.703 -7.059  1.00 0.00 ? 530 ASP A CG   2  
ATOM   630   O  OD1  . ASP A 1 2  ? -10.833 -14.184 -7.900  1.00 0.00 ? 530 ASP A OD1  2  
ATOM   631   O  OD2  . ASP A 1 2  ? -10.469 -15.446 -6.138  1.00 0.00 ? 530 ASP A OD2  2  
ATOM   632   H  H    . ASP A 1 2  ? -6.219  -15.350 -7.078  1.00 0.00 ? 530 ASP A H    2  
ATOM   633   H  HA   . ASP A 1 2  ? -8.538  -16.008 -8.587  1.00 0.00 ? 530 ASP A HA   2  
ATOM   634   H  HB2  . ASP A 1 2  ? -8.115  -14.715 -6.234  1.00 0.00 ? 530 ASP A HB2  2  
ATOM   635   H  HB3  . ASP A 1 2  ? -8.449  -13.353 -7.299  1.00 0.00 ? 530 ASP A HB3  2  
ATOM   636   N  N    . PRO A 1 3  ? -8.297  -14.664 -10.703 1.00 0.00 ? 531 PRO A N    2  
ATOM   637   C  CA   . PRO A 1 3  ? -8.230  -13.859 -11.928 1.00 0.00 ? 531 PRO A CA   2  
ATOM   638   C  C    . PRO A 1 3  ? -9.117  -12.621 -11.857 1.00 0.00 ? 531 PRO A C    2  
ATOM   639   O  O    . PRO A 1 3  ? -10.342 -12.725 -11.800 1.00 0.00 ? 531 PRO A O    2  
ATOM   640   C  CB   . PRO A 1 3  ? -8.732  -14.815 -13.014 1.00 0.00 ? 531 PRO A CB   2  
ATOM   641   C  CG   . PRO A 1 3  ? -9.586  -15.796 -12.289 1.00 0.00 ? 531 PRO A CG   2  
ATOM   642   C  CD   . PRO A 1 3  ? -8.966  -15.960 -10.930 1.00 0.00 ? 531 PRO A CD   2  
ATOM   643   H  HA   . PRO A 1 3  ? -7.215  -13.561 -12.149 1.00 0.00 ? 531 PRO A HA   2  
ATOM   644   H  HB2  . PRO A 1 3  ? -9.300  -14.262 -13.748 1.00 0.00 ? 531 PRO A HB2  2  
ATOM   645   H  HB3  . PRO A 1 3  ? -7.892  -15.299 -13.489 1.00 0.00 ? 531 PRO A HB3  2  
ATOM   646   H  HG2  . PRO A 1 3  ? -10.592 -15.412 -12.199 1.00 0.00 ? 531 PRO A HG2  2  
ATOM   647   H  HG3  . PRO A 1 3  ? -9.590  -16.739 -12.816 1.00 0.00 ? 531 PRO A HG3  2  
ATOM   648   H  HD2  . PRO A 1 3  ? -9.728  -16.136 -10.186 1.00 0.00 ? 531 PRO A HD2  2  
ATOM   649   H  HD3  . PRO A 1 3  ? -8.249  -16.767 -10.937 1.00 0.00 ? 531 PRO A HD3  2  
ATOM   650   N  N    . GLY A 1 4  ? -8.489  -11.449 -11.862 1.00 0.00 ? 532 GLY A N    2  
ATOM   651   C  CA   . GLY A 1 4  ? -9.237  -10.207 -11.799 1.00 0.00 ? 532 GLY A CA   2  
ATOM   652   C  C    . GLY A 1 4  ? -8.868  -9.368  -10.591 1.00 0.00 ? 532 GLY A C    2  
ATOM   653   O  O    . GLY A 1 4  ? -9.008  -9.814  -9.452  1.00 0.00 ? 532 GLY A O    2  
ATOM   654   H  H    . GLY A 1 4  ? -7.511  -11.428 -11.910 1.00 0.00 ? 532 GLY A H    2  
ATOM   655   H  HA2  . GLY A 1 4  ? -9.039  -9.635  -12.694 1.00 0.00 ? 532 GLY A HA2  2  
ATOM   656   H  HA3  . GLY A 1 4  ? -10.291 -10.435 -11.757 1.00 0.00 ? 532 GLY A HA3  2  
ATOM   657   N  N    . LYS A 1 5  ? -8.397  -8.151  -10.839 1.00 0.00 ? 533 LYS A N    2  
ATOM   658   C  CA   . LYS A 1 5  ? -8.007  -7.248  -9.762  1.00 0.00 ? 533 LYS A CA   2  
ATOM   659   C  C    . LYS A 1 5  ? -9.120  -6.250  -9.460  1.00 0.00 ? 533 LYS A C    2  
ATOM   660   O  O    . LYS A 1 5  ? -9.786  -5.753  -10.368 1.00 0.00 ? 533 LYS A O    2  
ATOM   661   C  CB   . LYS A 1 5  ? -6.723  -6.503  -10.132 1.00 0.00 ? 533 LYS A CB   2  
ATOM   662   C  CG   . LYS A 1 5  ? -5.459  -7.188  -9.637  1.00 0.00 ? 533 LYS A CG   2  
ATOM   663   C  CD   . LYS A 1 5  ? -4.270  -6.239  -9.647  1.00 0.00 ? 533 LYS A CD   2  
ATOM   664   C  CE   . LYS A 1 5  ? -3.453  -6.357  -8.370  1.00 0.00 ? 533 LYS A CE   2  
ATOM   665   N  NZ   . LYS A 1 5  ? -2.519  -7.516  -8.414  1.00 0.00 ? 533 LYS A NZ   2  
ATOM   666   H  H    . LYS A 1 5  ? -8.309  -7.852  -11.768 1.00 0.00 ? 533 LYS A H    2  
ATOM   667   H  HA   . LYS A 1 5  ? -7.826  -7.844  -8.880  1.00 0.00 ? 533 LYS A HA   2  
ATOM   668   H  HB2  . LYS A 1 5  ? -6.665  -6.421  -11.207 1.00 0.00 ? 533 LYS A HB2  2  
ATOM   669   H  HB3  . LYS A 1 5  ? -6.760  -5.512  -9.705  1.00 0.00 ? 533 LYS A HB3  2  
ATOM   670   H  HG2  . LYS A 1 5  ? -5.621  -7.536  -8.628  1.00 0.00 ? 533 LYS A HG2  2  
ATOM   671   H  HG3  . LYS A 1 5  ? -5.243  -8.029  -10.280 1.00 0.00 ? 533 LYS A HG3  2  
ATOM   672   H  HD2  . LYS A 1 5  ? -3.639  -6.478  -10.489 1.00 0.00 ? 533 LYS A HD2  2  
ATOM   673   H  HD3  . LYS A 1 5  ? -4.631  -5.225  -9.740  1.00 0.00 ? 533 LYS A HD3  2  
ATOM   674   H  HE2  . LYS A 1 5  ? -2.881  -5.451  -8.239  1.00 0.00 ? 533 LYS A HE2  2  
ATOM   675   H  HE3  . LYS A 1 5  ? -4.127  -6.480  -7.536  1.00 0.00 ? 533 LYS A HE3  2  
ATOM   676   H  HZ1  . LYS A 1 5  ? -1.685  -7.326  -7.821  1.00 0.00 ? 533 LYS A HZ1  2  
ATOM   677   H  HZ2  . LYS A 1 5  ? -2.204  -7.686  -9.390  1.00 0.00 ? 533 LYS A HZ2  2  
ATOM   678   H  HZ3  . LYS A 1 5  ? -2.994  -8.371  -8.061  1.00 0.00 ? 533 LYS A HZ3  2  
ATOM   679   N  N    . LYS A 1 6  ? -9.316  -5.962  -8.178  1.00 0.00 ? 534 LYS A N    2  
ATOM   680   C  CA   . LYS A 1 6  ? -10.349 -5.023  -7.754  1.00 0.00 ? 534 LYS A CA   2  
ATOM   681   C  C    . LYS A 1 6  ? -9.851  -4.149  -6.608  1.00 0.00 ? 534 LYS A C    2  
ATOM   682   O  O    . LYS A 1 6  ? -8.835  -4.450  -5.981  1.00 0.00 ? 534 LYS A O    2  
ATOM   683   C  CB   . LYS A 1 6  ? -11.608 -5.778  -7.326  1.00 0.00 ? 534 LYS A CB   2  
ATOM   684   C  CG   . LYS A 1 6  ? -12.247 -6.581  -8.449  1.00 0.00 ? 534 LYS A CG   2  
ATOM   685   C  CD   . LYS A 1 6  ? -13.644 -6.075  -8.775  1.00 0.00 ? 534 LYS A CD   2  
ATOM   686   C  CE   . LYS A 1 6  ? -13.908 -6.094  -10.272 1.00 0.00 ? 534 LYS A CE   2  
ATOM   687   N  NZ   . LYS A 1 6  ? -15.217 -5.471  -10.613 1.00 0.00 ? 534 LYS A NZ   2  
ATOM   688   H  H    . LYS A 1 6  ? -8.753  -6.391  -7.500  1.00 0.00 ? 534 LYS A H    2  
ATOM   689   H  HA   . LYS A 1 6  ? -10.587 -4.391  -8.596  1.00 0.00 ? 534 LYS A HA   2  
ATOM   690   H  HB2  . LYS A 1 6  ? -11.352 -6.458  -6.527  1.00 0.00 ? 534 LYS A HB2  2  
ATOM   691   H  HB3  . LYS A 1 6  ? -12.334 -5.066  -6.962  1.00 0.00 ? 534 LYS A HB3  2  
ATOM   692   H  HG2  . LYS A 1 6  ? -11.631 -6.499  -9.332  1.00 0.00 ? 534 LYS A HG2  2  
ATOM   693   H  HG3  . LYS A 1 6  ? -12.310 -7.616  -8.147  1.00 0.00 ? 534 LYS A HG3  2  
ATOM   694   H  HD2  . LYS A 1 6  ? -14.369 -6.706  -8.284  1.00 0.00 ? 534 LYS A HD2  2  
ATOM   695   H  HD3  . LYS A 1 6  ? -13.742 -5.062  -8.414  1.00 0.00 ? 534 LYS A HD3  2  
ATOM   696   H  HE2  . LYS A 1 6  ? -13.120 -5.551  -10.771 1.00 0.00 ? 534 LYS A HE2  2  
ATOM   697   H  HE3  . LYS A 1 6  ? -13.908 -7.120  -10.611 1.00 0.00 ? 534 LYS A HE3  2  
ATOM   698   H  HZ1  . LYS A 1 6  ? -15.987 -6.154  -10.466 1.00 0.00 ? 534 LYS A HZ1  2  
ATOM   699   H  HZ2  . LYS A 1 6  ? -15.221 -5.171  -11.609 1.00 0.00 ? 534 LYS A HZ2  2  
ATOM   700   H  HZ3  . LYS A 1 6  ? -15.384 -4.639  -10.011 1.00 0.00 ? 534 LYS A HZ3  2  
ATOM   701   N  N    . LYS A 1 7  ? -10.572 -3.066  -6.339  1.00 0.00 ? 535 LYS A N    2  
ATOM   702   C  CA   . LYS A 1 7  ? -10.203 -2.149  -5.267  1.00 0.00 ? 535 LYS A CA   2  
ATOM   703   C  C    . LYS A 1 7  ? -8.823  -1.549  -5.516  1.00 0.00 ? 535 LYS A C    2  
ATOM   704   O  O    . LYS A 1 7  ? -8.015  -2.112  -6.255  1.00 0.00 ? 535 LYS A O    2  
ATOM   705   C  CB   . LYS A 1 7  ? -10.222 -2.872  -3.919  1.00 0.00 ? 535 LYS A CB   2  
ATOM   706   C  CG   . LYS A 1 7  ? -11.617 -3.037  -3.337  1.00 0.00 ? 535 LYS A CG   2  
ATOM   707   C  CD   . LYS A 1 7  ? -11.894 -4.481  -2.950  1.00 0.00 ? 535 LYS A CD   2  
ATOM   708   C  CE   . LYS A 1 7  ? -13.382 -4.734  -2.770  1.00 0.00 ? 535 LYS A CE   2  
ATOM   709   N  NZ   . LYS A 1 7  ? -13.743 -6.151  -3.049  1.00 0.00 ? 535 LYS A NZ   2  
ATOM   710   H  H    . LYS A 1 7  ? -11.372 -2.879  -6.874  1.00 0.00 ? 535 LYS A H    2  
ATOM   711   H  HA   . LYS A 1 7  ? -10.931 -1.351  -5.248  1.00 0.00 ? 535 LYS A HA   2  
ATOM   712   H  HB2  . LYS A 1 7  ? -9.787  -3.852  -4.044  1.00 0.00 ? 535 LYS A HB2  2  
ATOM   713   H  HB3  . LYS A 1 7  ? -9.625  -2.311  -3.215  1.00 0.00 ? 535 LYS A HB3  2  
ATOM   714   H  HG2  . LYS A 1 7  ? -11.705 -2.417  -2.458  1.00 0.00 ? 535 LYS A HG2  2  
ATOM   715   H  HG3  . LYS A 1 7  ? -12.343 -2.725  -4.074  1.00 0.00 ? 535 LYS A HG3  2  
ATOM   716   H  HD2  . LYS A 1 7  ? -11.521 -5.131  -3.728  1.00 0.00 ? 535 LYS A HD2  2  
ATOM   717   H  HD3  . LYS A 1 7  ? -11.386 -4.699  -2.022  1.00 0.00 ? 535 LYS A HD3  2  
ATOM   718   H  HE2  . LYS A 1 7  ? -13.654 -4.497  -1.752  1.00 0.00 ? 535 LYS A HE2  2  
ATOM   719   H  HE3  . LYS A 1 7  ? -13.928 -4.092  -3.446  1.00 0.00 ? 535 LYS A HE3  2  
ATOM   720   H  HZ1  . LYS A 1 7  ? -13.052 -6.574  -3.702  1.00 0.00 ? 535 LYS A HZ1  2  
ATOM   721   H  HZ2  . LYS A 1 7  ? -14.687 -6.201  -3.481  1.00 0.00 ? 535 LYS A HZ2  2  
ATOM   722   H  HZ3  . LYS A 1 7  ? -13.750 -6.699  -2.165  1.00 0.00 ? 535 LYS A HZ3  2  
ATOM   723   N  N    . GLN A 1 8  ? -8.559  -0.404  -4.894  1.00 0.00 ? 536 GLN A N    2  
ATOM   724   C  CA   . GLN A 1 8  ? -7.276  0.271   -5.048  1.00 0.00 ? 536 GLN A CA   2  
ATOM   725   C  C    . GLN A 1 8  ? -6.344  -0.059  -3.887  1.00 0.00 ? 536 GLN A C    2  
ATOM   726   O  O    . GLN A 1 8  ? -6.693  -0.841  -3.002  1.00 0.00 ? 536 GLN A O    2  
ATOM   727   C  CB   . GLN A 1 8  ? -7.480  1.785   -5.139  1.00 0.00 ? 536 GLN A CB   2  
ATOM   728   C  CG   . GLN A 1 8  ? -8.238  2.223   -6.382  1.00 0.00 ? 536 GLN A CG   2  
ATOM   729   C  CD   . GLN A 1 8  ? -9.296  3.266   -6.083  1.00 0.00 ? 536 GLN A CD   2  
ATOM   730   O  OE1  . GLN A 1 8  ? -9.892  3.272   -5.005  1.00 0.00 ? 536 GLN A OE1  2  
ATOM   731   N  NE2  . GLN A 1 8  ? -9.536  4.156   -7.038  1.00 0.00 ? 536 GLN A NE2  2  
ATOM   732   H  H    . GLN A 1 8  ? -9.244  -0.005  -4.318  1.00 0.00 ? 536 GLN A H    2  
ATOM   733   H  HA   . GLN A 1 8  ? -6.826  -0.078  -5.966  1.00 0.00 ? 536 GLN A HA   2  
ATOM   734   H  HB2  . GLN A 1 8  ? -8.032  2.115   -4.272  1.00 0.00 ? 536 GLN A HB2  2  
ATOM   735   H  HB3  . GLN A 1 8  ? -6.513  2.267   -5.145  1.00 0.00 ? 536 GLN A HB3  2  
ATOM   736   H  HG2  . GLN A 1 8  ? -7.535  2.638   -7.089  1.00 0.00 ? 536 GLN A HG2  2  
ATOM   737   H  HG3  . GLN A 1 8  ? -8.717  1.359   -6.819  1.00 0.00 ? 536 GLN A HG3  2  
ATOM   738   H  HE21 . GLN A 1 8  ? -9.024  4.091   -7.871  1.00 0.00 ? 536 GLN A HE21 2  
ATOM   739   H  HE22 . GLN A 1 8  ? -10.216 4.843   -6.871  1.00 0.00 ? 536 GLN A HE22 2  
ATOM   740   N  N    . HIS A 1 9  ? -5.158  0.541   -3.896  1.00 0.00 ? 537 HIS A N    2  
ATOM   741   C  CA   . HIS A 1 9  ? -4.176  0.310   -2.843  1.00 0.00 ? 537 HIS A CA   2  
ATOM   742   C  C    . HIS A 1 9  ? -4.192  1.445   -1.824  1.00 0.00 ? 537 HIS A C    2  
ATOM   743   O  O    . HIS A 1 9  ? -3.622  2.510   -2.058  1.00 0.00 ? 537 HIS A O    2  
ATOM   744   C  CB   . HIS A 1 9  ? -2.776  0.168   -3.444  1.00 0.00 ? 537 HIS A CB   2  
ATOM   745   C  CG   . HIS A 1 9  ? -2.590  -1.085  -4.242  1.00 0.00 ? 537 HIS A CG   2  
ATOM   746   N  ND1  . HIS A 1 9  ? -3.628  -1.860  -4.710  1.00 0.00 ? 537 HIS A ND1  2  
ATOM   747   C  CD2  . HIS A 1 9  ? -1.451  -1.697  -4.656  1.00 0.00 ? 537 HIS A CD2  2  
ATOM   748   C  CE1  . HIS A 1 9  ? -3.100  -2.895  -5.377  1.00 0.00 ? 537 HIS A CE1  2  
ATOM   749   N  NE2  . HIS A 1 9  ? -1.782  -2.842  -5.374  1.00 0.00 ? 537 HIS A NE2  2  
ATOM   750   H  H    . HIS A 1 9  ? -4.938  1.153   -4.629  1.00 0.00 ? 537 HIS A H    2  
ATOM   751   H  HA   . HIS A 1 9  ? -4.438  -0.611  -2.343  1.00 0.00 ? 537 HIS A HA   2  
ATOM   752   H  HB2  . HIS A 1 9  ? -2.585  1.007   -4.096  1.00 0.00 ? 537 HIS A HB2  2  
ATOM   753   H  HB3  . HIS A 1 9  ? -2.048  0.166   -2.645  1.00 0.00 ? 537 HIS A HB3  2  
ATOM   754   H  HD1  . HIS A 1 9  ? -4.583  -1.685  -4.577  1.00 0.00 ? 537 HIS A HD1  2  
ATOM   755   H  HD2  . HIS A 1 9  ? -0.443  -1.358  -4.464  1.00 0.00 ? 537 HIS A HD2  2  
ATOM   756   H  HE1  . HIS A 1 9  ? -3.679  -3.671  -5.857  1.00 0.00 ? 537 HIS A HE1  2  
ATOM   757   N  N    . ILE A 1 10 ? -4.848  1.208   -0.692  1.00 0.00 ? 538 ILE A N    2  
ATOM   758   C  CA   . ILE A 1 10 ? -4.939  2.209   0.364   1.00 0.00 ? 538 ILE A CA   2  
ATOM   759   C  C    . ILE A 1 10 ? -4.387  1.668   1.679   1.00 0.00 ? 538 ILE A C    2  
ATOM   760   O  O    . ILE A 1 10 ? -4.461  0.469   1.947   1.00 0.00 ? 538 ILE A O    2  
ATOM   761   C  CB   . ILE A 1 10 ? -6.393  2.667   0.582   1.00 0.00 ? 538 ILE A CB   2  
ATOM   762   C  CG1  . ILE A 1 10 ? -7.053  3.000   -0.758  1.00 0.00 ? 538 ILE A CG1  2  
ATOM   763   C  CG2  . ILE A 1 10 ? -6.437  3.869   1.514   1.00 0.00 ? 538 ILE A CG2  2  
ATOM   764   C  CD1  . ILE A 1 10 ? -7.852  1.853   -1.338  1.00 0.00 ? 538 ILE A CD1  2  
ATOM   765   H  H    . ILE A 1 10 ? -5.282  0.338   -0.565  1.00 0.00 ? 538 ILE A H    2  
ATOM   766   H  HA   . ILE A 1 10 ? -4.353  3.066   0.064   1.00 0.00 ? 538 ILE A HA   2  
ATOM   767   H  HB   . ILE A 1 10 ? -6.935  1.860   1.051   1.00 0.00 ? 538 ILE A HB   2  
ATOM   768   H  HG12 . ILE A 1 10 ? -7.723  3.836   -0.625  1.00 0.00 ? 538 ILE A HG12 2  
ATOM   769   H  HG13 . ILE A 1 10 ? -6.288  3.267   -1.472  1.00 0.00 ? 538 ILE A HG13 2  
ATOM   770   H  HG21 . ILE A 1 10 ? -6.260  3.545   2.529   1.00 0.00 ? 538 ILE A HG21 2  
ATOM   771   H  HG22 . ILE A 1 10 ? -7.407  4.340   1.450   1.00 0.00 ? 538 ILE A HG22 2  
ATOM   772   H  HG23 . ILE A 1 10 ? -5.674  4.577   1.225   1.00 0.00 ? 538 ILE A HG23 2  
ATOM   773   H  HD11 . ILE A 1 10 ? -7.205  1.000   -1.480  1.00 0.00 ? 538 ILE A HD11 2  
ATOM   774   H  HD12 . ILE A 1 10 ? -8.270  2.150   -2.289  1.00 0.00 ? 538 ILE A HD12 2  
ATOM   775   H  HD13 . ILE A 1 10 ? -8.650  1.591   -0.660  1.00 0.00 ? 538 ILE A HD13 2  
ATOM   776   N  N    . CYS A 1 11 ? -3.834  2.558   2.497   1.00 0.00 ? 539 CYS A N    2  
ATOM   777   C  CA   . CYS A 1 11 ? -3.271  2.163   3.783   1.00 0.00 ? 539 CYS A CA   2  
ATOM   778   C  C    . CYS A 1 11 ? -4.357  1.628   4.712   1.00 0.00 ? 539 CYS A C    2  
ATOM   779   O  O    . CYS A 1 11 ? -5.378  2.280   4.930   1.00 0.00 ? 539 CYS A O    2  
ATOM   780   C  CB   . CYS A 1 11 ? -2.554  3.345   4.442   1.00 0.00 ? 539 CYS A CB   2  
ATOM   781   S  SG   . CYS A 1 11 ? -0.842  2.998   4.907   1.00 0.00 ? 539 CYS A SG   2  
ATOM   782   H  H    . CYS A 1 11 ? -3.804  3.501   2.229   1.00 0.00 ? 539 CYS A H    2  
ATOM   783   H  HA   . CYS A 1 11 ? -2.554  1.377   3.601   1.00 0.00 ? 539 CYS A HA   2  
ATOM   784   H  HB2  . CYS A 1 11 ? -2.545  4.179   3.757   1.00 0.00 ? 539 CYS A HB2  2  
ATOM   785   H  HB3  . CYS A 1 11 ? -3.086  3.629   5.339   1.00 0.00 ? 539 CYS A HB3  2  
ATOM   786   N  N    . HIS A 1 12 ? -4.126  0.439   5.258   1.00 0.00 ? 540 HIS A N    2  
ATOM   787   C  CA   . HIS A 1 12 ? -5.082  -0.184  6.167   1.00 0.00 ? 540 HIS A CA   2  
ATOM   788   C  C    . HIS A 1 12 ? -4.686  0.064   7.620   1.00 0.00 ? 540 HIS A C    2  
ATOM   789   O  O    . HIS A 1 12 ? -4.958  -0.757  8.496   1.00 0.00 ? 540 HIS A O    2  
ATOM   790   C  CB   . HIS A 1 12 ? -5.170  -1.688  5.894   1.00 0.00 ? 540 HIS A CB   2  
ATOM   791   C  CG   . HIS A 1 12 ? -6.536  -2.141  5.482   1.00 0.00 ? 540 HIS A CG   2  
ATOM   792   N  ND1  . HIS A 1 12 ? -7.238  -1.601  4.427   1.00 0.00 ? 540 HIS A ND1  2  
ATOM   793   C  CD2  . HIS A 1 12 ? -7.332  -3.109  6.005   1.00 0.00 ? 540 HIS A CD2  2  
ATOM   794   C  CE1  . HIS A 1 12 ? -8.413  -2.241  4.345   1.00 0.00 ? 540 HIS A CE1  2  
ATOM   795   N  NE2  . HIS A 1 12 ? -8.518  -3.166  5.280   1.00 0.00 ? 540 HIS A NE2  2  
ATOM   796   H  H    . HIS A 1 12 ? -3.292  -0.031  5.047   1.00 0.00 ? 540 HIS A H    2  
ATOM   797   H  HA   . HIS A 1 12 ? -6.048  0.263   5.988   1.00 0.00 ? 540 HIS A HA   2  
ATOM   798   H  HB2  . HIS A 1 12 ? -4.483  -1.944  5.102   1.00 0.00 ? 540 HIS A HB2  2  
ATOM   799   H  HB3  . HIS A 1 12 ? -4.896  -2.228  6.789   1.00 0.00 ? 540 HIS A HB3  2  
ATOM   800   H  HD1  . HIS A 1 12 ? -6.934  -0.877  3.841   1.00 0.00 ? 540 HIS A HD1  2  
ATOM   801   H  HD2  . HIS A 1 12 ? -7.092  -3.739  6.849   1.00 0.00 ? 540 HIS A HD2  2  
ATOM   802   H  HE1  . HIS A 1 12 ? -9.173  -2.029  3.608   1.00 0.00 ? 540 HIS A HE1  2  
ATOM   803   N  N    . ILE A 1 13 ? -4.043  1.200   7.866   1.00 0.00 ? 541 ILE A N    2  
ATOM   804   C  CA   . ILE A 1 13 ? -3.608  1.559   9.210   1.00 0.00 ? 541 ILE A CA   2  
ATOM   805   C  C    . ILE A 1 13 ? -4.122  2.940   9.600   1.00 0.00 ? 541 ILE A C    2  
ATOM   806   O  O    . ILE A 1 13 ? -4.094  3.873   8.797   1.00 0.00 ? 541 ILE A O    2  
ATOM   807   C  CB   . ILE A 1 13 ? -2.071  1.544   9.323   1.00 0.00 ? 541 ILE A CB   2  
ATOM   808   C  CG1  . ILE A 1 13 ? -1.510  0.218   8.803   1.00 0.00 ? 541 ILE A CG1  2  
ATOM   809   C  CG2  . ILE A 1 13 ? -1.640  1.778   10.764  1.00 0.00 ? 541 ILE A CG2  2  
ATOM   810   C  CD1  . ILE A 1 13 ? -0.262  0.379   7.962   1.00 0.00 ? 541 ILE A CD1  2  
ATOM   811   H  H    . ILE A 1 13 ? -3.855  1.813   7.125   1.00 0.00 ? 541 ILE A H    2  
ATOM   812   H  HA   . ILE A 1 13 ? -4.007  0.827   9.897   1.00 0.00 ? 541 ILE A HA   2  
ATOM   813   H  HB   . ILE A 1 13 ? -1.680  2.351   8.722   1.00 0.00 ? 541 ILE A HB   2  
ATOM   814   H  HG12 . ILE A 1 13 ? -1.264  -0.416  9.642   1.00 0.00 ? 541 ILE A HG12 2  
ATOM   815   H  HG13 . ILE A 1 13 ? -2.259  -0.270  8.197   1.00 0.00 ? 541 ILE A HG13 2  
ATOM   816   H  HG21 . ILE A 1 13 ? -1.381  0.834   11.220  1.00 0.00 ? 541 ILE A HG21 2  
ATOM   817   H  HG22 . ILE A 1 13 ? -2.451  2.233   11.313  1.00 0.00 ? 541 ILE A HG22 2  
ATOM   818   H  HG23 . ILE A 1 13 ? -0.781  2.433   10.780  1.00 0.00 ? 541 ILE A HG23 2  
ATOM   819   H  HD11 . ILE A 1 13 ? 0.274   -0.558  7.932   1.00 0.00 ? 541 ILE A HD11 2  
ATOM   820   H  HD12 . ILE A 1 13 ? 0.368   1.141   8.396   1.00 0.00 ? 541 ILE A HD12 2  
ATOM   821   H  HD13 . ILE A 1 13 ? -0.539  0.668   6.959   1.00 0.00 ? 541 ILE A HD13 2  
ATOM   822   N  N    . GLN A 1 14 ? -4.591  3.064   10.838  1.00 0.00 ? 542 GLN A N    2  
ATOM   823   C  CA   . GLN A 1 14 ? -5.111  4.332   11.334  1.00 0.00 ? 542 GLN A CA   2  
ATOM   824   C  C    . GLN A 1 14 ? -4.020  5.399   11.345  1.00 0.00 ? 542 GLN A C    2  
ATOM   825   O  O    . GLN A 1 14 ? -3.393  5.649   12.374  1.00 0.00 ? 542 GLN A O    2  
ATOM   826   C  CB   . GLN A 1 14 ? -5.683  4.157   12.742  1.00 0.00 ? 542 GLN A CB   2  
ATOM   827   C  CG   . GLN A 1 14 ? -4.762  3.398   13.683  1.00 0.00 ? 542 GLN A CG   2  
ATOM   828   C  CD   . GLN A 1 14 ? -5.173  3.534   15.136  1.00 0.00 ? 542 GLN A CD   2  
ATOM   829   O  OE1  . GLN A 1 14 ? -4.448  4.112   15.946  1.00 0.00 ? 542 GLN A OE1  2  
ATOM   830   N  NE2  . GLN A 1 14 ? -6.341  3.001   15.473  1.00 0.00 ? 542 GLN A NE2  2  
ATOM   831   H  H    . GLN A 1 14 ? -4.587  2.285   11.431  1.00 0.00 ? 542 GLN A H    2  
ATOM   832   H  HA   . GLN A 1 14 ? -5.901  4.648   10.670  1.00 0.00 ? 542 GLN A HA   2  
ATOM   833   H  HB2  . GLN A 1 14 ? -5.870  5.133   13.165  1.00 0.00 ? 542 GLN A HB2  2  
ATOM   834   H  HB3  . GLN A 1 14 ? -6.617  3.619   12.674  1.00 0.00 ? 542 GLN A HB3  2  
ATOM   835   H  HG2  . GLN A 1 14 ? -4.780  2.352   13.417  1.00 0.00 ? 542 GLN A HG2  2  
ATOM   836   H  HG3  . GLN A 1 14 ? -3.758  3.781   13.570  1.00 0.00 ? 542 GLN A HG3  2  
ATOM   837   H  HE21 . GLN A 1 14 ? -6.865  2.555   14.775  1.00 0.00 ? 542 GLN A HE21 2  
ATOM   838   H  HE22 . GLN A 1 14 ? -6.631  3.074   16.406  1.00 0.00 ? 542 GLN A HE22 2  
ATOM   839   N  N    . GLY A 1 15 ? -3.800  6.025   10.193  1.00 0.00 ? 543 GLY A N    2  
ATOM   840   C  CA   . GLY A 1 15 ? -2.785  7.056   10.092  1.00 0.00 ? 543 GLY A CA   2  
ATOM   841   C  C    . GLY A 1 15 ? -2.713  7.666   8.706   1.00 0.00 ? 543 GLY A C    2  
ATOM   842   O  O    . GLY A 1 15 ? -2.938  8.865   8.536   1.00 0.00 ? 543 GLY A O    2  
ATOM   843   H  H    . GLY A 1 15 ? -4.331  5.784   9.406   1.00 0.00 ? 543 GLY A H    2  
ATOM   844   H  HA2  . GLY A 1 15 ? -3.007  7.836   10.806  1.00 0.00 ? 543 GLY A HA2  2  
ATOM   845   H  HA3  . GLY A 1 15 ? -1.824  6.625   10.334  1.00 0.00 ? 543 GLY A HA3  2  
ATOM   846   N  N    . CYS A 1 16 ? -2.399  6.841   7.713   1.00 0.00 ? 544 CYS A N    2  
ATOM   847   C  CA   . CYS A 1 16 ? -2.298  7.307   6.336   1.00 0.00 ? 544 CYS A CA   2  
ATOM   848   C  C    . CYS A 1 16 ? -3.680  7.446   5.705   1.00 0.00 ? 544 CYS A C    2  
ATOM   849   O  O    . CYS A 1 16 ? -4.698  7.260   6.370   1.00 0.00 ? 544 CYS A O    2  
ATOM   850   C  CB   . CYS A 1 16 ? -1.442  6.343   5.512   1.00 0.00 ? 544 CYS A CB   2  
ATOM   851   S  SG   . CYS A 1 16 ? 0.302   6.808   5.411   1.00 0.00 ? 544 CYS A SG   2  
ATOM   852   H  H    . CYS A 1 16 ? -2.230  5.895   7.911   1.00 0.00 ? 544 CYS A H    2  
ATOM   853   H  HA   . CYS A 1 16 ? -1.822  8.276   6.348   1.00 0.00 ? 544 CYS A HA   2  
ATOM   854   H  HB2  . CYS A 1 16 ? -1.494  5.361   5.956   1.00 0.00 ? 544 CYS A HB2  2  
ATOM   855   H  HB3  . CYS A 1 16 ? -1.831  6.299   4.505   1.00 0.00 ? 544 CYS A HB3  2  
ATOM   856   N  N    . GLY A 1 17 ? -3.705  7.776   4.418   1.00 0.00 ? 545 GLY A N    2  
ATOM   857   C  CA   . GLY A 1 17 ? -4.965  7.935   3.717   1.00 0.00 ? 545 GLY A CA   2  
ATOM   858   C  C    . GLY A 1 17 ? -4.767  8.374   2.282   1.00 0.00 ? 545 GLY A C    2  
ATOM   859   O  O    . GLY A 1 17 ? -5.522  9.198   1.767   1.00 0.00 ? 545 GLY A O    2  
ATOM   860   H  H    . GLY A 1 17 ? -2.861  7.912   3.938   1.00 0.00 ? 545 GLY A H    2  
ATOM   861   H  HA2  . GLY A 1 17 ? -5.492  6.992   3.726   1.00 0.00 ? 545 GLY A HA2  2  
ATOM   862   H  HA3  . GLY A 1 17 ? -5.560  8.675   4.231   1.00 0.00 ? 545 GLY A HA3  2  
ATOM   863   N  N    . LYS A 1 18 ? -3.746  7.822   1.635   1.00 0.00 ? 546 LYS A N    2  
ATOM   864   C  CA   . LYS A 1 18 ? -3.447  8.162   0.250   1.00 0.00 ? 546 LYS A CA   2  
ATOM   865   C  C    . LYS A 1 18 ? -3.980  7.091   -0.698  1.00 0.00 ? 546 LYS A C    2  
ATOM   866   O  O    . LYS A 1 18 ? -4.796  6.256   -0.309  1.00 0.00 ? 546 LYS A O    2  
ATOM   867   C  CB   . LYS A 1 18 ? -1.935  8.344   0.060   1.00 0.00 ? 546 LYS A CB   2  
ATOM   868   C  CG   . LYS A 1 18 ? -1.140  7.047   0.113   1.00 0.00 ? 546 LYS A CG   2  
ATOM   869   C  CD   . LYS A 1 18 ? -0.593  6.781   1.507   1.00 0.00 ? 546 LYS A CD   2  
ATOM   870   C  CE   . LYS A 1 18 ? -0.508  5.291   1.799   1.00 0.00 ? 546 LYS A CE   2  
ATOM   871   N  NZ   . LYS A 1 18 ? -1.765  4.577   1.442   1.00 0.00 ? 546 LYS A NZ   2  
ATOM   872   H  H    . LYS A 1 18 ? -3.180  7.172   2.101   1.00 0.00 ? 546 LYS A H    2  
ATOM   873   H  HA   . LYS A 1 18 ? -3.941  9.096   0.030   1.00 0.00 ? 546 LYS A HA   2  
ATOM   874   H  HB2  . LYS A 1 18 ? -1.759  8.808   -0.899  1.00 0.00 ? 546 LYS A HB2  2  
ATOM   875   H  HB3  . LYS A 1 18 ? -1.565  8.997   0.837   1.00 0.00 ? 546 LYS A HB3  2  
ATOM   876   H  HG2  . LYS A 1 18 ? -1.782  6.229   -0.173  1.00 0.00 ? 546 LYS A HG2  2  
ATOM   877   H  HG3  . LYS A 1 18 ? -0.314  7.116   -0.580  1.00 0.00 ? 546 LYS A HG3  2  
ATOM   878   H  HD2  . LYS A 1 18 ? 0.396   7.207   1.582   1.00 0.00 ? 546 LYS A HD2  2  
ATOM   879   H  HD3  . LYS A 1 18 ? -1.243  7.245   2.233   1.00 0.00 ? 546 LYS A HD3  2  
ATOM   880   H  HE2  . LYS A 1 18 ? 0.307   4.871   1.229   1.00 0.00 ? 546 LYS A HE2  2  
ATOM   881   H  HE3  . LYS A 1 18 ? -0.315  5.155   2.853   1.00 0.00 ? 546 LYS A HE3  2  
ATOM   882   H  HZ1  . LYS A 1 18 ? -1.838  3.690   1.980   1.00 0.00 ? 546 LYS A HZ1  2  
ATOM   883   H  HZ2  . LYS A 1 18 ? -1.774  4.354   0.426   1.00 0.00 ? 546 LYS A HZ2  2  
ATOM   884   H  HZ3  . LYS A 1 18 ? -2.590  5.172   1.662   1.00 0.00 ? 546 LYS A HZ3  2  
ATOM   885   N  N    . VAL A 1 19 ? -3.513  7.119   -1.942  1.00 0.00 ? 547 VAL A N    2  
ATOM   886   C  CA   . VAL A 1 19 ? -3.945  6.147   -2.940  1.00 0.00 ? 547 VAL A CA   2  
ATOM   887   C  C    . VAL A 1 19 ? -2.774  5.692   -3.805  1.00 0.00 ? 547 VAL A C    2  
ATOM   888   O  O    . VAL A 1 19 ? -1.843  6.456   -4.059  1.00 0.00 ? 547 VAL A O    2  
ATOM   889   C  CB   . VAL A 1 19 ? -5.045  6.726   -3.850  1.00 0.00 ? 547 VAL A CB   2  
ATOM   890   C  CG1  . VAL A 1 19 ? -5.621  5.643   -4.748  1.00 0.00 ? 547 VAL A CG1  2  
ATOM   891   C  CG2  . VAL A 1 19 ? -6.139  7.376   -3.016  1.00 0.00 ? 547 VAL A CG2  2  
ATOM   892   H  H    . VAL A 1 19 ? -2.863  7.807   -2.195  1.00 0.00 ? 547 VAL A H    2  
ATOM   893   H  HA   . VAL A 1 19 ? -4.349  5.292   -2.419  1.00 0.00 ? 547 VAL A HA   2  
ATOM   894   H  HB   . VAL A 1 19 ? -4.602  7.485   -4.478  1.00 0.00 ? 547 VAL A HB   2  
ATOM   895   H  HG11 . VAL A 1 19 ? -5.784  4.745   -4.170  1.00 0.00 ? 547 VAL A HG11 2  
ATOM   896   H  HG12 . VAL A 1 19 ? -4.929  5.434   -5.550  1.00 0.00 ? 547 VAL A HG12 2  
ATOM   897   H  HG13 . VAL A 1 19 ? -6.560  5.980   -5.162  1.00 0.00 ? 547 VAL A HG13 2  
ATOM   898   H  HG21 . VAL A 1 19 ? -5.909  8.422   -2.874  1.00 0.00 ? 547 VAL A HG21 2  
ATOM   899   H  HG22 . VAL A 1 19 ? -6.199  6.887   -2.056  1.00 0.00 ? 547 VAL A HG22 2  
ATOM   900   H  HG23 . VAL A 1 19 ? -7.085  7.282   -3.528  1.00 0.00 ? 547 VAL A HG23 2  
ATOM   901   N  N    . TYR A 1 20 ? -2.828  4.442   -4.255  1.00 0.00 ? 548 TYR A N    2  
ATOM   902   C  CA   . TYR A 1 20 ? -1.772  3.884   -5.091  1.00 0.00 ? 548 TYR A CA   2  
ATOM   903   C  C    . TYR A 1 20 ? -2.336  2.845   -6.056  1.00 0.00 ? 548 TYR A C    2  
ATOM   904   O  O    . TYR A 1 20 ? -3.374  2.239   -5.793  1.00 0.00 ? 548 TYR A O    2  
ATOM   905   C  CB   . TYR A 1 20 ? -0.682  3.254   -4.221  1.00 0.00 ? 548 TYR A CB   2  
ATOM   906   C  CG   . TYR A 1 20 ? 0.512   4.154   -4.000  1.00 0.00 ? 548 TYR A CG   2  
ATOM   907   C  CD1  . TYR A 1 20 ? 0.444   5.228   -3.121  1.00 0.00 ? 548 TYR A CD1  2  
ATOM   908   C  CD2  . TYR A 1 20 ? 1.708   3.930   -4.670  1.00 0.00 ? 548 TYR A CD2  2  
ATOM   909   C  CE1  . TYR A 1 20 ? 1.534   6.053   -2.916  1.00 0.00 ? 548 TYR A CE1  2  
ATOM   910   C  CE2  . TYR A 1 20 ? 2.803   4.750   -4.470  1.00 0.00 ? 548 TYR A CE2  2  
ATOM   911   C  CZ   . TYR A 1 20 ? 2.710   5.810   -3.593  1.00 0.00 ? 548 TYR A CZ   2  
ATOM   912   O  OH   . TYR A 1 20 ? 3.797   6.629   -3.391  1.00 0.00 ? 548 TYR A OH   2  
ATOM   913   H  H    . TYR A 1 20 ? -3.597  3.882   -4.018  1.00 0.00 ? 548 TYR A H    2  
ATOM   914   H  HA   . TYR A 1 20 ? -1.341  4.692   -5.663  1.00 0.00 ? 548 TYR A HA   2  
ATOM   915   H  HB2  . TYR A 1 20 ? -1.098  3.013   -3.255  1.00 0.00 ? 548 TYR A HB2  2  
ATOM   916   H  HB3  . TYR A 1 20 ? -0.333  2.347   -4.694  1.00 0.00 ? 548 TYR A HB3  2  
ATOM   917   H  HD1  . TYR A 1 20 ? -0.479  5.415   -2.592  1.00 0.00 ? 548 TYR A HD1  2  
ATOM   918   H  HD2  . TYR A 1 20 ? 1.778   3.100   -5.357  1.00 0.00 ? 548 TYR A HD2  2  
ATOM   919   H  HE1  . TYR A 1 20 ? 1.461   6.882   -2.228  1.00 0.00 ? 548 TYR A HE1  2  
ATOM   920   H  HE2  . TYR A 1 20 ? 3.724   4.560   -5.001  1.00 0.00 ? 548 TYR A HE2  2  
ATOM   921   H  HH   . TYR A 1 20 ? 4.245   6.778   -4.227  1.00 0.00 ? 548 TYR A HH   2  
ATOM   922   N  N    . GLY A 1 21 ? -1.644  2.645   -7.173  1.00 0.00 ? 549 GLY A N    2  
ATOM   923   C  CA   . GLY A 1 21 ? -2.091  1.679   -8.160  1.00 0.00 ? 549 GLY A CA   2  
ATOM   924   C  C    . GLY A 1 21 ? -1.036  0.636   -8.474  1.00 0.00 ? 549 GLY A C    2  
ATOM   925   O  O    . GLY A 1 21 ? -1.041  0.044   -9.553  1.00 0.00 ? 549 GLY A O    2  
ATOM   926   H  H    . GLY A 1 21 ? -0.824  3.158   -7.329  1.00 0.00 ? 549 GLY A H    2  
ATOM   927   H  HA2  . GLY A 1 21 ? -2.973  1.181   -7.786  1.00 0.00 ? 549 GLY A HA2  2  
ATOM   928   H  HA3  . GLY A 1 21 ? -2.345  2.202   -9.070  1.00 0.00 ? 549 GLY A HA3  2  
ATOM   929   N  N    . LYS A 1 22 ? -0.129  0.409   -7.529  1.00 0.00 ? 550 LYS A N    2  
ATOM   930   C  CA   . LYS A 1 22 ? 0.936   -0.571  -7.711  1.00 0.00 ? 550 LYS A CA   2  
ATOM   931   C  C    . LYS A 1 22 ? 1.336   -1.195  -6.378  1.00 0.00 ? 550 LYS A C    2  
ATOM   932   O  O    . LYS A 1 22 ? 1.695   -0.490  -5.435  1.00 0.00 ? 550 LYS A O    2  
ATOM   933   C  CB   . LYS A 1 22 ? 2.153   0.084   -8.367  1.00 0.00 ? 550 LYS A CB   2  
ATOM   934   C  CG   . LYS A 1 22 ? 2.034   0.215   -9.877  1.00 0.00 ? 550 LYS A CG   2  
ATOM   935   C  CD   . LYS A 1 22 ? 3.389   0.452   -10.524 1.00 0.00 ? 550 LYS A CD   2  
ATOM   936   C  CE   . LYS A 1 22 ? 3.276   0.531   -12.038 1.00 0.00 ? 550 LYS A CE   2  
ATOM   937   N  NZ   . LYS A 1 22 ? 3.225   1.940   -12.519 1.00 0.00 ? 550 LYS A NZ   2  
ATOM   938   H  H    . LYS A 1 22 ? -0.176  0.911   -6.689  1.00 0.00 ? 550 LYS A H    2  
ATOM   939   H  HA   . LYS A 1 22 ? 0.563   -1.348  -8.361  1.00 0.00 ? 550 LYS A HA   2  
ATOM   940   H  HB2  . LYS A 1 22 ? 2.285   1.071   -7.951  1.00 0.00 ? 550 LYS A HB2  2  
ATOM   941   H  HB3  . LYS A 1 22 ? 3.029   -0.510  -8.148  1.00 0.00 ? 550 LYS A HB3  2  
ATOM   942   H  HG2  . LYS A 1 22 ? 1.610   -0.694  -10.276 1.00 0.00 ? 550 LYS A HG2  2  
ATOM   943   H  HG3  . LYS A 1 22 ? 1.385   1.048   -10.105 1.00 0.00 ? 550 LYS A HG3  2  
ATOM   944   H  HD2  . LYS A 1 22 ? 3.796   1.381   -10.155 1.00 0.00 ? 550 LYS A HD2  2  
ATOM   945   H  HD3  . LYS A 1 22 ? 4.049   -0.362  -10.263 1.00 0.00 ? 550 LYS A HD3  2  
ATOM   946   H  HE2  . LYS A 1 22 ? 4.134   0.043   -12.476 1.00 0.00 ? 550 LYS A HE2  2  
ATOM   947   H  HE3  . LYS A 1 22 ? 2.376   0.021   -12.347 1.00 0.00 ? 550 LYS A HE3  2  
ATOM   948   H  HZ1  . LYS A 1 22 ? 4.174   2.255   -12.805 1.00 0.00 ? 550 LYS A HZ1  2  
ATOM   949   H  HZ2  . LYS A 1 22 ? 2.879   2.564   -11.762 1.00 0.00 ? 550 LYS A HZ2  2  
ATOM   950   H  HZ3  . LYS A 1 22 ? 2.585   2.016   -13.335 1.00 0.00 ? 550 LYS A HZ3  2  
ATOM   951   N  N    . THR A 1 23 ? 1.274   -2.521  -6.308  1.00 0.00 ? 551 THR A N    2  
ATOM   952   C  CA   . THR A 1 23 ? 1.632   -3.239  -5.091  1.00 0.00 ? 551 THR A CA   2  
ATOM   953   C  C    . THR A 1 23 ? 3.130   -3.145  -4.825  1.00 0.00 ? 551 THR A C    2  
ATOM   954   O  O    . THR A 1 23 ? 3.561   -3.042  -3.676  1.00 0.00 ? 551 THR A O    2  
ATOM   955   C  CB   . THR A 1 23 ? 1.211   -4.706  -5.196  1.00 0.00 ? 551 THR A CB   2  
ATOM   956   O  OG1  . THR A 1 23 ? 1.534   -5.407  -4.008  1.00 0.00 ? 551 THR A OG1  2  
ATOM   957   C  CG2  . THR A 1 23 ? 1.865   -5.434  -6.351  1.00 0.00 ? 551 THR A CG2  2  
ATOM   958   H  H    . THR A 1 23 ? 0.982   -3.028  -7.094  1.00 0.00 ? 551 THR A H    2  
ATOM   959   H  HA   . THR A 1 23 ? 1.103   -2.780  -4.268  1.00 0.00 ? 551 THR A HA   2  
ATOM   960   H  HB   . THR A 1 23 ? 0.141   -4.754  -5.338  1.00 0.00 ? 551 THR A HB   2  
ATOM   961   H  HG1  . THR A 1 23 ? 2.482   -5.366  -3.860  1.00 0.00 ? 551 THR A HG1  2  
ATOM   962   H  HG21 . THR A 1 23 ? 1.156   -6.121  -6.791  1.00 0.00 ? 551 THR A HG21 2  
ATOM   963   H  HG22 . THR A 1 23 ? 2.722   -5.984  -5.991  1.00 0.00 ? 551 THR A HG22 2  
ATOM   964   H  HG23 . THR A 1 23 ? 2.182   -4.719  -7.095  1.00 0.00 ? 551 THR A HG23 2  
ATOM   965   N  N    . SER A 1 24 ? 3.920   -3.178  -5.894  1.00 0.00 ? 552 SER A N    2  
ATOM   966   C  CA   . SER A 1 24 ? 5.372   -3.093  -5.774  1.00 0.00 ? 552 SER A CA   2  
ATOM   967   C  C    . SER A 1 24 ? 5.779   -1.815  -5.050  1.00 0.00 ? 552 SER A C    2  
ATOM   968   O  O    . SER A 1 24 ? 6.727   -1.809  -4.266  1.00 0.00 ? 552 SER A O    2  
ATOM   969   C  CB   . SER A 1 24 ? 6.023   -3.140  -7.157  1.00 0.00 ? 552 SER A CB   2  
ATOM   970   O  OG   . SER A 1 24 ? 5.644   -4.310  -7.860  1.00 0.00 ? 552 SER A OG   2  
ATOM   971   H  H    . SER A 1 24 ? 3.518   -3.259  -6.784  1.00 0.00 ? 552 SER A H    2  
ATOM   972   H  HA   . SER A 1 24 ? 5.708   -3.942  -5.197  1.00 0.00 ? 552 SER A HA   2  
ATOM   973   H  HB2  . SER A 1 24 ? 5.715   -2.277  -7.728  1.00 0.00 ? 552 SER A HB2  2  
ATOM   974   H  HB3  . SER A 1 24 ? 7.098   -3.133  -7.047  1.00 0.00 ? 552 SER A HB3  2  
ATOM   975   H  HG   . SER A 1 24 ? 5.916   -5.085  -7.363  1.00 0.00 ? 552 SER A HG   2  
ATOM   976   N  N    . HIS A 1 25 ? 5.051   -0.735  -5.313  1.00 0.00 ? 553 HIS A N    2  
ATOM   977   C  CA   . HIS A 1 25 ? 5.332   0.547   -4.679  1.00 0.00 ? 553 HIS A CA   2  
ATOM   978   C  C    . HIS A 1 25 ? 4.988   0.499   -3.195  1.00 0.00 ? 553 HIS A C    2  
ATOM   979   O  O    . HIS A 1 25 ? 5.581   1.213   -2.386  1.00 0.00 ? 553 HIS A O    2  
ATOM   980   C  CB   . HIS A 1 25 ? 4.541   1.663   -5.363  1.00 0.00 ? 553 HIS A CB   2  
ATOM   981   C  CG   . HIS A 1 25 ? 5.141   2.115   -6.658  1.00 0.00 ? 553 HIS A CG   2  
ATOM   982   N  ND1  . HIS A 1 25 ? 5.670   3.370   -6.863  1.00 0.00 ? 553 HIS A ND1  2  
ATOM   983   C  CD2  . HIS A 1 25 ? 5.293   1.450   -7.832  1.00 0.00 ? 553 HIS A CD2  2  
ATOM   984   C  CE1  . HIS A 1 25 ? 6.115   3.428   -8.125  1.00 0.00 ? 553 HIS A CE1  2  
ATOM   985   N  NE2  . HIS A 1 25 ? 5.910   2.288   -8.756  1.00 0.00 ? 553 HIS A NE2  2  
ATOM   986   H  H    . HIS A 1 25 ? 4.303   -0.804  -5.943  1.00 0.00 ? 553 HIS A H    2  
ATOM   987   H  HA   . HIS A 1 25 ? 6.388   0.746   -4.787  1.00 0.00 ? 553 HIS A HA   2  
ATOM   988   H  HB2  . HIS A 1 25 ? 3.540   1.314   -5.566  1.00 0.00 ? 553 HIS A HB2  2  
ATOM   989   H  HB3  . HIS A 1 25 ? 4.492   2.517   -4.703  1.00 0.00 ? 553 HIS A HB3  2  
ATOM   990   H  HD1  . HIS A 1 25 ? 5.713   4.093   -6.202  1.00 0.00 ? 553 HIS A HD1  2  
ATOM   991   H  HD2  . HIS A 1 25 ? 4.986   0.433   -8.028  1.00 0.00 ? 553 HIS A HD2  2  
ATOM   992   H  HE1  . HIS A 1 25 ? 6.582   4.295   -8.569  1.00 0.00 ? 553 HIS A HE1  2  
ATOM   993   N  N    . LEU A 1 26 ? 4.028   -0.352  -2.843  1.00 0.00 ? 554 LEU A N    2  
ATOM   994   C  CA   . LEU A 1 26 ? 3.606   -0.498  -1.456  1.00 0.00 ? 554 LEU A CA   2  
ATOM   995   C  C    . LEU A 1 26 ? 4.775   -0.935  -0.577  1.00 0.00 ? 554 LEU A C    2  
ATOM   996   O  O    . LEU A 1 26 ? 4.834   -0.599  0.605   1.00 0.00 ? 554 LEU A O    2  
ATOM   997   C  CB   . LEU A 1 26 ? 2.462   -1.511  -1.354  1.00 0.00 ? 554 LEU A CB   2  
ATOM   998   C  CG   . LEU A 1 26 ? 1.196   -0.991  -0.673  1.00 0.00 ? 554 LEU A CG   2  
ATOM   999   C  CD1  . LEU A 1 26 ? 0.323   -0.243  -1.669  1.00 0.00 ? 554 LEU A CD1  2  
ATOM   1000  C  CD2  . LEU A 1 26 ? 0.423   -2.138  -0.040  1.00 0.00 ? 554 LEU A CD2  2  
ATOM   1001  H  H    . LEU A 1 26 ? 3.595   -0.895  -3.533  1.00 0.00 ? 554 LEU A H    2  
ATOM   1002  H  HA   . LEU A 1 26 ? 3.254   0.464   -1.115  1.00 0.00 ? 554 LEU A HA   2  
ATOM   1003  H  HB2  . LEU A 1 26 ? 2.203   -1.830  -2.354  1.00 0.00 ? 554 LEU A HB2  2  
ATOM   1004  H  HB3  . LEU A 1 26 ? 2.814   -2.369  -0.802  1.00 0.00 ? 554 LEU A HB3  2  
ATOM   1005  H  HG   . LEU A 1 26 ? 1.474   -0.301  0.111   1.00 0.00 ? 554 LEU A HG   2  
ATOM   1006  H  HD11 . LEU A 1 26 ? -0.404  0.351   -1.135  1.00 0.00 ? 554 LEU A HD11 2  
ATOM   1007  H  HD12 . LEU A 1 26 ? -0.188  -0.952  -2.303  1.00 0.00 ? 554 LEU A HD12 2  
ATOM   1008  H  HD13 . LEU A 1 26 ? 0.940   0.403   -2.274  1.00 0.00 ? 554 LEU A HD13 2  
ATOM   1009  H  HD21 . LEU A 1 26 ? 0.155   -2.855  -0.801  1.00 0.00 ? 554 LEU A HD21 2  
ATOM   1010  H  HD22 . LEU A 1 26 ? -0.473  -1.755  0.426   1.00 0.00 ? 554 LEU A HD22 2  
ATOM   1011  H  HD23 . LEU A 1 26 ? 1.039   -2.619  0.706   1.00 0.00 ? 554 LEU A HD23 2  
ATOM   1012  N  N    . ARG A 1 27 ? 5.701   -1.689  -1.164  1.00 0.00 ? 555 ARG A N    2  
ATOM   1013  C  CA   . ARG A 1 27 ? 6.865   -2.173  -0.433  1.00 0.00 ? 555 ARG A CA   2  
ATOM   1014  C  C    . ARG A 1 27 ? 7.724   -1.008  0.057   1.00 0.00 ? 555 ARG A C    2  
ATOM   1015  O  O    . ARG A 1 27 ? 8.136   -0.972  1.217   1.00 0.00 ? 555 ARG A O    2  
ATOM   1016  C  CB   . ARG A 1 27 ? 7.689   -3.125  -1.315  1.00 0.00 ? 555 ARG A CB   2  
ATOM   1017  C  CG   . ARG A 1 27 ? 8.784   -2.443  -2.125  1.00 0.00 ? 555 ARG A CG   2  
ATOM   1018  C  CD   . ARG A 1 27 ? 9.526   -3.435  -3.006  1.00 0.00 ? 555 ARG A CD   2  
ATOM   1019  N  NE   . ARG A 1 27 ? 10.424  -4.290  -2.232  1.00 0.00 ? 555 ARG A NE   2  
ATOM   1020  C  CZ   . ARG A 1 27 ? 11.563  -3.868  -1.688  1.00 0.00 ? 555 ARG A CZ   2  
ATOM   1021  N  NH1  . ARG A 1 27 ? 11.946  -2.606  -1.828  1.00 0.00 ? 555 ARG A NH1  2  
ATOM   1022  N  NH2  . ARG A 1 27 ? 12.321  -4.712  -1.000  1.00 0.00 ? 555 ARG A NH2  2  
ATOM   1023  H  H    . ARG A 1 27 ? 5.597   -1.925  -2.108  1.00 0.00 ? 555 ARG A H    2  
ATOM   1024  H  HA   . ARG A 1 27 ? 6.506   -2.719  0.426   1.00 0.00 ? 555 ARG A HA   2  
ATOM   1025  H  HB2  . ARG A 1 27 ? 8.153   -3.867  -0.683  1.00 0.00 ? 555 ARG A HB2  2  
ATOM   1026  H  HB3  . ARG A 1 27 ? 7.021   -3.622  -2.004  1.00 0.00 ? 555 ARG A HB3  2  
ATOM   1027  H  HG2  . ARG A 1 27 ? 8.338   -1.686  -2.751  1.00 0.00 ? 555 ARG A HG2  2  
ATOM   1028  H  HG3  . ARG A 1 27 ? 9.487   -1.983  -1.445  1.00 0.00 ? 555 ARG A HG3  2  
ATOM   1029  H  HD2  . ARG A 1 27 ? 8.803   -4.056  -3.514  1.00 0.00 ? 555 ARG A HD2  2  
ATOM   1030  H  HD3  . ARG A 1 27 ? 10.105  -2.888  -3.735  1.00 0.00 ? 555 ARG A HD3  2  
ATOM   1031  H  HE   . ARG A 1 27 ? 10.165  -5.228  -2.112  1.00 0.00 ? 555 ARG A HE   2  
ATOM   1032  H  HH11 . ARG A 1 27 ? 11.379  -1.964  -2.345  1.00 0.00 ? 555 ARG A HH11 2  
ATOM   1033  H  HH12 . ARG A 1 27 ? 12.803  -2.295  -1.417  1.00 0.00 ? 555 ARG A HH12 2  
ATOM   1034  H  HH21 . ARG A 1 27 ? 12.037  -5.664  -0.891  1.00 0.00 ? 555 ARG A HH21 2  
ATOM   1035  H  HH22 . ARG A 1 27 ? 13.177  -4.395  -0.592  1.00 0.00 ? 555 ARG A HH22 2  
ATOM   1036  N  N    . ALA A 1 28 ? 7.985   -0.055  -0.833  1.00 0.00 ? 556 ALA A N    2  
ATOM   1037  C  CA   . ALA A 1 28 ? 8.789   1.110   -0.491  1.00 0.00 ? 556 ALA A CA   2  
ATOM   1038  C  C    . ALA A 1 28 ? 8.068   1.988   0.524   1.00 0.00 ? 556 ALA A C    2  
ATOM   1039  O  O    . ALA A 1 28 ? 8.697   2.630   1.365   1.00 0.00 ? 556 ALA A O    2  
ATOM   1040  C  CB   . ALA A 1 28 ? 9.121   1.909   -1.743  1.00 0.00 ? 556 ALA A CB   2  
ATOM   1041  H  H    . ALA A 1 28 ? 7.628   -0.138  -1.740  1.00 0.00 ? 556 ALA A H    2  
ATOM   1042  H  HA   . ALA A 1 28 ? 9.714   0.761   -0.059  1.00 0.00 ? 556 ALA A HA   2  
ATOM   1043  H  HB1  . ALA A 1 28 ? 10.072  1.582   -2.137  1.00 0.00 ? 556 ALA A HB1  2  
ATOM   1044  H  HB2  . ALA A 1 28 ? 9.174   2.959   -1.497  1.00 0.00 ? 556 ALA A HB2  2  
ATOM   1045  H  HB3  . ALA A 1 28 ? 8.351   1.752   -2.484  1.00 0.00 ? 556 ALA A HB3  2  
ATOM   1046  N  N    . HIS A 1 29 ? 6.744   2.013   0.437   1.00 0.00 ? 557 HIS A N    2  
ATOM   1047  C  CA   . HIS A 1 29 ? 5.933   2.808   1.344   1.00 0.00 ? 557 HIS A CA   2  
ATOM   1048  C  C    . HIS A 1 29 ? 5.815   2.125   2.705   1.00 0.00 ? 557 HIS A C    2  
ATOM   1049  O  O    . HIS A 1 29 ? 5.765   2.788   3.741   1.00 0.00 ? 557 HIS A O    2  
ATOM   1050  C  CB   . HIS A 1 29 ? 4.542   3.038   0.744   1.00 0.00 ? 557 HIS A CB   2  
ATOM   1051  C  CG   . HIS A 1 29 ? 3.566   3.647   1.701   1.00 0.00 ? 557 HIS A CG   2  
ATOM   1052  N  ND1  . HIS A 1 29 ? 3.835   4.760   2.466   1.00 0.00 ? 557 HIS A ND1  2  
ATOM   1053  C  CD2  . HIS A 1 29 ? 2.301   3.271   2.017   1.00 0.00 ? 557 HIS A CD2  2  
ATOM   1054  C  CE1  . HIS A 1 29 ? 2.750   5.019   3.208   1.00 0.00 ? 557 HIS A CE1  2  
ATOM   1055  N  NE2  . HIS A 1 29 ? 1.791   4.144   2.973   1.00 0.00 ? 557 HIS A NE2  2  
ATOM   1056  H  H    . HIS A 1 29 ? 6.302   1.484   -0.255  1.00 0.00 ? 557 HIS A H    2  
ATOM   1057  H  HA   . HIS A 1 29 ? 6.422   3.758   1.470   1.00 0.00 ? 557 HIS A HA   2  
ATOM   1058  H  HB2  . HIS A 1 29 ? 4.630   3.698   -0.105  1.00 0.00 ? 557 HIS A HB2  2  
ATOM   1059  H  HB3  . HIS A 1 29 ? 4.140   2.090   0.416   1.00 0.00 ? 557 HIS A HB3  2  
ATOM   1060  H  HD1  . HIS A 1 29 ? 4.671   5.272   2.468   1.00 0.00 ? 557 HIS A HD1  2  
ATOM   1061  H  HD2  . HIS A 1 29 ? 1.767   2.430   1.600   1.00 0.00 ? 557 HIS A HD2  2  
ATOM   1062  H  HE1  . HIS A 1 29 ? 2.671   5.836   3.909   1.00 0.00 ? 557 HIS A HE1  2  
ATOM   1063  N  N    . LEU A 1 30 ? 5.767   0.797   2.691   1.00 0.00 ? 558 LEU A N    2  
ATOM   1064  C  CA   . LEU A 1 30 ? 5.649   0.023   3.921   1.00 0.00 ? 558 LEU A CA   2  
ATOM   1065  C  C    . LEU A 1 30 ? 6.857   0.244   4.828   1.00 0.00 ? 558 LEU A C    2  
ATOM   1066  O  O    . LEU A 1 30 ? 6.711   0.434   6.035   1.00 0.00 ? 558 LEU A O    2  
ATOM   1067  C  CB   . LEU A 1 30 ? 5.503   -1.467  3.597   1.00 0.00 ? 558 LEU A CB   2  
ATOM   1068  C  CG   . LEU A 1 30 ? 4.271   -2.142  4.201   1.00 0.00 ? 558 LEU A CG   2  
ATOM   1069  C  CD1  . LEU A 1 30 ? 4.273   -2.001  5.715   1.00 0.00 ? 558 LEU A CD1  2  
ATOM   1070  C  CD2  . LEU A 1 30 ? 2.999   -1.554  3.610   1.00 0.00 ? 558 LEU A CD2  2  
ATOM   1071  H  H    . LEU A 1 30 ? 5.807   0.326   1.833   1.00 0.00 ? 558 LEU A H    2  
ATOM   1072  H  HA   . LEU A 1 30 ? 4.762   0.358   4.438   1.00 0.00 ? 558 LEU A HA   2  
ATOM   1073  H  HB2  . LEU A 1 30 ? 5.457   -1.576  2.523   1.00 0.00 ? 558 LEU A HB2  2  
ATOM   1074  H  HB3  . LEU A 1 30 ? 6.380   -1.983  3.957   1.00 0.00 ? 558 LEU A HB3  2  
ATOM   1075  H  HG   . LEU A 1 30 ? 4.294   -3.196  3.964   1.00 0.00 ? 558 LEU A HG   2  
ATOM   1076  H  HD11 . LEU A 1 30 ? 3.853   -2.891  6.160   1.00 0.00 ? 558 LEU A HD11 2  
ATOM   1077  H  HD12 . LEU A 1 30 ? 3.681   -1.143  5.997   1.00 0.00 ? 558 LEU A HD12 2  
ATOM   1078  H  HD13 . LEU A 1 30 ? 5.287   -1.869  6.062   1.00 0.00 ? 558 LEU A HD13 2  
ATOM   1079  H  HD21 . LEU A 1 30 ? 2.258   -2.332  3.500   1.00 0.00 ? 558 LEU A HD21 2  
ATOM   1080  H  HD22 . LEU A 1 30 ? 3.217   -1.126  2.642   1.00 0.00 ? 558 LEU A HD22 2  
ATOM   1081  H  HD23 . LEU A 1 30 ? 2.619   -0.785  4.266   1.00 0.00 ? 558 LEU A HD23 2  
ATOM   1082  N  N    . ARG A 1 31 ? 8.049   0.217   4.240   1.00 0.00 ? 559 ARG A N    2  
ATOM   1083  C  CA   . ARG A 1 31 ? 9.278   0.413   5.001   1.00 0.00 ? 559 ARG A CA   2  
ATOM   1084  C  C    . ARG A 1 31 ? 9.272   1.770   5.700   1.00 0.00 ? 559 ARG A C    2  
ATOM   1085  O  O    . ARG A 1 31 ? 9.867   1.932   6.766   1.00 0.00 ? 559 ARG A O    2  
ATOM   1086  C  CB   . ARG A 1 31 ? 10.499  0.300   4.085   1.00 0.00 ? 559 ARG A CB   2  
ATOM   1087  C  CG   . ARG A 1 31 ? 10.453  1.236   2.890   1.00 0.00 ? 559 ARG A CG   2  
ATOM   1088  C  CD   . ARG A 1 31 ? 11.820  1.386   2.240   1.00 0.00 ? 559 ARG A CD   2  
ATOM   1089  N  NE   . ARG A 1 31 ? 12.834  1.849   3.187   1.00 0.00 ? 559 ARG A NE   2  
ATOM   1090  C  CZ   . ARG A 1 31 ? 13.647  1.040   3.865   1.00 0.00 ? 559 ARG A CZ   2  
ATOM   1091  N  NH1  . ARG A 1 31 ? 13.559  -0.278  3.727   1.00 0.00 ? 559 ARG A NH1  2  
ATOM   1092  N  NH2  . ARG A 1 31 ? 14.548  1.552   4.693   1.00 0.00 ? 559 ARG A NH2  2  
ATOM   1093  H  H    . ARG A 1 31 ? 8.104   0.060   3.274   1.00 0.00 ? 559 ARG A H    2  
ATOM   1094  H  HA   . ARG A 1 31 ? 9.329   -0.362  5.751   1.00 0.00 ? 559 ARG A HA   2  
ATOM   1095  H  HB2  . ARG A 1 31 ? 11.384  0.527   4.658   1.00 0.00 ? 559 ARG A HB2  2  
ATOM   1096  H  HB3  . ARG A 1 31 ? 10.567  -0.714  3.719   1.00 0.00 ? 559 ARG A HB3  2  
ATOM   1097  H  HG2  . ARG A 1 31 ? 9.762   0.839   2.161   1.00 0.00 ? 559 ARG A HG2  2  
ATOM   1098  H  HG3  . ARG A 1 31 ? 10.112  2.207   3.219   1.00 0.00 ? 559 ARG A HG3  2  
ATOM   1099  H  HD2  . ARG A 1 31 ? 12.121  0.431   1.839   1.00 0.00 ? 559 ARG A HD2  2  
ATOM   1100  H  HD3  . ARG A 1 31 ? 11.742  2.102   1.435   1.00 0.00 ? 559 ARG A HD3  2  
ATOM   1101  H  HE   . ARG A 1 31 ? 12.917  2.816   3.321   1.00 0.00 ? 559 ARG A HE   2  
ATOM   1102  H  HH11 . ARG A 1 31 ? 12.880  -0.673  3.111   1.00 0.00 ? 559 ARG A HH11 2  
ATOM   1103  H  HH12 . ARG A 1 31 ? 14.175  -0.875  4.240   1.00 0.00 ? 559 ARG A HH12 2  
ATOM   1104  H  HH21 . ARG A 1 31 ? 14.616  2.543   4.807   1.00 0.00 ? 559 ARG A HH21 2  
ATOM   1105  H  HH22 . ARG A 1 31 ? 15.159  0.947   5.203   1.00 0.00 ? 559 ARG A HH22 2  
ATOM   1106  N  N    . TRP A 1 32 ? 8.593   2.740   5.096   1.00 0.00 ? 560 TRP A N    2  
ATOM   1107  C  CA   . TRP A 1 32 ? 8.507   4.080   5.664   1.00 0.00 ? 560 TRP A CA   2  
ATOM   1108  C  C    . TRP A 1 32 ? 7.721   4.062   6.971   1.00 0.00 ? 560 TRP A C    2  
ATOM   1109  O  O    . TRP A 1 32 ? 8.032   4.799   7.906   1.00 0.00 ? 560 TRP A O    2  
ATOM   1110  C  CB   . TRP A 1 32 ? 7.846   5.037   4.670   1.00 0.00 ? 560 TRP A CB   2  
ATOM   1111  C  CG   . TRP A 1 32 ? 8.530   6.368   4.583   1.00 0.00 ? 560 TRP A CG   2  
ATOM   1112  C  CD1  . TRP A 1 32 ? 9.321   6.818   3.565   1.00 0.00 ? 560 TRP A CD1  2  
ATOM   1113  C  CD2  . TRP A 1 32 ? 8.485   7.420   5.553   1.00 0.00 ? 560 TRP A CD2  2  
ATOM   1114  N  NE1  . TRP A 1 32 ? 9.770   8.086   3.843   1.00 0.00 ? 560 TRP A NE1  2  
ATOM   1115  C  CE2  . TRP A 1 32 ? 9.271   8.478   5.058   1.00 0.00 ? 560 TRP A CE2  2  
ATOM   1116  C  CE3  . TRP A 1 32 ? 7.856   7.572   6.793   1.00 0.00 ? 560 TRP A CE3  2  
ATOM   1117  C  CZ2  . TRP A 1 32 ? 9.444   9.669   5.758   1.00 0.00 ? 560 TRP A CZ2  2  
ATOM   1118  C  CZ3  . TRP A 1 32 ? 8.029   8.755   7.487   1.00 0.00 ? 560 TRP A CZ3  2  
ATOM   1119  C  CH2  . TRP A 1 32 ? 8.816   9.790   6.968   1.00 0.00 ? 560 TRP A CH2  2  
ATOM   1120  H  H    . TRP A 1 32 ? 8.137   2.549   4.250   1.00 0.00 ? 560 TRP A H    2  
ATOM   1121  H  HA   . TRP A 1 32 ? 9.512   4.420   5.866   1.00 0.00 ? 560 TRP A HA   2  
ATOM   1122  H  HB2  . TRP A 1 32 ? 7.860   4.591   3.687   1.00 0.00 ? 560 TRP A HB2  2  
ATOM   1123  H  HB3  . TRP A 1 32 ? 6.821   5.207   4.970   1.00 0.00 ? 560 TRP A HB3  2  
ATOM   1124  H  HD1  . TRP A 1 32 ? 9.552   6.248   2.677   1.00 0.00 ? 560 TRP A HD1  2  
ATOM   1125  H  HE1  . TRP A 1 32 ? 10.353  8.623   3.266   1.00 0.00 ? 560 TRP A HE1  2  
ATOM   1126  H  HE3  . TRP A 1 32 ? 7.245   6.785   7.209   1.00 0.00 ? 560 TRP A HE3  2  
ATOM   1127  H  HZ2  . TRP A 1 32 ? 10.047  10.477  5.372   1.00 0.00 ? 560 TRP A HZ2  2  
ATOM   1128  H  HZ3  . TRP A 1 32 ? 7.551   8.890   8.446   1.00 0.00 ? 560 TRP A HZ3  2  
ATOM   1129  H  HH2  . TRP A 1 32 ? 8.924   10.697  7.545   1.00 0.00 ? 560 TRP A HH2  2  
ATOM   1130  N  N    . HIS A 1 33 ? 6.700   3.213   7.027   1.00 0.00 ? 561 HIS A N    2  
ATOM   1131  C  CA   . HIS A 1 33 ? 5.866   3.096   8.218   1.00 0.00 ? 561 HIS A CA   2  
ATOM   1132  C  C    . HIS A 1 33 ? 6.623   2.408   9.349   1.00 0.00 ? 561 HIS A C    2  
ATOM   1133  O  O    . HIS A 1 33 ? 6.376   2.673   10.525  1.00 0.00 ? 561 HIS A O    2  
ATOM   1134  C  CB   . HIS A 1 33 ? 4.589   2.317   7.895   1.00 0.00 ? 561 HIS A CB   2  
ATOM   1135  C  CG   . HIS A 1 33 ? 3.507   3.165   7.302   1.00 0.00 ? 561 HIS A CG   2  
ATOM   1136  N  ND1  . HIS A 1 33 ? 2.700   4.003   8.038   1.00 0.00 ? 561 HIS A ND1  2  
ATOM   1137  C  CD2  . HIS A 1 33 ? 3.106   3.296   6.012   1.00 0.00 ? 561 HIS A CD2  2  
ATOM   1138  C  CE1  . HIS A 1 33 ? 1.852   4.603   7.192   1.00 0.00 ? 561 HIS A CE1  2  
ATOM   1139  N  NE2  . HIS A 1 33 ? 2.057   4.209   5.950   1.00 0.00 ? 561 HIS A NE2  2  
ATOM   1140  H  H    . HIS A 1 33 ? 6.502   2.651   6.248   1.00 0.00 ? 561 HIS A H    2  
ATOM   1141  H  HA   . HIS A 1 33 ? 5.598   4.093   8.534   1.00 0.00 ? 561 HIS A HA   2  
ATOM   1142  H  HB2  . HIS A 1 33 ? 4.822   1.534   7.189   1.00 0.00 ? 561 HIS A HB2  2  
ATOM   1143  H  HB3  . HIS A 1 33 ? 4.207   1.875   8.804   1.00 0.00 ? 561 HIS A HB3  2  
ATOM   1144  H  HD1  . HIS A 1 33 ? 2.737   4.136   9.008   1.00 0.00 ? 561 HIS A HD1  2  
ATOM   1145  H  HD2  . HIS A 1 33 ? 3.527   2.780   5.161   1.00 0.00 ? 561 HIS A HD2  2  
ATOM   1146  H  HE1  . HIS A 1 33 ? 1.100   5.320   7.488   1.00 0.00 ? 561 HIS A HE1  2  
ATOM   1147  N  N    . THR A 1 34 ? 7.547   1.524   8.986   1.00 0.00 ? 562 THR A N    2  
ATOM   1148  C  CA   . THR A 1 34 ? 8.339   0.799   9.971   1.00 0.00 ? 562 THR A CA   2  
ATOM   1149  C  C    . THR A 1 34 ? 9.694   1.468   10.180  1.00 0.00 ? 562 THR A C    2  
ATOM   1150  O  O    . THR A 1 34 ? 10.706  0.796   10.381  1.00 0.00 ? 562 THR A O    2  
ATOM   1151  C  CB   . THR A 1 34 ? 8.537   -0.652  9.530   1.00 0.00 ? 562 THR A CB   2  
ATOM   1152  O  OG1  . THR A 1 34 ? 8.809   -0.721  8.141   1.00 0.00 ? 562 THR A OG1  2  
ATOM   1153  C  CG2  . THR A 1 34 ? 7.336   -1.531  9.807   1.00 0.00 ? 562 THR A CG2  2  
ATOM   1154  H  H    . THR A 1 34 ? 7.698   1.355   8.032   1.00 0.00 ? 562 THR A H    2  
ATOM   1155  H  HA   . THR A 1 34 ? 7.798   0.811   10.905  1.00 0.00 ? 562 THR A HA   2  
ATOM   1156  H  HB   . THR A 1 34 ? 9.381   -1.068  10.062  1.00 0.00 ? 562 THR A HB   2  
ATOM   1157  H  HG1  . THR A 1 34 ? 9.470   -0.064  7.911   1.00 0.00 ? 562 THR A HG1  2  
ATOM   1158  H  HG21 . THR A 1 34 ? 7.518   -2.522  9.419   1.00 0.00 ? 562 THR A HG21 2  
ATOM   1159  H  HG22 . THR A 1 34 ? 6.465   -1.111  9.327   1.00 0.00 ? 562 THR A HG22 2  
ATOM   1160  H  HG23 . THR A 1 34 ? 7.169   -1.587  10.872  1.00 0.00 ? 562 THR A HG23 2  
ATOM   1161  N  N    . GLY A 1 35 ? 9.707   2.796   10.130  1.00 0.00 ? 563 GLY A N    2  
ATOM   1162  C  CA   . GLY A 1 35 ? 10.943  3.534   10.315  1.00 0.00 ? 563 GLY A CA   2  
ATOM   1163  C  C    . GLY A 1 35 ? 10.703  4.980   10.699  1.00 0.00 ? 563 GLY A C    2  
ATOM   1164  O  O    . GLY A 1 35 ? 11.462  5.867   10.307  1.00 0.00 ? 563 GLY A O    2  
ATOM   1165  H  H    . GLY A 1 35 ? 8.870   3.279   9.966   1.00 0.00 ? 563 GLY A H    2  
ATOM   1166  H  HA2  . GLY A 1 35 ? 11.520  3.057   11.093  1.00 0.00 ? 563 GLY A HA2  2  
ATOM   1167  H  HA3  . GLY A 1 35 ? 11.507  3.506   9.394   1.00 0.00 ? 563 GLY A HA3  2  
ATOM   1168  N  N    . GLU A 1 36 ? 9.646   5.219   11.469  1.00 0.00 ? 564 GLU A N    2  
ATOM   1169  C  CA   . GLU A 1 36 ? 9.309   6.569   11.907  1.00 0.00 ? 564 GLU A CA   2  
ATOM   1170  C  C    . GLU A 1 36 ? 9.888   6.851   13.290  1.00 0.00 ? 564 GLU A C    2  
ATOM   1171  O  O    . GLU A 1 36 ? 10.473  5.970   13.920  1.00 0.00 ? 564 GLU A O    2  
ATOM   1172  C  CB   . GLU A 1 36 ? 7.790   6.757   11.925  1.00 0.00 ? 564 GLU A CB   2  
ATOM   1173  C  CG   . GLU A 1 36 ? 7.264   7.573   10.755  1.00 0.00 ? 564 GLU A CG   2  
ATOM   1174  C  CD   . GLU A 1 36 ? 7.113   9.043   11.092  1.00 0.00 ? 564 GLU A CD   2  
ATOM   1175  O  OE1  . GLU A 1 36 ? 8.133   9.764   11.077  1.00 0.00 ? 564 GLU A OE1  2  
ATOM   1176  O  OE2  . GLU A 1 36 ? 5.974   9.474   11.370  1.00 0.00 ? 564 GLU A OE2  2  
ATOM   1177  H  H    . GLU A 1 36 ? 9.080   4.470   11.749  1.00 0.00 ? 564 GLU A H    2  
ATOM   1178  H  HA   . GLU A 1 36 ? 9.740   7.263   11.201  1.00 0.00 ? 564 GLU A HA   2  
ATOM   1179  H  HB2  . GLU A 1 36 ? 7.318   5.786   11.899  1.00 0.00 ? 564 GLU A HB2  2  
ATOM   1180  H  HB3  . GLU A 1 36 ? 7.510   7.258   12.840  1.00 0.00 ? 564 GLU A HB3  2  
ATOM   1181  H  HG2  . GLU A 1 36 ? 7.952   7.477   9.928   1.00 0.00 ? 564 GLU A HG2  2  
ATOM   1182  H  HG3  . GLU A 1 36 ? 6.299   7.183   10.466  1.00 0.00 ? 564 GLU A HG3  2  
ATOM   1183  N  N    . ARG A 1 37 ? 9.721   8.084   13.756  1.00 0.00 ? 565 ARG A N    2  
ATOM   1184  C  CA   . ARG A 1 37 ? 10.227  8.482   15.065  1.00 0.00 ? 565 ARG A CA   2  
ATOM   1185  C  C    . ARG A 1 37 ? 9.090   8.949   15.968  1.00 0.00 ? 565 ARG A C    2  
ATOM   1186  O  O    . ARG A 1 37 ? 9.373   9.341   17.120  1.00 0.00 ? 565 ARG A O    2  
ATOM   1187  C  CB   . ARG A 1 37 ? 11.267  9.595   14.915  1.00 0.00 ? 565 ARG A CB   2  
ATOM   1188  C  CG   . ARG A 1 37 ? 12.699  9.087   14.883  1.00 0.00 ? 565 ARG A CG   2  
ATOM   1189  C  CD   . ARG A 1 37 ? 13.668  10.179  14.457  1.00 0.00 ? 565 ARG A CD   2  
ATOM   1190  N  NE   . ARG A 1 37 ? 14.216  10.902  15.602  1.00 0.00 ? 565 ARG A NE   2  
ATOM   1191  C  CZ   . ARG A 1 37 ? 15.190  10.433  16.378  1.00 0.00 ? 565 ARG A CZ   2  
ATOM   1192  N  NH1  . ARG A 1 37 ? 15.725  9.242   16.137  1.00 0.00 ? 565 ARG A NH1  2  
ATOM   1193  N  NH2  . ARG A 1 37 ? 15.630  11.156  17.399  1.00 0.00 ? 565 ARG A NH2  2  
ATOM   1194  O  OXT  . ARG A 1 37 ? 7.926   8.919   15.516  1.00 0.00 ? 565 ARG A OXT  2  
ATOM   1195  H  H    . ARG A 1 37 ? 9.246   8.742   13.207  1.00 0.00 ? 565 ARG A H    2  
ATOM   1196  H  HA   . ARG A 1 37 ? 10.697  7.620   15.514  1.00 0.00 ? 565 ARG A HA   2  
ATOM   1197  H  HB2  . ARG A 1 37 ? 11.076  10.129  13.996  1.00 0.00 ? 565 ARG A HB2  2  
ATOM   1198  H  HB3  . ARG A 1 37 ? 11.169  10.278  15.746  1.00 0.00 ? 565 ARG A HB3  2  
ATOM   1199  H  HG2  . ARG A 1 37 ? 12.972  8.744   15.870  1.00 0.00 ? 565 ARG A HG2  2  
ATOM   1200  H  HG3  . ARG A 1 37 ? 12.765  8.267   14.183  1.00 0.00 ? 565 ARG A HG3  2  
ATOM   1201  H  HD2  . ARG A 1 37 ? 14.480  9.727   13.907  1.00 0.00 ? 565 ARG A HD2  2  
ATOM   1202  H  HD3  . ARG A 1 37 ? 13.145  10.876  13.819  1.00 0.00 ? 565 ARG A HD3  2  
ATOM   1203  H  HE   . ARG A 1 37 ? 13.838  11.784  15.803  1.00 0.00 ? 565 ARG A HE   2  
ATOM   1204  H  HH11 . ARG A 1 37 ? 15.398  8.692   15.369  1.00 0.00 ? 565 ARG A HH11 2  
ATOM   1205  H  HH12 . ARG A 1 37 ? 16.457  8.896   16.723  1.00 0.00 ? 565 ARG A HH12 2  
ATOM   1206  H  HH21 . ARG A 1 37 ? 15.231  12.053  17.585  1.00 0.00 ? 565 ARG A HH21 2  
ATOM   1207  H  HH22 . ARG A 1 37 ? 16.362  10.803  17.982  1.00 0.00 ? 565 ARG A HH22 2  
HETATM 1208  ZN ZN   . ZN  B 2 .  ? 0.683   4.692   4.559   1.00 0.00 ? 100 ZN  A ZN   2  
ATOM   1209  N  N    . MET A 1 1  ? -11.834 -12.071 4.029   1.00 0.00 ? 1   MET A N    3  
ATOM   1210  C  CA   . MET A 1 1  ? -12.790 -11.196 3.301   1.00 0.00 ? 1   MET A CA   3  
ATOM   1211  C  C    . MET A 1 1  ? -12.626 -11.334 1.791   1.00 0.00 ? 1   MET A C    3  
ATOM   1212  O  O    . MET A 1 1  ? -11.570 -11.741 1.306   1.00 0.00 ? 1   MET A O    3  
ATOM   1213  C  CB   . MET A 1 1  ? -12.546 -9.747  3.728   1.00 0.00 ? 1   MET A CB   3  
ATOM   1214  C  CG   . MET A 1 1  ? -13.310 -9.345  4.979   1.00 0.00 ? 1   MET A CG   3  
ATOM   1215  S  SD   . MET A 1 1  ? -12.317 -9.492  6.477   1.00 0.00 ? 1   MET A SD   3  
ATOM   1216  C  CE   . MET A 1 1  ? -13.563 -9.227  7.736   1.00 0.00 ? 1   MET A CE   3  
ATOM   1217  H  H1   . MET A 1 1  ? -10.890 -11.918 3.621   1.00 0.00 ? 1   MET A H1   3  
ATOM   1218  H  H2   . MET A 1 1  ? -12.145 -13.055 3.899   1.00 0.00 ? 1   MET A H2   3  
ATOM   1219  H  H3   . MET A 1 1  ? -11.856 -11.799 5.032   1.00 0.00 ? 1   MET A H3   3  
ATOM   1220  H  HA   . MET A 1 1  ? -13.794 -11.482 3.574   1.00 0.00 ? 1   MET A HA   3  
ATOM   1221  H  HB2  . MET A 1 1  ? -11.491 -9.612  3.918   1.00 0.00 ? 1   MET A HB2  3  
ATOM   1222  H  HB3  . MET A 1 1  ? -12.845 -9.092  2.924   1.00 0.00 ? 1   MET A HB3  3  
ATOM   1223  H  HG2  . MET A 1 1  ? -13.628 -8.318  4.876   1.00 0.00 ? 1   MET A HG2  3  
ATOM   1224  H  HG3  . MET A 1 1  ? -14.177 -9.981  5.075   1.00 0.00 ? 1   MET A HG3  3  
ATOM   1225  H  HE1  . MET A 1 1  ? -13.277 -9.746  8.640   1.00 0.00 ? 1   MET A HE1  3  
ATOM   1226  H  HE2  . MET A 1 1  ? -14.512 -9.607  7.388   1.00 0.00 ? 1   MET A HE2  3  
ATOM   1227  H  HE3  . MET A 1 1  ? -13.650 -8.170  7.940   1.00 0.00 ? 1   MET A HE3  3  
ATOM   1228  N  N    . ASP A 1 2  ? -13.678 -10.994 1.054   1.00 0.00 ? 530 ASP A N    3  
ATOM   1229  C  CA   . ASP A 1 2  ? -13.653 -11.080 -0.401  1.00 0.00 ? 530 ASP A CA   3  
ATOM   1230  C  C    . ASP A 1 2  ? -13.204 -9.755  -1.018  1.00 0.00 ? 530 ASP A C    3  
ATOM   1231  O  O    . ASP A 1 2  ? -13.963 -8.787  -1.041  1.00 0.00 ? 530 ASP A O    3  
ATOM   1232  C  CB   . ASP A 1 2  ? -15.037 -11.457 -0.931  1.00 0.00 ? 530 ASP A CB   3  
ATOM   1233  C  CG   . ASP A 1 2  ? -16.113 -10.490 -0.476  1.00 0.00 ? 530 ASP A CG   3  
ATOM   1234  O  OD1  . ASP A 1 2  ? -16.626 -10.661 0.650   1.00 0.00 ? 530 ASP A OD1  3  
ATOM   1235  O  OD2  . ASP A 1 2  ? -16.442 -9.562  -1.245  1.00 0.00 ? 530 ASP A OD2  3  
ATOM   1236  H  H    . ASP A 1 2  ? -14.491 -10.677 1.500   1.00 0.00 ? 530 ASP A H    3  
ATOM   1237  H  HA   . ASP A 1 2  ? -12.951 -11.852 -0.676  1.00 0.00 ? 530 ASP A HA   3  
ATOM   1238  H  HB2  . ASP A 1 2  ? -15.015 -11.458 -2.011  1.00 0.00 ? 530 ASP A HB2  3  
ATOM   1239  H  HB3  . ASP A 1 2  ? -15.294 -12.445 -0.579  1.00 0.00 ? 530 ASP A HB3  3  
ATOM   1240  N  N    . PRO A 1 3  ? -11.959 -9.690  -1.528  1.00 0.00 ? 531 PRO A N    3  
ATOM   1241  C  CA   . PRO A 1 3  ? -11.424 -8.471  -2.143  1.00 0.00 ? 531 PRO A CA   3  
ATOM   1242  C  C    . PRO A 1 3  ? -12.121 -8.130  -3.455  1.00 0.00 ? 531 PRO A C    3  
ATOM   1243  O  O    . PRO A 1 3  ? -12.327 -6.958  -3.773  1.00 0.00 ? 531 PRO A O    3  
ATOM   1244  C  CB   . PRO A 1 3  ? -9.952  -8.811  -2.392  1.00 0.00 ? 531 PRO A CB   3  
ATOM   1245  C  CG   . PRO A 1 3  ? -9.915  -10.296 -2.482  1.00 0.00 ? 531 PRO A CG   3  
ATOM   1246  C  CD   . PRO A 1 3  ? -10.980 -10.794 -1.546  1.00 0.00 ? 531 PRO A CD   3  
ATOM   1247  H  HA   . PRO A 1 3  ? -11.493 -7.628  -1.471  1.00 0.00 ? 531 PRO A HA   3  
ATOM   1248  H  HB2  . PRO A 1 3  ? -9.625  -8.349  -3.312  1.00 0.00 ? 531 PRO A HB2  3  
ATOM   1249  H  HB3  . PRO A 1 3  ? -9.352  -8.451  -1.569  1.00 0.00 ? 531 PRO A HB3  3  
ATOM   1250  H  HG2  . PRO A 1 3  ? -10.129 -10.608 -3.494  1.00 0.00 ? 531 PRO A HG2  3  
ATOM   1251  H  HG3  . PRO A 1 3  ? -8.946  -10.659 -2.174  1.00 0.00 ? 531 PRO A HG3  3  
ATOM   1252  H  HD2  . PRO A 1 3  ? -11.426 -11.700 -1.929  1.00 0.00 ? 531 PRO A HD2  3  
ATOM   1253  H  HD3  . PRO A 1 3  ? -10.570 -10.961 -0.561  1.00 0.00 ? 531 PRO A HD3  3  
ATOM   1254  N  N    . GLY A 1 4  ? -12.483 -9.159  -4.213  1.00 0.00 ? 532 GLY A N    3  
ATOM   1255  C  CA   . GLY A 1 4  ? -13.153 -8.946  -5.482  1.00 0.00 ? 532 GLY A CA   3  
ATOM   1256  C  C    . GLY A 1 4  ? -12.198 -8.522  -6.580  1.00 0.00 ? 532 GLY A C    3  
ATOM   1257  O  O    . GLY A 1 4  ? -11.474 -9.348  -7.135  1.00 0.00 ? 532 GLY A O    3  
ATOM   1258  H  H    . GLY A 1 4  ? -12.293 -10.071 -3.908  1.00 0.00 ? 532 GLY A H    3  
ATOM   1259  H  HA2  . GLY A 1 4  ? -13.639 -9.864  -5.778  1.00 0.00 ? 532 GLY A HA2  3  
ATOM   1260  H  HA3  . GLY A 1 4  ? -13.903 -8.179  -5.356  1.00 0.00 ? 532 GLY A HA3  3  
ATOM   1261  N  N    . LYS A 1 5  ? -12.195 -7.230  -6.892  1.00 0.00 ? 533 LYS A N    3  
ATOM   1262  C  CA   . LYS A 1 5  ? -11.322 -6.696  -7.931  1.00 0.00 ? 533 LYS A CA   3  
ATOM   1263  C  C    . LYS A 1 5  ? -10.185 -5.883  -7.321  1.00 0.00 ? 533 LYS A C    3  
ATOM   1264  O  O    . LYS A 1 5  ? -10.292 -5.393  -6.196  1.00 0.00 ? 533 LYS A O    3  
ATOM   1265  C  CB   . LYS A 1 5  ? -12.121 -5.826  -8.903  1.00 0.00 ? 533 LYS A CB   3  
ATOM   1266  C  CG   . LYS A 1 5  ? -13.147 -6.602  -9.713  1.00 0.00 ? 533 LYS A CG   3  
ATOM   1267  C  CD   . LYS A 1 5  ? -14.076 -5.669  -10.473 1.00 0.00 ? 533 LYS A CD   3  
ATOM   1268  C  CE   . LYS A 1 5  ? -15.041 -6.443  -11.358 1.00 0.00 ? 533 LYS A CE   3  
ATOM   1269  N  NZ   . LYS A 1 5  ? -15.375 -5.696  -12.601 1.00 0.00 ? 533 LYS A NZ   3  
ATOM   1270  H  H    . LYS A 1 5  ? -12.796 -6.621  -6.414  1.00 0.00 ? 533 LYS A H    3  
ATOM   1271  H  HA   . LYS A 1 5  ? -10.901 -7.531  -8.472  1.00 0.00 ? 533 LYS A HA   3  
ATOM   1272  H  HB2  . LYS A 1 5  ? -12.641 -5.064  -8.341  1.00 0.00 ? 533 LYS A HB2  3  
ATOM   1273  H  HB3  . LYS A 1 5  ? -11.437 -5.351  -9.589  1.00 0.00 ? 533 LYS A HB3  3  
ATOM   1274  H  HG2  . LYS A 1 5  ? -12.630 -7.233  -10.420 1.00 0.00 ? 533 LYS A HG2  3  
ATOM   1275  H  HG3  . LYS A 1 5  ? -13.733 -7.213  -9.042  1.00 0.00 ? 533 LYS A HG3  3  
ATOM   1276  H  HD2  . LYS A 1 5  ? -14.644 -5.086  -9.764  1.00 0.00 ? 533 LYS A HD2  3  
ATOM   1277  H  HD3  . LYS A 1 5  ? -13.483 -5.011  -11.091 1.00 0.00 ? 533 LYS A HD3  3  
ATOM   1278  H  HE2  . LYS A 1 5  ? -14.586 -7.385  -11.626 1.00 0.00 ? 533 LYS A HE2  3  
ATOM   1279  H  HE3  . LYS A 1 5  ? -15.949 -6.627  -10.803 1.00 0.00 ? 533 LYS A HE3  3  
ATOM   1280  H  HZ1  . LYS A 1 5  ? -16.241 -6.082  -13.028 1.00 0.00 ? 533 LYS A HZ1  3  
ATOM   1281  H  HZ2  . LYS A 1 5  ? -14.598 -5.778  -13.288 1.00 0.00 ? 533 LYS A HZ2  3  
ATOM   1282  H  HZ3  . LYS A 1 5  ? -15.525 -4.690  -12.385 1.00 0.00 ? 533 LYS A HZ3  3  
ATOM   1283  N  N    . LYS A 1 6  ? -9.096  -5.742  -8.070  1.00 0.00 ? 534 LYS A N    3  
ATOM   1284  C  CA   . LYS A 1 6  ? -7.939  -4.987  -7.603  1.00 0.00 ? 534 LYS A CA   3  
ATOM   1285  C  C    . LYS A 1 6  ? -7.156  -4.412  -8.778  1.00 0.00 ? 534 LYS A C    3  
ATOM   1286  O  O    . LYS A 1 6  ? -6.991  -5.066  -9.808  1.00 0.00 ? 534 LYS A O    3  
ATOM   1287  C  CB   . LYS A 1 6  ? -7.029  -5.879  -6.756  1.00 0.00 ? 534 LYS A CB   3  
ATOM   1288  C  CG   . LYS A 1 6  ? -6.124  -5.103  -5.813  1.00 0.00 ? 534 LYS A CG   3  
ATOM   1289  C  CD   . LYS A 1 6  ? -5.495  -6.013  -4.771  1.00 0.00 ? 534 LYS A CD   3  
ATOM   1290  C  CE   . LYS A 1 6  ? -4.916  -5.217  -3.612  1.00 0.00 ? 534 LYS A CE   3  
ATOM   1291  N  NZ   . LYS A 1 6  ? -5.957  -4.414  -2.912  1.00 0.00 ? 534 LYS A NZ   3  
ATOM   1292  H  H    . LYS A 1 6  ? -9.070  -6.156  -8.958  1.00 0.00 ? 534 LYS A H    3  
ATOM   1293  H  HA   . LYS A 1 6  ? -8.299  -4.173  -6.993  1.00 0.00 ? 534 LYS A HA   3  
ATOM   1294  H  HB2  . LYS A 1 6  ? -7.643  -6.543  -6.166  1.00 0.00 ? 534 LYS A HB2  3  
ATOM   1295  H  HB3  . LYS A 1 6  ? -6.407  -6.467  -7.415  1.00 0.00 ? 534 LYS A HB3  3  
ATOM   1296  H  HG2  . LYS A 1 6  ? -5.339  -4.634  -6.387  1.00 0.00 ? 534 LYS A HG2  3  
ATOM   1297  H  HG3  . LYS A 1 6  ? -6.708  -4.345  -5.312  1.00 0.00 ? 534 LYS A HG3  3  
ATOM   1298  H  HD2  . LYS A 1 6  ? -6.250  -6.684  -4.390  1.00 0.00 ? 534 LYS A HD2  3  
ATOM   1299  H  HD3  . LYS A 1 6  ? -4.704  -6.584  -5.235  1.00 0.00 ? 534 LYS A HD3  3  
ATOM   1300  H  HE2  . LYS A 1 6  ? -4.470  -5.903  -2.908  1.00 0.00 ? 534 LYS A HE2  3  
ATOM   1301  H  HE3  . LYS A 1 6  ? -4.156  -4.551  -3.995  1.00 0.00 ? 534 LYS A HE3  3  
ATOM   1302  H  HZ1  . LYS A 1 6  ? -5.819  -4.472  -1.882  1.00 0.00 ? 534 LYS A HZ1  3  
ATOM   1303  H  HZ2  . LYS A 1 6  ? -6.904  -4.775  -3.144  1.00 0.00 ? 534 LYS A HZ2  3  
ATOM   1304  H  HZ3  . LYS A 1 6  ? -5.896  -3.418  -3.204  1.00 0.00 ? 534 LYS A HZ3  3  
ATOM   1305  N  N    . LYS A 1 7  ? -6.675  -3.183  -8.617  1.00 0.00 ? 535 LYS A N    3  
ATOM   1306  C  CA   . LYS A 1 7  ? -5.909  -2.519  -9.666  1.00 0.00 ? 535 LYS A CA   3  
ATOM   1307  C  C    . LYS A 1 7  ? -4.825  -1.628  -9.068  1.00 0.00 ? 535 LYS A C    3  
ATOM   1308  O  O    . LYS A 1 7  ? -5.056  -0.929  -8.081  1.00 0.00 ? 535 LYS A O    3  
ATOM   1309  C  CB   . LYS A 1 7  ? -6.837  -1.688  -10.554 1.00 0.00 ? 535 LYS A CB   3  
ATOM   1310  C  CG   . LYS A 1 7  ? -7.786  -0.793  -9.772  1.00 0.00 ? 535 LYS A CG   3  
ATOM   1311  C  CD   . LYS A 1 7  ? -9.173  -0.771  -10.395 1.00 0.00 ? 535 LYS A CD   3  
ATOM   1312  C  CE   . LYS A 1 7  ? -10.049 0.302   -9.769  1.00 0.00 ? 535 LYS A CE   3  
ATOM   1313  N  NZ   . LYS A 1 7  ? -10.930 -0.251  -8.704  1.00 0.00 ? 535 LYS A NZ   3  
ATOM   1314  H  H    . LYS A 1 7  ? -6.839  -2.712  -7.774  1.00 0.00 ? 535 LYS A H    3  
ATOM   1315  H  HA   . LYS A 1 7  ? -5.440  -3.283  -10.267 1.00 0.00 ? 535 LYS A HA   3  
ATOM   1316  H  HB2  . LYS A 1 7  ? -6.236  -1.063  -11.197 1.00 0.00 ? 535 LYS A HB2  3  
ATOM   1317  H  HB3  . LYS A 1 7  ? -7.427  -2.356  -11.164 1.00 0.00 ? 535 LYS A HB3  3  
ATOM   1318  H  HG2  . LYS A 1 7  ? -7.863  -1.162  -8.761  1.00 0.00 ? 535 LYS A HG2  3  
ATOM   1319  H  HG3  . LYS A 1 7  ? -7.390  0.212   -9.761  1.00 0.00 ? 535 LYS A HG3  3  
ATOM   1320  H  HD2  . LYS A 1 7  ? -9.079  -0.573  -11.452 1.00 0.00 ? 535 LYS A HD2  3  
ATOM   1321  H  HD3  . LYS A 1 7  ? -9.638  -1.735  -10.247 1.00 0.00 ? 535 LYS A HD3  3  
ATOM   1322  H  HE2  . LYS A 1 7  ? -9.413  1.062   -9.339  1.00 0.00 ? 535 LYS A HE2  3  
ATOM   1323  H  HE3  . LYS A 1 7  ? -10.663 0.743   -10.541 1.00 0.00 ? 535 LYS A HE3  3  
ATOM   1324  H  HZ1  . LYS A 1 7  ? -11.701 0.415   -8.496  1.00 0.00 ? 535 LYS A HZ1  3  
ATOM   1325  H  HZ2  . LYS A 1 7  ? -10.383 -0.412  -7.835  1.00 0.00 ? 535 LYS A HZ2  3  
ATOM   1326  H  HZ3  . LYS A 1 7  ? -11.341 -1.155  -9.014  1.00 0.00 ? 535 LYS A HZ3  3  
ATOM   1327  N  N    . GLN A 1 8  ? -3.643  -1.657  -9.674  1.00 0.00 ? 536 GLN A N    3  
ATOM   1328  C  CA   . GLN A 1 8  ? -2.522  -0.851  -9.204  1.00 0.00 ? 536 GLN A CA   3  
ATOM   1329  C  C    . GLN A 1 8  ? -2.154  -1.214  -7.769  1.00 0.00 ? 536 GLN A C    3  
ATOM   1330  O  O    . GLN A 1 8  ? -2.758  -2.103  -7.168  1.00 0.00 ? 536 GLN A O    3  
ATOM   1331  C  CB   . GLN A 1 8  ? -2.865  0.637   -9.293  1.00 0.00 ? 536 GLN A CB   3  
ATOM   1332  C  CG   . GLN A 1 8  ? -3.450  1.047   -10.635 1.00 0.00 ? 536 GLN A CG   3  
ATOM   1333  C  CD   . GLN A 1 8  ? -4.095  2.418   -10.595 1.00 0.00 ? 536 GLN A CD   3  
ATOM   1334  O  OE1  . GLN A 1 8  ? -3.763  3.296   -11.391 1.00 0.00 ? 536 GLN A OE1  3  
ATOM   1335  N  NE2  . GLN A 1 8  ? -5.023  2.609   -9.665  1.00 0.00 ? 536 GLN A NE2  3  
ATOM   1336  H  H    . GLN A 1 8  ? -3.521  -2.233  -10.458 1.00 0.00 ? 536 GLN A H    3  
ATOM   1337  H  HA   . GLN A 1 8  ? -1.676  -1.055  -9.842  1.00 0.00 ? 536 GLN A HA   3  
ATOM   1338  H  HB2  . GLN A 1 8  ? -3.584  0.876   -8.523  1.00 0.00 ? 536 GLN A HB2  3  
ATOM   1339  H  HB3  . GLN A 1 8  ? -1.967  1.213   -9.125  1.00 0.00 ? 536 GLN A HB3  3  
ATOM   1340  H  HG2  . GLN A 1 8  ? -2.659  1.060   -11.369 1.00 0.00 ? 536 GLN A HG2  3  
ATOM   1341  H  HG3  . GLN A 1 8  ? -4.197  0.322   -10.924 1.00 0.00 ? 536 GLN A HG3  3  
ATOM   1342  H  HE21 . GLN A 1 8  ? -5.237  1.864   -9.064  1.00 0.00 ? 536 GLN A HE21 3  
ATOM   1343  H  HE22 . GLN A 1 8  ? -5.457  3.486   -9.617  1.00 0.00 ? 536 GLN A HE22 3  
ATOM   1344  N  N    . HIS A 1 9  ? -1.159  -0.520  -7.225  1.00 0.00 ? 537 HIS A N    3  
ATOM   1345  C  CA   . HIS A 1 9  ? -0.710  -0.769  -5.860  1.00 0.00 ? 537 HIS A CA   3  
ATOM   1346  C  C    . HIS A 1 9  ? -1.535  0.036   -4.861  1.00 0.00 ? 537 HIS A C    3  
ATOM   1347  O  O    . HIS A 1 9  ? -1.571  1.265   -4.919  1.00 0.00 ? 537 HIS A O    3  
ATOM   1348  C  CB   . HIS A 1 9  ? 0.772   -0.416  -5.716  1.00 0.00 ? 537 HIS A CB   3  
ATOM   1349  C  CG   . HIS A 1 9  ? 1.669   -1.222  -6.602  1.00 0.00 ? 537 HIS A CG   3  
ATOM   1350  N  ND1  . HIS A 1 9  ? 1.214   -2.117  -7.546  1.00 0.00 ? 537 HIS A ND1  3  
ATOM   1351  C  CD2  . HIS A 1 9  ? 3.024   -1.256  -6.677  1.00 0.00 ? 537 HIS A CD2  3  
ATOM   1352  C  CE1  . HIS A 1 9  ? 2.282   -2.655  -8.150  1.00 0.00 ? 537 HIS A CE1  3  
ATOM   1353  N  NE2  . HIS A 1 9  ? 3.404   -2.165  -7.660  1.00 0.00 ? 537 HIS A NE2  3  
ATOM   1354  H  H    . HIS A 1 9  ? -0.717  0.176   -7.755  1.00 0.00 ? 537 HIS A H    3  
ATOM   1355  H  HA   . HIS A 1 9  ? -0.842  -1.820  -5.654  1.00 0.00 ? 537 HIS A HA   3  
ATOM   1356  H  HB2  . HIS A 1 9  ? 0.912   0.626   -5.962  1.00 0.00 ? 537 HIS A HB2  3  
ATOM   1357  H  HB3  . HIS A 1 9  ? 1.076   -0.583  -4.693  1.00 0.00 ? 537 HIS A HB3  3  
ATOM   1358  H  HD1  . HIS A 1 9  ? 0.276   -2.323  -7.740  1.00 0.00 ? 537 HIS A HD1  3  
ATOM   1359  H  HD2  . HIS A 1 9  ? 3.707   -0.674  -6.076  1.00 0.00 ? 537 HIS A HD2  3  
ATOM   1360  H  HE1  . HIS A 1 9  ? 2.230   -3.392  -8.938  1.00 0.00 ? 537 HIS A HE1  3  
ATOM   1361  N  N    . ILE A 1 10 ? -2.195  -0.666  -3.946  1.00 0.00 ? 538 ILE A N    3  
ATOM   1362  C  CA   . ILE A 1 10 ? -3.019  -0.017  -2.934  1.00 0.00 ? 538 ILE A CA   3  
ATOM   1363  C  C    . ILE A 1 10 ? -2.574  -0.410  -1.529  1.00 0.00 ? 538 ILE A C    3  
ATOM   1364  O  O    . ILE A 1 10 ? -2.240  -1.567  -1.274  1.00 0.00 ? 538 ILE A O    3  
ATOM   1365  C  CB   . ILE A 1 10 ? -4.507  -0.374  -3.107  1.00 0.00 ? 538 ILE A CB   3  
ATOM   1366  C  CG1  . ILE A 1 10 ? -4.933  -0.189  -4.564  1.00 0.00 ? 538 ILE A CG1  3  
ATOM   1367  C  CG2  . ILE A 1 10 ? -5.367  0.477   -2.184  1.00 0.00 ? 538 ILE A CG2  3  
ATOM   1368  C  CD1  . ILE A 1 10 ? -4.866  1.247   -5.036  1.00 0.00 ? 538 ILE A CD1  3  
ATOM   1369  H  H    . ILE A 1 10 ? -2.126  -1.644  -3.951  1.00 0.00 ? 538 ILE A H    3  
ATOM   1370  H  HA   . ILE A 1 10 ? -2.910  1.052   -3.050  1.00 0.00 ? 538 ILE A HA   3  
ATOM   1371  H  HB   . ILE A 1 10 ? -4.640  -1.409  -2.829  1.00 0.00 ? 538 ILE A HB   3  
ATOM   1372  H  HG12 . ILE A 1 10 ? -4.286  -0.776  -5.199  1.00 0.00 ? 538 ILE A HG12 3  
ATOM   1373  H  HG13 . ILE A 1 10 ? -5.951  -0.531  -4.681  1.00 0.00 ? 538 ILE A HG13 3  
ATOM   1374  H  HG21 . ILE A 1 10 ? -4.960  1.476   -2.133  1.00 0.00 ? 538 ILE A HG21 3  
ATOM   1375  H  HG22 . ILE A 1 10 ? -5.376  0.041   -1.196  1.00 0.00 ? 538 ILE A HG22 3  
ATOM   1376  H  HG23 . ILE A 1 10 ? -6.375  0.518   -2.569  1.00 0.00 ? 538 ILE A HG23 3  
ATOM   1377  H  HD11 . ILE A 1 10 ? -4.056  1.754   -4.533  1.00 0.00 ? 538 ILE A HD11 3  
ATOM   1378  H  HD12 . ILE A 1 10 ? -5.798  1.744   -4.810  1.00 0.00 ? 538 ILE A HD12 3  
ATOM   1379  H  HD13 . ILE A 1 10 ? -4.697  1.268   -6.102  1.00 0.00 ? 538 ILE A HD13 3  
ATOM   1380  N  N    . CYS A 1 11 ? -2.571  0.561   -0.621  1.00 0.00 ? 539 CYS A N    3  
ATOM   1381  C  CA   . CYS A 1 11 ? -2.166  0.315   0.758   1.00 0.00 ? 539 CYS A CA   3  
ATOM   1382  C  C    . CYS A 1 11 ? -3.141  -0.634  1.448   1.00 0.00 ? 539 CYS A C    3  
ATOM   1383  O  O    . CYS A 1 11 ? -4.137  -0.203  2.029   1.00 0.00 ? 539 CYS A O    3  
ATOM   1384  C  CB   . CYS A 1 11 ? -2.084  1.635   1.530   1.00 0.00 ? 539 CYS A CB   3  
ATOM   1385  S  SG   . CYS A 1 11 ? -0.437  2.012   2.173   1.00 0.00 ? 539 CYS A SG   3  
ATOM   1386  H  H    . CYS A 1 11 ? -2.847  1.464   -0.885  1.00 0.00 ? 539 CYS A H    3  
ATOM   1387  H  HA   . CYS A 1 11 ? -1.189  -0.142  0.740   1.00 0.00 ? 539 CYS A HA   3  
ATOM   1388  H  HB2  . CYS A 1 11 ? -2.372  2.444   0.876   1.00 0.00 ? 539 CYS A HB2  3  
ATOM   1389  H  HB3  . CYS A 1 11 ? -2.764  1.598   2.369   1.00 0.00 ? 539 CYS A HB3  3  
ATOM   1390  N  N    . HIS A 1 12 ? -2.846  -1.928  1.380   1.00 0.00 ? 540 HIS A N    3  
ATOM   1391  C  CA   . HIS A 1 12 ? -3.696  -2.939  1.999   1.00 0.00 ? 540 HIS A CA   3  
ATOM   1392  C  C    . HIS A 1 12 ? -3.818  -2.704  3.502   1.00 0.00 ? 540 HIS A C    3  
ATOM   1393  O  O    . HIS A 1 12 ? -4.831  -3.042  4.113   1.00 0.00 ? 540 HIS A O    3  
ATOM   1394  C  CB   . HIS A 1 12 ? -3.136  -4.338  1.734   1.00 0.00 ? 540 HIS A CB   3  
ATOM   1395  C  CG   . HIS A 1 12 ? -4.032  -5.440  2.207   1.00 0.00 ? 540 HIS A CG   3  
ATOM   1396  N  ND1  . HIS A 1 12 ? -5.406  -5.402  2.123   1.00 0.00 ? 540 HIS A ND1  3  
ATOM   1397  C  CD2  . HIS A 1 12 ? -3.725  -6.633  2.778   1.00 0.00 ? 540 HIS A CD2  3  
ATOM   1398  C  CE1  . HIS A 1 12 ? -5.881  -6.545  2.634   1.00 0.00 ? 540 HIS A CE1  3  
ATOM   1399  N  NE2  . HIS A 1 12 ? -4.901  -7.327  3.045   1.00 0.00 ? 540 HIS A NE2  3  
ATOM   1400  H  H    . HIS A 1 12 ? -2.038  -2.210  0.903   1.00 0.00 ? 540 HIS A H    3  
ATOM   1401  H  HA   . HIS A 1 12 ? -4.677  -2.864  1.555   1.00 0.00 ? 540 HIS A HA   3  
ATOM   1402  H  HB2  . HIS A 1 12 ? -2.987  -4.463  0.672   1.00 0.00 ? 540 HIS A HB2  3  
ATOM   1403  H  HB3  . HIS A 1 12 ? -2.187  -4.439  2.240   1.00 0.00 ? 540 HIS A HB3  3  
ATOM   1404  H  HD1  . HIS A 1 12 ? -5.941  -4.668  1.755   1.00 0.00 ? 540 HIS A HD1  3  
ATOM   1405  H  HD2  . HIS A 1 12 ? -2.730  -6.994  2.995   1.00 0.00 ? 540 HIS A HD2  3  
ATOM   1406  H  HE1  . HIS A 1 12 ? -6.929  -6.795  2.700   1.00 0.00 ? 540 HIS A HE1  3  
ATOM   1407  N  N    . ILE A 1 13 ? -2.778  -2.122  4.091   1.00 0.00 ? 541 ILE A N    3  
ATOM   1408  C  CA   . ILE A 1 13 ? -2.768  -1.841  5.522   1.00 0.00 ? 541 ILE A CA   3  
ATOM   1409  C  C    . ILE A 1 13 ? -3.917  -0.915  5.907   1.00 0.00 ? 541 ILE A C    3  
ATOM   1410  O  O    . ILE A 1 13 ? -4.079  0.162   5.332   1.00 0.00 ? 541 ILE A O    3  
ATOM   1411  C  CB   . ILE A 1 13 ? -1.437  -1.200  5.960   1.00 0.00 ? 541 ILE A CB   3  
ATOM   1412  C  CG1  . ILE A 1 13 ? -0.252  -2.013  5.432   1.00 0.00 ? 541 ILE A CG1  3  
ATOM   1413  C  CG2  . ILE A 1 13 ? -1.377  -1.087  7.476   1.00 0.00 ? 541 ILE A CG2  3  
ATOM   1414  C  CD1  . ILE A 1 13 ? 0.814   -1.167  4.769   1.00 0.00 ? 541 ILE A CD1  3  
ATOM   1415  H  H    . ILE A 1 13 ? -1.998  -1.876  3.551   1.00 0.00 ? 541 ILE A H    3  
ATOM   1416  H  HA   . ILE A 1 13 ? -2.883  -2.779  6.047   1.00 0.00 ? 541 ILE A HA   3  
ATOM   1417  H  HB   . ILE A 1 13 ? -1.392  -0.203  5.548   1.00 0.00 ? 541 ILE A HB   3  
ATOM   1418  H  HG12 . ILE A 1 13 ? 0.210   -2.541  6.253   1.00 0.00 ? 541 ILE A HG12 3  
ATOM   1419  H  HG13 . ILE A 1 13 ? -0.607  -2.729  4.705   1.00 0.00 ? 541 ILE A HG13 3  
ATOM   1420  H  HG21 . ILE A 1 13 ? -0.900  -0.157  7.749   1.00 0.00 ? 541 ILE A HG21 3  
ATOM   1421  H  HG22 . ILE A 1 13 ? -0.809  -1.914  7.876   1.00 0.00 ? 541 ILE A HG22 3  
ATOM   1422  H  HG23 . ILE A 1 13 ? -2.379  -1.109  7.879   1.00 0.00 ? 541 ILE A HG23 3  
ATOM   1423  H  HD11 . ILE A 1 13 ? 0.753   -1.286  3.698   1.00 0.00 ? 541 ILE A HD11 3  
ATOM   1424  H  HD12 . ILE A 1 13 ? 1.788   -1.481  5.113   1.00 0.00 ? 541 ILE A HD12 3  
ATOM   1425  H  HD13 . ILE A 1 13 ? 0.659   -0.129  5.025   1.00 0.00 ? 541 ILE A HD13 3  
ATOM   1426  N  N    . GLN A 1 14 ? -4.712  -1.340  6.884   1.00 0.00 ? 542 GLN A N    3  
ATOM   1427  C  CA   . GLN A 1 14 ? -5.846  -0.548  7.347   1.00 0.00 ? 542 GLN A CA   3  
ATOM   1428  C  C    . GLN A 1 14 ? -5.384  0.805   7.878   1.00 0.00 ? 542 GLN A C    3  
ATOM   1429  O  O    . GLN A 1 14 ? -4.865  0.903   8.990   1.00 0.00 ? 542 GLN A O    3  
ATOM   1430  C  CB   . GLN A 1 14 ? -6.610  -1.301  8.437   1.00 0.00 ? 542 GLN A CB   3  
ATOM   1431  C  CG   . GLN A 1 14 ? -7.044  -2.698  8.022   1.00 0.00 ? 542 GLN A CG   3  
ATOM   1432  C  CD   . GLN A 1 14 ? -8.037  -3.310  8.990   1.00 0.00 ? 542 GLN A CD   3  
ATOM   1433  O  OE1  . GLN A 1 14 ? -9.055  -3.869  8.583   1.00 0.00 ? 542 GLN A OE1  3  
ATOM   1434  N  NE2  . GLN A 1 14 ? -7.744  -3.207  10.282  1.00 0.00 ? 542 GLN A NE2  3  
ATOM   1435  H  H    . GLN A 1 14 ? -4.531  -2.207  7.304   1.00 0.00 ? 542 GLN A H    3  
ATOM   1436  H  HA   . GLN A 1 14 ? -6.502  -0.386  6.505   1.00 0.00 ? 542 GLN A HA   3  
ATOM   1437  H  HB2  . GLN A 1 14 ? -5.980  -1.388  9.309   1.00 0.00 ? 542 GLN A HB2  3  
ATOM   1438  H  HB3  . GLN A 1 14 ? -7.493  -0.736  8.696   1.00 0.00 ? 542 GLN A HB3  3  
ATOM   1439  H  HG2  . GLN A 1 14 ? -7.502  -2.644  7.046   1.00 0.00 ? 542 GLN A HG2  3  
ATOM   1440  H  HG3  . GLN A 1 14 ? -6.171  -3.332  7.975   1.00 0.00 ? 542 GLN A HG3  3  
ATOM   1441  H  HE21 . GLN A 1 14 ? -6.916  -2.748  10.533  1.00 0.00 ? 542 GLN A HE21 3  
ATOM   1442  H  HE22 . GLN A 1 14 ? -8.369  -3.594  10.930  1.00 0.00 ? 542 GLN A HE22 3  
ATOM   1443  N  N    . GLY A 1 15 ? -5.578  1.848   7.077   1.00 0.00 ? 543 GLY A N    3  
ATOM   1444  C  CA   . GLY A 1 15 ? -5.177  3.181   7.485   1.00 0.00 ? 543 GLY A CA   3  
ATOM   1445  C  C    . GLY A 1 15 ? -5.066  4.139   6.315   1.00 0.00 ? 543 GLY A C    3  
ATOM   1446  O  O    . GLY A 1 15 ? -5.733  5.173   6.285   1.00 0.00 ? 543 GLY A O    3  
ATOM   1447  H  H    . GLY A 1 15 ? -5.997  1.711   6.202   1.00 0.00 ? 543 GLY A H    3  
ATOM   1448  H  HA2  . GLY A 1 15 ? -5.905  3.566   8.183   1.00 0.00 ? 543 GLY A HA2  3  
ATOM   1449  H  HA3  . GLY A 1 15 ? -4.218  3.121   7.978   1.00 0.00 ? 543 GLY A HA3  3  
ATOM   1450  N  N    . CYS A 1 16 ? -4.220  3.796   5.349   1.00 0.00 ? 544 CYS A N    3  
ATOM   1451  C  CA   . CYS A 1 16 ? -4.021  4.633   4.172   1.00 0.00 ? 544 CYS A CA   3  
ATOM   1452  C  C    . CYS A 1 16 ? -5.163  4.455   3.175   1.00 0.00 ? 544 CYS A C    3  
ATOM   1453  O  O    . CYS A 1 16 ? -6.163  3.802   3.470   1.00 0.00 ? 544 CYS A O    3  
ATOM   1454  C  CB   . CYS A 1 16 ? -2.689  4.294   3.501   1.00 0.00 ? 544 CYS A CB   3  
ATOM   1455  S  SG   . CYS A 1 16 ? -1.758  5.736   2.933   1.00 0.00 ? 544 CYS A SG   3  
ATOM   1456  H  H    . CYS A 1 16 ? -3.716  2.959   5.431   1.00 0.00 ? 544 CYS A H    3  
ATOM   1457  H  HA   . CYS A 1 16 ? -3.999  5.662   4.496   1.00 0.00 ? 544 CYS A HA   3  
ATOM   1458  H  HB2  . CYS A 1 16 ? -2.067  3.760   4.203   1.00 0.00 ? 544 CYS A HB2  3  
ATOM   1459  H  HB3  . CYS A 1 16 ? -2.876  3.666   2.644   1.00 0.00 ? 544 CYS A HB3  3  
ATOM   1460  N  N    . GLY A 1 17 ? -5.002  5.040   1.992   1.00 0.00 ? 545 GLY A N    3  
ATOM   1461  C  CA   . GLY A 1 17 ? -6.021  4.937   0.966   1.00 0.00 ? 545 GLY A CA   3  
ATOM   1462  C  C    . GLY A 1 17 ? -5.641  5.682   -0.298  1.00 0.00 ? 545 GLY A C    3  
ATOM   1463  O  O    . GLY A 1 17 ? -6.493  6.280   -0.955  1.00 0.00 ? 545 GLY A O    3  
ATOM   1464  H  H    . GLY A 1 17 ? -4.182  5.547   1.814   1.00 0.00 ? 545 GLY A H    3  
ATOM   1465  H  HA2  . GLY A 1 17 ? -6.171  3.894   0.725   1.00 0.00 ? 545 GLY A HA2  3  
ATOM   1466  H  HA3  . GLY A 1 17 ? -6.946  5.344   1.347   1.00 0.00 ? 545 GLY A HA3  3  
ATOM   1467  N  N    . LYS A 1 18 ? -4.356  5.649   -0.636  1.00 0.00 ? 546 LYS A N    3  
ATOM   1468  C  CA   . LYS A 1 18 ? -3.860  6.329   -1.826  1.00 0.00 ? 546 LYS A CA   3  
ATOM   1469  C  C    . LYS A 1 18 ? -3.748  5.361   -3.001  1.00 0.00 ? 546 LYS A C    3  
ATOM   1470  O  O    . LYS A 1 18 ? -4.199  4.218   -2.921  1.00 0.00 ? 546 LYS A O    3  
ATOM   1471  C  CB   . LYS A 1 18 ? -2.499  6.968   -1.543  1.00 0.00 ? 546 LYS A CB   3  
ATOM   1472  C  CG   . LYS A 1 18 ? -1.396  5.959   -1.268  1.00 0.00 ? 546 LYS A CG   3  
ATOM   1473  C  CD   . LYS A 1 18 ? -0.427  6.465   -0.211  1.00 0.00 ? 546 LYS A CD   3  
ATOM   1474  C  CE   . LYS A 1 18 ? 0.541   7.486   -0.785  1.00 0.00 ? 546 LYS A CE   3  
ATOM   1475  N  NZ   . LYS A 1 18 ? 0.121   8.882   -0.482  1.00 0.00 ? 546 LYS A NZ   3  
ATOM   1476  H  H    . LYS A 1 18 ? -3.725  5.157   -0.070  1.00 0.00 ? 546 LYS A H    3  
ATOM   1477  H  HA   . LYS A 1 18 ? -4.565  7.105   -2.081  1.00 0.00 ? 546 LYS A HA   3  
ATOM   1478  H  HB2  . LYS A 1 18 ? -2.208  7.563   -2.396  1.00 0.00 ? 546 LYS A HB2  3  
ATOM   1479  H  HB3  . LYS A 1 18 ? -2.590  7.613   -0.681  1.00 0.00 ? 546 LYS A HB3  3  
ATOM   1480  H  HG2  . LYS A 1 18 ? -1.841  5.038   -0.922  1.00 0.00 ? 546 LYS A HG2  3  
ATOM   1481  H  HG3  . LYS A 1 18 ? -0.852  5.777   -2.184  1.00 0.00 ? 546 LYS A HG3  3  
ATOM   1482  H  HD2  . LYS A 1 18 ? -0.989  6.926   0.587   1.00 0.00 ? 546 LYS A HD2  3  
ATOM   1483  H  HD3  . LYS A 1 18 ? 0.134   5.628   0.179   1.00 0.00 ? 546 LYS A HD3  3  
ATOM   1484  H  HE2  . LYS A 1 18 ? 1.519   7.314   -0.360  1.00 0.00 ? 546 LYS A HE2  3  
ATOM   1485  H  HE3  . LYS A 1 18 ? 0.587   7.357   -1.856  1.00 0.00 ? 546 LYS A HE3  3  
ATOM   1486  H  HZ1  . LYS A 1 18 ? 0.346   9.504   -1.285  1.00 0.00 ? 546 LYS A HZ1  3  
ATOM   1487  H  HZ2  . LYS A 1 18 ? 0.618   9.230   0.362   1.00 0.00 ? 546 LYS A HZ2  3  
ATOM   1488  H  HZ3  . LYS A 1 18 ? -0.903  8.916   -0.306  1.00 0.00 ? 546 LYS A HZ3  3  
ATOM   1489  N  N    . VAL A 1 19 ? -3.143  5.826   -4.090  1.00 0.00 ? 547 VAL A N    3  
ATOM   1490  C  CA   . VAL A 1 19 ? -2.972  5.001   -5.280  1.00 0.00 ? 547 VAL A CA   3  
ATOM   1491  C  C    . VAL A 1 19 ? -1.537  5.066   -5.791  1.00 0.00 ? 547 VAL A C    3  
ATOM   1492  O  O    . VAL A 1 19 ? -1.031  6.140   -6.118  1.00 0.00 ? 547 VAL A O    3  
ATOM   1493  C  CB   . VAL A 1 19 ? -3.926  5.437   -6.408  1.00 0.00 ? 547 VAL A CB   3  
ATOM   1494  C  CG1  . VAL A 1 19 ? -3.875  4.448   -7.563  1.00 0.00 ? 547 VAL A CG1  3  
ATOM   1495  C  CG2  . VAL A 1 19 ? -5.345  5.579   -5.881  1.00 0.00 ? 547 VAL A CG2  3  
ATOM   1496  H  H    . VAL A 1 19 ? -2.804  6.745   -4.093  1.00 0.00 ? 547 VAL A H    3  
ATOM   1497  H  HA   . VAL A 1 19 ? -3.204  3.980   -5.014  1.00 0.00 ? 547 VAL A HA   3  
ATOM   1498  H  HB   . VAL A 1 19 ? -3.602  6.400   -6.774  1.00 0.00 ? 547 VAL A HB   3  
ATOM   1499  H  HG11 . VAL A 1 19 ? -3.919  4.986   -8.499  1.00 0.00 ? 547 VAL A HG11 3  
ATOM   1500  H  HG12 . VAL A 1 19 ? -4.715  3.773   -7.496  1.00 0.00 ? 547 VAL A HG12 3  
ATOM   1501  H  HG13 . VAL A 1 19 ? -2.955  3.885   -7.514  1.00 0.00 ? 547 VAL A HG13 3  
ATOM   1502  H  HG21 . VAL A 1 19 ? -5.491  6.582   -5.507  1.00 0.00 ? 547 VAL A HG21 3  
ATOM   1503  H  HG22 . VAL A 1 19 ? -5.506  4.870   -5.083  1.00 0.00 ? 547 VAL A HG22 3  
ATOM   1504  H  HG23 . VAL A 1 19 ? -6.047  5.388   -6.680  1.00 0.00 ? 547 VAL A HG23 3  
ATOM   1505  N  N    . TYR A 1 20 ? -0.885  3.910   -5.857  1.00 0.00 ? 548 TYR A N    3  
ATOM   1506  C  CA   . TYR A 1 20 ? 0.493   3.834   -6.328  1.00 0.00 ? 548 TYR A CA   3  
ATOM   1507  C  C    . TYR A 1 20 ? 0.632   2.793   -7.435  1.00 0.00 ? 548 TYR A C    3  
ATOM   1508  O  O    . TYR A 1 20 ? -0.158  1.853   -7.519  1.00 0.00 ? 548 TYR A O    3  
ATOM   1509  C  CB   . TYR A 1 20 ? 1.432   3.495   -5.169  1.00 0.00 ? 548 TYR A CB   3  
ATOM   1510  C  CG   . TYR A 1 20 ? 2.164   4.694   -4.611  1.00 0.00 ? 548 TYR A CG   3  
ATOM   1511  C  CD1  . TYR A 1 20 ? 1.480   5.856   -4.275  1.00 0.00 ? 548 TYR A CD1  3  
ATOM   1512  C  CD2  . TYR A 1 20 ? 3.540   4.664   -4.419  1.00 0.00 ? 548 TYR A CD2  3  
ATOM   1513  C  CE1  . TYR A 1 20 ? 2.147   6.954   -3.766  1.00 0.00 ? 548 TYR A CE1  3  
ATOM   1514  C  CE2  . TYR A 1 20 ? 4.213   5.758   -3.910  1.00 0.00 ? 548 TYR A CE2  3  
ATOM   1515  C  CZ   . TYR A 1 20 ? 3.512   6.900   -3.585  1.00 0.00 ? 548 TYR A CZ   3  
ATOM   1516  O  OH   . TYR A 1 20 ? 4.179   7.992   -3.078  1.00 0.00 ? 548 TYR A OH   3  
ATOM   1517  H  H    . TYR A 1 20 ? -1.341  3.087   -5.582  1.00 0.00 ? 548 TYR A H    3  
ATOM   1518  H  HA   . TYR A 1 20 ? 0.761   4.802   -6.725  1.00 0.00 ? 548 TYR A HA   3  
ATOM   1519  H  HB2  . TYR A 1 20 ? 0.859   3.055   -4.367  1.00 0.00 ? 548 TYR A HB2  3  
ATOM   1520  H  HB3  . TYR A 1 20 ? 2.171   2.783   -5.509  1.00 0.00 ? 548 TYR A HB3  3  
ATOM   1521  H  HD1  . TYR A 1 20 ? 0.410   5.895   -4.418  1.00 0.00 ? 548 TYR A HD1  3  
ATOM   1522  H  HD2  . TYR A 1 20 ? 4.086   3.769   -4.676  1.00 0.00 ? 548 TYR A HD2  3  
ATOM   1523  H  HE1  . TYR A 1 20 ? 1.597   7.848   -3.511  1.00 0.00 ? 548 TYR A HE1  3  
ATOM   1524  H  HE2  . TYR A 1 20 ? 5.283   5.716   -3.768  1.00 0.00 ? 548 TYR A HE2  3  
ATOM   1525  H  HH   . TYR A 1 20 ? 5.021   8.091   -3.528  1.00 0.00 ? 548 TYR A HH   3  
ATOM   1526  N  N    . GLY A 1 21 ? 1.642   2.968   -8.282  1.00 0.00 ? 549 GLY A N    3  
ATOM   1527  C  CA   . GLY A 1 21 ? 1.865   2.036   -9.372  1.00 0.00 ? 549 GLY A CA   3  
ATOM   1528  C  C    . GLY A 1 21 ? 3.321   1.633   -9.503  1.00 0.00 ? 549 GLY A C    3  
ATOM   1529  O  O    . GLY A 1 21 ? 3.822   1.444   -10.611 1.00 0.00 ? 549 GLY A O    3  
ATOM   1530  H  H    . GLY A 1 21 ? 2.239   3.736   -8.166  1.00 0.00 ? 549 GLY A H    3  
ATOM   1531  H  HA2  . GLY A 1 21 ? 1.272   1.150   -9.200  1.00 0.00 ? 549 GLY A HA2  3  
ATOM   1532  H  HA3  . GLY A 1 21 ? 1.546   2.497   -10.295 1.00 0.00 ? 549 GLY A HA3  3  
ATOM   1533  N  N    . LYS A 1 22 ? 4.001   1.500   -8.369  1.00 0.00 ? 550 LYS A N    3  
ATOM   1534  C  CA   . LYS A 1 22 ? 5.408   1.116   -8.363  1.00 0.00 ? 550 LYS A CA   3  
ATOM   1535  C  C    . LYS A 1 22 ? 5.751   0.321   -7.107  1.00 0.00 ? 550 LYS A C    3  
ATOM   1536  O  O    . LYS A 1 22 ? 5.531   0.785   -5.988  1.00 0.00 ? 550 LYS A O    3  
ATOM   1537  C  CB   . LYS A 1 22 ? 6.298   2.356   -8.456  1.00 0.00 ? 550 LYS A CB   3  
ATOM   1538  C  CG   . LYS A 1 22 ? 6.633   2.759   -9.883  1.00 0.00 ? 550 LYS A CG   3  
ATOM   1539  C  CD   . LYS A 1 22 ? 7.608   1.784   -10.527 1.00 0.00 ? 550 LYS A CD   3  
ATOM   1540  C  CE   . LYS A 1 22 ? 7.068   1.233   -11.838 1.00 0.00 ? 550 LYS A CE   3  
ATOM   1541  N  NZ   . LYS A 1 22 ? 6.656   -0.193  -11.716 1.00 0.00 ? 550 LYS A NZ   3  
ATOM   1542  H  H    . LYS A 1 22 ? 3.547   1.663   -7.516  1.00 0.00 ? 550 LYS A H    3  
ATOM   1543  H  HA   . LYS A 1 22 ? 5.585   0.493   -9.227  1.00 0.00 ? 550 LYS A HA   3  
ATOM   1544  H  HB2  . LYS A 1 22 ? 5.793   3.184   -7.980  1.00 0.00 ? 550 LYS A HB2  3  
ATOM   1545  H  HB3  . LYS A 1 22 ? 7.223   2.162   -7.933  1.00 0.00 ? 550 LYS A HB3  3  
ATOM   1546  H  HG2  . LYS A 1 22 ? 5.722   2.779   -10.463 1.00 0.00 ? 550 LYS A HG2  3  
ATOM   1547  H  HG3  . LYS A 1 22 ? 7.077   3.744   -9.873  1.00 0.00 ? 550 LYS A HG3  3  
ATOM   1548  H  HD2  . LYS A 1 22 ? 8.538   2.296   -10.720 1.00 0.00 ? 550 LYS A HD2  3  
ATOM   1549  H  HD3  . LYS A 1 22 ? 7.782   0.962   -9.847  1.00 0.00 ? 550 LYS A HD3  3  
ATOM   1550  H  HE2  . LYS A 1 22 ? 6.212   1.820   -12.137 1.00 0.00 ? 550 LYS A HE2  3  
ATOM   1551  H  HE3  . LYS A 1 22 ? 7.838   1.313   -12.591 1.00 0.00 ? 550 LYS A HE3  3  
ATOM   1552  H  HZ1  . LYS A 1 22 ? 7.382   -0.811  -12.132 1.00 0.00 ? 550 LYS A HZ1  3  
ATOM   1553  H  HZ2  . LYS A 1 22 ? 5.757   -0.350  -12.214 1.00 0.00 ? 550 LYS A HZ2  3  
ATOM   1554  H  HZ3  . LYS A 1 22 ? 6.534   -0.446  -10.714 1.00 0.00 ? 550 LYS A HZ3  3  
ATOM   1555  N  N    . THR A 1 23 ? 6.291   -0.878  -7.301  1.00 0.00 ? 551 THR A N    3  
ATOM   1556  C  CA   . THR A 1 23 ? 6.664   -1.738  -6.183  1.00 0.00 ? 551 THR A CA   3  
ATOM   1557  C  C    . THR A 1 23 ? 7.877   -1.180  -5.447  1.00 0.00 ? 551 THR A C    3  
ATOM   1558  O  O    . THR A 1 23 ? 7.907   -1.149  -4.217  1.00 0.00 ? 551 THR A O    3  
ATOM   1559  C  CB   . THR A 1 23 ? 6.961   -3.154  -6.679  1.00 0.00 ? 551 THR A CB   3  
ATOM   1560  O  OG1  . THR A 1 23 ? 6.150   -3.475  -7.796  1.00 0.00 ? 551 THR A OG1  3  
ATOM   1561  C  CG2  . THR A 1 23 ? 6.732   -4.217  -5.626  1.00 0.00 ? 551 THR A CG2  3  
ATOM   1562  H  H    . THR A 1 23 ? 6.441   -1.192  -8.217  1.00 0.00 ? 551 THR A H    3  
ATOM   1563  H  HA   . THR A 1 23 ? 5.828   -1.773  -5.500  1.00 0.00 ? 551 THR A HA   3  
ATOM   1564  H  HB   . THR A 1 23 ? 7.996   -3.208  -6.984  1.00 0.00 ? 551 THR A HB   3  
ATOM   1565  H  HG1  . THR A 1 23 ? 5.236   -3.254  -7.602  1.00 0.00 ? 551 THR A HG1  3  
ATOM   1566  H  HG21 . THR A 1 23 ? 6.016   -3.858  -4.902  1.00 0.00 ? 551 THR A HG21 3  
ATOM   1567  H  HG22 . THR A 1 23 ? 7.666   -4.438  -5.130  1.00 0.00 ? 551 THR A HG22 3  
ATOM   1568  H  HG23 . THR A 1 23 ? 6.353   -5.112  -6.095  1.00 0.00 ? 551 THR A HG23 3  
ATOM   1569  N  N    . SER A 1 24 ? 8.875   -0.738  -6.206  1.00 0.00 ? 552 SER A N    3  
ATOM   1570  C  CA   . SER A 1 24 ? 10.089  -0.179  -5.622  1.00 0.00 ? 552 SER A CA   3  
ATOM   1571  C  C    . SER A 1 24 ? 9.758   0.991   -4.702  1.00 0.00 ? 552 SER A C    3  
ATOM   1572  O  O    . SER A 1 24 ? 10.431  1.214   -3.697  1.00 0.00 ? 552 SER A O    3  
ATOM   1573  C  CB   . SER A 1 24 ? 11.049  0.276   -6.722  1.00 0.00 ? 552 SER A CB   3  
ATOM   1574  O  OG   . SER A 1 24 ? 10.374  1.046   -7.702  1.00 0.00 ? 552 SER A OG   3  
ATOM   1575  H  H    . SER A 1 24 ? 8.792   -0.788  -7.181  1.00 0.00 ? 552 SER A H    3  
ATOM   1576  H  HA   . SER A 1 24 ? 10.564  -0.955  -5.038  1.00 0.00 ? 552 SER A HA   3  
ATOM   1577  H  HB2  . SER A 1 24 ? 11.833  0.878   -6.288  1.00 0.00 ? 552 SER A HB2  3  
ATOM   1578  H  HB3  . SER A 1 24 ? 11.483  -0.590  -7.199  1.00 0.00 ? 552 SER A HB3  3  
ATOM   1579  H  HG   . SER A 1 24 ? 10.064  0.470   -8.405  1.00 0.00 ? 552 SER A HG   3  
ATOM   1580  N  N    . HIS A 1 25 ? 8.711   1.732   -5.050  1.00 0.00 ? 553 HIS A N    3  
ATOM   1581  C  CA   . HIS A 1 25 ? 8.285   2.873   -4.250  1.00 0.00 ? 553 HIS A CA   3  
ATOM   1582  C  C    . HIS A 1 25 ? 7.556   2.405   -2.996  1.00 0.00 ? 553 HIS A C    3  
ATOM   1583  O  O    . HIS A 1 25 ? 7.603   3.062   -1.956  1.00 0.00 ? 553 HIS A O    3  
ATOM   1584  C  CB   . HIS A 1 25 ? 7.375   3.790   -5.071  1.00 0.00 ? 553 HIS A CB   3  
ATOM   1585  C  CG   . HIS A 1 25 ? 8.120   4.823   -5.858  1.00 0.00 ? 553 HIS A CG   3  
ATOM   1586  N  ND1  . HIS A 1 25 ? 9.493   4.897   -5.923  1.00 0.00 ? 553 HIS A ND1  3  
ATOM   1587  C  CD2  . HIS A 1 25 ? 7.653   5.841   -6.626  1.00 0.00 ? 553 HIS A CD2  3  
ATOM   1588  C  CE1  . HIS A 1 25 ? 9.812   5.934   -6.710  1.00 0.00 ? 553 HIS A CE1  3  
ATOM   1589  N  NE2  . HIS A 1 25 ? 8.731   6.540   -7.162  1.00 0.00 ? 553 HIS A NE2  3  
ATOM   1590  H  H    . HIS A 1 25 ? 8.209   1.501   -5.860  1.00 0.00 ? 553 HIS A H    3  
ATOM   1591  H  HA   . HIS A 1 25 ? 9.167   3.422   -3.957  1.00 0.00 ? 553 HIS A HA   3  
ATOM   1592  H  HB2  . HIS A 1 25 ? 6.805   3.191   -5.766  1.00 0.00 ? 553 HIS A HB2  3  
ATOM   1593  H  HB3  . HIS A 1 25 ? 6.697   4.302   -4.404  1.00 0.00 ? 553 HIS A HB3  3  
ATOM   1594  H  HD1  . HIS A 1 25 ? 10.125  4.298   -5.473  1.00 0.00 ? 553 HIS A HD1  3  
ATOM   1595  H  HD2  . HIS A 1 25 ? 6.614   6.079   -6.799  1.00 0.00 ? 553 HIS A HD2  3  
ATOM   1596  H  HE1  . HIS A 1 25 ? 10.823  6.234   -6.944  1.00 0.00 ? 553 HIS A HE1  3  
ATOM   1597  N  N    . LEU A 1 26 ? 6.886   1.262   -3.103  1.00 0.00 ? 554 LEU A N    3  
ATOM   1598  C  CA   . LEU A 1 26 ? 6.150   0.700   -1.979  1.00 0.00 ? 554 LEU A CA   3  
ATOM   1599  C  C    . LEU A 1 26 ? 7.086   0.418   -0.808  1.00 0.00 ? 554 LEU A C    3  
ATOM   1600  O  O    . LEU A 1 26 ? 6.721   0.608   0.351   1.00 0.00 ? 554 LEU A O    3  
ATOM   1601  C  CB   . LEU A 1 26 ? 5.436   -0.588  -2.401  1.00 0.00 ? 554 LEU A CB   3  
ATOM   1602  C  CG   . LEU A 1 26 ? 3.933   -0.617  -2.120  1.00 0.00 ? 554 LEU A CG   3  
ATOM   1603  C  CD1  . LEU A 1 26 ? 3.152   -0.172  -3.346  1.00 0.00 ? 554 LEU A CD1  3  
ATOM   1604  C  CD2  . LEU A 1 26 ? 3.499   -2.009  -1.684  1.00 0.00 ? 554 LEU A CD2  3  
ATOM   1605  H  H    . LEU A 1 26 ? 6.889   0.784   -3.959  1.00 0.00 ? 554 LEU A H    3  
ATOM   1606  H  HA   . LEU A 1 26 ? 5.412   1.425   -1.670  1.00 0.00 ? 554 LEU A HA   3  
ATOM   1607  H  HB2  . LEU A 1 26 ? 5.586   -0.724  -3.463  1.00 0.00 ? 554 LEU A HB2  3  
ATOM   1608  H  HB3  . LEU A 1 26 ? 5.893   -1.417  -1.882  1.00 0.00 ? 554 LEU A HB3  3  
ATOM   1609  H  HG   . LEU A 1 26 ? 3.711   0.071   -1.316  1.00 0.00 ? 554 LEU A HG   3  
ATOM   1610  H  HD11 . LEU A 1 26 ? 3.773   0.466   -3.957  1.00 0.00 ? 554 LEU A HD11 3  
ATOM   1611  H  HD12 . LEU A 1 26 ? 2.272   0.372   -3.036  1.00 0.00 ? 554 LEU A HD12 3  
ATOM   1612  H  HD13 . LEU A 1 26 ? 2.855   -1.040  -3.918  1.00 0.00 ? 554 LEU A HD13 3  
ATOM   1613  H  HD21 . LEU A 1 26 ? 2.498   -2.202  -2.042  1.00 0.00 ? 554 LEU A HD21 3  
ATOM   1614  H  HD22 . LEU A 1 26 ? 3.514   -2.070  -0.606  1.00 0.00 ? 554 LEU A HD22 3  
ATOM   1615  H  HD23 . LEU A 1 26 ? 4.176   -2.742  -2.096  1.00 0.00 ? 554 LEU A HD23 3  
ATOM   1616  N  N    . ARG A 1 27 ? 8.294   -0.037  -1.123  1.00 0.00 ? 555 ARG A N    3  
ATOM   1617  C  CA   . ARG A 1 27 ? 9.285   -0.347  -0.100  1.00 0.00 ? 555 ARG A CA   3  
ATOM   1618  C  C    . ARG A 1 27 ? 9.587   0.880   0.758   1.00 0.00 ? 555 ARG A C    3  
ATOM   1619  O  O    . ARG A 1 27 ? 9.751   0.776   1.973   1.00 0.00 ? 555 ARG A O    3  
ATOM   1620  C  CB   . ARG A 1 27 ? 10.569  -0.883  -0.750  1.00 0.00 ? 555 ARG A CB   3  
ATOM   1621  C  CG   . ARG A 1 27 ? 11.539  0.199   -1.202  1.00 0.00 ? 555 ARG A CG   3  
ATOM   1622  C  CD   . ARG A 1 27 ? 12.447  -0.299  -2.315  1.00 0.00 ? 555 ARG A CD   3  
ATOM   1623  N  NE   . ARG A 1 27 ? 13.520  0.647   -2.615  1.00 0.00 ? 555 ARG A NE   3  
ATOM   1624  C  CZ   . ARG A 1 27 ? 14.628  0.766   -1.887  1.00 0.00 ? 555 ARG A CZ   3  
ATOM   1625  N  NH1  . ARG A 1 27 ? 14.808  0.009   -0.811  1.00 0.00 ? 555 ARG A NH1  3  
ATOM   1626  N  NH2  . ARG A 1 27 ? 15.557  1.646   -2.234  1.00 0.00 ? 555 ARG A NH2  3  
ATOM   1627  H  H    . ARG A 1 27 ? 8.525   -0.168  -2.066  1.00 0.00 ? 555 ARG A H    3  
ATOM   1628  H  HA   . ARG A 1 27 ? 8.870   -1.116  0.535   1.00 0.00 ? 555 ARG A HA   3  
ATOM   1629  H  HB2  . ARG A 1 27 ? 11.079  -1.516  -0.040  1.00 0.00 ? 555 ARG A HB2  3  
ATOM   1630  H  HB3  . ARG A 1 27 ? 10.298  -1.473  -1.613  1.00 0.00 ? 555 ARG A HB3  3  
ATOM   1631  H  HG2  . ARG A 1 27 ? 10.977  1.046   -1.562  1.00 0.00 ? 555 ARG A HG2  3  
ATOM   1632  H  HG3  . ARG A 1 27 ? 12.146  0.498   -0.360  1.00 0.00 ? 555 ARG A HG3  3  
ATOM   1633  H  HD2  . ARG A 1 27 ? 12.885  -1.239  -2.012  1.00 0.00 ? 555 ARG A HD2  3  
ATOM   1634  H  HD3  . ARG A 1 27 ? 11.854  -0.451  -3.205  1.00 0.00 ? 555 ARG A HD3  3  
ATOM   1635  H  HE   . ARG A 1 27 ? 13.410  1.221   -3.401  1.00 0.00 ? 555 ARG A HE   3  
ATOM   1636  H  HH11 . ARG A 1 27 ? 14.111  -0.655  -0.543  1.00 0.00 ? 555 ARG A HH11 3  
ATOM   1637  H  HH12 . ARG A 1 27 ? 15.643  0.104   -0.269  1.00 0.00 ? 555 ARG A HH12 3  
ATOM   1638  H  HH21 . ARG A 1 27 ? 15.425  2.219   -3.043  1.00 0.00 ? 555 ARG A HH21 3  
ATOM   1639  H  HH22 . ARG A 1 27 ? 16.389  1.736   -1.688  1.00 0.00 ? 555 ARG A HH22 3  
ATOM   1640  N  N    . ALA A 1 28 ? 9.658   2.042   0.115   1.00 0.00 ? 556 ALA A N    3  
ATOM   1641  C  CA   . ALA A 1 28 ? 9.937   3.286   0.816   1.00 0.00 ? 556 ALA A CA   3  
ATOM   1642  C  C    . ALA A 1 28 ? 8.713   3.762   1.589   1.00 0.00 ? 556 ALA A C    3  
ATOM   1643  O  O    . ALA A 1 28 ? 8.833   4.341   2.668   1.00 0.00 ? 556 ALA A O    3  
ATOM   1644  C  CB   . ALA A 1 28 ? 10.393  4.354   -0.166  1.00 0.00 ? 556 ALA A CB   3  
ATOM   1645  H  H    . ALA A 1 28 ? 9.518   2.063   -0.851  1.00 0.00 ? 556 ALA A H    3  
ATOM   1646  H  HA   . ALA A 1 28 ? 10.741  3.100   1.509   1.00 0.00 ? 556 ALA A HA   3  
ATOM   1647  H  HB1  . ALA A 1 28 ? 11.088  5.020   0.324   1.00 0.00 ? 556 ALA A HB1  3  
ATOM   1648  H  HB2  . ALA A 1 28 ? 9.537   4.916   -0.509  1.00 0.00 ? 556 ALA A HB2  3  
ATOM   1649  H  HB3  . ALA A 1 28 ? 10.878  3.885   -1.009  1.00 0.00 ? 556 ALA A HB3  3  
ATOM   1650  N  N    . HIS A 1 29 ? 7.536   3.514   1.027   1.00 0.00 ? 557 HIS A N    3  
ATOM   1651  C  CA   . HIS A 1 29 ? 6.289   3.916   1.658   1.00 0.00 ? 557 HIS A CA   3  
ATOM   1652  C  C    . HIS A 1 29 ? 5.942   2.987   2.819   1.00 0.00 ? 557 HIS A C    3  
ATOM   1653  O  O    . HIS A 1 29 ? 5.350   3.413   3.810   1.00 0.00 ? 557 HIS A O    3  
ATOM   1654  C  CB   . HIS A 1 29 ? 5.153   3.923   0.630   1.00 0.00 ? 557 HIS A CB   3  
ATOM   1655  C  CG   . HIS A 1 29 ? 3.804   4.172   1.229   1.00 0.00 ? 557 HIS A CG   3  
ATOM   1656  N  ND1  . HIS A 1 29 ? 3.583   5.013   2.297   1.00 0.00 ? 557 HIS A ND1  3  
ATOM   1657  C  CD2  . HIS A 1 29 ? 2.591   3.662   0.897   1.00 0.00 ? 557 HIS A CD2  3  
ATOM   1658  C  CE1  . HIS A 1 29 ? 2.273   4.986   2.577   1.00 0.00 ? 557 HIS A CE1  3  
ATOM   1659  N  NE2  . HIS A 1 29 ? 1.627   4.181   1.756   1.00 0.00 ? 557 HIS A NE2  3  
ATOM   1660  H  H    . HIS A 1 29 ? 7.505   3.053   0.167   1.00 0.00 ? 557 HIS A H    3  
ATOM   1661  H  HA   . HIS A 1 29 ? 6.423   4.914   2.038   1.00 0.00 ? 557 HIS A HA   3  
ATOM   1662  H  HB2  . HIS A 1 29 ? 5.341   4.697   -0.098  1.00 0.00 ? 557 HIS A HB2  3  
ATOM   1663  H  HB3  . HIS A 1 29 ? 5.124   2.965   0.130   1.00 0.00 ? 557 HIS A HB3  3  
ATOM   1664  H  HD1  . HIS A 1 29 ? 4.263   5.537   2.769   1.00 0.00 ? 557 HIS A HD1  3  
ATOM   1665  H  HD2  . HIS A 1 29 ? 2.394   2.964   0.096   1.00 0.00 ? 557 HIS A HD2  3  
ATOM   1666  H  HE1  . HIS A 1 29 ? 1.807   5.550   3.371   1.00 0.00 ? 557 HIS A HE1  3  
ATOM   1667  N  N    . LEU A 1 30 ? 6.311   1.716   2.688   1.00 0.00 ? 558 LEU A N    3  
ATOM   1668  C  CA   . LEU A 1 30 ? 6.032   0.732   3.727   1.00 0.00 ? 558 LEU A CA   3  
ATOM   1669  C  C    . LEU A 1 30 ? 6.786   1.064   5.011   1.00 0.00 ? 558 LEU A C    3  
ATOM   1670  O  O    . LEU A 1 30 ? 6.224   1.005   6.105   1.00 0.00 ? 558 LEU A O    3  
ATOM   1671  C  CB   . LEU A 1 30 ? 6.408   -0.672  3.246   1.00 0.00 ? 558 LEU A CB   3  
ATOM   1672  C  CG   . LEU A 1 30 ? 5.373   -1.759  3.552   1.00 0.00 ? 558 LEU A CG   3  
ATOM   1673  C  CD1  . LEU A 1 30 ? 4.620   -2.152  2.290   1.00 0.00 ? 558 LEU A CD1  3  
ATOM   1674  C  CD2  . LEU A 1 30 ? 6.043   -2.975  4.175   1.00 0.00 ? 558 LEU A CD2  3  
ATOM   1675  H  H    . LEU A 1 30 ? 6.778   1.434   1.874   1.00 0.00 ? 558 LEU A H    3  
ATOM   1676  H  HA   . LEU A 1 30 ? 4.972   0.761   3.929   1.00 0.00 ? 558 LEU A HA   3  
ATOM   1677  H  HB2  . LEU A 1 30 ? 6.557   -0.635  2.177   1.00 0.00 ? 558 LEU A HB2  3  
ATOM   1678  H  HB3  . LEU A 1 30 ? 7.341   -0.952  3.712   1.00 0.00 ? 558 LEU A HB3  3  
ATOM   1679  H  HG   . LEU A 1 30 ? 4.655   -1.372  4.261   1.00 0.00 ? 558 LEU A HG   3  
ATOM   1680  H  HD11 . LEU A 1 30 ? 3.714   -2.673  2.559   1.00 0.00 ? 558 LEU A HD11 3  
ATOM   1681  H  HD12 . LEU A 1 30 ? 5.242   -2.797  1.687   1.00 0.00 ? 558 LEU A HD12 3  
ATOM   1682  H  HD13 . LEU A 1 30 ? 4.372   -1.264  1.728   1.00 0.00 ? 558 LEU A HD13 3  
ATOM   1683  H  HD21 . LEU A 1 30 ? 5.363   -3.443  4.872   1.00 0.00 ? 558 LEU A HD21 3  
ATOM   1684  H  HD22 . LEU A 1 30 ? 6.936   -2.666  4.697   1.00 0.00 ? 558 LEU A HD22 3  
ATOM   1685  H  HD23 . LEU A 1 30 ? 6.304   -3.679  3.400   1.00 0.00 ? 558 LEU A HD23 3  
ATOM   1686  N  N    . ARG A 1 31 ? 8.061   1.411   4.871   1.00 0.00 ? 559 ARG A N    3  
ATOM   1687  C  CA   . ARG A 1 31 ? 8.891   1.751   6.021   1.00 0.00 ? 559 ARG A CA   3  
ATOM   1688  C  C    . ARG A 1 31 ? 8.303   2.932   6.788   1.00 0.00 ? 559 ARG A C    3  
ATOM   1689  O  O    . ARG A 1 31 ? 8.474   3.043   8.002   1.00 0.00 ? 559 ARG A O    3  
ATOM   1690  C  CB   . ARG A 1 31 ? 10.318  2.075   5.571   1.00 0.00 ? 559 ARG A CB   3  
ATOM   1691  C  CG   . ARG A 1 31 ? 10.408  3.269   4.637   1.00 0.00 ? 559 ARG A CG   3  
ATOM   1692  C  CD   . ARG A 1 31 ? 11.753  3.968   4.756   1.00 0.00 ? 559 ARG A CD   3  
ATOM   1693  N  NE   . ARG A 1 31 ? 12.081  4.733   3.555   1.00 0.00 ? 559 ARG A NE   3  
ATOM   1694  C  CZ   . ARG A 1 31 ? 11.598  5.945   3.292   1.00 0.00 ? 559 ARG A CZ   3  
ATOM   1695  N  NH1  . ARG A 1 31 ? 10.761  6.531   4.139   1.00 0.00 ? 559 ARG A NH1  3  
ATOM   1696  N  NH2  . ARG A 1 31 ? 11.952  6.572   2.179   1.00 0.00 ? 559 ARG A NH2  3  
ATOM   1697  H  H    . ARG A 1 31 ? 8.454   1.439   3.973   1.00 0.00 ? 559 ARG A H    3  
ATOM   1698  H  HA   . ARG A 1 31 ? 8.917   0.892   6.674   1.00 0.00 ? 559 ARG A HA   3  
ATOM   1699  H  HB2  . ARG A 1 31 ? 10.919  2.282   6.444   1.00 0.00 ? 559 ARG A HB2  3  
ATOM   1700  H  HB3  . ARG A 1 31 ? 10.725  1.214   5.061   1.00 0.00 ? 559 ARG A HB3  3  
ATOM   1701  H  HG2  . ARG A 1 31 ? 10.279  2.929   3.620   1.00 0.00 ? 559 ARG A HG2  3  
ATOM   1702  H  HG3  . ARG A 1 31 ? 9.624   3.970   4.887   1.00 0.00 ? 559 ARG A HG3  3  
ATOM   1703  H  HD2  . ARG A 1 31 ? 11.722  4.639   5.601   1.00 0.00 ? 559 ARG A HD2  3  
ATOM   1704  H  HD3  . ARG A 1 31 ? 12.517  3.222   4.917   1.00 0.00 ? 559 ARG A HD3  3  
ATOM   1705  H  HE   . ARG A 1 31 ? 12.696  4.322   2.912   1.00 0.00 ? 559 ARG A HE   3  
ATOM   1706  H  HH11 . ARG A 1 31 ? 10.489  6.064   4.980   1.00 0.00 ? 559 ARG A HH11 3  
ATOM   1707  H  HH12 . ARG A 1 31 ? 10.402  7.442   3.935   1.00 0.00 ? 559 ARG A HH12 3  
ATOM   1708  H  HH21 . ARG A 1 31 ? 12.582  6.134   1.537   1.00 0.00 ? 559 ARG A HH21 3  
ATOM   1709  H  HH22 . ARG A 1 31 ? 11.589  7.482   1.981   1.00 0.00 ? 559 ARG A HH22 3  
ATOM   1710  N  N    . TRP A 1 32 ? 7.609   3.811   6.073   1.00 0.00 ? 560 TRP A N    3  
ATOM   1711  C  CA   . TRP A 1 32 ? 6.995   4.982   6.688   1.00 0.00 ? 560 TRP A CA   3  
ATOM   1712  C  C    . TRP A 1 32 ? 5.846   4.574   7.604   1.00 0.00 ? 560 TRP A C    3  
ATOM   1713  O  O    . TRP A 1 32 ? 5.678   5.129   8.690   1.00 0.00 ? 560 TRP A O    3  
ATOM   1714  C  CB   . TRP A 1 32 ? 6.488   5.943   5.610   1.00 0.00 ? 560 TRP A CB   3  
ATOM   1715  C  CG   . TRP A 1 32 ? 6.804   7.379   5.899   1.00 0.00 ? 560 TRP A CG   3  
ATOM   1716  C  CD1  . TRP A 1 32 ? 7.823   8.117   5.369   1.00 0.00 ? 560 TRP A CD1  3  
ATOM   1717  C  CD2  . TRP A 1 32 ? 6.097   8.250   6.788   1.00 0.00 ? 560 TRP A CD2  3  
ATOM   1718  N  NE1  . TRP A 1 32 ? 7.792   9.394   5.874   1.00 0.00 ? 560 TRP A NE1  3  
ATOM   1719  C  CE2  . TRP A 1 32 ? 6.742   9.501   6.747   1.00 0.00 ? 560 TRP A CE2  3  
ATOM   1720  C  CE3  . TRP A 1 32 ? 4.980   8.095   7.615   1.00 0.00 ? 560 TRP A CE3  3  
ATOM   1721  C  CZ2  . TRP A 1 32 ? 6.307   10.589  7.501   1.00 0.00 ? 560 TRP A CZ2  3  
ATOM   1722  C  CZ3  . TRP A 1 32 ? 4.550   9.175   8.363   1.00 0.00 ? 560 TRP A CZ3  3  
ATOM   1723  C  CH2  . TRP A 1 32 ? 5.211   10.408  8.301   1.00 0.00 ? 560 TRP A CH2  3  
ATOM   1724  H  H    . TRP A 1 32 ? 7.506   3.668   5.109   1.00 0.00 ? 560 TRP A H    3  
ATOM   1725  H  HA   . TRP A 1 32 ? 7.750   5.481   7.277   1.00 0.00 ? 560 TRP A HA   3  
ATOM   1726  H  HB2  . TRP A 1 32 ? 6.944   5.686   4.665   1.00 0.00 ? 560 TRP A HB2  3  
ATOM   1727  H  HB3  . TRP A 1 32 ? 5.416   5.847   5.525   1.00 0.00 ? 560 TRP A HB3  3  
ATOM   1728  H  HD1  . TRP A 1 32 ? 8.541   7.739   4.657   1.00 0.00 ? 560 TRP A HD1  3  
ATOM   1729  H  HE1  . TRP A 1 32 ? 8.419   10.112  5.645   1.00 0.00 ? 560 TRP A HE1  3  
ATOM   1730  H  HE3  . TRP A 1 32 ? 4.457   7.152   7.676   1.00 0.00 ? 560 TRP A HE3  3  
ATOM   1731  H  HZ2  . TRP A 1 32 ? 6.805   11.546  7.464   1.00 0.00 ? 560 TRP A HZ2  3  
ATOM   1732  H  HZ3  . TRP A 1 32 ? 3.689   9.074   9.007   1.00 0.00 ? 560 TRP A HZ3  3  
ATOM   1733  H  HH2  . TRP A 1 32 ? 4.840   11.224  8.903   1.00 0.00 ? 560 TRP A HH2  3  
ATOM   1734  N  N    . HIS A 1 33 ? 5.059   3.600   7.159   1.00 0.00 ? 561 HIS A N    3  
ATOM   1735  C  CA   . HIS A 1 33 ? 3.925   3.117   7.939   1.00 0.00 ? 561 HIS A CA   3  
ATOM   1736  C  C    . HIS A 1 33 ? 4.394   2.476   9.241   1.00 0.00 ? 561 HIS A C    3  
ATOM   1737  O  O    . HIS A 1 33 ? 3.820   2.712   10.303  1.00 0.00 ? 561 HIS A O    3  
ATOM   1738  C  CB   . HIS A 1 33 ? 3.113   2.108   7.125   1.00 0.00 ? 561 HIS A CB   3  
ATOM   1739  C  CG   . HIS A 1 33 ? 2.073   2.742   6.253   1.00 0.00 ? 561 HIS A CG   3  
ATOM   1740  N  ND1  . HIS A 1 33 ? 0.974   3.417   6.736   1.00 0.00 ? 561 HIS A ND1  3  
ATOM   1741  C  CD2  . HIS A 1 33 ? 1.981   2.795   4.900   1.00 0.00 ? 561 HIS A CD2  3  
ATOM   1742  C  CE1  . HIS A 1 33 ? 0.262   3.848   5.685   1.00 0.00 ? 561 HIS A CE1  3  
ATOM   1743  N  NE2  . HIS A 1 33 ? 0.831   3.497   4.548   1.00 0.00 ? 561 HIS A NE2  3  
ATOM   1744  H  H    . HIS A 1 33 ? 5.244   3.197   6.286   1.00 0.00 ? 561 HIS A H    3  
ATOM   1745  H  HA   . HIS A 1 33 ? 3.299   3.964   8.174   1.00 0.00 ? 561 HIS A HA   3  
ATOM   1746  H  HB2  . HIS A 1 33 ? 3.781   1.547   6.489   1.00 0.00 ? 561 HIS A HB2  3  
ATOM   1747  H  HB3  . HIS A 1 33 ? 2.613   1.430   7.801   1.00 0.00 ? 561 HIS A HB3  3  
ATOM   1748  H  HD1  . HIS A 1 33 ? 0.751   3.556   7.680   1.00 0.00 ? 561 HIS A HD1  3  
ATOM   1749  H  HD2  . HIS A 1 33 ? 2.682   2.366   4.199   1.00 0.00 ? 561 HIS A HD2  3  
ATOM   1750  H  HE1  . HIS A 1 33 ? -0.656  4.411   5.760   1.00 0.00 ? 561 HIS A HE1  3  
ATOM   1751  N  N    . THR A 1 34 ? 5.442   1.663   9.151   1.00 0.00 ? 562 THR A N    3  
ATOM   1752  C  CA   . THR A 1 34 ? 5.989   0.988   10.322  1.00 0.00 ? 562 THR A CA   3  
ATOM   1753  C  C    . THR A 1 34 ? 7.089   1.824   10.967  1.00 0.00 ? 562 THR A C    3  
ATOM   1754  O  O    . THR A 1 34 ? 8.141   2.052   10.370  1.00 0.00 ? 562 THR A O    3  
ATOM   1755  C  CB   . THR A 1 34 ? 6.537   -0.386  9.934   1.00 0.00 ? 562 THR A CB   3  
ATOM   1756  O  OG1  . THR A 1 34 ? 7.163   -0.337  8.664   1.00 0.00 ? 562 THR A OG1  3  
ATOM   1757  C  CG2  . THR A 1 34 ? 5.473   -1.462  9.880   1.00 0.00 ? 562 THR A CG2  3  
ATOM   1758  H  H    . THR A 1 34 ? 5.858   1.514   8.276   1.00 0.00 ? 562 THR A H    3  
ATOM   1759  H  HA   . THR A 1 34 ? 5.187   0.858   11.033  1.00 0.00 ? 562 THR A HA   3  
ATOM   1760  H  HB   . THR A 1 34 ? 7.275   -0.687  10.665  1.00 0.00 ? 562 THR A HB   3  
ATOM   1761  H  HG1  . THR A 1 34 ? 8.068   -0.033  8.765   1.00 0.00 ? 562 THR A HG1  3  
ATOM   1762  H  HG21 . THR A 1 34 ? 4.593   -1.124  10.406  1.00 0.00 ? 562 THR A HG21 3  
ATOM   1763  H  HG22 . THR A 1 34 ? 5.847   -2.362  10.345  1.00 0.00 ? 562 THR A HG22 3  
ATOM   1764  H  HG23 . THR A 1 34 ? 5.221   -1.667  8.851   1.00 0.00 ? 562 THR A HG23 3  
ATOM   1765  N  N    . GLY A 1 35 ? 6.838   2.280   12.190  1.00 0.00 ? 563 GLY A N    3  
ATOM   1766  C  CA   . GLY A 1 35 ? 7.815   3.087   12.897  1.00 0.00 ? 563 GLY A CA   3  
ATOM   1767  C  C    . GLY A 1 35 ? 7.339   4.508   13.123  1.00 0.00 ? 563 GLY A C    3  
ATOM   1768  O  O    . GLY A 1 35 ? 8.127   5.452   13.061  1.00 0.00 ? 563 GLY A O    3  
ATOM   1769  H  H    . GLY A 1 35 ? 5.981   2.067   12.616  1.00 0.00 ? 563 GLY A H    3  
ATOM   1770  H  HA2  . GLY A 1 35 ? 8.018   2.631   13.855  1.00 0.00 ? 563 GLY A HA2  3  
ATOM   1771  H  HA3  . GLY A 1 35 ? 8.729   3.113   12.322  1.00 0.00 ? 563 GLY A HA3  3  
ATOM   1772  N  N    . GLU A 1 36 ? 6.045   4.661   13.385  1.00 0.00 ? 564 GLU A N    3  
ATOM   1773  C  CA   . GLU A 1 36 ? 5.463   5.978   13.620  1.00 0.00 ? 564 GLU A CA   3  
ATOM   1774  C  C    . GLU A 1 36 ? 4.325   5.896   14.633  1.00 0.00 ? 564 GLU A C    3  
ATOM   1775  O  O    . GLU A 1 36 ? 4.269   6.678   15.582  1.00 0.00 ? 564 GLU A O    3  
ATOM   1776  C  CB   . GLU A 1 36 ? 4.951   6.574   12.308  1.00 0.00 ? 564 GLU A CB   3  
ATOM   1777  C  CG   . GLU A 1 36 ? 4.088   5.617   11.500  1.00 0.00 ? 564 GLU A CG   3  
ATOM   1778  C  CD   . GLU A 1 36 ? 2.606   5.816   11.749  1.00 0.00 ? 564 GLU A CD   3  
ATOM   1779  O  OE1  . GLU A 1 36 ? 2.221   6.919   12.192  1.00 0.00 ? 564 GLU A OE1  3  
ATOM   1780  O  OE2  . GLU A 1 36 ? 1.830   4.870   11.501  1.00 0.00 ? 564 GLU A OE2  3  
ATOM   1781  H  H    . GLU A 1 36 ? 5.467   3.870   13.421  1.00 0.00 ? 564 GLU A H    3  
ATOM   1782  H  HA   . GLU A 1 36 ? 6.237   6.616   14.017  1.00 0.00 ? 564 GLU A HA   3  
ATOM   1783  H  HB2  . GLU A 1 36 ? 4.365   7.453   12.529  1.00 0.00 ? 564 GLU A HB2  3  
ATOM   1784  H  HB3  . GLU A 1 36 ? 5.798   6.859   11.701  1.00 0.00 ? 564 GLU A HB3  3  
ATOM   1785  H  HG2  . GLU A 1 36 ? 4.285   5.774   10.450  1.00 0.00 ? 564 GLU A HG2  3  
ATOM   1786  H  HG3  . GLU A 1 36 ? 4.350   4.604   11.767  1.00 0.00 ? 564 GLU A HG3  3  
ATOM   1787  N  N    . ARG A 1 37 ? 3.421   4.945   14.424  1.00 0.00 ? 565 ARG A N    3  
ATOM   1788  C  CA   . ARG A 1 37 ? 2.284   4.761   15.320  1.00 0.00 ? 565 ARG A CA   3  
ATOM   1789  C  C    . ARG A 1 37 ? 2.115   3.291   15.688  1.00 0.00 ? 565 ARG A C    3  
ATOM   1790  O  O    . ARG A 1 37 ? 3.092   2.527   15.538  1.00 0.00 ? 565 ARG A O    3  
ATOM   1791  C  CB   . ARG A 1 37 ? 1.004   5.286   14.667  1.00 0.00 ? 565 ARG A CB   3  
ATOM   1792  C  CG   . ARG A 1 37 ? 0.745   6.760   14.934  1.00 0.00 ? 565 ARG A CG   3  
ATOM   1793  C  CD   . ARG A 1 37 ? -0.275  6.956   16.044  1.00 0.00 ? 565 ARG A CD   3  
ATOM   1794  N  NE   . ARG A 1 37 ? -0.226  8.305   16.601  1.00 0.00 ? 565 ARG A NE   3  
ATOM   1795  C  CZ   . ARG A 1 37 ? -1.211  8.850   17.311  1.00 0.00 ? 565 ARG A CZ   3  
ATOM   1796  N  NH1  . ARG A 1 37 ? -2.322  8.165   17.553  1.00 0.00 ? 565 ARG A NH1  3  
ATOM   1797  N  NH2  . ARG A 1 37 ? -1.085  10.083  17.782  1.00 0.00 ? 565 ARG A NH2  3  
ATOM   1798  O  OXT  . ARG A 1 37 ? 1.006   2.915   16.125  1.00 0.00 ? 565 ARG A OXT  3  
ATOM   1799  H  H    . ARG A 1 37 ? 3.520   4.352   13.650  1.00 0.00 ? 565 ARG A H    3  
ATOM   1800  H  HA   . ARG A 1 37 ? 2.477   5.326   16.219  1.00 0.00 ? 565 ARG A HA   3  
ATOM   1801  H  HB2  . ARG A 1 37 ? 1.073   5.143   13.599  1.00 0.00 ? 565 ARG A HB2  3  
ATOM   1802  H  HB3  . ARG A 1 37 ? 0.164   4.721   15.043  1.00 0.00 ? 565 ARG A HB3  3  
ATOM   1803  H  HG2  . ARG A 1 37 ? 1.672   7.232   15.224  1.00 0.00 ? 565 ARG A HG2  3  
ATOM   1804  H  HG3  . ARG A 1 37 ? 0.373   7.219   14.030  1.00 0.00 ? 565 ARG A HG3  3  
ATOM   1805  H  HD2  . ARG A 1 37 ? -1.262  6.777   15.644  1.00 0.00 ? 565 ARG A HD2  3  
ATOM   1806  H  HD3  . ARG A 1 37 ? -0.072  6.244   16.831  1.00 0.00 ? 565 ARG A HD3  3  
ATOM   1807  H  HE   . ARG A 1 37 ? 0.583   8.834   16.437  1.00 0.00 ? 565 ARG A HE   3  
ATOM   1808  H  HH11 . ARG A 1 37 ? -2.423  7.235   17.202  1.00 0.00 ? 565 ARG A HH11 3  
ATOM   1809  H  HH12 . ARG A 1 37 ? -3.058  8.580   18.088  1.00 0.00 ? 565 ARG A HH12 3  
ATOM   1810  H  HH21 . ARG A 1 37 ? -0.250  10.604  17.603  1.00 0.00 ? 565 ARG A HH21 3  
ATOM   1811  H  HH22 . ARG A 1 37 ? -1.825  10.493  18.315  1.00 0.00 ? 565 ARG A HH22 3  
HETATM 1812  ZN ZN   . ZN  B 2 .  ? -0.058  4.177   2.865   1.00 0.00 ? 100 ZN  A ZN   3  
ATOM   1813  N  N    . MET A 1 1  ? -18.377 -8.876  -6.008  1.00 0.00 ? 1   MET A N    4  
ATOM   1814  C  CA   . MET A 1 1  ? -19.133 -7.908  -6.845  1.00 0.00 ? 1   MET A CA   4  
ATOM   1815  C  C    . MET A 1 1  ? -18.771 -8.053  -8.320  1.00 0.00 ? 1   MET A C    4  
ATOM   1816  O  O    . MET A 1 1  ? -19.598 -7.814  -9.199  1.00 0.00 ? 1   MET A O    4  
ATOM   1817  C  CB   . MET A 1 1  ? -18.816 -6.492  -6.360  1.00 0.00 ? 1   MET A CB   4  
ATOM   1818  C  CG   . MET A 1 1  ? -17.359 -6.099  -6.542  1.00 0.00 ? 1   MET A CG   4  
ATOM   1819  S  SD   . MET A 1 1  ? -17.088 -4.327  -6.352  1.00 0.00 ? 1   MET A SD   4  
ATOM   1820  C  CE   . MET A 1 1  ? -15.317 -4.280  -6.093  1.00 0.00 ? 1   MET A CE   4  
ATOM   1821  H  H1   . MET A 1 1  ? -18.856 -8.939  -5.087  1.00 0.00 ? 1   MET A H1   4  
ATOM   1822  H  H2   . MET A 1 1  ? -17.407 -8.514  -5.903  1.00 0.00 ? 1   MET A H2   4  
ATOM   1823  H  H3   . MET A 1 1  ? -18.385 -9.793  -6.497  1.00 0.00 ? 1   MET A H3   4  
ATOM   1824  H  HA   . MET A 1 1  ? -20.189 -8.098  -6.721  1.00 0.00 ? 1   MET A HA   4  
ATOM   1825  H  HB2  . MET A 1 1  ? -19.426 -5.790  -6.909  1.00 0.00 ? 1   MET A HB2  4  
ATOM   1826  H  HB3  . MET A 1 1  ? -19.057 -6.421  -5.310  1.00 0.00 ? 1   MET A HB3  4  
ATOM   1827  H  HG2  . MET A 1 1  ? -16.765 -6.620  -5.805  1.00 0.00 ? 1   MET A HG2  4  
ATOM   1828  H  HG3  . MET A 1 1  ? -17.041 -6.394  -7.531  1.00 0.00 ? 1   MET A HG3  4  
ATOM   1829  H  HE1  . MET A 1 1  ? -15.105 -4.351  -5.037  1.00 0.00 ? 1   MET A HE1  4  
ATOM   1830  H  HE2  . MET A 1 1  ? -14.921 -3.352  -6.479  1.00 0.00 ? 1   MET A HE2  4  
ATOM   1831  H  HE3  . MET A 1 1  ? -14.856 -5.110  -6.609  1.00 0.00 ? 1   MET A HE3  4  
ATOM   1832  N  N    . ASP A 1 2  ? -17.529 -8.447  -8.582  1.00 0.00 ? 530 ASP A N    4  
ATOM   1833  C  CA   . ASP A 1 2  ? -17.056 -8.624  -9.950  1.00 0.00 ? 530 ASP A CA   4  
ATOM   1834  C  C    . ASP A 1 2  ? -16.113 -9.823  -10.049 1.00 0.00 ? 530 ASP A C    4  
ATOM   1835  O  O    . ASP A 1 2  ? -15.009 -9.797  -9.507  1.00 0.00 ? 530 ASP A O    4  
ATOM   1836  C  CB   . ASP A 1 2  ? -16.342 -7.359  -10.431 1.00 0.00 ? 530 ASP A CB   4  
ATOM   1837  C  CG   . ASP A 1 2  ? -17.269 -6.421  -11.179 1.00 0.00 ? 530 ASP A CG   4  
ATOM   1838  O  OD1  . ASP A 1 2  ? -18.082 -6.911  -11.990 1.00 0.00 ? 530 ASP A OD1  4  
ATOM   1839  O  OD2  . ASP A 1 2  ? -17.181 -5.195  -10.953 1.00 0.00 ? 530 ASP A OD2  4  
ATOM   1840  H  H    . ASP A 1 2  ? -16.916 -8.622  -7.838  1.00 0.00 ? 530 ASP A H    4  
ATOM   1841  H  HA   . ASP A 1 2  ? -17.917 -8.799  -10.577 1.00 0.00 ? 530 ASP A HA   4  
ATOM   1842  H  HB2  . ASP A 1 2  ? -15.940 -6.833  -9.577  1.00 0.00 ? 530 ASP A HB2  4  
ATOM   1843  H  HB3  . ASP A 1 2  ? -15.533 -7.638  -11.090 1.00 0.00 ? 530 ASP A HB3  4  
ATOM   1844  N  N    . PRO A 1 3  ? -16.534 -10.896 -10.745 1.00 0.00 ? 531 PRO A N    4  
ATOM   1845  C  CA   . PRO A 1 3  ? -15.714 -12.102 -10.906 1.00 0.00 ? 531 PRO A CA   4  
ATOM   1846  C  C    . PRO A 1 3  ? -14.306 -11.784 -11.398 1.00 0.00 ? 531 PRO A C    4  
ATOM   1847  O  O    . PRO A 1 3  ? -14.085 -11.585 -12.593 1.00 0.00 ? 531 PRO A O    4  
ATOM   1848  C  CB   . PRO A 1 3  ? -16.477 -12.913 -11.955 1.00 0.00 ? 531 PRO A CB   4  
ATOM   1849  C  CG   . PRO A 1 3  ? -17.892 -12.472 -11.816 1.00 0.00 ? 531 PRO A CG   4  
ATOM   1850  C  CD   . PRO A 1 3  ? -17.837 -11.020 -11.428 1.00 0.00 ? 531 PRO A CD   4  
ATOM   1851  H  HA   . PRO A 1 3  ? -15.654 -12.664 -9.986  1.00 0.00 ? 531 PRO A HA   4  
ATOM   1852  H  HB2  . PRO A 1 3  ? -16.087 -12.693 -12.938 1.00 0.00 ? 531 PRO A HB2  4  
ATOM   1853  H  HB3  . PRO A 1 3  ? -16.371 -13.967 -11.747 1.00 0.00 ? 531 PRO A HB3  4  
ATOM   1854  H  HG2  . PRO A 1 3  ? -18.408 -12.590 -12.758 1.00 0.00 ? 531 PRO A HG2  4  
ATOM   1855  H  HG3  . PRO A 1 3  ? -18.382 -13.048 -11.045 1.00 0.00 ? 531 PRO A HG3  4  
ATOM   1856  H  HD2  . PRO A 1 3  ? -17.873 -10.393 -12.307 1.00 0.00 ? 531 PRO A HD2  4  
ATOM   1857  H  HD3  . PRO A 1 3  ? -18.648 -10.778 -10.757 1.00 0.00 ? 531 PRO A HD3  4  
ATOM   1858  N  N    . GLY A 1 4  ? -13.358 -11.738 -10.468 1.00 0.00 ? 532 GLY A N    4  
ATOM   1859  C  CA   . GLY A 1 4  ? -11.982 -11.443 -10.825 1.00 0.00 ? 532 GLY A CA   4  
ATOM   1860  C  C    . GLY A 1 4  ? -11.152 -11.026 -9.627  1.00 0.00 ? 532 GLY A C    4  
ATOM   1861  O  O    . GLY A 1 4  ? -11.622 -11.075 -8.491  1.00 0.00 ? 532 GLY A O    4  
ATOM   1862  H  H    . GLY A 1 4  ? -13.594 -11.905 -9.532  1.00 0.00 ? 532 GLY A H    4  
ATOM   1863  H  HA2  . GLY A 1 4  ? -11.540 -12.324 -11.267 1.00 0.00 ? 532 GLY A HA2  4  
ATOM   1864  H  HA3  . GLY A 1 4  ? -11.973 -10.644 -11.551 1.00 0.00 ? 532 GLY A HA3  4  
ATOM   1865  N  N    . LYS A 1 5  ? -9.913  -10.616 -9.881  1.00 0.00 ? 533 LYS A N    4  
ATOM   1866  C  CA   . LYS A 1 5  ? -9.017  -10.190 -8.812  1.00 0.00 ? 533 LYS A CA   4  
ATOM   1867  C  C    . LYS A 1 5  ? -8.358  -8.857  -9.152  1.00 0.00 ? 533 LYS A C    4  
ATOM   1868  O  O    . LYS A 1 5  ? -8.404  -8.404  -10.295 1.00 0.00 ? 533 LYS A O    4  
ATOM   1869  C  CB   . LYS A 1 5  ? -7.946  -11.253 -8.562  1.00 0.00 ? 533 LYS A CB   4  
ATOM   1870  C  CG   . LYS A 1 5  ? -7.102  -11.567 -9.787  1.00 0.00 ? 533 LYS A CG   4  
ATOM   1871  C  CD   . LYS A 1 5  ? -7.516  -12.883 -10.428 1.00 0.00 ? 533 LYS A CD   4  
ATOM   1872  C  CE   . LYS A 1 5  ? -6.354  -13.540 -11.156 1.00 0.00 ? 533 LYS A CE   4  
ATOM   1873  N  NZ   . LYS A 1 5  ? -5.828  -14.718 -10.413 1.00 0.00 ? 533 LYS A NZ   4  
ATOM   1874  H  H    . LYS A 1 5  ? -9.595  -10.600 -10.807 1.00 0.00 ? 533 LYS A H    4  
ATOM   1875  H  HA   . LYS A 1 5  ? -9.606  -10.068 -7.916  1.00 0.00 ? 533 LYS A HA   4  
ATOM   1876  H  HB2  . LYS A 1 5  ? -7.288  -10.906 -7.778  1.00 0.00 ? 533 LYS A HB2  4  
ATOM   1877  H  HB3  . LYS A 1 5  ? -8.428  -12.164 -8.239  1.00 0.00 ? 533 LYS A HB3  4  
ATOM   1878  H  HG2  . LYS A 1 5  ? -7.223  -10.773 -10.509 1.00 0.00 ? 533 LYS A HG2  4  
ATOM   1879  H  HG3  . LYS A 1 5  ? -6.065  -11.632 -9.491  1.00 0.00 ? 533 LYS A HG3  4  
ATOM   1880  H  HD2  . LYS A 1 5  ? -7.869  -13.552 -9.658  1.00 0.00 ? 533 LYS A HD2  4  
ATOM   1881  H  HD3  . LYS A 1 5  ? -8.311  -12.693 -11.134 1.00 0.00 ? 533 LYS A HD3  4  
ATOM   1882  H  HE2  . LYS A 1 5  ? -6.691  -13.862 -12.130 1.00 0.00 ? 533 LYS A HE2  4  
ATOM   1883  H  HE3  . LYS A 1 5  ? -5.561  -12.815 -11.272 1.00 0.00 ? 533 LYS A HE3  4  
ATOM   1884  H  HZ1  . LYS A 1 5  ? -5.362  -15.376 -11.070 1.00 0.00 ? 533 LYS A HZ1  4  
ATOM   1885  H  HZ2  . LYS A 1 5  ? -6.605  -15.216 -9.935  1.00 0.00 ? 533 LYS A HZ2  4  
ATOM   1886  H  HZ3  . LYS A 1 5  ? -5.137  -14.411 -9.698  1.00 0.00 ? 533 LYS A HZ3  4  
ATOM   1887  N  N    . LYS A 1 6  ? -7.745  -8.235  -8.150  1.00 0.00 ? 534 LYS A N    4  
ATOM   1888  C  CA   . LYS A 1 6  ? -7.075  -6.954  -8.341  1.00 0.00 ? 534 LYS A CA   4  
ATOM   1889  C  C    . LYS A 1 6  ? -5.697  -6.960  -7.687  1.00 0.00 ? 534 LYS A C    4  
ATOM   1890  O  O    . LYS A 1 6  ? -5.529  -7.458  -6.574  1.00 0.00 ? 534 LYS A O    4  
ATOM   1891  C  CB   . LYS A 1 6  ? -7.922  -5.820  -7.763  1.00 0.00 ? 534 LYS A CB   4  
ATOM   1892  C  CG   . LYS A 1 6  ? -9.137  -5.475  -8.609  1.00 0.00 ? 534 LYS A CG   4  
ATOM   1893  C  CD   . LYS A 1 6  ? -8.805  -4.425  -9.657  1.00 0.00 ? 534 LYS A CD   4  
ATOM   1894  C  CE   . LYS A 1 6  ? -8.349  -5.060  -10.962 1.00 0.00 ? 534 LYS A CE   4  
ATOM   1895  N  NZ   . LYS A 1 6  ? -9.346  -4.868  -12.051 1.00 0.00 ? 534 LYS A NZ   4  
ATOM   1896  H  H    . LYS A 1 6  ? -7.743  -8.648  -7.261  1.00 0.00 ? 534 LYS A H    4  
ATOM   1897  H  HA   . LYS A 1 6  ? -6.955  -6.798  -9.402  1.00 0.00 ? 534 LYS A HA   4  
ATOM   1898  H  HB2  . LYS A 1 6  ? -8.265  -6.107  -6.780  1.00 0.00 ? 534 LYS A HB2  4  
ATOM   1899  H  HB3  . LYS A 1 6  ? -7.308  -4.936  -7.676  1.00 0.00 ? 534 LYS A HB3  4  
ATOM   1900  H  HG2  . LYS A 1 6  ? -9.482  -6.369  -9.107  1.00 0.00 ? 534 LYS A HG2  4  
ATOM   1901  H  HG3  . LYS A 1 6  ? -9.916  -5.095  -7.965  1.00 0.00 ? 534 LYS A HG3  4  
ATOM   1902  H  HD2  . LYS A 1 6  ? -9.686  -3.830  -9.848  1.00 0.00 ? 534 LYS A HD2  4  
ATOM   1903  H  HD3  . LYS A 1 6  ? -8.015  -3.792  -9.280  1.00 0.00 ? 534 LYS A HD3  4  
ATOM   1904  H  HE2  . LYS A 1 6  ? -7.414  -4.610  -11.259 1.00 0.00 ? 534 LYS A HE2  4  
ATOM   1905  H  HE3  . LYS A 1 6  ? -8.203  -6.118  -10.802 1.00 0.00 ? 534 LYS A HE3  4  
ATOM   1906  H  HZ1  . LYS A 1 6  ? -10.306 -5.052  -11.694 1.00 0.00 ? 534 LYS A HZ1  4  
ATOM   1907  H  HZ2  . LYS A 1 6  ? -9.149  -5.521  -12.835 1.00 0.00 ? 534 LYS A HZ2  4  
ATOM   1908  H  HZ3  . LYS A 1 6  ? -9.301  -3.892  -12.408 1.00 0.00 ? 534 LYS A HZ3  4  
ATOM   1909  N  N    . LYS A 1 7  ? -4.714  -6.402  -8.385  1.00 0.00 ? 535 LYS A N    4  
ATOM   1910  C  CA   . LYS A 1 7  ? -3.350  -6.344  -7.871  1.00 0.00 ? 535 LYS A CA   4  
ATOM   1911  C  C    . LYS A 1 7  ? -2.994  -4.926  -7.435  1.00 0.00 ? 535 LYS A C    4  
ATOM   1912  O  O    . LYS A 1 7  ? -1.878  -4.458  -7.659  1.00 0.00 ? 535 LYS A O    4  
ATOM   1913  C  CB   . LYS A 1 7  ? -2.362  -6.828  -8.934  1.00 0.00 ? 535 LYS A CB   4  
ATOM   1914  C  CG   . LYS A 1 7  ? -2.414  -8.328  -9.173  1.00 0.00 ? 535 LYS A CG   4  
ATOM   1915  C  CD   . LYS A 1 7  ? -1.480  -8.746  -10.297 1.00 0.00 ? 535 LYS A CD   4  
ATOM   1916  C  CE   . LYS A 1 7  ? -0.053  -8.916  -9.801  1.00 0.00 ? 535 LYS A CE   4  
ATOM   1917  N  NZ   . LYS A 1 7  ? 0.784   -9.678  -10.767 1.00 0.00 ? 535 LYS A NZ   4  
ATOM   1918  H  H    . LYS A 1 7  ? -4.909  -6.022  -9.267  1.00 0.00 ? 535 LYS A H    4  
ATOM   1919  H  HA   . LYS A 1 7  ? -3.292  -6.997  -7.014  1.00 0.00 ? 535 LYS A HA   4  
ATOM   1920  H  HB2  . LYS A 1 7  ? -2.579  -6.329  -9.866  1.00 0.00 ? 535 LYS A HB2  4  
ATOM   1921  H  HB3  . LYS A 1 7  ? -1.361  -6.570  -8.622  1.00 0.00 ? 535 LYS A HB3  4  
ATOM   1922  H  HG2  . LYS A 1 7  ? -2.122  -8.838  -8.267  1.00 0.00 ? 535 LYS A HG2  4  
ATOM   1923  H  HG3  . LYS A 1 7  ? -3.425  -8.606  -9.434  1.00 0.00 ? 535 LYS A HG3  4  
ATOM   1924  H  HD2  . LYS A 1 7  ? -1.822  -9.686  -10.705 1.00 0.00 ? 535 LYS A HD2  4  
ATOM   1925  H  HD3  . LYS A 1 7  ? -1.497  -7.989  -11.066 1.00 0.00 ? 535 LYS A HD3  4  
ATOM   1926  H  HE2  . LYS A 1 7  ? 0.382   -7.938  -9.655  1.00 0.00 ? 535 LYS A HE2  4  
ATOM   1927  H  HE3  . LYS A 1 7  ? -0.073  -9.444  -8.859  1.00 0.00 ? 535 LYS A HE3  4  
ATOM   1928  H  HZ1  . LYS A 1 7  ? 1.509   -10.224 -10.259 1.00 0.00 ? 535 LYS A HZ1  4  
ATOM   1929  H  HZ2  . LYS A 1 7  ? 1.255   -9.026  -11.425 1.00 0.00 ? 535 LYS A HZ2  4  
ATOM   1930  H  HZ3  . LYS A 1 7  ? 0.190   -10.335 -11.314 1.00 0.00 ? 535 LYS A HZ3  4  
ATOM   1931  N  N    . GLN A 1 8  ? -3.951  -4.249  -6.809  1.00 0.00 ? 536 GLN A N    4  
ATOM   1932  C  CA   . GLN A 1 8  ? -3.740  -2.884  -6.340  1.00 0.00 ? 536 GLN A CA   4  
ATOM   1933  C  C    . GLN A 1 8  ? -3.176  -2.879  -4.922  1.00 0.00 ? 536 GLN A C    4  
ATOM   1934  O  O    . GLN A 1 8  ? -3.767  -3.451  -4.006  1.00 0.00 ? 536 GLN A O    4  
ATOM   1935  C  CB   . GLN A 1 8  ? -5.052  -2.098  -6.385  1.00 0.00 ? 536 GLN A CB   4  
ATOM   1936  C  CG   . GLN A 1 8  ? -5.195  -1.225  -7.620  1.00 0.00 ? 536 GLN A CG   4  
ATOM   1937  C  CD   . GLN A 1 8  ? -5.109  -2.019  -8.909  1.00 0.00 ? 536 GLN A CD   4  
ATOM   1938  O  OE1  . GLN A 1 8  ? -6.081  -2.645  -9.332  1.00 0.00 ? 536 GLN A OE1  4  
ATOM   1939  N  NE2  . GLN A 1 8  ? -3.941  -1.999  -9.540  1.00 0.00 ? 536 GLN A NE2  4  
ATOM   1940  H  H    . GLN A 1 8  ? -4.820  -4.676  -6.659  1.00 0.00 ? 536 GLN A H    4  
ATOM   1941  H  HA   . GLN A 1 8  ? -3.026  -2.414  -7.000  1.00 0.00 ? 536 GLN A HA   4  
ATOM   1942  H  HB2  . GLN A 1 8  ? -5.877  -2.795  -6.366  1.00 0.00 ? 536 GLN A HB2  4  
ATOM   1943  H  HB3  . GLN A 1 8  ? -5.109  -1.463  -5.513  1.00 0.00 ? 536 GLN A HB3  4  
ATOM   1944  H  HG2  . GLN A 1 8  ? -6.152  -0.727  -7.585  1.00 0.00 ? 536 GLN A HG2  4  
ATOM   1945  H  HG3  . GLN A 1 8  ? -4.406  -0.487  -7.616  1.00 0.00 ? 536 GLN A HG3  4  
ATOM   1946  H  HE21 . GLN A 1 8  ? -3.210  -1.479  -9.145  1.00 0.00 ? 536 GLN A HE21 4  
ATOM   1947  H  HE22 . GLN A 1 8  ? -3.858  -2.503  -10.376 1.00 0.00 ? 536 GLN A HE22 4  
ATOM   1948  N  N    . HIS A 1 9  ? -2.029  -2.230  -4.749  1.00 0.00 ? 537 HIS A N    4  
ATOM   1949  C  CA   . HIS A 1 9  ? -1.386  -2.150  -3.442  1.00 0.00 ? 537 HIS A CA   4  
ATOM   1950  C  C    . HIS A 1 9  ? -1.862  -0.920  -2.677  1.00 0.00 ? 537 HIS A C    4  
ATOM   1951  O  O    . HIS A 1 9  ? -1.518  0.210   -3.022  1.00 0.00 ? 537 HIS A O    4  
ATOM   1952  C  CB   . HIS A 1 9  ? 0.135   -2.110  -3.601  1.00 0.00 ? 537 HIS A CB   4  
ATOM   1953  C  CG   . HIS A 1 9  ? 0.704   -3.350  -4.218  1.00 0.00 ? 537 HIS A CG   4  
ATOM   1954  N  ND1  . HIS A 1 9  ? 0.027   -4.545  -4.304  1.00 0.00 ? 537 HIS A ND1  4  
ATOM   1955  C  CD2  . HIS A 1 9  ? 1.917   -3.564  -4.789  1.00 0.00 ? 537 HIS A CD2  4  
ATOM   1956  C  CE1  . HIS A 1 9  ? 0.830   -5.430  -4.910  1.00 0.00 ? 537 HIS A CE1  4  
ATOM   1957  N  NE2  . HIS A 1 9  ? 1.989   -4.884  -5.225  1.00 0.00 ? 537 HIS A NE2  4  
ATOM   1958  H  H    . HIS A 1 9  ? -1.606  -1.794  -5.517  1.00 0.00 ? 537 HIS A H    4  
ATOM   1959  H  HA   . HIS A 1 9  ? -1.658  -3.034  -2.885  1.00 0.00 ? 537 HIS A HA   4  
ATOM   1960  H  HB2  . HIS A 1 9  ? 0.402   -1.274  -4.229  1.00 0.00 ? 537 HIS A HB2  4  
ATOM   1961  H  HB3  . HIS A 1 9  ? 0.587   -1.984  -2.628  1.00 0.00 ? 537 HIS A HB3  4  
ATOM   1962  H  HD1  . HIS A 1 9  ? -0.882  -4.719  -3.980  1.00 0.00 ? 537 HIS A HD1  4  
ATOM   1963  H  HD2  . HIS A 1 9  ? 2.707   -2.835  -4.893  1.00 0.00 ? 537 HIS A HD2  4  
ATOM   1964  H  HE1  . HIS A 1 9  ? 0.563   -6.456  -5.115  1.00 0.00 ? 537 HIS A HE1  4  
ATOM   1965  N  N    . ILE A 1 10 ? -2.657  -1.148  -1.636  1.00 0.00 ? 538 ILE A N    4  
ATOM   1966  C  CA   . ILE A 1 10 ? -3.181  -0.058  -0.822  1.00 0.00 ? 538 ILE A CA   4  
ATOM   1967  C  C    . ILE A 1 10 ? -2.819  -0.246  0.647   1.00 0.00 ? 538 ILE A C    4  
ATOM   1968  O  O    . ILE A 1 10 ? -2.808  -1.367  1.156   1.00 0.00 ? 538 ILE A O    4  
ATOM   1969  C  CB   . ILE A 1 10 ? -4.713  0.052   -0.951  1.00 0.00 ? 538 ILE A CB   4  
ATOM   1970  C  CG1  . ILE A 1 10 ? -5.121  0.075   -2.426  1.00 0.00 ? 538 ILE A CG1  4  
ATOM   1971  C  CG2  . ILE A 1 10 ? -5.219  1.297   -0.235  1.00 0.00 ? 538 ILE A CG2  4  
ATOM   1972  C  CD1  . ILE A 1 10 ? -6.617  -0.011  -2.640  1.00 0.00 ? 538 ILE A CD1  4  
ATOM   1973  H  H    . ILE A 1 10 ? -2.897  -2.071  -1.411  1.00 0.00 ? 538 ILE A H    4  
ATOM   1974  H  HA   . ILE A 1 10 ? -2.743  0.864   -1.176  1.00 0.00 ? 538 ILE A HA   4  
ATOM   1975  H  HB   . ILE A 1 10 ? -5.155  -0.810  -0.476  1.00 0.00 ? 538 ILE A HB   4  
ATOM   1976  H  HG12 . ILE A 1 10 ? -4.776  0.995   -2.874  1.00 0.00 ? 538 ILE A HG12 4  
ATOM   1977  H  HG13 . ILE A 1 10 ? -4.664  -0.762  -2.933  1.00 0.00 ? 538 ILE A HG13 4  
ATOM   1978  H  HG21 . ILE A 1 10 ? -5.652  1.015   0.714   1.00 0.00 ? 538 ILE A HG21 4  
ATOM   1979  H  HG22 . ILE A 1 10 ? -5.968  1.784   -0.842  1.00 0.00 ? 538 ILE A HG22 4  
ATOM   1980  H  HG23 . ILE A 1 10 ? -4.395  1.975   -0.066  1.00 0.00 ? 538 ILE A HG23 4  
ATOM   1981  H  HD11 . ILE A 1 10 ? -6.927  0.760   -3.330  1.00 0.00 ? 538 ILE A HD11 4  
ATOM   1982  H  HD12 . ILE A 1 10 ? -7.124  0.127   -1.696  1.00 0.00 ? 538 ILE A HD12 4  
ATOM   1983  H  HD13 . ILE A 1 10 ? -6.867  -0.980  -3.045  1.00 0.00 ? 538 ILE A HD13 4  
ATOM   1984  N  N    . CYS A 1 11 ? -2.524  0.859   1.324   1.00 0.00 ? 539 CYS A N    4  
ATOM   1985  C  CA   . CYS A 1 11 ? -2.162  0.818   2.736   1.00 0.00 ? 539 CYS A CA   4  
ATOM   1986  C  C    . CYS A 1 11 ? -3.293  0.221   3.568   1.00 0.00 ? 539 CYS A C    4  
ATOM   1987  O  O    . CYS A 1 11 ? -4.407  0.746   3.587   1.00 0.00 ? 539 CYS A O    4  
ATOM   1988  C  CB   . CYS A 1 11 ? -1.826  2.224   3.239   1.00 0.00 ? 539 CYS A CB   4  
ATOM   1989  S  SG   . CYS A 1 11 ? -0.216  2.351   4.052   1.00 0.00 ? 539 CYS A SG   4  
ATOM   1990  H  H    . CYS A 1 11 ? -2.551  1.723   0.863   1.00 0.00 ? 539 CYS A H    4  
ATOM   1991  H  HA   . CYS A 1 11 ? -1.289  0.191   2.836   1.00 0.00 ? 539 CYS A HA   4  
ATOM   1992  H  HB2  . CYS A 1 11 ? -1.825  2.906   2.403   1.00 0.00 ? 539 CYS A HB2  4  
ATOM   1993  H  HB3  . CYS A 1 11 ? -2.579  2.535   3.949   1.00 0.00 ? 539 CYS A HB3  4  
ATOM   1994  N  N    . HIS A 1 12 ? -2.999  -0.878  4.255   1.00 0.00 ? 540 HIS A N    4  
ATOM   1995  C  CA   . HIS A 1 12 ? -3.992  -1.546  5.089   1.00 0.00 ? 540 HIS A CA   4  
ATOM   1996  C  C    . HIS A 1 12 ? -3.585  -1.506  6.559   1.00 0.00 ? 540 HIS A C    4  
ATOM   1997  O  O    . HIS A 1 12 ? -3.567  -2.533  7.238   1.00 0.00 ? 540 HIS A O    4  
ATOM   1998  C  CB   . HIS A 1 12 ? -4.175  -2.996  4.635   1.00 0.00 ? 540 HIS A CB   4  
ATOM   1999  C  CG   . HIS A 1 12 ? -5.595  -3.468  4.701   1.00 0.00 ? 540 HIS A CG   4  
ATOM   2000  N  ND1  . HIS A 1 12 ? -6.176  -3.996  5.832   1.00 0.00 ? 540 HIS A ND1  4  
ATOM   2001  C  CD2  . HIS A 1 12 ? -6.557  -3.483  3.743   1.00 0.00 ? 540 HIS A CD2  4  
ATOM   2002  C  CE1  . HIS A 1 12 ? -7.445  -4.309  5.534   1.00 0.00 ? 540 HIS A CE1  4  
ATOM   2003  N  NE2  . HIS A 1 12 ? -7.726  -4.017  4.279   1.00 0.00 ? 540 HIS A NE2  4  
ATOM   2004  H  H    . HIS A 1 12 ? -2.094  -1.249  4.199   1.00 0.00 ? 540 HIS A H    4  
ATOM   2005  H  HA   . HIS A 1 12 ? -4.928  -1.022  4.973   1.00 0.00 ? 540 HIS A HA   4  
ATOM   2006  H  HB2  . HIS A 1 12 ? -3.841  -3.091  3.613   1.00 0.00 ? 540 HIS A HB2  4  
ATOM   2007  H  HB3  . HIS A 1 12 ? -3.580  -3.641  5.265   1.00 0.00 ? 540 HIS A HB3  4  
ATOM   2008  H  HD1  . HIS A 1 12 ? -5.740  -4.121  6.701   1.00 0.00 ? 540 HIS A HD1  4  
ATOM   2009  H  HD2  . HIS A 1 12 ? -6.444  -3.138  2.726   1.00 0.00 ? 540 HIS A HD2  4  
ATOM   2010  H  HE1  . HIS A 1 12 ? -8.146  -4.743  6.231   1.00 0.00 ? 540 HIS A HE1  4  
ATOM   2011  N  N    . ILE A 1 13 ? -3.258  -0.313  7.046   1.00 0.00 ? 541 ILE A N    4  
ATOM   2012  C  CA   . ILE A 1 13 ? -2.853  -0.141  8.436   1.00 0.00 ? 541 ILE A CA   4  
ATOM   2013  C  C    . ILE A 1 13 ? -3.885  0.667   9.213   1.00 0.00 ? 541 ILE A C    4  
ATOM   2014  O  O    . ILE A 1 13 ? -3.540  1.459   10.091  1.00 0.00 ? 541 ILE A O    4  
ATOM   2015  C  CB   . ILE A 1 13 ? -1.481  0.553   8.543   1.00 0.00 ? 541 ILE A CB   4  
ATOM   2016  C  CG1  . ILE A 1 13 ? -1.530  1.937   7.890   1.00 0.00 ? 541 ILE A CG1  4  
ATOM   2017  C  CG2  . ILE A 1 13 ? -0.402  -0.306  7.902   1.00 0.00 ? 541 ILE A CG2  4  
ATOM   2018  C  CD1  . ILE A 1 13 ? -0.932  3.031   8.747   1.00 0.00 ? 541 ILE A CD1  4  
ATOM   2019  H  H    . ILE A 1 13 ? -3.291  0.470   6.457   1.00 0.00 ? 541 ILE A H    4  
ATOM   2020  H  HA   . ILE A 1 13 ? -2.774  -1.121  8.881   1.00 0.00 ? 541 ILE A HA   4  
ATOM   2021  H  HB   . ILE A 1 13 ? -1.241  0.666   9.590   1.00 0.00 ? 541 ILE A HB   4  
ATOM   2022  H  HG12 . ILE A 1 13 ? -0.983  1.909   6.960   1.00 0.00 ? 541 ILE A HG12 4  
ATOM   2023  H  HG13 . ILE A 1 13 ? -2.559  2.198   7.689   1.00 0.00 ? 541 ILE A HG13 4  
ATOM   2024  H  HG21 . ILE A 1 13 ? -0.233  0.026   6.888   1.00 0.00 ? 541 ILE A HG21 4  
ATOM   2025  H  HG22 . ILE A 1 13 ? -0.719  -1.338  7.895   1.00 0.00 ? 541 ILE A HG22 4  
ATOM   2026  H  HG23 . ILE A 1 13 ? 0.514   -0.214  8.467   1.00 0.00 ? 541 ILE A HG23 4  
ATOM   2027  H  HD11 . ILE A 1 13 ? -1.276  2.919   9.765   1.00 0.00 ? 541 ILE A HD11 4  
ATOM   2028  H  HD12 . ILE A 1 13 ? -1.238  3.994   8.367   1.00 0.00 ? 541 ILE A HD12 4  
ATOM   2029  H  HD13 . ILE A 1 13 ? 0.145   2.959   8.722   1.00 0.00 ? 541 ILE A HD13 4  
ATOM   2030  N  N    . GLN A 1 14 ? -5.154  0.457   8.883   1.00 0.00 ? 542 GLN A N    4  
ATOM   2031  C  CA   . GLN A 1 14 ? -6.253  1.158   9.544   1.00 0.00 ? 542 GLN A CA   4  
ATOM   2032  C  C    . GLN A 1 14 ? -5.968  2.654   9.658   1.00 0.00 ? 542 GLN A C    4  
ATOM   2033  O  O    . GLN A 1 14 ? -6.368  3.300   10.627  1.00 0.00 ? 542 GLN A O    4  
ATOM   2034  C  CB   . GLN A 1 14 ? -6.495  0.569   10.935  1.00 0.00 ? 542 GLN A CB   4  
ATOM   2035  C  CG   . GLN A 1 14 ? -7.312  -0.713  10.918  1.00 0.00 ? 542 GLN A CG   4  
ATOM   2036  C  CD   . GLN A 1 14 ? -7.501  -1.303  12.302  1.00 0.00 ? 542 GLN A CD   4  
ATOM   2037  O  OE1  . GLN A 1 14 ? -8.624  -1.566  12.730  1.00 0.00 ? 542 GLN A OE1  4  
ATOM   2038  N  NE2  . GLN A 1 14 ? -6.397  -1.513  13.011  1.00 0.00 ? 542 GLN A NE2  4  
ATOM   2039  H  H    . GLN A 1 14 ? -5.358  -0.190  8.176   1.00 0.00 ? 542 GLN A H    4  
ATOM   2040  H  HA   . GLN A 1 14 ? -7.141  1.019   8.946   1.00 0.00 ? 542 GLN A HA   4  
ATOM   2041  H  HB2  . GLN A 1 14 ? -5.541  0.356   11.395  1.00 0.00 ? 542 GLN A HB2  4  
ATOM   2042  H  HB3  . GLN A 1 14 ? -7.020  1.297   11.536  1.00 0.00 ? 542 GLN A HB3  4  
ATOM   2043  H  HG2  . GLN A 1 14 ? -8.285  -0.499  10.500  1.00 0.00 ? 542 GLN A HG2  4  
ATOM   2044  H  HG3  . GLN A 1 14 ? -6.807  -1.439  10.299  1.00 0.00 ? 542 GLN A HG3  4  
ATOM   2045  H  HE21 . GLN A 1 14 ? -5.536  -1.279  12.606  1.00 0.00 ? 542 GLN A HE21 4  
ATOM   2046  H  HE22 . GLN A 1 14 ? -6.490  -1.894  13.909  1.00 0.00 ? 542 GLN A HE22 4  
ATOM   2047  N  N    . GLY A 1 15 ? -5.274  3.199   8.663   1.00 0.00 ? 543 GLY A N    4  
ATOM   2048  C  CA   . GLY A 1 15 ? -4.949  4.613   8.676   1.00 0.00 ? 543 GLY A CA   4  
ATOM   2049  C  C    . GLY A 1 15 ? -4.865  5.206   7.283   1.00 0.00 ? 543 GLY A C    4  
ATOM   2050  O  O    . GLY A 1 15 ? -5.712  6.008   6.892   1.00 0.00 ? 543 GLY A O    4  
ATOM   2051  H  H    . GLY A 1 15 ? -4.980  2.636   7.917   1.00 0.00 ? 543 GLY A H    4  
ATOM   2052  H  HA2  . GLY A 1 15 ? -5.708  5.140   9.234   1.00 0.00 ? 543 GLY A HA2  4  
ATOM   2053  H  HA3  . GLY A 1 15 ? -3.997  4.747   9.170   1.00 0.00 ? 543 GLY A HA3  4  
ATOM   2054  N  N    . CYS A 1 16 ? -3.841  4.811   6.534   1.00 0.00 ? 544 CYS A N    4  
ATOM   2055  C  CA   . CYS A 1 16 ? -3.650  5.310   5.178   1.00 0.00 ? 544 CYS A CA   4  
ATOM   2056  C  C    . CYS A 1 16 ? -4.737  4.782   4.247   1.00 0.00 ? 544 CYS A C    4  
ATOM   2057  O  O    . CYS A 1 16 ? -5.672  4.112   4.685   1.00 0.00 ? 544 CYS A O    4  
ATOM   2058  C  CB   . CYS A 1 16 ? -2.271  4.906   4.653   1.00 0.00 ? 544 CYS A CB   4  
ATOM   2059  S  SG   . CYS A 1 16 ? -1.022  6.207   4.780   1.00 0.00 ? 544 CYS A SG   4  
ATOM   2060  H  H    . CYS A 1 16 ? -3.199  4.169   6.901   1.00 0.00 ? 544 CYS A H    4  
ATOM   2061  H  HA   . CYS A 1 16 ? -3.712  6.387   5.210   1.00 0.00 ? 544 CYS A HA   4  
ATOM   2062  H  HB2  . CYS A 1 16 ? -1.915  4.056   5.216   1.00 0.00 ? 544 CYS A HB2  4  
ATOM   2063  H  HB3  . CYS A 1 16 ? -2.355  4.632   3.612   1.00 0.00 ? 544 CYS A HB3  4  
ATOM   2064  N  N    . GLY A 1 17 ? -4.606  5.088   2.961   1.00 0.00 ? 545 GLY A N    4  
ATOM   2065  C  CA   . GLY A 1 17 ? -5.583  4.636   1.989   1.00 0.00 ? 545 GLY A CA   4  
ATOM   2066  C  C    . GLY A 1 17 ? -5.273  5.119   0.586   1.00 0.00 ? 545 GLY A C    4  
ATOM   2067  O  O    . GLY A 1 17 ? -6.180  5.450   -0.178  1.00 0.00 ? 545 GLY A O    4  
ATOM   2068  H  H    . GLY A 1 17 ? -3.840  5.625   2.670   1.00 0.00 ? 545 GLY A H    4  
ATOM   2069  H  HA2  . GLY A 1 17 ? -5.602  3.556   1.991   1.00 0.00 ? 545 GLY A HA2  4  
ATOM   2070  H  HA3  . GLY A 1 17 ? -6.557  5.002   2.278   1.00 0.00 ? 545 GLY A HA3  4  
ATOM   2071  N  N    . LYS A 1 18 ? -3.989  5.159   0.246   1.00 0.00 ? 546 LYS A N    4  
ATOM   2072  C  CA   . LYS A 1 18 ? -3.561  5.604   -1.074  1.00 0.00 ? 546 LYS A CA   4  
ATOM   2073  C  C    . LYS A 1 18 ? -3.615  4.456   -2.078  1.00 0.00 ? 546 LYS A C    4  
ATOM   2074  O  O    . LYS A 1 18 ? -4.156  3.390   -1.786  1.00 0.00 ? 546 LYS A O    4  
ATOM   2075  C  CB   . LYS A 1 18 ? -2.144  6.179   -1.007  1.00 0.00 ? 546 LYS A CB   4  
ATOM   2076  C  CG   . LYS A 1 18 ? -1.081  5.145   -0.669  1.00 0.00 ? 546 LYS A CG   4  
ATOM   2077  C  CD   . LYS A 1 18 ? -0.241  5.572   0.525   1.00 0.00 ? 546 LYS A CD   4  
ATOM   2078  C  CE   . LYS A 1 18 ? 0.490   6.877   0.255   1.00 0.00 ? 546 LYS A CE   4  
ATOM   2079  N  NZ   . LYS A 1 18 ? 1.867   6.646   -0.262  1.00 0.00 ? 546 LYS A NZ   4  
ATOM   2080  H  H    . LYS A 1 18 ? -3.313  4.881   0.899   1.00 0.00 ? 546 LYS A H    4  
ATOM   2081  H  HA   . LYS A 1 18 ? -4.239  6.380   -1.397  1.00 0.00 ? 546 LYS A HA   4  
ATOM   2082  H  HB2  . LYS A 1 18 ? -1.899  6.616   -1.964  1.00 0.00 ? 546 LYS A HB2  4  
ATOM   2083  H  HB3  . LYS A 1 18 ? -2.118  6.951   -0.252  1.00 0.00 ? 546 LYS A HB3  4  
ATOM   2084  H  HG2  . LYS A 1 18 ? -1.565  4.208   -0.439  1.00 0.00 ? 546 LYS A HG2  4  
ATOM   2085  H  HG3  . LYS A 1 18 ? -0.434  5.016   -1.525  1.00 0.00 ? 546 LYS A HG3  4  
ATOM   2086  H  HD2  . LYS A 1 18 ? -0.889  5.704   1.379   1.00 0.00 ? 546 LYS A HD2  4  
ATOM   2087  H  HD3  . LYS A 1 18 ? 0.484   4.800   0.737   1.00 0.00 ? 546 LYS A HD3  4  
ATOM   2088  H  HE2  . LYS A 1 18 ? -0.069  7.444   -0.475  1.00 0.00 ? 546 LYS A HE2  4  
ATOM   2089  H  HE3  . LYS A 1 18 ? 0.549   7.439   1.176   1.00 0.00 ? 546 LYS A HE3  4  
ATOM   2090  H  HZ1  . LYS A 1 18 ? 2.213   5.715   0.046   1.00 0.00 ? 546 LYS A HZ1  4  
ATOM   2091  H  HZ2  . LYS A 1 18 ? 2.511   7.379   0.097   1.00 0.00 ? 546 LYS A HZ2  4  
ATOM   2092  H  HZ3  . LYS A 1 18 ? 1.869   6.679   -1.302  1.00 0.00 ? 546 LYS A HZ3  4  
ATOM   2093  N  N    . VAL A 1 19 ? -3.053  4.680   -3.261  1.00 0.00 ? 547 VAL A N    4  
ATOM   2094  C  CA   . VAL A 1 19 ? -3.040  3.663   -4.305  1.00 0.00 ? 547 VAL A CA   4  
ATOM   2095  C  C    . VAL A 1 19 ? -1.623  3.410   -4.811  1.00 0.00 ? 547 VAL A C    4  
ATOM   2096  O  O    . VAL A 1 19 ? -0.843  4.344   -4.993  1.00 0.00 ? 547 VAL A O    4  
ATOM   2097  C  CB   . VAL A 1 19 ? -3.933  4.066   -5.493  1.00 0.00 ? 547 VAL A CB   4  
ATOM   2098  C  CG1  . VAL A 1 19 ? -4.067  2.914   -6.478  1.00 0.00 ? 547 VAL A CG1  4  
ATOM   2099  C  CG2  . VAL A 1 19 ? -5.300  4.519   -5.003  1.00 0.00 ? 547 VAL A CG2  4  
ATOM   2100  H  H    . VAL A 1 19 ? -2.637  5.550   -3.436  1.00 0.00 ? 547 VAL A H    4  
ATOM   2101  H  HA   . VAL A 1 19 ? -3.429  2.747   -3.883  1.00 0.00 ? 547 VAL A HA   4  
ATOM   2102  H  HB   . VAL A 1 19 ? -3.465  4.894   -6.005  1.00 0.00 ? 547 VAL A HB   4  
ATOM   2103  H  HG11 . VAL A 1 19 ? -4.802  2.212   -6.113  1.00 0.00 ? 547 VAL A HG11 4  
ATOM   2104  H  HG12 . VAL A 1 19 ? -3.114  2.416   -6.580  1.00 0.00 ? 547 VAL A HG12 4  
ATOM   2105  H  HG13 . VAL A 1 19 ? -4.379  3.296   -7.438  1.00 0.00 ? 547 VAL A HG13 4  
ATOM   2106  H  HG21 . VAL A 1 19 ? -5.179  5.156   -4.139  1.00 0.00 ? 547 VAL A HG21 4  
ATOM   2107  H  HG22 . VAL A 1 19 ? -5.891  3.656   -4.734  1.00 0.00 ? 547 VAL A HG22 4  
ATOM   2108  H  HG23 . VAL A 1 19 ? -5.800  5.067   -5.787  1.00 0.00 ? 547 VAL A HG23 4  
ATOM   2109  N  N    . TYR A 1 20 ? -1.299  2.141   -5.036  1.00 0.00 ? 548 TYR A N    4  
ATOM   2110  C  CA   . TYR A 1 20 ? 0.023   1.763   -5.521  1.00 0.00 ? 548 TYR A CA   4  
ATOM   2111  C  C    . TYR A 1 20 ? -0.061  0.533   -6.420  1.00 0.00 ? 548 TYR A C    4  
ATOM   2112  O  O    . TYR A 1 20 ? -0.986  -0.271  -6.304  1.00 0.00 ? 548 TYR A O    4  
ATOM   2113  C  CB   . TYR A 1 20 ? 0.962   1.489   -4.344  1.00 0.00 ? 548 TYR A CB   4  
ATOM   2114  C  CG   . TYR A 1 20 ? 1.938   2.612   -4.074  1.00 0.00 ? 548 TYR A CG   4  
ATOM   2115  C  CD1  . TYR A 1 20 ? 2.914   2.949   -5.004  1.00 0.00 ? 548 TYR A CD1  4  
ATOM   2116  C  CD2  . TYR A 1 20 ? 1.884   3.335   -2.889  1.00 0.00 ? 548 TYR A CD2  4  
ATOM   2117  C  CE1  . TYR A 1 20 ? 3.808   3.975   -4.761  1.00 0.00 ? 548 TYR A CE1  4  
ATOM   2118  C  CE2  . TYR A 1 20 ? 2.774   4.362   -2.638  1.00 0.00 ? 548 TYR A CE2  4  
ATOM   2119  C  CZ   . TYR A 1 20 ? 3.734   4.678   -3.577  1.00 0.00 ? 548 TYR A CZ   4  
ATOM   2120  O  OH   . TYR A 1 20 ? 4.622   5.699   -3.331  1.00 0.00 ? 548 TYR A OH   4  
ATOM   2121  H  H    . TYR A 1 20 ? -1.966  1.442   -4.872  1.00 0.00 ? 548 TYR A H    4  
ATOM   2122  H  HA   . TYR A 1 20 ? 0.413   2.589   -6.097  1.00 0.00 ? 548 TYR A HA   4  
ATOM   2123  H  HB2  . TYR A 1 20 ? 0.375   1.339   -3.451  1.00 0.00 ? 548 TYR A HB2  4  
ATOM   2124  H  HB3  . TYR A 1 20 ? 1.533   0.595   -4.548  1.00 0.00 ? 548 TYR A HB3  4  
ATOM   2125  H  HD1  . TYR A 1 20 ? 2.969   2.397   -5.931  1.00 0.00 ? 548 TYR A HD1  4  
ATOM   2126  H  HD2  . TYR A 1 20 ? 1.132   3.085   -2.155  1.00 0.00 ? 548 TYR A HD2  4  
ATOM   2127  H  HE1  . TYR A 1 20 ? 4.559   4.222   -5.496  1.00 0.00 ? 548 TYR A HE1  4  
ATOM   2128  H  HE2  . TYR A 1 20 ? 2.717   4.912   -1.710  1.00 0.00 ? 548 TYR A HE2  4  
ATOM   2129  H  HH   . TYR A 1 20 ? 5.507   5.420   -3.577  1.00 0.00 ? 548 TYR A HH   4  
ATOM   2130  N  N    . GLY A 1 21 ? 0.912   0.392   -7.314  1.00 0.00 ? 549 GLY A N    4  
ATOM   2131  C  CA   . GLY A 1 21 ? 0.929   -0.744  -8.218  1.00 0.00 ? 549 GLY A CA   4  
ATOM   2132  C  C    . GLY A 1 21 ? 2.299   -1.384  -8.325  1.00 0.00 ? 549 GLY A C    4  
ATOM   2133  O  O    . GLY A 1 21 ? 2.609   -2.038  -9.320  1.00 0.00 ? 549 GLY A O    4  
ATOM   2134  H  H    . GLY A 1 21 ? 1.624   1.063   -7.361  1.00 0.00 ? 549 GLY A H    4  
ATOM   2135  H  HA2  . GLY A 1 21 ? 0.226   -1.483  -7.863  1.00 0.00 ? 549 GLY A HA2  4  
ATOM   2136  H  HA3  . GLY A 1 21 ? 0.621   -0.413  -9.199  1.00 0.00 ? 549 GLY A HA3  4  
ATOM   2137  N  N    . LYS A 1 22 ? 3.123   -1.196  -7.298  1.00 0.00 ? 550 LYS A N    4  
ATOM   2138  C  CA   . LYS A 1 22 ? 4.466   -1.762  -7.283  1.00 0.00 ? 550 LYS A CA   4  
ATOM   2139  C  C    . LYS A 1 22 ? 4.906   -2.083  -5.858  1.00 0.00 ? 550 LYS A C    4  
ATOM   2140  O  O    . LYS A 1 22 ? 4.967   -1.200  -5.003  1.00 0.00 ? 550 LYS A O    4  
ATOM   2141  C  CB   . LYS A 1 22 ? 5.458   -0.792  -7.929  1.00 0.00 ? 550 LYS A CB   4  
ATOM   2142  C  CG   . LYS A 1 22 ? 6.693   -1.474  -8.498  1.00 0.00 ? 550 LYS A CG   4  
ATOM   2143  C  CD   . LYS A 1 22 ? 6.964   -1.036  -9.929  1.00 0.00 ? 550 LYS A CD   4  
ATOM   2144  C  CE   . LYS A 1 22 ? 5.985   -1.673  -10.902 1.00 0.00 ? 550 LYS A CE   4  
ATOM   2145  N  NZ   . LYS A 1 22 ? 4.899   -0.732  -11.292 1.00 0.00 ? 550 LYS A NZ   4  
ATOM   2146  H  H    . LYS A 1 22 ? 2.819   -0.666  -6.532  1.00 0.00 ? 550 LYS A H    4  
ATOM   2147  H  HA   . LYS A 1 22 ? 4.447   -2.677  -7.856  1.00 0.00 ? 550 LYS A HA   4  
ATOM   2148  H  HB2  . LYS A 1 22 ? 4.959   -0.267  -8.730  1.00 0.00 ? 550 LYS A HB2  4  
ATOM   2149  H  HB3  . LYS A 1 22 ? 5.778   -0.076  -7.186  1.00 0.00 ? 550 LYS A HB3  4  
ATOM   2150  H  HG2  . LYS A 1 22 ? 7.546   -1.219  -7.887  1.00 0.00 ? 550 LYS A HG2  4  
ATOM   2151  H  HG3  . LYS A 1 22 ? 6.541   -2.543  -8.480  1.00 0.00 ? 550 LYS A HG3  4  
ATOM   2152  H  HD2  . LYS A 1 22 ? 6.871   0.037   -9.991  1.00 0.00 ? 550 LYS A HD2  4  
ATOM   2153  H  HD3  . LYS A 1 22 ? 7.969   -1.328  -10.199 1.00 0.00 ? 550 LYS A HD3  4  
ATOM   2154  H  HE2  . LYS A 1 22 ? 6.523   -1.975  -11.788 1.00 0.00 ? 550 LYS A HE2  4  
ATOM   2155  H  HE3  . LYS A 1 22 ? 5.547   -2.542  -10.435 1.00 0.00 ? 550 LYS A HE3  4  
ATOM   2156  H  HZ1  . LYS A 1 22 ? 5.232   0.250   -11.216 1.00 0.00 ? 550 LYS A HZ1  4  
ATOM   2157  H  HZ2  . LYS A 1 22 ? 4.076   -0.857  -10.669 1.00 0.00 ? 550 LYS A HZ2  4  
ATOM   2158  H  HZ3  . LYS A 1 22 ? 4.606   -0.913  -12.274 1.00 0.00 ? 550 LYS A HZ3  4  
ATOM   2159  N  N    . THR A 1 23 ? 5.211   -3.352  -5.610  1.00 0.00 ? 551 THR A N    4  
ATOM   2160  C  CA   . THR A 1 23 ? 5.645   -3.790  -4.289  1.00 0.00 ? 551 THR A CA   4  
ATOM   2161  C  C    . THR A 1 23 ? 6.926   -3.073  -3.873  1.00 0.00 ? 551 THR A C    4  
ATOM   2162  O  O    . THR A 1 23 ? 7.112   -2.744  -2.702  1.00 0.00 ? 551 THR A O    4  
ATOM   2163  C  CB   . THR A 1 23 ? 5.866   -5.303  -4.276  1.00 0.00 ? 551 THR A CB   4  
ATOM   2164  O  OG1  . THR A 1 23 ? 4.967   -5.948  -5.160  1.00 0.00 ? 551 THR A OG1  4  
ATOM   2165  C  CG2  . THR A 1 23 ? 5.687   -5.922  -2.907  1.00 0.00 ? 551 THR A CG2  4  
ATOM   2166  H  H    . THR A 1 23 ? 5.143   -4.011  -6.333  1.00 0.00 ? 551 THR A H    4  
ATOM   2167  H  HA   . THR A 1 23 ? 4.864   -3.542  -3.585  1.00 0.00 ? 551 THR A HA   4  
ATOM   2168  H  HB   . THR A 1 23 ? 6.874   -5.512  -4.604  1.00 0.00 ? 551 THR A HB   4  
ATOM   2169  H  HG1  . THR A 1 23 ? 5.351   -5.982  -6.039  1.00 0.00 ? 551 THR A HG1  4  
ATOM   2170  H  HG21 . THR A 1 23 ? 4.732   -6.425  -2.861  1.00 0.00 ? 551 THR A HG21 4  
ATOM   2171  H  HG22 . THR A 1 23 ? 5.722   -5.148  -2.154  1.00 0.00 ? 551 THR A HG22 4  
ATOM   2172  H  HG23 . THR A 1 23 ? 6.478   -6.635  -2.728  1.00 0.00 ? 551 THR A HG23 4  
ATOM   2173  N  N    . SER A 1 24 ? 7.805   -2.833  -4.841  1.00 0.00 ? 552 SER A N    4  
ATOM   2174  C  CA   . SER A 1 24 ? 9.068   -2.154  -4.574  1.00 0.00 ? 552 SER A CA   4  
ATOM   2175  C  C    . SER A 1 24 ? 8.823   -0.771  -3.978  1.00 0.00 ? 552 SER A C    4  
ATOM   2176  O  O    . SER A 1 24 ? 9.602   -0.292  -3.155  1.00 0.00 ? 552 SER A O    4  
ATOM   2177  C  CB   . SER A 1 24 ? 9.888   -2.030  -5.860  1.00 0.00 ? 552 SER A CB   4  
ATOM   2178  O  OG   . SER A 1 24 ? 10.412  -3.287  -6.253  1.00 0.00 ? 552 SER A OG   4  
ATOM   2179  H  H    . SER A 1 24 ? 7.599   -3.119  -5.756  1.00 0.00 ? 552 SER A H    4  
ATOM   2180  H  HA   . SER A 1 24 ? 9.620   -2.747  -3.861  1.00 0.00 ? 552 SER A HA   4  
ATOM   2181  H  HB2  . SER A 1 24 ? 9.257   -1.654  -6.652  1.00 0.00 ? 552 SER A HB2  4  
ATOM   2182  H  HB3  . SER A 1 24 ? 10.708  -1.346  -5.697  1.00 0.00 ? 552 SER A HB3  4  
ATOM   2183  H  HG   . SER A 1 24 ? 11.359  -3.209  -6.395  1.00 0.00 ? 552 SER A HG   4  
ATOM   2184  N  N    . HIS A 1 25 ? 7.733   -0.138  -4.398  1.00 0.00 ? 553 HIS A N    4  
ATOM   2185  C  CA   . HIS A 1 25 ? 7.382   1.188   -3.904  1.00 0.00 ? 553 HIS A CA   4  
ATOM   2186  C  C    . HIS A 1 25 ? 6.855   1.110   -2.475  1.00 0.00 ? 553 HIS A C    4  
ATOM   2187  O  O    . HIS A 1 25 ? 6.996   2.055   -1.698  1.00 0.00 ? 553 HIS A O    4  
ATOM   2188  C  CB   . HIS A 1 25 ? 6.334   1.835   -4.812  1.00 0.00 ? 553 HIS A CB   4  
ATOM   2189  C  CG   . HIS A 1 25 ? 6.890   2.317   -6.116  1.00 0.00 ? 553 HIS A CG   4  
ATOM   2190  N  ND1  . HIS A 1 25 ? 7.561   1.512   -7.009  1.00 0.00 ? 553 HIS A ND1  4  
ATOM   2191  C  CD2  . HIS A 1 25 ? 6.862   3.554   -6.675  1.00 0.00 ? 553 HIS A CD2  4  
ATOM   2192  C  CE1  . HIS A 1 25 ? 7.915   2.267   -8.058  1.00 0.00 ? 553 HIS A CE1  4  
ATOM   2193  N  NE2  . HIS A 1 25 ? 7.513   3.514   -7.905  1.00 0.00 ? 553 HIS A NE2  4  
ATOM   2194  H  H    . HIS A 1 25 ? 7.149   -0.573  -5.054  1.00 0.00 ? 553 HIS A H    4  
ATOM   2195  H  HA   . HIS A 1 25 ? 8.276   1.792   -3.911  1.00 0.00 ? 553 HIS A HA   4  
ATOM   2196  H  HB2  . HIS A 1 25 ? 5.560   1.115   -5.027  1.00 0.00 ? 553 HIS A HB2  4  
ATOM   2197  H  HB3  . HIS A 1 25 ? 5.899   2.682   -4.302  1.00 0.00 ? 553 HIS A HB3  4  
ATOM   2198  H  HD1  . HIS A 1 25 ? 7.748   0.556   -6.897  1.00 0.00 ? 553 HIS A HD1  4  
ATOM   2199  H  HD2  . HIS A 1 25 ? 6.411   4.434   -6.243  1.00 0.00 ? 553 HIS A HD2  4  
ATOM   2200  H  HE1  . HIS A 1 25 ? 8.457   1.902   -8.918  1.00 0.00 ? 553 HIS A HE1  4  
ATOM   2201  N  N    . LEU A 1 26 ? 6.250   -0.025  -2.132  1.00 0.00 ? 554 LEU A N    4  
ATOM   2202  C  CA   . LEU A 1 26 ? 5.706   -0.227  -0.794  1.00 0.00 ? 554 LEU A CA   4  
ATOM   2203  C  C    . LEU A 1 26 ? 6.788   -0.028  0.264   1.00 0.00 ? 554 LEU A C    4  
ATOM   2204  O  O    . LEU A 1 26 ? 6.554   0.599   1.297   1.00 0.00 ? 554 LEU A O    4  
ATOM   2205  C  CB   . LEU A 1 26 ? 5.103   -1.629  -0.671  1.00 0.00 ? 554 LEU A CB   4  
ATOM   2206  C  CG   . LEU A 1 26 ? 3.690   -1.677  -0.088  1.00 0.00 ? 554 LEU A CG   4  
ATOM   2207  C  CD1  . LEU A 1 26 ? 2.653   -1.649  -1.200  1.00 0.00 ? 554 LEU A CD1  4  
ATOM   2208  C  CD2  . LEU A 1 26 ? 3.512   -2.916  0.777   1.00 0.00 ? 554 LEU A CD2  4  
ATOM   2209  H  H    . LEU A 1 26 ? 6.170   -0.743  -2.794  1.00 0.00 ? 554 LEU A H    4  
ATOM   2210  H  HA   . LEU A 1 26 ? 4.928   0.505   -0.638  1.00 0.00 ? 554 LEU A HA   4  
ATOM   2211  H  HB2  . LEU A 1 26 ? 5.079   -2.074  -1.656  1.00 0.00 ? 554 LEU A HB2  4  
ATOM   2212  H  HB3  . LEU A 1 26 ? 5.749   -2.225  -0.042  1.00 0.00 ? 554 LEU A HB3  4  
ATOM   2213  H  HG   . LEU A 1 26 ? 3.535   -0.808  0.535   1.00 0.00 ? 554 LEU A HG   4  
ATOM   2214  H  HD11 . LEU A 1 26 ? 2.834   -0.798  -1.840  1.00 0.00 ? 554 LEU A HD11 4  
ATOM   2215  H  HD12 . LEU A 1 26 ? 1.665   -1.572  -0.769  1.00 0.00 ? 554 LEU A HD12 4  
ATOM   2216  H  HD13 . LEU A 1 26 ? 2.722   -2.557  -1.780  1.00 0.00 ? 554 LEU A HD13 4  
ATOM   2217  H  HD21 . LEU A 1 26 ? 4.436   -3.132  1.292   1.00 0.00 ? 554 LEU A HD21 4  
ATOM   2218  H  HD22 . LEU A 1 26 ? 3.244   -3.756  0.153   1.00 0.00 ? 554 LEU A HD22 4  
ATOM   2219  H  HD23 . LEU A 1 26 ? 2.729   -2.741  1.500   1.00 0.00 ? 554 LEU A HD23 4  
ATOM   2220  N  N    . ARG A 1 27 ? 7.974   -0.566  -0.005  1.00 0.00 ? 555 ARG A N    4  
ATOM   2221  C  CA   . ARG A 1 27 ? 9.097   -0.450  0.915   1.00 0.00 ? 555 ARG A CA   4  
ATOM   2222  C  C    . ARG A 1 27 ? 9.407   1.011   1.222   1.00 0.00 ? 555 ARG A C    4  
ATOM   2223  O  O    . ARG A 1 27 ? 9.519   1.401   2.385   1.00 0.00 ? 555 ARG A O    4  
ATOM   2224  C  CB   . ARG A 1 27 ? 10.333  -1.133  0.325   1.00 0.00 ? 555 ARG A CB   4  
ATOM   2225  C  CG   . ARG A 1 27 ? 10.881  -2.244  1.199   1.00 0.00 ? 555 ARG A CG   4  
ATOM   2226  C  CD   . ARG A 1 27 ? 11.889  -3.099  0.449   1.00 0.00 ? 555 ARG A CD   4  
ATOM   2227  N  NE   . ARG A 1 27 ? 12.392  -4.199  1.269   1.00 0.00 ? 555 ARG A NE   4  
ATOM   2228  C  CZ   . ARG A 1 27 ? 12.982  -5.284  0.774   1.00 0.00 ? 555 ARG A CZ   4  
ATOM   2229  N  NH1  . ARG A 1 27 ? 13.145  -5.420  -0.536  1.00 0.00 ? 555 ARG A NH1  4  
ATOM   2230  N  NH2  . ARG A 1 27 ? 13.409  -6.237  1.591   1.00 0.00 ? 555 ARG A NH2  4  
ATOM   2231  H  H    . ARG A 1 27 ? 8.097   -1.054  -0.846  1.00 0.00 ? 555 ARG A H    4  
ATOM   2232  H  HA   . ARG A 1 27 ? 8.826   -0.949  1.833   1.00 0.00 ? 555 ARG A HA   4  
ATOM   2233  H  HB2  . ARG A 1 27 ? 10.073  -1.553  -0.636  1.00 0.00 ? 555 ARG A HB2  4  
ATOM   2234  H  HB3  . ARG A 1 27 ? 11.110  -0.395  0.187   1.00 0.00 ? 555 ARG A HB3  4  
ATOM   2235  H  HG2  . ARG A 1 27 ? 11.363  -1.806  2.059   1.00 0.00 ? 555 ARG A HG2  4  
ATOM   2236  H  HG3  . ARG A 1 27 ? 10.061  -2.868  1.522   1.00 0.00 ? 555 ARG A HG3  4  
ATOM   2237  H  HD2  . ARG A 1 27 ? 11.413  -3.508  -0.430  1.00 0.00 ? 555 ARG A HD2  4  
ATOM   2238  H  HD3  . ARG A 1 27 ? 12.719  -2.476  0.151   1.00 0.00 ? 555 ARG A HD3  4  
ATOM   2239  H  HE   . ARG A 1 27 ? 12.285  -4.124  2.241   1.00 0.00 ? 555 ARG A HE   4  
ATOM   2240  H  HH11 . ARG A 1 27 ? 12.825  -4.705  -1.158  1.00 0.00 ? 555 ARG A HH11 4  
ATOM   2241  H  HH12 . ARG A 1 27 ? 13.589  -6.238  -0.902  1.00 0.00 ? 555 ARG A HH12 4  
ATOM   2242  H  HH21 . ARG A 1 27 ? 13.289  -6.140  2.579   1.00 0.00 ? 555 ARG A HH21 4  
ATOM   2243  H  HH22 . ARG A 1 27 ? 13.852  -7.053  1.219   1.00 0.00 ? 555 ARG A HH22 4  
ATOM   2244  N  N    . ALA A 1 28 ? 9.549   1.814   0.173   1.00 0.00 ? 556 ALA A N    4  
ATOM   2245  C  CA   . ALA A 1 28 ? 9.850   3.230   0.334   1.00 0.00 ? 556 ALA A CA   4  
ATOM   2246  C  C    . ALA A 1 28 ? 8.779   3.931   1.162   1.00 0.00 ? 556 ALA A C    4  
ATOM   2247  O  O    . ALA A 1 28 ? 9.067   4.873   1.898   1.00 0.00 ? 556 ALA A O    4  
ATOM   2248  C  CB   . ALA A 1 28 ? 9.991   3.898   -1.026  1.00 0.00 ? 556 ALA A CB   4  
ATOM   2249  H  H    . ALA A 1 28 ? 9.450   1.445   -0.730  1.00 0.00 ? 556 ALA A H    4  
ATOM   2250  H  HA   . ALA A 1 28 ? 10.797  3.310   0.848   1.00 0.00 ? 556 ALA A HA   4  
ATOM   2251  H  HB1  . ALA A 1 28 ? 9.397   3.363   -1.753  1.00 0.00 ? 556 ALA A HB1  4  
ATOM   2252  H  HB2  . ALA A 1 28 ? 11.028  3.884   -1.328  1.00 0.00 ? 556 ALA A HB2  4  
ATOM   2253  H  HB3  . ALA A 1 28 ? 9.648   4.920   -0.963  1.00 0.00 ? 556 ALA A HB3  4  
ATOM   2254  N  N    . HIS A 1 29 ? 7.541   3.465   1.035   1.00 0.00 ? 557 HIS A N    4  
ATOM   2255  C  CA   . HIS A 1 29 ? 6.428   4.045   1.771   1.00 0.00 ? 557 HIS A CA   4  
ATOM   2256  C  C    . HIS A 1 29 ? 6.423   3.562   3.219   1.00 0.00 ? 557 HIS A C    4  
ATOM   2257  O  O    . HIS A 1 29 ? 6.073   4.309   4.133   1.00 0.00 ? 557 HIS A O    4  
ATOM   2258  C  CB   . HIS A 1 29 ? 5.100   3.690   1.093   1.00 0.00 ? 557 HIS A CB   4  
ATOM   2259  C  CG   . HIS A 1 29 ? 3.893   4.096   1.883   1.00 0.00 ? 557 HIS A CG   4  
ATOM   2260  N  ND1  . HIS A 1 29 ? 3.779   5.295   2.550   1.00 0.00 ? 557 HIS A ND1  4  
ATOM   2261  C  CD2  . HIS A 1 29 ? 2.733   3.428   2.111   1.00 0.00 ? 557 HIS A CD2  4  
ATOM   2262  C  CE1  . HIS A 1 29 ? 2.582   5.318   3.152   1.00 0.00 ? 557 HIS A CE1  4  
ATOM   2263  N  NE2  . HIS A 1 29 ? 1.908   4.209   2.917   1.00 0.00 ? 557 HIS A NE2  4  
ATOM   2264  H  H    . HIS A 1 29 ? 7.372   2.715   0.433   1.00 0.00 ? 557 HIS A H    4  
ATOM   2265  H  HA   . HIS A 1 29 ? 6.552   5.113   1.760   1.00 0.00 ? 557 HIS A HA   4  
ATOM   2266  H  HB2  . HIS A 1 29 ? 5.051   4.185   0.135   1.00 0.00 ? 557 HIS A HB2  4  
ATOM   2267  H  HB3  . HIS A 1 29 ? 5.057   2.621   0.943   1.00 0.00 ? 557 HIS A HB3  4  
ATOM   2268  H  HD1  . HIS A 1 29 ? 4.454   6.005   2.580   1.00 0.00 ? 557 HIS A HD1  4  
ATOM   2269  H  HD2  . HIS A 1 29 ? 2.480   2.448   1.735   1.00 0.00 ? 557 HIS A HD2  4  
ATOM   2270  H  HE1  . HIS A 1 29 ? 2.216   6.138   3.752   1.00 0.00 ? 557 HIS A HE1  4  
ATOM   2271  N  N    . LEU A 1 30 ? 6.811   2.307   3.420   1.00 0.00 ? 558 LEU A N    4  
ATOM   2272  C  CA   . LEU A 1 30 ? 6.847   1.721   4.755   1.00 0.00 ? 558 LEU A CA   4  
ATOM   2273  C  C    . LEU A 1 30 ? 7.797   2.491   5.668   1.00 0.00 ? 558 LEU A C    4  
ATOM   2274  O  O    . LEU A 1 30 ? 7.522   2.670   6.854   1.00 0.00 ? 558 LEU A O    4  
ATOM   2275  C  CB   . LEU A 1 30 ? 7.268   0.251   4.676   1.00 0.00 ? 558 LEU A CB   4  
ATOM   2276  C  CG   . LEU A 1 30 ? 6.216   -0.750  5.155   1.00 0.00 ? 558 LEU A CG   4  
ATOM   2277  C  CD1  . LEU A 1 30 ? 5.760   -0.410  6.565   1.00 0.00 ? 558 LEU A CD1  4  
ATOM   2278  C  CD2  . LEU A 1 30 ? 5.031   -0.774  4.201   1.00 0.00 ? 558 LEU A CD2  4  
ATOM   2279  H  H    . LEU A 1 30 ? 7.075   1.759   2.651   1.00 0.00 ? 558 LEU A H    4  
ATOM   2280  H  HA   . LEU A 1 30 ? 5.850   1.777   5.166   1.00 0.00 ? 558 LEU A HA   4  
ATOM   2281  H  HB2  . LEU A 1 30 ? 7.510   0.023   3.647   1.00 0.00 ? 558 LEU A HB2  4  
ATOM   2282  H  HB3  . LEU A 1 30 ? 8.158   0.117   5.274   1.00 0.00 ? 558 LEU A HB3  4  
ATOM   2283  H  HG   . LEU A 1 30 ? 6.651   -1.739  5.174   1.00 0.00 ? 558 LEU A HG   4  
ATOM   2284  H  HD11 . LEU A 1 30 ? 4.847   0.165   6.519   1.00 0.00 ? 558 LEU A HD11 4  
ATOM   2285  H  HD12 . LEU A 1 30 ? 6.525   0.167   7.062   1.00 0.00 ? 558 LEU A HD12 4  
ATOM   2286  H  HD13 . LEU A 1 30 ? 5.583   -1.322  7.116   1.00 0.00 ? 558 LEU A HD13 4  
ATOM   2287  H  HD21 . LEU A 1 30 ? 4.418   0.100   4.366   1.00 0.00 ? 558 LEU A HD21 4  
ATOM   2288  H  HD22 . LEU A 1 30 ? 4.445   -1.664  4.378   1.00 0.00 ? 558 LEU A HD22 4  
ATOM   2289  H  HD23 . LEU A 1 30 ? 5.389   -0.775  3.182   1.00 0.00 ? 558 LEU A HD23 4  
ATOM   2290  N  N    . ARG A 1 31 ? 8.916   2.943   5.110   1.00 0.00 ? 559 ARG A N    4  
ATOM   2291  C  CA   . ARG A 1 31 ? 9.903   3.691   5.880   1.00 0.00 ? 559 ARG A CA   4  
ATOM   2292  C  C    . ARG A 1 31 ? 9.288   4.956   6.474   1.00 0.00 ? 559 ARG A C    4  
ATOM   2293  O  O    . ARG A 1 31 ? 9.688   5.408   7.547   1.00 0.00 ? 559 ARG A O    4  
ATOM   2294  C  CB   . ARG A 1 31 ? 11.109  4.044   4.999   1.00 0.00 ? 559 ARG A CB   4  
ATOM   2295  C  CG   . ARG A 1 31 ? 10.907  5.281   4.136   1.00 0.00 ? 559 ARG A CG   4  
ATOM   2296  C  CD   . ARG A 1 31 ? 11.706  5.196   2.846   1.00 0.00 ? 559 ARG A CD   4  
ATOM   2297  N  NE   . ARG A 1 31 ? 13.132  5.422   3.069   1.00 0.00 ? 559 ARG A NE   4  
ATOM   2298  C  CZ   . ARG A 1 31 ? 13.651  6.598   3.417   1.00 0.00 ? 559 ARG A CZ   4  
ATOM   2299  N  NH1  . ARG A 1 31 ? 12.865  7.655   3.581   1.00 0.00 ? 559 ARG A NH1  4  
ATOM   2300  N  NH2  . ARG A 1 31 ? 14.958  6.716   3.603   1.00 0.00 ? 559 ARG A NH2  4  
ATOM   2301  H  H    . ARG A 1 31 ? 9.082   2.768   4.160   1.00 0.00 ? 559 ARG A H    4  
ATOM   2302  H  HA   . ARG A 1 31 ? 10.236  3.057   6.688   1.00 0.00 ? 559 ARG A HA   4  
ATOM   2303  H  HB2  . ARG A 1 31 ? 11.965  4.214   5.634   1.00 0.00 ? 559 ARG A HB2  4  
ATOM   2304  H  HB3  . ARG A 1 31 ? 11.318  3.209   4.347   1.00 0.00 ? 559 ARG A HB3  4  
ATOM   2305  H  HG2  . ARG A 1 31 ? 9.859   5.373   3.894   1.00 0.00 ? 559 ARG A HG2  4  
ATOM   2306  H  HG3  . ARG A 1 31 ? 11.228  6.151   4.690   1.00 0.00 ? 559 ARG A HG3  4  
ATOM   2307  H  HD2  . ARG A 1 31 ? 11.571  4.213   2.419   1.00 0.00 ? 559 ARG A HD2  4  
ATOM   2308  H  HD3  . ARG A 1 31 ? 11.335  5.941   2.158   1.00 0.00 ? 559 ARG A HD3  4  
ATOM   2309  H  HE   . ARG A 1 31 ? 13.735  4.658   2.955   1.00 0.00 ? 559 ARG A HE   4  
ATOM   2310  H  HH11 . ARG A 1 31 ? 11.878  7.573   3.443   1.00 0.00 ? 559 ARG A HH11 4  
ATOM   2311  H  HH12 . ARG A 1 31 ? 13.261  8.536   3.843   1.00 0.00 ? 559 ARG A HH12 4  
ATOM   2312  H  HH21 . ARG A 1 31 ? 15.554  5.922   3.481   1.00 0.00 ? 559 ARG A HH21 4  
ATOM   2313  H  HH22 . ARG A 1 31 ? 15.348  7.599   3.864   1.00 0.00 ? 559 ARG A HH22 4  
ATOM   2314  N  N    . TRP A 1 32 ? 8.312   5.520   5.769   1.00 0.00 ? 560 TRP A N    4  
ATOM   2315  C  CA   . TRP A 1 32 ? 7.640   6.731   6.226   1.00 0.00 ? 560 TRP A CA   4  
ATOM   2316  C  C    . TRP A 1 32 ? 6.844   6.464   7.499   1.00 0.00 ? 560 TRP A C    4  
ATOM   2317  O  O    . TRP A 1 32 ? 6.915   7.230   8.460   1.00 0.00 ? 560 TRP A O    4  
ATOM   2318  C  CB   . TRP A 1 32 ? 6.714   7.267   5.133   1.00 0.00 ? 560 TRP A CB   4  
ATOM   2319  C  CG   . TRP A 1 32 ? 6.737   8.760   5.014   1.00 0.00 ? 560 TRP A CG   4  
ATOM   2320  C  CD1  . TRP A 1 32 ? 5.658   9.592   4.923   1.00 0.00 ? 560 TRP A CD1  4  
ATOM   2321  C  CD2  . TRP A 1 32 ? 7.897   9.600   4.973   1.00 0.00 ? 560 TRP A CD2  4  
ATOM   2322  N  NE1  . TRP A 1 32 ? 6.076   10.898  4.828   1.00 0.00 ? 560 TRP A NE1  4  
ATOM   2323  C  CE2  . TRP A 1 32 ? 7.446   10.928  4.857   1.00 0.00 ? 560 TRP A CE2  4  
ATOM   2324  C  CE3  . TRP A 1 32 ? 9.273   9.357   5.025   1.00 0.00 ? 560 TRP A CE3  4  
ATOM   2325  C  CZ2  . TRP A 1 32 ? 8.322   12.009  4.791   1.00 0.00 ? 560 TRP A CZ2  4  
ATOM   2326  C  CZ3  . TRP A 1 32 ? 10.141  10.431  4.959   1.00 0.00 ? 560 TRP A CZ3  4  
ATOM   2327  C  CH2  . TRP A 1 32 ? 9.663   11.742  4.844   1.00 0.00 ? 560 TRP A CH2  4  
ATOM   2328  H  H    . TRP A 1 32 ? 8.037   5.112   4.922   1.00 0.00 ? 560 TRP A H    4  
ATOM   2329  H  HA   . TRP A 1 32 ? 8.398   7.470   6.438   1.00 0.00 ? 560 TRP A HA   4  
ATOM   2330  H  HB2  . TRP A 1 32 ? 7.013   6.853   4.182   1.00 0.00 ? 560 TRP A HB2  4  
ATOM   2331  H  HB3  . TRP A 1 32 ? 5.699   6.964   5.349   1.00 0.00 ? 560 TRP A HB3  4  
ATOM   2332  H  HD1  . TRP A 1 32 ? 4.631   9.259   4.925   1.00 0.00 ? 560 TRP A HD1  4  
ATOM   2333  H  HE1  . TRP A 1 32 ? 5.490   11.679  4.753   1.00 0.00 ? 560 TRP A HE1  4  
ATOM   2334  H  HE3  . TRP A 1 32 ? 9.660   8.353   5.114   1.00 0.00 ? 560 TRP A HE3  4  
ATOM   2335  H  HZ2  . TRP A 1 32 ? 7.970   13.026  4.703   1.00 0.00 ? 560 TRP A HZ2  4  
ATOM   2336  H  HZ3  . TRP A 1 32 ? 11.207  10.263  4.997   1.00 0.00 ? 560 TRP A HZ3  4  
ATOM   2337  H  HH2  . TRP A 1 32 ? 10.378  12.550  4.795   1.00 0.00 ? 560 TRP A HH2  4  
ATOM   2338  N  N    . HIS A 1 33 ? 6.085   5.373   7.498   1.00 0.00 ? 561 HIS A N    4  
ATOM   2339  C  CA   . HIS A 1 33 ? 5.275   5.004   8.652   1.00 0.00 ? 561 HIS A CA   4  
ATOM   2340  C  C    . HIS A 1 33 ? 6.150   4.778   9.881   1.00 0.00 ? 561 HIS A C    4  
ATOM   2341  O  O    . HIS A 1 33 ? 5.736   5.046   11.008  1.00 0.00 ? 561 HIS A O    4  
ATOM   2342  C  CB   . HIS A 1 33 ? 4.463   3.743   8.350   1.00 0.00 ? 561 HIS A CB   4  
ATOM   2343  C  CG   . HIS A 1 33 ? 3.233   4.004   7.537   1.00 0.00 ? 561 HIS A CG   4  
ATOM   2344  N  ND1  . HIS A 1 33 ? 2.026   4.394   8.074   1.00 0.00 ? 561 HIS A ND1  4  
ATOM   2345  C  CD2  . HIS A 1 33 ? 3.038   3.926   6.196   1.00 0.00 ? 561 HIS A CD2  4  
ATOM   2346  C  CE1  . HIS A 1 33 ? 1.155   4.536   7.066   1.00 0.00 ? 561 HIS A CE1  4  
ATOM   2347  N  NE2  . HIS A 1 33 ? 1.719   4.265   5.905   1.00 0.00 ? 561 HIS A NE2  4  
ATOM   2348  H  H    . HIS A 1 33 ? 6.071   4.801   6.701   1.00 0.00 ? 561 HIS A H    4  
ATOM   2349  H  HA   . HIS A 1 33 ? 4.596   5.819   8.854   1.00 0.00 ? 561 HIS A HA   4  
ATOM   2350  H  HB2  . HIS A 1 33 ? 5.081   3.048   7.802   1.00 0.00 ? 561 HIS A HB2  4  
ATOM   2351  H  HB3  . HIS A 1 33 ? 4.157   3.289   9.281   1.00 0.00 ? 561 HIS A HB3  4  
ATOM   2352  H  HD1  . HIS A 1 33 ? 1.837   4.539   9.024   1.00 0.00 ? 561 HIS A HD1  4  
ATOM   2353  H  HD2  . HIS A 1 33 ? 3.780   3.647   5.462   1.00 0.00 ? 561 HIS A HD2  4  
ATOM   2354  H  HE1  . HIS A 1 33 ? 0.124   4.836   7.188   1.00 0.00 ? 561 HIS A HE1  4  
ATOM   2355  N  N    . THR A 1 34 ? 7.362   4.283   9.654   1.00 0.00 ? 562 THR A N    4  
ATOM   2356  C  CA   . THR A 1 34 ? 8.296   4.020   10.743  1.00 0.00 ? 562 THR A CA   4  
ATOM   2357  C  C    . THR A 1 34 ? 8.911   5.318   11.258  1.00 0.00 ? 562 THR A C    4  
ATOM   2358  O  O    . THR A 1 34 ? 9.379   6.147   10.477  1.00 0.00 ? 562 THR A O    4  
ATOM   2359  C  CB   . THR A 1 34 ? 9.400   3.069   10.278  1.00 0.00 ? 562 THR A CB   4  
ATOM   2360  O  OG1  . THR A 1 34 ? 9.765   3.343   8.937   1.00 0.00 ? 562 THR A OG1  4  
ATOM   2361  C  CG2  . THR A 1 34 ? 9.006   1.611   10.358  1.00 0.00 ? 562 THR A CG2  4  
ATOM   2362  H  H    . THR A 1 34 ? 7.636   4.089   8.733   1.00 0.00 ? 562 THR A H    4  
ATOM   2363  H  HA   . THR A 1 34 ? 7.746   3.553   11.546  1.00 0.00 ? 562 THR A HA   4  
ATOM   2364  H  HB   . THR A 1 34 ? 10.271  3.212   10.903  1.00 0.00 ? 562 THR A HB   4  
ATOM   2365  H  HG1  . THR A 1 34 ? 10.681  3.628   8.906   1.00 0.00 ? 562 THR A HG1  4  
ATOM   2366  H  HG21 . THR A 1 34 ? 8.366   1.457   11.215  1.00 0.00 ? 562 THR A HG21 4  
ATOM   2367  H  HG22 . THR A 1 34 ? 9.894   1.003   10.458  1.00 0.00 ? 562 THR A HG22 4  
ATOM   2368  H  HG23 . THR A 1 34 ? 8.477   1.331   9.459   1.00 0.00 ? 562 THR A HG23 4  
ATOM   2369  N  N    . GLY A 1 35 ? 8.906   5.487   12.576  1.00 0.00 ? 563 GLY A N    4  
ATOM   2370  C  CA   . GLY A 1 35 ? 9.465   6.686   13.172  1.00 0.00 ? 563 GLY A CA   4  
ATOM   2371  C  C    . GLY A 1 35 ? 8.536   7.879   13.056  1.00 0.00 ? 563 GLY A C    4  
ATOM   2372  O  O    . GLY A 1 35 ? 8.909   8.913   12.503  1.00 0.00 ? 563 GLY A O    4  
ATOM   2373  H  H    . GLY A 1 35 ? 8.519   4.792   13.148  1.00 0.00 ? 563 GLY A H    4  
ATOM   2374  H  HA2  . GLY A 1 35 ? 9.663   6.497   14.216  1.00 0.00 ? 563 GLY A HA2  4  
ATOM   2375  H  HA3  . GLY A 1 35 ? 10.396  6.920   12.677  1.00 0.00 ? 563 GLY A HA3  4  
ATOM   2376  N  N    . GLU A 1 36 ? 7.323   7.734   13.580  1.00 0.00 ? 564 GLU A N    4  
ATOM   2377  C  CA   . GLU A 1 36 ? 6.337   8.807   13.533  1.00 0.00 ? 564 GLU A CA   4  
ATOM   2378  C  C    . GLU A 1 36 ? 6.769   9.981   14.407  1.00 0.00 ? 564 GLU A C    4  
ATOM   2379  O  O    . GLU A 1 36 ? 6.694   11.137  13.992  1.00 0.00 ? 564 GLU A O    4  
ATOM   2380  C  CB   . GLU A 1 36 ? 4.970   8.290   13.987  1.00 0.00 ? 564 GLU A CB   4  
ATOM   2381  C  CG   . GLU A 1 36 ? 3.837   8.657   13.043  1.00 0.00 ? 564 GLU A CG   4  
ATOM   2382  C  CD   . GLU A 1 36 ? 2.970   9.780   13.579  1.00 0.00 ? 564 GLU A CD   4  
ATOM   2383  O  OE1  . GLU A 1 36 ? 3.510   10.877  13.834  1.00 0.00 ? 564 GLU A OE1  4  
ATOM   2384  O  OE2  . GLU A 1 36 ? 1.752   9.561   13.746  1.00 0.00 ? 564 GLU A OE2  4  
ATOM   2385  H  H    . GLU A 1 36 ? 7.086   6.885   14.008  1.00 0.00 ? 564 GLU A H    4  
ATOM   2386  H  HA   . GLU A 1 36 ? 6.263   9.144   12.510  1.00 0.00 ? 564 GLU A HA   4  
ATOM   2387  H  HB2  . GLU A 1 36 ? 5.012   7.213   14.062  1.00 0.00 ? 564 GLU A HB2  4  
ATOM   2388  H  HB3  . GLU A 1 36 ? 4.745   8.701   14.961  1.00 0.00 ? 564 GLU A HB3  4  
ATOM   2389  H  HG2  . GLU A 1 36 ? 4.259   8.969   12.099  1.00 0.00 ? 564 GLU A HG2  4  
ATOM   2390  H  HG3  . GLU A 1 36 ? 3.217   7.786   12.888  1.00 0.00 ? 564 GLU A HG3  4  
ATOM   2391  N  N    . ARG A 1 37 ? 7.222   9.675   15.619  1.00 0.00 ? 565 ARG A N    4  
ATOM   2392  C  CA   . ARG A 1 37 ? 7.666   10.704  16.552  1.00 0.00 ? 565 ARG A CA   4  
ATOM   2393  C  C    . ARG A 1 37 ? 9.078   10.415  17.050  1.00 0.00 ? 565 ARG A C    4  
ATOM   2394  O  O    . ARG A 1 37 ? 9.249   9.433   17.803  1.00 0.00 ? 565 ARG A O    4  
ATOM   2395  C  CB   . ARG A 1 37 ? 6.703   10.796  17.737  1.00 0.00 ? 565 ARG A CB   4  
ATOM   2396  C  CG   . ARG A 1 37 ? 5.301   11.235  17.349  1.00 0.00 ? 565 ARG A CG   4  
ATOM   2397  C  CD   . ARG A 1 37 ? 4.586   11.908  18.509  1.00 0.00 ? 565 ARG A CD   4  
ATOM   2398  N  NE   . ARG A 1 37 ? 3.163   11.581  18.540  1.00 0.00 ? 565 ARG A NE   4  
ATOM   2399  C  CZ   . ARG A 1 37 ? 2.282   12.179  19.339  1.00 0.00 ? 565 ARG A CZ   4  
ATOM   2400  N  NH1  . ARG A 1 37 ? 2.673   13.133  20.174  1.00 0.00 ? 565 ARG A NH1  4  
ATOM   2401  N  NH2  . ARG A 1 37 ? 1.005   11.821  19.303  1.00 0.00 ? 565 ARG A NH2  4  
ATOM   2402  O  OXT  . ARG A 1 37 ? 10.001  11.172  16.683  1.00 0.00 ? 565 ARG A OXT  4  
ATOM   2403  H  H    . ARG A 1 37 ? 7.258   8.734   15.892  1.00 0.00 ? 565 ARG A H    4  
ATOM   2404  H  HA   . ARG A 1 37 ? 7.668   11.648  16.027  1.00 0.00 ? 565 ARG A HA   4  
ATOM   2405  H  HB2  . ARG A 1 37 ? 6.636   9.826   18.207  1.00 0.00 ? 565 ARG A HB2  4  
ATOM   2406  H  HB3  . ARG A 1 37 ? 7.095   11.506  18.450  1.00 0.00 ? 565 ARG A HB3  4  
ATOM   2407  H  HG2  . ARG A 1 37 ? 5.367   11.933  16.527  1.00 0.00 ? 565 ARG A HG2  4  
ATOM   2408  H  HG3  . ARG A 1 37 ? 4.734   10.368  17.042  1.00 0.00 ? 565 ARG A HG3  4  
ATOM   2409  H  HD2  . ARG A 1 37 ? 5.040   11.581  19.433  1.00 0.00 ? 565 ARG A HD2  4  
ATOM   2410  H  HD3  . ARG A 1 37 ? 4.699   12.978  18.413  1.00 0.00 ? 565 ARG A HD3  4  
ATOM   2411  H  HE   . ARG A 1 37 ? 2.847   10.880  17.933  1.00 0.00 ? 565 ARG A HE   4  
ATOM   2412  H  HH11 . ARG A 1 37 ? 3.634   13.408  20.206  1.00 0.00 ? 565 ARG A HH11 4  
ATOM   2413  H  HH12 . ARG A 1 37 ? 2.006   13.578  20.772  1.00 0.00 ? 565 ARG A HH12 4  
ATOM   2414  H  HH21 . ARG A 1 37 ? 0.705   11.103  18.675  1.00 0.00 ? 565 ARG A HH21 4  
ATOM   2415  H  HH22 . ARG A 1 37 ? 0.343   12.270  19.903  1.00 0.00 ? 565 ARG A HH22 4  
HETATM 2416  ZN ZN   . ZN  B 2 .  ? 0.512   4.536   4.318   1.00 0.00 ? 100 ZN  A ZN   4  
ATOM   2417  N  N    . MET A 1 1  ? -22.871 -11.113 -12.815 1.00 0.00 ? 1   MET A N    5  
ATOM   2418  C  CA   . MET A 1 1  ? -21.756 -12.037 -12.478 1.00 0.00 ? 1   MET A CA   5  
ATOM   2419  C  C    . MET A 1 1  ? -20.545 -11.272 -11.954 1.00 0.00 ? 1   MET A C    5  
ATOM   2420  O  O    . MET A 1 1  ? -20.430 -10.062 -12.151 1.00 0.00 ? 1   MET A O    5  
ATOM   2421  C  CB   . MET A 1 1  ? -21.380 -12.824 -13.735 1.00 0.00 ? 1   MET A CB   5  
ATOM   2422  C  CG   . MET A 1 1  ? -22.498 -13.713 -14.254 1.00 0.00 ? 1   MET A CG   5  
ATOM   2423  S  SD   . MET A 1 1  ? -23.467 -12.922 -15.553 1.00 0.00 ? 1   MET A SD   5  
ATOM   2424  C  CE   . MET A 1 1  ? -23.158 -14.029 -16.927 1.00 0.00 ? 1   MET A CE   5  
ATOM   2425  H  H1   . MET A 1 1  ? -22.639 -10.653 -13.718 1.00 0.00 ? 1   MET A H1   5  
ATOM   2426  H  H2   . MET A 1 1  ? -22.947 -10.416 -12.047 1.00 0.00 ? 1   MET A H2   5  
ATOM   2427  H  H3   . MET A 1 1  ? -23.739 -11.679 -12.897 1.00 0.00 ? 1   MET A H3   5  
ATOM   2428  H  HA   . MET A 1 1  ? -22.097 -12.723 -11.717 1.00 0.00 ? 1   MET A HA   5  
ATOM   2429  H  HB2  . MET A 1 1  ? -21.112 -12.126 -14.515 1.00 0.00 ? 1   MET A HB2  5  
ATOM   2430  H  HB3  . MET A 1 1  ? -20.527 -13.447 -13.513 1.00 0.00 ? 1   MET A HB3  5  
ATOM   2431  H  HG2  . MET A 1 1  ? -22.065 -14.619 -14.650 1.00 0.00 ? 1   MET A HG2  5  
ATOM   2432  H  HG3  . MET A 1 1  ? -23.155 -13.959 -13.433 1.00 0.00 ? 1   MET A HG3  5  
ATOM   2433  H  HE1  . MET A 1 1  ? -22.099 -14.225 -17.000 1.00 0.00 ? 1   MET A HE1  5  
ATOM   2434  H  HE2  . MET A 1 1  ? -23.504 -13.571 -17.843 1.00 0.00 ? 1   MET A HE2  5  
ATOM   2435  H  HE3  . MET A 1 1  ? -23.687 -14.957 -16.767 1.00 0.00 ? 1   MET A HE3  5  
ATOM   2436  N  N    . ASP A 1 2  ? -19.644 -11.985 -11.287 1.00 0.00 ? 530 ASP A N    5  
ATOM   2437  C  CA   . ASP A 1 2  ? -18.441 -11.374 -10.734 1.00 0.00 ? 530 ASP A CA   5  
ATOM   2438  C  C    . ASP A 1 2  ? -17.417 -11.097 -11.834 1.00 0.00 ? 530 ASP A C    5  
ATOM   2439  O  O    . ASP A 1 2  ? -16.877 -12.026 -12.435 1.00 0.00 ? 530 ASP A O    5  
ATOM   2440  C  CB   . ASP A 1 2  ? -17.826 -12.285 -9.670  1.00 0.00 ? 530 ASP A CB   5  
ATOM   2441  C  CG   . ASP A 1 2  ? -16.848 -11.549 -8.775  1.00 0.00 ? 530 ASP A CG   5  
ATOM   2442  O  OD1  . ASP A 1 2  ? -15.663 -11.441 -9.153  1.00 0.00 ? 530 ASP A OD1  5  
ATOM   2443  O  OD2  . ASP A 1 2  ? -17.268 -11.082 -7.695  1.00 0.00 ? 530 ASP A OD2  5  
ATOM   2444  H  H    . ASP A 1 2  ? -19.792 -12.946 -11.163 1.00 0.00 ? 530 ASP A H    5  
ATOM   2445  H  HA   . ASP A 1 2  ? -18.726 -10.441 -10.274 1.00 0.00 ? 530 ASP A HA   5  
ATOM   2446  H  HB2  . ASP A 1 2  ? -18.614 -12.691 -9.053  1.00 0.00 ? 530 ASP A HB2  5  
ATOM   2447  H  HB3  . ASP A 1 2  ? -17.302 -13.094 -10.157 1.00 0.00 ? 530 ASP A HB3  5  
ATOM   2448  N  N    . PRO A 1 3  ? -17.132 -9.811  -12.116 1.00 0.00 ? 531 PRO A N    5  
ATOM   2449  C  CA   . PRO A 1 3  ? -16.165 -9.430  -13.151 1.00 0.00 ? 531 PRO A CA   5  
ATOM   2450  C  C    . PRO A 1 3  ? -14.816 -10.116 -12.963 1.00 0.00 ? 531 PRO A C    5  
ATOM   2451  O  O    . PRO A 1 3  ? -14.129 -10.432 -13.934 1.00 0.00 ? 531 PRO A O    5  
ATOM   2452  C  CB   . PRO A 1 3  ? -16.025 -7.917  -12.970 1.00 0.00 ? 531 PRO A CB   5  
ATOM   2453  C  CG   . PRO A 1 3  ? -17.302 -7.491  -12.334 1.00 0.00 ? 531 PRO A CG   5  
ATOM   2454  C  CD   . PRO A 1 3  ? -17.725 -8.634  -11.454 1.00 0.00 ? 531 PRO A CD   5  
ATOM   2455  H  HA   . PRO A 1 3  ? -16.541 -9.644  -14.141 1.00 0.00 ? 531 PRO A HA   5  
ATOM   2456  H  HB2  . PRO A 1 3  ? -15.176 -7.705  -12.335 1.00 0.00 ? 531 PRO A HB2  5  
ATOM   2457  H  HB3  . PRO A 1 3  ? -15.888 -7.447  -13.932 1.00 0.00 ? 531 PRO A HB3  5  
ATOM   2458  H  HG2  . PRO A 1 3  ? -17.140 -6.602  -11.743 1.00 0.00 ? 531 PRO A HG2  5  
ATOM   2459  H  HG3  . PRO A 1 3  ? -18.047 -7.308  -13.093 1.00 0.00 ? 531 PRO A HG3  5  
ATOM   2460  H  HD2  . PRO A 1 3  ? -17.326 -8.510  -10.457 1.00 0.00 ? 531 PRO A HD2  5  
ATOM   2461  H  HD3  . PRO A 1 3  ? -18.801 -8.709  -11.424 1.00 0.00 ? 531 PRO A HD3  5  
ATOM   2462  N  N    . GLY A 1 4  ? -14.444 -10.343 -11.708 1.00 0.00 ? 532 GLY A N    5  
ATOM   2463  C  CA   . GLY A 1 4  ? -13.178 -10.990 -11.415 1.00 0.00 ? 532 GLY A CA   5  
ATOM   2464  C  C    . GLY A 1 4  ? -12.424 -10.306 -10.292 1.00 0.00 ? 532 GLY A C    5  
ATOM   2465  O  O    . GLY A 1 4  ? -13.003 -9.540  -9.522  1.00 0.00 ? 532 GLY A O    5  
ATOM   2466  H  H    . GLY A 1 4  ? -15.033 -10.069 -10.974 1.00 0.00 ? 532 GLY A H    5  
ATOM   2467  H  HA2  . GLY A 1 4  ? -13.367 -12.016 -11.135 1.00 0.00 ? 532 GLY A HA2  5  
ATOM   2468  H  HA3  . GLY A 1 4  ? -12.566 -10.978 -12.305 1.00 0.00 ? 532 GLY A HA3  5  
ATOM   2469  N  N    . LYS A 1 5  ? -11.127 -10.584 -10.198 1.00 0.00 ? 533 LYS A N    5  
ATOM   2470  C  CA   . LYS A 1 5  ? -10.292 -9.990  -9.160  1.00 0.00 ? 533 LYS A CA   5  
ATOM   2471  C  C    . LYS A 1 5  ? -9.151  -9.184  -9.773  1.00 0.00 ? 533 LYS A C    5  
ATOM   2472  O  O    . LYS A 1 5  ? -8.584  -9.570  -10.795 1.00 0.00 ? 533 LYS A O    5  
ATOM   2473  C  CB   . LYS A 1 5  ? -9.729  -11.078 -8.245  1.00 0.00 ? 533 LYS A CB   5  
ATOM   2474  C  CG   . LYS A 1 5  ? -9.501  -10.614 -6.816  1.00 0.00 ? 533 LYS A CG   5  
ATOM   2475  C  CD   . LYS A 1 5  ? -8.675  -11.619 -6.029  1.00 0.00 ? 533 LYS A CD   5  
ATOM   2476  C  CE   . LYS A 1 5  ? -8.577  -11.235 -4.561  1.00 0.00 ? 533 LYS A CE   5  
ATOM   2477  N  NZ   . LYS A 1 5  ? -7.753  -12.205 -3.789  1.00 0.00 ? 533 LYS A NZ   5  
ATOM   2478  H  H    . LYS A 1 5  ? -10.723 -11.203 -10.841 1.00 0.00 ? 533 LYS A H    5  
ATOM   2479  H  HA   . LYS A 1 5  ? -10.911 -9.326  -8.575  1.00 0.00 ? 533 LYS A HA   5  
ATOM   2480  H  HB2  . LYS A 1 5  ? -10.420 -11.908 -8.225  1.00 0.00 ? 533 LYS A HB2  5  
ATOM   2481  H  HB3  . LYS A 1 5  ? -8.785  -11.417 -8.646  1.00 0.00 ? 533 LYS A HB3  5  
ATOM   2482  H  HG2  . LYS A 1 5  ? -8.978  -9.669  -6.833  1.00 0.00 ? 533 LYS A HG2  5  
ATOM   2483  H  HG3  . LYS A 1 5  ? -10.458 -10.489 -6.331  1.00 0.00 ? 533 LYS A HG3  5  
ATOM   2484  H  HD2  . LYS A 1 5  ? -9.140  -12.591 -6.106  1.00 0.00 ? 533 LYS A HD2  5  
ATOM   2485  H  HD3  . LYS A 1 5  ? -7.680  -11.659 -6.449  1.00 0.00 ? 533 LYS A HD3  5  
ATOM   2486  H  HE2  . LYS A 1 5  ? -8.128  -10.256 -4.487  1.00 0.00 ? 533 LYS A HE2  5  
ATOM   2487  H  HE3  . LYS A 1 5  ? -9.572  -11.207 -4.142  1.00 0.00 ? 533 LYS A HE3  5  
ATOM   2488  H  HZ1  . LYS A 1 5  ? -7.093  -12.698 -4.424  1.00 0.00 ? 533 LYS A HZ1  5  
ATOM   2489  H  HZ2  . LYS A 1 5  ? -8.366  -12.909 -3.330  1.00 0.00 ? 533 LYS A HZ2  5  
ATOM   2490  H  HZ3  . LYS A 1 5  ? -7.207  -11.707 -3.057  1.00 0.00 ? 533 LYS A HZ3  5  
ATOM   2491  N  N    . LYS A 1 6  ? -8.819  -8.063  -9.141  1.00 0.00 ? 534 LYS A N    5  
ATOM   2492  C  CA   . LYS A 1 6  ? -7.746  -7.201  -9.623  1.00 0.00 ? 534 LYS A CA   5  
ATOM   2493  C  C    . LYS A 1 6  ? -6.684  -7.000  -8.546  1.00 0.00 ? 534 LYS A C    5  
ATOM   2494  O  O    . LYS A 1 6  ? -7.005  -6.808  -7.373  1.00 0.00 ? 534 LYS A O    5  
ATOM   2495  C  CB   . LYS A 1 6  ? -8.309  -5.847  -10.058 1.00 0.00 ? 534 LYS A CB   5  
ATOM   2496  C  CG   . LYS A 1 6  ? -7.493  -5.169  -11.146 1.00 0.00 ? 534 LYS A CG   5  
ATOM   2497  C  CD   . LYS A 1 6  ? -6.549  -4.126  -10.569 1.00 0.00 ? 534 LYS A CD   5  
ATOM   2498  C  CE   . LYS A 1 6  ? -7.093  -2.719  -10.754 1.00 0.00 ? 534 LYS A CE   5  
ATOM   2499  N  NZ   . LYS A 1 6  ? -8.342  -2.500  -9.973  1.00 0.00 ? 534 LYS A NZ   5  
ATOM   2500  H  H    . LYS A 1 6  ? -9.309  -7.809  -8.331  1.00 0.00 ? 534 LYS A H    5  
ATOM   2501  H  HA   . LYS A 1 6  ? -7.291  -7.682  -10.475 1.00 0.00 ? 534 LYS A HA   5  
ATOM   2502  H  HB2  . LYS A 1 6  ? -9.314  -5.990  -10.428 1.00 0.00 ? 534 LYS A HB2  5  
ATOM   2503  H  HB3  . LYS A 1 6  ? -8.341  -5.191  -9.200  1.00 0.00 ? 534 LYS A HB3  5  
ATOM   2504  H  HG2  . LYS A 1 6  ? -6.912  -5.916  -11.666 1.00 0.00 ? 534 LYS A HG2  5  
ATOM   2505  H  HG3  . LYS A 1 6  ? -8.166  -4.687  -11.840 1.00 0.00 ? 534 LYS A HG3  5  
ATOM   2506  H  HD2  . LYS A 1 6  ? -6.420  -4.316  -9.514  1.00 0.00 ? 534 LYS A HD2  5  
ATOM   2507  H  HD3  . LYS A 1 6  ? -5.594  -4.202  -11.069 1.00 0.00 ? 534 LYS A HD3  5  
ATOM   2508  H  HE2  . LYS A 1 6  ? -6.346  -2.011  -10.426 1.00 0.00 ? 534 LYS A HE2  5  
ATOM   2509  H  HE3  . LYS A 1 6  ? -7.302  -2.563  -11.802 1.00 0.00 ? 534 LYS A HE3  5  
ATOM   2510  H  HZ1  . LYS A 1 6  ? -9.174  -2.672  -10.573 1.00 0.00 ? 534 LYS A HZ1  5  
ATOM   2511  H  HZ2  . LYS A 1 6  ? -8.378  -1.522  -9.622  1.00 0.00 ? 534 LYS A HZ2  5  
ATOM   2512  H  HZ3  . LYS A 1 6  ? -8.374  -3.149  -9.160  1.00 0.00 ? 534 LYS A HZ3  5  
ATOM   2513  N  N    . LYS A 1 7  ? -5.420  -7.047  -8.953  1.00 0.00 ? 535 LYS A N    5  
ATOM   2514  C  CA   . LYS A 1 7  ? -4.310  -6.870  -8.023  1.00 0.00 ? 535 LYS A CA   5  
ATOM   2515  C  C    . LYS A 1 7  ? -4.105  -5.394  -7.695  1.00 0.00 ? 535 LYS A C    5  
ATOM   2516  O  O    . LYS A 1 7  ? -3.803  -4.588  -8.576  1.00 0.00 ? 535 LYS A O    5  
ATOM   2517  C  CB   . LYS A 1 7  ? -3.026  -7.459  -8.611  1.00 0.00 ? 535 LYS A CB   5  
ATOM   2518  C  CG   . LYS A 1 7  ? -2.246  -8.319  -7.629  1.00 0.00 ? 535 LYS A CG   5  
ATOM   2519  C  CD   . LYS A 1 7  ? -0.822  -8.557  -8.107  1.00 0.00 ? 535 LYS A CD   5  
ATOM   2520  C  CE   . LYS A 1 7  ? -0.165  -9.700  -7.351  1.00 0.00 ? 535 LYS A CE   5  
ATOM   2521  N  NZ   . LYS A 1 7  ? -0.968  -10.952 -7.429  1.00 0.00 ? 535 LYS A NZ   5  
ATOM   2522  H  H    . LYS A 1 7  ? -5.228  -7.204  -9.901  1.00 0.00 ? 535 LYS A H    5  
ATOM   2523  H  HA   . LYS A 1 7  ? -4.554  -7.397  -7.113  1.00 0.00 ? 535 LYS A HA   5  
ATOM   2524  H  HB2  . LYS A 1 7  ? -3.282  -8.069  -9.465  1.00 0.00 ? 535 LYS A HB2  5  
ATOM   2525  H  HB3  . LYS A 1 7  ? -2.387  -6.652  -8.936  1.00 0.00 ? 535 LYS A HB3  5  
ATOM   2526  H  HG2  . LYS A 1 7  ? -2.215  -7.819  -6.673  1.00 0.00 ? 535 LYS A HG2  5  
ATOM   2527  H  HG3  . LYS A 1 7  ? -2.745  -9.271  -7.524  1.00 0.00 ? 535 LYS A HG3  5  
ATOM   2528  H  HD2  . LYS A 1 7  ? -0.841  -8.798  -9.159  1.00 0.00 ? 535 LYS A HD2  5  
ATOM   2529  H  HD3  . LYS A 1 7  ? -0.246  -7.656  -7.952  1.00 0.00 ? 535 LYS A HD3  5  
ATOM   2530  H  HE2  . LYS A 1 7  ? 0.810   -9.883  -7.777  1.00 0.00 ? 535 LYS A HE2  5  
ATOM   2531  H  HE3  . LYS A 1 7  ? -0.057  -9.415  -6.315  1.00 0.00 ? 535 LYS A HE3  5  
ATOM   2532  H  HZ1  . LYS A 1 7  ? -1.801  -10.882 -6.810  1.00 0.00 ? 535 LYS A HZ1  5  
ATOM   2533  H  HZ2  . LYS A 1 7  ? -0.394  -11.765 -7.127  1.00 0.00 ? 535 LYS A HZ2  5  
ATOM   2534  H  HZ3  . LYS A 1 7  ? -1.288  -11.112 -8.406  1.00 0.00 ? 535 LYS A HZ3  5  
ATOM   2535  N  N    . GLN A 1 8  ? -4.272  -5.046  -6.423  1.00 0.00 ? 536 GLN A N    5  
ATOM   2536  C  CA   . GLN A 1 8  ? -4.105  -3.668  -5.978  1.00 0.00 ? 536 GLN A CA   5  
ATOM   2537  C  C    . GLN A 1 8  ? -3.258  -3.604  -4.711  1.00 0.00 ? 536 GLN A C    5  
ATOM   2538  O  O    . GLN A 1 8  ? -3.288  -4.517  -3.886  1.00 0.00 ? 536 GLN A O    5  
ATOM   2539  C  CB   . GLN A 1 8  ? -5.470  -3.023  -5.727  1.00 0.00 ? 536 GLN A CB   5  
ATOM   2540  C  CG   . GLN A 1 8  ? -6.039  -2.310  -6.943  1.00 0.00 ? 536 GLN A CG   5  
ATOM   2541  C  CD   . GLN A 1 8  ? -7.139  -1.331  -6.582  1.00 0.00 ? 536 GLN A CD   5  
ATOM   2542  O  OE1  . GLN A 1 8  ? -6.954  -0.116  -6.657  1.00 0.00 ? 536 GLN A OE1  5  
ATOM   2543  N  NE2  . GLN A 1 8  ? -8.293  -1.857  -6.188  1.00 0.00 ? 536 GLN A NE2  5  
ATOM   2544  H  H    . GLN A 1 8  ? -4.513  -5.734  -5.768  1.00 0.00 ? 536 GLN A H    5  
ATOM   2545  H  HA   . GLN A 1 8  ? -3.599  -3.125  -6.763  1.00 0.00 ? 536 GLN A HA   5  
ATOM   2546  H  HB2  . GLN A 1 8  ? -6.168  -3.790  -5.427  1.00 0.00 ? 536 GLN A HB2  5  
ATOM   2547  H  HB3  . GLN A 1 8  ? -5.374  -2.304  -4.927  1.00 0.00 ? 536 GLN A HB3  5  
ATOM   2548  H  HG2  . GLN A 1 8  ? -5.243  -1.768  -7.432  1.00 0.00 ? 536 GLN A HG2  5  
ATOM   2549  H  HG3  . GLN A 1 8  ? -6.441  -3.048  -7.621  1.00 0.00 ? 536 GLN A HG3  5  
ATOM   2550  H  HE21 . GLN A 1 8  ? -8.369  -2.833  -6.153  1.00 0.00 ? 536 GLN A HE21 5  
ATOM   2551  H  HE22 . GLN A 1 8  ? -9.022  -1.247  -5.947  1.00 0.00 ? 536 GLN A HE22 5  
ATOM   2552  N  N    . HIS A 1 9  ? -2.504  -2.519  -4.563  1.00 0.00 ? 537 HIS A N    5  
ATOM   2553  C  CA   . HIS A 1 9  ? -1.649  -2.335  -3.396  1.00 0.00 ? 537 HIS A CA   5  
ATOM   2554  C  C    . HIS A 1 9  ? -2.238  -1.295  -2.448  1.00 0.00 ? 537 HIS A C    5  
ATOM   2555  O  O    . HIS A 1 9  ? -2.430  -0.138  -2.821  1.00 0.00 ? 537 HIS A O    5  
ATOM   2556  C  CB   . HIS A 1 9  ? -0.245  -1.909  -3.830  1.00 0.00 ? 537 HIS A CB   5  
ATOM   2557  C  CG   . HIS A 1 9  ? 0.567   -3.028  -4.405  1.00 0.00 ? 537 HIS A CG   5  
ATOM   2558  N  ND1  . HIS A 1 9  ? 0.033   -4.074  -5.123  1.00 0.00 ? 537 HIS A ND1  5  
ATOM   2559  C  CD2  . HIS A 1 9  ? 1.905   -3.253  -4.355  1.00 0.00 ? 537 HIS A CD2  5  
ATOM   2560  C  CE1  . HIS A 1 9  ? 1.039   -4.884  -5.479  1.00 0.00 ? 537 HIS A CE1  5  
ATOM   2561  N  NE2  . HIS A 1 9  ? 2.196   -4.430  -5.038  1.00 0.00 ? 537 HIS A NE2  5  
ATOM   2562  H  H    . HIS A 1 9  ? -2.524  -1.825  -5.255  1.00 0.00 ? 537 HIS A H    5  
ATOM   2563  H  HA   . HIS A 1 9  ? -1.585  -3.281  -2.879  1.00 0.00 ? 537 HIS A HA   5  
ATOM   2564  H  HB2  . HIS A 1 9  ? -0.326  -1.139  -4.582  1.00 0.00 ? 537 HIS A HB2  5  
ATOM   2565  H  HB3  . HIS A 1 9  ? 0.286   -1.517  -2.975  1.00 0.00 ? 537 HIS A HB3  5  
ATOM   2566  H  HD1  . HIS A 1 9  ? -0.915  -4.202  -5.337  1.00 0.00 ? 537 HIS A HD1  5  
ATOM   2567  H  HD2  . HIS A 1 9  ? 2.636   -2.625  -3.867  1.00 0.00 ? 537 HIS A HD2  5  
ATOM   2568  H  HE1  . HIS A 1 9  ? 0.918   -5.791  -6.053  1.00 0.00 ? 537 HIS A HE1  5  
ATOM   2569  N  N    . ILE A 1 10 ? -2.524  -1.715  -1.220  1.00 0.00 ? 538 ILE A N    5  
ATOM   2570  C  CA   . ILE A 1 10 ? -3.092  -0.820  -0.220  1.00 0.00 ? 538 ILE A CA   5  
ATOM   2571  C  C    . ILE A 1 10 ? -2.330  -0.912  1.098   1.00 0.00 ? 538 ILE A C    5  
ATOM   2572  O  O    . ILE A 1 10 ? -1.663  -1.910  1.372   1.00 0.00 ? 538 ILE A O    5  
ATOM   2573  C  CB   . ILE A 1 10 ? -4.578  -1.137  0.035   1.00 0.00 ? 538 ILE A CB   5  
ATOM   2574  C  CG1  . ILE A 1 10 ? -5.337  -1.233  -1.290  1.00 0.00 ? 538 ILE A CG1  5  
ATOM   2575  C  CG2  . ILE A 1 10 ? -5.199  -0.077  0.933   1.00 0.00 ? 538 ILE A CG2  5  
ATOM   2576  C  CD1  . ILE A 1 10 ? -5.386  0.072   -2.055  1.00 0.00 ? 538 ILE A CD1  5  
ATOM   2577  H  H    . ILE A 1 10 ? -2.350  -2.649  -0.981  1.00 0.00 ? 538 ILE A H    5  
ATOM   2578  H  HA   . ILE A 1 10 ? -3.020  0.190   -0.596  1.00 0.00 ? 538 ILE A HA   5  
ATOM   2579  H  HB   . ILE A 1 10 ? -4.638  -2.086  0.546   1.00 0.00 ? 538 ILE A HB   5  
ATOM   2580  H  HG12 . ILE A 1 10 ? -4.857  -1.967  -1.919  1.00 0.00 ? 538 ILE A HG12 5  
ATOM   2581  H  HG13 . ILE A 1 10 ? -6.353  -1.543  -1.093  1.00 0.00 ? 538 ILE A HG13 5  
ATOM   2582  H  HG21 . ILE A 1 10 ? -4.772  -0.147  1.922   1.00 0.00 ? 538 ILE A HG21 5  
ATOM   2583  H  HG22 . ILE A 1 10 ? -6.266  -0.233  0.990   1.00 0.00 ? 538 ILE A HG22 5  
ATOM   2584  H  HG23 . ILE A 1 10 ? -5.000  0.902   0.523   1.00 0.00 ? 538 ILE A HG23 5  
ATOM   2585  H  HD11 . ILE A 1 10 ? -4.614  0.733   -1.691  1.00 0.00 ? 538 ILE A HD11 5  
ATOM   2586  H  HD12 . ILE A 1 10 ? -6.352  0.534   -1.916  1.00 0.00 ? 538 ILE A HD12 5  
ATOM   2587  H  HD13 . ILE A 1 10 ? -5.228  -0.121  -3.106  1.00 0.00 ? 538 ILE A HD13 5  
ATOM   2588  N  N    . CYS A 1 11 ? -2.434  0.134   1.911   1.00 0.00 ? 539 CYS A N    5  
ATOM   2589  C  CA   . CYS A 1 11 ? -1.753  0.170   3.201   1.00 0.00 ? 539 CYS A CA   5  
ATOM   2590  C  C    . CYS A 1 11 ? -2.333  -0.871  4.151   1.00 0.00 ? 539 CYS A C    5  
ATOM   2591  O  O    . CYS A 1 11 ? -3.460  -0.734  4.625   1.00 0.00 ? 539 CYS A O    5  
ATOM   2592  C  CB   . CYS A 1 11 ? -1.868  1.562   3.826   1.00 0.00 ? 539 CYS A CB   5  
ATOM   2593  S  SG   . CYS A 1 11 ? -0.530  1.968   4.972   1.00 0.00 ? 539 CYS A SG   5  
ATOM   2594  H  H    . CYS A 1 11 ? -2.980  0.901   1.637   1.00 0.00 ? 539 CYS A H    5  
ATOM   2595  H  HA   . CYS A 1 11 ? -0.711  -0.054  3.032   1.00 0.00 ? 539 CYS A HA   5  
ATOM   2596  H  HB2  . CYS A 1 11 ? -1.863  2.304   3.041   1.00 0.00 ? 539 CYS A HB2  5  
ATOM   2597  H  HB3  . CYS A 1 11 ? -2.799  1.628   4.370   1.00 0.00 ? 539 CYS A HB3  5  
ATOM   2598  N  N    . HIS A 1 12 ? -1.553  -1.911  4.430   1.00 0.00 ? 540 HIS A N    5  
ATOM   2599  C  CA   . HIS A 1 12 ? -1.989  -2.973  5.329   1.00 0.00 ? 540 HIS A CA   5  
ATOM   2600  C  C    . HIS A 1 12 ? -2.351  -2.406  6.699   1.00 0.00 ? 540 HIS A C    5  
ATOM   2601  O  O    . HIS A 1 12 ? -3.176  -2.969  7.418   1.00 0.00 ? 540 HIS A O    5  
ATOM   2602  C  CB   . HIS A 1 12 ? -0.892  -4.031  5.472   1.00 0.00 ? 540 HIS A CB   5  
ATOM   2603  C  CG   . HIS A 1 12 ? -1.236  -5.343  4.836   1.00 0.00 ? 540 HIS A CG   5  
ATOM   2604  N  ND1  . HIS A 1 12 ? -2.521  -5.825  4.717   1.00 0.00 ? 540 HIS A ND1  5  
ATOM   2605  C  CD2  . HIS A 1 12 ? -0.430  -6.282  4.278   1.00 0.00 ? 540 HIS A CD2  5  
ATOM   2606  C  CE1  . HIS A 1 12 ? -2.457  -7.015  4.105   1.00 0.00 ? 540 HIS A CE1  5  
ATOM   2607  N  NE2  . HIS A 1 12 ? -1.211  -7.338  3.817   1.00 0.00 ? 540 HIS A NE2  5  
ATOM   2608  H  H    . HIS A 1 12 ? -0.662  -1.964  4.024   1.00 0.00 ? 540 HIS A H    5  
ATOM   2609  H  HA   . HIS A 1 12 ? -2.867  -3.432  4.899   1.00 0.00 ? 540 HIS A HA   5  
ATOM   2610  H  HB2  . HIS A 1 12 ? 0.012   -3.667  5.009   1.00 0.00 ? 540 HIS A HB2  5  
ATOM   2611  H  HB3  . HIS A 1 12 ? -0.705  -4.209  6.522   1.00 0.00 ? 540 HIS A HB3  5  
ATOM   2612  H  HD1  . HIS A 1 12 ? -3.336  -5.378  5.025   1.00 0.00 ? 540 HIS A HD1  5  
ATOM   2613  H  HD2  . HIS A 1 12 ? 0.645   -6.228  4.199   1.00 0.00 ? 540 HIS A HD2  5  
ATOM   2614  H  HE1  . HIS A 1 12 ? -3.315  -7.630  3.876   1.00 0.00 ? 540 HIS A HE1  5  
ATOM   2615  N  N    . ILE A 1 13 ? -1.727  -1.286  7.052   1.00 0.00 ? 541 ILE A N    5  
ATOM   2616  C  CA   . ILE A 1 13 ? -1.978  -0.639  8.333   1.00 0.00 ? 541 ILE A CA   5  
ATOM   2617  C  C    . ILE A 1 13 ? -3.222  0.242   8.270   1.00 0.00 ? 541 ILE A C    5  
ATOM   2618  O  O    . ILE A 1 13 ? -3.515  0.849   7.240   1.00 0.00 ? 541 ILE A O    5  
ATOM   2619  C  CB   . ILE A 1 13 ? -0.775  0.220   8.769   1.00 0.00 ? 541 ILE A CB   5  
ATOM   2620  C  CG1  . ILE A 1 13 ? 0.508   -0.612  8.752   1.00 0.00 ? 541 ILE A CG1  5  
ATOM   2621  C  CG2  . ILE A 1 13 ? -1.014  0.809   10.151  1.00 0.00 ? 541 ILE A CG2  5  
ATOM   2622  C  CD1  . ILE A 1 13 ? 1.700   0.125   8.181   1.00 0.00 ? 541 ILE A CD1  5  
ATOM   2623  H  H    . ILE A 1 13 ? -1.079  -0.886  6.435   1.00 0.00 ? 541 ILE A H    5  
ATOM   2624  H  HA   . ILE A 1 13 ? -2.131  -1.410  9.073   1.00 0.00 ? 541 ILE A HA   5  
ATOM   2625  H  HB   . ILE A 1 13 ? -0.674  1.037   8.071   1.00 0.00 ? 541 ILE A HB   5  
ATOM   2626  H  HG12 . ILE A 1 13 ? 0.753   -0.906  9.762   1.00 0.00 ? 541 ILE A HG12 5  
ATOM   2627  H  HG13 . ILE A 1 13 ? 0.347   -1.498  8.154   1.00 0.00 ? 541 ILE A HG13 5  
ATOM   2628  H  HG21 . ILE A 1 13 ? -1.397  0.042   10.808  1.00 0.00 ? 541 ILE A HG21 5  
ATOM   2629  H  HG22 . ILE A 1 13 ? -1.732  1.613   10.080  1.00 0.00 ? 541 ILE A HG22 5  
ATOM   2630  H  HG23 . ILE A 1 13 ? -0.085  1.191   10.546  1.00 0.00 ? 541 ILE A HG23 5  
ATOM   2631  H  HD11 . ILE A 1 13 ? 2.460   0.225   8.942   1.00 0.00 ? 541 ILE A HD11 5  
ATOM   2632  H  HD12 . ILE A 1 13 ? 1.391   1.106   7.850   1.00 0.00 ? 541 ILE A HD12 5  
ATOM   2633  H  HD13 . ILE A 1 13 ? 2.099   -0.429  7.344   1.00 0.00 ? 541 ILE A HD13 5  
ATOM   2634  N  N    . GLN A 1 14 ? -3.950  0.309   9.381   1.00 0.00 ? 542 GLN A N    5  
ATOM   2635  C  CA   . GLN A 1 14 ? -5.158  1.114   9.455   1.00 0.00 ? 542 GLN A CA   5  
ATOM   2636  C  C    . GLN A 1 14 ? -4.817  2.593   9.627   1.00 0.00 ? 542 GLN A C    5  
ATOM   2637  O  O    . GLN A 1 14 ? -5.184  3.215   10.624  1.00 0.00 ? 542 GLN A O    5  
ATOM   2638  C  CB   . GLN A 1 14 ? -6.042  0.639   10.611  1.00 0.00 ? 542 GLN A CB   5  
ATOM   2639  C  CG   . GLN A 1 14 ? -7.528  0.676   10.295  1.00 0.00 ? 542 GLN A CG   5  
ATOM   2640  C  CD   . GLN A 1 14 ? -8.386  0.786   11.540  1.00 0.00 ? 542 GLN A CD   5  
ATOM   2641  O  OE1  . GLN A 1 14 ? -8.643  1.883   12.037  1.00 0.00 ? 542 GLN A OE1  5  
ATOM   2642  N  NE2  . GLN A 1 14 ? -8.835  -0.354  12.052  1.00 0.00 ? 542 GLN A NE2  5  
ATOM   2643  H  H    . GLN A 1 14 ? -3.667  -0.196  10.168  1.00 0.00 ? 542 GLN A H    5  
ATOM   2644  H  HA   . GLN A 1 14 ? -5.692  0.985   8.530   1.00 0.00 ? 542 GLN A HA   5  
ATOM   2645  H  HB2  . GLN A 1 14 ? -5.774  -0.378  10.859  1.00 0.00 ? 542 GLN A HB2  5  
ATOM   2646  H  HB3  . GLN A 1 14 ? -5.863  1.269   11.470  1.00 0.00 ? 542 GLN A HB3  5  
ATOM   2647  H  HG2  . GLN A 1 14 ? -7.728  1.528   9.662   1.00 0.00 ? 542 GLN A HG2  5  
ATOM   2648  H  HG3  . GLN A 1 14 ? -7.794  -0.230  9.771   1.00 0.00 ? 542 GLN A HG3  5  
ATOM   2649  H  HE21 . GLN A 1 14 ? -8.591  -1.191  11.603  1.00 0.00 ? 542 GLN A HE21 5  
ATOM   2650  H  HE22 . GLN A 1 14 ? -9.391  -0.313  12.858  1.00 0.00 ? 542 GLN A HE22 5  
ATOM   2651  N  N    . GLY A 1 15 ? -4.111  3.150   8.647   1.00 0.00 ? 543 GLY A N    5  
ATOM   2652  C  CA   . GLY A 1 15 ? -3.732  4.549   8.711   1.00 0.00 ? 543 GLY A CA   5  
ATOM   2653  C  C    . GLY A 1 15 ? -4.213  5.336   7.508   1.00 0.00 ? 543 GLY A C    5  
ATOM   2654  O  O    . GLY A 1 15 ? -5.173  6.101   7.602   1.00 0.00 ? 543 GLY A O    5  
ATOM   2655  H  H    . GLY A 1 15 ? -3.846  2.606   7.877   1.00 0.00 ? 543 GLY A H    5  
ATOM   2656  H  HA2  . GLY A 1 15 ? -4.153  4.985   9.604   1.00 0.00 ? 543 GLY A HA2  5  
ATOM   2657  H  HA3  . GLY A 1 15 ? -2.655  4.616   8.763   1.00 0.00 ? 543 GLY A HA3  5  
ATOM   2658  N  N    . CYS A 1 16 ? -3.546  5.149   6.373   1.00 0.00 ? 544 CYS A N    5  
ATOM   2659  C  CA   . CYS A 1 16 ? -3.912  5.848   5.147   1.00 0.00 ? 544 CYS A CA   5  
ATOM   2660  C  C    . CYS A 1 16 ? -4.566  4.895   4.150   1.00 0.00 ? 544 CYS A C    5  
ATOM   2661  O  O    . CYS A 1 16 ? -4.908  3.762   4.490   1.00 0.00 ? 544 CYS A O    5  
ATOM   2662  C  CB   . CYS A 1 16 ? -2.678  6.505   4.519   1.00 0.00 ? 544 CYS A CB   5  
ATOM   2663  S  SG   . CYS A 1 16 ? -1.511  5.344   3.770   1.00 0.00 ? 544 CYS A SG   5  
ATOM   2664  H  H    . CYS A 1 16 ? -2.790  4.526   6.361   1.00 0.00 ? 544 CYS A H    5  
ATOM   2665  H  HA   . CYS A 1 16 ? -4.624  6.617   5.407   1.00 0.00 ? 544 CYS A HA   5  
ATOM   2666  H  HB2  . CYS A 1 16 ? -2.999  7.188   3.747   1.00 0.00 ? 544 CYS A HB2  5  
ATOM   2667  H  HB3  . CYS A 1 16 ? -2.149  7.058   5.282   1.00 0.00 ? 544 CYS A HB3  5  
ATOM   2668  N  N    . GLY A 1 17 ? -4.734  5.362   2.918   1.00 0.00 ? 545 GLY A N    5  
ATOM   2669  C  CA   . GLY A 1 17 ? -5.343  4.541   1.888   1.00 0.00 ? 545 GLY A CA   5  
ATOM   2670  C  C    . GLY A 1 17 ? -4.755  4.805   0.517   1.00 0.00 ? 545 GLY A C    5  
ATOM   2671  O  O    . GLY A 1 17 ? -5.458  4.740   -0.491  1.00 0.00 ? 545 GLY A O    5  
ATOM   2672  H  H    . GLY A 1 17 ? -4.440  6.273   2.705   1.00 0.00 ? 545 GLY A H    5  
ATOM   2673  H  HA2  . GLY A 1 17 ? -5.194  3.501   2.138   1.00 0.00 ? 545 GLY A HA2  5  
ATOM   2674  H  HA3  . GLY A 1 17 ? -6.403  4.746   1.859   1.00 0.00 ? 545 GLY A HA3  5  
ATOM   2675  N  N    . LYS A 1 18 ? -3.461  5.108   0.480   1.00 0.00 ? 546 LYS A N    5  
ATOM   2676  C  CA   . LYS A 1 18 ? -2.776  5.385   -0.777  1.00 0.00 ? 546 LYS A CA   5  
ATOM   2677  C  C    . LYS A 1 18 ? -2.593  4.108   -1.591  1.00 0.00 ? 546 LYS A C    5  
ATOM   2678  O  O    . LYS A 1 18 ? -3.126  3.056   -1.241  1.00 0.00 ? 546 LYS A O    5  
ATOM   2679  C  CB   . LYS A 1 18 ? -1.417  6.035   -0.507  1.00 0.00 ? 546 LYS A CB   5  
ATOM   2680  C  CG   . LYS A 1 18 ? -0.433  5.118   0.201   1.00 0.00 ? 546 LYS A CG   5  
ATOM   2681  C  CD   . LYS A 1 18 ? 0.846   5.852   0.574   1.00 0.00 ? 546 LYS A CD   5  
ATOM   2682  C  CE   . LYS A 1 18 ? 0.565   7.047   1.473   1.00 0.00 ? 546 LYS A CE   5  
ATOM   2683  N  NZ   . LYS A 1 18 ? 0.605   8.331   0.720   1.00 0.00 ? 546 LYS A NZ   5  
ATOM   2684  H  H    . LYS A 1 18 ? -2.955  5.145   1.318   1.00 0.00 ? 546 LYS A H    5  
ATOM   2685  H  HA   . LYS A 1 18 ? -3.388  6.073   -1.341  1.00 0.00 ? 546 LYS A HA   5  
ATOM   2686  H  HB2  . LYS A 1 18 ? -0.982  6.335   -1.449  1.00 0.00 ? 546 LYS A HB2  5  
ATOM   2687  H  HB3  . LYS A 1 18 ? -1.565  6.911   0.107   1.00 0.00 ? 546 LYS A HB3  5  
ATOM   2688  H  HG2  . LYS A 1 18 ? -0.893  4.737   1.100   1.00 0.00 ? 546 LYS A HG2  5  
ATOM   2689  H  HG3  . LYS A 1 18 ? -0.187  4.296   -0.456  1.00 0.00 ? 546 LYS A HG3  5  
ATOM   2690  H  HD2  . LYS A 1 18 ? 1.502   5.170   1.094   1.00 0.00 ? 546 LYS A HD2  5  
ATOM   2691  H  HD3  . LYS A 1 18 ? 1.327   6.198   -0.329  1.00 0.00 ? 546 LYS A HD3  5  
ATOM   2692  H  HE2  . LYS A 1 18 ? -0.414  6.929   1.912   1.00 0.00 ? 546 LYS A HE2  5  
ATOM   2693  H  HE3  . LYS A 1 18 ? 1.308   7.074   2.255   1.00 0.00 ? 546 LYS A HE3  5  
ATOM   2694  H  HZ1  . LYS A 1 18 ? -0.358  8.618   0.450   1.00 0.00 ? 546 LYS A HZ1  5  
ATOM   2695  H  HZ2  . LYS A 1 18 ? 1.176   8.222   -0.142  1.00 0.00 ? 546 LYS A HZ2  5  
ATOM   2696  H  HZ3  . LYS A 1 18 ? 1.026   9.077   1.309   1.00 0.00 ? 546 LYS A HZ3  5  
ATOM   2697  N  N    . VAL A 1 19 ? -1.835  4.209   -2.678  1.00 0.00 ? 547 VAL A N    5  
ATOM   2698  C  CA   . VAL A 1 19 ? -1.582  3.063   -3.541  1.00 0.00 ? 547 VAL A CA   5  
ATOM   2699  C  C    . VAL A 1 19 ? -0.195  3.144   -4.169  1.00 0.00 ? 547 VAL A C    5  
ATOM   2700  O  O    . VAL A 1 19 ? 0.363   4.230   -4.328  1.00 0.00 ? 547 VAL A O    5  
ATOM   2701  C  CB   . VAL A 1 19 ? -2.634  2.960   -4.661  1.00 0.00 ? 547 VAL A CB   5  
ATOM   2702  C  CG1  . VAL A 1 19 ? -2.473  1.658   -5.431  1.00 0.00 ? 547 VAL A CG1  5  
ATOM   2703  C  CG2  . VAL A 1 19 ? -4.038  3.079   -4.087  1.00 0.00 ? 547 VAL A CG2  5  
ATOM   2704  H  H    . VAL A 1 19 ? -1.437  5.075   -2.905  1.00 0.00 ? 547 VAL A H    5  
ATOM   2705  H  HA   . VAL A 1 19 ? -1.641  2.169   -2.936  1.00 0.00 ? 547 VAL A HA   5  
ATOM   2706  H  HB   . VAL A 1 19 ? -2.480  3.779   -5.348  1.00 0.00 ? 547 VAL A HB   5  
ATOM   2707  H  HG11 . VAL A 1 19 ? -3.433  1.345   -5.813  1.00 0.00 ? 547 VAL A HG11 5  
ATOM   2708  H  HG12 . VAL A 1 19 ? -2.082  0.897   -4.772  1.00 0.00 ? 547 VAL A HG12 5  
ATOM   2709  H  HG13 . VAL A 1 19 ? -1.789  1.809   -6.253  1.00 0.00 ? 547 VAL A HG13 5  
ATOM   2710  H  HG21 . VAL A 1 19 ? -4.222  4.102   -3.795  1.00 0.00 ? 547 VAL A HG21 5  
ATOM   2711  H  HG22 . VAL A 1 19 ? -4.130  2.436   -3.225  1.00 0.00 ? 547 VAL A HG22 5  
ATOM   2712  H  HG23 . VAL A 1 19 ? -4.759  2.783   -4.835  1.00 0.00 ? 547 VAL A HG23 5  
ATOM   2713  N  N    . TYR A 1 20 ? 0.357   1.988   -4.526  1.00 0.00 ? 548 TYR A N    5  
ATOM   2714  C  CA   . TYR A 1 20 ? 1.681   1.930   -5.138  1.00 0.00 ? 548 TYR A CA   5  
ATOM   2715  C  C    . TYR A 1 20 ? 1.750   0.819   -6.181  1.00 0.00 ? 548 TYR A C    5  
ATOM   2716  O  O    . TYR A 1 20 ? 0.994   -0.151  -6.122  1.00 0.00 ? 548 TYR A O    5  
ATOM   2717  C  CB   . TYR A 1 20 ? 2.763   1.715   -4.074  1.00 0.00 ? 548 TYR A CB   5  
ATOM   2718  C  CG   . TYR A 1 20 ? 2.292   0.939   -2.863  1.00 0.00 ? 548 TYR A CG   5  
ATOM   2719  C  CD1  . TYR A 1 20 ? 1.440   1.518   -1.931  1.00 0.00 ? 548 TYR A CD1  5  
ATOM   2720  C  CD2  . TYR A 1 20 ? 2.700   -0.372  -2.652  1.00 0.00 ? 548 TYR A CD2  5  
ATOM   2721  C  CE1  . TYR A 1 20 ? 1.008   0.814   -0.823  1.00 0.00 ? 548 TYR A CE1  5  
ATOM   2722  C  CE2  . TYR A 1 20 ? 2.272   -1.084  -1.547  1.00 0.00 ? 548 TYR A CE2  5  
ATOM   2723  C  CZ   . TYR A 1 20 ? 1.427   -0.487  -0.636  1.00 0.00 ? 548 TYR A CZ   5  
ATOM   2724  O  OH   . TYR A 1 20 ? 1.000   -1.192  0.465   1.00 0.00 ? 548 TYR A OH   5  
ATOM   2725  H  H    . TYR A 1 20 ? -0.137  1.155   -4.374  1.00 0.00 ? 548 TYR A H    5  
ATOM   2726  H  HA   . TYR A 1 20 ? 1.857   2.875   -5.629  1.00 0.00 ? 548 TYR A HA   5  
ATOM   2727  H  HB2  . TYR A 1 20 ? 3.585   1.171   -4.514  1.00 0.00 ? 548 TYR A HB2  5  
ATOM   2728  H  HB3  . TYR A 1 20 ? 3.117   2.677   -3.734  1.00 0.00 ? 548 TYR A HB3  5  
ATOM   2729  H  HD1  . TYR A 1 20 ? 1.113   2.537   -2.080  1.00 0.00 ? 548 TYR A HD1  5  
ATOM   2730  H  HD2  . TYR A 1 20 ? 3.362   -0.837  -3.367  1.00 0.00 ? 548 TYR A HD2  5  
ATOM   2731  H  HE1  . TYR A 1 20 ? 0.347   1.282   -0.109  1.00 0.00 ? 548 TYR A HE1  5  
ATOM   2732  H  HE2  . TYR A 1 20 ? 2.600   -2.102  -1.401  1.00 0.00 ? 548 TYR A HE2  5  
ATOM   2733  H  HH   . TYR A 1 20 ? 0.775   -2.088  0.205   1.00 0.00 ? 548 TYR A HH   5  
ATOM   2734  N  N    . GLY A 1 21 ? 2.658   0.973   -7.139  1.00 0.00 ? 549 GLY A N    5  
ATOM   2735  C  CA   . GLY A 1 21 ? 2.808   -0.018  -8.188  1.00 0.00 ? 549 GLY A CA   5  
ATOM   2736  C  C    . GLY A 1 21 ? 3.271   -1.364  -7.664  1.00 0.00 ? 549 GLY A C    5  
ATOM   2737  O  O    . GLY A 1 21 ? 2.538   -2.351  -7.736  1.00 0.00 ? 549 GLY A O    5  
ATOM   2738  H  H    . GLY A 1 21 ? 3.229   1.770   -7.136  1.00 0.00 ? 549 GLY A H    5  
ATOM   2739  H  HA2  . GLY A 1 21 ? 1.858   -0.147  -8.684  1.00 0.00 ? 549 GLY A HA2  5  
ATOM   2740  H  HA3  . GLY A 1 21 ? 3.529   0.343   -8.906  1.00 0.00 ? 549 GLY A HA3  5  
ATOM   2741  N  N    . LYS A 1 22 ? 4.493   -1.408  -7.142  1.00 0.00 ? 550 LYS A N    5  
ATOM   2742  C  CA   . LYS A 1 22 ? 5.053   -2.647  -6.613  1.00 0.00 ? 550 LYS A CA   5  
ATOM   2743  C  C    . LYS A 1 22 ? 5.210   -2.580  -5.097  1.00 0.00 ? 550 LYS A C    5  
ATOM   2744  O  O    . LYS A 1 22 ? 5.162   -1.503  -4.503  1.00 0.00 ? 550 LYS A O    5  
ATOM   2745  C  CB   . LYS A 1 22 ? 6.407   -2.938  -7.264  1.00 0.00 ? 550 LYS A CB   5  
ATOM   2746  C  CG   . LYS A 1 22 ? 6.635   -4.414  -7.559  1.00 0.00 ? 550 LYS A CG   5  
ATOM   2747  C  CD   . LYS A 1 22 ? 6.800   -4.672  -9.050  1.00 0.00 ? 550 LYS A CD   5  
ATOM   2748  C  CE   . LYS A 1 22 ? 5.602   -5.412  -9.625  1.00 0.00 ? 550 LYS A CE   5  
ATOM   2749  N  NZ   . LYS A 1 22 ? 5.580   -5.362  -11.113 1.00 0.00 ? 550 LYS A NZ   5  
ATOM   2750  H  H    . LYS A 1 22 ? 5.032   -0.590  -7.116  1.00 0.00 ? 550 LYS A H    5  
ATOM   2751  H  HA   . LYS A 1 22 ? 4.371   -3.448  -6.855  1.00 0.00 ? 550 LYS A HA   5  
ATOM   2752  H  HB2  . LYS A 1 22 ? 6.471   -2.390  -8.192  1.00 0.00 ? 550 LYS A HB2  5  
ATOM   2753  H  HB3  . LYS A 1 22 ? 7.191   -2.600  -6.602  1.00 0.00 ? 550 LYS A HB3  5  
ATOM   2754  H  HG2  . LYS A 1 22 ? 7.529   -4.738  -7.048  1.00 0.00 ? 550 LYS A HG2  5  
ATOM   2755  H  HG3  . LYS A 1 22 ? 5.788   -4.977  -7.196  1.00 0.00 ? 550 LYS A HG3  5  
ATOM   2756  H  HD2  . LYS A 1 22 ? 6.905   -3.728  -9.561  1.00 0.00 ? 550 LYS A HD2  5  
ATOM   2757  H  HD3  . LYS A 1 22 ? 7.688   -5.268  -9.205  1.00 0.00 ? 550 LYS A HD3  5  
ATOM   2758  H  HE2  . LYS A 1 22 ? 5.646   -6.444  -9.309  1.00 0.00 ? 550 LYS A HE2  5  
ATOM   2759  H  HE3  . LYS A 1 22 ? 4.698   -4.959  -9.245  1.00 0.00 ? 550 LYS A HE3  5  
ATOM   2760  H  HZ1  . LYS A 1 22 ? 5.215   -6.258  -11.496 1.00 0.00 ? 550 LYS A HZ1  5  
ATOM   2761  H  HZ2  . LYS A 1 22 ? 6.541   -5.208  -11.479 1.00 0.00 ? 550 LYS A HZ2  5  
ATOM   2762  H  HZ3  . LYS A 1 22 ? 4.970   -4.584  -11.435 1.00 0.00 ? 550 LYS A HZ3  5  
ATOM   2763  N  N    . THR A 1 23 ? 5.398   -3.741  -4.478  1.00 0.00 ? 551 THR A N    5  
ATOM   2764  C  CA   . THR A 1 23 ? 5.563   -3.824  -3.031  1.00 0.00 ? 551 THR A CA   5  
ATOM   2765  C  C    . THR A 1 23 ? 6.792   -3.045  -2.572  1.00 0.00 ? 551 THR A C    5  
ATOM   2766  O  O    . THR A 1 23 ? 6.856   -2.588  -1.430  1.00 0.00 ? 551 THR A O    5  
ATOM   2767  C  CB   . THR A 1 23 ? 5.680   -5.286  -2.595  1.00 0.00 ? 551 THR A CB   5  
ATOM   2768  O  OG1  . THR A 1 23 ? 4.784   -6.101  -3.330  1.00 0.00 ? 551 THR A OG1  5  
ATOM   2769  C  CG2  . THR A 1 23 ? 5.392   -5.497  -1.124  1.00 0.00 ? 551 THR A CG2  5  
ATOM   2770  H  H    . THR A 1 23 ? 5.427   -4.565  -5.009  1.00 0.00 ? 551 THR A H    5  
ATOM   2771  H  HA   . THR A 1 23 ? 4.686   -3.391  -2.573  1.00 0.00 ? 551 THR A HA   5  
ATOM   2772  H  HB   . THR A 1 23 ? 6.686   -5.628  -2.788  1.00 0.00 ? 551 THR A HB   5  
ATOM   2773  H  HG1  . THR A 1 23 ? 3.910   -5.705  -3.321  1.00 0.00 ? 551 THR A HG1  5  
ATOM   2774  H  HG21 . THR A 1 23 ? 4.348   -5.303  -0.930  1.00 0.00 ? 551 THR A HG21 5  
ATOM   2775  H  HG22 . THR A 1 23 ? 5.999   -4.822  -0.538  1.00 0.00 ? 551 THR A HG22 5  
ATOM   2776  H  HG23 . THR A 1 23 ? 5.626   -6.516  -0.854  1.00 0.00 ? 551 THR A HG23 5  
ATOM   2777  N  N    . SER A 1 24 ? 7.766   -2.894  -3.464  1.00 0.00 ? 552 SER A N    5  
ATOM   2778  C  CA   . SER A 1 24 ? 8.990   -2.167  -3.142  1.00 0.00 ? 552 SER A CA   5  
ATOM   2779  C  C    . SER A 1 24 ? 8.670   -0.763  -2.640  1.00 0.00 ? 552 SER A C    5  
ATOM   2780  O  O    . SER A 1 24 ? 9.428   -0.182  -1.863  1.00 0.00 ? 552 SER A O    5  
ATOM   2781  C  CB   . SER A 1 24 ? 9.900   -2.087  -4.369  1.00 0.00 ? 552 SER A CB   5  
ATOM   2782  O  OG   . SER A 1 24 ? 11.244  -1.845  -3.992  1.00 0.00 ? 552 SER A OG   5  
ATOM   2783  H  H    . SER A 1 24 ? 7.660   -3.279  -4.359  1.00 0.00 ? 552 SER A H    5  
ATOM   2784  H  HA   . SER A 1 24 ? 9.501   -2.708  -2.359  1.00 0.00 ? 552 SER A HA   5  
ATOM   2785  H  HB2  . SER A 1 24 ? 9.854   -3.021  -4.910  1.00 0.00 ? 552 SER A HB2  5  
ATOM   2786  H  HB3  . SER A 1 24 ? 9.568   -1.283  -5.009  1.00 0.00 ? 552 SER A HB3  5  
ATOM   2787  H  HG   . SER A 1 24 ? 11.350  -0.919  -3.760  1.00 0.00 ? 552 SER A HG   5  
ATOM   2788  N  N    . HIS A 1 25 ? 7.537   -0.226  -3.082  1.00 0.00 ? 553 HIS A N    5  
ATOM   2789  C  CA   . HIS A 1 25 ? 7.113   1.106   -2.672  1.00 0.00 ? 553 HIS A CA   5  
ATOM   2790  C  C    . HIS A 1 25 ? 6.574   1.084   -1.246  1.00 0.00 ? 553 HIS A C    5  
ATOM   2791  O  O    . HIS A 1 25 ? 6.646   2.083   -0.529  1.00 0.00 ? 553 HIS A O    5  
ATOM   2792  C  CB   . HIS A 1 25 ? 6.044   1.641   -3.626  1.00 0.00 ? 553 HIS A CB   5  
ATOM   2793  C  CG   . HIS A 1 25 ? 6.604   2.412   -4.782  1.00 0.00 ? 553 HIS A CG   5  
ATOM   2794  N  ND1  . HIS A 1 25 ? 6.299   2.150   -6.099  1.00 0.00 ? 553 HIS A ND1  5  
ATOM   2795  C  CD2  . HIS A 1 25 ? 7.469   3.458   -4.798  1.00 0.00 ? 553 HIS A CD2  5  
ATOM   2796  C  CE1  . HIS A 1 25 ? 6.972   3.024   -6.858  1.00 0.00 ? 553 HIS A CE1  5  
ATOM   2797  N  NE2  . HIS A 1 25 ? 7.697   3.841   -6.117  1.00 0.00 ? 553 HIS A NE2  5  
ATOM   2798  H  H    . HIS A 1 25 ? 6.972   -0.739  -3.696  1.00 0.00 ? 553 HIS A H    5  
ATOM   2799  H  HA   . HIS A 1 25 ? 7.975   1.756   -2.709  1.00 0.00 ? 553 HIS A HA   5  
ATOM   2800  H  HB2  . HIS A 1 25 ? 5.480   0.811   -4.024  1.00 0.00 ? 553 HIS A HB2  5  
ATOM   2801  H  HB3  . HIS A 1 25 ? 5.379   2.294   -3.080  1.00 0.00 ? 553 HIS A HB3  5  
ATOM   2802  H  HD1  . HIS A 1 25 ? 5.695   1.449   -6.423  1.00 0.00 ? 553 HIS A HD1  5  
ATOM   2803  H  HD2  . HIS A 1 25 ? 7.914   3.928   -3.934  1.00 0.00 ? 553 HIS A HD2  5  
ATOM   2804  H  HE1  . HIS A 1 25 ? 6.928   3.057   -7.937  1.00 0.00 ? 553 HIS A HE1  5  
ATOM   2805  N  N    . LEU A 1 26 ? 6.036   -0.063  -0.838  1.00 0.00 ? 554 LEU A N    5  
ATOM   2806  C  CA   . LEU A 1 26 ? 5.489   -0.216  0.506   1.00 0.00 ? 554 LEU A CA   5  
ATOM   2807  C  C    . LEU A 1 26 ? 6.546   0.109   1.556   1.00 0.00 ? 554 LEU A C    5  
ATOM   2808  O  O    . LEU A 1 26 ? 6.262   0.767   2.556   1.00 0.00 ? 554 LEU A O    5  
ATOM   2809  C  CB   . LEU A 1 26 ? 4.970   -1.642  0.710   1.00 0.00 ? 554 LEU A CB   5  
ATOM   2810  C  CG   . LEU A 1 26 ? 4.431   -1.941  2.110   1.00 0.00 ? 554 LEU A CG   5  
ATOM   2811  C  CD1  . LEU A 1 26 ? 3.374   -0.921  2.505   1.00 0.00 ? 554 LEU A CD1  5  
ATOM   2812  C  CD2  . LEU A 1 26 ? 3.862   -3.350  2.171   1.00 0.00 ? 554 LEU A CD2  5  
ATOM   2813  H  H    . LEU A 1 26 ? 6.010   -0.825  -1.454  1.00 0.00 ? 554 LEU A H    5  
ATOM   2814  H  HA   . LEU A 1 26 ? 4.668   0.476   0.610   1.00 0.00 ? 554 LEU A HA   5  
ATOM   2815  H  HB2  . LEU A 1 26 ? 4.180   -1.820  -0.004  1.00 0.00 ? 554 LEU A HB2  5  
ATOM   2816  H  HB3  . LEU A 1 26 ? 5.778   -2.329  0.507   1.00 0.00 ? 554 LEU A HB3  5  
ATOM   2817  H  HG   . LEU A 1 26 ? 5.240   -1.874  2.822   1.00 0.00 ? 554 LEU A HG   5  
ATOM   2818  H  HD11 . LEU A 1 26 ? 3.850   -0.070  2.969   1.00 0.00 ? 554 LEU A HD11 5  
ATOM   2819  H  HD12 . LEU A 1 26 ? 2.682   -1.371  3.202   1.00 0.00 ? 554 LEU A HD12 5  
ATOM   2820  H  HD13 . LEU A 1 26 ? 2.838   -0.598  1.624   1.00 0.00 ? 554 LEU A HD13 5  
ATOM   2821  H  HD21 . LEU A 1 26 ? 4.310   -3.954  1.396   1.00 0.00 ? 554 LEU A HD21 5  
ATOM   2822  H  HD22 . LEU A 1 26 ? 2.792   -3.314  2.026   1.00 0.00 ? 554 LEU A HD22 5  
ATOM   2823  H  HD23 . LEU A 1 26 ? 4.080   -3.784  3.136   1.00 0.00 ? 554 LEU A HD23 5  
ATOM   2824  N  N    . ARG A 1 27 ? 7.768   -0.358  1.319   1.00 0.00 ? 555 ARG A N    5  
ATOM   2825  C  CA   . ARG A 1 27 ? 8.872   -0.119  2.238   1.00 0.00 ? 555 ARG A CA   5  
ATOM   2826  C  C    . ARG A 1 27 ? 9.083   1.373   2.464   1.00 0.00 ? 555 ARG A C    5  
ATOM   2827  O  O    . ARG A 1 27 ? 9.140   1.837   3.603   1.00 0.00 ? 555 ARG A O    5  
ATOM   2828  C  CB   . ARG A 1 27 ? 10.155  -0.752  1.695   1.00 0.00 ? 555 ARG A CB   5  
ATOM   2829  C  CG   . ARG A 1 27 ? 10.785  -1.743  2.654   1.00 0.00 ? 555 ARG A CG   5  
ATOM   2830  C  CD   . ARG A 1 27 ? 12.050  -2.355  2.073   1.00 0.00 ? 555 ARG A CD   5  
ATOM   2831  N  NE   . ARG A 1 27 ? 13.085  -2.541  3.087   1.00 0.00 ? 555 ARG A NE   5  
ATOM   2832  C  CZ   . ARG A 1 27 ? 13.095  -3.545  3.960   1.00 0.00 ? 555 ARG A CZ   5  
ATOM   2833  N  NH1  . ARG A 1 27 ? 12.129  -4.455  3.947   1.00 0.00 ? 555 ARG A NH1  5  
ATOM   2834  N  NH2  . ARG A 1 27 ? 14.075  -3.641  4.849   1.00 0.00 ? 555 ARG A NH2  5  
ATOM   2835  H  H    . ARG A 1 27 ? 7.932   -0.876  0.504   1.00 0.00 ? 555 ARG A H    5  
ATOM   2836  H  HA   . ARG A 1 27 ? 8.625   -0.583  3.181   1.00 0.00 ? 555 ARG A HA   5  
ATOM   2837  H  HB2  . ARG A 1 27 ? 9.926   -1.269  0.774   1.00 0.00 ? 555 ARG A HB2  5  
ATOM   2838  H  HB3  . ARG A 1 27 ? 10.874  0.028   1.492   1.00 0.00 ? 555 ARG A HB3  5  
ATOM   2839  H  HG2  . ARG A 1 27 ? 11.032  -1.231  3.571   1.00 0.00 ? 555 ARG A HG2  5  
ATOM   2840  H  HG3  . ARG A 1 27 ? 10.074  -2.529  2.857   1.00 0.00 ? 555 ARG A HG3  5  
ATOM   2841  H  HD2  . ARG A 1 27 ? 11.805  -3.315  1.643   1.00 0.00 ? 555 ARG A HD2  5  
ATOM   2842  H  HD3  . ARG A 1 27 ? 12.429  -1.702  1.300   1.00 0.00 ? 555 ARG A HD3  5  
ATOM   2843  H  HE   . ARG A 1 27 ? 13.811  -1.883  3.118   1.00 0.00 ? 555 ARG A HE   5  
ATOM   2844  H  HH11 . ARG A 1 27 ? 11.388  -4.390  3.279   1.00 0.00 ? 555 ARG A HH11 5  
ATOM   2845  H  HH12 . ARG A 1 27 ? 12.142  -5.207  4.607   1.00 0.00 ? 555 ARG A HH12 5  
ATOM   2846  H  HH21 . ARG A 1 27 ? 14.806  -2.959  4.862   1.00 0.00 ? 555 ARG A HH21 5  
ATOM   2847  H  HH22 . ARG A 1 27 ? 14.084  -4.395  5.505   1.00 0.00 ? 555 ARG A HH22 5  
ATOM   2848  N  N    . ALA A 1 28 ? 9.197   2.121   1.372   1.00 0.00 ? 556 ALA A N    5  
ATOM   2849  C  CA   . ALA A 1 28 ? 9.400   3.561   1.455   1.00 0.00 ? 556 ALA A CA   5  
ATOM   2850  C  C    . ALA A 1 28 ? 8.261   4.229   2.219   1.00 0.00 ? 556 ALA A C    5  
ATOM   2851  O  O    . ALA A 1 28 ? 8.463   5.228   2.908   1.00 0.00 ? 556 ALA A O    5  
ATOM   2852  C  CB   . ALA A 1 28 ? 9.527   4.158   0.062   1.00 0.00 ? 556 ALA A CB   5  
ATOM   2853  H  H    . ALA A 1 28 ? 9.142   1.695   0.491   1.00 0.00 ? 556 ALA A H    5  
ATOM   2854  H  HA   . ALA A 1 28 ? 10.326  3.736   1.984   1.00 0.00 ? 556 ALA A HA   5  
ATOM   2855  H  HB1  . ALA A 1 28 ? 9.110   5.155   0.057   1.00 0.00 ? 556 ALA A HB1  5  
ATOM   2856  H  HB2  . ALA A 1 28 ? 8.991   3.541   -0.644  1.00 0.00 ? 556 ALA A HB2  5  
ATOM   2857  H  HB3  . ALA A 1 28 ? 10.569  4.203   -0.217  1.00 0.00 ? 556 ALA A HB3  5  
ATOM   2858  N  N    . HIS A 1 29 ? 7.064   3.666   2.090   1.00 0.00 ? 557 HIS A N    5  
ATOM   2859  C  CA   . HIS A 1 29 ? 5.892   4.200   2.764   1.00 0.00 ? 557 HIS A CA   5  
ATOM   2860  C  C    . HIS A 1 29 ? 5.871   3.779   4.232   1.00 0.00 ? 557 HIS A C    5  
ATOM   2861  O  O    . HIS A 1 29 ? 5.501   4.562   5.107   1.00 0.00 ? 557 HIS A O    5  
ATOM   2862  C  CB   . HIS A 1 29 ? 4.614   3.729   2.061   1.00 0.00 ? 557 HIS A CB   5  
ATOM   2863  C  CG   . HIS A 1 29 ? 3.359   4.056   2.810   1.00 0.00 ? 557 HIS A CG   5  
ATOM   2864  N  ND1  . HIS A 1 29 ? 3.086   5.295   3.345   1.00 0.00 ? 557 HIS A ND1  5  
ATOM   2865  C  CD2  . HIS A 1 29 ? 2.295   3.272   3.119   1.00 0.00 ? 557 HIS A CD2  5  
ATOM   2866  C  CE1  . HIS A 1 29 ? 1.893   5.227   3.952   1.00 0.00 ? 557 HIS A CE1  5  
ATOM   2867  N  NE2  . HIS A 1 29 ? 1.371   4.021   3.843   1.00 0.00 ? 557 HIS A NE2  5  
ATOM   2868  H  H    . HIS A 1 29 ? 6.968   2.875   1.527   1.00 0.00 ? 557 HIS A H    5  
ATOM   2869  H  HA   . HIS A 1 29 ? 5.947   5.273   2.710   1.00 0.00 ? 557 HIS A HA   5  
ATOM   2870  H  HB2  . HIS A 1 29 ? 4.552   4.198   1.091   1.00 0.00 ? 557 HIS A HB2  5  
ATOM   2871  H  HB3  . HIS A 1 29 ? 4.657   2.657   1.934   1.00 0.00 ? 557 HIS A HB3  5  
ATOM   2872  H  HD1  . HIS A 1 29 ? 3.662   6.086   3.292   1.00 0.00 ? 557 HIS A HD1  5  
ATOM   2873  H  HD2  . HIS A 1 29 ? 2.174   2.233   2.851   1.00 0.00 ? 557 HIS A HD2  5  
ATOM   2874  H  HE1  . HIS A 1 29 ? 1.421   6.053   4.462   1.00 0.00 ? 557 HIS A HE1  5  
ATOM   2875  N  N    . LEU A 1 30 ? 6.267   2.536   4.495   1.00 0.00 ? 558 LEU A N    5  
ATOM   2876  C  CA   . LEU A 1 30 ? 6.288   2.014   5.856   1.00 0.00 ? 558 LEU A CA   5  
ATOM   2877  C  C    . LEU A 1 30 ? 7.243   2.815   6.735   1.00 0.00 ? 558 LEU A C    5  
ATOM   2878  O  O    . LEU A 1 30 ? 6.926   3.137   7.880   1.00 0.00 ? 558 LEU A O    5  
ATOM   2879  C  CB   . LEU A 1 30 ? 6.693   0.539   5.852   1.00 0.00 ? 558 LEU A CB   5  
ATOM   2880  C  CG   . LEU A 1 30 ? 6.049   -0.311  6.949   1.00 0.00 ? 558 LEU A CG   5  
ATOM   2881  C  CD1  . LEU A 1 30 ? 4.536   -0.319  6.798   1.00 0.00 ? 558 LEU A CD1  5  
ATOM   2882  C  CD2  . LEU A 1 30 ? 6.598   -1.729  6.915   1.00 0.00 ? 558 LEU A CD2  5  
ATOM   2883  H  H    . LEU A 1 30 ? 6.548   1.957   3.756   1.00 0.00 ? 558 LEU A H    5  
ATOM   2884  H  HA   . LEU A 1 30 ? 5.289   2.102   6.258   1.00 0.00 ? 558 LEU A HA   5  
ATOM   2885  H  HB2  . LEU A 1 30 ? 6.426   0.116   4.894   1.00 0.00 ? 558 LEU A HB2  5  
ATOM   2886  H  HB3  . LEU A 1 30 ? 7.765   0.481   5.966   1.00 0.00 ? 558 LEU A HB3  5  
ATOM   2887  H  HG   . LEU A 1 30 ? 6.286   0.117   7.912   1.00 0.00 ? 558 LEU A HG   5  
ATOM   2888  H  HD11 . LEU A 1 30 ? 4.107   0.447   7.427   1.00 0.00 ? 558 LEU A HD11 5  
ATOM   2889  H  HD12 . LEU A 1 30 ? 4.150   -1.284  7.093   1.00 0.00 ? 558 LEU A HD12 5  
ATOM   2890  H  HD13 . LEU A 1 30 ? 4.275   -0.127  5.768   1.00 0.00 ? 558 LEU A HD13 5  
ATOM   2891  H  HD21 . LEU A 1 30 ? 6.903   -1.973  5.908   1.00 0.00 ? 558 LEU A HD21 5  
ATOM   2892  H  HD22 . LEU A 1 30 ? 5.832   -2.420  7.235   1.00 0.00 ? 558 LEU A HD22 5  
ATOM   2893  H  HD23 . LEU A 1 30 ? 7.449   -1.802  7.576   1.00 0.00 ? 558 LEU A HD23 5  
ATOM   2894  N  N    . ARG A 1 31 ? 8.414   3.134   6.192   1.00 0.00 ? 559 ARG A N    5  
ATOM   2895  C  CA   . ARG A 1 31 ? 9.415   3.897   6.929   1.00 0.00 ? 559 ARG A CA   5  
ATOM   2896  C  C    . ARG A 1 31 ? 8.860   5.253   7.356   1.00 0.00 ? 559 ARG A C    5  
ATOM   2897  O  O    . ARG A 1 31 ? 9.263   5.804   8.381   1.00 0.00 ? 559 ARG A O    5  
ATOM   2898  C  CB   . ARG A 1 31 ? 10.671  4.091   6.078   1.00 0.00 ? 559 ARG A CB   5  
ATOM   2899  C  CG   . ARG A 1 31 ? 10.420  4.852   4.786   1.00 0.00 ? 559 ARG A CG   5  
ATOM   2900  C  CD   . ARG A 1 31 ? 11.685  5.526   4.282   1.00 0.00 ? 559 ARG A CD   5  
ATOM   2901  N  NE   . ARG A 1 31 ? 12.178  6.534   5.217   1.00 0.00 ? 559 ARG A NE   5  
ATOM   2902  C  CZ   . ARG A 1 31 ? 13.102  7.442   4.909   1.00 0.00 ? 559 ARG A CZ   5  
ATOM   2903  N  NH1  . ARG A 1 31 ? 13.634  7.471   3.693   1.00 0.00 ? 559 ARG A NH1  5  
ATOM   2904  N  NH2  . ARG A 1 31 ? 13.494  8.324   5.818   1.00 0.00 ? 559 ARG A NH2  5  
ATOM   2905  H  H    . ARG A 1 31 ? 8.610   2.848   5.275   1.00 0.00 ? 559 ARG A H    5  
ATOM   2906  H  HA   . ARG A 1 31 ? 9.675   3.335   7.813   1.00 0.00 ? 559 ARG A HA   5  
ATOM   2907  H  HB2  . ARG A 1 31 ? 11.403  4.637   6.655   1.00 0.00 ? 559 ARG A HB2  5  
ATOM   2908  H  HB3  . ARG A 1 31 ? 11.075  3.121   5.826   1.00 0.00 ? 559 ARG A HB3  5  
ATOM   2909  H  HG2  . ARG A 1 31 ? 10.070  4.160   4.035   1.00 0.00 ? 559 ARG A HG2  5  
ATOM   2910  H  HG3  . ARG A 1 31 ? 9.666   5.605   4.964   1.00 0.00 ? 559 ARG A HG3  5  
ATOM   2911  H  HD2  . ARG A 1 31 ? 12.448  4.775   4.142   1.00 0.00 ? 559 ARG A HD2  5  
ATOM   2912  H  HD3  . ARG A 1 31 ? 11.471  6.001   3.336   1.00 0.00 ? 559 ARG A HD3  5  
ATOM   2913  H  HE   . ARG A 1 31 ? 11.802  6.535   6.122   1.00 0.00 ? 559 ARG A HE   5  
ATOM   2914  H  HH11 . ARG A 1 31 ? 13.343  6.809   3.003   1.00 0.00 ? 559 ARG A HH11 5  
ATOM   2915  H  HH12 . ARG A 1 31 ? 14.328  8.155   3.468   1.00 0.00 ? 559 ARG A HH12 5  
ATOM   2916  H  HH21 . ARG A 1 31 ? 13.096  8.307   6.735   1.00 0.00 ? 559 ARG A HH21 5  
ATOM   2917  H  HH22 . ARG A 1 31 ? 14.187  9.006   5.586   1.00 0.00 ? 559 ARG A HH22 5  
ATOM   2918  N  N    . TRP A 1 32 ? 7.934   5.785   6.565   1.00 0.00 ? 560 TRP A N    5  
ATOM   2919  C  CA   . TRP A 1 32 ? 7.324   7.075   6.863   1.00 0.00 ? 560 TRP A CA   5  
ATOM   2920  C  C    . TRP A 1 32 ? 6.387   6.968   8.063   1.00 0.00 ? 560 TRP A C    5  
ATOM   2921  O  O    . TRP A 1 32 ? 6.233   7.918   8.830   1.00 0.00 ? 560 TRP A O    5  
ATOM   2922  C  CB   . TRP A 1 32 ? 6.558   7.595   5.644   1.00 0.00 ? 560 TRP A CB   5  
ATOM   2923  C  CG   . TRP A 1 32 ? 7.285   8.676   4.905   1.00 0.00 ? 560 TRP A CG   5  
ATOM   2924  C  CD1  . TRP A 1 32 ? 7.464   8.769   3.554   1.00 0.00 ? 560 TRP A CD1  5  
ATOM   2925  C  CD2  . TRP A 1 32 ? 7.932   9.819   5.475   1.00 0.00 ? 560 TRP A CD2  5  
ATOM   2926  N  NE1  . TRP A 1 32 ? 8.183   9.899   3.250   1.00 0.00 ? 560 TRP A NE1  5  
ATOM   2927  C  CE2  . TRP A 1 32 ? 8.482   10.561  4.412   1.00 0.00 ? 560 TRP A CE2  5  
ATOM   2928  C  CE3  . TRP A 1 32 ? 8.099   10.288  6.782   1.00 0.00 ? 560 TRP A CE3  5  
ATOM   2929  C  CZ2  . TRP A 1 32 ? 9.186   11.745  4.617   1.00 0.00 ? 560 TRP A CZ2  5  
ATOM   2930  C  CZ3  . TRP A 1 32 ? 8.799   11.464  6.983   1.00 0.00 ? 560 TRP A CZ3  5  
ATOM   2931  C  CH2  . TRP A 1 32 ? 9.334   12.181  5.905   1.00 0.00 ? 560 TRP A CH2  5  
ATOM   2932  H  H    . TRP A 1 32 ? 7.653   5.298   5.762   1.00 0.00 ? 560 TRP A H    5  
ATOM   2933  H  HA   . TRP A 1 32 ? 8.117   7.769   7.102   1.00 0.00 ? 560 TRP A HA   5  
ATOM   2934  H  HB2  . TRP A 1 32 ? 6.389   6.778   4.959   1.00 0.00 ? 560 TRP A HB2  5  
ATOM   2935  H  HB3  . TRP A 1 32 ? 5.606   7.992   5.966   1.00 0.00 ? 560 TRP A HB3  5  
ATOM   2936  H  HD1  . TRP A 1 32 ? 7.090   8.050   2.840   1.00 0.00 ? 560 TRP A HD1  5  
ATOM   2937  H  HE1  . TRP A 1 32 ? 8.440   10.186  2.349   1.00 0.00 ? 560 TRP A HE1  5  
ATOM   2938  H  HE3  . TRP A 1 32 ? 7.694   9.749   7.625   1.00 0.00 ? 560 TRP A HE3  5  
ATOM   2939  H  HZ2  . TRP A 1 32 ? 9.604   12.310  3.797   1.00 0.00 ? 560 TRP A HZ2  5  
ATOM   2940  H  HZ3  . TRP A 1 32 ? 8.938   11.841  7.985   1.00 0.00 ? 560 TRP A HZ3  5  
ATOM   2941  H  HH2  . TRP A 1 32 ? 9.874   13.094  6.109   1.00 0.00 ? 560 TRP A HH2  5  
ATOM   2942  N  N    . HIS A 1 33 ? 5.764   5.804   8.217   1.00 0.00 ? 561 HIS A N    5  
ATOM   2943  C  CA   . HIS A 1 33 ? 4.843   5.571   9.323   1.00 0.00 ? 561 HIS A CA   5  
ATOM   2944  C  C    . HIS A 1 33 ? 5.600   5.384   10.633  1.00 0.00 ? 561 HIS A C    5  
ATOM   2945  O  O    . HIS A 1 33 ? 5.098   5.721   11.705  1.00 0.00 ? 561 HIS A O    5  
ATOM   2946  C  CB   . HIS A 1 33 ? 3.977   4.341   9.041   1.00 0.00 ? 561 HIS A CB   5  
ATOM   2947  C  CG   . HIS A 1 33 ? 2.735   4.647   8.264   1.00 0.00 ? 561 HIS A CG   5  
ATOM   2948  N  ND1  . HIS A 1 33 ? 1.696   5.412   8.746   1.00 0.00 ? 561 HIS A ND1  5  
ATOM   2949  C  CD2  . HIS A 1 33 ? 2.374   4.272   7.011   1.00 0.00 ? 561 HIS A CD2  5  
ATOM   2950  C  CE1  . HIS A 1 33 ? 0.756   5.475   7.794   1.00 0.00 ? 561 HIS A CE1  5  
ATOM   2951  N  NE2  . HIS A 1 33 ? 1.119   4.801   6.720   1.00 0.00 ? 561 HIS A NE2  5  
ATOM   2952  H  H    . HIS A 1 33 ? 5.929   5.085   7.572   1.00 0.00 ? 561 HIS A H    5  
ATOM   2953  H  HA   . HIS A 1 33 ? 4.204   6.437   9.410   1.00 0.00 ? 561 HIS A HA   5  
ATOM   2954  H  HB2  . HIS A 1 33 ? 4.554   3.625   8.475   1.00 0.00 ? 561 HIS A HB2  5  
ATOM   2955  H  HB3  . HIS A 1 33 ? 3.681   3.895   9.981   1.00 0.00 ? 561 HIS A HB3  5  
ATOM   2956  H  HD1  . HIS A 1 33 ? 1.653   5.834   9.630   1.00 0.00 ? 561 HIS A HD1  5  
ATOM   2957  H  HD2  . HIS A 1 33 ? 2.958   3.661   6.337   1.00 0.00 ? 561 HIS A HD2  5  
ATOM   2958  H  HE1  . HIS A 1 33 ? -0.177  6.009   7.892   1.00 0.00 ? 561 HIS A HE1  5  
ATOM   2959  N  N    . THR A 1 34 ? 6.811   4.843   10.540  1.00 0.00 ? 562 THR A N    5  
ATOM   2960  C  CA   . THR A 1 34 ? 7.637   4.611   11.719  1.00 0.00 ? 562 THR A CA   5  
ATOM   2961  C  C    . THR A 1 34 ? 8.650   5.737   11.908  1.00 0.00 ? 562 THR A C    5  
ATOM   2962  O  O    . THR A 1 34 ? 9.743   5.521   12.430  1.00 0.00 ? 562 THR A O    5  
ATOM   2963  C  CB   . THR A 1 34 ? 8.365   3.270   11.601  1.00 0.00 ? 562 THR A CB   5  
ATOM   2964  O  OG1  . THR A 1 34 ? 9.154   3.026   12.752  1.00 0.00 ? 562 THR A OG1  5  
ATOM   2965  C  CG2  . THR A 1 34 ? 9.276   3.188   10.394  1.00 0.00 ? 562 THR A CG2  5  
ATOM   2966  H  H    . THR A 1 34 ? 7.157   4.595   9.657   1.00 0.00 ? 562 THR A H    5  
ATOM   2967  H  HA   . THR A 1 34 ? 6.986   4.582   12.579  1.00 0.00 ? 562 THR A HA   5  
ATOM   2968  H  HB   . THR A 1 34 ? 7.633   2.480   11.518  1.00 0.00 ? 562 THR A HB   5  
ATOM   2969  H  HG1  . THR A 1 34 ? 9.804   3.726   12.849  1.00 0.00 ? 562 THR A HG1  5  
ATOM   2970  H  HG21 . THR A 1 34 ? 8.742   2.736   9.571   1.00 0.00 ? 562 THR A HG21 5  
ATOM   2971  H  HG22 . THR A 1 34 ? 10.140  2.587   10.636  1.00 0.00 ? 562 THR A HG22 5  
ATOM   2972  H  HG23 . THR A 1 34 ? 9.595   4.181   10.116  1.00 0.00 ? 562 THR A HG23 5  
ATOM   2973  N  N    . GLY A 1 35 ? 8.277   6.939   11.481  1.00 0.00 ? 563 GLY A N    5  
ATOM   2974  C  CA   . GLY A 1 35 ? 9.164   8.080   11.613  1.00 0.00 ? 563 GLY A CA   5  
ATOM   2975  C  C    . GLY A 1 35 ? 8.463   9.294   12.192  1.00 0.00 ? 563 GLY A C    5  
ATOM   2976  O  O    . GLY A 1 35 ? 8.375   9.444   13.411  1.00 0.00 ? 563 GLY A O    5  
ATOM   2977  H  H    . GLY A 1 35 ? 7.393   7.053   11.073  1.00 0.00 ? 563 GLY A H    5  
ATOM   2978  H  HA2  . GLY A 1 35 ? 9.986   7.811   12.260  1.00 0.00 ? 563 GLY A HA2  5  
ATOM   2979  H  HA3  . GLY A 1 35 ? 9.554   8.334   10.639  1.00 0.00 ? 563 GLY A HA3  5  
ATOM   2980  N  N    . GLU A 1 36 ? 7.965   10.161  11.315  1.00 0.00 ? 564 GLU A N    5  
ATOM   2981  C  CA   . GLU A 1 36 ? 7.268   11.370  11.740  1.00 0.00 ? 564 GLU A CA   5  
ATOM   2982  C  C    . GLU A 1 36 ? 8.199   12.295  12.520  1.00 0.00 ? 564 GLU A C    5  
ATOM   2983  O  O    . GLU A 1 36 ? 8.713   13.274  11.977  1.00 0.00 ? 564 GLU A O    5  
ATOM   2984  C  CB   . GLU A 1 36 ? 6.046   11.012  12.591  1.00 0.00 ? 564 GLU A CB   5  
ATOM   2985  C  CG   . GLU A 1 36 ? 4.945   10.312  11.811  1.00 0.00 ? 564 GLU A CG   5  
ATOM   2986  C  CD   . GLU A 1 36 ? 4.045   9.475   12.698  1.00 0.00 ? 564 GLU A CD   5  
ATOM   2987  O  OE1  . GLU A 1 36 ? 3.743   9.920   13.826  1.00 0.00 ? 564 GLU A OE1  5  
ATOM   2988  O  OE2  . GLU A 1 36 ? 3.641   8.376   12.266  1.00 0.00 ? 564 GLU A OE2  5  
ATOM   2989  H  H    . GLU A 1 36 ? 8.070   9.982   10.357  1.00 0.00 ? 564 GLU A H    5  
ATOM   2990  H  HA   . GLU A 1 36 ? 6.935   11.886  10.851  1.00 0.00 ? 564 GLU A HA   5  
ATOM   2991  H  HB2  . GLU A 1 36 ? 6.358   10.360  13.394  1.00 0.00 ? 564 GLU A HB2  5  
ATOM   2992  H  HB3  . GLU A 1 36 ? 5.638   11.918  13.013  1.00 0.00 ? 564 GLU A HB3  5  
ATOM   2993  H  HG2  . GLU A 1 36 ? 4.343   11.058  11.315  1.00 0.00 ? 564 GLU A HG2  5  
ATOM   2994  H  HG3  . GLU A 1 36 ? 5.399   9.668   11.073  1.00 0.00 ? 564 GLU A HG3  5  
ATOM   2995  N  N    . ARG A 1 37 ? 8.414   11.979  13.793  1.00 0.00 ? 565 ARG A N    5  
ATOM   2996  C  CA   . ARG A 1 37 ? 9.285   12.783  14.644  1.00 0.00 ? 565 ARG A CA   5  
ATOM   2997  C  C    . ARG A 1 37 ? 10.442  11.948  15.181  1.00 0.00 ? 565 ARG A C    5  
ATOM   2998  O  O    . ARG A 1 37 ? 11.423  12.545  15.672  1.00 0.00 ? 565 ARG A O    5  
ATOM   2999  C  CB   . ARG A 1 37 ? 8.488   13.380  15.806  1.00 0.00 ? 565 ARG A CB   5  
ATOM   3000  C  CG   . ARG A 1 37 ? 9.001   14.736  16.263  1.00 0.00 ? 565 ARG A CG   5  
ATOM   3001  C  CD   . ARG A 1 37 ? 8.198   15.872  15.648  1.00 0.00 ? 565 ARG A CD   5  
ATOM   3002  N  NE   . ARG A 1 37 ? 8.634   16.177  14.288  1.00 0.00 ? 565 ARG A NE   5  
ATOM   3003  C  CZ   . ARG A 1 37 ? 8.330   17.304  13.647  1.00 0.00 ? 565 ARG A CZ   5  
ATOM   3004  N  NH1  . ARG A 1 37 ? 7.591   18.234  14.240  1.00 0.00 ? 565 ARG A NH1  5  
ATOM   3005  N  NH2  . ARG A 1 37 ? 8.768   17.503  12.412  1.00 0.00 ? 565 ARG A NH2  5  
ATOM   3006  O  OXT  . ARG A 1 37 ? 10.357  10.704  15.108  1.00 0.00 ? 565 ARG A OXT  5  
ATOM   3007  H  H    . ARG A 1 37 ? 7.978   11.187  14.169  1.00 0.00 ? 565 ARG A H    5  
ATOM   3008  H  HA   . ARG A 1 37 ? 9.685   13.586  14.044  1.00 0.00 ? 565 ARG A HA   5  
ATOM   3009  H  HB2  . ARG A 1 37 ? 7.458   13.493  15.501  1.00 0.00 ? 565 ARG A HB2  5  
ATOM   3010  H  HB3  . ARG A 1 37 ? 8.534   12.701  16.645  1.00 0.00 ? 565 ARG A HB3  5  
ATOM   3011  H  HG2  . ARG A 1 37 ? 8.925   14.796  17.338  1.00 0.00 ? 565 ARG A HG2  5  
ATOM   3012  H  HG3  . ARG A 1 37 ? 10.036  14.837  15.967  1.00 0.00 ? 565 ARG A HG3  5  
ATOM   3013  H  HD2  . ARG A 1 37 ? 7.157   15.588  15.627  1.00 0.00 ? 565 ARG A HD2  5  
ATOM   3014  H  HD3  . ARG A 1 37 ? 8.318   16.753  16.261  1.00 0.00 ? 565 ARG A HD3  5  
ATOM   3015  H  HE   . ARG A 1 37 ? 9.182   15.508  13.827  1.00 0.00 ? 565 ARG A HE   5  
ATOM   3016  H  HH11 . ARG A 1 37 ? 7.258   18.091  15.172  1.00 0.00 ? 565 ARG A HH11 5  
ATOM   3017  H  HH12 . ARG A 1 37 ? 7.367   19.078  13.754  1.00 0.00 ? 565 ARG A HH12 5  
ATOM   3018  H  HH21 . ARG A 1 37 ? 9.326   16.806  11.961  1.00 0.00 ? 565 ARG A HH21 5  
ATOM   3019  H  HH22 . ARG A 1 37 ? 8.540   18.349  11.931  1.00 0.00 ? 565 ARG A HH22 5  
HETATM 3020  ZN ZN   . ZN  B 2 .  ? -0.090  4.234   5.211   1.00 0.00 ? 100 ZN  A ZN   5  
ATOM   3021  N  N    . MET A 1 1  ? -15.169 -13.469 -13.411 1.00 0.00 ? 1   MET A N    6  
ATOM   3022  C  CA   . MET A 1 1  ? -13.857 -13.217 -12.760 1.00 0.00 ? 1   MET A CA   6  
ATOM   3023  C  C    . MET A 1 1  ? -13.684 -14.082 -11.516 1.00 0.00 ? 1   MET A C    6  
ATOM   3024  O  O    . MET A 1 1  ? -14.558 -14.124 -10.651 1.00 0.00 ? 1   MET A O    6  
ATOM   3025  C  CB   . MET A 1 1  ? -13.775 -11.735 -12.388 1.00 0.00 ? 1   MET A CB   6  
ATOM   3026  C  CG   . MET A 1 1  ? -14.975 -11.240 -11.598 1.00 0.00 ? 1   MET A CG   6  
ATOM   3027  S  SD   . MET A 1 1  ? -14.594 -9.793  -10.591 1.00 0.00 ? 1   MET A SD   6  
ATOM   3028  C  CE   . MET A 1 1  ? -15.466 -8.514  -11.491 1.00 0.00 ? 1   MET A CE   6  
ATOM   3029  H  H1   . MET A 1 1  ? -15.902 -13.426 -12.674 1.00 0.00 ? 1   MET A H1   6  
ATOM   3030  H  H2   . MET A 1 1  ? -15.130 -14.413 -13.848 1.00 0.00 ? 1   MET A H2   6  
ATOM   3031  H  H3   . MET A 1 1  ? -15.316 -12.729 -14.127 1.00 0.00 ? 1   MET A H3   6  
ATOM   3032  H  HA   . MET A 1 1  ? -13.073 -13.451 -13.465 1.00 0.00 ? 1   MET A HA   6  
ATOM   3033  H  HB2  . MET A 1 1  ? -12.888 -11.574 -11.794 1.00 0.00 ? 1   MET A HB2  6  
ATOM   3034  H  HB3  . MET A 1 1  ? -13.702 -11.152 -13.294 1.00 0.00 ? 1   MET A HB3  6  
ATOM   3035  H  HG2  . MET A 1 1  ? -15.762 -10.981 -12.290 1.00 0.00 ? 1   MET A HG2  6  
ATOM   3036  H  HG3  . MET A 1 1  ? -15.314 -12.034 -10.949 1.00 0.00 ? 1   MET A HG3  6  
ATOM   3037  H  HE1  . MET A 1 1  ? -15.078 -8.454  -12.497 1.00 0.00 ? 1   MET A HE1  6  
ATOM   3038  H  HE2  . MET A 1 1  ? -15.327 -7.565  -10.994 1.00 0.00 ? 1   MET A HE2  6  
ATOM   3039  H  HE3  . MET A 1 1  ? -16.519 -8.752  -11.525 1.00 0.00 ? 1   MET A HE3  6  
ATOM   3040  N  N    . ASP A 1 2  ? -12.551 -14.772 -11.434 1.00 0.00 ? 530 ASP A N    6  
ATOM   3041  C  CA   . ASP A 1 2  ? -12.265 -15.637 -10.294 1.00 0.00 ? 530 ASP A CA   6  
ATOM   3042  C  C    . ASP A 1 2  ? -11.718 -14.829 -9.119  1.00 0.00 ? 530 ASP A C    6  
ATOM   3043  O  O    . ASP A 1 2  ? -12.227 -14.923 -8.002  1.00 0.00 ? 530 ASP A O    6  
ATOM   3044  C  CB   . ASP A 1 2  ? -11.268 -16.728 -10.691 1.00 0.00 ? 530 ASP A CB   6  
ATOM   3045  C  CG   . ASP A 1 2  ? -11.704 -18.105 -10.229 1.00 0.00 ? 530 ASP A CG   6  
ATOM   3046  O  OD1  . ASP A 1 2  ? -12.778 -18.565 -10.669 1.00 0.00 ? 530 ASP A OD1  6  
ATOM   3047  O  OD2  . ASP A 1 2  ? -10.971 -18.722 -9.428  1.00 0.00 ? 530 ASP A OD2  6  
ATOM   3048  H  H    . ASP A 1 2  ? -11.892 -14.698 -12.155 1.00 0.00 ? 530 ASP A H    6  
ATOM   3049  H  HA   . ASP A 1 2  ? -13.191 -16.102 -9.993  1.00 0.00 ? 530 ASP A HA   6  
ATOM   3050  H  HB2  . ASP A 1 2  ? -11.170 -16.745 -11.766 1.00 0.00 ? 530 ASP A HB2  6  
ATOM   3051  H  HB3  . ASP A 1 2  ? -10.307 -16.508 -10.249 1.00 0.00 ? 530 ASP A HB3  6  
ATOM   3052  N  N    . PRO A 1 3  ? -10.668 -14.020 -9.354  1.00 0.00 ? 531 PRO A N    6  
ATOM   3053  C  CA   . PRO A 1 3  ? -10.058 -13.197 -8.304  1.00 0.00 ? 531 PRO A CA   6  
ATOM   3054  C  C    . PRO A 1 3  ? -11.069 -12.272 -7.635  1.00 0.00 ? 531 PRO A C    6  
ATOM   3055  O  O    . PRO A 1 3  ? -12.049 -11.857 -8.252  1.00 0.00 ? 531 PRO A O    6  
ATOM   3056  C  CB   . PRO A 1 3  ? -9.000  -12.379 -9.052  1.00 0.00 ? 531 PRO A CB   6  
ATOM   3057  C  CG   . PRO A 1 3  ? -8.709  -13.164 -10.284 1.00 0.00 ? 531 PRO A CG   6  
ATOM   3058  C  CD   . PRO A 1 3  ? -9.996  -13.844 -10.654 1.00 0.00 ? 531 PRO A CD   6  
ATOM   3059  H  HA   . PRO A 1 3  ? -9.579  -13.808 -7.552  1.00 0.00 ? 531 PRO A HA   6  
ATOM   3060  H  HB2  . PRO A 1 3  ? -9.398  -11.403 -9.290  1.00 0.00 ? 531 PRO A HB2  6  
ATOM   3061  H  HB3  . PRO A 1 3  ? -8.120  -12.274 -8.435  1.00 0.00 ? 531 PRO A HB3  6  
ATOM   3062  H  HG2  . PRO A 1 3  ? -8.394  -12.500 -11.076 1.00 0.00 ? 531 PRO A HG2  6  
ATOM   3063  H  HG3  . PRO A 1 3  ? -7.943  -13.897 -10.081 1.00 0.00 ? 531 PRO A HG3  6  
ATOM   3064  H  HD2  . PRO A 1 3  ? -10.581 -13.215 -11.309 1.00 0.00 ? 531 PRO A HD2  6  
ATOM   3065  H  HD3  . PRO A 1 3  ? -9.799  -14.797 -11.119 1.00 0.00 ? 531 PRO A HD3  6  
ATOM   3066  N  N    . GLY A 1 4  ? -10.822 -11.951 -6.369  1.00 0.00 ? 532 GLY A N    6  
ATOM   3067  C  CA   . GLY A 1 4  ? -11.719 -11.075 -5.638  1.00 0.00 ? 532 GLY A CA   6  
ATOM   3068  C  C    . GLY A 1 4  ? -11.363 -9.612  -5.805  1.00 0.00 ? 532 GLY A C    6  
ATOM   3069  O  O    . GLY A 1 4  ? -12.210 -8.797  -6.171  1.00 0.00 ? 532 GLY A O    6  
ATOM   3070  H  H    . GLY A 1 4  ? -10.024 -12.310 -5.928  1.00 0.00 ? 532 GLY A H    6  
ATOM   3071  H  HA2  . GLY A 1 4  ? -12.727 -11.232 -5.994  1.00 0.00 ? 532 GLY A HA2  6  
ATOM   3072  H  HA3  . GLY A 1 4  ? -11.676 -11.328 -4.589  1.00 0.00 ? 532 GLY A HA3  6  
ATOM   3073  N  N    . LYS A 1 5  ? -10.104 -9.278  -5.538  1.00 0.00 ? 533 LYS A N    6  
ATOM   3074  C  CA   . LYS A 1 5  ? -9.634  -7.903  -5.661  1.00 0.00 ? 533 LYS A CA   6  
ATOM   3075  C  C    . LYS A 1 5  ? -8.175  -7.866  -6.103  1.00 0.00 ? 533 LYS A C    6  
ATOM   3076  O  O    . LYS A 1 5  ? -7.305  -8.446  -5.454  1.00 0.00 ? 533 LYS A O    6  
ATOM   3077  C  CB   . LYS A 1 5  ? -9.797  -7.165  -4.331  1.00 0.00 ? 533 LYS A CB   6  
ATOM   3078  C  CG   . LYS A 1 5  ? -9.747  -5.652  -4.466  1.00 0.00 ? 533 LYS A CG   6  
ATOM   3079  C  CD   . LYS A 1 5  ? -10.619 -4.970  -3.424  1.00 0.00 ? 533 LYS A CD   6  
ATOM   3080  C  CE   . LYS A 1 5  ? -11.334 -3.760  -4.002  1.00 0.00 ? 533 LYS A CE   6  
ATOM   3081  N  NZ   . LYS A 1 5  ? -12.229 -3.113  -3.003  1.00 0.00 ? 533 LYS A NZ   6  
ATOM   3082  H  H    . LYS A 1 5  ? -9.476  -9.974  -5.252  1.00 0.00 ? 533 LYS A H    6  
ATOM   3083  H  HA   . LYS A 1 5  ? -10.238 -7.413  -6.411  1.00 0.00 ? 533 LYS A HA   6  
ATOM   3084  H  HB2  . LYS A 1 5  ? -10.747 -7.435  -3.897  1.00 0.00 ? 533 LYS A HB2  6  
ATOM   3085  H  HB3  . LYS A 1 5  ? -9.005  -7.472  -3.664  1.00 0.00 ? 533 LYS A HB3  6  
ATOM   3086  H  HG2  . LYS A 1 5  ? -8.727  -5.322  -4.338  1.00 0.00 ? 533 LYS A HG2  6  
ATOM   3087  H  HG3  . LYS A 1 5  ? -10.095 -5.376  -5.451  1.00 0.00 ? 533 LYS A HG3  6  
ATOM   3088  H  HD2  . LYS A 1 5  ? -11.356 -5.675  -3.069  1.00 0.00 ? 533 LYS A HD2  6  
ATOM   3089  H  HD3  . LYS A 1 5  ? -9.996  -4.651  -2.601  1.00 0.00 ? 533 LYS A HD3  6  
ATOM   3090  H  HE2  . LYS A 1 5  ? -10.595 -3.042  -4.327  1.00 0.00 ? 533 LYS A HE2  6  
ATOM   3091  H  HE3  . LYS A 1 5  ? -11.924 -4.077  -4.850  1.00 0.00 ? 533 LYS A HE3  6  
ATOM   3092  H  HZ1  . LYS A 1 5  ? -13.087 -2.757  -3.470  1.00 0.00 ? 533 LYS A HZ1  6  
ATOM   3093  H  HZ2  . LYS A 1 5  ? -11.740 -2.316  -2.548  1.00 0.00 ? 533 LYS A HZ2  6  
ATOM   3094  H  HZ3  . LYS A 1 5  ? -12.504 -3.800  -2.272  1.00 0.00 ? 533 LYS A HZ3  6  
ATOM   3095  N  N    . LYS A 1 6  ? -7.915  -7.181  -7.212  1.00 0.00 ? 534 LYS A N    6  
ATOM   3096  C  CA   . LYS A 1 6  ? -6.560  -7.069  -7.740  1.00 0.00 ? 534 LYS A CA   6  
ATOM   3097  C  C    . LYS A 1 6  ? -6.261  -5.638  -8.174  1.00 0.00 ? 534 LYS A C    6  
ATOM   3098  O  O    . LYS A 1 6  ? -7.163  -4.805  -8.264  1.00 0.00 ? 534 LYS A O    6  
ATOM   3099  C  CB   . LYS A 1 6  ? -6.371  -8.024  -8.921  1.00 0.00 ? 534 LYS A CB   6  
ATOM   3100  C  CG   . LYS A 1 6  ? -5.028  -8.738  -8.917  1.00 0.00 ? 534 LYS A CG   6  
ATOM   3101  C  CD   . LYS A 1 6  ? -4.276  -8.525  -10.222 1.00 0.00 ? 534 LYS A CD   6  
ATOM   3102  C  CE   . LYS A 1 6  ? -3.505  -9.770  -10.632 1.00 0.00 ? 534 LYS A CE   6  
ATOM   3103  N  NZ   . LYS A 1 6  ? -2.154  -9.437  -11.161 1.00 0.00 ? 534 LYS A NZ   6  
ATOM   3104  H  H    . LYS A 1 6  ? -8.651  -6.741  -7.686  1.00 0.00 ? 534 LYS A H    6  
ATOM   3105  H  HA   . LYS A 1 6  ? -5.874  -7.345  -6.953  1.00 0.00 ? 534 LYS A HA   6  
ATOM   3106  H  HB2  . LYS A 1 6  ? -7.151  -8.771  -8.893  1.00 0.00 ? 534 LYS A HB2  6  
ATOM   3107  H  HB3  . LYS A 1 6  ? -6.455  -7.463  -9.840  1.00 0.00 ? 534 LYS A HB3  6  
ATOM   3108  H  HG2  . LYS A 1 6  ? -4.431  -8.356  -8.103  1.00 0.00 ? 534 LYS A HG2  6  
ATOM   3109  H  HG3  . LYS A 1 6  ? -5.195  -9.797  -8.778  1.00 0.00 ? 534 LYS A HG3  6  
ATOM   3110  H  HD2  . LYS A 1 6  ? -4.985  -8.281  -10.999 1.00 0.00 ? 534 LYS A HD2  6  
ATOM   3111  H  HD3  . LYS A 1 6  ? -3.582  -7.707  -10.096 1.00 0.00 ? 534 LYS A HD3  6  
ATOM   3112  H  HE2  . LYS A 1 6  ? -3.395  -10.411 -9.769  1.00 0.00 ? 534 LYS A HE2  6  
ATOM   3113  H  HE3  . LYS A 1 6  ? -4.064  -10.289 -11.396 1.00 0.00 ? 534 LYS A HE3  6  
ATOM   3114  H  HZ1  . LYS A 1 6  ? -1.472  -10.175 -10.891 1.00 0.00 ? 534 LYS A HZ1  6  
ATOM   3115  H  HZ2  . LYS A 1 6  ? -1.833  -8.526  -10.776 1.00 0.00 ? 534 LYS A HZ2  6  
ATOM   3116  H  HZ3  . LYS A 1 6  ? -2.183  -9.370  -12.199 1.00 0.00 ? 534 LYS A HZ3  6  
ATOM   3117  N  N    . LYS A 1 7  ? -4.989  -5.359  -8.442  1.00 0.00 ? 535 LYS A N    6  
ATOM   3118  C  CA   . LYS A 1 7  ? -4.570  -4.028  -8.867  1.00 0.00 ? 535 LYS A CA   6  
ATOM   3119  C  C    . LYS A 1 7  ? -4.853  -2.995  -7.782  1.00 0.00 ? 535 LYS A C    6  
ATOM   3120  O  O    . LYS A 1 7  ? -5.708  -3.202  -6.921  1.00 0.00 ? 535 LYS A O    6  
ATOM   3121  C  CB   . LYS A 1 7  ? -5.284  -3.635  -10.162 1.00 0.00 ? 535 LYS A CB   6  
ATOM   3122  C  CG   . LYS A 1 7  ? -4.626  -2.476  -10.892 1.00 0.00 ? 535 LYS A CG   6  
ATOM   3123  C  CD   . LYS A 1 7  ? -5.404  -2.087  -12.140 1.00 0.00 ? 535 LYS A CD   6  
ATOM   3124  C  CE   . LYS A 1 7  ? -4.482  -1.880  -13.331 1.00 0.00 ? 535 LYS A CE   6  
ATOM   3125  N  NZ   . LYS A 1 7  ? -4.225  -0.437  -13.591 1.00 0.00 ? 535 LYS A NZ   6  
ATOM   3126  H  H    . LYS A 1 7  ? -4.316  -6.066  -8.352  1.00 0.00 ? 535 LYS A H    6  
ATOM   3127  H  HA   . LYS A 1 7  ? -3.506  -4.059  -9.049  1.00 0.00 ? 535 LYS A HA   6  
ATOM   3128  H  HB2  . LYS A 1 7  ? -5.299  -4.487  -10.824 1.00 0.00 ? 535 LYS A HB2  6  
ATOM   3129  H  HB3  . LYS A 1 7  ? -6.300  -3.354  -9.928  1.00 0.00 ? 535 LYS A HB3  6  
ATOM   3130  H  HG2  . LYS A 1 7  ? -4.581  -1.624  -10.229 1.00 0.00 ? 535 LYS A HG2  6  
ATOM   3131  H  HG3  . LYS A 1 7  ? -3.625  -2.765  -11.177 1.00 0.00 ? 535 LYS A HG3  6  
ATOM   3132  H  HD2  . LYS A 1 7  ? -6.106  -2.873  -12.374 1.00 0.00 ? 535 LYS A HD2  6  
ATOM   3133  H  HD3  . LYS A 1 7  ? -5.939  -1.169  -11.946 1.00 0.00 ? 535 LYS A HD3  6  
ATOM   3134  H  HE2  . LYS A 1 7  ? -3.542  -2.374  -13.134 1.00 0.00 ? 535 LYS A HE2  6  
ATOM   3135  H  HE3  . LYS A 1 7  ? -4.941  -2.319  -14.205 1.00 0.00 ? 535 LYS A HE3  6  
ATOM   3136  H  HZ1  . LYS A 1 7  ? -4.870  -0.086  -14.328 1.00 0.00 ? 535 LYS A HZ1  6  
ATOM   3137  H  HZ2  . LYS A 1 7  ? -3.245  -0.300  -13.910 1.00 0.00 ? 535 LYS A HZ2  6  
ATOM   3138  H  HZ3  . LYS A 1 7  ? -4.375  0.115   -12.722 1.00 0.00 ? 535 LYS A HZ3  6  
ATOM   3139  N  N    . GLN A 1 8  ? -4.128  -1.881  -7.830  1.00 0.00 ? 536 GLN A N    6  
ATOM   3140  C  CA   . GLN A 1 8  ? -4.299  -0.811  -6.852  1.00 0.00 ? 536 GLN A CA   6  
ATOM   3141  C  C    . GLN A 1 8  ? -3.941  -1.292  -5.449  1.00 0.00 ? 536 GLN A C    6  
ATOM   3142  O  O    . GLN A 1 8  ? -4.468  -2.297  -4.972  1.00 0.00 ? 536 GLN A O    6  
ATOM   3143  C  CB   . GLN A 1 8  ? -5.739  -0.294  -6.875  1.00 0.00 ? 536 GLN A CB   6  
ATOM   3144  C  CG   . GLN A 1 8  ? -6.170  0.246   -8.229  1.00 0.00 ? 536 GLN A CG   6  
ATOM   3145  C  CD   . GLN A 1 8  ? -7.451  1.053   -8.154  1.00 0.00 ? 536 GLN A CD   6  
ATOM   3146  O  OE1  . GLN A 1 8  ? -8.414  0.778   -8.870  1.00 0.00 ? 536 GLN A OE1  6  
ATOM   3147  N  NE2  . GLN A 1 8  ? -7.468  2.058   -7.286  1.00 0.00 ? 536 GLN A NE2  6  
ATOM   3148  H  H    . GLN A 1 8  ? -3.462  -1.775  -8.541  1.00 0.00 ? 536 GLN A H    6  
ATOM   3149  H  HA   . GLN A 1 8  ? -3.633  -0.006  -7.123  1.00 0.00 ? 536 GLN A HA   6  
ATOM   3150  H  HB2  . GLN A 1 8  ? -6.404  -1.101  -6.605  1.00 0.00 ? 536 GLN A HB2  6  
ATOM   3151  H  HB3  . GLN A 1 8  ? -5.836  0.499   -6.148  1.00 0.00 ? 536 GLN A HB3  6  
ATOM   3152  H  HG2  . GLN A 1 8  ? -5.385  0.880   -8.615  1.00 0.00 ? 536 GLN A HG2  6  
ATOM   3153  H  HG3  . GLN A 1 8  ? -6.323  -0.585  -8.901  1.00 0.00 ? 536 GLN A HG3  6  
ATOM   3154  H  HE21 . GLN A 1 8  ? -6.665  2.219   -6.749  1.00 0.00 ? 536 GLN A HE21 6  
ATOM   3155  H  HE22 . GLN A 1 8  ? -8.284  2.596   -7.217  1.00 0.00 ? 536 GLN A HE22 6  
ATOM   3156  N  N    . HIS A 1 9  ? -3.040  -0.568  -4.792  1.00 0.00 ? 537 HIS A N    6  
ATOM   3157  C  CA   . HIS A 1 9  ? -2.610  -0.920  -3.444  1.00 0.00 ? 537 HIS A CA   6  
ATOM   3158  C  C    . HIS A 1 9  ? -2.887  0.220   -2.469  1.00 0.00 ? 537 HIS A C    6  
ATOM   3159  O  O    . HIS A 1 9  ? -2.232  1.261   -2.513  1.00 0.00 ? 537 HIS A O    6  
ATOM   3160  C  CB   . HIS A 1 9  ? -1.120  -1.264  -3.434  1.00 0.00 ? 537 HIS A CB   6  
ATOM   3161  C  CG   . HIS A 1 9  ? -0.752  -2.355  -4.390  1.00 0.00 ? 537 HIS A CG   6  
ATOM   3162  N  ND1  . HIS A 1 9  ? -1.646  -3.282  -4.878  1.00 0.00 ? 537 HIS A ND1  6  
ATOM   3163  C  CD2  . HIS A 1 9  ? 0.446   -2.659  -4.953  1.00 0.00 ? 537 HIS A CD2  6  
ATOM   3164  C  CE1  . HIS A 1 9  ? -0.979  -4.102  -5.702  1.00 0.00 ? 537 HIS A CE1  6  
ATOM   3165  N  NE2  . HIS A 1 9  ? 0.294   -3.766  -5.782  1.00 0.00 ? 537 HIS A NE2  6  
ATOM   3166  H  H    . HIS A 1 9  ? -2.655  0.223   -5.225  1.00 0.00 ? 537 HIS A H    6  
ATOM   3167  H  HA   . HIS A 1 9  ? -3.173  -1.788  -3.133  1.00 0.00 ? 537 HIS A HA   6  
ATOM   3168  H  HB2  . HIS A 1 9  ? -0.553  -0.385  -3.701  1.00 0.00 ? 537 HIS A HB2  6  
ATOM   3169  H  HB3  . HIS A 1 9  ? -0.837  -1.581  -2.441  1.00 0.00 ? 537 HIS A HB3  6  
ATOM   3170  H  HD1  . HIS A 1 9  ? -2.600  -3.334  -4.660  1.00 0.00 ? 537 HIS A HD1  6  
ATOM   3171  H  HD2  . HIS A 1 9  ? 1.375   -2.132  -4.789  1.00 0.00 ? 537 HIS A HD2  6  
ATOM   3172  H  HE1  . HIS A 1 9  ? -1.426  -4.930  -6.232  1.00 0.00 ? 537 HIS A HE1  6  
ATOM   3173  N  N    . ILE A 1 10 ? -3.863  0.016   -1.589  1.00 0.00 ? 538 ILE A N    6  
ATOM   3174  C  CA   . ILE A 1 10 ? -4.227  1.027   -0.604  1.00 0.00 ? 538 ILE A CA   6  
ATOM   3175  C  C    . ILE A 1 10 ? -3.665  0.680   0.771   1.00 0.00 ? 538 ILE A C    6  
ATOM   3176  O  O    . ILE A 1 10 ? -3.638  -0.486  1.166   1.00 0.00 ? 538 ILE A O    6  
ATOM   3177  C  CB   . ILE A 1 10 ? -5.757  1.182   -0.496  1.00 0.00 ? 538 ILE A CB   6  
ATOM   3178  C  CG1  . ILE A 1 10 ? -6.375  1.372   -1.883  1.00 0.00 ? 538 ILE A CG1  6  
ATOM   3179  C  CG2  . ILE A 1 10 ? -6.110  2.353   0.409   1.00 0.00 ? 538 ILE A CG2  6  
ATOM   3180  C  CD1  . ILE A 1 10 ? -7.788  0.841   -1.993  1.00 0.00 ? 538 ILE A CD1  6  
ATOM   3181  H  H    . ILE A 1 10 ? -4.349  -0.835  -1.604  1.00 0.00 ? 538 ILE A H    6  
ATOM   3182  H  HA   . ILE A 1 10 ? -3.812  1.971   -0.924  1.00 0.00 ? 538 ILE A HA   6  
ATOM   3183  H  HB   . ILE A 1 10 ? -6.157  0.283   -0.052  1.00 0.00 ? 538 ILE A HB   6  
ATOM   3184  H  HG12 . ILE A 1 10 ? -6.398  2.425   -2.119  1.00 0.00 ? 538 ILE A HG12 6  
ATOM   3185  H  HG13 . ILE A 1 10 ? -5.768  0.857   -2.614  1.00 0.00 ? 538 ILE A HG13 6  
ATOM   3186  H  HG21 . ILE A 1 10 ? -6.228  2.001   1.424   1.00 0.00 ? 538 ILE A HG21 6  
ATOM   3187  H  HG22 . ILE A 1 10 ? -7.033  2.802   0.074   1.00 0.00 ? 538 ILE A HG22 6  
ATOM   3188  H  HG23 . ILE A 1 10 ? -5.319  3.087   0.373   1.00 0.00 ? 538 ILE A HG23 6  
ATOM   3189  H  HD11 . ILE A 1 10 ? -8.474  1.553   -1.560  1.00 0.00 ? 538 ILE A HD11 6  
ATOM   3190  H  HD12 . ILE A 1 10 ? -7.862  -0.098  -1.465  1.00 0.00 ? 538 ILE A HD12 6  
ATOM   3191  H  HD13 . ILE A 1 10 ? -8.035  0.690   -3.034  1.00 0.00 ? 538 ILE A HD13 6  
ATOM   3192  N  N    . CYS A 1 11 ? -3.218  1.700   1.497   1.00 0.00 ? 539 CYS A N    6  
ATOM   3193  C  CA   . CYS A 1 11 ? -2.658  1.503   2.829   1.00 0.00 ? 539 CYS A CA   6  
ATOM   3194  C  C    . CYS A 1 11 ? -3.690  0.880   3.764   1.00 0.00 ? 539 CYS A C    6  
ATOM   3195  O  O    . CYS A 1 11 ? -4.763  1.443   3.984   1.00 0.00 ? 539 CYS A O    6  
ATOM   3196  C  CB   . CYS A 1 11 ? -2.168  2.837   3.398   1.00 0.00 ? 539 CYS A CB   6  
ATOM   3197  S  SG   . CYS A 1 11 ? -0.375  3.055   3.325   1.00 0.00 ? 539 CYS A SG   6  
ATOM   3198  H  H    . CYS A 1 11 ? -3.267  2.607   1.130   1.00 0.00 ? 539 CYS A H    6  
ATOM   3199  H  HA   . CYS A 1 11 ? -1.819  0.830   2.739   1.00 0.00 ? 539 CYS A HA   6  
ATOM   3200  H  HB2  . CYS A 1 11 ? -2.618  3.645   2.841   1.00 0.00 ? 539 CYS A HB2  6  
ATOM   3201  H  HB3  . CYS A 1 11 ? -2.467  2.912   4.434   1.00 0.00 ? 539 CYS A HB3  6  
ATOM   3202  N  N    . HIS A 1 12 ? -3.360  -0.286  4.310   1.00 0.00 ? 540 HIS A N    6  
ATOM   3203  C  CA   . HIS A 1 12 ? -4.260  -0.986  5.219   1.00 0.00 ? 540 HIS A CA   6  
ATOM   3204  C  C    . HIS A 1 12 ? -3.903  -0.694  6.673   1.00 0.00 ? 540 HIS A C    6  
ATOM   3205  O  O    . HIS A 1 12 ? -4.054  -1.551  7.544   1.00 0.00 ? 540 HIS A O    6  
ATOM   3206  C  CB   . HIS A 1 12 ? -4.208  -2.493  4.961   1.00 0.00 ? 540 HIS A CB   6  
ATOM   3207  C  CG   . HIS A 1 12 ? -5.212  -2.961  3.954   1.00 0.00 ? 540 HIS A CG   6  
ATOM   3208  N  ND1  . HIS A 1 12 ? -4.963  -3.044  2.602   1.00 0.00 ? 540 HIS A ND1  6  
ATOM   3209  C  CD2  . HIS A 1 12 ? -6.493  -3.379  4.125   1.00 0.00 ? 540 HIS A CD2  6  
ATOM   3210  C  CE1  . HIS A 1 12 ? -6.074  -3.497  2.006   1.00 0.00 ? 540 HIS A CE1  6  
ATOM   3211  N  NE2  . HIS A 1 12 ? -7.032  -3.717  2.887   1.00 0.00 ? 540 HIS A NE2  6  
ATOM   3212  H  H    . HIS A 1 12 ? -2.491  -0.686  4.095   1.00 0.00 ? 540 HIS A H    6  
ATOM   3213  H  HA   . HIS A 1 12 ? -5.262  -0.632  5.030   1.00 0.00 ? 540 HIS A HA   6  
ATOM   3214  H  HB2  . HIS A 1 12 ? -3.226  -2.756  4.597   1.00 0.00 ? 540 HIS A HB2  6  
ATOM   3215  H  HB3  . HIS A 1 12 ? -4.396  -3.016  5.887   1.00 0.00 ? 540 HIS A HB3  6  
ATOM   3216  H  HD1  . HIS A 1 12 ? -4.123  -2.811  2.155   1.00 0.00 ? 540 HIS A HD1  6  
ATOM   3217  H  HD2  . HIS A 1 12 ? -7.019  -3.443  5.066   1.00 0.00 ? 540 HIS A HD2  6  
ATOM   3218  H  HE1  . HIS A 1 12 ? -6.173  -3.662  0.943   1.00 0.00 ? 540 HIS A HE1  6  
ATOM   3219  N  N    . ILE A 1 13 ? -3.433  0.522   6.930   1.00 0.00 ? 541 ILE A N    6  
ATOM   3220  C  CA   . ILE A 1 13 ? -3.059  0.927   8.279   1.00 0.00 ? 541 ILE A CA   6  
ATOM   3221  C  C    . ILE A 1 13 ? -3.817  2.179   8.705   1.00 0.00 ? 541 ILE A C    6  
ATOM   3222  O  O    . ILE A 1 13 ? -4.201  2.999   7.871   1.00 0.00 ? 541 ILE A O    6  
ATOM   3223  C  CB   . ILE A 1 13 ? -1.546  1.196   8.389   1.00 0.00 ? 541 ILE A CB   6  
ATOM   3224  C  CG1  . ILE A 1 13 ? -0.755  0.011   7.836   1.00 0.00 ? 541 ILE A CG1  6  
ATOM   3225  C  CG2  . ILE A 1 13 ? -1.157  1.469   9.835   1.00 0.00 ? 541 ILE A CG2  6  
ATOM   3226  C  CD1  . ILE A 1 13 ? -1.066  -1.299  8.526   1.00 0.00 ? 541 ILE A CD1  6  
ATOM   3227  H  H    . ILE A 1 13 ? -3.337  1.163   6.196   1.00 0.00 ? 541 ILE A H    6  
ATOM   3228  H  HA   . ILE A 1 13 ? -3.310  0.120   8.952   1.00 0.00 ? 541 ILE A HA   6  
ATOM   3229  H  HB   . ILE A 1 13 ? -1.315  2.076   7.808   1.00 0.00 ? 541 ILE A HB   6  
ATOM   3230  H  HG12 . ILE A 1 13 ? -0.980  -0.106  6.787   1.00 0.00 ? 541 ILE A HG12 6  
ATOM   3231  H  HG13 . ILE A 1 13 ? 0.301   0.206   7.954   1.00 0.00 ? 541 ILE A HG13 6  
ATOM   3232  H  HG21 . ILE A 1 13 ? -0.089  1.361   9.947   1.00 0.00 ? 541 ILE A HG21 6  
ATOM   3233  H  HG22 . ILE A 1 13 ? -1.660  0.766   10.482  1.00 0.00 ? 541 ILE A HG22 6  
ATOM   3234  H  HG23 . ILE A 1 13 ? -1.447  2.475   10.102  1.00 0.00 ? 541 ILE A HG23 6  
ATOM   3235  H  HD11 . ILE A 1 13 ? -0.187  -1.927  8.520   1.00 0.00 ? 541 ILE A HD11 6  
ATOM   3236  H  HD12 . ILE A 1 13 ? -1.869  -1.799  8.004   1.00 0.00 ? 541 ILE A HD12 6  
ATOM   3237  H  HD13 . ILE A 1 13 ? -1.364  -1.107  9.546   1.00 0.00 ? 541 ILE A HD13 6  
ATOM   3238  N  N    . GLN A 1 14 ? -4.029  2.317   10.008  1.00 0.00 ? 542 GLN A N    6  
ATOM   3239  C  CA   . GLN A 1 14 ? -4.741  3.464   10.549  1.00 0.00 ? 542 GLN A CA   6  
ATOM   3240  C  C    . GLN A 1 14 ? -3.855  4.706   10.549  1.00 0.00 ? 542 GLN A C    6  
ATOM   3241  O  O    . GLN A 1 14 ? -3.326  5.102   11.587  1.00 0.00 ? 542 GLN A O    6  
ATOM   3242  C  CB   . GLN A 1 14 ? -5.224  3.168   11.970  1.00 0.00 ? 542 GLN A CB   6  
ATOM   3243  C  CG   . GLN A 1 14 ? -6.346  2.144   12.029  1.00 0.00 ? 542 GLN A CG   6  
ATOM   3244  C  CD   . GLN A 1 14 ? -6.048  1.004   12.983  1.00 0.00 ? 542 GLN A CD   6  
ATOM   3245  O  OE1  . GLN A 1 14 ? -6.191  1.142   14.198  1.00 0.00 ? 542 GLN A OE1  6  
ATOM   3246  N  NE2  . GLN A 1 14 ? -5.629  -0.131  12.436  1.00 0.00 ? 542 GLN A NE2  6  
ATOM   3247  H  H    . GLN A 1 14 ? -3.699  1.630   10.619  1.00 0.00 ? 542 GLN A H    6  
ATOM   3248  H  HA   . GLN A 1 14 ? -5.595  3.645   9.919   1.00 0.00 ? 542 GLN A HA   6  
ATOM   3249  H  HB2  . GLN A 1 14 ? -4.393  2.794   12.549  1.00 0.00 ? 542 GLN A HB2  6  
ATOM   3250  H  HB3  . GLN A 1 14 ? -5.579  4.085   12.416  1.00 0.00 ? 542 GLN A HB3  6  
ATOM   3251  H  HG2  . GLN A 1 14 ? -7.250  2.637   12.354  1.00 0.00 ? 542 GLN A HG2  6  
ATOM   3252  H  HG3  . GLN A 1 14 ? -6.496  1.736   11.040  1.00 0.00 ? 542 GLN A HG3  6  
ATOM   3253  H  HE21 . GLN A 1 14 ? -5.538  -0.169  11.461  1.00 0.00 ? 542 GLN A HE21 6  
ATOM   3254  H  HE22 . GLN A 1 14 ? -5.429  -0.885  13.029  1.00 0.00 ? 542 GLN A HE22 6  
ATOM   3255  N  N    . GLY A 1 15 ? -3.695  5.315   9.378   1.00 0.00 ? 543 GLY A N    6  
ATOM   3256  C  CA   . GLY A 1 15 ? -2.871  6.504   9.272   1.00 0.00 ? 543 GLY A CA   6  
ATOM   3257  C  C    . GLY A 1 15 ? -2.882  7.103   7.879   1.00 0.00 ? 543 GLY A C    6  
ATOM   3258  O  O    . GLY A 1 15 ? -2.957  8.322   7.722   1.00 0.00 ? 543 GLY A O    6  
ATOM   3259  H  H    . GLY A 1 15 ? -4.140  4.955   8.582   1.00 0.00 ? 543 GLY A H    6  
ATOM   3260  H  HA2  . GLY A 1 15 ? -3.233  7.243   9.971   1.00 0.00 ? 543 GLY A HA2  6  
ATOM   3261  H  HA3  . GLY A 1 15 ? -1.855  6.247   9.532   1.00 0.00 ? 543 GLY A HA3  6  
ATOM   3262  N  N    . CYS A 1 16 ? -2.803  6.248   6.864   1.00 0.00 ? 544 CYS A N    6  
ATOM   3263  C  CA   . CYS A 1 16 ? -2.800  6.706   5.480   1.00 0.00 ? 544 CYS A CA   6  
ATOM   3264  C  C    . CYS A 1 16 ? -4.151  6.460   4.818   1.00 0.00 ? 544 CYS A C    6  
ATOM   3265  O  O    . CYS A 1 16 ? -5.044  5.853   5.409   1.00 0.00 ? 544 CYS A O    6  
ATOM   3266  C  CB   . CYS A 1 16 ? -1.698  5.999   4.692   1.00 0.00 ? 544 CYS A CB   6  
ATOM   3267  S  SG   . CYS A 1 16 ? -0.903  7.033   3.440   1.00 0.00 ? 544 CYS A SG   6  
ATOM   3268  H  H    . CYS A 1 16 ? -2.742  5.287   7.049   1.00 0.00 ? 544 CYS A H    6  
ATOM   3269  H  HA   . CYS A 1 16 ? -2.602  7.768   5.484   1.00 0.00 ? 544 CYS A HA   6  
ATOM   3270  H  HB2  . CYS A 1 16 ? -0.932  5.666   5.376   1.00 0.00 ? 544 CYS A HB2  6  
ATOM   3271  H  HB3  . CYS A 1 16 ? -2.121  5.143   4.190   1.00 0.00 ? 544 CYS A HB3  6  
ATOM   3272  N  N    . GLY A 1 17 ? -4.290  6.934   3.584   1.00 0.00 ? 545 GLY A N    6  
ATOM   3273  C  CA   . GLY A 1 17 ? -5.530  6.758   2.853   1.00 0.00 ? 545 GLY A CA   6  
ATOM   3274  C  C    . GLY A 1 17 ? -5.412  7.201   1.409   1.00 0.00 ? 545 GLY A C    6  
ATOM   3275  O  O    . GLY A 1 17 ? -6.372  7.703   0.825   1.00 0.00 ? 545 GLY A O    6  
ATOM   3276  H  H    . GLY A 1 17 ? -3.541  7.409   3.166   1.00 0.00 ? 545 GLY A H    6  
ATOM   3277  H  HA2  . GLY A 1 17 ? -5.806  5.714   2.878   1.00 0.00 ? 545 GLY A HA2  6  
ATOM   3278  H  HA3  . GLY A 1 17 ? -6.305  7.337   3.334   1.00 0.00 ? 545 GLY A HA3  6  
ATOM   3279  N  N    . LYS A 1 18 ? -4.228  7.017   0.833   1.00 0.00 ? 546 LYS A N    6  
ATOM   3280  C  CA   . LYS A 1 18 ? -3.982  7.402   -0.551  1.00 0.00 ? 546 LYS A CA   6  
ATOM   3281  C  C    . LYS A 1 18 ? -4.187  6.218   -1.491  1.00 0.00 ? 546 LYS A C    6  
ATOM   3282  O  O    . LYS A 1 18 ? -4.662  5.160   -1.079  1.00 0.00 ? 546 LYS A O    6  
ATOM   3283  C  CB   . LYS A 1 18 ? -2.561  7.952   -0.704  1.00 0.00 ? 546 LYS A CB   6  
ATOM   3284  C  CG   . LYS A 1 18 ? -1.476  6.916   -0.454  1.00 0.00 ? 546 LYS A CG   6  
ATOM   3285  C  CD   . LYS A 1 18 ? -0.220  7.553   0.119   1.00 0.00 ? 546 LYS A CD   6  
ATOM   3286  C  CE   . LYS A 1 18 ? 0.722   8.015   -0.982  1.00 0.00 ? 546 LYS A CE   6  
ATOM   3287  N  NZ   . LYS A 1 18 ? 2.143   7.703   -0.665  1.00 0.00 ? 546 LYS A NZ   6  
ATOM   3288  H  H    . LYS A 1 18 ? -3.501  6.613   1.352   1.00 0.00 ? 546 LYS A H    6  
ATOM   3289  H  HA   . LYS A 1 18 ? -4.687  8.177   -0.809  1.00 0.00 ? 546 LYS A HA   6  
ATOM   3290  H  HB2  . LYS A 1 18 ? -2.441  8.333   -1.707  1.00 0.00 ? 546 LYS A HB2  6  
ATOM   3291  H  HB3  . LYS A 1 18 ? -2.424  8.761   -0.002  1.00 0.00 ? 546 LYS A HB3  6  
ATOM   3292  H  HG2  . LYS A 1 18 ? -1.847  6.183   0.246   1.00 0.00 ? 546 LYS A HG2  6  
ATOM   3293  H  HG3  . LYS A 1 18 ? -1.231  6.434   -1.389  1.00 0.00 ? 546 LYS A HG3  6  
ATOM   3294  H  HD2  . LYS A 1 18 ? -0.501  8.404   0.720   1.00 0.00 ? 546 LYS A HD2  6  
ATOM   3295  H  HD3  . LYS A 1 18 ? 0.291   6.827   0.736   1.00 0.00 ? 546 LYS A HD3  6  
ATOM   3296  H  HE2  . LYS A 1 18 ? 0.451   7.520   -1.902  1.00 0.00 ? 546 LYS A HE2  6  
ATOM   3297  H  HE3  . LYS A 1 18 ? 0.615   9.083   -1.103  1.00 0.00 ? 546 LYS A HE3  6  
ATOM   3298  H  HZ1  . LYS A 1 18 ? 2.301   7.759   0.362   1.00 0.00 ? 546 LYS A HZ1  6  
ATOM   3299  H  HZ2  . LYS A 1 18 ? 2.773   8.382   -1.138  1.00 0.00 ? 546 LYS A HZ2  6  
ATOM   3300  H  HZ3  . LYS A 1 18 ? 2.379   6.744   -0.990  1.00 0.00 ? 546 LYS A HZ3  6  
ATOM   3301  N  N    . VAL A 1 19 ? -3.826  6.404   -2.757  1.00 0.00 ? 547 VAL A N    6  
ATOM   3302  C  CA   . VAL A 1 19 ? -3.971  5.351   -3.755  1.00 0.00 ? 547 VAL A CA   6  
ATOM   3303  C  C    . VAL A 1 19 ? -2.702  5.206   -4.589  1.00 0.00 ? 547 VAL A C    6  
ATOM   3304  O  O    . VAL A 1 19 ? -2.236  6.167   -5.201  1.00 0.00 ? 547 VAL A O    6  
ATOM   3305  C  CB   . VAL A 1 19 ? -5.159  5.627   -4.695  1.00 0.00 ? 547 VAL A CB   6  
ATOM   3306  C  CG1  . VAL A 1 19 ? -5.416  4.430   -5.597  1.00 0.00 ? 547 VAL A CG1  6  
ATOM   3307  C  CG2  . VAL A 1 19 ? -6.404  5.977   -3.894  1.00 0.00 ? 547 VAL A CG2  6  
ATOM   3308  H  H    . VAL A 1 19 ? -3.454  7.269   -3.026  1.00 0.00 ? 547 VAL A H    6  
ATOM   3309  H  HA   . VAL A 1 19 ? -4.157  4.423   -3.236  1.00 0.00 ? 547 VAL A HA   6  
ATOM   3310  H  HB   . VAL A 1 19 ? -4.909  6.472   -5.320  1.00 0.00 ? 547 VAL A HB   6  
ATOM   3311  H  HG11 . VAL A 1 19 ? -6.225  3.841   -5.192  1.00 0.00 ? 547 VAL A HG11 6  
ATOM   3312  H  HG12 . VAL A 1 19 ? -4.524  3.824   -5.654  1.00 0.00 ? 547 VAL A HG12 6  
ATOM   3313  H  HG13 . VAL A 1 19 ? -5.681  4.774   -6.586  1.00 0.00 ? 547 VAL A HG13 6  
ATOM   3314  H  HG21 . VAL A 1 19 ? -7.133  6.437   -4.545  1.00 0.00 ? 547 VAL A HG21 6  
ATOM   3315  H  HG22 . VAL A 1 19 ? -6.142  6.666   -3.105  1.00 0.00 ? 547 VAL A HG22 6  
ATOM   3316  H  HG23 . VAL A 1 19 ? -6.820  5.078   -3.465  1.00 0.00 ? 547 VAL A HG23 6  
ATOM   3317  N  N    . TYR A 1 20 ? -2.148  3.999   -4.608  1.00 0.00 ? 548 TYR A N    6  
ATOM   3318  C  CA   . TYR A 1 20 ? -0.933  3.727   -5.368  1.00 0.00 ? 548 TYR A CA   6  
ATOM   3319  C  C    . TYR A 1 20 ? -0.906  2.281   -5.851  1.00 0.00 ? 548 TYR A C    6  
ATOM   3320  O  O    . TYR A 1 20 ? -0.583  1.368   -5.091  1.00 0.00 ? 548 TYR A O    6  
ATOM   3321  C  CB   . TYR A 1 20 ? 0.304   4.016   -4.514  1.00 0.00 ? 548 TYR A CB   6  
ATOM   3322  C  CG   . TYR A 1 20 ? 0.250   3.392   -3.138  1.00 0.00 ? 548 TYR A CG   6  
ATOM   3323  C  CD1  . TYR A 1 20 ? -0.659  3.838   -2.187  1.00 0.00 ? 548 TYR A CD1  6  
ATOM   3324  C  CD2  . TYR A 1 20 ? 1.109   2.358   -2.790  1.00 0.00 ? 548 TYR A CD2  6  
ATOM   3325  C  CE1  . TYR A 1 20 ? -0.710  3.271   -0.928  1.00 0.00 ? 548 TYR A CE1  6  
ATOM   3326  C  CE2  . TYR A 1 20 ? 1.064   1.785   -1.534  1.00 0.00 ? 548 TYR A CE2  6  
ATOM   3327  C  CZ   . TYR A 1 20 ? 0.153   2.245   -0.606  1.00 0.00 ? 548 TYR A CZ   6  
ATOM   3328  O  OH   . TYR A 1 20 ? 0.105   1.677   0.646   1.00 0.00 ? 548 TYR A OH   6  
ATOM   3329  H  H    . TYR A 1 20 ? -2.566  3.272   -4.100  1.00 0.00 ? 548 TYR A H    6  
ATOM   3330  H  HA   . TYR A 1 20 ? -0.926  4.381   -6.227  1.00 0.00 ? 548 TYR A HA   6  
ATOM   3331  H  HB2  . TYR A 1 20 ? 1.178   3.631   -5.018  1.00 0.00 ? 548 TYR A HB2  6  
ATOM   3332  H  HB3  . TYR A 1 20 ? 0.406   5.084   -4.392  1.00 0.00 ? 548 TYR A HB3  6  
ATOM   3333  H  HD1  . TYR A 1 20 ? -1.334  4.642   -2.442  1.00 0.00 ? 548 TYR A HD1  6  
ATOM   3334  H  HD2  . TYR A 1 20 ? 1.822   2.000   -3.519  1.00 0.00 ? 548 TYR A HD2  6  
ATOM   3335  H  HE1  . TYR A 1 20 ? -1.424  3.631   -0.202  1.00 0.00 ? 548 TYR A HE1  6  
ATOM   3336  H  HE2  . TYR A 1 20 ? 1.740   0.981   -1.282  1.00 0.00 ? 548 TYR A HE2  6  
ATOM   3337  H  HH   . TYR A 1 20 ? 0.996   1.485   0.945   1.00 0.00 ? 548 TYR A HH   6  
ATOM   3338  N  N    . GLY A 1 21 ? -1.248  2.080   -7.120  1.00 0.00 ? 549 GLY A N    6  
ATOM   3339  C  CA   . GLY A 1 21 ? -1.257  0.742   -7.682  1.00 0.00 ? 549 GLY A CA   6  
ATOM   3340  C  C    . GLY A 1 21 ? 0.125   0.279   -8.100  1.00 0.00 ? 549 GLY A C    6  
ATOM   3341  O  O    . GLY A 1 21 ? 0.356   -0.032  -9.268  1.00 0.00 ? 549 GLY A O    6  
ATOM   3342  H  H    . GLY A 1 21 ? -1.496  2.846   -7.678  1.00 0.00 ? 549 GLY A H    6  
ATOM   3343  H  HA2  . GLY A 1 21 ? -1.647  0.057   -6.944  1.00 0.00 ? 549 GLY A HA2  6  
ATOM   3344  H  HA3  . GLY A 1 21 ? -1.904  0.732   -8.546  1.00 0.00 ? 549 GLY A HA3  6  
ATOM   3345  N  N    . LYS A 1 22 ? 1.046   0.231   -7.142  1.00 0.00 ? 550 LYS A N    6  
ATOM   3346  C  CA   . LYS A 1 22 ? 2.412   -0.199  -7.417  1.00 0.00 ? 550 LYS A CA   6  
ATOM   3347  C  C    . LYS A 1 22 ? 3.024   -0.880  -6.198  1.00 0.00 ? 550 LYS A C    6  
ATOM   3348  O  O    . LYS A 1 22 ? 3.259   -0.244  -5.171  1.00 0.00 ? 550 LYS A O    6  
ATOM   3349  C  CB   . LYS A 1 22 ? 3.271   0.997   -7.833  1.00 0.00 ? 550 LYS A CB   6  
ATOM   3350  C  CG   . LYS A 1 22 ? 3.109   1.384   -9.294  1.00 0.00 ? 550 LYS A CG   6  
ATOM   3351  C  CD   . LYS A 1 22 ? 4.440   1.765   -9.922  1.00 0.00 ? 550 LYS A CD   6  
ATOM   3352  C  CE   . LYS A 1 22 ? 4.246   2.474   -11.253 1.00 0.00 ? 550 LYS A CE   6  
ATOM   3353  N  NZ   . LYS A 1 22 ? 5.267   3.534   -11.473 1.00 0.00 ? 550 LYS A NZ   6  
ATOM   3354  H  H    . LYS A 1 22 ? 0.801   0.491   -6.230  1.00 0.00 ? 550 LYS A H    6  
ATOM   3355  H  HA   . LYS A 1 22 ? 2.379   -0.907  -8.232  1.00 0.00 ? 550 LYS A HA   6  
ATOM   3356  H  HB2  . LYS A 1 22 ? 3.002   1.848   -7.225  1.00 0.00 ? 550 LYS A HB2  6  
ATOM   3357  H  HB3  . LYS A 1 22 ? 4.310   0.756   -7.659  1.00 0.00 ? 550 LYS A HB3  6  
ATOM   3358  H  HG2  . LYS A 1 22 ? 2.695   0.547   -9.835  1.00 0.00 ? 550 LYS A HG2  6  
ATOM   3359  H  HG3  . LYS A 1 22 ? 2.436   2.227   -9.360  1.00 0.00 ? 550 LYS A HG3  6  
ATOM   3360  H  HD2  . LYS A 1 22 ? 4.969   2.424   -9.250  1.00 0.00 ? 550 LYS A HD2  6  
ATOM   3361  H  HD3  . LYS A 1 22 ? 5.021   0.869   -10.083 1.00 0.00 ? 550 LYS A HD3  6  
ATOM   3362  H  HE2  . LYS A 1 22 ? 4.319   1.746   -12.047 1.00 0.00 ? 550 LYS A HE2  6  
ATOM   3363  H  HE3  . LYS A 1 22 ? 3.263   2.923   -11.267 1.00 0.00 ? 550 LYS A HE3  6  
ATOM   3364  H  HZ1  . LYS A 1 22 ? 4.890   4.459   -11.182 1.00 0.00 ? 550 LYS A HZ1  6  
ATOM   3365  H  HZ2  . LYS A 1 22 ? 5.526   3.579   -12.479 1.00 0.00 ? 550 LYS A HZ2  6  
ATOM   3366  H  HZ3  . LYS A 1 22 ? 6.121   3.329   -10.915 1.00 0.00 ? 550 LYS A HZ3  6  
ATOM   3367  N  N    . THR A 1 23 ? 3.281   -2.179  -6.319  1.00 0.00 ? 551 THR A N    6  
ATOM   3368  C  CA   . THR A 1 23 ? 3.866   -2.948  -5.228  1.00 0.00 ? 551 THR A CA   6  
ATOM   3369  C  C    . THR A 1 23 ? 5.256   -2.425  -4.880  1.00 0.00 ? 551 THR A C    6  
ATOM   3370  O  O    . THR A 1 23 ? 5.612   -2.315  -3.706  1.00 0.00 ? 551 THR A O    6  
ATOM   3371  C  CB   . THR A 1 23 ? 3.945   -4.428  -5.603  1.00 0.00 ? 551 THR A CB   6  
ATOM   3372  O  OG1  . THR A 1 23 ? 2.734   -4.860  -6.198  1.00 0.00 ? 551 THR A OG1  6  
ATOM   3373  C  CG2  . THR A 1 23 ? 4.224   -5.331  -4.421  1.00 0.00 ? 551 THR A CG2  6  
ATOM   3374  H  H    . THR A 1 23 ? 3.072   -2.631  -7.164  1.00 0.00 ? 551 THR A H    6  
ATOM   3375  H  HA   . THR A 1 23 ? 3.227   -2.837  -4.364  1.00 0.00 ? 551 THR A HA   6  
ATOM   3376  H  HB   . THR A 1 23 ? 4.742   -4.565  -6.319  1.00 0.00 ? 551 THR A HB   6  
ATOM   3377  H  HG1  . THR A 1 23 ? 2.836   -5.760  -6.516  1.00 0.00 ? 551 THR A HG1  6  
ATOM   3378  H  HG21 . THR A 1 23 ? 5.121   -5.001  -3.920  1.00 0.00 ? 551 THR A HG21 6  
ATOM   3379  H  HG22 . THR A 1 23 ? 4.357   -6.346  -4.767  1.00 0.00 ? 551 THR A HG22 6  
ATOM   3380  H  HG23 . THR A 1 23 ? 3.392   -5.292  -3.734  1.00 0.00 ? 551 THR A HG23 6  
ATOM   3381  N  N    . SER A 1 24 ? 6.037   -2.103  -5.906  1.00 0.00 ? 552 SER A N    6  
ATOM   3382  C  CA   . SER A 1 24 ? 7.387   -1.590  -5.705  1.00 0.00 ? 552 SER A CA   6  
ATOM   3383  C  C    . SER A 1 24 ? 7.361   -0.316  -4.866  1.00 0.00 ? 552 SER A C    6  
ATOM   3384  O  O    . SER A 1 24 ? 8.244   -0.085  -4.042  1.00 0.00 ? 552 SER A O    6  
ATOM   3385  C  CB   . SER A 1 24 ? 8.060   -1.316  -7.051  1.00 0.00 ? 552 SER A CB   6  
ATOM   3386  O  OG   . SER A 1 24 ? 7.180   -0.641  -7.933  1.00 0.00 ? 552 SER A OG   6  
ATOM   3387  H  H    . SER A 1 24 ? 5.698   -2.211  -6.819  1.00 0.00 ? 552 SER A H    6  
ATOM   3388  H  HA   . SER A 1 24 ? 7.953   -2.343  -5.175  1.00 0.00 ? 552 SER A HA   6  
ATOM   3389  H  HB2  . SER A 1 24 ? 8.935   -0.703  -6.897  1.00 0.00 ? 552 SER A HB2  6  
ATOM   3390  H  HB3  . SER A 1 24 ? 8.352   -2.253  -7.502  1.00 0.00 ? 552 SER A HB3  6  
ATOM   3391  H  HG   . SER A 1 24 ? 6.875   0.171   -7.522  1.00 0.00 ? 552 SER A HG   6  
ATOM   3392  N  N    . HIS A 1 25 ? 6.337   0.504   -5.078  1.00 0.00 ? 553 HIS A N    6  
ATOM   3393  C  CA   . HIS A 1 25 ? 6.192   1.749   -4.335  1.00 0.00 ? 553 HIS A CA   6  
ATOM   3394  C  C    . HIS A 1 25 ? 5.696   1.474   -2.919  1.00 0.00 ? 553 HIS A C    6  
ATOM   3395  O  O    . HIS A 1 25 ? 5.997   2.222   -1.988  1.00 0.00 ? 553 HIS A O    6  
ATOM   3396  C  CB   . HIS A 1 25 ? 5.225   2.690   -5.055  1.00 0.00 ? 553 HIS A CB   6  
ATOM   3397  C  CG   . HIS A 1 25 ? 5.614   4.133   -4.959  1.00 0.00 ? 553 HIS A CG   6  
ATOM   3398  N  ND1  . HIS A 1 25 ? 6.561   4.616   -4.084  1.00 0.00 ? 553 HIS A ND1  6  
ATOM   3399  C  CD2  . HIS A 1 25 ? 5.164   5.209   -5.655  1.00 0.00 ? 553 HIS A CD2  6  
ATOM   3400  C  CE1  . HIS A 1 25 ? 6.654   5.940   -4.269  1.00 0.00 ? 553 HIS A CE1  6  
ATOM   3401  N  NE2  . HIS A 1 25 ? 5.827   6.350   -5.212  1.00 0.00 ? 553 HIS A NE2  6  
ATOM   3402  H  H    . HIS A 1 25 ? 5.660   0.263   -5.745  1.00 0.00 ? 553 HIS A H    6  
ATOM   3403  H  HA   . HIS A 1 25 ? 7.163   2.216   -4.279  1.00 0.00 ? 553 HIS A HA   6  
ATOM   3404  H  HB2  . HIS A 1 25 ? 5.187   2.426   -6.101  1.00 0.00 ? 553 HIS A HB2  6  
ATOM   3405  H  HB3  . HIS A 1 25 ? 4.240   2.581   -4.625  1.00 0.00 ? 553 HIS A HB3  6  
ATOM   3406  H  HD1  . HIS A 1 25 ? 7.075   4.087   -3.439  1.00 0.00 ? 553 HIS A HD1  6  
ATOM   3407  H  HD2  . HIS A 1 25 ? 4.411   5.193   -6.429  1.00 0.00 ? 553 HIS A HD2  6  
ATOM   3408  H  HE1  . HIS A 1 25 ? 7.321   6.588   -3.719  1.00 0.00 ? 553 HIS A HE1  6  
ATOM   3409  N  N    . LEU A 1 26 ? 4.937   0.394   -2.765  1.00 0.00 ? 554 LEU A N    6  
ATOM   3410  C  CA   . LEU A 1 26 ? 4.401   0.016   -1.464  1.00 0.00 ? 554 LEU A CA   6  
ATOM   3411  C  C    . LEU A 1 26 ? 5.524   -0.377  -0.509  1.00 0.00 ? 554 LEU A C    6  
ATOM   3412  O  O    . LEU A 1 26 ? 5.473   -0.074  0.683   1.00 0.00 ? 554 LEU A O    6  
ATOM   3413  C  CB   . LEU A 1 26 ? 3.413   -1.144  -1.614  1.00 0.00 ? 554 LEU A CB   6  
ATOM   3414  C  CG   . LEU A 1 26 ? 2.886   -1.724  -0.299  1.00 0.00 ? 554 LEU A CG   6  
ATOM   3415  C  CD1  . LEU A 1 26 ? 2.269   -0.630  0.558   1.00 0.00 ? 554 LEU A CD1  6  
ATOM   3416  C  CD2  . LEU A 1 26 ? 1.873   -2.825  -0.572  1.00 0.00 ? 554 LEU A CD2  6  
ATOM   3417  H  H    . LEU A 1 26 ? 4.733   -0.164  -3.545  1.00 0.00 ? 554 LEU A H    6  
ATOM   3418  H  HA   . LEU A 1 26 ? 3.880   0.870   -1.058  1.00 0.00 ? 554 LEU A HA   6  
ATOM   3419  H  HB2  . LEU A 1 26 ? 2.570   -0.797  -2.194  1.00 0.00 ? 554 LEU A HB2  6  
ATOM   3420  H  HB3  . LEU A 1 26 ? 3.902   -1.937  -2.159  1.00 0.00 ? 554 LEU A HB3  6  
ATOM   3421  H  HG   . LEU A 1 26 ? 3.710   -2.155  0.252   1.00 0.00 ? 554 LEU A HG   6  
ATOM   3422  H  HD11 . LEU A 1 26 ? 2.925   0.228   0.575   1.00 0.00 ? 554 LEU A HD11 6  
ATOM   3423  H  HD12 . LEU A 1 26 ? 2.130   -0.996  1.565   1.00 0.00 ? 554 LEU A HD12 6  
ATOM   3424  H  HD13 . LEU A 1 26 ? 1.314   -0.344  0.144   1.00 0.00 ? 554 LEU A HD13 6  
ATOM   3425  H  HD21 . LEU A 1 26 ? 1.124   -2.826  0.206   1.00 0.00 ? 554 LEU A HD21 6  
ATOM   3426  H  HD22 . LEU A 1 26 ? 2.376   -3.781  -0.589  1.00 0.00 ? 554 LEU A HD22 6  
ATOM   3427  H  HD23 . LEU A 1 26 ? 1.400   -2.651  -1.527  1.00 0.00 ? 554 LEU A HD23 6  
ATOM   3428  N  N    . ARG A 1 27 ? 6.537   -1.054  -1.041  1.00 0.00 ? 555 ARG A N    6  
ATOM   3429  C  CA   . ARG A 1 27 ? 7.670   -1.489  -0.236  1.00 0.00 ? 555 ARG A CA   6  
ATOM   3430  C  C    . ARG A 1 27 ? 8.449   -0.290  0.301   1.00 0.00 ? 555 ARG A C    6  
ATOM   3431  O  O    . ARG A 1 27 ? 8.895   -0.291  1.449   1.00 0.00 ? 555 ARG A O    6  
ATOM   3432  C  CB   . ARG A 1 27 ? 8.584   -2.411  -1.057  1.00 0.00 ? 555 ARG A CB   6  
ATOM   3433  C  CG   . ARG A 1 27 ? 9.666   -1.687  -1.846  1.00 0.00 ? 555 ARG A CG   6  
ATOM   3434  C  CD   . ARG A 1 27 ? 10.143  -2.517  -3.027  1.00 0.00 ? 555 ARG A CD   6  
ATOM   3435  N  NE   . ARG A 1 27 ? 11.357  -1.970  -3.627  1.00 0.00 ? 555 ARG A NE   6  
ATOM   3436  C  CZ   . ARG A 1 27 ? 12.582  -2.183  -3.150  1.00 0.00 ? 555 ARG A CZ   6  
ATOM   3437  N  NH1  . ARG A 1 27 ? 12.760  -2.925  -2.064  1.00 0.00 ? 555 ARG A NH1  6  
ATOM   3438  N  NH2  . ARG A 1 27 ? 13.632  -1.652  -3.761  1.00 0.00 ? 555 ARG A NH2  6  
ATOM   3439  H  H    . ARG A 1 27 ? 6.520   -1.267  -1.997  1.00 0.00 ? 555 ARG A H    6  
ATOM   3440  H  HA   . ARG A 1 27 ? 7.277   -2.045  0.601   1.00 0.00 ? 555 ARG A HA   6  
ATOM   3441  H  HB2  . ARG A 1 27 ? 9.067   -3.106  -0.386  1.00 0.00 ? 555 ARG A HB2  6  
ATOM   3442  H  HB3  . ARG A 1 27 ? 7.975   -2.968  -1.755  1.00 0.00 ? 555 ARG A HB3  6  
ATOM   3443  H  HG2  . ARG A 1 27 ? 9.267   -0.754  -2.214  1.00 0.00 ? 555 ARG A HG2  6  
ATOM   3444  H  HG3  . ARG A 1 27 ? 10.503  -1.490  -1.194  1.00 0.00 ? 555 ARG A HG3  6  
ATOM   3445  H  HD2  . ARG A 1 27 ? 10.342  -3.522  -2.687  1.00 0.00 ? 555 ARG A HD2  6  
ATOM   3446  H  HD3  . ARG A 1 27 ? 9.362   -2.539  -3.773  1.00 0.00 ? 555 ARG A HD3  6  
ATOM   3447  H  HE   . ARG A 1 27 ? 11.255  -1.416  -4.429  1.00 0.00 ? 555 ARG A HE   6  
ATOM   3448  H  HH11 . ARG A 1 27 ? 11.973  -3.329  -1.598  1.00 0.00 ? 555 ARG A HH11 6  
ATOM   3449  H  HH12 . ARG A 1 27 ? 13.683  -3.082  -1.712  1.00 0.00 ? 555 ARG A HH12 6  
ATOM   3450  H  HH21 . ARG A 1 27 ? 13.503  -1.091  -4.579  1.00 0.00 ? 555 ARG A HH21 6  
ATOM   3451  H  HH22 . ARG A 1 27 ? 14.552  -1.811  -3.404  1.00 0.00 ? 555 ARG A HH22 6  
ATOM   3452  N  N    . ALA A 1 28 ? 8.607   0.732   -0.535  1.00 0.00 ? 556 ALA A N    6  
ATOM   3453  C  CA   . ALA A 1 28 ? 9.328   1.933   -0.144  1.00 0.00 ? 556 ALA A CA   6  
ATOM   3454  C  C    . ALA A 1 28 ? 8.478   2.807   0.771   1.00 0.00 ? 556 ALA A C    6  
ATOM   3455  O  O    . ALA A 1 28 ? 8.987   3.429   1.702   1.00 0.00 ? 556 ALA A O    6  
ATOM   3456  C  CB   . ALA A 1 28 ? 9.758   2.715   -1.376  1.00 0.00 ? 556 ALA A CB   6  
ATOM   3457  H  H    . ALA A 1 28 ? 8.229   0.677   -1.434  1.00 0.00 ? 556 ALA A H    6  
ATOM   3458  H  HA   . ALA A 1 28 ? 10.214  1.627   0.386   1.00 0.00 ? 556 ALA A HA   6  
ATOM   3459  H  HB1  . ALA A 1 28 ? 9.777   2.057   -2.232  1.00 0.00 ? 556 ALA A HB1  6  
ATOM   3460  H  HB2  . ALA A 1 28 ? 10.744  3.126   -1.216  1.00 0.00 ? 556 ALA A HB2  6  
ATOM   3461  H  HB3  . ALA A 1 28 ? 9.058   3.518   -1.555  1.00 0.00 ? 556 ALA A HB3  6  
ATOM   3462  N  N    . HIS A 1 29 ? 7.179   2.849   0.496   1.00 0.00 ? 557 HIS A N    6  
ATOM   3463  C  CA   . HIS A 1 29 ? 6.252   3.645   1.287   1.00 0.00 ? 557 HIS A CA   6  
ATOM   3464  C  C    . HIS A 1 29 ? 5.964   2.974   2.628   1.00 0.00 ? 557 HIS A C    6  
ATOM   3465  O  O    . HIS A 1 29 ? 5.716   3.646   3.629   1.00 0.00 ? 557 HIS A O    6  
ATOM   3466  C  CB   . HIS A 1 29 ? 4.949   3.859   0.509   1.00 0.00 ? 557 HIS A CB   6  
ATOM   3467  C  CG   . HIS A 1 29 ? 3.831   4.421   1.334   1.00 0.00 ? 557 HIS A CG   6  
ATOM   3468  N  ND1  . HIS A 1 29 ? 3.952   5.531   2.139   1.00 0.00 ? 557 HIS A ND1  6  
ATOM   3469  C  CD2  . HIS A 1 29 ? 2.548   3.998   1.470   1.00 0.00 ? 557 HIS A CD2  6  
ATOM   3470  C  CE1  . HIS A 1 29 ? 2.767   5.743   2.728   1.00 0.00 ? 557 HIS A CE1  6  
ATOM   3471  N  NE2  . HIS A 1 29 ? 1.881   4.840   2.354   1.00 0.00 ? 557 HIS A NE2  6  
ATOM   3472  H  H    . HIS A 1 29 ? 6.835   2.335   -0.260  1.00 0.00 ? 557 HIS A H    6  
ATOM   3473  H  HA   . HIS A 1 29 ? 6.714   4.601   1.467   1.00 0.00 ? 557 HIS A HA   6  
ATOM   3474  H  HB2  . HIS A 1 29 ? 5.133   4.544   -0.305  1.00 0.00 ? 557 HIS A HB2  6  
ATOM   3475  H  HB3  . HIS A 1 29 ? 4.621   2.912   0.106   1.00 0.00 ? 557 HIS A HB3  6  
ATOM   3476  H  HD1  . HIS A 1 29 ? 4.762   6.070   2.261   1.00 0.00 ? 557 HIS A HD1  6  
ATOM   3477  H  HD2  . HIS A 1 29 ? 2.106   3.145   0.976   1.00 0.00 ? 557 HIS A HD2  6  
ATOM   3478  H  HE1  . HIS A 1 29 ? 2.564   6.548   3.417   1.00 0.00 ? 557 HIS A HE1  6  
ATOM   3479  N  N    . LEU A 1 30 ? 5.992   1.645   2.638   1.00 0.00 ? 558 LEU A N    6  
ATOM   3480  C  CA   . LEU A 1 30 ? 5.726   0.884   3.852   1.00 0.00 ? 558 LEU A CA   6  
ATOM   3481  C  C    . LEU A 1 30 ? 6.817   1.104   4.896   1.00 0.00 ? 558 LEU A C    6  
ATOM   3482  O  O    . LEU A 1 30 ? 6.535   1.189   6.092   1.00 0.00 ? 558 LEU A O    6  
ATOM   3483  C  CB   . LEU A 1 30 ? 5.611   -0.607  3.527   1.00 0.00 ? 558 LEU A CB   6  
ATOM   3484  C  CG   . LEU A 1 30 ? 5.211   -1.497  4.705   1.00 0.00 ? 558 LEU A CG   6  
ATOM   3485  C  CD1  . LEU A 1 30 ? 3.701   -1.495  4.887   1.00 0.00 ? 558 LEU A CD1  6  
ATOM   3486  C  CD2  . LEU A 1 30 ? 5.722   -2.915  4.497   1.00 0.00 ? 558 LEU A CD2  6  
ATOM   3487  H  H    . LEU A 1 30 ? 6.190   1.165   1.808   1.00 0.00 ? 558 LEU A H    6  
ATOM   3488  H  HA   . LEU A 1 30 ? 4.786   1.227   4.255   1.00 0.00 ? 558 LEU A HA   6  
ATOM   3489  H  HB2  . LEU A 1 30 ? 4.875   -0.727  2.745   1.00 0.00 ? 558 LEU A HB2  6  
ATOM   3490  H  HB3  . LEU A 1 30 ? 6.566   -0.948  3.156   1.00 0.00 ? 558 LEU A HB3  6  
ATOM   3491  H  HG   . LEU A 1 30 ? 5.657   -1.109  5.609   1.00 0.00 ? 558 LEU A HG   6  
ATOM   3492  H  HD11 . LEU A 1 30 ? 3.222   -1.566  3.922   1.00 0.00 ? 558 LEU A HD11 6  
ATOM   3493  H  HD12 . LEU A 1 30 ? 3.399   -0.579  5.373   1.00 0.00 ? 558 LEU A HD12 6  
ATOM   3494  H  HD13 . LEU A 1 30 ? 3.411   -2.338  5.496   1.00 0.00 ? 558 LEU A HD13 6  
ATOM   3495  H  HD21 . LEU A 1 30 ? 5.075   -3.610  5.011   1.00 0.00 ? 558 LEU A HD21 6  
ATOM   3496  H  HD22 . LEU A 1 30 ? 6.725   -2.997  4.891   1.00 0.00 ? 558 LEU A HD22 6  
ATOM   3497  H  HD23 . LEU A 1 30 ? 5.731   -3.143  3.442   1.00 0.00 ? 558 LEU A HD23 6  
ATOM   3498  N  N    . ARG A 1 31 ? 8.063   1.191   4.441   1.00 0.00 ? 559 ARG A N    6  
ATOM   3499  C  CA   . ARG A 1 31 ? 9.192   1.395   5.343   1.00 0.00 ? 559 ARG A CA   6  
ATOM   3500  C  C    . ARG A 1 31 ? 9.033   2.690   6.136   1.00 0.00 ? 559 ARG A C    6  
ATOM   3501  O  O    . ARG A 1 31 ? 9.509   2.798   7.266   1.00 0.00 ? 559 ARG A O    6  
ATOM   3502  C  CB   . ARG A 1 31 ? 10.507  1.415   4.556   1.00 0.00 ? 559 ARG A CB   6  
ATOM   3503  C  CG   . ARG A 1 31 ? 10.708  2.674   3.724   1.00 0.00 ? 559 ARG A CG   6  
ATOM   3504  C  CD   . ARG A 1 31 ? 11.856  3.521   4.254   1.00 0.00 ? 559 ARG A CD   6  
ATOM   3505  N  NE   . ARG A 1 31 ? 12.714  4.015   3.179   1.00 0.00 ? 559 ARG A NE   6  
ATOM   3506  C  CZ   . ARG A 1 31 ? 13.659  3.286   2.589   1.00 0.00 ? 559 ARG A CZ   6  
ATOM   3507  N  NH1  . ARG A 1 31 ? 13.870  2.030   2.964   1.00 0.00 ? 559 ARG A NH1  6  
ATOM   3508  N  NH2  . ARG A 1 31 ? 14.395  3.814   1.621   1.00 0.00 ? 559 ARG A NH2  6  
ATOM   3509  H  H    . ARG A 1 31 ? 8.227   1.112   3.478   1.00 0.00 ? 559 ARG A H    6  
ATOM   3510  H  HA   . ARG A 1 31 ? 9.212   0.567   6.035   1.00 0.00 ? 559 ARG A HA   6  
ATOM   3511  H  HB2  . ARG A 1 31 ? 11.328  1.333   5.252   1.00 0.00 ? 559 ARG A HB2  6  
ATOM   3512  H  HB3  . ARG A 1 31 ? 10.526  0.564   3.891   1.00 0.00 ? 559 ARG A HB3  6  
ATOM   3513  H  HG2  . ARG A 1 31 ? 10.926  2.390   2.706   1.00 0.00 ? 559 ARG A HG2  6  
ATOM   3514  H  HG3  . ARG A 1 31 ? 9.801   3.259   3.751   1.00 0.00 ? 559 ARG A HG3  6  
ATOM   3515  H  HD2  . ARG A 1 31 ? 11.447  4.364   4.790   1.00 0.00 ? 559 ARG A HD2  6  
ATOM   3516  H  HD3  . ARG A 1 31 ? 12.450  2.921   4.928   1.00 0.00 ? 559 ARG A HD3  6  
ATOM   3517  H  HE   . ARG A 1 31 ? 12.579  4.939   2.882   1.00 0.00 ? 559 ARG A HE   6  
ATOM   3518  H  HH11 . ARG A 1 31 ? 13.318  1.625   3.693   1.00 0.00 ? 559 ARG A HH11 6  
ATOM   3519  H  HH12 . ARG A 1 31 ? 14.582  1.488   2.517   1.00 0.00 ? 559 ARG A HH12 6  
ATOM   3520  H  HH21 . ARG A 1 31 ? 14.239  4.760   1.334   1.00 0.00 ? 559 ARG A HH21 6  
ATOM   3521  H  HH22 . ARG A 1 31 ? 15.105  3.267   1.178   1.00 0.00 ? 559 ARG A HH22 6  
ATOM   3522  N  N    . TRP A 1 32 ? 8.363   3.669   5.538   1.00 0.00 ? 560 TRP A N    6  
ATOM   3523  C  CA   . TRP A 1 32 ? 8.144   4.954   6.190   1.00 0.00 ? 560 TRP A CA   6  
ATOM   3524  C  C    . TRP A 1 32 ? 7.170   4.813   7.356   1.00 0.00 ? 560 TRP A C    6  
ATOM   3525  O  O    . TRP A 1 32 ? 7.398   5.356   8.438   1.00 0.00 ? 560 TRP A O    6  
ATOM   3526  C  CB   . TRP A 1 32 ? 7.613   5.978   5.183   1.00 0.00 ? 560 TRP A CB   6  
ATOM   3527  C  CG   . TRP A 1 32 ? 8.416   7.241   5.141   1.00 0.00 ? 560 TRP A CG   6  
ATOM   3528  C  CD1  . TRP A 1 32 ? 9.154   7.709   4.091   1.00 0.00 ? 560 TRP A CD1  6  
ATOM   3529  C  CD2  . TRP A 1 32 ? 8.565   8.200   6.194   1.00 0.00 ? 560 TRP A CD2  6  
ATOM   3530  N  NE1  . TRP A 1 32 ? 9.752   8.899   4.428   1.00 0.00 ? 560 TRP A NE1  6  
ATOM   3531  C  CE2  . TRP A 1 32 ? 9.405   9.222   5.713   1.00 0.00 ? 560 TRP A CE2  6  
ATOM   3532  C  CE3  . TRP A 1 32 ? 8.068   8.294   7.498   1.00 0.00 ? 560 TRP A CE3  6  
ATOM   3533  C  CZ2  . TRP A 1 32 ? 9.759   10.323  6.490   1.00 0.00 ? 560 TRP A CZ2  6  
ATOM   3534  C  CZ3  . TRP A 1 32 ? 8.419   9.387   8.267   1.00 0.00 ? 560 TRP A CZ3  6  
ATOM   3535  C  CH2  . TRP A 1 32 ? 9.258   10.389  7.761   1.00 0.00 ? 560 TRP A CH2  6  
ATOM   3536  H  H    . TRP A 1 32 ? 8.007   3.524   4.636   1.00 0.00 ? 560 TRP A H    6  
ATOM   3537  H  HA   . TRP A 1 32 ? 9.094   5.298   6.571   1.00 0.00 ? 560 TRP A HA   6  
ATOM   3538  H  HB2  . TRP A 1 32 ? 7.627   5.541   4.196   1.00 0.00 ? 560 TRP A HB2  6  
ATOM   3539  H  HB3  . TRP A 1 32 ? 6.596   6.236   5.442   1.00 0.00 ? 560 TRP A HB3  6  
ATOM   3540  H  HD1  . TRP A 1 32 ? 9.246   7.205   3.140   1.00 0.00 ? 560 TRP A HD1  6  
ATOM   3541  H  HE1  . TRP A 1 32 ? 10.331  9.431   3.842   1.00 0.00 ? 560 TRP A HE1  6  
ATOM   3542  H  HE3  . TRP A 1 32 ? 7.420   7.532   7.905   1.00 0.00 ? 560 TRP A HE3  6  
ATOM   3543  H  HZ2  . TRP A 1 32 ? 10.403  11.104  6.115   1.00 0.00 ? 560 TRP A HZ2  6  
ATOM   3544  H  HZ3  . TRP A 1 32 ? 8.045   9.477   9.276   1.00 0.00 ? 560 TRP A HZ3  6  
ATOM   3545  H  HH2  . TRP A 1 32 ? 9.507   11.225  8.398   1.00 0.00 ? 560 TRP A HH2  6  
ATOM   3546  N  N    . HIS A 1 33 ? 6.084   4.082   7.128   1.00 0.00 ? 561 HIS A N    6  
ATOM   3547  C  CA   . HIS A 1 33 ? 5.076   3.869   8.159   1.00 0.00 ? 561 HIS A CA   6  
ATOM   3548  C  C    . HIS A 1 33 ? 5.672   3.152   9.366   1.00 0.00 ? 561 HIS A C    6  
ATOM   3549  O  O    . HIS A 1 33 ? 5.241   3.360   10.500  1.00 0.00 ? 561 HIS A O    6  
ATOM   3550  C  CB   . HIS A 1 33 ? 3.906   3.059   7.598   1.00 0.00 ? 561 HIS A CB   6  
ATOM   3551  C  CG   . HIS A 1 33 ? 2.899   3.892   6.867   1.00 0.00 ? 561 HIS A CG   6  
ATOM   3552  N  ND1  . HIS A 1 33 ? 2.005   4.736   7.488   1.00 0.00 ? 561 HIS A ND1  6  
ATOM   3553  C  CD2  . HIS A 1 33 ? 2.656   4.002   5.536   1.00 0.00 ? 561 HIS A CD2  6  
ATOM   3554  C  CE1  . HIS A 1 33 ? 1.262   5.318   6.537   1.00 0.00 ? 561 HIS A CE1  6  
ATOM   3555  N  NE2  . HIS A 1 33 ? 1.617   4.907   5.335   1.00 0.00 ? 561 HIS A NE2  6  
ATOM   3556  H  H    . HIS A 1 33 ? 5.959   3.675   6.246   1.00 0.00 ? 561 HIS A H    6  
ATOM   3557  H  HA   . HIS A 1 33 ? 4.714   4.836   8.474   1.00 0.00 ? 561 HIS A HA   6  
ATOM   3558  H  HB2  . HIS A 1 33 ? 4.286   2.319   6.910   1.00 0.00 ? 561 HIS A HB2  6  
ATOM   3559  H  HB3  . HIS A 1 33 ? 3.399   2.561   8.411   1.00 0.00 ? 561 HIS A HB3  6  
ATOM   3560  H  HD1  . HIS A 1 33 ? 1.926   4.883   8.453   1.00 0.00 ? 561 HIS A HD1  6  
ATOM   3561  H  HD2  . HIS A 1 33 ? 3.178   3.476   4.750   1.00 0.00 ? 561 HIS A HD2  6  
ATOM   3562  H  HE1  . HIS A 1 33 ? 0.476   6.033   6.730   1.00 0.00 ? 561 HIS A HE1  6  
ATOM   3563  N  N    . THR A 1 34 ? 6.666   2.306   9.114   1.00 0.00 ? 562 THR A N    6  
ATOM   3564  C  CA   . THR A 1 34 ? 7.323   1.558   10.180  1.00 0.00 ? 562 THR A CA   6  
ATOM   3565  C  C    . THR A 1 34 ? 8.348   2.426   10.902  1.00 0.00 ? 562 THR A C    6  
ATOM   3566  O  O    . THR A 1 34 ? 9.525   2.443   10.543  1.00 0.00 ? 562 THR A O    6  
ATOM   3567  C  CB   . THR A 1 34 ? 8.002   0.311   9.612   1.00 0.00 ? 562 THR A CB   6  
ATOM   3568  O  OG1  . THR A 1 34 ? 8.944   0.663   8.615   1.00 0.00 ? 562 THR A OG1  6  
ATOM   3569  C  CG2  . THR A 1 34 ? 7.029   -0.673  8.999   1.00 0.00 ? 562 THR A CG2  6  
ATOM   3570  H  H    . THR A 1 34 ? 6.966   2.183   8.189   1.00 0.00 ? 562 THR A H    6  
ATOM   3571  H  HA   . THR A 1 34 ? 6.565   1.255   10.886  1.00 0.00 ? 562 THR A HA   6  
ATOM   3572  H  HB   . THR A 1 34 ? 8.525   -0.196  10.410  1.00 0.00 ? 562 THR A HB   6  
ATOM   3573  H  HG1  . THR A 1 34 ? 9.641   1.195   9.006   1.00 0.00 ? 562 THR A HG1  6  
ATOM   3574  H  HG21 . THR A 1 34 ? 7.028   -0.556  7.925   1.00 0.00 ? 562 THR A HG21 6  
ATOM   3575  H  HG22 . THR A 1 34 ? 6.037   -0.486  9.382   1.00 0.00 ? 562 THR A HG22 6  
ATOM   3576  H  HG23 . THR A 1 34 ? 7.328   -1.680  9.251   1.00 0.00 ? 562 THR A HG23 6  
ATOM   3577  N  N    . GLY A 1 35 ? 7.892   3.147   11.922  1.00 0.00 ? 563 GLY A N    6  
ATOM   3578  C  CA   . GLY A 1 35 ? 8.782   4.008   12.679  1.00 0.00 ? 563 GLY A CA   6  
ATOM   3579  C  C    . GLY A 1 35 ? 8.480   5.479   12.472  1.00 0.00 ? 563 GLY A C    6  
ATOM   3580  O  O    . GLY A 1 35 ? 8.266   5.923   11.344  1.00 0.00 ? 563 GLY A O    6  
ATOM   3581  H  H    . GLY A 1 35 ? 6.944   3.094   12.162  1.00 0.00 ? 563 GLY A H    6  
ATOM   3582  H  HA2  . GLY A 1 35 ? 8.683   3.775   13.729  1.00 0.00 ? 563 GLY A HA2  6  
ATOM   3583  H  HA3  . GLY A 1 35 ? 9.800   3.815   12.372  1.00 0.00 ? 563 GLY A HA3  6  
ATOM   3584  N  N    . GLU A 1 36 ? 8.461   6.237   13.564  1.00 0.00 ? 564 GLU A N    6  
ATOM   3585  C  CA   . GLU A 1 36 ? 8.182   7.667   13.497  1.00 0.00 ? 564 GLU A CA   6  
ATOM   3586  C  C    . GLU A 1 36 ? 8.970   8.425   14.559  1.00 0.00 ? 564 GLU A C    6  
ATOM   3587  O  O    . GLU A 1 36 ? 9.595   9.446   14.272  1.00 0.00 ? 564 GLU A O    6  
ATOM   3588  C  CB   . GLU A 1 36 ? 6.684   7.924   13.676  1.00 0.00 ? 564 GLU A CB   6  
ATOM   3589  C  CG   . GLU A 1 36 ? 5.887   7.800   12.387  1.00 0.00 ? 564 GLU A CG   6  
ATOM   3590  C  CD   . GLU A 1 36 ? 5.584   9.145   11.757  1.00 0.00 ? 564 GLU A CD   6  
ATOM   3591  O  OE1  . GLU A 1 36 ? 6.459   10.035  11.807  1.00 0.00 ? 564 GLU A OE1  6  
ATOM   3592  O  OE2  . GLU A 1 36 ? 4.471   9.309   11.214  1.00 0.00 ? 564 GLU A OE2  6  
ATOM   3593  H  H    . GLU A 1 36 ? 8.639   5.825   14.435  1.00 0.00 ? 564 GLU A H    6  
ATOM   3594  H  HA   . GLU A 1 36 ? 8.484   8.018   12.522  1.00 0.00 ? 564 GLU A HA   6  
ATOM   3595  H  HB2  . GLU A 1 36 ? 6.291   7.212   14.387  1.00 0.00 ? 564 GLU A HB2  6  
ATOM   3596  H  HB3  . GLU A 1 36 ? 6.546   8.922   14.065  1.00 0.00 ? 564 GLU A HB3  6  
ATOM   3597  H  HG2  . GLU A 1 36 ? 6.455   7.210   11.683  1.00 0.00 ? 564 GLU A HG2  6  
ATOM   3598  H  HG3  . GLU A 1 36 ? 4.954   7.301   12.604  1.00 0.00 ? 564 GLU A HG3  6  
ATOM   3599  N  N    . ARG A 1 37 ? 8.936   7.920   15.788  1.00 0.00 ? 565 ARG A N    6  
ATOM   3600  C  CA   . ARG A 1 37 ? 9.648   8.550   16.894  1.00 0.00 ? 565 ARG A CA   6  
ATOM   3601  C  C    . ARG A 1 37 ? 9.137   9.968   17.132  1.00 0.00 ? 565 ARG A C    6  
ATOM   3602  O  O    . ARG A 1 37 ? 9.735   10.680  17.965  1.00 0.00 ? 565 ARG A O    6  
ATOM   3603  C  CB   . ARG A 1 37 ? 11.152  8.577   16.611  1.00 0.00 ? 565 ARG A CB   6  
ATOM   3604  C  CG   . ARG A 1 37 ? 11.903  7.397   17.206  1.00 0.00 ? 565 ARG A CG   6  
ATOM   3605  C  CD   . ARG A 1 37 ? 13.361  7.392   16.777  1.00 0.00 ? 565 ARG A CD   6  
ATOM   3606  N  NE   . ARG A 1 37 ? 14.179  6.526   17.623  1.00 0.00 ? 565 ARG A NE   6  
ATOM   3607  C  CZ   . ARG A 1 37 ? 14.625  6.874   18.828  1.00 0.00 ? 565 ARG A CZ   6  
ATOM   3608  N  NH1  . ARG A 1 37 ? 14.335  8.068   19.332  1.00 0.00 ? 565 ARG A NH1  6  
ATOM   3609  N  NH2  . ARG A 1 37 ? 15.362  6.027   19.532  1.00 0.00 ? 565 ARG A NH2  6  
ATOM   3610  O  OXT  . ARG A 1 37 ? 8.142   10.354  16.482  1.00 0.00 ? 565 ARG A OXT  6  
ATOM   3611  H  H    . ARG A 1 37 ? 8.420   7.104   15.955  1.00 0.00 ? 565 ARG A H    6  
ATOM   3612  H  HA   . ARG A 1 37 ? 9.468   7.962   17.781  1.00 0.00 ? 565 ARG A HA   6  
ATOM   3613  H  HB2  . ARG A 1 37 ? 11.305  8.572   15.542  1.00 0.00 ? 565 ARG A HB2  6  
ATOM   3614  H  HB3  . ARG A 1 37 ? 11.568  9.485   17.022  1.00 0.00 ? 565 ARG A HB3  6  
ATOM   3615  H  HG2  . ARG A 1 37 ? 11.856  7.458   18.283  1.00 0.00 ? 565 ARG A HG2  6  
ATOM   3616  H  HG3  . ARG A 1 37 ? 11.436  6.481   16.874  1.00 0.00 ? 565 ARG A HG3  6  
ATOM   3617  H  HD2  . ARG A 1 37 ? 13.422  7.042   15.757  1.00 0.00 ? 565 ARG A HD2  6  
ATOM   3618  H  HD3  . ARG A 1 37 ? 13.744  8.401   16.834  1.00 0.00 ? 565 ARG A HD3  6  
ATOM   3619  H  HE   . ARG A 1 37 ? 14.407  5.639   17.276  1.00 0.00 ? 565 ARG A HE   6  
ATOM   3620  H  HH11 . ARG A 1 37 ? 13.778  8.712   18.806  1.00 0.00 ? 565 ARG A HH11 6  
ATOM   3621  H  HH12 . ARG A 1 37 ? 14.672  8.323   20.237  1.00 0.00 ? 565 ARG A HH12 6  
ATOM   3622  H  HH21 . ARG A 1 37 ? 15.584  5.126   19.158  1.00 0.00 ? 565 ARG A HH21 6  
ATOM   3623  H  HH22 . ARG A 1 37 ? 15.698  6.288   20.437  1.00 0.00 ? 565 ARG A HH22 6  
HETATM 3624  ZN ZN   . ZN  B 2 .  ? 0.446   5.173   3.719   1.00 0.00 ? 100 ZN  A ZN   6  
ATOM   3625  N  N    . MET A 1 1  ? -13.159 -14.894 -11.833 1.00 0.00 ? 1   MET A N    7  
ATOM   3626  C  CA   . MET A 1 1  ? -11.735 -14.772 -12.242 1.00 0.00 ? 1   MET A CA   7  
ATOM   3627  C  C    . MET A 1 1  ? -11.428 -13.370 -12.760 1.00 0.00 ? 1   MET A C    7  
ATOM   3628  O  O    . MET A 1 1  ? -12.255 -12.750 -13.429 1.00 0.00 ? 1   MET A O    7  
ATOM   3629  C  CB   . MET A 1 1  ? -11.450 -15.811 -13.329 1.00 0.00 ? 1   MET A CB   7  
ATOM   3630  C  CG   . MET A 1 1  ? -10.094 -16.483 -13.187 1.00 0.00 ? 1   MET A CG   7  
ATOM   3631  S  SD   . MET A 1 1  ? -9.289  -16.767 -14.776 1.00 0.00 ? 1   MET A SD   7  
ATOM   3632  C  CE   . MET A 1 1  ? -9.374  -18.553 -14.884 1.00 0.00 ? 1   MET A CE   7  
ATOM   3633  H  H1   . MET A 1 1  ? -13.371 -15.905 -11.720 1.00 0.00 ? 1   MET A H1   7  
ATOM   3634  H  H2   . MET A 1 1  ? -13.741 -14.469 -12.584 1.00 0.00 ? 1   MET A H2   7  
ATOM   3635  H  H3   . MET A 1 1  ? -13.275 -14.385 -10.934 1.00 0.00 ? 1   MET A H3   7  
ATOM   3636  H  HA   . MET A 1 1  ? -11.112 -14.975 -11.384 1.00 0.00 ? 1   MET A HA   7  
ATOM   3637  H  HB2  . MET A 1 1  ? -12.212 -16.575 -13.288 1.00 0.00 ? 1   MET A HB2  7  
ATOM   3638  H  HB3  . MET A 1 1  ? -11.489 -15.327 -14.294 1.00 0.00 ? 1   MET A HB3  7  
ATOM   3639  H  HG2  . MET A 1 1  ? -9.456  -15.853 -12.585 1.00 0.00 ? 1   MET A HG2  7  
ATOM   3640  H  HG3  . MET A 1 1  ? -10.228 -17.434 -12.692 1.00 0.00 ? 1   MET A HG3  7  
ATOM   3641  H  HE1  . MET A 1 1  ? -10.149 -18.835 -15.581 1.00 0.00 ? 1   MET A HE1  7  
ATOM   3642  H  HE2  . MET A 1 1  ? -9.599  -18.962 -13.910 1.00 0.00 ? 1   MET A HE2  7  
ATOM   3643  H  HE3  . MET A 1 1  ? -8.425  -18.938 -15.226 1.00 0.00 ? 1   MET A HE3  7  
ATOM   3644  N  N    . ASP A 1 2  ? -10.234 -12.877 -12.447 1.00 0.00 ? 530 ASP A N    7  
ATOM   3645  C  CA   . ASP A 1 2  ? -9.819  -11.549 -12.881 1.00 0.00 ? 530 ASP A CA   7  
ATOM   3646  C  C    . ASP A 1 2  ? -8.295  -11.430 -12.888 1.00 0.00 ? 530 ASP A C    7  
ATOM   3647  O  O    . ASP A 1 2  ? -7.649  -11.622 -11.858 1.00 0.00 ? 530 ASP A O    7  
ATOM   3648  C  CB   . ASP A 1 2  ? -10.420 -10.481 -11.966 1.00 0.00 ? 530 ASP A CB   7  
ATOM   3649  C  CG   . ASP A 1 2  ? -10.686 -9.178  -12.694 1.00 0.00 ? 530 ASP A CG   7  
ATOM   3650  O  OD1  . ASP A 1 2  ? -11.784 -9.035  -13.272 1.00 0.00 ? 530 ASP A OD1  7  
ATOM   3651  O  OD2  . ASP A 1 2  ? -9.797  -8.301  -12.686 1.00 0.00 ? 530 ASP A OD2  7  
ATOM   3652  H  H    . ASP A 1 2  ? -9.618  -13.419 -11.912 1.00 0.00 ? 530 ASP A H    7  
ATOM   3653  H  HA   . ASP A 1 2  ? -10.188 -11.399 -13.884 1.00 0.00 ? 530 ASP A HA   7  
ATOM   3654  H  HB2  . ASP A 1 2  ? -11.354 -10.844 -11.564 1.00 0.00 ? 530 ASP A HB2  7  
ATOM   3655  H  HB3  . ASP A 1 2  ? -9.735  -10.285 -11.154 1.00 0.00 ? 530 ASP A HB3  7  
ATOM   3656  N  N    . PRO A 1 3  ? -7.695  -11.112 -14.050 1.00 0.00 ? 531 PRO A N    7  
ATOM   3657  C  CA   . PRO A 1 3  ? -6.241  -10.971 -14.172 1.00 0.00 ? 531 PRO A CA   7  
ATOM   3658  C  C    . PRO A 1 3  ? -5.720  -9.718  -13.477 1.00 0.00 ? 531 PRO A C    7  
ATOM   3659  O  O    . PRO A 1 3  ? -5.828  -8.612  -14.007 1.00 0.00 ? 531 PRO A O    7  
ATOM   3660  C  CB   . PRO A 1 3  ? -6.018  -10.877 -15.682 1.00 0.00 ? 531 PRO A CB   7  
ATOM   3661  C  CG   . PRO A 1 3  ? -7.292  -10.324 -16.217 1.00 0.00 ? 531 PRO A CG   7  
ATOM   3662  C  CD   . PRO A 1 3  ? -8.383  -10.864 -15.333 1.00 0.00 ? 531 PRO A CD   7  
ATOM   3663  H  HA   . PRO A 1 3  ? -5.726  -11.837 -13.782 1.00 0.00 ? 531 PRO A HA   7  
ATOM   3664  H  HB2  . PRO A 1 3  ? -5.184  -10.220 -15.885 1.00 0.00 ? 531 PRO A HB2  7  
ATOM   3665  H  HB3  . PRO A 1 3  ? -5.816  -11.859 -16.082 1.00 0.00 ? 531 PRO A HB3  7  
ATOM   3666  H  HG2  . PRO A 1 3  ? -7.272  -9.245  -16.171 1.00 0.00 ? 531 PRO A HG2  7  
ATOM   3667  H  HG3  . PRO A 1 3  ? -7.437  -10.654 -17.235 1.00 0.00 ? 531 PRO A HG3  7  
ATOM   3668  H  HD2  . PRO A 1 3  ? -9.169  -10.133 -15.214 1.00 0.00 ? 531 PRO A HD2  7  
ATOM   3669  H  HD3  . PRO A 1 3  ? -8.779  -11.782 -15.741 1.00 0.00 ? 531 PRO A HD3  7  
ATOM   3670  N  N    . GLY A 1 4  ? -5.156  -9.898  -12.287 1.00 0.00 ? 532 GLY A N    7  
ATOM   3671  C  CA   . GLY A 1 4  ? -4.628  -8.772  -11.539 1.00 0.00 ? 532 GLY A CA   7  
ATOM   3672  C  C    . GLY A 1 4  ? -4.684  -8.995  -10.040 1.00 0.00 ? 532 GLY A C    7  
ATOM   3673  O  O    . GLY A 1 4  ? -4.490  -10.114 -9.565  1.00 0.00 ? 532 GLY A O    7  
ATOM   3674  H  H    . GLY A 1 4  ? -5.099  -10.802 -11.914 1.00 0.00 ? 532 GLY A H    7  
ATOM   3675  H  HA2  . GLY A 1 4  ? -3.600  -8.611  -11.830 1.00 0.00 ? 532 GLY A HA2  7  
ATOM   3676  H  HA3  . GLY A 1 4  ? -5.202  -7.891  -11.782 1.00 0.00 ? 532 GLY A HA3  7  
ATOM   3677  N  N    . LYS A 1 5  ? -4.950  -7.927  -9.294  1.00 0.00 ? 533 LYS A N    7  
ATOM   3678  C  CA   . LYS A 1 5  ? -5.031  -8.012  -7.841  1.00 0.00 ? 533 LYS A CA   7  
ATOM   3679  C  C    . LYS A 1 5  ? -6.452  -7.743  -7.359  1.00 0.00 ? 533 LYS A C    7  
ATOM   3680  O  O    . LYS A 1 5  ? -7.214  -7.028  -8.009  1.00 0.00 ? 533 LYS A O    7  
ATOM   3681  C  CB   . LYS A 1 5  ? -4.065  -7.016  -7.196  1.00 0.00 ? 533 LYS A CB   7  
ATOM   3682  C  CG   . LYS A 1 5  ? -3.811  -7.284  -5.721  1.00 0.00 ? 533 LYS A CG   7  
ATOM   3683  C  CD   . LYS A 1 5  ? -2.330  -7.203  -5.384  1.00 0.00 ? 533 LYS A CD   7  
ATOM   3684  C  CE   . LYS A 1 5  ? -1.955  -8.181  -4.283  1.00 0.00 ? 533 LYS A CE   7  
ATOM   3685  N  NZ   . LYS A 1 5  ? -1.778  -9.564  -4.804  1.00 0.00 ? 533 LYS A NZ   7  
ATOM   3686  H  H    . LYS A 1 5  ? -5.095  -7.063  -9.732  1.00 0.00 ? 533 LYS A H    7  
ATOM   3687  H  HA   . LYS A 1 5  ? -4.748  -9.013  -7.551  1.00 0.00 ? 533 LYS A HA   7  
ATOM   3688  H  HB2  . LYS A 1 5  ? -3.120  -7.061  -7.717  1.00 0.00 ? 533 LYS A HB2  7  
ATOM   3689  H  HB3  . LYS A 1 5  ? -4.473  -6.021  -7.294  1.00 0.00 ? 533 LYS A HB3  7  
ATOM   3690  H  HG2  . LYS A 1 5  ? -4.343  -6.550  -5.135  1.00 0.00 ? 533 LYS A HG2  7  
ATOM   3691  H  HG3  . LYS A 1 5  ? -4.173  -8.273  -5.478  1.00 0.00 ? 533 LYS A HG3  7  
ATOM   3692  H  HD2  . LYS A 1 5  ? -1.757  -7.436  -6.269  1.00 0.00 ? 533 LYS A HD2  7  
ATOM   3693  H  HD3  . LYS A 1 5  ? -2.100  -6.199  -5.057  1.00 0.00 ? 533 LYS A HD3  7  
ATOM   3694  H  HE2  . LYS A 1 5  ? -1.030  -7.856  -3.830  1.00 0.00 ? 533 LYS A HE2  7  
ATOM   3695  H  HE3  . LYS A 1 5  ? -2.738  -8.183  -3.539  1.00 0.00 ? 533 LYS A HE3  7  
ATOM   3696  H  HZ1  . LYS A 1 5  ? -1.485  -10.201 -4.036  1.00 0.00 ? 533 LYS A HZ1  7  
ATOM   3697  H  HZ2  . LYS A 1 5  ? -1.049  -9.576  -5.546  1.00 0.00 ? 533 LYS A HZ2  7  
ATOM   3698  H  HZ3  . LYS A 1 5  ? -2.672  -9.911  -5.207  1.00 0.00 ? 533 LYS A HZ3  7  
ATOM   3699  N  N    . LYS A 1 6  ? -6.803  -8.321  -6.215  1.00 0.00 ? 534 LYS A N    7  
ATOM   3700  C  CA   . LYS A 1 6  ? -8.134  -8.144  -5.645  1.00 0.00 ? 534 LYS A CA   7  
ATOM   3701  C  C    . LYS A 1 6  ? -8.168  -6.946  -4.702  1.00 0.00 ? 534 LYS A C    7  
ATOM   3702  O  O    . LYS A 1 6  ? -7.200  -6.675  -3.991  1.00 0.00 ? 534 LYS A O    7  
ATOM   3703  C  CB   . LYS A 1 6  ? -8.563  -9.409  -4.898  1.00 0.00 ? 534 LYS A CB   7  
ATOM   3704  C  CG   . LYS A 1 6  ? -7.663  -9.755  -3.722  1.00 0.00 ? 534 LYS A CG   7  
ATOM   3705  C  CD   . LYS A 1 6  ? -8.457  -9.901  -2.433  1.00 0.00 ? 534 LYS A CD   7  
ATOM   3706  C  CE   . LYS A 1 6  ? -8.747  -11.360 -2.119  1.00 0.00 ? 534 LYS A CE   7  
ATOM   3707  N  NZ   . LYS A 1 6  ? -10.122 -11.550 -1.582  1.00 0.00 ? 534 LYS A NZ   7  
ATOM   3708  H  H    . LYS A 1 6  ? -6.151  -8.881  -5.743  1.00 0.00 ? 534 LYS A H    7  
ATOM   3709  H  HA   . LYS A 1 6  ? -8.821  -7.967  -6.458  1.00 0.00 ? 534 LYS A HA   7  
ATOM   3710  H  HB2  . LYS A 1 6  ? -9.568  -9.270  -4.529  1.00 0.00 ? 534 LYS A HB2  7  
ATOM   3711  H  HB3  . LYS A 1 6  ? -8.554  -10.240 -5.587  1.00 0.00 ? 534 LYS A HB3  7  
ATOM   3712  H  HG2  . LYS A 1 6  ? -7.159  -10.687 -3.929  1.00 0.00 ? 534 LYS A HG2  7  
ATOM   3713  H  HG3  . LYS A 1 6  ? -6.932  -8.969  -3.597  1.00 0.00 ? 534 LYS A HG3  7  
ATOM   3714  H  HD2  . LYS A 1 6  ? -7.887  -9.475  -1.621  1.00 0.00 ? 534 LYS A HD2  7  
ATOM   3715  H  HD3  . LYS A 1 6  ? -9.392  -9.371  -2.536  1.00 0.00 ? 534 LYS A HD3  7  
ATOM   3716  H  HE2  . LYS A 1 6  ? -8.641  -11.939 -3.025  1.00 0.00 ? 534 LYS A HE2  7  
ATOM   3717  H  HE3  . LYS A 1 6  ? -8.032  -11.706 -1.387  1.00 0.00 ? 534 LYS A HE3  7  
ATOM   3718  H  HZ1  . LYS A 1 6  ? -10.103 -11.548 -0.542  1.00 0.00 ? 534 LYS A HZ1  7  
ATOM   3719  H  HZ2  . LYS A 1 6  ? -10.512 -12.457 -1.908  1.00 0.00 ? 534 LYS A HZ2  7  
ATOM   3720  H  HZ3  . LYS A 1 6  ? -10.743 -10.781 -1.908  1.00 0.00 ? 534 LYS A HZ3  7  
ATOM   3721  N  N    . LYS A 1 7  ? -9.289  -6.232  -4.701  1.00 0.00 ? 535 LYS A N    7  
ATOM   3722  C  CA   . LYS A 1 7  ? -9.450  -5.063  -3.845  1.00 0.00 ? 535 LYS A CA   7  
ATOM   3723  C  C    . LYS A 1 7  ? -8.398  -4.005  -4.163  1.00 0.00 ? 535 LYS A C    7  
ATOM   3724  O  O    . LYS A 1 7  ? -7.576  -4.184  -5.062  1.00 0.00 ? 535 LYS A O    7  
ATOM   3725  C  CB   . LYS A 1 7  ? -9.355  -5.466  -2.372  1.00 0.00 ? 535 LYS A CB   7  
ATOM   3726  C  CG   . LYS A 1 7  ? -10.572 -6.226  -1.869  1.00 0.00 ? 535 LYS A CG   7  
ATOM   3727  C  CD   . LYS A 1 7  ? -10.233 -7.082  -0.660  1.00 0.00 ? 535 LYS A CD   7  
ATOM   3728  C  CE   . LYS A 1 7  ? -11.488 -7.595  0.028   1.00 0.00 ? 535 LYS A CE   7  
ATOM   3729  N  NZ   . LYS A 1 7  ? -12.190 -6.518  0.778   1.00 0.00 ? 535 LYS A NZ   7  
ATOM   3730  H  H    . LYS A 1 7  ? -10.026 -6.498  -5.290  1.00 0.00 ? 535 LYS A H    7  
ATOM   3731  H  HA   . LYS A 1 7  ? -10.429 -4.647  -4.032  1.00 0.00 ? 535 LYS A HA   7  
ATOM   3732  H  HB2  . LYS A 1 7  ? -8.485  -6.093  -2.238  1.00 0.00 ? 535 LYS A HB2  7  
ATOM   3733  H  HB3  . LYS A 1 7  ? -9.241  -4.575  -1.773  1.00 0.00 ? 535 LYS A HB3  7  
ATOM   3734  H  HG2  . LYS A 1 7  ? -11.338 -5.517  -1.593  1.00 0.00 ? 535 LYS A HG2  7  
ATOM   3735  H  HG3  . LYS A 1 7  ? -10.938 -6.864  -2.660  1.00 0.00 ? 535 LYS A HG3  7  
ATOM   3736  H  HD2  . LYS A 1 7  ? -9.641  -7.925  -0.982  1.00 0.00 ? 535 LYS A HD2  7  
ATOM   3737  H  HD3  . LYS A 1 7  ? -9.666  -6.488  0.042   1.00 0.00 ? 535 LYS A HD3  7  
ATOM   3738  H  HE2  . LYS A 1 7  ? -12.156 -7.994  -0.721  1.00 0.00 ? 535 LYS A HE2  7  
ATOM   3739  H  HE3  . LYS A 1 7  ? -11.210 -8.380  0.716   1.00 0.00 ? 535 LYS A HE3  7  
ATOM   3740  H  HZ1  . LYS A 1 7  ? -11.890 -6.523  1.774   1.00 0.00 ? 535 LYS A HZ1  7  
ATOM   3741  H  HZ2  . LYS A 1 7  ? -13.219 -6.665  0.737   1.00 0.00 ? 535 LYS A HZ2  7  
ATOM   3742  H  HZ3  . LYS A 1 7  ? -11.968 -5.590  0.364   1.00 0.00 ? 535 LYS A HZ3  7  
ATOM   3743  N  N    . GLN A 1 8  ? -8.430  -2.903  -3.420  1.00 0.00 ? 536 GLN A N    7  
ATOM   3744  C  CA   . GLN A 1 8  ? -7.479  -1.816  -3.623  1.00 0.00 ? 536 GLN A CA   7  
ATOM   3745  C  C    . GLN A 1 8  ? -6.545  -1.681  -2.425  1.00 0.00 ? 536 GLN A C    7  
ATOM   3746  O  O    . GLN A 1 8  ? -6.954  -1.875  -1.281  1.00 0.00 ? 536 GLN A O    7  
ATOM   3747  C  CB   . GLN A 1 8  ? -8.220  -0.499  -3.858  1.00 0.00 ? 536 GLN A CB   7  
ATOM   3748  C  CG   . GLN A 1 8  ? -9.068  -0.058  -2.676  1.00 0.00 ? 536 GLN A CG   7  
ATOM   3749  C  CD   . GLN A 1 8  ? -10.291 0.731   -3.100  1.00 0.00 ? 536 GLN A CD   7  
ATOM   3750  O  OE1  . GLN A 1 8  ? -10.994 0.353   -4.037  1.00 0.00 ? 536 GLN A OE1  7  
ATOM   3751  N  NE2  . GLN A 1 8  ? -10.552 1.835   -2.409  1.00 0.00 ? 536 GLN A NE2  7  
ATOM   3752  H  H    . GLN A 1 8  ? -9.109  -2.819  -2.719  1.00 0.00 ? 536 GLN A H    7  
ATOM   3753  H  HA   . GLN A 1 8  ? -6.891  -2.049  -4.498  1.00 0.00 ? 536 GLN A HA   7  
ATOM   3754  H  HB2  . GLN A 1 8  ? -7.496  0.276   -4.063  1.00 0.00 ? 536 GLN A HB2  7  
ATOM   3755  H  HB3  . GLN A 1 8  ? -8.867  -0.611  -4.716  1.00 0.00 ? 536 GLN A HB3  7  
ATOM   3756  H  HG2  . GLN A 1 8  ? -9.393  -0.934  -2.136  1.00 0.00 ? 536 GLN A HG2  7  
ATOM   3757  H  HG3  . GLN A 1 8  ? -8.465  0.560   -2.028  1.00 0.00 ? 536 GLN A HG3  7  
ATOM   3758  H  HE21 . GLN A 1 8  ? -9.949  2.075   -1.675  1.00 0.00 ? 536 GLN A HE21 7  
ATOM   3759  H  HE22 . GLN A 1 8  ? -11.337 2.365   -2.662  1.00 0.00 ? 536 GLN A HE22 7  
ATOM   3760  N  N    . HIS A 1 9  ? -5.287  -1.346  -2.697  1.00 0.00 ? 537 HIS A N    7  
ATOM   3761  C  CA   . HIS A 1 9  ? -4.294  -1.185  -1.641  1.00 0.00 ? 537 HIS A CA   7  
ATOM   3762  C  C    . HIS A 1 9  ? -4.457  0.160   -0.940  1.00 0.00 ? 537 HIS A C    7  
ATOM   3763  O  O    . HIS A 1 9  ? -4.180  1.211   -1.519  1.00 0.00 ? 537 HIS A O    7  
ATOM   3764  C  CB   . HIS A 1 9  ? -2.882  -1.304  -2.218  1.00 0.00 ? 537 HIS A CB   7  
ATOM   3765  C  CG   . HIS A 1 9  ? -2.438  -2.719  -2.428  1.00 0.00 ? 537 HIS A CG   7  
ATOM   3766  N  ND1  . HIS A 1 9  ? -3.266  -3.811  -2.297  1.00 0.00 ? 537 HIS A ND1  7  
ATOM   3767  C  CD2  . HIS A 1 9  ? -1.219  -3.211  -2.769  1.00 0.00 ? 537 HIS A CD2  7  
ATOM   3768  C  CE1  . HIS A 1 9  ? -2.542  -4.909  -2.555  1.00 0.00 ? 537 HIS A CE1  7  
ATOM   3769  N  NE2  . HIS A 1 9  ? -1.293  -4.599  -2.847  1.00 0.00 ? 537 HIS A NE2  7  
ATOM   3770  H  H    . HIS A 1 9  ? -5.021  -1.205  -3.629  1.00 0.00 ? 537 HIS A H    7  
ATOM   3771  H  HA   . HIS A 1 9  ? -4.446  -1.974  -0.920  1.00 0.00 ? 537 HIS A HA   7  
ATOM   3772  H  HB2  . HIS A 1 9  ? -2.847  -0.801  -3.173  1.00 0.00 ? 537 HIS A HB2  7  
ATOM   3773  H  HB3  . HIS A 1 9  ? -2.184  -0.832  -1.543  1.00 0.00 ? 537 HIS A HB3  7  
ATOM   3774  H  HD1  . HIS A 1 9  ? -4.216  -3.790  -2.057  1.00 0.00 ? 537 HIS A HD1  7  
ATOM   3775  H  HD2  . HIS A 1 9  ? -0.329  -2.629  -2.951  1.00 0.00 ? 537 HIS A HD2  7  
ATOM   3776  H  HE1  . HIS A 1 9  ? -2.930  -5.916  -2.529  1.00 0.00 ? 537 HIS A HE1  7  
ATOM   3777  N  N    . ILE A 1 10 ? -4.906  0.120   0.310   1.00 0.00 ? 538 ILE A N    7  
ATOM   3778  C  CA   . ILE A 1 10 ? -5.105  1.335   1.091   1.00 0.00 ? 538 ILE A CA   7  
ATOM   3779  C  C    . ILE A 1 10 ? -4.400  1.239   2.440   1.00 0.00 ? 538 ILE A C    7  
ATOM   3780  O  O    . ILE A 1 10 ? -4.394  0.184   3.073   1.00 0.00 ? 538 ILE A O    7  
ATOM   3781  C  CB   . ILE A 1 10 ? -6.602  1.615   1.325   1.00 0.00 ? 538 ILE A CB   7  
ATOM   3782  C  CG1  . ILE A 1 10 ? -7.378  1.492   0.012   1.00 0.00 ? 538 ILE A CG1  7  
ATOM   3783  C  CG2  . ILE A 1 10 ? -6.796  2.996   1.933   1.00 0.00 ? 538 ILE A CG2  7  
ATOM   3784  C  CD1  . ILE A 1 10 ? -6.956  2.498   -1.036  1.00 0.00 ? 538 ILE A CD1  7  
ATOM   3785  H  H    . ILE A 1 10 ? -5.109  -0.748  0.717   1.00 0.00 ? 538 ILE A H    7  
ATOM   3786  H  HA   . ILE A 1 10 ? -4.687  2.162   0.535   1.00 0.00 ? 538 ILE A HA   7  
ATOM   3787  H  HB   . ILE A 1 10 ? -6.976  0.884   2.025   1.00 0.00 ? 538 ILE A HB   7  
ATOM   3788  H  HG12 . ILE A 1 10 ? -7.227  0.505   -0.397  1.00 0.00 ? 538 ILE A HG12 7  
ATOM   3789  H  HG13 . ILE A 1 10 ? -8.430  1.638   0.209   1.00 0.00 ? 538 ILE A HG13 7  
ATOM   3790  H  HG21 . ILE A 1 10 ? -7.564  2.950   2.692   1.00 0.00 ? 538 ILE A HG21 7  
ATOM   3791  H  HG22 . ILE A 1 10 ? -7.094  3.691   1.162   1.00 0.00 ? 538 ILE A HG22 7  
ATOM   3792  H  HG23 . ILE A 1 10 ? -5.870  3.328   2.378   1.00 0.00 ? 538 ILE A HG23 7  
ATOM   3793  H  HD11 . ILE A 1 10 ? -7.272  2.158   -2.010  1.00 0.00 ? 538 ILE A HD11 7  
ATOM   3794  H  HD12 . ILE A 1 10 ? -5.881  2.602   -1.022  1.00 0.00 ? 538 ILE A HD12 7  
ATOM   3795  H  HD13 . ILE A 1 10 ? -7.412  3.454   -0.822  1.00 0.00 ? 538 ILE A HD13 7  
ATOM   3796  N  N    . CYS A 1 11 ? -3.807  2.347   2.874   1.00 0.00 ? 539 CYS A N    7  
ATOM   3797  C  CA   . CYS A 1 11 ? -3.097  2.386   4.148   1.00 0.00 ? 539 CYS A CA   7  
ATOM   3798  C  C    . CYS A 1 11 ? -4.033  2.047   5.305   1.00 0.00 ? 539 CYS A C    7  
ATOM   3799  O  O    . CYS A 1 11 ? -4.608  2.936   5.932   1.00 0.00 ? 539 CYS A O    7  
ATOM   3800  C  CB   . CYS A 1 11 ? -2.471  3.766   4.366   1.00 0.00 ? 539 CYS A CB   7  
ATOM   3801  S  SG   . CYS A 1 11 ? -0.694  3.725   4.695   1.00 0.00 ? 539 CYS A SG   7  
ATOM   3802  H  H    . CYS A 1 11 ? -3.845  3.157   2.323   1.00 0.00 ? 539 CYS A H    7  
ATOM   3803  H  HA   . CYS A 1 11 ? -2.311  1.647   4.110   1.00 0.00 ? 539 CYS A HA   7  
ATOM   3804  H  HB2  . CYS A 1 11 ? -2.625  4.367   3.482   1.00 0.00 ? 539 CYS A HB2  7  
ATOM   3805  H  HB3  . CYS A 1 11 ? -2.950  4.245   5.208   1.00 0.00 ? 539 CYS A HB3  7  
ATOM   3806  N  N    . HIS A 1 12 ? -4.178  0.755   5.583   1.00 0.00 ? 540 HIS A N    7  
ATOM   3807  C  CA   . HIS A 1 12 ? -5.040  0.298   6.666   1.00 0.00 ? 540 HIS A CA   7  
ATOM   3808  C  C    . HIS A 1 12 ? -4.604  0.901   7.999   1.00 0.00 ? 540 HIS A C    7  
ATOM   3809  O  O    . HIS A 1 12 ? -5.414  1.071   8.910   1.00 0.00 ? 540 HIS A O    7  
ATOM   3810  C  CB   . HIS A 1 12 ? -5.021  -1.231  6.751   1.00 0.00 ? 540 HIS A CB   7  
ATOM   3811  C  CG   . HIS A 1 12 ? -6.363  -1.859  6.537   1.00 0.00 ? 540 HIS A CG   7  
ATOM   3812  N  ND1  . HIS A 1 12 ? -7.384  -1.821  7.460   1.00 0.00 ? 540 HIS A ND1  7  
ATOM   3813  C  CD2  . HIS A 1 12 ? -6.845  -2.554  5.475   1.00 0.00 ? 540 HIS A CD2  7  
ATOM   3814  C  CE1  . HIS A 1 12 ? -8.431  -2.479  6.943   1.00 0.00 ? 540 HIS A CE1  7  
ATOM   3815  N  NE2  . HIS A 1 12 ? -8.155  -2.943  5.739   1.00 0.00 ? 540 HIS A NE2  7  
ATOM   3816  H  H    . HIS A 1 12 ? -3.691  0.094   5.048   1.00 0.00 ? 540 HIS A H    7  
ATOM   3817  H  HA   . HIS A 1 12 ? -6.046  0.625   6.449   1.00 0.00 ? 540 HIS A HA   7  
ATOM   3818  H  HB2  . HIS A 1 12 ? -4.351  -1.617  5.997   1.00 0.00 ? 540 HIS A HB2  7  
ATOM   3819  H  HB3  . HIS A 1 12 ? -4.666  -1.528  7.727   1.00 0.00 ? 540 HIS A HB3  7  
ATOM   3820  H  HD1  . HIS A 1 12 ? -7.351  -1.391  8.340   1.00 0.00 ? 540 HIS A HD1  7  
ATOM   3821  H  HD2  . HIS A 1 12 ? -6.306  -2.775  4.565   1.00 0.00 ? 540 HIS A HD2  7  
ATOM   3822  H  HE1  . HIS A 1 12 ? -9.377  -2.611  7.446   1.00 0.00 ? 540 HIS A HE1  7  
ATOM   3823  N  N    . ILE A 1 13 ? -3.318  1.222   8.105   1.00 0.00 ? 541 ILE A N    7  
ATOM   3824  C  CA   . ILE A 1 13 ? -2.773  1.805   9.324   1.00 0.00 ? 541 ILE A CA   7  
ATOM   3825  C  C    . ILE A 1 13 ? -3.468  3.119   9.664   1.00 0.00 ? 541 ILE A C    7  
ATOM   3826  O  O    . ILE A 1 13 ? -3.938  3.833   8.778   1.00 0.00 ? 541 ILE A O    7  
ATOM   3827  C  CB   . ILE A 1 13 ? -1.257  2.055   9.198   1.00 0.00 ? 541 ILE A CB   7  
ATOM   3828  C  CG1  . ILE A 1 13 ? -0.538  0.767   8.794   1.00 0.00 ? 541 ILE A CG1  7  
ATOM   3829  C  CG2  . ILE A 1 13 ? -0.693  2.594   10.504  1.00 0.00 ? 541 ILE A CG2  7  
ATOM   3830  C  CD1  . ILE A 1 13 ? -0.768  -0.380  9.754   1.00 0.00 ? 541 ILE A CD1  7  
ATOM   3831  H  H    . ILE A 1 13 ? -2.721  1.062   7.345   1.00 0.00 ? 541 ILE A H    7  
ATOM   3832  H  HA   . ILE A 1 13 ? -2.935  1.105   10.131  1.00 0.00 ? 541 ILE A HA   7  
ATOM   3833  H  HB   . ILE A 1 13 ? -1.100  2.801   8.433   1.00 0.00 ? 541 ILE A HB   7  
ATOM   3834  H  HG12 . ILE A 1 13 ? -0.886  0.458   7.820   1.00 0.00 ? 541 ILE A HG12 7  
ATOM   3835  H  HG13 . ILE A 1 13 ? 0.524   0.955   8.749   1.00 0.00 ? 541 ILE A HG13 7  
ATOM   3836  H  HG21 . ILE A 1 13 ? -0.922  1.908   11.306  1.00 0.00 ? 541 ILE A HG21 7  
ATOM   3837  H  HG22 . ILE A 1 13 ? -1.134  3.557   10.717  1.00 0.00 ? 541 ILE A HG22 7  
ATOM   3838  H  HG23 . ILE A 1 13 ? 0.378   2.701   10.417  1.00 0.00 ? 541 ILE A HG23 7  
ATOM   3839  H  HD11 . ILE A 1 13 ? -0.736  -0.012  10.769  1.00 0.00 ? 541 ILE A HD11 7  
ATOM   3840  H  HD12 . ILE A 1 13 ? 0.003   -1.124  9.616   1.00 0.00 ? 541 ILE A HD12 7  
ATOM   3841  H  HD13 . ILE A 1 13 ? -1.734  -0.823  9.561   1.00 0.00 ? 541 ILE A HD13 7  
ATOM   3842  N  N    . GLN A 1 14 ? -3.529  3.431   10.954  1.00 0.00 ? 542 GLN A N    7  
ATOM   3843  C  CA   . GLN A 1 14 ? -4.164  4.655   11.416  1.00 0.00 ? 542 GLN A CA   7  
ATOM   3844  C  C    . GLN A 1 14 ? -3.253  5.859   11.195  1.00 0.00 ? 542 GLN A C    7  
ATOM   3845  O  O    . GLN A 1 14 ? -2.318  6.090   11.961  1.00 0.00 ? 542 GLN A O    7  
ATOM   3846  C  CB   . GLN A 1 14 ? -4.529  4.536   12.898  1.00 0.00 ? 542 GLN A CB   7  
ATOM   3847  C  CG   . GLN A 1 14 ? -6.021  4.387   13.146  1.00 0.00 ? 542 GLN A CG   7  
ATOM   3848  C  CD   . GLN A 1 14 ? -6.699  5.712   13.439  1.00 0.00 ? 542 GLN A CD   7  
ATOM   3849  O  OE1  . GLN A 1 14 ? -7.308  6.319   12.558  1.00 0.00 ? 542 GLN A OE1  7  
ATOM   3850  N  NE2  . GLN A 1 14 ? -6.596  6.167   14.682  1.00 0.00 ? 542 GLN A NE2  7  
ATOM   3851  H  H    . GLN A 1 14 ? -3.138  2.823   11.609  1.00 0.00 ? 542 GLN A H    7  
ATOM   3852  H  HA   . GLN A 1 14 ? -5.066  4.790   10.844  1.00 0.00 ? 542 GLN A HA   7  
ATOM   3853  H  HB2  . GLN A 1 14 ? -4.030  3.673   13.312  1.00 0.00 ? 542 GLN A HB2  7  
ATOM   3854  H  HB3  . GLN A 1 14 ? -4.187  5.421   13.415  1.00 0.00 ? 542 GLN A HB3  7  
ATOM   3855  H  HG2  . GLN A 1 14 ? -6.477  3.954   12.268  1.00 0.00 ? 542 GLN A HG2  7  
ATOM   3856  H  HG3  . GLN A 1 14 ? -6.169  3.729   13.989  1.00 0.00 ? 542 GLN A HG3  7  
ATOM   3857  H  HE21 . GLN A 1 14 ? -6.095  5.630   15.332  1.00 0.00 ? 542 GLN A HE21 7  
ATOM   3858  H  HE22 . GLN A 1 14 ? -7.024  7.021   14.899  1.00 0.00 ? 542 GLN A HE22 7  
ATOM   3859  N  N    . GLY A 1 15 ? -3.532  6.621   10.143  1.00 0.00 ? 543 GLY A N    7  
ATOM   3860  C  CA   . GLY A 1 15 ? -2.728  7.791   9.842   1.00 0.00 ? 543 GLY A CA   7  
ATOM   3861  C  C    . GLY A 1 15 ? -2.860  8.233   8.398   1.00 0.00 ? 543 GLY A C    7  
ATOM   3862  O  O    . GLY A 1 15 ? -3.292  9.352   8.122   1.00 0.00 ? 543 GLY A O    7  
ATOM   3863  H  H    . GLY A 1 15 ? -4.290  6.388   9.566   1.00 0.00 ? 543 GLY A H    7  
ATOM   3864  H  HA2  . GLY A 1 15 ? -3.038  8.602   10.485  1.00 0.00 ? 543 GLY A HA2  7  
ATOM   3865  H  HA3  . GLY A 1 15 ? -1.691  7.563   10.044  1.00 0.00 ? 543 GLY A HA3  7  
ATOM   3866  N  N    . CYS A 1 16 ? -2.485  7.353   7.475   1.00 0.00 ? 544 CYS A N    7  
ATOM   3867  C  CA   . CYS A 1 16 ? -2.563  7.661   6.052   1.00 0.00 ? 544 CYS A CA   7  
ATOM   3868  C  C    . CYS A 1 16 ? -3.982  7.469   5.528   1.00 0.00 ? 544 CYS A C    7  
ATOM   3869  O  O    . CYS A 1 16 ? -4.912  7.225   6.298   1.00 0.00 ? 544 CYS A O    7  
ATOM   3870  C  CB   . CYS A 1 16 ? -1.588  6.782   5.265   1.00 0.00 ? 544 CYS A CB   7  
ATOM   3871  S  SG   . CYS A 1 16 ? -0.244  7.697   4.475   1.00 0.00 ? 544 CYS A SG   7  
ATOM   3872  H  H    . CYS A 1 16 ? -2.147  6.478   7.757   1.00 0.00 ? 544 CYS A H    7  
ATOM   3873  H  HA   . CYS A 1 16 ? -2.283  8.696   5.922   1.00 0.00 ? 544 CYS A HA   7  
ATOM   3874  H  HB2  . CYS A 1 16 ? -1.143  6.061   5.935   1.00 0.00 ? 544 CYS A HB2  7  
ATOM   3875  H  HB3  . CYS A 1 16 ? -2.129  6.258   4.490   1.00 0.00 ? 544 CYS A HB3  7  
ATOM   3876  N  N    . GLY A 1 17 ? -4.141  7.580   4.213   1.00 0.00 ? 545 GLY A N    7  
ATOM   3877  C  CA   . GLY A 1 17 ? -5.448  7.416   3.606   1.00 0.00 ? 545 GLY A CA   7  
ATOM   3878  C  C    . GLY A 1 17 ? -5.419  7.630   2.106   1.00 0.00 ? 545 GLY A C    7  
ATOM   3879  O  O    . GLY A 1 17 ? -6.347  8.203   1.535   1.00 0.00 ? 545 GLY A O    7  
ATOM   3880  H  H    . GLY A 1 17 ? -3.363  7.776   3.651   1.00 0.00 ? 545 GLY A H    7  
ATOM   3881  H  HA2  . GLY A 1 17 ? -5.805  6.417   3.810   1.00 0.00 ? 545 GLY A HA2  7  
ATOM   3882  H  HA3  . GLY A 1 17 ? -6.130  8.128   4.047   1.00 0.00 ? 545 GLY A HA3  7  
ATOM   3883  N  N    . LYS A 1 18 ? -4.350  7.168   1.466   1.00 0.00 ? 546 LYS A N    7  
ATOM   3884  C  CA   . LYS A 1 18 ? -4.202  7.313   0.022   1.00 0.00 ? 546 LYS A CA   7  
ATOM   3885  C  C    . LYS A 1 18 ? -4.766  6.097   -0.707  1.00 0.00 ? 546 LYS A C    7  
ATOM   3886  O  O    . LYS A 1 18 ? -5.398  5.234   -0.098  1.00 0.00 ? 546 LYS A O    7  
ATOM   3887  C  CB   . LYS A 1 18 ? -2.727  7.505   -0.342  1.00 0.00 ? 546 LYS A CB   7  
ATOM   3888  C  CG   . LYS A 1 18 ? -1.865  6.285   -0.057  1.00 0.00 ? 546 LYS A CG   7  
ATOM   3889  C  CD   . LYS A 1 18 ? -0.483  6.681   0.436   1.00 0.00 ? 546 LYS A CD   7  
ATOM   3890  C  CE   . LYS A 1 18 ? 0.354   7.288   -0.678  1.00 0.00 ? 546 LYS A CE   7  
ATOM   3891  N  NZ   . LYS A 1 18 ? 1.225   8.389   -0.182  1.00 0.00 ? 546 LYS A NZ   7  
ATOM   3892  H  H    . LYS A 1 18 ? -3.643  6.721   1.976   1.00 0.00 ? 546 LYS A H    7  
ATOM   3893  H  HA   . LYS A 1 18 ? -4.755  8.189   -0.281  1.00 0.00 ? 546 LYS A HA   7  
ATOM   3894  H  HB2  . LYS A 1 18 ? -2.655  7.732   -1.395  1.00 0.00 ? 546 LYS A HB2  7  
ATOM   3895  H  HB3  . LYS A 1 18 ? -2.335  8.336   0.224   1.00 0.00 ? 546 LYS A HB3  7  
ATOM   3896  H  HG2  . LYS A 1 18 ? -2.347  5.685   0.700   1.00 0.00 ? 546 LYS A HG2  7  
ATOM   3897  H  HG3  . LYS A 1 18 ? -1.763  5.709   -0.965  1.00 0.00 ? 546 LYS A HG3  7  
ATOM   3898  H  HD2  . LYS A 1 18 ? -0.588  7.407   1.229   1.00 0.00 ? 546 LYS A HD2  7  
ATOM   3899  H  HD3  . LYS A 1 18 ? 0.019   5.803   0.814   1.00 0.00 ? 546 LYS A HD3  7  
ATOM   3900  H  HE2  . LYS A 1 18 ? 0.975   6.516   -1.107  1.00 0.00 ? 546 LYS A HE2  7  
ATOM   3901  H  HE3  . LYS A 1 18 ? -0.309  7.679   -1.437  1.00 0.00 ? 546 LYS A HE3  7  
ATOM   3902  H  HZ1  . LYS A 1 18 ? 0.660   9.247   -0.019  1.00 0.00 ? 546 LYS A HZ1  7  
ATOM   3903  H  HZ2  . LYS A 1 18 ? 1.965   8.603   -0.881  1.00 0.00 ? 546 LYS A HZ2  7  
ATOM   3904  H  HZ3  . LYS A 1 18 ? 1.679   8.111   0.712   1.00 0.00 ? 546 LYS A HZ3  7  
ATOM   3905  N  N    . VAL A 1 19 ? -4.534  6.036   -2.014  1.00 0.00 ? 547 VAL A N    7  
ATOM   3906  C  CA   . VAL A 1 19 ? -5.019  4.926   -2.826  1.00 0.00 ? 547 VAL A CA   7  
ATOM   3907  C  C    . VAL A 1 19 ? -3.940  4.433   -3.784  1.00 0.00 ? 547 VAL A C    7  
ATOM   3908  O  O    . VAL A 1 19 ? -3.392  5.206   -4.570  1.00 0.00 ? 547 VAL A O    7  
ATOM   3909  C  CB   . VAL A 1 19 ? -6.265  5.325   -3.639  1.00 0.00 ? 547 VAL A CB   7  
ATOM   3910  C  CG1  . VAL A 1 19 ? -6.873  4.107   -4.317  1.00 0.00 ? 547 VAL A CG1  7  
ATOM   3911  C  CG2  . VAL A 1 19 ? -7.286  6.015   -2.747  1.00 0.00 ? 547 VAL A CG2  7  
ATOM   3912  H  H    . VAL A 1 19 ? -4.024  6.754   -2.443  1.00 0.00 ? 547 VAL A H    7  
ATOM   3913  H  HA   . VAL A 1 19 ? -5.292  4.121   -2.160  1.00 0.00 ? 547 VAL A HA   7  
ATOM   3914  H  HB   . VAL A 1 19 ? -5.961  6.022   -4.407  1.00 0.00 ? 547 VAL A HB   7  
ATOM   3915  H  HG11 . VAL A 1 19 ? -7.332  4.405   -5.248  1.00 0.00 ? 547 VAL A HG11 7  
ATOM   3916  H  HG12 . VAL A 1 19 ? -7.620  3.671   -3.670  1.00 0.00 ? 547 VAL A HG12 7  
ATOM   3917  H  HG13 . VAL A 1 19 ? -6.099  3.381   -4.513  1.00 0.00 ? 547 VAL A HG13 7  
ATOM   3918  H  HG21 . VAL A 1 19 ? -6.841  6.890   -2.299  1.00 0.00 ? 547 VAL A HG21 7  
ATOM   3919  H  HG22 . VAL A 1 19 ? -7.604  5.334   -1.971  1.00 0.00 ? 547 VAL A HG22 7  
ATOM   3920  H  HG23 . VAL A 1 19 ? -8.140  6.309   -3.340  1.00 0.00 ? 547 VAL A HG23 7  
ATOM   3921  N  N    . TYR A 1 20 ? -3.640  3.140   -3.713  1.00 0.00 ? 548 TYR A N    7  
ATOM   3922  C  CA   . TYR A 1 20 ? -2.627  2.541   -4.575  1.00 0.00 ? 548 TYR A CA   7  
ATOM   3923  C  C    . TYR A 1 20 ? -3.116  1.214   -5.147  1.00 0.00 ? 548 TYR A C    7  
ATOM   3924  O  O    . TYR A 1 20 ? -3.974  0.553   -4.561  1.00 0.00 ? 548 TYR A O    7  
ATOM   3925  C  CB   . TYR A 1 20 ? -1.325  2.330   -3.797  1.00 0.00 ? 548 TYR A CB   7  
ATOM   3926  C  CG   . TYR A 1 20 ? -0.271  3.375   -4.083  1.00 0.00 ? 548 TYR A CG   7  
ATOM   3927  C  CD1  . TYR A 1 20 ? -0.249  4.577   -3.386  1.00 0.00 ? 548 TYR A CD1  7  
ATOM   3928  C  CD2  . TYR A 1 20 ? 0.704   3.160   -5.050  1.00 0.00 ? 548 TYR A CD2  7  
ATOM   3929  C  CE1  . TYR A 1 20 ? 0.714   5.535   -3.645  1.00 0.00 ? 548 TYR A CE1  7  
ATOM   3930  C  CE2  . TYR A 1 20 ? 1.670   4.112   -5.314  1.00 0.00 ? 548 TYR A CE2  7  
ATOM   3931  C  CZ   . TYR A 1 20 ? 1.670   5.297   -4.609  1.00 0.00 ? 548 TYR A CZ   7  
ATOM   3932  O  OH   . TYR A 1 20 ? 2.631   6.248   -4.869  1.00 0.00 ? 548 TYR A OH   7  
ATOM   3933  H  H    . TYR A 1 20 ? -4.112  2.574   -3.067  1.00 0.00 ? 548 TYR A H    7  
ATOM   3934  H  HA   . TYR A 1 20 ? -2.441  3.224   -5.391  1.00 0.00 ? 548 TYR A HA   7  
ATOM   3935  H  HB2  . TYR A 1 20 ? -1.539  2.356   -2.739  1.00 0.00 ? 548 TYR A HB2  7  
ATOM   3936  H  HB3  . TYR A 1 20 ? -0.914  1.364   -4.052  1.00 0.00 ? 548 TYR A HB3  7  
ATOM   3937  H  HD1  . TYR A 1 20 ? -0.999  4.760   -2.631  1.00 0.00 ? 548 TYR A HD1  7  
ATOM   3938  H  HD2  . TYR A 1 20 ? 0.700   2.231   -5.601  1.00 0.00 ? 548 TYR A HD2  7  
ATOM   3939  H  HE1  . TYR A 1 20 ? 0.714   6.462   -3.092  1.00 0.00 ? 548 TYR A HE1  7  
ATOM   3940  H  HE2  . TYR A 1 20 ? 2.419   3.926   -6.069  1.00 0.00 ? 548 TYR A HE2  7  
ATOM   3941  H  HH   . TYR A 1 20 ? 2.431   6.687   -5.699  1.00 0.00 ? 548 TYR A HH   7  
ATOM   3942  N  N    . GLY A 1 21 ? -2.566  0.830   -6.294  1.00 0.00 ? 549 GLY A N    7  
ATOM   3943  C  CA   . GLY A 1 21 ? -2.959  -0.416  -6.925  1.00 0.00 ? 549 GLY A CA   7  
ATOM   3944  C  C    . GLY A 1 21 ? -1.773  -1.299  -7.257  1.00 0.00 ? 549 GLY A C    7  
ATOM   3945  O  O    . GLY A 1 21 ? -1.778  -2.003  -8.267  1.00 0.00 ? 549 GLY A O    7  
ATOM   3946  H  H    . GLY A 1 21 ? -1.887  1.398   -6.716  1.00 0.00 ? 549 GLY A H    7  
ATOM   3947  H  HA2  . GLY A 1 21 ? -3.618  -0.952  -6.258  1.00 0.00 ? 549 GLY A HA2  7  
ATOM   3948  H  HA3  . GLY A 1 21 ? -3.493  -0.192  -7.837  1.00 0.00 ? 549 GLY A HA3  7  
ATOM   3949  N  N    . LYS A 1 22 ? -0.754  -1.262  -6.405  1.00 0.00 ? 550 LYS A N    7  
ATOM   3950  C  CA   . LYS A 1 22 ? 0.445   -2.065  -6.613  1.00 0.00 ? 550 LYS A CA   7  
ATOM   3951  C  C    . LYS A 1 22 ? 1.068   -2.469  -5.281  1.00 0.00 ? 550 LYS A C    7  
ATOM   3952  O  O    . LYS A 1 22 ? 1.375   -1.619  -4.445  1.00 0.00 ? 550 LYS A O    7  
ATOM   3953  C  CB   . LYS A 1 22 ? 1.464   -1.293  -7.453  1.00 0.00 ? 550 LYS A CB   7  
ATOM   3954  C  CG   . LYS A 1 22 ? 1.157   -1.306  -8.942  1.00 0.00 ? 550 LYS A CG   7  
ATOM   3955  C  CD   . LYS A 1 22 ? 2.332   -0.792  -9.758  1.00 0.00 ? 550 LYS A CD   7  
ATOM   3956  C  CE   . LYS A 1 22 ? 2.302   -1.331  -11.178 1.00 0.00 ? 550 LYS A CE   7  
ATOM   3957  N  NZ   . LYS A 1 22 ? 3.229   -0.588  -12.075 1.00 0.00 ? 550 LYS A NZ   7  
ATOM   3958  H  H    . LYS A 1 22 ? -0.809  -0.681  -5.618  1.00 0.00 ? 550 LYS A H    7  
ATOM   3959  H  HA   . LYS A 1 22 ? 0.156   -2.959  -7.146  1.00 0.00 ? 550 LYS A HA   7  
ATOM   3960  H  HB2  . LYS A 1 22 ? 1.483   -0.265  -7.120  1.00 0.00 ? 550 LYS A HB2  7  
ATOM   3961  H  HB3  . LYS A 1 22 ? 2.440   -1.728  -7.304  1.00 0.00 ? 550 LYS A HB3  7  
ATOM   3962  H  HG2  . LYS A 1 22 ? 0.938   -2.319  -9.245  1.00 0.00 ? 550 LYS A HG2  7  
ATOM   3963  H  HG3  . LYS A 1 22 ? 0.298   -0.678  -9.129  1.00 0.00 ? 550 LYS A HG3  7  
ATOM   3964  H  HD2  . LYS A 1 22 ? 2.291   0.287   -9.792  1.00 0.00 ? 550 LYS A HD2  7  
ATOM   3965  H  HD3  . LYS A 1 22 ? 3.251   -1.104  -9.283  1.00 0.00 ? 550 LYS A HD3  7  
ATOM   3966  H  HE2  . LYS A 1 22 ? 2.589   -2.371  -11.161 1.00 0.00 ? 550 LYS A HE2  7  
ATOM   3967  H  HE3  . LYS A 1 22 ? 1.296   -1.242  -11.562 1.00 0.00 ? 550 LYS A HE3  7  
ATOM   3968  H  HZ1  . LYS A 1 22 ? 3.661   -1.239  -12.762 1.00 0.00 ? 550 LYS A HZ1  7  
ATOM   3969  H  HZ2  . LYS A 1 22 ? 3.984   -0.141  -11.517 1.00 0.00 ? 550 LYS A HZ2  7  
ATOM   3970  H  HZ3  . LYS A 1 22 ? 2.711   0.152   -12.592 1.00 0.00 ? 550 LYS A HZ3  7  
ATOM   3971  N  N    . THR A 1 23 ? 1.251   -3.771  -5.090  1.00 0.00 ? 551 THR A N    7  
ATOM   3972  C  CA   . THR A 1 23 ? 1.837   -4.288  -3.859  1.00 0.00 ? 551 THR A CA   7  
ATOM   3973  C  C    . THR A 1 23 ? 3.320   -3.941  -3.774  1.00 0.00 ? 551 THR A C    7  
ATOM   3974  O  O    . THR A 1 23 ? 3.842   -3.666  -2.694  1.00 0.00 ? 551 THR A O    7  
ATOM   3975  C  CB   . THR A 1 23 ? 1.650   -5.803  -3.776  1.00 0.00 ? 551 THR A CB   7  
ATOM   3976  O  OG1  . THR A 1 23 ? 2.139   -6.302  -2.544  1.00 0.00 ? 551 THR A OG1  7  
ATOM   3977  C  CG2  . THR A 1 23 ? 2.351   -6.555  -4.886  1.00 0.00 ? 551 THR A CG2  7  
ATOM   3978  H  H    . THR A 1 23 ? 0.986   -4.399  -5.793  1.00 0.00 ? 551 THR A H    7  
ATOM   3979  H  HA   . THR A 1 23 ? 1.325   -3.825  -3.029  1.00 0.00 ? 551 THR A HA   7  
ATOM   3980  H  HB   . THR A 1 23 ? 0.595   -6.029  -3.839  1.00 0.00 ? 551 THR A HB   7  
ATOM   3981  H  HG1  . THR A 1 23 ? 3.054   -6.036  -2.430  1.00 0.00 ? 551 THR A HG1  7  
ATOM   3982  H  HG21 . THR A 1 23 ? 3.420   -6.476  -4.754  1.00 0.00 ? 551 THR A HG21 7  
ATOM   3983  H  HG22 . THR A 1 23 ? 2.074   -6.130  -5.840  1.00 0.00 ? 551 THR A HG22 7  
ATOM   3984  H  HG23 . THR A 1 23 ? 2.060   -7.595  -4.857  1.00 0.00 ? 551 THR A HG23 7  
ATOM   3985  N  N    . SER A 1 24 ? 3.994   -3.954  -4.920  1.00 0.00 ? 552 SER A N    7  
ATOM   3986  C  CA   . SER A 1 24 ? 5.417   -3.640  -4.973  1.00 0.00 ? 552 SER A CA   7  
ATOM   3987  C  C    . SER A 1 24 ? 5.685   -2.241  -4.428  1.00 0.00 ? 552 SER A C    7  
ATOM   3988  O  O    . SER A 1 24 ? 6.721   -1.992  -3.813  1.00 0.00 ? 552 SER A O    7  
ATOM   3989  C  CB   . SER A 1 24 ? 5.932   -3.748  -6.409  1.00 0.00 ? 552 SER A CB   7  
ATOM   3990  O  OG   . SER A 1 24 ? 5.435   -4.914  -7.043  1.00 0.00 ? 552 SER A OG   7  
ATOM   3991  H  H    . SER A 1 24 ? 3.523   -4.180  -5.749  1.00 0.00 ? 552 SER A H    7  
ATOM   3992  H  HA   . SER A 1 24 ? 5.938   -4.358  -4.358  1.00 0.00 ? 552 SER A HA   7  
ATOM   3993  H  HB2  . SER A 1 24 ? 5.612   -2.884  -6.971  1.00 0.00 ? 552 SER A HB2  7  
ATOM   3994  H  HB3  . SER A 1 24 ? 7.012   -3.791  -6.399  1.00 0.00 ? 552 SER A HB3  7  
ATOM   3995  H  HG   . SER A 1 24 ? 5.851   -5.689  -6.660  1.00 0.00 ? 552 SER A HG   7  
ATOM   3996  N  N    . HIS A 1 25 ? 4.742   -1.332  -4.653  1.00 0.00 ? 553 HIS A N    7  
ATOM   3997  C  CA   . HIS A 1 25 ? 4.877   0.039   -4.178  1.00 0.00 ? 553 HIS A CA   7  
ATOM   3998  C  C    . HIS A 1 25 ? 4.615   0.118   -2.678  1.00 0.00 ? 553 HIS A C    7  
ATOM   3999  O  O    . HIS A 1 25 ? 5.154   0.983   -1.987  1.00 0.00 ? 553 HIS A O    7  
ATOM   4000  C  CB   . HIS A 1 25 ? 3.911   0.960   -4.925  1.00 0.00 ? 553 HIS A CB   7  
ATOM   4001  C  CG   . HIS A 1 25 ? 4.283   1.185   -6.358  1.00 0.00 ? 553 HIS A CG   7  
ATOM   4002  N  ND1  . HIS A 1 25 ? 4.540   2.425   -6.898  1.00 0.00 ? 553 HIS A ND1  7  
ATOM   4003  C  CD2  . HIS A 1 25 ? 4.440   0.295   -7.371  1.00 0.00 ? 553 HIS A CD2  7  
ATOM   4004  C  CE1  . HIS A 1 25 ? 4.838   2.255   -8.194  1.00 0.00 ? 553 HIS A CE1  7  
ATOM   4005  N  NE2  . HIS A 1 25 ? 4.793   0.980   -8.530  1.00 0.00 ? 553 HIS A NE2  7  
ATOM   4006  H  H    . HIS A 1 25 ? 3.936   -1.591  -5.146  1.00 0.00 ? 553 HIS A H    7  
ATOM   4007  H  HA   . HIS A 1 25 ? 5.890   0.360   -4.371  1.00 0.00 ? 553 HIS A HA   7  
ATOM   4008  H  HB2  . HIS A 1 25 ? 2.922   0.525   -4.905  1.00 0.00 ? 553 HIS A HB2  7  
ATOM   4009  H  HB3  . HIS A 1 25 ? 3.886   1.921   -4.432  1.00 0.00 ? 553 HIS A HB3  7  
ATOM   4010  H  HD1  . HIS A 1 25 ? 4.509   3.280   -6.421  1.00 0.00 ? 553 HIS A HD1  7  
ATOM   4011  H  HD2  . HIS A 1 25 ? 4.313   -0.775  -7.300  1.00 0.00 ? 553 HIS A HD2  7  
ATOM   4012  H  HE1  . HIS A 1 25 ? 5.085   3.057   -8.873  1.00 0.00 ? 553 HIS A HE1  7  
ATOM   4013  N  N    . LEU A 1 26 ? 3.784   -0.792  -2.180  1.00 0.00 ? 554 LEU A N    7  
ATOM   4014  C  CA   . LEU A 1 26 ? 3.449   -0.827  -0.762  1.00 0.00 ? 554 LEU A CA   7  
ATOM   4015  C  C    . LEU A 1 26 ? 4.695   -1.076  0.084   1.00 0.00 ? 554 LEU A C    7  
ATOM   4016  O  O    . LEU A 1 26 ? 4.807   -0.575  1.203   1.00 0.00 ? 554 LEU A O    7  
ATOM   4017  C  CB   . LEU A 1 26 ? 2.403   -1.912  -0.490  1.00 0.00 ? 554 LEU A CB   7  
ATOM   4018  C  CG   . LEU A 1 26 ? 1.083   -1.405  0.095   1.00 0.00 ? 554 LEU A CG   7  
ATOM   4019  C  CD1  . LEU A 1 26 ? 0.410   -0.439  -0.867  1.00 0.00 ? 554 LEU A CD1  7  
ATOM   4020  C  CD2  . LEU A 1 26 ? 0.161   -2.572  0.414   1.00 0.00 ? 554 LEU A CD2  7  
ATOM   4021  H  H    . LEU A 1 26 ? 3.386   -1.456  -2.780  1.00 0.00 ? 554 LEU A H    7  
ATOM   4022  H  HA   . LEU A 1 26 ? 3.035   0.134   -0.496  1.00 0.00 ? 554 LEU A HA   7  
ATOM   4023  H  HB2  . LEU A 1 26 ? 2.190   -2.417  -1.421  1.00 0.00 ? 554 LEU A HB2  7  
ATOM   4024  H  HB3  . LEU A 1 26 ? 2.824   -2.628  0.200   1.00 0.00 ? 554 LEU A HB3  7  
ATOM   4025  H  HG   . LEU A 1 26 ? 1.284   -0.875  1.014   1.00 0.00 ? 554 LEU A HG   7  
ATOM   4026  H  HD11 . LEU A 1 26 ? 0.023   -0.985  -1.715  1.00 0.00 ? 554 LEU A HD11 7  
ATOM   4027  H  HD12 . LEU A 1 26 ? 1.129   0.291   -1.207  1.00 0.00 ? 554 LEU A HD12 7  
ATOM   4028  H  HD13 . LEU A 1 26 ? -0.402  0.064   -0.362  1.00 0.00 ? 554 LEU A HD13 7  
ATOM   4029  H  HD21 . LEU A 1 26 ? 0.474   -3.036  1.337   1.00 0.00 ? 554 LEU A HD21 7  
ATOM   4030  H  HD22 . LEU A 1 26 ? 0.205   -3.295  -0.386  1.00 0.00 ? 554 LEU A HD22 7  
ATOM   4031  H  HD23 . LEU A 1 26 ? -0.852  -2.211  0.519   1.00 0.00 ? 554 LEU A HD23 7  
ATOM   4032  N  N    . ARG A 1 27 ? 5.629   -1.853  -0.457  1.00 0.00 ? 555 ARG A N    7  
ATOM   4033  C  CA   . ARG A 1 27 ? 6.863   -2.165  0.252   1.00 0.00 ? 555 ARG A CA   7  
ATOM   4034  C  C    . ARG A 1 27 ? 7.685   -0.900  0.493   1.00 0.00 ? 555 ARG A C    7  
ATOM   4035  O  O    . ARG A 1 27 ? 8.164   -0.661  1.602   1.00 0.00 ? 555 ARG A O    7  
ATOM   4036  C  CB   . ARG A 1 27 ? 7.682   -3.205  -0.530  1.00 0.00 ? 555 ARG A CB   7  
ATOM   4037  C  CG   . ARG A 1 27 ? 8.711   -2.608  -1.482  1.00 0.00 ? 555 ARG A CG   7  
ATOM   4038  C  CD   . ARG A 1 27 ? 9.482   -3.688  -2.222  1.00 0.00 ? 555 ARG A CD   7  
ATOM   4039  N  NE   . ARG A 1 27 ? 10.605  -3.137  -2.977  1.00 0.00 ? 555 ARG A NE   7  
ATOM   4040  C  CZ   . ARG A 1 27 ? 11.641  -3.858  -3.398  1.00 0.00 ? 555 ARG A CZ   7  
ATOM   4041  N  NH1  . ARG A 1 27 ? 11.699  -5.160  -3.145  1.00 0.00 ? 555 ARG A NH1  7  
ATOM   4042  N  NH2  . ARG A 1 27 ? 12.621  -3.276  -4.076  1.00 0.00 ? 555 ARG A NH2  7  
ATOM   4043  H  H    . ARG A 1 27 ? 5.484   -2.224  -1.351  1.00 0.00 ? 555 ARG A H    7  
ATOM   4044  H  HA   . ARG A 1 27 ? 6.591   -2.585  1.208   1.00 0.00 ? 555 ARG A HA   7  
ATOM   4045  H  HB2  . ARG A 1 27 ? 8.203   -3.835  0.174   1.00 0.00 ? 555 ARG A HB2  7  
ATOM   4046  H  HB3  . ARG A 1 27 ? 7.003   -3.815  -1.109  1.00 0.00 ? 555 ARG A HB3  7  
ATOM   4047  H  HG2  . ARG A 1 27 ? 8.203   -1.985  -2.202  1.00 0.00 ? 555 ARG A HG2  7  
ATOM   4048  H  HG3  . ARG A 1 27 ? 9.406   -2.008  -0.913  1.00 0.00 ? 555 ARG A HG3  7  
ATOM   4049  H  HD2  . ARG A 1 27 ? 9.858   -4.400  -1.503  1.00 0.00 ? 555 ARG A HD2  7  
ATOM   4050  H  HD3  . ARG A 1 27 ? 8.811   -4.188  -2.905  1.00 0.00 ? 555 ARG A HD3  7  
ATOM   4051  H  HE   . ARG A 1 27 ? 10.587  -2.178  -3.179  1.00 0.00 ? 555 ARG A HE   7  
ATOM   4052  H  HH11 . ARG A 1 27 ? 10.963  -5.605  -2.635  1.00 0.00 ? 555 ARG A HH11 7  
ATOM   4053  H  HH12 . ARG A 1 27 ? 12.481  -5.696  -3.464  1.00 0.00 ? 555 ARG A HH12 7  
ATOM   4054  H  HH21 . ARG A 1 27 ? 12.582  -2.296  -4.270  1.00 0.00 ? 555 ARG A HH21 7  
ATOM   4055  H  HH22 . ARG A 1 27 ? 13.400  -3.818  -4.392  1.00 0.00 ? 555 ARG A HH22 7  
ATOM   4056  N  N    . ALA A 1 28 ? 7.842   -0.094  -0.553  1.00 0.00 ? 556 ALA A N    7  
ATOM   4057  C  CA   . ALA A 1 28 ? 8.604   1.143   -0.457  1.00 0.00 ? 556 ALA A CA   7  
ATOM   4058  C  C    . ALA A 1 28 ? 7.883   2.163   0.416   1.00 0.00 ? 556 ALA A C    7  
ATOM   4059  O  O    . ALA A 1 28 ? 8.514   2.967   1.101   1.00 0.00 ? 556 ALA A O    7  
ATOM   4060  C  CB   . ALA A 1 28 ? 8.856   1.716   -1.844  1.00 0.00 ? 556 ALA A CB   7  
ATOM   4061  H  H    . ALA A 1 28 ? 7.437   -0.338  -1.410  1.00 0.00 ? 556 ALA A H    7  
ATOM   4062  H  HA   . ALA A 1 28 ? 9.558   0.910   -0.011  1.00 0.00 ? 556 ALA A HA   7  
ATOM   4063  H  HB1  . ALA A 1 28 ? 9.795   2.250   -1.847  1.00 0.00 ? 556 ALA A HB1  7  
ATOM   4064  H  HB2  . ALA A 1 28 ? 8.056   2.393   -2.105  1.00 0.00 ? 556 ALA A HB2  7  
ATOM   4065  H  HB3  . ALA A 1 28 ? 8.897   0.912   -2.564  1.00 0.00 ? 556 ALA A HB3  7  
ATOM   4066  N  N    . HIS A 1 29 ? 6.556   2.124   0.384   1.00 0.00 ? 557 HIS A N    7  
ATOM   4067  C  CA   . HIS A 1 29 ? 5.746   3.042   1.168   1.00 0.00 ? 557 HIS A CA   7  
ATOM   4068  C  C    . HIS A 1 29 ? 5.663   2.592   2.625   1.00 0.00 ? 557 HIS A C    7  
ATOM   4069  O  O    . HIS A 1 29 ? 5.678   3.415   3.541   1.00 0.00 ? 557 HIS A O    7  
ATOM   4070  C  CB   . HIS A 1 29 ? 4.341   3.150   0.567   1.00 0.00 ? 557 HIS A CB   7  
ATOM   4071  C  CG   . HIS A 1 29 ? 3.392   3.955   1.399   1.00 0.00 ? 557 HIS A CG   7  
ATOM   4072  N  ND1  . HIS A 1 29 ? 3.741   5.112   2.057   1.00 0.00 ? 557 HIS A ND1  7  
ATOM   4073  C  CD2  . HIS A 1 29 ? 2.082   3.743   1.682   1.00 0.00 ? 557 HIS A CD2  7  
ATOM   4074  C  CE1  . HIS A 1 29 ? 2.658   5.557   2.708   1.00 0.00 ? 557 HIS A CE1  7  
ATOM   4075  N  NE2  . HIS A 1 29 ? 1.624   4.761   2.513   1.00 0.00 ? 557 HIS A NE2  7  
ATOM   4076  H  H    . HIS A 1 29 ? 6.111   1.465   -0.182  1.00 0.00 ? 557 HIS A H    7  
ATOM   4077  H  HA   . HIS A 1 29 ? 6.218   4.008   1.127   1.00 0.00 ? 557 HIS A HA   7  
ATOM   4078  H  HB2  . HIS A 1 29 ? 4.407   3.616   -0.404  1.00 0.00 ? 557 HIS A HB2  7  
ATOM   4079  H  HB3  . HIS A 1 29 ? 3.928   2.157   0.457   1.00 0.00 ? 557 HIS A HB3  7  
ATOM   4080  H  HD1  . HIS A 1 29 ? 4.625   5.536   2.052   1.00 0.00 ? 557 HIS A HD1  7  
ATOM   4081  H  HD2  . HIS A 1 29 ? 1.481   2.919   1.325   1.00 0.00 ? 557 HIS A HD2  7  
ATOM   4082  H  HE1  . HIS A 1 29 ? 2.634   6.451   3.313   1.00 0.00 ? 557 HIS A HE1  7  
ATOM   4083  N  N    . LEU A 1 30 ? 5.572   1.282   2.831   1.00 0.00 ? 558 LEU A N    7  
ATOM   4084  C  CA   . LEU A 1 30 ? 5.482   0.723   4.176   1.00 0.00 ? 558 LEU A CA   7  
ATOM   4085  C  C    . LEU A 1 30 ? 6.718   1.076   4.999   1.00 0.00 ? 558 LEU A C    7  
ATOM   4086  O  O    . LEU A 1 30 ? 6.611   1.460   6.164   1.00 0.00 ? 558 LEU A O    7  
ATOM   4087  C  CB   . LEU A 1 30 ? 5.316   -0.796  4.109   1.00 0.00 ? 558 LEU A CB   7  
ATOM   4088  C  CG   . LEU A 1 30 ? 3.868   -1.288  4.054   1.00 0.00 ? 558 LEU A CG   7  
ATOM   4089  C  CD1  . LEU A 1 30 ? 3.799   -2.676  3.435   1.00 0.00 ? 558 LEU A CD1  7  
ATOM   4090  C  CD2  . LEU A 1 30 ? 3.256   -1.293  5.446   1.00 0.00 ? 558 LEU A CD2  7  
ATOM   4091  H  H    . LEU A 1 30 ? 5.562   0.677   2.061   1.00 0.00 ? 558 LEU A H    7  
ATOM   4092  H  HA   . LEU A 1 30 ? 4.613   1.150   4.654   1.00 0.00 ? 558 LEU A HA   7  
ATOM   4093  H  HB2  . LEU A 1 30 ? 5.829   -1.154  3.228   1.00 0.00 ? 558 LEU A HB2  7  
ATOM   4094  H  HB3  . LEU A 1 30 ? 5.786   -1.228  4.979   1.00 0.00 ? 558 LEU A HB3  7  
ATOM   4095  H  HG   . LEU A 1 30 ? 3.290   -0.618  3.435   1.00 0.00 ? 558 LEU A HG   7  
ATOM   4096  H  HD11 . LEU A 1 30 ? 2.961   -3.214  3.851   1.00 0.00 ? 558 LEU A HD11 7  
ATOM   4097  H  HD12 . LEU A 1 30 ? 4.713   -3.211  3.648   1.00 0.00 ? 558 LEU A HD12 7  
ATOM   4098  H  HD13 . LEU A 1 30 ? 3.675   -2.587  2.365   1.00 0.00 ? 558 LEU A HD13 7  
ATOM   4099  H  HD21 . LEU A 1 30 ? 2.216   -1.008  5.383   1.00 0.00 ? 558 LEU A HD21 7  
ATOM   4100  H  HD22 . LEU A 1 30 ? 3.784   -0.592  6.075   1.00 0.00 ? 558 LEU A HD22 7  
ATOM   4101  H  HD23 . LEU A 1 30 ? 3.332   -2.284  5.869   1.00 0.00 ? 558 LEU A HD23 7  
ATOM   4102  N  N    . ARG A 1 31 ? 7.889   0.943   4.386   1.00 0.00 ? 559 ARG A N    7  
ATOM   4103  C  CA   . ARG A 1 31 ? 9.145   1.248   5.062   1.00 0.00 ? 559 ARG A CA   7  
ATOM   4104  C  C    . ARG A 1 31 ? 9.173   2.700   5.531   1.00 0.00 ? 559 ARG A C    7  
ATOM   4105  O  O    . ARG A 1 31 ? 9.810   3.027   6.533   1.00 0.00 ? 559 ARG A O    7  
ATOM   4106  C  CB   . ARG A 1 31 ? 10.327  0.976   4.130   1.00 0.00 ? 559 ARG A CB   7  
ATOM   4107  C  CG   . ARG A 1 31 ? 10.197  1.651   2.775   1.00 0.00 ? 559 ARG A CG   7  
ATOM   4108  C  CD   . ARG A 1 31 ? 11.477  1.531   1.964   1.00 0.00 ? 559 ARG A CD   7  
ATOM   4109  N  NE   . ARG A 1 31 ? 12.435  2.584   2.295   1.00 0.00 ? 559 ARG A NE   7  
ATOM   4110  C  CZ   . ARG A 1 31 ? 13.326  3.078   1.437   1.00 0.00 ? 559 ARG A CZ   7  
ATOM   4111  N  NH1  . ARG A 1 31 ? 13.396  2.613   0.195   1.00 0.00 ? 559 ARG A NH1  7  
ATOM   4112  N  NH2  . ARG A 1 31 ? 14.153  4.039   1.824   1.00 0.00 ? 559 ARG A NH2  7  
ATOM   4113  H  H    . ARG A 1 31 ? 7.910   0.633   3.457   1.00 0.00 ? 559 ARG A H    7  
ATOM   4114  H  HA   . ARG A 1 31 ? 9.222   0.602   5.924   1.00 0.00 ? 559 ARG A HA   7  
ATOM   4115  H  HB2  . ARG A 1 31 ? 11.232  1.332   4.601   1.00 0.00 ? 559 ARG A HB2  7  
ATOM   4116  H  HB3  . ARG A 1 31 ? 10.409  -0.089  3.972   1.00 0.00 ? 559 ARG A HB3  7  
ATOM   4117  H  HG2  . ARG A 1 31 ? 9.392   1.184   2.228   1.00 0.00 ? 559 ARG A HG2  7  
ATOM   4118  H  HG3  . ARG A 1 31 ? 9.973   2.697   2.926   1.00 0.00 ? 559 ARG A HG3  7  
ATOM   4119  H  HD2  . ARG A 1 31 ? 11.927  0.571   2.164   1.00 0.00 ? 559 ARG A HD2  7  
ATOM   4120  H  HD3  . ARG A 1 31 ? 11.227  1.599   0.916   1.00 0.00 ? 559 ARG A HD3  7  
ATOM   4121  H  HE   . ARG A 1 31 ? 12.412  2.944   3.206   1.00 0.00 ? 559 ARG A HE   7  
ATOM   4122  H  HH11 . ARG A 1 31 ? 12.779  1.886   -0.105  1.00 0.00 ? 559 ARG A HH11 7  
ATOM   4123  H  HH12 . ARG A 1 31 ? 14.068  2.991   -0.442  1.00 0.00 ? 559 ARG A HH12 7  
ATOM   4124  H  HH21 . ARG A 1 31 ? 14.107  4.392   2.759   1.00 0.00 ? 559 ARG A HH21 7  
ATOM   4125  H  HH22 . ARG A 1 31 ? 14.823  4.411   1.181   1.00 0.00 ? 559 ARG A HH22 7  
ATOM   4126  N  N    . TRP A 1 32 ? 8.479   3.566   4.800   1.00 0.00 ? 560 TRP A N    7  
ATOM   4127  C  CA   . TRP A 1 32 ? 8.423   4.984   5.140   1.00 0.00 ? 560 TRP A CA   7  
ATOM   4128  C  C    . TRP A 1 32 ? 7.632   5.204   6.426   1.00 0.00 ? 560 TRP A C    7  
ATOM   4129  O  O    . TRP A 1 32 ? 7.973   6.067   7.236   1.00 0.00 ? 560 TRP A O    7  
ATOM   4130  C  CB   . TRP A 1 32 ? 7.791   5.779   3.996   1.00 0.00 ? 560 TRP A CB   7  
ATOM   4131  C  CG   . TRP A 1 32 ? 8.471   7.089   3.736   1.00 0.00 ? 560 TRP A CG   7  
ATOM   4132  C  CD1  . TRP A 1 32 ? 8.423   8.207   4.517   1.00 0.00 ? 560 TRP A CD1  7  
ATOM   4133  C  CD2  . TRP A 1 32 ? 9.301   7.417   2.615   1.00 0.00 ? 560 TRP A CD2  7  
ATOM   4134  N  NE1  . TRP A 1 32 ? 9.172   9.210   3.952   1.00 0.00 ? 560 TRP A NE1  7  
ATOM   4135  C  CE2  . TRP A 1 32 ? 9.721   8.750   2.784   1.00 0.00 ? 560 TRP A CE2  7  
ATOM   4136  C  CE3  . TRP A 1 32 ? 9.731   6.713   1.486   1.00 0.00 ? 560 TRP A CE3  7  
ATOM   4137  C  CZ2  . TRP A 1 32 ? 10.549  9.392   1.866   1.00 0.00 ? 560 TRP A CZ2  7  
ATOM   4138  C  CZ3  . TRP A 1 32 ? 10.553  7.351   0.576   1.00 0.00 ? 560 TRP A CZ3  7  
ATOM   4139  C  CH2  . TRP A 1 32 ? 10.954  8.679   0.771   1.00 0.00 ? 560 TRP A CH2  7  
ATOM   4140  H  H    . TRP A 1 32 ? 7.992   3.245   4.013   1.00 0.00 ? 560 TRP A H    7  
ATOM   4141  H  HA   . TRP A 1 32 ? 9.435   5.329   5.291   1.00 0.00 ? 560 TRP A HA   7  
ATOM   4142  H  HB2  . TRP A 1 32 ? 7.839   5.194   3.090   1.00 0.00 ? 560 TRP A HB2  7  
ATOM   4143  H  HB3  . TRP A 1 32 ? 6.756   5.981   4.235   1.00 0.00 ? 560 TRP A HB3  7  
ATOM   4144  H  HD1  . TRP A 1 32 ? 7.871   8.279   5.443   1.00 0.00 ? 560 TRP A HD1  7  
ATOM   4145  H  HE1  . TRP A 1 32 ? 9.293   10.109  4.324   1.00 0.00 ? 560 TRP A HE1  7  
ATOM   4146  H  HE3  . TRP A 1 32 ? 9.431   5.689   1.319   1.00 0.00 ? 560 TRP A HE3  7  
ATOM   4147  H  HZ2  . TRP A 1 32 ? 10.868  10.414  2.002   1.00 0.00 ? 560 TRP A HZ2  7  
ATOM   4148  H  HZ3  . TRP A 1 32 ? 10.894  6.824   -0.302  1.00 0.00 ? 560 TRP A HZ3  7  
ATOM   4149  H  HH2  . TRP A 1 32 ? 11.596  9.138   0.034   1.00 0.00 ? 560 TRP A HH2  7  
ATOM   4150  N  N    . HIS A 1 33 ? 6.575   4.420   6.607   1.00 0.00 ? 561 HIS A N    7  
ATOM   4151  C  CA   . HIS A 1 33 ? 5.735   4.530   7.794   1.00 0.00 ? 561 HIS A CA   7  
ATOM   4152  C  C    . HIS A 1 33 ? 6.485   4.060   9.036   1.00 0.00 ? 561 HIS A C    7  
ATOM   4153  O  O    . HIS A 1 33 ? 6.424   4.697   10.088  1.00 0.00 ? 561 HIS A O    7  
ATOM   4154  C  CB   . HIS A 1 33 ? 4.455   3.710   7.616   1.00 0.00 ? 561 HIS A CB   7  
ATOM   4155  C  CG   . HIS A 1 33 ? 3.362   4.452   6.913   1.00 0.00 ? 561 HIS A CG   7  
ATOM   4156  N  ND1  . HIS A 1 33 ? 2.671   5.508   7.465   1.00 0.00 ? 561 HIS A ND1  7  
ATOM   4157  C  CD2  . HIS A 1 33 ? 2.840   4.272   5.672   1.00 0.00 ? 561 HIS A CD2  7  
ATOM   4158  C  CE1  . HIS A 1 33 ? 1.771   5.926   6.565   1.00 0.00 ? 561 HIS A CE1  7  
ATOM   4159  N  NE2  . HIS A 1 33 ? 1.833   5.209   5.459   1.00 0.00 ? 561 HIS A NE2  7  
ATOM   4160  H  H    . HIS A 1 33 ? 6.354   3.752   5.925   1.00 0.00 ? 561 HIS A H    7  
ATOM   4161  H  HA   . HIS A 1 33 ? 5.471   5.569   7.918   1.00 0.00 ? 561 HIS A HA   7  
ATOM   4162  H  HB2  . HIS A 1 33 ? 4.680   2.825   7.040   1.00 0.00 ? 561 HIS A HB2  7  
ATOM   4163  H  HB3  . HIS A 1 33 ? 4.087   3.417   8.589   1.00 0.00 ? 561 HIS A HB3  7  
ATOM   4164  H  HD1  . HIS A 1 33 ? 2.812   5.886   8.358   1.00 0.00 ? 561 HIS A HD1  7  
ATOM   4165  H  HD2  . HIS A 1 33 ? 3.150   3.524   4.957   1.00 0.00 ? 561 HIS A HD2  7  
ATOM   4166  H  HE1  . HIS A 1 33 ? 1.085   6.745   6.723   1.00 0.00 ? 561 HIS A HE1  7  
ATOM   4167  N  N    . THR A 1 34 ? 7.192   2.943   8.907   1.00 0.00 ? 562 THR A N    7  
ATOM   4168  C  CA   . THR A 1 34 ? 7.954   2.388   10.020  1.00 0.00 ? 562 THR A CA   7  
ATOM   4169  C  C    . THR A 1 34 ? 9.231   3.187   10.256  1.00 0.00 ? 562 THR A C    7  
ATOM   4170  O  O    . THR A 1 34 ? 9.681   3.336   11.392  1.00 0.00 ? 562 THR A O    7  
ATOM   4171  C  CB   . THR A 1 34 ? 8.298   0.922   9.749   1.00 0.00 ? 562 THR A CB   7  
ATOM   4172  O  OG1  . THR A 1 34 ? 9.197   0.811   8.660   1.00 0.00 ? 562 THR A OG1  7  
ATOM   4173  C  CG2  . THR A 1 34 ? 7.087   0.072   9.433   1.00 0.00 ? 562 THR A CG2  7  
ATOM   4174  H  H    . THR A 1 34 ? 7.201   2.480   8.043   1.00 0.00 ? 562 THR A H    7  
ATOM   4175  H  HA   . THR A 1 34 ? 7.338   2.446   10.905  1.00 0.00 ? 562 THR A HA   7  
ATOM   4176  H  HB   . THR A 1 34 ? 8.774   0.507   10.626  1.00 0.00 ? 562 THR A HB   7  
ATOM   4177  H  HG1  . THR A 1 34 ? 8.878   1.341   7.926   1.00 0.00 ? 562 THR A HG1  7  
ATOM   4178  H  HG21 . THR A 1 34 ? 7.291   -0.538  8.566   1.00 0.00 ? 562 THR A HG21 7  
ATOM   4179  H  HG22 . THR A 1 34 ? 6.240   0.712   9.232   1.00 0.00 ? 562 THR A HG22 7  
ATOM   4180  H  HG23 . THR A 1 34 ? 6.864   -0.565  10.276  1.00 0.00 ? 562 THR A HG23 7  
ATOM   4181  N  N    . GLY A 1 35 ? 9.811   3.699   9.175   1.00 0.00 ? 563 GLY A N    7  
ATOM   4182  C  CA   . GLY A 1 35 ? 11.031  4.477   9.286   1.00 0.00 ? 563 GLY A CA   7  
ATOM   4183  C  C    . GLY A 1 35 ? 10.782  5.967   9.163   1.00 0.00 ? 563 GLY A C    7  
ATOM   4184  O  O    . GLY A 1 35 ? 11.293  6.615   8.249   1.00 0.00 ? 563 GLY A O    7  
ATOM   4185  H  H    . GLY A 1 35 ? 9.407   3.547   8.295   1.00 0.00 ? 563 GLY A H    7  
ATOM   4186  H  HA2  . GLY A 1 35 ? 11.486  4.277   10.245  1.00 0.00 ? 563 GLY A HA2  7  
ATOM   4187  H  HA3  . GLY A 1 35 ? 11.712  4.171   8.505   1.00 0.00 ? 563 GLY A HA3  7  
ATOM   4188  N  N    . GLU A 1 36 ? 9.995   6.512   10.085  1.00 0.00 ? 564 GLU A N    7  
ATOM   4189  C  CA   . GLU A 1 36 ? 9.678   7.936   10.075  1.00 0.00 ? 564 GLU A CA   7  
ATOM   4190  C  C    . GLU A 1 36 ? 10.467  8.677   11.150  1.00 0.00 ? 564 GLU A C    7  
ATOM   4191  O  O    . GLU A 1 36 ? 11.217  9.607   10.854  1.00 0.00 ? 564 GLU A O    7  
ATOM   4192  C  CB   . GLU A 1 36 ? 8.177   8.146   10.287  1.00 0.00 ? 564 GLU A CB   7  
ATOM   4193  C  CG   . GLU A 1 36 ? 7.422   8.470   9.008   1.00 0.00 ? 564 GLU A CG   7  
ATOM   4194  C  CD   . GLU A 1 36 ? 7.049   9.936   8.905   1.00 0.00 ? 564 GLU A CD   7  
ATOM   4195  O  OE1  . GLU A 1 36 ? 6.179   10.382  9.683   1.00 0.00 ? 564 GLU A OE1  7  
ATOM   4196  O  OE2  . GLU A 1 36 ? 7.626   10.637  8.048   1.00 0.00 ? 564 GLU A OE2  7  
ATOM   4197  H  H    . GLU A 1 36 ? 9.618   5.944   10.788  1.00 0.00 ? 564 GLU A H    7  
ATOM   4198  H  HA   . GLU A 1 36 ? 9.954   8.330   9.108   1.00 0.00 ? 564 GLU A HA   7  
ATOM   4199  H  HB2  . GLU A 1 36 ? 7.756   7.246   10.710  1.00 0.00 ? 564 GLU A HB2  7  
ATOM   4200  H  HB3  . GLU A 1 36 ? 8.032   8.961   10.981  1.00 0.00 ? 564 GLU A HB3  7  
ATOM   4201  H  HG2  . GLU A 1 36 ? 8.044   8.213   8.163   1.00 0.00 ? 564 GLU A HG2  7  
ATOM   4202  H  HG3  . GLU A 1 36 ? 6.518   7.880   8.980   1.00 0.00 ? 564 GLU A HG3  7  
ATOM   4203  N  N    . ARG A 1 37 ? 10.292  8.259   12.400  1.00 0.00 ? 565 ARG A N    7  
ATOM   4204  C  CA   . ARG A 1 37 ? 10.988  8.884   13.519  1.00 0.00 ? 565 ARG A CA   7  
ATOM   4205  C  C    . ARG A 1 37 ? 11.656  7.834   14.400  1.00 0.00 ? 565 ARG A C    7  
ATOM   4206  O  O    . ARG A 1 37 ? 11.128  6.704   14.476  1.00 0.00 ? 565 ARG A O    7  
ATOM   4207  C  CB   . ARG A 1 37 ? 10.011  9.718   14.351  1.00 0.00 ? 565 ARG A CB   7  
ATOM   4208  C  CG   . ARG A 1 37 ? 10.694  10.689  15.301  1.00 0.00 ? 565 ARG A CG   7  
ATOM   4209  C  CD   . ARG A 1 37 ? 9.915   10.837  16.598  1.00 0.00 ? 565 ARG A CD   7  
ATOM   4210  N  NE   . ARG A 1 37 ? 10.599  11.707  17.553  1.00 0.00 ? 565 ARG A NE   7  
ATOM   4211  C  CZ   . ARG A 1 37 ? 10.024  12.207  18.644  1.00 0.00 ? 565 ARG A CZ   7  
ATOM   4212  N  NH1  . ARG A 1 37 ? 8.756   11.930  18.921  1.00 0.00 ? 565 ARG A NH1  7  
ATOM   4213  N  NH2  . ARG A 1 37 ? 10.718  12.987  19.461  1.00 0.00 ? 565 ARG A NH2  7  
ATOM   4214  O  OXT  . ARG A 1 37 ? 12.701  8.149   15.006  1.00 0.00 ? 565 ARG A OXT  7  
ATOM   4215  H  H    . ARG A 1 37 ? 9.681   7.513   12.573  1.00 0.00 ? 565 ARG A H    7  
ATOM   4216  H  HA   . ARG A 1 37 ? 11.748  9.535   13.115  1.00 0.00 ? 565 ARG A HA   7  
ATOM   4217  H  HB2  . ARG A 1 37 ? 9.381   10.286  13.682  1.00 0.00 ? 565 ARG A HB2  7  
ATOM   4218  H  HB3  . ARG A 1 37 ? 9.394   9.051   14.934  1.00 0.00 ? 565 ARG A HB3  7  
ATOM   4219  H  HG2  . ARG A 1 37 ? 11.684  10.321  15.527  1.00 0.00 ? 565 ARG A HG2  7  
ATOM   4220  H  HG3  . ARG A 1 37 ? 10.767  11.654  14.822  1.00 0.00 ? 565 ARG A HG3  7  
ATOM   4221  H  HD2  . ARG A 1 37 ? 8.946   11.257  16.375  1.00 0.00 ? 565 ARG A HD2  7  
ATOM   4222  H  HD3  . ARG A 1 37 ? 9.790   9.860   17.041  1.00 0.00 ? 565 ARG A HD3  7  
ATOM   4223  H  HE   . ARG A 1 37 ? 11.537  11.929  17.372  1.00 0.00 ? 565 ARG A HE   7  
ATOM   4224  H  HH11 . ARG A 1 37 ? 8.226   11.342  18.310  1.00 0.00 ? 565 ARG A HH11 7  
ATOM   4225  H  HH12 . ARG A 1 37 ? 8.329   12.309  19.743  1.00 0.00 ? 565 ARG A HH12 7  
ATOM   4226  H  HH21 . ARG A 1 37 ? 11.674  13.199  19.258  1.00 0.00 ? 565 ARG A HH21 7  
ATOM   4227  H  HH22 . ARG A 1 37 ? 10.286  13.363  20.281  1.00 0.00 ? 565 ARG A HH22 7  
HETATM 4228  ZN ZN   . ZN  B 2 .  ? 0.509   5.568   3.977   1.00 0.00 ? 100 ZN  A ZN   7  
ATOM   4229  N  N    . MET A 1 1  ? -9.943  -5.293  -21.349 1.00 0.00 ? 1   MET A N    8  
ATOM   4230  C  CA   . MET A 1 1  ? -9.471  -6.322  -20.385 1.00 0.00 ? 1   MET A CA   8  
ATOM   4231  C  C    . MET A 1 1  ? -10.313 -6.312  -19.113 1.00 0.00 ? 1   MET A C    8  
ATOM   4232  O  O    . MET A 1 1  ? -10.710 -5.253  -18.628 1.00 0.00 ? 1   MET A O    8  
ATOM   4233  C  CB   . MET A 1 1  ? -8.004  -6.039  -20.051 1.00 0.00 ? 1   MET A CB   8  
ATOM   4234  C  CG   . MET A 1 1  ? -7.140  -7.288  -20.002 1.00 0.00 ? 1   MET A CG   8  
ATOM   4235  S  SD   . MET A 1 1  ? -6.519  -7.768  -21.625 1.00 0.00 ? 1   MET A SD   8  
ATOM   4236  C  CE   . MET A 1 1  ? -5.633  -6.285  -22.100 1.00 0.00 ? 1   MET A CE   8  
ATOM   4237  H  H1   . MET A 1 1  ? -9.943  -4.376  -20.860 1.00 0.00 ? 1   MET A H1   8  
ATOM   4238  H  H2   . MET A 1 1  ? -10.903 -5.559  -21.651 1.00 0.00 ? 1   MET A H2   8  
ATOM   4239  H  H3   . MET A 1 1  ? -9.285  -5.287  -22.154 1.00 0.00 ? 1   MET A H3   8  
ATOM   4240  H  HA   . MET A 1 1  ? -9.549  -7.292  -20.852 1.00 0.00 ? 1   MET A HA   8  
ATOM   4241  H  HB2  . MET A 1 1  ? -7.598  -5.376  -20.800 1.00 0.00 ? 1   MET A HB2  8  
ATOM   4242  H  HB3  . MET A 1 1  ? -7.952  -5.554  -19.088 1.00 0.00 ? 1   MET A HB3  8  
ATOM   4243  H  HG2  . MET A 1 1  ? -6.298  -7.102  -19.352 1.00 0.00 ? 1   MET A HG2  8  
ATOM   4244  H  HG3  . MET A 1 1  ? -7.728  -8.101  -19.602 1.00 0.00 ? 1   MET A HG3  8  
ATOM   4245  H  HE1  . MET A 1 1  ? -5.200  -5.828  -21.223 1.00 0.00 ? 1   MET A HE1  8  
ATOM   4246  H  HE2  . MET A 1 1  ? -6.317  -5.591  -22.567 1.00 0.00 ? 1   MET A HE2  8  
ATOM   4247  H  HE3  . MET A 1 1  ? -4.849  -6.542  -22.797 1.00 0.00 ? 1   MET A HE3  8  
ATOM   4248  N  N    . ASP A 1 2  ? -10.583 -7.499  -18.579 1.00 0.00 ? 530 ASP A N    8  
ATOM   4249  C  CA   . ASP A 1 2  ? -11.380 -7.627  -17.365 1.00 0.00 ? 530 ASP A CA   8  
ATOM   4250  C  C    . ASP A 1 2  ? -11.063 -8.935  -16.640 1.00 0.00 ? 530 ASP A C    8  
ATOM   4251  O  O    . ASP A 1 2  ? -11.650 -9.975  -16.939 1.00 0.00 ? 530 ASP A O    8  
ATOM   4252  C  CB   . ASP A 1 2  ? -12.872 -7.562  -17.702 1.00 0.00 ? 530 ASP A CB   8  
ATOM   4253  C  CG   . ASP A 1 2  ? -13.579 -6.429  -16.983 1.00 0.00 ? 530 ASP A CG   8  
ATOM   4254  O  OD1  . ASP A 1 2  ? -13.298 -5.256  -17.305 1.00 0.00 ? 530 ASP A OD1  8  
ATOM   4255  O  OD2  . ASP A 1 2  ? -14.412 -6.716  -16.098 1.00 0.00 ? 530 ASP A OD2  8  
ATOM   4256  H  H    . ASP A 1 2  ? -10.239 -8.308  -19.013 1.00 0.00 ? 530 ASP A H    8  
ATOM   4257  H  HA   . ASP A 1 2  ? -11.131 -6.800  -16.717 1.00 0.00 ? 530 ASP A HA   8  
ATOM   4258  H  HB2  . ASP A 1 2  ? -12.988 -7.416  -18.765 1.00 0.00 ? 530 ASP A HB2  8  
ATOM   4259  H  HB3  . ASP A 1 2  ? -13.342 -8.493  -17.418 1.00 0.00 ? 530 ASP A HB3  8  
ATOM   4260  N  N    . PRO A 1 3  ? -10.129 -8.901  -15.672 1.00 0.00 ? 531 PRO A N    8  
ATOM   4261  C  CA   . PRO A 1 3  ? -9.743  -10.092 -14.908 1.00 0.00 ? 531 PRO A CA   8  
ATOM   4262  C  C    . PRO A 1 3  ? -10.863 -10.582 -13.997 1.00 0.00 ? 531 PRO A C    8  
ATOM   4263  O  O    . PRO A 1 3  ? -10.952 -11.770 -13.691 1.00 0.00 ? 531 PRO A O    8  
ATOM   4264  C  CB   . PRO A 1 3  ? -8.548  -9.615  -14.079 1.00 0.00 ? 531 PRO A CB   8  
ATOM   4265  C  CG   . PRO A 1 3  ? -8.727  -8.141  -13.966 1.00 0.00 ? 531 PRO A CG   8  
ATOM   4266  C  CD   . PRO A 1 3  ? -9.380  -7.704  -15.247 1.00 0.00 ? 531 PRO A CD   8  
ATOM   4267  H  HA   . PRO A 1 3  ? -9.435  -10.896 -15.560 1.00 0.00 ? 531 PRO A HA   8  
ATOM   4268  H  HB2  . PRO A 1 3  ? -8.567  -10.092 -13.109 1.00 0.00 ? 531 PRO A HB2  8  
ATOM   4269  H  HB3  . PRO A 1 3  ? -7.630  -9.863  -14.590 1.00 0.00 ? 531 PRO A HB3  8  
ATOM   4270  H  HG2  . PRO A 1 3  ? -9.363  -7.912  -13.123 1.00 0.00 ? 531 PRO A HG2  8  
ATOM   4271  H  HG3  . PRO A 1 3  ? -7.765  -7.662  -13.853 1.00 0.00 ? 531 PRO A HG3  8  
ATOM   4272  H  HD2  . PRO A 1 3  ? -10.047 -6.874  -15.066 1.00 0.00 ? 531 PRO A HD2  8  
ATOM   4273  H  HD3  . PRO A 1 3  ? -8.633  -7.437  -15.980 1.00 0.00 ? 531 PRO A HD3  8  
ATOM   4274  N  N    . GLY A 1 4  ? -11.717 -9.658  -13.568 1.00 0.00 ? 532 GLY A N    8  
ATOM   4275  C  CA   . GLY A 1 4  ? -12.821 -10.016 -12.697 1.00 0.00 ? 532 GLY A CA   8  
ATOM   4276  C  C    . GLY A 1 4  ? -12.503 -9.793  -11.232 1.00 0.00 ? 532 GLY A C    8  
ATOM   4277  O  O    . GLY A 1 4  ? -13.350 -9.325  -10.471 1.00 0.00 ? 532 GLY A O    8  
ATOM   4278  H  H    . GLY A 1 4  ? -11.597 -8.726  -13.846 1.00 0.00 ? 532 GLY A H    8  
ATOM   4279  H  HA2  . GLY A 1 4  ? -13.682 -9.420  -12.962 1.00 0.00 ? 532 GLY A HA2  8  
ATOM   4280  H  HA3  . GLY A 1 4  ? -13.059 -11.059 -12.847 1.00 0.00 ? 532 GLY A HA3  8  
ATOM   4281  N  N    . LYS A 1 5  ? -11.280 -10.129 -10.835 1.00 0.00 ? 533 LYS A N    8  
ATOM   4282  C  CA   . LYS A 1 5  ? -10.853 -9.964  -9.451  1.00 0.00 ? 533 LYS A CA   8  
ATOM   4283  C  C    . LYS A 1 5  ? -9.721  -8.946  -9.347  1.00 0.00 ? 533 LYS A C    8  
ATOM   4284  O  O    . LYS A 1 5  ? -8.936  -8.780  -10.280 1.00 0.00 ? 533 LYS A O    8  
ATOM   4285  C  CB   . LYS A 1 5  ? -10.402 -11.306 -8.871  1.00 0.00 ? 533 LYS A CB   8  
ATOM   4286  C  CG   . LYS A 1 5  ? -9.180  -11.888 -9.565  1.00 0.00 ? 533 LYS A CG   8  
ATOM   4287  C  CD   . LYS A 1 5  ? -8.227  -12.530 -8.570  1.00 0.00 ? 533 LYS A CD   8  
ATOM   4288  C  CE   . LYS A 1 5  ? -7.315  -13.541 -9.246  1.00 0.00 ? 533 LYS A CE   8  
ATOM   4289  N  NZ   . LYS A 1 5  ? -6.548  -14.348 -8.256  1.00 0.00 ? 533 LYS A NZ   8  
ATOM   4290  H  H    . LYS A 1 5  ? -10.650 -10.498 -11.489 1.00 0.00 ? 533 LYS A H    8  
ATOM   4291  H  HA   . LYS A 1 5  ? -11.698 -9.604  -8.884  1.00 0.00 ? 533 LYS A HA   8  
ATOM   4292  H  HB2  . LYS A 1 5  ? -10.167 -11.173 -7.825  1.00 0.00 ? 533 LYS A HB2  8  
ATOM   4293  H  HB3  . LYS A 1 5  ? -11.212 -12.015 -8.962  1.00 0.00 ? 533 LYS A HB3  8  
ATOM   4294  H  HG2  . LYS A 1 5  ? -9.502  -12.635 -10.273 1.00 0.00 ? 533 LYS A HG2  8  
ATOM   4295  H  HG3  . LYS A 1 5  ? -8.663  -11.095 -10.085 1.00 0.00 ? 533 LYS A HG3  8  
ATOM   4296  H  HD2  . LYS A 1 5  ? -7.620  -11.760 -8.118  1.00 0.00 ? 533 LYS A HD2  8  
ATOM   4297  H  HD3  . LYS A 1 5  ? -8.803  -13.032 -7.807  1.00 0.00 ? 533 LYS A HD3  8  
ATOM   4298  H  HE2  . LYS A 1 5  ? -7.917  -14.205 -9.848  1.00 0.00 ? 533 LYS A HE2  8  
ATOM   4299  H  HE3  . LYS A 1 5  ? -6.620  -13.012 -9.882  1.00 0.00 ? 533 LYS A HE3  8  
ATOM   4300  H  HZ1  . LYS A 1 5  ? -5.594  -14.547 -8.620  1.00 0.00 ? 533 LYS A HZ1  8  
ATOM   4301  H  HZ2  . LYS A 1 5  ? -7.034  -15.250 -8.077  1.00 0.00 ? 533 LYS A HZ2  8  
ATOM   4302  H  HZ3  . LYS A 1 5  ? -6.465  -13.828 -7.359  1.00 0.00 ? 533 LYS A HZ3  8  
ATOM   4303  N  N    . LYS A 1 6  ? -9.645  -8.269  -8.206  1.00 0.00 ? 534 LYS A N    8  
ATOM   4304  C  CA   . LYS A 1 6  ? -8.609  -7.268  -7.980  1.00 0.00 ? 534 LYS A CA   8  
ATOM   4305  C  C    . LYS A 1 6  ? -8.421  -7.007  -6.489  1.00 0.00 ? 534 LYS A C    8  
ATOM   4306  O  O    . LYS A 1 6  ? -9.330  -6.522  -5.814  1.00 0.00 ? 534 LYS A O    8  
ATOM   4307  C  CB   . LYS A 1 6  ? -8.964  -5.964  -8.700  1.00 0.00 ? 534 LYS A CB   8  
ATOM   4308  C  CG   . LYS A 1 6  ? -7.802  -5.358  -9.469  1.00 0.00 ? 534 LYS A CG   8  
ATOM   4309  C  CD   . LYS A 1 6  ? -8.253  -4.194  -10.336 1.00 0.00 ? 534 LYS A CD   8  
ATOM   4310  C  CE   . LYS A 1 6  ? -7.941  -2.857  -9.682  1.00 0.00 ? 534 LYS A CE   8  
ATOM   4311  N  NZ   . LYS A 1 6  ? -9.029  -1.864  -9.899  1.00 0.00 ? 534 LYS A NZ   8  
ATOM   4312  H  H    . LYS A 1 6  ? -10.300 -8.447  -7.500  1.00 0.00 ? 534 LYS A H    8  
ATOM   4313  H  HA   . LYS A 1 6  ? -7.684  -7.651  -8.385  1.00 0.00 ? 534 LYS A HA   8  
ATOM   4314  H  HB2  . LYS A 1 6  ? -9.766  -6.159  -9.397  1.00 0.00 ? 534 LYS A HB2  8  
ATOM   4315  H  HB3  . LYS A 1 6  ? -9.301  -5.242  -7.970  1.00 0.00 ? 534 LYS A HB3  8  
ATOM   4316  H  HG2  . LYS A 1 6  ? -7.063  -5.004  -8.766  1.00 0.00 ? 534 LYS A HG2  8  
ATOM   4317  H  HG3  . LYS A 1 6  ? -7.366  -6.118  -10.101 1.00 0.00 ? 534 LYS A HG3  8  
ATOM   4318  H  HD2  . LYS A 1 6  ? -7.743  -4.246  -11.286 1.00 0.00 ? 534 LYS A HD2  8  
ATOM   4319  H  HD3  . LYS A 1 6  ? -9.320  -4.267  -10.493 1.00 0.00 ? 534 LYS A HD3  8  
ATOM   4320  H  HE2  . LYS A 1 6  ? -7.812  -3.011  -8.621  1.00 0.00 ? 534 LYS A HE2  8  
ATOM   4321  H  HE3  . LYS A 1 6  ? -7.023  -2.471  -10.103 1.00 0.00 ? 534 LYS A HE3  8  
ATOM   4322  H  HZ1  . LYS A 1 6  ? -9.151  -1.684  -10.916 1.00 0.00 ? 534 LYS A HZ1  8  
ATOM   4323  H  HZ2  . LYS A 1 6  ? -8.795  -0.968  -9.425  1.00 0.00 ? 534 LYS A HZ2  8  
ATOM   4324  H  HZ3  . LYS A 1 6  ? -9.924  -2.225  -9.511  1.00 0.00 ? 534 LYS A HZ3  8  
ATOM   4325  N  N    . LYS A 1 7  ? -7.237  -7.331  -5.980  1.00 0.00 ? 535 LYS A N    8  
ATOM   4326  C  CA   . LYS A 1 7  ? -6.931  -7.132  -4.569  1.00 0.00 ? 535 LYS A CA   8  
ATOM   4327  C  C    . LYS A 1 7  ? -6.379  -5.732  -4.324  1.00 0.00 ? 535 LYS A C    8  
ATOM   4328  O  O    . LYS A 1 7  ? -5.726  -5.150  -5.191  1.00 0.00 ? 535 LYS A O    8  
ATOM   4329  C  CB   . LYS A 1 7  ? -5.924  -8.180  -4.090  1.00 0.00 ? 535 LYS A CB   8  
ATOM   4330  C  CG   . LYS A 1 7  ? -6.571  -9.451  -3.566  1.00 0.00 ? 535 LYS A CG   8  
ATOM   4331  C  CD   . LYS A 1 7  ? -5.528  -10.472 -3.141  1.00 0.00 ? 535 LYS A CD   8  
ATOM   4332  C  CE   . LYS A 1 7  ? -5.958  -11.220 -1.890  1.00 0.00 ? 535 LYS A CE   8  
ATOM   4333  N  NZ   . LYS A 1 7  ? -5.543  -10.510 -0.648  1.00 0.00 ? 535 LYS A NZ   8  
ATOM   4334  H  H    . LYS A 1 7  ? -6.553  -7.714  -6.569  1.00 0.00 ? 535 LYS A H    8  
ATOM   4335  H  HA   . LYS A 1 7  ? -7.848  -7.247  -4.011  1.00 0.00 ? 535 LYS A HA   8  
ATOM   4336  H  HB2  . LYS A 1 7  ? -5.278  -8.444  -4.914  1.00 0.00 ? 535 LYS A HB2  8  
ATOM   4337  H  HB3  . LYS A 1 7  ? -5.327  -7.752  -3.298  1.00 0.00 ? 535 LYS A HB3  8  
ATOM   4338  H  HG2  . LYS A 1 7  ? -7.187  -9.205  -2.713  1.00 0.00 ? 535 LYS A HG2  8  
ATOM   4339  H  HG3  . LYS A 1 7  ? -7.186  -9.878  -4.345  1.00 0.00 ? 535 LYS A HG3  8  
ATOM   4340  H  HD2  . LYS A 1 7  ? -5.388  -11.183 -3.942  1.00 0.00 ? 535 LYS A HD2  8  
ATOM   4341  H  HD3  . LYS A 1 7  ? -4.598  -9.961  -2.944  1.00 0.00 ? 535 LYS A HD3  8  
ATOM   4342  H  HE2  . LYS A 1 7  ? -7.033  -11.317 -1.895  1.00 0.00 ? 535 LYS A HE2  8  
ATOM   4343  H  HE3  . LYS A 1 7  ? -5.509  -12.202 -1.900  1.00 0.00 ? 535 LYS A HE3  8  
ATOM   4344  H  HZ1  . LYS A 1 7  ? -4.507  -10.537 -0.550  1.00 0.00 ? 535 LYS A HZ1  8  
ATOM   4345  H  HZ2  . LYS A 1 7  ? -5.970  -10.963 0.184   1.00 0.00 ? 535 LYS A HZ2  8  
ATOM   4346  H  HZ3  . LYS A 1 7  ? -5.851  -9.517  -0.684  1.00 0.00 ? 535 LYS A HZ3  8  
ATOM   4347  N  N    . GLN A 1 8  ? -6.644  -5.196  -3.137  1.00 0.00 ? 536 GLN A N    8  
ATOM   4348  C  CA   . GLN A 1 8  ? -6.173  -3.864  -2.777  1.00 0.00 ? 536 GLN A CA   8  
ATOM   4349  C  C    . GLN A 1 8  ? -5.593  -3.856  -1.367  1.00 0.00 ? 536 GLN A C    8  
ATOM   4350  O  O    . GLN A 1 8  ? -6.085  -4.554  -0.480  1.00 0.00 ? 536 GLN A O    8  
ATOM   4351  C  CB   . GLN A 1 8  ? -7.315  -2.851  -2.879  1.00 0.00 ? 536 GLN A CB   8  
ATOM   4352  C  CG   . GLN A 1 8  ? -7.592  -2.388  -4.300  1.00 0.00 ? 536 GLN A CG   8  
ATOM   4353  C  CD   . GLN A 1 8  ? -8.813  -1.494  -4.394  1.00 0.00 ? 536 GLN A CD   8  
ATOM   4354  O  OE1  . GLN A 1 8  ? -9.053  -0.658  -3.523  1.00 0.00 ? 536 GLN A OE1  8  
ATOM   4355  N  NE2  . GLN A 1 8  ? -9.593  -1.667  -5.455  1.00 0.00 ? 536 GLN A NE2  8  
ATOM   4356  H  H    . GLN A 1 8  ? -7.169  -5.709  -2.488  1.00 0.00 ? 536 GLN A H    8  
ATOM   4357  H  HA   . GLN A 1 8  ? -5.396  -3.588  -3.474  1.00 0.00 ? 536 GLN A HA   8  
ATOM   4358  H  HB2  . GLN A 1 8  ? -8.215  -3.300  -2.487  1.00 0.00 ? 536 GLN A HB2  8  
ATOM   4359  H  HB3  . GLN A 1 8  ? -7.066  -1.985  -2.283  1.00 0.00 ? 536 GLN A HB3  8  
ATOM   4360  H  HG2  . GLN A 1 8  ? -6.735  -1.839  -4.660  1.00 0.00 ? 536 GLN A HG2  8  
ATOM   4361  H  HG3  . GLN A 1 8  ? -7.751  -3.256  -4.923  1.00 0.00 ? 536 GLN A HG3  8  
ATOM   4362  H  HE21 . GLN A 1 8  ? -9.340  -2.352  -6.109  1.00 0.00 ? 536 GLN A HE21 8  
ATOM   4363  H  HE22 . GLN A 1 8  ? -10.389 -1.102  -5.541  1.00 0.00 ? 536 GLN A HE22 8  
ATOM   4364  N  N    . HIS A 1 9  ? -4.545  -3.065  -1.167  1.00 0.00 ? 537 HIS A N    8  
ATOM   4365  C  CA   . HIS A 1 9  ? -3.898  -2.968  0.137   1.00 0.00 ? 537 HIS A CA   8  
ATOM   4366  C  C    . HIS A 1 9  ? -4.058  -1.569  0.722   1.00 0.00 ? 537 HIS A C    8  
ATOM   4367  O  O    . HIS A 1 9  ? -3.643  -0.581  0.116   1.00 0.00 ? 537 HIS A O    8  
ATOM   4368  C  CB   . HIS A 1 9  ? -2.413  -3.319  0.020   1.00 0.00 ? 537 HIS A CB   8  
ATOM   4369  C  CG   . HIS A 1 9  ? -2.152  -4.549  -0.793  1.00 0.00 ? 537 HIS A CG   8  
ATOM   4370  N  ND1  . HIS A 1 9  ? -3.050  -5.584  -0.930  1.00 0.00 ? 537 HIS A ND1  8  
ATOM   4371  C  CD2  . HIS A 1 9  ? -1.062  -4.900  -1.524  1.00 0.00 ? 537 HIS A CD2  8  
ATOM   4372  C  CE1  . HIS A 1 9  ? -2.492  -6.511  -1.721  1.00 0.00 ? 537 HIS A CE1  8  
ATOM   4373  N  NE2  . HIS A 1 9  ? -1.286  -6.143  -2.109  1.00 0.00 ? 537 HIS A NE2  8  
ATOM   4374  H  H    . HIS A 1 9  ? -4.198  -2.533  -1.913  1.00 0.00 ? 537 HIS A H    8  
ATOM   4375  H  HA   . HIS A 1 9  ? -4.375  -3.677  0.797   1.00 0.00 ? 537 HIS A HA   8  
ATOM   4376  H  HB2  . HIS A 1 9  ? -1.892  -2.496  -0.446  1.00 0.00 ? 537 HIS A HB2  8  
ATOM   4377  H  HB3  . HIS A 1 9  ? -2.009  -3.481  1.009   1.00 0.00 ? 537 HIS A HB3  8  
ATOM   4378  H  HD1  . HIS A 1 9  ? -3.939  -5.633  -0.522  1.00 0.00 ? 537 HIS A HD1  8  
ATOM   4379  H  HD2  . HIS A 1 9  ? -0.161  -4.315  -1.641  1.00 0.00 ? 537 HIS A HD2  8  
ATOM   4380  H  HE1  . HIS A 1 9  ? -2.968  -7.437  -2.004  1.00 0.00 ? 537 HIS A HE1  8  
ATOM   4381  N  N    . ILE A 1 10 ? -4.661  -1.493  1.903   1.00 0.00 ? 538 ILE A N    8  
ATOM   4382  C  CA   . ILE A 1 10 ? -4.877  -0.215  2.571   1.00 0.00 ? 538 ILE A CA   8  
ATOM   4383  C  C    . ILE A 1 10 ? -3.973  -0.074  3.791   1.00 0.00 ? 538 ILE A C    8  
ATOM   4384  O  O    . ILE A 1 10 ? -3.694  -1.051  4.485   1.00 0.00 ? 538 ILE A O    8  
ATOM   4385  C  CB   . ILE A 1 10 ? -6.345  -0.049  3.010   1.00 0.00 ? 538 ILE A CB   8  
ATOM   4386  C  CG1  . ILE A 1 10 ? -7.289  -0.340  1.841   1.00 0.00 ? 538 ILE A CG1  8  
ATOM   4387  C  CG2  . ILE A 1 10 ? -6.581  1.353   3.553   1.00 0.00 ? 538 ILE A CG2  8  
ATOM   4388  C  CD1  . ILE A 1 10 ? -8.490  -1.175  2.227   1.00 0.00 ? 538 ILE A CD1  8  
ATOM   4389  H  H    . ILE A 1 10 ? -4.969  -2.316  2.337   1.00 0.00 ? 538 ILE A H    8  
ATOM   4390  H  HA   . ILE A 1 10 ? -4.642  0.572   1.868   1.00 0.00 ? 538 ILE A HA   8  
ATOM   4391  H  HB   . ILE A 1 10 ? -6.540  -0.753  3.805   1.00 0.00 ? 538 ILE A HB   8  
ATOM   4392  H  HG12 . ILE A 1 10 ? -7.652  0.594   1.438   1.00 0.00 ? 538 ILE A HG12 8  
ATOM   4393  H  HG13 . ILE A 1 10 ? -6.748  -0.871  1.072   1.00 0.00 ? 538 ILE A HG13 8  
ATOM   4394  H  HG21 . ILE A 1 10 ? -7.578  1.677   3.291   1.00 0.00 ? 538 ILE A HG21 8  
ATOM   4395  H  HG22 . ILE A 1 10 ? -5.858  2.031   3.125   1.00 0.00 ? 538 ILE A HG22 8  
ATOM   4396  H  HG23 . ILE A 1 10 ? -6.476  1.345   4.628   1.00 0.00 ? 538 ILE A HG23 8  
ATOM   4397  H  HD11 . ILE A 1 10 ? -9.163  -1.249  1.386   1.00 0.00 ? 538 ILE A HD11 8  
ATOM   4398  H  HD12 . ILE A 1 10 ? -9.001  -0.708  3.057   1.00 0.00 ? 538 ILE A HD12 8  
ATOM   4399  H  HD13 . ILE A 1 10 ? -8.163  -2.163  2.516   1.00 0.00 ? 538 ILE A HD13 8  
ATOM   4400  N  N    . CYS A 1 11 ? -3.519  1.148   4.047   1.00 0.00 ? 539 CYS A N    8  
ATOM   4401  C  CA   . CYS A 1 11 ? -2.647  1.418   5.183   1.00 0.00 ? 539 CYS A CA   8  
ATOM   4402  C  C    . CYS A 1 11 ? -3.402  1.259   6.498   1.00 0.00 ? 539 CYS A C    8  
ATOM   4403  O  O    . CYS A 1 11 ? -4.091  2.177   6.945   1.00 0.00 ? 539 CYS A O    8  
ATOM   4404  C  CB   . CYS A 1 11 ? -2.066  2.830   5.080   1.00 0.00 ? 539 CYS A CB   8  
ATOM   4405  S  SG   . CYS A 1 11 ? -0.364  2.887   4.475   1.00 0.00 ? 539 CYS A SG   8  
ATOM   4406  H  H    . CYS A 1 11 ? -3.776  1.887   3.457   1.00 0.00 ? 539 CYS A H    8  
ATOM   4407  H  HA   . CYS A 1 11 ? -1.838  0.704   5.157   1.00 0.00 ? 539 CYS A HA   8  
ATOM   4408  H  HB2  . CYS A 1 11 ? -2.673  3.412   4.402   1.00 0.00 ? 539 CYS A HB2  8  
ATOM   4409  H  HB3  . CYS A 1 11 ? -2.084  3.294   6.057   1.00 0.00 ? 539 CYS A HB3  8  
ATOM   4410  N  N    . HIS A 1 12 ? -3.267  0.090   7.116   1.00 0.00 ? 540 HIS A N    8  
ATOM   4411  C  CA   . HIS A 1 12 ? -3.936  -0.187  8.381   1.00 0.00 ? 540 HIS A CA   8  
ATOM   4412  C  C    . HIS A 1 12 ? -3.504  0.808   9.455   1.00 0.00 ? 540 HIS A C    8  
ATOM   4413  O  O    . HIS A 1 12 ? -4.249  1.082   10.396  1.00 0.00 ? 540 HIS A O    8  
ATOM   4414  C  CB   . HIS A 1 12 ? -3.635  -1.616  8.838   1.00 0.00 ? 540 HIS A CB   8  
ATOM   4415  C  CG   . HIS A 1 12 ? -4.769  -2.567  8.611   1.00 0.00 ? 540 HIS A CG   8  
ATOM   4416  N  ND1  . HIS A 1 12 ? -4.626  -3.808  8.030   1.00 0.00 ? 540 HIS A ND1  8  
ATOM   4417  C  CD2  . HIS A 1 12 ? -6.089  -2.439  8.901   1.00 0.00 ? 540 HIS A CD2  8  
ATOM   4418  C  CE1  . HIS A 1 12 ? -5.836  -4.382  7.985   1.00 0.00 ? 540 HIS A CE1  8  
ATOM   4419  N  NE2  . HIS A 1 12 ? -6.758  -3.593  8.502   1.00 0.00 ? 540 HIS A NE2  8  
ATOM   4420  H  H    . HIS A 1 12 ? -2.703  -0.602  6.711   1.00 0.00 ? 540 HIS A H    8  
ATOM   4421  H  HA   . HIS A 1 12 ? -4.999  -0.086  8.222   1.00 0.00 ? 540 HIS A HA   8  
ATOM   4422  H  HB2  . HIS A 1 12 ? -2.778  -1.987  8.297   1.00 0.00 ? 540 HIS A HB2  8  
ATOM   4423  H  HB3  . HIS A 1 12 ? -3.412  -1.611  9.896   1.00 0.00 ? 540 HIS A HB3  8  
ATOM   4424  H  HD1  . HIS A 1 12 ? -3.789  -4.201  7.707   1.00 0.00 ? 540 HIS A HD1  8  
ATOM   4425  H  HD2  . HIS A 1 12 ? -6.556  -1.584  9.367   1.00 0.00 ? 540 HIS A HD2  8  
ATOM   4426  H  HE1  . HIS A 1 12 ? -6.031  -5.364  7.580   1.00 0.00 ? 540 HIS A HE1  8  
ATOM   4427  N  N    . ILE A 1 13 ? -2.297  1.346   9.308   1.00 0.00 ? 541 ILE A N    8  
ATOM   4428  C  CA   . ILE A 1 13 ? -1.770  2.310   10.266  1.00 0.00 ? 541 ILE A CA   8  
ATOM   4429  C  C    . ILE A 1 13 ? -2.647  3.556   10.331  1.00 0.00 ? 541 ILE A C    8  
ATOM   4430  O  O    . ILE A 1 13 ? -3.302  3.918   9.354   1.00 0.00 ? 541 ILE A O    8  
ATOM   4431  C  CB   . ILE A 1 13 ? -0.329  2.728   9.912   1.00 0.00 ? 541 ILE A CB   8  
ATOM   4432  C  CG1  . ILE A 1 13 ? 0.554   1.494   9.729   1.00 0.00 ? 541 ILE A CG1  8  
ATOM   4433  C  CG2  . ILE A 1 13 ? 0.243   3.637   10.991  1.00 0.00 ? 541 ILE A CG2  8  
ATOM   4434  C  CD1  . ILE A 1 13 ? 0.594   0.593   10.944  1.00 0.00 ? 541 ILE A CD1  8  
ATOM   4435  H  H    . ILE A 1 13 ? -1.749  1.090   8.538   1.00 0.00 ? 541 ILE A H    8  
ATOM   4436  H  HA   . ILE A 1 13 ? -1.757  1.840   11.239  1.00 0.00 ? 541 ILE A HA   8  
ATOM   4437  H  HB   . ILE A 1 13 ? -0.356  3.283   8.987   1.00 0.00 ? 541 ILE A HB   8  
ATOM   4438  H  HG12 . ILE A 1 13 ? 0.183   0.913   8.899   1.00 0.00 ? 541 ILE A HG12 8  
ATOM   4439  H  HG13 . ILE A 1 13 ? 1.565   1.811   9.518   1.00 0.00 ? 541 ILE A HG13 8  
ATOM   4440  H  HG21 . ILE A 1 13 ? 1.257   3.906   10.735  1.00 0.00 ? 541 ILE A HG21 8  
ATOM   4441  H  HG22 . ILE A 1 13 ? 0.235   3.119   11.939  1.00 0.00 ? 541 ILE A HG22 8  
ATOM   4442  H  HG23 . ILE A 1 13 ? -0.359  4.531   11.065  1.00 0.00 ? 541 ILE A HG23 8  
ATOM   4443  H  HD11 . ILE A 1 13 ? 0.006   1.031   11.737  1.00 0.00 ? 541 ILE A HD11 8  
ATOM   4444  H  HD12 . ILE A 1 13 ? 1.616   0.480   11.275  1.00 0.00 ? 541 ILE A HD12 8  
ATOM   4445  H  HD13 . ILE A 1 13 ? 0.190   -0.375  10.688  1.00 0.00 ? 541 ILE A HD13 8  
ATOM   4446  N  N    . GLN A 1 14 ? -2.653  4.206   11.489  1.00 0.00 ? 542 GLN A N    8  
ATOM   4447  C  CA   . GLN A 1 14 ? -3.446  5.409   11.687  1.00 0.00 ? 542 GLN A CA   8  
ATOM   4448  C  C    . GLN A 1 14 ? -2.773  6.618   11.046  1.00 0.00 ? 542 GLN A C    8  
ATOM   4449  O  O    . GLN A 1 14 ? -1.792  7.144   11.570  1.00 0.00 ? 542 GLN A O    8  
ATOM   4450  C  CB   . GLN A 1 14 ? -3.662  5.664   13.180  1.00 0.00 ? 542 GLN A CB   8  
ATOM   4451  C  CG   . GLN A 1 14 ? -4.755  4.805   13.793  1.00 0.00 ? 542 GLN A CG   8  
ATOM   4452  C  CD   . GLN A 1 14 ? -4.682  4.762   15.307  1.00 0.00 ? 542 GLN A CD   8  
ATOM   4453  O  OE1  . GLN A 1 14 ? -3.717  5.235   15.907  1.00 0.00 ? 542 GLN A OE1  8  
ATOM   4454  N  NE2  . GLN A 1 14 ? -5.705  4.192   15.933  1.00 0.00 ? 542 GLN A NE2  8  
ATOM   4455  H  H    . GLN A 1 14 ? -2.112  3.867   12.227  1.00 0.00 ? 542 GLN A H    8  
ATOM   4456  H  HA   . GLN A 1 14 ? -4.401  5.251   11.217  1.00 0.00 ? 542 GLN A HA   8  
ATOM   4457  H  HB2  . GLN A 1 14 ? -2.739  5.462   13.704  1.00 0.00 ? 542 GLN A HB2  8  
ATOM   4458  H  HB3  . GLN A 1 14 ? -3.927  6.701   13.321  1.00 0.00 ? 542 GLN A HB3  8  
ATOM   4459  H  HG2  . GLN A 1 14 ? -5.715  5.207   13.506  1.00 0.00 ? 542 GLN A HG2  8  
ATOM   4460  H  HG3  . GLN A 1 14 ? -4.660  3.798   13.413  1.00 0.00 ? 542 GLN A HG3  8  
ATOM   4461  H  HE21 . GLN A 1 14 ? -6.440  3.836   15.390  1.00 0.00 ? 542 GLN A HE21 8  
ATOM   4462  H  HE22 . GLN A 1 14 ? -5.684  4.151   16.912  1.00 0.00 ? 542 GLN A HE22 8  
ATOM   4463  N  N    . GLY A 1 15 ? -3.307  7.056   9.910   1.00 0.00 ? 543 GLY A N    8  
ATOM   4464  C  CA   . GLY A 1 15 ? -2.742  8.202   9.221   1.00 0.00 ? 543 GLY A CA   8  
ATOM   4465  C  C    . GLY A 1 15 ? -2.978  8.158   7.724   1.00 0.00 ? 543 GLY A C    8  
ATOM   4466  O  O    . GLY A 1 15 ? -3.665  9.019   7.173   1.00 0.00 ? 543 GLY A O    8  
ATOM   4467  H  H    . GLY A 1 15 ? -4.090  6.599   9.538   1.00 0.00 ? 543 GLY A H    8  
ATOM   4468  H  HA2  . GLY A 1 15 ? -3.188  9.102   9.618   1.00 0.00 ? 543 GLY A HA2  8  
ATOM   4469  H  HA3  . GLY A 1 15 ? -1.679  8.229   9.406   1.00 0.00 ? 543 GLY A HA3  8  
ATOM   4470  N  N    . CYS A 1 16 ? -2.406  7.157   7.064   1.00 0.00 ? 544 CYS A N    8  
ATOM   4471  C  CA   . CYS A 1 16 ? -2.555  7.008   5.622   1.00 0.00 ? 544 CYS A CA   8  
ATOM   4472  C  C    . CYS A 1 16 ? -3.869  6.314   5.278   1.00 0.00 ? 544 CYS A C    8  
ATOM   4473  O  O    . CYS A 1 16 ? -4.609  5.888   6.165   1.00 0.00 ? 544 CYS A O    8  
ATOM   4474  C  CB   . CYS A 1 16 ? -1.381  6.211   5.054   1.00 0.00 ? 544 CYS A CB   8  
ATOM   4475  S  SG   . CYS A 1 16 ? -0.860  6.728   3.402   1.00 0.00 ? 544 CYS A SG   8  
ATOM   4476  H  H    . CYS A 1 16 ? -1.868  6.502   7.558   1.00 0.00 ? 544 CYS A H    8  
ATOM   4477  H  HA   . CYS A 1 16 ? -2.556  7.994   5.184   1.00 0.00 ? 544 CYS A HA   8  
ATOM   4478  H  HB2  . CYS A 1 16 ? -0.533  6.317   5.712   1.00 0.00 ? 544 CYS A HB2  8  
ATOM   4479  H  HB3  . CYS A 1 16 ? -1.658  5.171   4.999   1.00 0.00 ? 544 CYS A HB3  8  
ATOM   4480  N  N    . GLY A 1 17 ? -4.153  6.205   3.985   1.00 0.00 ? 545 GLY A N    8  
ATOM   4481  C  CA   . GLY A 1 17 ? -5.377  5.562   3.544   1.00 0.00 ? 545 GLY A CA   8  
ATOM   4482  C  C    . GLY A 1 17 ? -5.437  5.404   2.038   1.00 0.00 ? 545 GLY A C    8  
ATOM   4483  O  O    . GLY A 1 17 ? -6.506  5.514   1.438   1.00 0.00 ? 545 GLY A O    8  
ATOM   4484  H  H    . GLY A 1 17 ? -3.526  6.563   3.323   1.00 0.00 ? 545 GLY A H    8  
ATOM   4485  H  HA2  . GLY A 1 17 ? -5.442  4.585   4.000   1.00 0.00 ? 545 GLY A HA2  8  
ATOM   4486  H  HA3  . GLY A 1 17 ? -6.219  6.155   3.868   1.00 0.00 ? 545 GLY A HA3  8  
ATOM   4487  N  N    . LYS A 1 18 ? -4.286  5.147   1.427   1.00 0.00 ? 546 LYS A N    8  
ATOM   4488  C  CA   . LYS A 1 18 ? -4.209  4.975   -0.019  1.00 0.00 ? 546 LYS A CA   8  
ATOM   4489  C  C    . LYS A 1 18 ? -4.477  3.525   -0.409  1.00 0.00 ? 546 LYS A C    8  
ATOM   4490  O  O    . LYS A 1 18 ? -4.869  2.710   0.426   1.00 0.00 ? 546 LYS A O    8  
ATOM   4491  C  CB   . LYS A 1 18 ? -2.835  5.411   -0.533  1.00 0.00 ? 546 LYS A CB   8  
ATOM   4492  C  CG   . LYS A 1 18 ? -1.694  4.531   -0.046  1.00 0.00 ? 546 LYS A CG   8  
ATOM   4493  C  CD   . LYS A 1 18 ? -0.438  5.345   0.225   1.00 0.00 ? 546 LYS A CD   8  
ATOM   4494  C  CE   . LYS A 1 18 ? 0.567   5.216   -0.908  1.00 0.00 ? 546 LYS A CE   8  
ATOM   4495  N  NZ   . LYS A 1 18 ? 1.134   6.536   -1.301  1.00 0.00 ? 546 LYS A NZ   8  
ATOM   4496  H  H    . LYS A 1 18 ? -3.467  5.072   1.961   1.00 0.00 ? 546 LYS A H    8  
ATOM   4497  H  HA   . LYS A 1 18 ? -4.966  5.601   -0.468  1.00 0.00 ? 546 LYS A HA   8  
ATOM   4498  H  HB2  . LYS A 1 18 ? -2.843  5.389   -1.612  1.00 0.00 ? 546 LYS A HB2  8  
ATOM   4499  H  HB3  . LYS A 1 18 ? -2.646  6.423   -0.204  1.00 0.00 ? 546 LYS A HB3  8  
ATOM   4500  H  HG2  . LYS A 1 18 ? -1.996  4.039   0.866   1.00 0.00 ? 546 LYS A HG2  8  
ATOM   4501  H  HG3  . LYS A 1 18 ? -1.477  3.790   -0.802  1.00 0.00 ? 546 LYS A HG3  8  
ATOM   4502  H  HD2  . LYS A 1 18 ? -0.710  6.384   0.334   1.00 0.00 ? 546 LYS A HD2  8  
ATOM   4503  H  HD3  . LYS A 1 18 ? 0.016   4.992   1.139   1.00 0.00 ? 546 LYS A HD3  8  
ATOM   4504  H  HE2  . LYS A 1 18 ? 1.372   4.571   -0.588  1.00 0.00 ? 546 LYS A HE2  8  
ATOM   4505  H  HE3  . LYS A 1 18 ? 0.074   4.777   -1.763  1.00 0.00 ? 546 LYS A HE3  8  
ATOM   4506  H  HZ1  . LYS A 1 18 ? 0.382   7.150   -1.674  1.00 0.00 ? 546 LYS A HZ1  8  
ATOM   4507  H  HZ2  . LYS A 1 18 ? 1.859   6.410   -2.035  1.00 0.00 ? 546 LYS A HZ2  8  
ATOM   4508  H  HZ3  . LYS A 1 18 ? 1.567   6.998   -0.476  1.00 0.00 ? 546 LYS A HZ3  8  
ATOM   4509  N  N    . VAL A 1 19 ? -4.264  3.209   -1.682  1.00 0.00 ? 547 VAL A N    8  
ATOM   4510  C  CA   . VAL A 1 19 ? -4.484  1.857   -2.181  1.00 0.00 ? 547 VAL A CA   8  
ATOM   4511  C  C    . VAL A 1 19 ? -3.227  1.303   -2.842  1.00 0.00 ? 547 VAL A C    8  
ATOM   4512  O  O    . VAL A 1 19 ? -2.346  2.057   -3.254  1.00 0.00 ? 547 VAL A O    8  
ATOM   4513  C  CB   . VAL A 1 19 ? -5.644  1.813   -3.194  1.00 0.00 ? 547 VAL A CB   8  
ATOM   4514  C  CG1  . VAL A 1 19 ? -5.991  0.374   -3.547  1.00 0.00 ? 547 VAL A CG1  8  
ATOM   4515  C  CG2  . VAL A 1 19 ? -6.862  2.546   -2.646  1.00 0.00 ? 547 VAL A CG2  8  
ATOM   4516  H  H    . VAL A 1 19 ? -3.953  3.902   -2.301  1.00 0.00 ? 547 VAL A H    8  
ATOM   4517  H  HA   . VAL A 1 19 ? -4.743  1.229   -1.341  1.00 0.00 ? 547 VAL A HA   8  
ATOM   4518  H  HB   . VAL A 1 19 ? -5.326  2.314   -4.096  1.00 0.00 ? 547 VAL A HB   8  
ATOM   4519  H  HG11 . VAL A 1 19 ? -6.133  -0.195  -2.640  1.00 0.00 ? 547 VAL A HG11 8  
ATOM   4520  H  HG12 . VAL A 1 19 ? -5.186  -0.059  -4.122  1.00 0.00 ? 547 VAL A HG12 8  
ATOM   4521  H  HG13 . VAL A 1 19 ? -6.900  0.355   -4.130  1.00 0.00 ? 547 VAL A HG13 8  
ATOM   4522  H  HG21 . VAL A 1 19 ? -7.696  1.862   -2.581  1.00 0.00 ? 547 VAL A HG21 8  
ATOM   4523  H  HG22 . VAL A 1 19 ? -7.117  3.362   -3.306  1.00 0.00 ? 547 VAL A HG22 8  
ATOM   4524  H  HG23 . VAL A 1 19 ? -6.638  2.935   -1.664  1.00 0.00 ? 547 VAL A HG23 8  
ATOM   4525  N  N    . TYR A 1 20 ? -3.151  -0.020  -2.941  1.00 0.00 ? 548 TYR A N    8  
ATOM   4526  C  CA   . TYR A 1 20 ? -2.002  -0.678  -3.553  1.00 0.00 ? 548 TYR A CA   8  
ATOM   4527  C  C    . TYR A 1 20 ? -2.409  -2.011  -4.174  1.00 0.00 ? 548 TYR A C    8  
ATOM   4528  O  O    . TYR A 1 20 ? -3.394  -2.623  -3.763  1.00 0.00 ? 548 TYR A O    8  
ATOM   4529  C  CB   . TYR A 1 20 ? -0.902  -0.900  -2.513  1.00 0.00 ? 548 TYR A CB   8  
ATOM   4530  C  CG   . TYR A 1 20 ? 0.165   0.172   -2.521  1.00 0.00 ? 548 TYR A CG   8  
ATOM   4531  C  CD1  . TYR A 1 20 ? 0.966   0.374   -3.638  1.00 0.00 ? 548 TYR A CD1  8  
ATOM   4532  C  CD2  . TYR A 1 20 ? 0.371   0.982   -1.411  1.00 0.00 ? 548 TYR A CD2  8  
ATOM   4533  C  CE1  . TYR A 1 20 ? 1.942   1.352   -3.649  1.00 0.00 ? 548 TYR A CE1  8  
ATOM   4534  C  CE2  . TYR A 1 20 ? 1.345   1.963   -1.415  1.00 0.00 ? 548 TYR A CE2  8  
ATOM   4535  C  CZ   . TYR A 1 20 ? 2.127   2.144   -2.535  1.00 0.00 ? 548 TYR A CZ   8  
ATOM   4536  O  OH   . TYR A 1 20 ? 3.097   3.119   -2.543  1.00 0.00 ? 548 TYR A OH   8  
ATOM   4537  H  H    . TYR A 1 20 ? -3.886  -0.568  -2.594  1.00 0.00 ? 548 TYR A H    8  
ATOM   4538  H  HA   . TYR A 1 20 ? -1.626  -0.031  -4.331  1.00 0.00 ? 548 TYR A HA   8  
ATOM   4539  H  HB2  . TYR A 1 20 ? -1.345  -0.918  -1.529  1.00 0.00 ? 548 TYR A HB2  8  
ATOM   4540  H  HB3  . TYR A 1 20 ? -0.422  -1.848  -2.704  1.00 0.00 ? 548 TYR A HB3  8  
ATOM   4541  H  HD1  . TYR A 1 20 ? 0.818   -0.247  -4.509  1.00 0.00 ? 548 TYR A HD1  8  
ATOM   4542  H  HD2  . TYR A 1 20 ? -0.243  0.837   -0.535  1.00 0.00 ? 548 TYR A HD2  8  
ATOM   4543  H  HE1  . TYR A 1 20 ? 2.554   1.494   -4.527  1.00 0.00 ? 548 TYR A HE1  8  
ATOM   4544  H  HE2  . TYR A 1 20 ? 1.489   2.582   -0.542  1.00 0.00 ? 548 TYR A HE2  8  
ATOM   4545  H  HH   . TYR A 1 20 ? 3.825   2.852   -1.976  1.00 0.00 ? 548 TYR A HH   8  
ATOM   4546  N  N    . GLY A 1 21 ? -1.645  -2.453  -5.168  1.00 0.00 ? 549 GLY A N    8  
ATOM   4547  C  CA   . GLY A 1 21 ? -1.944  -3.709  -5.830  1.00 0.00 ? 549 GLY A CA   8  
ATOM   4548  C  C    . GLY A 1 21 ? -0.926  -4.789  -5.521  1.00 0.00 ? 549 GLY A C    8  
ATOM   4549  O  O    . GLY A 1 21 ? -1.239  -5.979  -5.576  1.00 0.00 ? 549 GLY A O    8  
ATOM   4550  H  H    . GLY A 1 21 ? -0.873  -1.921  -5.454  1.00 0.00 ? 549 GLY A H    8  
ATOM   4551  H  HA2  . GLY A 1 21 ? -2.919  -4.048  -5.512  1.00 0.00 ? 549 GLY A HA2  8  
ATOM   4552  H  HA3  . GLY A 1 21 ? -1.964  -3.544  -6.898  1.00 0.00 ? 549 GLY A HA3  8  
ATOM   4553  N  N    . LYS A 1 22 ? 0.296   -4.377  -5.198  1.00 0.00 ? 550 LYS A N    8  
ATOM   4554  C  CA   . LYS A 1 22 ? 1.362   -5.322  -4.882  1.00 0.00 ? 550 LYS A CA   8  
ATOM   4555  C  C    . LYS A 1 22 ? 1.929   -5.063  -3.490  1.00 0.00 ? 550 LYS A C    8  
ATOM   4556  O  O    . LYS A 1 22 ? 2.096   -3.914  -3.081  1.00 0.00 ? 550 LYS A O    8  
ATOM   4557  C  CB   . LYS A 1 22 ? 2.477   -5.230  -5.925  1.00 0.00 ? 550 LYS A CB   8  
ATOM   4558  C  CG   . LYS A 1 22 ? 2.093   -5.801  -7.280  1.00 0.00 ? 550 LYS A CG   8  
ATOM   4559  C  CD   . LYS A 1 22 ? 2.601   -7.224  -7.450  1.00 0.00 ? 550 LYS A CD   8  
ATOM   4560  C  CE   . LYS A 1 22 ? 2.067   -7.857  -8.724  1.00 0.00 ? 550 LYS A CE   8  
ATOM   4561  N  NZ   . LYS A 1 22 ? 0.578   -7.856  -8.764  1.00 0.00 ? 550 LYS A NZ   8  
ATOM   4562  H  H    . LYS A 1 22 ? 0.486   -3.416  -5.173  1.00 0.00 ? 550 LYS A H    8  
ATOM   4563  H  HA   . LYS A 1 22 ? 0.941   -6.316  -4.907  1.00 0.00 ? 550 LYS A HA   8  
ATOM   4564  H  HB2  . LYS A 1 22 ? 2.745   -4.192  -6.058  1.00 0.00 ? 550 LYS A HB2  8  
ATOM   4565  H  HB3  . LYS A 1 22 ? 3.339   -5.771  -5.562  1.00 0.00 ? 550 LYS A HB3  8  
ATOM   4566  H  HG2  . LYS A 1 22 ? 1.017   -5.801  -7.368  1.00 0.00 ? 550 LYS A HG2  8  
ATOM   4567  H  HG3  . LYS A 1 22 ? 2.519   -5.181  -8.055  1.00 0.00 ? 550 LYS A HG3  8  
ATOM   4568  H  HD2  . LYS A 1 22 ? 3.679   -7.208  -7.492  1.00 0.00 ? 550 LYS A HD2  8  
ATOM   4569  H  HD3  . LYS A 1 22 ? 2.280   -7.813  -6.603  1.00 0.00 ? 550 LYS A HD3  8  
ATOM   4570  H  HE2  . LYS A 1 22 ? 2.440   -7.300  -9.571  1.00 0.00 ? 550 LYS A HE2  8  
ATOM   4571  H  HE3  . LYS A 1 22 ? 2.420   -8.876  -8.780  1.00 0.00 ? 550 LYS A HE3  8  
ATOM   4572  H  HZ1  . LYS A 1 22 ? 0.235   -7.039  -9.308  1.00 0.00 ? 550 LYS A HZ1  8  
ATOM   4573  H  HZ2  . LYS A 1 22 ? 0.194   -7.801  -7.799  1.00 0.00 ? 550 LYS A HZ2  8  
ATOM   4574  H  HZ3  . LYS A 1 22 ? 0.232   -8.729  -9.213  1.00 0.00 ? 550 LYS A HZ3  8  
ATOM   4575  N  N    . THR A 1 23 ? 2.224   -6.139  -2.768  1.00 0.00 ? 551 THR A N    8  
ATOM   4576  C  CA   . THR A 1 23 ? 2.774   -6.029  -1.422  1.00 0.00 ? 551 THR A CA   8  
ATOM   4577  C  C    . THR A 1 23 ? 4.209   -5.515  -1.462  1.00 0.00 ? 551 THR A C    8  
ATOM   4578  O  O    . THR A 1 23 ? 4.664   -4.845  -0.535  1.00 0.00 ? 551 THR A O    8  
ATOM   4579  C  CB   . THR A 1 23 ? 2.725   -7.384  -0.715  1.00 0.00 ? 551 THR A CB   8  
ATOM   4580  O  OG1  . THR A 1 23 ? 3.198   -7.274  0.616   1.00 0.00 ? 551 THR A OG1  8  
ATOM   4581  C  CG2  . THR A 1 23 ? 3.548   -8.450  -1.407  1.00 0.00 ? 551 THR A CG2  8  
ATOM   4582  H  H    . THR A 1 23 ? 2.069   -7.028  -3.149  1.00 0.00 ? 551 THR A H    8  
ATOM   4583  H  HA   . THR A 1 23 ? 2.168   -5.324  -0.872  1.00 0.00 ? 551 THR A HA   8  
ATOM   4584  H  HB   . THR A 1 23 ? 1.700   -7.726  -0.684  1.00 0.00 ? 551 THR A HB   8  
ATOM   4585  H  HG1  . THR A 1 23 ? 4.138   -7.080  0.606   1.00 0.00 ? 551 THR A HG1  8  
ATOM   4586  H  HG21 . THR A 1 23 ? 3.895   -8.075  -2.358  1.00 0.00 ? 551 THR A HG21 8  
ATOM   4587  H  HG22 . THR A 1 23 ? 2.939   -9.328  -1.565  1.00 0.00 ? 551 THR A HG22 8  
ATOM   4588  H  HG23 . THR A 1 23 ? 4.396   -8.706  -0.790  1.00 0.00 ? 551 THR A HG23 8  
ATOM   4589  N  N    . SER A 1 24 ? 4.918   -5.827  -2.543  1.00 0.00 ? 552 SER A N    8  
ATOM   4590  C  CA   . SER A 1 24 ? 6.301   -5.389  -2.701  1.00 0.00 ? 552 SER A CA   8  
ATOM   4591  C  C    . SER A 1 24 ? 6.405   -3.874  -2.565  1.00 0.00 ? 552 SER A C    8  
ATOM   4592  O  O    . SER A 1 24 ? 7.435   -3.348  -2.145  1.00 0.00 ? 552 SER A O    8  
ATOM   4593  C  CB   . SER A 1 24 ? 6.848   -5.832  -4.059  1.00 0.00 ? 552 SER A CB   8  
ATOM   4594  O  OG   . SER A 1 24 ? 8.265   -5.802  -4.072  1.00 0.00 ? 552 SER A OG   8  
ATOM   4595  H  H    . SER A 1 24 ? 4.501   -6.361  -3.251  1.00 0.00 ? 552 SER A H    8  
ATOM   4596  H  HA   . SER A 1 24 ? 6.886   -5.849  -1.918  1.00 0.00 ? 552 SER A HA   8  
ATOM   4597  H  HB2  . SER A 1 24 ? 6.520   -6.839  -4.266  1.00 0.00 ? 552 SER A HB2  8  
ATOM   4598  H  HB3  . SER A 1 24 ? 6.480   -5.168  -4.827  1.00 0.00 ? 552 SER A HB3  8  
ATOM   4599  H  HG   . SER A 1 24 ? 8.603   -6.321  -3.338  1.00 0.00 ? 552 SER A HG   8  
ATOM   4600  N  N    . HIS A 1 25 ? 5.328   -3.178  -2.915  1.00 0.00 ? 553 HIS A N    8  
ATOM   4601  C  CA   . HIS A 1 25 ? 5.296   -1.725  -2.823  1.00 0.00 ? 553 HIS A CA   8  
ATOM   4602  C  C    . HIS A 1 25 ? 5.147   -1.283  -1.371  1.00 0.00 ? 553 HIS A C    8  
ATOM   4603  O  O    . HIS A 1 25 ? 5.583   -0.195  -0.993  1.00 0.00 ? 553 HIS A O    8  
ATOM   4604  C  CB   . HIS A 1 25 ? 4.145   -1.164  -3.662  1.00 0.00 ? 553 HIS A CB   8  
ATOM   4605  C  CG   . HIS A 1 25 ? 4.468   -1.048  -5.119  1.00 0.00 ? 553 HIS A CG   8  
ATOM   4606  N  ND1  . HIS A 1 25 ? 3.599   -1.397  -6.129  1.00 0.00 ? 553 HIS A ND1  8  
ATOM   4607  C  CD2  . HIS A 1 25 ? 5.596   -0.606  -5.732  1.00 0.00 ? 553 HIS A CD2  8  
ATOM   4608  C  CE1  . HIS A 1 25 ? 4.213   -1.165  -7.298  1.00 0.00 ? 553 HIS A CE1  8  
ATOM   4609  N  NE2  . HIS A 1 25 ? 5.427   -0.683  -7.112  1.00 0.00 ? 553 HIS A NE2  8  
ATOM   4610  H  H    . HIS A 1 25 ? 4.534   -3.654  -3.238  1.00 0.00 ? 553 HIS A H    8  
ATOM   4611  H  HA   . HIS A 1 25 ? 6.230   -1.346  -3.209  1.00 0.00 ? 553 HIS A HA   8  
ATOM   4612  H  HB2  . HIS A 1 25 ? 3.288   -1.813  -3.563  1.00 0.00 ? 553 HIS A HB2  8  
ATOM   4613  H  HB3  . HIS A 1 25 ? 3.889   -0.180  -3.297  1.00 0.00 ? 553 HIS A HB3  8  
ATOM   4614  H  HD1  . HIS A 1 25 ? 2.694   -1.754  -6.014  1.00 0.00 ? 553 HIS A HD1  8  
ATOM   4615  H  HD2  . HIS A 1 25 ? 6.488   -0.251  -5.238  1.00 0.00 ? 553 HIS A HD2  8  
ATOM   4616  H  HE1  . HIS A 1 25 ? 3.770   -1.346  -8.266  1.00 0.00 ? 553 HIS A HE1  8  
ATOM   4617  N  N    . LEU A 1 26 ? 4.529   -2.138  -0.560  1.00 0.00 ? 554 LEU A N    8  
ATOM   4618  C  CA   . LEU A 1 26 ? 4.323   -1.841  0.853   1.00 0.00 ? 554 LEU A CA   8  
ATOM   4619  C  C    . LEU A 1 26 ? 5.658   -1.660  1.569   1.00 0.00 ? 554 LEU A C    8  
ATOM   4620  O  O    . LEU A 1 26 ? 5.766   -0.879  2.514   1.00 0.00 ? 554 LEU A O    8  
ATOM   4621  C  CB   . LEU A 1 26 ? 3.520   -2.962  1.518   1.00 0.00 ? 554 LEU A CB   8  
ATOM   4622  C  CG   . LEU A 1 26 ? 2.229   -2.514  2.206   1.00 0.00 ? 554 LEU A CG   8  
ATOM   4623  C  CD1  . LEU A 1 26 ? 1.042   -2.675  1.269   1.00 0.00 ? 554 LEU A CD1  8  
ATOM   4624  C  CD2  . LEU A 1 26 ? 2.007   -3.302  3.489   1.00 0.00 ? 554 LEU A CD2  8  
ATOM   4625  H  H    . LEU A 1 26 ? 4.205   -2.989  -0.919  1.00 0.00 ? 554 LEU A H    8  
ATOM   4626  H  HA   . LEU A 1 26 ? 3.763   -0.921  0.919   1.00 0.00 ? 554 LEU A HA   8  
ATOM   4627  H  HB2  . LEU A 1 26 ? 3.266   -3.691  0.762   1.00 0.00 ? 554 LEU A HB2  8  
ATOM   4628  H  HB3  . LEU A 1 26 ? 4.147   -3.440  2.256   1.00 0.00 ? 554 LEU A HB3  8  
ATOM   4629  H  HG   . LEU A 1 26 ? 2.311   -1.468  2.464   1.00 0.00 ? 554 LEU A HG   8  
ATOM   4630  H  HD11 . LEU A 1 26 ? 0.153   -2.882  1.846   1.00 0.00 ? 554 LEU A HD11 8  
ATOM   4631  H  HD12 . LEU A 1 26 ? 1.228   -3.492  0.589   1.00 0.00 ? 554 LEU A HD12 8  
ATOM   4632  H  HD13 . LEU A 1 26 ? 0.901   -1.763  0.707   1.00 0.00 ? 554 LEU A HD13 8  
ATOM   4633  H  HD21 . LEU A 1 26 ? 1.410   -2.716  4.172   1.00 0.00 ? 554 LEU A HD21 8  
ATOM   4634  H  HD22 . LEU A 1 26 ? 2.961   -3.524  3.945   1.00 0.00 ? 554 LEU A HD22 8  
ATOM   4635  H  HD23 . LEU A 1 26 ? 1.494   -4.224  3.261   1.00 0.00 ? 554 LEU A HD23 8  
ATOM   4636  N  N    . ARG A 1 27 ? 6.671   -2.391  1.114   1.00 0.00 ? 555 ARG A N    8  
ATOM   4637  C  CA   . ARG A 1 27 ? 7.997   -2.314  1.713   1.00 0.00 ? 555 ARG A CA   8  
ATOM   4638  C  C    . ARG A 1 27 ? 8.598   -0.920  1.532   1.00 0.00 ? 555 ARG A C    8  
ATOM   4639  O  O    . ARG A 1 27 ? 9.125   -0.333  2.476   1.00 0.00 ? 555 ARG A O    8  
ATOM   4640  C  CB   . ARG A 1 27 ? 8.916   -3.388  1.110   1.00 0.00 ? 555 ARG A CB   8  
ATOM   4641  C  CG   . ARG A 1 27 ? 9.732   -2.918  -0.087  1.00 0.00 ? 555 ARG A CG   8  
ATOM   4642  C  CD   . ARG A 1 27 ? 10.602  -4.035  -0.641  1.00 0.00 ? 555 ARG A CD   8  
ATOM   4643  N  NE   . ARG A 1 27 ? 11.752  -3.517  -1.379  1.00 0.00 ? 555 ARG A NE   8  
ATOM   4644  C  CZ   . ARG A 1 27 ? 12.747  -2.834  -0.817  1.00 0.00 ? 555 ARG A CZ   8  
ATOM   4645  N  NH1  . ARG A 1 27 ? 12.738  -2.586  0.487   1.00 0.00 ? 555 ARG A NH1  8  
ATOM   4646  N  NH2  . ARG A 1 27 ? 13.754  -2.397  -1.561  1.00 0.00 ? 555 ARG A NH2  8  
ATOM   4647  H  H    . ARG A 1 27 ? 6.523   -2.997  0.360   1.00 0.00 ? 555 ARG A H    8  
ATOM   4648  H  HA   . ARG A 1 27 ? 7.888   -2.505  2.770   1.00 0.00 ? 555 ARG A HA   8  
ATOM   4649  H  HB2  . ARG A 1 27 ? 9.602   -3.724  1.872   1.00 0.00 ? 555 ARG A HB2  8  
ATOM   4650  H  HB3  . ARG A 1 27 ? 8.308   -4.224  0.794   1.00 0.00 ? 555 ARG A HB3  8  
ATOM   4651  H  HG2  . ARG A 1 27 ? 9.059   -2.583  -0.861  1.00 0.00 ? 555 ARG A HG2  8  
ATOM   4652  H  HG3  . ARG A 1 27 ? 10.365  -2.099  0.221   1.00 0.00 ? 555 ARG A HG3  8  
ATOM   4653  H  HD2  . ARG A 1 27 ? 10.957  -4.638  0.181   1.00 0.00 ? 555 ARG A HD2  8  
ATOM   4654  H  HD3  . ARG A 1 27 ? 10.006  -4.644  -1.303  1.00 0.00 ? 555 ARG A HD3  8  
ATOM   4655  H  HE   . ARG A 1 27 ? 11.784  -3.686  -2.343  1.00 0.00 ? 555 ARG A HE   8  
ATOM   4656  H  HH11 . ARG A 1 27 ? 11.982  -2.913  1.054   1.00 0.00 ? 555 ARG A HH11 8  
ATOM   4657  H  HH12 . ARG A 1 27 ? 13.488  -2.073  0.903   1.00 0.00 ? 555 ARG A HH12 8  
ATOM   4658  H  HH21 . ARG A 1 27 ? 13.766  -2.581  -2.543  1.00 0.00 ? 555 ARG A HH21 8  
ATOM   4659  H  HH22 . ARG A 1 27 ? 14.501  -1.884  -1.139  1.00 0.00 ? 555 ARG A HH22 8  
ATOM   4660  N  N    . ALA A 1 28 ? 8.514   -0.399  0.311   1.00 0.00 ? 556 ALA A N    8  
ATOM   4661  C  CA   . ALA A 1 28 ? 9.047   0.920   0.005   1.00 0.00 ? 556 ALA A CA   8  
ATOM   4662  C  C    . ALA A 1 28 ? 8.221   2.015   0.671   1.00 0.00 ? 556 ALA A C    8  
ATOM   4663  O  O    . ALA A 1 28 ? 8.750   3.055   1.063   1.00 0.00 ? 556 ALA A O    8  
ATOM   4664  C  CB   . ALA A 1 28 ? 9.093   1.134   -1.501  1.00 0.00 ? 556 ALA A CB   8  
ATOM   4665  H  H    . ALA A 1 28 ? 8.084   -0.915  -0.400  1.00 0.00 ? 556 ALA A H    8  
ATOM   4666  H  HA   . ALA A 1 28 ? 10.056  0.964   0.381   1.00 0.00 ? 556 ALA A HA   8  
ATOM   4667  H  HB1  . ALA A 1 28 ? 9.954   1.737   -1.752  1.00 0.00 ? 556 ALA A HB1  8  
ATOM   4668  H  HB2  . ALA A 1 28 ? 8.194   1.639   -1.821  1.00 0.00 ? 556 ALA A HB2  8  
ATOM   4669  H  HB3  . ALA A 1 28 ? 9.166   0.178   -1.998  1.00 0.00 ? 556 ALA A HB3  8  
ATOM   4670  N  N    . HIS A 1 29 ? 6.920   1.775   0.793   1.00 0.00 ? 557 HIS A N    8  
ATOM   4671  C  CA   . HIS A 1 29 ? 6.020   2.737   1.408   1.00 0.00 ? 557 HIS A CA   8  
ATOM   4672  C  C    . HIS A 1 29 ? 6.113   2.677   2.931   1.00 0.00 ? 557 HIS A C    8  
ATOM   4673  O  O    . HIS A 1 29 ? 6.033   3.701   3.608   1.00 0.00 ? 557 HIS A O    8  
ATOM   4674  C  CB   . HIS A 1 29 ? 4.580   2.479   0.956   1.00 0.00 ? 557 HIS A CB   8  
ATOM   4675  C  CG   . HIS A 1 29 ? 3.565   3.311   1.678   1.00 0.00 ? 557 HIS A CG   8  
ATOM   4676  N  ND1  . HIS A 1 29 ? 3.808   4.584   2.144   1.00 0.00 ? 557 HIS A ND1  8  
ATOM   4677  C  CD2  . HIS A 1 29 ? 2.284   3.024   2.023   1.00 0.00 ? 557 HIS A CD2  8  
ATOM   4678  C  CE1  . HIS A 1 29 ? 2.693   5.020   2.746   1.00 0.00 ? 557 HIS A CE1  8  
ATOM   4679  N  NE2  . HIS A 1 29 ? 1.739   4.111   2.699   1.00 0.00 ? 557 HIS A NE2  8  
ATOM   4680  H  H    . HIS A 1 29 ? 6.557   0.933   0.459   1.00 0.00 ? 557 HIS A H    8  
ATOM   4681  H  HA   . HIS A 1 29 ? 6.319   3.717   1.079   1.00 0.00 ? 557 HIS A HA   8  
ATOM   4682  H  HB2  . HIS A 1 29 ? 4.496   2.697   -0.098  1.00 0.00 ? 557 HIS A HB2  8  
ATOM   4683  H  HB3  . HIS A 1 29 ? 4.339   1.440   1.123   1.00 0.00 ? 557 HIS A HB3  8  
ATOM   4684  H  HD1  . HIS A 1 29 ? 4.646   5.082   2.052   1.00 0.00 ? 557 HIS A HD1  8  
ATOM   4685  H  HD2  . HIS A 1 29 ? 1.762   2.103   1.811   1.00 0.00 ? 557 HIS A HD2  8  
ATOM   4686  H  HE1  . HIS A 1 29 ? 2.589   5.990   3.208   1.00 0.00 ? 557 HIS A HE1  8  
ATOM   4687  N  N    . LEU A 1 30 ? 6.279   1.470   3.462   1.00 0.00 ? 558 LEU A N    8  
ATOM   4688  C  CA   . LEU A 1 30 ? 6.378   1.277   4.904   1.00 0.00 ? 558 LEU A CA   8  
ATOM   4689  C  C    . LEU A 1 30 ? 7.570   2.038   5.474   1.00 0.00 ? 558 LEU A C    8  
ATOM   4690  O  O    . LEU A 1 30 ? 7.458   2.708   6.501   1.00 0.00 ? 558 LEU A O    8  
ATOM   4691  C  CB   . LEU A 1 30 ? 6.502   -0.212  5.232   1.00 0.00 ? 558 LEU A CB   8  
ATOM   4692  C  CG   . LEU A 1 30 ? 5.174   -0.943  5.434   1.00 0.00 ? 558 LEU A CG   8  
ATOM   4693  C  CD1  . LEU A 1 30 ? 5.415   -2.404  5.783   1.00 0.00 ? 558 LEU A CD1  8  
ATOM   4694  C  CD2  . LEU A 1 30 ? 4.353   -0.262  6.519   1.00 0.00 ? 558 LEU A CD2  8  
ATOM   4695  H  H    . LEU A 1 30 ? 6.334   0.690   2.870   1.00 0.00 ? 558 LEU A H    8  
ATOM   4696  H  HA   . LEU A 1 30 ? 5.473   1.661   5.352   1.00 0.00 ? 558 LEU A HA   8  
ATOM   4697  H  HB2  . LEU A 1 30 ? 7.035   -0.694  4.425   1.00 0.00 ? 558 LEU A HB2  8  
ATOM   4698  H  HB3  . LEU A 1 30 ? 7.083   -0.314  6.136   1.00 0.00 ? 558 LEU A HB3  8  
ATOM   4699  H  HG   . LEU A 1 30 ? 4.608   -0.909  4.515   1.00 0.00 ? 558 LEU A HG   8  
ATOM   4700  H  HD11 . LEU A 1 30 ? 6.379   -2.505  6.260   1.00 0.00 ? 558 LEU A HD11 8  
ATOM   4701  H  HD12 . LEU A 1 30 ? 5.395   -2.997  4.881   1.00 0.00 ? 558 LEU A HD12 8  
ATOM   4702  H  HD13 . LEU A 1 30 ? 4.643   -2.745  6.456   1.00 0.00 ? 558 LEU A HD13 8  
ATOM   4703  H  HD21 . LEU A 1 30 ? 5.015   0.245   7.206   1.00 0.00 ? 558 LEU A HD21 8  
ATOM   4704  H  HD22 . LEU A 1 30 ? 3.778   -1.003  7.054   1.00 0.00 ? 558 LEU A HD22 8  
ATOM   4705  H  HD23 . LEU A 1 30 ? 3.684   0.456   6.068   1.00 0.00 ? 558 LEU A HD23 8  
ATOM   4706  N  N    . ARG A 1 31 ? 8.711   1.930   4.802   1.00 0.00 ? 559 ARG A N    8  
ATOM   4707  C  CA   . ARG A 1 31 ? 9.924   2.610   5.241   1.00 0.00 ? 559 ARG A CA   8  
ATOM   4708  C  C    . ARG A 1 31 ? 9.709   4.119   5.304   1.00 0.00 ? 559 ARG A C    8  
ATOM   4709  O  O    . ARG A 1 31 ? 10.327  4.810   6.114   1.00 0.00 ? 559 ARG A O    8  
ATOM   4710  C  CB   . ARG A 1 31 ? 11.087  2.284   4.302   1.00 0.00 ? 559 ARG A CB   8  
ATOM   4711  C  CG   . ARG A 1 31 ? 10.781  2.549   2.838   1.00 0.00 ? 559 ARG A CG   8  
ATOM   4712  C  CD   . ARG A 1 31 ? 11.985  2.257   1.956   1.00 0.00 ? 559 ARG A CD   8  
ATOM   4713  N  NE   . ARG A 1 31 ? 12.907  3.389   1.894   1.00 0.00 ? 559 ARG A NE   8  
ATOM   4714  C  CZ   . ARG A 1 31 ? 14.097  3.344   1.299   1.00 0.00 ? 559 ARG A CZ   8  
ATOM   4715  N  NH1  . ARG A 1 31 ? 14.513  2.228   0.715   1.00 0.00 ? 559 ARG A NH1  8  
ATOM   4716  N  NH2  . ARG A 1 31 ? 14.873  4.419   1.288   1.00 0.00 ? 559 ARG A NH2  8  
ATOM   4717  H  H    . ARG A 1 31 ? 8.737   1.382   3.990   1.00 0.00 ? 559 ARG A H    8  
ATOM   4718  H  HA   . ARG A 1 31 ? 10.162  2.251   6.232   1.00 0.00 ? 559 ARG A HA   8  
ATOM   4719  H  HB2  . ARG A 1 31 ? 11.940  2.882   4.584   1.00 0.00 ? 559 ARG A HB2  8  
ATOM   4720  H  HB3  . ARG A 1 31 ? 11.339  1.239   4.411   1.00 0.00 ? 559 ARG A HB3  8  
ATOM   4721  H  HG2  . ARG A 1 31 ? 9.963   1.916   2.531   1.00 0.00 ? 559 ARG A HG2  8  
ATOM   4722  H  HG3  . ARG A 1 31 ? 10.502  3.586   2.720   1.00 0.00 ? 559 ARG A HG3  8  
ATOM   4723  H  HD2  . ARG A 1 31 ? 12.508  1.401   2.354   1.00 0.00 ? 559 ARG A HD2  8  
ATOM   4724  H  HD3  . ARG A 1 31 ? 11.638  2.033   0.958   1.00 0.00 ? 559 ARG A HD3  8  
ATOM   4725  H  HE   . ARG A 1 31 ? 12.625  4.226   2.319   1.00 0.00 ? 559 ARG A HE   8  
ATOM   4726  H  HH11 . ARG A 1 31 ? 13.932  1.414   0.719   1.00 0.00 ? 559 ARG A HH11 8  
ATOM   4727  H  HH12 . ARG A 1 31 ? 15.408  2.200   0.269   1.00 0.00 ? 559 ARG A HH12 8  
ATOM   4728  H  HH21 . ARG A 1 31 ? 14.565  5.263   1.727   1.00 0.00 ? 559 ARG A HH21 8  
ATOM   4729  H  HH22 . ARG A 1 31 ? 15.767  4.386   0.842   1.00 0.00 ? 559 ARG A HH22 8  
ATOM   4730  N  N    . TRP A 1 32 ? 8.828   4.623   4.447   1.00 0.00 ? 560 TRP A N    8  
ATOM   4731  C  CA   . TRP A 1 32 ? 8.530   6.050   4.408   1.00 0.00 ? 560 TRP A CA   8  
ATOM   4732  C  C    . TRP A 1 32 ? 7.745   6.474   5.645   1.00 0.00 ? 560 TRP A C    8  
ATOM   4733  O  O    . TRP A 1 32 ? 7.877   7.602   6.120   1.00 0.00 ? 560 TRP A O    8  
ATOM   4734  C  CB   . TRP A 1 32 ? 7.739   6.394   3.145   1.00 0.00 ? 560 TRP A CB   8  
ATOM   4735  C  CG   . TRP A 1 32 ? 8.590   6.472   1.915   1.00 0.00 ? 560 TRP A CG   8  
ATOM   4736  C  CD1  . TRP A 1 32 ? 8.371   5.840   0.724   1.00 0.00 ? 560 TRP A CD1  8  
ATOM   4737  C  CD2  . TRP A 1 32 ? 9.798   7.225   1.754   1.00 0.00 ? 560 TRP A CD2  8  
ATOM   4738  N  NE1  . TRP A 1 32 ? 9.369   6.154   -0.166  1.00 0.00 ? 560 TRP A NE1  8  
ATOM   4739  C  CE2  . TRP A 1 32 ? 10.257  7.002   0.442   1.00 0.00 ? 560 TRP A CE2  8  
ATOM   4740  C  CE3  . TRP A 1 32 ? 10.536  8.066   2.592   1.00 0.00 ? 560 TRP A CE3  8  
ATOM   4741  C  CZ2  . TRP A 1 32 ? 11.419  7.590   -0.050  1.00 0.00 ? 560 TRP A CZ2  8  
ATOM   4742  C  CZ3  . TRP A 1 32 ? 11.689  8.649   2.103   1.00 0.00 ? 560 TRP A CZ3  8  
ATOM   4743  C  CH2  . TRP A 1 32 ? 12.121  8.409   0.792   1.00 0.00 ? 560 TRP A CH2  8  
ATOM   4744  H  H    . TRP A 1 32 ? 8.365   4.022   3.826   1.00 0.00 ? 560 TRP A H    8  
ATOM   4745  H  HA   . TRP A 1 32 ? 9.468   6.584   4.391   1.00 0.00 ? 560 TRP A HA   8  
ATOM   4746  H  HB2  . TRP A 1 32 ? 6.987   5.636   2.982   1.00 0.00 ? 560 TRP A HB2  8  
ATOM   4747  H  HB3  . TRP A 1 32 ? 7.256   7.351   3.280   1.00 0.00 ? 560 TRP A HB3  8  
ATOM   4748  H  HD1  . TRP A 1 32 ? 7.532   5.191   0.526   1.00 0.00 ? 560 TRP A HD1  8  
ATOM   4749  H  HE1  . TRP A 1 32 ? 9.434   5.825   -1.087  1.00 0.00 ? 560 TRP A HE1  8  
ATOM   4750  H  HE3  . TRP A 1 32 ? 10.219  8.263   3.606   1.00 0.00 ? 560 TRP A HE3  8  
ATOM   4751  H  HZ2  . TRP A 1 32 ? 11.765  7.416   -1.058  1.00 0.00 ? 560 TRP A HZ2  8  
ATOM   4752  H  HZ3  . TRP A 1 32 ? 12.273  9.301   2.736   1.00 0.00 ? 560 TRP A HZ3  8  
ATOM   4753  H  HH2  . TRP A 1 32 ? 13.029  8.885   0.452   1.00 0.00 ? 560 TRP A HH2  8  
ATOM   4754  N  N    . HIS A 1 33 ? 6.927   5.562   6.161   1.00 0.00 ? 561 HIS A N    8  
ATOM   4755  C  CA   . HIS A 1 33 ? 6.120   5.840   7.344   1.00 0.00 ? 561 HIS A CA   8  
ATOM   4756  C  C    . HIS A 1 33 ? 6.988   5.878   8.597   1.00 0.00 ? 561 HIS A C    8  
ATOM   4757  O  O    . HIS A 1 33 ? 6.861   6.781   9.425   1.00 0.00 ? 561 HIS A O    8  
ATOM   4758  C  CB   . HIS A 1 33 ? 5.026   4.783   7.500   1.00 0.00 ? 561 HIS A CB   8  
ATOM   4759  C  CG   . HIS A 1 33 ? 3.752   5.132   6.795   1.00 0.00 ? 561 HIS A CG   8  
ATOM   4760  N  ND1  . HIS A 1 33 ? 3.033   6.281   7.035   1.00 0.00 ? 561 HIS A ND1  8  
ATOM   4761  C  CD2  . HIS A 1 33 ? 3.070   4.456   5.836   1.00 0.00 ? 561 HIS A CD2  8  
ATOM   4762  C  CE1  . HIS A 1 33 ? 1.959   6.269   6.235   1.00 0.00 ? 561 HIS A CE1  8  
ATOM   4763  N  NE2  . HIS A 1 33 ? 1.934   5.183   5.485   1.00 0.00 ? 561 HIS A NE2  8  
ATOM   4764  H  H    . HIS A 1 33 ? 6.866   4.681   5.737   1.00 0.00 ? 561 HIS A H    8  
ATOM   4765  H  HA   . HIS A 1 33 ? 5.658   6.807   7.210   1.00 0.00 ? 561 HIS A HA   8  
ATOM   4766  H  HB2  . HIS A 1 33 ? 5.380   3.845   7.099   1.00 0.00 ? 561 HIS A HB2  8  
ATOM   4767  H  HB3  . HIS A 1 33 ? 4.802   4.658   8.550   1.00 0.00 ? 561 HIS A HB3  8  
ATOM   4768  H  HD1  . HIS A 1 33 ? 3.264   6.983   7.679   1.00 0.00 ? 561 HIS A HD1  8  
ATOM   4769  H  HD2  . HIS A 1 33 ? 3.354   3.507   5.405   1.00 0.00 ? 561 HIS A HD2  8  
ATOM   4770  H  HE1  . HIS A 1 33 ? 1.211   7.048   6.205   1.00 0.00 ? 561 HIS A HE1  8  
ATOM   4771  N  N    . THR A 1 34 ? 7.869   4.893   8.731   1.00 0.00 ? 562 THR A N    8  
ATOM   4772  C  CA   . THR A 1 34 ? 8.758   4.813   9.884   1.00 0.00 ? 562 THR A CA   8  
ATOM   4773  C  C    . THR A 1 34 ? 9.844   5.881   9.809   1.00 0.00 ? 562 THR A C    8  
ATOM   4774  O  O    . THR A 1 34 ? 10.761  5.792   8.993   1.00 0.00 ? 562 THR A O    8  
ATOM   4775  C  CB   . THR A 1 34 ? 9.395   3.425   9.967   1.00 0.00 ? 562 THR A CB   8  
ATOM   4776  O  OG1  . THR A 1 34 ? 10.221  3.321   11.113  1.00 0.00 ? 562 THR A OG1  8  
ATOM   4777  C  CG2  . THR A 1 34 ? 10.240  3.082   8.760   1.00 0.00 ? 562 THR A CG2  8  
ATOM   4778  H  H    . THR A 1 34 ? 7.922   4.202   8.038   1.00 0.00 ? 562 THR A H    8  
ATOM   4779  H  HA   . THR A 1 34 ? 8.165   4.981   10.771  1.00 0.00 ? 562 THR A HA   8  
ATOM   4780  H  HB   . THR A 1 34 ? 8.612   2.685   10.044  1.00 0.00 ? 562 THR A HB   8  
ATOM   4781  H  HG1  . THR A 1 34 ? 10.599  2.440   11.156  1.00 0.00 ? 562 THR A HG1  8  
ATOM   4782  H  HG21 . THR A 1 34 ? 9.817   3.543   7.880   1.00 0.00 ? 562 THR A HG21 8  
ATOM   4783  H  HG22 . THR A 1 34 ? 10.262  2.010   8.629   1.00 0.00 ? 562 THR A HG22 8  
ATOM   4784  H  HG23 . THR A 1 34 ? 11.246  3.446   8.909   1.00 0.00 ? 562 THR A HG23 8  
ATOM   4785  N  N    . GLY A 1 35 ? 9.733   6.891   10.665  1.00 0.00 ? 563 GLY A N    8  
ATOM   4786  C  CA   . GLY A 1 35 ? 10.712  7.962   10.680  1.00 0.00 ? 563 GLY A CA   8  
ATOM   4787  C  C    . GLY A 1 35 ? 10.193  9.232   10.034  1.00 0.00 ? 563 GLY A C    8  
ATOM   4788  O  O    . GLY A 1 35 ? 10.142  9.337   8.809   1.00 0.00 ? 563 GLY A O    8  
ATOM   4789  H  H    . GLY A 1 35 ? 8.980   6.909   11.293  1.00 0.00 ? 563 GLY A H    8  
ATOM   4790  H  HA2  . GLY A 1 35 ? 10.980  8.176   11.704  1.00 0.00 ? 563 GLY A HA2  8  
ATOM   4791  H  HA3  . GLY A 1 35 ? 11.594  7.636   10.149  1.00 0.00 ? 563 GLY A HA3  8  
ATOM   4792  N  N    . GLU A 1 36 ? 9.807   10.198  10.861  1.00 0.00 ? 564 GLU A N    8  
ATOM   4793  C  CA   . GLU A 1 36 ? 9.290   11.468  10.365  1.00 0.00 ? 564 GLU A CA   8  
ATOM   4794  C  C    . GLU A 1 36 ? 10.120  12.635  10.888  1.00 0.00 ? 564 GLU A C    8  
ATOM   4795  O  O    . GLU A 1 36 ? 11.026  12.451  11.701  1.00 0.00 ? 564 GLU A O    8  
ATOM   4796  C  CB   . GLU A 1 36 ? 7.827   11.643  10.777  1.00 0.00 ? 564 GLU A CB   8  
ATOM   4797  C  CG   . GLU A 1 36 ? 6.864   10.773  9.985   1.00 0.00 ? 564 GLU A CG   8  
ATOM   4798  C  CD   . GLU A 1 36 ? 5.587   11.504  9.617   1.00 0.00 ? 564 GLU A CD   8  
ATOM   4799  O  OE1  . GLU A 1 36 ? 4.772   11.769  10.526  1.00 0.00 ? 564 GLU A OE1  8  
ATOM   4800  O  OE2  . GLU A 1 36 ? 5.401   11.809  8.421   1.00 0.00 ? 564 GLU A OE2  8  
ATOM   4801  H  H    . GLU A 1 36 ? 9.872   10.054  11.828  1.00 0.00 ? 564 GLU A H    8  
ATOM   4802  H  HA   . GLU A 1 36 ? 9.351   11.453  9.287   1.00 0.00 ? 564 GLU A HA   8  
ATOM   4803  H  HB2  . GLU A 1 36 ? 7.727   11.392  11.823  1.00 0.00 ? 564 GLU A HB2  8  
ATOM   4804  H  HB3  . GLU A 1 36 ? 7.546   12.676  10.635  1.00 0.00 ? 564 GLU A HB3  8  
ATOM   4805  H  HG2  . GLU A 1 36 ? 7.352   10.454  9.076   1.00 0.00 ? 564 GLU A HG2  8  
ATOM   4806  H  HG3  . GLU A 1 36 ? 6.609   9.908   10.579  1.00 0.00 ? 564 GLU A HG3  8  
ATOM   4807  N  N    . ARG A 1 37 ? 9.805   13.838  10.416  1.00 0.00 ? 565 ARG A N    8  
ATOM   4808  C  CA   . ARG A 1 37 ? 10.523  15.036  10.837  1.00 0.00 ? 565 ARG A CA   8  
ATOM   4809  C  C    . ARG A 1 37 ? 9.575   16.034  11.494  1.00 0.00 ? 565 ARG A C    8  
ATOM   4810  O  O    . ARG A 1 37 ? 10.019  16.749  12.417  1.00 0.00 ? 565 ARG A O    8  
ATOM   4811  C  CB   . ARG A 1 37 ? 11.216  15.687  9.639   1.00 0.00 ? 565 ARG A CB   8  
ATOM   4812  C  CG   . ARG A 1 37 ? 10.284  15.951  8.466   1.00 0.00 ? 565 ARG A CG   8  
ATOM   4813  C  CD   . ARG A 1 37 ? 10.394  17.386  7.976   1.00 0.00 ? 565 ARG A CD   8  
ATOM   4814  N  NE   . ARG A 1 37 ? 10.145  17.495  6.540   1.00 0.00 ? 565 ARG A NE   8  
ATOM   4815  C  CZ   . ARG A 1 37 ? 11.047  17.201  5.607   1.00 0.00 ? 565 ARG A CZ   8  
ATOM   4816  N  NH1  . ARG A 1 37 ? 12.257  16.779  5.953   1.00 0.00 ? 565 ARG A NH1  8  
ATOM   4817  N  NH2  . ARG A 1 37 ? 10.738  17.329  4.324   1.00 0.00 ? 565 ARG A NH2  8  
ATOM   4818  O  OXT  . ARG A 1 37 ? 8.398   16.092  11.081  1.00 0.00 ? 565 ARG A OXT  8  
ATOM   4819  H  H    . ARG A 1 37 ? 9.073   13.921  9.770   1.00 0.00 ? 565 ARG A H    8  
ATOM   4820  H  HA   . ARG A 1 37 ? 11.270  14.739  11.557  1.00 0.00 ? 565 ARG A HA   8  
ATOM   4821  H  HB2  . ARG A 1 37 ? 11.643  16.628  9.953   1.00 0.00 ? 565 ARG A HB2  8  
ATOM   4822  H  HB3  . ARG A 1 37 ? 12.010  15.037  9.301   1.00 0.00 ? 565 ARG A HB3  8  
ATOM   4823  H  HG2  . ARG A 1 37 ? 10.543  15.285  7.657   1.00 0.00 ? 565 ARG A HG2  8  
ATOM   4824  H  HG3  . ARG A 1 37 ? 9.267   15.763  8.778   1.00 0.00 ? 565 ARG A HG3  8  
ATOM   4825  H  HD2  . ARG A 1 37 ? 9.670   17.990  8.503   1.00 0.00 ? 565 ARG A HD2  8  
ATOM   4826  H  HD3  . ARG A 1 37 ? 11.388  17.751  8.188   1.00 0.00 ? 565 ARG A HD3  8  
ATOM   4827  H  HE   . ARG A 1 37 ? 9.259   17.804  6.257   1.00 0.00 ? 565 ARG A HE   8  
ATOM   4828  H  HH11 . ARG A 1 37 ? 12.496  16.681  6.918   1.00 0.00 ? 565 ARG A HH11 8  
ATOM   4829  H  HH12 . ARG A 1 37 ? 12.930  16.560  5.246   1.00 0.00 ? 565 ARG A HH12 8  
ATOM   4830  H  HH21 . ARG A 1 37 ? 9.828   17.646  4.058   1.00 0.00 ? 565 ARG A HH21 8  
ATOM   4831  H  HH22 . ARG A 1 37 ? 11.416  17.108  3.622   1.00 0.00 ? 565 ARG A HH22 8  
HETATM 4832  ZN ZN   . ZN  B 2 .  ? 0.527   4.977   4.046   1.00 0.00 ? 100 ZN  A ZN   8  
ATOM   4833  N  N    . MET A 1 1  ? -12.327 -17.922 -6.766  1.00 0.00 ? 1   MET A N    9  
ATOM   4834  C  CA   . MET A 1 1  ? -11.509 -17.311 -7.847  1.00 0.00 ? 1   MET A CA   9  
ATOM   4835  C  C    . MET A 1 1  ? -11.107 -15.883 -7.493  1.00 0.00 ? 1   MET A C    9  
ATOM   4836  O  O    . MET A 1 1  ? -11.961 -15.022 -7.280  1.00 0.00 ? 1   MET A O    9  
ATOM   4837  C  CB   . MET A 1 1  ? -12.323 -17.324 -9.141  1.00 0.00 ? 1   MET A CB   9  
ATOM   4838  C  CG   . MET A 1 1  ? -12.123 -18.580 -9.973  1.00 0.00 ? 1   MET A CG   9  
ATOM   4839  S  SD   . MET A 1 1  ? -13.642 -19.136 -10.770 1.00 0.00 ? 1   MET A SD   9  
ATOM   4840  C  CE   . MET A 1 1  ? -13.029 -20.504 -11.750 1.00 0.00 ? 1   MET A CE   9  
ATOM   4841  H  H1   . MET A 1 1  ? -13.035 -17.221 -6.470  1.00 0.00 ? 1   MET A H1   9  
ATOM   4842  H  H2   . MET A 1 1  ? -11.686 -18.164 -5.983  1.00 0.00 ? 1   MET A H2   9  
ATOM   4843  H  H3   . MET A 1 1  ? -12.782 -18.771 -7.156  1.00 0.00 ? 1   MET A H3   9  
ATOM   4844  H  HA   . MET A 1 1  ? -10.617 -17.905 -7.981  1.00 0.00 ? 1   MET A HA   9  
ATOM   4845  H  HB2  . MET A 1 1  ? -13.372 -17.245 -8.894  1.00 0.00 ? 1   MET A HB2  9  
ATOM   4846  H  HB3  . MET A 1 1  ? -12.038 -16.472 -9.741  1.00 0.00 ? 1   MET A HB3  9  
ATOM   4847  H  HG2  . MET A 1 1  ? -11.387 -18.377 -10.737 1.00 0.00 ? 1   MET A HG2  9  
ATOM   4848  H  HG3  . MET A 1 1  ? -11.761 -19.368 -9.328  1.00 0.00 ? 1   MET A HG3  9  
ATOM   4849  H  HE1  . MET A 1 1  ? -13.581 -20.559 -12.676 1.00 0.00 ? 1   MET A HE1  9  
ATOM   4850  H  HE2  . MET A 1 1  ? -13.155 -21.426 -11.200 1.00 0.00 ? 1   MET A HE2  9  
ATOM   4851  H  HE3  . MET A 1 1  ? -11.981 -20.353 -11.964 1.00 0.00 ? 1   MET A HE3  9  
ATOM   4852  N  N    . ASP A 1 2  ? -9.802  -15.638 -7.433  1.00 0.00 ? 530 ASP A N    9  
ATOM   4853  C  CA   . ASP A 1 2  ? -9.287  -14.313 -7.105  1.00 0.00 ? 530 ASP A CA   9  
ATOM   4854  C  C    . ASP A 1 2  ? -9.152  -13.455 -8.362  1.00 0.00 ? 530 ASP A C    9  
ATOM   4855  O  O    . ASP A 1 2  ? -9.667  -12.338 -8.417  1.00 0.00 ? 530 ASP A O    9  
ATOM   4856  C  CB   . ASP A 1 2  ? -7.935  -14.429 -6.398  1.00 0.00 ? 530 ASP A CB   9  
ATOM   4857  C  CG   . ASP A 1 2  ? -8.045  -14.210 -4.902  1.00 0.00 ? 530 ASP A CG   9  
ATOM   4858  O  OD1  . ASP A 1 2  ? -9.107  -14.537 -4.330  1.00 0.00 ? 530 ASP A OD1  9  
ATOM   4859  O  OD2  . ASP A 1 2  ? -7.070  -13.712 -4.301  1.00 0.00 ? 530 ASP A OD2  9  
ATOM   4860  H  H    . ASP A 1 2  ? -9.170  -16.365 -7.613  1.00 0.00 ? 530 ASP A H    9  
ATOM   4861  H  HA   . ASP A 1 2  ? -9.993  -13.842 -6.438  1.00 0.00 ? 530 ASP A HA   9  
ATOM   4862  H  HB2  . ASP A 1 2  ? -7.529  -15.414 -6.569  1.00 0.00 ? 530 ASP A HB2  9  
ATOM   4863  H  HB3  . ASP A 1 2  ? -7.258  -13.690 -6.802  1.00 0.00 ? 530 ASP A HB3  9  
ATOM   4864  N  N    . PRO A 1 3  ? -8.456  -13.966 -9.393  1.00 0.00 ? 531 PRO A N    9  
ATOM   4865  C  CA   . PRO A 1 3  ? -8.260  -13.236 -10.650 1.00 0.00 ? 531 PRO A CA   9  
ATOM   4866  C  C    . PRO A 1 3  ? -9.577  -12.757 -11.252 1.00 0.00 ? 531 PRO A C    9  
ATOM   4867  O  O    . PRO A 1 3  ? -10.655 -13.151 -10.804 1.00 0.00 ? 531 PRO A O    9  
ATOM   4868  C  CB   . PRO A 1 3  ? -7.600  -14.269 -11.567 1.00 0.00 ? 531 PRO A CB   9  
ATOM   4869  C  CG   . PRO A 1 3  ? -6.939  -15.231 -10.642 1.00 0.00 ? 531 PRO A CG   9  
ATOM   4870  C  CD   . PRO A 1 3  ? -7.808  -15.291 -9.417  1.00 0.00 ? 531 PRO A CD   9  
ATOM   4871  H  HA   . PRO A 1 3  ? -7.599  -12.392 -10.518 1.00 0.00 ? 531 PRO A HA   9  
ATOM   4872  H  HB2  . PRO A 1 3  ? -8.355  -14.754 -12.169 1.00 0.00 ? 531 PRO A HB2  9  
ATOM   4873  H  HB3  . PRO A 1 3  ? -6.880  -13.780 -12.206 1.00 0.00 ? 531 PRO A HB3  9  
ATOM   4874  H  HG2  . PRO A 1 3  ? -6.879  -16.204 -11.107 1.00 0.00 ? 531 PRO A HG2  9  
ATOM   4875  H  HG3  . PRO A 1 3  ? -5.953  -14.875 -10.384 1.00 0.00 ? 531 PRO A HG3  9  
ATOM   4876  H  HD2  . PRO A 1 3  ? -8.543  -16.078 -9.513  1.00 0.00 ? 531 PRO A HD2  9  
ATOM   4877  H  HD3  . PRO A 1 3  ? -7.205  -15.441 -8.534  1.00 0.00 ? 531 PRO A HD3  9  
ATOM   4878  N  N    . GLY A 1 4  ? -9.484  -11.906 -12.268 1.00 0.00 ? 532 GLY A N    9  
ATOM   4879  C  CA   . GLY A 1 4  ? -10.677 -11.389 -12.914 1.00 0.00 ? 532 GLY A CA   9  
ATOM   4880  C  C    . GLY A 1 4  ? -10.618 -9.890  -13.129 1.00 0.00 ? 532 GLY A C    9  
ATOM   4881  O  O    . GLY A 1 4  ? -10.829 -9.406  -14.241 1.00 0.00 ? 532 GLY A O    9  
ATOM   4882  H  H    . GLY A 1 4  ? -8.599  -11.628 -12.583 1.00 0.00 ? 532 GLY A H    9  
ATOM   4883  H  HA2  . GLY A 1 4  ? -10.792 -11.874 -13.873 1.00 0.00 ? 532 GLY A HA2  9  
ATOM   4884  H  HA3  . GLY A 1 4  ? -11.534 -11.621 -12.300 1.00 0.00 ? 532 GLY A HA3  9  
ATOM   4885  N  N    . LYS A 1 5  ? -10.332 -9.151  -12.061 1.00 0.00 ? 533 LYS A N    9  
ATOM   4886  C  CA   . LYS A 1 5  ? -10.248 -7.698  -12.137 1.00 0.00 ? 533 LYS A CA   9  
ATOM   4887  C  C    . LYS A 1 5  ? -9.134  -7.169  -11.239 1.00 0.00 ? 533 LYS A C    9  
ATOM   4888  O  O    . LYS A 1 5  ? -8.612  -7.891  -10.390 1.00 0.00 ? 533 LYS A O    9  
ATOM   4889  C  CB   . LYS A 1 5  ? -11.585 -7.068  -11.740 1.00 0.00 ? 533 LYS A CB   9  
ATOM   4890  C  CG   . LYS A 1 5  ? -12.404 -6.582  -12.925 1.00 0.00 ? 533 LYS A CG   9  
ATOM   4891  C  CD   . LYS A 1 5  ? -12.048 -5.152  -13.300 1.00 0.00 ? 533 LYS A CD   9  
ATOM   4892  C  CE   . LYS A 1 5  ? -11.124 -5.106  -14.506 1.00 0.00 ? 533 LYS A CE   9  
ATOM   4893  N  NZ   . LYS A 1 5  ? -11.883 -5.113  -15.788 1.00 0.00 ? 533 LYS A NZ   9  
ATOM   4894  H  H    . LYS A 1 5  ? -10.175 -9.595  -11.201 1.00 0.00 ? 533 LYS A H    9  
ATOM   4895  H  HA   . LYS A 1 5  ? -10.025 -7.433  -13.160 1.00 0.00 ? 533 LYS A HA   9  
ATOM   4896  H  HB2  . LYS A 1 5  ? -12.169 -7.800  -11.203 1.00 0.00 ? 533 LYS A HB2  9  
ATOM   4897  H  HB3  . LYS A 1 5  ? -11.397 -6.225  -11.092 1.00 0.00 ? 533 LYS A HB3  9  
ATOM   4898  H  HG2  . LYS A 1 5  ? -12.211 -7.224  -13.771 1.00 0.00 ? 533 LYS A HG2  9  
ATOM   4899  H  HG3  . LYS A 1 5  ? -13.453 -6.627  -12.668 1.00 0.00 ? 533 LYS A HG3  9  
ATOM   4900  H  HD2  . LYS A 1 5  ? -12.955 -4.615  -13.534 1.00 0.00 ? 533 LYS A HD2  9  
ATOM   4901  H  HD3  . LYS A 1 5  ? -11.555 -4.682  -12.462 1.00 0.00 ? 533 LYS A HD3  9  
ATOM   4902  H  HE2  . LYS A 1 5  ? -10.531 -4.205  -14.455 1.00 0.00 ? 533 LYS A HE2  9  
ATOM   4903  H  HE3  . LYS A 1 5  ? -10.473 -5.967  -14.478 1.00 0.00 ? 533 LYS A HE3  9  
ATOM   4904  H  HZ1  . LYS A 1 5  ? -12.036 -6.091  -16.107 1.00 0.00 ? 533 LYS A HZ1  9  
ATOM   4905  H  HZ2  . LYS A 1 5  ? -11.352 -4.600  -16.520 1.00 0.00 ? 533 LYS A HZ2  9  
ATOM   4906  H  HZ3  . LYS A 1 5  ? -12.806 -4.652  -15.659 1.00 0.00 ? 533 LYS A HZ3  9  
ATOM   4907  N  N    . LYS A 1 6  ? -8.776  -5.904  -11.433 1.00 0.00 ? 534 LYS A N    9  
ATOM   4908  C  CA   . LYS A 1 6  ? -7.724  -5.277  -10.640 1.00 0.00 ? 534 LYS A CA   9  
ATOM   4909  C  C    . LYS A 1 6  ? -8.300  -4.639  -9.380  1.00 0.00 ? 534 LYS A C    9  
ATOM   4910  O  O    . LYS A 1 6  ? -9.512  -4.466  -9.258  1.00 0.00 ? 534 LYS A O    9  
ATOM   4911  C  CB   . LYS A 1 6  ? -6.991  -4.221  -11.470 1.00 0.00 ? 534 LYS A CB   9  
ATOM   4912  C  CG   . LYS A 1 6  ? -6.378  -4.771  -12.749 1.00 0.00 ? 534 LYS A CG   9  
ATOM   4913  C  CD   . LYS A 1 6  ? -4.891  -5.048  -12.582 1.00 0.00 ? 534 LYS A CD   9  
ATOM   4914  C  CE   . LYS A 1 6  ? -4.051  -4.160  -13.487 1.00 0.00 ? 534 LYS A CE   9  
ATOM   4915  N  NZ   . LYS A 1 6  ? -2.719  -4.759  -13.772 1.00 0.00 ? 534 LYS A NZ   9  
ATOM   4916  H  H    . LYS A 1 6  ? -9.230  -5.379  -12.125 1.00 0.00 ? 534 LYS A H    9  
ATOM   4917  H  HA   . LYS A 1 6  ? -7.023  -6.046  -10.352 1.00 0.00 ? 534 LYS A HA   9  
ATOM   4918  H  HB2  . LYS A 1 6  ? -7.690  -3.442  -11.738 1.00 0.00 ? 534 LYS A HB2  9  
ATOM   4919  H  HB3  . LYS A 1 6  ? -6.201  -3.794  -10.872 1.00 0.00 ? 534 LYS A HB3  9  
ATOM   4920  H  HG2  . LYS A 1 6  ? -6.878  -5.692  -13.009 1.00 0.00 ? 534 LYS A HG2  9  
ATOM   4921  H  HG3  . LYS A 1 6  ? -6.515  -4.049  -13.541 1.00 0.00 ? 534 LYS A HG3  9  
ATOM   4922  H  HD2  . LYS A 1 6  ? -4.611  -4.864  -11.556 1.00 0.00 ? 534 LYS A HD2  9  
ATOM   4923  H  HD3  . LYS A 1 6  ? -4.698  -6.082  -12.829 1.00 0.00 ? 534 LYS A HD3  9  
ATOM   4924  H  HE2  . LYS A 1 6  ? -4.578  -4.016  -14.418 1.00 0.00 ? 534 LYS A HE2  9  
ATOM   4925  H  HE3  . LYS A 1 6  ? -3.911  -3.204  -13.002 1.00 0.00 ? 534 LYS A HE3  9  
ATOM   4926  H  HZ1  . LYS A 1 6  ? -2.168  -4.128  -14.390 1.00 0.00 ? 534 LYS A HZ1  9  
ATOM   4927  H  HZ2  . LYS A 1 6  ? -2.833  -5.677  -14.247 1.00 0.00 ? 534 LYS A HZ2  9  
ATOM   4928  H  HZ3  . LYS A 1 6  ? -2.194  -4.903  -12.886 1.00 0.00 ? 534 LYS A HZ3  9  
ATOM   4929  N  N    . LYS A 1 7  ? -7.422  -4.293  -8.444  1.00 0.00 ? 535 LYS A N    9  
ATOM   4930  C  CA   . LYS A 1 7  ? -7.844  -3.675  -7.192  1.00 0.00 ? 535 LYS A CA   9  
ATOM   4931  C  C    . LYS A 1 7  ? -6.886  -2.560  -6.785  1.00 0.00 ? 535 LYS A C    9  
ATOM   4932  O  O    . LYS A 1 7  ? -5.749  -2.502  -7.254  1.00 0.00 ? 535 LYS A O    9  
ATOM   4933  C  CB   . LYS A 1 7  ? -7.923  -4.725  -6.082  1.00 0.00 ? 535 LYS A CB   9  
ATOM   4934  C  CG   . LYS A 1 7  ? -6.646  -5.533  -5.917  1.00 0.00 ? 535 LYS A CG   9  
ATOM   4935  C  CD   . LYS A 1 7  ? -6.738  -6.872  -6.631  1.00 0.00 ? 535 LYS A CD   9  
ATOM   4936  C  CE   . LYS A 1 7  ? -5.712  -7.858  -6.098  1.00 0.00 ? 535 LYS A CE   9  
ATOM   4937  N  NZ   . LYS A 1 7  ? -5.417  -8.938  -7.080  1.00 0.00 ? 535 LYS A NZ   9  
ATOM   4938  H  H    . LYS A 1 7  ? -6.468  -4.457  -8.598  1.00 0.00 ? 535 LYS A H    9  
ATOM   4939  H  HA   . LYS A 1 7  ? -8.825  -3.252  -7.346  1.00 0.00 ? 535 LYS A HA   9  
ATOM   4940  H  HB2  . LYS A 1 7  ? -8.133  -4.227  -5.146  1.00 0.00 ? 535 LYS A HB2  9  
ATOM   4941  H  HB3  . LYS A 1 7  ? -8.730  -5.408  -6.305  1.00 0.00 ? 535 LYS A HB3  9  
ATOM   4942  H  HG2  . LYS A 1 7  ? -5.821  -4.972  -6.329  1.00 0.00 ? 535 LYS A HG2  9  
ATOM   4943  H  HG3  . LYS A 1 7  ? -6.476  -5.707  -4.864  1.00 0.00 ? 535 LYS A HG3  9  
ATOM   4944  H  HD2  . LYS A 1 7  ? -7.726  -7.281  -6.483  1.00 0.00 ? 535 LYS A HD2  9  
ATOM   4945  H  HD3  . LYS A 1 7  ? -6.563  -6.719  -7.686  1.00 0.00 ? 535 LYS A HD3  9  
ATOM   4946  H  HE2  . LYS A 1 7  ? -4.799  -7.325  -5.878  1.00 0.00 ? 535 LYS A HE2  9  
ATOM   4947  H  HE3  . LYS A 1 7  ? -6.095  -8.303  -5.191  1.00 0.00 ? 535 LYS A HE3  9  
ATOM   4948  H  HZ1  . LYS A 1 7  ? -5.132  -9.806  -6.582  1.00 0.00 ? 535 LYS A HZ1  9  
ATOM   4949  H  HZ2  . LYS A 1 7  ? -4.644  -8.646  -7.712  1.00 0.00 ? 535 LYS A HZ2  9  
ATOM   4950  H  HZ3  . LYS A 1 7  ? -6.261  -9.140  -7.653  1.00 0.00 ? 535 LYS A HZ3  9  
ATOM   4951  N  N    . GLN A 1 8  ? -7.353  -1.676  -5.910  1.00 0.00 ? 536 GLN A N    9  
ATOM   4952  C  CA   . GLN A 1 8  ? -6.539  -0.562  -5.438  1.00 0.00 ? 536 GLN A CA   9  
ATOM   4953  C  C    . GLN A 1 8  ? -5.937  -0.870  -4.071  1.00 0.00 ? 536 GLN A C    9  
ATOM   4954  O  O    . GLN A 1 8  ? -6.635  -1.316  -3.161  1.00 0.00 ? 536 GLN A O    9  
ATOM   4955  C  CB   . GLN A 1 8  ? -7.377  0.716   -5.365  1.00 0.00 ? 536 GLN A CB   9  
ATOM   4956  C  CG   . GLN A 1 8  ? -8.504  0.647   -4.346  1.00 0.00 ? 536 GLN A CG   9  
ATOM   4957  C  CD   . GLN A 1 8  ? -9.548  1.725   -4.560  1.00 0.00 ? 536 GLN A CD   9  
ATOM   4958  O  OE1  . GLN A 1 8  ? -9.234  2.915   -4.576  1.00 0.00 ? 536 GLN A OE1  9  
ATOM   4959  N  NE2  . GLN A 1 8  ? -10.800 1.312   -4.724  1.00 0.00 ? 536 GLN A NE2  9  
ATOM   4960  H  H    . GLN A 1 8  ? -8.268  -1.776  -5.572  1.00 0.00 ? 536 GLN A H    9  
ATOM   4961  H  HA   . GLN A 1 8  ? -5.737  -0.415  -6.146  1.00 0.00 ? 536 GLN A HA   9  
ATOM   4962  H  HB2  . GLN A 1 8  ? -6.732  1.541   -5.101  1.00 0.00 ? 536 GLN A HB2  9  
ATOM   4963  H  HB3  . GLN A 1 8  ? -7.810  0.904   -6.336  1.00 0.00 ? 536 GLN A HB3  9  
ATOM   4964  H  HG2  . GLN A 1 8  ? -8.984  -0.317  -4.423  1.00 0.00 ? 536 GLN A HG2  9  
ATOM   4965  H  HG3  . GLN A 1 8  ? -8.085  0.763   -3.357  1.00 0.00 ? 536 GLN A HG3  9  
ATOM   4966  H  HE21 . GLN A 1 8  ? -10.976 0.349   -4.699  1.00 0.00 ? 536 GLN A HE21 9  
ATOM   4967  H  HE22 . GLN A 1 8  ? -11.495 1.988   -4.864  1.00 0.00 ? 536 GLN A HE22 9  
ATOM   4968  N  N    . HIS A 1 9  ? -4.637  -0.630  -3.934  1.00 0.00 ? 537 HIS A N    9  
ATOM   4969  C  CA   . HIS A 1 9  ? -3.941  -0.883  -2.677  1.00 0.00 ? 537 HIS A CA   9  
ATOM   4970  C  C    . HIS A 1 9  ? -4.013  0.335   -1.761  1.00 0.00 ? 537 HIS A C    9  
ATOM   4971  O  O    . HIS A 1 9  ? -3.489  1.401   -2.086  1.00 0.00 ? 537 HIS A O    9  
ATOM   4972  C  CB   . HIS A 1 9  ? -2.478  -1.251  -2.940  1.00 0.00 ? 537 HIS A CB   9  
ATOM   4973  C  CG   . HIS A 1 9  ? -2.287  -2.152  -4.122  1.00 0.00 ? 537 HIS A CG   9  
ATOM   4974  N  ND1  . HIS A 1 9  ? -3.260  -2.996  -4.609  1.00 0.00 ? 537 HIS A ND1  9  
ATOM   4975  C  CD2  . HIS A 1 9  ? -1.204  -2.328  -4.921  1.00 0.00 ? 537 HIS A CD2  9  
ATOM   4976  C  CE1  . HIS A 1 9  ? -2.750  -3.645  -5.664  1.00 0.00 ? 537 HIS A CE1  9  
ATOM   4977  N  NE2  . HIS A 1 9  ? -1.505  -3.275  -5.896  1.00 0.00 ? 537 HIS A NE2  9  
ATOM   4978  H  H    . HIS A 1 9  ? -4.133  -0.275  -4.697  1.00 0.00 ? 537 HIS A H    9  
ATOM   4979  H  HA   . HIS A 1 9  ? -4.429  -1.713  -2.190  1.00 0.00 ? 537 HIS A HA   9  
ATOM   4980  H  HB2  . HIS A 1 9  ? -1.913  -0.348  -3.118  1.00 0.00 ? 537 HIS A HB2  9  
ATOM   4981  H  HB3  . HIS A 1 9  ? -2.079  -1.753  -2.071  1.00 0.00 ? 537 HIS A HB3  9  
ATOM   4982  H  HD1  . HIS A 1 9  ? -4.164  -3.104  -4.247  1.00 0.00 ? 537 HIS A HD1  9  
ATOM   4983  H  HD2  . HIS A 1 9  ? -0.255  -1.820  -4.826  1.00 0.00 ? 537 HIS A HD2  9  
ATOM   4984  H  HE1  . HIS A 1 9  ? -3.289  -4.375  -6.250  1.00 0.00 ? 537 HIS A HE1  9  
ATOM   4985  N  N    . ILE A 1 10 ? -4.665  0.169   -0.615  1.00 0.00 ? 538 ILE A N    9  
ATOM   4986  C  CA   . ILE A 1 10 ? -4.804  1.254   0.350   1.00 0.00 ? 538 ILE A CA   9  
ATOM   4987  C  C    . ILE A 1 10 ? -4.056  0.936   1.640   1.00 0.00 ? 538 ILE A C    9  
ATOM   4988  O  O    . ILE A 1 10 ? -3.946  -0.224  2.034   1.00 0.00 ? 538 ILE A O    9  
ATOM   4989  C  CB   . ILE A 1 10 ? -6.285  1.527   0.681   1.00 0.00 ? 538 ILE A CB   9  
ATOM   4990  C  CG1  . ILE A 1 10 ? -7.098  1.694   -0.604  1.00 0.00 ? 538 ILE A CG1  9  
ATOM   4991  C  CG2  . ILE A 1 10 ? -6.413  2.764   1.559   1.00 0.00 ? 538 ILE A CG2  9  
ATOM   4992  C  CD1  . ILE A 1 10 ? -8.453  1.023   -0.553  1.00 0.00 ? 538 ILE A CD1  9  
ATOM   4993  H  H    . ILE A 1 10 ? -5.060  -0.704  -0.412  1.00 0.00 ? 538 ILE A H    9  
ATOM   4994  H  HA   . ILE A 1 10 ? -4.384  2.147   -0.089  1.00 0.00 ? 538 ILE A HA   9  
ATOM   4995  H  HB   . ILE A 1 10 ? -6.668  0.683   1.234   1.00 0.00 ? 538 ILE A HB   9  
ATOM   4996  H  HG12 . ILE A 1 10 ? -7.258  2.746   -0.788  1.00 0.00 ? 538 ILE A HG12 9  
ATOM   4997  H  HG13 . ILE A 1 10 ? -6.547  1.268   -1.430  1.00 0.00 ? 538 ILE A HG13 9  
ATOM   4998  H  HG21 . ILE A 1 10 ? -6.123  2.519   2.570   1.00 0.00 ? 538 ILE A HG21 9  
ATOM   4999  H  HG22 . ILE A 1 10 ? -7.437  3.106   1.551   1.00 0.00 ? 538 ILE A HG22 9  
ATOM   5000  H  HG23 . ILE A 1 10 ? -5.770  3.543   1.179   1.00 0.00 ? 538 ILE A HG23 9  
ATOM   5001  H  HD11 . ILE A 1 10 ? -9.227  1.760   -0.708  1.00 0.00 ? 538 ILE A HD11 9  
ATOM   5002  H  HD12 . ILE A 1 10 ? -8.588  0.557   0.412   1.00 0.00 ? 538 ILE A HD12 9  
ATOM   5003  H  HD13 . ILE A 1 10 ? -8.513  0.272   -1.327  1.00 0.00 ? 538 ILE A HD13 9  
ATOM   5004  N  N    . CYS A 1 11 ? -3.544  1.974   2.294   1.00 0.00 ? 539 CYS A N    9  
ATOM   5005  C  CA   . CYS A 1 11 ? -2.806  1.800   3.540   1.00 0.00 ? 539 CYS A CA   9  
ATOM   5006  C  C    . CYS A 1 11 ? -3.689  1.169   4.611   1.00 0.00 ? 539 CYS A C    9  
ATOM   5007  O  O    . CYS A 1 11 ? -4.688  1.754   5.029   1.00 0.00 ? 539 CYS A O    9  
ATOM   5008  C  CB   . CYS A 1 11 ? -2.263  3.144   4.035   1.00 0.00 ? 539 CYS A CB   9  
ATOM   5009  S  SG   . CYS A 1 11 ? -0.475  3.163   4.298   1.00 0.00 ? 539 CYS A SG   9  
ATOM   5010  H  H    . CYS A 1 11 ? -3.664  2.876   1.931   1.00 0.00 ? 539 CYS A H    9  
ATOM   5011  H  HA   . CYS A 1 11 ? -1.975  1.139   3.341   1.00 0.00 ? 539 CYS A HA   9  
ATOM   5012  H  HB2  . CYS A 1 11 ? -2.496  3.908   3.308   1.00 0.00 ? 539 CYS A HB2  9  
ATOM   5013  H  HB3  . CYS A 1 11 ? -2.736  3.394   4.975   1.00 0.00 ? 539 CYS A HB3  9  
ATOM   5014  N  N    . HIS A 1 12 ? -3.310  -0.025  5.055   1.00 0.00 ? 540 HIS A N    9  
ATOM   5015  C  CA   . HIS A 1 12 ? -4.067  -0.731  6.084   1.00 0.00 ? 540 HIS A CA   9  
ATOM   5016  C  C    . HIS A 1 12 ? -3.529  -0.410  7.478   1.00 0.00 ? 540 HIS A C    9  
ATOM   5017  O  O    . HIS A 1 12 ? -3.692  -1.196  8.412   1.00 0.00 ? 540 HIS A O    9  
ATOM   5018  C  CB   . HIS A 1 12 ? -4.028  -2.242  5.835   1.00 0.00 ? 540 HIS A CB   9  
ATOM   5019  C  CG   . HIS A 1 12 ? -2.687  -2.868  6.076   1.00 0.00 ? 540 HIS A CG   9  
ATOM   5020  N  ND1  . HIS A 1 12 ? -1.505  -2.164  6.120   1.00 0.00 ? 540 HIS A ND1  9  
ATOM   5021  C  CD2  . HIS A 1 12 ? -2.356  -4.167  6.289   1.00 0.00 ? 540 HIS A CD2  9  
ATOM   5022  C  CE1  . HIS A 1 12 ? -0.514  -3.036  6.351   1.00 0.00 ? 540 HIS A CE1  9  
ATOM   5023  N  NE2  . HIS A 1 12 ? -0.979  -4.266  6.463   1.00 0.00 ? 540 HIS A NE2  9  
ATOM   5024  H  H    . HIS A 1 12 ? -2.504  -0.439  4.685   1.00 0.00 ? 540 HIS A H    9  
ATOM   5025  H  HA   . HIS A 1 12 ? -5.091  -0.394  6.024   1.00 0.00 ? 540 HIS A HA   9  
ATOM   5026  H  HB2  . HIS A 1 12 ? -4.738  -2.724  6.490   1.00 0.00 ? 540 HIS A HB2  9  
ATOM   5027  H  HB3  . HIS A 1 12 ? -4.306  -2.436  4.809   1.00 0.00 ? 540 HIS A HB3  9  
ATOM   5028  H  HD1  . HIS A 1 12 ? -1.404  -1.197  6.002   1.00 0.00 ? 540 HIS A HD1  9  
ATOM   5029  H  HD2  . HIS A 1 12 ? -3.044  -4.999  6.321   1.00 0.00 ? 540 HIS A HD2  9  
ATOM   5030  H  HE1  . HIS A 1 12 ? 0.528   -2.768  6.437   1.00 0.00 ? 540 HIS A HE1  9  
ATOM   5031  N  N    . ILE A 1 13 ? -2.893  0.751   7.612   1.00 0.00 ? 541 ILE A N    9  
ATOM   5032  C  CA   . ILE A 1 13 ? -2.337  1.181   8.889   1.00 0.00 ? 541 ILE A CA   9  
ATOM   5033  C  C    . ILE A 1 13 ? -2.930  2.520   9.314   1.00 0.00 ? 541 ILE A C    9  
ATOM   5034  O  O    . ILE A 1 13 ? -3.293  3.343   8.474   1.00 0.00 ? 541 ILE A O    9  
ATOM   5035  C  CB   . ILE A 1 13 ? -0.801  1.314   8.818   1.00 0.00 ? 541 ILE A CB   9  
ATOM   5036  C  CG1  . ILE A 1 13 ? -0.169  -0.009  8.387   1.00 0.00 ? 541 ILE A CG1  9  
ATOM   5037  C  CG2  . ILE A 1 13 ? -0.240  1.761   10.160  1.00 0.00 ? 541 ILE A CG2  9  
ATOM   5038  C  CD1  . ILE A 1 13 ? -0.528  -1.173  9.285   1.00 0.00 ? 541 ILE A CD1  9  
ATOM   5039  H  H    . ILE A 1 13 ? -2.798  1.336   6.834   1.00 0.00 ? 541 ILE A H    9  
ATOM   5040  H  HA   . ILE A 1 13 ? -2.582  0.434   9.630   1.00 0.00 ? 541 ILE A HA   9  
ATOM   5041  H  HB   . ILE A 1 13 ? -0.563  2.072   8.087   1.00 0.00 ? 541 ILE A HB   9  
ATOM   5042  H  HG12 . ILE A 1 13 ? -0.498  -0.248  7.388   1.00 0.00 ? 541 ILE A HG12 9  
ATOM   5043  H  HG13 . ILE A 1 13 ? 0.906   0.095   8.392   1.00 0.00 ? 541 ILE A HG13 9  
ATOM   5044  H  HG21 . ILE A 1 13 ? 0.820   1.558   10.192  1.00 0.00 ? 541 ILE A HG21 9  
ATOM   5045  H  HG22 . ILE A 1 13 ? -0.735  1.223   10.955  1.00 0.00 ? 541 ILE A HG22 9  
ATOM   5046  H  HG23 . ILE A 1 13 ? -0.407  2.821   10.284  1.00 0.00 ? 541 ILE A HG23 9  
ATOM   5047  H  HD11 . ILE A 1 13 ? -1.347  -1.725  8.848   1.00 0.00 ? 541 ILE A HD11 9  
ATOM   5048  H  HD12 . ILE A 1 13 ? -0.821  -0.801  10.256  1.00 0.00 ? 541 ILE A HD12 9  
ATOM   5049  H  HD13 . ILE A 1 13 ? 0.328   -1.823  9.392   1.00 0.00 ? 541 ILE A HD13 9  
ATOM   5050  N  N    . GLN A 1 14 ? -3.022  2.734   10.621  1.00 0.00 ? 542 GLN A N    9  
ATOM   5051  C  CA   . GLN A 1 14 ? -3.565  3.975   11.153  1.00 0.00 ? 542 GLN A CA   9  
ATOM   5052  C  C    . GLN A 1 14 ? -2.597  5.131   10.921  1.00 0.00 ? 542 GLN A C    9  
ATOM   5053  O  O    . GLN A 1 14 ? -2.069  5.715   11.868  1.00 0.00 ? 542 GLN A O    9  
ATOM   5054  C  CB   . GLN A 1 14 ? -3.860  3.828   12.648  1.00 0.00 ? 542 GLN A CB   9  
ATOM   5055  C  CG   . GLN A 1 14 ? -2.620  3.578   13.491  1.00 0.00 ? 542 GLN A CG   9  
ATOM   5056  C  CD   . GLN A 1 14 ? -2.430  4.623   14.573  1.00 0.00 ? 542 GLN A CD   9  
ATOM   5057  O  OE1  . GLN A 1 14 ? -3.172  4.661   15.554  1.00 0.00 ? 542 GLN A OE1  9  
ATOM   5058  N  NE2  . GLN A 1 14 ? -1.430  5.480   14.399  1.00 0.00 ? 542 GLN A NE2  9  
ATOM   5059  H  H    . GLN A 1 14 ? -2.715  2.044   11.242  1.00 0.00 ? 542 GLN A H    9  
ATOM   5060  H  HA   . GLN A 1 14 ? -4.486  4.179   10.632  1.00 0.00 ? 542 GLN A HA   9  
ATOM   5061  H  HB2  . GLN A 1 14 ? -4.334  4.733   13.000  1.00 0.00 ? 542 GLN A HB2  9  
ATOM   5062  H  HB3  . GLN A 1 14 ? -4.538  2.999   12.789  1.00 0.00 ? 542 GLN A HB3  9  
ATOM   5063  H  HG2  . GLN A 1 14 ? -2.708  2.610   13.960  1.00 0.00 ? 542 GLN A HG2  9  
ATOM   5064  H  HG3  . GLN A 1 14 ? -1.754  3.588   12.845  1.00 0.00 ? 542 GLN A HG3  9  
ATOM   5065  H  HE21 . GLN A 1 14 ? -0.879  5.391   13.593  1.00 0.00 ? 542 GLN A HE21 9  
ATOM   5066  H  HE22 . GLN A 1 14 ? -1.284  6.167   15.083  1.00 0.00 ? 542 GLN A HE22 9  
ATOM   5067  N  N    . GLY A 1 15 ? -2.364  5.456   9.652   1.00 0.00 ? 543 GLY A N    9  
ATOM   5068  C  CA   . GLY A 1 15 ? -1.456  6.537   9.318   1.00 0.00 ? 543 GLY A CA   9  
ATOM   5069  C  C    . GLY A 1 15 ? -2.028  7.477   8.275   1.00 0.00 ? 543 GLY A C    9  
ATOM   5070  O  O    . GLY A 1 15 ? -2.540  8.546   8.609   1.00 0.00 ? 543 GLY A O    9  
ATOM   5071  H  H    . GLY A 1 15 ? -2.810  4.955   8.938   1.00 0.00 ? 543 GLY A H    9  
ATOM   5072  H  HA2  . GLY A 1 15 ? -1.241  7.101   10.214  1.00 0.00 ? 543 GLY A HA2  9  
ATOM   5073  H  HA3  . GLY A 1 15 ? -0.536  6.116   8.941   1.00 0.00 ? 543 GLY A HA3  9  
ATOM   5074  N  N    . CYS A 1 16 ? -1.938  7.082   7.008   1.00 0.00 ? 544 CYS A N    9  
ATOM   5075  C  CA   . CYS A 1 16 ? -2.448  7.903   5.917   1.00 0.00 ? 544 CYS A CA   9  
ATOM   5076  C  C    . CYS A 1 16 ? -3.539  7.168   5.142   1.00 0.00 ? 544 CYS A C    9  
ATOM   5077  O  O    . CYS A 1 16 ? -3.980  6.090   5.540   1.00 0.00 ? 544 CYS A O    9  
ATOM   5078  C  CB   . CYS A 1 16 ? -1.305  8.304   4.977   1.00 0.00 ? 544 CYS A CB   9  
ATOM   5079  S  SG   . CYS A 1 16 ? -0.736  6.986   3.876   1.00 0.00 ? 544 CYS A SG   9  
ATOM   5080  H  H    . CYS A 1 16 ? -1.516  6.222   6.803   1.00 0.00 ? 544 CYS A H    9  
ATOM   5081  H  HA   . CYS A 1 16 ? -2.874  8.796   6.348   1.00 0.00 ? 544 CYS A HA   9  
ATOM   5082  H  HB2  . CYS A 1 16 ? -1.631  9.126   4.359   1.00 0.00 ? 544 CYS A HB2  9  
ATOM   5083  H  HB3  . CYS A 1 16 ? -0.461  8.622   5.571   1.00 0.00 ? 544 CYS A HB3  9  
ATOM   5084  N  N    . GLY A 1 17 ? -3.969  7.761   4.033   1.00 0.00 ? 545 GLY A N    9  
ATOM   5085  C  CA   . GLY A 1 17 ? -5.003  7.151   3.218   1.00 0.00 ? 545 GLY A CA   9  
ATOM   5086  C  C    . GLY A 1 17 ? -4.770  7.365   1.735   1.00 0.00 ? 545 GLY A C    9  
ATOM   5087  O  O    . GLY A 1 17 ? -5.714  7.593   0.978   1.00 0.00 ? 545 GLY A O    9  
ATOM   5088  H  H    . GLY A 1 17 ? -3.580  8.619   3.765   1.00 0.00 ? 545 GLY A H    9  
ATOM   5089  H  HA2  . GLY A 1 17 ? -5.025  6.090   3.418   1.00 0.00 ? 545 GLY A HA2  9  
ATOM   5090  H  HA3  . GLY A 1 17 ? -5.958  7.578   3.487   1.00 0.00 ? 545 GLY A HA3  9  
ATOM   5091  N  N    . LYS A 1 18 ? -3.510  7.294   1.321   1.00 0.00 ? 546 LYS A N    9  
ATOM   5092  C  CA   . LYS A 1 18 ? -3.154  7.483   -0.081  1.00 0.00 ? 546 LYS A CA   9  
ATOM   5093  C  C    . LYS A 1 18 ? -3.679  6.335   -0.936  1.00 0.00 ? 546 LYS A C    9  
ATOM   5094  O  O    . LYS A 1 18 ? -4.428  5.483   -0.457  1.00 0.00 ? 546 LYS A O    9  
ATOM   5095  C  CB   . LYS A 1 18 ? -1.635  7.597   -0.233  1.00 0.00 ? 546 LYS A CB   9  
ATOM   5096  C  CG   . LYS A 1 18 ? -0.889  6.320   0.118   1.00 0.00 ? 546 LYS A CG   9  
ATOM   5097  C  CD   . LYS A 1 18 ? 0.540   6.609   0.549   1.00 0.00 ? 546 LYS A CD   9  
ATOM   5098  C  CE   . LYS A 1 18 ? 1.531   6.336   -0.573  1.00 0.00 ? 546 LYS A CE   9  
ATOM   5099  N  NZ   . LYS A 1 18 ? 2.137   7.590   -1.098  1.00 0.00 ? 546 LYS A NZ   9  
ATOM   5100  H  H    . LYS A 1 18 ? -2.801  7.110   1.973   1.00 0.00 ? 546 LYS A H    9  
ATOM   5101  H  HA   . LYS A 1 18 ? -3.609  8.403   -0.416  1.00 0.00 ? 546 LYS A HA   9  
ATOM   5102  H  HB2  . LYS A 1 18 ? -1.405  7.853   -1.256  1.00 0.00 ? 546 LYS A HB2  9  
ATOM   5103  H  HB3  . LYS A 1 18 ? -1.279  8.385   0.415   1.00 0.00 ? 546 LYS A HB3  9  
ATOM   5104  H  HG2  . LYS A 1 18 ? -1.404  5.823   0.926   1.00 0.00 ? 546 LYS A HG2  9  
ATOM   5105  H  HG3  . LYS A 1 18 ? -0.871  5.676   -0.750  1.00 0.00 ? 546 LYS A HG3  9  
ATOM   5106  H  HD2  . LYS A 1 18 ? 0.616   7.647   0.836   1.00 0.00 ? 546 LYS A HD2  9  
ATOM   5107  H  HD3  . LYS A 1 18 ? 0.784   5.982   1.394   1.00 0.00 ? 546 LYS A HD3  9  
ATOM   5108  H  HE2  . LYS A 1 18 ? 2.316   5.699   -0.194  1.00 0.00 ? 546 LYS A HE2  9  
ATOM   5109  H  HE3  . LYS A 1 18 ? 1.016   5.830   -1.377  1.00 0.00 ? 546 LYS A HE3  9  
ATOM   5110  H  HZ1  . LYS A 1 18 ? 2.181   8.308   -0.346  1.00 0.00 ? 546 LYS A HZ1  9  
ATOM   5111  H  HZ2  . LYS A 1 18 ? 1.566   7.962   -1.884  1.00 0.00 ? 546 LYS A HZ2  9  
ATOM   5112  H  HZ3  . LYS A 1 18 ? 3.101   7.405   -1.442  1.00 0.00 ? 546 LYS A HZ3  9  
ATOM   5113  N  N    . VAL A 1 19 ? -3.283  6.318   -2.204  1.00 0.00 ? 547 VAL A N    9  
ATOM   5114  C  CA   . VAL A 1 19 ? -3.715  5.274   -3.125  1.00 0.00 ? 547 VAL A CA   9  
ATOM   5115  C  C    . VAL A 1 19 ? -2.686  5.049   -4.227  1.00 0.00 ? 547 VAL A C    9  
ATOM   5116  O  O    . VAL A 1 19 ? -2.163  6.001   -4.807  1.00 0.00 ? 547 VAL A O    9  
ATOM   5117  C  CB   . VAL A 1 19 ? -5.071  5.618   -3.770  1.00 0.00 ? 547 VAL A CB   9  
ATOM   5118  C  CG1  . VAL A 1 19 ? -5.598  4.437   -4.570  1.00 0.00 ? 547 VAL A CG1  9  
ATOM   5119  C  CG2  . VAL A 1 19 ? -6.074  6.045   -2.709  1.00 0.00 ? 547 VAL A CG2  9  
ATOM   5120  H  H    . VAL A 1 19 ? -2.686  7.024   -2.528  1.00 0.00 ? 547 VAL A H    9  
ATOM   5121  H  HA   . VAL A 1 19 ? -3.831  4.359   -2.562  1.00 0.00 ? 547 VAL A HA   9  
ATOM   5122  H  HB   . VAL A 1 19 ? -4.923  6.446   -4.448  1.00 0.00 ? 547 VAL A HB   9  
ATOM   5123  H  HG11 . VAL A 1 19 ? -6.331  3.903   -3.983  1.00 0.00 ? 547 VAL A HG11 9  
ATOM   5124  H  HG12 . VAL A 1 19 ? -4.781  3.775   -4.815  1.00 0.00 ? 547 VAL A HG12 9  
ATOM   5125  H  HG13 . VAL A 1 19 ? -6.057  4.795   -5.480  1.00 0.00 ? 547 VAL A HG13 9  
ATOM   5126  H  HG21 . VAL A 1 19 ? -6.135  5.285   -1.944  1.00 0.00 ? 547 VAL A HG21 9  
ATOM   5127  H  HG22 . VAL A 1 19 ? -7.045  6.175   -3.164  1.00 0.00 ? 547 VAL A HG22 9  
ATOM   5128  H  HG23 . VAL A 1 19 ? -5.756  6.977   -2.266  1.00 0.00 ? 547 VAL A HG23 9  
ATOM   5129  N  N    . TYR A 1 20 ? -2.402  3.783   -4.514  1.00 0.00 ? 548 TYR A N    9  
ATOM   5130  C  CA   . TYR A 1 20 ? -1.438  3.429   -5.550  1.00 0.00 ? 548 TYR A CA   9  
ATOM   5131  C  C    . TYR A 1 20 ? -1.832  2.123   -6.233  1.00 0.00 ? 548 TYR A C    9  
ATOM   5132  O  O    . TYR A 1 20 ? -2.394  1.227   -5.605  1.00 0.00 ? 548 TYR A O    9  
ATOM   5133  C  CB   . TYR A 1 20 ? -0.024  3.309   -4.965  1.00 0.00 ? 548 TYR A CB   9  
ATOM   5134  C  CG   . TYR A 1 20 ? 0.014   2.982   -3.487  1.00 0.00 ? 548 TYR A CG   9  
ATOM   5135  C  CD1  . TYR A 1 20 ? -0.843  2.034   -2.941  1.00 0.00 ? 548 TYR A CD1  9  
ATOM   5136  C  CD2  . TYR A 1 20 ? 0.909   3.621   -2.639  1.00 0.00 ? 548 TYR A CD2  9  
ATOM   5137  C  CE1  . TYR A 1 20 ? -0.809  1.734   -1.592  1.00 0.00 ? 548 TYR A CE1  9  
ATOM   5138  C  CE2  . TYR A 1 20 ? 0.950   3.326   -1.289  1.00 0.00 ? 548 TYR A CE2  9  
ATOM   5139  C  CZ   . TYR A 1 20 ? 0.089   2.382   -0.771  1.00 0.00 ? 548 TYR A CZ   9  
ATOM   5140  O  OH   . TYR A 1 20 ? 0.125   2.086   0.572   1.00 0.00 ? 548 TYR A OH   9  
ATOM   5141  H  H    . TYR A 1 20 ? -2.854  3.068   -4.018  1.00 0.00 ? 548 TYR A H    9  
ATOM   5142  H  HA   . TYR A 1 20 ? -1.444  4.219   -6.287  1.00 0.00 ? 548 TYR A HA   9  
ATOM   5143  H  HB2  . TYR A 1 20 ? 0.507   2.528   -5.488  1.00 0.00 ? 548 TYR A HB2  9  
ATOM   5144  H  HB3  . TYR A 1 20 ? 0.495   4.246   -5.110  1.00 0.00 ? 548 TYR A HB3  9  
ATOM   5145  H  HD1  . TYR A 1 20 ? -1.545  1.528   -3.585  1.00 0.00 ? 548 TYR A HD1  9  
ATOM   5146  H  HD2  . TYR A 1 20 ? 1.583   4.360   -3.047  1.00 0.00 ? 548 TYR A HD2  9  
ATOM   5147  H  HE1  . TYR A 1 20 ? -1.484  0.995   -1.186  1.00 0.00 ? 548 TYR A HE1  9  
ATOM   5148  H  HE2  . TYR A 1 20 ? 1.653   3.834   -0.646  1.00 0.00 ? 548 TYR A HE2  9  
ATOM   5149  H  HH   . TYR A 1 20 ? 0.966   1.675   0.786   1.00 0.00 ? 548 TYR A HH   9  
ATOM   5150  N  N    . GLY A 1 21 ? -1.535  2.023   -7.525  1.00 0.00 ? 549 GLY A N    9  
ATOM   5151  C  CA   . GLY A 1 21 ? -1.868  0.824   -8.270  1.00 0.00 ? 549 GLY A CA   9  
ATOM   5152  C  C    . GLY A 1 21 ? -0.664  -0.065  -8.510  1.00 0.00 ? 549 GLY A C    9  
ATOM   5153  O  O    . GLY A 1 21 ? -0.581  -0.746  -9.532  1.00 0.00 ? 549 GLY A O    9  
ATOM   5154  H  H    . GLY A 1 21 ? -1.088  2.770   -7.975  1.00 0.00 ? 549 GLY A H    9  
ATOM   5155  H  HA2  . GLY A 1 21 ? -2.610  0.265   -7.719  1.00 0.00 ? 549 GLY A HA2  9  
ATOM   5156  H  HA3  . GLY A 1 21 ? -2.285  1.111   -9.224  1.00 0.00 ? 549 GLY A HA3  9  
ATOM   5157  N  N    . LYS A 1 22 ? 0.270   -0.059  -7.565  1.00 0.00 ? 550 LYS A N    9  
ATOM   5158  C  CA   . LYS A 1 22 ? 1.476   -0.871  -7.678  1.00 0.00 ? 550 LYS A CA   9  
ATOM   5159  C  C    . LYS A 1 22 ? 1.974   -1.300  -6.302  1.00 0.00 ? 550 LYS A C    9  
ATOM   5160  O  O    . LYS A 1 22 ? 2.337   -0.465  -5.474  1.00 0.00 ? 550 LYS A O    9  
ATOM   5161  C  CB   . LYS A 1 22 ? 2.572   -0.096  -8.412  1.00 0.00 ? 550 LYS A CB   9  
ATOM   5162  C  CG   . LYS A 1 22 ? 3.428   -0.965  -9.318  1.00 0.00 ? 550 LYS A CG   9  
ATOM   5163  C  CD   . LYS A 1 22 ? 4.445   -0.137  -10.086 1.00 0.00 ? 550 LYS A CD   9  
ATOM   5164  C  CE   . LYS A 1 22 ? 3.923   0.254   -11.458 1.00 0.00 ? 550 LYS A CE   9  
ATOM   5165  N  NZ   . LYS A 1 22 ? 5.014   0.318   -12.470 1.00 0.00 ? 550 LYS A NZ   9  
ATOM   5166  H  H    . LYS A 1 22 ? 0.146   0.505   -6.773  1.00 0.00 ? 550 LYS A H    9  
ATOM   5167  H  HA   . LYS A 1 22 ? 1.228   -1.754  -8.249  1.00 0.00 ? 550 LYS A HA   9  
ATOM   5168  H  HB2  . LYS A 1 22 ? 2.111   0.672   -9.016  1.00 0.00 ? 550 LYS A HB2  9  
ATOM   5169  H  HB3  . LYS A 1 22 ? 3.217   0.370   -7.682  1.00 0.00 ? 550 LYS A HB3  9  
ATOM   5170  H  HG2  . LYS A 1 22 ? 3.952   -1.692  -8.715  1.00 0.00 ? 550 LYS A HG2  9  
ATOM   5171  H  HG3  . LYS A 1 22 ? 2.787   -1.475  -10.023 1.00 0.00 ? 550 LYS A HG3  9  
ATOM   5172  H  HD2  . LYS A 1 22 ? 4.661   0.760   -9.525  1.00 0.00 ? 550 LYS A HD2  9  
ATOM   5173  H  HD3  . LYS A 1 22 ? 5.350   -0.716  -10.205 1.00 0.00 ? 550 LYS A HD3  9  
ATOM   5174  H  HE2  . LYS A 1 22 ? 3.194   -0.477  -11.774 1.00 0.00 ? 550 LYS A HE2  9  
ATOM   5175  H  HE3  . LYS A 1 22 ? 3.452   1.224   -11.387 1.00 0.00 ? 550 LYS A HE3  9  
ATOM   5176  H  HZ1  . LYS A 1 22 ? 5.314   -0.643  -12.733 1.00 0.00 ? 550 LYS A HZ1  9  
ATOM   5177  H  HZ2  . LYS A 1 22 ? 5.831   0.830   -12.084 1.00 0.00 ? 550 LYS A HZ2  9  
ATOM   5178  H  HZ3  . LYS A 1 22 ? 4.681   0.811   -13.324 1.00 0.00 ? 550 LYS A HZ3  9  
ATOM   5179  N  N    . THR A 1 23 ? 1.991   -2.608  -6.065  1.00 0.00 ? 551 THR A N    9  
ATOM   5180  C  CA   . THR A 1 23 ? 2.446   -3.148  -4.790  1.00 0.00 ? 551 THR A CA   9  
ATOM   5181  C  C    . THR A 1 23 ? 3.887   -2.737  -4.507  1.00 0.00 ? 551 THR A C    9  
ATOM   5182  O  O    . THR A 1 23 ? 4.288   -2.597  -3.351  1.00 0.00 ? 551 THR A O    9  
ATOM   5183  C  CB   . THR A 1 23 ? 2.330   -4.673  -4.787  1.00 0.00 ? 551 THR A CB   9  
ATOM   5184  O  OG1  . THR A 1 23 ? 2.662   -5.204  -6.057  1.00 0.00 ? 551 THR A OG1  9  
ATOM   5185  C  CG2  . THR A 1 23 ? 0.944   -5.167  -4.432  1.00 0.00 ? 551 THR A CG2  9  
ATOM   5186  H  H    . THR A 1 23 ? 1.690   -3.225  -6.765  1.00 0.00 ? 551 THR A H    9  
ATOM   5187  H  HA   . THR A 1 23 ? 1.811   -2.746  -4.014  1.00 0.00 ? 551 THR A HA   9  
ATOM   5188  H  HB   . THR A 1 23 ? 3.020   -5.075  -4.060  1.00 0.00 ? 551 THR A HB   9  
ATOM   5189  H  HG1  . THR A 1 23 ? 3.516   -5.641  -6.009  1.00 0.00 ? 551 THR A HG1  9  
ATOM   5190  H  HG21 . THR A 1 23 ? 0.205   -4.535  -4.902  1.00 0.00 ? 551 THR A HG21 9  
ATOM   5191  H  HG22 . THR A 1 23 ? 0.814   -5.136  -3.360  1.00 0.00 ? 551 THR A HG22 9  
ATOM   5192  H  HG23 . THR A 1 23 ? 0.823   -6.182  -4.780  1.00 0.00 ? 551 THR A HG23 9  
ATOM   5193  N  N    . SER A 1 24 ? 4.663   -2.542  -5.569  1.00 0.00 ? 552 SER A N    9  
ATOM   5194  C  CA   . SER A 1 24 ? 6.059   -2.144  -5.432  1.00 0.00 ? 552 SER A CA   9  
ATOM   5195  C  C    . SER A 1 24 ? 6.175   -0.824  -4.678  1.00 0.00 ? 552 SER A C    9  
ATOM   5196  O  O    . SER A 1 24 ? 7.139   -0.597  -3.948  1.00 0.00 ? 552 SER A O    9  
ATOM   5197  C  CB   . SER A 1 24 ? 6.712   -2.017  -6.810  1.00 0.00 ? 552 SER A CB   9  
ATOM   5198  O  OG   . SER A 1 24 ? 7.174   -3.273  -7.274  1.00 0.00 ? 552 SER A OG   9  
ATOM   5199  H  H    . SER A 1 24 ? 4.287   -2.667  -6.465  1.00 0.00 ? 552 SER A H    9  
ATOM   5200  H  HA   . SER A 1 24 ? 6.569   -2.912  -4.871  1.00 0.00 ? 552 SER A HA   9  
ATOM   5201  H  HB2  . SER A 1 24 ? 5.991   -1.630  -7.514  1.00 0.00 ? 552 SER A HB2  9  
ATOM   5202  H  HB3  . SER A 1 24 ? 7.551   -1.339  -6.746  1.00 0.00 ? 552 SER A HB3  9  
ATOM   5203  H  HG   . SER A 1 24 ? 7.510   -3.181  -8.168  1.00 0.00 ? 552 SER A HG   9  
ATOM   5204  N  N    . HIS A 1 25 ? 5.183   0.043   -4.857  1.00 0.00 ? 553 HIS A N    9  
ATOM   5205  C  CA   . HIS A 1 25 ? 5.173   1.340   -4.191  1.00 0.00 ? 553 HIS A CA   9  
ATOM   5206  C  C    . HIS A 1 25 ? 4.792   1.191   -2.723  1.00 0.00 ? 553 HIS A C    9  
ATOM   5207  O  O    . HIS A 1 25 ? 5.262   1.943   -1.869  1.00 0.00 ? 553 HIS A O    9  
ATOM   5208  C  CB   . HIS A 1 25 ? 4.201   2.292   -4.893  1.00 0.00 ? 553 HIS A CB   9  
ATOM   5209  C  CG   . HIS A 1 25 ? 4.800   3.624   -5.220  1.00 0.00 ? 553 HIS A CG   9  
ATOM   5210  N  ND1  . HIS A 1 25 ? 5.101   4.583   -4.279  1.00 0.00 ? 553 HIS A ND1  9  
ATOM   5211  C  CD2  . HIS A 1 25 ? 5.155   4.152   -6.419  1.00 0.00 ? 553 HIS A CD2  9  
ATOM   5212  C  CE1  . HIS A 1 25 ? 5.618   5.640   -4.920  1.00 0.00 ? 553 HIS A CE1  9  
ATOM   5213  N  NE2  . HIS A 1 25 ? 5.673   5.429   -6.221  1.00 0.00 ? 553 HIS A NE2  9  
ATOM   5214  H  H    . HIS A 1 25 ? 4.440   -0.196  -5.450  1.00 0.00 ? 553 HIS A H    9  
ATOM   5215  H  HA   . HIS A 1 25 ? 6.171   1.750   -4.250  1.00 0.00 ? 553 HIS A HA   9  
ATOM   5216  H  HB2  . HIS A 1 25 ? 3.871   1.841   -5.817  1.00 0.00 ? 553 HIS A HB2  9  
ATOM   5217  H  HB3  . HIS A 1 25 ? 3.345   2.459   -4.255  1.00 0.00 ? 553 HIS A HB3  9  
ATOM   5218  H  HD1  . HIS A 1 25 ? 4.962   4.506   -3.312  1.00 0.00 ? 553 HIS A HD1  9  
ATOM   5219  H  HD2  . HIS A 1 25 ? 5.056   3.669   -7.380  1.00 0.00 ? 553 HIS A HD2  9  
ATOM   5220  H  HE1  . HIS A 1 25 ? 5.949   6.546   -4.434  1.00 0.00 ? 553 HIS A HE1  9  
ATOM   5221  N  N    . LEU A 1 26 ? 3.940   0.211   -2.435  1.00 0.00 ? 554 LEU A N    9  
ATOM   5222  C  CA   . LEU A 1 26 ? 3.500   -0.040  -1.068  1.00 0.00 ? 554 LEU A CA   9  
ATOM   5223  C  C    . LEU A 1 26 ? 4.697   -0.293  -0.157  1.00 0.00 ? 554 LEU A C    9  
ATOM   5224  O  O    . LEU A 1 26 ? 4.762   0.221   0.959   1.00 0.00 ? 554 LEU A O    9  
ATOM   5225  C  CB   . LEU A 1 26 ? 2.549   -1.237  -1.026  1.00 0.00 ? 554 LEU A CB   9  
ATOM   5226  C  CG   . LEU A 1 26 ? 1.645   -1.303  0.207   1.00 0.00 ? 554 LEU A CG   9  
ATOM   5227  C  CD1  . LEU A 1 26 ? 0.265   -1.821  -0.169  1.00 0.00 ? 554 LEU A CD1  9  
ATOM   5228  C  CD2  . LEU A 1 26 ? 2.272   -2.182  1.279   1.00 0.00 ? 554 LEU A CD2  9  
ATOM   5229  H  H    . LEU A 1 26 ? 3.602   -0.357  -3.158  1.00 0.00 ? 554 LEU A H    9  
ATOM   5230  H  HA   . LEU A 1 26 ? 2.977   0.838   -0.721  1.00 0.00 ? 554 LEU A HA   9  
ATOM   5231  H  HB2  . LEU A 1 26 ? 1.922   -1.202  -1.906  1.00 0.00 ? 554 LEU A HB2  9  
ATOM   5232  H  HB3  . LEU A 1 26 ? 3.139   -2.140  -1.061  1.00 0.00 ? 554 LEU A HB3  9  
ATOM   5233  H  HG   . LEU A 1 26 ? 1.529   -0.309  0.614   1.00 0.00 ? 554 LEU A HG   9  
ATOM   5234  H  HD11 . LEU A 1 26 ? -0.477  -1.362  0.468   1.00 0.00 ? 554 LEU A HD11 9  
ATOM   5235  H  HD12 . LEU A 1 26 ? 0.235   -2.893  -0.041  1.00 0.00 ? 554 LEU A HD12 9  
ATOM   5236  H  HD13 . LEU A 1 26 ? 0.056   -1.574  -1.199  1.00 0.00 ? 554 LEU A HD13 9  
ATOM   5237  H  HD21 . LEU A 1 26 ? 3.155   -1.699  1.669   1.00 0.00 ? 554 LEU A HD21 9  
ATOM   5238  H  HD22 . LEU A 1 26 ? 2.544   -3.135  0.849   1.00 0.00 ? 554 LEU A HD22 9  
ATOM   5239  H  HD23 . LEU A 1 26 ? 1.563   -2.336  2.078   1.00 0.00 ? 554 LEU A HD23 9  
ATOM   5240  N  N    . ARG A 1 27 ? 5.642   -1.088  -0.646  1.00 0.00 ? 555 ARG A N    9  
ATOM   5241  C  CA   . ARG A 1 27 ? 6.840   -1.413  0.114   1.00 0.00 ? 555 ARG A CA   9  
ATOM   5242  C  C    . ARG A 1 27 ? 7.623   -0.155  0.471   1.00 0.00 ? 555 ARG A C    9  
ATOM   5243  O  O    . ARG A 1 27 ? 7.970   0.064   1.632   1.00 0.00 ? 555 ARG A O    9  
ATOM   5244  C  CB   . ARG A 1 27 ? 7.726   -2.366  -0.687  1.00 0.00 ? 555 ARG A CB   9  
ATOM   5245  C  CG   . ARG A 1 27 ? 8.039   -3.653  0.049   1.00 0.00 ? 555 ARG A CG   9  
ATOM   5246  C  CD   . ARG A 1 27 ? 9.055   -4.496  -0.705  1.00 0.00 ? 555 ARG A CD   9  
ATOM   5247  N  NE   . ARG A 1 27 ? 8.487   -5.086  -1.916  1.00 0.00 ? 555 ARG A NE   9  
ATOM   5248  C  CZ   . ARG A 1 27 ? 7.764   -6.204  -1.928  1.00 0.00 ? 555 ARG A CZ   9  
ATOM   5249  N  NH1  . ARG A 1 27 ? 7.512   -6.854  -0.799  1.00 0.00 ? 555 ARG A NH1  9  
ATOM   5250  N  NH2  . ARG A 1 27 ? 7.289   -6.672  -3.074  1.00 0.00 ? 555 ARG A NH2  9  
ATOM   5251  H  H    . ARG A 1 27 ? 5.532   -1.467  -1.542  1.00 0.00 ? 555 ARG A H    9  
ATOM   5252  H  HA   . ARG A 1 27 ? 6.533   -1.902  1.026   1.00 0.00 ? 555 ARG A HA   9  
ATOM   5253  H  HB2  . ARG A 1 27 ? 7.224   -2.617  -1.610  1.00 0.00 ? 555 ARG A HB2  9  
ATOM   5254  H  HB3  . ARG A 1 27 ? 8.659   -1.871  -0.917  1.00 0.00 ? 555 ARG A HB3  9  
ATOM   5255  H  HG2  . ARG A 1 27 ? 8.439   -3.408  1.022   1.00 0.00 ? 555 ARG A HG2  9  
ATOM   5256  H  HG3  . ARG A 1 27 ? 7.126   -4.218  0.163   1.00 0.00 ? 555 ARG A HG3  9  
ATOM   5257  H  HD2  . ARG A 1 27 ? 9.890   -3.868  -0.981  1.00 0.00 ? 555 ARG A HD2  9  
ATOM   5258  H  HD3  . ARG A 1 27 ? 9.400   -5.287  -0.057  1.00 0.00 ? 555 ARG A HD3  9  
ATOM   5259  H  HE   . ARG A 1 27 ? 8.655   -4.626  -2.764  1.00 0.00 ? 555 ARG A HE   9  
ATOM   5260  H  HH11 . ARG A 1 27 ? 7.865   -6.506  0.069   1.00 0.00 ? 555 ARG A HH11 9  
ATOM   5261  H  HH12 . ARG A 1 27 ? 6.968   -7.693  -0.816  1.00 0.00 ? 555 ARG A HH12 9  
ATOM   5262  H  HH21 . ARG A 1 27 ? 7.475   -6.186  -3.928  1.00 0.00 ? 555 ARG A HH21 9  
ATOM   5263  H  HH22 . ARG A 1 27 ? 6.746   -7.512  -3.085  1.00 0.00 ? 555 ARG A HH22 9  
ATOM   5264  N  N    . ALA A 1 28 ? 7.904   0.667   -0.535  1.00 0.00 ? 556 ALA A N    9  
ATOM   5265  C  CA   . ALA A 1 28 ? 8.652   1.899   -0.323  1.00 0.00 ? 556 ALA A CA   9  
ATOM   5266  C  C    . ALA A 1 28 ? 7.950   2.800   0.686   1.00 0.00 ? 556 ALA A C    9  
ATOM   5267  O  O    . ALA A 1 28 ? 8.597   3.511   1.455   1.00 0.00 ? 556 ALA A O    9  
ATOM   5268  C  CB   . ALA A 1 28 ? 8.850   2.630   -1.642  1.00 0.00 ? 556 ALA A CB   9  
ATOM   5269  H  H    . ALA A 1 28 ? 7.604   0.438   -1.440  1.00 0.00 ? 556 ALA A H    9  
ATOM   5270  H  HA   . ALA A 1 28 ? 9.625   1.632   0.064   1.00 0.00 ? 556 ALA A HA   9  
ATOM   5271  H  HB1  . ALA A 1 28 ? 9.839   3.063   -1.669  1.00 0.00 ? 556 ALA A HB1  9  
ATOM   5272  H  HB2  . ALA A 1 28 ? 8.112   3.413   -1.734  1.00 0.00 ? 556 ALA A HB2  9  
ATOM   5273  H  HB3  . ALA A 1 28 ? 8.739   1.933   -2.460  1.00 0.00 ? 556 ALA A HB3  9  
ATOM   5274  N  N    . HIS A 1 29 ? 6.623   2.766   0.677   1.00 0.00 ? 557 HIS A N    9  
ATOM   5275  C  CA   . HIS A 1 29 ? 5.833   3.577   1.589   1.00 0.00 ? 557 HIS A CA   9  
ATOM   5276  C  C    . HIS A 1 29 ? 5.778   2.940   2.976   1.00 0.00 ? 557 HIS A C    9  
ATOM   5277  O  O    . HIS A 1 29 ? 5.816   3.635   3.991   1.00 0.00 ? 557 HIS A O    9  
ATOM   5278  C  CB   . HIS A 1 29 ? 4.416   3.768   1.038   1.00 0.00 ? 557 HIS A CB   9  
ATOM   5279  C  CG   . HIS A 1 29 ? 3.471   4.397   2.016   1.00 0.00 ? 557 HIS A CG   9  
ATOM   5280  N  ND1  . HIS A 1 29 ? 3.813   5.432   2.856   1.00 0.00 ? 557 HIS A ND1  9  
ATOM   5281  C  CD2  . HIS A 1 29 ? 2.174   4.106   2.288   1.00 0.00 ? 557 HIS A CD2  9  
ATOM   5282  C  CE1  . HIS A 1 29 ? 2.739   5.730   3.599   1.00 0.00 ? 557 HIS A CE1  9  
ATOM   5283  N  NE2  . HIS A 1 29 ? 1.718   4.953   3.293   1.00 0.00 ? 557 HIS A NE2  9  
ATOM   5284  H  H    . HIS A 1 29 ? 6.164   2.184   0.043   1.00 0.00 ? 557 HIS A H    9  
ATOM   5285  H  HA   . HIS A 1 29 ? 6.311   4.538   1.666   1.00 0.00 ? 557 HIS A HA   9  
ATOM   5286  H  HB2  . HIS A 1 29 ? 4.460   4.402   0.165   1.00 0.00 ? 557 HIS A HB2  9  
ATOM   5287  H  HB3  . HIS A 1 29 ? 4.014   2.806   0.758   1.00 0.00 ? 557 HIS A HB3  9  
ATOM   5288  H  HD1  . HIS A 1 29 ? 4.687   5.873   2.903   1.00 0.00 ? 557 HIS A HD1  9  
ATOM   5289  H  HD2  . HIS A 1 29 ? 1.581   3.341   1.809   1.00 0.00 ? 557 HIS A HD2  9  
ATOM   5290  H  HE1  . HIS A 1 29 ? 2.713   6.505   4.351   1.00 0.00 ? 557 HIS A HE1  9  
ATOM   5291  N  N    . LEU A 1 30 ? 5.683   1.614   3.011   1.00 0.00 ? 558 LEU A N    9  
ATOM   5292  C  CA   . LEU A 1 30 ? 5.618   0.887   4.273   1.00 0.00 ? 558 LEU A CA   9  
ATOM   5293  C  C    . LEU A 1 30 ? 6.860   1.148   5.120   1.00 0.00 ? 558 LEU A C    9  
ATOM   5294  O  O    . LEU A 1 30 ? 6.765   1.367   6.327   1.00 0.00 ? 558 LEU A O    9  
ATOM   5295  C  CB   . LEU A 1 30 ? 5.469   -0.614  4.015   1.00 0.00 ? 558 LEU A CB   9  
ATOM   5296  C  CG   . LEU A 1 30 ? 4.603   -1.363  5.030   1.00 0.00 ? 558 LEU A CG   9  
ATOM   5297  C  CD1  . LEU A 1 30 ? 3.181   -1.513  4.511   1.00 0.00 ? 558 LEU A CD1  9  
ATOM   5298  C  CD2  . LEU A 1 30 ? 5.204   -2.725  5.343   1.00 0.00 ? 558 LEU A CD2  9  
ATOM   5299  H  H    . LEU A 1 30 ? 5.654   1.113   2.169   1.00 0.00 ? 558 LEU A H    9  
ATOM   5300  H  HA   . LEU A 1 30 ? 4.750   1.238   4.812   1.00 0.00 ? 558 LEU A HA   9  
ATOM   5301  H  HB2  . LEU A 1 30 ? 5.036   -0.747  3.034   1.00 0.00 ? 558 LEU A HB2  9  
ATOM   5302  H  HB3  . LEU A 1 30 ? 6.453   -1.057  4.018   1.00 0.00 ? 558 LEU A HB3  9  
ATOM   5303  H  HG   . LEU A 1 30 ? 4.563   -0.795  5.948   1.00 0.00 ? 558 LEU A HG   9  
ATOM   5304  H  HD11 . LEU A 1 30 ? 2.935   -0.668  3.886   1.00 0.00 ? 558 LEU A HD11 9  
ATOM   5305  H  HD12 . LEU A 1 30 ? 2.496   -1.557  5.344   1.00 0.00 ? 558 LEU A HD12 9  
ATOM   5306  H  HD13 . LEU A 1 30 ? 3.103   -2.422  3.933   1.00 0.00 ? 558 LEU A HD13 9  
ATOM   5307  H  HD21 . LEU A 1 30 ? 5.797   -3.059  4.504   1.00 0.00 ? 558 LEU A HD21 9  
ATOM   5308  H  HD22 . LEU A 1 30 ? 4.412   -3.435  5.529   1.00 0.00 ? 558 LEU A HD22 9  
ATOM   5309  H  HD23 . LEU A 1 30 ? 5.832   -2.649  6.219   1.00 0.00 ? 558 LEU A HD23 9  
ATOM   5310  N  N    . ARG A 1 31 ? 8.024   1.122   4.479   1.00 0.00 ? 559 ARG A N    9  
ATOM   5311  C  CA   . ARG A 1 31 ? 9.284   1.356   5.175   1.00 0.00 ? 559 ARG A CA   9  
ATOM   5312  C  C    . ARG A 1 31 ? 9.295   2.730   5.837   1.00 0.00 ? 559 ARG A C    9  
ATOM   5313  O  O    . ARG A 1 31 ? 9.940   2.929   6.866   1.00 0.00 ? 559 ARG A O    9  
ATOM   5314  C  CB   . ARG A 1 31 ? 10.460  1.234   4.203   1.00 0.00 ? 559 ARG A CB   9  
ATOM   5315  C  CG   . ARG A 1 31 ? 10.399  2.218   3.047   1.00 0.00 ? 559 ARG A CG   9  
ATOM   5316  C  CD   . ARG A 1 31 ? 11.786  2.706   2.657   1.00 0.00 ? 559 ARG A CD   9  
ATOM   5317  N  NE   . ARG A 1 31 ? 11.736  3.965   1.918   1.00 0.00 ? 559 ARG A NE   9  
ATOM   5318  C  CZ   . ARG A 1 31 ? 12.779  4.779   1.769   1.00 0.00 ? 559 ARG A CZ   9  
ATOM   5319  N  NH1  . ARG A 1 31 ? 13.953  4.469   2.303   1.00 0.00 ? 559 ARG A NH1  9  
ATOM   5320  N  NH2  . ARG A 1 31 ? 12.647  5.906   1.082   1.00 0.00 ? 559 ARG A NH2  9  
ATOM   5321  H  H    . ARG A 1 31 ? 8.036   0.942   3.516   1.00 0.00 ? 559 ARG A H    9  
ATOM   5322  H  HA   . ARG A 1 31 ? 9.383   0.601   5.941   1.00 0.00 ? 559 ARG A HA   9  
ATOM   5323  H  HB2  . ARG A 1 31 ? 11.378  1.404   4.745   1.00 0.00 ? 559 ARG A HB2  9  
ATOM   5324  H  HB3  . ARG A 1 31 ? 10.473  0.234   3.796   1.00 0.00 ? 559 ARG A HB3  9  
ATOM   5325  H  HG2  . ARG A 1 31 ? 9.948   1.731   2.195   1.00 0.00 ? 559 ARG A HG2  9  
ATOM   5326  H  HG3  . ARG A 1 31 ? 9.798   3.066   3.339   1.00 0.00 ? 559 ARG A HG3  9  
ATOM   5327  H  HD2  . ARG A 1 31 ? 12.368  2.850   3.555   1.00 0.00 ? 559 ARG A HD2  9  
ATOM   5328  H  HD3  . ARG A 1 31 ? 12.257  1.955   2.040   1.00 0.00 ? 559 ARG A HD3  9  
ATOM   5329  H  HE   . ARG A 1 31 ? 10.880  4.219   1.513   1.00 0.00 ? 559 ARG A HE   9  
ATOM   5330  H  HH11 . ARG A 1 31 ? 14.060  3.620   2.822   1.00 0.00 ? 559 ARG A HH11 9  
ATOM   5331  H  HH12 . ARG A 1 31 ? 14.733  5.084   2.187   1.00 0.00 ? 559 ARG A HH12 9  
ATOM   5332  H  HH21 . ARG A 1 31 ? 11.764  6.144   0.677   1.00 0.00 ? 559 ARG A HH21 9  
ATOM   5333  H  HH22 . ARG A 1 31 ? 13.430  6.518   0.970   1.00 0.00 ? 559 ARG A HH22 9  
ATOM   5334  N  N    . TRP A 1 32 ? 8.575   3.676   5.241   1.00 0.00 ? 560 TRP A N    9  
ATOM   5335  C  CA   . TRP A 1 32 ? 8.502   5.031   5.773   1.00 0.00 ? 560 TRP A CA   9  
ATOM   5336  C  C    . TRP A 1 32 ? 7.722   5.059   7.084   1.00 0.00 ? 560 TRP A C    9  
ATOM   5337  O  O    . TRP A 1 32 ? 8.075   5.787   8.012   1.00 0.00 ? 560 TRP A O    9  
ATOM   5338  C  CB   . TRP A 1 32 ? 7.846   5.967   4.756   1.00 0.00 ? 560 TRP A CB   9  
ATOM   5339  C  CG   . TRP A 1 32 ? 8.503   7.310   4.674   1.00 0.00 ? 560 TRP A CG   9  
ATOM   5340  C  CD1  . TRP A 1 32 ? 8.842   8.122   5.719   1.00 0.00 ? 560 TRP A CD1  9  
ATOM   5341  C  CD2  . TRP A 1 32 ? 8.901   8.000   3.484   1.00 0.00 ? 560 TRP A CD2  9  
ATOM   5342  N  NE1  . TRP A 1 32 ? 9.426   9.274   5.251   1.00 0.00 ? 560 TRP A NE1  9  
ATOM   5343  C  CE2  . TRP A 1 32 ? 9.474   9.223   3.882   1.00 0.00 ? 560 TRP A CE2  9  
ATOM   5344  C  CE3  . TRP A 1 32 ? 8.829   7.702   2.120   1.00 0.00 ? 560 TRP A CE3  9  
ATOM   5345  C  CZ2  . TRP A 1 32 ? 9.971   10.146  2.965   1.00 0.00 ? 560 TRP A CZ2  9  
ATOM   5346  C  CZ3  . TRP A 1 32 ? 9.323   8.620   1.211   1.00 0.00 ? 560 TRP A CZ3  9  
ATOM   5347  C  CH2  . TRP A 1 32 ? 9.888   9.828   1.637   1.00 0.00 ? 560 TRP A CH2  9  
ATOM   5348  H  H    . TRP A 1 32 ? 8.082   3.457   4.423   1.00 0.00 ? 560 TRP A H    9  
ATOM   5349  H  HA   . TRP A 1 32 ? 9.510   5.368   5.961   1.00 0.00 ? 560 TRP A HA   9  
ATOM   5350  H  HB2  . TRP A 1 32 ? 7.892   5.513   3.777   1.00 0.00 ? 560 TRP A HB2  9  
ATOM   5351  H  HB3  . TRP A 1 32 ? 6.811   6.116   5.029   1.00 0.00 ? 560 TRP A HB3  9  
ATOM   5352  H  HD1  . TRP A 1 32 ? 8.669   7.881   6.757   1.00 0.00 ? 560 TRP A HD1  9  
ATOM   5353  H  HE1  . TRP A 1 32 ? 9.756   10.011  5.806   1.00 0.00 ? 560 TRP A HE1  9  
ATOM   5354  H  HE3  . TRP A 1 32 ? 8.397   6.776   1.773   1.00 0.00 ? 560 TRP A HE3  9  
ATOM   5355  H  HZ2  . TRP A 1 32 ? 10.411  11.082  3.278   1.00 0.00 ? 560 TRP A HZ2  9  
ATOM   5356  H  HZ3  . TRP A 1 32 ? 9.276   8.407   0.154   1.00 0.00 ? 560 TRP A HZ3  9  
ATOM   5357  H  HH2  . TRP A 1 32 ? 10.261  10.515  0.892   1.00 0.00 ? 560 TRP A HH2  9  
ATOM   5358  N  N    . HIS A 1 33 ? 6.661   4.262   7.153   1.00 0.00 ? 561 HIS A N    9  
ATOM   5359  C  CA   . HIS A 1 33 ? 5.831   4.196   8.350   1.00 0.00 ? 561 HIS A CA   9  
ATOM   5360  C  C    . HIS A 1 33 ? 6.612   3.612   9.522   1.00 0.00 ? 561 HIS A C    9  
ATOM   5361  O  O    . HIS A 1 33 ? 6.545   4.122   10.641  1.00 0.00 ? 561 HIS A O    9  
ATOM   5362  C  CB   . HIS A 1 33 ? 4.582   3.353   8.082   1.00 0.00 ? 561 HIS A CB   9  
ATOM   5363  C  CG   . HIS A 1 33 ? 3.436   4.143   7.531   1.00 0.00 ? 561 HIS A CG   9  
ATOM   5364  N  ND1  . HIS A 1 33 ? 2.814   5.168   8.208   1.00 0.00 ? 561 HIS A ND1  9  
ATOM   5365  C  CD2  . HIS A 1 33 ? 2.798   4.041   6.338   1.00 0.00 ? 561 HIS A CD2  9  
ATOM   5366  C  CE1  . HIS A 1 33 ? 1.839   5.647   7.424   1.00 0.00 ? 561 HIS A CE1  9  
ATOM   5367  N  NE2  . HIS A 1 33 ? 1.787   4.998   6.277   1.00 0.00 ? 561 HIS A NE2  9  
ATOM   5368  H  H    . HIS A 1 33 ? 6.431   3.706   6.380   1.00 0.00 ? 561 HIS A H    9  
ATOM   5369  H  HA   . HIS A 1 33 ? 5.528   5.202   8.599   1.00 0.00 ? 561 HIS A HA   9  
ATOM   5370  H  HB2  . HIS A 1 33 ? 4.824   2.579   7.370   1.00 0.00 ? 561 HIS A HB2  9  
ATOM   5371  H  HB3  . HIS A 1 33 ? 4.259   2.897   9.007   1.00 0.00 ? 561 HIS A HB3  9  
ATOM   5372  H  HD1  . HIS A 1 33 ? 3.043   5.490   9.105   1.00 0.00 ? 561 HIS A HD1  9  
ATOM   5373  H  HD2  . HIS A 1 33 ? 3.029   3.336   5.553   1.00 0.00 ? 561 HIS A HD2  9  
ATOM   5374  H  HE1  . HIS A 1 33 ? 1.183   6.461   7.694   1.00 0.00 ? 561 HIS A HE1  9  
ATOM   5375  N  N    . THR A 1 34 ? 7.351   2.539   9.259   1.00 0.00 ? 562 THR A N    9  
ATOM   5376  C  CA   . THR A 1 34 ? 8.145   1.886   10.293  1.00 0.00 ? 562 THR A CA   9  
ATOM   5377  C  C    . THR A 1 34 ? 9.319   2.765   10.714  1.00 0.00 ? 562 THR A C    9  
ATOM   5378  O  O    . THR A 1 34 ? 10.311  2.879   9.994   1.00 0.00 ? 562 THR A O    9  
ATOM   5379  C  CB   . THR A 1 34 ? 8.658   0.534   9.795   1.00 0.00 ? 562 THR A CB   9  
ATOM   5380  O  OG1  . THR A 1 34 ? 9.283   0.670   8.531   1.00 0.00 ? 562 THR A OG1  9  
ATOM   5381  C  CG2  . THR A 1 34 ? 7.567   -0.506  9.659   1.00 0.00 ? 562 THR A CG2  9  
ATOM   5382  H  H    . THR A 1 34 ? 7.363   2.179   8.348   1.00 0.00 ? 562 THR A H    9  
ATOM   5383  H  HA   . THR A 1 34 ? 7.507   1.726   11.149  1.00 0.00 ? 562 THR A HA   9  
ATOM   5384  H  HB   . THR A 1 34 ? 9.389   0.158   10.496  1.00 0.00 ? 562 THR A HB   9  
ATOM   5385  H  HG1  . THR A 1 34 ? 9.654   -0.174  8.265   1.00 0.00 ? 562 THR A HG1  9  
ATOM   5386  H  HG21 . THR A 1 34 ? 7.761   -1.119  8.791   1.00 0.00 ? 562 THR A HG21 9  
ATOM   5387  H  HG22 . THR A 1 34 ? 6.612   -0.014  9.546   1.00 0.00 ? 562 THR A HG22 9  
ATOM   5388  H  HG23 . THR A 1 34 ? 7.551   -1.128  10.541  1.00 0.00 ? 562 THR A HG23 9  
ATOM   5389  N  N    . GLY A 1 35 ? 9.199   3.383   11.884  1.00 0.00 ? 563 GLY A N    9  
ATOM   5390  C  CA   . GLY A 1 35 ? 10.258  4.243   12.381  1.00 0.00 ? 563 GLY A CA   9  
ATOM   5391  C  C    . GLY A 1 35 ? 9.869   5.709   12.366  1.00 0.00 ? 563 GLY A C    9  
ATOM   5392  O  O    . GLY A 1 35 ? 10.291  6.461   11.487  1.00 0.00 ? 563 GLY A O    9  
ATOM   5393  H  H    . GLY A 1 35 ? 8.386   3.254   12.415  1.00 0.00 ? 563 GLY A H    9  
ATOM   5394  H  HA2  . GLY A 1 35 ? 10.494  3.955   13.394  1.00 0.00 ? 563 GLY A HA2  9  
ATOM   5395  H  HA3  . GLY A 1 35 ? 11.135  4.108   11.765  1.00 0.00 ? 563 GLY A HA3  9  
ATOM   5396  N  N    . GLU A 1 36 ? 9.063   6.115   13.341  1.00 0.00 ? 564 GLU A N    9  
ATOM   5397  C  CA   . GLU A 1 36 ? 8.618   7.501   13.438  1.00 0.00 ? 564 GLU A CA   9  
ATOM   5398  C  C    . GLU A 1 36 ? 9.231   8.186   14.655  1.00 0.00 ? 564 GLU A C    9  
ATOM   5399  O  O    . GLU A 1 36 ? 9.829   9.256   14.541  1.00 0.00 ? 564 GLU A O    9  
ATOM   5400  C  CB   . GLU A 1 36 ? 7.091   7.563   13.518  1.00 0.00 ? 564 GLU A CB   9  
ATOM   5401  C  CG   . GLU A 1 36 ? 6.398   7.192   12.217  1.00 0.00 ? 564 GLU A CG   9  
ATOM   5402  C  CD   . GLU A 1 36 ? 4.897   7.398   12.277  1.00 0.00 ? 564 GLU A CD   9  
ATOM   5403  O  OE1  . GLU A 1 36 ? 4.465   8.514   12.635  1.00 0.00 ? 564 GLU A OE1  9  
ATOM   5404  O  OE2  . GLU A 1 36 ? 4.154   6.444   11.965  1.00 0.00 ? 564 GLU A OE2  9  
ATOM   5405  H  H    . GLU A 1 36 ? 8.761   5.468   14.013  1.00 0.00 ? 564 GLU A H    9  
ATOM   5406  H  HA   . GLU A 1 36 ? 8.944   8.016   12.547  1.00 0.00 ? 564 GLU A HA   9  
ATOM   5407  H  HB2  . GLU A 1 36 ? 6.755   6.883   14.287  1.00 0.00 ? 564 GLU A HB2  9  
ATOM   5408  H  HB3  . GLU A 1 36 ? 6.797   8.567   13.784  1.00 0.00 ? 564 GLU A HB3  9  
ATOM   5409  H  HG2  . GLU A 1 36 ? 6.798   7.805   11.423  1.00 0.00 ? 564 GLU A HG2  9  
ATOM   5410  H  HG3  . GLU A 1 36 ? 6.596   6.152   12.002  1.00 0.00 ? 564 GLU A HG3  9  
ATOM   5411  N  N    . ARG A 1 37 ? 9.077   7.562   15.818  1.00 0.00 ? 565 ARG A N    9  
ATOM   5412  C  CA   . ARG A 1 37 ? 9.615   8.112   17.057  1.00 0.00 ? 565 ARG A CA   9  
ATOM   5413  C  C    . ARG A 1 37 ? 9.949   6.999   18.045  1.00 0.00 ? 565 ARG A C    9  
ATOM   5414  O  O    . ARG A 1 37 ? 10.640  7.284   19.045  1.00 0.00 ? 565 ARG A O    9  
ATOM   5415  C  CB   . ARG A 1 37 ? 8.616   9.086   17.684  1.00 0.00 ? 565 ARG A CB   9  
ATOM   5416  C  CG   . ARG A 1 37 ? 8.845   10.535  17.283  1.00 0.00 ? 565 ARG A CG   9  
ATOM   5417  C  CD   . ARG A 1 37 ? 9.355   11.365  18.451  1.00 0.00 ? 565 ARG A CD   9  
ATOM   5418  N  NE   . ARG A 1 37 ? 10.302  12.391  18.021  1.00 0.00 ? 565 ARG A NE   9  
ATOM   5419  C  CZ   . ARG A 1 37 ? 10.623  13.456  18.752  1.00 0.00 ? 565 ARG A CZ   9  
ATOM   5420  N  NH1  . ARG A 1 37 ? 10.075  13.639  19.948  1.00 0.00 ? 565 ARG A NH1  9  
ATOM   5421  N  NH2  . ARG A 1 37 ? 11.494  14.341  18.287  1.00 0.00 ? 565 ARG A NH2  9  
ATOM   5422  O  OXT  . ARG A 1 37 ? 9.514   5.851   17.812  1.00 0.00 ? 565 ARG A OXT  9  
ATOM   5423  H  H    . ARG A 1 37 ? 8.590   6.712   15.844  1.00 0.00 ? 565 ARG A H    9  
ATOM   5424  H  HA   . ARG A 1 37 ? 10.522  8.646   16.816  1.00 0.00 ? 565 ARG A HA   9  
ATOM   5425  H  HB2  . ARG A 1 37 ? 7.618   8.805   17.379  1.00 0.00 ? 565 ARG A HB2  9  
ATOM   5426  H  HB3  . ARG A 1 37 ? 8.687   9.015   18.759  1.00 0.00 ? 565 ARG A HB3  9  
ATOM   5427  H  HG2  . ARG A 1 37 ? 9.574   10.567  16.488  1.00 0.00 ? 565 ARG A HG2  9  
ATOM   5428  H  HG3  . ARG A 1 37 ? 7.912   10.954  16.935  1.00 0.00 ? 565 ARG A HG3  9  
ATOM   5429  H  HD2  . ARG A 1 37 ? 8.513   11.843  18.930  1.00 0.00 ? 565 ARG A HD2  9  
ATOM   5430  H  HD3  . ARG A 1 37 ? 9.844   10.709  19.156  1.00 0.00 ? 565 ARG A HD3  9  
ATOM   5431  H  HE   . ARG A 1 37 ? 10.721  12.280  17.142  1.00 0.00 ? 565 ARG A HE   9  
ATOM   5432  H  HH11 . ARG A 1 37 ? 9.418   12.975  20.305  1.00 0.00 ? 565 ARG A HH11 9  
ATOM   5433  H  HH12 . ARG A 1 37 ? 10.321  14.441  20.492  1.00 0.00 ? 565 ARG A HH12 9  
ATOM   5434  H  HH21 . ARG A 1 37 ? 11.909  14.208  17.387  1.00 0.00 ? 565 ARG A HH21 9  
ATOM   5435  H  HH22 . ARG A 1 37 ? 11.735  15.141  18.836  1.00 0.00 ? 565 ARG A HH22 9  
HETATM 5436  ZN ZN   . ZN  B 2 .  ? 0.428   5.242   4.814   1.00 0.00 ? 100 ZN  A ZN   9  
ATOM   5437  N  N    . MET A 1 1  ? -17.854 -5.708  -1.226  1.00 0.00 ? 1   MET A N    10 
ATOM   5438  C  CA   . MET A 1 1  ? -18.403 -4.514  -1.921  1.00 0.00 ? 1   MET A CA   10 
ATOM   5439  C  C    . MET A 1 1  ? -17.669 -4.253  -3.232  1.00 0.00 ? 1   MET A C    10 
ATOM   5440  O  O    . MET A 1 1  ? -18.279 -4.228  -4.301  1.00 0.00 ? 1   MET A O    10 
ATOM   5441  C  CB   . MET A 1 1  ? -18.269 -3.306  -0.992  1.00 0.00 ? 1   MET A CB   10 
ATOM   5442  C  CG   . MET A 1 1  ? -19.114 -3.410  0.267   1.00 0.00 ? 1   MET A CG   10 
ATOM   5443  S  SD   . MET A 1 1  ? -18.777 -2.084  1.442   1.00 0.00 ? 1   MET A SD   10 
ATOM   5444  C  CE   . MET A 1 1  ? -20.042 -0.900  0.988   1.00 0.00 ? 1   MET A CE   10 
ATOM   5445  H  H1   . MET A 1 1  ? -16.954 -5.432  -0.785  1.00 0.00 ? 1   MET A H1   10 
ATOM   5446  H  H2   . MET A 1 1  ? -17.711 -6.451  -1.940  1.00 0.00 ? 1   MET A H2   10 
ATOM   5447  H  H3   . MET A 1 1  ? -18.546 -6.004  -0.509  1.00 0.00 ? 1   MET A H3   10 
ATOM   5448  H  HA   . MET A 1 1  ? -19.448 -4.688  -2.130  1.00 0.00 ? 1   MET A HA   10 
ATOM   5449  H  HB2  . MET A 1 1  ? -17.235 -3.206  -0.697  1.00 0.00 ? 1   MET A HB2  10 
ATOM   5450  H  HB3  . MET A 1 1  ? -18.569 -2.419  -1.529  1.00 0.00 ? 1   MET A HB3  10 
ATOM   5451  H  HG2  . MET A 1 1  ? -20.157 -3.368  -0.011  1.00 0.00 ? 1   MET A HG2  10 
ATOM   5452  H  HG3  . MET A 1 1  ? -18.909 -4.357  0.745   1.00 0.00 ? 1   MET A HG3  10 
ATOM   5453  H  HE1  . MET A 1 1  ? -20.962 -1.421  0.771   1.00 0.00 ? 1   MET A HE1  10 
ATOM   5454  H  HE2  . MET A 1 1  ? -19.724 -0.352  0.113   1.00 0.00 ? 1   MET A HE2  10 
ATOM   5455  H  HE3  . MET A 1 1  ? -20.201 -0.213  1.805   1.00 0.00 ? 1   MET A HE3  10 
ATOM   5456  N  N    . ASP A 1 2  ? -16.358 -4.060  -3.142  1.00 0.00 ? 530 ASP A N    10 
ATOM   5457  C  CA   . ASP A 1 2  ? -15.540 -3.802  -4.322  1.00 0.00 ? 530 ASP A CA   10 
ATOM   5458  C  C    . ASP A 1 2  ? -15.462 -5.041  -5.211  1.00 0.00 ? 530 ASP A C    10 
ATOM   5459  O  O    . ASP A 1 2  ? -15.528 -6.170  -4.724  1.00 0.00 ? 530 ASP A O    10 
ATOM   5460  C  CB   . ASP A 1 2  ? -14.134 -3.364  -3.907  1.00 0.00 ? 530 ASP A CB   10 
ATOM   5461  C  CG   . ASP A 1 2  ? -13.651 -2.156  -4.686  1.00 0.00 ? 530 ASP A CG   10 
ATOM   5462  O  OD1  . ASP A 1 2  ? -14.329 -1.108  -4.636  1.00 0.00 ? 530 ASP A OD1  10 
ATOM   5463  O  OD2  . ASP A 1 2  ? -12.596 -2.258  -5.347  1.00 0.00 ? 530 ASP A OD2  10 
ATOM   5464  H  H    . ASP A 1 2  ? -15.929 -4.093  -2.261  1.00 0.00 ? 530 ASP A H    10 
ATOM   5465  H  HA   . ASP A 1 2  ? -16.007 -3.003  -4.879  1.00 0.00 ? 530 ASP A HA   10 
ATOM   5466  H  HB2  . ASP A 1 2  ? -14.136 -3.113  -2.857  1.00 0.00 ? 530 ASP A HB2  10 
ATOM   5467  H  HB3  . ASP A 1 2  ? -13.444 -4.178  -4.077  1.00 0.00 ? 530 ASP A HB3  10 
ATOM   5468  N  N    . PRO A 1 3  ? -15.318 -4.846  -6.533  1.00 0.00 ? 531 PRO A N    10 
ATOM   5469  C  CA   . PRO A 1 3  ? -15.231 -5.954  -7.490  1.00 0.00 ? 531 PRO A CA   10 
ATOM   5470  C  C    . PRO A 1 3  ? -14.163 -6.971  -7.101  1.00 0.00 ? 531 PRO A C    10 
ATOM   5471  O  O    . PRO A 1 3  ? -14.447 -8.161  -6.960  1.00 0.00 ? 531 PRO A O    10 
ATOM   5472  C  CB   . PRO A 1 3  ? -14.858 -5.263  -8.803  1.00 0.00 ? 531 PRO A CB   10 
ATOM   5473  C  CG   . PRO A 1 3  ? -15.367 -3.871  -8.657  1.00 0.00 ? 531 PRO A CG   10 
ATOM   5474  C  CD   . PRO A 1 3  ? -15.231 -3.532  -7.199  1.00 0.00 ? 531 PRO A CD   10 
ATOM   5475  H  HA   . PRO A 1 3  ? -16.181 -6.456  -7.601  1.00 0.00 ? 531 PRO A HA   10 
ATOM   5476  H  HB2  . PRO A 1 3  ? -13.785 -5.281  -8.931  1.00 0.00 ? 531 PRO A HB2  10 
ATOM   5477  H  HB3  . PRO A 1 3  ? -15.333 -5.772  -9.629  1.00 0.00 ? 531 PRO A HB3  10 
ATOM   5478  H  HG2  . PRO A 1 3  ? -14.773 -3.198  -9.256  1.00 0.00 ? 531 PRO A HG2  10 
ATOM   5479  H  HG3  . PRO A 1 3  ? -16.404 -3.826  -8.956  1.00 0.00 ? 531 PRO A HG3  10 
ATOM   5480  H  HD2  . PRO A 1 3  ? -14.275 -3.066  -7.008  1.00 0.00 ? 531 PRO A HD2  10 
ATOM   5481  H  HD3  . PRO A 1 3  ? -16.037 -2.887  -6.884  1.00 0.00 ? 531 PRO A HD3  10 
ATOM   5482  N  N    . GLY A 1 4  ? -12.935 -6.495  -6.930  1.00 0.00 ? 532 GLY A N    10 
ATOM   5483  C  CA   . GLY A 1 4  ? -11.843 -7.376  -6.559  1.00 0.00 ? 532 GLY A CA   10 
ATOM   5484  C  C    . GLY A 1 4  ? -10.885 -7.628  -7.707  1.00 0.00 ? 532 GLY A C    10 
ATOM   5485  O  O    . GLY A 1 4  ? -11.011 -8.621  -8.424  1.00 0.00 ? 532 GLY A O    10 
ATOM   5486  H  H    . GLY A 1 4  ? -12.768 -5.538  -7.057  1.00 0.00 ? 532 GLY A H    10 
ATOM   5487  H  HA2  . GLY A 1 4  ? -11.297 -6.930  -5.741  1.00 0.00 ? 532 GLY A HA2  10 
ATOM   5488  H  HA3  . GLY A 1 4  ? -12.252 -8.321  -6.233  1.00 0.00 ? 532 GLY A HA3  10 
ATOM   5489  N  N    . LYS A 1 5  ? -9.925  -6.725  -7.882  1.00 0.00 ? 533 LYS A N    10 
ATOM   5490  C  CA   . LYS A 1 5  ? -8.942  -6.853  -8.951  1.00 0.00 ? 533 LYS A CA   10 
ATOM   5491  C  C    . LYS A 1 5  ? -7.775  -7.733  -8.514  1.00 0.00 ? 533 LYS A C    10 
ATOM   5492  O  O    . LYS A 1 5  ? -7.307  -7.642  -7.379  1.00 0.00 ? 533 LYS A O    10 
ATOM   5493  C  CB   . LYS A 1 5  ? -8.430  -5.471  -9.368  1.00 0.00 ? 533 LYS A CB   10 
ATOM   5494  C  CG   . LYS A 1 5  ? -8.499  -5.224  -10.867 1.00 0.00 ? 533 LYS A CG   10 
ATOM   5495  C  CD   . LYS A 1 5  ? -9.478  -4.111  -11.207 1.00 0.00 ? 533 LYS A CD   10 
ATOM   5496  C  CE   . LYS A 1 5  ? -10.829 -4.667  -11.628 1.00 0.00 ? 533 LYS A CE   10 
ATOM   5497  N  NZ   . LYS A 1 5  ? -11.546 -3.744  -12.550 1.00 0.00 ? 533 LYS A NZ   10 
ATOM   5498  H  H    . LYS A 1 5  ? -9.877  -5.955  -7.278  1.00 0.00 ? 533 LYS A H    10 
ATOM   5499  H  HA   . LYS A 1 5  ? -9.429  -7.316  -9.796  1.00 0.00 ? 533 LYS A HA   10 
ATOM   5500  H  HB2  . LYS A 1 5  ? -9.022  -4.717  -8.871  1.00 0.00 ? 533 LYS A HB2  10 
ATOM   5501  H  HB3  . LYS A 1 5  ? -7.400  -5.371  -9.056  1.00 0.00 ? 533 LYS A HB3  10 
ATOM   5502  H  HG2  . LYS A 1 5  ? -7.518  -4.946  -11.222 1.00 0.00 ? 533 LYS A HG2  10 
ATOM   5503  H  HG3  . LYS A 1 5  ? -8.816  -6.133  -11.357 1.00 0.00 ? 533 LYS A HG3  10 
ATOM   5504  H  HD2  . LYS A 1 5  ? -9.613  -3.486  -10.337 1.00 0.00 ? 533 LYS A HD2  10 
ATOM   5505  H  HD3  . LYS A 1 5  ? -9.072  -3.523  -12.016 1.00 0.00 ? 533 LYS A HD3  10 
ATOM   5506  H  HE2  . LYS A 1 5  ? -10.675 -5.612  -12.127 1.00 0.00 ? 533 LYS A HE2  10 
ATOM   5507  H  HE3  . LYS A 1 5  ? -11.432 -4.821  -10.745 1.00 0.00 ? 533 LYS A HE3  10 
ATOM   5508  H  HZ1  . LYS A 1 5  ? -11.204 -2.771  -12.419 1.00 0.00 ? 533 LYS A HZ1  10 
ATOM   5509  H  HZ2  . LYS A 1 5  ? -12.568 -3.769  -12.359 1.00 0.00 ? 533 LYS A HZ2  10 
ATOM   5510  H  HZ3  . LYS A 1 5  ? -11.383 -4.028  -13.538 1.00 0.00 ? 533 LYS A HZ3  10 
ATOM   5511  N  N    . LYS A 1 6  ? -7.310  -8.585  -9.421  1.00 0.00 ? 534 LYS A N    10 
ATOM   5512  C  CA   . LYS A 1 6  ? -6.198  -9.482  -9.128  1.00 0.00 ? 534 LYS A CA   10 
ATOM   5513  C  C    . LYS A 1 6  ? -4.876  -8.721  -9.108  1.00 0.00 ? 534 LYS A C    10 
ATOM   5514  O  O    . LYS A 1 6  ? -4.754  -7.657  -9.715  1.00 0.00 ? 534 LYS A O    10 
ATOM   5515  C  CB   . LYS A 1 6  ? -6.138  -10.608 -10.163 1.00 0.00 ? 534 LYS A CB   10 
ATOM   5516  C  CG   . LYS A 1 6  ? -5.962  -10.115 -11.590 1.00 0.00 ? 534 LYS A CG   10 
ATOM   5517  C  CD   . LYS A 1 6  ? -6.706  -10.998 -12.580 1.00 0.00 ? 534 LYS A CD   10 
ATOM   5518  C  CE   . LYS A 1 6  ? -7.357  -10.175 -13.680 1.00 0.00 ? 534 LYS A CE   10 
ATOM   5519  N  NZ   . LYS A 1 6  ? -8.289  -10.990 -14.507 1.00 0.00 ? 534 LYS A NZ   10 
ATOM   5520  H  H    . LYS A 1 6  ? -7.725  -8.612  -10.309 1.00 0.00 ? 534 LYS A H    10 
ATOM   5521  H  HA   . LYS A 1 6  ? -6.367  -9.911  -8.152  1.00 0.00 ? 534 LYS A HA   10 
ATOM   5522  H  HB2  . LYS A 1 6  ? -5.307  -11.256 -9.924  1.00 0.00 ? 534 LYS A HB2  10 
ATOM   5523  H  HB3  . LYS A 1 6  ? -7.054  -11.178 -10.111 1.00 0.00 ? 534 LYS A HB3  10 
ATOM   5524  H  HG2  . LYS A 1 6  ? -6.345  -9.109  -11.662 1.00 0.00 ? 534 LYS A HG2  10 
ATOM   5525  H  HG3  . LYS A 1 6  ? -4.910  -10.121 -11.835 1.00 0.00 ? 534 LYS A HG3  10 
ATOM   5526  H  HD2  . LYS A 1 6  ? -6.007  -11.688 -13.027 1.00 0.00 ? 534 LYS A HD2  10 
ATOM   5527  H  HD3  . LYS A 1 6  ? -7.471  -11.548 -12.052 1.00 0.00 ? 534 LYS A HD3  10 
ATOM   5528  H  HE2  . LYS A 1 6  ? -7.908  -9.364  -13.227 1.00 0.00 ? 534 LYS A HE2  10 
ATOM   5529  H  HE3  . LYS A 1 6  ? -6.583  -9.771  -14.316 1.00 0.00 ? 534 LYS A HE3  10 
ATOM   5530  H  HZ1  . LYS A 1 6  ? -7.754  -11.678 -15.075 1.00 0.00 ? 534 LYS A HZ1  10 
ATOM   5531  H  HZ2  . LYS A 1 6  ? -8.830  -10.376 -15.147 1.00 0.00 ? 534 LYS A HZ2  10 
ATOM   5532  H  HZ3  . LYS A 1 6  ? -8.953  -11.505 -13.894 1.00 0.00 ? 534 LYS A HZ3  10 
ATOM   5533  N  N    . LYS A 1 7  ? -3.890  -9.275  -8.404  1.00 0.00 ? 535 LYS A N    10 
ATOM   5534  C  CA   . LYS A 1 7  ? -2.568  -8.658  -8.295  1.00 0.00 ? 535 LYS A CA   10 
ATOM   5535  C  C    . LYS A 1 7  ? -2.672  -7.153  -8.054  1.00 0.00 ? 535 LYS A C    10 
ATOM   5536  O  O    . LYS A 1 7  ? -2.748  -6.366  -8.997  1.00 0.00 ? 535 LYS A O    10 
ATOM   5537  C  CB   . LYS A 1 7  ? -1.739  -8.932  -9.554  1.00 0.00 ? 535 LYS A CB   10 
ATOM   5538  C  CG   . LYS A 1 7  ? -2.472  -8.637  -10.853 1.00 0.00 ? 535 LYS A CG   10 
ATOM   5539  C  CD   . LYS A 1 7  ? -1.565  -8.825  -12.058 1.00 0.00 ? 535 LYS A CD   10 
ATOM   5540  C  CE   . LYS A 1 7  ? -0.944  -7.510  -12.499 1.00 0.00 ? 535 LYS A CE   10 
ATOM   5541  N  NZ   . LYS A 1 7  ? 0.228   -7.720  -13.392 1.00 0.00 ? 535 LYS A NZ   10 
ATOM   5542  H  H    . LYS A 1 7  ? -4.056  -10.124 -7.944  1.00 0.00 ? 535 LYS A H    10 
ATOM   5543  H  HA   . LYS A 1 7  ? -2.069  -9.105  -7.448  1.00 0.00 ? 535 LYS A HA   10 
ATOM   5544  H  HB2  . LYS A 1 7  ? -0.849  -8.321  -9.523  1.00 0.00 ? 535 LYS A HB2  10 
ATOM   5545  H  HB3  . LYS A 1 7  ? -1.449  -9.972  -9.558  1.00 0.00 ? 535 LYS A HB3  10 
ATOM   5546  H  HG2  . LYS A 1 7  ? -3.313  -9.308  -10.941 1.00 0.00 ? 535 LYS A HG2  10 
ATOM   5547  H  HG3  . LYS A 1 7  ? -2.823  -7.616  -10.834 1.00 0.00 ? 535 LYS A HG3  10 
ATOM   5548  H  HD2  . LYS A 1 7  ? -0.776  -9.515  -11.799 1.00 0.00 ? 535 LYS A HD2  10 
ATOM   5549  H  HD3  . LYS A 1 7  ? -2.146  -9.230  -12.874 1.00 0.00 ? 535 LYS A HD3  10 
ATOM   5550  H  HE2  . LYS A 1 7  ? -1.689  -6.933  -13.027 1.00 0.00 ? 535 LYS A HE2  10 
ATOM   5551  H  HE3  . LYS A 1 7  ? -0.624  -6.966  -11.622 1.00 0.00 ? 535 LYS A HE3  10 
ATOM   5552  H  HZ1  . LYS A 1 7  ? -0.092  -7.994  -14.343 1.00 0.00 ? 535 LYS A HZ1  10 
ATOM   5553  H  HZ2  . LYS A 1 7  ? 0.836   -8.474  -13.014 1.00 0.00 ? 535 LYS A HZ2  10 
ATOM   5554  H  HZ3  . LYS A 1 7  ? 0.786   -6.845  -13.464 1.00 0.00 ? 535 LYS A HZ3  10 
ATOM   5555  N  N    . GLN A 1 8  ? -2.674  -6.761  -6.784  1.00 0.00 ? 536 GLN A N    10 
ATOM   5556  C  CA   . GLN A 1 8  ? -2.768  -5.353  -6.417  1.00 0.00 ? 536 GLN A CA   10 
ATOM   5557  C  C    . GLN A 1 8  ? -2.021  -5.078  -5.116  1.00 0.00 ? 536 GLN A C    10 
ATOM   5558  O  O    . GLN A 1 8  ? -1.857  -5.969  -4.283  1.00 0.00 ? 536 GLN A O    10 
ATOM   5559  C  CB   . GLN A 1 8  ? -4.235  -4.938  -6.276  1.00 0.00 ? 536 GLN A CB   10 
ATOM   5560  C  CG   . GLN A 1 8  ? -4.806  -4.289  -7.526  1.00 0.00 ? 536 GLN A CG   10 
ATOM   5561  C  CD   . GLN A 1 8  ? -5.932  -3.322  -7.218  1.00 0.00 ? 536 GLN A CD   10 
ATOM   5562  O  OE1  . GLN A 1 8  ? -6.447  -3.287  -6.100  1.00 0.00 ? 536 GLN A OE1  10 
ATOM   5563  N  NE2  . GLN A 1 8  ? -6.321  -2.530  -8.210  1.00 0.00 ? 536 GLN A NE2  10 
ATOM   5564  H  H    . GLN A 1 8  ? -2.611  -7.436  -6.075  1.00 0.00 ? 536 GLN A H    10 
ATOM   5565  H  HA   . GLN A 1 8  ? -2.315  -4.774  -7.208  1.00 0.00 ? 536 GLN A HA   10 
ATOM   5566  H  HB2  . GLN A 1 8  ? -4.824  -5.814  -6.051  1.00 0.00 ? 536 GLN A HB2  10 
ATOM   5567  H  HB3  . GLN A 1 8  ? -4.323  -4.236  -5.460  1.00 0.00 ? 536 GLN A HB3  10 
ATOM   5568  H  HG2  . GLN A 1 8  ? -4.017  -3.750  -8.029  1.00 0.00 ? 536 GLN A HG2  10 
ATOM   5569  H  HG3  . GLN A 1 8  ? -5.184  -5.063  -8.178  1.00 0.00 ? 536 GLN A HG3  10 
ATOM   5570  H  HE21 . GLN A 1 8  ? -5.866  -2.613  -9.074  1.00 0.00 ? 536 GLN A HE21 10 
ATOM   5571  H  HE22 . GLN A 1 8  ? -7.048  -1.895  -8.038  1.00 0.00 ? 536 GLN A HE22 10 
ATOM   5572  N  N    . HIS A 1 9  ? -1.572  -3.839  -4.948  1.00 0.00 ? 537 HIS A N    10 
ATOM   5573  C  CA   . HIS A 1 9  ? -0.842  -3.445  -3.748  1.00 0.00 ? 537 HIS A CA   10 
ATOM   5574  C  C    . HIS A 1 9  ? -1.566  -2.319  -3.017  1.00 0.00 ? 537 HIS A C    10 
ATOM   5575  O  O    . HIS A 1 9  ? -1.512  -1.161  -3.433  1.00 0.00 ? 537 HIS A O    10 
ATOM   5576  C  CB   . HIS A 1 9  ? 0.577   -3.004  -4.111  1.00 0.00 ? 537 HIS A CB   10 
ATOM   5577  C  CG   . HIS A 1 9  ? 1.461   -4.132  -4.547  1.00 0.00 ? 537 HIS A CG   10 
ATOM   5578  N  ND1  . HIS A 1 9  ? 1.085   -5.456  -4.519  1.00 0.00 ? 537 HIS A ND1  10 
ATOM   5579  C  CD2  . HIS A 1 9  ? 2.729   -4.112  -5.030  1.00 0.00 ? 537 HIS A CD2  10 
ATOM   5580  C  CE1  . HIS A 1 9  ? 2.114   -6.184  -4.976  1.00 0.00 ? 537 HIS A CE1  10 
ATOM   5581  N  NE2  . HIS A 1 9  ? 3.135   -5.416  -5.300  1.00 0.00 ? 537 HIS A NE2  10 
ATOM   5582  H  H    . HIS A 1 9  ? -1.734  -3.172  -5.648  1.00 0.00 ? 537 HIS A H    10 
ATOM   5583  H  HA   . HIS A 1 9  ? -0.787  -4.304  -3.096  1.00 0.00 ? 537 HIS A HA   10 
ATOM   5584  H  HB2  . HIS A 1 9  ? 0.529   -2.289  -4.918  1.00 0.00 ? 537 HIS A HB2  10 
ATOM   5585  H  HB3  . HIS A 1 9  ? 1.032   -2.537  -3.250  1.00 0.00 ? 537 HIS A HB3  10 
ATOM   5586  H  HD1  . HIS A 1 9  ? 0.220   -5.805  -4.219  1.00 0.00 ? 537 HIS A HD1  10 
ATOM   5587  H  HD2  . HIS A 1 9  ? 3.335   -3.232  -5.186  1.00 0.00 ? 537 HIS A HD2  10 
ATOM   5588  H  HE1  . HIS A 1 9  ? 2.106   -7.261  -5.067  1.00 0.00 ? 537 HIS A HE1  10 
ATOM   5589  N  N    . ILE A 1 10 ? -2.242  -2.666  -1.927  1.00 0.00 ? 538 ILE A N    10 
ATOM   5590  C  CA   . ILE A 1 10 ? -2.976  -1.685  -1.138  1.00 0.00 ? 538 ILE A CA   10 
ATOM   5591  C  C    . ILE A 1 10 ? -2.493  -1.672  0.309   1.00 0.00 ? 538 ILE A C    10 
ATOM   5592  O  O    . ILE A 1 10 ? -2.010  -2.682  0.821   1.00 0.00 ? 538 ILE A O    10 
ATOM   5593  C  CB   . ILE A 1 10 ? -4.492  -1.965  -1.159  1.00 0.00 ? 538 ILE A CB   10 
ATOM   5594  C  CG1  . ILE A 1 10 ? -4.981  -2.147  -2.598  1.00 0.00 ? 538 ILE A CG1  10 
ATOM   5595  C  CG2  . ILE A 1 10 ? -5.250  -0.838  -0.474  1.00 0.00 ? 538 ILE A CG2  10 
ATOM   5596  C  CD1  . ILE A 1 10 ? -5.922  -3.319  -2.772  1.00 0.00 ? 538 ILE A CD1  10 
ATOM   5597  H  H    . ILE A 1 10 ? -2.246  -3.605  -1.646  1.00 0.00 ? 538 ILE A H    10 
ATOM   5598  H  HA   . ILE A 1 10 ? -2.805  -0.711  -1.572  1.00 0.00 ? 538 ILE A HA   10 
ATOM   5599  H  HB   . ILE A 1 10 ? -4.674  -2.875  -0.607  1.00 0.00 ? 538 ILE A HB   10 
ATOM   5600  H  HG12 . ILE A 1 10 ? -5.504  -1.255  -2.910  1.00 0.00 ? 538 ILE A HG12 10 
ATOM   5601  H  HG13 . ILE A 1 10 ? -4.131  -2.305  -3.245  1.00 0.00 ? 538 ILE A HG13 10 
ATOM   5602  H  HG21 . ILE A 1 10 ? -6.312  -1.007  -0.572  1.00 0.00 ? 538 ILE A HG21 10 
ATOM   5603  H  HG22 . ILE A 1 10 ? -4.992  0.103   -0.937  1.00 0.00 ? 538 ILE A HG22 10 
ATOM   5604  H  HG23 . ILE A 1 10 ? -4.985  -0.809  0.572   1.00 0.00 ? 538 ILE A HG23 10 
ATOM   5605  H  HD11 . ILE A 1 10 ? -5.686  -3.838  -3.689  1.00 0.00 ? 538 ILE A HD11 10 
ATOM   5606  H  HD12 . ILE A 1 10 ? -6.940  -2.961  -2.813  1.00 0.00 ? 538 ILE A HD12 10 
ATOM   5607  H  HD13 . ILE A 1 10 ? -5.812  -3.996  -1.937  1.00 0.00 ? 538 ILE A HD13 10 
ATOM   5608  N  N    . CYS A 1 11 ? -2.628  -0.523  0.962   1.00 0.00 ? 539 CYS A N    10 
ATOM   5609  C  CA   . CYS A 1 11 ? -2.205  -0.377  2.349   1.00 0.00 ? 539 CYS A CA   10 
ATOM   5610  C  C    . CYS A 1 11 ? -3.180  -1.077  3.292   1.00 0.00 ? 539 CYS A C    10 
ATOM   5611  O  O    . CYS A 1 11 ? -4.337  -0.676  3.414   1.00 0.00 ? 539 CYS A O    10 
ATOM   5612  C  CB   . CYS A 1 11 ? -2.094  1.104   2.716   1.00 0.00 ? 539 CYS A CB   10 
ATOM   5613  S  SG   . CYS A 1 11 ? -0.402  1.742   2.706   1.00 0.00 ? 539 CYS A SG   10 
ATOM   5614  H  H    . CYS A 1 11 ? -3.020  0.247   0.499   1.00 0.00 ? 539 CYS A H    10 
ATOM   5615  H  HA   . CYS A 1 11 ? -1.234  -0.838  2.450   1.00 0.00 ? 539 CYS A HA   10 
ATOM   5616  H  HB2  . CYS A 1 11 ? -2.666  1.686   2.010   1.00 0.00 ? 539 CYS A HB2  10 
ATOM   5617  H  HB3  . CYS A 1 11 ? -2.497  1.256   3.708   1.00 0.00 ? 539 CYS A HB3  10 
ATOM   5618  N  N    . HIS A 1 12 ? -2.703  -2.124  3.956   1.00 0.00 ? 540 HIS A N    10 
ATOM   5619  C  CA   . HIS A 1 12 ? -3.530  -2.880  4.889   1.00 0.00 ? 540 HIS A CA   10 
ATOM   5620  C  C    . HIS A 1 12 ? -3.789  -2.082  6.166   1.00 0.00 ? 540 HIS A C    10 
ATOM   5621  O  O    . HIS A 1 12 ? -4.742  -2.357  6.896   1.00 0.00 ? 540 HIS A O    10 
ATOM   5622  C  CB   . HIS A 1 12 ? -2.860  -4.213  5.231   1.00 0.00 ? 540 HIS A CB   10 
ATOM   5623  C  CG   . HIS A 1 12 ? -3.499  -5.392  4.566   1.00 0.00 ? 540 HIS A CG   10 
ATOM   5624  N  ND1  . HIS A 1 12 ? -4.297  -6.304  5.220   1.00 0.00 ? 540 HIS A ND1  10 
ATOM   5625  C  CD2  . HIS A 1 12 ? -3.448  -5.800  3.272   1.00 0.00 ? 540 HIS A CD2  10 
ATOM   5626  C  CE1  . HIS A 1 12 ? -4.696  -7.218  4.326   1.00 0.00 ? 540 HIS A CE1  10 
ATOM   5627  N  NE2  . HIS A 1 12 ? -4.208  -6.958  3.128   1.00 0.00 ? 540 HIS A NE2  10 
ATOM   5628  H  H    . HIS A 1 12 ? -1.771  -2.394  3.817   1.00 0.00 ? 540 HIS A H    10 
ATOM   5629  H  HA   . HIS A 1 12 ? -4.476  -3.078  4.406   1.00 0.00 ? 540 HIS A HA   10 
ATOM   5630  H  HB2  . HIS A 1 12 ? -1.826  -4.178  4.920   1.00 0.00 ? 540 HIS A HB2  10 
ATOM   5631  H  HB3  . HIS A 1 12 ? -2.904  -4.369  6.299   1.00 0.00 ? 540 HIS A HB3  10 
ATOM   5632  H  HD1  . HIS A 1 12 ? -4.530  -6.288  6.172   1.00 0.00 ? 540 HIS A HD1  10 
ATOM   5633  H  HD2  . HIS A 1 12 ? -2.907  -5.314  2.474   1.00 0.00 ? 540 HIS A HD2  10 
ATOM   5634  H  HE1  . HIS A 1 12 ? -5.334  -8.059  4.555   1.00 0.00 ? 540 HIS A HE1  10 
ATOM   5635  N  N    . ILE A 1 13 ? -2.937  -1.096  6.431   1.00 0.00 ? 541 ILE A N    10 
ATOM   5636  C  CA   . ILE A 1 13 ? -3.078  -0.264  7.621   1.00 0.00 ? 541 ILE A CA   10 
ATOM   5637  C  C    . ILE A 1 13 ? -4.440  0.421   7.657   1.00 0.00 ? 541 ILE A C    10 
ATOM   5638  O  O    . ILE A 1 13 ? -5.036  0.697   6.616   1.00 0.00 ? 541 ILE A O    10 
ATOM   5639  C  CB   . ILE A 1 13 ? -1.973  0.809   7.695   1.00 0.00 ? 541 ILE A CB   10 
ATOM   5640  C  CG1  . ILE A 1 13 ? -0.593  0.163   7.565   1.00 0.00 ? 541 ILE A CG1  10 
ATOM   5641  C  CG2  . ILE A 1 13 ? -2.075  1.590   8.998   1.00 0.00 ? 541 ILE A CG2  10 
ATOM   5642  C  CD1  . ILE A 1 13 ? -0.323  -0.902  8.606   1.00 0.00 ? 541 ILE A CD1  10 
ATOM   5643  H  H    . ILE A 1 13 ? -2.196  -0.924  5.814   1.00 0.00 ? 541 ILE A H    10 
ATOM   5644  H  HA   . ILE A 1 13 ? -2.986  -0.904  8.487   1.00 0.00 ? 541 ILE A HA   10 
ATOM   5645  H  HB   . ILE A 1 13 ? -2.117  1.500   6.878   1.00 0.00 ? 541 ILE A HB   10 
ATOM   5646  H  HG12 . ILE A 1 13 ? -0.507  -0.296  6.593   1.00 0.00 ? 541 ILE A HG12 10 
ATOM   5647  H  HG13 . ILE A 1 13 ? 0.165   0.926   7.666   1.00 0.00 ? 541 ILE A HG13 10 
ATOM   5648  H  HG21 . ILE A 1 13 ? -3.003  2.142   9.015   1.00 0.00 ? 541 ILE A HG21 10 
ATOM   5649  H  HG22 . ILE A 1 13 ? -1.245  2.277   9.071   1.00 0.00 ? 541 ILE A HG22 10 
ATOM   5650  H  HG23 . ILE A 1 13 ? -2.049  0.904   9.832   1.00 0.00 ? 541 ILE A HG23 10 
ATOM   5651  H  HD11 . ILE A 1 13 ? 0.638   -0.721  9.065   1.00 0.00 ? 541 ILE A HD11 10 
ATOM   5652  H  HD12 . ILE A 1 13 ? -0.319  -1.873  8.135   1.00 0.00 ? 541 ILE A HD12 10 
ATOM   5653  H  HD13 . ILE A 1 13 ? -1.094  -0.870  9.362   1.00 0.00 ? 541 ILE A HD13 10 
ATOM   5654  N  N    . GLN A 1 14 ? -4.925  0.690   8.864   1.00 0.00 ? 542 GLN A N    10 
ATOM   5655  C  CA   . GLN A 1 14 ? -6.213  1.339   9.044   1.00 0.00 ? 542 GLN A CA   10 
ATOM   5656  C  C    . GLN A 1 14 ? -6.088  2.854   8.908   1.00 0.00 ? 542 GLN A C    10 
ATOM   5657  O  O    . GLN A 1 14 ? -6.416  3.601   9.831   1.00 0.00 ? 542 GLN A O    10 
ATOM   5658  C  CB   . GLN A 1 14 ? -6.799  0.982   10.412  1.00 0.00 ? 542 GLN A CB   10 
ATOM   5659  C  CG   . GLN A 1 14 ? -5.932  1.423   11.580  1.00 0.00 ? 542 GLN A CG   10 
ATOM   5660  C  CD   . GLN A 1 14 ? -5.010  0.324   12.070  1.00 0.00 ? 542 GLN A CD   10 
ATOM   5661  O  OE1  . GLN A 1 14 ? -3.967  0.060   11.471  1.00 0.00 ? 542 GLN A OE1  10 
ATOM   5662  N  NE2  . GLN A 1 14 ? -5.390  -0.325  13.164  1.00 0.00 ? 542 GLN A NE2  10 
ATOM   5663  H  H    . GLN A 1 14 ? -4.404  0.444   9.651   1.00 0.00 ? 542 GLN A H    10 
ATOM   5664  H  HA   . GLN A 1 14 ? -6.871  0.973   8.276   1.00 0.00 ? 542 GLN A HA   10 
ATOM   5665  H  HB2  . GLN A 1 14 ? -7.766  1.454   10.511  1.00 0.00 ? 542 GLN A HB2  10 
ATOM   5666  H  HB3  . GLN A 1 14 ? -6.924  -0.090  10.469  1.00 0.00 ? 542 GLN A HB3  10 
ATOM   5667  H  HG2  . GLN A 1 14 ? -5.330  2.263   11.268  1.00 0.00 ? 542 GLN A HG2  10 
ATOM   5668  H  HG3  . GLN A 1 14 ? -6.574  1.724   12.395  1.00 0.00 ? 542 GLN A HG3  10 
ATOM   5669  H  HE21 . GLN A 1 14 ? -6.233  -0.061  13.589  1.00 0.00 ? 542 GLN A HE21 10 
ATOM   5670  H  HE22 . GLN A 1 14 ? -4.813  -1.040  13.503  1.00 0.00 ? 542 GLN A HE22 10 
ATOM   5671  N  N    . GLY A 1 15 ? -5.611  3.303   7.752   1.00 0.00 ? 543 GLY A N    10 
ATOM   5672  C  CA   . GLY A 1 15 ? -5.452  4.727   7.519   1.00 0.00 ? 543 GLY A CA   10 
ATOM   5673  C  C    . GLY A 1 15 ? -5.262  5.060   6.053   1.00 0.00 ? 543 GLY A C    10 
ATOM   5674  O  O    . GLY A 1 15 ? -5.963  5.912   5.507   1.00 0.00 ? 543 GLY A O    10 
ATOM   5675  H  H    . GLY A 1 15 ? -5.366  2.663   7.051   1.00 0.00 ? 543 GLY A H    10 
ATOM   5676  H  HA2  . GLY A 1 15 ? -6.331  5.240   7.882   1.00 0.00 ? 543 GLY A HA2  10 
ATOM   5677  H  HA3  . GLY A 1 15 ? -4.592  5.076   8.070   1.00 0.00 ? 543 GLY A HA3  10 
ATOM   5678  N  N    . CYS A 1 16 ? -4.312  4.387   5.413   1.00 0.00 ? 544 CYS A N    10 
ATOM   5679  C  CA   . CYS A 1 16 ? -4.031  4.615   4.001   1.00 0.00 ? 544 CYS A CA   10 
ATOM   5680  C  C    . CYS A 1 16 ? -4.869  3.688   3.127   1.00 0.00 ? 544 CYS A C    10 
ATOM   5681  O  O    . CYS A 1 16 ? -5.599  2.835   3.632   1.00 0.00 ? 544 CYS A O    10 
ATOM   5682  C  CB   . CYS A 1 16 ? -2.544  4.397   3.723   1.00 0.00 ? 544 CYS A CB   10 
ATOM   5683  S  SG   . CYS A 1 16 ? -1.860  5.470   2.439   1.00 0.00 ? 544 CYS A SG   10 
ATOM   5684  H  H    . CYS A 1 16 ? -3.786  3.719   5.902   1.00 0.00 ? 544 CYS A H    10 
ATOM   5685  H  HA   . CYS A 1 16 ? -4.287  5.639   3.772   1.00 0.00 ? 544 CYS A HA   10 
ATOM   5686  H  HB2  . CYS A 1 16 ? -1.986  4.577   4.629   1.00 0.00 ? 544 CYS A HB2  10 
ATOM   5687  H  HB3  . CYS A 1 16 ? -2.393  3.377   3.412   1.00 0.00 ? 544 CYS A HB3  10 
ATOM   5688  N  N    . GLY A 1 17 ? -4.761  3.859   1.813   1.00 0.00 ? 545 GLY A N    10 
ATOM   5689  C  CA   . GLY A 1 17 ? -5.517  3.028   0.895   1.00 0.00 ? 545 GLY A CA   10 
ATOM   5690  C  C    . GLY A 1 17 ? -5.220  3.342   -0.558  1.00 0.00 ? 545 GLY A C    10 
ATOM   5691  O  O    . GLY A 1 17 ? -6.128  3.390   -1.388  1.00 0.00 ? 545 GLY A O    10 
ATOM   5692  H  H    . GLY A 1 17 ? -4.165  4.554   1.465   1.00 0.00 ? 545 GLY A H    10 
ATOM   5693  H  HA2  . GLY A 1 17 ? -5.276  1.992   1.083   1.00 0.00 ? 545 GLY A HA2  10 
ATOM   5694  H  HA3  . GLY A 1 17 ? -6.571  3.179   1.075   1.00 0.00 ? 545 GLY A HA3  10 
ATOM   5695  N  N    . LYS A 1 18 ? -3.945  3.554   -0.869  1.00 0.00 ? 546 LYS A N    10 
ATOM   5696  C  CA   . LYS A 1 18 ? -3.533  3.863   -2.233  1.00 0.00 ? 546 LYS A CA   10 
ATOM   5697  C  C    . LYS A 1 18 ? -3.264  2.583   -3.019  1.00 0.00 ? 546 LYS A C    10 
ATOM   5698  O  O    . LYS A 1 18 ? -3.567  1.484   -2.555  1.00 0.00 ? 546 LYS A O    10 
ATOM   5699  C  CB   . LYS A 1 18 ? -2.284  4.747   -2.224  1.00 0.00 ? 546 LYS A CB   10 
ATOM   5700  C  CG   . LYS A 1 18 ? -1.048  4.051   -1.676  1.00 0.00 ? 546 LYS A CG   10 
ATOM   5701  C  CD   . LYS A 1 18 ? -0.321  4.917   -0.659  1.00 0.00 ? 546 LYS A CD   10 
ATOM   5702  C  CE   . LYS A 1 18 ? 0.913   5.568   -1.262  1.00 0.00 ? 546 LYS A CE   10 
ATOM   5703  N  NZ   . LYS A 1 18 ? 1.104   6.960   -0.769  1.00 0.00 ? 546 LYS A NZ   10 
ATOM   5704  H  H    . LYS A 1 18 ? -3.266  3.500   -0.165  1.00 0.00 ? 546 LYS A H    10 
ATOM   5705  H  HA   . LYS A 1 18 ? -4.340  4.400   -2.709  1.00 0.00 ? 546 LYS A HA   10 
ATOM   5706  H  HB2  . LYS A 1 18 ? -2.074  5.064   -3.235  1.00 0.00 ? 546 LYS A HB2  10 
ATOM   5707  H  HB3  . LYS A 1 18 ? -2.480  5.619   -1.617  1.00 0.00 ? 546 LYS A HB3  10 
ATOM   5708  H  HG2  . LYS A 1 18 ? -1.348  3.130   -1.199  1.00 0.00 ? 546 LYS A HG2  10 
ATOM   5709  H  HG3  . LYS A 1 18 ? -0.378  3.832   -2.494  1.00 0.00 ? 546 LYS A HG3  10 
ATOM   5710  H  HD2  . LYS A 1 18 ? -0.990  5.690   -0.313  1.00 0.00 ? 546 LYS A HD2  10 
ATOM   5711  H  HD3  . LYS A 1 18 ? -0.021  4.299   0.174   1.00 0.00 ? 546 LYS A HD3  10 
ATOM   5712  H  HE2  . LYS A 1 18 ? 1.780   4.980   -0.998  1.00 0.00 ? 546 LYS A HE2  10 
ATOM   5713  H  HE3  . LYS A 1 18 ? 0.806   5.587   -2.337  1.00 0.00 ? 546 LYS A HE3  10 
ATOM   5714  H  HZ1  . LYS A 1 18 ? 2.118   7.159   -0.645  1.00 0.00 ? 546 LYS A HZ1  10 
ATOM   5715  H  HZ2  . LYS A 1 18 ? 0.624   7.085   0.145   1.00 0.00 ? 546 LYS A HZ2  10 
ATOM   5716  H  HZ3  . LYS A 1 18 ? 0.709   7.638   -1.451  1.00 0.00 ? 546 LYS A HZ3  10 
ATOM   5717  N  N    . VAL A 1 19 ? -2.696  2.731   -4.212  1.00 0.00 ? 547 VAL A N    10 
ATOM   5718  C  CA   . VAL A 1 19 ? -2.390  1.584   -5.057  1.00 0.00 ? 547 VAL A CA   10 
ATOM   5719  C  C    . VAL A 1 19 ? -1.153  1.840   -5.911  1.00 0.00 ? 547 VAL A C    10 
ATOM   5720  O  O    . VAL A 1 19 ? -0.992  2.918   -6.483  1.00 0.00 ? 547 VAL A O    10 
ATOM   5721  C  CB   . VAL A 1 19 ? -3.572  1.236   -5.981  1.00 0.00 ? 547 VAL A CB   10 
ATOM   5722  C  CG1  . VAL A 1 19 ? -3.317  -0.076  -6.706  1.00 0.00 ? 547 VAL A CG1  10 
ATOM   5723  C  CG2  . VAL A 1 19 ? -4.869  1.173   -5.188  1.00 0.00 ? 547 VAL A CG2  10 
ATOM   5724  H  H    . VAL A 1 19 ? -2.478  3.632   -4.530  1.00 0.00 ? 547 VAL A H    10 
ATOM   5725  H  HA   . VAL A 1 19 ? -2.203  0.736   -4.414  1.00 0.00 ? 547 VAL A HA   10 
ATOM   5726  H  HB   . VAL A 1 19 ? -3.666  2.017   -6.722  1.00 0.00 ? 547 VAL A HB   10 
ATOM   5727  H  HG11 . VAL A 1 19 ? -4.249  -0.609  -6.826  1.00 0.00 ? 547 VAL A HG11 10 
ATOM   5728  H  HG12 . VAL A 1 19 ? -2.630  -0.679  -6.130  1.00 0.00 ? 547 VAL A HG12 10 
ATOM   5729  H  HG13 . VAL A 1 19 ? -2.891  0.126   -7.678  1.00 0.00 ? 547 VAL A HG13 10 
ATOM   5730  H  HG21 . VAL A 1 19 ? -5.687  0.945   -5.855  1.00 0.00 ? 547 VAL A HG21 10 
ATOM   5731  H  HG22 . VAL A 1 19 ? -5.046  2.127   -4.713  1.00 0.00 ? 547 VAL A HG22 10 
ATOM   5732  H  HG23 . VAL A 1 19 ? -4.793  0.404   -4.435  1.00 0.00 ? 547 VAL A HG23 10 
ATOM   5733  N  N    . TYR A 1 20 ? -0.282  0.839   -5.994  1.00 0.00 ? 548 TYR A N    10 
ATOM   5734  C  CA   . TYR A 1 20 ? 0.941   0.951   -6.780  1.00 0.00 ? 548 TYR A CA   10 
ATOM   5735  C  C    . TYR A 1 20 ? 1.136   -0.283  -7.655  1.00 0.00 ? 548 TYR A C    10 
ATOM   5736  O  O    . TYR A 1 20 ? 0.686   -1.377  -7.312  1.00 0.00 ? 548 TYR A O    10 
ATOM   5737  C  CB   . TYR A 1 20 ? 2.150   1.133   -5.861  1.00 0.00 ? 548 TYR A CB   10 
ATOM   5738  C  CG   . TYR A 1 20 ? 2.294   2.536   -5.313  1.00 0.00 ? 548 TYR A CG   10 
ATOM   5739  C  CD1  . TYR A 1 20 ? 2.091   3.646   -6.123  1.00 0.00 ? 548 TYR A CD1  10 
ATOM   5740  C  CD2  . TYR A 1 20 ? 2.634   2.748   -3.983  1.00 0.00 ? 548 TYR A CD2  10 
ATOM   5741  C  CE1  . TYR A 1 20 ? 2.224   4.928   -5.623  1.00 0.00 ? 548 TYR A CE1  10 
ATOM   5742  C  CE2  . TYR A 1 20 ? 2.767   4.027   -3.475  1.00 0.00 ? 548 TYR A CE2  10 
ATOM   5743  C  CZ   . TYR A 1 20 ? 2.561   5.113   -4.299  1.00 0.00 ? 548 TYR A CZ   10 
ATOM   5744  O  OH   . TYR A 1 20 ? 2.694   6.388   -3.798  1.00 0.00 ? 548 TYR A OH   10 
ATOM   5745  H  H    . TYR A 1 20 ? -0.468  0.003   -5.517  1.00 0.00 ? 548 TYR A H    10 
ATOM   5746  H  HA   . TYR A 1 20 ? 0.848   1.817   -7.417  1.00 0.00 ? 548 TYR A HA   10 
ATOM   5747  H  HB2  . TYR A 1 20 ? 2.061   0.459   -5.023  1.00 0.00 ? 548 TYR A HB2  10 
ATOM   5748  H  HB3  . TYR A 1 20 ? 3.049   0.898   -6.412  1.00 0.00 ? 548 TYR A HB3  10 
ATOM   5749  H  HD1  . TYR A 1 20 ? 1.827   3.499   -7.160  1.00 0.00 ? 548 TYR A HD1  10 
ATOM   5750  H  HD2  . TYR A 1 20 ? 2.795   1.896   -3.340  1.00 0.00 ? 548 TYR A HD2  10 
ATOM   5751  H  HE1  . TYR A 1 20 ? 2.062   5.778   -6.269  1.00 0.00 ? 548 TYR A HE1  10 
ATOM   5752  H  HE2  . TYR A 1 20 ? 3.032   4.171   -2.438  1.00 0.00 ? 548 TYR A HE2  10 
ATOM   5753  H  HH   . TYR A 1 20 ? 1.931   6.913   -4.051  1.00 0.00 ? 548 TYR A HH   10 
ATOM   5754  N  N    . GLY A 1 21 ? 1.809   -0.101  -8.786  1.00 0.00 ? 549 GLY A N    10 
ATOM   5755  C  CA   . GLY A 1 21 ? 2.050   -1.210  -9.691  1.00 0.00 ? 549 GLY A CA   10 
ATOM   5756  C  C    . GLY A 1 21 ? 3.403   -1.863  -9.471  1.00 0.00 ? 549 GLY A C    10 
ATOM   5757  O  O    . GLY A 1 21 ? 3.868   -2.635  -10.310 1.00 0.00 ? 549 GLY A O    10 
ATOM   5758  H  H    . GLY A 1 21 ? 2.144   0.792   -9.009  1.00 0.00 ? 549 GLY A H    10 
ATOM   5759  H  HA2  . GLY A 1 21 ? 1.279   -1.952  -9.546  1.00 0.00 ? 549 GLY A HA2  10 
ATOM   5760  H  HA3  . GLY A 1 21 ? 1.999   -0.848  -10.707 1.00 0.00 ? 549 GLY A HA3  10 
ATOM   5761  N  N    . LYS A 1 22 ? 4.038   -1.555  -8.343  1.00 0.00 ? 550 LYS A N    10 
ATOM   5762  C  CA   . LYS A 1 22 ? 5.343   -2.121  -8.024  1.00 0.00 ? 550 LYS A CA   10 
ATOM   5763  C  C    . LYS A 1 22 ? 5.517   -2.268  -6.515  1.00 0.00 ? 550 LYS A C    10 
ATOM   5764  O  O    . LYS A 1 22 ? 5.258   -1.334  -5.756  1.00 0.00 ? 550 LYS A O    10 
ATOM   5765  C  CB   . LYS A 1 22 ? 6.457   -1.242  -8.598  1.00 0.00 ? 550 LYS A CB   10 
ATOM   5766  C  CG   . LYS A 1 22 ? 7.250   -1.914  -9.707  1.00 0.00 ? 550 LYS A CG   10 
ATOM   5767  C  CD   . LYS A 1 22 ? 8.446   -1.074  -10.124 1.00 0.00 ? 550 LYS A CD   10 
ATOM   5768  C  CE   . LYS A 1 22 ? 8.956   -1.474  -11.499 1.00 0.00 ? 550 LYS A CE   10 
ATOM   5769  N  NZ   . LYS A 1 22 ? 10.412  -1.203  -11.651 1.00 0.00 ? 550 LYS A NZ   10 
ATOM   5770  H  H    . LYS A 1 22 ? 3.619   -0.935  -7.711  1.00 0.00 ? 550 LYS A H    10 
ATOM   5771  H  HA   . LYS A 1 22 ? 5.399   -3.099  -8.477  1.00 0.00 ? 550 LYS A HA   10 
ATOM   5772  H  HB2  . LYS A 1 22 ? 6.018   -0.339  -8.997  1.00 0.00 ? 550 LYS A HB2  10 
ATOM   5773  H  HB3  . LYS A 1 22 ? 7.141   -0.978  -7.805  1.00 0.00 ? 550 LYS A HB3  10 
ATOM   5774  H  HG2  . LYS A 1 22 ? 7.602   -2.872  -9.354  1.00 0.00 ? 550 LYS A HG2  10 
ATOM   5775  H  HG3  . LYS A 1 22 ? 6.606   -2.057  -10.562 1.00 0.00 ? 550 LYS A HG3  10 
ATOM   5776  H  HD2  . LYS A 1 22 ? 8.153   -0.035  -10.148 1.00 0.00 ? 550 LYS A HD2  10 
ATOM   5777  H  HD3  . LYS A 1 22 ? 9.239   -1.210  -9.402  1.00 0.00 ? 550 LYS A HD3  10 
ATOM   5778  H  HE2  . LYS A 1 22 ? 8.778   -2.529  -11.642 1.00 0.00 ? 550 LYS A HE2  10 
ATOM   5779  H  HE3  . LYS A 1 22 ? 8.414   -0.914  -12.247 1.00 0.00 ? 550 LYS A HE3  10 
ATOM   5780  H  HZ1  . LYS A 1 22 ? 10.919  -1.479  -10.786 1.00 0.00 ? 550 LYS A HZ1  10 
ATOM   5781  H  HZ2  . LYS A 1 22 ? 10.571  -0.190  -11.825 1.00 0.00 ? 550 LYS A HZ2  10 
ATOM   5782  H  HZ3  . LYS A 1 22 ? 10.794  -1.745  -12.453 1.00 0.00 ? 550 LYS A HZ3  10 
ATOM   5783  N  N    . THR A 1 23 ? 5.957   -3.447  -6.087  1.00 0.00 ? 551 THR A N    10 
ATOM   5784  C  CA   . THR A 1 23 ? 6.167   -3.715  -4.668  1.00 0.00 ? 551 THR A CA   10 
ATOM   5785  C  C    . THR A 1 23 ? 7.344   -2.909  -4.130  1.00 0.00 ? 551 THR A C    10 
ATOM   5786  O  O    . THR A 1 23 ? 7.381   -2.558  -2.951  1.00 0.00 ? 551 THR A O    10 
ATOM   5787  C  CB   . THR A 1 23 ? 6.408   -5.208  -4.440  1.00 0.00 ? 551 THR A CB   10 
ATOM   5788  O  OG1  . THR A 1 23 ? 6.608   -5.478  -3.064  1.00 0.00 ? 551 THR A OG1  10 
ATOM   5789  C  CG2  . THR A 1 23 ? 7.608   -5.741  -5.192  1.00 0.00 ? 551 THR A CG2  10 
ATOM   5790  H  H    . THR A 1 23 ? 6.147   -4.152  -6.740  1.00 0.00 ? 551 THR A H    10 
ATOM   5791  H  HA   . THR A 1 23 ? 5.273   -3.418  -4.140  1.00 0.00 ? 551 THR A HA   10 
ATOM   5792  H  HB   . THR A 1 23 ? 5.539   -5.757  -4.771  1.00 0.00 ? 551 THR A HB   10 
ATOM   5793  H  HG1  . THR A 1 23 ? 7.424   -5.066  -2.771  1.00 0.00 ? 551 THR A HG1  10 
ATOM   5794  H  HG21 . THR A 1 23 ? 7.275   -6.398  -5.981  1.00 0.00 ? 551 THR A HG21 10 
ATOM   5795  H  HG22 . THR A 1 23 ? 8.244   -6.289  -4.512  1.00 0.00 ? 551 THR A HG22 10 
ATOM   5796  H  HG23 . THR A 1 23 ? 8.161   -4.918  -5.618  1.00 0.00 ? 551 THR A HG23 10 
ATOM   5797  N  N    . SER A 1 24 ? 8.306   -2.616  -5.002  1.00 0.00 ? 552 SER A N    10 
ATOM   5798  C  CA   . SER A 1 24 ? 9.484   -1.849  -4.613  1.00 0.00 ? 552 SER A CA   10 
ATOM   5799  C  C    . SER A 1 24 ? 9.082   -0.507  -4.008  1.00 0.00 ? 552 SER A C    10 
ATOM   5800  O  O    . SER A 1 24 ? 9.759   0.015   -3.123  1.00 0.00 ? 552 SER A O    10 
ATOM   5801  C  CB   . SER A 1 24 ? 10.396  -1.625  -5.821  1.00 0.00 ? 552 SER A CB   10 
ATOM   5802  O  OG   . SER A 1 24 ? 10.761  -2.857  -6.419  1.00 0.00 ? 552 SER A OG   10 
ATOM   5803  H  H    . SER A 1 24 ? 8.220   -2.922  -5.929  1.00 0.00 ? 552 SER A H    10 
ATOM   5804  H  HA   . SER A 1 24 ? 10.020  -2.419  -3.869  1.00 0.00 ? 552 SER A HA   10 
ATOM   5805  H  HB2  . SER A 1 24 ? 9.878   -1.023  -6.553  1.00 0.00 ? 552 SER A HB2  10 
ATOM   5806  H  HB3  . SER A 1 24 ? 11.292  -1.113  -5.502  1.00 0.00 ? 552 SER A HB3  10 
ATOM   5807  H  HG   . SER A 1 24 ? 11.296  -2.688  -7.198  1.00 0.00 ? 552 SER A HG   10 
ATOM   5808  N  N    . HIS A 1 25 ? 7.971   0.042   -4.490  1.00 0.00 ? 553 HIS A N    10 
ATOM   5809  C  CA   . HIS A 1 25 ? 7.474   1.319   -3.994  1.00 0.00 ? 553 HIS A CA   10 
ATOM   5810  C  C    . HIS A 1 25 ? 6.902   1.166   -2.588  1.00 0.00 ? 553 HIS A C    10 
ATOM   5811  O  O    . HIS A 1 25 ? 6.911   2.109   -1.797  1.00 0.00 ? 553 HIS A O    10 
ATOM   5812  C  CB   . HIS A 1 25 ? 6.405   1.876   -4.938  1.00 0.00 ? 553 HIS A CB   10 
ATOM   5813  C  CG   . HIS A 1 25 ? 6.678   3.277   -5.390  1.00 0.00 ? 553 HIS A CG   10 
ATOM   5814  N  ND1  . HIS A 1 25 ? 6.894   3.632   -6.703  1.00 0.00 ? 553 HIS A ND1  10 
ATOM   5815  C  CD2  . HIS A 1 25 ? 6.766   4.426   -4.672  1.00 0.00 ? 553 HIS A CD2  10 
ATOM   5816  C  CE1  . HIS A 1 25 ? 7.104   4.955   -6.742  1.00 0.00 ? 553 HIS A CE1  10 
ATOM   5817  N  NE2  . HIS A 1 25 ? 7.036   5.484   -5.536  1.00 0.00 ? 553 HIS A NE2  10 
ATOM   5818  H  H    . HIS A 1 25 ? 7.472   -0.425  -5.192  1.00 0.00 ? 553 HIS A H    10 
ATOM   5819  H  HA   . HIS A 1 25 ? 8.305   2.007   -3.958  1.00 0.00 ? 553 HIS A HA   10 
ATOM   5820  H  HB2  . HIS A 1 25 ? 6.349   1.250   -5.816  1.00 0.00 ? 553 HIS A HB2  10 
ATOM   5821  H  HB3  . HIS A 1 25 ? 5.448   1.869   -4.435  1.00 0.00 ? 553 HIS A HB3  10 
ATOM   5822  H  HD1  . HIS A 1 25 ? 6.895   3.025   -7.473  1.00 0.00 ? 553 HIS A HD1  10 
ATOM   5823  H  HD2  . HIS A 1 25 ? 6.649   4.516   -3.603  1.00 0.00 ? 553 HIS A HD2  10 
ATOM   5824  H  HE1  . HIS A 1 25 ? 7.301   5.516   -7.644  1.00 0.00 ? 553 HIS A HE1  10 
ATOM   5825  N  N    . LEU A 1 26 ? 6.408   -0.031  -2.283  1.00 0.00 ? 554 LEU A N    10 
ATOM   5826  C  CA   . LEU A 1 26 ? 5.836   -0.309  -0.971  1.00 0.00 ? 554 LEU A CA   10 
ATOM   5827  C  C    . LEU A 1 26 ? 6.849   -0.020  0.132   1.00 0.00 ? 554 LEU A C    10 
ATOM   5828  O  O    . LEU A 1 26 ? 6.514   0.571   1.159   1.00 0.00 ? 554 LEU A O    10 
ATOM   5829  C  CB   . LEU A 1 26 ? 5.374   -1.767  -0.892  1.00 0.00 ? 554 LEU A CB   10 
ATOM   5830  C  CG   . LEU A 1 26 ? 3.954   -1.966  -0.358  1.00 0.00 ? 554 LEU A CG   10 
ATOM   5831  C  CD1  . LEU A 1 26 ? 2.963   -2.077  -1.506  1.00 0.00 ? 554 LEU A CD1  10 
ATOM   5832  C  CD2  . LEU A 1 26 ? 3.886   -3.201  0.528   1.00 0.00 ? 554 LEU A CD2  10 
ATOM   5833  H  H    . LEU A 1 26 ? 6.431   -0.744  -2.955  1.00 0.00 ? 554 LEU A H    10 
ATOM   5834  H  HA   . LEU A 1 26 ? 4.982   0.338   -0.839  1.00 0.00 ? 554 LEU A HA   10 
ATOM   5835  H  HB2  . LEU A 1 26 ? 5.427   -2.193  -1.883  1.00 0.00 ? 554 LEU A HB2  10 
ATOM   5836  H  HB3  . LEU A 1 26 ? 6.055   -2.306  -0.250  1.00 0.00 ? 554 LEU A HB3  10 
ATOM   5837  H  HG   . LEU A 1 26 ? 3.677   -1.109  0.239   1.00 0.00 ? 554 LEU A HG   10 
ATOM   5838  H  HD11 . LEU A 1 26 ? 3.371   -1.593  -2.382  1.00 0.00 ? 554 LEU A HD11 10 
ATOM   5839  H  HD12 . LEU A 1 26 ? 2.036   -1.597  -1.229  1.00 0.00 ? 554 LEU A HD12 10 
ATOM   5840  H  HD13 . LEU A 1 26 ? 2.778   -3.118  -1.723  1.00 0.00 ? 554 LEU A HD13 10 
ATOM   5841  H  HD21 . LEU A 1 26 ? 4.862   -3.399  0.945   1.00 0.00 ? 554 LEU A HD21 10 
ATOM   5842  H  HD22 . LEU A 1 26 ? 3.567   -4.049  -0.060  1.00 0.00 ? 554 LEU A HD22 10 
ATOM   5843  H  HD23 . LEU A 1 26 ? 3.180   -3.032  1.328   1.00 0.00 ? 554 LEU A HD23 10 
ATOM   5844  N  N    . ARG A 1 27 ? 8.090   -0.442  -0.089  1.00 0.00 ? 555 ARG A N    10 
ATOM   5845  C  CA   . ARG A 1 27 ? 9.155   -0.231  0.881   1.00 0.00 ? 555 ARG A CA   10 
ATOM   5846  C  C    . ARG A 1 27 ? 9.346   1.252   1.178   1.00 0.00 ? 555 ARG A C    10 
ATOM   5847  O  O    . ARG A 1 27 ? 9.357   1.666   2.337   1.00 0.00 ? 555 ARG A O    10 
ATOM   5848  C  CB   . ARG A 1 27 ? 10.463  -0.832  0.364   1.00 0.00 ? 555 ARG A CB   10 
ATOM   5849  C  CG   . ARG A 1 27 ? 11.072  -1.845  1.312   1.00 0.00 ? 555 ARG A CG   10 
ATOM   5850  C  CD   . ARG A 1 27 ? 12.458  -2.273  0.858   1.00 0.00 ? 555 ARG A CD   10 
ATOM   5851  N  NE   . ARG A 1 27 ? 13.155  -3.048  1.883   1.00 0.00 ? 555 ARG A NE   10 
ATOM   5852  C  CZ   . ARG A 1 27 ? 14.473  -3.228  1.908   1.00 0.00 ? 555 ARG A CZ   10 
ATOM   5853  N  NH1  . ARG A 1 27 ? 15.242  -2.693  0.968   1.00 0.00 ? 555 ARG A NH1  10 
ATOM   5854  N  NH2  . ARG A 1 27 ? 15.025  -3.945  2.877   1.00 0.00 ? 555 ARG A NH2  10 
ATOM   5855  H  H    . ARG A 1 27 ? 8.295   -0.908  -0.925  1.00 0.00 ? 555 ARG A H    10 
ATOM   5856  H  HA   . ARG A 1 27 ? 8.876   -0.735  1.794   1.00 0.00 ? 555 ARG A HA   10 
ATOM   5857  H  HB2  . ARG A 1 27 ? 10.272  -1.322  -0.580  1.00 0.00 ? 555 ARG A HB2  10 
ATOM   5858  H  HB3  . ARG A 1 27 ? 11.179  -0.038  0.210   1.00 0.00 ? 555 ARG A HB3  10 
ATOM   5859  H  HG2  . ARG A 1 27 ? 11.145  -1.403  2.294   1.00 0.00 ? 555 ARG A HG2  10 
ATOM   5860  H  HG3  . ARG A 1 27 ? 10.430  -2.713  1.352   1.00 0.00 ? 555 ARG A HG3  10 
ATOM   5861  H  HD2  . ARG A 1 27 ? 12.361  -2.877  -0.032  1.00 0.00 ? 555 ARG A HD2  10 
ATOM   5862  H  HD3  . ARG A 1 27 ? 13.037  -1.390  0.632   1.00 0.00 ? 555 ARG A HD3  10 
ATOM   5863  H  HE   . ARG A 1 27 ? 12.611  -3.455  2.589   1.00 0.00 ? 555 ARG A HE   10 
ATOM   5864  H  HH11 . ARG A 1 27 ? 14.832  -2.151  0.234   1.00 0.00 ? 555 ARG A HH11 10 
ATOM   5865  H  HH12 . ARG A 1 27 ? 16.232  -2.832  0.993   1.00 0.00 ? 555 ARG A HH12 10 
ATOM   5866  H  HH21 . ARG A 1 27 ? 14.451  -4.351  3.589   1.00 0.00 ? 555 ARG A HH21 10 
ATOM   5867  H  HH22 . ARG A 1 27 ? 16.016  -4.081  2.897   1.00 0.00 ? 555 ARG A HH22 10 
ATOM   5868  N  N    . ALA A 1 28 ? 9.499   2.047   0.125   1.00 0.00 ? 556 ALA A N    10 
ATOM   5869  C  CA   . ALA A 1 28 ? 9.693   3.482   0.280   1.00 0.00 ? 556 ALA A CA   10 
ATOM   5870  C  C    . ALA A 1 28 ? 8.497   4.120   0.977   1.00 0.00 ? 556 ALA A C    10 
ATOM   5871  O  O    . ALA A 1 28 ? 8.643   5.091   1.718   1.00 0.00 ? 556 ALA A O    10 
ATOM   5872  C  CB   . ALA A 1 28 ? 9.930   4.134   -1.074  1.00 0.00 ? 556 ALA A CB   10 
ATOM   5873  H  H    . ALA A 1 28 ? 9.484   1.660   -0.776  1.00 0.00 ? 556 ALA A H    10 
ATOM   5874  H  HA   . ALA A 1 28 ? 10.574  3.633   0.888   1.00 0.00 ? 556 ALA A HA   10 
ATOM   5875  H  HB1  . ALA A 1 28 ? 9.454   3.546   -1.845  1.00 0.00 ? 556 ALA A HB1  10 
ATOM   5876  H  HB2  . ALA A 1 28 ? 10.991  4.189   -1.266  1.00 0.00 ? 556 ALA A HB2  10 
ATOM   5877  H  HB3  . ALA A 1 28 ? 9.513   5.130   -1.071  1.00 0.00 ? 556 ALA A HB3  10 
ATOM   5878  N  N    . HIS A 1 29 ? 7.315   3.567   0.734   1.00 0.00 ? 557 HIS A N    10 
ATOM   5879  C  CA   . HIS A 1 29 ? 6.096   4.077   1.337   1.00 0.00 ? 557 HIS A CA   10 
ATOM   5880  C  C    . HIS A 1 29 ? 5.954   3.584   2.776   1.00 0.00 ? 557 HIS A C    10 
ATOM   5881  O  O    . HIS A 1 29 ? 5.442   4.297   3.639   1.00 0.00 ? 557 HIS A O    10 
ATOM   5882  C  CB   . HIS A 1 29 ? 4.877   3.653   0.512   1.00 0.00 ? 557 HIS A CB   10 
ATOM   5883  C  CG   . HIS A 1 29 ? 3.568   3.979   1.161   1.00 0.00 ? 557 HIS A CG   10 
ATOM   5884  N  ND1  . HIS A 1 29 ? 3.340   5.122   1.895   1.00 0.00 ? 557 HIS A ND1  10 
ATOM   5885  C  CD2  . HIS A 1 29 ? 2.406   3.280   1.186   1.00 0.00 ? 557 HIS A CD2  10 
ATOM   5886  C  CE1  . HIS A 1 29 ? 2.075   5.082   2.335   1.00 0.00 ? 557 HIS A CE1  10 
ATOM   5887  N  NE2  . HIS A 1 29 ? 1.465   3.984   1.932   1.00 0.00 ? 557 HIS A NE2  10 
ATOM   5888  H  H    . HIS A 1 29 ? 7.262   2.798   0.136   1.00 0.00 ? 557 HIS A H    10 
ATOM   5889  H  HA   . HIS A 1 29 ? 6.159   5.151   1.341   1.00 0.00 ? 557 HIS A HA   10 
ATOM   5890  H  HB2  . HIS A 1 29 ? 4.907   4.154   -0.444  1.00 0.00 ? 557 HIS A HB2  10 
ATOM   5891  H  HB3  . HIS A 1 29 ? 4.914   2.585   0.353   1.00 0.00 ? 557 HIS A HB3  10 
ATOM   5892  H  HD1  . HIS A 1 29 ? 3.987   5.838   2.065   1.00 0.00 ? 557 HIS A HD1  10 
ATOM   5893  H  HD2  . HIS A 1 29 ? 2.228   2.328   0.707   1.00 0.00 ? 557 HIS A HD2  10 
ATOM   5894  H  HE1  . HIS A 1 29 ? 1.615   5.848   2.940   1.00 0.00 ? 557 HIS A HE1  10 
ATOM   5895  N  N    . LEU A 1 30 ? 6.406   2.359   3.023   1.00 0.00 ? 558 LEU A N    10 
ATOM   5896  C  CA   . LEU A 1 30 ? 6.325   1.768   4.353   1.00 0.00 ? 558 LEU A CA   10 
ATOM   5897  C  C    . LEU A 1 30 ? 7.150   2.565   5.360   1.00 0.00 ? 558 LEU A C    10 
ATOM   5898  O  O    . LEU A 1 30 ? 6.736   2.753   6.504   1.00 0.00 ? 558 LEU A O    10 
ATOM   5899  C  CB   . LEU A 1 30 ? 6.803   0.314   4.317   1.00 0.00 ? 558 LEU A CB   10 
ATOM   5900  C  CG   . LEU A 1 30 ? 5.832   -0.702  4.920   1.00 0.00 ? 558 LEU A CG   10 
ATOM   5901  C  CD1  . LEU A 1 30 ? 4.489   -0.642  4.209   1.00 0.00 ? 558 LEU A CD1  10 
ATOM   5902  C  CD2  . LEU A 1 30 ? 6.415   -2.105  4.846   1.00 0.00 ? 558 LEU A CD2  10 
ATOM   5903  H  H    . LEU A 1 30 ? 6.801   1.838   2.293   1.00 0.00 ? 558 LEU A H    10 
ATOM   5904  H  HA   . LEU A 1 30 ? 5.290   1.788   4.659   1.00 0.00 ? 558 LEU A HA   10 
ATOM   5905  H  HB2  . LEU A 1 30 ? 6.982   0.042   3.287   1.00 0.00 ? 558 LEU A HB2  10 
ATOM   5906  H  HB3  . LEU A 1 30 ? 7.737   0.247   4.855   1.00 0.00 ? 558 LEU A HB3  10 
ATOM   5907  H  HG   . LEU A 1 30 ? 5.669   -0.460  5.961   1.00 0.00 ? 558 LEU A HG   10 
ATOM   5908  H  HD11 . LEU A 1 30 ? 3.826   0.020   4.747   1.00 0.00 ? 558 LEU A HD11 10 
ATOM   5909  H  HD12 . LEU A 1 30 ? 4.057   -1.631  4.170   1.00 0.00 ? 558 LEU A HD12 10 
ATOM   5910  H  HD13 . LEU A 1 30 ? 4.630   -0.271  3.205   1.00 0.00 ? 558 LEU A HD13 10 
ATOM   5911  H  HD21 . LEU A 1 30 ? 7.456   -2.077  5.131   1.00 0.00 ? 558 LEU A HD21 10 
ATOM   5912  H  HD22 . LEU A 1 30 ? 6.327   -2.478  3.837   1.00 0.00 ? 558 LEU A HD22 10 
ATOM   5913  H  HD23 . LEU A 1 30 ? 5.875   -2.755  5.519   1.00 0.00 ? 558 LEU A HD23 10 
ATOM   5914  N  N    . ARG A 1 31 ? 8.318   3.030   4.930   1.00 0.00 ? 559 ARG A N    10 
ATOM   5915  C  CA   . ARG A 1 31 ? 9.196   3.805   5.799   1.00 0.00 ? 559 ARG A CA   10 
ATOM   5916  C  C    . ARG A 1 31 ? 8.494   5.063   6.300   1.00 0.00 ? 559 ARG A C    10 
ATOM   5917  O  O    . ARG A 1 31 ? 8.775   5.547   7.397   1.00 0.00 ? 559 ARG A O    10 
ATOM   5918  C  CB   . ARG A 1 31 ? 10.485  4.178   5.062   1.00 0.00 ? 559 ARG A CB   10 
ATOM   5919  C  CG   . ARG A 1 31 ? 10.269  5.113   3.883   1.00 0.00 ? 559 ARG A CG   10 
ATOM   5920  C  CD   . ARG A 1 31 ? 11.189  6.323   3.948   1.00 0.00 ? 559 ARG A CD   10 
ATOM   5921  N  NE   . ARG A 1 31 ? 12.422  6.116   3.189   1.00 0.00 ? 559 ARG A NE   10 
ATOM   5922  C  CZ   . ARG A 1 31 ? 13.568  5.694   3.722   1.00 0.00 ? 559 ARG A CZ   10 
ATOM   5923  N  NH1  . ARG A 1 31 ? 13.654  5.434   5.022   1.00 0.00 ? 559 ARG A NH1  10 
ATOM   5924  N  NH2  . ARG A 1 31 ? 14.634  5.532   2.951   1.00 0.00 ? 559 ARG A NH2  10 
ATOM   5925  H  H    . ARG A 1 31 ? 8.596   2.848   4.008   1.00 0.00 ? 559 ARG A H    10 
ATOM   5926  H  HA   . ARG A 1 31 ? 9.446   3.187   6.648   1.00 0.00 ? 559 ARG A HA   10 
ATOM   5927  H  HB2  . ARG A 1 31 ? 11.155  4.658   5.758   1.00 0.00 ? 559 ARG A HB2  10 
ATOM   5928  H  HB3  . ARG A 1 31 ? 10.950  3.274   4.696   1.00 0.00 ? 559 ARG A HB3  10 
ATOM   5929  H  HG2  . ARG A 1 31 ? 10.467  4.573   2.969   1.00 0.00 ? 559 ARG A HG2  10 
ATOM   5930  H  HG3  . ARG A 1 31 ? 9.244   5.451   3.887   1.00 0.00 ? 559 ARG A HG3  10 
ATOM   5931  H  HD2  . ARG A 1 31 ? 10.667  7.176   3.539   1.00 0.00 ? 559 ARG A HD2  10 
ATOM   5932  H  HD3  . ARG A 1 31 ? 11.437  6.517   4.980   1.00 0.00 ? 559 ARG A HD3  10 
ATOM   5933  H  HE   . ARG A 1 31 ? 12.394  6.301   2.227   1.00 0.00 ? 559 ARG A HE   10 
ATOM   5934  H  HH11 . ARG A 1 31 ? 12.858  5.553   5.612   1.00 0.00 ? 559 ARG A HH11 10 
ATOM   5935  H  HH12 . ARG A 1 31 ? 14.520  5.118   5.410   1.00 0.00 ? 559 ARG A HH12 10 
ATOM   5936  H  HH21 . ARG A 1 31 ? 14.577  5.726   1.972   1.00 0.00 ? 559 ARG A HH21 10 
ATOM   5937  H  HH22 . ARG A 1 31 ? 15.495  5.216   3.349   1.00 0.00 ? 559 ARG A HH22 10 
ATOM   5938  N  N    . TRP A 1 32 ? 7.576   5.586   5.493   1.00 0.00 ? 560 TRP A N    10 
ATOM   5939  C  CA   . TRP A 1 32 ? 6.831   6.785   5.858   1.00 0.00 ? 560 TRP A CA   10 
ATOM   5940  C  C    . TRP A 1 32 ? 5.800   6.471   6.938   1.00 0.00 ? 560 TRP A C    10 
ATOM   5941  O  O    . TRP A 1 32 ? 5.512   7.304   7.798   1.00 0.00 ? 560 TRP A O    10 
ATOM   5942  C  CB   . TRP A 1 32 ? 6.138   7.376   4.627   1.00 0.00 ? 560 TRP A CB   10 
ATOM   5943  C  CG   . TRP A 1 32 ? 6.539   8.791   4.343   1.00 0.00 ? 560 TRP A CG   10 
ATOM   5944  C  CD1  . TRP A 1 32 ? 7.789   9.241   4.026   1.00 0.00 ? 560 TRP A CD1  10 
ATOM   5945  C  CD2  . TRP A 1 32 ? 5.688   9.943   4.352   1.00 0.00 ? 560 TRP A CD2  10 
ATOM   5946  N  NE1  . TRP A 1 32 ? 7.766   10.602  3.836   1.00 0.00 ? 560 TRP A NE1  10 
ATOM   5947  C  CE2  . TRP A 1 32 ? 6.488   11.056  4.031   1.00 0.00 ? 560 TRP A CE2  10 
ATOM   5948  C  CE3  . TRP A 1 32 ? 4.326   10.141  4.599   1.00 0.00 ? 560 TRP A CE3  10 
ATOM   5949  C  CZ2  . TRP A 1 32 ? 5.971   12.346  3.951   1.00 0.00 ? 560 TRP A CZ2  10 
ATOM   5950  C  CZ3  . TRP A 1 32 ? 3.814   11.423  4.519   1.00 0.00 ? 560 TRP A CZ3  10 
ATOM   5951  C  CH2  . TRP A 1 32 ? 4.635   12.511  4.197   1.00 0.00 ? 560 TRP A CH2  10 
ATOM   5952  H  H    . TRP A 1 32 ? 7.394   5.154   4.632   1.00 0.00 ? 560 TRP A H    10 
ATOM   5953  H  HA   . TRP A 1 32 ? 7.534   7.506   6.247   1.00 0.00 ? 560 TRP A HA   10 
ATOM   5954  H  HB2  . TRP A 1 32 ? 6.387   6.780   3.762   1.00 0.00 ? 560 TRP A HB2  10 
ATOM   5955  H  HB3  . TRP A 1 32 ? 5.068   7.355   4.777   1.00 0.00 ? 560 TRP A HB3  10 
ATOM   5956  H  HD1  . TRP A 1 32 ? 8.659   8.608   3.940   1.00 0.00 ? 560 TRP A HD1  10 
ATOM   5957  H  HE1  . TRP A 1 32 ? 8.539   11.156  3.600   1.00 0.00 ? 560 TRP A HE1  10 
ATOM   5958  H  HE3  . TRP A 1 32 ? 3.677   9.314   4.849   1.00 0.00 ? 560 TRP A HE3  10 
ATOM   5959  H  HZ2  . TRP A 1 32 ? 6.590   13.196  3.703   1.00 0.00 ? 560 TRP A HZ2  10 
ATOM   5960  H  HZ3  . TRP A 1 32 ? 2.765   11.595  4.707   1.00 0.00 ? 560 TRP A HZ3  10 
ATOM   5961  H  HH2  . TRP A 1 32 ? 4.193   13.495  4.147   1.00 0.00 ? 560 TRP A HH2  10 
ATOM   5962  N  N    . HIS A 1 33 ? 5.249   5.263   6.887   1.00 0.00 ? 561 HIS A N    10 
ATOM   5963  C  CA   . HIS A 1 33 ? 4.251   4.835   7.860   1.00 0.00 ? 561 HIS A CA   10 
ATOM   5964  C  C    . HIS A 1 33 ? 4.892   4.574   9.219   1.00 0.00 ? 561 HIS A C    10 
ATOM   5965  O  O    . HIS A 1 33 ? 4.378   5.003   10.252  1.00 0.00 ? 561 HIS A O    10 
ATOM   5966  C  CB   . HIS A 1 33 ? 3.539   3.573   7.369   1.00 0.00 ? 561 HIS A CB   10 
ATOM   5967  C  CG   . HIS A 1 33 ? 2.340   3.854   6.517   1.00 0.00 ? 561 HIS A CG   10 
ATOM   5968  N  ND1  . HIS A 1 33 ? 1.203   4.482   6.974   1.00 0.00 ? 561 HIS A ND1  10 
ATOM   5969  C  CD2  . HIS A 1 33 ? 2.115   3.579   5.206   1.00 0.00 ? 561 HIS A CD2  10 
ATOM   5970  C  CE1  . HIS A 1 33 ? 0.341   4.566   5.952   1.00 0.00 ? 561 HIS A CE1  10 
ATOM   5971  N  NE2  . HIS A 1 33 ? 0.846   4.033   4.856   1.00 0.00 ? 561 HIS A NE2  10 
ATOM   5972  H  H    . HIS A 1 33 ? 5.521   4.643   6.178   1.00 0.00 ? 561 HIS A H    10 
ATOM   5973  H  HA   . HIS A 1 33 ? 3.527   5.629   7.963   1.00 0.00 ? 561 HIS A HA   10 
ATOM   5974  H  HB2  . HIS A 1 33 ? 4.229   2.983   6.785   1.00 0.00 ? 561 HIS A HB2  10 
ATOM   5975  H  HB3  . HIS A 1 33 ? 3.213   2.997   8.223   1.00 0.00 ? 561 HIS A HB3  10 
ATOM   5976  H  HD1  . HIS A 1 33 ? 1.052   4.809   7.885   1.00 0.00 ? 561 HIS A HD1  10 
ATOM   5977  H  HD2  . HIS A 1 33 ? 2.803   3.088   4.534   1.00 0.00 ? 561 HIS A HD2  10 
ATOM   5978  H  HE1  . HIS A 1 33 ? -0.640  5.014   6.017   1.00 0.00 ? 561 HIS A HE1  10 
ATOM   5979  N  N    . THR A 1 34 ? 6.018   3.868   9.210   1.00 0.00 ? 562 THR A N    10 
ATOM   5980  C  CA   . THR A 1 34 ? 6.731   3.550   10.442  1.00 0.00 ? 562 THR A CA   10 
ATOM   5981  C  C    . THR A 1 34 ? 7.650   4.696   10.850  1.00 0.00 ? 562 THR A C    10 
ATOM   5982  O  O    . THR A 1 34 ? 8.581   5.047   10.125  1.00 0.00 ? 562 THR A O    10 
ATOM   5983  C  CB   . THR A 1 34 ? 7.543   2.266   10.270  1.00 0.00 ? 562 THR A CB   10 
ATOM   5984  O  OG1  . THR A 1 34 ? 8.243   2.277   9.038   1.00 0.00 ? 562 THR A OG1  10 
ATOM   5985  C  CG2  . THR A 1 34 ? 6.697   1.012   10.306  1.00 0.00 ? 562 THR A CG2  10 
ATOM   5986  H  H    . THR A 1 34 ? 6.379   3.554   8.355   1.00 0.00 ? 562 THR A H    10 
ATOM   5987  H  HA   . THR A 1 34 ? 5.997   3.399   11.219  1.00 0.00 ? 562 THR A HA   10 
ATOM   5988  H  HB   . THR A 1 34 ? 8.267   2.200   11.070  1.00 0.00 ? 562 THR A HB   10 
ATOM   5989  H  HG1  . THR A 1 34 ? 9.181   2.398   9.203   1.00 0.00 ? 562 THR A HG1  10 
ATOM   5990  H  HG21 . THR A 1 34 ? 7.261   0.185   9.900   1.00 0.00 ? 562 THR A HG21 10 
ATOM   5991  H  HG22 . THR A 1 34 ? 5.804   1.163   9.717   1.00 0.00 ? 562 THR A HG22 10 
ATOM   5992  H  HG23 . THR A 1 34 ? 6.422   0.793   11.327  1.00 0.00 ? 562 THR A HG23 10 
ATOM   5993  N  N    . GLY A 1 35 ? 7.384   5.276   12.016  1.00 0.00 ? 563 GLY A N    10 
ATOM   5994  C  CA   . GLY A 1 35 ? 8.197   6.376   12.500  1.00 0.00 ? 563 GLY A CA   10 
ATOM   5995  C  C    . GLY A 1 35 ? 7.494   7.714   12.380  1.00 0.00 ? 563 GLY A C    10 
ATOM   5996  O  O    . GLY A 1 35 ? 8.141   8.752   12.239  1.00 0.00 ? 563 GLY A O    10 
ATOM   5997  H  H    . GLY A 1 35 ? 6.629   4.954   12.552  1.00 0.00 ? 563 GLY A H    10 
ATOM   5998  H  HA2  . GLY A 1 35 ? 8.439   6.201   13.538  1.00 0.00 ? 563 GLY A HA2  10 
ATOM   5999  H  HA3  . GLY A 1 35 ? 9.113   6.410   11.929  1.00 0.00 ? 563 GLY A HA3  10 
ATOM   6000  N  N    . GLU A 1 36 ? 6.167   7.691   12.435  1.00 0.00 ? 564 GLU A N    10 
ATOM   6001  C  CA   . GLU A 1 36 ? 5.376   8.912   12.331  1.00 0.00 ? 564 GLU A CA   10 
ATOM   6002  C  C    . GLU A 1 36 ? 5.264   9.605   13.684  1.00 0.00 ? 564 GLU A C    10 
ATOM   6003  O  O    . GLU A 1 36 ? 5.385   10.827  13.779  1.00 0.00 ? 564 GLU A O    10 
ATOM   6004  C  CB   . GLU A 1 36 ? 3.980   8.594   11.791  1.00 0.00 ? 564 GLU A CB   10 
ATOM   6005  C  CG   . GLU A 1 36 ? 3.959   8.289   10.302  1.00 0.00 ? 564 GLU A CG   10 
ATOM   6006  C  CD   . GLU A 1 36 ? 2.695   8.779   9.624   1.00 0.00 ? 564 GLU A CD   10 
ATOM   6007  O  OE1  . GLU A 1 36 ? 2.334   9.958   9.822   1.00 0.00 ? 564 GLU A OE1  10 
ATOM   6008  O  OE2  . GLU A 1 36 ? 2.065   7.983   8.896   1.00 0.00 ? 564 GLU A OE2  10 
ATOM   6009  H  H    . GLU A 1 36 ? 5.708   6.832   12.548  1.00 0.00 ? 564 GLU A H    10 
ATOM   6010  H  HA   . GLU A 1 36 ? 5.877   9.573   11.641  1.00 0.00 ? 564 GLU A HA   10 
ATOM   6011  H  HB2  . GLU A 1 36 ? 3.589   7.737   12.318  1.00 0.00 ? 564 GLU A HB2  10 
ATOM   6012  H  HB3  . GLU A 1 36 ? 3.336   9.442   11.971  1.00 0.00 ? 564 GLU A HB3  10 
ATOM   6013  H  HG2  . GLU A 1 36 ? 4.807   8.769   9.837   1.00 0.00 ? 564 GLU A HG2  10 
ATOM   6014  H  HG3  . GLU A 1 36 ? 4.033   7.220   10.166  1.00 0.00 ? 564 GLU A HG3  10 
ATOM   6015  N  N    . ARG A 1 37 ? 5.034   8.818   14.729  1.00 0.00 ? 565 ARG A N    10 
ATOM   6016  C  CA   . ARG A 1 37 ? 4.906   9.356   16.079  1.00 0.00 ? 565 ARG A CA   10 
ATOM   6017  C  C    . ARG A 1 37 ? 5.615   8.462   17.091  1.00 0.00 ? 565 ARG A C    10 
ATOM   6018  O  O    . ARG A 1 37 ? 5.173   7.308   17.272  1.00 0.00 ? 565 ARG A O    10 
ATOM   6019  C  CB   . ARG A 1 37 ? 3.430   9.501   16.455  1.00 0.00 ? 565 ARG A CB   10 
ATOM   6020  C  CG   . ARG A 1 37 ? 2.587   8.290   16.089  1.00 0.00 ? 565 ARG A CG   10 
ATOM   6021  C  CD   . ARG A 1 37 ? 1.218   8.344   16.748  1.00 0.00 ? 565 ARG A CD   10 
ATOM   6022  N  NE   . ARG A 1 37 ? 1.194   7.625   18.020  1.00 0.00 ? 565 ARG A NE   10 
ATOM   6023  C  CZ   . ARG A 1 37 ? 1.098   6.301   18.122  1.00 0.00 ? 565 ARG A CZ   10 
ATOM   6024  N  NH1  . ARG A 1 37 ? 1.018   5.549   17.031  1.00 0.00 ? 565 ARG A NH1  10 
ATOM   6025  N  NH2  . ARG A 1 37 ? 1.083   5.728   19.317  1.00 0.00 ? 565 ARG A NH2  10 
ATOM   6026  O  OXT  . ARG A 1 37 ? 6.607   8.923   17.693  1.00 0.00 ? 565 ARG A OXT  10 
ATOM   6027  H  H    . ARG A 1 37 ? 4.947   7.852   14.590  1.00 0.00 ? 565 ARG A H    10 
ATOM   6028  H  HA   . ARG A 1 37 ? 5.368   10.331  16.091  1.00 0.00 ? 565 ARG A HA   10 
ATOM   6029  H  HB2  . ARG A 1 37 ? 3.356   9.655   17.521  1.00 0.00 ? 565 ARG A HB2  10 
ATOM   6030  H  HB3  . ARG A 1 37 ? 3.024   10.362  15.946  1.00 0.00 ? 565 ARG A HB3  10 
ATOM   6031  H  HG2  . ARG A 1 37 ? 2.458   8.263   15.018  1.00 0.00 ? 565 ARG A HG2  10 
ATOM   6032  H  HG3  . ARG A 1 37 ? 3.099   7.396   16.415  1.00 0.00 ? 565 ARG A HG3  10 
ATOM   6033  H  HD2  . ARG A 1 37 ? 0.959   9.377   16.925  1.00 0.00 ? 565 ARG A HD2  10 
ATOM   6034  H  HD3  . ARG A 1 37 ? 0.494   7.901   16.081  1.00 0.00 ? 565 ARG A HD3  10 
ATOM   6035  H  HE   . ARG A 1 37 ? 1.251   8.157   18.841  1.00 0.00 ? 565 ARG A HE   10 
ATOM   6036  H  HH11 . ARG A 1 37 ? 1.029   5.975   16.127  1.00 0.00 ? 565 ARG A HH11 10 
ATOM   6037  H  HH12 . ARG A 1 37 ? 0.947   4.555   17.115  1.00 0.00 ? 565 ARG A HH12 10 
ATOM   6038  H  HH21 . ARG A 1 37 ? 1.143   6.290   20.142  1.00 0.00 ? 565 ARG A HH21 10 
ATOM   6039  H  HH22 . ARG A 1 37 ? 1.011   4.734   19.394  1.00 0.00 ? 565 ARG A HH22 10 
HETATM 6040  ZN ZN   . ZN  B 2 .  ? -0.166  4.015   3.104   1.00 0.00 ? 100 ZN  A ZN   10 
ATOM   6041  N  N    . MET A 1 1  ? -4.637  -18.423 -7.676  1.00 0.00 ? 1   MET A N    11 
ATOM   6042  C  CA   . MET A 1 1  ? -4.599  -17.002 -8.110  1.00 0.00 ? 1   MET A CA   11 
ATOM   6043  C  C    . MET A 1 1  ? -5.954  -16.555 -8.651  1.00 0.00 ? 1   MET A C    11 
ATOM   6044  O  O    . MET A 1 1  ? -6.388  -17.004 -9.712  1.00 0.00 ? 1   MET A O    11 
ATOM   6045  C  CB   . MET A 1 1  ? -3.521  -16.850 -9.185  1.00 0.00 ? 1   MET A CB   11 
ATOM   6046  C  CG   . MET A 1 1  ? -2.480  -15.792 -8.858  1.00 0.00 ? 1   MET A CG   11 
ATOM   6047  S  SD   . MET A 1 1  ? -1.029  -15.891 -9.923  1.00 0.00 ? 1   MET A SD   11 
ATOM   6048  C  CE   . MET A 1 1  ? -0.162  -14.396 -9.455  1.00 0.00 ? 1   MET A CE   11 
ATOM   6049  H  H1   . MET A 1 1  ? -5.530  -18.575 -7.166  1.00 0.00 ? 1   MET A H1   11 
ATOM   6050  H  H2   . MET A 1 1  ? -3.817  -18.586 -7.055  1.00 0.00 ? 1   MET A H2   11 
ATOM   6051  H  H3   . MET A 1 1  ? -4.587  -19.016 -8.528  1.00 0.00 ? 1   MET A H3   11 
ATOM   6052  H  HA   . MET A 1 1  ? -4.341  -16.390 -7.259  1.00 0.00 ? 1   MET A HA   11 
ATOM   6053  H  HB2  . MET A 1 1  ? -3.014  -17.796 -9.306  1.00 0.00 ? 1   MET A HB2  11 
ATOM   6054  H  HB3  . MET A 1 1  ? -3.992  -16.584 -10.120 1.00 0.00 ? 1   MET A HB3  11 
ATOM   6055  H  HG2  . MET A 1 1  ? -2.929  -14.817 -8.976  1.00 0.00 ? 1   MET A HG2  11 
ATOM   6056  H  HG3  . MET A 1 1  ? -2.167  -15.920 -7.832  1.00 0.00 ? 1   MET A HG3  11 
ATOM   6057  H  HE1  . MET A 1 1  ? 0.217   -14.500 -8.449  1.00 0.00 ? 1   MET A HE1  11 
ATOM   6058  H  HE2  . MET A 1 1  ? -0.841  -13.557 -9.499  1.00 0.00 ? 1   MET A HE2  11 
ATOM   6059  H  HE3  . MET A 1 1  ? 0.661   -14.229 -10.134 1.00 0.00 ? 1   MET A HE3  11 
ATOM   6060  N  N    . ASP A 1 2  ? -6.617  -15.670 -7.915  1.00 0.00 ? 530 ASP A N    11 
ATOM   6061  C  CA   . ASP A 1 2  ? -7.923  -15.162 -8.320  1.00 0.00 ? 530 ASP A CA   11 
ATOM   6062  C  C    . ASP A 1 2  ? -7.795  -14.236 -9.530  1.00 0.00 ? 530 ASP A C    11 
ATOM   6063  O  O    . ASP A 1 2  ? -7.250  -13.138 -9.421  1.00 0.00 ? 530 ASP A O    11 
ATOM   6064  C  CB   . ASP A 1 2  ? -8.584  -14.416 -7.159  1.00 0.00 ? 530 ASP A CB   11 
ATOM   6065  C  CG   . ASP A 1 2  ? -10.069 -14.703 -7.059  1.00 0.00 ? 530 ASP A CG   11 
ATOM   6066  O  OD1  . ASP A 1 2  ? -10.833 -14.184 -7.900  1.00 0.00 ? 530 ASP A OD1  11 
ATOM   6067  O  OD2  . ASP A 1 2  ? -10.469 -15.446 -6.138  1.00 0.00 ? 530 ASP A OD2  11 
ATOM   6068  H  H    . ASP A 1 2  ? -6.219  -15.350 -7.078  1.00 0.00 ? 530 ASP A H    11 
ATOM   6069  H  HA   . ASP A 1 2  ? -8.538  -16.008 -8.587  1.00 0.00 ? 530 ASP A HA   11 
ATOM   6070  H  HB2  . ASP A 1 2  ? -8.115  -14.715 -6.234  1.00 0.00 ? 530 ASP A HB2  11 
ATOM   6071  H  HB3  . ASP A 1 2  ? -8.449  -13.353 -7.299  1.00 0.00 ? 530 ASP A HB3  11 
ATOM   6072  N  N    . PRO A 1 3  ? -8.297  -14.664 -10.703 1.00 0.00 ? 531 PRO A N    11 
ATOM   6073  C  CA   . PRO A 1 3  ? -8.230  -13.859 -11.928 1.00 0.00 ? 531 PRO A CA   11 
ATOM   6074  C  C    . PRO A 1 3  ? -9.117  -12.621 -11.857 1.00 0.00 ? 531 PRO A C    11 
ATOM   6075  O  O    . PRO A 1 3  ? -10.342 -12.725 -11.800 1.00 0.00 ? 531 PRO A O    11 
ATOM   6076  C  CB   . PRO A 1 3  ? -8.732  -14.815 -13.014 1.00 0.00 ? 531 PRO A CB   11 
ATOM   6077  C  CG   . PRO A 1 3  ? -9.586  -15.796 -12.289 1.00 0.00 ? 531 PRO A CG   11 
ATOM   6078  C  CD   . PRO A 1 3  ? -8.966  -15.960 -10.930 1.00 0.00 ? 531 PRO A CD   11 
ATOM   6079  H  HA   . PRO A 1 3  ? -7.215  -13.561 -12.149 1.00 0.00 ? 531 PRO A HA   11 
ATOM   6080  H  HB2  . PRO A 1 3  ? -9.300  -14.262 -13.748 1.00 0.00 ? 531 PRO A HB2  11 
ATOM   6081  H  HB3  . PRO A 1 3  ? -7.892  -15.299 -13.489 1.00 0.00 ? 531 PRO A HB3  11 
ATOM   6082  H  HG2  . PRO A 1 3  ? -10.592 -15.412 -12.199 1.00 0.00 ? 531 PRO A HG2  11 
ATOM   6083  H  HG3  . PRO A 1 3  ? -9.590  -16.739 -12.816 1.00 0.00 ? 531 PRO A HG3  11 
ATOM   6084  H  HD2  . PRO A 1 3  ? -9.728  -16.136 -10.186 1.00 0.00 ? 531 PRO A HD2  11 
ATOM   6085  H  HD3  . PRO A 1 3  ? -8.249  -16.767 -10.937 1.00 0.00 ? 531 PRO A HD3  11 
ATOM   6086  N  N    . GLY A 1 4  ? -8.489  -11.449 -11.862 1.00 0.00 ? 532 GLY A N    11 
ATOM   6087  C  CA   . GLY A 1 4  ? -9.237  -10.207 -11.799 1.00 0.00 ? 532 GLY A CA   11 
ATOM   6088  C  C    . GLY A 1 4  ? -8.868  -9.368  -10.591 1.00 0.00 ? 532 GLY A C    11 
ATOM   6089  O  O    . GLY A 1 4  ? -9.008  -9.814  -9.452  1.00 0.00 ? 532 GLY A O    11 
ATOM   6090  H  H    . GLY A 1 4  ? -7.511  -11.428 -11.910 1.00 0.00 ? 532 GLY A H    11 
ATOM   6091  H  HA2  . GLY A 1 4  ? -9.039  -9.635  -12.694 1.00 0.00 ? 532 GLY A HA2  11 
ATOM   6092  H  HA3  . GLY A 1 4  ? -10.291 -10.435 -11.757 1.00 0.00 ? 532 GLY A HA3  11 
ATOM   6093  N  N    . LYS A 1 5  ? -8.397  -8.151  -10.839 1.00 0.00 ? 533 LYS A N    11 
ATOM   6094  C  CA   . LYS A 1 5  ? -8.007  -7.248  -9.762  1.00 0.00 ? 533 LYS A CA   11 
ATOM   6095  C  C    . LYS A 1 5  ? -9.120  -6.250  -9.460  1.00 0.00 ? 533 LYS A C    11 
ATOM   6096  O  O    . LYS A 1 5  ? -9.786  -5.753  -10.368 1.00 0.00 ? 533 LYS A O    11 
ATOM   6097  C  CB   . LYS A 1 5  ? -6.723  -6.503  -10.132 1.00 0.00 ? 533 LYS A CB   11 
ATOM   6098  C  CG   . LYS A 1 5  ? -5.459  -7.188  -9.637  1.00 0.00 ? 533 LYS A CG   11 
ATOM   6099  C  CD   . LYS A 1 5  ? -4.270  -6.239  -9.647  1.00 0.00 ? 533 LYS A CD   11 
ATOM   6100  C  CE   . LYS A 1 5  ? -3.453  -6.357  -8.370  1.00 0.00 ? 533 LYS A CE   11 
ATOM   6101  N  NZ   . LYS A 1 5  ? -2.519  -7.516  -8.414  1.00 0.00 ? 533 LYS A NZ   11 
ATOM   6102  H  H    . LYS A 1 5  ? -8.309  -7.852  -11.768 1.00 0.00 ? 533 LYS A H    11 
ATOM   6103  H  HA   . LYS A 1 5  ? -7.826  -7.844  -8.880  1.00 0.00 ? 533 LYS A HA   11 
ATOM   6104  H  HB2  . LYS A 1 5  ? -6.665  -6.421  -11.207 1.00 0.00 ? 533 LYS A HB2  11 
ATOM   6105  H  HB3  . LYS A 1 5  ? -6.760  -5.512  -9.705  1.00 0.00 ? 533 LYS A HB3  11 
ATOM   6106  H  HG2  . LYS A 1 5  ? -5.621  -7.536  -8.628  1.00 0.00 ? 533 LYS A HG2  11 
ATOM   6107  H  HG3  . LYS A 1 5  ? -5.243  -8.029  -10.280 1.00 0.00 ? 533 LYS A HG3  11 
ATOM   6108  H  HD2  . LYS A 1 5  ? -3.639  -6.478  -10.489 1.00 0.00 ? 533 LYS A HD2  11 
ATOM   6109  H  HD3  . LYS A 1 5  ? -4.631  -5.225  -9.740  1.00 0.00 ? 533 LYS A HD3  11 
ATOM   6110  H  HE2  . LYS A 1 5  ? -2.881  -5.451  -8.239  1.00 0.00 ? 533 LYS A HE2  11 
ATOM   6111  H  HE3  . LYS A 1 5  ? -4.127  -6.480  -7.536  1.00 0.00 ? 533 LYS A HE3  11 
ATOM   6112  H  HZ1  . LYS A 1 5  ? -1.685  -7.326  -7.821  1.00 0.00 ? 533 LYS A HZ1  11 
ATOM   6113  H  HZ2  . LYS A 1 5  ? -2.204  -7.686  -9.390  1.00 0.00 ? 533 LYS A HZ2  11 
ATOM   6114  H  HZ3  . LYS A 1 5  ? -2.994  -8.371  -8.061  1.00 0.00 ? 533 LYS A HZ3  11 
ATOM   6115  N  N    . LYS A 1 6  ? -9.316  -5.962  -8.178  1.00 0.00 ? 534 LYS A N    11 
ATOM   6116  C  CA   . LYS A 1 6  ? -10.349 -5.023  -7.754  1.00 0.00 ? 534 LYS A CA   11 
ATOM   6117  C  C    . LYS A 1 6  ? -9.851  -4.149  -6.608  1.00 0.00 ? 534 LYS A C    11 
ATOM   6118  O  O    . LYS A 1 6  ? -8.835  -4.450  -5.981  1.00 0.00 ? 534 LYS A O    11 
ATOM   6119  C  CB   . LYS A 1 6  ? -11.608 -5.778  -7.326  1.00 0.00 ? 534 LYS A CB   11 
ATOM   6120  C  CG   . LYS A 1 6  ? -12.247 -6.581  -8.449  1.00 0.00 ? 534 LYS A CG   11 
ATOM   6121  C  CD   . LYS A 1 6  ? -13.644 -6.075  -8.775  1.00 0.00 ? 534 LYS A CD   11 
ATOM   6122  C  CE   . LYS A 1 6  ? -13.908 -6.094  -10.272 1.00 0.00 ? 534 LYS A CE   11 
ATOM   6123  N  NZ   . LYS A 1 6  ? -15.217 -5.471  -10.613 1.00 0.00 ? 534 LYS A NZ   11 
ATOM   6124  H  H    . LYS A 1 6  ? -8.753  -6.391  -7.500  1.00 0.00 ? 534 LYS A H    11 
ATOM   6125  H  HA   . LYS A 1 6  ? -10.587 -4.391  -8.596  1.00 0.00 ? 534 LYS A HA   11 
ATOM   6126  H  HB2  . LYS A 1 6  ? -11.352 -6.458  -6.527  1.00 0.00 ? 534 LYS A HB2  11 
ATOM   6127  H  HB3  . LYS A 1 6  ? -12.334 -5.066  -6.962  1.00 0.00 ? 534 LYS A HB3  11 
ATOM   6128  H  HG2  . LYS A 1 6  ? -11.631 -6.499  -9.332  1.00 0.00 ? 534 LYS A HG2  11 
ATOM   6129  H  HG3  . LYS A 1 6  ? -12.310 -7.616  -8.147  1.00 0.00 ? 534 LYS A HG3  11 
ATOM   6130  H  HD2  . LYS A 1 6  ? -14.369 -6.706  -8.284  1.00 0.00 ? 534 LYS A HD2  11 
ATOM   6131  H  HD3  . LYS A 1 6  ? -13.742 -5.062  -8.414  1.00 0.00 ? 534 LYS A HD3  11 
ATOM   6132  H  HE2  . LYS A 1 6  ? -13.120 -5.551  -10.771 1.00 0.00 ? 534 LYS A HE2  11 
ATOM   6133  H  HE3  . LYS A 1 6  ? -13.908 -7.120  -10.611 1.00 0.00 ? 534 LYS A HE3  11 
ATOM   6134  H  HZ1  . LYS A 1 6  ? -15.987 -6.154  -10.466 1.00 0.00 ? 534 LYS A HZ1  11 
ATOM   6135  H  HZ2  . LYS A 1 6  ? -15.221 -5.171  -11.609 1.00 0.00 ? 534 LYS A HZ2  11 
ATOM   6136  H  HZ3  . LYS A 1 6  ? -15.384 -4.639  -10.011 1.00 0.00 ? 534 LYS A HZ3  11 
ATOM   6137  N  N    . LYS A 1 7  ? -10.572 -3.066  -6.339  1.00 0.00 ? 535 LYS A N    11 
ATOM   6138  C  CA   . LYS A 1 7  ? -10.203 -2.149  -5.267  1.00 0.00 ? 535 LYS A CA   11 
ATOM   6139  C  C    . LYS A 1 7  ? -8.823  -1.549  -5.516  1.00 0.00 ? 535 LYS A C    11 
ATOM   6140  O  O    . LYS A 1 7  ? -8.015  -2.112  -6.255  1.00 0.00 ? 535 LYS A O    11 
ATOM   6141  C  CB   . LYS A 1 7  ? -10.222 -2.872  -3.919  1.00 0.00 ? 535 LYS A CB   11 
ATOM   6142  C  CG   . LYS A 1 7  ? -11.617 -3.037  -3.337  1.00 0.00 ? 535 LYS A CG   11 
ATOM   6143  C  CD   . LYS A 1 7  ? -11.894 -4.481  -2.950  1.00 0.00 ? 535 LYS A CD   11 
ATOM   6144  C  CE   . LYS A 1 7  ? -13.382 -4.734  -2.770  1.00 0.00 ? 535 LYS A CE   11 
ATOM   6145  N  NZ   . LYS A 1 7  ? -13.743 -6.151  -3.049  1.00 0.00 ? 535 LYS A NZ   11 
ATOM   6146  H  H    . LYS A 1 7  ? -11.372 -2.879  -6.874  1.00 0.00 ? 535 LYS A H    11 
ATOM   6147  H  HA   . LYS A 1 7  ? -10.931 -1.351  -5.248  1.00 0.00 ? 535 LYS A HA   11 
ATOM   6148  H  HB2  . LYS A 1 7  ? -9.787  -3.852  -4.044  1.00 0.00 ? 535 LYS A HB2  11 
ATOM   6149  H  HB3  . LYS A 1 7  ? -9.625  -2.311  -3.215  1.00 0.00 ? 535 LYS A HB3  11 
ATOM   6150  H  HG2  . LYS A 1 7  ? -11.705 -2.417  -2.458  1.00 0.00 ? 535 LYS A HG2  11 
ATOM   6151  H  HG3  . LYS A 1 7  ? -12.343 -2.725  -4.074  1.00 0.00 ? 535 LYS A HG3  11 
ATOM   6152  H  HD2  . LYS A 1 7  ? -11.521 -5.131  -3.728  1.00 0.00 ? 535 LYS A HD2  11 
ATOM   6153  H  HD3  . LYS A 1 7  ? -11.386 -4.699  -2.022  1.00 0.00 ? 535 LYS A HD3  11 
ATOM   6154  H  HE2  . LYS A 1 7  ? -13.654 -4.497  -1.752  1.00 0.00 ? 535 LYS A HE2  11 
ATOM   6155  H  HE3  . LYS A 1 7  ? -13.928 -4.092  -3.446  1.00 0.00 ? 535 LYS A HE3  11 
ATOM   6156  H  HZ1  . LYS A 1 7  ? -13.052 -6.574  -3.702  1.00 0.00 ? 535 LYS A HZ1  11 
ATOM   6157  H  HZ2  . LYS A 1 7  ? -14.687 -6.201  -3.481  1.00 0.00 ? 535 LYS A HZ2  11 
ATOM   6158  H  HZ3  . LYS A 1 7  ? -13.750 -6.699  -2.165  1.00 0.00 ? 535 LYS A HZ3  11 
ATOM   6159  N  N    . GLN A 1 8  ? -8.559  -0.404  -4.894  1.00 0.00 ? 536 GLN A N    11 
ATOM   6160  C  CA   . GLN A 1 8  ? -7.276  0.271   -5.048  1.00 0.00 ? 536 GLN A CA   11 
ATOM   6161  C  C    . GLN A 1 8  ? -6.344  -0.059  -3.887  1.00 0.00 ? 536 GLN A C    11 
ATOM   6162  O  O    . GLN A 1 8  ? -6.693  -0.841  -3.002  1.00 0.00 ? 536 GLN A O    11 
ATOM   6163  C  CB   . GLN A 1 8  ? -7.480  1.785   -5.139  1.00 0.00 ? 536 GLN A CB   11 
ATOM   6164  C  CG   . GLN A 1 8  ? -8.238  2.223   -6.382  1.00 0.00 ? 536 GLN A CG   11 
ATOM   6165  C  CD   . GLN A 1 8  ? -9.296  3.266   -6.083  1.00 0.00 ? 536 GLN A CD   11 
ATOM   6166  O  OE1  . GLN A 1 8  ? -9.892  3.272   -5.005  1.00 0.00 ? 536 GLN A OE1  11 
ATOM   6167  N  NE2  . GLN A 1 8  ? -9.536  4.156   -7.038  1.00 0.00 ? 536 GLN A NE2  11 
ATOM   6168  H  H    . GLN A 1 8  ? -9.244  -0.005  -4.318  1.00 0.00 ? 536 GLN A H    11 
ATOM   6169  H  HA   . GLN A 1 8  ? -6.826  -0.078  -5.966  1.00 0.00 ? 536 GLN A HA   11 
ATOM   6170  H  HB2  . GLN A 1 8  ? -8.032  2.115   -4.272  1.00 0.00 ? 536 GLN A HB2  11 
ATOM   6171  H  HB3  . GLN A 1 8  ? -6.513  2.267   -5.145  1.00 0.00 ? 536 GLN A HB3  11 
ATOM   6172  H  HG2  . GLN A 1 8  ? -7.535  2.638   -7.089  1.00 0.00 ? 536 GLN A HG2  11 
ATOM   6173  H  HG3  . GLN A 1 8  ? -8.717  1.359   -6.819  1.00 0.00 ? 536 GLN A HG3  11 
ATOM   6174  H  HE21 . GLN A 1 8  ? -9.024  4.091   -7.871  1.00 0.00 ? 536 GLN A HE21 11 
ATOM   6175  H  HE22 . GLN A 1 8  ? -10.216 4.843   -6.871  1.00 0.00 ? 536 GLN A HE22 11 
ATOM   6176  N  N    . HIS A 1 9  ? -5.158  0.541   -3.896  1.00 0.00 ? 537 HIS A N    11 
ATOM   6177  C  CA   . HIS A 1 9  ? -4.176  0.310   -2.843  1.00 0.00 ? 537 HIS A CA   11 
ATOM   6178  C  C    . HIS A 1 9  ? -4.192  1.445   -1.824  1.00 0.00 ? 537 HIS A C    11 
ATOM   6179  O  O    . HIS A 1 9  ? -3.622  2.510   -2.058  1.00 0.00 ? 537 HIS A O    11 
ATOM   6180  C  CB   . HIS A 1 9  ? -2.776  0.168   -3.444  1.00 0.00 ? 537 HIS A CB   11 
ATOM   6181  C  CG   . HIS A 1 9  ? -2.590  -1.085  -4.242  1.00 0.00 ? 537 HIS A CG   11 
ATOM   6182  N  ND1  . HIS A 1 9  ? -3.628  -1.860  -4.710  1.00 0.00 ? 537 HIS A ND1  11 
ATOM   6183  C  CD2  . HIS A 1 9  ? -1.451  -1.697  -4.656  1.00 0.00 ? 537 HIS A CD2  11 
ATOM   6184  C  CE1  . HIS A 1 9  ? -3.100  -2.895  -5.377  1.00 0.00 ? 537 HIS A CE1  11 
ATOM   6185  N  NE2  . HIS A 1 9  ? -1.782  -2.842  -5.374  1.00 0.00 ? 537 HIS A NE2  11 
ATOM   6186  H  H    . HIS A 1 9  ? -4.938  1.153   -4.629  1.00 0.00 ? 537 HIS A H    11 
ATOM   6187  H  HA   . HIS A 1 9  ? -4.438  -0.611  -2.343  1.00 0.00 ? 537 HIS A HA   11 
ATOM   6188  H  HB2  . HIS A 1 9  ? -2.585  1.007   -4.096  1.00 0.00 ? 537 HIS A HB2  11 
ATOM   6189  H  HB3  . HIS A 1 9  ? -2.048  0.166   -2.645  1.00 0.00 ? 537 HIS A HB3  11 
ATOM   6190  H  HD1  . HIS A 1 9  ? -4.583  -1.685  -4.577  1.00 0.00 ? 537 HIS A HD1  11 
ATOM   6191  H  HD2  . HIS A 1 9  ? -0.443  -1.358  -4.464  1.00 0.00 ? 537 HIS A HD2  11 
ATOM   6192  H  HE1  . HIS A 1 9  ? -3.679  -3.671  -5.857  1.00 0.00 ? 537 HIS A HE1  11 
ATOM   6193  N  N    . ILE A 1 10 ? -4.848  1.208   -0.692  1.00 0.00 ? 538 ILE A N    11 
ATOM   6194  C  CA   . ILE A 1 10 ? -4.939  2.209   0.364   1.00 0.00 ? 538 ILE A CA   11 
ATOM   6195  C  C    . ILE A 1 10 ? -4.387  1.668   1.679   1.00 0.00 ? 538 ILE A C    11 
ATOM   6196  O  O    . ILE A 1 10 ? -4.461  0.469   1.947   1.00 0.00 ? 538 ILE A O    11 
ATOM   6197  C  CB   . ILE A 1 10 ? -6.393  2.667   0.582   1.00 0.00 ? 538 ILE A CB   11 
ATOM   6198  C  CG1  . ILE A 1 10 ? -7.053  3.000   -0.758  1.00 0.00 ? 538 ILE A CG1  11 
ATOM   6199  C  CG2  . ILE A 1 10 ? -6.437  3.869   1.514   1.00 0.00 ? 538 ILE A CG2  11 
ATOM   6200  C  CD1  . ILE A 1 10 ? -7.852  1.853   -1.338  1.00 0.00 ? 538 ILE A CD1  11 
ATOM   6201  H  H    . ILE A 1 10 ? -5.282  0.338   -0.565  1.00 0.00 ? 538 ILE A H    11 
ATOM   6202  H  HA   . ILE A 1 10 ? -4.353  3.066   0.064   1.00 0.00 ? 538 ILE A HA   11 
ATOM   6203  H  HB   . ILE A 1 10 ? -6.935  1.860   1.051   1.00 0.00 ? 538 ILE A HB   11 
ATOM   6204  H  HG12 . ILE A 1 10 ? -7.723  3.836   -0.625  1.00 0.00 ? 538 ILE A HG12 11 
ATOM   6205  H  HG13 . ILE A 1 10 ? -6.288  3.267   -1.472  1.00 0.00 ? 538 ILE A HG13 11 
ATOM   6206  H  HG21 . ILE A 1 10 ? -6.260  3.545   2.529   1.00 0.00 ? 538 ILE A HG21 11 
ATOM   6207  H  HG22 . ILE A 1 10 ? -7.407  4.340   1.450   1.00 0.00 ? 538 ILE A HG22 11 
ATOM   6208  H  HG23 . ILE A 1 10 ? -5.674  4.577   1.225   1.00 0.00 ? 538 ILE A HG23 11 
ATOM   6209  H  HD11 . ILE A 1 10 ? -7.205  1.000   -1.480  1.00 0.00 ? 538 ILE A HD11 11 
ATOM   6210  H  HD12 . ILE A 1 10 ? -8.270  2.150   -2.289  1.00 0.00 ? 538 ILE A HD12 11 
ATOM   6211  H  HD13 . ILE A 1 10 ? -8.650  1.591   -0.660  1.00 0.00 ? 538 ILE A HD13 11 
ATOM   6212  N  N    . CYS A 1 11 ? -3.834  2.558   2.497   1.00 0.00 ? 539 CYS A N    11 
ATOM   6213  C  CA   . CYS A 1 11 ? -3.271  2.163   3.783   1.00 0.00 ? 539 CYS A CA   11 
ATOM   6214  C  C    . CYS A 1 11 ? -4.357  1.628   4.712   1.00 0.00 ? 539 CYS A C    11 
ATOM   6215  O  O    . CYS A 1 11 ? -5.378  2.280   4.930   1.00 0.00 ? 539 CYS A O    11 
ATOM   6216  C  CB   . CYS A 1 11 ? -2.554  3.345   4.442   1.00 0.00 ? 539 CYS A CB   11 
ATOM   6217  S  SG   . CYS A 1 11 ? -0.842  2.998   4.907   1.00 0.00 ? 539 CYS A SG   11 
ATOM   6218  H  H    . CYS A 1 11 ? -3.804  3.501   2.229   1.00 0.00 ? 539 CYS A H    11 
ATOM   6219  H  HA   . CYS A 1 11 ? -2.554  1.377   3.601   1.00 0.00 ? 539 CYS A HA   11 
ATOM   6220  H  HB2  . CYS A 1 11 ? -2.545  4.179   3.757   1.00 0.00 ? 539 CYS A HB2  11 
ATOM   6221  H  HB3  . CYS A 1 11 ? -3.086  3.629   5.339   1.00 0.00 ? 539 CYS A HB3  11 
ATOM   6222  N  N    . HIS A 1 12 ? -4.126  0.439   5.258   1.00 0.00 ? 540 HIS A N    11 
ATOM   6223  C  CA   . HIS A 1 12 ? -5.082  -0.184  6.167   1.00 0.00 ? 540 HIS A CA   11 
ATOM   6224  C  C    . HIS A 1 12 ? -4.686  0.064   7.620   1.00 0.00 ? 540 HIS A C    11 
ATOM   6225  O  O    . HIS A 1 12 ? -4.958  -0.757  8.496   1.00 0.00 ? 540 HIS A O    11 
ATOM   6226  C  CB   . HIS A 1 12 ? -5.170  -1.688  5.894   1.00 0.00 ? 540 HIS A CB   11 
ATOM   6227  C  CG   . HIS A 1 12 ? -6.536  -2.141  5.482   1.00 0.00 ? 540 HIS A CG   11 
ATOM   6228  N  ND1  . HIS A 1 12 ? -7.238  -1.601  4.427   1.00 0.00 ? 540 HIS A ND1  11 
ATOM   6229  C  CD2  . HIS A 1 12 ? -7.332  -3.109  6.005   1.00 0.00 ? 540 HIS A CD2  11 
ATOM   6230  C  CE1  . HIS A 1 12 ? -8.413  -2.241  4.345   1.00 0.00 ? 540 HIS A CE1  11 
ATOM   6231  N  NE2  . HIS A 1 12 ? -8.518  -3.166  5.280   1.00 0.00 ? 540 HIS A NE2  11 
ATOM   6232  H  H    . HIS A 1 12 ? -3.292  -0.031  5.047   1.00 0.00 ? 540 HIS A H    11 
ATOM   6233  H  HA   . HIS A 1 12 ? -6.048  0.263   5.988   1.00 0.00 ? 540 HIS A HA   11 
ATOM   6234  H  HB2  . HIS A 1 12 ? -4.483  -1.944  5.102   1.00 0.00 ? 540 HIS A HB2  11 
ATOM   6235  H  HB3  . HIS A 1 12 ? -4.896  -2.228  6.789   1.00 0.00 ? 540 HIS A HB3  11 
ATOM   6236  H  HD1  . HIS A 1 12 ? -6.934  -0.877  3.841   1.00 0.00 ? 540 HIS A HD1  11 
ATOM   6237  H  HD2  . HIS A 1 12 ? -7.092  -3.739  6.849   1.00 0.00 ? 540 HIS A HD2  11 
ATOM   6238  H  HE1  . HIS A 1 12 ? -9.173  -2.029  3.608   1.00 0.00 ? 540 HIS A HE1  11 
ATOM   6239  N  N    . ILE A 1 13 ? -4.043  1.200   7.866   1.00 0.00 ? 541 ILE A N    11 
ATOM   6240  C  CA   . ILE A 1 13 ? -3.608  1.559   9.210   1.00 0.00 ? 541 ILE A CA   11 
ATOM   6241  C  C    . ILE A 1 13 ? -4.122  2.940   9.600   1.00 0.00 ? 541 ILE A C    11 
ATOM   6242  O  O    . ILE A 1 13 ? -4.094  3.873   8.797   1.00 0.00 ? 541 ILE A O    11 
ATOM   6243  C  CB   . ILE A 1 13 ? -2.071  1.544   9.323   1.00 0.00 ? 541 ILE A CB   11 
ATOM   6244  C  CG1  . ILE A 1 13 ? -1.510  0.218   8.803   1.00 0.00 ? 541 ILE A CG1  11 
ATOM   6245  C  CG2  . ILE A 1 13 ? -1.640  1.778   10.764  1.00 0.00 ? 541 ILE A CG2  11 
ATOM   6246  C  CD1  . ILE A 1 13 ? -0.262  0.379   7.962   1.00 0.00 ? 541 ILE A CD1  11 
ATOM   6247  H  H    . ILE A 1 13 ? -3.855  1.813   7.125   1.00 0.00 ? 541 ILE A H    11 
ATOM   6248  H  HA   . ILE A 1 13 ? -4.007  0.827   9.897   1.00 0.00 ? 541 ILE A HA   11 
ATOM   6249  H  HB   . ILE A 1 13 ? -1.680  2.351   8.722   1.00 0.00 ? 541 ILE A HB   11 
ATOM   6250  H  HG12 . ILE A 1 13 ? -1.264  -0.416  9.642   1.00 0.00 ? 541 ILE A HG12 11 
ATOM   6251  H  HG13 . ILE A 1 13 ? -2.259  -0.270  8.197   1.00 0.00 ? 541 ILE A HG13 11 
ATOM   6252  H  HG21 . ILE A 1 13 ? -1.381  0.834   11.220  1.00 0.00 ? 541 ILE A HG21 11 
ATOM   6253  H  HG22 . ILE A 1 13 ? -2.451  2.233   11.313  1.00 0.00 ? 541 ILE A HG22 11 
ATOM   6254  H  HG23 . ILE A 1 13 ? -0.781  2.433   10.780  1.00 0.00 ? 541 ILE A HG23 11 
ATOM   6255  H  HD11 . ILE A 1 13 ? 0.274   -0.558  7.932   1.00 0.00 ? 541 ILE A HD11 11 
ATOM   6256  H  HD12 . ILE A 1 13 ? 0.368   1.141   8.396   1.00 0.00 ? 541 ILE A HD12 11 
ATOM   6257  H  HD13 . ILE A 1 13 ? -0.539  0.668   6.959   1.00 0.00 ? 541 ILE A HD13 11 
ATOM   6258  N  N    . GLN A 1 14 ? -4.591  3.064   10.838  1.00 0.00 ? 542 GLN A N    11 
ATOM   6259  C  CA   . GLN A 1 14 ? -5.111  4.332   11.334  1.00 0.00 ? 542 GLN A CA   11 
ATOM   6260  C  C    . GLN A 1 14 ? -4.020  5.399   11.345  1.00 0.00 ? 542 GLN A C    11 
ATOM   6261  O  O    . GLN A 1 14 ? -3.393  5.649   12.374  1.00 0.00 ? 542 GLN A O    11 
ATOM   6262  C  CB   . GLN A 1 14 ? -5.683  4.157   12.742  1.00 0.00 ? 542 GLN A CB   11 
ATOM   6263  C  CG   . GLN A 1 14 ? -4.762  3.398   13.683  1.00 0.00 ? 542 GLN A CG   11 
ATOM   6264  C  CD   . GLN A 1 14 ? -5.173  3.534   15.136  1.00 0.00 ? 542 GLN A CD   11 
ATOM   6265  O  OE1  . GLN A 1 14 ? -4.448  4.112   15.946  1.00 0.00 ? 542 GLN A OE1  11 
ATOM   6266  N  NE2  . GLN A 1 14 ? -6.341  3.001   15.473  1.00 0.00 ? 542 GLN A NE2  11 
ATOM   6267  H  H    . GLN A 1 14 ? -4.587  2.285   11.431  1.00 0.00 ? 542 GLN A H    11 
ATOM   6268  H  HA   . GLN A 1 14 ? -5.901  4.648   10.670  1.00 0.00 ? 542 GLN A HA   11 
ATOM   6269  H  HB2  . GLN A 1 14 ? -5.870  5.133   13.165  1.00 0.00 ? 542 GLN A HB2  11 
ATOM   6270  H  HB3  . GLN A 1 14 ? -6.617  3.619   12.674  1.00 0.00 ? 542 GLN A HB3  11 
ATOM   6271  H  HG2  . GLN A 1 14 ? -4.780  2.352   13.417  1.00 0.00 ? 542 GLN A HG2  11 
ATOM   6272  H  HG3  . GLN A 1 14 ? -3.758  3.781   13.570  1.00 0.00 ? 542 GLN A HG3  11 
ATOM   6273  H  HE21 . GLN A 1 14 ? -6.865  2.555   14.775  1.00 0.00 ? 542 GLN A HE21 11 
ATOM   6274  H  HE22 . GLN A 1 14 ? -6.631  3.074   16.406  1.00 0.00 ? 542 GLN A HE22 11 
ATOM   6275  N  N    . GLY A 1 15 ? -3.800  6.025   10.193  1.00 0.00 ? 543 GLY A N    11 
ATOM   6276  C  CA   . GLY A 1 15 ? -2.785  7.056   10.092  1.00 0.00 ? 543 GLY A CA   11 
ATOM   6277  C  C    . GLY A 1 15 ? -2.713  7.666   8.706   1.00 0.00 ? 543 GLY A C    11 
ATOM   6278  O  O    . GLY A 1 15 ? -2.938  8.865   8.536   1.00 0.00 ? 543 GLY A O    11 
ATOM   6279  H  H    . GLY A 1 15 ? -4.331  5.784   9.406   1.00 0.00 ? 543 GLY A H    11 
ATOM   6280  H  HA2  . GLY A 1 15 ? -3.007  7.836   10.806  1.00 0.00 ? 543 GLY A HA2  11 
ATOM   6281  H  HA3  . GLY A 1 15 ? -1.824  6.625   10.334  1.00 0.00 ? 543 GLY A HA3  11 
ATOM   6282  N  N    . CYS A 1 16 ? -2.399  6.841   7.713   1.00 0.00 ? 544 CYS A N    11 
ATOM   6283  C  CA   . CYS A 1 16 ? -2.298  7.307   6.336   1.00 0.00 ? 544 CYS A CA   11 
ATOM   6284  C  C    . CYS A 1 16 ? -3.680  7.446   5.705   1.00 0.00 ? 544 CYS A C    11 
ATOM   6285  O  O    . CYS A 1 16 ? -4.698  7.260   6.370   1.00 0.00 ? 544 CYS A O    11 
ATOM   6286  C  CB   . CYS A 1 16 ? -1.442  6.343   5.512   1.00 0.00 ? 544 CYS A CB   11 
ATOM   6287  S  SG   . CYS A 1 16 ? 0.302   6.808   5.411   1.00 0.00 ? 544 CYS A SG   11 
ATOM   6288  H  H    . CYS A 1 16 ? -2.230  5.895   7.911   1.00 0.00 ? 544 CYS A H    11 
ATOM   6289  H  HA   . CYS A 1 16 ? -1.822  8.276   6.348   1.00 0.00 ? 544 CYS A HA   11 
ATOM   6290  H  HB2  . CYS A 1 16 ? -1.494  5.361   5.956   1.00 0.00 ? 544 CYS A HB2  11 
ATOM   6291  H  HB3  . CYS A 1 16 ? -1.831  6.299   4.505   1.00 0.00 ? 544 CYS A HB3  11 
ATOM   6292  N  N    . GLY A 1 17 ? -3.705  7.776   4.418   1.00 0.00 ? 545 GLY A N    11 
ATOM   6293  C  CA   . GLY A 1 17 ? -4.965  7.935   3.717   1.00 0.00 ? 545 GLY A CA   11 
ATOM   6294  C  C    . GLY A 1 17 ? -4.767  8.374   2.282   1.00 0.00 ? 545 GLY A C    11 
ATOM   6295  O  O    . GLY A 1 17 ? -5.522  9.198   1.767   1.00 0.00 ? 545 GLY A O    11 
ATOM   6296  H  H    . GLY A 1 17 ? -2.861  7.912   3.938   1.00 0.00 ? 545 GLY A H    11 
ATOM   6297  H  HA2  . GLY A 1 17 ? -5.492  6.992   3.726   1.00 0.00 ? 545 GLY A HA2  11 
ATOM   6298  H  HA3  . GLY A 1 17 ? -5.560  8.675   4.231   1.00 0.00 ? 545 GLY A HA3  11 
ATOM   6299  N  N    . LYS A 1 18 ? -3.746  7.822   1.635   1.00 0.00 ? 546 LYS A N    11 
ATOM   6300  C  CA   . LYS A 1 18 ? -3.447  8.162   0.250   1.00 0.00 ? 546 LYS A CA   11 
ATOM   6301  C  C    . LYS A 1 18 ? -3.980  7.091   -0.698  1.00 0.00 ? 546 LYS A C    11 
ATOM   6302  O  O    . LYS A 1 18 ? -4.796  6.256   -0.309  1.00 0.00 ? 546 LYS A O    11 
ATOM   6303  C  CB   . LYS A 1 18 ? -1.935  8.344   0.060   1.00 0.00 ? 546 LYS A CB   11 
ATOM   6304  C  CG   . LYS A 1 18 ? -1.140  7.047   0.113   1.00 0.00 ? 546 LYS A CG   11 
ATOM   6305  C  CD   . LYS A 1 18 ? -0.593  6.781   1.507   1.00 0.00 ? 546 LYS A CD   11 
ATOM   6306  C  CE   . LYS A 1 18 ? -0.508  5.291   1.799   1.00 0.00 ? 546 LYS A CE   11 
ATOM   6307  N  NZ   . LYS A 1 18 ? -1.765  4.577   1.442   1.00 0.00 ? 546 LYS A NZ   11 
ATOM   6308  H  H    . LYS A 1 18 ? -3.180  7.172   2.101   1.00 0.00 ? 546 LYS A H    11 
ATOM   6309  H  HA   . LYS A 1 18 ? -3.941  9.096   0.030   1.00 0.00 ? 546 LYS A HA   11 
ATOM   6310  H  HB2  . LYS A 1 18 ? -1.759  8.808   -0.899  1.00 0.00 ? 546 LYS A HB2  11 
ATOM   6311  H  HB3  . LYS A 1 18 ? -1.565  8.997   0.837   1.00 0.00 ? 546 LYS A HB3  11 
ATOM   6312  H  HG2  . LYS A 1 18 ? -1.782  6.229   -0.173  1.00 0.00 ? 546 LYS A HG2  11 
ATOM   6313  H  HG3  . LYS A 1 18 ? -0.314  7.116   -0.580  1.00 0.00 ? 546 LYS A HG3  11 
ATOM   6314  H  HD2  . LYS A 1 18 ? 0.396   7.207   1.582   1.00 0.00 ? 546 LYS A HD2  11 
ATOM   6315  H  HD3  . LYS A 1 18 ? -1.243  7.245   2.233   1.00 0.00 ? 546 LYS A HD3  11 
ATOM   6316  H  HE2  . LYS A 1 18 ? 0.307   4.871   1.229   1.00 0.00 ? 546 LYS A HE2  11 
ATOM   6317  H  HE3  . LYS A 1 18 ? -0.315  5.155   2.853   1.00 0.00 ? 546 LYS A HE3  11 
ATOM   6318  H  HZ1  . LYS A 1 18 ? -1.838  3.690   1.980   1.00 0.00 ? 546 LYS A HZ1  11 
ATOM   6319  H  HZ2  . LYS A 1 18 ? -1.774  4.354   0.426   1.00 0.00 ? 546 LYS A HZ2  11 
ATOM   6320  H  HZ3  . LYS A 1 18 ? -2.590  5.172   1.662   1.00 0.00 ? 546 LYS A HZ3  11 
ATOM   6321  N  N    . VAL A 1 19 ? -3.513  7.119   -1.942  1.00 0.00 ? 547 VAL A N    11 
ATOM   6322  C  CA   . VAL A 1 19 ? -3.945  6.147   -2.940  1.00 0.00 ? 547 VAL A CA   11 
ATOM   6323  C  C    . VAL A 1 19 ? -2.774  5.692   -3.805  1.00 0.00 ? 547 VAL A C    11 
ATOM   6324  O  O    . VAL A 1 19 ? -1.843  6.456   -4.059  1.00 0.00 ? 547 VAL A O    11 
ATOM   6325  C  CB   . VAL A 1 19 ? -5.045  6.726   -3.850  1.00 0.00 ? 547 VAL A CB   11 
ATOM   6326  C  CG1  . VAL A 1 19 ? -5.621  5.643   -4.748  1.00 0.00 ? 547 VAL A CG1  11 
ATOM   6327  C  CG2  . VAL A 1 19 ? -6.139  7.376   -3.016  1.00 0.00 ? 547 VAL A CG2  11 
ATOM   6328  H  H    . VAL A 1 19 ? -2.863  7.807   -2.195  1.00 0.00 ? 547 VAL A H    11 
ATOM   6329  H  HA   . VAL A 1 19 ? -4.349  5.292   -2.419  1.00 0.00 ? 547 VAL A HA   11 
ATOM   6330  H  HB   . VAL A 1 19 ? -4.602  7.485   -4.478  1.00 0.00 ? 547 VAL A HB   11 
ATOM   6331  H  HG11 . VAL A 1 19 ? -5.784  4.745   -4.170  1.00 0.00 ? 547 VAL A HG11 11 
ATOM   6332  H  HG12 . VAL A 1 19 ? -4.929  5.434   -5.550  1.00 0.00 ? 547 VAL A HG12 11 
ATOM   6333  H  HG13 . VAL A 1 19 ? -6.560  5.980   -5.162  1.00 0.00 ? 547 VAL A HG13 11 
ATOM   6334  H  HG21 . VAL A 1 19 ? -5.909  8.422   -2.874  1.00 0.00 ? 547 VAL A HG21 11 
ATOM   6335  H  HG22 . VAL A 1 19 ? -6.199  6.887   -2.056  1.00 0.00 ? 547 VAL A HG22 11 
ATOM   6336  H  HG23 . VAL A 1 19 ? -7.085  7.282   -3.528  1.00 0.00 ? 547 VAL A HG23 11 
ATOM   6337  N  N    . TYR A 1 20 ? -2.828  4.442   -4.255  1.00 0.00 ? 548 TYR A N    11 
ATOM   6338  C  CA   . TYR A 1 20 ? -1.772  3.884   -5.091  1.00 0.00 ? 548 TYR A CA   11 
ATOM   6339  C  C    . TYR A 1 20 ? -2.336  2.845   -6.056  1.00 0.00 ? 548 TYR A C    11 
ATOM   6340  O  O    . TYR A 1 20 ? -3.374  2.239   -5.793  1.00 0.00 ? 548 TYR A O    11 
ATOM   6341  C  CB   . TYR A 1 20 ? -0.682  3.254   -4.221  1.00 0.00 ? 548 TYR A CB   11 
ATOM   6342  C  CG   . TYR A 1 20 ? 0.512   4.154   -4.000  1.00 0.00 ? 548 TYR A CG   11 
ATOM   6343  C  CD1  . TYR A 1 20 ? 0.444   5.228   -3.121  1.00 0.00 ? 548 TYR A CD1  11 
ATOM   6344  C  CD2  . TYR A 1 20 ? 1.708   3.930   -4.670  1.00 0.00 ? 548 TYR A CD2  11 
ATOM   6345  C  CE1  . TYR A 1 20 ? 1.534   6.053   -2.916  1.00 0.00 ? 548 TYR A CE1  11 
ATOM   6346  C  CE2  . TYR A 1 20 ? 2.803   4.750   -4.470  1.00 0.00 ? 548 TYR A CE2  11 
ATOM   6347  C  CZ   . TYR A 1 20 ? 2.710   5.810   -3.593  1.00 0.00 ? 548 TYR A CZ   11 
ATOM   6348  O  OH   . TYR A 1 20 ? 3.797   6.629   -3.391  1.00 0.00 ? 548 TYR A OH   11 
ATOM   6349  H  H    . TYR A 1 20 ? -3.597  3.882   -4.018  1.00 0.00 ? 548 TYR A H    11 
ATOM   6350  H  HA   . TYR A 1 20 ? -1.341  4.692   -5.663  1.00 0.00 ? 548 TYR A HA   11 
ATOM   6351  H  HB2  . TYR A 1 20 ? -1.098  3.013   -3.255  1.00 0.00 ? 548 TYR A HB2  11 
ATOM   6352  H  HB3  . TYR A 1 20 ? -0.333  2.347   -4.694  1.00 0.00 ? 548 TYR A HB3  11 
ATOM   6353  H  HD1  . TYR A 1 20 ? -0.479  5.415   -2.592  1.00 0.00 ? 548 TYR A HD1  11 
ATOM   6354  H  HD2  . TYR A 1 20 ? 1.778   3.100   -5.357  1.00 0.00 ? 548 TYR A HD2  11 
ATOM   6355  H  HE1  . TYR A 1 20 ? 1.461   6.882   -2.228  1.00 0.00 ? 548 TYR A HE1  11 
ATOM   6356  H  HE2  . TYR A 1 20 ? 3.724   4.560   -5.001  1.00 0.00 ? 548 TYR A HE2  11 
ATOM   6357  H  HH   . TYR A 1 20 ? 4.245   6.778   -4.227  1.00 0.00 ? 548 TYR A HH   11 
ATOM   6358  N  N    . GLY A 1 21 ? -1.644  2.645   -7.173  1.00 0.00 ? 549 GLY A N    11 
ATOM   6359  C  CA   . GLY A 1 21 ? -2.091  1.679   -8.160  1.00 0.00 ? 549 GLY A CA   11 
ATOM   6360  C  C    . GLY A 1 21 ? -1.036  0.636   -8.474  1.00 0.00 ? 549 GLY A C    11 
ATOM   6361  O  O    . GLY A 1 21 ? -1.041  0.044   -9.553  1.00 0.00 ? 549 GLY A O    11 
ATOM   6362  H  H    . GLY A 1 21 ? -0.824  3.158   -7.329  1.00 0.00 ? 549 GLY A H    11 
ATOM   6363  H  HA2  . GLY A 1 21 ? -2.973  1.181   -7.786  1.00 0.00 ? 549 GLY A HA2  11 
ATOM   6364  H  HA3  . GLY A 1 21 ? -2.345  2.202   -9.070  1.00 0.00 ? 549 GLY A HA3  11 
ATOM   6365  N  N    . LYS A 1 22 ? -0.129  0.409   -7.529  1.00 0.00 ? 550 LYS A N    11 
ATOM   6366  C  CA   . LYS A 1 22 ? 0.936   -0.571  -7.711  1.00 0.00 ? 550 LYS A CA   11 
ATOM   6367  C  C    . LYS A 1 22 ? 1.336   -1.195  -6.378  1.00 0.00 ? 550 LYS A C    11 
ATOM   6368  O  O    . LYS A 1 22 ? 1.695   -0.490  -5.435  1.00 0.00 ? 550 LYS A O    11 
ATOM   6369  C  CB   . LYS A 1 22 ? 2.153   0.084   -8.367  1.00 0.00 ? 550 LYS A CB   11 
ATOM   6370  C  CG   . LYS A 1 22 ? 2.034   0.215   -9.877  1.00 0.00 ? 550 LYS A CG   11 
ATOM   6371  C  CD   . LYS A 1 22 ? 3.389   0.452   -10.524 1.00 0.00 ? 550 LYS A CD   11 
ATOM   6372  C  CE   . LYS A 1 22 ? 3.276   0.531   -12.038 1.00 0.00 ? 550 LYS A CE   11 
ATOM   6373  N  NZ   . LYS A 1 22 ? 3.225   1.940   -12.519 1.00 0.00 ? 550 LYS A NZ   11 
ATOM   6374  H  H    . LYS A 1 22 ? -0.176  0.911   -6.689  1.00 0.00 ? 550 LYS A H    11 
ATOM   6375  H  HA   . LYS A 1 22 ? 0.563   -1.348  -8.361  1.00 0.00 ? 550 LYS A HA   11 
ATOM   6376  H  HB2  . LYS A 1 22 ? 2.285   1.071   -7.951  1.00 0.00 ? 550 LYS A HB2  11 
ATOM   6377  H  HB3  . LYS A 1 22 ? 3.029   -0.510  -8.148  1.00 0.00 ? 550 LYS A HB3  11 
ATOM   6378  H  HG2  . LYS A 1 22 ? 1.610   -0.694  -10.276 1.00 0.00 ? 550 LYS A HG2  11 
ATOM   6379  H  HG3  . LYS A 1 22 ? 1.385   1.048   -10.105 1.00 0.00 ? 550 LYS A HG3  11 
ATOM   6380  H  HD2  . LYS A 1 22 ? 3.796   1.381   -10.155 1.00 0.00 ? 550 LYS A HD2  11 
ATOM   6381  H  HD3  . LYS A 1 22 ? 4.049   -0.362  -10.263 1.00 0.00 ? 550 LYS A HD3  11 
ATOM   6382  H  HE2  . LYS A 1 22 ? 4.134   0.043   -12.476 1.00 0.00 ? 550 LYS A HE2  11 
ATOM   6383  H  HE3  . LYS A 1 22 ? 2.376   0.021   -12.347 1.00 0.00 ? 550 LYS A HE3  11 
ATOM   6384  H  HZ1  . LYS A 1 22 ? 4.174   2.255   -12.805 1.00 0.00 ? 550 LYS A HZ1  11 
ATOM   6385  H  HZ2  . LYS A 1 22 ? 2.879   2.564   -11.762 1.00 0.00 ? 550 LYS A HZ2  11 
ATOM   6386  H  HZ3  . LYS A 1 22 ? 2.585   2.016   -13.335 1.00 0.00 ? 550 LYS A HZ3  11 
ATOM   6387  N  N    . THR A 1 23 ? 1.274   -2.521  -6.308  1.00 0.00 ? 551 THR A N    11 
ATOM   6388  C  CA   . THR A 1 23 ? 1.632   -3.239  -5.091  1.00 0.00 ? 551 THR A CA   11 
ATOM   6389  C  C    . THR A 1 23 ? 3.130   -3.145  -4.825  1.00 0.00 ? 551 THR A C    11 
ATOM   6390  O  O    . THR A 1 23 ? 3.561   -3.042  -3.676  1.00 0.00 ? 551 THR A O    11 
ATOM   6391  C  CB   . THR A 1 23 ? 1.211   -4.706  -5.196  1.00 0.00 ? 551 THR A CB   11 
ATOM   6392  O  OG1  . THR A 1 23 ? 1.534   -5.407  -4.008  1.00 0.00 ? 551 THR A OG1  11 
ATOM   6393  C  CG2  . THR A 1 23 ? 1.865   -5.434  -6.351  1.00 0.00 ? 551 THR A CG2  11 
ATOM   6394  H  H    . THR A 1 23 ? 0.982   -3.028  -7.094  1.00 0.00 ? 551 THR A H    11 
ATOM   6395  H  HA   . THR A 1 23 ? 1.103   -2.780  -4.268  1.00 0.00 ? 551 THR A HA   11 
ATOM   6396  H  HB   . THR A 1 23 ? 0.141   -4.754  -5.338  1.00 0.00 ? 551 THR A HB   11 
ATOM   6397  H  HG1  . THR A 1 23 ? 2.482   -5.366  -3.860  1.00 0.00 ? 551 THR A HG1  11 
ATOM   6398  H  HG21 . THR A 1 23 ? 1.156   -6.121  -6.791  1.00 0.00 ? 551 THR A HG21 11 
ATOM   6399  H  HG22 . THR A 1 23 ? 2.722   -5.984  -5.991  1.00 0.00 ? 551 THR A HG22 11 
ATOM   6400  H  HG23 . THR A 1 23 ? 2.182   -4.719  -7.095  1.00 0.00 ? 551 THR A HG23 11 
ATOM   6401  N  N    . SER A 1 24 ? 3.920   -3.178  -5.894  1.00 0.00 ? 552 SER A N    11 
ATOM   6402  C  CA   . SER A 1 24 ? 5.372   -3.093  -5.774  1.00 0.00 ? 552 SER A CA   11 
ATOM   6403  C  C    . SER A 1 24 ? 5.779   -1.815  -5.050  1.00 0.00 ? 552 SER A C    11 
ATOM   6404  O  O    . SER A 1 24 ? 6.727   -1.809  -4.266  1.00 0.00 ? 552 SER A O    11 
ATOM   6405  C  CB   . SER A 1 24 ? 6.023   -3.140  -7.157  1.00 0.00 ? 552 SER A CB   11 
ATOM   6406  O  OG   . SER A 1 24 ? 5.644   -4.310  -7.860  1.00 0.00 ? 552 SER A OG   11 
ATOM   6407  H  H    . SER A 1 24 ? 3.518   -3.259  -6.784  1.00 0.00 ? 552 SER A H    11 
ATOM   6408  H  HA   . SER A 1 24 ? 5.708   -3.942  -5.197  1.00 0.00 ? 552 SER A HA   11 
ATOM   6409  H  HB2  . SER A 1 24 ? 5.715   -2.277  -7.728  1.00 0.00 ? 552 SER A HB2  11 
ATOM   6410  H  HB3  . SER A 1 24 ? 7.098   -3.133  -7.047  1.00 0.00 ? 552 SER A HB3  11 
ATOM   6411  H  HG   . SER A 1 24 ? 5.916   -5.085  -7.363  1.00 0.00 ? 552 SER A HG   11 
ATOM   6412  N  N    . HIS A 1 25 ? 5.051   -0.735  -5.313  1.00 0.00 ? 553 HIS A N    11 
ATOM   6413  C  CA   . HIS A 1 25 ? 5.332   0.547   -4.679  1.00 0.00 ? 553 HIS A CA   11 
ATOM   6414  C  C    . HIS A 1 25 ? 4.988   0.499   -3.195  1.00 0.00 ? 553 HIS A C    11 
ATOM   6415  O  O    . HIS A 1 25 ? 5.581   1.213   -2.386  1.00 0.00 ? 553 HIS A O    11 
ATOM   6416  C  CB   . HIS A 1 25 ? 4.541   1.663   -5.363  1.00 0.00 ? 553 HIS A CB   11 
ATOM   6417  C  CG   . HIS A 1 25 ? 5.141   2.115   -6.658  1.00 0.00 ? 553 HIS A CG   11 
ATOM   6418  N  ND1  . HIS A 1 25 ? 5.670   3.370   -6.863  1.00 0.00 ? 553 HIS A ND1  11 
ATOM   6419  C  CD2  . HIS A 1 25 ? 5.293   1.450   -7.832  1.00 0.00 ? 553 HIS A CD2  11 
ATOM   6420  C  CE1  . HIS A 1 25 ? 6.115   3.428   -8.125  1.00 0.00 ? 553 HIS A CE1  11 
ATOM   6421  N  NE2  . HIS A 1 25 ? 5.910   2.288   -8.756  1.00 0.00 ? 553 HIS A NE2  11 
ATOM   6422  H  H    . HIS A 1 25 ? 4.303   -0.804  -5.943  1.00 0.00 ? 553 HIS A H    11 
ATOM   6423  H  HA   . HIS A 1 25 ? 6.388   0.746   -4.787  1.00 0.00 ? 553 HIS A HA   11 
ATOM   6424  H  HB2  . HIS A 1 25 ? 3.540   1.314   -5.566  1.00 0.00 ? 553 HIS A HB2  11 
ATOM   6425  H  HB3  . HIS A 1 25 ? 4.492   2.517   -4.703  1.00 0.00 ? 553 HIS A HB3  11 
ATOM   6426  H  HD1  . HIS A 1 25 ? 5.713   4.093   -6.202  1.00 0.00 ? 553 HIS A HD1  11 
ATOM   6427  H  HD2  . HIS A 1 25 ? 4.986   0.433   -8.028  1.00 0.00 ? 553 HIS A HD2  11 
ATOM   6428  H  HE1  . HIS A 1 25 ? 6.582   4.295   -8.569  1.00 0.00 ? 553 HIS A HE1  11 
ATOM   6429  N  N    . LEU A 1 26 ? 4.028   -0.352  -2.843  1.00 0.00 ? 554 LEU A N    11 
ATOM   6430  C  CA   . LEU A 1 26 ? 3.606   -0.498  -1.456  1.00 0.00 ? 554 LEU A CA   11 
ATOM   6431  C  C    . LEU A 1 26 ? 4.775   -0.935  -0.577  1.00 0.00 ? 554 LEU A C    11 
ATOM   6432  O  O    . LEU A 1 26 ? 4.834   -0.599  0.605   1.00 0.00 ? 554 LEU A O    11 
ATOM   6433  C  CB   . LEU A 1 26 ? 2.462   -1.511  -1.354  1.00 0.00 ? 554 LEU A CB   11 
ATOM   6434  C  CG   . LEU A 1 26 ? 1.196   -0.991  -0.673  1.00 0.00 ? 554 LEU A CG   11 
ATOM   6435  C  CD1  . LEU A 1 26 ? 0.323   -0.243  -1.669  1.00 0.00 ? 554 LEU A CD1  11 
ATOM   6436  C  CD2  . LEU A 1 26 ? 0.423   -2.138  -0.040  1.00 0.00 ? 554 LEU A CD2  11 
ATOM   6437  H  H    . LEU A 1 26 ? 3.595   -0.895  -3.533  1.00 0.00 ? 554 LEU A H    11 
ATOM   6438  H  HA   . LEU A 1 26 ? 3.254   0.464   -1.115  1.00 0.00 ? 554 LEU A HA   11 
ATOM   6439  H  HB2  . LEU A 1 26 ? 2.203   -1.830  -2.354  1.00 0.00 ? 554 LEU A HB2  11 
ATOM   6440  H  HB3  . LEU A 1 26 ? 2.814   -2.369  -0.802  1.00 0.00 ? 554 LEU A HB3  11 
ATOM   6441  H  HG   . LEU A 1 26 ? 1.474   -0.301  0.111   1.00 0.00 ? 554 LEU A HG   11 
ATOM   6442  H  HD11 . LEU A 1 26 ? -0.404  0.351   -1.135  1.00 0.00 ? 554 LEU A HD11 11 
ATOM   6443  H  HD12 . LEU A 1 26 ? -0.188  -0.952  -2.303  1.00 0.00 ? 554 LEU A HD12 11 
ATOM   6444  H  HD13 . LEU A 1 26 ? 0.940   0.403   -2.274  1.00 0.00 ? 554 LEU A HD13 11 
ATOM   6445  H  HD21 . LEU A 1 26 ? 0.155   -2.855  -0.801  1.00 0.00 ? 554 LEU A HD21 11 
ATOM   6446  H  HD22 . LEU A 1 26 ? -0.473  -1.755  0.426   1.00 0.00 ? 554 LEU A HD22 11 
ATOM   6447  H  HD23 . LEU A 1 26 ? 1.039   -2.619  0.706   1.00 0.00 ? 554 LEU A HD23 11 
ATOM   6448  N  N    . ARG A 1 27 ? 5.701   -1.689  -1.164  1.00 0.00 ? 555 ARG A N    11 
ATOM   6449  C  CA   . ARG A 1 27 ? 6.865   -2.173  -0.433  1.00 0.00 ? 555 ARG A CA   11 
ATOM   6450  C  C    . ARG A 1 27 ? 7.724   -1.008  0.057   1.00 0.00 ? 555 ARG A C    11 
ATOM   6451  O  O    . ARG A 1 27 ? 8.136   -0.972  1.217   1.00 0.00 ? 555 ARG A O    11 
ATOM   6452  C  CB   . ARG A 1 27 ? 7.689   -3.125  -1.315  1.00 0.00 ? 555 ARG A CB   11 
ATOM   6453  C  CG   . ARG A 1 27 ? 8.784   -2.443  -2.125  1.00 0.00 ? 555 ARG A CG   11 
ATOM   6454  C  CD   . ARG A 1 27 ? 9.526   -3.435  -3.006  1.00 0.00 ? 555 ARG A CD   11 
ATOM   6455  N  NE   . ARG A 1 27 ? 10.424  -4.290  -2.232  1.00 0.00 ? 555 ARG A NE   11 
ATOM   6456  C  CZ   . ARG A 1 27 ? 11.563  -3.868  -1.688  1.00 0.00 ? 555 ARG A CZ   11 
ATOM   6457  N  NH1  . ARG A 1 27 ? 11.946  -2.606  -1.828  1.00 0.00 ? 555 ARG A NH1  11 
ATOM   6458  N  NH2  . ARG A 1 27 ? 12.321  -4.712  -1.000  1.00 0.00 ? 555 ARG A NH2  11 
ATOM   6459  H  H    . ARG A 1 27 ? 5.597   -1.925  -2.108  1.00 0.00 ? 555 ARG A H    11 
ATOM   6460  H  HA   . ARG A 1 27 ? 6.506   -2.719  0.426   1.00 0.00 ? 555 ARG A HA   11 
ATOM   6461  H  HB2  . ARG A 1 27 ? 8.153   -3.867  -0.683  1.00 0.00 ? 555 ARG A HB2  11 
ATOM   6462  H  HB3  . ARG A 1 27 ? 7.021   -3.622  -2.004  1.00 0.00 ? 555 ARG A HB3  11 
ATOM   6463  H  HG2  . ARG A 1 27 ? 8.338   -1.686  -2.751  1.00 0.00 ? 555 ARG A HG2  11 
ATOM   6464  H  HG3  . ARG A 1 27 ? 9.487   -1.983  -1.445  1.00 0.00 ? 555 ARG A HG3  11 
ATOM   6465  H  HD2  . ARG A 1 27 ? 8.803   -4.056  -3.514  1.00 0.00 ? 555 ARG A HD2  11 
ATOM   6466  H  HD3  . ARG A 1 27 ? 10.105  -2.888  -3.735  1.00 0.00 ? 555 ARG A HD3  11 
ATOM   6467  H  HE   . ARG A 1 27 ? 10.165  -5.228  -2.112  1.00 0.00 ? 555 ARG A HE   11 
ATOM   6468  H  HH11 . ARG A 1 27 ? 11.379  -1.964  -2.345  1.00 0.00 ? 555 ARG A HH11 11 
ATOM   6469  H  HH12 . ARG A 1 27 ? 12.803  -2.295  -1.417  1.00 0.00 ? 555 ARG A HH12 11 
ATOM   6470  H  HH21 . ARG A 1 27 ? 12.037  -5.664  -0.891  1.00 0.00 ? 555 ARG A HH21 11 
ATOM   6471  H  HH22 . ARG A 1 27 ? 13.177  -4.395  -0.592  1.00 0.00 ? 555 ARG A HH22 11 
ATOM   6472  N  N    . ALA A 1 28 ? 7.985   -0.055  -0.833  1.00 0.00 ? 556 ALA A N    11 
ATOM   6473  C  CA   . ALA A 1 28 ? 8.789   1.110   -0.491  1.00 0.00 ? 556 ALA A CA   11 
ATOM   6474  C  C    . ALA A 1 28 ? 8.068   1.988   0.524   1.00 0.00 ? 556 ALA A C    11 
ATOM   6475  O  O    . ALA A 1 28 ? 8.697   2.630   1.365   1.00 0.00 ? 556 ALA A O    11 
ATOM   6476  C  CB   . ALA A 1 28 ? 9.121   1.909   -1.743  1.00 0.00 ? 556 ALA A CB   11 
ATOM   6477  H  H    . ALA A 1 28 ? 7.628   -0.138  -1.740  1.00 0.00 ? 556 ALA A H    11 
ATOM   6478  H  HA   . ALA A 1 28 ? 9.714   0.761   -0.059  1.00 0.00 ? 556 ALA A HA   11 
ATOM   6479  H  HB1  . ALA A 1 28 ? 10.072  1.582   -2.137  1.00 0.00 ? 556 ALA A HB1  11 
ATOM   6480  H  HB2  . ALA A 1 28 ? 9.174   2.959   -1.497  1.00 0.00 ? 556 ALA A HB2  11 
ATOM   6481  H  HB3  . ALA A 1 28 ? 8.351   1.752   -2.484  1.00 0.00 ? 556 ALA A HB3  11 
ATOM   6482  N  N    . HIS A 1 29 ? 6.744   2.013   0.437   1.00 0.00 ? 557 HIS A N    11 
ATOM   6483  C  CA   . HIS A 1 29 ? 5.933   2.808   1.344   1.00 0.00 ? 557 HIS A CA   11 
ATOM   6484  C  C    . HIS A 1 29 ? 5.815   2.125   2.705   1.00 0.00 ? 557 HIS A C    11 
ATOM   6485  O  O    . HIS A 1 29 ? 5.765   2.788   3.741   1.00 0.00 ? 557 HIS A O    11 
ATOM   6486  C  CB   . HIS A 1 29 ? 4.542   3.038   0.744   1.00 0.00 ? 557 HIS A CB   11 
ATOM   6487  C  CG   . HIS A 1 29 ? 3.566   3.647   1.701   1.00 0.00 ? 557 HIS A CG   11 
ATOM   6488  N  ND1  . HIS A 1 29 ? 3.835   4.760   2.466   1.00 0.00 ? 557 HIS A ND1  11 
ATOM   6489  C  CD2  . HIS A 1 29 ? 2.301   3.271   2.017   1.00 0.00 ? 557 HIS A CD2  11 
ATOM   6490  C  CE1  . HIS A 1 29 ? 2.750   5.019   3.208   1.00 0.00 ? 557 HIS A CE1  11 
ATOM   6491  N  NE2  . HIS A 1 29 ? 1.791   4.144   2.973   1.00 0.00 ? 557 HIS A NE2  11 
ATOM   6492  H  H    . HIS A 1 29 ? 6.302   1.484   -0.255  1.00 0.00 ? 557 HIS A H    11 
ATOM   6493  H  HA   . HIS A 1 29 ? 6.422   3.758   1.470   1.00 0.00 ? 557 HIS A HA   11 
ATOM   6494  H  HB2  . HIS A 1 29 ? 4.630   3.698   -0.105  1.00 0.00 ? 557 HIS A HB2  11 
ATOM   6495  H  HB3  . HIS A 1 29 ? 4.140   2.090   0.416   1.00 0.00 ? 557 HIS A HB3  11 
ATOM   6496  H  HD1  . HIS A 1 29 ? 4.671   5.272   2.468   1.00 0.00 ? 557 HIS A HD1  11 
ATOM   6497  H  HD2  . HIS A 1 29 ? 1.767   2.430   1.600   1.00 0.00 ? 557 HIS A HD2  11 
ATOM   6498  H  HE1  . HIS A 1 29 ? 2.671   5.836   3.909   1.00 0.00 ? 557 HIS A HE1  11 
ATOM   6499  N  N    . LEU A 1 30 ? 5.767   0.797   2.691   1.00 0.00 ? 558 LEU A N    11 
ATOM   6500  C  CA   . LEU A 1 30 ? 5.649   0.023   3.921   1.00 0.00 ? 558 LEU A CA   11 
ATOM   6501  C  C    . LEU A 1 30 ? 6.857   0.244   4.828   1.00 0.00 ? 558 LEU A C    11 
ATOM   6502  O  O    . LEU A 1 30 ? 6.711   0.434   6.035   1.00 0.00 ? 558 LEU A O    11 
ATOM   6503  C  CB   . LEU A 1 30 ? 5.503   -1.467  3.597   1.00 0.00 ? 558 LEU A CB   11 
ATOM   6504  C  CG   . LEU A 1 30 ? 4.271   -2.142  4.201   1.00 0.00 ? 558 LEU A CG   11 
ATOM   6505  C  CD1  . LEU A 1 30 ? 4.273   -2.001  5.715   1.00 0.00 ? 558 LEU A CD1  11 
ATOM   6506  C  CD2  . LEU A 1 30 ? 2.999   -1.554  3.610   1.00 0.00 ? 558 LEU A CD2  11 
ATOM   6507  H  H    . LEU A 1 30 ? 5.807   0.326   1.833   1.00 0.00 ? 558 LEU A H    11 
ATOM   6508  H  HA   . LEU A 1 30 ? 4.762   0.358   4.438   1.00 0.00 ? 558 LEU A HA   11 
ATOM   6509  H  HB2  . LEU A 1 30 ? 5.457   -1.576  2.523   1.00 0.00 ? 558 LEU A HB2  11 
ATOM   6510  H  HB3  . LEU A 1 30 ? 6.380   -1.983  3.957   1.00 0.00 ? 558 LEU A HB3  11 
ATOM   6511  H  HG   . LEU A 1 30 ? 4.294   -3.196  3.964   1.00 0.00 ? 558 LEU A HG   11 
ATOM   6512  H  HD11 . LEU A 1 30 ? 3.853   -2.891  6.160   1.00 0.00 ? 558 LEU A HD11 11 
ATOM   6513  H  HD12 . LEU A 1 30 ? 3.681   -1.143  5.997   1.00 0.00 ? 558 LEU A HD12 11 
ATOM   6514  H  HD13 . LEU A 1 30 ? 5.287   -1.869  6.062   1.00 0.00 ? 558 LEU A HD13 11 
ATOM   6515  H  HD21 . LEU A 1 30 ? 2.258   -2.332  3.500   1.00 0.00 ? 558 LEU A HD21 11 
ATOM   6516  H  HD22 . LEU A 1 30 ? 3.217   -1.126  2.642   1.00 0.00 ? 558 LEU A HD22 11 
ATOM   6517  H  HD23 . LEU A 1 30 ? 2.619   -0.785  4.266   1.00 0.00 ? 558 LEU A HD23 11 
ATOM   6518  N  N    . ARG A 1 31 ? 8.049   0.217   4.240   1.00 0.00 ? 559 ARG A N    11 
ATOM   6519  C  CA   . ARG A 1 31 ? 9.278   0.413   5.001   1.00 0.00 ? 559 ARG A CA   11 
ATOM   6520  C  C    . ARG A 1 31 ? 9.272   1.770   5.700   1.00 0.00 ? 559 ARG A C    11 
ATOM   6521  O  O    . ARG A 1 31 ? 9.867   1.932   6.766   1.00 0.00 ? 559 ARG A O    11 
ATOM   6522  C  CB   . ARG A 1 31 ? 10.499  0.300   4.085   1.00 0.00 ? 559 ARG A CB   11 
ATOM   6523  C  CG   . ARG A 1 31 ? 10.453  1.236   2.890   1.00 0.00 ? 559 ARG A CG   11 
ATOM   6524  C  CD   . ARG A 1 31 ? 11.820  1.386   2.240   1.00 0.00 ? 559 ARG A CD   11 
ATOM   6525  N  NE   . ARG A 1 31 ? 12.834  1.849   3.187   1.00 0.00 ? 559 ARG A NE   11 
ATOM   6526  C  CZ   . ARG A 1 31 ? 13.647  1.040   3.865   1.00 0.00 ? 559 ARG A CZ   11 
ATOM   6527  N  NH1  . ARG A 1 31 ? 13.559  -0.278  3.727   1.00 0.00 ? 559 ARG A NH1  11 
ATOM   6528  N  NH2  . ARG A 1 31 ? 14.548  1.552   4.693   1.00 0.00 ? 559 ARG A NH2  11 
ATOM   6529  H  H    . ARG A 1 31 ? 8.104   0.060   3.274   1.00 0.00 ? 559 ARG A H    11 
ATOM   6530  H  HA   . ARG A 1 31 ? 9.329   -0.362  5.751   1.00 0.00 ? 559 ARG A HA   11 
ATOM   6531  H  HB2  . ARG A 1 31 ? 11.384  0.527   4.658   1.00 0.00 ? 559 ARG A HB2  11 
ATOM   6532  H  HB3  . ARG A 1 31 ? 10.567  -0.714  3.719   1.00 0.00 ? 559 ARG A HB3  11 
ATOM   6533  H  HG2  . ARG A 1 31 ? 9.762   0.839   2.161   1.00 0.00 ? 559 ARG A HG2  11 
ATOM   6534  H  HG3  . ARG A 1 31 ? 10.112  2.207   3.219   1.00 0.00 ? 559 ARG A HG3  11 
ATOM   6535  H  HD2  . ARG A 1 31 ? 12.121  0.431   1.839   1.00 0.00 ? 559 ARG A HD2  11 
ATOM   6536  H  HD3  . ARG A 1 31 ? 11.742  2.102   1.435   1.00 0.00 ? 559 ARG A HD3  11 
ATOM   6537  H  HE   . ARG A 1 31 ? 12.917  2.816   3.321   1.00 0.00 ? 559 ARG A HE   11 
ATOM   6538  H  HH11 . ARG A 1 31 ? 12.880  -0.673  3.111   1.00 0.00 ? 559 ARG A HH11 11 
ATOM   6539  H  HH12 . ARG A 1 31 ? 14.175  -0.875  4.240   1.00 0.00 ? 559 ARG A HH12 11 
ATOM   6540  H  HH21 . ARG A 1 31 ? 14.616  2.543   4.807   1.00 0.00 ? 559 ARG A HH21 11 
ATOM   6541  H  HH22 . ARG A 1 31 ? 15.159  0.947   5.203   1.00 0.00 ? 559 ARG A HH22 11 
ATOM   6542  N  N    . TRP A 1 32 ? 8.593   2.740   5.096   1.00 0.00 ? 560 TRP A N    11 
ATOM   6543  C  CA   . TRP A 1 32 ? 8.507   4.080   5.664   1.00 0.00 ? 560 TRP A CA   11 
ATOM   6544  C  C    . TRP A 1 32 ? 7.721   4.062   6.971   1.00 0.00 ? 560 TRP A C    11 
ATOM   6545  O  O    . TRP A 1 32 ? 8.032   4.799   7.906   1.00 0.00 ? 560 TRP A O    11 
ATOM   6546  C  CB   . TRP A 1 32 ? 7.846   5.037   4.670   1.00 0.00 ? 560 TRP A CB   11 
ATOM   6547  C  CG   . TRP A 1 32 ? 8.530   6.368   4.583   1.00 0.00 ? 560 TRP A CG   11 
ATOM   6548  C  CD1  . TRP A 1 32 ? 9.321   6.818   3.565   1.00 0.00 ? 560 TRP A CD1  11 
ATOM   6549  C  CD2  . TRP A 1 32 ? 8.485   7.420   5.553   1.00 0.00 ? 560 TRP A CD2  11 
ATOM   6550  N  NE1  . TRP A 1 32 ? 9.770   8.086   3.843   1.00 0.00 ? 560 TRP A NE1  11 
ATOM   6551  C  CE2  . TRP A 1 32 ? 9.271   8.478   5.058   1.00 0.00 ? 560 TRP A CE2  11 
ATOM   6552  C  CE3  . TRP A 1 32 ? 7.856   7.572   6.793   1.00 0.00 ? 560 TRP A CE3  11 
ATOM   6553  C  CZ2  . TRP A 1 32 ? 9.444   9.669   5.758   1.00 0.00 ? 560 TRP A CZ2  11 
ATOM   6554  C  CZ3  . TRP A 1 32 ? 8.029   8.755   7.487   1.00 0.00 ? 560 TRP A CZ3  11 
ATOM   6555  C  CH2  . TRP A 1 32 ? 8.816   9.790   6.968   1.00 0.00 ? 560 TRP A CH2  11 
ATOM   6556  H  H    . TRP A 1 32 ? 8.137   2.549   4.250   1.00 0.00 ? 560 TRP A H    11 
ATOM   6557  H  HA   . TRP A 1 32 ? 9.512   4.420   5.866   1.00 0.00 ? 560 TRP A HA   11 
ATOM   6558  H  HB2  . TRP A 1 32 ? 7.860   4.591   3.687   1.00 0.00 ? 560 TRP A HB2  11 
ATOM   6559  H  HB3  . TRP A 1 32 ? 6.821   5.207   4.970   1.00 0.00 ? 560 TRP A HB3  11 
ATOM   6560  H  HD1  . TRP A 1 32 ? 9.552   6.248   2.677   1.00 0.00 ? 560 TRP A HD1  11 
ATOM   6561  H  HE1  . TRP A 1 32 ? 10.353  8.623   3.266   1.00 0.00 ? 560 TRP A HE1  11 
ATOM   6562  H  HE3  . TRP A 1 32 ? 7.245   6.785   7.209   1.00 0.00 ? 560 TRP A HE3  11 
ATOM   6563  H  HZ2  . TRP A 1 32 ? 10.047  10.477  5.372   1.00 0.00 ? 560 TRP A HZ2  11 
ATOM   6564  H  HZ3  . TRP A 1 32 ? 7.551   8.890   8.446   1.00 0.00 ? 560 TRP A HZ3  11 
ATOM   6565  H  HH2  . TRP A 1 32 ? 8.924   10.697  7.545   1.00 0.00 ? 560 TRP A HH2  11 
ATOM   6566  N  N    . HIS A 1 33 ? 6.700   3.213   7.027   1.00 0.00 ? 561 HIS A N    11 
ATOM   6567  C  CA   . HIS A 1 33 ? 5.866   3.096   8.218   1.00 0.00 ? 561 HIS A CA   11 
ATOM   6568  C  C    . HIS A 1 33 ? 6.623   2.408   9.349   1.00 0.00 ? 561 HIS A C    11 
ATOM   6569  O  O    . HIS A 1 33 ? 6.376   2.673   10.525  1.00 0.00 ? 561 HIS A O    11 
ATOM   6570  C  CB   . HIS A 1 33 ? 4.589   2.317   7.895   1.00 0.00 ? 561 HIS A CB   11 
ATOM   6571  C  CG   . HIS A 1 33 ? 3.507   3.165   7.302   1.00 0.00 ? 561 HIS A CG   11 
ATOM   6572  N  ND1  . HIS A 1 33 ? 2.700   4.003   8.038   1.00 0.00 ? 561 HIS A ND1  11 
ATOM   6573  C  CD2  . HIS A 1 33 ? 3.106   3.296   6.012   1.00 0.00 ? 561 HIS A CD2  11 
ATOM   6574  C  CE1  . HIS A 1 33 ? 1.852   4.603   7.192   1.00 0.00 ? 561 HIS A CE1  11 
ATOM   6575  N  NE2  . HIS A 1 33 ? 2.057   4.209   5.950   1.00 0.00 ? 561 HIS A NE2  11 
ATOM   6576  H  H    . HIS A 1 33 ? 6.502   2.651   6.248   1.00 0.00 ? 561 HIS A H    11 
ATOM   6577  H  HA   . HIS A 1 33 ? 5.598   4.093   8.534   1.00 0.00 ? 561 HIS A HA   11 
ATOM   6578  H  HB2  . HIS A 1 33 ? 4.822   1.534   7.189   1.00 0.00 ? 561 HIS A HB2  11 
ATOM   6579  H  HB3  . HIS A 1 33 ? 4.207   1.875   8.804   1.00 0.00 ? 561 HIS A HB3  11 
ATOM   6580  H  HD1  . HIS A 1 33 ? 2.737   4.136   9.008   1.00 0.00 ? 561 HIS A HD1  11 
ATOM   6581  H  HD2  . HIS A 1 33 ? 3.527   2.780   5.161   1.00 0.00 ? 561 HIS A HD2  11 
ATOM   6582  H  HE1  . HIS A 1 33 ? 1.100   5.320   7.488   1.00 0.00 ? 561 HIS A HE1  11 
ATOM   6583  N  N    . THR A 1 34 ? 7.547   1.524   8.986   1.00 0.00 ? 562 THR A N    11 
ATOM   6584  C  CA   . THR A 1 34 ? 8.339   0.799   9.971   1.00 0.00 ? 562 THR A CA   11 
ATOM   6585  C  C    . THR A 1 34 ? 9.694   1.468   10.180  1.00 0.00 ? 562 THR A C    11 
ATOM   6586  O  O    . THR A 1 34 ? 10.706  0.796   10.381  1.00 0.00 ? 562 THR A O    11 
ATOM   6587  C  CB   . THR A 1 34 ? 8.537   -0.652  9.530   1.00 0.00 ? 562 THR A CB   11 
ATOM   6588  O  OG1  . THR A 1 34 ? 8.809   -0.721  8.141   1.00 0.00 ? 562 THR A OG1  11 
ATOM   6589  C  CG2  . THR A 1 34 ? 7.336   -1.531  9.807   1.00 0.00 ? 562 THR A CG2  11 
ATOM   6590  H  H    . THR A 1 34 ? 7.698   1.355   8.032   1.00 0.00 ? 562 THR A H    11 
ATOM   6591  H  HA   . THR A 1 34 ? 7.798   0.811   10.905  1.00 0.00 ? 562 THR A HA   11 
ATOM   6592  H  HB   . THR A 1 34 ? 9.381   -1.068  10.062  1.00 0.00 ? 562 THR A HB   11 
ATOM   6593  H  HG1  . THR A 1 34 ? 9.470   -0.064  7.911   1.00 0.00 ? 562 THR A HG1  11 
ATOM   6594  H  HG21 . THR A 1 34 ? 7.518   -2.522  9.419   1.00 0.00 ? 562 THR A HG21 11 
ATOM   6595  H  HG22 . THR A 1 34 ? 6.465   -1.111  9.327   1.00 0.00 ? 562 THR A HG22 11 
ATOM   6596  H  HG23 . THR A 1 34 ? 7.169   -1.587  10.872  1.00 0.00 ? 562 THR A HG23 11 
ATOM   6597  N  N    . GLY A 1 35 ? 9.707   2.796   10.130  1.00 0.00 ? 563 GLY A N    11 
ATOM   6598  C  CA   . GLY A 1 35 ? 10.943  3.534   10.315  1.00 0.00 ? 563 GLY A CA   11 
ATOM   6599  C  C    . GLY A 1 35 ? 10.703  4.980   10.699  1.00 0.00 ? 563 GLY A C    11 
ATOM   6600  O  O    . GLY A 1 35 ? 11.462  5.867   10.307  1.00 0.00 ? 563 GLY A O    11 
ATOM   6601  H  H    . GLY A 1 35 ? 8.870   3.279   9.966   1.00 0.00 ? 563 GLY A H    11 
ATOM   6602  H  HA2  . GLY A 1 35 ? 11.520  3.057   11.093  1.00 0.00 ? 563 GLY A HA2  11 
ATOM   6603  H  HA3  . GLY A 1 35 ? 11.507  3.506   9.394   1.00 0.00 ? 563 GLY A HA3  11 
ATOM   6604  N  N    . GLU A 1 36 ? 9.646   5.219   11.469  1.00 0.00 ? 564 GLU A N    11 
ATOM   6605  C  CA   . GLU A 1 36 ? 9.309   6.569   11.907  1.00 0.00 ? 564 GLU A CA   11 
ATOM   6606  C  C    . GLU A 1 36 ? 9.888   6.851   13.290  1.00 0.00 ? 564 GLU A C    11 
ATOM   6607  O  O    . GLU A 1 36 ? 10.473  5.970   13.920  1.00 0.00 ? 564 GLU A O    11 
ATOM   6608  C  CB   . GLU A 1 36 ? 7.790   6.757   11.925  1.00 0.00 ? 564 GLU A CB   11 
ATOM   6609  C  CG   . GLU A 1 36 ? 7.264   7.573   10.755  1.00 0.00 ? 564 GLU A CG   11 
ATOM   6610  C  CD   . GLU A 1 36 ? 7.113   9.043   11.092  1.00 0.00 ? 564 GLU A CD   11 
ATOM   6611  O  OE1  . GLU A 1 36 ? 8.133   9.764   11.077  1.00 0.00 ? 564 GLU A OE1  11 
ATOM   6612  O  OE2  . GLU A 1 36 ? 5.974   9.474   11.370  1.00 0.00 ? 564 GLU A OE2  11 
ATOM   6613  H  H    . GLU A 1 36 ? 9.080   4.470   11.749  1.00 0.00 ? 564 GLU A H    11 
ATOM   6614  H  HA   . GLU A 1 36 ? 9.740   7.263   11.201  1.00 0.00 ? 564 GLU A HA   11 
ATOM   6615  H  HB2  . GLU A 1 36 ? 7.318   5.786   11.899  1.00 0.00 ? 564 GLU A HB2  11 
ATOM   6616  H  HB3  . GLU A 1 36 ? 7.510   7.258   12.840  1.00 0.00 ? 564 GLU A HB3  11 
ATOM   6617  H  HG2  . GLU A 1 36 ? 7.952   7.477   9.928   1.00 0.00 ? 564 GLU A HG2  11 
ATOM   6618  H  HG3  . GLU A 1 36 ? 6.299   7.183   10.466  1.00 0.00 ? 564 GLU A HG3  11 
ATOM   6619  N  N    . ARG A 1 37 ? 9.721   8.084   13.756  1.00 0.00 ? 565 ARG A N    11 
ATOM   6620  C  CA   . ARG A 1 37 ? 10.227  8.482   15.065  1.00 0.00 ? 565 ARG A CA   11 
ATOM   6621  C  C    . ARG A 1 37 ? 9.090   8.949   15.968  1.00 0.00 ? 565 ARG A C    11 
ATOM   6622  O  O    . ARG A 1 37 ? 9.373   9.341   17.120  1.00 0.00 ? 565 ARG A O    11 
ATOM   6623  C  CB   . ARG A 1 37 ? 11.267  9.595   14.915  1.00 0.00 ? 565 ARG A CB   11 
ATOM   6624  C  CG   . ARG A 1 37 ? 12.699  9.087   14.883  1.00 0.00 ? 565 ARG A CG   11 
ATOM   6625  C  CD   . ARG A 1 37 ? 13.668  10.179  14.457  1.00 0.00 ? 565 ARG A CD   11 
ATOM   6626  N  NE   . ARG A 1 37 ? 14.216  10.902  15.602  1.00 0.00 ? 565 ARG A NE   11 
ATOM   6627  C  CZ   . ARG A 1 37 ? 15.190  10.433  16.378  1.00 0.00 ? 565 ARG A CZ   11 
ATOM   6628  N  NH1  . ARG A 1 37 ? 15.725  9.242   16.137  1.00 0.00 ? 565 ARG A NH1  11 
ATOM   6629  N  NH2  . ARG A 1 37 ? 15.630  11.156  17.399  1.00 0.00 ? 565 ARG A NH2  11 
ATOM   6630  O  OXT  . ARG A 1 37 ? 7.926   8.919   15.516  1.00 0.00 ? 565 ARG A OXT  11 
ATOM   6631  H  H    . ARG A 1 37 ? 9.246   8.742   13.207  1.00 0.00 ? 565 ARG A H    11 
ATOM   6632  H  HA   . ARG A 1 37 ? 10.697  7.620   15.514  1.00 0.00 ? 565 ARG A HA   11 
ATOM   6633  H  HB2  . ARG A 1 37 ? 11.076  10.129  13.996  1.00 0.00 ? 565 ARG A HB2  11 
ATOM   6634  H  HB3  . ARG A 1 37 ? 11.169  10.278  15.746  1.00 0.00 ? 565 ARG A HB3  11 
ATOM   6635  H  HG2  . ARG A 1 37 ? 12.972  8.744   15.870  1.00 0.00 ? 565 ARG A HG2  11 
ATOM   6636  H  HG3  . ARG A 1 37 ? 12.765  8.267   14.183  1.00 0.00 ? 565 ARG A HG3  11 
ATOM   6637  H  HD2  . ARG A 1 37 ? 14.480  9.727   13.907  1.00 0.00 ? 565 ARG A HD2  11 
ATOM   6638  H  HD3  . ARG A 1 37 ? 13.145  10.876  13.819  1.00 0.00 ? 565 ARG A HD3  11 
ATOM   6639  H  HE   . ARG A 1 37 ? 13.838  11.784  15.803  1.00 0.00 ? 565 ARG A HE   11 
ATOM   6640  H  HH11 . ARG A 1 37 ? 15.398  8.692   15.369  1.00 0.00 ? 565 ARG A HH11 11 
ATOM   6641  H  HH12 . ARG A 1 37 ? 16.457  8.896   16.723  1.00 0.00 ? 565 ARG A HH12 11 
ATOM   6642  H  HH21 . ARG A 1 37 ? 15.231  12.053  17.585  1.00 0.00 ? 565 ARG A HH21 11 
ATOM   6643  H  HH22 . ARG A 1 37 ? 16.362  10.803  17.982  1.00 0.00 ? 565 ARG A HH22 11 
HETATM 6644  ZN ZN   . ZN  B 2 .  ? 0.683   4.692   4.559   1.00 0.00 ? 100 ZN  A ZN   11 
ATOM   6645  N  N    . MET A 1 1  ? -13.282 -17.923 -9.469  1.00 0.00 ? 1   MET A N    12 
ATOM   6646  C  CA   . MET A 1 1  ? -13.396 -17.201 -10.763 1.00 0.00 ? 1   MET A CA   12 
ATOM   6647  C  C    . MET A 1 1  ? -14.439 -16.091 -10.685 1.00 0.00 ? 1   MET A C    12 
ATOM   6648  O  O    . MET A 1 1  ? -15.498 -16.262 -10.083 1.00 0.00 ? 1   MET A O    12 
ATOM   6649  C  CB   . MET A 1 1  ? -13.777 -18.207 -11.851 1.00 0.00 ? 1   MET A CB   12 
ATOM   6650  C  CG   . MET A 1 1  ? -12.636 -19.128 -12.253 1.00 0.00 ? 1   MET A CG   12 
ATOM   6651  S  SD   . MET A 1 1  ? -11.650 -18.460 -13.607 1.00 0.00 ? 1   MET A SD   12 
ATOM   6652  C  CE   . MET A 1 1  ? -10.195 -19.499 -13.511 1.00 0.00 ? 1   MET A CE   12 
ATOM   6653  H  H1   . MET A 1 1  ? -13.298 -17.215 -8.708  1.00 0.00 ? 1   MET A H1   12 
ATOM   6654  H  H2   . MET A 1 1  ? -12.383 -18.446 -9.477  1.00 0.00 ? 1   MET A H2   12 
ATOM   6655  H  H3   . MET A 1 1  ? -14.092 -18.570 -9.395  1.00 0.00 ? 1   MET A H3   12 
ATOM   6656  H  HA   . MET A 1 1  ? -12.436 -16.767 -11.000 1.00 0.00 ? 1   MET A HA   12 
ATOM   6657  H  HB2  . MET A 1 1  ? -14.593 -18.817 -11.491 1.00 0.00 ? 1   MET A HB2  12 
ATOM   6658  H  HB3  . MET A 1 1  ? -14.101 -17.667 -12.727 1.00 0.00 ? 1   MET A HB3  12 
ATOM   6659  H  HG2  . MET A 1 1  ? -11.993 -19.277 -11.399 1.00 0.00 ? 1   MET A HG2  12 
ATOM   6660  H  HG3  . MET A 1 1  ? -13.049 -20.077 -12.561 1.00 0.00 ? 1   MET A HG3  12 
ATOM   6661  H  HE1  . MET A 1 1  ? -9.703  -19.519 -14.472 1.00 0.00 ? 1   MET A HE1  12 
ATOM   6662  H  HE2  . MET A 1 1  ? -10.487 -20.502 -13.235 1.00 0.00 ? 1   MET A HE2  12 
ATOM   6663  H  HE3  . MET A 1 1  ? -9.519  -19.104 -12.768 1.00 0.00 ? 1   MET A HE3  12 
ATOM   6664  N  N    . ASP A 1 2  ? -14.131 -14.953 -11.299 1.00 0.00 ? 530 ASP A N    12 
ATOM   6665  C  CA   . ASP A 1 2  ? -15.042 -13.814 -11.299 1.00 0.00 ? 530 ASP A CA   12 
ATOM   6666  C  C    . ASP A 1 2  ? -14.935 -13.031 -12.605 1.00 0.00 ? 530 ASP A C    12 
ATOM   6667  O  O    . ASP A 1 2  ? -13.961 -13.171 -13.344 1.00 0.00 ? 530 ASP A O    12 
ATOM   6668  C  CB   . ASP A 1 2  ? -14.741 -12.894 -10.114 1.00 0.00 ? 530 ASP A CB   12 
ATOM   6669  C  CG   . ASP A 1 2  ? -15.262 -13.451 -8.803  1.00 0.00 ? 530 ASP A CG   12 
ATOM   6670  O  OD1  . ASP A 1 2  ? -16.490 -13.395 -8.581  1.00 0.00 ? 530 ASP A OD1  12 
ATOM   6671  O  OD2  . ASP A 1 2  ? -14.443 -13.942 -7.999  1.00 0.00 ? 530 ASP A OD2  12 
ATOM   6672  H  H    . ASP A 1 2  ? -13.271 -14.877 -11.762 1.00 0.00 ? 530 ASP A H    12 
ATOM   6673  H  HA   . ASP A 1 2  ? -16.048 -14.194 -11.202 1.00 0.00 ? 530 ASP A HA   12 
ATOM   6674  H  HB2  . ASP A 1 2  ? -13.673 -12.765 -10.028 1.00 0.00 ? 530 ASP A HB2  12 
ATOM   6675  H  HB3  . ASP A 1 2  ? -15.204 -11.933 -10.285 1.00 0.00 ? 530 ASP A HB3  12 
ATOM   6676  N  N    . PRO A 1 3  ? -15.941 -12.192 -12.907 1.00 0.00 ? 531 PRO A N    12 
ATOM   6677  C  CA   . PRO A 1 3  ? -15.956 -11.385 -14.131 1.00 0.00 ? 531 PRO A CA   12 
ATOM   6678  C  C    . PRO A 1 3  ? -14.672 -10.582 -14.310 1.00 0.00 ? 531 PRO A C    12 
ATOM   6679  O  O    . PRO A 1 3  ? -14.157 -10.455 -15.421 1.00 0.00 ? 531 PRO A O    12 
ATOM   6680  C  CB   . PRO A 1 3  ? -17.148 -10.448 -13.927 1.00 0.00 ? 531 PRO A CB   12 
ATOM   6681  C  CG   . PRO A 1 3  ? -18.045 -11.176 -12.987 1.00 0.00 ? 531 PRO A CG   12 
ATOM   6682  C  CD   . PRO A 1 3  ? -17.141 -11.964 -12.080 1.00 0.00 ? 531 PRO A CD   12 
ATOM   6683  H  HA   . PRO A 1 3  ? -16.121 -11.997 -15.006 1.00 0.00 ? 531 PRO A HA   12 
ATOM   6684  H  HB2  . PRO A 1 3  ? -16.807 -9.513  -13.505 1.00 0.00 ? 531 PRO A HB2  12 
ATOM   6685  H  HB3  . PRO A 1 3  ? -17.634 -10.266 -14.873 1.00 0.00 ? 531 PRO A HB3  12 
ATOM   6686  H  HG2  . PRO A 1 3  ? -18.628 -10.470 -12.415 1.00 0.00 ? 531 PRO A HG2  12 
ATOM   6687  H  HG3  . PRO A 1 3  ? -18.693 -11.840 -13.539 1.00 0.00 ? 531 PRO A HG3  12 
ATOM   6688  H  HD2  . PRO A 1 3  ? -16.898 -11.390 -11.198 1.00 0.00 ? 531 PRO A HD2  12 
ATOM   6689  H  HD3  . PRO A 1 3  ? -17.604 -12.901 -11.807 1.00 0.00 ? 531 PRO A HD3  12 
ATOM   6690  N  N    . GLY A 1 4  ? -14.160 -10.041 -13.209 1.00 0.00 ? 532 GLY A N    12 
ATOM   6691  C  CA   . GLY A 1 4  ? -12.940 -9.257  -13.266 1.00 0.00 ? 532 GLY A CA   12 
ATOM   6692  C  C    . GLY A 1 4  ? -12.071 -9.447  -12.039 1.00 0.00 ? 532 GLY A C    12 
ATOM   6693  O  O    . GLY A 1 4  ? -12.526 -9.972  -11.023 1.00 0.00 ? 532 GLY A O    12 
ATOM   6694  H  H    . GLY A 1 4  ? -14.614 -10.176 -12.351 1.00 0.00 ? 532 GLY A H    12 
ATOM   6695  H  HA2  . GLY A 1 4  ? -12.378 -9.550  -14.141 1.00 0.00 ? 532 GLY A HA2  12 
ATOM   6696  H  HA3  . GLY A 1 4  ? -13.200 -8.213  -13.352 1.00 0.00 ? 532 GLY A HA3  12 
ATOM   6697  N  N    . LYS A 1 5  ? -10.816 -9.018  -12.132 1.00 0.00 ? 533 LYS A N    12 
ATOM   6698  C  CA   . LYS A 1 5  ? -9.881  -9.143  -11.020 1.00 0.00 ? 533 LYS A CA   12 
ATOM   6699  C  C    . LYS A 1 5  ? -8.926  -7.954  -10.976 1.00 0.00 ? 533 LYS A C    12 
ATOM   6700  O  O    . LYS A 1 5  ? -8.272  -7.633  -11.968 1.00 0.00 ? 533 LYS A O    12 
ATOM   6701  C  CB   . LYS A 1 5  ? -9.090  -10.448 -11.137 1.00 0.00 ? 533 LYS A CB   12 
ATOM   6702  C  CG   . LYS A 1 5  ? -9.129  -11.297 -9.874  1.00 0.00 ? 533 LYS A CG   12 
ATOM   6703  C  CD   . LYS A 1 5  ? -7.748  -11.820 -9.504  1.00 0.00 ? 533 LYS A CD   12 
ATOM   6704  C  CE   . LYS A 1 5  ? -7.404  -11.512 -8.056  1.00 0.00 ? 533 LYS A CE   12 
ATOM   6705  N  NZ   . LYS A 1 5  ? -7.982  -12.517 -7.121  1.00 0.00 ? 533 LYS A NZ   12 
ATOM   6706  H  H    . LYS A 1 5  ? -10.512 -8.608  -12.969 1.00 0.00 ? 533 LYS A H    12 
ATOM   6707  H  HA   . LYS A 1 5  ? -10.456 -9.162  -10.106 1.00 0.00 ? 533 LYS A HA   12 
ATOM   6708  H  HB2  . LYS A 1 5  ? -9.499  -11.032 -11.949 1.00 0.00 ? 533 LYS A HB2  12 
ATOM   6709  H  HB3  . LYS A 1 5  ? -8.059  -10.214 -11.357 1.00 0.00 ? 533 LYS A HB3  12 
ATOM   6710  H  HG2  . LYS A 1 5  ? -9.505  -10.695 -9.061  1.00 0.00 ? 533 LYS A HG2  12 
ATOM   6711  H  HG3  . LYS A 1 5  ? -9.790  -12.136 -10.038 1.00 0.00 ? 533 LYS A HG3  12 
ATOM   6712  H  HD2  . LYS A 1 5  ? -7.730  -12.890 -9.647  1.00 0.00 ? 533 LYS A HD2  12 
ATOM   6713  H  HD3  . LYS A 1 5  ? -7.013  -11.357 -10.146 1.00 0.00 ? 533 LYS A HD3  12 
ATOM   6714  H  HE2  . LYS A 1 5  ? -6.330  -11.509 -7.947  1.00 0.00 ? 533 LYS A HE2  12 
ATOM   6715  H  HE3  . LYS A 1 5  ? -7.793  -10.535 -7.807  1.00 0.00 ? 533 LYS A HE3  12 
ATOM   6716  H  HZ1  . LYS A 1 5  ? -8.982  -12.297 -6.934  1.00 0.00 ? 533 LYS A HZ1  12 
ATOM   6717  H  HZ2  . LYS A 1 5  ? -7.463  -12.508 -6.221  1.00 0.00 ? 533 LYS A HZ2  12 
ATOM   6718  H  HZ3  . LYS A 1 5  ? -7.919  -13.468 -7.536  1.00 0.00 ? 533 LYS A HZ3  12 
ATOM   6719  N  N    . LYS A 1 6  ? -8.852  -7.305  -9.819  1.00 0.00 ? 534 LYS A N    12 
ATOM   6720  C  CA   . LYS A 1 6  ? -7.976  -6.151  -9.645  1.00 0.00 ? 534 LYS A CA   12 
ATOM   6721  C  C    . LYS A 1 6  ? -7.196  -6.253  -8.338  1.00 0.00 ? 534 LYS A C    12 
ATOM   6722  O  O    . LYS A 1 6  ? -7.578  -6.992  -7.432  1.00 0.00 ? 534 LYS A O    12 
ATOM   6723  C  CB   . LYS A 1 6  ? -8.793  -4.857  -9.666  1.00 0.00 ? 534 LYS A CB   12 
ATOM   6724  C  CG   . LYS A 1 6  ? -9.938  -4.845  -8.667  1.00 0.00 ? 534 LYS A CG   12 
ATOM   6725  C  CD   . LYS A 1 6  ? -10.937 -3.743  -8.980  1.00 0.00 ? 534 LYS A CD   12 
ATOM   6726  C  CE   . LYS A 1 6  ? -11.834 -4.118  -10.148 1.00 0.00 ? 534 LYS A CE   12 
ATOM   6727  N  NZ   . LYS A 1 6  ? -13.178 -3.487  -10.042 1.00 0.00 ? 534 LYS A NZ   12 
ATOM   6728  H  H    . LYS A 1 6  ? -9.398  -7.608  -9.064  1.00 0.00 ? 534 LYS A H    12 
ATOM   6729  H  HA   . LYS A 1 6  ? -7.277  -6.139  -10.468 1.00 0.00 ? 534 LYS A HA   12 
ATOM   6730  H  HB2  . LYS A 1 6  ? -8.138  -4.029  -9.441  1.00 0.00 ? 534 LYS A HB2  12 
ATOM   6731  H  HB3  . LYS A 1 6  ? -9.204  -4.721  -10.655 1.00 0.00 ? 534 LYS A HB3  12 
ATOM   6732  H  HG2  . LYS A 1 6  ? -10.446 -5.797  -8.704  1.00 0.00 ? 534 LYS A HG2  12 
ATOM   6733  H  HG3  . LYS A 1 6  ? -9.538  -4.686  -7.677  1.00 0.00 ? 534 LYS A HG3  12 
ATOM   6734  H  HD2  . LYS A 1 6  ? -11.552 -3.570  -8.109  1.00 0.00 ? 534 LYS A HD2  12 
ATOM   6735  H  HD3  . LYS A 1 6  ? -10.397 -2.840  -9.227  1.00 0.00 ? 534 LYS A HD3  12 
ATOM   6736  H  HE2  . LYS A 1 6  ? -11.365 -3.793  -11.065 1.00 0.00 ? 534 LYS A HE2  12 
ATOM   6737  H  HE3  . LYS A 1 6  ? -11.950 -5.192  -10.166 1.00 0.00 ? 534 LYS A HE3  12 
ATOM   6738  H  HZ1  . LYS A 1 6  ? -13.206 -2.609  -10.600 1.00 0.00 ? 534 LYS A HZ1  12 
ATOM   6739  H  HZ2  . LYS A 1 6  ? -13.390 -3.260  -9.050  1.00 0.00 ? 534 LYS A HZ2  12 
ATOM   6740  H  HZ3  . LYS A 1 6  ? -13.908 -4.136  -10.401 1.00 0.00 ? 534 LYS A HZ3  12 
ATOM   6741  N  N    . LYS A 1 7  ? -6.101  -5.505  -8.249  1.00 0.00 ? 535 LYS A N    12 
ATOM   6742  C  CA   . LYS A 1 7  ? -5.268  -5.511  -7.053  1.00 0.00 ? 535 LYS A CA   12 
ATOM   6743  C  C    . LYS A 1 7  ? -4.962  -4.088  -6.596  1.00 0.00 ? 535 LYS A C    12 
ATOM   6744  O  O    . LYS A 1 7  ? -4.838  -3.176  -7.413  1.00 0.00 ? 535 LYS A O    12 
ATOM   6745  C  CB   . LYS A 1 7  ? -3.964  -6.266  -7.318  1.00 0.00 ? 535 LYS A CB   12 
ATOM   6746  C  CG   . LYS A 1 7  ? -4.018  -7.731  -6.914  1.00 0.00 ? 535 LYS A CG   12 
ATOM   6747  C  CD   . LYS A 1 7  ? -2.631  -8.352  -6.884  1.00 0.00 ? 535 LYS A CD   12 
ATOM   6748  C  CE   . LYS A 1 7  ? -2.649  -9.780  -7.407  1.00 0.00 ? 535 LYS A CE   12 
ATOM   6749  N  NZ   . LYS A 1 7  ? -1.308  -10.421 -7.317  1.00 0.00 ? 535 LYS A NZ   12 
ATOM   6750  H  H    . LYS A 1 7  ? -5.848  -4.935  -9.005  1.00 0.00 ? 535 LYS A H    12 
ATOM   6751  H  HA   . LYS A 1 7  ? -5.814  -6.017  -6.271  1.00 0.00 ? 535 LYS A HA   12 
ATOM   6752  H  HB2  . LYS A 1 7  ? -3.739  -6.214  -8.373  1.00 0.00 ? 535 LYS A HB2  12 
ATOM   6753  H  HB3  . LYS A 1 7  ? -3.166  -5.792  -6.765  1.00 0.00 ? 535 LYS A HB3  12 
ATOM   6754  H  HG2  . LYS A 1 7  ? -4.457  -7.807  -5.931  1.00 0.00 ? 535 LYS A HG2  12 
ATOM   6755  H  HG3  . LYS A 1 7  ? -4.628  -8.268  -7.626  1.00 0.00 ? 535 LYS A HG3  12 
ATOM   6756  H  HD2  . LYS A 1 7  ? -1.969  -7.762  -7.501  1.00 0.00 ? 535 LYS A HD2  12 
ATOM   6757  H  HD3  . LYS A 1 7  ? -2.270  -8.355  -5.866  1.00 0.00 ? 535 LYS A HD3  12 
ATOM   6758  H  HE2  . LYS A 1 7  ? -3.352  -10.355 -6.823  1.00 0.00 ? 535 LYS A HE2  12 
ATOM   6759  H  HE3  . LYS A 1 7  ? -2.965  -9.767  -8.440  1.00 0.00 ? 535 LYS A HE3  12 
ATOM   6760  H  HZ1  . LYS A 1 7  ? -0.674  -10.026 -8.041  1.00 0.00 ? 535 LYS A HZ1  12 
ATOM   6761  H  HZ2  . LYS A 1 7  ? -1.391  -11.446 -7.468  1.00 0.00 ? 535 LYS A HZ2  12 
ATOM   6762  H  HZ3  . LYS A 1 7  ? -0.893  -10.253 -6.379  1.00 0.00 ? 535 LYS A HZ3  12 
ATOM   6763  N  N    . GLN A 1 8  ? -4.844  -3.906  -5.284  1.00 0.00 ? 536 GLN A N    12 
ATOM   6764  C  CA   . GLN A 1 8  ? -4.555  -2.593  -4.718  1.00 0.00 ? 536 GLN A CA   12 
ATOM   6765  C  C    . GLN A 1 8  ? -3.855  -2.725  -3.369  1.00 0.00 ? 536 GLN A C    12 
ATOM   6766  O  O    . GLN A 1 8  ? -4.108  -3.667  -2.617  1.00 0.00 ? 536 GLN A O    12 
ATOM   6767  C  CB   . GLN A 1 8  ? -5.845  -1.788  -4.559  1.00 0.00 ? 536 GLN A CB   12 
ATOM   6768  C  CG   . GLN A 1 8  ? -6.199  -0.958  -5.783  1.00 0.00 ? 536 GLN A CG   12 
ATOM   6769  C  CD   . GLN A 1 8  ? -7.614  -1.206  -6.269  1.00 0.00 ? 536 GLN A CD   12 
ATOM   6770  O  OE1  . GLN A 1 8  ? -8.569  -1.145  -5.495  1.00 0.00 ? 536 GLN A OE1  12 
ATOM   6771  N  NE2  . GLN A 1 8  ? -7.754  -1.490  -7.559  1.00 0.00 ? 536 GLN A NE2  12 
ATOM   6772  H  H    . GLN A 1 8  ? -4.955  -4.672  -4.683  1.00 0.00 ? 536 GLN A H    12 
ATOM   6773  H  HA   . GLN A 1 8  ? -3.899  -2.075  -5.401  1.00 0.00 ? 536 GLN A HA   12 
ATOM   6774  H  HB2  . GLN A 1 8  ? -6.660  -2.470  -4.365  1.00 0.00 ? 536 GLN A HB2  12 
ATOM   6775  H  HB3  . GLN A 1 8  ? -5.738  -1.121  -3.717  1.00 0.00 ? 536 GLN A HB3  12 
ATOM   6776  H  HG2  . GLN A 1 8  ? -6.100  0.088   -5.533  1.00 0.00 ? 536 GLN A HG2  12 
ATOM   6777  H  HG3  . GLN A 1 8  ? -5.511  -1.203  -6.579  1.00 0.00 ? 536 GLN A HG3  12 
ATOM   6778  H  HE21 . GLN A 1 8  ? -6.949  -1.523  -8.116  1.00 0.00 ? 536 GLN A HE21 12 
ATOM   6779  H  HE22 . GLN A 1 8  ? -8.658  -1.656  -7.900  1.00 0.00 ? 536 GLN A HE22 12 
ATOM   6780  N  N    . HIS A 1 9  ? -2.975  -1.776  -3.069  1.00 0.00 ? 537 HIS A N    12 
ATOM   6781  C  CA   . HIS A 1 9  ? -2.239  -1.786  -1.810  1.00 0.00 ? 537 HIS A CA   12 
ATOM   6782  C  C    . HIS A 1 9  ? -2.711  -0.661  -0.896  1.00 0.00 ? 537 HIS A C    12 
ATOM   6783  O  O    . HIS A 1 9  ? -2.308  0.492   -1.055  1.00 0.00 ? 537 HIS A O    12 
ATOM   6784  C  CB   . HIS A 1 9  ? -0.738  -1.650  -2.071  1.00 0.00 ? 537 HIS A CB   12 
ATOM   6785  C  CG   . HIS A 1 9  ? -0.036  -2.963  -2.231  1.00 0.00 ? 537 HIS A CG   12 
ATOM   6786  N  ND1  . HIS A 1 9  ? -0.416  -4.121  -1.591  1.00 0.00 ? 537 HIS A ND1  12 
ATOM   6787  C  CD2  . HIS A 1 9  ? 1.047   -3.289  -2.983  1.00 0.00 ? 537 HIS A CD2  12 
ATOM   6788  C  CE1  . HIS A 1 9  ? 0.428   -5.093  -1.964  1.00 0.00 ? 537 HIS A CE1  12 
ATOM   6789  N  NE2  . HIS A 1 9  ? 1.334   -4.640  -2.808  1.00 0.00 ? 537 HIS A NE2  12 
ATOM   6790  H  H    . HIS A 1 9  ? -2.816  -1.051  -3.709  1.00 0.00 ? 537 HIS A H    12 
ATOM   6791  H  HA   . HIS A 1 9  ? -2.427  -2.731  -1.324  1.00 0.00 ? 537 HIS A HA   12 
ATOM   6792  H  HB2  . HIS A 1 9  ? -0.587  -1.081  -2.976  1.00 0.00 ? 537 HIS A HB2  12 
ATOM   6793  H  HB3  . HIS A 1 9  ? -0.282  -1.128  -1.243  1.00 0.00 ? 537 HIS A HB3  12 
ATOM   6794  H  HD1  . HIS A 1 9  ? -1.169  -4.218  -0.971  1.00 0.00 ? 537 HIS A HD1  12 
ATOM   6795  H  HD2  . HIS A 1 9  ? 1.604   -2.615  -3.618  1.00 0.00 ? 537 HIS A HD2  12 
ATOM   6796  H  HE1  . HIS A 1 9  ? 0.373   -6.115  -1.619  1.00 0.00 ? 537 HIS A HE1  12 
ATOM   6797  N  N    . ILE A 1 10 ? -3.565  -1.002  0.063   1.00 0.00 ? 538 ILE A N    12 
ATOM   6798  C  CA   . ILE A 1 10 ? -4.091  -0.020  1.004   1.00 0.00 ? 538 ILE A CA   12 
ATOM   6799  C  C    . ILE A 1 10 ? -3.251  0.026   2.275   1.00 0.00 ? 538 ILE A C    12 
ATOM   6800  O  O    . ILE A 1 10 ? -2.753  -0.999  2.740   1.00 0.00 ? 538 ILE A O    12 
ATOM   6801  C  CB   . ILE A 1 10 ? -5.553  -0.328  1.378   1.00 0.00 ? 538 ILE A CB   12 
ATOM   6802  C  CG1  . ILE A 1 10 ? -6.385  -0.568  0.117   1.00 0.00 ? 538 ILE A CG1  12 
ATOM   6803  C  CG2  . ILE A 1 10 ? -6.141  0.811   2.199   1.00 0.00 ? 538 ILE A CG2  12 
ATOM   6804  C  CD1  . ILE A 1 10 ? -6.502  -2.028  -0.261  1.00 0.00 ? 538 ILE A CD1  12 
ATOM   6805  H  H    . ILE A 1 10 ? -3.848  -1.937  0.140   1.00 0.00 ? 538 ILE A H    12 
ATOM   6806  H  HA   . ILE A 1 10 ? -4.059  0.949   0.527   1.00 0.00 ? 538 ILE A HA   12 
ATOM   6807  H  HB   . ILE A 1 10 ? -5.566  -1.220  1.985   1.00 0.00 ? 538 ILE A HB   12 
ATOM   6808  H  HG12 . ILE A 1 10 ? -7.383  -0.186  0.274   1.00 0.00 ? 538 ILE A HG12 12 
ATOM   6809  H  HG13 . ILE A 1 10 ? -5.930  -0.045  -0.711  1.00 0.00 ? 538 ILE A HG13 12 
ATOM   6810  H  HG21 . ILE A 1 10 ? -5.791  0.738   3.218   1.00 0.00 ? 538 ILE A HG21 12 
ATOM   6811  H  HG22 . ILE A 1 10 ? -7.219  0.747   2.183   1.00 0.00 ? 538 ILE A HG22 12 
ATOM   6812  H  HG23 . ILE A 1 10 ? -5.830  1.756   1.779   1.00 0.00 ? 538 ILE A HG23 12 
ATOM   6813  H  HD11 . ILE A 1 10 ? -7.538  -2.271  -0.443  1.00 0.00 ? 538 ILE A HD11 12 
ATOM   6814  H  HD12 . ILE A 1 10 ? -6.125  -2.640  0.546   1.00 0.00 ? 538 ILE A HD12 12 
ATOM   6815  H  HD13 . ILE A 1 10 ? -5.926  -2.216  -1.154  1.00 0.00 ? 538 ILE A HD13 12 
ATOM   6816  N  N    . CYS A 1 11 ? -3.097  1.222   2.833   1.00 0.00 ? 539 CYS A N    12 
ATOM   6817  C  CA   . CYS A 1 11 ? -2.317  1.403   4.051   1.00 0.00 ? 539 CYS A CA   12 
ATOM   6818  C  C    . CYS A 1 11 ? -3.119  0.982   5.279   1.00 0.00 ? 539 CYS A C    12 
ATOM   6819  O  O    . CYS A 1 11 ? -4.025  1.694   5.714   1.00 0.00 ? 539 CYS A O    12 
ATOM   6820  C  CB   . CYS A 1 11 ? -1.874  2.862   4.185   1.00 0.00 ? 539 CYS A CB   12 
ATOM   6821  S  SG   . CYS A 1 11 ? -0.167  3.161   3.675   1.00 0.00 ? 539 CYS A SG   12 
ATOM   6822  H  H    . CYS A 1 11 ? -3.518  2.003   2.416   1.00 0.00 ? 539 CYS A H    12 
ATOM   6823  H  HA   . CYS A 1 11 ? -1.440  0.776   3.978   1.00 0.00 ? 539 CYS A HA   12 
ATOM   6824  H  HB2  . CYS A 1 11 ? -2.512  3.481   3.572   1.00 0.00 ? 539 CYS A HB2  12 
ATOM   6825  H  HB3  . CYS A 1 11 ? -1.968  3.167   5.217   1.00 0.00 ? 539 CYS A HB3  12 
ATOM   6826  N  N    . HIS A 1 12 ? -2.781  -0.179  5.830   1.00 0.00 ? 540 HIS A N    12 
ATOM   6827  C  CA   . HIS A 1 12 ? -3.470  -0.697  7.007   1.00 0.00 ? 540 HIS A CA   12 
ATOM   6828  C  C    . HIS A 1 12 ? -3.365  0.279   8.175   1.00 0.00 ? 540 HIS A C    12 
ATOM   6829  O  O    . HIS A 1 12 ? -4.268  0.366   9.007   1.00 0.00 ? 540 HIS A O    12 
ATOM   6830  C  CB   . HIS A 1 12 ? -2.887  -2.053  7.408   1.00 0.00 ? 540 HIS A CB   12 
ATOM   6831  C  CG   . HIS A 1 12 ? -3.483  -3.205  6.659   1.00 0.00 ? 540 HIS A CG   12 
ATOM   6832  N  ND1  . HIS A 1 12 ? -3.069  -3.604  5.407   1.00 0.00 ? 540 HIS A ND1  12 
ATOM   6833  C  CD2  . HIS A 1 12 ? -4.483  -4.053  7.010   1.00 0.00 ? 540 HIS A CD2  12 
ATOM   6834  C  CE1  . HIS A 1 12 ? -3.813  -4.657  5.044   1.00 0.00 ? 540 HIS A CE1  12 
ATOM   6835  N  NE2  . HIS A 1 12 ? -4.686  -4.970  5.982   1.00 0.00 ? 540 HIS A NE2  12 
ATOM   6836  H  H    . HIS A 1 12 ? -2.051  -0.700  5.436   1.00 0.00 ? 540 HIS A H    12 
ATOM   6837  H  HA   . HIS A 1 12 ? -4.511  -0.824  6.752   1.00 0.00 ? 540 HIS A HA   12 
ATOM   6838  H  HB2  . HIS A 1 12 ? -1.824  -2.050  7.220   1.00 0.00 ? 540 HIS A HB2  12 
ATOM   6839  H  HB3  . HIS A 1 12 ? -3.061  -2.215  8.461   1.00 0.00 ? 540 HIS A HB3  12 
ATOM   6840  H  HD1  . HIS A 1 12 ? -2.356  -3.190  4.876   1.00 0.00 ? 540 HIS A HD1  12 
ATOM   6841  H  HD2  . HIS A 1 12 ? -5.039  -4.029  7.936   1.00 0.00 ? 540 HIS A HD2  12 
ATOM   6842  H  HE1  . HIS A 1 12 ? -3.711  -5.182  4.106   1.00 0.00 ? 540 HIS A HE1  12 
ATOM   6843  N  N    . ILE A 1 13 ? -2.257  1.011   8.230   1.00 0.00 ? 541 ILE A N    12 
ATOM   6844  C  CA   . ILE A 1 13 ? -2.035  1.981   9.295   1.00 0.00 ? 541 ILE A CA   12 
ATOM   6845  C  C    . ILE A 1 13 ? -3.129  3.043   9.307   1.00 0.00 ? 541 ILE A C    12 
ATOM   6846  O  O    . ILE A 1 13 ? -3.282  3.802   8.349   1.00 0.00 ? 541 ILE A O    12 
ATOM   6847  C  CB   . ILE A 1 13 ? -0.664  2.672   9.150   1.00 0.00 ? 541 ILE A CB   12 
ATOM   6848  C  CG1  . ILE A 1 13 ? 0.444   1.630   8.975   1.00 0.00 ? 541 ILE A CG1  12 
ATOM   6849  C  CG2  . ILE A 1 13 ? -0.384  3.554   10.358  1.00 0.00 ? 541 ILE A CG2  12 
ATOM   6850  C  CD1  . ILE A 1 13 ? 1.424   1.970   7.874   1.00 0.00 ? 541 ILE A CD1  12 
ATOM   6851  H  H    . ILE A 1 13 ? -1.573  0.897   7.537   1.00 0.00 ? 541 ILE A H    12 
ATOM   6852  H  HA   . ILE A 1 13 ? -2.050  1.452   10.237  1.00 0.00 ? 541 ILE A HA   12 
ATOM   6853  H  HB   . ILE A 1 13 ? -0.696  3.303   8.275   1.00 0.00 ? 541 ILE A HB   12 
ATOM   6854  H  HG12 . ILE A 1 13 ? 0.999   1.546   9.897   1.00 0.00 ? 541 ILE A HG12 12 
ATOM   6855  H  HG13 . ILE A 1 13 ? -0.001  0.674   8.741   1.00 0.00 ? 541 ILE A HG13 12 
ATOM   6856  H  HG21 . ILE A 1 13 ? 0.255   3.025   11.050  1.00 0.00 ? 541 ILE A HG21 12 
ATOM   6857  H  HG22 . ILE A 1 13 ? -1.315  3.803   10.846  1.00 0.00 ? 541 ILE A HG22 12 
ATOM   6858  H  HG23 . ILE A 1 13 ? 0.106   4.461   10.036  1.00 0.00 ? 541 ILE A HG23 12 
ATOM   6859  H  HD11 . ILE A 1 13 ? 2.423   1.700   8.184   1.00 0.00 ? 541 ILE A HD11 12 
ATOM   6860  H  HD12 . ILE A 1 13 ? 1.385   3.030   7.672   1.00 0.00 ? 541 ILE A HD12 12 
ATOM   6861  H  HD13 . ILE A 1 13 ? 1.165   1.423   6.980   1.00 0.00 ? 541 ILE A HD13 12 
ATOM   6862  N  N    . GLN A 1 14 ? -3.889  3.091   10.396  1.00 0.00 ? 542 GLN A N    12 
ATOM   6863  C  CA   . GLN A 1 14 ? -4.971  4.060   10.532  1.00 0.00 ? 542 GLN A CA   12 
ATOM   6864  C  C    . GLN A 1 14 ? -4.440  5.487   10.422  1.00 0.00 ? 542 GLN A C    12 
ATOM   6865  O  O    . GLN A 1 14 ? -4.080  6.105   11.424  1.00 0.00 ? 542 GLN A O    12 
ATOM   6866  C  CB   . GLN A 1 14 ? -5.688  3.869   11.871  1.00 0.00 ? 542 GLN A CB   12 
ATOM   6867  C  CG   . GLN A 1 14 ? -7.051  3.209   11.741  1.00 0.00 ? 542 GLN A CG   12 
ATOM   6868  C  CD   . GLN A 1 14 ? -7.888  3.347   12.998  1.00 0.00 ? 542 GLN A CD   12 
ATOM   6869  O  OE1  . GLN A 1 14 ? -7.704  2.608   13.965  1.00 0.00 ? 542 GLN A OE1  12 
ATOM   6870  N  NE2  . GLN A 1 14 ? -8.815  4.298   12.991  1.00 0.00 ? 542 GLN A NE2  12 
ATOM   6871  H  H    . GLN A 1 14 ? -3.719  2.459   11.126  1.00 0.00 ? 542 GLN A H    12 
ATOM   6872  H  HA   . GLN A 1 14 ? -5.673  3.887   9.730   1.00 0.00 ? 542 GLN A HA   12 
ATOM   6873  H  HB2  . GLN A 1 14 ? -5.074  3.253   12.511  1.00 0.00 ? 542 GLN A HB2  12 
ATOM   6874  H  HB3  . GLN A 1 14 ? -5.823  4.834   12.338  1.00 0.00 ? 542 GLN A HB3  12 
ATOM   6875  H  HG2  . GLN A 1 14 ? -7.583  3.668   10.921  1.00 0.00 ? 542 GLN A HG2  12 
ATOM   6876  H  HG3  . GLN A 1 14 ? -6.910  2.158   11.534  1.00 0.00 ? 542 GLN A HG3  12 
ATOM   6877  H  HE21 . GLN A 1 14 ? -8.906  4.850   12.185  1.00 0.00 ? 542 GLN A HE21 12 
ATOM   6878  H  HE22 . GLN A 1 14 ? -9.371  4.409   13.790  1.00 0.00 ? 542 GLN A HE22 12 
ATOM   6879  N  N    . GLY A 1 15 ? -4.396  6.003   9.199   1.00 0.00 ? 543 GLY A N    12 
ATOM   6880  C  CA   . GLY A 1 15 ? -3.908  7.352   8.981   1.00 0.00 ? 543 GLY A CA   12 
ATOM   6881  C  C    . GLY A 1 15 ? -3.655  7.650   7.517   1.00 0.00 ? 543 GLY A C    12 
ATOM   6882  O  O    . GLY A 1 15 ? -4.082  8.685   7.004   1.00 0.00 ? 543 GLY A O    12 
ATOM   6883  H  H    . GLY A 1 15 ? -4.696  5.464   8.437   1.00 0.00 ? 543 GLY A H    12 
ATOM   6884  H  HA2  . GLY A 1 15 ? -4.639  8.052   9.358   1.00 0.00 ? 543 GLY A HA2  12 
ATOM   6885  H  HA3  . GLY A 1 15 ? -2.986  7.482   9.528   1.00 0.00 ? 543 GLY A HA3  12 
ATOM   6886  N  N    . CYS A 1 16 ? -2.957  6.742   6.842   1.00 0.00 ? 544 CYS A N    12 
ATOM   6887  C  CA   . CYS A 1 16 ? -2.647  6.915   5.428   1.00 0.00 ? 544 CYS A CA   12 
ATOM   6888  C  C    . CYS A 1 16 ? -3.766  6.359   4.552   1.00 0.00 ? 544 CYS A C    12 
ATOM   6889  O  O    . CYS A 1 16 ? -4.775  5.866   5.055   1.00 0.00 ? 544 CYS A O    12 
ATOM   6890  C  CB   . CYS A 1 16 ? -1.326  6.223   5.089   1.00 0.00 ? 544 CYS A CB   12 
ATOM   6891  S  SG   . CYS A 1 16 ? -0.272  7.157   3.955   1.00 0.00 ? 544 CYS A SG   12 
ATOM   6892  H  H    . CYS A 1 16 ? -2.643  5.938   7.305   1.00 0.00 ? 544 CYS A H    12 
ATOM   6893  H  HA   . CYS A 1 16 ? -2.548  7.973   5.237   1.00 0.00 ? 544 CYS A HA   12 
ATOM   6894  H  HB2  . CYS A 1 16 ? -0.767  6.064   5.999   1.00 0.00 ? 544 CYS A HB2  12 
ATOM   6895  H  HB3  . CYS A 1 16 ? -1.536  5.268   4.631   1.00 0.00 ? 544 CYS A HB3  12 
ATOM   6896  N  N    . GLY A 1 17 ? -3.578  6.444   3.239   1.00 0.00 ? 545 GLY A N    12 
ATOM   6897  C  CA   . GLY A 1 17 ? -4.579  5.946   2.313   1.00 0.00 ? 545 GLY A CA   12 
ATOM   6898  C  C    . GLY A 1 17 ? -4.324  6.397   0.888   1.00 0.00 ? 545 GLY A C    12 
ATOM   6899  O  O    . GLY A 1 17 ? -5.227  6.897   0.217   1.00 0.00 ? 545 GLY A O    12 
ATOM   6900  H  H    . GLY A 1 17 ? -2.754  6.847   2.896   1.00 0.00 ? 545 GLY A H    12 
ATOM   6901  H  HA2  . GLY A 1 17 ? -4.577  4.867   2.343   1.00 0.00 ? 545 GLY A HA2  12 
ATOM   6902  H  HA3  . GLY A 1 17 ? -5.550  6.303   2.623   1.00 0.00 ? 545 GLY A HA3  12 
ATOM   6903  N  N    . LYS A 1 18 ? -3.091  6.221   0.426   1.00 0.00 ? 546 LYS A N    12 
ATOM   6904  C  CA   . LYS A 1 18 ? -2.717  6.614   -0.929  1.00 0.00 ? 546 LYS A CA   12 
ATOM   6905  C  C    . LYS A 1 18 ? -3.171  5.571   -1.945  1.00 0.00 ? 546 LYS A C    12 
ATOM   6906  O  O    . LYS A 1 18 ? -3.563  5.906   -3.062  1.00 0.00 ? 546 LYS A O    12 
ATOM   6907  C  CB   . LYS A 1 18 ? -1.204  6.810   -1.028  1.00 0.00 ? 546 LYS A CB   12 
ATOM   6908  C  CG   . LYS A 1 18 ? -0.399  5.627   -0.512  1.00 0.00 ? 546 LYS A CG   12 
ATOM   6909  C  CD   . LYS A 1 18 ? 0.590   6.049   0.563   1.00 0.00 ? 546 LYS A CD   12 
ATOM   6910  C  CE   . LYS A 1 18 ? 1.588   7.069   0.037   1.00 0.00 ? 546 LYS A CE   12 
ATOM   6911  N  NZ   . LYS A 1 18 ? 1.599   8.310   0.861   1.00 0.00 ? 546 LYS A NZ   12 
ATOM   6912  H  H    . LYS A 1 18 ? -2.415  5.817   1.010   1.00 0.00 ? 546 LYS A H    12 
ATOM   6913  H  HA   . LYS A 1 18 ? -3.207  7.550   -1.149  1.00 0.00 ? 546 LYS A HA   12 
ATOM   6914  H  HB2  . LYS A 1 18 ? -0.942  6.970   -2.063  1.00 0.00 ? 546 LYS A HB2  12 
ATOM   6915  H  HB3  . LYS A 1 18 ? -0.928  7.683   -0.457  1.00 0.00 ? 546 LYS A HB3  12 
ATOM   6916  H  HG2  . LYS A 1 18 ? -1.076  4.896   -0.097  1.00 0.00 ? 546 LYS A HG2  12 
ATOM   6917  H  HG3  . LYS A 1 18 ? 0.145   5.188   -1.336  1.00 0.00 ? 546 LYS A HG3  12 
ATOM   6918  H  HD2  . LYS A 1 18 ? 0.046   6.485   1.387   1.00 0.00 ? 546 LYS A HD2  12 
ATOM   6919  H  HD3  . LYS A 1 18 ? 1.127   5.177   0.906   1.00 0.00 ? 546 LYS A HD3  12 
ATOM   6920  H  HE2  . LYS A 1 18 ? 2.574   6.630   0.052   1.00 0.00 ? 546 LYS A HE2  12 
ATOM   6921  H  HE3  . LYS A 1 18 ? 1.324   7.324   -0.979  1.00 0.00 ? 546 LYS A HE3  12 
ATOM   6922  H  HZ1  . LYS A 1 18 ? 2.524   8.780   0.786   1.00 0.00 ? 546 LYS A HZ1  12 
ATOM   6923  H  HZ2  . LYS A 1 18 ? 1.420   8.078   1.859   1.00 0.00 ? 546 LYS A HZ2  12 
ATOM   6924  H  HZ3  . LYS A 1 18 ? 0.861   8.965   0.531   1.00 0.00 ? 546 LYS A HZ3  12 
ATOM   6925  N  N    . VAL A 1 19 ? -3.115  4.305   -1.547  1.00 0.00 ? 547 VAL A N    12 
ATOM   6926  C  CA   . VAL A 1 19 ? -3.521  3.210   -2.416  1.00 0.00 ? 547 VAL A CA   12 
ATOM   6927  C  C    . VAL A 1 19 ? -2.727  3.223   -3.721  1.00 0.00 ? 547 VAL A C    12 
ATOM   6928  O  O    . VAL A 1 19 ? -3.159  3.802   -4.717  1.00 0.00 ? 547 VAL A O    12 
ATOM   6929  C  CB   . VAL A 1 19 ? -5.028  3.288   -2.724  1.00 0.00 ? 547 VAL A CB   12 
ATOM   6930  C  CG1  . VAL A 1 19 ? -5.425  2.280   -3.796  1.00 0.00 ? 547 VAL A CG1  12 
ATOM   6931  C  CG2  . VAL A 1 19 ? -5.840  3.071   -1.457  1.00 0.00 ? 547 VAL A CG2  12 
ATOM   6932  H  H    . VAL A 1 19 ? -2.798  4.104   -0.646  1.00 0.00 ? 547 VAL A H    12 
ATOM   6933  H  HA   . VAL A 1 19 ? -3.327  2.283   -1.897  1.00 0.00 ? 547 VAL A HA   12 
ATOM   6934  H  HB   . VAL A 1 19 ? -5.241  4.278   -3.093  1.00 0.00 ? 547 VAL A HB   12 
ATOM   6935  H  HG11 . VAL A 1 19 ? -4.876  1.362   -3.648  1.00 0.00 ? 547 VAL A HG11 12 
ATOM   6936  H  HG12 . VAL A 1 19 ? -5.196  2.683   -4.771  1.00 0.00 ? 547 VAL A HG12 12 
ATOM   6937  H  HG13 . VAL A 1 19 ? -6.484  2.081   -3.728  1.00 0.00 ? 547 VAL A HG13 12 
ATOM   6938  H  HG21 . VAL A 1 19 ? -6.068  4.026   -1.007  1.00 0.00 ? 547 VAL A HG21 12 
ATOM   6939  H  HG22 . VAL A 1 19 ? -5.270  2.473   -0.761  1.00 0.00 ? 547 VAL A HG22 12 
ATOM   6940  H  HG23 . VAL A 1 19 ? -6.760  2.559   -1.701  1.00 0.00 ? 547 VAL A HG23 12 
ATOM   6941  N  N    . TYR A 1 20 ? -1.564  2.578   -3.706  1.00 0.00 ? 548 TYR A N    12 
ATOM   6942  C  CA   . TYR A 1 20 ? -0.709  2.513   -4.885  1.00 0.00 ? 548 TYR A CA   12 
ATOM   6943  C  C    . TYR A 1 20 ? -0.879  1.180   -5.606  1.00 0.00 ? 548 TYR A C    12 
ATOM   6944  O  O    . TYR A 1 20 ? -1.261  0.179   -5.000  1.00 0.00 ? 548 TYR A O    12 
ATOM   6945  C  CB   . TYR A 1 20 ? 0.757   2.708   -4.492  1.00 0.00 ? 548 TYR A CB   12 
ATOM   6946  C  CG   . TYR A 1 20 ? 1.099   4.129   -4.105  1.00 0.00 ? 548 TYR A CG   12 
ATOM   6947  C  CD1  . TYR A 1 20 ? 0.623   5.205   -4.844  1.00 0.00 ? 548 TYR A CD1  12 
ATOM   6948  C  CD2  . TYR A 1 20 ? 1.898   4.394   -3.000  1.00 0.00 ? 548 TYR A CD2  12 
ATOM   6949  C  CE1  . TYR A 1 20 ? 0.934   6.505   -4.493  1.00 0.00 ? 548 TYR A CE1  12 
ATOM   6950  C  CE2  . TYR A 1 20 ? 2.214   5.691   -2.643  1.00 0.00 ? 548 TYR A CE2  12 
ATOM   6951  C  CZ   . TYR A 1 20 ? 1.729   6.742   -3.392  1.00 0.00 ? 548 TYR A CZ   12 
ATOM   6952  O  OH   . TYR A 1 20 ? 2.041   8.035   -3.039  1.00 0.00 ? 548 TYR A OH   12 
ATOM   6953  H  H    . TYR A 1 20 ? -1.274  2.135   -2.881  1.00 0.00 ? 548 TYR A H    12 
ATOM   6954  H  HA   . TYR A 1 20 ? -1.003  3.310   -5.552  1.00 0.00 ? 548 TYR A HA   12 
ATOM   6955  H  HB2  . TYR A 1 20 ? 0.984   2.072   -3.650  1.00 0.00 ? 548 TYR A HB2  12 
ATOM   6956  H  HB3  . TYR A 1 20 ? 1.385   2.430   -5.326  1.00 0.00 ? 548 TYR A HB3  12 
ATOM   6957  H  HD1  . TYR A 1 20 ? 0.000   5.016   -5.706  1.00 0.00 ? 548 TYR A HD1  12 
ATOM   6958  H  HD2  . TYR A 1 20 ? 2.277   3.568   -2.416  1.00 0.00 ? 548 TYR A HD2  12 
ATOM   6959  H  HE1  . TYR A 1 20 ? 0.555   7.328   -5.080  1.00 0.00 ? 548 TYR A HE1  12 
ATOM   6960  H  HE2  . TYR A 1 20 ? 2.837   5.877   -1.780  1.00 0.00 ? 548 TYR A HE2  12 
ATOM   6961  H  HH   . TYR A 1 20 ? 2.339   8.516   -3.815  1.00 0.00 ? 548 TYR A HH   12 
ATOM   6962  N  N    . GLY A 1 21 ? -0.592  1.174   -6.904  1.00 0.00 ? 549 GLY A N    12 
ATOM   6963  C  CA   . GLY A 1 21 ? -0.718  -0.042  -7.686  1.00 0.00 ? 549 GLY A CA   12 
ATOM   6964  C  C    . GLY A 1 21 ? 0.613   -0.733  -7.901  1.00 0.00 ? 549 GLY A C    12 
ATOM   6965  O  O    . GLY A 1 21 ? 0.837   -1.356  -8.939  1.00 0.00 ? 549 GLY A O    12 
ATOM   6966  H  H    . GLY A 1 21 ? -0.291  2.002   -7.334  1.00 0.00 ? 549 GLY A H    12 
ATOM   6967  H  HA2  . GLY A 1 21 ? -1.385  -0.719  -7.172  1.00 0.00 ? 549 GLY A HA2  12 
ATOM   6968  H  HA3  . GLY A 1 21 ? -1.143  0.205   -8.648  1.00 0.00 ? 549 GLY A HA3  12 
ATOM   6969  N  N    . LYS A 1 22 ? 1.500   -0.625  -6.917  1.00 0.00 ? 550 LYS A N    12 
ATOM   6970  C  CA   . LYS A 1 22 ? 2.818   -1.245  -7.003  1.00 0.00 ? 550 LYS A CA   12 
ATOM   6971  C  C    . LYS A 1 22 ? 3.322   -1.647  -5.621  1.00 0.00 ? 550 LYS A C    12 
ATOM   6972  O  O    . LYS A 1 22 ? 3.357   -0.831  -4.700  1.00 0.00 ? 550 LYS A O    12 
ATOM   6973  C  CB   . LYS A 1 22 ? 3.812   -0.288  -7.666  1.00 0.00 ? 550 LYS A CB   12 
ATOM   6974  C  CG   . LYS A 1 22 ? 4.759   -0.973  -8.637  1.00 0.00 ? 550 LYS A CG   12 
ATOM   6975  C  CD   . LYS A 1 22 ? 5.574   0.039   -9.426  1.00 0.00 ? 550 LYS A CD   12 
ATOM   6976  C  CE   . LYS A 1 22 ? 6.271   -0.609  -10.611 1.00 0.00 ? 550 LYS A CE   12 
ATOM   6977  N  NZ   . LYS A 1 22 ? 7.694   -0.930  -10.311 1.00 0.00 ? 550 LYS A NZ   12 
ATOM   6978  H  H    . LYS A 1 22 ? 1.264   -0.115  -6.114  1.00 0.00 ? 550 LYS A H    12 
ATOM   6979  H  HA   . LYS A 1 22 ? 2.726   -2.132  -7.612  1.00 0.00 ? 550 LYS A HA   12 
ATOM   6980  H  HB2  . LYS A 1 22 ? 3.261   0.467   -8.206  1.00 0.00 ? 550 LYS A HB2  12 
ATOM   6981  H  HB3  . LYS A 1 22 ? 4.401   0.189   -6.897  1.00 0.00 ? 550 LYS A HB3  12 
ATOM   6982  H  HG2  . LYS A 1 22 ? 5.433   -1.607  -8.081  1.00 0.00 ? 550 LYS A HG2  12 
ATOM   6983  H  HG3  . LYS A 1 22 ? 4.182   -1.573  -9.325  1.00 0.00 ? 550 LYS A HG3  12 
ATOM   6984  H  HD2  . LYS A 1 22 ? 4.915   0.813   -9.789  1.00 0.00 ? 550 LYS A HD2  12 
ATOM   6985  H  HD3  . LYS A 1 22 ? 6.318   0.474   -8.775  1.00 0.00 ? 550 LYS A HD3  12 
ATOM   6986  H  HE2  . LYS A 1 22 ? 5.752   -1.521  -10.864 1.00 0.00 ? 550 LYS A HE2  12 
ATOM   6987  H  HE3  . LYS A 1 22 ? 6.233   0.070   -11.450 1.00 0.00 ? 550 LYS A HE3  12 
ATOM   6988  H  HZ1  . LYS A 1 22 ? 7.973   -1.807  -10.796 1.00 0.00 ? 550 LYS A HZ1  12 
ATOM   6989  H  HZ2  . LYS A 1 22 ? 7.824   -1.056  -9.287  1.00 0.00 ? 550 LYS A HZ2  12 
ATOM   6990  H  HZ3  . LYS A 1 22 ? 8.311   -0.156  -10.634 1.00 0.00 ? 550 LYS A HZ3  12 
ATOM   6991  N  N    . THR A 1 23 ? 3.713   -2.910  -5.483  1.00 0.00 ? 551 THR A N    12 
ATOM   6992  C  CA   . THR A 1 23 ? 4.217   -3.421  -4.213  1.00 0.00 ? 551 THR A CA   12 
ATOM   6993  C  C    . THR A 1 23 ? 5.589   -2.837  -3.897  1.00 0.00 ? 551 THR A C    12 
ATOM   6994  O  O    . THR A 1 23 ? 5.919   -2.594  -2.736  1.00 0.00 ? 551 THR A O    12 
ATOM   6995  C  CB   . THR A 1 23 ? 4.296   -4.948  -4.248  1.00 0.00 ? 551 THR A CB   12 
ATOM   6996  O  OG1  . THR A 1 23 ? 5.418   -5.375  -5.000  1.00 0.00 ? 551 THR A OG1  12 
ATOM   6997  C  CG2  . THR A 1 23 ? 3.068   -5.599  -4.848  1.00 0.00 ? 551 THR A CG2  12 
ATOM   6998  H  H    . THR A 1 23 ? 3.662   -3.513  -6.254  1.00 0.00 ? 551 THR A H    12 
ATOM   6999  H  HA   . THR A 1 23 ? 3.526   -3.123  -3.438  1.00 0.00 ? 551 THR A HA   12 
ATOM   7000  H  HB   . THR A 1 23 ? 4.405   -5.316  -3.238  1.00 0.00 ? 551 THR A HB   12 
ATOM   7001  H  HG1  . THR A 1 23 ? 5.357   -5.025  -5.892  1.00 0.00 ? 551 THR A HG1  12 
ATOM   7002  H  HG21 . THR A 1 23 ? 2.721   -6.386  -4.195  1.00 0.00 ? 551 THR A HG21 12 
ATOM   7003  H  HG22 . THR A 1 23 ? 3.316   -6.015  -5.813  1.00 0.00 ? 551 THR A HG22 12 
ATOM   7004  H  HG23 . THR A 1 23 ? 2.289   -4.859  -4.965  1.00 0.00 ? 551 THR A HG23 12 
ATOM   7005  N  N    . SER A 1 24 ? 6.387   -2.611  -4.937  1.00 0.00 ? 552 SER A N    12 
ATOM   7006  C  CA   . SER A 1 24 ? 7.724   -2.053  -4.767  1.00 0.00 ? 552 SER A CA   12 
ATOM   7007  C  C    . SER A 1 24 ? 7.664   -0.716  -4.038  1.00 0.00 ? 552 SER A C    12 
ATOM   7008  O  O    . SER A 1 24 ? 8.580   -0.359  -3.297  1.00 0.00 ? 552 SER A O    12 
ATOM   7009  C  CB   . SER A 1 24 ? 8.403   -1.877  -6.127  1.00 0.00 ? 552 SER A CB   12 
ATOM   7010  O  OG   . SER A 1 24 ? 9.078   -3.061  -6.517  1.00 0.00 ? 552 SER A OG   12 
ATOM   7011  H  H    . SER A 1 24 ? 6.068   -2.824  -5.839  1.00 0.00 ? 552 SER A H    12 
ATOM   7012  H  HA   . SER A 1 24 ? 8.300   -2.748  -4.173  1.00 0.00 ? 552 SER A HA   12 
ATOM   7013  H  HB2  . SER A 1 24 ? 7.658   -1.641  -6.872  1.00 0.00 ? 552 SER A HB2  12 
ATOM   7014  H  HB3  . SER A 1 24 ? 9.120   -1.072  -6.067  1.00 0.00 ? 552 SER A HB3  12 
ATOM   7015  H  HG   . SER A 1 24 ? 9.704   -3.313  -5.834  1.00 0.00 ? 552 SER A HG   12 
ATOM   7016  N  N    . HIS A 1 25 ? 6.577   0.018   -4.247  1.00 0.00 ? 553 HIS A N    12 
ATOM   7017  C  CA   . HIS A 1 25 ? 6.394   1.313   -3.603  1.00 0.00 ? 553 HIS A CA   12 
ATOM   7018  C  C    . HIS A 1 25 ? 6.009   1.135   -2.138  1.00 0.00 ? 553 HIS A C    12 
ATOM   7019  O  O    . HIS A 1 25 ? 6.298   1.990   -1.301  1.00 0.00 ? 553 HIS A O    12 
ATOM   7020  C  CB   . HIS A 1 25 ? 5.321   2.124   -4.333  1.00 0.00 ? 553 HIS A CB   12 
ATOM   7021  C  CG   . HIS A 1 25 ? 5.880   3.120   -5.301  1.00 0.00 ? 553 HIS A CG   12 
ATOM   7022  N  ND1  . HIS A 1 25 ? 7.186   3.118   -5.736  1.00 0.00 ? 553 HIS A ND1  12 
ATOM   7023  C  CD2  . HIS A 1 25 ? 5.279   4.166   -5.924  1.00 0.00 ? 553 HIS A CD2  12 
ATOM   7024  C  CE1  . HIS A 1 25 ? 7.337   4.141   -6.589  1.00 0.00 ? 553 HIS A CE1  12 
ATOM   7025  N  NE2  . HIS A 1 25 ? 6.209   4.808   -6.738  1.00 0.00 ? 553 HIS A NE2  12 
ATOM   7026  H  H    . HIS A 1 25 ? 5.878   -0.322  -4.845  1.00 0.00 ? 553 HIS A H    12 
ATOM   7027  H  HA   . HIS A 1 25 ? 7.333   1.844   -3.654  1.00 0.00 ? 553 HIS A HA   12 
ATOM   7028  H  HB2  . HIS A 1 25 ? 4.682   1.449   -4.884  1.00 0.00 ? 553 HIS A HB2  12 
ATOM   7029  H  HB3  . HIS A 1 25 ? 4.728   2.661   -3.607  1.00 0.00 ? 553 HIS A HB3  12 
ATOM   7030  H  HD1  . HIS A 1 25 ? 7.883   2.482   -5.469  1.00 0.00 ? 553 HIS A HD1  12 
ATOM   7031  H  HD2  . HIS A 1 25 ? 4.247   4.463   -5.812  1.00 0.00 ? 553 HIS A HD2  12 
ATOM   7032  H  HE1  . HIS A 1 25 ? 8.262   4.386   -7.091  1.00 0.00 ? 553 HIS A HE1  12 
ATOM   7033  N  N    . LEU A 1 26 ? 5.354   0.018   -1.837  1.00 0.00 ? 554 LEU A N    12 
ATOM   7034  C  CA   . LEU A 1 26 ? 4.929   -0.274  -0.474  1.00 0.00 ? 554 LEU A CA   12 
ATOM   7035  C  C    . LEU A 1 26 ? 6.133   -0.427  0.451   1.00 0.00 ? 554 LEU A C    12 
ATOM   7036  O  O    . LEU A 1 26 ? 6.089   -0.026  1.614   1.00 0.00 ? 554 LEU A O    12 
ATOM   7037  C  CB   . LEU A 1 26 ? 4.081   -1.548  -0.445  1.00 0.00 ? 554 LEU A CB   12 
ATOM   7038  C  CG   . LEU A 1 26 ? 2.839   -1.479  0.444   1.00 0.00 ? 554 LEU A CG   12 
ATOM   7039  C  CD1  . LEU A 1 26 ? 1.912   -0.366  -0.021  1.00 0.00 ? 554 LEU A CD1  12 
ATOM   7040  C  CD2  . LEU A 1 26 ? 2.111   -2.815  0.447   1.00 0.00 ? 554 LEU A CD2  12 
ATOM   7041  H  H    . LEU A 1 26 ? 5.153   -0.625  -2.547  1.00 0.00 ? 554 LEU A H    12 
ATOM   7042  H  HA   . LEU A 1 26 ? 4.328   0.554   -0.130  1.00 0.00 ? 554 LEU A HA   12 
ATOM   7043  H  HB2  . LEU A 1 26 ? 3.764   -1.767  -1.455  1.00 0.00 ? 554 LEU A HB2  12 
ATOM   7044  H  HB3  . LEU A 1 26 ? 4.700   -2.361  -0.096  1.00 0.00 ? 554 LEU A HB3  12 
ATOM   7045  H  HG   . LEU A 1 26 ? 3.141   -1.259  1.458   1.00 0.00 ? 554 LEU A HG   12 
ATOM   7046  H  HD11 . LEU A 1 26 ? 1.768   -0.439  -1.088  1.00 0.00 ? 554 LEU A HD11 12 
ATOM   7047  H  HD12 . LEU A 1 26 ? 2.351   0.592   0.218   1.00 0.00 ? 554 LEU A HD12 12 
ATOM   7048  H  HD13 . LEU A 1 26 ? 0.959   -0.459  0.478   1.00 0.00 ? 554 LEU A HD13 12 
ATOM   7049  H  HD21 . LEU A 1 26 ? 2.630   -3.506  1.095   1.00 0.00 ? 554 LEU A HD21 12 
ATOM   7050  H  HD22 . LEU A 1 26 ? 2.085   -3.212  -0.556  1.00 0.00 ? 554 LEU A HD22 12 
ATOM   7051  H  HD23 . LEU A 1 26 ? 1.102   -2.674  0.806   1.00 0.00 ? 554 LEU A HD23 12 
ATOM   7052  N  N    . ARG A 1 27 ? 7.205   -1.011  -0.073  1.00 0.00 ? 555 ARG A N    12 
ATOM   7053  C  CA   . ARG A 1 27 ? 8.419   -1.219  0.706   1.00 0.00 ? 555 ARG A CA   12 
ATOM   7054  C  C    . ARG A 1 27 ? 9.067   0.116   1.071   1.00 0.00 ? 555 ARG A C    12 
ATOM   7055  O  O    . ARG A 1 27 ? 9.450   0.338   2.220   1.00 0.00 ? 555 ARG A O    12 
ATOM   7056  C  CB   . ARG A 1 27 ? 9.402   -2.111  -0.068  1.00 0.00 ? 555 ARG A CB   12 
ATOM   7057  C  CG   . ARG A 1 27 ? 10.444  -1.349  -0.876  1.00 0.00 ? 555 ARG A CG   12 
ATOM   7058  C  CD   . ARG A 1 27 ? 11.369  -2.294  -1.625  1.00 0.00 ? 555 ARG A CD   12 
ATOM   7059  N  NE   . ARG A 1 27 ? 12.412  -2.840  -0.759  1.00 0.00 ? 555 ARG A NE   12 
ATOM   7060  C  CZ   . ARG A 1 27 ? 13.534  -3.397  -1.211  1.00 0.00 ? 555 ARG A CZ   12 
ATOM   7061  N  NH1  . ARG A 1 27 ? 13.762  -3.485  -2.515  1.00 0.00 ? 555 ARG A NH1  12 
ATOM   7062  N  NH2  . ARG A 1 27 ? 14.431  -3.868  -0.355  1.00 0.00 ? 555 ARG A NH2  12 
ATOM   7063  H  H    . ARG A 1 27 ? 7.179   -1.312  -1.004  1.00 0.00 ? 555 ARG A H    12 
ATOM   7064  H  HA   . ARG A 1 27 ? 8.136   -1.723  1.617   1.00 0.00 ? 555 ARG A HA   12 
ATOM   7065  H  HB2  . ARG A 1 27 ? 9.922   -2.744  0.635   1.00 0.00 ? 555 ARG A HB2  12 
ATOM   7066  H  HB3  . ARG A 1 27 ? 8.840   -2.735  -0.749  1.00 0.00 ? 555 ARG A HB3  12 
ATOM   7067  H  HG2  . ARG A 1 27 ? 9.940   -0.715  -1.589  1.00 0.00 ? 555 ARG A HG2  12 
ATOM   7068  H  HG3  . ARG A 1 27 ? 11.032  -0.741  -0.203  1.00 0.00 ? 555 ARG A HG3  12 
ATOM   7069  H  HD2  . ARG A 1 27 ? 10.784  -3.110  -2.024  1.00 0.00 ? 555 ARG A HD2  12 
ATOM   7070  H  HD3  . ARG A 1 27 ? 11.834  -1.755  -2.437  1.00 0.00 ? 555 ARG A HD3  12 
ATOM   7071  H  HE   . ARG A 1 27 ? 12.270  -2.788  0.209   1.00 0.00 ? 555 ARG A HE   12 
ATOM   7072  H  HH11 . ARG A 1 27 ? 13.090  -3.131  -3.166  1.00 0.00 ? 555 ARG A HH11 12 
ATOM   7073  H  HH12 . ARG A 1 27 ? 14.606  -3.904  -2.848  1.00 0.00 ? 555 ARG A HH12 12 
ATOM   7074  H  HH21 . ARG A 1 27 ? 14.265  -3.804  0.629   1.00 0.00 ? 555 ARG A HH21 12 
ATOM   7075  H  HH22 . ARG A 1 27 ? 15.273  -4.287  -0.693  1.00 0.00 ? 555 ARG A HH22 12 
ATOM   7076  N  N    . ALA A 1 28 ? 9.187   1.000   0.085   1.00 0.00 ? 556 ALA A N    12 
ATOM   7077  C  CA   . ALA A 1 28 ? 9.788   2.308   0.300   1.00 0.00 ? 556 ALA A CA   12 
ATOM   7078  C  C    . ALA A 1 28 ? 8.892   3.188   1.163   1.00 0.00 ? 556 ALA A C    12 
ATOM   7079  O  O    . ALA A 1 28 ? 9.374   4.016   1.934   1.00 0.00 ? 556 ALA A O    12 
ATOM   7080  C  CB   . ALA A 1 28 ? 10.070  2.985   -1.033  1.00 0.00 ? 556 ALA A CB   12 
ATOM   7081  H  H    . ALA A 1 28 ? 8.865   0.766   -0.809  1.00 0.00 ? 556 ALA A H    12 
ATOM   7082  H  HA   . ALA A 1 28 ? 10.728  2.161   0.808   1.00 0.00 ? 556 ALA A HA   12 
ATOM   7083  H  HB1  . ALA A 1 28 ? 10.141  2.238   -1.809  1.00 0.00 ? 556 ALA A HB1  12 
ATOM   7084  H  HB2  . ALA A 1 28 ? 11.002  3.529   -0.970  1.00 0.00 ? 556 ALA A HB2  12 
ATOM   7085  H  HB3  . ALA A 1 28 ? 9.269   3.671   -1.265  1.00 0.00 ? 556 ALA A HB3  12 
ATOM   7086  N  N    . HIS A 1 29 ? 7.584   3.003   1.028   1.00 0.00 ? 557 HIS A N    12 
ATOM   7087  C  CA   . HIS A 1 29 ? 6.621   3.779   1.793   1.00 0.00 ? 557 HIS A CA   12 
ATOM   7088  C  C    . HIS A 1 29 ? 6.516   3.255   3.224   1.00 0.00 ? 557 HIS A C    12 
ATOM   7089  O  O    . HIS A 1 29 ? 6.369   4.030   4.169   1.00 0.00 ? 557 HIS A O    12 
ATOM   7090  C  CB   . HIS A 1 29 ? 5.249   3.740   1.114   1.00 0.00 ? 557 HIS A CB   12 
ATOM   7091  C  CG   . HIS A 1 29 ? 4.155   4.354   1.933   1.00 0.00 ? 557 HIS A CG   12 
ATOM   7092  N  ND1  . HIS A 1 29 ? 4.296   5.524   2.646   1.00 0.00 ? 557 HIS A ND1  12 
ATOM   7093  C  CD2  . HIS A 1 29 ? 2.885   3.932   2.152   1.00 0.00 ? 557 HIS A CD2  12 
ATOM   7094  C  CE1  . HIS A 1 29 ? 3.134   5.769   3.266   1.00 0.00 ? 557 HIS A CE1  12 
ATOM   7095  N  NE2  . HIS A 1 29 ? 2.244   4.832   2.998   1.00 0.00 ? 557 HIS A NE2  12 
ATOM   7096  H  H    . HIS A 1 29 ? 7.259   2.333   0.397   1.00 0.00 ? 557 HIS A H    12 
ATOM   7097  H  HA   . HIS A 1 29 ? 6.970   4.796   1.819   1.00 0.00 ? 557 HIS A HA   12 
ATOM   7098  H  HB2  . HIS A 1 29 ? 5.303   4.275   0.179   1.00 0.00 ? 557 HIS A HB2  12 
ATOM   7099  H  HB3  . HIS A 1 29 ? 4.981   2.711   0.919   1.00 0.00 ? 557 HIS A HB3  12 
ATOM   7100  H  HD1  . HIS A 1 29 ? 5.103   6.078   2.693   1.00 0.00 ? 557 HIS A HD1  12 
ATOM   7101  H  HD2  . HIS A 1 29 ? 2.433   3.041   1.742   1.00 0.00 ? 557 HIS A HD2  12 
ATOM   7102  H  HE1  . HIS A 1 29 ? 2.949   6.621   3.902   1.00 0.00 ? 557 HIS A HE1  12 
ATOM   7103  N  N    . LEU A 1 30 ? 6.588   1.937   3.373   1.00 0.00 ? 558 LEU A N    12 
ATOM   7104  C  CA   . LEU A 1 30 ? 6.497   1.310   4.687   1.00 0.00 ? 558 LEU A CA   12 
ATOM   7105  C  C    . LEU A 1 30 ? 7.601   1.812   5.612   1.00 0.00 ? 558 LEU A C    12 
ATOM   7106  O  O    . LEU A 1 30 ? 7.370   2.052   6.797   1.00 0.00 ? 558 LEU A O    12 
ATOM   7107  C  CB   . LEU A 1 30 ? 6.576   -0.213  4.555   1.00 0.00 ? 558 LEU A CB   12 
ATOM   7108  C  CG   . LEU A 1 30 ? 5.227   -0.934  4.539   1.00 0.00 ? 558 LEU A CG   12 
ATOM   7109  C  CD1  . LEU A 1 30 ? 5.417   -2.416  4.258   1.00 0.00 ? 558 LEU A CD1  12 
ATOM   7110  C  CD2  . LEU A 1 30 ? 4.499   -0.729  5.860   1.00 0.00 ? 558 LEU A CD2  12 
ATOM   7111  H  H    . LEU A 1 30 ? 6.703   1.371   2.581   1.00 0.00 ? 558 LEU A H    12 
ATOM   7112  H  HA   . LEU A 1 30 ? 5.540   1.575   5.113   1.00 0.00 ? 558 LEU A HA   12 
ATOM   7113  H  HB2  . LEU A 1 30 ? 7.097   -0.447  3.637   1.00 0.00 ? 558 LEU A HB2  12 
ATOM   7114  H  HB3  . LEU A 1 30 ? 7.153   -0.597  5.383   1.00 0.00 ? 558 LEU A HB3  12 
ATOM   7115  H  HG   . LEU A 1 30 ? 4.615   -0.520  3.751   1.00 0.00 ? 558 LEU A HG   12 
ATOM   7116  H  HD11 . LEU A 1 30 ? 5.798   -2.546  3.256   1.00 0.00 ? 558 LEU A HD11 12 
ATOM   7117  H  HD12 . LEU A 1 30 ? 4.469   -2.925  4.352   1.00 0.00 ? 558 LEU A HD12 12 
ATOM   7118  H  HD13 . LEU A 1 30 ? 6.119   -2.830  4.966   1.00 0.00 ? 558 LEU A HD13 12 
ATOM   7119  H  HD21 . LEU A 1 30 ? 3.443   -0.608  5.674   1.00 0.00 ? 558 LEU A HD21 12 
ATOM   7120  H  HD22 . LEU A 1 30 ? 4.882   0.154   6.349   1.00 0.00 ? 558 LEU A HD22 12 
ATOM   7121  H  HD23 . LEU A 1 30 ? 4.657   -1.589  6.494   1.00 0.00 ? 558 LEU A HD23 12 
ATOM   7122  N  N    . ARG A 1 31 ? 8.803   1.968   5.064   1.00 0.00 ? 559 ARG A N    12 
ATOM   7123  C  CA   . ARG A 1 31 ? 9.941   2.441   5.844   1.00 0.00 ? 559 ARG A CA   12 
ATOM   7124  C  C    . ARG A 1 31 ? 9.657   3.818   6.440   1.00 0.00 ? 559 ARG A C    12 
ATOM   7125  O  O    . ARG A 1 31 ? 10.169  4.161   7.506   1.00 0.00 ? 559 ARG A O    12 
ATOM   7126  C  CB   . ARG A 1 31 ? 11.202  2.487   4.976   1.00 0.00 ? 559 ARG A CB   12 
ATOM   7127  C  CG   . ARG A 1 31 ? 11.181  3.579   3.916   1.00 0.00 ? 559 ARG A CG   12 
ATOM   7128  C  CD   . ARG A 1 31 ? 12.322  4.567   4.108   1.00 0.00 ? 559 ARG A CD   12 
ATOM   7129  N  NE   . ARG A 1 31 ? 12.158  5.759   3.279   1.00 0.00 ? 559 ARG A NE   12 
ATOM   7130  C  CZ   . ARG A 1 31 ? 12.797  6.907   3.497   1.00 0.00 ? 559 ARG A CZ   12 
ATOM   7131  N  NH1  . ARG A 1 31 ? 13.642  7.021   4.514   1.00 0.00 ? 559 ARG A NH1  12 
ATOM   7132  N  NH2  . ARG A 1 31 ? 12.590  7.942   2.695   1.00 0.00 ? 559 ARG A NH2  12 
ATOM   7133  H  H    . ARG A 1 31 ? 8.927   1.760   4.115   1.00 0.00 ? 559 ARG A H    12 
ATOM   7134  H  HA   . ARG A 1 31 ? 10.098  1.741   6.652   1.00 0.00 ? 559 ARG A HA   12 
ATOM   7135  H  HB2  . ARG A 1 31 ? 12.057  2.650   5.614   1.00 0.00 ? 559 ARG A HB2  12 
ATOM   7136  H  HB3  . ARG A 1 31 ? 11.314  1.536   4.477   1.00 0.00 ? 559 ARG A HB3  12 
ATOM   7137  H  HG2  . ARG A 1 31 ? 11.274  3.123   2.942   1.00 0.00 ? 559 ARG A HG2  12 
ATOM   7138  H  HG3  . ARG A 1 31 ? 10.243  4.110   3.979   1.00 0.00 ? 559 ARG A HG3  12 
ATOM   7139  H  HD2  . ARG A 1 31 ? 12.354  4.863   5.145   1.00 0.00 ? 559 ARG A HD2  12 
ATOM   7140  H  HD3  . ARG A 1 31 ? 13.250  4.081   3.844   1.00 0.00 ? 559 ARG A HD3  12 
ATOM   7141  H  HE   . ARG A 1 31 ? 11.539  5.702   2.521   1.00 0.00 ? 559 ARG A HE   12 
ATOM   7142  H  HH11 . ARG A 1 31 ? 13.802  6.244   5.122   1.00 0.00 ? 559 ARG A HH11 12 
ATOM   7143  H  HH12 . ARG A 1 31 ? 14.119  7.886   4.672   1.00 0.00 ? 559 ARG A HH12 12 
ATOM   7144  H  HH21 . ARG A 1 31 ? 11.955  7.861   1.927   1.00 0.00 ? 559 ARG A HH21 12 
ATOM   7145  H  HH22 . ARG A 1 31 ? 13.070  8.805   2.859   1.00 0.00 ? 559 ARG A HH22 12 
ATOM   7146  N  N    . TRP A 1 32 ? 8.837   4.601   5.746   1.00 0.00 ? 560 TRP A N    12 
ATOM   7147  C  CA   . TRP A 1 32 ? 8.484   5.938   6.208   1.00 0.00 ? 560 TRP A CA   12 
ATOM   7148  C  C    . TRP A 1 32 ? 7.635   5.868   7.473   1.00 0.00 ? 560 TRP A C    12 
ATOM   7149  O  O    . TRP A 1 32 ? 7.882   6.590   8.439   1.00 0.00 ? 560 TRP A O    12 
ATOM   7150  C  CB   . TRP A 1 32 ? 7.729   6.695   5.112   1.00 0.00 ? 560 TRP A CB   12 
ATOM   7151  C  CG   . TRP A 1 32 ? 8.288   8.058   4.839   1.00 0.00 ? 560 TRP A CG   12 
ATOM   7152  C  CD1  . TRP A 1 32 ? 9.428   8.352   4.149   1.00 0.00 ? 560 TRP A CD1  12 
ATOM   7153  C  CD2  . TRP A 1 32 ? 7.732   9.311   5.251   1.00 0.00 ? 560 TRP A CD2  12 
ATOM   7154  N  NE1  . TRP A 1 32 ? 9.616   9.713   4.106   1.00 0.00 ? 560 TRP A NE1  12 
ATOM   7155  C  CE2  . TRP A 1 32 ? 8.588   10.323  4.776   1.00 0.00 ? 560 TRP A CE2  12 
ATOM   7156  C  CE3  . TRP A 1 32 ? 6.593   9.677   5.974   1.00 0.00 ? 560 TRP A CE3  12 
ATOM   7157  C  CZ2  . TRP A 1 32 ? 8.340   11.675  5.001   1.00 0.00 ? 560 TRP A CZ2  12 
ATOM   7158  C  CZ3  . TRP A 1 32 ? 6.348   11.019  6.198   1.00 0.00 ? 560 TRP A CZ3  12 
ATOM   7159  C  CH2  . TRP A 1 32 ? 7.218   12.004  5.712   1.00 0.00 ? 560 TRP A CH2  12 
ATOM   7160  H  H    . TRP A 1 32 ? 8.459   4.271   4.905   1.00 0.00 ? 560 TRP A H    12 
ATOM   7161  H  HA   . TRP A 1 32 ? 9.399   6.465   6.431   1.00 0.00 ? 560 TRP A HA   12 
ATOM   7162  H  HB2  . TRP A 1 32 ? 7.775   6.127   4.195   1.00 0.00 ? 560 TRP A HB2  12 
ATOM   7163  H  HB3  . TRP A 1 32 ? 6.696   6.810   5.407   1.00 0.00 ? 560 TRP A HB3  12 
ATOM   7164  H  HD1  . TRP A 1 32 ? 10.080  7.613   3.707   1.00 0.00 ? 560 TRP A HD1  12 
ATOM   7165  H  HE1  . TRP A 1 32 ? 10.363  10.171  3.668   1.00 0.00 ? 560 TRP A HE1  12 
ATOM   7166  H  HE3  . TRP A 1 32 ? 5.911   8.932   6.357   1.00 0.00 ? 560 TRP A HE3  12 
ATOM   7167  H  HZ2  . TRP A 1 32 ? 9.000   12.446  4.633   1.00 0.00 ? 560 TRP A HZ2  12 
ATOM   7168  H  HZ3  . TRP A 1 32 ? 5.474   11.320  6.755   1.00 0.00 ? 560 TRP A HZ3  12 
ATOM   7169  H  HH2  . TRP A 1 32 ? 6.988   13.040  5.911   1.00 0.00 ? 560 TRP A HH2  12 
ATOM   7170  N  N    . HIS A 1 33 ? 6.633   4.995   7.459   1.00 0.00 ? 561 HIS A N    12 
ATOM   7171  C  CA   . HIS A 1 33 ? 5.746   4.829   8.604   1.00 0.00 ? 561 HIS A CA   12 
ATOM   7172  C  C    . HIS A 1 33 ? 6.529   4.402   9.842   1.00 0.00 ? 561 HIS A C    12 
ATOM   7173  O  O    . HIS A 1 33 ? 6.332   4.943   10.930  1.00 0.00 ? 561 HIS A O    12 
ATOM   7174  C  CB   . HIS A 1 33 ? 4.663   3.796   8.290   1.00 0.00 ? 561 HIS A CB   12 
ATOM   7175  C  CG   . HIS A 1 33 ? 3.501   4.358   7.531   1.00 0.00 ? 561 HIS A CG   12 
ATOM   7176  N  ND1  . HIS A 1 33 ? 2.514   5.131   8.099   1.00 0.00 ? 561 HIS A ND1  12 
ATOM   7177  C  CD2  . HIS A 1 33 ? 3.179   4.246   6.216   1.00 0.00 ? 561 HIS A CD2  12 
ATOM   7178  C  CE1  . HIS A 1 33 ? 1.641   5.457   7.136   1.00 0.00 ? 561 HIS A CE1  12 
ATOM   7179  N  NE2  . HIS A 1 33 ? 1.999   4.945   5.974   1.00 0.00 ? 561 HIS A NE2  12 
ATOM   7180  H  H    . HIS A 1 33 ? 6.487   4.448   6.659   1.00 0.00 ? 561 HIS A H    12 
ATOM   7181  H  HA   . HIS A 1 33 ? 5.277   5.781   8.800   1.00 0.00 ? 561 HIS A HA   12 
ATOM   7182  H  HB2  . HIS A 1 33 ? 5.093   3.002   7.698   1.00 0.00 ? 561 HIS A HB2  12 
ATOM   7183  H  HB3  . HIS A 1 33 ? 4.288   3.385   9.216   1.00 0.00 ? 561 HIS A HB3  12 
ATOM   7184  H  HD1  . HIS A 1 33 ? 2.458   5.395   9.041   1.00 0.00 ? 561 HIS A HD1  12 
ATOM   7185  H  HD2  . HIS A 1 33 ? 3.741   3.705   5.469   1.00 0.00 ? 561 HIS A HD2  12 
ATOM   7186  H  HE1  . HIS A 1 33 ? 0.759   6.062   7.290   1.00 0.00 ? 561 HIS A HE1  12 
ATOM   7187  N  N    . THR A 1 34 ? 7.416   3.428   9.668   1.00 0.00 ? 562 THR A N    12 
ATOM   7188  C  CA   . THR A 1 34 ? 8.228   2.928   10.771  1.00 0.00 ? 562 THR A CA   12 
ATOM   7189  C  C    . THR A 1 34 ? 9.140   4.023   11.315  1.00 0.00 ? 562 THR A C    12 
ATOM   7190  O  O    . THR A 1 34 ? 10.031  4.506   10.617  1.00 0.00 ? 562 THR A O    12 
ATOM   7191  C  CB   . THR A 1 34 ? 9.065   1.732   10.314  1.00 0.00 ? 562 THR A CB   12 
ATOM   7192  O  OG1  . THR A 1 34 ? 10.034  2.132   9.361   1.00 0.00 ? 562 THR A OG1  12 
ATOM   7193  C  CG2  . THR A 1 34 ? 8.240   0.626   9.692   1.00 0.00 ? 562 THR A CG2  12 
ATOM   7194  H  H    . THR A 1 34 ? 7.527   3.036   8.776   1.00 0.00 ? 562 THR A H    12 
ATOM   7195  H  HA   . THR A 1 34 ? 7.560   2.609   11.556  1.00 0.00 ? 562 THR A HA   12 
ATOM   7196  H  HB   . THR A 1 34 ? 9.581   1.319   11.169  1.00 0.00 ? 562 THR A HB   12 
ATOM   7197  H  HG1  . THR A 1 34 ? 10.574  1.377   9.116   1.00 0.00 ? 562 THR A HG1  12 
ATOM   7198  H  HG21 . THR A 1 34 ? 8.663   0.355   8.736   1.00 0.00 ? 562 THR A HG21 12 
ATOM   7199  H  HG22 . THR A 1 34 ? 7.225   0.969   9.553   1.00 0.00 ? 562 THR A HG22 12 
ATOM   7200  H  HG23 . THR A 1 34 ? 8.242   -0.235  10.344  1.00 0.00 ? 562 THR A HG23 12 
ATOM   7201  N  N    . GLY A 1 35 ? 8.910   4.410   12.565  1.00 0.00 ? 563 GLY A N    12 
ATOM   7202  C  CA   . GLY A 1 35 ? 9.719   5.445   13.182  1.00 0.00 ? 563 GLY A CA   12 
ATOM   7203  C  C    . GLY A 1 35 ? 9.502   6.805   12.548  1.00 0.00 ? 563 GLY A C    12 
ATOM   7204  O  O    . GLY A 1 35 ? 10.079  7.110   11.504  1.00 0.00 ? 563 GLY A O    12 
ATOM   7205  H  H    . GLY A 1 35 ? 8.186   3.989   13.073  1.00 0.00 ? 563 GLY A H    12 
ATOM   7206  H  HA2  . GLY A 1 35 ? 9.469   5.505   14.231  1.00 0.00 ? 563 GLY A HA2  12 
ATOM   7207  H  HA3  . GLY A 1 35 ? 10.761  5.177   13.086  1.00 0.00 ? 563 GLY A HA3  12 
ATOM   7208  N  N    . GLU A 1 36 ? 8.669   7.624   13.180  1.00 0.00 ? 564 GLU A N    12 
ATOM   7209  C  CA   . GLU A 1 36 ? 8.377   8.960   12.672  1.00 0.00 ? 564 GLU A CA   12 
ATOM   7210  C  C    . GLU A 1 36 ? 7.783   9.841   13.766  1.00 0.00 ? 564 GLU A C    12 
ATOM   7211  O  O    . GLU A 1 36 ? 6.959   10.714  13.495  1.00 0.00 ? 564 GLU A O    12 
ATOM   7212  C  CB   . GLU A 1 36 ? 7.413   8.878   11.487  1.00 0.00 ? 564 GLU A CB   12 
ATOM   7213  C  CG   . GLU A 1 36 ? 6.183   8.026   11.761  1.00 0.00 ? 564 GLU A CG   12 
ATOM   7214  C  CD   . GLU A 1 36 ? 4.898   8.830   11.738  1.00 0.00 ? 564 GLU A CD   12 
ATOM   7215  O  OE1  . GLU A 1 36 ? 4.897   9.964   12.262  1.00 0.00 ? 564 GLU A OE1  12 
ATOM   7216  O  OE2  . GLU A 1 36 ? 3.891   8.326   11.197  1.00 0.00 ? 564 GLU A OE2  12 
ATOM   7217  H  H    . GLU A 1 36 ? 8.240   7.324   14.008  1.00 0.00 ? 564 GLU A H    12 
ATOM   7218  H  HA   . GLU A 1 36 ? 9.306   9.398   12.339  1.00 0.00 ? 564 GLU A HA   12 
ATOM   7219  H  HB2  . GLU A 1 36 ? 7.085   9.876   11.235  1.00 0.00 ? 564 GLU A HB2  12 
ATOM   7220  H  HB3  . GLU A 1 36 ? 7.935   8.457   10.641  1.00 0.00 ? 564 GLU A HB3  12 
ATOM   7221  H  HG2  . GLU A 1 36 ? 6.120   7.256   11.007  1.00 0.00 ? 564 GLU A HG2  12 
ATOM   7222  H  HG3  . GLU A 1 36 ? 6.288   7.569   12.734  1.00 0.00 ? 564 GLU A HG3  12 
ATOM   7223  N  N    . ARG A 1 37 ? 8.206   9.605   15.003  1.00 0.00 ? 565 ARG A N    12 
ATOM   7224  C  CA   . ARG A 1 37 ? 7.716   10.377  16.139  1.00 0.00 ? 565 ARG A CA   12 
ATOM   7225  C  C    . ARG A 1 37 ? 8.671   10.268  17.324  1.00 0.00 ? 565 ARG A C    12 
ATOM   7226  O  O    . ARG A 1 37 ? 8.815   9.153   17.867  1.00 0.00 ? 565 ARG A O    12 
ATOM   7227  C  CB   . ARG A 1 37 ? 6.323   9.894   16.547  1.00 0.00 ? 565 ARG A CB   12 
ATOM   7228  C  CG   . ARG A 1 37 ? 5.609   10.836  17.504  1.00 0.00 ? 565 ARG A CG   12 
ATOM   7229  C  CD   . ARG A 1 37 ? 4.221   11.201  17.001  1.00 0.00 ? 565 ARG A CD   12 
ATOM   7230  N  NE   . ARG A 1 37 ? 3.324   10.048  16.986  1.00 0.00 ? 565 ARG A NE   12 
ATOM   7231  C  CZ   . ARG A 1 37 ? 2.712   9.570   18.067  1.00 0.00 ? 565 ARG A CZ   12 
ATOM   7232  N  NH1  . ARG A 1 37 ? 2.899   10.140  19.251  1.00 0.00 ? 565 ARG A NH1  12 
ATOM   7233  N  NH2  . ARG A 1 37 ? 1.911   8.518   17.964  1.00 0.00 ? 565 ARG A NH2  12 
ATOM   7234  O  OXT  . ARG A 1 37 ? 9.268   11.300  17.698  1.00 0.00 ? 565 ARG A OXT  12 
ATOM   7235  H  H    . ARG A 1 37 ? 8.865   8.895   15.156  1.00 0.00 ? 565 ARG A H    12 
ATOM   7236  H  HA   . ARG A 1 37 ? 7.655   11.411  15.835  1.00 0.00 ? 565 ARG A HA   12 
ATOM   7237  H  HB2  . ARG A 1 37 ? 5.717   9.789   15.658  1.00 0.00 ? 565 ARG A HB2  12 
ATOM   7238  H  HB3  . ARG A 1 37 ? 6.414   8.930   17.025  1.00 0.00 ? 565 ARG A HB3  12 
ATOM   7239  H  HG2  . ARG A 1 37 ? 5.516   10.353  18.466  1.00 0.00 ? 565 ARG A HG2  12 
ATOM   7240  H  HG3  . ARG A 1 37 ? 6.194   11.738  17.608  1.00 0.00 ? 565 ARG A HG3  12 
ATOM   7241  H  HD2  . ARG A 1 37 ? 3.806   11.959  17.648  1.00 0.00 ? 565 ARG A HD2  12 
ATOM   7242  H  HD3  . ARG A 1 37 ? 4.308   11.592  15.998  1.00 0.00 ? 565 ARG A HD3  12 
ATOM   7243  H  HE   . ARG A 1 37 ? 3.169   9.607   16.124  1.00 0.00 ? 565 ARG A HE   12 
ATOM   7244  H  HH11 . ARG A 1 37 ? 3.502   10.934  19.335  1.00 0.00 ? 565 ARG A HH11 12 
ATOM   7245  H  HH12 . ARG A 1 37 ? 2.437   9.776   20.059  1.00 0.00 ? 565 ARG A HH12 12 
ATOM   7246  H  HH21 . ARG A 1 37 ? 1.767   8.084   17.075  1.00 0.00 ? 565 ARG A HH21 12 
ATOM   7247  H  HH22 . ARG A 1 37 ? 1.452   8.158   18.776  1.00 0.00 ? 565 ARG A HH22 12 
HETATM 7248  ZN ZN   . ZN  B 2 .  ? 0.800   5.141   4.364   1.00 0.00 ? 100 ZN  A ZN   12 
ATOM   7249  N  N    . MET A 1 1  ? -20.133 -8.938  -2.289  1.00 0.00 ? 1   MET A N    13 
ATOM   7250  C  CA   . MET A 1 1  ? -19.197 -9.841  -3.009  1.00 0.00 ? 1   MET A CA   13 
ATOM   7251  C  C    . MET A 1 1  ? -17.745 -9.461  -2.737  1.00 0.00 ? 1   MET A C    13 
ATOM   7252  O  O    . MET A 1 1  ? -17.420 -8.283  -2.583  1.00 0.00 ? 1   MET A O    13 
ATOM   7253  C  CB   . MET A 1 1  ? -19.493 -9.756  -4.507  1.00 0.00 ? 1   MET A CB   13 
ATOM   7254  C  CG   . MET A 1 1  ? -19.270 -8.371  -5.093  1.00 0.00 ? 1   MET A CG   13 
ATOM   7255  S  SD   . MET A 1 1  ? -18.566 -8.424  -6.752  1.00 0.00 ? 1   MET A SD   13 
ATOM   7256  C  CE   . MET A 1 1  ? -16.855 -8.020  -6.407  1.00 0.00 ? 1   MET A CE   13 
ATOM   7257  H  H1   . MET A 1 1  ? -19.816 -8.877  -1.300  1.00 0.00 ? 1   MET A H1   13 
ATOM   7258  H  H2   . MET A 1 1  ? -21.085 -9.353  -2.354  1.00 0.00 ? 1   MET A H2   13 
ATOM   7259  H  H3   . MET A 1 1  ? -20.095 -8.008  -2.751  1.00 0.00 ? 1   MET A H3   13 
ATOM   7260  H  HA   . MET A 1 1  ? -19.365 -10.852 -2.670  1.00 0.00 ? 1   MET A HA   13 
ATOM   7261  H  HB2  . MET A 1 1  ? -18.854 -10.452 -5.029  1.00 0.00 ? 1   MET A HB2  13 
ATOM   7262  H  HB3  . MET A 1 1  ? -20.524 -10.032 -4.675  1.00 0.00 ? 1   MET A HB3  13 
ATOM   7263  H  HG2  . MET A 1 1  ? -20.218 -7.857  -5.137  1.00 0.00 ? 1   MET A HG2  13 
ATOM   7264  H  HG3  . MET A 1 1  ? -18.596 -7.827  -4.448  1.00 0.00 ? 1   MET A HG3  13 
ATOM   7265  H  HE1  . MET A 1 1  ? -16.487 -7.340  -7.160  1.00 0.00 ? 1   MET A HE1  13 
ATOM   7266  H  HE2  . MET A 1 1  ? -16.263 -8.923  -6.417  1.00 0.00 ? 1   MET A HE2  13 
ATOM   7267  H  HE3  . MET A 1 1  ? -16.785 -7.555  -5.435  1.00 0.00 ? 1   MET A HE3  13 
ATOM   7268  N  N    . ASP A 1 2  ? -16.876 -10.465 -2.680  1.00 0.00 ? 530 ASP A N    13 
ATOM   7269  C  CA   . ASP A 1 2  ? -15.458 -10.235 -2.428  1.00 0.00 ? 530 ASP A CA   13 
ATOM   7270  C  C    . ASP A 1 2  ? -14.691 -10.075 -3.738  1.00 0.00 ? 530 ASP A C    13 
ATOM   7271  O  O    . ASP A 1 2  ? -15.180 -10.450 -4.803  1.00 0.00 ? 530 ASP A O    13 
ATOM   7272  C  CB   . ASP A 1 2  ? -14.870 -11.391 -1.616  1.00 0.00 ? 530 ASP A CB   13 
ATOM   7273  C  CG   . ASP A 1 2  ? -14.914 -11.129 -0.123  1.00 0.00 ? 530 ASP A CG   13 
ATOM   7274  O  OD1  . ASP A 1 2  ? -15.810 -10.383 0.323   1.00 0.00 ? 530 ASP A OD1  13 
ATOM   7275  O  OD2  . ASP A 1 2  ? -14.052 -11.671 0.600   1.00 0.00 ? 530 ASP A OD2  13 
ATOM   7276  H  H    . ASP A 1 2  ? -17.196 -11.382 -2.811  1.00 0.00 ? 530 ASP A H    13 
ATOM   7277  H  HA   . ASP A 1 2  ? -15.367 -9.323  -1.857  1.00 0.00 ? 530 ASP A HA   13 
ATOM   7278  H  HB2  . ASP A 1 2  ? -15.431 -12.290 -1.821  1.00 0.00 ? 530 ASP A HB2  13 
ATOM   7279  H  HB3  . ASP A 1 2  ? -13.840 -11.539 -1.907  1.00 0.00 ? 530 ASP A HB3  13 
ATOM   7280  N  N    . PRO A 1 3  ? -13.471 -9.513  -3.675  1.00 0.00 ? 531 PRO A N    13 
ATOM   7281  C  CA   . PRO A 1 3  ? -12.636 -9.305  -4.863  1.00 0.00 ? 531 PRO A CA   13 
ATOM   7282  C  C    . PRO A 1 3  ? -12.113 -10.616 -5.440  1.00 0.00 ? 531 PRO A C    13 
ATOM   7283  O  O    . PRO A 1 3  ? -12.132 -11.651 -4.773  1.00 0.00 ? 531 PRO A O    13 
ATOM   7284  C  CB   . PRO A 1 3  ? -11.479 -8.452  -4.340  1.00 0.00 ? 531 PRO A CB   13 
ATOM   7285  C  CG   . PRO A 1 3  ? -11.400 -8.770  -2.887  1.00 0.00 ? 531 PRO A CG   13 
ATOM   7286  C  CD   . PRO A 1 3  ? -12.812 -9.038  -2.445  1.00 0.00 ? 531 PRO A CD   13 
ATOM   7287  H  HA   . PRO A 1 3  ? -13.169 -8.763  -5.630  1.00 0.00 ? 531 PRO A HA   13 
ATOM   7288  H  HB2  . PRO A 1 3  ? -10.568 -8.721  -4.854  1.00 0.00 ? 531 PRO A HB2  13 
ATOM   7289  H  HB3  . PRO A 1 3  ? -11.696 -7.407  -4.503  1.00 0.00 ? 531 PRO A HB3  13 
ATOM   7290  H  HG2  . PRO A 1 3  ? -10.787 -9.647  -2.736  1.00 0.00 ? 531 PRO A HG2  13 
ATOM   7291  H  HG3  . PRO A 1 3  ? -10.992 -7.928  -2.348  1.00 0.00 ? 531 PRO A HG3  13 
ATOM   7292  H  HD2  . PRO A 1 3  ? -12.830 -9.800  -1.679  1.00 0.00 ? 531 PRO A HD2  13 
ATOM   7293  H  HD3  . PRO A 1 3  ? -13.274 -8.130  -2.086  1.00 0.00 ? 531 PRO A HD3  13 
ATOM   7294  N  N    . GLY A 1 4  ? -11.646 -10.565 -6.683  1.00 0.00 ? 532 GLY A N    13 
ATOM   7295  C  CA   . GLY A 1 4  ? -11.124 -11.755 -7.329  1.00 0.00 ? 532 GLY A CA   13 
ATOM   7296  C  C    . GLY A 1 4  ? -9.728  -11.550 -7.883  1.00 0.00 ? 532 GLY A C    13 
ATOM   7297  O  O    . GLY A 1 4  ? -8.755  -12.075 -7.343  1.00 0.00 ? 532 GLY A O    13 
ATOM   7298  H  H    . GLY A 1 4  ? -11.657 -9.713  -7.166  1.00 0.00 ? 532 GLY A H    13 
ATOM   7299  H  HA2  . GLY A 1 4  ? -11.099 -12.561 -6.610  1.00 0.00 ? 532 GLY A HA2  13 
ATOM   7300  H  HA3  . GLY A 1 4  ? -11.784 -12.030 -8.139  1.00 0.00 ? 532 GLY A HA3  13 
ATOM   7301  N  N    . LYS A 1 5  ? -9.630  -10.783 -8.964  1.00 0.00 ? 533 LYS A N    13 
ATOM   7302  C  CA   . LYS A 1 5  ? -8.342  -10.509 -9.592  1.00 0.00 ? 533 LYS A CA   13 
ATOM   7303  C  C    . LYS A 1 5  ? -8.185  -9.021  -9.886  1.00 0.00 ? 533 LYS A C    13 
ATOM   7304  O  O    . LYS A 1 5  ? -8.896  -8.465  -10.723 1.00 0.00 ? 533 LYS A O    13 
ATOM   7305  C  CB   . LYS A 1 5  ? -8.200  -11.314 -10.885 1.00 0.00 ? 533 LYS A CB   13 
ATOM   7306  C  CG   . LYS A 1 5  ? -6.787  -11.320 -11.445 1.00 0.00 ? 533 LYS A CG   13 
ATOM   7307  C  CD   . LYS A 1 5  ? -6.780  -11.621 -12.935 1.00 0.00 ? 533 LYS A CD   13 
ATOM   7308  C  CE   . LYS A 1 5  ? -5.591  -12.485 -13.323 1.00 0.00 ? 533 LYS A CE   13 
ATOM   7309  N  NZ   . LYS A 1 5  ? -5.718  -13.015 -14.709 1.00 0.00 ? 533 LYS A NZ   13 
ATOM   7310  H  H    . LYS A 1 5  ? -10.442 -10.392 -9.349  1.00 0.00 ? 533 LYS A H    13 
ATOM   7311  H  HA   . LYS A 1 5  ? -7.567  -10.812 -8.904  1.00 0.00 ? 533 LYS A HA   13 
ATOM   7312  H  HB2  . LYS A 1 5  ? -8.493  -12.336 -10.694 1.00 0.00 ? 533 LYS A HB2  13 
ATOM   7313  H  HB3  . LYS A 1 5  ? -8.858  -10.894 -11.631 1.00 0.00 ? 533 LYS A HB3  13 
ATOM   7314  H  HG2  . LYS A 1 5  ? -6.341  -10.350 -11.283 1.00 0.00 ? 533 LYS A HG2  13 
ATOM   7315  H  HG3  . LYS A 1 5  ? -6.210  -12.075 -10.932 1.00 0.00 ? 533 LYS A HG3  13 
ATOM   7316  H  HD2  . LYS A 1 5  ? -7.690  -12.143 -13.192 1.00 0.00 ? 533 LYS A HD2  13 
ATOM   7317  H  HD3  . LYS A 1 5  ? -6.730  -10.690 -13.481 1.00 0.00 ? 533 LYS A HD3  13 
ATOM   7318  H  HE2  . LYS A 1 5  ? -4.693  -11.890 -13.256 1.00 0.00 ? 533 LYS A HE2  13 
ATOM   7319  H  HE3  . LYS A 1 5  ? -5.525  -13.314 -12.634 1.00 0.00 ? 533 LYS A HE3  13 
ATOM   7320  H  HZ1  . LYS A 1 5  ? -6.115  -13.976 -14.689 1.00 0.00 ? 533 LYS A HZ1  13 
ATOM   7321  H  HZ2  . LYS A 1 5  ? -4.785  -13.048 -15.166 1.00 0.00 ? 533 LYS A HZ2  13 
ATOM   7322  H  HZ3  . LYS A 1 5  ? -6.345  -12.403 -15.270 1.00 0.00 ? 533 LYS A HZ3  13 
ATOM   7323  N  N    . LYS A 1 6  ? -7.250  -8.381  -9.192  1.00 0.00 ? 534 LYS A N    13 
ATOM   7324  C  CA   . LYS A 1 6  ? -6.999  -6.957  -9.379  1.00 0.00 ? 534 LYS A CA   13 
ATOM   7325  C  C    . LYS A 1 6  ? -5.526  -6.630  -9.149  1.00 0.00 ? 534 LYS A C    13 
ATOM   7326  O  O    . LYS A 1 6  ? -4.828  -7.342  -8.427  1.00 0.00 ? 534 LYS A O    13 
ATOM   7327  C  CB   . LYS A 1 6  ? -7.875  -6.135  -8.430  1.00 0.00 ? 534 LYS A CB   13 
ATOM   7328  C  CG   . LYS A 1 6  ? -8.685  -5.057  -9.131  1.00 0.00 ? 534 LYS A CG   13 
ATOM   7329  C  CD   . LYS A 1 6  ? -9.437  -4.188  -8.135  1.00 0.00 ? 534 LYS A CD   13 
ATOM   7330  C  CE   . LYS A 1 6  ? -10.635 -4.919  -7.549  1.00 0.00 ? 534 LYS A CE   13 
ATOM   7331  N  NZ   . LYS A 1 6  ? -10.427 -5.265  -6.115  1.00 0.00 ? 534 LYS A NZ   13 
ATOM   7332  H  H    . LYS A 1 6  ? -6.715  -8.879  -8.539  1.00 0.00 ? 534 LYS A H    13 
ATOM   7333  H  HA   . LYS A 1 6  ? -7.255  -6.707  -10.398 1.00 0.00 ? 534 LYS A HA   13 
ATOM   7334  H  HB2  . LYS A 1 6  ? -8.562  -6.800  -7.927  1.00 0.00 ? 534 LYS A HB2  13 
ATOM   7335  H  HB3  . LYS A 1 6  ? -7.244  -5.660  -7.694  1.00 0.00 ? 534 LYS A HB3  13 
ATOM   7336  H  HG2  . LYS A 1 6  ? -8.016  -4.433  -9.704  1.00 0.00 ? 534 LYS A HG2  13 
ATOM   7337  H  HG3  . LYS A 1 6  ? -9.396  -5.529  -9.793  1.00 0.00 ? 534 LYS A HG3  13 
ATOM   7338  H  HD2  . LYS A 1 6  ? -8.767  -3.915  -7.334  1.00 0.00 ? 534 LYS A HD2  13 
ATOM   7339  H  HD3  . LYS A 1 6  ? -9.781  -3.297  -8.639  1.00 0.00 ? 534 LYS A HD3  13 
ATOM   7340  H  HE2  . LYS A 1 6  ? -11.504 -4.284  -7.634  1.00 0.00 ? 534 LYS A HE2  13 
ATOM   7341  H  HE3  . LYS A 1 6  ? -10.798 -5.828  -8.110  1.00 0.00 ? 534 LYS A HE3  13 
ATOM   7342  H  HZ1  . LYS A 1 6  ? -9.410  -5.304  -5.901  1.00 0.00 ? 534 LYS A HZ1  13 
ATOM   7343  H  HZ2  . LYS A 1 6  ? -10.850 -6.191  -5.906  1.00 0.00 ? 534 LYS A HZ2  13 
ATOM   7344  H  HZ3  . LYS A 1 6  ? -10.872 -4.548  -5.507  1.00 0.00 ? 534 LYS A HZ3  13 
ATOM   7345  N  N    . LYS A 1 7  ? -5.062  -5.549  -9.766  1.00 0.00 ? 535 LYS A N    13 
ATOM   7346  C  CA   . LYS A 1 7  ? -3.672  -5.127  -9.628  1.00 0.00 ? 535 LYS A CA   13 
ATOM   7347  C  C    . LYS A 1 7  ? -3.585  -3.722  -9.042  1.00 0.00 ? 535 LYS A C    13 
ATOM   7348  O  O    . LYS A 1 7  ? -3.827  -2.733  -9.734  1.00 0.00 ? 535 LYS A O    13 
ATOM   7349  C  CB   . LYS A 1 7  ? -2.967  -5.172  -10.986 1.00 0.00 ? 535 LYS A CB   13 
ATOM   7350  C  CG   . LYS A 1 7  ? -2.253  -6.487  -11.257 1.00 0.00 ? 535 LYS A CG   13 
ATOM   7351  C  CD   . LYS A 1 7  ? -1.879  -6.626  -12.724 1.00 0.00 ? 535 LYS A CD   13 
ATOM   7352  C  CE   . LYS A 1 7  ? -2.852  -7.531  -13.463 1.00 0.00 ? 535 LYS A CE   13 
ATOM   7353  N  NZ   . LYS A 1 7  ? -2.202  -8.228  -14.607 1.00 0.00 ? 535 LYS A NZ   13 
ATOM   7354  H  H    . LYS A 1 7  ? -5.667  -5.022  -10.328 1.00 0.00 ? 535 LYS A H    13 
ATOM   7355  H  HA   . LYS A 1 7  ? -3.182  -5.816  -8.956  1.00 0.00 ? 535 LYS A HA   13 
ATOM   7356  H  HB2  . LYS A 1 7  ? -3.700  -5.018  -11.764 1.00 0.00 ? 535 LYS A HB2  13 
ATOM   7357  H  HB3  . LYS A 1 7  ? -2.238  -4.376  -11.027 1.00 0.00 ? 535 LYS A HB3  13 
ATOM   7358  H  HG2  . LYS A 1 7  ? -1.353  -6.525  -10.662 1.00 0.00 ? 535 LYS A HG2  13 
ATOM   7359  H  HG3  . LYS A 1 7  ? -2.905  -7.303  -10.981 1.00 0.00 ? 535 LYS A HG3  13 
ATOM   7360  H  HD2  . LYS A 1 7  ? -1.892  -5.649  -13.184 1.00 0.00 ? 535 LYS A HD2  13 
ATOM   7361  H  HD3  . LYS A 1 7  ? -0.886  -7.046  -12.794 1.00 0.00 ? 535 LYS A HD3  13 
ATOM   7362  H  HE2  . LYS A 1 7  ? -3.233  -8.269  -12.773 1.00 0.00 ? 535 LYS A HE2  13 
ATOM   7363  H  HE3  . LYS A 1 7  ? -3.669  -6.931  -13.835 1.00 0.00 ? 535 LYS A HE3  13 
ATOM   7364  H  HZ1  . LYS A 1 7  ? -1.742  -7.536  -15.233 1.00 0.00 ? 535 LYS A HZ1  13 
ATOM   7365  H  HZ2  . LYS A 1 7  ? -2.911  -8.755  -15.155 1.00 0.00 ? 535 LYS A HZ2  13 
ATOM   7366  H  HZ3  . LYS A 1 7  ? -1.484  -8.896  -14.258 1.00 0.00 ? 535 LYS A HZ3  13 
ATOM   7367  N  N    . GLN A 1 8  ? -3.236  -3.642  -7.762  1.00 0.00 ? 536 GLN A N    13 
ATOM   7368  C  CA   . GLN A 1 8  ? -3.116  -2.358  -7.081  1.00 0.00 ? 536 GLN A CA   13 
ATOM   7369  C  C    . GLN A 1 8  ? -2.537  -2.538  -5.680  1.00 0.00 ? 536 GLN A C    13 
ATOM   7370  O  O    . GLN A 1 8  ? -2.994  -3.385  -4.913  1.00 0.00 ? 536 GLN A O    13 
ATOM   7371  C  CB   . GLN A 1 8  ? -4.481  -1.669  -7.001  1.00 0.00 ? 536 GLN A CB   13 
ATOM   7372  C  CG   . GLN A 1 8  ? -4.611  -0.470  -7.927  1.00 0.00 ? 536 GLN A CG   13 
ATOM   7373  C  CD   . GLN A 1 8  ? -6.055  -0.130  -8.240  1.00 0.00 ? 536 GLN A CD   13 
ATOM   7374  O  OE1  . GLN A 1 8  ? -6.960  -0.437  -7.464  1.00 0.00 ? 536 GLN A OE1  13 
ATOM   7375  N  NE2  . GLN A 1 8  ? -6.278  0.509   -9.383  1.00 0.00 ? 536 GLN A NE2  13 
ATOM   7376  H  H    . GLN A 1 8  ? -3.056  -4.466  -7.263  1.00 0.00 ? 536 GLN A H    13 
ATOM   7377  H  HA   . GLN A 1 8  ? -2.444  -1.739  -7.657  1.00 0.00 ? 536 GLN A HA   13 
ATOM   7378  H  HB2  . GLN A 1 8  ? -5.247  -2.383  -7.263  1.00 0.00 ? 536 GLN A HB2  13 
ATOM   7379  H  HB3  . GLN A 1 8  ? -4.646  -1.333  -5.988  1.00 0.00 ? 536 GLN A HB3  13 
ATOM   7380  H  HG2  . GLN A 1 8  ? -4.150  0.385   -7.455  1.00 0.00 ? 536 GLN A HG2  13 
ATOM   7381  H  HG3  . GLN A 1 8  ? -4.099  -0.689  -8.852  1.00 0.00 ? 536 GLN A HG3  13 
ATOM   7382  H  HE21 . GLN A 1 8  ? -5.509  0.722   -9.951  1.00 0.00 ? 536 GLN A HE21 13 
ATOM   7383  H  HE22 . GLN A 1 8  ? -7.202  0.742   -9.610  1.00 0.00 ? 536 GLN A HE22 13 
ATOM   7384  N  N    . HIS A 1 9  ? -1.528  -1.737  -5.355  1.00 0.00 ? 537 HIS A N    13 
ATOM   7385  C  CA   . HIS A 1 9  ? -0.886  -1.808  -4.047  1.00 0.00 ? 537 HIS A CA   13 
ATOM   7386  C  C    . HIS A 1 9  ? -1.460  -0.760  -3.100  1.00 0.00 ? 537 HIS A C    13 
ATOM   7387  O  O    . HIS A 1 9  ? -1.153  0.427   -3.213  1.00 0.00 ? 537 HIS A O    13 
ATOM   7388  C  CB   . HIS A 1 9  ? 0.625   -1.613  -4.186  1.00 0.00 ? 537 HIS A CB   13 
ATOM   7389  C  CG   . HIS A 1 9  ? 1.289   -2.660  -5.026  1.00 0.00 ? 537 HIS A CG   13 
ATOM   7390  N  ND1  . HIS A 1 9  ? 0.685   -3.838  -5.404  1.00 0.00 ? 537 HIS A ND1  13 
ATOM   7391  C  CD2  . HIS A 1 9  ? 2.535   -2.688  -5.563  1.00 0.00 ? 537 HIS A CD2  13 
ATOM   7392  C  CE1  . HIS A 1 9  ? 1.563   -4.531  -6.143  1.00 0.00 ? 537 HIS A CE1  13 
ATOM   7393  N  NE2  . HIS A 1 9  ? 2.701   -3.876  -6.270  1.00 0.00 ? 537 HIS A NE2  13 
ATOM   7394  H  H    . HIS A 1 9  ? -1.207  -1.082  -6.009  1.00 0.00 ? 537 HIS A H    13 
ATOM   7395  H  HA   . HIS A 1 9  ? -1.077  -2.789  -3.638  1.00 0.00 ? 537 HIS A HA   13 
ATOM   7396  H  HB2  . HIS A 1 9  ? 0.816   -0.653  -4.641  1.00 0.00 ? 537 HIS A HB2  13 
ATOM   7397  H  HB3  . HIS A 1 9  ? 1.075   -1.637  -3.205  1.00 0.00 ? 537 HIS A HB3  13 
ATOM   7398  H  HD1  . HIS A 1 9  ? -0.224  -4.120  -5.174  1.00 0.00 ? 537 HIS A HD1  13 
ATOM   7399  H  HD2  . HIS A 1 9  ? 3.286   -1.917  -5.465  1.00 0.00 ? 537 HIS A HD2  13 
ATOM   7400  H  HE1  . HIS A 1 9  ? 1.364   -5.499  -6.579  1.00 0.00 ? 537 HIS A HE1  13 
ATOM   7401  N  N    . ILE A 1 10 ? -2.292  -1.206  -2.165  1.00 0.00 ? 538 ILE A N    13 
ATOM   7402  C  CA   . ILE A 1 10 ? -2.906  -0.307  -1.196  1.00 0.00 ? 538 ILE A CA   13 
ATOM   7403  C  C    . ILE A 1 10 ? -2.226  -0.420  0.164   1.00 0.00 ? 538 ILE A C    13 
ATOM   7404  O  O    . ILE A 1 10 ? -1.778  -1.497  0.557   1.00 0.00 ? 538 ILE A O    13 
ATOM   7405  C  CB   . ILE A 1 10 ? -4.410  -0.598  -1.031  1.00 0.00 ? 538 ILE A CB   13 
ATOM   7406  C  CG1  . ILE A 1 10 ? -5.091  -0.665  -2.400  1.00 0.00 ? 538 ILE A CG1  13 
ATOM   7407  C  CG2  . ILE A 1 10 ? -5.064  0.462   -0.156  1.00 0.00 ? 538 ILE A CG2  13 
ATOM   7408  C  CD1  . ILE A 1 10 ? -5.278  -2.075  -2.914  1.00 0.00 ? 538 ILE A CD1  13 
ATOM   7409  H  H    . ILE A 1 10 ? -2.496  -2.164  -2.124  1.00 0.00 ? 538 ILE A H    13 
ATOM   7410  H  HA   . ILE A 1 10 ? -2.794  0.704   -1.561  1.00 0.00 ? 538 ILE A HA   13 
ATOM   7411  H  HB   . ILE A 1 10 ? -4.517  -1.553  -0.538  1.00 0.00 ? 538 ILE A HB   13 
ATOM   7412  H  HG12 . ILE A 1 10 ? -6.066  -0.205  -2.333  1.00 0.00 ? 538 ILE A HG12 13 
ATOM   7413  H  HG13 . ILE A 1 10 ? -4.493  -0.125  -3.119  1.00 0.00 ? 538 ILE A HG13 13 
ATOM   7414  H  HG21 . ILE A 1 10 ? -4.442  1.344   -0.133  1.00 0.00 ? 538 ILE A HG21 13 
ATOM   7415  H  HG22 . ILE A 1 10 ? -5.181  0.078   0.847   1.00 0.00 ? 538 ILE A HG22 13 
ATOM   7416  H  HG23 . ILE A 1 10 ? -6.033  0.715   -0.560  1.00 0.00 ? 538 ILE A HG23 13 
ATOM   7417  H  HD11 . ILE A 1 10 ? -5.925  -2.621  -2.243  1.00 0.00 ? 538 ILE A HD11 13 
ATOM   7418  H  HD12 . ILE A 1 10 ? -4.319  -2.568  -2.969  1.00 0.00 ? 538 ILE A HD12 13 
ATOM   7419  H  HD13 . ILE A 1 10 ? -5.724  -2.044  -3.897  1.00 0.00 ? 538 ILE A HD13 13 
ATOM   7420  N  N    . CYS A 1 11 ? -2.151  0.698   0.879   1.00 0.00 ? 539 CYS A N    13 
ATOM   7421  C  CA   . CYS A 1 11 ? -1.524  0.722   2.195   1.00 0.00 ? 539 CYS A CA   13 
ATOM   7422  C  C    . CYS A 1 11 ? -2.267  -0.186  3.169   1.00 0.00 ? 539 CYS A C    13 
ATOM   7423  O  O    . CYS A 1 11 ? -3.287  0.201   3.738   1.00 0.00 ? 539 CYS A O    13 
ATOM   7424  C  CB   . CYS A 1 11 ? -1.485  2.151   2.742   1.00 0.00 ? 539 CYS A CB   13 
ATOM   7425  S  SG   . CYS A 1 11 ? 0.028   2.552   3.645   1.00 0.00 ? 539 CYS A SG   13 
ATOM   7426  H  H    . CYS A 1 11 ? -2.525  1.526   0.512   1.00 0.00 ? 539 CYS A H    13 
ATOM   7427  H  HA   . CYS A 1 11 ? -0.512  0.361   2.086   1.00 0.00 ? 539 CYS A HA   13 
ATOM   7428  H  HB2  . CYS A 1 11 ? -1.571  2.846   1.920   1.00 0.00 ? 539 CYS A HB2  13 
ATOM   7429  H  HB3  . CYS A 1 11 ? -2.318  2.293   3.416   1.00 0.00 ? 539 CYS A HB3  13 
ATOM   7430  N  N    . HIS A 1 12 ? -1.747  -1.395  3.358   1.00 0.00 ? 540 HIS A N    13 
ATOM   7431  C  CA   . HIS A 1 12 ? -2.360  -2.358  4.266   1.00 0.00 ? 540 HIS A CA   13 
ATOM   7432  C  C    . HIS A 1 12 ? -2.486  -1.775  5.671   1.00 0.00 ? 540 HIS A C    13 
ATOM   7433  O  O    . HIS A 1 12 ? -3.384  -2.143  6.428   1.00 0.00 ? 540 HIS A O    13 
ATOM   7434  C  CB   . HIS A 1 12 ? -1.538  -3.647  4.308   1.00 0.00 ? 540 HIS A CB   13 
ATOM   7435  C  CG   . HIS A 1 12 ? -1.901  -4.624  3.233   1.00 0.00 ? 540 HIS A CG   13 
ATOM   7436  N  ND1  . HIS A 1 12 ? -3.144  -5.205  3.111   1.00 0.00 ? 540 HIS A ND1  13 
ATOM   7437  C  CD2  . HIS A 1 12 ? -1.154  -5.122  2.215   1.00 0.00 ? 540 HIS A CD2  13 
ATOM   7438  C  CE1  . HIS A 1 12 ? -3.114  -6.020  2.048   1.00 0.00 ? 540 HIS A CE1  13 
ATOM   7439  N  NE2  . HIS A 1 12 ? -1.929  -6.005  1.468   1.00 0.00 ? 540 HIS A NE2  13 
ATOM   7440  H  H    . HIS A 1 12 ? -0.931  -1.645  2.877   1.00 0.00 ? 540 HIS A H    13 
ATOM   7441  H  HA   . HIS A 1 12 ? -3.348  -2.583  3.893   1.00 0.00 ? 540 HIS A HA   13 
ATOM   7442  H  HB2  . HIS A 1 12 ? -0.493  -3.403  4.195   1.00 0.00 ? 540 HIS A HB2  13 
ATOM   7443  H  HB3  . HIS A 1 12 ? -1.689  -4.131  5.263   1.00 0.00 ? 540 HIS A HB3  13 
ATOM   7444  H  HD1  . HIS A 1 12 ? -3.913  -5.051  3.699   1.00 0.00 ? 540 HIS A HD1  13 
ATOM   7445  H  HD2  . HIS A 1 12 ? -0.122  -4.879  2.008   1.00 0.00 ? 540 HIS A HD2  13 
ATOM   7446  H  HE1  . HIS A 1 12 ? -3.952  -6.611  1.708   1.00 0.00 ? 540 HIS A HE1  13 
ATOM   7447  N  N    . ILE A 1 13 ? -1.581  -0.863  6.010   1.00 0.00 ? 541 ILE A N    13 
ATOM   7448  C  CA   . ILE A 1 13 ? -1.590  -0.226  7.321   1.00 0.00 ? 541 ILE A CA   13 
ATOM   7449  C  C    . ILE A 1 13 ? -2.736  0.773   7.437   1.00 0.00 ? 541 ILE A C    13 
ATOM   7450  O  O    . ILE A 1 13 ? -3.164  1.362   6.444   1.00 0.00 ? 541 ILE A O    13 
ATOM   7451  C  CB   . ILE A 1 13 ? -0.259  0.500   7.601   1.00 0.00 ? 541 ILE A CB   13 
ATOM   7452  C  CG1  . ILE A 1 13 ? 0.917   -0.463  7.434   1.00 0.00 ? 541 ILE A CG1  13 
ATOM   7453  C  CG2  . ILE A 1 13 ? -0.263  1.101   8.999   1.00 0.00 ? 541 ILE A CG2  13 
ATOM   7454  C  CD1  . ILE A 1 13 ? 0.832   -1.682  8.326   1.00 0.00 ? 541 ILE A CD1  13 
ATOM   7455  H  H    . ILE A 1 13 ? -0.891  -0.610  5.362   1.00 0.00 ? 541 ILE A H    13 
ATOM   7456  H  HA   . ILE A 1 13 ? -1.720  -0.998  8.066   1.00 0.00 ? 541 ILE A HA   13 
ATOM   7457  H  HB   . ILE A 1 13 ? -0.159  1.306   6.890   1.00 0.00 ? 541 ILE A HB   13 
ATOM   7458  H  HG12 . ILE A 1 13 ? 0.953   -0.804  6.410   1.00 0.00 ? 541 ILE A HG12 13 
ATOM   7459  H  HG13 . ILE A 1 13 ? 1.834   0.058   7.667   1.00 0.00 ? 541 ILE A HG13 13 
ATOM   7460  H  HG21 . ILE A 1 13 ? 0.745   1.370   9.278   1.00 0.00 ? 541 ILE A HG21 13 
ATOM   7461  H  HG22 . ILE A 1 13 ? -0.649  0.377   9.701   1.00 0.00 ? 541 ILE A HG22 13 
ATOM   7462  H  HG23 . ILE A 1 13 ? -0.887  1.982   9.010   1.00 0.00 ? 541 ILE A HG23 13 
ATOM   7463  H  HD11 . ILE A 1 13 ? 1.769   -2.219  8.291   1.00 0.00 ? 541 ILE A HD11 13 
ATOM   7464  H  HD12 . ILE A 1 13 ? 0.035   -2.325  7.983   1.00 0.00 ? 541 ILE A HD12 13 
ATOM   7465  H  HD13 . ILE A 1 13 ? 0.633   -1.371  9.341   1.00 0.00 ? 541 ILE A HD13 13 
ATOM   7466  N  N    . GLN A 1 14 ? -3.228  0.959   8.657   1.00 0.00 ? 542 GLN A N    13 
ATOM   7467  C  CA   . GLN A 1 14 ? -4.321  1.885   8.907   1.00 0.00 ? 542 GLN A CA   13 
ATOM   7468  C  C    . GLN A 1 14 ? -3.806  3.318   9.014   1.00 0.00 ? 542 GLN A C    13 
ATOM   7469  O  O    . GLN A 1 14 ? -3.980  3.978   10.039  1.00 0.00 ? 542 GLN A O    13 
ATOM   7470  C  CB   . GLN A 1 14 ? -5.064  1.496   10.187  1.00 0.00 ? 542 GLN A CB   13 
ATOM   7471  C  CG   . GLN A 1 14 ? -6.239  0.562   9.948   1.00 0.00 ? 542 GLN A CG   13 
ATOM   7472  C  CD   . GLN A 1 14 ? -7.167  0.475   11.143  1.00 0.00 ? 542 GLN A CD   13 
ATOM   7473  O  OE1  . GLN A 1 14 ? -8.306  0.938   11.095  1.00 0.00 ? 542 GLN A OE1  13 
ATOM   7474  N  NE2  . GLN A 1 14 ? -6.682  -0.122  12.226  1.00 0.00 ? 542 GLN A NE2  13 
ATOM   7475  H  H    . GLN A 1 14 ? -2.847  0.463   9.405   1.00 0.00 ? 542 GLN A H    13 
ATOM   7476  H  HA   . GLN A 1 14 ? -4.999  1.819   8.075   1.00 0.00 ? 542 GLN A HA   13 
ATOM   7477  H  HB2  . GLN A 1 14 ? -4.372  1.005   10.856  1.00 0.00 ? 542 GLN A HB2  13 
ATOM   7478  H  HB3  . GLN A 1 14 ? -5.435  2.392   10.661  1.00 0.00 ? 542 GLN A HB3  13 
ATOM   7479  H  HG2  . GLN A 1 14 ? -6.802  0.922   9.100   1.00 0.00 ? 542 GLN A HG2  13 
ATOM   7480  H  HG3  . GLN A 1 14 ? -5.859  -0.426  9.732   1.00 0.00 ? 542 GLN A HG3  13 
ATOM   7481  H  HE21 . GLN A 1 14 ? -5.765  -0.467  12.193  1.00 0.00 ? 542 GLN A HE21 13 
ATOM   7482  H  HE22 . GLN A 1 14 ? -7.260  -0.192  13.014  1.00 0.00 ? 542 GLN A HE22 13 
ATOM   7483  N  N    . GLY A 1 15 ? -3.169  3.794   7.949   1.00 0.00 ? 543 GLY A N    13 
ATOM   7484  C  CA   . GLY A 1 15 ? -2.637  5.144   7.944   1.00 0.00 ? 543 GLY A CA   13 
ATOM   7485  C  C    . GLY A 1 15 ? -3.221  5.996   6.835   1.00 0.00 ? 543 GLY A C    13 
ATOM   7486  O  O    . GLY A 1 15 ? -4.125  6.798   7.070   1.00 0.00 ? 543 GLY A O    13 
ATOM   7487  H  H    . GLY A 1 15 ? -3.058  3.224   7.160   1.00 0.00 ? 543 GLY A H    13 
ATOM   7488  H  HA2  . GLY A 1 15 ? -2.857  5.610   8.894   1.00 0.00 ? 543 GLY A HA2  13 
ATOM   7489  H  HA3  . GLY A 1 15 ? -1.565  5.096   7.819   1.00 0.00 ? 543 GLY A HA3  13 
ATOM   7490  N  N    . CYS A 1 16 ? -2.703  5.824   5.623   1.00 0.00 ? 544 CYS A N    13 
ATOM   7491  C  CA   . CYS A 1 16 ? -3.179  6.585   4.474   1.00 0.00 ? 544 CYS A CA   13 
ATOM   7492  C  C    . CYS A 1 16 ? -3.820  5.666   3.437   1.00 0.00 ? 544 CYS A C    13 
ATOM   7493  O  O    . CYS A 1 16 ? -4.122  4.507   3.723   1.00 0.00 ? 544 CYS A O    13 
ATOM   7494  C  CB   . CYS A 1 16 ? -2.023  7.373   3.847   1.00 0.00 ? 544 CYS A CB   13 
ATOM   7495  S  SG   . CYS A 1 16 ? -0.842  6.363   2.920   1.00 0.00 ? 544 CYS A SG   13 
ATOM   7496  H  H    . CYS A 1 16 ? -1.984  5.170   5.499   1.00 0.00 ? 544 CYS A H    13 
ATOM   7497  H  HA   . CYS A 1 16 ? -3.925  7.282   4.826   1.00 0.00 ? 544 CYS A HA   13 
ATOM   7498  H  HB2  . CYS A 1 16 ? -2.427  8.108   3.167   1.00 0.00 ? 544 CYS A HB2  13 
ATOM   7499  H  HB3  . CYS A 1 16 ? -1.478  7.879   4.631   1.00 0.00 ? 544 CYS A HB3  13 
ATOM   7500  N  N    . GLY A 1 17 ? -4.024  6.190   2.232   1.00 0.00 ? 545 GLY A N    13 
ATOM   7501  C  CA   . GLY A 1 17 ? -4.627  5.402   1.174   1.00 0.00 ? 545 GLY A CA   13 
ATOM   7502  C  C    . GLY A 1 17 ? -4.326  5.956   -0.205  1.00 0.00 ? 545 GLY A C    13 
ATOM   7503  O  O    . GLY A 1 17 ? -5.237  6.324   -0.946  1.00 0.00 ? 545 GLY A O    13 
ATOM   7504  H  H    . GLY A 1 17 ? -3.763  7.119   2.061   1.00 0.00 ? 545 GLY A H    13 
ATOM   7505  H  HA2  . GLY A 1 17 ? -4.251  4.391   1.233   1.00 0.00 ? 545 GLY A HA2  13 
ATOM   7506  H  HA3  . GLY A 1 17 ? -5.698  5.385   1.317   1.00 0.00 ? 545 GLY A HA3  13 
ATOM   7507  N  N    . LYS A 1 18 ? -3.044  6.016   -0.549  1.00 0.00 ? 546 LYS A N    13 
ATOM   7508  C  CA   . LYS A 1 18 ? -2.624  6.531   -1.848  1.00 0.00 ? 546 LYS A CA   13 
ATOM   7509  C  C    . LYS A 1 18 ? -2.844  5.493   -2.944  1.00 0.00 ? 546 LYS A C    13 
ATOM   7510  O  O    . LYS A 1 18 ? -3.187  5.833   -4.076  1.00 0.00 ? 546 LYS A O    13 
ATOM   7511  C  CB   . LYS A 1 18 ? -1.151  6.941   -1.809  1.00 0.00 ? 546 LYS A CB   13 
ATOM   7512  C  CG   . LYS A 1 18 ? -0.237  5.881   -1.212  1.00 0.00 ? 546 LYS A CG   13 
ATOM   7513  C  CD   . LYS A 1 18 ? 0.479   6.393   0.027   1.00 0.00 ? 546 LYS A CD   13 
ATOM   7514  C  CE   . LYS A 1 18 ? 1.849   6.958   -0.315  1.00 0.00 ? 546 LYS A CE   13 
ATOM   7515  N  NZ   . LYS A 1 18 ? 1.795   8.421   -0.584  1.00 0.00 ? 546 LYS A NZ   13 
ATOM   7516  H  H    . LYS A 1 18 ? -2.364  5.708   0.086   1.00 0.00 ? 546 LYS A H    13 
ATOM   7517  H  HA   . LYS A 1 18 ? -3.224  7.401   -2.069  1.00 0.00 ? 546 LYS A HA   13 
ATOM   7518  H  HB2  . LYS A 1 18 ? -0.820  7.142   -2.817  1.00 0.00 ? 546 LYS A HB2  13 
ATOM   7519  H  HB3  . LYS A 1 18 ? -1.056  7.841   -1.221  1.00 0.00 ? 546 LYS A HB3  13 
ATOM   7520  H  HG2  . LYS A 1 18 ? -0.829  5.019   -0.942  1.00 0.00 ? 546 LYS A HG2  13 
ATOM   7521  H  HG3  . LYS A 1 18 ? 0.498   5.598   -1.951  1.00 0.00 ? 546 LYS A HG3  13 
ATOM   7522  H  HD2  . LYS A 1 18 ? -0.117  7.172   0.479   1.00 0.00 ? 546 LYS A HD2  13 
ATOM   7523  H  HD3  . LYS A 1 18 ? 0.599   5.578   0.725   1.00 0.00 ? 546 LYS A HD3  13 
ATOM   7524  H  HE2  . LYS A 1 18 ? 2.515   6.778   0.515   1.00 0.00 ? 546 LYS A HE2  13 
ATOM   7525  H  HE3  . LYS A 1 18 ? 2.223   6.452   -1.193  1.00 0.00 ? 546 LYS A HE3  13 
ATOM   7526  H  HZ1  . LYS A 1 18 ? 2.631   8.716   -1.127  1.00 0.00 ? 546 LYS A HZ1  13 
ATOM   7527  H  HZ2  . LYS A 1 18 ? 1.773   8.949   0.311   1.00 0.00 ? 546 LYS A HZ2  13 
ATOM   7528  H  HZ3  . LYS A 1 18 ? 0.940   8.653   -1.131  1.00 0.00 ? 546 LYS A HZ3  13 
ATOM   7529  N  N    . VAL A 1 19 ? -2.645  4.225   -2.598  1.00 0.00 ? 547 VAL A N    13 
ATOM   7530  C  CA   . VAL A 1 19 ? -2.823  3.134   -3.546  1.00 0.00 ? 547 VAL A CA   13 
ATOM   7531  C  C    . VAL A 1 19 ? -1.999  3.367   -4.812  1.00 0.00 ? 547 VAL A C    13 
ATOM   7532  O  O    . VAL A 1 19 ? -2.495  3.917   -5.795  1.00 0.00 ? 547 VAL A O    13 
ATOM   7533  C  CB   . VAL A 1 19 ? -4.308  2.969   -3.919  1.00 0.00 ? 547 VAL A CB   13 
ATOM   7534  C  CG1  . VAL A 1 19 ? -4.485  1.949   -5.036  1.00 0.00 ? 547 VAL A CG1  13 
ATOM   7535  C  CG2  . VAL A 1 19 ? -5.120  2.572   -2.695  1.00 0.00 ? 547 VAL A CG2  13 
ATOM   7536  H  H    . VAL A 1 19 ? -2.378  4.019   -1.682  1.00 0.00 ? 547 VAL A H    13 
ATOM   7537  H  HA   . VAL A 1 19 ? -2.488  2.223   -3.073  1.00 0.00 ? 547 VAL A HA   13 
ATOM   7538  H  HB   . VAL A 1 19 ? -4.672  3.922   -4.267  1.00 0.00 ? 547 VAL A HB   13 
ATOM   7539  H  HG11 . VAL A 1 19 ? -4.458  2.452   -5.991  1.00 0.00 ? 547 VAL A HG11 13 
ATOM   7540  H  HG12 . VAL A 1 19 ? -5.436  1.449   -4.919  1.00 0.00 ? 547 VAL A HG12 13 
ATOM   7541  H  HG13 . VAL A 1 19 ? -3.688  1.222   -4.989  1.00 0.00 ? 547 VAL A HG13 13 
ATOM   7542  H  HG21 . VAL A 1 19 ? -5.518  3.459   -2.224  1.00 0.00 ? 547 VAL A HG21 13 
ATOM   7543  H  HG22 . VAL A 1 19 ? -4.485  2.047   -1.997  1.00 0.00 ? 547 VAL A HG22 13 
ATOM   7544  H  HG23 . VAL A 1 19 ? -5.934  1.929   -2.996  1.00 0.00 ? 547 VAL A HG23 13 
ATOM   7545  N  N    . TYR A 1 20 ? -0.741  2.942   -4.779  1.00 0.00 ? 548 TYR A N    13 
ATOM   7546  C  CA   . TYR A 1 20 ? 0.151   3.102   -5.922  1.00 0.00 ? 548 TYR A CA   13 
ATOM   7547  C  C    . TYR A 1 20 ? 0.225   1.816   -6.739  1.00 0.00 ? 548 TYR A C    13 
ATOM   7548  O  O    . TYR A 1 20 ? -0.009  0.725   -6.219  1.00 0.00 ? 548 TYR A O    13 
ATOM   7549  C  CB   . TYR A 1 20 ? 1.551   3.500   -5.451  1.00 0.00 ? 548 TYR A CB   13 
ATOM   7550  C  CG   . TYR A 1 20 ? 1.706   4.983   -5.196  1.00 0.00 ? 548 TYR A CG   13 
ATOM   7551  C  CD1  . TYR A 1 20 ? 1.225   5.917   -6.105  1.00 0.00 ? 548 TYR A CD1  13 
ATOM   7552  C  CD2  . TYR A 1 20 ? 2.335   5.448   -4.048  1.00 0.00 ? 548 TYR A CD2  13 
ATOM   7553  C  CE1  . TYR A 1 20 ? 1.365   7.273   -5.876  1.00 0.00 ? 548 TYR A CE1  13 
ATOM   7554  C  CE2  . TYR A 1 20 ? 2.478   6.802   -3.812  1.00 0.00 ? 548 TYR A CE2  13 
ATOM   7555  C  CZ   . TYR A 1 20 ? 1.992   7.710   -4.729  1.00 0.00 ? 548 TYR A CZ   13 
ATOM   7556  O  OH   . TYR A 1 20 ? 2.134   9.059   -4.497  1.00 0.00 ? 548 TYR A OH   13 
ATOM   7557  H  H    . TYR A 1 20 ? -0.403  2.510   -3.967  1.00 0.00 ? 548 TYR A H    13 
ATOM   7558  H  HA   . TYR A 1 20 ? -0.246  3.888   -6.545  1.00 0.00 ? 548 TYR A HA   13 
ATOM   7559  H  HB2  . TYR A 1 20 ? 1.775   2.982   -4.530  1.00 0.00 ? 548 TYR A HB2  13 
ATOM   7560  H  HB3  . TYR A 1 20 ? 2.271   3.215   -6.203  1.00 0.00 ? 548 TYR A HB3  13 
ATOM   7561  H  HD1  . TYR A 1 20 ? 0.733   5.572   -7.002  1.00 0.00 ? 548 TYR A HD1  13 
ATOM   7562  H  HD2  . TYR A 1 20 ? 2.714   4.734   -3.332  1.00 0.00 ? 548 TYR A HD2  13 
ATOM   7563  H  HE1  . TYR A 1 20 ? 0.984   7.984   -6.594  1.00 0.00 ? 548 TYR A HE1  13 
ATOM   7564  H  HE2  . TYR A 1 20 ? 2.970   7.144   -2.913  1.00 0.00 ? 548 TYR A HE2  13 
ATOM   7565  H  HH   . TYR A 1 20 ? 1.279   9.489   -4.575  1.00 0.00 ? 548 TYR A HH   13 
ATOM   7566  N  N    . GLY A 1 21 ? 0.551   1.952   -8.020  1.00 0.00 ? 549 GLY A N    13 
ATOM   7567  C  CA   . GLY A 1 21 ? 0.650   0.793   -8.887  1.00 0.00 ? 549 GLY A CA   13 
ATOM   7568  C  C    . GLY A 1 21 ? 2.076   0.301   -9.039  1.00 0.00 ? 549 GLY A C    13 
ATOM   7569  O  O    . GLY A 1 21 ? 2.433   -0.279  -10.064 1.00 0.00 ? 549 GLY A O    13 
ATOM   7570  H  H    . GLY A 1 21 ? 0.727   2.847   -8.379  1.00 0.00 ? 549 GLY A H    13 
ATOM   7571  H  HA2  . GLY A 1 21 ? 0.048   -0.003  -8.475  1.00 0.00 ? 549 GLY A HA2  13 
ATOM   7572  H  HA3  . GLY A 1 21 ? 0.265   1.054   -9.862  1.00 0.00 ? 549 GLY A HA3  13 
ATOM   7573  N  N    . LYS A 1 22 ? 2.892   0.533   -8.016  1.00 0.00 ? 550 LYS A N    13 
ATOM   7574  C  CA   . LYS A 1 22 ? 4.287   0.110   -8.040  1.00 0.00 ? 550 LYS A CA   13 
ATOM   7575  C  C    . LYS A 1 22 ? 4.759   -0.287  -6.645  1.00 0.00 ? 550 LYS A C    13 
ATOM   7576  O  O    . LYS A 1 22 ? 4.608   0.473   -5.688  1.00 0.00 ? 550 LYS A O    13 
ATOM   7577  C  CB   . LYS A 1 22 ? 5.172   1.229   -8.593  1.00 0.00 ? 550 LYS A CB   13 
ATOM   7578  C  CG   . LYS A 1 22 ? 6.248   0.737   -9.548  1.00 0.00 ? 550 LYS A CG   13 
ATOM   7579  C  CD   . LYS A 1 22 ? 5.684   0.475   -10.935 1.00 0.00 ? 550 LYS A CD   13 
ATOM   7580  C  CE   . LYS A 1 22 ? 6.628   -0.376  -11.769 1.00 0.00 ? 550 LYS A CE   13 
ATOM   7581  N  NZ   . LYS A 1 22 ? 6.226   -1.810  -11.773 1.00 0.00 ? 550 LYS A NZ   13 
ATOM   7582  H  H    . LYS A 1 22 ? 2.548   1.000   -7.226  1.00 0.00 ? 550 LYS A H    13 
ATOM   7583  H  HA   . LYS A 1 22 ? 4.361   -0.750  -8.690  1.00 0.00 ? 550 LYS A HA   13 
ATOM   7584  H  HB2  . LYS A 1 22 ? 4.550   1.937   -9.120  1.00 0.00 ? 550 LYS A HB2  13 
ATOM   7585  H  HB3  . LYS A 1 22 ? 5.656   1.732   -7.769  1.00 0.00 ? 550 LYS A HB3  13 
ATOM   7586  H  HG2  . LYS A 1 22 ? 7.021   1.487   -9.621  1.00 0.00 ? 550 LYS A HG2  13 
ATOM   7587  H  HG3  . LYS A 1 22 ? 6.668   -0.179  -9.161  1.00 0.00 ? 550 LYS A HG3  13 
ATOM   7588  H  HD2  . LYS A 1 22 ? 4.741   -0.041  -10.838 1.00 0.00 ? 550 LYS A HD2  13 
ATOM   7589  H  HD3  . LYS A 1 22 ? 5.529   1.421   -11.434 1.00 0.00 ? 550 LYS A HD3  13 
ATOM   7590  H  HE2  . LYS A 1 22 ? 6.623   -0.007  -12.784 1.00 0.00 ? 550 LYS A HE2  13 
ATOM   7591  H  HE3  . LYS A 1 22 ? 7.624   -0.291  -11.361 1.00 0.00 ? 550 LYS A HE3  13 
ATOM   7592  H  HZ1  . LYS A 1 22 ? 5.918   -2.097  -10.822 1.00 0.00 ? 550 LYS A HZ1  13 
ATOM   7593  H  HZ2  . LYS A 1 22 ? 7.028   -2.405  -12.060 1.00 0.00 ? 550 LYS A HZ2  13 
ATOM   7594  H  HZ3  . LYS A 1 22 ? 5.442   -1.959  -12.440 1.00 0.00 ? 550 LYS A HZ3  13 
ATOM   7595  N  N    . THR A 1 23 ? 5.330   -1.482  -6.536  1.00 0.00 ? 551 THR A N    13 
ATOM   7596  C  CA   . THR A 1 23 ? 5.824   -1.981  -5.257  1.00 0.00 ? 551 THR A CA   13 
ATOM   7597  C  C    . THR A 1 23 ? 7.060   -1.206  -4.812  1.00 0.00 ? 551 THR A C    13 
ATOM   7598  O  O    . THR A 1 23 ? 7.281   -1.006  -3.617  1.00 0.00 ? 551 THR A O    13 
ATOM   7599  C  CB   . THR A 1 23 ? 6.152   -3.471  -5.359  1.00 0.00 ? 551 THR A CB   13 
ATOM   7600  O  OG1  . THR A 1 23 ? 6.585   -3.976  -4.108  1.00 0.00 ? 551 THR A OG1  13 
ATOM   7601  C  CG2  . THR A 1 23 ? 7.229   -3.779  -6.376  1.00 0.00 ? 551 THR A CG2  13 
ATOM   7602  H  H    . THR A 1 23 ? 5.422   -2.043  -7.335  1.00 0.00 ? 551 THR A H    13 
ATOM   7603  H  HA   . THR A 1 23 ? 5.044   -1.842  -4.524  1.00 0.00 ? 551 THR A HA   13 
ATOM   7604  H  HB   . THR A 1 23 ? 5.259   -4.006  -5.650  1.00 0.00 ? 551 THR A HB   13 
ATOM   7605  H  HG1  . THR A 1 23 ? 6.585   -4.935  -4.133  1.00 0.00 ? 551 THR A HG1  13 
ATOM   7606  H  HG21 . THR A 1 23 ? 6.958   -3.349  -7.329  1.00 0.00 ? 551 THR A HG21 13 
ATOM   7607  H  HG22 . THR A 1 23 ? 7.331   -4.849  -6.480  1.00 0.00 ? 551 THR A HG22 13 
ATOM   7608  H  HG23 . THR A 1 23 ? 8.167   -3.359  -6.046  1.00 0.00 ? 551 THR A HG23 13 
ATOM   7609  N  N    . SER A 1 24 ? 7.862   -0.772  -5.779  1.00 0.00 ? 552 SER A N    13 
ATOM   7610  C  CA   . SER A 1 24 ? 9.075   -0.018  -5.484  1.00 0.00 ? 552 SER A CA   13 
ATOM   7611  C  C    . SER A 1 24 ? 8.750   1.248   -4.699  1.00 0.00 ? 552 SER A C    13 
ATOM   7612  O  O    . SER A 1 24 ? 9.534   1.688   -3.859  1.00 0.00 ? 552 SER A O    13 
ATOM   7613  C  CB   . SER A 1 24 ? 9.804   0.344   -6.779  1.00 0.00 ? 552 SER A CB   13 
ATOM   7614  O  OG   . SER A 1 24 ? 10.120  -0.816  -7.529  1.00 0.00 ? 552 SER A OG   13 
ATOM   7615  H  H    . SER A 1 24 ? 7.632   -0.962  -6.712  1.00 0.00 ? 552 SER A H    13 
ATOM   7616  H  HA   . SER A 1 24 ? 9.717   -0.644  -4.883  1.00 0.00 ? 552 SER A HA   13 
ATOM   7617  H  HB2  . SER A 1 24 ? 9.172   0.983   -7.379  1.00 0.00 ? 552 SER A HB2  13 
ATOM   7618  H  HB3  . SER A 1 24 ? 10.719  0.865   -6.541  1.00 0.00 ? 552 SER A HB3  13 
ATOM   7619  H  HG   . SER A 1 24 ? 11.073  -0.888  -7.621  1.00 0.00 ? 552 SER A HG   13 
ATOM   7620  N  N    . HIS A 1 25 ? 7.586   1.827   -4.975  1.00 0.00 ? 553 HIS A N    13 
ATOM   7621  C  CA   . HIS A 1 25 ? 7.156   3.040   -4.290  1.00 0.00 ? 553 HIS A CA   13 
ATOM   7622  C  C    . HIS A 1 25 ? 6.676   2.722   -2.877  1.00 0.00 ? 553 HIS A C    13 
ATOM   7623  O  O    . HIS A 1 25 ? 6.779   3.552   -1.974  1.00 0.00 ? 553 HIS A O    13 
ATOM   7624  C  CB   . HIS A 1 25 ? 6.042   3.731   -5.079  1.00 0.00 ? 553 HIS A CB   13 
ATOM   7625  C  CG   . HIS A 1 25 ? 6.526   4.860   -5.935  1.00 0.00 ? 553 HIS A CG   13 
ATOM   7626  N  ND1  . HIS A 1 25 ? 7.567   5.692   -5.590  1.00 0.00 ? 553 HIS A ND1  13 
ATOM   7627  C  CD2  . HIS A 1 25 ? 6.089   5.288   -7.146  1.00 0.00 ? 553 HIS A CD2  13 
ATOM   7628  C  CE1  . HIS A 1 25 ? 7.728   6.582   -6.579  1.00 0.00 ? 553 HIS A CE1  13 
ATOM   7629  N  NE2  . HIS A 1 25 ? 6.856   6.379   -7.548  1.00 0.00 ? 553 HIS A NE2  13 
ATOM   7630  H  H    . HIS A 1 25 ? 7.002   1.428   -5.653  1.00 0.00 ? 553 HIS A H    13 
ATOM   7631  H  HA   . HIS A 1 25 ? 8.006   3.704   -4.226  1.00 0.00 ? 553 HIS A HA   13 
ATOM   7632  H  HB2  . HIS A 1 25 ? 5.565   3.007   -5.723  1.00 0.00 ? 553 HIS A HB2  13 
ATOM   7633  H  HB3  . HIS A 1 25 ? 5.311   4.126   -4.388  1.00 0.00 ? 553 HIS A HB3  13 
ATOM   7634  H  HD1  . HIS A 1 25 ? 8.097   5.644   -4.767  1.00 0.00 ? 553 HIS A HD1  13 
ATOM   7635  H  HD2  . HIS A 1 25 ? 5.278   4.860   -7.716  1.00 0.00 ? 553 HIS A HD2  13 
ATOM   7636  H  HE1  . HIS A 1 25 ? 8.474   7.362   -6.584  1.00 0.00 ? 553 HIS A HE1  13 
ATOM   7637  N  N    . LEU A 1 26 ? 6.152   1.514   -2.695  1.00 0.00 ? 554 LEU A N    13 
ATOM   7638  C  CA   . LEU A 1 26 ? 5.656   1.085   -1.393  1.00 0.00 ? 554 LEU A CA   13 
ATOM   7639  C  C    . LEU A 1 26 ? 6.778   1.076   -0.359  1.00 0.00 ? 554 LEU A C    13 
ATOM   7640  O  O    . LEU A 1 26 ? 6.557   1.379   0.813   1.00 0.00 ? 554 LEU A O    13 
ATOM   7641  C  CB   . LEU A 1 26 ? 5.026   -0.307  -1.499  1.00 0.00 ? 554 LEU A CB   13 
ATOM   7642  C  CG   . LEU A 1 26 ? 3.551   -0.380  -1.102  1.00 0.00 ? 554 LEU A CG   13 
ATOM   7643  C  CD1  . LEU A 1 26 ? 2.734   0.630   -1.893  1.00 0.00 ? 554 LEU A CD1  13 
ATOM   7644  C  CD2  . LEU A 1 26 ? 3.012   -1.787  -1.313  1.00 0.00 ? 554 LEU A CD2  13 
ATOM   7645  H  H    . LEU A 1 26 ? 6.098   0.897   -3.454  1.00 0.00 ? 554 LEU A H    13 
ATOM   7646  H  HA   . LEU A 1 26 ? 4.900   1.788   -1.080  1.00 0.00 ? 554 LEU A HA   13 
ATOM   7647  H  HB2  . LEU A 1 26 ? 5.119   -0.643  -2.522  1.00 0.00 ? 554 LEU A HB2  13 
ATOM   7648  H  HB3  . LEU A 1 26 ? 5.580   -0.983  -0.865  1.00 0.00 ? 554 LEU A HB3  13 
ATOM   7649  H  HG   . LEU A 1 26 ? 3.455   -0.138  -0.053  1.00 0.00 ? 554 LEU A HG   13 
ATOM   7650  H  HD11 . LEU A 1 26 ? 2.980   0.550   -2.941  1.00 0.00 ? 554 LEU A HD11 13 
ATOM   7651  H  HD12 . LEU A 1 26 ? 2.961   1.627   -1.546  1.00 0.00 ? 554 LEU A HD12 13 
ATOM   7652  H  HD13 . LEU A 1 26 ? 1.682   0.431   -1.754  1.00 0.00 ? 554 LEU A HD13 13 
ATOM   7653  H  HD21 . LEU A 1 26 ? 3.341   -2.423  -0.505  1.00 0.00 ? 554 LEU A HD21 13 
ATOM   7654  H  HD22 . LEU A 1 26 ? 3.380   -2.176  -2.251  1.00 0.00 ? 554 LEU A HD22 13 
ATOM   7655  H  HD23 . LEU A 1 26 ? 1.933   -1.760  -1.333  1.00 0.00 ? 554 LEU A HD23 13 
ATOM   7656  N  N    . ARG A 1 27 ? 7.982   0.724   -0.801  1.00 0.00 ? 555 ARG A N    13 
ATOM   7657  C  CA   . ARG A 1 27 ? 9.136   0.675   0.088   1.00 0.00 ? 555 ARG A CA   13 
ATOM   7658  C  C    . ARG A 1 27 ? 9.454   2.063   0.641   1.00 0.00 ? 555 ARG A C    13 
ATOM   7659  O  O    . ARG A 1 27 ? 9.680   2.228   1.840   1.00 0.00 ? 555 ARG A O    13 
ATOM   7660  C  CB   . ARG A 1 27 ? 10.351  0.089   -0.647  1.00 0.00 ? 555 ARG A CB   13 
ATOM   7661  C  CG   . ARG A 1 27 ? 11.267  1.131   -1.277  1.00 0.00 ? 555 ARG A CG   13 
ATOM   7662  C  CD   . ARG A 1 27 ? 12.431  0.481   -2.008  1.00 0.00 ? 555 ARG A CD   13 
ATOM   7663  N  NE   . ARG A 1 27 ? 12.954  1.334   -3.072  1.00 0.00 ? 555 ARG A NE   13 
ATOM   7664  C  CZ   . ARG A 1 27 ? 14.161  1.189   -3.613  1.00 0.00 ? 555 ARG A CZ   13 
ATOM   7665  N  NH1  . ARG A 1 27 ? 14.973  0.226   -3.194  1.00 0.00 ? 555 ARG A NH1  13 
ATOM   7666  N  NH2  . ARG A 1 27 ? 14.558  2.010   -4.576  1.00 0.00 ? 555 ARG A NH2  13 
ATOM   7667  H  H    . ARG A 1 27 ? 8.097   0.492   -1.745  1.00 0.00 ? 555 ARG A H    13 
ATOM   7668  H  HA   . ARG A 1 27 ? 8.883   0.026   0.913   1.00 0.00 ? 555 ARG A HA   13 
ATOM   7669  H  HB2  . ARG A 1 27 ? 10.934  -0.489  0.053   1.00 0.00 ? 555 ARG A HB2  13 
ATOM   7670  H  HB3  . ARG A 1 27 ? 9.998   -0.566  -1.431  1.00 0.00 ? 555 ARG A HB3  13 
ATOM   7671  H  HG2  . ARG A 1 27 ? 10.697  1.719   -1.980  1.00 0.00 ? 555 ARG A HG2  13 
ATOM   7672  H  HG3  . ARG A 1 27 ? 11.654  1.772   -0.499  1.00 0.00 ? 555 ARG A HG3  13 
ATOM   7673  H  HD2  . ARG A 1 27 ? 13.220  0.284   -1.298  1.00 0.00 ? 555 ARG A HD2  13 
ATOM   7674  H  HD3  . ARG A 1 27 ? 12.094  -0.451  -2.438  1.00 0.00 ? 555 ARG A HD3  13 
ATOM   7675  H  HE   . ARG A 1 27 ? 12.375  2.053   -3.401  1.00 0.00 ? 555 ARG A HE   13 
ATOM   7676  H  HH11 . ARG A 1 27 ? 14.680  -0.396  -2.469  1.00 0.00 ? 555 ARG A HH11 13 
ATOM   7677  H  HH12 . ARG A 1 27 ? 15.879  0.123   -3.605  1.00 0.00 ? 555 ARG A HH12 13 
ATOM   7678  H  HH21 . ARG A 1 27 ? 13.951  2.737   -4.896  1.00 0.00 ? 555 ARG A HH21 13 
ATOM   7679  H  HH22 . ARG A 1 27 ? 15.465  1.902   -4.983  1.00 0.00 ? 555 ARG A HH22 13 
ATOM   7680  N  N    . ALA A 1 28 ? 9.470   3.057   -0.242  1.00 0.00 ? 556 ALA A N    13 
ATOM   7681  C  CA   . ALA A 1 28 ? 9.760   4.428   0.156   1.00 0.00 ? 556 ALA A CA   13 
ATOM   7682  C  C    . ALA A 1 28 ? 8.676   4.970   1.080   1.00 0.00 ? 556 ALA A C    13 
ATOM   7683  O  O    . ALA A 1 28 ? 8.958   5.723   2.012   1.00 0.00 ? 556 ALA A O    13 
ATOM   7684  C  CB   . ALA A 1 28 ? 9.901   5.315   -1.072  1.00 0.00 ? 556 ALA A CB   13 
ATOM   7685  H  H    . ALA A 1 28 ? 9.283   2.864   -1.183  1.00 0.00 ? 556 ALA A H    13 
ATOM   7686  H  HA   . ALA A 1 28 ? 10.703  4.429   0.682   1.00 0.00 ? 556 ALA A HA   13 
ATOM   7687  H  HB1  . ALA A 1 28 ? 9.157   5.037   -1.804  1.00 0.00 ? 556 ALA A HB1  13 
ATOM   7688  H  HB2  . ALA A 1 28 ? 10.886  5.190   -1.496  1.00 0.00 ? 556 ALA A HB2  13 
ATOM   7689  H  HB3  . ALA A 1 28 ? 9.759   6.347   -0.789  1.00 0.00 ? 556 ALA A HB3  13 
ATOM   7690  N  N    . HIS A 1 29 ? 7.434   4.581   0.815   1.00 0.00 ? 557 HIS A N    13 
ATOM   7691  C  CA   . HIS A 1 29 ? 6.305   5.025   1.618   1.00 0.00 ? 557 HIS A CA   13 
ATOM   7692  C  C    . HIS A 1 29 ? 6.293   4.324   2.975   1.00 0.00 ? 557 HIS A C    13 
ATOM   7693  O  O    . HIS A 1 29 ? 5.995   4.938   3.999   1.00 0.00 ? 557 HIS A O    13 
ATOM   7694  C  CB   . HIS A 1 29 ? 4.992   4.762   0.874   1.00 0.00 ? 557 HIS A CB   13 
ATOM   7695  C  CG   . HIS A 1 29 ? 3.769   4.979   1.712   1.00 0.00 ? 557 HIS A CG   13 
ATOM   7696  N  ND1  . HIS A 1 29 ? 3.614   6.031   2.586   1.00 0.00 ? 557 HIS A ND1  13 
ATOM   7697  C  CD2  . HIS A 1 29 ? 2.631   4.245   1.804   1.00 0.00 ? 557 HIS A CD2  13 
ATOM   7698  C  CE1  . HIS A 1 29 ? 2.416   5.907   3.171   1.00 0.00 ? 557 HIS A CE1  13 
ATOM   7699  N  NE2  . HIS A 1 29 ? 1.779   4.839   2.731   1.00 0.00 ? 557 HIS A NE2  13 
ATOM   7700  H  H    . HIS A 1 29 ? 7.273   3.984   0.059   1.00 0.00 ? 557 HIS A H    13 
ATOM   7701  H  HA   . HIS A 1 29 ? 6.412   6.085   1.775   1.00 0.00 ? 557 HIS A HA   13 
ATOM   7702  H  HB2  . HIS A 1 29 ? 4.931   5.422   0.023   1.00 0.00 ? 557 HIS A HB2  13 
ATOM   7703  H  HB3  . HIS A 1 29 ? 4.982   3.738   0.530   1.00 0.00 ? 557 HIS A HB3  13 
ATOM   7704  H  HD1  . HIS A 1 29 ? 4.266   6.745   2.751   1.00 0.00 ? 557 HIS A HD1  13 
ATOM   7705  H  HD2  . HIS A 1 29 ? 2.411   3.343   1.252   1.00 0.00 ? 557 HIS A HD2  13 
ATOM   7706  H  HE1  . HIS A 1 29 ? 2.022   6.591   3.908   1.00 0.00 ? 557 HIS A HE1  13 
ATOM   7707  N  N    . LEU A 1 30 ? 6.613   3.034   2.972   1.00 0.00 ? 558 LEU A N    13 
ATOM   7708  C  CA   . LEU A 1 30 ? 6.633   2.249   4.202   1.00 0.00 ? 558 LEU A CA   13 
ATOM   7709  C  C    . LEU A 1 30 ? 7.631   2.824   5.203   1.00 0.00 ? 558 LEU A C    13 
ATOM   7710  O  O    . LEU A 1 30 ? 7.320   2.978   6.384   1.00 0.00 ? 558 LEU A O    13 
ATOM   7711  C  CB   . LEU A 1 30 ? 6.982   0.791   3.895   1.00 0.00 ? 558 LEU A CB   13 
ATOM   7712  C  CG   . LEU A 1 30 ? 5.785   -0.110  3.590   1.00 0.00 ? 558 LEU A CG   13 
ATOM   7713  C  CD1  . LEU A 1 30 ? 6.241   -1.391  2.909   1.00 0.00 ? 558 LEU A CD1  13 
ATOM   7714  C  CD2  . LEU A 1 30 ? 5.018   -0.425  4.865   1.00 0.00 ? 558 LEU A CD2  13 
ATOM   7715  H  H    . LEU A 1 30 ? 6.839   2.598   2.123   1.00 0.00 ? 558 LEU A H    13 
ATOM   7716  H  HA   . LEU A 1 30 ? 5.645   2.290   4.635   1.00 0.00 ? 558 LEU A HA   13 
ATOM   7717  H  HB2  . LEU A 1 30 ? 7.647   0.774   3.044   1.00 0.00 ? 558 LEU A HB2  13 
ATOM   7718  H  HB3  . LEU A 1 30 ? 7.504   0.381   4.747   1.00 0.00 ? 558 LEU A HB3  13 
ATOM   7719  H  HG   . LEU A 1 30 ? 5.117   0.406   2.915   1.00 0.00 ? 558 LEU A HG   13 
ATOM   7720  H  HD11 . LEU A 1 30 ? 5.497   -1.701  2.190   1.00 0.00 ? 558 LEU A HD11 13 
ATOM   7721  H  HD12 . LEU A 1 30 ? 6.371   -2.166  3.650   1.00 0.00 ? 558 LEU A HD12 13 
ATOM   7722  H  HD13 . LEU A 1 30 ? 7.179   -1.216  2.404   1.00 0.00 ? 558 LEU A HD13 13 
ATOM   7723  H  HD21 . LEU A 1 30 ? 5.686   -0.366  5.711   1.00 0.00 ? 558 LEU A HD21 13 
ATOM   7724  H  HD22 . LEU A 1 30 ? 4.606   -1.422  4.801   1.00 0.00 ? 558 LEU A HD22 13 
ATOM   7725  H  HD23 . LEU A 1 30 ? 4.216   0.288   4.989   1.00 0.00 ? 558 LEU A HD23 13 
ATOM   7726  N  N    . ARG A 1 31 ? 8.831   3.138   4.725   1.00 0.00 ? 559 ARG A N    13 
ATOM   7727  C  CA   . ARG A 1 31 ? 9.872   3.694   5.582   1.00 0.00 ? 559 ARG A CA   13 
ATOM   7728  C  C    . ARG A 1 31 ? 9.412   5.000   6.223   1.00 0.00 ? 559 ARG A C    13 
ATOM   7729  O  O    . ARG A 1 31 ? 9.833   5.343   7.327   1.00 0.00 ? 559 ARG A O    13 
ATOM   7730  C  CB   . ARG A 1 31 ? 11.155  3.927   4.781   1.00 0.00 ? 559 ARG A CB   13 
ATOM   7731  C  CG   . ARG A 1 31 ? 10.996  4.938   3.657   1.00 0.00 ? 559 ARG A CG   13 
ATOM   7732  C  CD   . ARG A 1 31 ? 12.319  5.602   3.313   1.00 0.00 ? 559 ARG A CD   13 
ATOM   7733  N  NE   . ARG A 1 31 ? 12.131  6.844   2.568   1.00 0.00 ? 559 ARG A NE   13 
ATOM   7734  C  CZ   . ARG A 1 31 ? 11.687  7.975   3.112   1.00 0.00 ? 559 ARG A CZ   13 
ATOM   7735  N  NH1  . ARG A 1 31 ? 11.385  8.025   4.403   1.00 0.00 ? 559 ARG A NH1  13 
ATOM   7736  N  NH2  . ARG A 1 31 ? 11.546  9.060   2.362   1.00 0.00 ? 559 ARG A NH2  13 
ATOM   7737  H  H    . ARG A 1 31 ? 9.021   2.992   3.775   1.00 0.00 ? 559 ARG A H    13 
ATOM   7738  H  HA   . ARG A 1 31 ? 10.074  2.977   6.364   1.00 0.00 ? 559 ARG A HA   13 
ATOM   7739  H  HB2  . ARG A 1 31 ? 11.924  4.284   5.450   1.00 0.00 ? 559 ARG A HB2  13 
ATOM   7740  H  HB3  . ARG A 1 31 ? 11.472  2.989   4.350   1.00 0.00 ? 559 ARG A HB3  13 
ATOM   7741  H  HG2  . ARG A 1 31 ? 10.621  4.431   2.780   1.00 0.00 ? 559 ARG A HG2  13 
ATOM   7742  H  HG3  . ARG A 1 31 ? 10.291  5.697   3.965   1.00 0.00 ? 559 ARG A HG3  13 
ATOM   7743  H  HD2  . ARG A 1 31 ? 12.846  5.820   4.230   1.00 0.00 ? 559 ARG A HD2  13 
ATOM   7744  H  HD3  . ARG A 1 31 ? 12.905  4.919   2.716   1.00 0.00 ? 559 ARG A HD3  13 
ATOM   7745  H  HE   . ARG A 1 31 ? 12.347  6.836   1.612   1.00 0.00 ? 559 ARG A HE   13 
ATOM   7746  H  HH11 . ARG A 1 31 ? 11.489  7.211   4.974   1.00 0.00 ? 559 ARG A HH11 13 
ATOM   7747  H  HH12 . ARG A 1 31 ? 11.052  8.878   4.805   1.00 0.00 ? 559 ARG A HH12 13 
ATOM   7748  H  HH21 . ARG A 1 31 ? 11.773  9.028   1.389   1.00 0.00 ? 559 ARG A HH21 13 
ATOM   7749  H  HH22 . ARG A 1 31 ? 11.212  9.910   2.770   1.00 0.00 ? 559 ARG A HH22 13 
ATOM   7750  N  N    . TRP A 1 32 ? 8.545   5.724   5.523   1.00 0.00 ? 560 TRP A N    13 
ATOM   7751  C  CA   . TRP A 1 32 ? 8.028   6.992   6.025   1.00 0.00 ? 560 TRP A CA   13 
ATOM   7752  C  C    . TRP A 1 32 ? 7.103   6.767   7.217   1.00 0.00 ? 560 TRP A C    13 
ATOM   7753  O  O    . TRP A 1 32 ? 7.077   7.566   8.154   1.00 0.00 ? 560 TRP A O    13 
ATOM   7754  C  CB   . TRP A 1 32 ? 7.280   7.736   4.918   1.00 0.00 ? 560 TRP A CB   13 
ATOM   7755  C  CG   . TRP A 1 32 ? 7.465   9.222   4.971   1.00 0.00 ? 560 TRP A CG   13 
ATOM   7756  C  CD1  . TRP A 1 32 ? 8.490   9.940   4.426   1.00 0.00 ? 560 TRP A CD1  13 
ATOM   7757  C  CD2  . TRP A 1 32 ? 6.601   10.172  5.606   1.00 0.00 ? 560 TRP A CD2  13 
ATOM   7758  N  NE1  . TRP A 1 32 ? 8.316   11.279  4.683   1.00 0.00 ? 560 TRP A NE1  13 
ATOM   7759  C  CE2  . TRP A 1 32 ? 7.164   11.446  5.406   1.00 0.00 ? 560 TRP A CE2  13 
ATOM   7760  C  CE3  . TRP A 1 32 ? 5.406   10.068  6.324   1.00 0.00 ? 560 TRP A CE3  13 
ATOM   7761  C  CZ2  . TRP A 1 32 ? 6.572   12.607  5.898   1.00 0.00 ? 560 TRP A CZ2  13 
ATOM   7762  C  CZ3  . TRP A 1 32 ? 4.820   11.221  6.811   1.00 0.00 ? 560 TRP A CZ3  13 
ATOM   7763  C  CH2  . TRP A 1 32 ? 5.403   12.476  6.596   1.00 0.00 ? 560 TRP A CH2  13 
ATOM   7764  H  H    . TRP A 1 32 ? 8.245   5.399   4.648   1.00 0.00 ? 560 TRP A H    13 
ATOM   7765  H  HA   . TRP A 1 32 ? 8.868   7.589   6.344   1.00 0.00 ? 560 TRP A HA   13 
ATOM   7766  H  HB2  . TRP A 1 32 ? 7.634   7.391   3.958   1.00 0.00 ? 560 TRP A HB2  13 
ATOM   7767  H  HB3  . TRP A 1 32 ? 6.223   7.527   5.003   1.00 0.00 ? 560 TRP A HB3  13 
ATOM   7768  H  HD1  . TRP A 1 32 ? 9.312   9.506   3.876   1.00 0.00 ? 560 TRP A HD1  13 
ATOM   7769  H  HE1  . TRP A 1 32 ? 8.919   11.996  4.396   1.00 0.00 ? 560 TRP A HE1  13 
ATOM   7770  H  HE3  . TRP A 1 32 ? 4.941   9.109   6.499   1.00 0.00 ? 560 TRP A HE3  13 
ATOM   7771  H  HZ2  . TRP A 1 32 ? 7.009   13.582  5.740   1.00 0.00 ? 560 TRP A HZ2  13 
ATOM   7772  H  HZ3  . TRP A 1 32 ? 3.896   11.161  7.368   1.00 0.00 ? 560 TRP A HZ3  13 
ATOM   7773  H  HH2  . TRP A 1 32 ? 4.910   13.350  6.996   1.00 0.00 ? 560 TRP A HH2  13 
ATOM   7774  N  N    . HIS A 1 33 ? 6.346   5.676   7.176   1.00 0.00 ? 561 HIS A N    13 
ATOM   7775  C  CA   . HIS A 1 33 ? 5.420   5.346   8.253   1.00 0.00 ? 561 HIS A CA   13 
ATOM   7776  C  C    . HIS A 1 33 ? 6.176   4.980   9.526   1.00 0.00 ? 561 HIS A C    13 
ATOM   7777  O  O    . HIS A 1 33 ? 5.776   5.357   10.628  1.00 0.00 ? 561 HIS A O    13 
ATOM   7778  C  CB   . HIS A 1 33 ? 4.511   4.188   7.837   1.00 0.00 ? 561 HIS A CB   13 
ATOM   7779  C  CG   . HIS A 1 33 ? 3.256   4.630   7.148   1.00 0.00 ? 561 HIS A CG   13 
ATOM   7780  N  ND1  . HIS A 1 33 ? 2.323   5.470   7.715   1.00 0.00 ? 561 HIS A ND1  13 
ATOM   7781  C  CD2  . HIS A 1 33 ? 2.787   4.330   5.911   1.00 0.00 ? 561 HIS A CD2  13 
ATOM   7782  C  CE1  . HIS A 1 33 ? 1.337   5.649   6.825   1.00 0.00 ? 561 HIS A CE1  13 
ATOM   7783  N  NE2  . HIS A 1 33 ? 1.571   4.979   5.714   1.00 0.00 ? 561 HIS A NE2  13 
ATOM   7784  H  H    . HIS A 1 33 ? 6.412   5.077   6.402   1.00 0.00 ? 561 HIS A H    13 
ATOM   7785  H  HA   . HIS A 1 33 ? 4.813   6.217   8.447   1.00 0.00 ? 561 HIS A HA   13 
ATOM   7786  H  HB2  . HIS A 1 33 ? 5.049   3.542   7.160   1.00 0.00 ? 561 HIS A HB2  13 
ATOM   7787  H  HB3  . HIS A 1 33 ? 4.229   3.627   8.716   1.00 0.00 ? 561 HIS A HB3  13 
ATOM   7788  H  HD1  . HIS A 1 33 ? 2.371   5.865   8.611   1.00 0.00 ? 561 HIS A HD1  13 
ATOM   7789  H  HD2  . HIS A 1 33 ? 3.272   3.693   5.185   1.00 0.00 ? 561 HIS A HD2  13 
ATOM   7790  H  HE1  . HIS A 1 33 ? 0.466   6.265   6.995   1.00 0.00 ? 561 HIS A HE1  13 
ATOM   7791  N  N    . THR A 1 34 ? 7.271   4.242   9.367   1.00 0.00 ? 562 THR A N    13 
ATOM   7792  C  CA   . THR A 1 34 ? 8.087   3.822   10.502  1.00 0.00 ? 562 THR A CA   13 
ATOM   7793  C  C    . THR A 1 34 ? 7.249   3.062   11.526  1.00 0.00 ? 562 THR A C    13 
ATOM   7794  O  O    . THR A 1 34 ? 7.462   3.184   12.732  1.00 0.00 ? 562 THR A O    13 
ATOM   7795  C  CB   . THR A 1 34 ? 8.745   5.035   11.164  1.00 0.00 ? 562 THR A CB   13 
ATOM   7796  O  OG1  . THR A 1 34 ? 7.816   5.730   11.977  1.00 0.00 ? 562 THR A OG1  13 
ATOM   7797  C  CG2  . THR A 1 34 ? 9.317   6.024   10.171  1.00 0.00 ? 562 THR A CG2  13 
ATOM   7798  H  H    . THR A 1 34 ? 7.537   3.973   8.463   1.00 0.00 ? 562 THR A H    13 
ATOM   7799  H  HA   . THR A 1 34 ? 8.858   3.165   10.129  1.00 0.00 ? 562 THR A HA   13 
ATOM   7800  H  HB   . THR A 1 34 ? 9.555   4.692   11.792  1.00 0.00 ? 562 THR A HB   13 
ATOM   7801  H  HG1  . THR A 1 34 ? 8.268   6.431   12.453  1.00 0.00 ? 562 THR A HG1  13 
ATOM   7802  H  HG21 . THR A 1 34 ? 10.240  5.636   9.768   1.00 0.00 ? 562 THR A HG21 13 
ATOM   7803  H  HG22 . THR A 1 34 ? 9.508   6.964   10.668  1.00 0.00 ? 562 THR A HG22 13 
ATOM   7804  H  HG23 . THR A 1 34 ? 8.610   6.178   9.369   1.00 0.00 ? 562 THR A HG23 13 
ATOM   7805  N  N    . GLY A 1 35 ? 6.295   2.276   11.036  1.00 0.00 ? 563 GLY A N    13 
ATOM   7806  C  CA   . GLY A 1 35 ? 5.440   1.507   11.921  1.00 0.00 ? 563 GLY A CA   13 
ATOM   7807  C  C    . GLY A 1 35 ? 4.439   2.375   12.659  1.00 0.00 ? 563 GLY A C    13 
ATOM   7808  O  O    . GLY A 1 35 ? 4.803   3.111   13.576  1.00 0.00 ? 563 GLY A O    13 
ATOM   7809  H  H    . GLY A 1 35 ? 6.171   2.218   10.065  1.00 0.00 ? 563 GLY A H    13 
ATOM   7810  H  HA2  . GLY A 1 35 ? 4.903   0.774   11.337  1.00 0.00 ? 563 GLY A HA2  13 
ATOM   7811  H  HA3  . GLY A 1 35 ? 6.057   0.995   12.644  1.00 0.00 ? 563 GLY A HA3  13 
ATOM   7812  N  N    . GLU A 1 36 ? 3.175   2.287   12.258  1.00 0.00 ? 564 GLU A N    13 
ATOM   7813  C  CA   . GLU A 1 36 ? 2.118   3.070   12.887  1.00 0.00 ? 564 GLU A CA   13 
ATOM   7814  C  C    . GLU A 1 36 ? 1.276   2.201   13.815  1.00 0.00 ? 564 GLU A C    13 
ATOM   7815  O  O    . GLU A 1 36 ? 1.358   0.973   13.776  1.00 0.00 ? 564 GLU A O    13 
ATOM   7816  C  CB   . GLU A 1 36 ? 1.228   3.713   11.822  1.00 0.00 ? 564 GLU A CB   13 
ATOM   7817  C  CG   . GLU A 1 36 ? 1.728   5.067   11.347  1.00 0.00 ? 564 GLU A CG   13 
ATOM   7818  C  CD   . GLU A 1 36 ? 1.050   6.222   12.057  1.00 0.00 ? 564 GLU A CD   13 
ATOM   7819  O  OE1  . GLU A 1 36 ? -0.141  6.474   11.776  1.00 0.00 ? 564 GLU A OE1  13 
ATOM   7820  O  OE2  . GLU A 1 36 ? 1.709   6.873   12.894  1.00 0.00 ? 564 GLU A OE2  13 
ATOM   7821  H  H    . GLU A 1 36 ? 2.948   1.682   11.522  1.00 0.00 ? 564 GLU A H    13 
ATOM   7822  H  HA   . GLU A 1 36 ? 2.586   3.850   13.471  1.00 0.00 ? 564 GLU A HA   13 
ATOM   7823  H  HB2  . GLU A 1 36 ? 1.173   3.053   10.969  1.00 0.00 ? 564 GLU A HB2  13 
ATOM   7824  H  HB3  . GLU A 1 36 ? 0.236   3.843   12.230  1.00 0.00 ? 564 GLU A HB3  13 
ATOM   7825  H  HG2  . GLU A 1 36 ? 2.791   5.127   11.528  1.00 0.00 ? 564 GLU A HG2  13 
ATOM   7826  H  HG3  . GLU A 1 36 ? 1.540   5.154   10.287  1.00 0.00 ? 564 GLU A HG3  13 
ATOM   7827  N  N    . ARG A 1 37 ? 0.465   2.845   14.648  1.00 0.00 ? 565 ARG A N    13 
ATOM   7828  C  CA   . ARG A 1 37 ? -0.393  2.130   15.585  1.00 0.00 ? 565 ARG A CA   13 
ATOM   7829  C  C    . ARG A 1 37 ? 0.438   1.283   16.545  1.00 0.00 ? 565 ARG A C    13 
ATOM   7830  O  O    . ARG A 1 37 ? 0.752   0.127   16.191  1.00 0.00 ? 565 ARG A O    13 
ATOM   7831  C  CB   . ARG A 1 37 ? -1.385  1.245   14.826  1.00 0.00 ? 565 ARG A CB   13 
ATOM   7832  C  CG   . ARG A 1 37 ? -2.821  1.737   14.903  1.00 0.00 ? 565 ARG A CG   13 
ATOM   7833  C  CD   . ARG A 1 37 ? -3.777  0.775   14.217  1.00 0.00 ? 565 ARG A CD   13 
ATOM   7834  N  NE   . ARG A 1 37 ? -5.161  1.239   14.281  1.00 0.00 ? 565 ARG A NE   13 
ATOM   7835  C  CZ   . ARG A 1 37 ? -5.938  1.111   15.355  1.00 0.00 ? 565 ARG A CZ   13 
ATOM   7836  N  NH1  . ARG A 1 37 ? -5.471  0.534   16.455  1.00 0.00 ? 565 ARG A NH1  13 
ATOM   7837  N  NH2  . ARG A 1 37 ? -7.185  1.562   15.328  1.00 0.00 ? 565 ARG A NH2  13 
ATOM   7838  O  OXT  . ARG A 1 37 ? 0.767   1.783   17.641  1.00 0.00 ? 565 ARG A OXT  13 
ATOM   7839  H  H    . ARG A 1 37 ? 0.444   3.825   14.632  1.00 0.00 ? 565 ARG A H    13 
ATOM   7840  H  HA   . ARG A 1 37 ? -0.943  2.863   16.156  1.00 0.00 ? 565 ARG A HA   13 
ATOM   7841  H  HB2  . ARG A 1 37 ? -1.095  1.209   13.786  1.00 0.00 ? 565 ARG A HB2  13 
ATOM   7842  H  HB3  . ARG A 1 37 ? -1.348  0.245   15.235  1.00 0.00 ? 565 ARG A HB3  13 
ATOM   7843  H  HG2  . ARG A 1 37 ? -3.104  1.831   15.941  1.00 0.00 ? 565 ARG A HG2  13 
ATOM   7844  H  HG3  . ARG A 1 37 ? -2.887  2.701   14.421  1.00 0.00 ? 565 ARG A HG3  13 
ATOM   7845  H  HD2  . ARG A 1 37 ? -3.488  0.678   13.181  1.00 0.00 ? 565 ARG A HD2  13 
ATOM   7846  H  HD3  . ARG A 1 37 ? -3.708  -0.188  14.702  1.00 0.00 ? 565 ARG A HD3  13 
ATOM   7847  H  HE   . ARG A 1 37 ? -5.532  1.669   13.482  1.00 0.00 ? 565 ARG A HE   13 
ATOM   7848  H  HH11 . ARG A 1 37 ? -4.532  0.193   16.482  1.00 0.00 ? 565 ARG A HH11 13 
ATOM   7849  H  HH12 . ARG A 1 37 ? -6.059  0.441   17.258  1.00 0.00 ? 565 ARG A HH12 13 
ATOM   7850  H  HH21 . ARG A 1 37 ? -7.541  1.997   14.501  1.00 0.00 ? 565 ARG A HH21 13 
ATOM   7851  H  HH22 . ARG A 1 37 ? -7.768  1.465   16.134  1.00 0.00 ? 565 ARG A HH22 13 
HETATM 7852  ZN ZN   . ZN  B 2 .  ? 0.338   4.796   4.135   1.00 0.00 ? 100 ZN  A ZN   13 
ATOM   7853  N  N    . MET A 1 1  ? -15.236 -10.403 -20.395 1.00 0.00 ? 1   MET A N    14 
ATOM   7854  C  CA   . MET A 1 1  ? -16.297 -11.402 -20.100 1.00 0.00 ? 1   MET A CA   14 
ATOM   7855  C  C    . MET A 1 1  ? -15.847 -12.385 -19.023 1.00 0.00 ? 1   MET A C    14 
ATOM   7856  O  O    . MET A 1 1  ? -16.668 -12.930 -18.286 1.00 0.00 ? 1   MET A O    14 
ATOM   7857  C  CB   . MET A 1 1  ? -16.634 -12.152 -21.391 1.00 0.00 ? 1   MET A CB   14 
ATOM   7858  C  CG   . MET A 1 1  ? -15.469 -12.950 -21.955 1.00 0.00 ? 1   MET A CG   14 
ATOM   7859  S  SD   . MET A 1 1  ? -15.881 -14.684 -22.237 1.00 0.00 ? 1   MET A SD   14 
ATOM   7860  C  CE   . MET A 1 1  ? -15.054 -15.458 -20.850 1.00 0.00 ? 1   MET A CE   14 
ATOM   7861  H  H1   . MET A 1 1  ? -14.511 -10.872 -20.974 1.00 0.00 ? 1   MET A H1   14 
ATOM   7862  H  H2   . MET A 1 1  ? -14.842 -10.083 -19.486 1.00 0.00 ? 1   MET A H2   14 
ATOM   7863  H  H3   . MET A 1 1  ? -15.676 -9.617  -20.912 1.00 0.00 ? 1   MET A H3   14 
ATOM   7864  H  HA   . MET A 1 1  ? -17.175 -10.878 -19.754 1.00 0.00 ? 1   MET A HA   14 
ATOM   7865  H  HB2  . MET A 1 1  ? -17.450 -12.832 -21.195 1.00 0.00 ? 1   MET A HB2  14 
ATOM   7866  H  HB3  . MET A 1 1  ? -16.946 -11.436 -22.137 1.00 0.00 ? 1   MET A HB3  14 
ATOM   7867  H  HG2  . MET A 1 1  ? -15.170 -12.510 -22.894 1.00 0.00 ? 1   MET A HG2  14 
ATOM   7868  H  HG3  . MET A 1 1  ? -14.645 -12.900 -21.258 1.00 0.00 ? 1   MET A HG3  14 
ATOM   7869  H  HE1  . MET A 1 1  ? -14.802 -16.477 -21.105 1.00 0.00 ? 1   MET A HE1  14 
ATOM   7870  H  HE2  . MET A 1 1  ? -15.709 -15.453 -19.991 1.00 0.00 ? 1   MET A HE2  14 
ATOM   7871  H  HE3  . MET A 1 1  ? -14.152 -14.912 -20.618 1.00 0.00 ? 1   MET A HE3  14 
ATOM   7872  N  N    . ASP A 1 2  ? -14.540 -12.606 -18.938 1.00 0.00 ? 530 ASP A N    14 
ATOM   7873  C  CA   . ASP A 1 2  ? -13.983 -13.522 -17.950 1.00 0.00 ? 530 ASP A CA   14 
ATOM   7874  C  C    . ASP A 1 2  ? -14.059 -12.921 -16.548 1.00 0.00 ? 530 ASP A C    14 
ATOM   7875  O  O    . ASP A 1 2  ? -13.870 -11.718 -16.370 1.00 0.00 ? 530 ASP A O    14 
ATOM   7876  C  CB   . ASP A 1 2  ? -12.531 -13.858 -18.298 1.00 0.00 ? 530 ASP A CB   14 
ATOM   7877  C  CG   . ASP A 1 2  ? -12.215 -15.329 -18.110 1.00 0.00 ? 530 ASP A CG   14 
ATOM   7878  O  OD1  . ASP A 1 2  ? -12.932 -16.169 -18.694 1.00 0.00 ? 530 ASP A OD1  14 
ATOM   7879  O  OD2  . ASP A 1 2  ? -11.252 -15.640 -17.378 1.00 0.00 ? 530 ASP A OD2  14 
ATOM   7880  H  H    . ASP A 1 2  ? -13.934 -12.142 -19.553 1.00 0.00 ? 530 ASP A H    14 
ATOM   7881  H  HA   . ASP A 1 2  ? -14.568 -14.429 -17.974 1.00 0.00 ? 530 ASP A HA   14 
ATOM   7882  H  HB2  . ASP A 1 2  ? -12.346 -13.599 -19.330 1.00 0.00 ? 530 ASP A HB2  14 
ATOM   7883  H  HB3  . ASP A 1 2  ? -11.872 -13.282 -17.664 1.00 0.00 ? 530 ASP A HB3  14 
ATOM   7884  N  N    . PRO A 1 3  ? -14.337 -13.753 -15.528 1.00 0.00 ? 531 PRO A N    14 
ATOM   7885  C  CA   . PRO A 1 3  ? -14.436 -13.292 -14.140 1.00 0.00 ? 531 PRO A CA   14 
ATOM   7886  C  C    . PRO A 1 3  ? -13.080 -12.895 -13.566 1.00 0.00 ? 531 PRO A C    14 
ATOM   7887  O  O    . PRO A 1 3  ? -12.065 -12.933 -14.261 1.00 0.00 ? 531 PRO A O    14 
ATOM   7888  C  CB   . PRO A 1 3  ? -14.994 -14.509 -13.399 1.00 0.00 ? 531 PRO A CB   14 
ATOM   7889  C  CG   . PRO A 1 3  ? -14.572 -15.678 -14.220 1.00 0.00 ? 531 PRO A CG   14 
ATOM   7890  C  CD   . PRO A 1 3  ? -14.577 -15.205 -15.648 1.00 0.00 ? 531 PRO A CD   14 
ATOM   7891  H  HA   . PRO A 1 3  ? -15.122 -12.464 -14.046 1.00 0.00 ? 531 PRO A HA   14 
ATOM   7892  H  HB2  . PRO A 1 3  ? -14.576 -14.552 -12.404 1.00 0.00 ? 531 PRO A HB2  14 
ATOM   7893  H  HB3  . PRO A 1 3  ? -16.070 -14.437 -13.341 1.00 0.00 ? 531 PRO A HB3  14 
ATOM   7894  H  HG2  . PRO A 1 3  ? -13.578 -15.989 -13.932 1.00 0.00 ? 531 PRO A HG2  14 
ATOM   7895  H  HG3  . PRO A 1 3  ? -15.272 -16.490 -14.092 1.00 0.00 ? 531 PRO A HG3  14 
ATOM   7896  H  HD2  . PRO A 1 3  ? -13.785 -15.681 -16.206 1.00 0.00 ? 531 PRO A HD2  14 
ATOM   7897  H  HD3  . PRO A 1 3  ? -15.534 -15.400 -16.107 1.00 0.00 ? 531 PRO A HD3  14 
ATOM   7898  N  N    . GLY A 1 4  ? -13.071 -12.514 -12.292 1.00 0.00 ? 532 GLY A N    14 
ATOM   7899  C  CA   . GLY A 1 4  ? -11.833 -12.115 -11.647 1.00 0.00 ? 532 GLY A CA   14 
ATOM   7900  C  C    . GLY A 1 4  ? -11.899 -10.709 -11.083 1.00 0.00 ? 532 GLY A C    14 
ATOM   7901  O  O    . GLY A 1 4  ? -12.540 -9.831  -11.661 1.00 0.00 ? 532 GLY A O    14 
ATOM   7902  H  H    . GLY A 1 4  ? -13.910 -12.504 -11.787 1.00 0.00 ? 532 GLY A H    14 
ATOM   7903  H  HA2  . GLY A 1 4  ? -11.622 -12.804 -10.842 1.00 0.00 ? 532 GLY A HA2  14 
ATOM   7904  H  HA3  . GLY A 1 4  ? -11.031 -12.165 -12.368 1.00 0.00 ? 532 GLY A HA3  14 
ATOM   7905  N  N    . LYS A 1 5  ? -11.235 -10.495 -9.952  1.00 0.00 ? 533 LYS A N    14 
ATOM   7906  C  CA   . LYS A 1 5  ? -11.220 -9.186  -9.310  1.00 0.00 ? 533 LYS A CA   14 
ATOM   7907  C  C    . LYS A 1 5  ? -9.800  -8.786  -8.920  1.00 0.00 ? 533 LYS A C    14 
ATOM   7908  O  O    . LYS A 1 5  ? -9.046  -9.590  -8.372  1.00 0.00 ? 533 LYS A O    14 
ATOM   7909  C  CB   . LYS A 1 5  ? -12.118 -9.193  -8.071  1.00 0.00 ? 533 LYS A CB   14 
ATOM   7910  C  CG   . LYS A 1 5  ? -11.704 -10.217 -7.026  1.00 0.00 ? 533 LYS A CG   14 
ATOM   7911  C  CD   . LYS A 1 5  ? -12.910 -10.929 -6.430  1.00 0.00 ? 533 LYS A CD   14 
ATOM   7912  C  CE   . LYS A 1 5  ? -12.934 -12.401 -6.809  1.00 0.00 ? 533 LYS A CE   14 
ATOM   7913  N  NZ   . LYS A 1 5  ? -12.887 -12.596 -8.284  1.00 0.00 ? 533 LYS A NZ   14 
ATOM   7914  H  H    . LYS A 1 5  ? -10.743 -11.236 -9.540  1.00 0.00 ? 533 LYS A H    14 
ATOM   7915  H  HA   . LYS A 1 5  ? -11.603 -8.465  -10.017 1.00 0.00 ? 533 LYS A HA   14 
ATOM   7916  H  HB2  . LYS A 1 5  ? -12.091 -8.214  -7.616  1.00 0.00 ? 533 LYS A HB2  14 
ATOM   7917  H  HB3  . LYS A 1 5  ? -13.130 -9.410  -8.377  1.00 0.00 ? 533 LYS A HB3  14 
ATOM   7918  H  HG2  . LYS A 1 5  ? -11.059 -10.949 -7.489  1.00 0.00 ? 533 LYS A HG2  14 
ATOM   7919  H  HG3  . LYS A 1 5  ? -11.168 -9.712  -6.235  1.00 0.00 ? 533 LYS A HG3  14 
ATOM   7920  H  HD2  . LYS A 1 5  ? -12.868 -10.846 -5.354  1.00 0.00 ? 533 LYS A HD2  14 
ATOM   7921  H  HD3  . LYS A 1 5  ? -13.811 -10.457 -6.794  1.00 0.00 ? 533 LYS A HD3  14 
ATOM   7922  H  HE2  . LYS A 1 5  ? -12.080 -12.888 -6.363  1.00 0.00 ? 533 LYS A HE2  14 
ATOM   7923  H  HE3  . LYS A 1 5  ? -13.841 -12.843 -6.424  1.00 0.00 ? 533 LYS A HE3  14 
ATOM   7924  H  HZ1  . LYS A 1 5  ? -13.468 -13.415 -8.555  1.00 0.00 ? 533 LYS A HZ1  14 
ATOM   7925  H  HZ2  . LYS A 1 5  ? -11.908 -12.763 -8.592  1.00 0.00 ? 533 LYS A HZ2  14 
ATOM   7926  H  HZ3  . LYS A 1 5  ? -13.251 -11.750 -8.768  1.00 0.00 ? 533 LYS A HZ3  14 
ATOM   7927  N  N    . LYS A 1 6  ? -9.441  -7.538  -9.207  1.00 0.00 ? 534 LYS A N    14 
ATOM   7928  C  CA   . LYS A 1 6  ? -8.111  -7.031  -8.887  1.00 0.00 ? 534 LYS A CA   14 
ATOM   7929  C  C    . LYS A 1 6  ? -8.018  -6.640  -7.415  1.00 0.00 ? 534 LYS A C    14 
ATOM   7930  O  O    . LYS A 1 6  ? -9.035  -6.459  -6.745  1.00 0.00 ? 534 LYS A O    14 
ATOM   7931  C  CB   . LYS A 1 6  ? -7.776  -5.827  -9.769  1.00 0.00 ? 534 LYS A CB   14 
ATOM   7932  C  CG   . LYS A 1 6  ? -7.907  -6.107  -11.257 1.00 0.00 ? 534 LYS A CG   14 
ATOM   7933  C  CD   . LYS A 1 6  ? -7.353  -4.963  -12.091 1.00 0.00 ? 534 LYS A CD   14 
ATOM   7934  C  CE   . LYS A 1 6  ? -5.834  -4.931  -12.052 1.00 0.00 ? 534 LYS A CE   14 
ATOM   7935  N  NZ   . LYS A 1 6  ? -5.306  -3.540  -12.106 1.00 0.00 ? 534 LYS A NZ   14 
ATOM   7936  H  H    . LYS A 1 6  ? -10.087 -6.944  -9.644  1.00 0.00 ? 534 LYS A H    14 
ATOM   7937  H  HA   . LYS A 1 6  ? -7.400  -7.819  -9.083  1.00 0.00 ? 534 LYS A HA   14 
ATOM   7938  H  HB2  . LYS A 1 6  ? -8.442  -5.014  -9.518  1.00 0.00 ? 534 LYS A HB2  14 
ATOM   7939  H  HB3  . LYS A 1 6  ? -6.759  -5.522  -9.571  1.00 0.00 ? 534 LYS A HB3  14 
ATOM   7940  H  HG2  . LYS A 1 6  ? -7.361  -7.008  -11.494 1.00 0.00 ? 534 LYS A HG2  14 
ATOM   7941  H  HG3  . LYS A 1 6  ? -8.952  -6.244  -11.498 1.00 0.00 ? 534 LYS A HG3  14 
ATOM   7942  H  HD2  . LYS A 1 6  ? -7.675  -5.087  -13.114 1.00 0.00 ? 534 LYS A HD2  14 
ATOM   7943  H  HD3  . LYS A 1 6  ? -7.734  -4.030  -11.702 1.00 0.00 ? 534 LYS A HD3  14 
ATOM   7944  H  HE2  . LYS A 1 6  ? -5.500  -5.398  -11.138 1.00 0.00 ? 534 LYS A HE2  14 
ATOM   7945  H  HE3  . LYS A 1 6  ? -5.453  -5.485  -12.898 1.00 0.00 ? 534 LYS A HE3  14 
ATOM   7946  H  HZ1  . LYS A 1 6  ? -4.352  -3.536  -12.521 1.00 0.00 ? 534 LYS A HZ1  14 
ATOM   7947  H  HZ2  . LYS A 1 6  ? -5.257  -3.139  -11.148 1.00 0.00 ? 534 LYS A HZ2  14 
ATOM   7948  H  HZ3  . LYS A 1 6  ? -5.929  -2.944  -12.688 1.00 0.00 ? 534 LYS A HZ3  14 
ATOM   7949  N  N    . LYS A 1 7  ? -6.792  -6.511  -6.918  1.00 0.00 ? 535 LYS A N    14 
ATOM   7950  C  CA   . LYS A 1 7  ? -6.566  -6.142  -5.524  1.00 0.00 ? 535 LYS A CA   14 
ATOM   7951  C  C    . LYS A 1 7  ? -5.694  -4.893  -5.425  1.00 0.00 ? 535 LYS A C    14 
ATOM   7952  O  O    . LYS A 1 7  ? -4.995  -4.535  -6.372  1.00 0.00 ? 535 LYS A O    14 
ATOM   7953  C  CB   . LYS A 1 7  ? -5.908  -7.299  -4.770  1.00 0.00 ? 535 LYS A CB   14 
ATOM   7954  C  CG   . LYS A 1 7  ? -6.122  -7.244  -3.265  1.00 0.00 ? 535 LYS A CG   14 
ATOM   7955  C  CD   . LYS A 1 7  ? -6.319  -8.633  -2.680  1.00 0.00 ? 535 LYS A CD   14 
ATOM   7956  C  CE   . LYS A 1 7  ? -6.272  -8.609  -1.161  1.00 0.00 ? 535 LYS A CE   14 
ATOM   7957  N  NZ   . LYS A 1 7  ? -6.380  -9.976  -0.580  1.00 0.00 ? 535 LYS A NZ   14 
ATOM   7958  H  H    . LYS A 1 7  ? -6.020  -6.668  -7.501  1.00 0.00 ? 535 LYS A H    14 
ATOM   7959  H  HA   . LYS A 1 7  ? -7.526  -5.932  -5.077  1.00 0.00 ? 535 LYS A HA   14 
ATOM   7960  H  HB2  . LYS A 1 7  ? -6.316  -8.229  -5.136  1.00 0.00 ? 535 LYS A HB2  14 
ATOM   7961  H  HB3  . LYS A 1 7  ? -4.845  -7.281  -4.961  1.00 0.00 ? 535 LYS A HB3  14 
ATOM   7962  H  HG2  . LYS A 1 7  ? -5.257  -6.790  -2.805  1.00 0.00 ? 535 LYS A HG2  14 
ATOM   7963  H  HG3  . LYS A 1 7  ? -6.998  -6.647  -3.057  1.00 0.00 ? 535 LYS A HG3  14 
ATOM   7964  H  HD2  . LYS A 1 7  ? -7.280  -9.012  -2.994  1.00 0.00 ? 535 LYS A HD2  14 
ATOM   7965  H  HD3  . LYS A 1 7  ? -5.536  -9.281  -3.046  1.00 0.00 ? 535 LYS A HD3  14 
ATOM   7966  H  HE2  . LYS A 1 7  ? -5.337  -8.169  -0.849  1.00 0.00 ? 535 LYS A HE2  14 
ATOM   7967  H  HE3  . LYS A 1 7  ? -7.092  -8.007  -0.798  1.00 0.00 ? 535 LYS A HE3  14 
ATOM   7968  H  HZ1  . LYS A 1 7  ? -6.050  -9.972  0.406   1.00 0.00 ? 535 LYS A HZ1  14 
ATOM   7969  H  HZ2  . LYS A 1 7  ? -5.799  -10.643 -1.126  1.00 0.00 ? 535 LYS A HZ2  14 
ATOM   7970  H  HZ3  . LYS A 1 7  ? -7.370  -10.297 -0.603  1.00 0.00 ? 535 LYS A HZ3  14 
ATOM   7971  N  N    . GLN A 1 8  ? -5.741  -4.235  -4.271  1.00 0.00 ? 536 GLN A N    14 
ATOM   7972  C  CA   . GLN A 1 8  ? -4.956  -3.026  -4.048  1.00 0.00 ? 536 GLN A CA   14 
ATOM   7973  C  C    . GLN A 1 8  ? -4.283  -3.056  -2.679  1.00 0.00 ? 536 GLN A C    14 
ATOM   7974  O  O    . GLN A 1 8  ? -4.615  -3.885  -1.831  1.00 0.00 ? 536 GLN A O    14 
ATOM   7975  C  CB   . GLN A 1 8  ? -5.845  -1.786  -4.162  1.00 0.00 ? 536 GLN A CB   14 
ATOM   7976  C  CG   . GLN A 1 8  ? -5.913  -1.213  -5.568  1.00 0.00 ? 536 GLN A CG   14 
ATOM   7977  C  CD   . GLN A 1 8  ? -7.312  -0.768  -5.948  1.00 0.00 ? 536 GLN A CD   14 
ATOM   7978  O  OE1  . GLN A 1 8  ? -7.621  0.424   -5.935  1.00 0.00 ? 536 GLN A OE1  14 
ATOM   7979  N  NE2  . GLN A 1 8  ? -8.166  -1.725  -6.289  1.00 0.00 ? 536 GLN A NE2  14 
ATOM   7980  H  H    . GLN A 1 8  ? -6.318  -4.569  -3.552  1.00 0.00 ? 536 GLN A H    14 
ATOM   7981  H  HA   . GLN A 1 8  ? -4.193  -2.981  -4.810  1.00 0.00 ? 536 GLN A HA   14 
ATOM   7982  H  HB2  . GLN A 1 8  ? -6.847  -2.047  -3.853  1.00 0.00 ? 536 GLN A HB2  14 
ATOM   7983  H  HB3  . GLN A 1 8  ? -5.463  -1.021  -3.502  1.00 0.00 ? 536 GLN A HB3  14 
ATOM   7984  H  HG2  . GLN A 1 8  ? -5.252  -0.362  -5.628  1.00 0.00 ? 536 GLN A HG2  14 
ATOM   7985  H  HG3  . GLN A 1 8  ? -5.589  -1.970  -6.267  1.00 0.00 ? 536 GLN A HG3  14 
ATOM   7986  H  HE21 . GLN A 1 8  ? -7.850  -2.653  -6.276  1.00 0.00 ? 536 GLN A HE21 14 
ATOM   7987  H  HE22 . GLN A 1 8  ? -9.077  -1.466  -6.540  1.00 0.00 ? 536 GLN A HE22 14 
ATOM   7988  N  N    . HIS A 1 9  ? -3.336  -2.146  -2.470  1.00 0.00 ? 537 HIS A N    14 
ATOM   7989  C  CA   . HIS A 1 9  ? -2.616  -2.066  -1.204  1.00 0.00 ? 537 HIS A CA   14 
ATOM   7990  C  C    . HIS A 1 9  ? -2.892  -0.738  -0.506  1.00 0.00 ? 537 HIS A C    14 
ATOM   7991  O  O    . HIS A 1 9  ? -2.412  0.311   -0.934  1.00 0.00 ? 537 HIS A O    14 
ATOM   7992  C  CB   . HIS A 1 9  ? -1.113  -2.230  -1.435  1.00 0.00 ? 537 HIS A CB   14 
ATOM   7993  C  CG   . HIS A 1 9  ? -0.755  -3.463  -2.203  1.00 0.00 ? 537 HIS A CG   14 
ATOM   7994  N  ND1  . HIS A 1 9  ? -1.506  -4.618  -2.197  1.00 0.00 ? 537 HIS A ND1  14 
ATOM   7995  C  CD2  . HIS A 1 9  ? 0.303   -3.710  -3.017  1.00 0.00 ? 537 HIS A CD2  14 
ATOM   7996  C  CE1  . HIS A 1 9  ? -0.895  -5.510  -2.987  1.00 0.00 ? 537 HIS A CE1  14 
ATOM   7997  N  NE2  . HIS A 1 9  ? 0.208   -5.008  -3.510  1.00 0.00 ? 537 HIS A NE2  14 
ATOM   7998  H  H    . HIS A 1 9  ? -3.117  -1.512  -3.185  1.00 0.00 ? 537 HIS A H    14 
ATOM   7999  H  HA   . HIS A 1 9  ? -2.964  -2.870  -0.573  1.00 0.00 ? 537 HIS A HA   14 
ATOM   8000  H  HB2  . HIS A 1 9  ? -0.745  -1.377  -1.986  1.00 0.00 ? 537 HIS A HB2  14 
ATOM   8001  H  HB3  . HIS A 1 9  ? -0.612  -2.276  -0.478  1.00 0.00 ? 537 HIS A HB3  14 
ATOM   8002  H  HD1  . HIS A 1 9  ? -2.339  -4.761  -1.701  1.00 0.00 ? 537 HIS A HD1  14 
ATOM   8003  H  HD2  . HIS A 1 9  ? 1.098   -3.018  -3.252  1.00 0.00 ? 537 HIS A HD2  14 
ATOM   8004  H  HE1  . HIS A 1 9  ? -1.258  -6.510  -3.173  1.00 0.00 ? 537 HIS A HE1  14 
ATOM   8005  N  N    . ILE A 1 10 ? -3.667  -0.792  0.572   1.00 0.00 ? 538 ILE A N    14 
ATOM   8006  C  CA   . ILE A 1 10 ? -4.007  0.406   1.331   1.00 0.00 ? 538 ILE A CA   14 
ATOM   8007  C  C    . ILE A 1 10 ? -3.353  0.383   2.708   1.00 0.00 ? 538 ILE A C    14 
ATOM   8008  O  O    . ILE A 1 10 ? -3.275  -0.664  3.351   1.00 0.00 ? 538 ILE A O    14 
ATOM   8009  C  CB   . ILE A 1 10 ? -5.532  0.552   1.500   1.00 0.00 ? 538 ILE A CB   14 
ATOM   8010  C  CG1  . ILE A 1 10 ? -6.238  0.389   0.152   1.00 0.00 ? 538 ILE A CG1  14 
ATOM   8011  C  CG2  . ILE A 1 10 ? -5.873  1.899   2.122   1.00 0.00 ? 538 ILE A CG2  14 
ATOM   8012  C  CD1  . ILE A 1 10 ? -7.595  -0.271  0.256   1.00 0.00 ? 538 ILE A CD1  14 
ATOM   8013  H  H    . ILE A 1 10 ? -4.020  -1.658  0.865   1.00 0.00 ? 538 ILE A H    14 
ATOM   8014  H  HA   . ILE A 1 10 ? -3.642  1.263   0.783   1.00 0.00 ? 538 ILE A HA   14 
ATOM   8015  H  HB   . ILE A 1 10 ? -5.872  -0.222  2.172   1.00 0.00 ? 538 ILE A HB   14 
ATOM   8016  H  HG12 . ILE A 1 10 ? -6.377  1.362   -0.294  1.00 0.00 ? 538 ILE A HG12 14 
ATOM   8017  H  HG13 . ILE A 1 10 ? -5.624  -0.215  -0.499  1.00 0.00 ? 538 ILE A HG13 14 
ATOM   8018  H  HG21 . ILE A 1 10 ? -6.266  2.558   1.361   1.00 0.00 ? 538 ILE A HG21 14 
ATOM   8019  H  HG22 . ILE A 1 10 ? -4.983  2.335   2.550   1.00 0.00 ? 538 ILE A HG22 14 
ATOM   8020  H  HG23 . ILE A 1 10 ? -6.614  1.761   2.896   1.00 0.00 ? 538 ILE A HG23 14 
ATOM   8021  H  HD11 . ILE A 1 10 ? -7.472  -1.343  0.303   1.00 0.00 ? 538 ILE A HD11 14 
ATOM   8022  H  HD12 . ILE A 1 10 ? -8.188  -0.014  -0.610  1.00 0.00 ? 538 ILE A HD12 14 
ATOM   8023  H  HD13 . ILE A 1 10 ? -8.095  0.072   1.149   1.00 0.00 ? 538 ILE A HD13 14 
ATOM   8024  N  N    . CYS A 1 11 ? -2.882  1.544   3.158   1.00 0.00 ? 539 CYS A N    14 
ATOM   8025  C  CA   . CYS A 1 11 ? -2.234  1.655   4.461   1.00 0.00 ? 539 CYS A CA   14 
ATOM   8026  C  C    . CYS A 1 11 ? -3.119  1.079   5.563   1.00 0.00 ? 539 CYS A C    14 
ATOM   8027  O  O    . CYS A 1 11 ? -4.258  1.509   5.746   1.00 0.00 ? 539 CYS A O    14 
ATOM   8028  C  CB   . CYS A 1 11 ? -1.900  3.118   4.766   1.00 0.00 ? 539 CYS A CB   14 
ATOM   8029  S  SG   . CYS A 1 11 ? -0.178  3.394   5.243   1.00 0.00 ? 539 CYS A SG   14 
ATOM   8030  H  H    . CYS A 1 11 ? -2.973  2.344   2.600   1.00 0.00 ? 539 CYS A H    14 
ATOM   8031  H  HA   . CYS A 1 11 ? -1.316  1.087   4.422   1.00 0.00 ? 539 CYS A HA   14 
ATOM   8032  H  HB2  . CYS A 1 11 ? -2.096  3.714   3.887   1.00 0.00 ? 539 CYS A HB2  14 
ATOM   8033  H  HB3  . CYS A 1 11 ? -2.525  3.464   5.576   1.00 0.00 ? 539 CYS A HB3  14 
ATOM   8034  N  N    . HIS A 1 12 ? -2.588  0.102   6.291   1.00 0.00 ? 540 HIS A N    14 
ATOM   8035  C  CA   . HIS A 1 12 ? -3.330  -0.536  7.372   1.00 0.00 ? 540 HIS A CA   14 
ATOM   8036  C  C    . HIS A 1 12 ? -2.972  0.082   8.720   1.00 0.00 ? 540 HIS A C    14 
ATOM   8037  O  O    . HIS A 1 12 ? -2.913  -0.613  9.735   1.00 0.00 ? 540 HIS A O    14 
ATOM   8038  C  CB   . HIS A 1 12 ? -3.047  -2.041  7.391   1.00 0.00 ? 540 HIS A CB   14 
ATOM   8039  C  CG   . HIS A 1 12 ? -4.285  -2.882  7.431   1.00 0.00 ? 540 HIS A CG   14 
ATOM   8040  N  ND1  . HIS A 1 12 ? -5.353  -2.636  8.264   1.00 0.00 ? 540 HIS A ND1  14 
ATOM   8041  C  CD2  . HIS A 1 12 ? -4.615  -3.986  6.714   1.00 0.00 ? 540 HIS A CD2  14 
ATOM   8042  C  CE1  . HIS A 1 12 ? -6.278  -3.578  8.034   1.00 0.00 ? 540 HIS A CE1  14 
ATOM   8043  N  NE2  . HIS A 1 12 ? -5.879  -4.421  7.102   1.00 0.00 ? 540 HIS A NE2  14 
ATOM   8044  H  H    . HIS A 1 12 ? -1.676  -0.199  6.094   1.00 0.00 ? 540 HIS A H    14 
ATOM   8045  H  HA   . HIS A 1 12 ? -4.382  -0.381  7.187   1.00 0.00 ? 540 HIS A HA   14 
ATOM   8046  H  HB2  . HIS A 1 12 ? -2.494  -2.307  6.503   1.00 0.00 ? 540 HIS A HB2  14 
ATOM   8047  H  HB3  . HIS A 1 12 ? -2.454  -2.279  8.263   1.00 0.00 ? 540 HIS A HB3  14 
ATOM   8048  H  HD1  . HIS A 1 12 ? -5.424  -1.904  8.911   1.00 0.00 ? 540 HIS A HD1  14 
ATOM   8049  H  HD2  . HIS A 1 12 ? -4.002  -4.460  5.961   1.00 0.00 ? 540 HIS A HD2  14 
ATOM   8050  H  HE1  . HIS A 1 12 ? -7.228  -3.638  8.545   1.00 0.00 ? 540 HIS A HE1  14 
ATOM   8051  N  N    . ILE A 1 13 ? -2.736  1.390   8.725   1.00 0.00 ? 541 ILE A N    14 
ATOM   8052  C  CA   . ILE A 1 13 ? -2.388  2.097   9.951   1.00 0.00 ? 541 ILE A CA   14 
ATOM   8053  C  C    . ILE A 1 13 ? -3.306  3.295   10.172  1.00 0.00 ? 541 ILE A C    14 
ATOM   8054  O  O    . ILE A 1 13 ? -3.847  3.860   9.222   1.00 0.00 ? 541 ILE A O    14 
ATOM   8055  C  CB   . ILE A 1 13 ? -0.923  2.578   9.930   1.00 0.00 ? 541 ILE A CB   14 
ATOM   8056  C  CG1  . ILE A 1 13 ? -0.713  3.617   8.826   1.00 0.00 ? 541 ILE A CG1  14 
ATOM   8057  C  CG2  . ILE A 1 13 ? 0.017   1.398   9.738   1.00 0.00 ? 541 ILE A CG2  14 
ATOM   8058  C  CD1  . ILE A 1 13 ? -0.711  5.043   9.333   1.00 0.00 ? 541 ILE A CD1  14 
ATOM   8059  H  H    . ILE A 1 13 ? -2.800  1.891   7.886   1.00 0.00 ? 541 ILE A H    14 
ATOM   8060  H  HA   . ILE A 1 13 ? -2.507  1.410   10.776  1.00 0.00 ? 541 ILE A HA   14 
ATOM   8061  H  HB   . ILE A 1 13 ? -0.703  3.030   10.885  1.00 0.00 ? 541 ILE A HB   14 
ATOM   8062  H  HG12 . ILE A 1 13 ? 0.236   3.436   8.345   1.00 0.00 ? 541 ILE A HG12 14 
ATOM   8063  H  HG13 . ILE A 1 13 ? -1.505  3.524   8.097   1.00 0.00 ? 541 ILE A HG13 14 
ATOM   8064  H  HG21 . ILE A 1 13 ? 0.997   1.653   10.114  1.00 0.00 ? 541 ILE A HG21 14 
ATOM   8065  H  HG22 . ILE A 1 13 ? 0.085   1.159   8.687   1.00 0.00 ? 541 ILE A HG22 14 
ATOM   8066  H  HG23 . ILE A 1 13 ? -0.363  0.543   10.278  1.00 0.00 ? 541 ILE A HG23 14 
ATOM   8067  H  HD11 . ILE A 1 13 ? -0.836  5.720   8.502   1.00 0.00 ? 541 ILE A HD11 14 
ATOM   8068  H  HD12 . ILE A 1 13 ? 0.228   5.248   9.826   1.00 0.00 ? 541 ILE A HD12 14 
ATOM   8069  H  HD13 . ILE A 1 13 ? -1.522  5.177   10.032  1.00 0.00 ? 541 ILE A HD13 14 
ATOM   8070  N  N    . GLN A 1 14 ? -3.478  3.676   11.433  1.00 0.00 ? 542 GLN A N    14 
ATOM   8071  C  CA   . GLN A 1 14 ? -4.330  4.803   11.780  1.00 0.00 ? 542 GLN A CA   14 
ATOM   8072  C  C    . GLN A 1 14 ? -3.658  6.125   11.424  1.00 0.00 ? 542 GLN A C    14 
ATOM   8073  O  O    . GLN A 1 14 ? -3.038  6.765   12.273  1.00 0.00 ? 542 GLN A O    14 
ATOM   8074  C  CB   . GLN A 1 14 ? -4.665  4.775   13.273  1.00 0.00 ? 542 GLN A CB   14 
ATOM   8075  C  CG   . GLN A 1 14 ? -5.682  5.825   13.687  1.00 0.00 ? 542 GLN A CG   14 
ATOM   8076  C  CD   . GLN A 1 14 ? -5.484  6.297   15.114  1.00 0.00 ? 542 GLN A CD   14 
ATOM   8077  O  OE1  . GLN A 1 14 ? -4.418  6.800   15.471  1.00 0.00 ? 542 GLN A OE1  14 
ATOM   8078  N  NE2  . GLN A 1 14 ? -6.512  6.137   15.939  1.00 0.00 ? 542 GLN A NE2  14 
ATOM   8079  H  H    . GLN A 1 14 ? -3.023  3.186   12.145  1.00 0.00 ? 542 GLN A H    14 
ATOM   8080  H  HA   . GLN A 1 14 ? -5.241  4.711   11.215  1.00 0.00 ? 542 GLN A HA   14 
ATOM   8081  H  HB2  . GLN A 1 14 ? -5.062  3.802   13.522  1.00 0.00 ? 542 GLN A HB2  14 
ATOM   8082  H  HB3  . GLN A 1 14 ? -3.759  4.940   13.836  1.00 0.00 ? 542 GLN A HB3  14 
ATOM   8083  H  HG2  . GLN A 1 14 ? -5.592  6.675   13.027  1.00 0.00 ? 542 GLN A HG2  14 
ATOM   8084  H  HG3  . GLN A 1 14 ? -6.673  5.404   13.597  1.00 0.00 ? 542 GLN A HG3  14 
ATOM   8085  H  HE21 . GLN A 1 14 ? -7.330  5.728   15.586  1.00 0.00 ? 542 GLN A HE21 14 
ATOM   8086  H  HE22 . GLN A 1 14 ? -6.411  6.433   16.868  1.00 0.00 ? 542 GLN A HE22 14 
ATOM   8087  N  N    . GLY A 1 15 ? -3.786  6.529   10.164  1.00 0.00 ? 543 GLY A N    14 
ATOM   8088  C  CA   . GLY A 1 15 ? -3.185  7.774   9.723   1.00 0.00 ? 543 GLY A CA   14 
ATOM   8089  C  C    . GLY A 1 15 ? -3.225  7.943   8.216   1.00 0.00 ? 543 GLY A C    14 
ATOM   8090  O  O    . GLY A 1 15 ? -3.520  9.028   7.715   1.00 0.00 ? 543 GLY A O    14 
ATOM   8091  H  H    . GLY A 1 15 ? -4.292  5.979   9.530   1.00 0.00 ? 543 GLY A H    14 
ATOM   8092  H  HA2  . GLY A 1 15 ? -3.714  8.597   10.180  1.00 0.00 ? 543 GLY A HA2  14 
ATOM   8093  H  HA3  . GLY A 1 15 ? -2.155  7.797   10.048  1.00 0.00 ? 543 GLY A HA3  14 
ATOM   8094  N  N    . CYS A 1 16 ? -2.924  6.870   7.491   1.00 0.00 ? 544 CYS A N    14 
ATOM   8095  C  CA   . CYS A 1 16 ? -2.924  6.910   6.034   1.00 0.00 ? 544 CYS A CA   14 
ATOM   8096  C  C    . CYS A 1 16 ? -4.167  6.232   5.467   1.00 0.00 ? 544 CYS A C    14 
ATOM   8097  O  O    . CYS A 1 16 ? -4.949  5.629   6.201   1.00 0.00 ? 544 CYS A O    14 
ATOM   8098  C  CB   . CYS A 1 16 ? -1.664  6.235   5.488   1.00 0.00 ? 544 CYS A CB   14 
ATOM   8099  S  SG   . CYS A 1 16 ? -0.386  7.391   4.942   1.00 0.00 ? 544 CYS A SG   14 
ATOM   8100  H  H    . CYS A 1 16 ? -2.694  6.033   7.947   1.00 0.00 ? 544 CYS A H    14 
ATOM   8101  H  HA   . CYS A 1 16 ? -2.925  7.947   5.732   1.00 0.00 ? 544 CYS A HA   14 
ATOM   8102  H  HB2  . CYS A 1 16 ? -1.235  5.615   6.261   1.00 0.00 ? 544 CYS A HB2  14 
ATOM   8103  H  HB3  . CYS A 1 16 ? -1.931  5.616   4.644   1.00 0.00 ? 544 CYS A HB3  14 
ATOM   8104  N  N    . GLY A 1 17 ? -4.340  6.335   4.153   1.00 0.00 ? 545 GLY A N    14 
ATOM   8105  C  CA   . GLY A 1 17 ? -5.487  5.729   3.504   1.00 0.00 ? 545 GLY A CA   14 
ATOM   8106  C  C    . GLY A 1 17 ? -5.413  5.825   1.993   1.00 0.00 ? 545 GLY A C    14 
ATOM   8107  O  O    . GLY A 1 17 ? -6.436  5.964   1.322   1.00 0.00 ? 545 GLY A O    14 
ATOM   8108  H  H    . GLY A 1 17 ? -3.682  6.829   3.620   1.00 0.00 ? 545 GLY A H    14 
ATOM   8109  H  HA2  . GLY A 1 17 ? -5.537  4.687   3.786   1.00 0.00 ? 545 GLY A HA2  14 
ATOM   8110  H  HA3  . GLY A 1 17 ? -6.384  6.226   3.843   1.00 0.00 ? 545 GLY A HA3  14 
ATOM   8111  N  N    . LYS A 1 18 ? -4.199  5.752   1.457   1.00 0.00 ? 546 LYS A N    14 
ATOM   8112  C  CA   . LYS A 1 18 ? -3.993  5.832   0.016   1.00 0.00 ? 546 LYS A CA   14 
ATOM   8113  C  C    . LYS A 1 18 ? -4.124  4.456   -0.630  1.00 0.00 ? 546 LYS A C    14 
ATOM   8114  O  O    . LYS A 1 18 ? -4.525  3.490   0.019   1.00 0.00 ? 546 LYS A O    14 
ATOM   8115  C  CB   . LYS A 1 18 ? -2.616  6.426   -0.290  1.00 0.00 ? 546 LYS A CB   14 
ATOM   8116  C  CG   . LYS A 1 18 ? -1.459  5.545   0.156   1.00 0.00 ? 546 LYS A CG   14 
ATOM   8117  C  CD   . LYS A 1 18 ? -0.276  6.375   0.629   1.00 0.00 ? 546 LYS A CD   14 
ATOM   8118  C  CE   . LYS A 1 18 ? 0.374   7.129   -0.521  1.00 0.00 ? 546 LYS A CE   14 
ATOM   8119  N  NZ   . LYS A 1 18 ? 0.086   8.588   -0.462  1.00 0.00 ? 546 LYS A NZ   14 
ATOM   8120  H  H    . LYS A 1 18 ? -3.423  5.640   2.045   1.00 0.00 ? 546 LYS A H    14 
ATOM   8121  H  HA   . LYS A 1 18 ? -4.753  6.481   -0.392  1.00 0.00 ? 546 LYS A HA   14 
ATOM   8122  H  HB2  . LYS A 1 18 ? -2.532  6.582   -1.355  1.00 0.00 ? 546 LYS A HB2  14 
ATOM   8123  H  HB3  . LYS A 1 18 ? -2.528  7.378   0.212   1.00 0.00 ? 546 LYS A HB3  14 
ATOM   8124  H  HG2  . LYS A 1 18 ? -1.791  4.915   0.967   1.00 0.00 ? 546 LYS A HG2  14 
ATOM   8125  H  HG3  . LYS A 1 18 ? -1.147  4.931   -0.676  1.00 0.00 ? 546 LYS A HG3  14 
ATOM   8126  H  HD2  . LYS A 1 18 ? -0.620  7.088   1.363   1.00 0.00 ? 546 LYS A HD2  14 
ATOM   8127  H  HD3  . LYS A 1 18 ? 0.456   5.719   1.077   1.00 0.00 ? 546 LYS A HD3  14 
ATOM   8128  H  HE2  . LYS A 1 18 ? 1.442   6.980   -0.474  1.00 0.00 ? 546 LYS A HE2  14 
ATOM   8129  H  HE3  . LYS A 1 18 ? -0.002  6.733   -1.453  1.00 0.00 ? 546 LYS A HE3  14 
ATOM   8130  H  HZ1  . LYS A 1 18 ? -0.040  8.967   -1.423  1.00 0.00 ? 546 LYS A HZ1  14 
ATOM   8131  H  HZ2  . LYS A 1 18 ? 0.874   9.090   -0.005  1.00 0.00 ? 546 LYS A HZ2  14 
ATOM   8132  H  HZ3  . LYS A 1 18 ? -0.782  8.760   0.084   1.00 0.00 ? 546 LYS A HZ3  14 
ATOM   8133  N  N    . VAL A 1 19 ? -3.785  4.374   -1.913  1.00 0.00 ? 547 VAL A N    14 
ATOM   8134  C  CA   . VAL A 1 19 ? -3.866  3.116   -2.646  1.00 0.00 ? 547 VAL A CA   14 
ATOM   8135  C  C    . VAL A 1 19 ? -2.522  2.755   -3.269  1.00 0.00 ? 547 VAL A C    14 
ATOM   8136  O  O    . VAL A 1 19 ? -1.668  3.619   -3.470  1.00 0.00 ? 547 VAL A O    14 
ATOM   8137  C  CB   . VAL A 1 19 ? -4.934  3.177   -3.755  1.00 0.00 ? 547 VAL A CB   14 
ATOM   8138  C  CG1  . VAL A 1 19 ? -5.117  1.812   -4.400  1.00 0.00 ? 547 VAL A CG1  14 
ATOM   8139  C  CG2  . VAL A 1 19 ? -6.255  3.692   -3.200  1.00 0.00 ? 547 VAL A CG2  14 
ATOM   8140  H  H    . VAL A 1 19 ? -3.474  5.178   -2.378  1.00 0.00 ? 547 VAL A H    14 
ATOM   8141  H  HA   . VAL A 1 19 ? -4.147  2.341   -1.947  1.00 0.00 ? 547 VAL A HA   14 
ATOM   8142  H  HB   . VAL A 1 19 ? -4.596  3.867   -4.515  1.00 0.00 ? 547 VAL A HB   14 
ATOM   8143  H  HG11 . VAL A 1 19 ? -5.973  1.836   -5.059  1.00 0.00 ? 547 VAL A HG11 14 
ATOM   8144  H  HG12 . VAL A 1 19 ? -5.274  1.069   -3.632  1.00 0.00 ? 547 VAL A HG12 14 
ATOM   8145  H  HG13 . VAL A 1 19 ? -4.233  1.561   -4.968  1.00 0.00 ? 547 VAL A HG13 14 
ATOM   8146  H  HG21 . VAL A 1 19 ? -6.080  4.192   -2.258  1.00 0.00 ? 547 VAL A HG21 14 
ATOM   8147  H  HG22 . VAL A 1 19 ? -6.929  2.862   -3.046  1.00 0.00 ? 547 VAL A HG22 14 
ATOM   8148  H  HG23 . VAL A 1 19 ? -6.693  4.387   -3.900  1.00 0.00 ? 547 VAL A HG23 14 
ATOM   8149  N  N    . TYR A 1 20 ? -2.341  1.474   -3.570  1.00 0.00 ? 548 TYR A N    14 
ATOM   8150  C  CA   . TYR A 1 20 ? -1.100  0.996   -4.169  1.00 0.00 ? 548 TYR A CA   14 
ATOM   8151  C  C    . TYR A 1 20 ? -1.323  -0.331  -4.888  1.00 0.00 ? 548 TYR A C    14 
ATOM   8152  O  O    . TYR A 1 20 ? -2.242  -1.080  -4.559  1.00 0.00 ? 548 TYR A O    14 
ATOM   8153  C  CB   . TYR A 1 20 ? -0.020  0.835   -3.097  1.00 0.00 ? 548 TYR A CB   14 
ATOM   8154  C  CG   . TYR A 1 20 ? 0.892   2.034   -2.968  1.00 0.00 ? 548 TYR A CG   14 
ATOM   8155  C  CD1  . TYR A 1 20 ? 1.875   2.289   -3.917  1.00 0.00 ? 548 TYR A CD1  14 
ATOM   8156  C  CD2  . TYR A 1 20 ? 0.770   2.912   -1.898  1.00 0.00 ? 548 TYR A CD2  14 
ATOM   8157  C  CE1  . TYR A 1 20 ? 2.710   3.383   -3.802  1.00 0.00 ? 548 TYR A CE1  14 
ATOM   8158  C  CE2  . TYR A 1 20 ? 1.602   4.009   -1.777  1.00 0.00 ? 548 TYR A CE2  14 
ATOM   8159  C  CZ   . TYR A 1 20 ? 2.570   4.240   -2.731  1.00 0.00 ? 548 TYR A CZ   14 
ATOM   8160  O  OH   . TYR A 1 20 ? 3.400   5.331   -2.614  1.00 0.00 ? 548 TYR A OH   14 
ATOM   8161  H  H    . TYR A 1 20 ? -3.059  0.834   -3.384  1.00 0.00 ? 548 TYR A H    14 
ATOM   8162  H  HA   . TYR A 1 20 ? -0.774  1.732   -4.889  1.00 0.00 ? 548 TYR A HA   14 
ATOM   8163  H  HB2  . TYR A 1 20 ? -0.495  0.676   -2.140  1.00 0.00 ? 548 TYR A HB2  14 
ATOM   8164  H  HB3  . TYR A 1 20 ? 0.590   -0.023  -3.336  1.00 0.00 ? 548 TYR A HB3  14 
ATOM   8165  H  HD1  . TYR A 1 20 ? 1.982   1.616   -4.755  1.00 0.00 ? 548 TYR A HD1  14 
ATOM   8166  H  HD2  . TYR A 1 20 ? 0.012   2.727   -1.152  1.00 0.00 ? 548 TYR A HD2  14 
ATOM   8167  H  HE1  . TYR A 1 20 ? 3.468   3.564   -4.550  1.00 0.00 ? 548 TYR A HE1  14 
ATOM   8168  H  HE2  . TYR A 1 20 ? 1.492   4.679   -0.938  1.00 0.00 ? 548 TYR A HE2  14 
ATOM   8169  H  HH   . TYR A 1 20 ? 4.315   5.041   -2.630  1.00 0.00 ? 548 TYR A HH   14 
ATOM   8170  N  N    . GLY A 1 21 ? -0.476  -0.617  -5.872  1.00 0.00 ? 549 GLY A N    14 
ATOM   8171  C  CA   . GLY A 1 21 ? -0.600  -1.854  -6.621  1.00 0.00 ? 549 GLY A CA   14 
ATOM   8172  C  C    . GLY A 1 21 ? 0.695   -2.643  -6.668  1.00 0.00 ? 549 GLY A C    14 
ATOM   8173  O  O    . GLY A 1 21 ? 0.874   -3.501  -7.532  1.00 0.00 ? 549 GLY A O    14 
ATOM   8174  H  H    . GLY A 1 21 ? 0.238   0.018   -6.092  1.00 0.00 ? 549 GLY A H    14 
ATOM   8175  H  HA2  . GLY A 1 21 ? -1.363  -2.465  -6.161  1.00 0.00 ? 549 GLY A HA2  14 
ATOM   8176  H  HA3  . GLY A 1 21 ? -0.902  -1.621  -7.631  1.00 0.00 ? 549 GLY A HA3  14 
ATOM   8177  N  N    . LYS A 1 22 ? 1.601   -2.354  -5.738  1.00 0.00 ? 550 LYS A N    14 
ATOM   8178  C  CA   . LYS A 1 22 ? 2.883   -3.046  -5.681  1.00 0.00 ? 550 LYS A CA   14 
ATOM   8179  C  C    . LYS A 1 22 ? 3.388   -3.141  -4.245  1.00 0.00 ? 550 LYS A C    14 
ATOM   8180  O  O    . LYS A 1 22 ? 3.404   -2.149  -3.515  1.00 0.00 ? 550 LYS A O    14 
ATOM   8181  C  CB   . LYS A 1 22 ? 3.916   -2.324  -6.549  1.00 0.00 ? 550 LYS A CB   14 
ATOM   8182  C  CG   . LYS A 1 22 ? 4.906   -3.261  -7.222  1.00 0.00 ? 550 LYS A CG   14 
ATOM   8183  C  CD   . LYS A 1 22 ? 5.590   -2.592  -8.404  1.00 0.00 ? 550 LYS A CD   14 
ATOM   8184  C  CE   . LYS A 1 22 ? 6.034   -3.612  -9.440  1.00 0.00 ? 550 LYS A CE   14 
ATOM   8185  N  NZ   . LYS A 1 22 ? 7.473   -3.965  -9.291  1.00 0.00 ? 550 LYS A NZ   14 
ATOM   8186  H  H    . LYS A 1 22 ? 1.402   -1.661  -5.075  1.00 0.00 ? 550 LYS A H    14 
ATOM   8187  H  HA   . LYS A 1 22 ? 2.738   -4.045  -6.065  1.00 0.00 ? 550 LYS A HA   14 
ATOM   8188  H  HB2  . LYS A 1 22 ? 3.398   -1.770  -7.318  1.00 0.00 ? 550 LYS A HB2  14 
ATOM   8189  H  HB3  . LYS A 1 22 ? 4.469   -1.633  -5.931  1.00 0.00 ? 550 LYS A HB3  14 
ATOM   8190  H  HG2  . LYS A 1 22 ? 5.657   -3.553  -6.503  1.00 0.00 ? 550 LYS A HG2  14 
ATOM   8191  H  HG3  . LYS A 1 22 ? 4.379   -4.136  -7.571  1.00 0.00 ? 550 LYS A HG3  14 
ATOM   8192  H  HD2  . LYS A 1 22 ? 4.899   -1.903  -8.865  1.00 0.00 ? 550 LYS A HD2  14 
ATOM   8193  H  HD3  . LYS A 1 22 ? 6.456   -2.052  -8.048  1.00 0.00 ? 550 LYS A HD3  14 
ATOM   8194  H  HE2  . LYS A 1 22 ? 5.440   -4.506  -9.325  1.00 0.00 ? 550 LYS A HE2  14 
ATOM   8195  H  HE3  . LYS A 1 22 ? 5.874   -3.198  -10.425 1.00 0.00 ? 550 LYS A HE3  14 
ATOM   8196  H  HZ1  . LYS A 1 22 ? 8.062   -3.113  -9.387  1.00 0.00 ? 550 LYS A HZ1  14 
ATOM   8197  H  HZ2  . LYS A 1 22 ? 7.751   -4.648  -10.024 1.00 0.00 ? 550 LYS A HZ2  14 
ATOM   8198  H  HZ3  . LYS A 1 22 ? 7.643   -4.387  -8.356  1.00 0.00 ? 550 LYS A HZ3  14 
ATOM   8199  N  N    . THR A 1 23 ? 3.801   -4.339  -3.846  1.00 0.00 ? 551 THR A N    14 
ATOM   8200  C  CA   . THR A 1 23 ? 4.308   -4.562  -2.496  1.00 0.00 ? 551 THR A CA   14 
ATOM   8201  C  C    . THR A 1 23 ? 5.652   -3.868  -2.301  1.00 0.00 ? 551 THR A C    14 
ATOM   8202  O  O    . THR A 1 23 ? 5.929   -3.324  -1.232  1.00 0.00 ? 551 THR A O    14 
ATOM   8203  C  CB   . THR A 1 23 ? 4.448   -6.060  -2.221  1.00 0.00 ? 551 THR A CB   14 
ATOM   8204  O  OG1  . THR A 1 23 ? 3.411   -6.786  -2.857  1.00 0.00 ? 551 THR A OG1  14 
ATOM   8205  C  CG2  . THR A 1 23 ? 4.412   -6.404  -0.748  1.00 0.00 ? 551 THR A CG2  14 
ATOM   8206  H  H    . THR A 1 23 ? 3.765   -5.091  -4.473  1.00 0.00 ? 551 THR A H    14 
ATOM   8207  H  HA   . THR A 1 23 ? 3.597   -4.141  -1.801  1.00 0.00 ? 551 THR A HA   14 
ATOM   8208  H  HB   . THR A 1 23 ? 5.394   -6.401  -2.617  1.00 0.00 ? 551 THR A HB   14 
ATOM   8209  H  HG1  . THR A 1 23 ? 3.654   -6.959  -3.769  1.00 0.00 ? 551 THR A HG1  14 
ATOM   8210  H  HG21 . THR A 1 23 ? 5.390   -6.736  -0.431  1.00 0.00 ? 551 THR A HG21 14 
ATOM   8211  H  HG22 . THR A 1 23 ? 3.692   -7.191  -0.579  1.00 0.00 ? 551 THR A HG22 14 
ATOM   8212  H  HG23 . THR A 1 23 ? 4.128   -5.529  -0.180  1.00 0.00 ? 551 THR A HG23 14 
ATOM   8213  N  N    . SER A 1 24 ? 6.482   -3.883  -3.341  1.00 0.00 ? 552 SER A N    14 
ATOM   8214  C  CA   . SER A 1 24 ? 7.794   -3.247  -3.279  1.00 0.00 ? 552 SER A CA   14 
ATOM   8215  C  C    . SER A 1 24 ? 7.658   -1.782  -2.880  1.00 0.00 ? 552 SER A C    14 
ATOM   8216  O  O    . SER A 1 24 ? 8.533   -1.224  -2.218  1.00 0.00 ? 552 SER A O    14 
ATOM   8217  C  CB   . SER A 1 24 ? 8.506   -3.359  -4.629  1.00 0.00 ? 552 SER A CB   14 
ATOM   8218  O  OG   . SER A 1 24 ? 8.028   -4.470  -5.368  1.00 0.00 ? 552 SER A OG   14 
ATOM   8219  H  H    . SER A 1 24 ? 6.204   -4.328  -4.169  1.00 0.00 ? 552 SER A H    14 
ATOM   8220  H  HA   . SER A 1 24 ? 8.377   -3.759  -2.527  1.00 0.00 ? 552 SER A HA   14 
ATOM   8221  H  HB2  . SER A 1 24 ? 8.331   -2.461  -5.202  1.00 0.00 ? 552 SER A HB2  14 
ATOM   8222  H  HB3  . SER A 1 24 ? 9.566   -3.480  -4.465  1.00 0.00 ? 552 SER A HB3  14 
ATOM   8223  H  HG   . SER A 1 24 ? 8.769   -5.019  -5.635  1.00 0.00 ? 552 SER A HG   14 
ATOM   8224  N  N    . HIS A 1 25 ? 6.547   -1.170  -3.275  1.00 0.00 ? 553 HIS A N    14 
ATOM   8225  C  CA   . HIS A 1 25 ? 6.288   0.225   -2.946  1.00 0.00 ? 553 HIS A CA   14 
ATOM   8226  C  C    . HIS A 1 25 ? 5.918   0.358   -1.473  1.00 0.00 ? 553 HIS A C    14 
ATOM   8227  O  O    . HIS A 1 25 ? 6.147   1.398   -0.854  1.00 0.00 ? 553 HIS A O    14 
ATOM   8228  C  CB   . HIS A 1 25 ? 5.163   0.780   -3.822  1.00 0.00 ? 553 HIS A CB   14 
ATOM   8229  C  CG   . HIS A 1 25 ? 5.649   1.420   -5.085  1.00 0.00 ? 553 HIS A CG   14 
ATOM   8230  N  ND1  . HIS A 1 25 ? 6.824   2.131   -5.184  1.00 0.00 ? 553 HIS A ND1  14 
ATOM   8231  C  CD2  . HIS A 1 25 ? 5.091   1.444   -6.323  1.00 0.00 ? 553 HIS A CD2  14 
ATOM   8232  C  CE1  . HIS A 1 25 ? 6.941   2.558   -6.449  1.00 0.00 ? 553 HIS A CE1  14 
ATOM   8233  N  NE2  . HIS A 1 25 ? 5.915   2.167   -7.181  1.00 0.00 ? 553 HIS A NE2  14 
ATOM   8234  H  H    . HIS A 1 25 ? 5.882   -1.671  -3.791  1.00 0.00 ? 553 HIS A H    14 
ATOM   8235  H  HA   . HIS A 1 25 ? 7.192   0.785   -3.131  1.00 0.00 ? 553 HIS A HA   14 
ATOM   8236  H  HB2  . HIS A 1 25 ? 4.497   -0.025  -4.093  1.00 0.00 ? 553 HIS A HB2  14 
ATOM   8237  H  HB3  . HIS A 1 25 ? 4.614   1.523   -3.262  1.00 0.00 ? 553 HIS A HB3  14 
ATOM   8238  H  HD1  . HIS A 1 25 ? 7.461   2.296   -4.458  1.00 0.00 ? 553 HIS A HD1  14 
ATOM   8239  H  HD2  . HIS A 1 25 ? 4.159   0.981   -6.607  1.00 0.00 ? 553 HIS A HD2  14 
ATOM   8240  H  HE1  . HIS A 1 25 ? 7.767   3.146   -6.821  1.00 0.00 ? 553 HIS A HE1  14 
ATOM   8241  N  N    . LEU A 1 26 ? 5.348   -0.708  -0.916  1.00 0.00 ? 554 LEU A N    14 
ATOM   8242  C  CA   . LEU A 1 26 ? 4.950   -0.719  0.484   1.00 0.00 ? 554 LEU A CA   14 
ATOM   8243  C  C    . LEU A 1 26 ? 6.176   -0.686  1.391   1.00 0.00 ? 554 LEU A C    14 
ATOM   8244  O  O    . LEU A 1 26 ? 6.164   -0.053  2.446   1.00 0.00 ? 554 LEU A O    14 
ATOM   8245  C  CB   . LEU A 1 26 ? 4.105   -1.961  0.786   1.00 0.00 ? 554 LEU A CB   14 
ATOM   8246  C  CG   . LEU A 1 26 ? 2.676   -1.673  1.248   1.00 0.00 ? 554 LEU A CG   14 
ATOM   8247  C  CD1  . LEU A 1 26 ? 1.921   -0.888  0.187   1.00 0.00 ? 554 LEU A CD1  14 
ATOM   8248  C  CD2  . LEU A 1 26 ? 1.950   -2.970  1.572   1.00 0.00 ? 554 LEU A CD2  14 
ATOM   8249  H  H    . LEU A 1 26 ? 5.195   -1.508  -1.461  1.00 0.00 ? 554 LEU A H    14 
ATOM   8250  H  HA   . LEU A 1 26 ? 4.356   0.162   0.666   1.00 0.00 ? 554 LEU A HA   14 
ATOM   8251  H  HB2  . LEU A 1 26 ? 4.058   -2.564  -0.109  1.00 0.00 ? 554 LEU A HB2  14 
ATOM   8252  H  HB3  . LEU A 1 26 ? 4.600   -2.532  1.558   1.00 0.00 ? 554 LEU A HB3  14 
ATOM   8253  H  HG   . LEU A 1 26 ? 2.709   -1.073  2.146   1.00 0.00 ? 554 LEU A HG   14 
ATOM   8254  H  HD11 . LEU A 1 26 ? 1.267   -0.173  0.664   1.00 0.00 ? 554 LEU A HD11 14 
ATOM   8255  H  HD12 . LEU A 1 26 ? 1.334   -1.567  -0.414  1.00 0.00 ? 554 LEU A HD12 14 
ATOM   8256  H  HD13 . LEU A 1 26 ? 2.625   -0.366  -0.444  1.00 0.00 ? 554 LEU A HD13 14 
ATOM   8257  H  HD21 . LEU A 1 26 ? 1.358   -3.274  0.722   1.00 0.00 ? 554 LEU A HD21 14 
ATOM   8258  H  HD22 . LEU A 1 26 ? 1.305   -2.818  2.425   1.00 0.00 ? 554 LEU A HD22 14 
ATOM   8259  H  HD23 . LEU A 1 26 ? 2.673   -3.739  1.801   1.00 0.00 ? 554 LEU A HD23 14 
ATOM   8260  N  N    . ARG A 1 27 ? 7.234   -1.374  0.971   1.00 0.00 ? 555 ARG A N    14 
ATOM   8261  C  CA   . ARG A 1 27 ? 8.467   -1.423  1.744   1.00 0.00 ? 555 ARG A CA   14 
ATOM   8262  C  C    . ARG A 1 27 ? 9.106   -0.041  1.835   1.00 0.00 ? 555 ARG A C    14 
ATOM   8263  O  O    . ARG A 1 27 ? 9.661   0.333   2.868   1.00 0.00 ? 555 ARG A O    14 
ATOM   8264  C  CB   . ARG A 1 27 ? 9.444   -2.436  1.130   1.00 0.00 ? 555 ARG A CB   14 
ATOM   8265  C  CG   . ARG A 1 27 ? 10.125  -1.968  -0.149  1.00 0.00 ? 555 ARG A CG   14 
ATOM   8266  C  CD   . ARG A 1 27 ? 11.640  -1.993  -0.018  1.00 0.00 ? 555 ARG A CD   14 
ATOM   8267  N  NE   . ARG A 1 27 ? 12.299  -2.135  -1.314  1.00 0.00 ? 555 ARG A NE   14 
ATOM   8268  C  CZ   . ARG A 1 27 ? 12.491  -1.128  -2.163  1.00 0.00 ? 555 ARG A CZ   14 
ATOM   8269  N  NH1  . ARG A 1 27 ? 12.076  0.095   -1.859  1.00 0.00 ? 555 ARG A NH1  14 
ATOM   8270  N  NH2  . ARG A 1 27 ? 13.099  -1.346  -3.321  1.00 0.00 ? 555 ARG A NH2  14 
ATOM   8271  H  H    . ARG A 1 27 ? 7.183   -1.859  0.122   1.00 0.00 ? 555 ARG A H    14 
ATOM   8272  H  HA   . ARG A 1 27 ? 8.211   -1.749  2.741   1.00 0.00 ? 555 ARG A HA   14 
ATOM   8273  H  HB2  . ARG A 1 27 ? 10.210  -2.658  1.856   1.00 0.00 ? 555 ARG A HB2  14 
ATOM   8274  H  HB3  . ARG A 1 27 ? 8.902   -3.342  0.907   1.00 0.00 ? 555 ARG A HB3  14 
ATOM   8275  H  HG2  . ARG A 1 27 ? 9.835   -2.623  -0.957  1.00 0.00 ? 555 ARG A HG2  14 
ATOM   8276  H  HG3  . ARG A 1 27 ? 9.809   -0.963  -0.372  1.00 0.00 ? 555 ARG A HG3  14 
ATOM   8277  H  HD2  . ARG A 1 27 ? 11.964  -1.070  0.441   1.00 0.00 ? 555 ARG A HD2  14 
ATOM   8278  H  HD3  . ARG A 1 27 ? 11.920  -2.825  0.612   1.00 0.00 ? 555 ARG A HD3  14 
ATOM   8279  H  HE   . ARG A 1 27 ? 12.615  -3.028  -1.565  1.00 0.00 ? 555 ARG A HE   14 
ATOM   8280  H  HH11 . ARG A 1 27 ? 11.616  0.266   -0.988  1.00 0.00 ? 555 ARG A HH11 14 
ATOM   8281  H  HH12 . ARG A 1 27 ? 12.224  0.847   -2.501  1.00 0.00 ? 555 ARG A HH12 14 
ATOM   8282  H  HH21 . ARG A 1 27 ? 13.413  -2.266  -3.556  1.00 0.00 ? 555 ARG A HH21 14 
ATOM   8283  H  HH22 . ARG A 1 27 ? 13.243  -0.590  -3.960  1.00 0.00 ? 555 ARG A HH22 14 
ATOM   8284  N  N    . ALA A 1 28 ? 9.015   0.716   0.747   1.00 0.00 ? 556 ALA A N    14 
ATOM   8285  C  CA   . ALA A 1 28 ? 9.572   2.058   0.697   1.00 0.00 ? 556 ALA A CA   14 
ATOM   8286  C  C    . ALA A 1 28 ? 8.687   3.038   1.457   1.00 0.00 ? 556 ALA A C    14 
ATOM   8287  O  O    . ALA A 1 28 ? 9.177   3.951   2.120   1.00 0.00 ? 556 ALA A O    14 
ATOM   8288  C  CB   . ALA A 1 28 ? 9.746   2.505   -0.747  1.00 0.00 ? 556 ALA A CB   14 
ATOM   8289  H  H    . ALA A 1 28 ? 8.557   0.362   -0.039  1.00 0.00 ? 556 ALA A H    14 
ATOM   8290  H  HA   . ALA A 1 28 ? 10.543  2.029   1.162   1.00 0.00 ? 556 ALA A HA   14 
ATOM   8291  H  HB1  . ALA A 1 28 ? 9.148   1.878   -1.392  1.00 0.00 ? 556 ALA A HB1  14 
ATOM   8292  H  HB2  . ALA A 1 28 ? 10.786  2.421   -1.026  1.00 0.00 ? 556 ALA A HB2  14 
ATOM   8293  H  HB3  . ALA A 1 28 ? 9.428   3.532   -0.848  1.00 0.00 ? 556 ALA A HB3  14 
ATOM   8294  N  N    . HIS A 1 29 ? 7.378   2.838   1.354   1.00 0.00 ? 557 HIS A N    14 
ATOM   8295  C  CA   . HIS A 1 29 ? 6.417   3.696   2.027   1.00 0.00 ? 557 HIS A CA   14 
ATOM   8296  C  C    . HIS A 1 29 ? 6.345   3.365   3.516   1.00 0.00 ? 557 HIS A C    14 
ATOM   8297  O  O    . HIS A 1 29 ? 6.058   4.232   4.342   1.00 0.00 ? 557 HIS A O    14 
ATOM   8298  C  CB   . HIS A 1 29 ? 5.034   3.546   1.383   1.00 0.00 ? 557 HIS A CB   14 
ATOM   8299  C  CG   . HIS A 1 29 ? 3.931   4.209   2.151   1.00 0.00 ? 557 HIS A CG   14 
ATOM   8300  N  ND1  . HIS A 1 29 ? 4.020   5.476   2.684   1.00 0.00 ? 557 HIS A ND1  14 
ATOM   8301  C  CD2  . HIS A 1 29 ? 2.696   3.751   2.477   1.00 0.00 ? 557 HIS A CD2  14 
ATOM   8302  C  CE1  . HIS A 1 29 ? 2.863   5.741   3.306   1.00 0.00 ? 557 HIS A CE1  14 
ATOM   8303  N  NE2  . HIS A 1 29 ? 2.026   4.726   3.209   1.00 0.00 ? 557 HIS A NE2  14 
ATOM   8304  H  H    . HIS A 1 29 ? 7.050   2.096   0.811   1.00 0.00 ? 557 HIS A H    14 
ATOM   8305  H  HA   . HIS A 1 29 ? 6.749   4.714   1.911   1.00 0.00 ? 557 HIS A HA   14 
ATOM   8306  H  HB2  . HIS A 1 29 ? 5.057   3.982   0.396   1.00 0.00 ? 557 HIS A HB2  14 
ATOM   8307  H  HB3  . HIS A 1 29 ? 4.797   2.496   1.300   1.00 0.00 ? 557 HIS A HB3  14 
ATOM   8308  H  HD1  . HIS A 1 29 ? 4.792   6.076   2.620   1.00 0.00 ? 557 HIS A HD1  14 
ATOM   8309  H  HD2  . HIS A 1 29 ? 2.288   2.785   2.216   1.00 0.00 ? 557 HIS A HD2  14 
ATOM   8310  H  HE1  . HIS A 1 29 ? 2.644   6.666   3.819   1.00 0.00 ? 557 HIS A HE1  14 
ATOM   8311  N  N    . LEU A 1 30 ? 6.605   2.105   3.850   1.00 0.00 ? 558 LEU A N    14 
ATOM   8312  C  CA   . LEU A 1 30 ? 6.567   1.658   5.237   1.00 0.00 ? 558 LEU A CA   14 
ATOM   8313  C  C    . LEU A 1 30 ? 7.684   2.302   6.052   1.00 0.00 ? 558 LEU A C    14 
ATOM   8314  O  O    . LEU A 1 30 ? 7.495   2.641   7.221   1.00 0.00 ? 558 LEU A O    14 
ATOM   8315  C  CB   . LEU A 1 30 ? 6.681   0.134   5.306   1.00 0.00 ? 558 LEU A CB   14 
ATOM   8316  C  CG   . LEU A 1 30 ? 5.348   -0.616  5.270   1.00 0.00 ? 558 LEU A CG   14 
ATOM   8317  C  CD1  . LEU A 1 30 ? 5.582   -2.112  5.128   1.00 0.00 ? 558 LEU A CD1  14 
ATOM   8318  C  CD2  . LEU A 1 30 ? 4.537   -0.319  6.522   1.00 0.00 ? 558 LEU A CD2  14 
ATOM   8319  H  H    . LEU A 1 30 ? 6.825   1.459   3.148   1.00 0.00 ? 558 LEU A H    14 
ATOM   8320  H  HA   . LEU A 1 30 ? 5.617   1.958   5.651   1.00 0.00 ? 558 LEU A HA   14 
ATOM   8321  H  HB2  . LEU A 1 30 ? 7.281   -0.199  4.472   1.00 0.00 ? 558 LEU A HB2  14 
ATOM   8322  H  HB3  . LEU A 1 30 ? 7.190   -0.127  6.221   1.00 0.00 ? 558 LEU A HB3  14 
ATOM   8323  H  HG   . LEU A 1 30 ? 4.779   -0.285  4.414   1.00 0.00 ? 558 LEU A HG   14 
ATOM   8324  H  HD11 . LEU A 1 30 ? 4.814   -2.650  5.663   1.00 0.00 ? 558 LEU A HD11 14 
ATOM   8325  H  HD12 . LEU A 1 30 ? 6.550   -2.366  5.535   1.00 0.00 ? 558 LEU A HD12 14 
ATOM   8326  H  HD13 . LEU A 1 30 ? 5.549   -2.384  4.083   1.00 0.00 ? 558 LEU A HD13 14 
ATOM   8327  H  HD21 . LEU A 1 30 ? 3.487   -0.284  6.271   1.00 0.00 ? 558 LEU A HD21 14 
ATOM   8328  H  HD22 . LEU A 1 30 ? 4.841   0.634   6.930   1.00 0.00 ? 558 LEU A HD22 14 
ATOM   8329  H  HD23 . LEU A 1 30 ? 4.706   -1.094  7.254   1.00 0.00 ? 558 LEU A HD23 14 
ATOM   8330  N  N    . ARG A 1 31 ? 8.847   2.467   5.431   1.00 0.00 ? 559 ARG A N    14 
ATOM   8331  C  CA   . ARG A 1 31 ? 9.993   3.069   6.104   1.00 0.00 ? 559 ARG A CA   14 
ATOM   8332  C  C    . ARG A 1 31 ? 9.666   4.481   6.583   1.00 0.00 ? 559 ARG A C    14 
ATOM   8333  O  O    . ARG A 1 31 ? 10.210  4.949   7.583   1.00 0.00 ? 559 ARG A O    14 
ATOM   8334  C  CB   . ARG A 1 31 ? 11.207  3.095   5.168   1.00 0.00 ? 559 ARG A CB   14 
ATOM   8335  C  CG   . ARG A 1 31 ? 11.092  4.106   4.037   1.00 0.00 ? 559 ARG A CG   14 
ATOM   8336  C  CD   . ARG A 1 31 ? 12.125  5.214   4.167   1.00 0.00 ? 559 ARG A CD   14 
ATOM   8337  N  NE   . ARG A 1 31 ? 11.933  6.261   3.167   1.00 0.00 ? 559 ARG A NE   14 
ATOM   8338  C  CZ   . ARG A 1 31 ? 12.538  7.447   3.210   1.00 0.00 ? 559 ARG A CZ   14 
ATOM   8339  N  NH1  . ARG A 1 31 ? 13.372  7.738   4.200   1.00 0.00 ? 559 ARG A NH1  14 
ATOM   8340  N  NH2  . ARG A 1 31 ? 12.308  8.342   2.260   1.00 0.00 ? 559 ARG A NH2  14 
ATOM   8341  H  H    . ARG A 1 31 ? 8.938   2.176   4.500   1.00 0.00 ? 559 ARG A H    14 
ATOM   8342  H  HA   . ARG A 1 31 ? 10.228  2.458   6.963   1.00 0.00 ? 559 ARG A HA   14 
ATOM   8343  H  HB2  . ARG A 1 31 ? 12.087  3.333   5.746   1.00 0.00 ? 559 ARG A HB2  14 
ATOM   8344  H  HB3  . ARG A 1 31 ? 11.330  2.114   4.733   1.00 0.00 ? 559 ARG A HB3  14 
ATOM   8345  H  HG2  . ARG A 1 31 ? 11.243  3.597   3.096   1.00 0.00 ? 559 ARG A HG2  14 
ATOM   8346  H  HG3  . ARG A 1 31 ? 10.104  4.543   4.057   1.00 0.00 ? 559 ARG A HG3  14 
ATOM   8347  H  HD2  . ARG A 1 31 ? 12.043  5.650   5.152   1.00 0.00 ? 559 ARG A HD2  14 
ATOM   8348  H  HD3  . ARG A 1 31 ? 13.109  4.787   4.044   1.00 0.00 ? 559 ARG A HD3  14 
ATOM   8349  H  HE   . ARG A 1 31 ? 11.322  6.072   2.425   1.00 0.00 ? 559 ARG A HE   14 
ATOM   8350  H  HH11 . ARG A 1 31 ? 13.550  7.067   4.919   1.00 0.00 ? 559 ARG A HH11 14 
ATOM   8351  H  HH12 . ARG A 1 31 ? 13.823  8.631   4.226   1.00 0.00 ? 559 ARG A HH12 14 
ATOM   8352  H  HH21 . ARG A 1 31 ? 11.681  8.128   1.511   1.00 0.00 ? 559 ARG A HH21 14 
ATOM   8353  H  HH22 . ARG A 1 31 ? 12.762  9.233   2.292   1.00 0.00 ? 559 ARG A HH22 14 
ATOM   8354  N  N    . TRP A 1 32 ? 8.774   5.154   5.863   1.00 0.00 ? 560 TRP A N    14 
ATOM   8355  C  CA   . TRP A 1 32 ? 8.374   6.512   6.215   1.00 0.00 ? 560 TRP A CA   14 
ATOM   8356  C  C    . TRP A 1 32 ? 7.561   6.523   7.505   1.00 0.00 ? 560 TRP A C    14 
ATOM   8357  O  O    . TRP A 1 32 ? 7.808   7.333   8.399   1.00 0.00 ? 560 TRP A O    14 
ATOM   8358  C  CB   . TRP A 1 32 ? 7.561   7.137   5.078   1.00 0.00 ? 560 TRP A CB   14 
ATOM   8359  C  CG   . TRP A 1 32 ? 7.973   8.540   4.756   1.00 0.00 ? 560 TRP A CG   14 
ATOM   8360  C  CD1  . TRP A 1 32 ? 8.877   8.933   3.811   1.00 0.00 ? 560 TRP A CD1  14 
ATOM   8361  C  CD2  . TRP A 1 32 ? 7.498   9.739   5.380   1.00 0.00 ? 560 TRP A CD2  14 
ATOM   8362  N  NE1  . TRP A 1 32 ? 8.992   10.302  3.809   1.00 0.00 ? 560 TRP A NE1  14 
ATOM   8363  C  CE2  . TRP A 1 32 ? 8.155   10.820  4.763   1.00 0.00 ? 560 TRP A CE2  14 
ATOM   8364  C  CE3  . TRP A 1 32 ? 6.579   10.003  6.400   1.00 0.00 ? 560 TRP A CE3  14 
ATOM   8365  C  CZ2  . TRP A 1 32 ? 7.923   12.142  5.133   1.00 0.00 ? 560 TRP A CZ2  14 
ATOM   8366  C  CZ3  . TRP A 1 32 ? 6.349   11.316  6.766   1.00 0.00 ? 560 TRP A CZ3  14 
ATOM   8367  C  CH2  . TRP A 1 32 ? 7.019   12.371  6.134   1.00 0.00 ? 560 TRP A CH2  14 
ATOM   8368  H  H    . TRP A 1 32 ? 8.375   4.728   5.076   1.00 0.00 ? 560 TRP A H    14 
ATOM   8369  H  HA   . TRP A 1 32 ? 9.272   7.093   6.364   1.00 0.00 ? 560 TRP A HA   14 
ATOM   8370  H  HB2  . TRP A 1 32 ? 7.685   6.541   4.187   1.00 0.00 ? 560 TRP A HB2  14 
ATOM   8371  H  HB3  . TRP A 1 32 ? 6.517   7.149   5.355   1.00 0.00 ? 560 TRP A HB3  14 
ATOM   8372  H  HD1  . TRP A 1 32 ? 9.416   8.255   3.166   1.00 0.00 ? 560 TRP A HD1  14 
ATOM   8373  H  HE1  . TRP A 1 32 ? 9.577   10.823  3.220   1.00 0.00 ? 560 TRP A HE1  14 
ATOM   8374  H  HE3  . TRP A 1 32 ? 6.053   9.202   6.899   1.00 0.00 ? 560 TRP A HE3  14 
ATOM   8375  H  HZ2  . TRP A 1 32 ? 8.431   12.967  4.655   1.00 0.00 ? 560 TRP A HZ2  14 
ATOM   8376  H  HZ3  . TRP A 1 32 ? 5.643   11.539  7.552   1.00 0.00 ? 560 TRP A HZ3  14 
ATOM   8377  H  HH2  . TRP A 1 32 ? 6.809   13.381  6.453   1.00 0.00 ? 560 TRP A HH2  14 
ATOM   8378  N  N    . HIS A 1 33 ? 6.590   5.620   7.596   1.00 0.00 ? 561 HIS A N    14 
ATOM   8379  C  CA   . HIS A 1 33 ? 5.741   5.527   8.777   1.00 0.00 ? 561 HIS A CA   14 
ATOM   8380  C  C    . HIS A 1 33 ? 6.572   5.243   10.024  1.00 0.00 ? 561 HIS A C    14 
ATOM   8381  O  O    . HIS A 1 33 ? 6.347   5.835   11.080  1.00 0.00 ? 561 HIS A O    14 
ATOM   8382  C  CB   . HIS A 1 33 ? 4.689   4.431   8.590   1.00 0.00 ? 561 HIS A CB   14 
ATOM   8383  C  CG   . HIS A 1 33 ? 3.511   4.866   7.775   1.00 0.00 ? 561 HIS A CG   14 
ATOM   8384  N  ND1  . HIS A 1 33 ? 2.450   5.584   8.282   1.00 0.00 ? 561 HIS A ND1  14 
ATOM   8385  C  CD2  . HIS A 1 33 ? 3.238   4.672   6.460   1.00 0.00 ? 561 HIS A CD2  14 
ATOM   8386  C  CE1  . HIS A 1 33 ? 1.584   5.798   7.282   1.00 0.00 ? 561 HIS A CE1  14 
ATOM   8387  N  NE2  . HIS A 1 33 ? 2.016   5.266   6.155   1.00 0.00 ? 561 HIS A NE2  14 
ATOM   8388  H  H    . HIS A 1 33 ? 6.441   5.002   6.850   1.00 0.00 ? 561 HIS A H    14 
ATOM   8389  H  HA   . HIS A 1 33 ? 5.240   6.475   8.901   1.00 0.00 ? 561 HIS A HA   14 
ATOM   8390  H  HB2  . HIS A 1 33 ? 5.143   3.588   8.092   1.00 0.00 ? 561 HIS A HB2  14 
ATOM   8391  H  HB3  . HIS A 1 33 ? 4.328   4.119   9.559   1.00 0.00 ? 561 HIS A HB3  14 
ATOM   8392  H  HD1  . HIS A 1 33 ? 2.347   5.884   9.209   1.00 0.00 ? 561 HIS A HD1  14 
ATOM   8393  H  HD2  . HIS A 1 33 ? 3.861   4.144   5.754   1.00 0.00 ? 561 HIS A HD2  14 
ATOM   8394  H  HE1  . HIS A 1 33 ? 0.654   6.338   7.385   1.00 0.00 ? 561 HIS A HE1  14 
ATOM   8395  N  N    . THR A 1 34 ? 7.533   4.335   9.894   1.00 0.00 ? 562 THR A N    14 
ATOM   8396  C  CA   . THR A 1 34 ? 8.398   3.973   11.011  1.00 0.00 ? 562 THR A CA   14 
ATOM   8397  C  C    . THR A 1 34 ? 9.432   5.064   11.272  1.00 0.00 ? 562 THR A C    14 
ATOM   8398  O  O    . THR A 1 34 ? 9.826   5.299   12.415  1.00 0.00 ? 562 THR A O    14 
ATOM   8399  C  CB   . THR A 1 34 ? 9.102   2.645   10.728  1.00 0.00 ? 562 THR A CB   14 
ATOM   8400  O  OG1  . THR A 1 34 ? 9.927   2.749   9.582   1.00 0.00 ? 562 THR A OG1  14 
ATOM   8401  C  CG2  . THR A 1 34 ? 8.144   1.496   10.501  1.00 0.00 ? 562 THR A CG2  14 
ATOM   8402  H  H    . THR A 1 34 ? 7.663   3.897   9.027   1.00 0.00 ? 562 THR A H    14 
ATOM   8403  H  HA   . THR A 1 34 ? 7.779   3.862   11.888  1.00 0.00 ? 562 THR A HA   14 
ATOM   8404  H  HB   . THR A 1 34 ? 9.726   2.392   11.573  1.00 0.00 ? 562 THR A HB   14 
ATOM   8405  H  HG1  . THR A 1 34 ? 10.361  1.908   9.421   1.00 0.00 ? 562 THR A HG1  14 
ATOM   8406  H  HG21 . THR A 1 34 ? 7.128   1.860   10.547  1.00 0.00 ? 562 THR A HG21 14 
ATOM   8407  H  HG22 . THR A 1 34 ? 8.293   0.747   11.264  1.00 0.00 ? 562 THR A HG22 14 
ATOM   8408  H  HG23 . THR A 1 34 ? 8.326   1.061   9.529   1.00 0.00 ? 562 THR A HG23 14 
ATOM   8409  N  N    . GLY A 1 35 ? 9.868   5.726   10.206  1.00 0.00 ? 563 GLY A N    14 
ATOM   8410  C  CA   . GLY A 1 35 ? 10.852  6.784   10.341  1.00 0.00 ? 563 GLY A CA   14 
ATOM   8411  C  C    . GLY A 1 35 ? 10.244  8.165   10.195  1.00 0.00 ? 563 GLY A C    14 
ATOM   8412  O  O    . GLY A 1 35 ? 10.168  8.703   9.091   1.00 0.00 ? 563 GLY A O    14 
ATOM   8413  H  H    . GLY A 1 35 ? 9.518   5.495   9.320   1.00 0.00 ? 563 GLY A H    14 
ATOM   8414  H  HA2  . GLY A 1 35 ? 11.315  6.707   11.314  1.00 0.00 ? 563 GLY A HA2  14 
ATOM   8415  H  HA3  . GLY A 1 35 ? 11.610  6.654   9.583   1.00 0.00 ? 563 GLY A HA3  14 
ATOM   8416  N  N    . GLU A 1 36 ? 9.811   8.739   11.312  1.00 0.00 ? 564 GLU A N    14 
ATOM   8417  C  CA   . GLU A 1 36 ? 9.207   10.067  11.306  1.00 0.00 ? 564 GLU A CA   14 
ATOM   8418  C  C    . GLU A 1 36 ? 10.097  11.072  12.031  1.00 0.00 ? 564 GLU A C    14 
ATOM   8419  O  O    . GLU A 1 36 ? 11.119  10.705  12.610  1.00 0.00 ? 564 GLU A O    14 
ATOM   8420  C  CB   . GLU A 1 36 ? 7.824   10.024  11.960  1.00 0.00 ? 564 GLU A CB   14 
ATOM   8421  C  CG   . GLU A 1 36 ? 6.759   10.779  11.180  1.00 0.00 ? 564 GLU A CG   14 
ATOM   8422  C  CD   . GLU A 1 36 ? 6.434   12.127  11.792  1.00 0.00 ? 564 GLU A CD   14 
ATOM   8423  O  OE1  . GLU A 1 36 ? 6.537   12.258  13.029  1.00 0.00 ? 564 GLU A OE1  14 
ATOM   8424  O  OE2  . GLU A 1 36 ? 6.078   13.053  11.033  1.00 0.00 ? 564 GLU A OE2  14 
ATOM   8425  H  H    . GLU A 1 36 ? 9.900   8.260   12.162  1.00 0.00 ? 564 GLU A H    14 
ATOM   8426  H  HA   . GLU A 1 36 ? 9.099   10.377  10.277  1.00 0.00 ? 564 GLU A HA   14 
ATOM   8427  H  HB2  . GLU A 1 36 ? 7.512   8.994   12.047  1.00 0.00 ? 564 GLU A HB2  14 
ATOM   8428  H  HB3  . GLU A 1 36 ? 7.890   10.456  12.947  1.00 0.00 ? 564 GLU A HB3  14 
ATOM   8429  H  HG2  . GLU A 1 36 ? 7.111   10.934  10.171  1.00 0.00 ? 564 GLU A HG2  14 
ATOM   8430  H  HG3  . GLU A 1 36 ? 5.858   10.184  11.158  1.00 0.00 ? 564 GLU A HG3  14 
ATOM   8431  N  N    . ARG A 1 37 ? 9.702   12.340  11.994  1.00 0.00 ? 565 ARG A N    14 
ATOM   8432  C  CA   . ARG A 1 37 ? 10.465  13.397  12.648  1.00 0.00 ? 565 ARG A CA   14 
ATOM   8433  C  C    . ARG A 1 37 ? 9.851   13.756  13.997  1.00 0.00 ? 565 ARG A C    14 
ATOM   8434  O  O    . ARG A 1 37 ? 8.998   12.984  14.482  1.00 0.00 ? 565 ARG A O    14 
ATOM   8435  C  CB   . ARG A 1 37 ? 10.527  14.638  11.756  1.00 0.00 ? 565 ARG A CB   14 
ATOM   8436  C  CG   . ARG A 1 37 ? 9.168   15.091  11.250  1.00 0.00 ? 565 ARG A CG   14 
ATOM   8437  C  CD   . ARG A 1 37 ? 9.226   16.502  10.686  1.00 0.00 ? 565 ARG A CD   14 
ATOM   8438  N  NE   . ARG A 1 37 ? 7.994   17.245  10.940  1.00 0.00 ? 565 ARG A NE   14 
ATOM   8439  C  CZ   . ARG A 1 37 ? 6.822   16.951  10.382  1.00 0.00 ? 565 ARG A CZ   14 
ATOM   8440  N  NH1  . ARG A 1 37 ? 6.718   15.932  9.538   1.00 0.00 ? 565 ARG A NH1  14 
ATOM   8441  N  NH2  . ARG A 1 37 ? 5.750   17.677  10.669  1.00 0.00 ? 565 ARG A NH2  14 
ATOM   8442  O  OXT  . ARG A 1 37 ? 10.229  14.806  14.558  1.00 0.00 ? 565 ARG A OXT  14 
ATOM   8443  H  H    . ARG A 1 37 ? 8.879   12.571  11.516  1.00 0.00 ? 565 ARG A H    14 
ATOM   8444  H  HA   . ARG A 1 37 ? 11.468  13.030  12.809  1.00 0.00 ? 565 ARG A HA   14 
ATOM   8445  H  HB2  . ARG A 1 37 ? 10.967  15.449  12.317  1.00 0.00 ? 565 ARG A HB2  14 
ATOM   8446  H  HB3  . ARG A 1 37 ? 11.152  14.423  10.902  1.00 0.00 ? 565 ARG A HB3  14 
ATOM   8447  H  HG2  . ARG A 1 37 ? 8.840   14.417  10.472  1.00 0.00 ? 565 ARG A HG2  14 
ATOM   8448  H  HG3  . ARG A 1 37 ? 8.464   15.069  12.069  1.00 0.00 ? 565 ARG A HG3  14 
ATOM   8449  H  HD2  . ARG A 1 37 ? 10.052  17.025  11.144  1.00 0.00 ? 565 ARG A HD2  14 
ATOM   8450  H  HD3  . ARG A 1 37 ? 9.386   16.443  9.619   1.00 0.00 ? 565 ARG A HD3  14 
ATOM   8451  H  HE   . ARG A 1 37 ? 8.043   18.003  11.560  1.00 0.00 ? 565 ARG A HE   14 
ATOM   8452  H  HH11 . ARG A 1 37 ? 7.522   15.380  9.317   1.00 0.00 ? 565 ARG A HH11 14 
ATOM   8453  H  HH12 . ARG A 1 37 ? 5.835   15.717  9.122   1.00 0.00 ? 565 ARG A HH12 14 
ATOM   8454  H  HH21 . ARG A 1 37 ? 5.822   18.445  11.305  1.00 0.00 ? 565 ARG A HH21 14 
ATOM   8455  H  HH22 . ARG A 1 37 ? 4.870   17.456  10.250  1.00 0.00 ? 565 ARG A HH22 14 
HETATM 8456  ZN ZN   . ZN  B 2 .  ? 0.750   5.409   4.594   1.00 0.00 ? 100 ZN  A ZN   14 
ATOM   8457  N  N    . MET A 1 1  ? -19.930 -11.019 -13.604 1.00 0.00 ? 1   MET A N    15 
ATOM   8458  C  CA   . MET A 1 1  ? -20.258 -12.028 -12.563 1.00 0.00 ? 1   MET A CA   15 
ATOM   8459  C  C    . MET A 1 1  ? -19.027 -12.390 -11.739 1.00 0.00 ? 1   MET A C    15 
ATOM   8460  O  O    . MET A 1 1  ? -19.034 -12.283 -10.513 1.00 0.00 ? 1   MET A O    15 
ATOM   8461  C  CB   . MET A 1 1  ? -20.820 -13.274 -13.252 1.00 0.00 ? 1   MET A CB   15 
ATOM   8462  C  CG   . MET A 1 1  ? -22.331 -13.399 -13.145 1.00 0.00 ? 1   MET A CG   15 
ATOM   8463  S  SD   . MET A 1 1  ? -23.183 -12.821 -14.625 1.00 0.00 ? 1   MET A SD   15 
ATOM   8464  C  CE   . MET A 1 1  ? -24.651 -13.846 -14.593 1.00 0.00 ? 1   MET A CE   15 
ATOM   8465  H  H1   . MET A 1 1  ? -19.256 -11.454 -14.266 1.00 0.00 ? 1   MET A H1   15 
ATOM   8466  H  H2   . MET A 1 1  ? -19.511 -10.196 -13.126 1.00 0.00 ? 1   MET A H2   15 
ATOM   8467  H  H3   . MET A 1 1  ? -20.815 -10.763 -14.087 1.00 0.00 ? 1   MET A H3   15 
ATOM   8468  H  HA   . MET A 1 1  ? -21.011 -11.614 -11.908 1.00 0.00 ? 1   MET A HA   15 
ATOM   8469  H  HB2  . MET A 1 1  ? -20.557 -13.242 -14.299 1.00 0.00 ? 1   MET A HB2  15 
ATOM   8470  H  HB3  . MET A 1 1  ? -20.376 -14.152 -12.805 1.00 0.00 ? 1   MET A HB3  15 
ATOM   8471  H  HG2  . MET A 1 1  ? -22.583 -14.437 -12.985 1.00 0.00 ? 1   MET A HG2  15 
ATOM   8472  H  HG3  . MET A 1 1  ? -22.668 -12.815 -12.301 1.00 0.00 ? 1   MET A HG3  15 
ATOM   8473  H  HE1  . MET A 1 1  ? -24.369 -14.883 -14.705 1.00 0.00 ? 1   MET A HE1  15 
ATOM   8474  H  HE2  . MET A 1 1  ? -25.307 -13.562 -15.402 1.00 0.00 ? 1   MET A HE2  15 
ATOM   8475  H  HE3  . MET A 1 1  ? -25.163 -13.712 -13.651 1.00 0.00 ? 1   MET A HE3  15 
ATOM   8476  N  N    . ASP A 1 2  ? -17.971 -12.820 -12.422 1.00 0.00 ? 530 ASP A N    15 
ATOM   8477  C  CA   . ASP A 1 2  ? -16.731 -13.200 -11.754 1.00 0.00 ? 530 ASP A CA   15 
ATOM   8478  C  C    . ASP A 1 2  ? -15.818 -11.987 -11.570 1.00 0.00 ? 530 ASP A C    15 
ATOM   8479  O  O    . ASP A 1 2  ? -15.403 -11.363 -12.546 1.00 0.00 ? 530 ASP A O    15 
ATOM   8480  C  CB   . ASP A 1 2  ? -16.005 -14.278 -12.561 1.00 0.00 ? 530 ASP A CB   15 
ATOM   8481  C  CG   . ASP A 1 2  ? -15.796 -13.874 -14.007 1.00 0.00 ? 530 ASP A CG   15 
ATOM   8482  O  OD1  . ASP A 1 2  ? -16.712 -14.101 -14.826 1.00 0.00 ? 530 ASP A OD1  15 
ATOM   8483  O  OD2  . ASP A 1 2  ? -14.716 -13.331 -14.322 1.00 0.00 ? 530 ASP A OD2  15 
ATOM   8484  H  H    . ASP A 1 2  ? -18.027 -12.885 -13.398 1.00 0.00 ? 530 ASP A H    15 
ATOM   8485  H  HA   . ASP A 1 2  ? -16.987 -13.599 -10.786 1.00 0.00 ? 530 ASP A HA   15 
ATOM   8486  H  HB2  . ASP A 1 2  ? -15.039 -14.463 -12.115 1.00 0.00 ? 530 ASP A HB2  15 
ATOM   8487  H  HB3  . ASP A 1 2  ? -16.587 -15.187 -12.540 1.00 0.00 ? 530 ASP A HB3  15 
ATOM   8488  N  N    . PRO A 1 3  ? -15.489 -11.635 -10.312 1.00 0.00 ? 531 PRO A N    15 
ATOM   8489  C  CA   . PRO A 1 3  ? -14.619 -10.491 -10.019 1.00 0.00 ? 531 PRO A CA   15 
ATOM   8490  C  C    . PRO A 1 3  ? -13.307 -10.552 -10.793 1.00 0.00 ? 531 PRO A C    15 
ATOM   8491  O  O    . PRO A 1 3  ? -12.707 -9.521  -11.100 1.00 0.00 ? 531 PRO A O    15 
ATOM   8492  C  CB   . PRO A 1 3  ? -14.359 -10.615 -8.516  1.00 0.00 ? 531 PRO A CB   15 
ATOM   8493  C  CG   . PRO A 1 3  ? -15.529 -11.370 -7.990  1.00 0.00 ? 531 PRO A CG   15 
ATOM   8494  C  CD   . PRO A 1 3  ? -15.934 -12.319 -9.083  1.00 0.00 ? 531 PRO A CD   15 
ATOM   8495  H  HA   . PRO A 1 3  ? -15.115 -9.554  -10.227 1.00 0.00 ? 531 PRO A HA   15 
ATOM   8496  H  HB2  . PRO A 1 3  ? -13.435 -11.149 -8.351  1.00 0.00 ? 531 PRO A HB2  15 
ATOM   8497  H  HB3  . PRO A 1 3  ? -14.296 -9.630  -8.076  1.00 0.00 ? 531 PRO A HB3  15 
ATOM   8498  H  HG2  . PRO A 1 3  ? -15.244 -11.919 -7.104  1.00 0.00 ? 531 PRO A HG2  15 
ATOM   8499  H  HG3  . PRO A 1 3  ? -16.337 -10.689 -7.767  1.00 0.00 ? 531 PRO A HG3  15 
ATOM   8500  H  HD2  . PRO A 1 3  ? -15.430 -13.268 -8.966  1.00 0.00 ? 531 PRO A HD2  15 
ATOM   8501  H  HD3  . PRO A 1 3  ? -17.005 -12.457 -9.086  1.00 0.00 ? 531 PRO A HD3  15 
ATOM   8502  N  N    . GLY A 1 4  ? -12.867 -11.766 -11.107 1.00 0.00 ? 532 GLY A N    15 
ATOM   8503  C  CA   . GLY A 1 4  ? -11.630 -11.940 -11.843 1.00 0.00 ? 532 GLY A CA   15 
ATOM   8504  C  C    . GLY A 1 4  ? -10.404 -11.763 -10.969 1.00 0.00 ? 532 GLY A C    15 
ATOM   8505  O  O    . GLY A 1 4  ? -10.232 -12.472 -9.978  1.00 0.00 ? 532 GLY A O    15 
ATOM   8506  H  H    . GLY A 1 4  ? -13.389 -12.551 -10.836 1.00 0.00 ? 532 GLY A H    15 
ATOM   8507  H  HA2  . GLY A 1 4  ? -11.614 -12.933 -12.269 1.00 0.00 ? 532 GLY A HA2  15 
ATOM   8508  H  HA3  . GLY A 1 4  ? -11.595 -11.216 -12.644 1.00 0.00 ? 532 GLY A HA3  15 
ATOM   8509  N  N    . LYS A 1 5  ? -9.550  -10.814 -11.338 1.00 0.00 ? 533 LYS A N    15 
ATOM   8510  C  CA   . LYS A 1 5  ? -8.333  -10.545 -10.581 1.00 0.00 ? 533 LYS A CA   15 
ATOM   8511  C  C    . LYS A 1 5  ? -8.472  -9.264  -9.765  1.00 0.00 ? 533 LYS A C    15 
ATOM   8512  O  O    . LYS A 1 5  ? -8.942  -8.244  -10.268 1.00 0.00 ? 533 LYS A O    15 
ATOM   8513  C  CB   . LYS A 1 5  ? -7.134  -10.434 -11.525 1.00 0.00 ? 533 LYS A CB   15 
ATOM   8514  C  CG   . LYS A 1 5  ? -7.291  -9.352  -12.582 1.00 0.00 ? 533 LYS A CG   15 
ATOM   8515  C  CD   . LYS A 1 5  ? -7.541  -9.946  -13.959 1.00 0.00 ? 533 LYS A CD   15 
ATOM   8516  C  CE   . LYS A 1 5  ? -8.190  -8.937  -14.893 1.00 0.00 ? 533 LYS A CE   15 
ATOM   8517  N  NZ   . LYS A 1 5  ? -7.623  -9.007  -16.268 1.00 0.00 ? 533 LYS A NZ   15 
ATOM   8518  H  H    . LYS A 1 5  ? -9.742  -10.282 -12.138 1.00 0.00 ? 533 LYS A H    15 
ATOM   8519  H  HA   . LYS A 1 5  ? -8.173  -11.372 -9.906  1.00 0.00 ? 533 LYS A HA   15 
ATOM   8520  H  HB2  . LYS A 1 5  ? -6.252  -10.214 -10.943 1.00 0.00 ? 533 LYS A HB2  15 
ATOM   8521  H  HB3  . LYS A 1 5  ? -6.997  -11.381 -12.026 1.00 0.00 ? 533 LYS A HB3  15 
ATOM   8522  H  HG2  . LYS A 1 5  ? -8.126  -8.722  -12.317 1.00 0.00 ? 533 LYS A HG2  15 
ATOM   8523  H  HG3  . LYS A 1 5  ? -6.387  -8.761  -12.613 1.00 0.00 ? 533 LYS A HG3  15 
ATOM   8524  H  HD2  . LYS A 1 5  ? -6.598  -10.258 -14.383 1.00 0.00 ? 533 LYS A HD2  15 
ATOM   8525  H  HD3  . LYS A 1 5  ? -8.193  -10.802 -13.859 1.00 0.00 ? 533 LYS A HD3  15 
ATOM   8526  H  HE2  . LYS A 1 5  ? -9.249  -9.138  -14.939 1.00 0.00 ? 533 LYS A HE2  15 
ATOM   8527  H  HE3  . LYS A 1 5  ? -8.030  -7.944  -14.497 1.00 0.00 ? 533 LYS A HE3  15 
ATOM   8528  H  HZ1  . LYS A 1 5  ? -7.618  -8.061  -16.701 1.00 0.00 ? 533 LYS A HZ1  15 
ATOM   8529  H  HZ2  . LYS A 1 5  ? -8.196  -9.643  -16.859 1.00 0.00 ? 533 LYS A HZ2  15 
ATOM   8530  H  HZ3  . LYS A 1 5  ? -6.648  -9.367  -16.235 1.00 0.00 ? 533 LYS A HZ3  15 
ATOM   8531  N  N    . LYS A 1 6  ? -8.059  -9.324  -8.503  1.00 0.00 ? 534 LYS A N    15 
ATOM   8532  C  CA   . LYS A 1 6  ? -8.137  -8.167  -7.618  1.00 0.00 ? 534 LYS A CA   15 
ATOM   8533  C  C    . LYS A 1 6  ? -6.805  -7.929  -6.916  1.00 0.00 ? 534 LYS A C    15 
ATOM   8534  O  O    . LYS A 1 6  ? -6.311  -8.791  -6.188  1.00 0.00 ? 534 LYS A O    15 
ATOM   8535  C  CB   . LYS A 1 6  ? -9.246  -8.366  -6.582  1.00 0.00 ? 534 LYS A CB   15 
ATOM   8536  C  CG   . LYS A 1 6  ? -10.592 -7.813  -7.019  1.00 0.00 ? 534 LYS A CG   15 
ATOM   8537  C  CD   . LYS A 1 6  ? -11.717 -8.322  -6.133  1.00 0.00 ? 534 LYS A CD   15 
ATOM   8538  C  CE   . LYS A 1 6  ? -12.813 -7.281  -5.971  1.00 0.00 ? 534 LYS A CE   15 
ATOM   8539  N  NZ   . LYS A 1 6  ? -13.531 -7.026  -7.251  1.00 0.00 ? 534 LYS A NZ   15 
ATOM   8540  H  H    . LYS A 1 6  ? -7.693  -10.165 -8.159  1.00 0.00 ? 534 LYS A H    15 
ATOM   8541  H  HA   . LYS A 1 6  ? -8.372  -7.304  -8.222  1.00 0.00 ? 534 LYS A HA   15 
ATOM   8542  H  HB2  . LYS A 1 6  ? -9.359  -9.423  -6.392  1.00 0.00 ? 534 LYS A HB2  15 
ATOM   8543  H  HB3  . LYS A 1 6  ? -8.959  -7.873  -5.665  1.00 0.00 ? 534 LYS A HB3  15 
ATOM   8544  H  HG2  . LYS A 1 6  ? -10.563 -6.735  -6.964  1.00 0.00 ? 534 LYS A HG2  15 
ATOM   8545  H  HG3  . LYS A 1 6  ? -10.782 -8.118  -8.038  1.00 0.00 ? 534 LYS A HG3  15 
ATOM   8546  H  HD2  . LYS A 1 6  ? -12.141 -9.209  -6.579  1.00 0.00 ? 534 LYS A HD2  15 
ATOM   8547  H  HD3  . LYS A 1 6  ? -11.315 -8.563  -5.160  1.00 0.00 ? 534 LYS A HD3  15 
ATOM   8548  H  HE2  . LYS A 1 6  ? -13.521 -7.633  -5.236  1.00 0.00 ? 534 LYS A HE2  15 
ATOM   8549  H  HE3  . LYS A 1 6  ? -12.367 -6.359  -5.628  1.00 0.00 ? 534 LYS A HE3  15 
ATOM   8550  H  HZ1  . LYS A 1 6  ? -12.863 -7.059  -8.048  1.00 0.00 ? 534 LYS A HZ1  15 
ATOM   8551  H  HZ2  . LYS A 1 6  ? -13.980 -6.089  -7.228  1.00 0.00 ? 534 LYS A HZ2  15 
ATOM   8552  H  HZ3  . LYS A 1 6  ? -14.266 -7.747  -7.398  1.00 0.00 ? 534 LYS A HZ3  15 
ATOM   8553  N  N    . LYS A 1 7  ? -6.227  -6.753  -7.139  1.00 0.00 ? 535 LYS A N    15 
ATOM   8554  C  CA   . LYS A 1 7  ? -4.951  -6.399  -6.528  1.00 0.00 ? 535 LYS A CA   15 
ATOM   8555  C  C    . LYS A 1 7  ? -4.886  -4.905  -6.230  1.00 0.00 ? 535 LYS A C    15 
ATOM   8556  O  O    . LYS A 1 7  ? -5.028  -4.076  -7.129  1.00 0.00 ? 535 LYS A O    15 
ATOM   8557  C  CB   . LYS A 1 7  ? -3.794  -6.800  -7.445  1.00 0.00 ? 535 LYS A CB   15 
ATOM   8558  C  CG   . LYS A 1 7  ? -3.523  -8.295  -7.464  1.00 0.00 ? 535 LYS A CG   15 
ATOM   8559  C  CD   . LYS A 1 7  ? -2.043  -8.591  -7.648  1.00 0.00 ? 535 LYS A CD   15 
ATOM   8560  C  CE   . LYS A 1 7  ? -1.748  -10.074 -7.494  1.00 0.00 ? 535 LYS A CE   15 
ATOM   8561  N  NZ   . LYS A 1 7  ? -1.225  -10.399 -6.139  1.00 0.00 ? 535 LYS A NZ   15 
ATOM   8562  H  H    . LYS A 1 7  ? -6.669  -6.107  -7.729  1.00 0.00 ? 535 LYS A H    15 
ATOM   8563  H  HA   . LYS A 1 7  ? -4.867  -6.943  -5.599  1.00 0.00 ? 535 LYS A HA   15 
ATOM   8564  H  HB2  . LYS A 1 7  ? -4.022  -6.484  -8.452  1.00 0.00 ? 535 LYS A HB2  15 
ATOM   8565  H  HB3  . LYS A 1 7  ? -2.897  -6.298  -7.113  1.00 0.00 ? 535 LYS A HB3  15 
ATOM   8566  H  HG2  . LYS A 1 7  ? -3.852  -8.723  -6.529  1.00 0.00 ? 535 LYS A HG2  15 
ATOM   8567  H  HG3  . LYS A 1 7  ? -4.074  -8.740  -8.280  1.00 0.00 ? 535 LYS A HG3  15 
ATOM   8568  H  HD2  . LYS A 1 7  ? -1.743  -8.275  -8.636  1.00 0.00 ? 535 LYS A HD2  15 
ATOM   8569  H  HD3  . LYS A 1 7  ? -1.482  -8.042  -6.906  1.00 0.00 ? 535 LYS A HD3  15 
ATOM   8570  H  HE2  . LYS A 1 7  ? -2.659  -10.629 -7.661  1.00 0.00 ? 535 LYS A HE2  15 
ATOM   8571  H  HE3  . LYS A 1 7  ? -1.013  -10.360 -8.233  1.00 0.00 ? 535 LYS A HE3  15 
ATOM   8572  H  HZ1  . LYS A 1 7  ? -0.782  -11.340 -6.142  1.00 0.00 ? 535 LYS A HZ1  15 
ATOM   8573  H  HZ2  . LYS A 1 7  ? -2.000  -10.396 -5.446  1.00 0.00 ? 535 LYS A HZ2  15 
ATOM   8574  H  HZ3  . LYS A 1 7  ? -0.516  -9.694  -5.851  1.00 0.00 ? 535 LYS A HZ3  15 
ATOM   8575  N  N    . GLN A 1 8  ? -4.669  -4.568  -4.963  1.00 0.00 ? 536 GLN A N    15 
ATOM   8576  C  CA   . GLN A 1 8  ? -4.585  -3.173  -4.547  1.00 0.00 ? 536 GLN A CA   15 
ATOM   8577  C  C    . GLN A 1 8  ? -3.721  -3.031  -3.298  1.00 0.00 ? 536 GLN A C    15 
ATOM   8578  O  O    . GLN A 1 8  ? -3.830  -3.823  -2.362  1.00 0.00 ? 536 GLN A O    15 
ATOM   8579  C  CB   . GLN A 1 8  ? -5.983  -2.613  -4.281  1.00 0.00 ? 536 GLN A CB   15 
ATOM   8580  C  CG   . GLN A 1 8  ? -6.809  -3.466  -3.331  1.00 0.00 ? 536 GLN A CG   15 
ATOM   8581  C  CD   . GLN A 1 8  ? -8.293  -3.412  -3.640  1.00 0.00 ? 536 GLN A CD   15 
ATOM   8582  O  OE1  . GLN A 1 8  ? -8.697  -3.014  -4.732  1.00 0.00 ? 536 GLN A OE1  15 
ATOM   8583  N  NE2  . GLN A 1 8  ? -9.113  -3.814  -2.676  1.00 0.00 ? 536 GLN A NE2  15 
ATOM   8584  H  H    . GLN A 1 8  ? -4.564  -5.275  -4.292  1.00 0.00 ? 536 GLN A H    15 
ATOM   8585  H  HA   . GLN A 1 8  ? -4.130  -2.615  -5.351  1.00 0.00 ? 536 GLN A HA   15 
ATOM   8586  H  HB2  . GLN A 1 8  ? -5.888  -1.626  -3.853  1.00 0.00 ? 536 GLN A HB2  15 
ATOM   8587  H  HB3  . GLN A 1 8  ? -6.514  -2.540  -5.219  1.00 0.00 ? 536 GLN A HB3  15 
ATOM   8588  H  HG2  . GLN A 1 8  ? -6.479  -4.491  -3.408  1.00 0.00 ? 536 GLN A HG2  15 
ATOM   8589  H  HG3  . GLN A 1 8  ? -6.653  -3.113  -2.323  1.00 0.00 ? 536 GLN A HG3  15 
ATOM   8590  H  HE21 . GLN A 1 8  ? -8.720  -4.118  -1.831  1.00 0.00 ? 536 GLN A HE21 15 
ATOM   8591  H  HE22 . GLN A 1 8  ? -10.077 -3.789  -2.848  1.00 0.00 ? 536 GLN A HE22 15 
ATOM   8592  N  N    . HIS A 1 9  ? -2.862  -2.017  -3.291  1.00 0.00 ? 537 HIS A N    15 
ATOM   8593  C  CA   . HIS A 1 9  ? -1.979  -1.772  -2.157  1.00 0.00 ? 537 HIS A CA   15 
ATOM   8594  C  C    . HIS A 1 9  ? -2.500  -0.624  -1.297  1.00 0.00 ? 537 HIS A C    15 
ATOM   8595  O  O    . HIS A 1 9  ? -2.373  0.545   -1.661  1.00 0.00 ? 537 HIS A O    15 
ATOM   8596  C  CB   . HIS A 1 9  ? -0.564  -1.457  -2.645  1.00 0.00 ? 537 HIS A CB   15 
ATOM   8597  C  CG   . HIS A 1 9  ? 0.200   -2.667  -3.086  1.00 0.00 ? 537 HIS A CG   15 
ATOM   8598  N  ND1  . HIS A 1 9  ? -0.119  -3.955  -2.719  1.00 0.00 ? 537 HIS A ND1  15 
ATOM   8599  C  CD2  . HIS A 1 9  ? 1.293   -2.766  -3.886  1.00 0.00 ? 537 HIS A CD2  15 
ATOM   8600  C  CE1  . HIS A 1 9  ? 0.769   -4.778  -3.291  1.00 0.00 ? 537 HIS A CE1  15 
ATOM   8601  N  NE2  . HIS A 1 9  ? 1.647   -4.107  -4.011  1.00 0.00 ? 537 HIS A NE2  15 
ATOM   8602  H  H    . HIS A 1 9  ? -2.821  -1.419  -4.067  1.00 0.00 ? 537 HIS A H    15 
ATOM   8603  H  HA   . HIS A 1 9  ? -1.952  -2.670  -1.558  1.00 0.00 ? 537 HIS A HA   15 
ATOM   8604  H  HB2  . HIS A 1 9  ? -0.621  -0.778  -3.482  1.00 0.00 ? 537 HIS A HB2  15 
ATOM   8605  H  HB3  . HIS A 1 9  ? -0.011  -0.988  -1.844  1.00 0.00 ? 537 HIS A HB3  15 
ATOM   8606  H  HD1  . HIS A 1 9  ? -0.864  -4.222  -2.140  1.00 0.00 ? 537 HIS A HD1  15 
ATOM   8607  H  HD2  . HIS A 1 9  ? 1.813   -1.944  -4.354  1.00 0.00 ? 537 HIS A HD2  15 
ATOM   8608  H  HE1  . HIS A 1 9  ? 0.766   -5.853  -3.179  1.00 0.00 ? 537 HIS A HE1  15 
ATOM   8609  N  N    . ILE A 1 10 ? -3.085  -0.967  -0.154  1.00 0.00 ? 538 ILE A N    15 
ATOM   8610  C  CA   . ILE A 1 10 ? -3.624  0.033   0.759   1.00 0.00 ? 538 ILE A CA   15 
ATOM   8611  C  C    . ILE A 1 10 ? -2.813  0.085   2.050   1.00 0.00 ? 538 ILE A C    15 
ATOM   8612  O  O    . ILE A 1 10 ? -2.478  -0.950  2.626   1.00 0.00 ? 538 ILE A O    15 
ATOM   8613  C  CB   . ILE A 1 10 ? -5.099  -0.253  1.102   1.00 0.00 ? 538 ILE A CB   15 
ATOM   8614  C  CG1  . ILE A 1 10 ? -5.913  -0.465  -0.176  1.00 0.00 ? 538 ILE A CG1  15 
ATOM   8615  C  CG2  . ILE A 1 10 ? -5.684  0.885   1.925   1.00 0.00 ? 538 ILE A CG2  15 
ATOM   8616  C  CD1  . ILE A 1 10 ? -7.029  -1.475  -0.021  1.00 0.00 ? 538 ILE A CD1  15 
ATOM   8617  H  H    . ILE A 1 10 ? -3.155  -1.916  0.081   1.00 0.00 ? 538 ILE A H    15 
ATOM   8618  H  HA   . ILE A 1 10 ? -3.569  0.996   0.271   1.00 0.00 ? 538 ILE A HA   15 
ATOM   8619  H  HB   . ILE A 1 10 ? -5.138  -1.153  1.698   1.00 0.00 ? 538 ILE A HB   15 
ATOM   8620  H  HG12 . ILE A 1 10 ? -6.356  0.474   -0.473  1.00 0.00 ? 538 ILE A HG12 15 
ATOM   8621  H  HG13 . ILE A 1 10 ? -5.257  -0.812  -0.961  1.00 0.00 ? 538 ILE A HG13 15 
ATOM   8622  H  HG21 . ILE A 1 10 ? -4.884  1.438   2.394   1.00 0.00 ? 538 ILE A HG21 15 
ATOM   8623  H  HG22 . ILE A 1 10 ? -6.337  0.481   2.685   1.00 0.00 ? 538 ILE A HG22 15 
ATOM   8624  H  HG23 . ILE A 1 10 ? -6.247  1.543   1.280   1.00 0.00 ? 538 ILE A HG23 15 
ATOM   8625  H  HD11 . ILE A 1 10 ? -6.656  -2.462  -0.254  1.00 0.00 ? 538 ILE A HD11 15 
ATOM   8626  H  HD12 . ILE A 1 10 ? -7.835  -1.226  -0.695  1.00 0.00 ? 538 ILE A HD12 15 
ATOM   8627  H  HD13 . ILE A 1 10 ? -7.391  -1.458  0.996   1.00 0.00 ? 538 ILE A HD13 15 
ATOM   8628  N  N    . CYS A 1 11 ? -2.500  1.296   2.499   1.00 0.00 ? 539 CYS A N    15 
ATOM   8629  C  CA   . CYS A 1 11 ? -1.726  1.481   3.721   1.00 0.00 ? 539 CYS A CA   15 
ATOM   8630  C  C    . CYS A 1 11 ? -2.489  0.959   4.934   1.00 0.00 ? 539 CYS A C    15 
ATOM   8631  O  O    . CYS A 1 11 ? -3.283  1.680   5.538   1.00 0.00 ? 539 CYS A O    15 
ATOM   8632  C  CB   . CYS A 1 11 ? -1.384  2.960   3.918   1.00 0.00 ? 539 CYS A CB   15 
ATOM   8633  S  SG   . CYS A 1 11 ? 0.373   3.280   4.197   1.00 0.00 ? 539 CYS A SG   15 
ATOM   8634  H  H    . CYS A 1 11 ? -2.794  2.084   1.995   1.00 0.00 ? 539 CYS A H    15 
ATOM   8635  H  HA   . CYS A 1 11 ? -0.809  0.920   3.620   1.00 0.00 ? 539 CYS A HA   15 
ATOM   8636  H  HB2  . CYS A 1 11 ? -1.681  3.511   3.038   1.00 0.00 ? 539 CYS A HB2  15 
ATOM   8637  H  HB3  . CYS A 1 11 ? -1.927  3.338   4.772   1.00 0.00 ? 539 CYS A HB3  15 
ATOM   8638  N  N    . HIS A 1 12 ? -2.239  -0.298  5.290   1.00 0.00 ? 540 HIS A N    15 
ATOM   8639  C  CA   . HIS A 1 12 ? -2.900  -0.911  6.436   1.00 0.00 ? 540 HIS A CA   15 
ATOM   8640  C  C    . HIS A 1 12 ? -2.646  -0.101  7.705   1.00 0.00 ? 540 HIS A C    15 
ATOM   8641  O  O    . HIS A 1 12 ? -3.434  -0.146  8.650   1.00 0.00 ? 540 HIS A O    15 
ATOM   8642  C  CB   . HIS A 1 12 ? -2.408  -2.347  6.627   1.00 0.00 ? 540 HIS A CB   15 
ATOM   8643  C  CG   . HIS A 1 12 ? -2.995  -3.316  5.648   1.00 0.00 ? 540 HIS A CG   15 
ATOM   8644  N  ND1  . HIS A 1 12 ? -2.371  -3.704  4.483   1.00 0.00 ? 540 HIS A ND1  15 
ATOM   8645  C  CD2  . HIS A 1 12 ? -4.178  -3.982  5.679   1.00 0.00 ? 540 HIS A CD2  15 
ATOM   8646  C  CE1  . HIS A 1 12 ? -3.176  -4.573  3.855   1.00 0.00 ? 540 HIS A CE1  15 
ATOM   8647  N  NE2  . HIS A 1 12 ? -4.285  -4.776  4.540   1.00 0.00 ? 540 HIS A NE2  15 
ATOM   8648  H  H    . HIS A 1 12 ? -1.593  -0.822  4.772   1.00 0.00 ? 540 HIS A H    15 
ATOM   8649  H  HA   . HIS A 1 12 ? -3.961  -0.926  6.239   1.00 0.00 ? 540 HIS A HA   15 
ATOM   8650  H  HB2  . HIS A 1 12 ? -1.335  -2.371  6.513   1.00 0.00 ? 540 HIS A HB2  15 
ATOM   8651  H  HB3  . HIS A 1 12 ? -2.667  -2.680  7.621   1.00 0.00 ? 540 HIS A HB3  15 
ATOM   8652  H  HD1  . HIS A 1 12 ? -1.495  -3.398  4.168   1.00 0.00 ? 540 HIS A HD1  15 
ATOM   8653  H  HD2  . HIS A 1 12 ? -4.923  -3.914  6.457   1.00 0.00 ? 540 HIS A HD2  15 
ATOM   8654  H  HE1  . HIS A 1 12 ? -2.946  -5.046  2.912   1.00 0.00 ? 540 HIS A HE1  15 
ATOM   8655  N  N    . ILE A 1 13 ? -1.541  0.639   7.716   1.00 0.00 ? 541 ILE A N    15 
ATOM   8656  C  CA   . ILE A 1 13 ? -1.181  1.462   8.864   1.00 0.00 ? 541 ILE A CA   15 
ATOM   8657  C  C    . ILE A 1 13 ? -2.152  2.627   9.029   1.00 0.00 ? 541 ILE A C    15 
ATOM   8658  O  O    . ILE A 1 13 ? -2.865  2.991   8.094   1.00 0.00 ? 541 ILE A O    15 
ATOM   8659  C  CB   . ILE A 1 13 ? 0.252   2.016   8.730   1.00 0.00 ? 541 ILE A CB   15 
ATOM   8660  C  CG1  . ILE A 1 13 ? 1.210   0.919   8.256   1.00 0.00 ? 541 ILE A CG1  15 
ATOM   8661  C  CG2  . ILE A 1 13 ? 0.721   2.600   10.054  1.00 0.00 ? 541 ILE A CG2  15 
ATOM   8662  C  CD1  . ILE A 1 13 ? 1.846   1.212   6.914   1.00 0.00 ? 541 ILE A CD1  15 
ATOM   8663  H  H    . ILE A 1 13 ? -0.954  0.633   6.932   1.00 0.00 ? 541 ILE A H    15 
ATOM   8664  H  HA   . ILE A 1 13 ? -1.225  0.841   9.747   1.00 0.00 ? 541 ILE A HA   15 
ATOM   8665  H  HB   . ILE A 1 13 ? 0.238   2.811   8.000   1.00 0.00 ? 541 ILE A HB   15 
ATOM   8666  H  HG12 . ILE A 1 13 ? 2.003   0.802   8.979   1.00 0.00 ? 541 ILE A HG12 15 
ATOM   8667  H  HG13 . ILE A 1 13 ? 0.669   -0.012  8.170   1.00 0.00 ? 541 ILE A HG13 15 
ATOM   8668  H  HG21 . ILE A 1 13 ? 0.240   2.078   10.868  1.00 0.00 ? 541 ILE A HG21 15 
ATOM   8669  H  HG22 . ILE A 1 13 ? 0.464   3.648   10.096  1.00 0.00 ? 541 ILE A HG22 15 
ATOM   8670  H  HG23 . ILE A 1 13 ? 1.791   2.489   10.138  1.00 0.00 ? 541 ILE A HG23 15 
ATOM   8671  H  HD11 . ILE A 1 13 ? 1.309   2.012   6.428   1.00 0.00 ? 541 ILE A HD11 15 
ATOM   8672  H  HD12 . ILE A 1 13 ? 1.809   0.326   6.297   1.00 0.00 ? 541 ILE A HD12 15 
ATOM   8673  H  HD13 . ILE A 1 13 ? 2.875   1.505   7.061   1.00 0.00 ? 541 ILE A HD13 15 
ATOM   8674  N  N    . GLN A 1 14 ? -2.175  3.208   10.224  1.00 0.00 ? 542 GLN A N    15 
ATOM   8675  C  CA   . GLN A 1 14 ? -3.058  4.330   10.515  1.00 0.00 ? 542 GLN A CA   15 
ATOM   8676  C  C    . GLN A 1 14 ? -2.628  5.594   9.769   1.00 0.00 ? 542 GLN A C    15 
ATOM   8677  O  O    . GLN A 1 14 ? -3.353  6.588   9.754   1.00 0.00 ? 542 GLN A O    15 
ATOM   8678  C  CB   . GLN A 1 14 ? -3.088  4.601   12.020  1.00 0.00 ? 542 GLN A CB   15 
ATOM   8679  C  CG   . GLN A 1 14 ? -4.021  3.678   12.786  1.00 0.00 ? 542 GLN A CG   15 
ATOM   8680  C  CD   . GLN A 1 14 ? -3.292  2.515   13.429  1.00 0.00 ? 542 GLN A CD   15 
ATOM   8681  O  OE1  . GLN A 1 14 ? -2.339  1.976   12.866  1.00 0.00 ? 542 GLN A OE1  15 
ATOM   8682  N  NE2  . GLN A 1 14 ? -3.738  2.120   14.616  1.00 0.00 ? 542 GLN A NE2  15 
ATOM   8683  H  H    . GLN A 1 14 ? -1.586  2.872   10.929  1.00 0.00 ? 542 GLN A H    15 
ATOM   8684  H  HA   . GLN A 1 14 ? -4.049  4.058   10.192  1.00 0.00 ? 542 GLN A HA   15 
ATOM   8685  H  HB2  . GLN A 1 14 ? -2.091  4.479   12.416  1.00 0.00 ? 542 GLN A HB2  15 
ATOM   8686  H  HB3  . GLN A 1 14 ? -3.409  5.619   12.185  1.00 0.00 ? 542 GLN A HB3  15 
ATOM   8687  H  HG2  . GLN A 1 14 ? -4.514  4.246   13.561  1.00 0.00 ? 542 GLN A HG2  15 
ATOM   8688  H  HG3  . GLN A 1 14 ? -4.761  3.287   12.102  1.00 0.00 ? 542 GLN A HG3  15 
ATOM   8689  H  HE21 . GLN A 1 14 ? -4.502  2.595   15.005  1.00 0.00 ? 542 GLN A HE21 15 
ATOM   8690  H  HE22 . GLN A 1 14 ? -3.285  1.370   15.055  1.00 0.00 ? 542 GLN A HE22 15 
ATOM   8691  N  N    . GLY A 1 15 ? -1.446  5.555   9.155   1.00 0.00 ? 543 GLY A N    15 
ATOM   8692  C  CA   . GLY A 1 15 ? -0.950  6.708   8.424   1.00 0.00 ? 543 GLY A CA   15 
ATOM   8693  C  C    . GLY A 1 15 ? -1.934  7.215   7.386   1.00 0.00 ? 543 GLY A C    15 
ATOM   8694  O  O    . GLY A 1 15 ? -2.894  7.910   7.719   1.00 0.00 ? 543 GLY A O    15 
ATOM   8695  H  H    . GLY A 1 15 ? -0.906  4.741   9.201   1.00 0.00 ? 543 GLY A H    15 
ATOM   8696  H  HA2  . GLY A 1 15 ? -0.744  7.503   9.125   1.00 0.00 ? 543 GLY A HA2  15 
ATOM   8697  H  HA3  . GLY A 1 15 ? -0.030  6.436   7.927   1.00 0.00 ? 543 GLY A HA3  15 
ATOM   8698  N  N    . CYS A 1 16 ? -1.695  6.868   6.125   1.00 0.00 ? 544 CYS A N    15 
ATOM   8699  C  CA   . CYS A 1 16 ? -2.569  7.296   5.038   1.00 0.00 ? 544 CYS A CA   15 
ATOM   8700  C  C    . CYS A 1 16 ? -3.344  6.113   4.463   1.00 0.00 ? 544 CYS A C    15 
ATOM   8701  O  O    . CYS A 1 16 ? -3.361  5.028   5.044   1.00 0.00 ? 544 CYS A O    15 
ATOM   8702  C  CB   . CYS A 1 16 ? -1.751  7.979   3.936   1.00 0.00 ? 544 CYS A CB   15 
ATOM   8703  S  SG   . CYS A 1 16 ? -0.697  6.860   2.983   1.00 0.00 ? 544 CYS A SG   15 
ATOM   8704  H  H    . CYS A 1 16 ? -0.913  6.314   5.921   1.00 0.00 ? 544 CYS A H    15 
ATOM   8705  H  HA   . CYS A 1 16 ? -3.273  8.007   5.442   1.00 0.00 ? 544 CYS A HA   15 
ATOM   8706  H  HB2  . CYS A 1 16 ? -2.426  8.460   3.244   1.00 0.00 ? 544 CYS A HB2  15 
ATOM   8707  H  HB3  . CYS A 1 16 ? -1.114  8.727   4.385   1.00 0.00 ? 544 CYS A HB3  15 
ATOM   8708  N  N    . GLY A 1 17 ? -3.984  6.331   3.318   1.00 0.00 ? 545 GLY A N    15 
ATOM   8709  C  CA   . GLY A 1 17 ? -4.751  5.276   2.684   1.00 0.00 ? 545 GLY A CA   15 
ATOM   8710  C  C    . GLY A 1 17 ? -4.718  5.366   1.171   1.00 0.00 ? 545 GLY A C    15 
ATOM   8711  O  O    . GLY A 1 17 ? -5.667  4.963   0.497   1.00 0.00 ? 545 GLY A O    15 
ATOM   8712  H  H    . GLY A 1 17 ? -3.934  7.217   2.901   1.00 0.00 ? 545 GLY A H    15 
ATOM   8713  H  HA2  . GLY A 1 17 ? -4.346  4.321   2.985   1.00 0.00 ? 545 GLY A HA2  15 
ATOM   8714  H  HA3  . GLY A 1 17 ? -5.776  5.341   3.015   1.00 0.00 ? 545 GLY A HA3  15 
ATOM   8715  N  N    . LYS A 1 18 ? -3.623  5.896   0.636   1.00 0.00 ? 546 LYS A N    15 
ATOM   8716  C  CA   . LYS A 1 18 ? -3.468  6.040   -0.806  1.00 0.00 ? 546 LYS A CA   15 
ATOM   8717  C  C    . LYS A 1 18 ? -3.520  4.681   -1.497  1.00 0.00 ? 546 LYS A C    15 
ATOM   8718  O  O    . LYS A 1 18 ? -3.831  3.667   -0.872  1.00 0.00 ? 546 LYS A O    15 
ATOM   8719  C  CB   . LYS A 1 18 ? -2.148  6.743   -1.130  1.00 0.00 ? 546 LYS A CB   15 
ATOM   8720  C  CG   . LYS A 1 18 ? -0.918  5.938   -0.744  1.00 0.00 ? 546 LYS A CG   15 
ATOM   8721  C  CD   . LYS A 1 18 ? 0.224   6.841   -0.306  1.00 0.00 ? 546 LYS A CD   15 
ATOM   8722  C  CE   . LYS A 1 18 ? 0.848   7.568   -1.487  1.00 0.00 ? 546 LYS A CE   15 
ATOM   8723  N  NZ   . LYS A 1 18 ? 0.742   9.047   -1.348  1.00 0.00 ? 546 LYS A NZ   15 
ATOM   8724  H  H    . LYS A 1 18 ? -2.902  6.199   1.227   1.00 0.00 ? 546 LYS A H    15 
ATOM   8725  H  HA   . LYS A 1 18 ? -4.286  6.645   -1.168  1.00 0.00 ? 546 LYS A HA   15 
ATOM   8726  H  HB2  . LYS A 1 18 ? -2.107  6.936   -2.192  1.00 0.00 ? 546 LYS A HB2  15 
ATOM   8727  H  HB3  . LYS A 1 18 ? -2.116  7.684   -0.601  1.00 0.00 ? 546 LYS A HB3  15 
ATOM   8728  H  HG2  . LYS A 1 18 ? -1.174  5.277   0.070   1.00 0.00 ? 546 LYS A HG2  15 
ATOM   8729  H  HG3  . LYS A 1 18 ? -0.599  5.356   -1.596  1.00 0.00 ? 546 LYS A HG3  15 
ATOM   8730  H  HD2  . LYS A 1 18 ? -0.156  7.571   0.393   1.00 0.00 ? 546 LYS A HD2  15 
ATOM   8731  H  HD3  . LYS A 1 18 ? 0.981   6.239   0.176   1.00 0.00 ? 546 LYS A HD3  15 
ATOM   8732  H  HE2  . LYS A 1 18 ? 1.891   7.296   -1.550  1.00 0.00 ? 546 LYS A HE2  15 
ATOM   8733  H  HE3  . LYS A 1 18 ? 0.342   7.262   -2.391  1.00 0.00 ? 546 LYS A HE3  15 
ATOM   8734  H  HZ1  . LYS A 1 18 ? -0.142  9.297   -0.860  1.00 0.00 ? 546 LYS A HZ1  15 
ATOM   8735  H  HZ2  . LYS A 1 18 ? 0.746   9.495   -2.286  1.00 0.00 ? 546 LYS A HZ2  15 
ATOM   8736  H  HZ3  . LYS A 1 18 ? 1.545   9.412   -0.798  1.00 0.00 ? 546 LYS A HZ3  15 
ATOM   8737  N  N    . VAL A 1 19 ? -3.215  4.666   -2.791  1.00 0.00 ? 547 VAL A N    15 
ATOM   8738  C  CA   . VAL A 1 19 ? -3.228  3.431   -3.566  1.00 0.00 ? 547 VAL A CA   15 
ATOM   8739  C  C    . VAL A 1 19 ? -1.886  3.197   -4.251  1.00 0.00 ? 547 VAL A C    15 
ATOM   8740  O  O    . VAL A 1 19 ? -1.117  4.134   -4.470  1.00 0.00 ? 547 VAL A O    15 
ATOM   8741  C  CB   . VAL A 1 19 ? -4.338  3.449   -4.632  1.00 0.00 ? 547 VAL A CB   15 
ATOM   8742  C  CG1  . VAL A 1 19 ? -4.466  2.085   -5.294  1.00 0.00 ? 547 VAL A CG1  15 
ATOM   8743  C  CG2  . VAL A 1 19 ? -5.662  3.878   -4.018  1.00 0.00 ? 547 VAL A CG2  15 
ATOM   8744  H  H    . VAL A 1 19 ? -2.975  5.506   -3.235  1.00 0.00 ? 547 VAL A H    15 
ATOM   8745  H  HA   . VAL A 1 19 ? -3.422  2.614   -2.887  1.00 0.00 ? 547 VAL A HA   15 
ATOM   8746  H  HB   . VAL A 1 19 ? -4.069  4.168   -5.392  1.00 0.00 ? 547 VAL A HB   15 
ATOM   8747  H  HG11 . VAL A 1 19 ? -5.451  1.985   -5.725  1.00 0.00 ? 547 VAL A HG11 15 
ATOM   8748  H  HG12 . VAL A 1 19 ? -4.316  1.311   -4.555  1.00 0.00 ? 547 VAL A HG12 15 
ATOM   8749  H  HG13 . VAL A 1 19 ? -3.722  1.990   -6.070  1.00 0.00 ? 547 VAL A HG13 15 
ATOM   8750  H  HG21 . VAL A 1 19 ? -5.496  4.712   -3.352  1.00 0.00 ? 547 VAL A HG21 15 
ATOM   8751  H  HG22 . VAL A 1 19 ? -6.086  3.054   -3.464  1.00 0.00 ? 547 VAL A HG22 15 
ATOM   8752  H  HG23 . VAL A 1 19 ? -6.344  4.174   -4.802  1.00 0.00 ? 547 VAL A HG23 15 
ATOM   8753  N  N    . TYR A 1 20 ? -1.610  1.941   -4.586  1.00 0.00 ? 548 TYR A N    15 
ATOM   8754  C  CA   . TYR A 1 20 ? -0.361  1.582   -5.247  1.00 0.00 ? 548 TYR A CA   15 
ATOM   8755  C  C    . TYR A 1 20 ? -0.493  0.245   -5.969  1.00 0.00 ? 548 TYR A C    15 
ATOM   8756  O  O    . TYR A 1 20 ? -1.323  -0.588  -5.605  1.00 0.00 ? 548 TYR A O    15 
ATOM   8757  C  CB   . TYR A 1 20 ? 0.778   1.512   -4.228  1.00 0.00 ? 548 TYR A CB   15 
ATOM   8758  C  CG   . TYR A 1 20 ? 1.489   2.830   -4.020  1.00 0.00 ? 548 TYR A CG   15 
ATOM   8759  C  CD1  . TYR A 1 20 ? 2.317   3.358   -5.003  1.00 0.00 ? 548 TYR A CD1  15 
ATOM   8760  C  CD2  . TYR A 1 20 ? 1.333   3.547   -2.840  1.00 0.00 ? 548 TYR A CD2  15 
ATOM   8761  C  CE1  . TYR A 1 20 ? 2.970   4.562   -4.816  1.00 0.00 ? 548 TYR A CE1  15 
ATOM   8762  C  CE2  . TYR A 1 20 ? 1.982   4.751   -2.645  1.00 0.00 ? 548 TYR A CE2  15 
ATOM   8763  C  CZ   . TYR A 1 20 ? 2.799   5.254   -3.636  1.00 0.00 ? 548 TYR A CZ   15 
ATOM   8764  O  OH   . TYR A 1 20 ? 3.446   6.453   -3.446  1.00 0.00 ? 548 TYR A OH   15 
ATOM   8765  H  H    . TYR A 1 20 ? -2.263  1.239   -4.385  1.00 0.00 ? 548 TYR A H    15 
ATOM   8766  H  HA   . TYR A 1 20 ? -0.137  2.350   -5.972  1.00 0.00 ? 548 TYR A HA   15 
ATOM   8767  H  HB2  . TYR A 1 20 ? 0.379   1.197   -3.275  1.00 0.00 ? 548 TYR A HB2  15 
ATOM   8768  H  HB3  . TYR A 1 20 ? 1.507   0.790   -4.564  1.00 0.00 ? 548 TYR A HB3  15 
ATOM   8769  H  HD1  . TYR A 1 20 ? 2.449   2.813   -5.926  1.00 0.00 ? 548 TYR A HD1  15 
ATOM   8770  H  HD2  . TYR A 1 20 ? 0.693   3.150   -2.065  1.00 0.00 ? 548 TYR A HD2  15 
ATOM   8771  H  HE1  . TYR A 1 20 ? 3.609   4.955   -5.592  1.00 0.00 ? 548 TYR A HE1  15 
ATOM   8772  H  HE2  . TYR A 1 20 ? 1.848   5.293   -1.721  1.00 0.00 ? 548 TYR A HE2  15 
ATOM   8773  H  HH   . TYR A 1 20 ? 2.939   7.160   -3.852  1.00 0.00 ? 548 TYR A HH   15 
ATOM   8774  N  N    . GLY A 1 21 ? 0.330   0.046   -6.993  1.00 0.00 ? 549 GLY A N    15 
ATOM   8775  C  CA   . GLY A 1 21 ? 0.288   -1.193  -7.749  1.00 0.00 ? 549 GLY A CA   15 
ATOM   8776  C  C    . GLY A 1 21 ? 1.625   -1.910  -7.771  1.00 0.00 ? 549 GLY A C    15 
ATOM   8777  O  O    . GLY A 1 21 ? 1.856   -2.777  -8.614  1.00 0.00 ? 549 GLY A O    15 
ATOM   8778  H  H    . GLY A 1 21 ? 0.971   0.746   -7.238  1.00 0.00 ? 549 GLY A H    15 
ATOM   8779  H  HA2  . GLY A 1 21 ? -0.450  -1.846  -7.307  1.00 0.00 ? 549 GLY A HA2  15 
ATOM   8780  H  HA3  . GLY A 1 21 ? -0.005  -0.972  -8.764  1.00 0.00 ? 549 GLY A HA3  15 
ATOM   8781  N  N    . LYS A 1 22 ? 2.508   -1.551  -6.843  1.00 0.00 ? 550 LYS A N    15 
ATOM   8782  C  CA   . LYS A 1 22 ? 3.826   -2.171  -6.764  1.00 0.00 ? 550 LYS A CA   15 
ATOM   8783  C  C    . LYS A 1 22 ? 4.327   -2.205  -5.324  1.00 0.00 ? 550 LYS A C    15 
ATOM   8784  O  O    . LYS A 1 22 ? 4.254   -1.206  -4.607  1.00 0.00 ? 550 LYS A O    15 
ATOM   8785  C  CB   . LYS A 1 22 ? 4.822   -1.414  -7.644  1.00 0.00 ? 550 LYS A CB   15 
ATOM   8786  C  CG   . LYS A 1 22 ? 6.044   -2.235  -8.025  1.00 0.00 ? 550 LYS A CG   15 
ATOM   8787  C  CD   . LYS A 1 22 ? 7.089   -1.385  -8.729  1.00 0.00 ? 550 LYS A CD   15 
ATOM   8788  C  CE   . LYS A 1 22 ? 8.103   -2.245  -9.465  1.00 0.00 ? 550 LYS A CE   15 
ATOM   8789  N  NZ   . LYS A 1 22 ? 9.479   -1.682  -9.375  1.00 0.00 ? 550 LYS A NZ   15 
ATOM   8790  H  H    . LYS A 1 22 ? 2.269   -0.856  -6.196  1.00 0.00 ? 550 LYS A H    15 
ATOM   8791  H  HA   . LYS A 1 22 ? 3.738   -3.184  -7.125  1.00 0.00 ? 550 LYS A HA   15 
ATOM   8792  H  HB2  . LYS A 1 22 ? 4.323   -1.108  -8.552  1.00 0.00 ? 550 LYS A HB2  15 
ATOM   8793  H  HB3  . LYS A 1 22 ? 5.158   -0.534  -7.115  1.00 0.00 ? 550 LYS A HB3  15 
ATOM   8794  H  HG2  . LYS A 1 22 ? 6.478   -2.653  -7.129  1.00 0.00 ? 550 LYS A HG2  15 
ATOM   8795  H  HG3  . LYS A 1 22 ? 5.737   -3.033  -8.685  1.00 0.00 ? 550 LYS A HG3  15 
ATOM   8796  H  HD2  . LYS A 1 22 ? 6.595   -0.741  -9.442  1.00 0.00 ? 550 LYS A HD2  15 
ATOM   8797  H  HD3  . LYS A 1 22 ? 7.604   -0.784  -7.995  1.00 0.00 ? 550 LYS A HD3  15 
ATOM   8798  H  HE2  . LYS A 1 22 ? 8.101   -3.234  -9.030  1.00 0.00 ? 550 LYS A HE2  15 
ATOM   8799  H  HE3  . LYS A 1 22 ? 7.816   -2.309  -10.504 1.00 0.00 ? 550 LYS A HE3  15 
ATOM   8800  H  HZ1  . LYS A 1 22 ? 9.435   -0.658  -9.196  1.00 0.00 ? 550 LYS A HZ1  15 
ATOM   8801  H  HZ2  . LYS A 1 22 ? 9.991   -1.845  -10.266 1.00 0.00 ? 550 LYS A HZ2  15 
ATOM   8802  H  HZ3  . LYS A 1 22 ? 10.002  -2.137  -8.600  1.00 0.00 ? 550 LYS A HZ3  15 
ATOM   8803  N  N    . THR A 1 23 ? 4.838   -3.358  -4.906  1.00 0.00 ? 551 THR A N    15 
ATOM   8804  C  CA   . THR A 1 23 ? 5.354   -3.520  -3.552  1.00 0.00 ? 551 THR A CA   15 
ATOM   8805  C  C    . THR A 1 23 ? 6.613   -2.685  -3.349  1.00 0.00 ? 551 THR A C    15 
ATOM   8806  O  O    . THR A 1 23 ? 6.856   -2.166  -2.259  1.00 0.00 ? 551 THR A O    15 
ATOM   8807  C  CB   . THR A 1 23 ? 5.652   -4.993  -3.268  1.00 0.00 ? 551 THR A CB   15 
ATOM   8808  O  OG1  . THR A 1 23 ? 6.267   -5.145  -2.001  1.00 0.00 ? 551 THR A OG1  15 
ATOM   8809  C  CG2  . THR A 1 23 ? 6.559   -5.629  -4.299  1.00 0.00 ? 551 THR A CG2  15 
ATOM   8810  H  H    . THR A 1 23 ? 4.871   -4.118  -5.524  1.00 0.00 ? 551 THR A H    15 
ATOM   8811  H  HA   . THR A 1 23 ? 4.595   -3.175  -2.864  1.00 0.00 ? 551 THR A HA   15 
ATOM   8812  H  HB   . THR A 1 23 ? 4.722   -5.543  -3.262  1.00 0.00 ? 551 THR A HB   15 
ATOM   8813  H  HG1  . THR A 1 23 ? 7.134   -4.734  -2.015  1.00 0.00 ? 551 THR A HG1  15 
ATOM   8814  H  HG21 . THR A 1 23 ? 7.279   -4.901  -4.643  1.00 0.00 ? 551 THR A HG21 15 
ATOM   8815  H  HG22 . THR A 1 23 ? 5.969   -5.974  -5.134  1.00 0.00 ? 551 THR A HG22 15 
ATOM   8816  H  HG23 . THR A 1 23 ? 7.078   -6.465  -3.855  1.00 0.00 ? 551 THR A HG23 15 
ATOM   8817  N  N    . SER A 1 24 ? 7.409   -2.554  -4.406  1.00 0.00 ? 552 SER A N    15 
ATOM   8818  C  CA   . SER A 1 24 ? 8.640   -1.775  -4.342  1.00 0.00 ? 552 SER A CA   15 
ATOM   8819  C  C    . SER A 1 24 ? 8.351   -0.354  -3.872  1.00 0.00 ? 552 SER A C    15 
ATOM   8820  O  O    . SER A 1 24 ? 9.174   0.270   -3.203  1.00 0.00 ? 552 SER A O    15 
ATOM   8821  C  CB   . SER A 1 24 ? 9.324   -1.744  -5.710  1.00 0.00 ? 552 SER A CB   15 
ATOM   8822  O  OG   . SER A 1 24 ? 9.451   -3.050  -6.247  1.00 0.00 ? 552 SER A OG   15 
ATOM   8823  H  H    . SER A 1 24 ? 7.160   -2.988  -5.249  1.00 0.00 ? 552 SER A H    15 
ATOM   8824  H  HA   . SER A 1 24 ? 9.298   -2.250  -3.629  1.00 0.00 ? 552 SER A HA   15 
ATOM   8825  H  HB2  . SER A 1 24 ? 8.737   -1.145  -6.390  1.00 0.00 ? 552 SER A HB2  15 
ATOM   8826  H  HB3  . SER A 1 24 ? 10.309  -1.312  -5.608  1.00 0.00 ? 552 SER A HB3  15 
ATOM   8827  H  HG   . SER A 1 24 ? 10.323  -3.153  -6.635  1.00 0.00 ? 552 SER A HG   15 
ATOM   8828  N  N    . HIS A 1 25 ? 7.170   0.147   -4.218  1.00 0.00 ? 553 HIS A N    15 
ATOM   8829  C  CA   . HIS A 1 25 ? 6.764   1.489   -3.822  1.00 0.00 ? 553 HIS A CA   15 
ATOM   8830  C  C    . HIS A 1 25 ? 6.413   1.523   -2.338  1.00 0.00 ? 553 HIS A C    15 
ATOM   8831  O  O    . HIS A 1 25 ? 6.546   2.555   -1.681  1.00 0.00 ? 553 HIS A O    15 
ATOM   8832  C  CB   . HIS A 1 25 ? 5.566   1.951   -4.654  1.00 0.00 ? 553 HIS A CB   15 
ATOM   8833  C  CG   . HIS A 1 25 ? 5.860   2.060   -6.118  1.00 0.00 ? 553 HIS A CG   15 
ATOM   8834  N  ND1  . HIS A 1 25 ? 7.132   2.121   -6.643  1.00 0.00 ? 553 HIS A ND1  15 
ATOM   8835  C  CD2  . HIS A 1 25 ? 5.014   2.117   -7.178  1.00 0.00 ? 553 HIS A CD2  15 
ATOM   8836  C  CE1  . HIS A 1 25 ? 7.022   2.213   -7.976  1.00 0.00 ? 553 HIS A CE1  15 
ATOM   8837  N  NE2  . HIS A 1 25 ? 5.757   2.214   -8.351  1.00 0.00 ? 553 HIS A NE2  15 
ATOM   8838  H  H    . HIS A 1 25 ? 6.553   -0.403  -4.746  1.00 0.00 ? 553 HIS A H    15 
ATOM   8839  H  HA   . HIS A 1 25 ? 7.596   2.154   -4.000  1.00 0.00 ? 553 HIS A HA   15 
ATOM   8840  H  HB2  . HIS A 1 25 ? 4.757   1.247   -4.529  1.00 0.00 ? 553 HIS A HB2  15 
ATOM   8841  H  HB3  . HIS A 1 25 ? 5.248   2.923   -4.304  1.00 0.00 ? 553 HIS A HB3  15 
ATOM   8842  H  HD1  . HIS A 1 25 ? 7.968   2.102   -6.134  1.00 0.00 ? 553 HIS A HD1  15 
ATOM   8843  H  HD2  . HIS A 1 25 ? 3.935   2.093   -7.130  1.00 0.00 ? 553 HIS A HD2  15 
ATOM   8844  H  HE1  . HIS A 1 25 ? 7.860   2.276   -8.654  1.00 0.00 ? 553 HIS A HE1  15 
ATOM   8845  N  N    . LEU A 1 26 ? 5.968   0.382   -1.817  1.00 0.00 ? 554 LEU A N    15 
ATOM   8846  C  CA   . LEU A 1 26 ? 5.601   0.275   -0.411  1.00 0.00 ? 554 LEU A CA   15 
ATOM   8847  C  C    . LEU A 1 26 ? 6.827   0.447   0.480   1.00 0.00 ? 554 LEU A C    15 
ATOM   8848  O  O    . LEU A 1 26 ? 6.749   1.044   1.554   1.00 0.00 ? 554 LEU A O    15 
ATOM   8849  C  CB   . LEU A 1 26 ? 4.937   -1.077  -0.136  1.00 0.00 ? 554 LEU A CB   15 
ATOM   8850  C  CG   . LEU A 1 26 ? 3.520   -0.998  0.433   1.00 0.00 ? 554 LEU A CG   15 
ATOM   8851  C  CD1  . LEU A 1 26 ? 2.556   -0.449  -0.607  1.00 0.00 ? 554 LEU A CD1  15 
ATOM   8852  C  CD2  . LEU A 1 26 ? 3.064   -2.366  0.916   1.00 0.00 ? 554 LEU A CD2  15 
ATOM   8853  H  H    . LEU A 1 26 ? 5.886   -0.407  -2.392  1.00 0.00 ? 554 LEU A H    15 
ATOM   8854  H  HA   . LEU A 1 26 ? 4.897   1.062   -0.192  1.00 0.00 ? 554 LEU A HA   15 
ATOM   8855  H  HB2  . LEU A 1 26 ? 4.900   -1.631  -1.064  1.00 0.00 ? 554 LEU A HB2  15 
ATOM   8856  H  HB3  . LEU A 1 26 ? 5.552   -1.624  0.564   1.00 0.00 ? 554 LEU A HB3  15 
ATOM   8857  H  HG   . LEU A 1 26 ? 3.516   -0.325  1.279   1.00 0.00 ? 554 LEU A HG   15 
ATOM   8858  H  HD11 . LEU A 1 26 ? 1.555   -0.785  -0.383  1.00 0.00 ? 554 LEU A HD11 15 
ATOM   8859  H  HD12 . LEU A 1 26 ? 2.844   -0.803  -1.586  1.00 0.00 ? 554 LEU A HD12 15 
ATOM   8860  H  HD13 . LEU A 1 26 ? 2.586   0.630   -0.592  1.00 0.00 ? 554 LEU A HD13 15 
ATOM   8861  H  HD21 . LEU A 1 26 ? 2.467   -2.839  0.150   1.00 0.00 ? 554 LEU A HD21 15 
ATOM   8862  H  HD22 . LEU A 1 26 ? 2.473   -2.253  1.813   1.00 0.00 ? 554 LEU A HD22 15 
ATOM   8863  H  HD23 . LEU A 1 26 ? 3.927   -2.979  1.130   1.00 0.00 ? 554 LEU A HD23 15 
ATOM   8864  N  N    . ARG A 1 27 ? 7.959   -0.084  0.027   1.00 0.00 ? 555 ARG A N    15 
ATOM   8865  C  CA   . ARG A 1 27 ? 9.202   0.007   0.781   1.00 0.00 ? 555 ARG A CA   15 
ATOM   8866  C  C    . ARG A 1 27 ? 9.652   1.459   0.919   1.00 0.00 ? 555 ARG A C    15 
ATOM   8867  O  O    . ARG A 1 27 ? 10.189  1.859   1.951   1.00 0.00 ? 555 ARG A O    15 
ATOM   8868  C  CB   . ARG A 1 27 ? 10.293  -0.836  0.107   1.00 0.00 ? 555 ARG A CB   15 
ATOM   8869  C  CG   . ARG A 1 27 ? 10.950  -0.172  -1.095  1.00 0.00 ? 555 ARG A CG   15 
ATOM   8870  C  CD   . ARG A 1 27 ? 12.366  0.283   -0.778  1.00 0.00 ? 555 ARG A CD   15 
ATOM   8871  N  NE   . ARG A 1 27 ? 12.742  1.474   -1.536  1.00 0.00 ? 555 ARG A NE   15 
ATOM   8872  C  CZ   . ARG A 1 27 ? 12.927  1.487   -2.854  1.00 0.00 ? 555 ARG A CZ   15 
ATOM   8873  N  NH1  . ARG A 1 27 ? 12.773  0.376   -3.564  1.00 0.00 ? 555 ARG A NH1  15 
ATOM   8874  N  NH2  . ARG A 1 27 ? 13.267  2.613   -3.465  1.00 0.00 ? 555 ARG A NH2  15 
ATOM   8875  H  H    . ARG A 1 27 ? 7.956   -0.549  -0.835  1.00 0.00 ? 555 ARG A H    15 
ATOM   8876  H  HA   . ARG A 1 27 ? 9.015   -0.391  1.767   1.00 0.00 ? 555 ARG A HA   15 
ATOM   8877  H  HB2  . ARG A 1 27 ? 11.060  -1.052  0.833   1.00 0.00 ? 555 ARG A HB2  15 
ATOM   8878  H  HB3  . ARG A 1 27 ? 9.852   -1.764  -0.224  1.00 0.00 ? 555 ARG A HB3  15 
ATOM   8879  H  HG2  . ARG A 1 27 ? 10.985  -0.880  -1.908  1.00 0.00 ? 555 ARG A HG2  15 
ATOM   8880  H  HG3  . ARG A 1 27 ? 10.364  0.684   -1.387  1.00 0.00 ? 555 ARG A HG3  15 
ATOM   8881  H  HD2  . ARG A 1 27 ? 12.431  0.505   0.277   1.00 0.00 ? 555 ARG A HD2  15 
ATOM   8882  H  HD3  . ARG A 1 27 ? 13.050  -0.517  -1.019  1.00 0.00 ? 555 ARG A HD3  15 
ATOM   8883  H  HE   . ARG A 1 27 ? 12.864  2.308   -1.037  1.00 0.00 ? 555 ARG A HE   15 
ATOM   8884  H  HH11 . ARG A 1 27 ? 12.517  -0.478  -3.110  1.00 0.00 ? 555 ARG A HH11 15 
ATOM   8885  H  HH12 . ARG A 1 27 ? 12.913  0.392   -4.554  1.00 0.00 ? 555 ARG A HH12 15 
ATOM   8886  H  HH21 . ARG A 1 27 ? 13.385  3.453   -2.935  1.00 0.00 ? 555 ARG A HH21 15 
ATOM   8887  H  HH22 . ARG A 1 27 ? 13.406  2.623   -4.455  1.00 0.00 ? 555 ARG A HH22 15 
ATOM   8888  N  N    . ALA A 1 28 ? 9.425   2.240   -0.130  1.00 0.00 ? 556 ALA A N    15 
ATOM   8889  C  CA   . ALA A 1 28 ? 9.800   3.645   -0.135  1.00 0.00 ? 556 ALA A CA   15 
ATOM   8890  C  C    . ALA A 1 28 ? 8.827   4.468   0.699   1.00 0.00 ? 556 ALA A C    15 
ATOM   8891  O  O    . ALA A 1 28 ? 9.234   5.320   1.488   1.00 0.00 ? 556 ALA A O    15 
ATOM   8892  C  CB   . ALA A 1 28 ? 9.857   4.173   -1.560  1.00 0.00 ? 556 ALA A CB   15 
ATOM   8893  H  H    . ALA A 1 28 ? 8.994   1.861   -0.919  1.00 0.00 ? 556 ALA A H    15 
ATOM   8894  H  HA   . ALA A 1 28 ? 10.785  3.724   0.294   1.00 0.00 ? 556 ALA A HA   15 
ATOM   8895  H  HB1  . ALA A 1 28 ? 8.940   4.697   -1.787  1.00 0.00 ? 556 ALA A HB1  15 
ATOM   8896  H  HB2  . ALA A 1 28 ? 9.979   3.347   -2.245  1.00 0.00 ? 556 ALA A HB2  15 
ATOM   8897  H  HB3  . ALA A 1 28 ? 10.693  4.850   -1.660  1.00 0.00 ? 556 ALA A HB3  15 
ATOM   8898  N  N    . HIS A 1 29 ? 7.539   4.203   0.521   1.00 0.00 ? 557 HIS A N    15 
ATOM   8899  C  CA   . HIS A 1 29 ? 6.507   4.912   1.259   1.00 0.00 ? 557 HIS A CA   15 
ATOM   8900  C  C    . HIS A 1 29 ? 6.520   4.503   2.729   1.00 0.00 ? 557 HIS A C    15 
ATOM   8901  O  O    . HIS A 1 29 ? 6.142   5.283   3.604   1.00 0.00 ? 557 HIS A O    15 
ATOM   8902  C  CB   . HIS A 1 29 ? 5.130   4.637   0.643   1.00 0.00 ? 557 HIS A CB   15 
ATOM   8903  C  CG   . HIS A 1 29 ? 3.986   5.080   1.502   1.00 0.00 ? 557 HIS A CG   15 
ATOM   8904  N  ND1  . HIS A 1 29 ? 3.920   6.309   2.119   1.00 0.00 ? 557 HIS A ND1  15 
ATOM   8905  C  CD2  . HIS A 1 29 ? 2.852   4.422   1.856   1.00 0.00 ? 557 HIS A CD2  15 
ATOM   8906  C  CE1  . HIS A 1 29 ? 2.777   6.358   2.816   1.00 0.00 ? 557 HIS A CE1  15 
ATOM   8907  N  NE2  . HIS A 1 29 ? 2.093   5.238   2.690   1.00 0.00 ? 557 HIS A NE2  15 
ATOM   8908  H  H    . HIS A 1 29 ? 7.277   3.512   -0.120  1.00 0.00 ? 557 HIS A H    15 
ATOM   8909  H  HA   . HIS A 1 29 ? 6.719   5.966   1.188   1.00 0.00 ? 557 HIS A HA   15 
ATOM   8910  H  HB2  . HIS A 1 29 ? 5.055   5.157   -0.300  1.00 0.00 ? 557 HIS A HB2  15 
ATOM   8911  H  HB3  . HIS A 1 29 ? 5.027   3.575   0.471   1.00 0.00 ? 557 HIS A HB3  15 
ATOM   8912  H  HD1  . HIS A 1 29 ? 4.591   7.021   2.060   1.00 0.00 ? 557 HIS A HD1  15 
ATOM   8913  H  HD2  . HIS A 1 29 ? 2.575   3.425   1.547   1.00 0.00 ? 557 HIS A HD2  15 
ATOM   8914  H  HE1  . HIS A 1 29 ? 2.459   7.204   3.406   1.00 0.00 ? 557 HIS A HE1  15 
ATOM   8915  N  N    . LEU A 1 30 ? 6.953   3.274   2.995   1.00 0.00 ? 558 LEU A N    15 
ATOM   8916  C  CA   . LEU A 1 30 ? 7.010   2.764   4.358   1.00 0.00 ? 558 LEU A CA   15 
ATOM   8917  C  C    . LEU A 1 30 ? 8.080   3.489   5.169   1.00 0.00 ? 558 LEU A C    15 
ATOM   8918  O  O    . LEU A 1 30 ? 7.839   3.902   6.303   1.00 0.00 ? 558 LEU A O    15 
ATOM   8919  C  CB   . LEU A 1 30 ? 7.289   1.259   4.352   1.00 0.00 ? 558 LEU A CB   15 
ATOM   8920  C  CG   . LEU A 1 30 ? 6.044   0.371   4.327   1.00 0.00 ? 558 LEU A CG   15 
ATOM   8921  C  CD1  . LEU A 1 30 ? 6.432   -1.086  4.125   1.00 0.00 ? 558 LEU A CD1  15 
ATOM   8922  C  CD2  . LEU A 1 30 ? 5.244   0.538   5.610   1.00 0.00 ? 558 LEU A CD2  15 
ATOM   8923  H  H    . LEU A 1 30 ? 7.239   2.696   2.257   1.00 0.00 ? 558 LEU A H    15 
ATOM   8924  H  HA   . LEU A 1 30 ? 6.049   2.941   4.814   1.00 0.00 ? 558 LEU A HA   15 
ATOM   8925  H  HB2  . LEU A 1 30 ? 7.889   1.029   3.484   1.00 0.00 ? 558 LEU A HB2  15 
ATOM   8926  H  HB3  . LEU A 1 30 ? 7.858   1.016   5.237   1.00 0.00 ? 558 LEU A HB3  15 
ATOM   8927  H  HG   . LEU A 1 30 ? 5.415   0.666   3.499   1.00 0.00 ? 558 LEU A HG   15 
ATOM   8928  H  HD11 . LEU A 1 30 ? 7.117   -1.164  3.294   1.00 0.00 ? 558 LEU A HD11 15 
ATOM   8929  H  HD12 . LEU A 1 30 ? 5.547   -1.668  3.917   1.00 0.00 ? 558 LEU A HD12 15 
ATOM   8930  H  HD13 . LEU A 1 30 ? 6.907   -1.459  5.020   1.00 0.00 ? 558 LEU A HD13 15 
ATOM   8931  H  HD21 . LEU A 1 30 ? 5.487   1.488   6.065   1.00 0.00 ? 558 LEU A HD21 15 
ATOM   8932  H  HD22 . LEU A 1 30 ? 5.489   -0.261  6.294   1.00 0.00 ? 558 LEU A HD22 15 
ATOM   8933  H  HD23 . LEU A 1 30 ? 4.189   0.507   5.384   1.00 0.00 ? 558 LEU A HD23 15 
ATOM   8934  N  N    . ARG A 1 31 ? 9.263   3.639   4.581   1.00 0.00 ? 559 ARG A N    15 
ATOM   8935  C  CA   . ARG A 1 31 ? 10.368  4.315   5.252   1.00 0.00 ? 559 ARG A CA   15 
ATOM   8936  C  C    . ARG A 1 31 ? 9.989   5.749   5.612   1.00 0.00 ? 559 ARG A C    15 
ATOM   8937  O  O    . ARG A 1 31 ? 10.478  6.301   6.597   1.00 0.00 ? 559 ARG A O    15 
ATOM   8938  C  CB   . ARG A 1 31 ? 11.616  4.307   4.366   1.00 0.00 ? 559 ARG A CB   15 
ATOM   8939  C  CG   . ARG A 1 31 ? 11.438  5.047   3.051   1.00 0.00 ? 559 ARG A CG   15 
ATOM   8940  C  CD   . ARG A 1 31 ? 12.747  5.654   2.572   1.00 0.00 ? 559 ARG A CD   15 
ATOM   8941  N  NE   . ARG A 1 31 ? 13.239  6.684   3.483   1.00 0.00 ? 559 ARG A NE   15 
ATOM   8942  C  CZ   . ARG A 1 31 ? 14.141  7.602   3.146   1.00 0.00 ? 559 ARG A CZ   15 
ATOM   8943  N  NH1  . ARG A 1 31 ? 14.652  7.623   1.921   1.00 0.00 ? 559 ARG A NH1  15 
ATOM   8944  N  NH2  . ARG A 1 31 ? 14.534  8.503   4.036   1.00 0.00 ? 559 ARG A NH2  15 
ATOM   8945  H  H    . ARG A 1 31 ? 9.396   3.288   3.675   1.00 0.00 ? 559 ARG A H    15 
ATOM   8946  H  HA   . ARG A 1 31 ? 10.580  3.774   6.162   1.00 0.00 ? 559 ARG A HA   15 
ATOM   8947  H  HB2  . ARG A 1 31 ? 12.429  4.770   4.906   1.00 0.00 ? 559 ARG A HB2  15 
ATOM   8948  H  HB3  . ARG A 1 31 ? 11.880  3.283   4.146   1.00 0.00 ? 559 ARG A HB3  15 
ATOM   8949  H  HG2  . ARG A 1 31 ? 11.081  4.353   2.305   1.00 0.00 ? 559 ARG A HG2  15 
ATOM   8950  H  HG3  . ARG A 1 31 ? 10.714  5.836   3.188   1.00 0.00 ? 559 ARG A HG3  15 
ATOM   8951  H  HD2  . ARG A 1 31 ? 13.486  4.870   2.496   1.00 0.00 ? 559 ARG A HD2  15 
ATOM   8952  H  HD3  . ARG A 1 31 ? 12.589  6.093   1.598   1.00 0.00 ? 559 ARG A HD3  15 
ATOM   8953  H  HE   . ARG A 1 31 ? 12.879  6.691   4.394   1.00 0.00 ? 559 ARG A HE   15 
ATOM   8954  H  HH11 . ARG A 1 31 ? 14.360  6.947   1.245   1.00 0.00 ? 559 ARG A HH11 15 
ATOM   8955  H  HH12 . ARG A 1 31 ? 15.329  8.316   1.674   1.00 0.00 ? 559 ARG A HH12 15 
ATOM   8956  H  HH21 . ARG A 1 31 ? 14.153  8.492   4.960   1.00 0.00 ? 559 ARG A HH21 15 
ATOM   8957  H  HH22 . ARG A 1 31 ? 15.212  9.193   3.783   1.00 0.00 ? 559 ARG A HH22 15 
ATOM   8958  N  N    . TRP A 1 32 ? 9.114   6.345   4.808   1.00 0.00 ? 560 TRP A N    15 
ATOM   8959  C  CA   . TRP A 1 32 ? 8.668   7.713   5.045   1.00 0.00 ? 560 TRP A CA   15 
ATOM   8960  C  C    . TRP A 1 32 ? 7.818   7.796   6.309   1.00 0.00 ? 560 TRP A C    15 
ATOM   8961  O  O    . TRP A 1 32 ? 7.848   8.797   7.025   1.00 0.00 ? 560 TRP A O    15 
ATOM   8962  C  CB   . TRP A 1 32 ? 7.870   8.226   3.844   1.00 0.00 ? 560 TRP A CB   15 
ATOM   8963  C  CG   . TRP A 1 32 ? 8.246   9.616   3.430   1.00 0.00 ? 560 TRP A CG   15 
ATOM   8964  C  CD1  . TRP A 1 32 ? 7.433   10.712  3.407   1.00 0.00 ? 560 TRP A CD1  15 
ATOM   8965  C  CD2  . TRP A 1 32 ? 9.531   10.059  2.980   1.00 0.00 ? 560 TRP A CD2  15 
ATOM   8966  N  NE1  . TRP A 1 32 ? 8.134   11.810  2.969   1.00 0.00 ? 560 TRP A NE1  15 
ATOM   8967  C  CE2  . TRP A 1 32 ? 9.424   11.434  2.701   1.00 0.00 ? 560 TRP A CE2  15 
ATOM   8968  C  CE3  . TRP A 1 32 ? 10.762  9.426   2.786   1.00 0.00 ? 560 TRP A CE3  15 
ATOM   8969  C  CZ2  . TRP A 1 32 ? 10.501  12.186  2.239   1.00 0.00 ? 560 TRP A CZ2  15 
ATOM   8970  C  CZ3  . TRP A 1 32 ? 11.831  10.173  2.328   1.00 0.00 ? 560 TRP A CZ3  15 
ATOM   8971  C  CH2  . TRP A 1 32 ? 11.694  11.541  2.059   1.00 0.00 ? 560 TRP A CH2  15 
ATOM   8972  H  H    . TRP A 1 32 ? 8.758   5.852   4.040   1.00 0.00 ? 560 TRP A H    15 
ATOM   8973  H  HA   . TRP A 1 32 ? 9.545   8.330   5.173   1.00 0.00 ? 560 TRP A HA   15 
ATOM   8974  H  HB2  . TRP A 1 32 ? 8.038   7.571   3.002   1.00 0.00 ? 560 TRP A HB2  15 
ATOM   8975  H  HB3  . TRP A 1 32 ? 6.817   8.223   4.091   1.00 0.00 ? 560 TRP A HB3  15 
ATOM   8976  H  HD1  . TRP A 1 32 ? 6.391   10.704  3.692   1.00 0.00 ? 560 TRP A HD1  15 
ATOM   8977  H  HE1  . TRP A 1 32 ? 7.770   12.714  2.866   1.00 0.00 ? 560 TRP A HE1  15 
ATOM   8978  H  HE3  . TRP A 1 32 ? 10.886  8.372   2.988   1.00 0.00 ? 560 TRP A HE3  15 
ATOM   8979  H  HZ2  . TRP A 1 32 ? 10.413  13.242  2.028   1.00 0.00 ? 560 TRP A HZ2  15 
ATOM   8980  H  HZ3  . TRP A 1 32 ? 12.789  9.701   2.172   1.00 0.00 ? 560 TRP A HZ3  15 
ATOM   8981  H  HH2  . TRP A 1 32 ? 12.556  12.085  1.702   1.00 0.00 ? 560 TRP A HH2  15 
ATOM   8982  N  N    . HIS A 1 33 ? 7.061   6.737   6.576   1.00 0.00 ? 561 HIS A N    15 
ATOM   8983  C  CA   . HIS A 1 33 ? 6.201   6.688   7.753   1.00 0.00 ? 561 HIS A CA   15 
ATOM   8984  C  C    . HIS A 1 33 ? 7.029   6.557   9.027   1.00 0.00 ? 561 HIS A C    15 
ATOM   8985  O  O    . HIS A 1 33 ? 6.659   7.084   10.076  1.00 0.00 ? 561 HIS A O    15 
ATOM   8986  C  CB   . HIS A 1 33 ? 5.221   5.519   7.645   1.00 0.00 ? 561 HIS A CB   15 
ATOM   8987  C  CG   . HIS A 1 33 ? 3.939   5.874   6.958   1.00 0.00 ? 561 HIS A CG   15 
ATOM   8988  N  ND1  . HIS A 1 33 ? 3.053   6.817   7.427   1.00 0.00 ? 561 HIS A ND1  15 
ATOM   8989  C  CD2  . HIS A 1 33 ? 3.400   5.391   5.810   1.00 0.00 ? 561 HIS A CD2  15 
ATOM   8990  C  CE1  . HIS A 1 33 ? 2.024   6.877   6.571   1.00 0.00 ? 561 HIS A CE1  15 
ATOM   8991  N  NE2  . HIS A 1 33 ? 2.186   6.031   5.572   1.00 0.00 ? 561 HIS A NE2  15 
ATOM   8992  H  H    . HIS A 1 33 ? 7.080   5.970   5.966   1.00 0.00 ? 561 HIS A H    15 
ATOM   8993  H  HA   . HIS A 1 33 ? 5.643   7.611   7.794   1.00 0.00 ? 561 HIS A HA   15 
ATOM   8994  H  HB2  . HIS A 1 33 ? 5.685   4.719   7.089   1.00 0.00 ? 561 HIS A HB2  15 
ATOM   8995  H  HB3  . HIS A 1 33 ? 4.981   5.168   8.638   1.00 0.00 ? 561 HIS A HB3  15 
ATOM   8996  H  HD1  . HIS A 1 33 ? 3.155   7.350   8.244   1.00 0.00 ? 561 HIS A HD1  15 
ATOM   8997  H  HD2  . HIS A 1 33 ? 3.834   4.634   5.173   1.00 0.00 ? 561 HIS A HD2  15 
ATOM   8998  H  HE1  . HIS A 1 33 ? 1.175   7.534   6.682   1.00 0.00 ? 561 HIS A HE1  15 
ATOM   8999  N  N    . THR A 1 34 ? 8.151   5.850   8.928   1.00 0.00 ? 562 THR A N    15 
ATOM   9000  C  CA   . THR A 1 34 ? 9.034   5.647   10.073  1.00 0.00 ? 562 THR A CA   15 
ATOM   9001  C  C    . THR A 1 34 ? 8.279   5.018   11.240  1.00 0.00 ? 562 THR A C    15 
ATOM   9002  O  O    . THR A 1 34 ? 7.090   4.719   11.135  1.00 0.00 ? 562 THR A O    15 
ATOM   9003  C  CB   . THR A 1 34 ? 9.656   6.976   10.509  1.00 0.00 ? 562 THR A CB   15 
ATOM   9004  O  OG1  . THR A 1 34 ? 8.731   7.741   11.261  1.00 0.00 ? 562 THR A OG1  15 
ATOM   9005  C  CG2  . THR A 1 34 ? 10.124  7.829   9.350   1.00 0.00 ? 562 THR A CG2  15 
ATOM   9006  H  H    . THR A 1 34 ? 8.391   5.454   8.064   1.00 0.00 ? 562 THR A H    15 
ATOM   9007  H  HA   . THR A 1 34 ? 9.822   4.975   9.767   1.00 0.00 ? 562 THR A HA   15 
ATOM   9008  H  HB   . THR A 1 34 ? 10.513  6.770   11.135  1.00 0.00 ? 562 THR A HB   15 
ATOM   9009  H  HG1  . THR A 1 34 ? 9.003   7.759   12.181  1.00 0.00 ? 562 THR A HG1  15 
ATOM   9010  H  HG21 . THR A 1 34 ? 10.657  7.213   8.641   1.00 0.00 ? 562 THR A HG21 15 
ATOM   9011  H  HG22 . THR A 1 34 ? 10.779  8.606   9.716   1.00 0.00 ? 562 THR A HG22 15 
ATOM   9012  H  HG23 . THR A 1 34 ? 9.269   8.278   8.866   1.00 0.00 ? 562 THR A HG23 15 
ATOM   9013  N  N    . GLY A 1 35 ? 8.979   4.820   12.352  1.00 0.00 ? 563 GLY A N    15 
ATOM   9014  C  CA   . GLY A 1 35 ? 8.359   4.228   13.523  1.00 0.00 ? 563 GLY A CA   15 
ATOM   9015  C  C    . GLY A 1 35 ? 7.437   5.193   14.242  1.00 0.00 ? 563 GLY A C    15 
ATOM   9016  O  O    . GLY A 1 35 ? 7.894   6.061   14.986  1.00 0.00 ? 563 GLY A O    15 
ATOM   9017  H  H    . GLY A 1 35 ? 9.924   5.078   12.379  1.00 0.00 ? 563 GLY A H    15 
ATOM   9018  H  HA2  . GLY A 1 35 ? 7.789   3.363   13.216  1.00 0.00 ? 563 GLY A HA2  15 
ATOM   9019  H  HA3  . GLY A 1 35 ? 9.133   3.911   14.206  1.00 0.00 ? 563 GLY A HA3  15 
ATOM   9020  N  N    . GLU A 1 36 ? 6.135   5.041   14.020  1.00 0.00 ? 564 GLU A N    15 
ATOM   9021  C  CA   . GLU A 1 36 ? 5.146   5.906   14.652  1.00 0.00 ? 564 GLU A CA   15 
ATOM   9022  C  C    . GLU A 1 36 ? 3.896   5.119   15.029  1.00 0.00 ? 564 GLU A C    15 
ATOM   9023  O  O    . GLU A 1 36 ? 3.834   3.904   14.838  1.00 0.00 ? 564 GLU A O    15 
ATOM   9024  C  CB   . GLU A 1 36 ? 4.775   7.059   13.718  1.00 0.00 ? 564 GLU A CB   15 
ATOM   9025  C  CG   . GLU A 1 36 ? 4.199   6.602   12.387  1.00 0.00 ? 564 GLU A CG   15 
ATOM   9026  C  CD   . GLU A 1 36 ? 2.684   6.645   12.362  1.00 0.00 ? 564 GLU A CD   15 
ATOM   9027  O  OE1  . GLU A 1 36 ? 2.110   7.639   12.854  1.00 0.00 ? 564 GLU A OE1  15 
ATOM   9028  O  OE2  . GLU A 1 36 ? 2.071   5.684   11.850  1.00 0.00 ? 564 GLU A OE2  15 
ATOM   9029  H  H    . GLU A 1 36 ? 5.833   4.331   13.417  1.00 0.00 ? 564 GLU A H    15 
ATOM   9030  H  HA   . GLU A 1 36 ? 5.587   6.311   15.551  1.00 0.00 ? 564 GLU A HA   15 
ATOM   9031  H  HB2  . GLU A 1 36 ? 4.041   7.682   14.208  1.00 0.00 ? 564 GLU A HB2  15 
ATOM   9032  H  HB3  . GLU A 1 36 ? 5.659   7.647   13.520  1.00 0.00 ? 564 GLU A HB3  15 
ATOM   9033  H  HG2  . GLU A 1 36 ? 4.575   7.247   11.607  1.00 0.00 ? 564 GLU A HG2  15 
ATOM   9034  H  HG3  . GLU A 1 36 ? 4.520   5.588   12.201  1.00 0.00 ? 564 GLU A HG3  15 
ATOM   9035  N  N    . ARG A 1 37 ? 2.902   5.819   15.566  1.00 0.00 ? 565 ARG A N    15 
ATOM   9036  C  CA   . ARG A 1 37 ? 1.652   5.185   15.971  1.00 0.00 ? 565 ARG A CA   15 
ATOM   9037  C  C    . ARG A 1 37 ? 0.525   5.540   15.007  1.00 0.00 ? 565 ARG A C    15 
ATOM   9038  O  O    . ARG A 1 37 ? 0.090   6.710   15.012  1.00 0.00 ? 565 ARG A O    15 
ATOM   9039  C  CB   . ARG A 1 37 ? 1.277   5.612   17.392  1.00 0.00 ? 565 ARG A CB   15 
ATOM   9040  C  CG   . ARG A 1 37 ? 1.072   7.111   17.542  1.00 0.00 ? 565 ARG A CG   15 
ATOM   9041  C  CD   . ARG A 1 37 ? 1.765   7.648   18.785  1.00 0.00 ? 565 ARG A CD   15 
ATOM   9042  N  NE   . ARG A 1 37 ? 1.912   9.101   18.745  1.00 0.00 ? 565 ARG A NE   15 
ATOM   9043  C  CZ   . ARG A 1 37 ? 0.909   9.953   18.944  1.00 0.00 ? 565 ARG A CZ   15 
ATOM   9044  N  NH1  . ARG A 1 37 ? -0.314  9.503   19.197  1.00 0.00 ? 565 ARG A NH1  15 
ATOM   9045  N  NH2  . ARG A 1 37 ? 1.129   11.260  18.890  1.00 0.00 ? 565 ARG A NH2  15 
ATOM   9046  O  OXT  . ARG A 1 37 ? 0.088   4.644   14.254  1.00 0.00 ? 565 ARG A OXT  15 
ATOM   9047  H  H    . ARG A 1 37 ? 3.011   6.784   15.694  1.00 0.00 ? 565 ARG A H    15 
ATOM   9048  H  HA   . ARG A 1 37 ? 1.802   4.116   15.954  1.00 0.00 ? 565 ARG A HA   15 
ATOM   9049  H  HB2  . ARG A 1 37 ? 0.361   5.115   17.674  1.00 0.00 ? 565 ARG A HB2  15 
ATOM   9050  H  HB3  . ARG A 1 37 ? 2.064   5.307   18.066  1.00 0.00 ? 565 ARG A HB3  15 
ATOM   9051  H  HG2  . ARG A 1 37 ? 1.477   7.609   16.674  1.00 0.00 ? 565 ARG A HG2  15 
ATOM   9052  H  HG3  . ARG A 1 37 ? 0.014   7.314   17.615  1.00 0.00 ? 565 ARG A HG3  15 
ATOM   9053  H  HD2  . ARG A 1 37 ? 1.180   7.379   19.652  1.00 0.00 ? 565 ARG A HD2  15 
ATOM   9054  H  HD3  . ARG A 1 37 ? 2.744   7.198   18.859  1.00 0.00 ? 565 ARG A HD3  15 
ATOM   9055  H  HE   . ARG A 1 37 ? 2.804   9.461   18.560  1.00 0.00 ? 565 ARG A HE   15 
ATOM   9056  H  HH11 . ARG A 1 37 ? -0.487  8.519   19.239  1.00 0.00 ? 565 ARG A HH11 15 
ATOM   9057  H  HH12 . ARG A 1 37 ? -1.063  10.148  19.346  1.00 0.00 ? 565 ARG A HH12 15 
ATOM   9058  H  HH21 . ARG A 1 37 ? 2.048   11.605  18.700  1.00 0.00 ? 565 ARG A HH21 15 
ATOM   9059  H  HH22 . ARG A 1 37 ? 0.375   11.900  19.039  1.00 0.00 ? 565 ARG A HH22 15 
HETATM 9060  ZN ZN   . ZN  B 2 .  ? 0.790   5.568   4.188   1.00 0.00 ? 100 ZN  A ZN   15 
ATOM   9061  N  N    . MET A 1 1  ? -6.533  -8.393  -16.335 1.00 0.00 ? 1   MET A N    16 
ATOM   9062  C  CA   . MET A 1 1  ? -6.784  -9.822  -16.657 1.00 0.00 ? 1   MET A CA   16 
ATOM   9063  C  C    . MET A 1 1  ? -7.403  -10.553 -15.470 1.00 0.00 ? 1   MET A C    16 
ATOM   9064  O  O    . MET A 1 1  ? -7.582  -9.976  -14.397 1.00 0.00 ? 1   MET A O    16 
ATOM   9065  C  CB   . MET A 1 1  ? -5.456  -10.475 -17.045 1.00 0.00 ? 1   MET A CB   16 
ATOM   9066  C  CG   . MET A 1 1  ? -5.043  -10.204 -18.483 1.00 0.00 ? 1   MET A CG   16 
ATOM   9067  S  SD   . MET A 1 1  ? -3.267  -9.946  -18.658 1.00 0.00 ? 1   MET A SD   16 
ATOM   9068  C  CE   . MET A 1 1  ? -2.724  -11.602 -19.072 1.00 0.00 ? 1   MET A CE   16 
ATOM   9069  H  H1   . MET A 1 1  ? -5.682  -8.347  -15.739 1.00 0.00 ? 1   MET A H1   16 
ATOM   9070  H  H2   . MET A 1 1  ? -7.367  -8.031  -15.829 1.00 0.00 ? 1   MET A H2   16 
ATOM   9071  H  H3   . MET A 1 1  ? -6.388  -7.887  -17.232 1.00 0.00 ? 1   MET A H3   16 
ATOM   9072  H  HA   . MET A 1 1  ? -7.463  -9.872  -17.495 1.00 0.00 ? 1   MET A HA   16 
ATOM   9073  H  HB2  . MET A 1 1  ? -4.681  -10.101 -16.393 1.00 0.00 ? 1   MET A HB2  16 
ATOM   9074  H  HB3  . MET A 1 1  ? -5.542  -11.543 -16.913 1.00 0.00 ? 1   MET A HB3  16 
ATOM   9075  H  HG2  . MET A 1 1  ? -5.331  -11.048 -19.091 1.00 0.00 ? 1   MET A HG2  16 
ATOM   9076  H  HG3  . MET A 1 1  ? -5.557  -9.320  -18.830 1.00 0.00 ? 1   MET A HG3  16 
ATOM   9077  H  HE1  . MET A 1 1  ? -2.679  -12.201 -18.175 1.00 0.00 ? 1   MET A HE1  16 
ATOM   9078  H  HE2  . MET A 1 1  ? -1.745  -11.557 -19.525 1.00 0.00 ? 1   MET A HE2  16 
ATOM   9079  H  HE3  . MET A 1 1  ? -3.422  -12.046 -19.767 1.00 0.00 ? 1   MET A HE3  16 
ATOM   9080  N  N    . ASP A 1 2  ? -7.728  -11.826 -15.669 1.00 0.00 ? 530 ASP A N    16 
ATOM   9081  C  CA   . ASP A 1 2  ? -8.327  -12.636 -14.615 1.00 0.00 ? 530 ASP A CA   16 
ATOM   9082  C  C    . ASP A 1 2  ? -9.660  -12.041 -14.163 1.00 0.00 ? 530 ASP A C    16 
ATOM   9083  O  O    . ASP A 1 2  ? -9.690  -11.105 -13.365 1.00 0.00 ? 530 ASP A O    16 
ATOM   9084  C  CB   . ASP A 1 2  ? -7.375  -12.740 -13.422 1.00 0.00 ? 530 ASP A CB   16 
ATOM   9085  C  CG   . ASP A 1 2  ? -7.546  -14.038 -12.658 1.00 0.00 ? 530 ASP A CG   16 
ATOM   9086  O  OD1  . ASP A 1 2  ? -8.663  -14.291 -12.160 1.00 0.00 ? 530 ASP A OD1  16 
ATOM   9087  O  OD2  . ASP A 1 2  ? -6.563  -14.802 -12.557 1.00 0.00 ? 530 ASP A OD2  16 
ATOM   9088  H  H    . ASP A 1 2  ? -7.562  -12.231 -16.546 1.00 0.00 ? 530 ASP A H    16 
ATOM   9089  H  HA   . ASP A 1 2  ? -8.500  -13.624 -15.013 1.00 0.00 ? 530 ASP A HA   16 
ATOM   9090  H  HB2  . ASP A 1 2  ? -6.356  -12.686 -13.777 1.00 0.00 ? 530 ASP A HB2  16 
ATOM   9091  H  HB3  . ASP A 1 2  ? -7.561  -11.918 -12.747 1.00 0.00 ? 530 ASP A HB3  16 
ATOM   9092  N  N    . PRO A 1 3  ? -10.787 -12.577 -14.669 1.00 0.00 ? 531 PRO A N    16 
ATOM   9093  C  CA   . PRO A 1 3  ? -12.122 -12.087 -14.308 1.00 0.00 ? 531 PRO A CA   16 
ATOM   9094  C  C    . PRO A 1 3  ? -12.471 -12.378 -12.852 1.00 0.00 ? 531 PRO A C    16 
ATOM   9095  O  O    . PRO A 1 3  ? -11.878 -13.256 -12.225 1.00 0.00 ? 531 PRO A O    16 
ATOM   9096  C  CB   . PRO A 1 3  ? -13.054 -12.857 -15.246 1.00 0.00 ? 531 PRO A CB   16 
ATOM   9097  C  CG   . PRO A 1 3  ? -12.300 -14.090 -15.605 1.00 0.00 ? 531 PRO A CG   16 
ATOM   9098  C  CD   . PRO A 1 3  ? -10.850 -13.696 -15.628 1.00 0.00 ? 531 PRO A CD   16 
ATOM   9099  H  HA   . PRO A 1 3  ? -12.216 -11.027 -14.493 1.00 0.00 ? 531 PRO A HA   16 
ATOM   9100  H  HB2  . PRO A 1 3  ? -13.974 -13.092 -14.730 1.00 0.00 ? 531 PRO A HB2  16 
ATOM   9101  H  HB3  . PRO A 1 3  ? -13.267 -12.258 -16.119 1.00 0.00 ? 531 PRO A HB3  16 
ATOM   9102  H  HG2  . PRO A 1 3  ? -12.469 -14.854 -14.861 1.00 0.00 ? 531 PRO A HG2  16 
ATOM   9103  H  HG3  . PRO A 1 3  ? -12.608 -14.439 -16.580 1.00 0.00 ? 531 PRO A HG3  16 
ATOM   9104  H  HD2  . PRO A 1 3  ? -10.230 -14.519 -15.303 1.00 0.00 ? 531 PRO A HD2  16 
ATOM   9105  H  HD3  . PRO A 1 3  ? -10.562 -13.372 -16.617 1.00 0.00 ? 531 PRO A HD3  16 
ATOM   9106  N  N    . GLY A 1 4  ? -13.436 -11.634 -12.321 1.00 0.00 ? 532 GLY A N    16 
ATOM   9107  C  CA   . GLY A 1 4  ? -13.848 -11.826 -10.943 1.00 0.00 ? 532 GLY A CA   16 
ATOM   9108  C  C    . GLY A 1 4  ? -13.689 -10.568 -10.111 1.00 0.00 ? 532 GLY A C    16 
ATOM   9109  O  O    . GLY A 1 4  ? -13.602 -9.466  -10.652 1.00 0.00 ? 532 GLY A O    16 
ATOM   9110  H  H    . GLY A 1 4  ? -13.871 -10.949 -12.870 1.00 0.00 ? 532 GLY A H    16 
ATOM   9111  H  HA2  . GLY A 1 4  ? -14.885 -12.126 -10.927 1.00 0.00 ? 532 GLY A HA2  16 
ATOM   9112  H  HA3  . GLY A 1 4  ? -13.249 -12.612 -10.505 1.00 0.00 ? 532 GLY A HA3  16 
ATOM   9113  N  N    . LYS A 1 5  ? -13.651 -10.733 -8.793  1.00 0.00 ? 533 LYS A N    16 
ATOM   9114  C  CA   . LYS A 1 5  ? -13.501 -9.601  -7.886  1.00 0.00 ? 533 LYS A CA   16 
ATOM   9115  C  C    . LYS A 1 5  ? -12.039 -9.179  -7.781  1.00 0.00 ? 533 LYS A C    16 
ATOM   9116  O  O    . LYS A 1 5  ? -11.141 -10.020 -7.740  1.00 0.00 ? 533 LYS A O    16 
ATOM   9117  C  CB   . LYS A 1 5  ? -14.041 -9.956  -6.500  1.00 0.00 ? 533 LYS A CB   16 
ATOM   9118  C  CG   . LYS A 1 5  ? -13.399 -11.195 -5.895  1.00 0.00 ? 533 LYS A CG   16 
ATOM   9119  C  CD   . LYS A 1 5  ? -13.150 -11.024 -4.406  1.00 0.00 ? 533 LYS A CD   16 
ATOM   9120  C  CE   . LYS A 1 5  ? -14.449 -10.824 -3.642  1.00 0.00 ? 533 LYS A CE   16 
ATOM   9121  N  NZ   . LYS A 1 5  ? -14.223 -10.746 -2.173  1.00 0.00 ? 533 LYS A NZ   16 
ATOM   9122  H  H    . LYS A 1 5  ? -13.725 -11.637 -8.422  1.00 0.00 ? 533 LYS A H    16 
ATOM   9123  H  HA   . LYS A 1 5  ? -14.073 -8.778  -8.286  1.00 0.00 ? 533 LYS A HA   16 
ATOM   9124  H  HB2  . LYS A 1 5  ? -13.866 -9.124  -5.834  1.00 0.00 ? 533 LYS A HB2  16 
ATOM   9125  H  HB3  . LYS A 1 5  ? -15.105 -10.128 -6.574  1.00 0.00 ? 533 LYS A HB3  16 
ATOM   9126  H  HG2  . LYS A 1 5  ? -14.056 -12.038 -6.045  1.00 0.00 ? 533 LYS A HG2  16 
ATOM   9127  H  HG3  . LYS A 1 5  ? -12.457 -11.377 -6.391  1.00 0.00 ? 533 LYS A HG3  16 
ATOM   9128  H  HD2  . LYS A 1 5  ? -12.655 -11.907 -4.030  1.00 0.00 ? 533 LYS A HD2  16 
ATOM   9129  H  HD3  . LYS A 1 5  ? -12.517 -10.161 -4.253  1.00 0.00 ? 533 LYS A HD3  16 
ATOM   9130  H  HE2  . LYS A 1 5  ? -14.911 -9.907  -3.976  1.00 0.00 ? 533 LYS A HE2  16 
ATOM   9131  H  HE3  . LYS A 1 5  ? -15.106 -11.655 -3.853  1.00 0.00 ? 533 LYS A HE3  16 
ATOM   9132  H  HZ1  . LYS A 1 5  ? -13.563 -11.492 -1.872  1.00 0.00 ? 533 LYS A HZ1  16 
ATOM   9133  H  HZ2  . LYS A 1 5  ? -15.122 -10.869 -1.665  1.00 0.00 ? 533 LYS A HZ2  16 
ATOM   9134  H  HZ3  . LYS A 1 5  ? -13.821 -9.820  -1.922  1.00 0.00 ? 533 LYS A HZ3  16 
ATOM   9135  N  N    . LYS A 1 6  ? -11.807 -7.871  -7.738  1.00 0.00 ? 534 LYS A N    16 
ATOM   9136  C  CA   . LYS A 1 6  ? -10.454 -7.337  -7.637  1.00 0.00 ? 534 LYS A CA   16 
ATOM   9137  C  C    . LYS A 1 6  ? -10.261 -6.589  -6.322  1.00 0.00 ? 534 LYS A C    16 
ATOM   9138  O  O    . LYS A 1 6  ? -11.224 -6.122  -5.714  1.00 0.00 ? 534 LYS A O    16 
ATOM   9139  C  CB   . LYS A 1 6  ? -10.161 -6.407  -8.818  1.00 0.00 ? 534 LYS A CB   16 
ATOM   9140  C  CG   . LYS A 1 6  ? -9.313  -7.052  -9.903  1.00 0.00 ? 534 LYS A CG   16 
ATOM   9141  C  CD   . LYS A 1 6  ? -8.265  -6.089  -10.437 1.00 0.00 ? 534 LYS A CD   16 
ATOM   9142  C  CE   . LYS A 1 6  ? -7.400  -6.743  -11.503 1.00 0.00 ? 534 LYS A CE   16 
ATOM   9143  N  NZ   . LYS A 1 6  ? -6.113  -6.019  -11.696 1.00 0.00 ? 534 LYS A NZ   16 
ATOM   9144  H  H    . LYS A 1 6  ? -12.565 -7.250  -7.774  1.00 0.00 ? 534 LYS A H    16 
ATOM   9145  H  HA   . LYS A 1 6  ? -9.766  -8.169  -7.668  1.00 0.00 ? 534 LYS A HA   16 
ATOM   9146  H  HB2  . LYS A 1 6  ? -11.098 -6.099  -9.258  1.00 0.00 ? 534 LYS A HB2  16 
ATOM   9147  H  HB3  . LYS A 1 6  ? -9.640  -5.534  -8.454  1.00 0.00 ? 534 LYS A HB3  16 
ATOM   9148  H  HG2  . LYS A 1 6  ? -8.816  -7.917  -9.491  1.00 0.00 ? 534 LYS A HG2  16 
ATOM   9149  H  HG3  . LYS A 1 6  ? -9.957  -7.356  -10.715 1.00 0.00 ? 534 LYS A HG3  16 
ATOM   9150  H  HD2  . LYS A 1 6  ? -8.762  -5.233  -10.867 1.00 0.00 ? 534 LYS A HD2  16 
ATOM   9151  H  HD3  . LYS A 1 6  ? -7.634  -5.770  -9.621  1.00 0.00 ? 534 LYS A HD3  16 
ATOM   9152  H  HE2  . LYS A 1 6  ? -7.190  -7.759  -11.205 1.00 0.00 ? 534 LYS A HE2  16 
ATOM   9153  H  HE3  . LYS A 1 6  ? -7.944  -6.747  -12.437 1.00 0.00 ? 534 LYS A HE3  16 
ATOM   9154  H  HZ1  . LYS A 1 6  ? -6.269  -5.155  -12.252 1.00 0.00 ? 534 LYS A HZ1  16 
ATOM   9155  H  HZ2  . LYS A 1 6  ? -5.434  -6.625  -12.199 1.00 0.00 ? 534 LYS A HZ2  16 
ATOM   9156  H  HZ3  . LYS A 1 6  ? -5.709  -5.757  -10.774 1.00 0.00 ? 534 LYS A HZ3  16 
ATOM   9157  N  N    . LYS A 1 7  ? -9.009  -6.478  -5.889  1.00 0.00 ? 535 LYS A N    16 
ATOM   9158  C  CA   . LYS A 1 7  ? -8.688  -5.787  -4.645  1.00 0.00 ? 535 LYS A CA   16 
ATOM   9159  C  C    . LYS A 1 7  ? -7.554  -4.788  -4.855  1.00 0.00 ? 535 LYS A C    16 
ATOM   9160  O  O    . LYS A 1 7  ? -7.005  -4.678  -5.951  1.00 0.00 ? 535 LYS A O    16 
ATOM   9161  C  CB   . LYS A 1 7  ? -8.302  -6.795  -3.562  1.00 0.00 ? 535 LYS A CB   16 
ATOM   9162  C  CG   . LYS A 1 7  ? -7.267  -7.811  -4.017  1.00 0.00 ? 535 LYS A CG   16 
ATOM   9163  C  CD   . LYS A 1 7  ? -6.926  -8.794  -2.909  1.00 0.00 ? 535 LYS A CD   16 
ATOM   9164  C  CE   . LYS A 1 7  ? -6.727  -10.199 -3.452  1.00 0.00 ? 535 LYS A CE   16 
ATOM   9165  N  NZ   . LYS A 1 7  ? -5.804  -10.999 -2.600  1.00 0.00 ? 535 LYS A NZ   16 
ATOM   9166  H  H    . LYS A 1 7  ? -8.284  -6.871  -6.418  1.00 0.00 ? 535 LYS A H    16 
ATOM   9167  H  HA   . LYS A 1 7  ? -9.570  -5.251  -4.328  1.00 0.00 ? 535 LYS A HA   16 
ATOM   9168  H  HB2  . LYS A 1 7  ? -7.900  -6.259  -2.714  1.00 0.00 ? 535 LYS A HB2  16 
ATOM   9169  H  HB3  . LYS A 1 7  ? -9.188  -7.330  -3.251  1.00 0.00 ? 535 LYS A HB3  16 
ATOM   9170  H  HG2  . LYS A 1 7  ? -7.661  -8.359  -4.860  1.00 0.00 ? 535 LYS A HG2  16 
ATOM   9171  H  HG3  . LYS A 1 7  ? -6.369  -7.288  -4.312  1.00 0.00 ? 535 LYS A HG3  16 
ATOM   9172  H  HD2  . LYS A 1 7  ? -6.015  -8.474  -2.425  1.00 0.00 ? 535 LYS A HD2  16 
ATOM   9173  H  HD3  . LYS A 1 7  ? -7.732  -8.805  -2.190  1.00 0.00 ? 535 LYS A HD3  16 
ATOM   9174  H  HE2  . LYS A 1 7  ? -7.686  -10.695 -3.491  1.00 0.00 ? 535 LYS A HE2  16 
ATOM   9175  H  HE3  . LYS A 1 7  ? -6.317  -10.132 -4.448  1.00 0.00 ? 535 LYS A HE3  16 
ATOM   9176  H  HZ1  . LYS A 1 7  ? -4.840  -10.965 -2.989  1.00 0.00 ? 535 LYS A HZ1  16 
ATOM   9177  H  HZ2  . LYS A 1 7  ? -6.117  -11.990 -2.565  1.00 0.00 ? 535 LYS A HZ2  16 
ATOM   9178  H  HZ3  . LYS A 1 7  ? -5.790  -10.617 -1.632  1.00 0.00 ? 535 LYS A HZ3  16 
ATOM   9179  N  N    . GLN A 1 8  ? -7.209  -4.063  -3.796  1.00 0.00 ? 536 GLN A N    16 
ATOM   9180  C  CA   . GLN A 1 8  ? -6.140  -3.073  -3.863  1.00 0.00 ? 536 GLN A CA   16 
ATOM   9181  C  C    . GLN A 1 8  ? -5.433  -2.945  -2.517  1.00 0.00 ? 536 GLN A C    16 
ATOM   9182  O  O    . GLN A 1 8  ? -6.026  -3.195  -1.467  1.00 0.00 ? 536 GLN A O    16 
ATOM   9183  C  CB   . GLN A 1 8  ? -6.701  -1.715  -4.293  1.00 0.00 ? 536 GLN A CB   16 
ATOM   9184  C  CG   . GLN A 1 8  ? -6.410  -1.369  -5.744  1.00 0.00 ? 536 GLN A CG   16 
ATOM   9185  C  CD   . GLN A 1 8  ? -7.550  -1.740  -6.672  1.00 0.00 ? 536 GLN A CD   16 
ATOM   9186  O  OE1  . GLN A 1 8  ? -7.422  -2.639  -7.503  1.00 0.00 ? 536 GLN A OE1  16 
ATOM   9187  N  NE2  . GLN A 1 8  ? -8.674  -1.045  -6.535  1.00 0.00 ? 536 GLN A NE2  16 
ATOM   9188  H  H    . GLN A 1 8  ? -7.684  -4.197  -2.949  1.00 0.00 ? 536 GLN A H    16 
ATOM   9189  H  HA   . GLN A 1 8  ? -5.425  -3.407  -4.600  1.00 0.00 ? 536 GLN A HA   16 
ATOM   9190  H  HB2  . GLN A 1 8  ? -7.772  -1.721  -4.155  1.00 0.00 ? 536 GLN A HB2  16 
ATOM   9191  H  HB3  . GLN A 1 8  ? -6.271  -0.945  -3.669  1.00 0.00 ? 536 GLN A HB3  16 
ATOM   9192  H  HG2  . GLN A 1 8  ? -6.236  -0.306  -5.819  1.00 0.00 ? 536 GLN A HG2  16 
ATOM   9193  H  HG3  . GLN A 1 8  ? -5.523  -1.901  -6.056  1.00 0.00 ? 536 GLN A HG3  16 
ATOM   9194  H  HE21 . GLN A 1 8  ? -8.704  -0.343  -5.852  1.00 0.00 ? 536 GLN A HE21 16 
ATOM   9195  H  HE22 . GLN A 1 8  ? -9.427  -1.264  -7.122  1.00 0.00 ? 536 GLN A HE22 16 
ATOM   9196  N  N    . HIS A 1 9  ? -4.164  -2.554  -2.556  1.00 0.00 ? 537 HIS A N    16 
ATOM   9197  C  CA   . HIS A 1 9  ? -3.376  -2.393  -1.338  1.00 0.00 ? 537 HIS A CA   16 
ATOM   9198  C  C    . HIS A 1 9  ? -3.607  -1.017  -0.721  1.00 0.00 ? 537 HIS A C    16 
ATOM   9199  O  O    . HIS A 1 9  ? -3.298  0.007   -1.329  1.00 0.00 ? 537 HIS A O    16 
ATOM   9200  C  CB   . HIS A 1 9  ? -1.888  -2.586  -1.636  1.00 0.00 ? 537 HIS A CB   16 
ATOM   9201  C  CG   . HIS A 1 9  ? -1.602  -3.735  -2.554  1.00 0.00 ? 537 HIS A CG   16 
ATOM   9202  N  ND1  . HIS A 1 9  ? -2.482  -4.768  -2.788  1.00 0.00 ? 537 HIS A ND1  16 
ATOM   9203  C  CD2  . HIS A 1 9  ? -0.504  -4.000  -3.308  1.00 0.00 ? 537 HIS A CD2  16 
ATOM   9204  C  CE1  . HIS A 1 9  ? -1.905  -5.611  -3.655  1.00 0.00 ? 537 HIS A CE1  16 
ATOM   9205  N  NE2  . HIS A 1 9  ? -0.704  -5.190  -4.003  1.00 0.00 ? 537 HIS A NE2  16 
ATOM   9206  H  H    . HIS A 1 9  ? -3.746  -2.370  -3.423  1.00 0.00 ? 537 HIS A H    16 
ATOM   9207  H  HA   . HIS A 1 9  ? -3.695  -3.148  -0.635  1.00 0.00 ? 537 HIS A HA   16 
ATOM   9208  H  HB2  . HIS A 1 9  ? -1.501  -1.690  -2.098  1.00 0.00 ? 537 HIS A HB2  16 
ATOM   9209  H  HB3  . HIS A 1 9  ? -1.363  -2.763  -0.709  1.00 0.00 ? 537 HIS A HB3  16 
ATOM   9210  H  HD1  . HIS A 1 9  ? -3.372  -4.870  -2.390  1.00 0.00 ? 537 HIS A HD1  16 
ATOM   9211  H  HD2  . HIS A 1 9  ? 0.387   -3.392  -3.366  1.00 0.00 ? 537 HIS A HD2  16 
ATOM   9212  H  HE1  . HIS A 1 9  ? -2.365  -6.516  -4.024  1.00 0.00 ? 537 HIS A HE1  16 
ATOM   9213  N  N    . ILE A 1 10 ? -4.153  -1.002  0.491   1.00 0.00 ? 538 ILE A N    16 
ATOM   9214  C  CA   . ILE A 1 10 ? -4.425  0.248   1.192   1.00 0.00 ? 538 ILE A CA   16 
ATOM   9215  C  C    . ILE A 1 10 ? -3.698  0.293   2.531   1.00 0.00 ? 538 ILE A C    16 
ATOM   9216  O  O    . ILE A 1 10 ? -3.530  -0.732  3.191   1.00 0.00 ? 538 ILE A O    16 
ATOM   9217  C  CB   . ILE A 1 10 ? -5.936  0.441   1.432   1.00 0.00 ? 538 ILE A CB   16 
ATOM   9218  C  CG1  . ILE A 1 10 ? -6.714  0.240   0.130   1.00 0.00 ? 538 ILE A CG1  16 
ATOM   9219  C  CG2  . ILE A 1 10 ? -6.209  1.821   2.011   1.00 0.00 ? 538 ILE A CG2  16 
ATOM   9220  C  CD1  . ILE A 1 10 ? -7.991  -0.553  0.306   1.00 0.00 ? 538 ILE A CD1  16 
ATOM   9221  H  H    . ILE A 1 10 ? -4.378  -1.851  0.925   1.00 0.00 ? 538 ILE A H    16 
ATOM   9222  H  HA   . ILE A 1 10 ? -4.073  1.061   0.574   1.00 0.00 ? 538 ILE A HA   16 
ATOM   9223  H  HB   . ILE A 1 10 ? -6.259  -0.294  2.153   1.00 0.00 ? 538 ILE A HB   16 
ATOM   9224  H  HG12 . ILE A 1 10 ? -6.978  1.205   -0.277  1.00 0.00 ? 538 ILE A HG12 16 
ATOM   9225  H  HG13 . ILE A 1 10 ? -6.091  -0.286  -0.579  1.00 0.00 ? 538 ILE A HG13 16 
ATOM   9226  H  HG21 . ILE A 1 10 ? -7.245  2.081   1.850   1.00 0.00 ? 538 ILE A HG21 16 
ATOM   9227  H  HG22 . ILE A 1 10 ? -5.576  2.548   1.523   1.00 0.00 ? 538 ILE A HG22 16 
ATOM   9228  H  HG23 . ILE A 1 10 ? -6.000  1.815   3.070   1.00 0.00 ? 538 ILE A HG23 16 
ATOM   9229  H  HD11 . ILE A 1 10 ? -8.841  0.106   0.205   1.00 0.00 ? 538 ILE A HD11 16 
ATOM   9230  H  HD12 . ILE A 1 10 ? -8.001  -1.006  1.286   1.00 0.00 ? 538 ILE A HD12 16 
ATOM   9231  H  HD13 . ILE A 1 10 ? -8.042  -1.324  -0.448  1.00 0.00 ? 538 ILE A HD13 16 
ATOM   9232  N  N    . CYS A 1 11 ? -3.268  1.487   2.928   1.00 0.00 ? 539 CYS A N    16 
ATOM   9233  C  CA   . CYS A 1 11 ? -2.558  1.660   4.189   1.00 0.00 ? 539 CYS A CA   16 
ATOM   9234  C  C    . CYS A 1 11 ? -3.427  1.233   5.367   1.00 0.00 ? 539 CYS A C    16 
ATOM   9235  O  O    . CYS A 1 11 ? -4.512  1.774   5.581   1.00 0.00 ? 539 CYS A O    16 
ATOM   9236  C  CB   . CYS A 1 11 ? -2.123  3.119   4.363   1.00 0.00 ? 539 CYS A CB   16 
ATOM   9237  S  SG   . CYS A 1 11 ? -0.332  3.346   4.456   1.00 0.00 ? 539 CYS A SG   16 
ATOM   9238  H  H    . CYS A 1 11 ? -3.431  2.267   2.358   1.00 0.00 ? 539 CYS A H    16 
ATOM   9239  H  HA   . CYS A 1 11 ? -1.679  1.034   4.162   1.00 0.00 ? 539 CYS A HA   16 
ATOM   9240  H  HB2  . CYS A 1 11 ? -2.483  3.698   3.525   1.00 0.00 ? 539 CYS A HB2  16 
ATOM   9241  H  HB3  . CYS A 1 11 ? -2.551  3.512   5.276   1.00 0.00 ? 539 CYS A HB3  16 
ATOM   9242  N  N    . HIS A 1 12 ? -2.938  0.263   6.134   1.00 0.00 ? 540 HIS A N    16 
ATOM   9243  C  CA   . HIS A 1 12 ? -3.665  -0.232  7.296   1.00 0.00 ? 540 HIS A CA   16 
ATOM   9244  C  C    . HIS A 1 12 ? -3.165  0.443   8.569   1.00 0.00 ? 540 HIS A C    16 
ATOM   9245  O  O    . HIS A 1 12 ? -3.203  -0.141  9.652   1.00 0.00 ? 540 HIS A O    16 
ATOM   9246  C  CB   . HIS A 1 12 ? -3.512  -1.749  7.413   1.00 0.00 ? 540 HIS A CB   16 
ATOM   9247  C  CG   . HIS A 1 12 ? -4.053  -2.498  6.235   1.00 0.00 ? 540 HIS A CG   16 
ATOM   9248  N  ND1  . HIS A 1 12 ? -3.313  -2.808  5.116   1.00 0.00 ? 540 HIS A ND1  16 
ATOM   9249  C  CD2  . HIS A 1 12 ? -5.294  -3.003  6.015   1.00 0.00 ? 540 HIS A CD2  16 
ATOM   9250  C  CE1  . HIS A 1 12 ? -4.108  -3.476  4.269   1.00 0.00 ? 540 HIS A CE1  16 
ATOM   9251  N  NE2  . HIS A 1 12 ? -5.321  -3.621  4.767   1.00 0.00 ? 540 HIS A NE2  16 
ATOM   9252  H  H    . HIS A 1 12 ? -2.065  -0.124  5.915   1.00 0.00 ? 540 HIS A H    16 
ATOM   9253  H  HA   . HIS A 1 12 ? -4.710  0.007   7.162   1.00 0.00 ? 540 HIS A HA   16 
ATOM   9254  H  HB2  . HIS A 1 12 ? -2.464  -1.992  7.507   1.00 0.00 ? 540 HIS A HB2  16 
ATOM   9255  H  HB3  . HIS A 1 12 ? -4.035  -2.090  8.294   1.00 0.00 ? 540 HIS A HB3  16 
ATOM   9256  H  HD1  . HIS A 1 12 ? -2.372  -2.581  4.965   1.00 0.00 ? 540 HIS A HD1  16 
ATOM   9257  H  HD2  . HIS A 1 12 ? -6.133  -2.940  6.691   1.00 0.00 ? 540 HIS A HD2  16 
ATOM   9258  H  HE1  . HIS A 1 12 ? -3.797  -3.848  3.304   1.00 0.00 ? 540 HIS A HE1  16 
ATOM   9259  N  N    . ILE A 1 13 ? -2.692  1.678   8.428   1.00 0.00 ? 541 ILE A N    16 
ATOM   9260  C  CA   . ILE A 1 13 ? -2.179  2.438   9.559   1.00 0.00 ? 541 ILE A CA   16 
ATOM   9261  C  C    . ILE A 1 13 ? -2.788  3.836   9.599   1.00 0.00 ? 541 ILE A C    16 
ATOM   9262  O  O    . ILE A 1 13 ? -3.140  4.399   8.563   1.00 0.00 ? 541 ILE A O    16 
ATOM   9263  C  CB   . ILE A 1 13 ? -0.643  2.559   9.496   1.00 0.00 ? 541 ILE A CB   16 
ATOM   9264  C  CG1  . ILE A 1 13 ? -0.004  1.173   9.394   1.00 0.00 ? 541 ILE A CG1  16 
ATOM   9265  C  CG2  . ILE A 1 13 ? -0.115  3.304   10.712  1.00 0.00 ? 541 ILE A CG2  16 
ATOM   9266  C  CD1  . ILE A 1 13 ? 1.413   1.199   8.865   1.00 0.00 ? 541 ILE A CD1  16 
ATOM   9267  H  H    . ILE A 1 13 ? -2.686  2.088   7.539   1.00 0.00 ? 541 ILE A H    16 
ATOM   9268  H  HA   . ILE A 1 13 ? -2.442  1.912   10.465  1.00 0.00 ? 541 ILE A HA   16 
ATOM   9269  H  HB   . ILE A 1 13 ? -0.386  3.131   8.617   1.00 0.00 ? 541 ILE A HB   16 
ATOM   9270  H  HG12 . ILE A 1 13 ? 0.016   0.720   10.373  1.00 0.00 ? 541 ILE A HG12 16 
ATOM   9271  H  HG13 . ILE A 1 13 ? -0.596  0.560   8.730   1.00 0.00 ? 541 ILE A HG13 16 
ATOM   9272  H  HG21 . ILE A 1 13 ? -0.590  2.921   11.603  1.00 0.00 ? 541 ILE A HG21 16 
ATOM   9273  H  HG22 . ILE A 1 13 ? -0.335  4.357   10.612  1.00 0.00 ? 541 ILE A HG22 16 
ATOM   9274  H  HG23 . ILE A 1 13 ? 0.953   3.164   10.784  1.00 0.00 ? 541 ILE A HG23 16 
ATOM   9275  H  HD11 . ILE A 1 13 ? 1.977   0.391   9.308   1.00 0.00 ? 541 ILE A HD11 16 
ATOM   9276  H  HD12 . ILE A 1 13 ? 1.875   2.141   9.118   1.00 0.00 ? 541 ILE A HD12 16 
ATOM   9277  H  HD13 . ILE A 1 13 ? 1.400   1.081   7.792   1.00 0.00 ? 541 ILE A HD13 16 
ATOM   9278  N  N    . GLN A 1 14 ? -2.907  4.390   10.801  1.00 0.00 ? 542 GLN A N    16 
ATOM   9279  C  CA   . GLN A 1 14 ? -3.470  5.721   10.975  1.00 0.00 ? 542 GLN A CA   16 
ATOM   9280  C  C    . GLN A 1 14 ? -2.518  6.786   10.434  1.00 0.00 ? 542 GLN A C    16 
ATOM   9281  O  O    . GLN A 1 14 ? -1.975  7.593   11.188  1.00 0.00 ? 542 GLN A O    16 
ATOM   9282  C  CB   . GLN A 1 14 ? -3.771  5.981   12.455  1.00 0.00 ? 542 GLN A CB   16 
ATOM   9283  C  CG   . GLN A 1 14 ? -5.248  5.881   12.800  1.00 0.00 ? 542 GLN A CG   16 
ATOM   9284  C  CD   . GLN A 1 14 ? -5.734  7.052   13.632  1.00 0.00 ? 542 GLN A CD   16 
ATOM   9285  O  OE1  . GLN A 1 14 ? -5.259  7.279   14.744  1.00 0.00 ? 542 GLN A OE1  16 
ATOM   9286  N  NE2  . GLN A 1 14 ? -6.688  7.804   13.094  1.00 0.00 ? 542 GLN A NE2  16 
ATOM   9287  H  H    . GLN A 1 14 ? -2.609  3.893   11.589  1.00 0.00 ? 542 GLN A H    16 
ATOM   9288  H  HA   . GLN A 1 14 ? -4.392  5.762   10.418  1.00 0.00 ? 542 GLN A HA   16 
ATOM   9289  H  HB2  . GLN A 1 14 ? -3.234  5.259   13.051  1.00 0.00 ? 542 GLN A HB2  16 
ATOM   9290  H  HB3  . GLN A 1 14 ? -3.430  6.973   12.713  1.00 0.00 ? 542 GLN A HB3  16 
ATOM   9291  H  HG2  . GLN A 1 14 ? -5.818  5.849   11.884  1.00 0.00 ? 542 GLN A HG2  16 
ATOM   9292  H  HG3  . GLN A 1 14 ? -5.413  4.970   13.357  1.00 0.00 ? 542 GLN A HG3  16 
ATOM   9293  H  HE21 . GLN A 1 14 ? -7.020  7.564   12.204  1.00 0.00 ? 542 GLN A HE21 16 
ATOM   9294  H  HE22 . GLN A 1 14 ? -7.021  8.568   13.609  1.00 0.00 ? 542 GLN A HE22 16 
ATOM   9295  N  N    . GLY A 1 15 ? -2.319  6.778   9.120   1.00 0.00 ? 543 GLY A N    16 
ATOM   9296  C  CA   . GLY A 1 15 ? -1.432  7.743   8.498   1.00 0.00 ? 543 GLY A CA   16 
ATOM   9297  C  C    . GLY A 1 15 ? -2.057  8.412   7.291   1.00 0.00 ? 543 GLY A C    16 
ATOM   9298  O  O    . GLY A 1 15 ? -2.594  9.515   7.393   1.00 0.00 ? 543 GLY A O    16 
ATOM   9299  H  H    . GLY A 1 15 ? -2.777  6.110   8.568   1.00 0.00 ? 543 GLY A H    16 
ATOM   9300  H  HA2  . GLY A 1 15 ? -1.177  8.502   9.224   1.00 0.00 ? 543 GLY A HA2  16 
ATOM   9301  H  HA3  . GLY A 1 15 ? -0.528  7.239   8.189   1.00 0.00 ? 543 GLY A HA3  16 
ATOM   9302  N  N    . CYS A 1 16 ? -1.986  7.745   6.143   1.00 0.00 ? 544 CYS A N    16 
ATOM   9303  C  CA   . CYS A 1 16 ? -2.549  8.284   4.911   1.00 0.00 ? 544 CYS A CA   16 
ATOM   9304  C  C    . CYS A 1 16 ? -3.639  7.367   4.361   1.00 0.00 ? 544 CYS A C    16 
ATOM   9305  O  O    . CYS A 1 16 ? -4.131  6.482   5.061   1.00 0.00 ? 544 CYS A O    16 
ATOM   9306  C  CB   . CYS A 1 16 ? -1.442  8.484   3.870   1.00 0.00 ? 544 CYS A CB   16 
ATOM   9307  S  SG   . CYS A 1 16 ? -0.851  6.958   3.097   1.00 0.00 ? 544 CYS A SG   16 
ATOM   9308  H  H    . CYS A 1 16 ? -1.545  6.870   6.123   1.00 0.00 ? 544 CYS A H    16 
ATOM   9309  H  HA   . CYS A 1 16 ? -2.988  9.243   5.142   1.00 0.00 ? 544 CYS A HA   16 
ATOM   9310  H  HB2  . CYS A 1 16 ? -1.810  9.126   3.084   1.00 0.00 ? 544 CYS A HB2  16 
ATOM   9311  H  HB3  . CYS A 1 16 ? -0.597  8.959   4.347   1.00 0.00 ? 544 CYS A HB3  16 
ATOM   9312  N  N    . GLY A 1 17 ? -4.010  7.584   3.104   1.00 0.00 ? 545 GLY A N    16 
ATOM   9313  C  CA   . GLY A 1 17 ? -5.037  6.770   2.481   1.00 0.00 ? 545 GLY A CA   16 
ATOM   9314  C  C    . GLY A 1 17 ? -4.861  6.672   0.979   1.00 0.00 ? 545 GLY A C    16 
ATOM   9315  O  O    . GLY A 1 17 ? -5.813  6.861   0.222   1.00 0.00 ? 545 GLY A O    16 
ATOM   9316  H  H    . GLY A 1 17 ? -3.582  8.304   2.593   1.00 0.00 ? 545 GLY A H    16 
ATOM   9317  H  HA2  . GLY A 1 17 ? -4.998  5.777   2.904   1.00 0.00 ? 545 GLY A HA2  16 
ATOM   9318  H  HA3  . GLY A 1 17 ? -6.003  7.203   2.693   1.00 0.00 ? 545 GLY A HA3  16 
ATOM   9319  N  N    . LYS A 1 18 ? -3.639  6.378   0.547   1.00 0.00 ? 546 LYS A N    16 
ATOM   9320  C  CA   . LYS A 1 18 ? -3.340  6.258   -0.874  1.00 0.00 ? 546 LYS A CA   16 
ATOM   9321  C  C    . LYS A 1 18 ? -3.743  4.885   -1.401  1.00 0.00 ? 546 LYS A C    16 
ATOM   9322  O  O    . LYS A 1 18 ? -4.374  4.099   -0.695  1.00 0.00 ? 546 LYS A O    16 
ATOM   9323  C  CB   . LYS A 1 18 ? -1.851  6.501   -1.127  1.00 0.00 ? 546 LYS A CB   16 
ATOM   9324  C  CG   . LYS A 1 18 ? -0.948  5.436   -0.526  1.00 0.00 ? 546 LYS A CG   16 
ATOM   9325  C  CD   . LYS A 1 18 ? 0.370   6.026   -0.051  1.00 0.00 ? 546 LYS A CD   16 
ATOM   9326  C  CE   . LYS A 1 18 ? 1.497   5.738   -1.031  1.00 0.00 ? 546 LYS A CE   16 
ATOM   9327  N  NZ   . LYS A 1 18 ? 2.348   6.937   -1.266  1.00 0.00 ? 546 LYS A NZ   16 
ATOM   9328  H  H    . LYS A 1 18 ? -2.921  6.240   1.200   1.00 0.00 ? 546 LYS A H    16 
ATOM   9329  H  HA   . LYS A 1 18 ? -3.912  7.012   -1.396  1.00 0.00 ? 546 LYS A HA   16 
ATOM   9330  H  HB2  . LYS A 1 18 ? -1.678  6.529   -2.193  1.00 0.00 ? 546 LYS A HB2  16 
ATOM   9331  H  HB3  . LYS A 1 18 ? -1.577  7.456   -0.703  1.00 0.00 ? 546 LYS A HB3  16 
ATOM   9332  H  HG2  . LYS A 1 18 ? -1.452  4.984   0.314   1.00 0.00 ? 546 LYS A HG2  16 
ATOM   9333  H  HG3  . LYS A 1 18 ? -0.748  4.685   -1.276  1.00 0.00 ? 546 LYS A HG3  16 
ATOM   9334  H  HD2  . LYS A 1 18 ? 0.260   7.095   0.050   1.00 0.00 ? 546 LYS A HD2  16 
ATOM   9335  H  HD3  . LYS A 1 18 ? 0.620   5.596   0.908   1.00 0.00 ? 546 LYS A HD3  16 
ATOM   9336  H  HE2  . LYS A 1 18 ? 2.111   4.945   -0.630  1.00 0.00 ? 546 LYS A HE2  16 
ATOM   9337  H  HE3  . LYS A 1 18 ? 1.069   5.421   -1.970  1.00 0.00 ? 546 LYS A HE3  16 
ATOM   9338  H  HZ1  . LYS A 1 18 ? 1.757   7.791   -1.315  1.00 0.00 ? 546 LYS A HZ1  16 
ATOM   9339  H  HZ2  . LYS A 1 18 ? 2.867   6.837   -2.161  1.00 0.00 ? 546 LYS A HZ2  16 
ATOM   9340  H  HZ3  . LYS A 1 18 ? 3.034   7.046   -0.491  1.00 0.00 ? 546 LYS A HZ3  16 
ATOM   9341  N  N    . VAL A 1 19 ? -3.375  4.602   -2.647  1.00 0.00 ? 547 VAL A N    16 
ATOM   9342  C  CA   . VAL A 1 19 ? -3.698  3.324   -3.270  1.00 0.00 ? 547 VAL A CA   16 
ATOM   9343  C  C    . VAL A 1 19 ? -2.709  2.987   -4.380  1.00 0.00 ? 547 VAL A C    16 
ATOM   9344  O  O    . VAL A 1 19 ? -2.394  3.829   -5.221  1.00 0.00 ? 547 VAL A O    16 
ATOM   9345  C  CB   . VAL A 1 19 ? -5.124  3.326   -3.855  1.00 0.00 ? 547 VAL A CB   16 
ATOM   9346  C  CG1  . VAL A 1 19 ? -5.502  1.938   -4.349  1.00 0.00 ? 547 VAL A CG1  16 
ATOM   9347  C  CG2  . VAL A 1 19 ? -6.127  3.822   -2.825  1.00 0.00 ? 547 VAL A CG2  16 
ATOM   9348  H  H    . VAL A 1 19 ? -2.873  5.270   -3.160  1.00 0.00 ? 547 VAL A H    16 
ATOM   9349  H  HA   . VAL A 1 19 ? -3.645  2.559   -2.509  1.00 0.00 ? 547 VAL A HA   16 
ATOM   9350  H  HB   . VAL A 1 19 ? -5.144  4.000   -4.699  1.00 0.00 ? 547 VAL A HB   16 
ATOM   9351  H  HG11 . VAL A 1 19 ? -4.912  1.692   -5.219  1.00 0.00 ? 547 VAL A HG11 16 
ATOM   9352  H  HG12 . VAL A 1 19 ? -6.551  1.921   -4.608  1.00 0.00 ? 547 VAL A HG12 16 
ATOM   9353  H  HG13 . VAL A 1 19 ? -5.312  1.214   -3.570  1.00 0.00 ? 547 VAL A HG13 16 
ATOM   9354  H  HG21 . VAL A 1 19 ? -5.930  4.860   -2.601  1.00 0.00 ? 547 VAL A HG21 16 
ATOM   9355  H  HG22 . VAL A 1 19 ? -6.037  3.236   -1.922  1.00 0.00 ? 547 VAL A HG22 16 
ATOM   9356  H  HG23 . VAL A 1 19 ? -7.128  3.724   -3.219  1.00 0.00 ? 547 VAL A HG23 16 
ATOM   9357  N  N    . TYR A 1 20 ? -2.224  1.750   -4.379  1.00 0.00 ? 548 TYR A N    16 
ATOM   9358  C  CA   . TYR A 1 20 ? -1.272  1.298   -5.388  1.00 0.00 ? 548 TYR A CA   16 
ATOM   9359  C  C    . TYR A 1 20 ? -1.504  -0.169  -5.734  1.00 0.00 ? 548 TYR A C    16 
ATOM   9360  O  O    . TYR A 1 20 ? -1.930  -0.956  -4.889  1.00 0.00 ? 548 TYR A O    16 
ATOM   9361  C  CB   . TYR A 1 20 ? 0.168   1.501   -4.904  1.00 0.00 ? 548 TYR A CB   16 
ATOM   9362  C  CG   . TYR A 1 20 ? 0.341   1.350   -3.408  1.00 0.00 ? 548 TYR A CG   16 
ATOM   9363  C  CD1  . TYR A 1 20 ? 0.025   0.159   -2.768  1.00 0.00 ? 548 TYR A CD1  16 
ATOM   9364  C  CD2  . TYR A 1 20 ? 0.821   2.402   -2.636  1.00 0.00 ? 548 TYR A CD2  16 
ATOM   9365  C  CE1  . TYR A 1 20 ? 0.182   0.018   -1.403  1.00 0.00 ? 548 TYR A CE1  16 
ATOM   9366  C  CE2  . TYR A 1 20 ? 0.980   2.269   -1.270  1.00 0.00 ? 548 TYR A CE2  16 
ATOM   9367  C  CZ   . TYR A 1 20 ? 0.659   1.076   -0.658  1.00 0.00 ? 548 TYR A CZ   16 
ATOM   9368  O  OH   . TYR A 1 20 ? 0.816   0.940   0.702   1.00 0.00 ? 548 TYR A OH   16 
ATOM   9369  H  H    . TYR A 1 20 ? -2.515  1.124   -3.683  1.00 0.00 ? 548 TYR A H    16 
ATOM   9370  H  HA   . TYR A 1 20 ? -1.429  1.892   -6.277  1.00 0.00 ? 548 TYR A HA   16 
ATOM   9371  H  HB2  . TYR A 1 20 ? 0.806   0.774   -5.383  1.00 0.00 ? 548 TYR A HB2  16 
ATOM   9372  H  HB3  . TYR A 1 20 ? 0.495   2.493   -5.177  1.00 0.00 ? 548 TYR A HB3  16 
ATOM   9373  H  HD1  . TYR A 1 20 ? -0.347  -0.668  -3.354  1.00 0.00 ? 548 TYR A HD1  16 
ATOM   9374  H  HD2  . TYR A 1 20 ? 1.072   3.335   -3.118  1.00 0.00 ? 548 TYR A HD2  16 
ATOM   9375  H  HE1  . TYR A 1 20 ? -0.070  -0.916  -0.924  1.00 0.00 ? 548 TYR A HE1  16 
ATOM   9376  H  HE2  . TYR A 1 20 ? 1.354   3.098   -0.687  1.00 0.00 ? 548 TYR A HE2  16 
ATOM   9377  H  HH   . TYR A 1 20 ? 1.701   1.215   0.952   1.00 0.00 ? 548 TYR A HH   16 
ATOM   9378  N  N    . GLY A 1 21 ? -1.225  -0.529  -6.982  1.00 0.00 ? 549 GLY A N    16 
ATOM   9379  C  CA   . GLY A 1 21 ? -1.413  -1.901  -7.417  1.00 0.00 ? 549 GLY A CA   16 
ATOM   9380  C  C    . GLY A 1 21 ? -0.113  -2.681  -7.454  1.00 0.00 ? 549 GLY A C    16 
ATOM   9381  O  O    . GLY A 1 21 ? 0.052   -3.587  -8.271  1.00 0.00 ? 549 GLY A O    16 
ATOM   9382  H  H    . GLY A 1 21 ? -0.891  0.142   -7.613  1.00 0.00 ? 549 GLY A H    16 
ATOM   9383  H  HA2  . GLY A 1 21 ? -2.095  -2.392  -6.740  1.00 0.00 ? 549 GLY A HA2  16 
ATOM   9384  H  HA3  . GLY A 1 21 ? -1.845  -1.897  -8.407  1.00 0.00 ? 549 GLY A HA3  16 
ATOM   9385  N  N    . LYS A 1 22 ? 0.811   -2.330  -6.566  1.00 0.00 ? 550 LYS A N    16 
ATOM   9386  C  CA   . LYS A 1 22 ? 2.102   -3.005  -6.499  1.00 0.00 ? 550 LYS A CA   16 
ATOM   9387  C  C    . LYS A 1 22 ? 2.640   -3.010  -5.072  1.00 0.00 ? 550 LYS A C    16 
ATOM   9388  O  O    . LYS A 1 22 ? 2.799   -1.957  -4.455  1.00 0.00 ? 550 LYS A O    16 
ATOM   9389  C  CB   . LYS A 1 22 ? 3.106   -2.324  -7.432  1.00 0.00 ? 550 LYS A CB   16 
ATOM   9390  C  CG   . LYS A 1 22 ? 2.628   -2.224  -8.872  1.00 0.00 ? 550 LYS A CG   16 
ATOM   9391  C  CD   . LYS A 1 22 ? 3.625   -1.471  -9.740  1.00 0.00 ? 550 LYS A CD   16 
ATOM   9392  C  CE   . LYS A 1 22 ? 3.148   -0.060  -10.044 1.00 0.00 ? 550 LYS A CE   16 
ATOM   9393  N  NZ   . LYS A 1 22 ? 4.175   0.727   -10.781 1.00 0.00 ? 550 LYS A NZ   16 
ATOM   9394  H  H    . LYS A 1 22 ? 0.620   -1.601  -5.940  1.00 0.00 ? 550 LYS A H    16 
ATOM   9395  H  HA   . LYS A 1 22 ? 1.959   -4.025  -6.821  1.00 0.00 ? 550 LYS A HA   16 
ATOM   9396  H  HB2  . LYS A 1 22 ? 3.298   -1.325  -7.069  1.00 0.00 ? 550 LYS A HB2  16 
ATOM   9397  H  HB3  . LYS A 1 22 ? 4.028   -2.885  -7.420  1.00 0.00 ? 550 LYS A HB3  16 
ATOM   9398  H  HG2  . LYS A 1 22 ? 2.501   -3.220  -9.269  1.00 0.00 ? 550 LYS A HG2  16 
ATOM   9399  H  HG3  . LYS A 1 22 ? 1.682   -1.703  -8.891  1.00 0.00 ? 550 LYS A HG3  16 
ATOM   9400  H  HD2  . LYS A 1 22 ? 4.571   -1.416  -9.221  1.00 0.00 ? 550 LYS A HD2  16 
ATOM   9401  H  HD3  . LYS A 1 22 ? 3.753   -2.007  -10.669 1.00 0.00 ? 550 LYS A HD3  16 
ATOM   9402  H  HE2  . LYS A 1 22 ? 2.253   -0.118  -10.645 1.00 0.00 ? 550 LYS A HE2  16 
ATOM   9403  H  HE3  . LYS A 1 22 ? 2.924   0.439   -9.113  1.00 0.00 ? 550 LYS A HE3  16 
ATOM   9404  H  HZ1  . LYS A 1 22 ? 4.651   0.125   -11.483 1.00 0.00 ? 550 LYS A HZ1  16 
ATOM   9405  H  HZ2  . LYS A 1 22 ? 4.886   1.096   -10.118 1.00 0.00 ? 550 LYS A HZ2  16 
ATOM   9406  H  HZ3  . LYS A 1 22 ? 3.727   1.527   -11.272 1.00 0.00 ? 550 LYS A HZ3  16 
ATOM   9407  N  N    . THR A 1 23 ? 2.919   -4.201  -4.553  1.00 0.00 ? 551 THR A N    16 
ATOM   9408  C  CA   . THR A 1 23 ? 3.440   -4.342  -3.198  1.00 0.00 ? 551 THR A CA   16 
ATOM   9409  C  C    . THR A 1 23 ? 4.755   -3.584  -3.040  1.00 0.00 ? 551 THR A C    16 
ATOM   9410  O  O    . THR A 1 23 ? 5.082   -3.111  -1.952  1.00 0.00 ? 551 THR A O    16 
ATOM   9411  C  CB   . THR A 1 23 ? 3.646   -5.818  -2.857  1.00 0.00 ? 551 THR A CB   16 
ATOM   9412  O  OG1  . THR A 1 23 ? 2.553   -6.596  -3.312  1.00 0.00 ? 551 THR A OG1  16 
ATOM   9413  C  CG2  . THR A 1 23 ? 3.804   -6.073  -1.374  1.00 0.00 ? 551 THR A CG2  16 
ATOM   9414  H  H    . THR A 1 23 ? 2.771   -5.005  -5.094  1.00 0.00 ? 551 THR A H    16 
ATOM   9415  H  HA   . THR A 1 23 ? 2.714   -3.921  -2.518  1.00 0.00 ? 551 THR A HA   16 
ATOM   9416  H  HB   . THR A 1 23 ? 4.541   -6.170  -3.350  1.00 0.00 ? 551 THR A HB   16 
ATOM   9417  H  HG1  . THR A 1 23 ? 2.859   -7.478  -3.535  1.00 0.00 ? 551 THR A HG1  16 
ATOM   9418  H  HG21 . THR A 1 23 ? 3.605   -7.113  -1.164  1.00 0.00 ? 551 THR A HG21 16 
ATOM   9419  H  HG22 . THR A 1 23 ? 3.107   -5.455  -0.826  1.00 0.00 ? 551 THR A HG22 16 
ATOM   9420  H  HG23 . THR A 1 23 ? 4.813   -5.831  -1.072  1.00 0.00 ? 551 THR A HG23 16 
ATOM   9421  N  N    . SER A 1 24 ? 5.504   -3.469  -4.134  1.00 0.00 ? 552 SER A N    16 
ATOM   9422  C  CA   . SER A 1 24 ? 6.781   -2.765  -4.113  1.00 0.00 ? 552 SER A CA   16 
ATOM   9423  C  C    . SER A 1 24 ? 6.602   -1.337  -3.606  1.00 0.00 ? 552 SER A C    16 
ATOM   9424  O  O    . SER A 1 24 ? 7.484   -0.784  -2.950  1.00 0.00 ? 552 SER A O    16 
ATOM   9425  C  CB   . SER A 1 24 ? 7.404   -2.750  -5.510  1.00 0.00 ? 552 SER A CB   16 
ATOM   9426  O  OG   . SER A 1 24 ? 8.205   -3.899  -5.724  1.00 0.00 ? 552 SER A OG   16 
ATOM   9427  H  H    . SER A 1 24 ? 5.190   -3.865  -4.973  1.00 0.00 ? 552 SER A H    16 
ATOM   9428  H  HA   . SER A 1 24 ? 7.439   -3.294  -3.438  1.00 0.00 ? 552 SER A HA   16 
ATOM   9429  H  HB2  . SER A 1 24 ? 6.619   -2.731  -6.251  1.00 0.00 ? 552 SER A HB2  16 
ATOM   9430  H  HB3  . SER A 1 24 ? 8.022   -1.870  -5.617  1.00 0.00 ? 552 SER A HB3  16 
ATOM   9431  H  HG   . SER A 1 24 ? 8.771   -3.758  -6.487  1.00 0.00 ? 552 SER A HG   16 
ATOM   9432  N  N    . HIS A 1 25 ? 5.449   -0.750  -3.906  1.00 0.00 ? 553 HIS A N    16 
ATOM   9433  C  CA   . HIS A 1 25 ? 5.152   0.607   -3.468  1.00 0.00 ? 553 HIS A CA   16 
ATOM   9434  C  C    . HIS A 1 25 ? 4.794   0.615   -1.987  1.00 0.00 ? 553 HIS A C    16 
ATOM   9435  O  O    . HIS A 1 25 ? 5.056   1.586   -1.278  1.00 0.00 ? 553 HIS A O    16 
ATOM   9436  C  CB   . HIS A 1 25 ? 4.006   1.199   -4.293  1.00 0.00 ? 553 HIS A CB   16 
ATOM   9437  C  CG   . HIS A 1 25 ? 4.330   2.530   -4.897  1.00 0.00 ? 553 HIS A CG   16 
ATOM   9438  N  ND1  . HIS A 1 25 ? 4.551   2.730   -6.242  1.00 0.00 ? 553 HIS A ND1  16 
ATOM   9439  C  CD2  . HIS A 1 25 ? 4.470   3.746   -4.310  1.00 0.00 ? 553 HIS A CD2  16 
ATOM   9440  C  CE1  . HIS A 1 25 ? 4.812   4.031   -6.426  1.00 0.00 ? 553 HIS A CE1  16 
ATOM   9441  N  NE2  . HIS A 1 25 ? 4.775   4.692   -5.285  1.00 0.00 ? 553 HIS A NE2  16 
ATOM   9442  H  H    . HIS A 1 25 ? 4.780   -1.243  -4.426  1.00 0.00 ? 553 HIS A H    16 
ATOM   9443  H  HA   . HIS A 1 25 ? 6.040   1.204   -3.614  1.00 0.00 ? 553 HIS A HA   16 
ATOM   9444  H  HB2  . HIS A 1 25 ? 3.763   0.520   -5.097  1.00 0.00 ? 553 HIS A HB2  16 
ATOM   9445  H  HB3  . HIS A 1 25 ? 3.139   1.323   -3.660  1.00 0.00 ? 553 HIS A HB3  16 
ATOM   9446  H  HD1  . HIS A 1 25 ? 4.522   2.043   -6.940  1.00 0.00 ? 553 HIS A HD1  16 
ATOM   9447  H  HD2  . HIS A 1 25 ? 4.364   3.957   -3.256  1.00 0.00 ? 553 HIS A HD2  16 
ATOM   9448  H  HE1  . HIS A 1 25 ? 5.025   4.481   -7.384  1.00 0.00 ? 553 HIS A HE1  16 
ATOM   9449  N  N    . LEU A 1 26 ? 4.200   -0.481  -1.527  1.00 0.00 ? 554 LEU A N    16 
ATOM   9450  C  CA   . LEU A 1 26 ? 3.813   -0.611  -0.130  1.00 0.00 ? 554 LEU A CA   16 
ATOM   9451  C  C    . LEU A 1 26 ? 5.047   -0.750  0.754   1.00 0.00 ? 554 LEU A C    16 
ATOM   9452  O  O    . LEU A 1 26 ? 5.086   -0.233  1.870   1.00 0.00 ? 554 LEU A O    16 
ATOM   9453  C  CB   . LEU A 1 26 ? 2.896   -1.822  0.058   1.00 0.00 ? 554 LEU A CB   16 
ATOM   9454  C  CG   . LEU A 1 26 ? 2.111   -1.844  1.372   1.00 0.00 ? 554 LEU A CG   16 
ATOM   9455  C  CD1  . LEU A 1 26 ? 0.848   -2.679  1.223   1.00 0.00 ? 554 LEU A CD1  16 
ATOM   9456  C  CD2  . LEU A 1 26 ? 2.978   -2.378  2.504   1.00 0.00 ? 554 LEU A CD2  16 
ATOM   9457  H  H    . LEU A 1 26 ? 4.024   -1.224  -2.141  1.00 0.00 ? 554 LEU A H    16 
ATOM   9458  H  HA   . LEU A 1 26 ? 3.279   0.283   0.152   1.00 0.00 ? 554 LEU A HA   16 
ATOM   9459  H  HB2  . LEU A 1 26 ? 2.190   -1.841  -0.760  1.00 0.00 ? 554 LEU A HB2  16 
ATOM   9460  H  HB3  . LEU A 1 26 ? 3.500   -2.715  0.011   1.00 0.00 ? 554 LEU A HB3  16 
ATOM   9461  H  HG   . LEU A 1 26 ? 1.816   -0.836  1.623   1.00 0.00 ? 554 LEU A HG   16 
ATOM   9462  H  HD11 . LEU A 1 26 ? 1.085   -3.604  0.720   1.00 0.00 ? 554 LEU A HD11 16 
ATOM   9463  H  HD12 . LEU A 1 26 ? 0.120   -2.130  0.645   1.00 0.00 ? 554 LEU A HD12 16 
ATOM   9464  H  HD13 . LEU A 1 26 ? 0.442   -2.894  2.201   1.00 0.00 ? 554 LEU A HD13 16 
ATOM   9465  H  HD21 . LEU A 1 26 ? 2.581   -3.323  2.848   1.00 0.00 ? 554 LEU A HD21 16 
ATOM   9466  H  HD22 . LEU A 1 26 ? 2.978   -1.671  3.321   1.00 0.00 ? 554 LEU A HD22 16 
ATOM   9467  H  HD23 . LEU A 1 26 ? 3.988   -2.520  2.151   1.00 0.00 ? 554 LEU A HD23 16 
ATOM   9468  N  N    . ARG A 1 27 ? 6.055   -1.452  0.245   1.00 0.00 ? 555 ARG A N    16 
ATOM   9469  C  CA   . ARG A 1 27 ? 7.291   -1.659  0.986   1.00 0.00 ? 555 ARG A CA   16 
ATOM   9470  C  C    . ARG A 1 27 ? 8.065   -0.352  1.130   1.00 0.00 ? 555 ARG A C    16 
ATOM   9471  O  O    . ARG A 1 27 ? 8.658   -0.081  2.174   1.00 0.00 ? 555 ARG A O    16 
ATOM   9472  C  CB   . ARG A 1 27 ? 8.156   -2.724  0.297   1.00 0.00 ? 555 ARG A CB   16 
ATOM   9473  C  CG   . ARG A 1 27 ? 8.798   -2.269  -1.006  1.00 0.00 ? 555 ARG A CG   16 
ATOM   9474  C  CD   . ARG A 1 27 ? 10.130  -2.964  -1.243  1.00 0.00 ? 555 ARG A CD   16 
ATOM   9475  N  NE   . ARG A 1 27 ? 11.256  -2.040  -1.131  1.00 0.00 ? 555 ARG A NE   16 
ATOM   9476  C  CZ   . ARG A 1 27 ? 11.612  -1.185  -2.087  1.00 0.00 ? 555 ARG A CZ   16 
ATOM   9477  N  NH1  . ARG A 1 27 ? 10.935  -1.136  -3.228  1.00 0.00 ? 555 ARG A NH1  16 
ATOM   9478  N  NH2  . ARG A 1 27 ? 12.647  -0.378  -1.903  1.00 0.00 ? 555 ARG A NH2  16 
ATOM   9479  H  H    . ARG A 1 27 ? 5.965   -1.839  -0.649  1.00 0.00 ? 555 ARG A H    16 
ATOM   9480  H  HA   . ARG A 1 27 ? 7.024   -2.012  1.969   1.00 0.00 ? 555 ARG A HA   16 
ATOM   9481  H  HB2  . ARG A 1 27 ? 8.943   -3.020  0.972   1.00 0.00 ? 555 ARG A HB2  16 
ATOM   9482  H  HB3  . ARG A 1 27 ? 7.537   -3.582  0.082   1.00 0.00 ? 555 ARG A HB3  16 
ATOM   9483  H  HG2  . ARG A 1 27 ? 8.133   -2.505  -1.821  1.00 0.00 ? 555 ARG A HG2  16 
ATOM   9484  H  HG3  . ARG A 1 27 ? 8.961   -1.205  -0.968  1.00 0.00 ? 555 ARG A HG3  16 
ATOM   9485  H  HD2  . ARG A 1 27 ? 10.248  -3.750  -0.512  1.00 0.00 ? 555 ARG A HD2  16 
ATOM   9486  H  HD3  . ARG A 1 27 ? 10.125  -3.393  -2.234  1.00 0.00 ? 555 ARG A HD3  16 
ATOM   9487  H  HE   . ARG A 1 27 ? 11.773  -2.056  -0.299  1.00 0.00 ? 555 ARG A HE   16 
ATOM   9488  H  HH11 . ARG A 1 27 ? 10.153  -1.741  -3.374  1.00 0.00 ? 555 ARG A HH11 16 
ATOM   9489  H  HH12 . ARG A 1 27 ? 11.207  -0.491  -3.943  1.00 0.00 ? 555 ARG A HH12 16 
ATOM   9490  H  HH21 . ARG A 1 27 ? 13.161  -0.412  -1.045  1.00 0.00 ? 555 ARG A HH21 16 
ATOM   9491  H  HH22 . ARG A 1 27 ? 12.915  0.263   -2.621  1.00 0.00 ? 555 ARG A HH22 16 
ATOM   9492  N  N    . ALA A 1 28 ? 8.056   0.453   0.073   1.00 0.00 ? 556 ALA A N    16 
ATOM   9493  C  CA   . ALA A 1 28 ? 8.754   1.728   0.078   1.00 0.00 ? 556 ALA A CA   16 
ATOM   9494  C  C    . ALA A 1 28 ? 8.010   2.755   0.922   1.00 0.00 ? 556 ALA A C    16 
ATOM   9495  O  O    . ALA A 1 28 ? 8.618   3.514   1.676   1.00 0.00 ? 556 ALA A O    16 
ATOM   9496  C  CB   . ALA A 1 28 ? 8.933   2.239   -1.344  1.00 0.00 ? 556 ALA A CB   16 
ATOM   9497  H  H    . ALA A 1 28 ? 7.568   0.180   -0.729  1.00 0.00 ? 556 ALA A H    16 
ATOM   9498  H  HA   . ALA A 1 28 ? 9.732   1.567   0.502   1.00 0.00 ? 556 ALA A HA   16 
ATOM   9499  H  HB1  . ALA A 1 28 ? 9.799   2.883   -1.389  1.00 0.00 ? 556 ALA A HB1  16 
ATOM   9500  H  HB2  . ALA A 1 28 ? 8.055   2.794   -1.640  1.00 0.00 ? 556 ALA A HB2  16 
ATOM   9501  H  HB3  . ALA A 1 28 ? 9.072   1.402   -2.012  1.00 0.00 ? 556 ALA A HB3  16 
ATOM   9502  N  N    . HIS A 1 29 ? 6.689   2.771   0.788   1.00 0.00 ? 557 HIS A N    16 
ATOM   9503  C  CA   . HIS A 1 29 ? 5.857   3.700   1.536   1.00 0.00 ? 557 HIS A CA   16 
ATOM   9504  C  C    . HIS A 1 29 ? 5.752   3.279   3.000   1.00 0.00 ? 557 HIS A C    16 
ATOM   9505  O  O    . HIS A 1 29 ? 5.650   4.121   3.892   1.00 0.00 ? 557 HIS A O    16 
ATOM   9506  C  CB   . HIS A 1 29 ? 4.463   3.785   0.906   1.00 0.00 ? 557 HIS A CB   16 
ATOM   9507  C  CG   . HIS A 1 29 ? 3.450   4.470   1.772   1.00 0.00 ? 557 HIS A CG   16 
ATOM   9508  N  ND1  . HIS A 1 29 ? 3.670   5.673   2.404   1.00 0.00 ? 557 HIS A ND1  16 
ATOM   9509  C  CD2  . HIS A 1 29 ? 2.195   4.088   2.119   1.00 0.00 ? 557 HIS A CD2  16 
ATOM   9510  C  CE1  . HIS A 1 29 ? 2.568   5.977   3.103   1.00 0.00 ? 557 HIS A CE1  16 
ATOM   9511  N  NE2  . HIS A 1 29 ? 1.644   5.047   2.963   1.00 0.00 ? 557 HIS A NE2  16 
ATOM   9512  H  H    . HIS A 1 29 ? 6.263   2.144   0.172   1.00 0.00 ? 557 HIS A H    16 
ATOM   9513  H  HA   . HIS A 1 29 ? 6.324   4.669   1.485   1.00 0.00 ? 557 HIS A HA   16 
ATOM   9514  H  HB2  . HIS A 1 29 ? 4.528   4.333   -0.022  1.00 0.00 ? 557 HIS A HB2  16 
ATOM   9515  H  HB3  . HIS A 1 29 ? 4.106   2.786   0.703   1.00 0.00 ? 557 HIS A HB3  16 
ATOM   9516  H  HD1  . HIS A 1 29 ? 4.488   6.211   2.354   1.00 0.00 ? 557 HIS A HD1  16 
ATOM   9517  H  HD2  . HIS A 1 29 ? 1.695   3.186   1.798   1.00 0.00 ? 557 HIS A HD2  16 
ATOM   9518  H  HE1  . HIS A 1 29 ? 2.452   6.867   3.703   1.00 0.00 ? 557 HIS A HE1  16 
ATOM   9519  N  N    . LEU A 1 30 ? 5.772   1.971   3.241   1.00 0.00 ? 558 LEU A N    16 
ATOM   9520  C  CA   . LEU A 1 30 ? 5.674   1.445   4.597   1.00 0.00 ? 558 LEU A CA   16 
ATOM   9521  C  C    . LEU A 1 30 ? 6.889   1.843   5.428   1.00 0.00 ? 558 LEU A C    16 
ATOM   9522  O  O    . LEU A 1 30 ? 6.754   2.284   6.569   1.00 0.00 ? 558 LEU A O    16 
ATOM   9523  C  CB   . LEU A 1 30 ? 5.535   -0.079  4.568   1.00 0.00 ? 558 LEU A CB   16 
ATOM   9524  C  CG   . LEU A 1 30 ? 5.486   -0.752  5.941   1.00 0.00 ? 558 LEU A CG   16 
ATOM   9525  C  CD1  . LEU A 1 30 ? 4.057   -0.802  6.460   1.00 0.00 ? 558 LEU A CD1  16 
ATOM   9526  C  CD2  . LEU A 1 30 ? 6.078   -2.151  5.868   1.00 0.00 ? 558 LEU A CD2  16 
ATOM   9527  H  H    . LEU A 1 30 ? 5.852   1.347   2.489   1.00 0.00 ? 558 LEU A H    16 
ATOM   9528  H  HA   . LEU A 1 30 ? 4.791   1.869   5.049   1.00 0.00 ? 558 LEU A HA   16 
ATOM   9529  H  HB2  . LEU A 1 30 ? 4.627   -0.326  4.038   1.00 0.00 ? 558 LEU A HB2  16 
ATOM   9530  H  HB3  . LEU A 1 30 ? 6.373   -0.486  4.023   1.00 0.00 ? 558 LEU A HB3  16 
ATOM   9531  H  HG   . LEU A 1 30 ? 6.074   -0.175  6.640   1.00 0.00 ? 558 LEU A HG   16 
ATOM   9532  H  HD11 . LEU A 1 30 ? 4.067   -0.900  7.535   1.00 0.00 ? 558 LEU A HD11 16 
ATOM   9533  H  HD12 . LEU A 1 30 ? 3.546   -1.649  6.026   1.00 0.00 ? 558 LEU A HD12 16 
ATOM   9534  H  HD13 . LEU A 1 30 ? 3.543   0.107   6.186   1.00 0.00 ? 558 LEU A HD13 16 
ATOM   9535  H  HD21 . LEU A 1 30 ? 5.953   -2.645  6.821   1.00 0.00 ? 558 LEU A HD21 16 
ATOM   9536  H  HD22 . LEU A 1 30 ? 7.130   -2.086  5.632   1.00 0.00 ? 558 LEU A HD22 16 
ATOM   9537  H  HD23 . LEU A 1 30 ? 5.571   -2.717  5.100   1.00 0.00 ? 558 LEU A HD23 16 
ATOM   9538  N  N    . ARG A 1 31 ? 8.075   1.687   4.849   1.00 0.00 ? 559 ARG A N    16 
ATOM   9539  C  CA   . ARG A 1 31 ? 9.311   2.032   5.541   1.00 0.00 ? 559 ARG A CA   16 
ATOM   9540  C  C    . ARG A 1 31 ? 9.317   3.506   5.936   1.00 0.00 ? 559 ARG A C    16 
ATOM   9541  O  O    . ARG A 1 31 ? 9.924   3.888   6.937   1.00 0.00 ? 559 ARG A O    16 
ATOM   9542  C  CB   . ARG A 1 31 ? 10.522  1.721   4.658   1.00 0.00 ? 559 ARG A CB   16 
ATOM   9543  C  CG   . ARG A 1 31 ? 10.522  2.470   3.336   1.00 0.00 ? 559 ARG A CG   16 
ATOM   9544  C  CD   . ARG A 1 31 ? 11.923  2.574   2.756   1.00 0.00 ? 559 ARG A CD   16 
ATOM   9545  N  NE   . ARG A 1 31 ? 12.381  1.303   2.199   1.00 0.00 ? 559 ARG A NE   16 
ATOM   9546  C  CZ   . ARG A 1 31 ? 13.659  1.012   1.969   1.00 0.00 ? 559 ARG A CZ   16 
ATOM   9547  N  NH1  . ARG A 1 31 ? 14.610  1.897   2.245   1.00 0.00 ? 559 ARG A NH1  16 
ATOM   9548  N  NH2  . ARG A 1 31 ? 13.989  -0.168  1.461   1.00 0.00 ? 559 ARG A NH2  16 
ATOM   9549  H  H    . ARG A 1 31 ? 8.120   1.332   3.937   1.00 0.00 ? 559 ARG A H    16 
ATOM   9550  H  HA   . ARG A 1 31 ? 9.367   1.432   6.437   1.00 0.00 ? 559 ARG A HA   16 
ATOM   9551  H  HB2  . ARG A 1 31 ? 11.421  1.983   5.194   1.00 0.00 ? 559 ARG A HB2  16 
ATOM   9552  H  HB3  . ARG A 1 31 ? 10.535  0.662   4.447   1.00 0.00 ? 559 ARG A HB3  16 
ATOM   9553  H  HG2  . ARG A 1 31 ? 9.892   1.943   2.635   1.00 0.00 ? 559 ARG A HG2  16 
ATOM   9554  H  HG3  . ARG A 1 31 ? 10.133  3.465   3.496   1.00 0.00 ? 559 ARG A HG3  16 
ATOM   9555  H  HD2  . ARG A 1 31 ? 11.921  3.319   1.974   1.00 0.00 ? 559 ARG A HD2  16 
ATOM   9556  H  HD3  . ARG A 1 31 ? 12.601  2.878   3.539   1.00 0.00 ? 559 ARG A HD3  16 
ATOM   9557  H  HE   . ARG A 1 31 ? 11.700  0.632   1.985   1.00 0.00 ? 559 ARG A HE   16 
ATOM   9558  H  HH11 . ARG A 1 31 ? 14.368  2.788   2.628   1.00 0.00 ? 559 ARG A HH11 16 
ATOM   9559  H  HH12 . ARG A 1 31 ? 15.568  1.671   2.070   1.00 0.00 ? 559 ARG A HH12 16 
ATOM   9560  H  HH21 . ARG A 1 31 ? 13.277  -0.838  1.251   1.00 0.00 ? 559 ARG A HH21 16 
ATOM   9561  H  HH22 . ARG A 1 31 ? 14.949  -0.387  1.287   1.00 0.00 ? 559 ARG A HH22 16 
ATOM   9562  N  N    . TRP A 1 32 ? 8.634   4.329   5.146   1.00 0.00 ? 560 TRP A N    16 
ATOM   9563  C  CA   . TRP A 1 32 ? 8.558   5.759   5.416   1.00 0.00 ? 560 TRP A CA   16 
ATOM   9564  C  C    . TRP A 1 32 ? 7.773   6.029   6.696   1.00 0.00 ? 560 TRP A C    16 
ATOM   9565  O  O    . TRP A 1 32 ? 8.140   6.895   7.490   1.00 0.00 ? 560 TRP A O    16 
ATOM   9566  C  CB   . TRP A 1 32 ? 7.904   6.488   4.241   1.00 0.00 ? 560 TRP A CB   16 
ATOM   9567  C  CG   . TRP A 1 32 ? 8.417   7.882   4.047   1.00 0.00 ? 560 TRP A CG   16 
ATOM   9568  C  CD1  . TRP A 1 32 ? 9.620   8.246   3.515   1.00 0.00 ? 560 TRP A CD1  16 
ATOM   9569  C  CD2  . TRP A 1 32 ? 7.742   9.100   4.385   1.00 0.00 ? 560 TRP A CD2  16 
ATOM   9570  N  NE1  . TRP A 1 32 ? 9.736   9.615   3.501   1.00 0.00 ? 560 TRP A NE1  16 
ATOM   9571  C  CE2  . TRP A 1 32 ? 8.596   10.162  4.029   1.00 0.00 ? 560 TRP A CE2  16 
ATOM   9572  C  CE3  . TRP A 1 32 ? 6.499   9.395   4.952   1.00 0.00 ? 560 TRP A CE3  16 
ATOM   9573  C  CZ2  . TRP A 1 32 ? 8.245   11.495  4.223   1.00 0.00 ? 560 TRP A CZ2  16 
ATOM   9574  C  CZ3  . TRP A 1 32 ? 6.153   10.719  5.144   1.00 0.00 ? 560 TRP A CZ3  16 
ATOM   9575  C  CH2  . TRP A 1 32 ? 7.023   11.755  4.780   1.00 0.00 ? 560 TRP A CH2  16 
ATOM   9576  H  H    . TRP A 1 32 ? 8.169   3.965   4.364   1.00 0.00 ? 560 TRP A H    16 
ATOM   9577  H  HA   . TRP A 1 32 ? 9.565   6.128   5.541   1.00 0.00 ? 560 TRP A HA   16 
ATOM   9578  H  HB2  . TRP A 1 32 ? 8.091   5.935   3.333   1.00 0.00 ? 560 TRP A HB2  16 
ATOM   9579  H  HB3  . TRP A 1 32 ? 6.838   6.544   4.410   1.00 0.00 ? 560 TRP A HB3  16 
ATOM   9580  H  HD1  . TRP A 1 32 ? 10.365  7.548   3.161   1.00 0.00 ? 560 TRP A HD1  16 
ATOM   9581  H  HE1  . TRP A 1 32 ? 10.507  10.118  3.166   1.00 0.00 ? 560 TRP A HE1  16 
ATOM   9582  H  HE3  . TRP A 1 32 ? 5.816   8.610   5.239   1.00 0.00 ? 560 TRP A HE3  16 
ATOM   9583  H  HZ2  . TRP A 1 32 ? 8.904   12.306  3.948   1.00 0.00 ? 560 TRP A HZ2  16 
ATOM   9584  H  HZ3  . TRP A 1 32 ? 5.197   10.966  5.582   1.00 0.00 ? 560 TRP A HZ3  16 
ATOM   9585  H  HH2  . TRP A 1 32 ? 6.710   12.775  4.949   1.00 0.00 ? 560 TRP A HH2  16 
ATOM   9586  N  N    . HIS A 1 33 ? 6.690   5.283   6.888   1.00 0.00 ? 561 HIS A N    16 
ATOM   9587  C  CA   . HIS A 1 33 ? 5.853   5.442   8.072   1.00 0.00 ? 561 HIS A CA   16 
ATOM   9588  C  C    . HIS A 1 33 ? 6.626   5.087   9.338   1.00 0.00 ? 561 HIS A C    16 
ATOM   9589  O  O    . HIS A 1 33 ? 6.578   5.813   10.331  1.00 0.00 ? 561 HIS A O    16 
ATOM   9590  C  CB   . HIS A 1 33 ? 4.605   4.565   7.961   1.00 0.00 ? 561 HIS A CB   16 
ATOM   9591  C  CG   . HIS A 1 33 ? 3.466   5.231   7.253   1.00 0.00 ? 561 HIS A CG   16 
ATOM   9592  N  ND1  . HIS A 1 33 ? 2.853   6.382   7.697   1.00 0.00 ? 561 HIS A ND1  16 
ATOM   9593  C  CD2  . HIS A 1 33 ? 2.826   4.885   6.107   1.00 0.00 ? 561 HIS A CD2  16 
ATOM   9594  C  CE1  . HIS A 1 33 ? 1.882   6.692   6.828   1.00 0.00 ? 561 HIS A CE1  16 
ATOM   9595  N  NE2  . HIS A 1 33 ? 1.824   5.815   5.844   1.00 0.00 ? 561 HIS A NE2  16 
ATOM   9596  H  H    . HIS A 1 33 ? 6.448   4.608   6.219   1.00 0.00 ? 561 HIS A H    16 
ATOM   9597  H  HA   . HIS A 1 33 ? 5.551   6.477   8.127   1.00 0.00 ? 561 HIS A HA   16 
ATOM   9598  H  HB2  . HIS A 1 33 ? 4.852   3.666   7.417   1.00 0.00 ? 561 HIS A HB2  16 
ATOM   9599  H  HB3  . HIS A 1 33 ? 4.271   4.300   8.953   1.00 0.00 ? 561 HIS A HB3  16 
ATOM   9600  H  HD1  . HIS A 1 33 ? 3.086   6.885   8.506   1.00 0.00 ? 561 HIS A HD1  16 
ATOM   9601  H  HD2  . HIS A 1 33 ? 3.052   4.029   5.488   1.00 0.00 ? 561 HIS A HD2  16 
ATOM   9602  H  HE1  . HIS A 1 33 ? 1.232   7.550   6.919   1.00 0.00 ? 561 HIS A HE1  16 
ATOM   9603  N  N    . THR A 1 34 ? 7.338   3.966   9.294   1.00 0.00 ? 562 THR A N    16 
ATOM   9604  C  CA   . THR A 1 34 ? 8.122   3.513   10.438  1.00 0.00 ? 562 THR A CA   16 
ATOM   9605  C  C    . THR A 1 34 ? 9.434   4.285   10.540  1.00 0.00 ? 562 THR A C    16 
ATOM   9606  O  O    . THR A 1 34 ? 10.099  4.533   9.534   1.00 0.00 ? 562 THR A O    16 
ATOM   9607  C  CB   . THR A 1 34 ? 8.406   2.014   10.327  1.00 0.00 ? 562 THR A CB   16 
ATOM   9608  O  OG1  . THR A 1 34 ? 9.082   1.545   11.480  1.00 0.00 ? 562 THR A OG1  16 
ATOM   9609  C  CG2  . THR A 1 34 ? 9.247   1.652   9.122   1.00 0.00 ? 562 THR A CG2  16 
ATOM   9610  H  H    . THR A 1 34 ? 7.336   3.429   8.474   1.00 0.00 ? 562 THR A H    16 
ATOM   9611  H  HA   . THR A 1 34 ? 7.541   3.695   11.330  1.00 0.00 ? 562 THR A HA   16 
ATOM   9612  H  HB   . THR A 1 34 ? 7.467   1.486   10.246  1.00 0.00 ? 562 THR A HB   16 
ATOM   9613  H  HG1  . THR A 1 34 ? 9.207   0.596   11.414  1.00 0.00 ? 562 THR A HG1  16 
ATOM   9614  H  HG21 . THR A 1 34 ? 10.268  1.962   9.289   1.00 0.00 ? 562 THR A HG21 16 
ATOM   9615  H  HG22 . THR A 1 34 ? 8.858   2.153   8.248   1.00 0.00 ? 562 THR A HG22 16 
ATOM   9616  H  HG23 . THR A 1 34 ? 9.215   0.584   8.969   1.00 0.00 ? 562 THR A HG23 16 
ATOM   9617  N  N    . GLY A 1 35 ? 9.800   4.661   11.761  1.00 0.00 ? 563 GLY A N    16 
ATOM   9618  C  CA   . GLY A 1 35 ? 11.031  5.400   11.971  1.00 0.00 ? 563 GLY A CA   16 
ATOM   9619  C  C    . GLY A 1 35 ? 10.843  6.897   11.822  1.00 0.00 ? 563 GLY A C    16 
ATOM   9620  O  O    . GLY A 1 35 ? 11.541  7.541   11.039  1.00 0.00 ? 563 GLY A O    16 
ATOM   9621  H  H    . GLY A 1 35 ? 9.230   4.435   12.525  1.00 0.00 ? 563 GLY A H    16 
ATOM   9622  H  HA2  . GLY A 1 35 ? 11.397  5.192   12.966  1.00 0.00 ? 563 GLY A HA2  16 
ATOM   9623  H  HA3  . GLY A 1 35 ? 11.765  5.067   11.252  1.00 0.00 ? 563 GLY A HA3  16 
ATOM   9624  N  N    . GLU A 1 36 ? 9.899   7.451   12.575  1.00 0.00 ? 564 GLU A N    16 
ATOM   9625  C  CA   . GLU A 1 36 ? 9.622   8.882   12.523  1.00 0.00 ? 564 GLU A CA   16 
ATOM   9626  C  C    . GLU A 1 36 ? 9.973   9.552   13.848  1.00 0.00 ? 564 GLU A C    16 
ATOM   9627  O  O    . GLU A 1 36 ? 10.478  10.674  13.873  1.00 0.00 ? 564 GLU A O    16 
ATOM   9628  C  CB   . GLU A 1 36 ? 8.149   9.126   12.190  1.00 0.00 ? 564 GLU A CB   16 
ATOM   9629  C  CG   . GLU A 1 36 ? 7.754   8.654   10.800  1.00 0.00 ? 564 GLU A CG   16 
ATOM   9630  C  CD   . GLU A 1 36 ? 7.965   9.718   9.741   1.00 0.00 ? 564 GLU A CD   16 
ATOM   9631  O  OE1  . GLU A 1 36 ? 9.072   9.770   9.164   1.00 0.00 ? 564 GLU A OE1  16 
ATOM   9632  O  OE2  . GLU A 1 36 ? 7.024   10.499  9.488   1.00 0.00 ? 564 GLU A OE2  16 
ATOM   9633  H  H    . GLU A 1 36 ? 9.376   6.885   13.181  1.00 0.00 ? 564 GLU A H    16 
ATOM   9634  H  HA   . GLU A 1 36 ? 10.234  9.311   11.744  1.00 0.00 ? 564 GLU A HA   16 
ATOM   9635  H  HB2  . GLU A 1 36 ? 7.537   8.605   12.911  1.00 0.00 ? 564 GLU A HB2  16 
ATOM   9636  H  HB3  . GLU A 1 36 ? 7.947   10.185  12.257  1.00 0.00 ? 564 GLU A HB3  16 
ATOM   9637  H  HG2  . GLU A 1 36 ? 8.349   7.790   10.544  1.00 0.00 ? 564 GLU A HG2  16 
ATOM   9638  H  HG3  . GLU A 1 36 ? 6.709   8.379   10.811  1.00 0.00 ? 564 GLU A HG3  16 
ATOM   9639  N  N    . ARG A 1 37 ? 9.702   8.856   14.947  1.00 0.00 ? 565 ARG A N    16 
ATOM   9640  C  CA   . ARG A 1 37 ? 9.989   9.382   16.276  1.00 0.00 ? 565 ARG A CA   16 
ATOM   9641  C  C    . ARG A 1 37 ? 9.213   10.670  16.531  1.00 0.00 ? 565 ARG A C    16 
ATOM   9642  O  O    . ARG A 1 37 ? 9.592   11.415  17.459  1.00 0.00 ? 565 ARG A O    16 
ATOM   9643  C  CB   . ARG A 1 37 ? 11.489  9.638   16.433  1.00 0.00 ? 565 ARG A CB   16 
ATOM   9644  C  CG   . ARG A 1 37 ? 11.996  9.435   17.851  1.00 0.00 ? 565 ARG A CG   16 
ATOM   9645  C  CD   . ARG A 1 37 ? 13.513  9.507   17.916  1.00 0.00 ? 565 ARG A CD   16 
ATOM   9646  N  NE   . ARG A 1 37 ? 14.134  8.203   17.699  1.00 0.00 ? 565 ARG A NE   16 
ATOM   9647  C  CZ   . ARG A 1 37 ? 14.222  7.259   18.633  1.00 0.00 ? 565 ARG A CZ   16 
ATOM   9648  N  NH1  . ARG A 1 37 ? 13.729  7.469   19.848  1.00 0.00 ? 565 ARG A NH1  16 
ATOM   9649  N  NH2  . ARG A 1 37 ? 14.804  6.101   18.352  1.00 0.00 ? 565 ARG A NH2  16 
ATOM   9650  O  OXT  . ARG A 1 37 ? 8.233   10.924  15.799  1.00 0.00 ? 565 ARG A OXT  16 
ATOM   9651  H  H    . ARG A 1 37 ? 9.299   7.966   14.862  1.00 0.00 ? 565 ARG A H    16 
ATOM   9652  H  HA   . ARG A 1 37 ? 9.682   8.642   16.999  1.00 0.00 ? 565 ARG A HA   16 
ATOM   9653  H  HB2  . ARG A 1 37 ? 12.027  8.966   15.781  1.00 0.00 ? 565 ARG A HB2  16 
ATOM   9654  H  HB3  . ARG A 1 37 ? 11.702  10.656  16.140  1.00 0.00 ? 565 ARG A HB3  16 
ATOM   9655  H  HG2  . ARG A 1 37 ? 11.582  10.204  18.485  1.00 0.00 ? 565 ARG A HG2  16 
ATOM   9656  H  HG3  . ARG A 1 37 ? 11.675  8.465   18.202  1.00 0.00 ? 565 ARG A HG3  16 
ATOM   9657  H  HD2  . ARG A 1 37 ? 13.861  10.191  17.156  1.00 0.00 ? 565 ARG A HD2  16 
ATOM   9658  H  HD3  . ARG A 1 37 ? 13.802  9.876   18.889  1.00 0.00 ? 565 ARG A HD3  16 
ATOM   9659  H  HE   . ARG A 1 37 ? 14.505  8.021   16.810  1.00 0.00 ? 565 ARG A HE   16 
ATOM   9660  H  HH11 . ARG A 1 37 ? 13.289  8.340   20.066  1.00 0.00 ? 565 ARG A HH11 16 
ATOM   9661  H  HH12 . ARG A 1 37 ? 13.799  6.756   20.545  1.00 0.00 ? 565 ARG A HH12 16 
ATOM   9662  H  HH21 . ARG A 1 37 ? 15.176  5.937   17.439  1.00 0.00 ? 565 ARG A HH21 16 
ATOM   9663  H  HH22 . ARG A 1 37 ? 14.870  5.391   19.054  1.00 0.00 ? 565 ARG A HH22 16 
HETATM 9664  ZN ZN   . ZN  B 2 .  ? 0.390   5.555   4.450   1.00 0.00 ? 100 ZN  A ZN   16 
ATOM   9665  N  N    . MET A 1 1  ? -16.770 -12.540 -17.796 1.00 0.00 ? 1   MET A N    17 
ATOM   9666  C  CA   . MET A 1 1  ? -17.298 -11.152 -17.728 1.00 0.00 ? 1   MET A CA   17 
ATOM   9667  C  C    . MET A 1 1  ? -16.731 -10.405 -16.524 1.00 0.00 ? 1   MET A C    17 
ATOM   9668  O  O    . MET A 1 1  ? -16.198 -9.304  -16.660 1.00 0.00 ? 1   MET A O    17 
ATOM   9669  C  CB   . MET A 1 1  ? -18.825 -11.217 -17.640 1.00 0.00 ? 1   MET A CB   17 
ATOM   9670  C  CG   . MET A 1 1  ? -19.528 -10.191 -18.514 1.00 0.00 ? 1   MET A CG   17 
ATOM   9671  S  SD   . MET A 1 1  ? -21.141 -9.714  -17.864 1.00 0.00 ? 1   MET A SD   17 
ATOM   9672  C  CE   . MET A 1 1  ? -21.442 -8.203  -18.778 1.00 0.00 ? 1   MET A CE   17 
ATOM   9673  H  H1   . MET A 1 1  ? -15.734 -12.481 -17.869 1.00 0.00 ? 1   MET A H1   17 
ATOM   9674  H  H2   . MET A 1 1  ? -17.181 -12.993 -18.638 1.00 0.00 ? 1   MET A H2   17 
ATOM   9675  H  H3   . MET A 1 1  ? -17.056 -13.032 -16.926 1.00 0.00 ? 1   MET A H3   17 
ATOM   9676  H  HA   . MET A 1 1  ? -17.015 -10.632 -18.630 1.00 0.00 ? 1   MET A HA   17 
ATOM   9677  H  HB2  . MET A 1 1  ? -19.150 -12.200 -17.945 1.00 0.00 ? 1   MET A HB2  17 
ATOM   9678  H  HB3  . MET A 1 1  ? -19.124 -11.050 -16.616 1.00 0.00 ? 1   MET A HB3  17 
ATOM   9679  H  HG2  . MET A 1 1  ? -18.909 -9.309  -18.581 1.00 0.00 ? 1   MET A HG2  17 
ATOM   9680  H  HG3  . MET A 1 1  ? -19.662 -10.610 -19.501 1.00 0.00 ? 1   MET A HG3  17 
ATOM   9681  H  HE1  . MET A 1 1  ? -21.490 -7.371  -18.091 1.00 0.00 ? 1   MET A HE1  17 
ATOM   9682  H  HE2  . MET A 1 1  ? -22.377 -8.285  -19.311 1.00 0.00 ? 1   MET A HE2  17 
ATOM   9683  H  HE3  . MET A 1 1  ? -20.639 -8.042  -19.482 1.00 0.00 ? 1   MET A HE3  17 
ATOM   9684  N  N    . ASP A 1 2  ? -16.850 -11.012 -15.347 1.00 0.00 ? 530 ASP A N    17 
ATOM   9685  C  CA   . ASP A 1 2  ? -16.349 -10.404 -14.120 1.00 0.00 ? 530 ASP A CA   17 
ATOM   9686  C  C    . ASP A 1 2  ? -14.885 -10.776 -13.888 1.00 0.00 ? 530 ASP A C    17 
ATOM   9687  O  O    . ASP A 1 2  ? -14.528 -11.954 -13.906 1.00 0.00 ? 530 ASP A O    17 
ATOM   9688  C  CB   . ASP A 1 2  ? -17.195 -10.849 -12.925 1.00 0.00 ? 530 ASP A CB   17 
ATOM   9689  C  CG   . ASP A 1 2  ? -17.221 -9.813  -11.818 1.00 0.00 ? 530 ASP A CG   17 
ATOM   9690  O  OD1  . ASP A 1 2  ? -16.133 -9.380  -11.385 1.00 0.00 ? 530 ASP A OD1  17 
ATOM   9691  O  OD2  . ASP A 1 2  ? -18.330 -9.437  -11.384 1.00 0.00 ? 530 ASP A OD2  17 
ATOM   9692  H  H    . ASP A 1 2  ? -17.285 -11.889 -15.303 1.00 0.00 ? 530 ASP A H    17 
ATOM   9693  H  HA   . ASP A 1 2  ? -16.428 -9.333  -14.227 1.00 0.00 ? 530 ASP A HA   17 
ATOM   9694  H  HB2  . ASP A 1 2  ? -18.208 -11.022 -13.254 1.00 0.00 ? 530 ASP A HB2  17 
ATOM   9695  H  HB3  . ASP A 1 2  ? -16.788 -11.766 -12.526 1.00 0.00 ? 530 ASP A HB3  17 
ATOM   9696  N  N    . PRO A 1 3  ? -14.011 -9.775  -13.664 1.00 0.00 ? 531 PRO A N    17 
ATOM   9697  C  CA   . PRO A 1 3  ? -12.584 -10.016 -13.429 1.00 0.00 ? 531 PRO A CA   17 
ATOM   9698  C  C    . PRO A 1 3  ? -12.343 -11.012 -12.300 1.00 0.00 ? 531 PRO A C    17 
ATOM   9699  O  O    . PRO A 1 3  ? -11.768 -12.080 -12.512 1.00 0.00 ? 531 PRO A O    17 
ATOM   9700  C  CB   . PRO A 1 3  ? -12.045 -8.635  -13.045 1.00 0.00 ? 531 PRO A CB   17 
ATOM   9701  C  CG   . PRO A 1 3  ? -12.997 -7.671  -13.662 1.00 0.00 ? 531 PRO A CG   17 
ATOM   9702  C  CD   . PRO A 1 3  ? -14.343 -8.338  -13.624 1.00 0.00 ? 531 PRO A CD   17 
ATOM   9703  H  HA   . PRO A 1 3  ? -12.089 -10.362 -14.324 1.00 0.00 ? 531 PRO A HA   17 
ATOM   9704  H  HB2  . PRO A 1 3  ? -12.026 -8.539  -11.969 1.00 0.00 ? 531 PRO A HB2  17 
ATOM   9705  H  HB3  . PRO A 1 3  ? -11.048 -8.512  -13.440 1.00 0.00 ? 531 PRO A HB3  17 
ATOM   9706  H  HG2  . PRO A 1 3  ? -13.016 -6.755  -13.089 1.00 0.00 ? 531 PRO A HG2  17 
ATOM   9707  H  HG3  . PRO A 1 3  ? -12.707 -7.470  -14.683 1.00 0.00 ? 531 PRO A HG3  17 
ATOM   9708  H  HD2  . PRO A 1 3  ? -14.863 -8.088  -12.710 1.00 0.00 ? 531 PRO A HD2  17 
ATOM   9709  H  HD3  . PRO A 1 3  ? -14.930 -8.054  -14.484 1.00 0.00 ? 531 PRO A HD3  17 
ATOM   9710  N  N    . GLY A 1 4  ? -12.787 -10.655 -11.099 1.00 0.00 ? 532 GLY A N    17 
ATOM   9711  C  CA   . GLY A 1 4  ? -12.610 -11.529 -9.954  1.00 0.00 ? 532 GLY A CA   17 
ATOM   9712  C  C    . GLY A 1 4  ? -12.291 -10.762 -8.685  1.00 0.00 ? 532 GLY A C    17 
ATOM   9713  O  O    . GLY A 1 4  ? -13.126 -10.659 -7.787  1.00 0.00 ? 532 GLY A O    17 
ATOM   9714  H  H    . GLY A 1 4  ? -13.237 -9.792  -10.990 1.00 0.00 ? 532 GLY A H    17 
ATOM   9715  H  HA2  . GLY A 1 4  ? -13.519 -12.093 -9.801  1.00 0.00 ? 532 GLY A HA2  17 
ATOM   9716  H  HA3  . GLY A 1 4  ? -11.803 -12.215 -10.159 1.00 0.00 ? 532 GLY A HA3  17 
ATOM   9717  N  N    . LYS A 1 5  ? -11.078 -10.224 -8.611  1.00 0.00 ? 533 LYS A N    17 
ATOM   9718  C  CA   . LYS A 1 5  ? -10.649 -9.463  -7.444  1.00 0.00 ? 533 LYS A CA   17 
ATOM   9719  C  C    . LYS A 1 5  ? -9.701  -8.338  -7.847  1.00 0.00 ? 533 LYS A C    17 
ATOM   9720  O  O    . LYS A 1 5  ? -8.843  -8.515  -8.711  1.00 0.00 ? 533 LYS A O    17 
ATOM   9721  C  CB   . LYS A 1 5  ? -9.966  -10.384 -6.431  1.00 0.00 ? 533 LYS A CB   17 
ATOM   9722  C  CG   . LYS A 1 5  ? -10.292 -10.046 -4.985  1.00 0.00 ? 533 LYS A CG   17 
ATOM   9723  C  CD   . LYS A 1 5  ? -9.095  -10.272 -4.076  1.00 0.00 ? 533 LYS A CD   17 
ATOM   9724  C  CE   . LYS A 1 5  ? -9.066  -9.269  -2.934  1.00 0.00 ? 533 LYS A CE   17 
ATOM   9725  N  NZ   . LYS A 1 5  ? -8.199  -8.099  -3.244  1.00 0.00 ? 533 LYS A NZ   17 
ATOM   9726  H  H    . LYS A 1 5  ? -10.457 -10.341 -9.360  1.00 0.00 ? 533 LYS A H    17 
ATOM   9727  H  HA   . LYS A 1 5  ? -11.528 -9.031  -6.989  1.00 0.00 ? 533 LYS A HA   17 
ATOM   9728  H  HB2  . LYS A 1 5  ? -10.276 -11.401 -6.620  1.00 0.00 ? 533 LYS A HB2  17 
ATOM   9729  H  HB3  . LYS A 1 5  ? -8.896  -10.314 -6.562  1.00 0.00 ? 533 LYS A HB3  17 
ATOM   9730  H  HG2  . LYS A 1 5  ? -10.586 -9.009  -4.925  1.00 0.00 ? 533 LYS A HG2  17 
ATOM   9731  H  HG3  . LYS A 1 5  ? -11.107 -10.673 -4.655  1.00 0.00 ? 533 LYS A HG3  17 
ATOM   9732  H  HD2  . LYS A 1 5  ? -9.150  -11.269 -3.665  1.00 0.00 ? 533 LYS A HD2  17 
ATOM   9733  H  HD3  . LYS A 1 5  ? -8.190  -10.169 -4.657  1.00 0.00 ? 533 LYS A HD3  17 
ATOM   9734  H  HE2  . LYS A 1 5  ? -10.072 -8.922  -2.751  1.00 0.00 ? 533 LYS A HE2  17 
ATOM   9735  H  HE3  . LYS A 1 5  ? -8.690  -9.762  -2.049  1.00 0.00 ? 533 LYS A HE3  17 
ATOM   9736  H  HZ1  . LYS A 1 5  ? -8.773  -7.319  -3.623  1.00 0.00 ? 533 LYS A HZ1  17 
ATOM   9737  H  HZ2  . LYS A 1 5  ? -7.482  -8.362  -3.949  1.00 0.00 ? 533 LYS A HZ2  17 
ATOM   9738  H  HZ3  . LYS A 1 5  ? -7.717  -7.773  -2.381  1.00 0.00 ? 533 LYS A HZ3  17 
ATOM   9739  N  N    . LYS A 1 6  ? -9.863  -7.179  -7.216  1.00 0.00 ? 534 LYS A N    17 
ATOM   9740  C  CA   . LYS A 1 6  ? -9.022  -6.025  -7.509  1.00 0.00 ? 534 LYS A CA   17 
ATOM   9741  C  C    . LYS A 1 6  ? -7.713  -6.093  -6.729  1.00 0.00 ? 534 LYS A C    17 
ATOM   9742  O  O    . LYS A 1 6  ? -7.711  -6.093  -5.498  1.00 0.00 ? 534 LYS A O    17 
ATOM   9743  C  CB   . LYS A 1 6  ? -9.763  -4.729  -7.172  1.00 0.00 ? 534 LYS A CB   17 
ATOM   9744  C  CG   . LYS A 1 6  ? -11.139 -4.632  -7.810  1.00 0.00 ? 534 LYS A CG   17 
ATOM   9745  C  CD   . LYS A 1 6  ? -12.241 -4.965  -6.815  1.00 0.00 ? 534 LYS A CD   17 
ATOM   9746  C  CE   . LYS A 1 6  ? -13.429 -4.029  -6.967  1.00 0.00 ? 534 LYS A CE   17 
ATOM   9747  N  NZ   . LYS A 1 6  ? -14.566 -4.430  -6.092  1.00 0.00 ? 534 LYS A NZ   17 
ATOM   9748  H  H    . LYS A 1 6  ? -10.565 -7.099  -6.536  1.00 0.00 ? 534 LYS A H    17 
ATOM   9749  H  HA   . LYS A 1 6  ? -8.799  -6.038  -8.565  1.00 0.00 ? 534 LYS A HA   17 
ATOM   9750  H  HB2  . LYS A 1 6  ? -9.879  -4.663  -6.101  1.00 0.00 ? 534 LYS A HB2  17 
ATOM   9751  H  HB3  . LYS A 1 6  ? -9.172  -3.892  -7.514  1.00 0.00 ? 534 LYS A HB3  17 
ATOM   9752  H  HG2  . LYS A 1 6  ? -11.287 -3.626  -8.172  1.00 0.00 ? 534 LYS A HG2  17 
ATOM   9753  H  HG3  . LYS A 1 6  ? -11.192 -5.325  -8.637  1.00 0.00 ? 534 LYS A HG3  17 
ATOM   9754  H  HD2  . LYS A 1 6  ? -12.570 -5.979  -6.984  1.00 0.00 ? 534 LYS A HD2  17 
ATOM   9755  H  HD3  . LYS A 1 6  ? -11.847 -4.873  -5.813  1.00 0.00 ? 534 LYS A HD3  17 
ATOM   9756  H  HE2  . LYS A 1 6  ? -13.120 -3.029  -6.703  1.00 0.00 ? 534 LYS A HE2  17 
ATOM   9757  H  HE3  . LYS A 1 6  ? -13.755 -4.045  -7.996  1.00 0.00 ? 534 LYS A HE3  17 
ATOM   9758  H  HZ1  . LYS A 1 6  ? -15.459 -4.053  -6.472  1.00 0.00 ? 534 LYS A HZ1  17 
ATOM   9759  H  HZ2  . LYS A 1 6  ? -14.427 -4.058  -5.131  1.00 0.00 ? 534 LYS A HZ2  17 
ATOM   9760  H  HZ3  . LYS A 1 6  ? -14.632 -5.467  -6.044  1.00 0.00 ? 534 LYS A HZ3  17 
ATOM   9761  N  N    . LYS A 1 7  ? -6.601  -6.150  -7.455  1.00 0.00 ? 535 LYS A N    17 
ATOM   9762  C  CA   . LYS A 1 7  ? -5.284  -6.217  -6.831  1.00 0.00 ? 535 LYS A CA   17 
ATOM   9763  C  C    . LYS A 1 7  ? -4.813  -4.831  -6.403  1.00 0.00 ? 535 LYS A C    17 
ATOM   9764  O  O    . LYS A 1 7  ? -4.461  -3.999  -7.239  1.00 0.00 ? 535 LYS A O    17 
ATOM   9765  C  CB   . LYS A 1 7  ? -4.271  -6.837  -7.795  1.00 0.00 ? 535 LYS A CB   17 
ATOM   9766  C  CG   . LYS A 1 7  ? -4.219  -8.355  -7.730  1.00 0.00 ? 535 LYS A CG   17 
ATOM   9767  C  CD   . LYS A 1 7  ? -5.336  -8.988  -8.545  1.00 0.00 ? 535 LYS A CD   17 
ATOM   9768  C  CE   . LYS A 1 7  ? -6.031  -10.098 -7.772  1.00 0.00 ? 535 LYS A CE   17 
ATOM   9769  N  NZ   . LYS A 1 7  ? -5.315  -11.399 -7.899  1.00 0.00 ? 535 LYS A NZ   17 
ATOM   9770  H  H    . LYS A 1 7  ? -6.667  -6.146  -8.432  1.00 0.00 ? 535 LYS A H    17 
ATOM   9771  H  HA   . LYS A 1 7  ? -5.364  -6.843  -5.955  1.00 0.00 ? 535 LYS A HA   17 
ATOM   9772  H  HB2  . LYS A 1 7  ? -4.529  -6.550  -8.804  1.00 0.00 ? 535 LYS A HB2  17 
ATOM   9773  H  HB3  . LYS A 1 7  ? -3.288  -6.454  -7.562  1.00 0.00 ? 535 LYS A HB3  17 
ATOM   9774  H  HG2  . LYS A 1 7  ? -3.269  -8.690  -8.120  1.00 0.00 ? 535 LYS A HG2  17 
ATOM   9775  H  HG3  . LYS A 1 7  ? -4.316  -8.664  -6.699  1.00 0.00 ? 535 LYS A HG3  17 
ATOM   9776  H  HD2  . LYS A 1 7  ? -6.062  -8.229  -8.794  1.00 0.00 ? 535 LYS A HD2  17 
ATOM   9777  H  HD3  . LYS A 1 7  ? -4.917  -9.400  -9.452  1.00 0.00 ? 535 LYS A HD3  17 
ATOM   9778  H  HE2  . LYS A 1 7  ? -6.073  -9.822  -6.729  1.00 0.00 ? 535 LYS A HE2  17 
ATOM   9779  H  HE3  . LYS A 1 7  ? -7.035  -10.211 -8.154  1.00 0.00 ? 535 LYS A HE3  17 
ATOM   9780  H  HZ1  . LYS A 1 7  ? -5.037  -11.746 -6.959  1.00 0.00 ? 535 LYS A HZ1  17 
ATOM   9781  H  HZ2  . LYS A 1 7  ? -4.461  -11.284 -8.480  1.00 0.00 ? 535 LYS A HZ2  17 
ATOM   9782  H  HZ3  . LYS A 1 7  ? -5.934  -12.105 -8.348  1.00 0.00 ? 535 LYS A HZ3  17 
ATOM   9783  N  N    . GLN A 1 8  ? -4.811  -4.589  -5.096  1.00 0.00 ? 536 GLN A N    17 
ATOM   9784  C  CA   . GLN A 1 8  ? -4.384  -3.303  -4.558  1.00 0.00 ? 536 GLN A CA   17 
ATOM   9785  C  C    . GLN A 1 8  ? -3.709  -3.478  -3.201  1.00 0.00 ? 536 GLN A C    17 
ATOM   9786  O  O    . GLN A 1 8  ? -3.964  -4.450  -2.491  1.00 0.00 ? 536 GLN A O    17 
ATOM   9787  C  CB   . GLN A 1 8  ? -5.580  -2.358  -4.428  1.00 0.00 ? 536 GLN A CB   17 
ATOM   9788  C  CG   . GLN A 1 8  ? -6.311  -2.119  -5.738  1.00 0.00 ? 536 GLN A CG   17 
ATOM   9789  C  CD   . GLN A 1 8  ? -7.216  -0.904  -5.687  1.00 0.00 ? 536 GLN A CD   17 
ATOM   9790  O  OE1  . GLN A 1 8  ? -7.798  -0.591  -4.648  1.00 0.00 ? 536 GLN A OE1  17 
ATOM   9791  N  NE2  . GLN A 1 8  ? -7.340  -0.210  -6.813  1.00 0.00 ? 536 GLN A NE2  17 
ATOM   9792  H  H    . GLN A 1 8  ? -5.103  -5.292  -4.480  1.00 0.00 ? 536 GLN A H    17 
ATOM   9793  H  HA   . GLN A 1 8  ? -3.672  -2.875  -5.248  1.00 0.00 ? 536 GLN A HA   17 
ATOM   9794  H  HB2  . GLN A 1 8  ? -6.280  -2.778  -3.721  1.00 0.00 ? 536 GLN A HB2  17 
ATOM   9795  H  HB3  . GLN A 1 8  ? -5.233  -1.406  -4.055  1.00 0.00 ? 536 GLN A HB3  17 
ATOM   9796  H  HG2  . GLN A 1 8  ? -5.582  -1.973  -6.522  1.00 0.00 ? 536 GLN A HG2  17 
ATOM   9797  H  HG3  . GLN A 1 8  ? -6.912  -2.988  -5.964  1.00 0.00 ? 536 GLN A HG3  17 
ATOM   9798  H  HE21 . GLN A 1 8  ? -6.848  -0.518  -7.603  1.00 0.00 ? 536 GLN A HE21 17 
ATOM   9799  H  HE22 . GLN A 1 8  ? -7.919  0.580   -6.809  1.00 0.00 ? 536 GLN A HE22 17 
ATOM   9800  N  N    . HIS A 1 9  ? -2.847  -2.530  -2.848  1.00 0.00 ? 537 HIS A N    17 
ATOM   9801  C  CA   . HIS A 1 9  ? -2.136  -2.578  -1.576  1.00 0.00 ? 537 HIS A CA   17 
ATOM   9802  C  C    . HIS A 1 9  ? -2.585  -1.446  -0.658  1.00 0.00 ? 537 HIS A C    17 
ATOM   9803  O  O    . HIS A 1 9  ? -2.213  -0.289  -0.854  1.00 0.00 ? 537 HIS A O    17 
ATOM   9804  C  CB   . HIS A 1 9  ? -0.626  -2.494  -1.809  1.00 0.00 ? 537 HIS A CB   17 
ATOM   9805  C  CG   . HIS A 1 9  ? -0.137  -3.402  -2.895  1.00 0.00 ? 537 HIS A CG   17 
ATOM   9806  N  ND1  . HIS A 1 9  ? -0.796  -4.543  -3.296  1.00 0.00 ? 537 HIS A ND1  17 
ATOM   9807  C  CD2  . HIS A 1 9  ? 0.973   -3.317  -3.672  1.00 0.00 ? 537 HIS A CD2  17 
ATOM   9808  C  CE1  . HIS A 1 9  ? -0.082  -5.105  -4.280  1.00 0.00 ? 537 HIS A CE1  17 
ATOM   9809  N  NE2  . HIS A 1 9  ? 1.001   -4.399  -4.547  1.00 0.00 ? 537 HIS A NE2  17 
ATOM   9810  H  H    . HIS A 1 9  ? -2.686  -1.779  -3.458  1.00 0.00 ? 537 HIS A H    17 
ATOM   9811  H  HA   . HIS A 1 9  ? -2.365  -3.521  -1.104  1.00 0.00 ? 537 HIS A HA   17 
ATOM   9812  H  HB2  . HIS A 1 9  ? -0.367  -1.481  -2.082  1.00 0.00 ? 537 HIS A HB2  17 
ATOM   9813  H  HB3  . HIS A 1 9  ? -0.113  -2.758  -0.897  1.00 0.00 ? 537 HIS A HB3  17 
ATOM   9814  H  HD1  . HIS A 1 9  ? -1.637  -4.884  -2.926  1.00 0.00 ? 537 HIS A HD1  17 
ATOM   9815  H  HD2  . HIS A 1 9  ? 1.721   -2.540  -3.627  1.00 0.00 ? 537 HIS A HD2  17 
ATOM   9816  H  HE1  . HIS A 1 9  ? -0.357  -6.016  -4.791  1.00 0.00 ? 537 HIS A HE1  17 
ATOM   9817  N  N    . ILE A 1 10 ? -3.390  -1.788  0.343   1.00 0.00 ? 538 ILE A N    17 
ATOM   9818  C  CA   . ILE A 1 10 ? -3.892  -0.801  1.291   1.00 0.00 ? 538 ILE A CA   17 
ATOM   9819  C  C    . ILE A 1 10 ? -2.973  -0.682  2.502   1.00 0.00 ? 538 ILE A C    17 
ATOM   9820  O  O    . ILE A 1 10 ? -2.293  -1.639  2.873   1.00 0.00 ? 538 ILE A O    17 
ATOM   9821  C  CB   . ILE A 1 10 ? -5.312  -1.156  1.773   1.00 0.00 ? 538 ILE A CB   17 
ATOM   9822  C  CG1  . ILE A 1 10 ? -6.201  -1.533  0.587   1.00 0.00 ? 538 ILE A CG1  17 
ATOM   9823  C  CG2  . ILE A 1 10 ? -5.915  0.007   2.546   1.00 0.00 ? 538 ILE A CG2  17 
ATOM   9824  C  CD1  . ILE A 1 10 ? -6.381  -0.411  -0.414  1.00 0.00 ? 538 ILE A CD1  17 
ATOM   9825  H  H    . ILE A 1 10 ? -3.652  -2.726  0.446   1.00 0.00 ? 538 ILE A H    17 
ATOM   9826  H  HA   . ILE A 1 10 ? -3.934  0.154   0.788   1.00 0.00 ? 538 ILE A HA   17 
ATOM   9827  H  HB   . ILE A 1 10 ? -5.240  -2.000  2.442   1.00 0.00 ? 538 ILE A HB   17 
ATOM   9828  H  HG12 . ILE A 1 10 ? -5.761  -2.371  0.068   1.00 0.00 ? 538 ILE A HG12 17 
ATOM   9829  H  HG13 . ILE A 1 10 ? -7.178  -1.813  0.952   1.00 0.00 ? 538 ILE A HG13 17 
ATOM   9830  H  HG21 . ILE A 1 10 ? -6.973  -0.163  2.686   1.00 0.00 ? 538 ILE A HG21 17 
ATOM   9831  H  HG22 . ILE A 1 10 ? -5.769  0.923   1.991   1.00 0.00 ? 538 ILE A HG22 17 
ATOM   9832  H  HG23 . ILE A 1 10 ? -5.433  0.089   3.509   1.00 0.00 ? 538 ILE A HG23 17 
ATOM   9833  H  HD11 . ILE A 1 10 ? -5.447  -0.229  -0.923  1.00 0.00 ? 538 ILE A HD11 17 
ATOM   9834  H  HD12 . ILE A 1 10 ? -6.691  0.485   0.103   1.00 0.00 ? 538 ILE A HD12 17 
ATOM   9835  H  HD13 . ILE A 1 10 ? -7.135  -0.690  -1.135  1.00 0.00 ? 538 ILE A HD13 17 
ATOM   9836  N  N    . CYS A 1 11 ? -2.958  0.497   3.114   1.00 0.00 ? 539 CYS A N    17 
ATOM   9837  C  CA   . CYS A 1 11 ? -2.123  0.740   4.285   1.00 0.00 ? 539 CYS A CA   17 
ATOM   9838  C  C    . CYS A 1 11 ? -2.656  -0.015  5.498   1.00 0.00 ? 539 CYS A C    17 
ATOM   9839  O  O    . CYS A 1 11 ? -3.778  0.220   5.944   1.00 0.00 ? 539 CYS A O    17 
ATOM   9840  C  CB   . CYS A 1 11 ? -2.059  2.238   4.590   1.00 0.00 ? 539 CYS A CB   17 
ATOM   9841  S  SG   . CYS A 1 11 ? -0.544  2.757   5.428   1.00 0.00 ? 539 CYS A SG   17 
ATOM   9842  H  H    . CYS A 1 11 ? -3.523  1.221   2.772   1.00 0.00 ? 539 CYS A H    17 
ATOM   9843  H  HA   . CYS A 1 11 ? -1.128  0.385   4.062   1.00 0.00 ? 539 CYS A HA   17 
ATOM   9844  H  HB2  . CYS A 1 11 ? -2.127  2.790   3.665   1.00 0.00 ? 539 CYS A HB2  17 
ATOM   9845  H  HB3  . CYS A 1 11 ? -2.893  2.504   5.224   1.00 0.00 ? 539 CYS A HB3  17 
ATOM   9846  N  N    . HIS A 1 12 ? -1.843  -0.925  6.026   1.00 0.00 ? 540 HIS A N    17 
ATOM   9847  C  CA   . HIS A 1 12 ? -2.233  -1.717  7.187   1.00 0.00 ? 540 HIS A CA   17 
ATOM   9848  C  C    . HIS A 1 12 ? -2.577  -0.818  8.372   1.00 0.00 ? 540 HIS A C    17 
ATOM   9849  O  O    . HIS A 1 12 ? -3.390  -1.181  9.222   1.00 0.00 ? 540 HIS A O    17 
ATOM   9850  C  CB   . HIS A 1 12 ? -1.111  -2.683  7.573   1.00 0.00 ? 540 HIS A CB   17 
ATOM   9851  C  CG   . HIS A 1 12 ? 0.194   -2.006  7.855   1.00 0.00 ? 540 HIS A CG   17 
ATOM   9852  N  ND1  . HIS A 1 12 ? 0.723   -1.853  9.117   1.00 0.00 ? 540 HIS A ND1  17 
ATOM   9853  C  CD2  . HIS A 1 12 ? 1.085   -1.436  7.004   1.00 0.00 ? 540 HIS A CD2  17 
ATOM   9854  C  CE1  . HIS A 1 12 ? 1.892   -1.210  8.997   1.00 0.00 ? 540 HIS A CE1  17 
ATOM   9855  N  NE2  . HIS A 1 12 ? 2.159   -0.935  7.735   1.00 0.00 ? 540 HIS A NE2  17 
ATOM   9856  H  H    . HIS A 1 12 ? -0.960  -1.068  5.625   1.00 0.00 ? 540 HIS A H    17 
ATOM   9857  H  HA   . HIS A 1 12 ? -3.109  -2.287  6.919   1.00 0.00 ? 540 HIS A HA   17 
ATOM   9858  H  HB2  . HIS A 1 12 ? -1.402  -3.224  8.461   1.00 0.00 ? 540 HIS A HB2  17 
ATOM   9859  H  HB3  . HIS A 1 12 ? -0.956  -3.384  6.766   1.00 0.00 ? 540 HIS A HB3  17 
ATOM   9860  H  HD1  . HIS A 1 12 ? 0.316   -2.160  9.954   1.00 0.00 ? 540 HIS A HD1  17 
ATOM   9861  H  HD2  . HIS A 1 12 ? 0.988   -1.376  5.930   1.00 0.00 ? 540 HIS A HD2  17 
ATOM   9862  H  HE1  . HIS A 1 12 ? 2.534   -0.951  9.826   1.00 0.00 ? 540 HIS A HE1  17 
ATOM   9863  N  N    . ILE A 1 13 ? -1.955  0.355   8.421   1.00 0.00 ? 541 ILE A N    17 
ATOM   9864  C  CA   . ILE A 1 13 ? -2.198  1.303   9.502   1.00 0.00 ? 541 ILE A CA   17 
ATOM   9865  C  C    . ILE A 1 13 ? -3.406  2.184   9.197   1.00 0.00 ? 541 ILE A C    17 
ATOM   9866  O  O    . ILE A 1 13 ? -3.461  2.842   8.158   1.00 0.00 ? 541 ILE A O    17 
ATOM   9867  C  CB   . ILE A 1 13 ? -0.971  2.201   9.750   1.00 0.00 ? 541 ILE A CB   17 
ATOM   9868  C  CG1  . ILE A 1 13 ? 0.293   1.349   9.897   1.00 0.00 ? 541 ILE A CG1  17 
ATOM   9869  C  CG2  . ILE A 1 13 ? -1.185  3.063   10.986  1.00 0.00 ? 541 ILE A CG2  17 
ATOM   9870  C  CD1  . ILE A 1 13 ? 1.404   1.748   8.950   1.00 0.00 ? 541 ILE A CD1  17 
ATOM   9871  H  H    . ILE A 1 13 ? -1.318  0.590   7.715   1.00 0.00 ? 541 ILE A H    17 
ATOM   9872  H  HA   . ILE A 1 13 ? -2.394  0.740   10.402  1.00 0.00 ? 541 ILE A HA   17 
ATOM   9873  H  HB   . ILE A 1 13 ? -0.856  2.858   8.900   1.00 0.00 ? 541 ILE A HB   17 
ATOM   9874  H  HG12 . ILE A 1 13 ? 0.669   1.443   10.905  1.00 0.00 ? 541 ILE A HG12 17 
ATOM   9875  H  HG13 . ILE A 1 13 ? 0.048   0.315   9.705   1.00 0.00 ? 541 ILE A HG13 17 
ATOM   9876  H  HG21 . ILE A 1 13 ? -1.936  3.811   10.777  1.00 0.00 ? 541 ILE A HG21 17 
ATOM   9877  H  HG22 . ILE A 1 13 ? -0.257  3.549   11.251  1.00 0.00 ? 541 ILE A HG22 17 
ATOM   9878  H  HG23 . ILE A 1 13 ? -1.513  2.442   11.805  1.00 0.00 ? 541 ILE A HG23 17 
ATOM   9879  H  HD11 . ILE A 1 13 ? 1.282   1.226   8.012   1.00 0.00 ? 541 ILE A HD11 17 
ATOM   9880  H  HD12 . ILE A 1 13 ? 2.358   1.489   9.384   1.00 0.00 ? 541 ILE A HD12 17 
ATOM   9881  H  HD13 . ILE A 1 13 ? 1.364   2.813   8.776   1.00 0.00 ? 541 ILE A HD13 17 
ATOM   9882  N  N    . GLN A 1 14 ? -4.372  2.191   10.110  1.00 0.00 ? 542 GLN A N    17 
ATOM   9883  C  CA   . GLN A 1 14 ? -5.579  2.991   9.940   1.00 0.00 ? 542 GLN A CA   17 
ATOM   9884  C  C    . GLN A 1 14 ? -5.239  4.475   9.847   1.00 0.00 ? 542 GLN A C    17 
ATOM   9885  O  O    . GLN A 1 14 ? -4.864  5.099   10.839  1.00 0.00 ? 542 GLN A O    17 
ATOM   9886  C  CB   . GLN A 1 14 ? -6.545  2.748   11.101  1.00 0.00 ? 542 GLN A CB   17 
ATOM   9887  C  CG   . GLN A 1 14 ? -5.925  2.988   12.468  1.00 0.00 ? 542 GLN A CG   17 
ATOM   9888  C  CD   . GLN A 1 14 ? -6.103  1.810   13.406  1.00 0.00 ? 542 GLN A CD   17 
ATOM   9889  O  OE1  . GLN A 1 14 ? -6.078  0.655   12.982  1.00 0.00 ? 542 GLN A OE1  17 
ATOM   9890  N  NE2  . GLN A 1 14 ? -6.283  2.098   14.690  1.00 0.00 ? 542 GLN A NE2  17 
ATOM   9891  H  H    . GLN A 1 14 ? -4.270  1.646   10.918  1.00 0.00 ? 542 GLN A H    17 
ATOM   9892  H  HA   . GLN A 1 14 ? -6.052  2.684   9.020   1.00 0.00 ? 542 GLN A HA   17 
ATOM   9893  H  HB2  . GLN A 1 14 ? -7.392  3.409   10.993  1.00 0.00 ? 542 GLN A HB2  17 
ATOM   9894  H  HB3  . GLN A 1 14 ? -6.889  1.726   11.060  1.00 0.00 ? 542 GLN A HB3  17 
ATOM   9895  H  HG2  . GLN A 1 14 ? -4.868  3.172   12.343  1.00 0.00 ? 542 GLN A HG2  17 
ATOM   9896  H  HG3  . GLN A 1 14 ? -6.390  3.856   12.913  1.00 0.00 ? 542 GLN A HG3  17 
ATOM   9897  H  HE21 . GLN A 1 14 ? -6.291  3.041   14.956  1.00 0.00 ? 542 GLN A HE21 17 
ATOM   9898  H  HE22 . GLN A 1 14 ? -6.400  1.355   15.319  1.00 0.00 ? 542 GLN A HE22 17 
ATOM   9899  N  N    . GLY A 1 15 ? -5.373  5.034   8.649   1.00 0.00 ? 543 GLY A N    17 
ATOM   9900  C  CA   . GLY A 1 15 ? -5.077  6.440   8.449   1.00 0.00 ? 543 GLY A CA   17 
ATOM   9901  C  C    . GLY A 1 15 ? -4.694  6.755   7.017   1.00 0.00 ? 543 GLY A C    17 
ATOM   9902  O  O    . GLY A 1 15 ? -5.342  7.568   6.358   1.00 0.00 ? 543 GLY A O    17 
ATOM   9903  H  H    . GLY A 1 15 ? -5.676  4.487   7.894   1.00 0.00 ? 543 GLY A H    17 
ATOM   9904  H  HA2  . GLY A 1 15 ? -5.947  7.022   8.714   1.00 0.00 ? 543 GLY A HA2  17 
ATOM   9905  H  HA3  . GLY A 1 15 ? -4.260  6.720   9.098   1.00 0.00 ? 543 GLY A HA3  17 
ATOM   9906  N  N    . CYS A 1 16 ? -3.638  6.109   6.533   1.00 0.00 ? 544 CYS A N    17 
ATOM   9907  C  CA   . CYS A 1 16 ? -3.170  6.323   5.170   1.00 0.00 ? 544 CYS A CA   17 
ATOM   9908  C  C    . CYS A 1 16 ? -4.210  5.853   4.158   1.00 0.00 ? 544 CYS A C    17 
ATOM   9909  O  O    . CYS A 1 16 ? -5.360  5.592   4.510   1.00 0.00 ? 544 CYS A O    17 
ATOM   9910  C  CB   . CYS A 1 16 ? -1.849  5.585   4.944   1.00 0.00 ? 544 CYS A CB   17 
ATOM   9911  S  SG   . CYS A 1 16 ? -0.589  6.566   4.100   1.00 0.00 ? 544 CYS A SG   17 
ATOM   9912  H  H    . CYS A 1 16 ? -3.162  5.472   7.106   1.00 0.00 ? 544 CYS A H    17 
ATOM   9913  H  HA   . CYS A 1 16 ? -3.007  7.382   5.037   1.00 0.00 ? 544 CYS A HA   17 
ATOM   9914  H  HB2  . CYS A 1 16 ? -1.445  5.286   5.899   1.00 0.00 ? 544 CYS A HB2  17 
ATOM   9915  H  HB3  . CYS A 1 16 ? -2.035  4.705   4.347   1.00 0.00 ? 544 CYS A HB3  17 
ATOM   9916  N  N    . GLY A 1 17 ? -3.797  5.748   2.899   1.00 0.00 ? 545 GLY A N    17 
ATOM   9917  C  CA   . GLY A 1 17 ? -4.704  5.309   1.857   1.00 0.00 ? 545 GLY A CA   17 
ATOM   9918  C  C    . GLY A 1 17 ? -4.211  5.674   0.471   1.00 0.00 ? 545 GLY A C    17 
ATOM   9919  O  O    . GLY A 1 17 ? -4.894  6.378   -0.273  1.00 0.00 ? 545 GLY A O    17 
ATOM   9920  H  H    . GLY A 1 17 ? -2.868  5.969   2.677   1.00 0.00 ? 545 GLY A H    17 
ATOM   9921  H  HA2  . GLY A 1 17 ? -4.812  4.236   1.918   1.00 0.00 ? 545 GLY A HA2  17 
ATOM   9922  H  HA3  . GLY A 1 17 ? -5.668  5.768   2.017   1.00 0.00 ? 545 GLY A HA3  17 
ATOM   9923  N  N    . LYS A 1 18 ? -3.021  5.195   0.123   1.00 0.00 ? 546 LYS A N    17 
ATOM   9924  C  CA   . LYS A 1 18 ? -2.436  5.477   -1.184  1.00 0.00 ? 546 LYS A CA   17 
ATOM   9925  C  C    . LYS A 1 18 ? -2.873  4.440   -2.212  1.00 0.00 ? 546 LYS A C    17 
ATOM   9926  O  O    . LYS A 1 18 ? -3.069  4.756   -3.385  1.00 0.00 ? 546 LYS A O    17 
ATOM   9927  C  CB   . LYS A 1 18 ? -0.910  5.503   -1.090  1.00 0.00 ? 546 LYS A CB   17 
ATOM   9928  C  CG   . LYS A 1 18 ? -0.311  4.253   -0.465  1.00 0.00 ? 546 LYS A CG   17 
ATOM   9929  C  CD   . LYS A 1 18 ? -0.061  4.439   1.023   1.00 0.00 ? 546 LYS A CD   17 
ATOM   9930  C  CE   . LYS A 1 18 ? -0.435  3.194   1.811   1.00 0.00 ? 546 LYS A CE   17 
ATOM   9931  N  NZ   . LYS A 1 18 ? 0.186   1.965   1.241   1.00 0.00 ? 546 LYS A NZ   17 
ATOM   9932  H  H    . LYS A 1 18 ? -2.524  4.640   0.759   1.00 0.00 ? 546 LYS A H    17 
ATOM   9933  H  HA   . LYS A 1 18 ? -2.785  6.448   -1.499  1.00 0.00 ? 546 LYS A HA   17 
ATOM   9934  H  HB2  . LYS A 1 18 ? -0.504  5.608   -2.084  1.00 0.00 ? 546 LYS A HB2  17 
ATOM   9935  H  HB3  . LYS A 1 18 ? -0.612  6.354   -0.497  1.00 0.00 ? 546 LYS A HB3  17 
ATOM   9936  H  HG2  . LYS A 1 18 ? -0.993  3.429   -0.604  1.00 0.00 ? 546 LYS A HG2  17 
ATOM   9937  H  HG3  . LYS A 1 18 ? 0.627   4.033   -0.953  1.00 0.00 ? 546 LYS A HG3  17 
ATOM   9938  H  HD2  . LYS A 1 18 ? 0.986   4.650   1.178   1.00 0.00 ? 546 LYS A HD2  17 
ATOM   9939  H  HD3  . LYS A 1 18 ? -0.654  5.270   1.377   1.00 0.00 ? 546 LYS A HD3  17 
ATOM   9940  H  HE2  . LYS A 1 18 ? -0.100  3.314   2.831   1.00 0.00 ? 546 LYS A HE2  17 
ATOM   9941  H  HE3  . LYS A 1 18 ? -1.509  3.084   1.797   1.00 0.00 ? 546 LYS A HE3  17 
ATOM   9942  H  HZ1  . LYS A 1 18 ? -0.551  1.334   0.865   1.00 0.00 ? 546 LYS A HZ1  17 
ATOM   9943  H  HZ2  . LYS A 1 18 ? 0.717   1.458   1.977   1.00 0.00 ? 546 LYS A HZ2  17 
ATOM   9944  H  HZ3  . LYS A 1 18 ? 0.838   2.216   0.470   1.00 0.00 ? 546 LYS A HZ3  17 
ATOM   9945  N  N    . VAL A 1 19 ? -3.026  3.200   -1.760  1.00 0.00 ? 547 VAL A N    17 
ATOM   9946  C  CA   . VAL A 1 19 ? -3.443  2.111   -2.632  1.00 0.00 ? 547 VAL A CA   17 
ATOM   9947  C  C    . VAL A 1 19 ? -2.530  2.002   -3.852  1.00 0.00 ? 547 VAL A C    17 
ATOM   9948  O  O    . VAL A 1 19 ? -2.847  2.515   -4.926  1.00 0.00 ? 547 VAL A O    17 
ATOM   9949  C  CB   . VAL A 1 19 ? -4.900  2.307   -3.093  1.00 0.00 ? 547 VAL A CB   17 
ATOM   9950  C  CG1  . VAL A 1 19 ? -5.290  1.272   -4.141  1.00 0.00 ? 547 VAL A CG1  17 
ATOM   9951  C  CG2  . VAL A 1 19 ? -5.845  2.252   -1.900  1.00 0.00 ? 547 VAL A CG2  17 
ATOM   9952  H  H    . VAL A 1 19 ? -2.859  3.016   -0.817  1.00 0.00 ? 547 VAL A H    17 
ATOM   9953  H  HA   . VAL A 1 19 ? -3.386  1.192   -2.068  1.00 0.00 ? 547 VAL A HA   17 
ATOM   9954  H  HB   . VAL A 1 19 ? -4.979  3.287   -3.537  1.00 0.00 ? 547 VAL A HB   17 
ATOM   9955  H  HG11 . VAL A 1 19 ? -6.266  0.872   -3.908  1.00 0.00 ? 547 VAL A HG11 17 
ATOM   9956  H  HG12 . VAL A 1 19 ? -4.565  0.472   -4.144  1.00 0.00 ? 547 VAL A HG12 17 
ATOM   9957  H  HG13 . VAL A 1 19 ? -5.315  1.738   -5.115  1.00 0.00 ? 547 VAL A HG13 17 
ATOM   9958  H  HG21 . VAL A 1 19 ? -5.353  1.762   -1.073  1.00 0.00 ? 547 VAL A HG21 17 
ATOM   9959  H  HG22 . VAL A 1 19 ? -6.733  1.701   -2.169  1.00 0.00 ? 547 VAL A HG22 17 
ATOM   9960  H  HG23 . VAL A 1 19 ? -6.118  3.256   -1.612  1.00 0.00 ? 547 VAL A HG23 17 
ATOM   9961  N  N    . TYR A 1 20 ? -1.397  1.329   -3.679  1.00 0.00 ? 548 TYR A N    17 
ATOM   9962  C  CA   . TYR A 1 20 ? -0.440  1.150   -4.764  1.00 0.00 ? 548 TYR A CA   17 
ATOM   9963  C  C    . TYR A 1 20 ? -0.543  -0.252  -5.354  1.00 0.00 ? 548 TYR A C    17 
ATOM   9964  O  O    . TYR A 1 20 ? -0.978  -1.188  -4.683  1.00 0.00 ? 548 TYR A O    17 
ATOM   9965  C  CB   . TYR A 1 20 ? 0.986   1.400   -4.266  1.00 0.00 ? 548 TYR A CB   17 
ATOM   9966  C  CG   . TYR A 1 20 ? 1.341   2.865   -4.136  1.00 0.00 ? 548 TYR A CG   17 
ATOM   9967  C  CD1  . TYR A 1 20 ? 0.941   3.788   -5.095  1.00 0.00 ? 548 TYR A CD1  17 
ATOM   9968  C  CD2  . TYR A 1 20 ? 2.078   3.325   -3.051  1.00 0.00 ? 548 TYR A CD2  17 
ATOM   9969  C  CE1  . TYR A 1 20 ? 1.266   5.126   -4.977  1.00 0.00 ? 548 TYR A CE1  17 
ATOM   9970  C  CE2  . TYR A 1 20 ? 2.406   4.661   -2.926  1.00 0.00 ? 548 TYR A CE2  17 
ATOM   9971  C  CZ   . TYR A 1 20 ? 1.998   5.557   -3.891  1.00 0.00 ? 548 TYR A CZ   17 
ATOM   9972  O  OH   . TYR A 1 20 ? 2.323   6.889   -3.770  1.00 0.00 ? 548 TYR A OH   17 
ATOM   9973  H  H    . TYR A 1 20 ? -1.201  0.942   -2.800  1.00 0.00 ? 548 TYR A H    17 
ATOM   9974  H  HA   . TYR A 1 20 ? -0.674  1.869   -5.534  1.00 0.00 ? 548 TYR A HA   17 
ATOM   9975  H  HB2  . TYR A 1 20 ? 1.104   0.944   -3.295  1.00 0.00 ? 548 TYR A HB2  17 
ATOM   9976  H  HB3  . TYR A 1 20 ? 1.684   0.949   -4.956  1.00 0.00 ? 548 TYR A HB3  17 
ATOM   9977  H  HD1  . TYR A 1 20 ? 0.368   3.448   -5.945  1.00 0.00 ? 548 TYR A HD1  17 
ATOM   9978  H  HD2  . TYR A 1 20 ? 2.397   2.620   -2.297  1.00 0.00 ? 548 TYR A HD2  17 
ATOM   9979  H  HE1  . TYR A 1 20 ? 0.946   5.828   -5.733  1.00 0.00 ? 548 TYR A HE1  17 
ATOM   9980  H  HE2  . TYR A 1 20 ? 2.980   4.999   -2.076  1.00 0.00 ? 548 TYR A HE2  17 
ATOM   9981  H  HH   . TYR A 1 20 ? 2.191   7.170   -2.862  1.00 0.00 ? 548 TYR A HH   17 
ATOM   9982  N  N    . GLY A 1 21 ? -0.140  -0.389  -6.613  1.00 0.00 ? 549 GLY A N    17 
ATOM   9983  C  CA   . GLY A 1 21 ? -0.195  -1.681  -7.272  1.00 0.00 ? 549 GLY A CA   17 
ATOM   9984  C  C    . GLY A 1 21 ? 1.089   -2.472  -7.114  1.00 0.00 ? 549 GLY A C    17 
ATOM   9985  O  O    . GLY A 1 21 ? 1.088   -3.697  -7.232  1.00 0.00 ? 549 GLY A O    17 
ATOM   9986  H  H    . GLY A 1 21 ? 0.197   0.392   -7.098  1.00 0.00 ? 549 GLY A H    17 
ATOM   9987  H  HA2  . GLY A 1 21 ? -1.010  -2.252  -6.853  1.00 0.00 ? 549 GLY A HA2  17 
ATOM   9988  H  HA3  . GLY A 1 21 ? -0.382  -1.527  -8.325  1.00 0.00 ? 549 GLY A HA3  17 
ATOM   9989  N  N    . LYS A 1 22 ? 2.188   -1.772  -6.848  1.00 0.00 ? 550 LYS A N    17 
ATOM   9990  C  CA   . LYS A 1 22 ? 3.484   -2.420  -6.676  1.00 0.00 ? 550 LYS A CA   17 
ATOM   9991  C  C    . LYS A 1 22 ? 3.859   -2.508  -5.200  1.00 0.00 ? 550 LYS A C    17 
ATOM   9992  O  O    . LYS A 1 22 ? 3.864   -1.502  -4.490  1.00 0.00 ? 550 LYS A O    17 
ATOM   9993  C  CB   . LYS A 1 22 ? 4.564   -1.656  -7.445  1.00 0.00 ? 550 LYS A CB   17 
ATOM   9994  C  CG   . LYS A 1 22 ? 5.595   -2.559  -8.103  1.00 0.00 ? 550 LYS A CG   17 
ATOM   9995  C  CD   . LYS A 1 22 ? 4.997   -3.326  -9.272  1.00 0.00 ? 550 LYS A CD   17 
ATOM   9996  C  CE   . LYS A 1 22 ? 5.706   -4.653  -9.489  1.00 0.00 ? 550 LYS A CE   17 
ATOM   9997  N  NZ   . LYS A 1 22 ? 4.751   -5.741  -9.837  1.00 0.00 ? 550 LYS A NZ   17 
ATOM   9998  H  H    . LYS A 1 22 ? 2.127   -0.798  -6.767  1.00 0.00 ? 550 LYS A H    17 
ATOM   9999  H  HA   . LYS A 1 22 ? 3.409   -3.420  -7.076  1.00 0.00 ? 550 LYS A HA   17 
ATOM   10000 H  HB2  . LYS A 1 22 ? 4.092   -1.065  -8.215  1.00 0.00 ? 550 LYS A HB2  17 
ATOM   10001 H  HB3  . LYS A 1 22 ? 5.079   -0.997  -6.762  1.00 0.00 ? 550 LYS A HB3  17 
ATOM   10002 H  HG2  . LYS A 1 22 ? 6.412   -1.953  -8.463  1.00 0.00 ? 550 LYS A HG2  17 
ATOM   10003 H  HG3  . LYS A 1 22 ? 5.961   -3.264  -7.371  1.00 0.00 ? 550 LYS A HG3  17 
ATOM   10004 H  HD2  . LYS A 1 22 ? 3.954   -3.515  -9.069  1.00 0.00 ? 550 LYS A HD2  17 
ATOM   10005 H  HD3  . LYS A 1 22 ? 5.089   -2.727  -10.166 1.00 0.00 ? 550 LYS A HD3  17 
ATOM   10006 H  HE2  . LYS A 1 22 ? 6.417   -4.539  -10.293 1.00 0.00 ? 550 LYS A HE2  17 
ATOM   10007 H  HE3  . LYS A 1 22 ? 6.228   -4.920  -8.582  1.00 0.00 ? 550 LYS A HE3  17 
ATOM   10008 H  HZ1  . LYS A 1 22 ? 4.462   -6.252  -8.979  1.00 0.00 ? 550 LYS A HZ1  17 
ATOM   10009 H  HZ2  . LYS A 1 22 ? 5.198   -6.413  -10.493 1.00 0.00 ? 550 LYS A HZ2  17 
ATOM   10010 H  HZ3  . LYS A 1 22 ? 3.905   -5.342  -10.292 1.00 0.00 ? 550 LYS A HZ3  17 
ATOM   10011 N  N    . THR A 1 23 ? 4.176   -3.716  -4.747  1.00 0.00 ? 551 THR A N    17 
ATOM   10012 C  CA   . THR A 1 23 ? 4.556   -3.936  -3.356  1.00 0.00 ? 551 THR A CA   17 
ATOM   10013 C  C    . THR A 1 23 ? 5.928   -3.337  -3.064  1.00 0.00 ? 551 THR A C    17 
ATOM   10014 O  O    . THR A 1 23 ? 6.219   -2.954  -1.931  1.00 0.00 ? 551 THR A O    17 
ATOM   10015 C  CB   . THR A 1 23 ? 4.561   -5.432  -3.037  1.00 0.00 ? 551 THR A CB   17 
ATOM   10016 O  OG1  . THR A 1 23 ? 5.367   -6.139  -3.963  1.00 0.00 ? 551 THR A OG1  17 
ATOM   10017 C  CG2  . THR A 1 23 ? 3.182   -6.054  -3.059  1.00 0.00 ? 551 THR A CG2  17 
ATOM   10018 H  H    . THR A 1 23 ? 4.156   -4.478  -5.363  1.00 0.00 ? 551 THR A H    17 
ATOM   10019 H  HA   . THR A 1 23 ? 3.823   -3.447  -2.732  1.00 0.00 ? 551 THR A HA   17 
ATOM   10020 H  HB   . THR A 1 23 ? 4.974   -5.577  -2.049  1.00 0.00 ? 551 THR A HB   17 
ATOM   10021 H  HG1  . THR A 1 23 ? 5.655   -6.966  -3.570  1.00 0.00 ? 551 THR A HG1  17 
ATOM   10022 H  HG21 . THR A 1 23 ? 3.261   -7.113  -2.865  1.00 0.00 ? 551 THR A HG21 17 
ATOM   10023 H  HG22 . THR A 1 23 ? 2.732   -5.899  -4.029  1.00 0.00 ? 551 THR A HG22 17 
ATOM   10024 H  HG23 . THR A 1 23 ? 2.567   -5.594  -2.299  1.00 0.00 ? 551 THR A HG23 17 
ATOM   10025 N  N    . SER A 1 24 ? 6.768   -3.257  -4.093  1.00 0.00 ? 552 SER A N    17 
ATOM   10026 C  CA   . SER A 1 24 ? 8.109   -2.702  -3.945  1.00 0.00 ? 552 SER A CA   17 
ATOM   10027 C  C    . SER A 1 24 ? 8.055   -1.296  -3.357  1.00 0.00 ? 552 SER A C    17 
ATOM   10028 O  O    . SER A 1 24 ? 8.964   -0.876  -2.643  1.00 0.00 ? 552 SER A O    17 
ATOM   10029 C  CB   . SER A 1 24 ? 8.825   -2.675  -5.297  1.00 0.00 ? 552 SER A CB   17 
ATOM   10030 O  OG   . SER A 1 24 ? 8.140   -1.846  -6.220  1.00 0.00 ? 552 SER A OG   17 
ATOM   10031 H  H    . SER A 1 24 ? 6.479   -3.578  -4.972  1.00 0.00 ? 552 SER A H    17 
ATOM   10032 H  HA   . SER A 1 24 ? 8.659   -3.340  -3.269  1.00 0.00 ? 552 SER A HA   17 
ATOM   10033 H  HB2  . SER A 1 24 ? 9.826   -2.294  -5.164  1.00 0.00 ? 552 SER A HB2  17 
ATOM   10034 H  HB3  . SER A 1 24 ? 8.872   -3.677  -5.697  1.00 0.00 ? 552 SER A HB3  17 
ATOM   10035 H  HG   . SER A 1 24 ? 8.030   -2.315  -7.051  1.00 0.00 ? 552 SER A HG   17 
ATOM   10036 N  N    . HIS A 1 25 ? 6.980   -0.575  -3.658  1.00 0.00 ? 553 HIS A N    17 
ATOM   10037 C  CA   . HIS A 1 25 ? 6.805   0.782   -3.154  1.00 0.00 ? 553 HIS A CA   17 
ATOM   10038 C  C    . HIS A 1 25 ? 6.396   0.762   -1.684  1.00 0.00 ? 553 HIS A C    17 
ATOM   10039 O  O    . HIS A 1 25 ? 6.687   1.695   -0.935  1.00 0.00 ? 553 HIS A O    17 
ATOM   10040 C  CB   . HIS A 1 25 ? 5.754   1.526   -3.982  1.00 0.00 ? 553 HIS A CB   17 
ATOM   10041 C  CG   . HIS A 1 25 ? 6.225   2.850   -4.498  1.00 0.00 ? 553 HIS A CG   17 
ATOM   10042 N  ND1  . HIS A 1 25 ? 7.177   3.623   -3.872  1.00 0.00 ? 553 HIS A ND1  17 
ATOM   10043 C  CD2  . HIS A 1 25 ? 5.856   3.537   -5.609  1.00 0.00 ? 553 HIS A CD2  17 
ATOM   10044 C  CE1  . HIS A 1 25 ? 7.352   4.732   -4.604  1.00 0.00 ? 553 HIS A CE1  17 
ATOM   10045 N  NE2  . HIS A 1 25 ? 6.574   4.728   -5.669  1.00 0.00 ? 553 HIS A NE2  17 
ATOM   10046 H  H    . HIS A 1 25 ? 6.287   -0.966  -4.230  1.00 0.00 ? 553 HIS A H    17 
ATOM   10047 H  HA   . HIS A 1 25 ? 7.751   1.294   -3.244  1.00 0.00 ? 553 HIS A HA   17 
ATOM   10048 H  HB2  . HIS A 1 25 ? 5.480   0.918   -4.832  1.00 0.00 ? 553 HIS A HB2  17 
ATOM   10049 H  HB3  . HIS A 1 25 ? 4.878   1.698   -3.373  1.00 0.00 ? 553 HIS A HB3  17 
ATOM   10050 H  HD1  . HIS A 1 25 ? 7.643   3.402   -3.039  1.00 0.00 ? 553 HIS A HD1  17 
ATOM   10051 H  HD2  . HIS A 1 25 ? 5.123   3.221   -6.336  1.00 0.00 ? 553 HIS A HD2  17 
ATOM   10052 H  HE1  . HIS A 1 25 ? 8.042   5.525   -4.355  1.00 0.00 ? 553 HIS A HE1  17 
ATOM   10053 N  N    . LEU A 1 26 ? 5.720   -0.308  -1.279  1.00 0.00 ? 554 LEU A N    17 
ATOM   10054 C  CA   . LEU A 1 26 ? 5.271   -0.452  0.100   1.00 0.00 ? 554 LEU A CA   17 
ATOM   10055 C  C    . LEU A 1 26 ? 6.460   -0.509  1.055   1.00 0.00 ? 554 LEU A C    17 
ATOM   10056 O  O    . LEU A 1 26 ? 6.383   -0.033  2.187   1.00 0.00 ? 554 LEU A O    17 
ATOM   10057 C  CB   . LEU A 1 26 ? 4.415   -1.713  0.251   1.00 0.00 ? 554 LEU A CB   17 
ATOM   10058 C  CG   . LEU A 1 26 ? 2.944   -1.460  0.583   1.00 0.00 ? 554 LEU A CG   17 
ATOM   10059 C  CD1  . LEU A 1 26 ? 2.160   -1.134  -0.679  1.00 0.00 ? 554 LEU A CD1  17 
ATOM   10060 C  CD2  . LEU A 1 26 ? 2.343   -2.666  1.289   1.00 0.00 ? 554 LEU A CD2  17 
ATOM   10061 H  H    . LEU A 1 26 ? 5.518   -1.019  -1.923  1.00 0.00 ? 554 LEU A H    17 
ATOM   10062 H  HA   . LEU A 1 26 ? 4.670   0.411   0.344   1.00 0.00 ? 554 LEU A HA   17 
ATOM   10063 H  HB2  . LEU A 1 26 ? 4.463   -2.267  -0.676  1.00 0.00 ? 554 LEU A HB2  17 
ATOM   10064 H  HB3  . LEU A 1 26 ? 4.838   -2.322  1.036   1.00 0.00 ? 554 LEU A HB3  17 
ATOM   10065 H  HG   . LEU A 1 26 ? 2.872   -0.612  1.248   1.00 0.00 ? 554 LEU A HG   17 
ATOM   10066 H  HD11 . LEU A 1 26 ? 1.934   -2.048  -1.209  1.00 0.00 ? 554 LEU A HD11 17 
ATOM   10067 H  HD12 . LEU A 1 26 ? 2.750   -0.488  -1.312  1.00 0.00 ? 554 LEU A HD12 17 
ATOM   10068 H  HD13 . LEU A 1 26 ? 1.240   -0.635  -0.413  1.00 0.00 ? 554 LEU A HD13 17 
ATOM   10069 H  HD21 . LEU A 1 26 ? 1.266   -2.627  1.216   1.00 0.00 ? 554 LEU A HD21 17 
ATOM   10070 H  HD22 . LEU A 1 26 ? 2.634   -2.656  2.329   1.00 0.00 ? 554 LEU A HD22 17 
ATOM   10071 H  HD23 . LEU A 1 26 ? 2.702   -3.572  0.823   1.00 0.00 ? 554 LEU A HD23 17 
ATOM   10072 N  N    . ARG A 1 27 ? 7.559   -1.098  0.591   1.00 0.00 ? 555 ARG A N    17 
ATOM   10073 C  CA   . ARG A 1 27 ? 8.761   -1.218  1.406   1.00 0.00 ? 555 ARG A CA   17 
ATOM   10074 C  C    . ARG A 1 27 ? 9.320   0.159   1.760   1.00 0.00 ? 555 ARG A C    17 
ATOM   10075 O  O    . ARG A 1 27 ? 9.729   0.400   2.896   1.00 0.00 ? 555 ARG A O    17 
ATOM   10076 C  CB   . ARG A 1 27 ? 9.818   -2.062  0.677   1.00 0.00 ? 555 ARG A CB   17 
ATOM   10077 C  CG   . ARG A 1 27 ? 10.719  -1.267  -0.257  1.00 0.00 ? 555 ARG A CG   17 
ATOM   10078 C  CD   . ARG A 1 27 ? 11.428  -2.171  -1.253  1.00 0.00 ? 555 ARG A CD   17 
ATOM   10079 N  NE   . ARG A 1 27 ? 11.670  -1.499  -2.527  1.00 0.00 ? 555 ARG A NE   17 
ATOM   10080 C  CZ   . ARG A 1 27 ? 12.065  -2.126  -3.633  1.00 0.00 ? 555 ARG A CZ   17 
ATOM   10081 N  NH1  . ARG A 1 27 ? 12.266  -3.438  -3.625  1.00 0.00 ? 555 ARG A NH1  17 
ATOM   10082 N  NH2  . ARG A 1 27 ? 12.261  -1.439  -4.750  1.00 0.00 ? 555 ARG A NH2  17 
ATOM   10083 H  H    . ARG A 1 27 ? 7.560   -1.460  -0.319  1.00 0.00 ? 555 ARG A H    17 
ATOM   10084 H  HA   . ARG A 1 27 ? 8.485   -1.722  2.320   1.00 0.00 ? 555 ARG A HA   17 
ATOM   10085 H  HB2  . ARG A 1 27 ? 10.441  -2.547  1.413   1.00 0.00 ? 555 ARG A HB2  17 
ATOM   10086 H  HB3  . ARG A 1 27 ? 9.313   -2.819  0.094   1.00 0.00 ? 555 ARG A HB3  17 
ATOM   10087 H  HG2  . ARG A 1 27 ? 10.120  -0.553  -0.800  1.00 0.00 ? 555 ARG A HG2  17 
ATOM   10088 H  HG3  . ARG A 1 27 ? 11.459  -0.744  0.331   1.00 0.00 ? 555 ARG A HG3  17 
ATOM   10089 H  HD2  . ARG A 1 27 ? 12.375  -2.475  -0.832  1.00 0.00 ? 555 ARG A HD2  17 
ATOM   10090 H  HD3  . ARG A 1 27 ? 10.815  -3.044  -1.426  1.00 0.00 ? 555 ARG A HD3  17 
ATOM   10091 H  HE   . ARG A 1 27 ? 11.529  -0.530  -2.562  1.00 0.00 ? 555 ARG A HE   17 
ATOM   10092 H  HH11 . ARG A 1 27 ? 12.120  -3.962  -2.786  1.00 0.00 ? 555 ARG A HH11 17 
ATOM   10093 H  HH12 . ARG A 1 27 ? 12.563  -3.903  -4.458  1.00 0.00 ? 555 ARG A HH12 17 
ATOM   10094 H  HH21 . ARG A 1 27 ? 12.112  -0.450  -4.762  1.00 0.00 ? 555 ARG A HH21 17 
ATOM   10095 H  HH22 . ARG A 1 27 ? 12.559  -1.910  -5.580  1.00 0.00 ? 555 ARG A HH22 17 
ATOM   10096 N  N    . ALA A 1 28 ? 9.333   1.058   0.780   1.00 0.00 ? 556 ALA A N    17 
ATOM   10097 C  CA   . ALA A 1 28 ? 9.839   2.406   0.988   1.00 0.00 ? 556 ALA A CA   17 
ATOM   10098 C  C    . ALA A 1 28 ? 8.834   3.254   1.759   1.00 0.00 ? 556 ALA A C    17 
ATOM   10099 O  O    . ALA A 1 28 ? 9.211   4.135   2.531   1.00 0.00 ? 556 ALA A O    17 
ATOM   10100 C  CB   . ALA A 1 28 ? 10.171  3.058   -0.346  1.00 0.00 ? 556 ALA A CB   17 
ATOM   10101 H  H    . ALA A 1 28 ? 8.994   0.810   -0.102  1.00 0.00 ? 556 ALA A H    17 
ATOM   10102 H  HA   . ALA A 1 28 ? 10.748  2.332   1.562   1.00 0.00 ? 556 ALA A HA   17 
ATOM   10103 H  HB1  . ALA A 1 28 ? 11.213  2.894   -0.577  1.00 0.00 ? 556 ALA A HB1  17 
ATOM   10104 H  HB2  . ALA A 1 28 ? 9.978   4.119   -0.286  1.00 0.00 ? 556 ALA A HB2  17 
ATOM   10105 H  HB3  . ALA A 1 28 ? 9.557   2.624   -1.121  1.00 0.00 ? 556 ALA A HB3  17 
ATOM   10106 N  N    . HIS A 1 29 ? 7.553   2.982   1.542   1.00 0.00 ? 557 HIS A N    17 
ATOM   10107 C  CA   . HIS A 1 29 ? 6.492   3.718   2.213   1.00 0.00 ? 557 HIS A CA   17 
ATOM   10108 C  C    . HIS A 1 29 ? 6.383   3.303   3.679   1.00 0.00 ? 557 HIS A C    17 
ATOM   10109 O  O    . HIS A 1 29 ? 6.022   4.109   4.536   1.00 0.00 ? 557 HIS A O    17 
ATOM   10110 C  CB   . HIS A 1 29 ? 5.156   3.487   1.497   1.00 0.00 ? 557 HIS A CB   17 
ATOM   10111 C  CG   . HIS A 1 29 ? 3.970   4.007   2.249   1.00 0.00 ? 557 HIS A CG   17 
ATOM   10112 N  ND1  . HIS A 1 29 ? 3.925   5.244   2.851   1.00 0.00 ? 557 HIS A ND1  17 
ATOM   10113 C  CD2  . HIS A 1 29 ? 2.770   3.425   2.498   1.00 0.00 ? 557 HIS A CD2  17 
ATOM   10114 C  CE1  . HIS A 1 29 ? 2.727   5.372   3.437   1.00 0.00 ? 557 HIS A CE1  17 
ATOM   10115 N  NE2  . HIS A 1 29 ? 1.988   4.296   3.251   1.00 0.00 ? 557 HIS A NE2  17 
ATOM   10116 H  H    . HIS A 1 29 ? 7.315   2.273   0.915   1.00 0.00 ? 557 HIS A H    17 
ATOM   10117 H  HA   . HIS A 1 29 ? 6.738   4.765   2.164   1.00 0.00 ? 557 HIS A HA   17 
ATOM   10118 H  HB2  . HIS A 1 29 ? 5.181   3.980   0.537   1.00 0.00 ? 557 HIS A HB2  17 
ATOM   10119 H  HB3  . HIS A 1 29 ? 5.016   2.426   1.347   1.00 0.00 ? 557 HIS A HB3  17 
ATOM   10120 H  HD1  . HIS A 1 29 ? 4.642   5.912   2.852   1.00 0.00 ? 557 HIS A HD1  17 
ATOM   10121 H  HD2  . HIS A 1 29 ? 2.460   2.444   2.169   1.00 0.00 ? 557 HIS A HD2  17 
ATOM   10122 H  HE1  . HIS A 1 29 ? 2.407   6.244   3.989   1.00 0.00 ? 557 HIS A HE1  17 
ATOM   10123 N  N    . LEU A 1 30 ? 6.692   2.041   3.958   1.00 0.00 ? 558 LEU A N    17 
ATOM   10124 C  CA   . LEU A 1 30 ? 6.622   1.520   5.318   1.00 0.00 ? 558 LEU A CA   17 
ATOM   10125 C  C    . LEU A 1 30 ? 7.629   2.221   6.227   1.00 0.00 ? 558 LEU A C    17 
ATOM   10126 O  O    . LEU A 1 30 ? 7.338   2.499   7.391   1.00 0.00 ? 558 LEU A O    17 
ATOM   10127 C  CB   . LEU A 1 30 ? 6.872   0.009   5.321   1.00 0.00 ? 558 LEU A CB   17 
ATOM   10128 C  CG   . LEU A 1 30 ? 5.724   -0.834  5.879   1.00 0.00 ? 558 LEU A CG   17 
ATOM   10129 C  CD1  . LEU A 1 30 ? 4.828   -1.328  4.754   1.00 0.00 ? 558 LEU A CD1  17 
ATOM   10130 C  CD2  . LEU A 1 30 ? 6.265   -2.006  6.685   1.00 0.00 ? 558 LEU A CD2  17 
ATOM   10131 H  H    . LEU A 1 30 ? 6.969   1.444   3.231   1.00 0.00 ? 558 LEU A H    17 
ATOM   10132 H  HA   . LEU A 1 30 ? 5.628   1.711   5.691   1.00 0.00 ? 558 LEU A HA   17 
ATOM   10133 H  HB2  . LEU A 1 30 ? 7.061   -0.304  4.304   1.00 0.00 ? 558 LEU A HB2  17 
ATOM   10134 H  HB3  . LEU A 1 30 ? 7.755   -0.190  5.910   1.00 0.00 ? 558 LEU A HB3  17 
ATOM   10135 H  HG   . LEU A 1 30 ? 5.124   -0.222  6.538   1.00 0.00 ? 558 LEU A HG   17 
ATOM   10136 H  HD11 . LEU A 1 30 ? 5.407   -1.419  3.847   1.00 0.00 ? 558 LEU A HD11 17 
ATOM   10137 H  HD12 . LEU A 1 30 ? 4.023   -0.625  4.599   1.00 0.00 ? 558 LEU A HD12 17 
ATOM   10138 H  HD13 . LEU A 1 30 ? 4.418   -2.292  5.016   1.00 0.00 ? 558 LEU A HD13 17 
ATOM   10139 H  HD21 . LEU A 1 30 ? 7.168   -1.705  7.196   1.00 0.00 ? 558 LEU A HD21 17 
ATOM   10140 H  HD22 . LEU A 1 30 ? 6.484   -2.829  6.021   1.00 0.00 ? 558 LEU A HD22 17 
ATOM   10141 H  HD23 . LEU A 1 30 ? 5.527   -2.315  7.411   1.00 0.00 ? 558 LEU A HD23 17 
ATOM   10142 N  N    . ARG A 1 31 ? 8.813   2.500   5.692   1.00 0.00 ? 559 ARG A N    17 
ATOM   10143 C  CA   . ARG A 1 31 ? 9.859   3.165   6.461   1.00 0.00 ? 559 ARG A CA   17 
ATOM   10144 C  C    . ARG A 1 31 ? 9.386   4.527   6.964   1.00 0.00 ? 559 ARG A C    17 
ATOM   10145 O  O    . ARG A 1 31 ? 9.823   4.998   8.014   1.00 0.00 ? 559 ARG A O    17 
ATOM   10146 C  CB   . ARG A 1 31 ? 11.127  3.320   5.615   1.00 0.00 ? 559 ARG A CB   17 
ATOM   10147 C  CG   . ARG A 1 31 ? 11.025  4.390   4.537   1.00 0.00 ? 559 ARG A CG   17 
ATOM   10148 C  CD   . ARG A 1 31 ? 11.970  5.550   4.807   1.00 0.00 ? 559 ARG A CD   17 
ATOM   10149 N  NE   . ARG A 1 31 ? 12.094  6.436   3.652   1.00 0.00 ? 559 ARG A NE   17 
ATOM   10150 C  CZ   . ARG A 1 31 ? 12.564  7.679   3.719   1.00 0.00 ? 559 ARG A CZ   17 
ATOM   10151 N  NH1  . ARG A 1 31 ? 12.957  8.187   4.881   1.00 0.00 ? 559 ARG A NH1  17 
ATOM   10152 N  NH2  . ARG A 1 31 ? 12.643  8.418   2.620   1.00 0.00 ? 559 ARG A NH2  17 
ATOM   10153 H  H    . ARG A 1 31 ? 8.988   2.252   4.761   1.00 0.00 ? 559 ARG A H    17 
ATOM   10154 H  HA   . ARG A 1 31 ? 10.084  2.543   7.315   1.00 0.00 ? 559 ARG A HA   17 
ATOM   10155 H  HB2  . ARG A 1 31 ? 11.950  3.574   6.265   1.00 0.00 ? 559 ARG A HB2  17 
ATOM   10156 H  HB3  . ARG A 1 31 ? 11.340  2.377   5.134   1.00 0.00 ? 559 ARG A HB3  17 
ATOM   10157 H  HG2  . ARG A 1 31 ? 11.276  3.950   3.583   1.00 0.00 ? 559 ARG A HG2  17 
ATOM   10158 H  HG3  . ARG A 1 31 ? 10.012  4.762   4.508   1.00 0.00 ? 559 ARG A HG3  17 
ATOM   10159 H  HD2  . ARG A 1 31 ? 11.592  6.117   5.645   1.00 0.00 ? 559 ARG A HD2  17 
ATOM   10160 H  HD3  . ARG A 1 31 ? 12.944  5.154   5.052   1.00 0.00 ? 559 ARG A HD3  17 
ATOM   10161 H  HE   . ARG A 1 31 ? 11.812  6.086   2.781   1.00 0.00 ? 559 ARG A HE   17 
ATOM   10162 H  HH11 . ARG A 1 31 ? 12.900  7.635   5.713   1.00 0.00 ? 559 ARG A HH11 17 
ATOM   10163 H  HH12 . ARG A 1 31 ? 13.309  9.121   4.924   1.00 0.00 ? 559 ARG A HH12 17 
ATOM   10164 H  HH21 . ARG A 1 31 ? 12.350  8.040   1.742   1.00 0.00 ? 559 ARG A HH21 17 
ATOM   10165 H  HH22 . ARG A 1 31 ? 12.996  9.352   2.670   1.00 0.00 ? 559 ARG A HH22 17 
ATOM   10166 N  N    . TRP A 1 32 ? 8.490   5.154   6.208   1.00 0.00 ? 560 TRP A N    17 
ATOM   10167 C  CA   . TRP A 1 32 ? 7.957   6.461   6.576   1.00 0.00 ? 560 TRP A CA   17 
ATOM   10168 C  C    . TRP A 1 32 ? 7.089   6.362   7.827   1.00 0.00 ? 560 TRP A C    17 
ATOM   10169 O  O    . TRP A 1 32 ? 7.228   7.157   8.756   1.00 0.00 ? 560 TRP A O    17 
ATOM   10170 C  CB   . TRP A 1 32 ? 7.143   7.046   5.420   1.00 0.00 ? 560 TRP A CB   17 
ATOM   10171 C  CG   . TRP A 1 32 ? 7.401   8.504   5.190   1.00 0.00 ? 560 TRP A CG   17 
ATOM   10172 C  CD1  . TRP A 1 32 ? 7.048   9.538   6.009   1.00 0.00 ? 560 TRP A CD1  17 
ATOM   10173 C  CD2  . TRP A 1 32 ? 8.066   9.091   4.066   1.00 0.00 ? 560 TRP A CD2  17 
ATOM   10174 N  NE1  . TRP A 1 32 ? 7.453   10.732  5.463   1.00 0.00 ? 560 TRP A NE1  17 
ATOM   10175 C  CE2  . TRP A 1 32 ? 8.081   10.484  4.270   1.00 0.00 ? 560 TRP A CE2  17 
ATOM   10176 C  CE3  . TRP A 1 32 ? 8.652   8.574   2.907   1.00 0.00 ? 560 TRP A CE3  17 
ATOM   10177 C  CZ2  . TRP A 1 32 ? 8.658   11.365  3.358   1.00 0.00 ? 560 TRP A CZ2  17 
ATOM   10178 C  CZ3  . TRP A 1 32 ? 9.224   9.449   2.003   1.00 0.00 ? 560 TRP A CZ3  17 
ATOM   10179 C  CH2  . TRP A 1 32 ? 9.224   10.831  2.233   1.00 0.00 ? 560 TRP A CH2  17 
ATOM   10180 H  H    . TRP A 1 32 ? 8.180   4.728   5.382   1.00 0.00 ? 560 TRP A H    17 
ATOM   10181 H  HA   . TRP A 1 32 ? 8.792   7.113   6.783   1.00 0.00 ? 560 TRP A HA   17 
ATOM   10182 H  HB2  . TRP A 1 32 ? 7.389   6.518   4.512   1.00 0.00 ? 560 TRP A HB2  17 
ATOM   10183 H  HB3  . TRP A 1 32 ? 6.090   6.922   5.630   1.00 0.00 ? 560 TRP A HB3  17 
ATOM   10184 H  HD1  . TRP A 1 32 ? 6.525   9.421   6.947   1.00 0.00 ? 560 TRP A HD1  17 
ATOM   10185 H  HE1  . TRP A 1 32 ? 7.315   11.617  5.862   1.00 0.00 ? 560 TRP A HE1  17 
ATOM   10186 H  HE3  . TRP A 1 32 ? 8.662   7.512   2.712   1.00 0.00 ? 560 TRP A HE3  17 
ATOM   10187 H  HZ2  . TRP A 1 32 ? 8.666   12.432  3.521   1.00 0.00 ? 560 TRP A HZ2  17 
ATOM   10188 H  HZ3  . TRP A 1 32 ? 9.681   9.068   1.102   1.00 0.00 ? 560 TRP A HZ3  17 
ATOM   10189 H  HH2  . TRP A 1 32 ? 9.682   11.477  1.499   1.00 0.00 ? 560 TRP A HH2  17 
ATOM   10190 N  N    . HIS A 1 33 ? 6.192   5.380   7.843   1.00 0.00 ? 561 HIS A N    17 
ATOM   10191 C  CA   . HIS A 1 33 ? 5.300   5.178   8.979   1.00 0.00 ? 561 HIS A CA   17 
ATOM   10192 C  C    . HIS A 1 33 ? 6.094   4.925   10.256  1.00 0.00 ? 561 HIS A C    17 
ATOM   10193 O  O    . HIS A 1 33 ? 5.801   5.498   11.305  1.00 0.00 ? 561 HIS A O    17 
ATOM   10194 C  CB   . HIS A 1 33 ? 4.358   4.003   8.711   1.00 0.00 ? 561 HIS A CB   17 
ATOM   10195 C  CG   . HIS A 1 33 ? 3.175   4.363   7.866   1.00 0.00 ? 561 HIS A CG   17 
ATOM   10196 N  ND1  . HIS A 1 33 ? 2.056   5.007   8.346   1.00 0.00 ? 561 HIS A ND1  17 
ATOM   10197 C  CD2  . HIS A 1 33 ? 2.949   4.154   6.544   1.00 0.00 ? 561 HIS A CD2  17 
ATOM   10198 C  CE1  . HIS A 1 33 ? 1.203   5.165   7.324   1.00 0.00 ? 561 HIS A CE1  17 
ATOM   10199 N  NE2  . HIS A 1 33 ? 1.698   4.665   6.209   1.00 0.00 ? 561 HIS A NE2  17 
ATOM   10200 H  H    . HIS A 1 33 ? 6.128   4.778   7.072   1.00 0.00 ? 561 HIS A H    17 
ATOM   10201 H  HA   . HIS A 1 33 ? 4.715   6.076   9.105   1.00 0.00 ? 561 HIS A HA   17 
ATOM   10202 H  HB2  . HIS A 1 33 ? 4.902   3.222   8.202   1.00 0.00 ? 561 HIS A HB2  17 
ATOM   10203 H  HB3  . HIS A 1 33 ? 3.991   3.623   9.654   1.00 0.00 ? 561 HIS A HB3  17 
ATOM   10204 H  HD1  . HIS A 1 33 ? 1.909   5.298   9.270   1.00 0.00 ? 561 HIS A HD1  17 
ATOM   10205 H  HD2  . HIS A 1 33 ? 3.624   3.670   5.854   1.00 0.00 ? 561 HIS A HD2  17 
ATOM   10206 H  HE1  . HIS A 1 33 ? 0.235   5.640   7.404   1.00 0.00 ? 561 HIS A HE1  17 
ATOM   10207 N  N    . THR A 1 34 ? 7.101   4.063   10.160  1.00 0.00 ? 562 THR A N    17 
ATOM   10208 C  CA   . THR A 1 34 ? 7.938   3.734   11.309  1.00 0.00 ? 562 THR A CA   17 
ATOM   10209 C  C    . THR A 1 34 ? 9.034   4.777   11.501  1.00 0.00 ? 562 THR A C    17 
ATOM   10210 O  O    . THR A 1 34 ? 10.129  4.649   10.954  1.00 0.00 ? 562 THR A O    17 
ATOM   10211 C  CB   . THR A 1 34 ? 8.561   2.348   11.132  1.00 0.00 ? 562 THR A CB   17 
ATOM   10212 O  OG1  . THR A 1 34 ? 9.391   2.028   12.234  1.00 0.00 ? 562 THR A OG1  17 
ATOM   10213 C  CG2  . THR A 1 34 ? 9.397   2.224   9.876   1.00 0.00 ? 562 THR A CG2  17 
ATOM   10214 H  H    . THR A 1 34 ? 7.286   3.638   9.297   1.00 0.00 ? 562 THR A H    17 
ATOM   10215 H  HA   . THR A 1 34 ? 7.308   3.725   12.186  1.00 0.00 ? 562 THR A HA   17 
ATOM   10216 H  HB   . THR A 1 34 ? 7.771   1.613   11.078  1.00 0.00 ? 562 THR A HB   17 
ATOM   10217 H  HG1  . THR A 1 34 ? 10.142  2.626   12.254  1.00 0.00 ? 562 THR A HG1  17 
ATOM   10218 H  HG21 . THR A 1 34 ? 9.114   1.329   9.343   1.00 0.00 ? 562 THR A HG21 17 
ATOM   10219 H  HG22 . THR A 1 34 ? 10.442  2.169   10.143  1.00 0.00 ? 562 THR A HG22 17 
ATOM   10220 H  HG23 . THR A 1 34 ? 9.231   3.086   9.247   1.00 0.00 ? 562 THR A HG23 17 
ATOM   10221 N  N    . GLY A 1 35 ? 8.731   5.808   12.282  1.00 0.00 ? 563 GLY A N    17 
ATOM   10222 C  CA   . GLY A 1 35 ? 9.701   6.858   12.533  1.00 0.00 ? 563 GLY A CA   17 
ATOM   10223 C  C    . GLY A 1 35 ? 9.097   8.244   12.423  1.00 0.00 ? 563 GLY A C    17 
ATOM   10224 O  O    . GLY A 1 35 ? 8.679   8.828   13.424  1.00 0.00 ? 563 GLY A O    17 
ATOM   10225 H  H    . GLY A 1 35 ? 7.842   5.857   12.692  1.00 0.00 ? 563 GLY A H    17 
ATOM   10226 H  HA2  . GLY A 1 35 ? 10.104  6.731   13.527  1.00 0.00 ? 563 GLY A HA2  17 
ATOM   10227 H  HA3  . GLY A 1 35 ? 10.504  6.770   11.817  1.00 0.00 ? 563 GLY A HA3  17 
ATOM   10228 N  N    . GLU A 1 36 ? 9.050   8.772   11.205  1.00 0.00 ? 564 GLU A N    17 
ATOM   10229 C  CA   . GLU A 1 36 ? 8.493   10.099  10.967  1.00 0.00 ? 564 GLU A CA   17 
ATOM   10230 C  C    . GLU A 1 36 ? 9.264   11.160  11.745  1.00 0.00 ? 564 GLU A C    17 
ATOM   10231 O  O    . GLU A 1 36 ? 10.030  10.843  12.655  1.00 0.00 ? 564 GLU A O    17 
ATOM   10232 C  CB   . GLU A 1 36 ? 7.015   10.132  11.362  1.00 0.00 ? 564 GLU A CB   17 
ATOM   10233 C  CG   . GLU A 1 36 ? 6.120   9.325   10.436  1.00 0.00 ? 564 GLU A CG   17 
ATOM   10234 C  CD   . GLU A 1 36 ? 4.665   9.741   10.524  1.00 0.00 ? 564 GLU A CD   17 
ATOM   10235 O  OE1  . GLU A 1 36 ? 4.137   9.821   11.653  1.00 0.00 ? 564 GLU A OE1  17 
ATOM   10236 O  OE2  . GLU A 1 36 ? 4.053   9.987   9.463   1.00 0.00 ? 564 GLU A OE2  17 
ATOM   10237 H  H    . GLU A 1 36 ? 9.399   8.258   10.447  1.00 0.00 ? 564 GLU A H    17 
ATOM   10238 H  HA   . GLU A 1 36 ? 8.579   10.310  9.912   1.00 0.00 ? 564 GLU A HA   17 
ATOM   10239 H  HB2  . GLU A 1 36 ? 6.913   9.737   12.362  1.00 0.00 ? 564 GLU A HB2  17 
ATOM   10240 H  HB3  . GLU A 1 36 ? 6.675   11.157  11.353  1.00 0.00 ? 564 GLU A HB3  17 
ATOM   10241 H  HG2  . GLU A 1 36 ? 6.457   9.463   9.420   1.00 0.00 ? 564 GLU A HG2  17 
ATOM   10242 H  HG3  . GLU A 1 36 ? 6.198   8.281   10.702  1.00 0.00 ? 564 GLU A HG3  17 
ATOM   10243 N  N    . ARG A 1 37 ? 9.056   12.421  11.381  1.00 0.00 ? 565 ARG A N    17 
ATOM   10244 C  CA   . ARG A 1 37 ? 9.732   13.530  12.045  1.00 0.00 ? 565 ARG A CA   17 
ATOM   10245 C  C    . ARG A 1 37 ? 8.777   14.700  12.259  1.00 0.00 ? 565 ARG A C    17 
ATOM   10246 O  O    . ARG A 1 37 ? 9.265   15.823  12.504  1.00 0.00 ? 565 ARG A O    17 
ATOM   10247 C  CB   . ARG A 1 37 ? 10.939  13.985  11.223  1.00 0.00 ? 565 ARG A CB   17 
ATOM   10248 C  CG   . ARG A 1 37 ? 12.059  12.960  11.168  1.00 0.00 ? 565 ARG A CG   17 
ATOM   10249 C  CD   . ARG A 1 37 ? 13.383  13.600  10.782  1.00 0.00 ? 565 ARG A CD   17 
ATOM   10250 N  NE   . ARG A 1 37 ? 14.493  13.086  11.582  1.00 0.00 ? 565 ARG A NE   17 
ATOM   10251 C  CZ   . ARG A 1 37 ? 15.754  13.488  11.445  1.00 0.00 ? 565 ARG A CZ   17 
ATOM   10252 N  NH1  . ARG A 1 37 ? 16.070  14.408  10.541  1.00 0.00 ? 565 ARG A NH1  17 
ATOM   10253 N  NH2  . ARG A 1 37 ? 16.702  12.970  12.213  1.00 0.00 ? 565 ARG A NH2  17 
ATOM   10254 O  OXT  . ARG A 1 37 ? 7.549   14.483  12.179  1.00 0.00 ? 565 ARG A OXT  17 
ATOM   10255 H  H    . ARG A 1 37 ? 8.434   12.611  10.648  1.00 0.00 ? 565 ARG A H    17 
ATOM   10256 H  HA   . ARG A 1 37 ? 10.074  13.180  13.007  1.00 0.00 ? 565 ARG A HA   17 
ATOM   10257 H  HB2  . ARG A 1 37 ? 10.616  14.188  10.213  1.00 0.00 ? 565 ARG A HB2  17 
ATOM   10258 H  HB3  . ARG A 1 37 ? 11.332  14.893  11.655  1.00 0.00 ? 565 ARG A HB3  17 
ATOM   10259 H  HG2  . ARG A 1 37 ? 12.163  12.501  12.140  1.00 0.00 ? 565 ARG A HG2  17 
ATOM   10260 H  HG3  . ARG A 1 37 ? 11.808  12.205  10.437  1.00 0.00 ? 565 ARG A HG3  17 
ATOM   10261 H  HD2  . ARG A 1 37 ? 13.578  13.394  9.740   1.00 0.00 ? 565 ARG A HD2  17 
ATOM   10262 H  HD3  . ARG A 1 37 ? 13.309  14.667  10.929  1.00 0.00 ? 565 ARG A HD3  17 
ATOM   10263 H  HE   . ARG A 1 37 ? 14.287  12.405  12.256  1.00 0.00 ? 565 ARG A HE   17 
ATOM   10264 H  HH11 . ARG A 1 37 ? 15.361  14.803  9.958   1.00 0.00 ? 565 ARG A HH11 17 
ATOM   10265 H  HH12 . ARG A 1 37 ? 17.020  14.706  10.443  1.00 0.00 ? 565 ARG A HH12 17 
ATOM   10266 H  HH21 . ARG A 1 37 ? 16.469  12.277  12.896  1.00 0.00 ? 565 ARG A HH21 17 
ATOM   10267 H  HH22 . ARG A 1 37 ? 17.650  13.272  12.111  1.00 0.00 ? 565 ARG A HH22 17 
HETATM 10268 ZN ZN   . ZN  B 2 .  ? 0.527   4.608   4.578   1.00 0.00 ? 100 ZN  A ZN   17 
ATOM   10269 N  N    . MET A 1 1  ? -9.532  -16.475 -9.830  1.00 0.00 ? 1   MET A N    18 
ATOM   10270 C  CA   . MET A 1 1  ? -9.802  -15.614 -11.011 1.00 0.00 ? 1   MET A CA   18 
ATOM   10271 C  C    . MET A 1 1  ? -9.233  -14.213 -10.814 1.00 0.00 ? 1   MET A C    18 
ATOM   10272 O  O    . MET A 1 1  ? -9.871  -13.353 -10.206 1.00 0.00 ? 1   MET A O    18 
ATOM   10273 C  CB   . MET A 1 1  ? -11.315 -15.544 -11.226 1.00 0.00 ? 1   MET A CB   18 
ATOM   10274 C  CG   . MET A 1 1  ? -11.897 -16.793 -11.867 1.00 0.00 ? 1   MET A CG   18 
ATOM   10275 S  SD   . MET A 1 1  ? -13.538 -16.518 -12.561 1.00 0.00 ? 1   MET A SD   18 
ATOM   10276 C  CE   . MET A 1 1  ? -13.206 -16.725 -14.309 1.00 0.00 ? 1   MET A CE   18 
ATOM   10277 H  H1   . MET A 1 1  ? -8.551  -16.305 -9.531  1.00 0.00 ? 1   MET A H1   18 
ATOM   10278 H  H2   . MET A 1 1  ? -9.670  -17.465 -10.121 1.00 0.00 ? 1   MET A H2   18 
ATOM   10279 H  H3   . MET A 1 1  ? -10.202 -16.207 -9.082  1.00 0.00 ? 1   MET A H3   18 
ATOM   10280 H  HA   . MET A 1 1  ? -9.340  -16.064 -11.877 1.00 0.00 ? 1   MET A HA   18 
ATOM   10281 H  HB2  . MET A 1 1  ? -11.797 -15.399 -10.271 1.00 0.00 ? 1   MET A HB2  18 
ATOM   10282 H  HB3  . MET A 1 1  ? -11.538 -14.701 -11.864 1.00 0.00 ? 1   MET A HB3  18 
ATOM   10283 H  HG2  . MET A 1 1  ? -11.237 -17.116 -12.659 1.00 0.00 ? 1   MET A HG2  18 
ATOM   10284 H  HG3  . MET A 1 1  ? -11.964 -17.569 -11.118 1.00 0.00 ? 1   MET A HG3  18 
ATOM   10285 H  HE1  . MET A 1 1  ? -12.843 -17.725 -14.490 1.00 0.00 ? 1   MET A HE1  18 
ATOM   10286 H  HE2  . MET A 1 1  ? -12.460 -16.009 -14.621 1.00 0.00 ? 1   MET A HE2  18 
ATOM   10287 H  HE3  . MET A 1 1  ? -14.115 -16.564 -14.870 1.00 0.00 ? 1   MET A HE3  18 
ATOM   10288 N  N    . ASP A 1 2  ? -8.030  -13.990 -11.331 1.00 0.00 ? 530 ASP A N    18 
ATOM   10289 C  CA   . ASP A 1 2  ? -7.375  -12.693 -11.212 1.00 0.00 ? 530 ASP A CA   18 
ATOM   10290 C  C    . ASP A 1 2  ? -7.825  -11.749 -12.327 1.00 0.00 ? 530 ASP A C    18 
ATOM   10291 O  O    . ASP A 1 2  ? -8.262  -10.629 -12.062 1.00 0.00 ? 530 ASP A O    18 
ATOM   10292 C  CB   . ASP A 1 2  ? -5.854  -12.859 -11.247 1.00 0.00 ? 530 ASP A CB   18 
ATOM   10293 C  CG   . ASP A 1 2  ? -5.164  -12.107 -10.126 1.00 0.00 ? 530 ASP A CG   18 
ATOM   10294 O  OD1  . ASP A 1 2  ? -5.791  -11.921 -9.062  1.00 0.00 ? 530 ASP A OD1  18 
ATOM   10295 O  OD2  . ASP A 1 2  ? -3.997  -11.702 -10.313 1.00 0.00 ? 530 ASP A OD2  18 
ATOM   10296 H  H    . ASP A 1 2  ? -7.571  -14.715 -11.805 1.00 0.00 ? 530 ASP A H    18 
ATOM   10297 H  HA   . ASP A 1 2  ? -7.658  -12.266 -10.262 1.00 0.00 ? 530 ASP A HA   18 
ATOM   10298 H  HB2  . ASP A 1 2  ? -5.610  -13.907 -11.154 1.00 0.00 ? 530 ASP A HB2  18 
ATOM   10299 H  HB3  . ASP A 1 2  ? -5.477  -12.489 -12.190 1.00 0.00 ? 530 ASP A HB3  18 
ATOM   10300 N  N    . PRO A 1 3  ? -7.725  -12.191 -13.593 1.00 0.00 ? 531 PRO A N    18 
ATOM   10301 C  CA   . PRO A 1 3  ? -8.126  -11.377 -14.746 1.00 0.00 ? 531 PRO A CA   18 
ATOM   10302 C  C    . PRO A 1 3  ? -9.539  -10.824 -14.601 1.00 0.00 ? 531 PRO A C    18 
ATOM   10303 O  O    . PRO A 1 3  ? -10.519 -11.563 -14.695 1.00 0.00 ? 531 PRO A O    18 
ATOM   10304 C  CB   . PRO A 1 3  ? -8.055  -12.359 -15.918 1.00 0.00 ? 531 PRO A CB   18 
ATOM   10305 C  CG   . PRO A 1 3  ? -7.064  -13.385 -15.492 1.00 0.00 ? 531 PRO A CG   18 
ATOM   10306 C  CD   . PRO A 1 3  ? -7.216  -13.514 -14.001 1.00 0.00 ? 531 PRO A CD   18 
ATOM   10307 H  HA   . PRO A 1 3  ? -7.437  -10.562 -14.913 1.00 0.00 ? 531 PRO A HA   18 
ATOM   10308 H  HB2  . PRO A 1 3  ? -9.029  -12.794 -16.086 1.00 0.00 ? 531 PRO A HB2  18 
ATOM   10309 H  HB3  . PRO A 1 3  ? -7.727  -11.840 -16.806 1.00 0.00 ? 531 PRO A HB3  18 
ATOM   10310 H  HG2  . PRO A 1 3  ? -7.281  -14.327 -15.974 1.00 0.00 ? 531 PRO A HG2  18 
ATOM   10311 H  HG3  . PRO A 1 3  ? -6.065  -13.058 -15.740 1.00 0.00 ? 531 PRO A HG3  18 
ATOM   10312 H  HD2  . PRO A 1 3  ? -7.926  -14.292 -13.760 1.00 0.00 ? 531 PRO A HD2  18 
ATOM   10313 H  HD3  . PRO A 1 3  ? -6.260  -13.718 -13.542 1.00 0.00 ? 531 PRO A HD3  18 
ATOM   10314 N  N    . GLY A 1 4  ? -9.637  -9.518  -14.370 1.00 0.00 ? 532 GLY A N    18 
ATOM   10315 C  CA   . GLY A 1 4  ? -10.935 -8.888  -14.215 1.00 0.00 ? 532 GLY A CA   18 
ATOM   10316 C  C    . GLY A 1 4  ? -10.907 -7.736  -13.231 1.00 0.00 ? 532 GLY A C    18 
ATOM   10317 O  O    . GLY A 1 4  ? -10.520 -6.621  -13.581 1.00 0.00 ? 532 GLY A O    18 
ATOM   10318 H  H    . GLY A 1 4  ? -8.822  -8.979  -14.305 1.00 0.00 ? 532 GLY A H    18 
ATOM   10319 H  HA2  . GLY A 1 4  ? -11.261 -8.519  -15.177 1.00 0.00 ? 532 GLY A HA2  18 
ATOM   10320 H  HA3  . GLY A 1 4  ? -11.643 -9.627  -13.868 1.00 0.00 ? 532 GLY A HA3  18 
ATOM   10321 N  N    . LYS A 1 5  ? -11.319 -8.005  -11.996 1.00 0.00 ? 533 LYS A N    18 
ATOM   10322 C  CA   . LYS A 1 5  ? -11.340 -6.982  -10.958 1.00 0.00 ? 533 LYS A CA   18 
ATOM   10323 C  C    . LYS A 1 5  ? -10.145 -7.134  -10.020 1.00 0.00 ? 533 LYS A C    18 
ATOM   10324 O  O    . LYS A 1 5  ? -10.025 -8.132  -9.309  1.00 0.00 ? 533 LYS A O    18 
ATOM   10325 C  CB   . LYS A 1 5  ? -12.646 -7.059  -10.162 1.00 0.00 ? 533 LYS A CB   18 
ATOM   10326 C  CG   . LYS A 1 5  ? -13.605 -5.917  -10.457 1.00 0.00 ? 533 LYS A CG   18 
ATOM   10327 C  CD   . LYS A 1 5  ? -14.957 -6.428  -10.932 1.00 0.00 ? 533 LYS A CD   18 
ATOM   10328 C  CE   . LYS A 1 5  ? -15.891 -5.283  -11.288 1.00 0.00 ? 533 LYS A CE   18 
ATOM   10329 N  NZ   . LYS A 1 5  ? -17.051 -5.744  -12.099 1.00 0.00 ? 533 LYS A NZ   18 
ATOM   10330 H  H    . LYS A 1 5  ? -11.615 -8.913  -11.778 1.00 0.00 ? 533 LYS A H    18 
ATOM   10331 H  HA   . LYS A 1 5  ? -11.281 -6.018  -11.442 1.00 0.00 ? 533 LYS A HA   18 
ATOM   10332 H  HB2  . LYS A 1 5  ? -13.141 -7.990  -10.398 1.00 0.00 ? 533 LYS A HB2  18 
ATOM   10333 H  HB3  . LYS A 1 5  ? -12.415 -7.043  -9.107  1.00 0.00 ? 533 LYS A HB3  18 
ATOM   10334 H  HG2  . LYS A 1 5  ? -13.747 -5.338  -9.557  1.00 0.00 ? 533 LYS A HG2  18 
ATOM   10335 H  HG3  . LYS A 1 5  ? -13.177 -5.290  -11.226 1.00 0.00 ? 533 LYS A HG3  18 
ATOM   10336 H  HD2  . LYS A 1 5  ? -14.811 -7.045  -11.806 1.00 0.00 ? 533 LYS A HD2  18 
ATOM   10337 H  HD3  . LYS A 1 5  ? -15.405 -7.015  -10.144 1.00 0.00 ? 533 LYS A HD3  18 
ATOM   10338 H  HE2  . LYS A 1 5  ? -16.256 -4.836  -10.375 1.00 0.00 ? 533 LYS A HE2  18 
ATOM   10339 H  HE3  . LYS A 1 5  ? -15.338 -4.546  -11.852 1.00 0.00 ? 533 LYS A HE3  18 
ATOM   10340 H  HZ1  . LYS A 1 5  ? -16.718 -6.252  -12.943 1.00 0.00 ? 533 LYS A HZ1  18 
ATOM   10341 H  HZ2  . LYS A 1 5  ? -17.622 -4.929  -12.401 1.00 0.00 ? 533 LYS A HZ2  18 
ATOM   10342 H  HZ3  . LYS A 1 5  ? -17.649 -6.382  -11.536 1.00 0.00 ? 533 LYS A HZ3  18 
ATOM   10343 N  N    . LYS A 1 6  ? -9.266  -6.138  -10.025 1.00 0.00 ? 534 LYS A N    18 
ATOM   10344 C  CA   . LYS A 1 6  ? -8.081  -6.160  -9.175  1.00 0.00 ? 534 LYS A CA   18 
ATOM   10345 C  C    . LYS A 1 6  ? -8.379  -5.547  -7.810  1.00 0.00 ? 534 LYS A C    18 
ATOM   10346 O  O    . LYS A 1 6  ? -9.352  -4.810  -7.649  1.00 0.00 ? 534 LYS A O    18 
ATOM   10347 C  CB   . LYS A 1 6  ? -6.932  -5.406  -9.847  1.00 0.00 ? 534 LYS A CB   18 
ATOM   10348 C  CG   . LYS A 1 6  ? -6.020  -6.298  -10.674 1.00 0.00 ? 534 LYS A CG   18 
ATOM   10349 C  CD   . LYS A 1 6  ? -4.981  -6.990  -9.806  1.00 0.00 ? 534 LYS A CD   18 
ATOM   10350 C  CE   . LYS A 1 6  ? -3.728  -7.325  -10.598 1.00 0.00 ? 534 LYS A CE   18 
ATOM   10351 N  NZ   . LYS A 1 6  ? -3.852  -8.627  -11.310 1.00 0.00 ? 534 LYS A NZ   18 
ATOM   10352 H  H    . LYS A 1 6  ? -9.417  -5.369  -10.613 1.00 0.00 ? 534 LYS A H    18 
ATOM   10353 H  HA   . LYS A 1 6  ? -7.792  -7.191  -9.037  1.00 0.00 ? 534 LYS A HA   18 
ATOM   10354 H  HB2  . LYS A 1 6  ? -7.345  -4.649  -10.497 1.00 0.00 ? 534 LYS A HB2  18 
ATOM   10355 H  HB3  . LYS A 1 6  ? -6.335  -4.927  -9.084  1.00 0.00 ? 534 LYS A HB3  18 
ATOM   10356 H  HG2  . LYS A 1 6  ? -6.619  -7.049  -11.168 1.00 0.00 ? 534 LYS A HG2  18 
ATOM   10357 H  HG3  . LYS A 1 6  ? -5.515  -5.694  -11.413 1.00 0.00 ? 534 LYS A HG3  18 
ATOM   10358 H  HD2  . LYS A 1 6  ? -4.715  -6.335  -8.990  1.00 0.00 ? 534 LYS A HD2  18 
ATOM   10359 H  HD3  . LYS A 1 6  ? -5.404  -7.903  -9.414  1.00 0.00 ? 534 LYS A HD3  18 
ATOM   10360 H  HE2  . LYS A 1 6  ? -3.556  -6.544  -11.323 1.00 0.00 ? 534 LYS A HE2  18 
ATOM   10361 H  HE3  . LYS A 1 6  ? -2.890  -7.374  -9.918  1.00 0.00 ? 534 LYS A HE3  18 
ATOM   10362 H  HZ1  . LYS A 1 6  ? -4.754  -8.667  -11.826 1.00 0.00 ? 534 LYS A HZ1  18 
ATOM   10363 H  HZ2  . LYS A 1 6  ? -3.820  -9.412  -10.629 1.00 0.00 ? 534 LYS A HZ2  18 
ATOM   10364 H  HZ3  . LYS A 1 6  ? -3.071  -8.739  -11.988 1.00 0.00 ? 534 LYS A HZ3  18 
ATOM   10365 N  N    . LYS A 1 7  ? -7.536  -5.856  -6.831  1.00 0.00 ? 535 LYS A N    18 
ATOM   10366 C  CA   . LYS A 1 7  ? -7.709  -5.335  -5.480  1.00 0.00 ? 535 LYS A CA   18 
ATOM   10367 C  C    . LYS A 1 7  ? -6.932  -4.035  -5.295  1.00 0.00 ? 535 LYS A C    18 
ATOM   10368 O  O    . LYS A 1 7  ? -6.166  -3.628  -6.169  1.00 0.00 ? 535 LYS A O    18 
ATOM   10369 C  CB   . LYS A 1 7  ? -7.251  -6.371  -4.450  1.00 0.00 ? 535 LYS A CB   18 
ATOM   10370 C  CG   . LYS A 1 7  ? -8.395  -7.160  -3.833  1.00 0.00 ? 535 LYS A CG   18 
ATOM   10371 C  CD   . LYS A 1 7  ? -8.472  -6.952  -2.328  1.00 0.00 ? 535 LYS A CD   18 
ATOM   10372 C  CE   . LYS A 1 7  ? -7.829  -8.104  -1.573  1.00 0.00 ? 535 LYS A CE   18 
ATOM   10373 N  NZ   . LYS A 1 7  ? -8.619  -9.360  -1.699  1.00 0.00 ? 535 LYS A NZ   18 
ATOM   10374 H  H    . LYS A 1 7  ? -6.779  -6.449  -7.022  1.00 0.00 ? 535 LYS A H    18 
ATOM   10375 H  HA   . LYS A 1 7  ? -8.760  -5.136  -5.334  1.00 0.00 ? 535 LYS A HA   18 
ATOM   10376 H  HB2  . LYS A 1 7  ? -6.580  -7.067  -4.931  1.00 0.00 ? 535 LYS A HB2  18 
ATOM   10377 H  HB3  . LYS A 1 7  ? -6.721  -5.864  -3.657  1.00 0.00 ? 535 LYS A HB3  18 
ATOM   10378 H  HG2  . LYS A 1 7  ? -9.324  -6.837  -4.278  1.00 0.00 ? 535 LYS A HG2  18 
ATOM   10379 H  HG3  . LYS A 1 7  ? -8.244  -8.211  -4.035  1.00 0.00 ? 535 LYS A HG3  18 
ATOM   10380 H  HD2  . LYS A 1 7  ? -7.958  -6.037  -2.074  1.00 0.00 ? 535 LYS A HD2  18 
ATOM   10381 H  HD3  . LYS A 1 7  ? -9.510  -6.877  -2.038  1.00 0.00 ? 535 LYS A HD3  18 
ATOM   10382 H  HE2  . LYS A 1 7  ? -6.839  -8.271  -1.970  1.00 0.00 ? 535 LYS A HE2  18 
ATOM   10383 H  HE3  . LYS A 1 7  ? -7.757  -7.837  -0.529  1.00 0.00 ? 535 LYS A HE3  18 
ATOM   10384 H  HZ1  . LYS A 1 7  ? -9.613  -9.138  -1.911  1.00 0.00 ? 535 LYS A HZ1  18 
ATOM   10385 H  HZ2  . LYS A 1 7  ? -8.578  -9.899  -0.810  1.00 0.00 ? 535 LYS A HZ2  18 
ATOM   10386 H  HZ3  . LYS A 1 7  ? -8.234  -9.949  -2.465  1.00 0.00 ? 535 LYS A HZ3  18 
ATOM   10387 N  N    . GLN A 1 8  ? -7.135  -3.389  -4.152  1.00 0.00 ? 536 GLN A N    18 
ATOM   10388 C  CA   . GLN A 1 8  ? -6.454  -2.135  -3.851  1.00 0.00 ? 536 GLN A CA   18 
ATOM   10389 C  C    . GLN A 1 8  ? -5.743  -2.211  -2.504  1.00 0.00 ? 536 GLN A C    18 
ATOM   10390 O  O    . GLN A 1 8  ? -6.276  -2.761  -1.540  1.00 0.00 ? 536 GLN A O    18 
ATOM   10391 C  CB   . GLN A 1 8  ? -7.452  -0.976  -3.849  1.00 0.00 ? 536 GLN A CB   18 
ATOM   10392 C  CG   . GLN A 1 8  ? -8.358  -0.951  -5.070  1.00 0.00 ? 536 GLN A CG   18 
ATOM   10393 C  CD   . GLN A 1 8  ? -9.750  -1.473  -4.773  1.00 0.00 ? 536 GLN A CD   18 
ATOM   10394 O  OE1  . GLN A 1 8  ? -9.968  -2.682  -4.691  1.00 0.00 ? 536 GLN A OE1  18 
ATOM   10395 N  NE2  . GLN A 1 8  ? -10.702 -0.561  -4.611  1.00 0.00 ? 536 GLN A NE2  18 
ATOM   10396 H  H    . GLN A 1 8  ? -7.757  -3.764  -3.494  1.00 0.00 ? 536 GLN A H    18 
ATOM   10397 H  HA   . GLN A 1 8  ? -5.719  -1.963  -4.623  1.00 0.00 ? 536 GLN A HA   18 
ATOM   10398 H  HB2  . GLN A 1 8  ? -8.073  -1.052  -2.969  1.00 0.00 ? 536 GLN A HB2  18 
ATOM   10399 H  HB3  . GLN A 1 8  ? -6.906  -0.045  -3.814  1.00 0.00 ? 536 GLN A HB3  18 
ATOM   10400 H  HG2  . GLN A 1 8  ? -8.439  0.066   -5.421  1.00 0.00 ? 536 GLN A HG2  18 
ATOM   10401 H  HG3  . GLN A 1 8  ? -7.916  -1.564  -5.842  1.00 0.00 ? 536 GLN A HG3  18 
ATOM   10402 H  HE21 . GLN A 1 8  ? -10.456 0.384   -4.691  1.00 0.00 ? 536 GLN A HE21 18 
ATOM   10403 H  HE22 . GLN A 1 8  ? -11.612 -0.871  -4.419  1.00 0.00 ? 536 GLN A HE22 18 
ATOM   10404 N  N    . HIS A 1 9  ? -4.537  -1.656  -2.445  1.00 0.00 ? 537 HIS A N    18 
ATOM   10405 C  CA   . HIS A 1 9  ? -3.753  -1.662  -1.215  1.00 0.00 ? 537 HIS A CA   18 
ATOM   10406 C  C    . HIS A 1 9  ? -3.756  -0.284  -0.561  1.00 0.00 ? 537 HIS A C    18 
ATOM   10407 O  O    . HIS A 1 9  ? -3.322  0.700   -1.160  1.00 0.00 ? 537 HIS A O    18 
ATOM   10408 C  CB   . HIS A 1 9  ? -2.316  -2.099  -1.504  1.00 0.00 ? 537 HIS A CB   18 
ATOM   10409 C  CG   . HIS A 1 9  ? -2.224  -3.354  -2.315  1.00 0.00 ? 537 HIS A CG   18 
ATOM   10410 N  ND1  . HIS A 1 9  ? -3.274  -4.226  -2.501  1.00 0.00 ? 537 HIS A ND1  18 
ATOM   10411 C  CD2  . HIS A 1 9  ? -1.176  -3.879  -2.999  1.00 0.00 ? 537 HIS A CD2  18 
ATOM   10412 C  CE1  . HIS A 1 9  ? -2.841  -5.232  -3.273  1.00 0.00 ? 537 HIS A CE1  18 
ATOM   10413 N  NE2  . HIS A 1 9  ? -1.574  -5.068  -3.604  1.00 0.00 ? 537 HIS A NE2  18 
ATOM   10414 H  H    . HIS A 1 9  ? -4.165  -1.233  -3.246  1.00 0.00 ? 537 HIS A H    18 
ATOM   10415 H  HA   . HIS A 1 9  ? -4.205  -2.369  -0.537  1.00 0.00 ? 537 HIS A HA   18 
ATOM   10416 H  HB2  . HIS A 1 9  ? -1.810  -1.315  -2.047  1.00 0.00 ? 537 HIS A HB2  18 
ATOM   10417 H  HB3  . HIS A 1 9  ? -1.804  -2.269  -0.568  1.00 0.00 ? 537 HIS A HB3  18 
ATOM   10418 H  HD1  . HIS A 1 9  ? -4.177  -4.129  -2.133  1.00 0.00 ? 537 HIS A HD1  18 
ATOM   10419 H  HD2  . HIS A 1 9  ? -0.187  -3.451  -3.069  1.00 0.00 ? 537 HIS A HD2  18 
ATOM   10420 H  HE1  . HIS A 1 9  ? -3.450  -6.067  -3.586  1.00 0.00 ? 537 HIS A HE1  18 
ATOM   10421 N  N    . ILE A 1 10 ? -4.247  -0.222  0.672   1.00 0.00 ? 538 ILE A N    18 
ATOM   10422 C  CA   . ILE A 1 10 ? -4.306  1.035   1.410   1.00 0.00 ? 538 ILE A CA   18 
ATOM   10423 C  C    . ILE A 1 10 ? -3.591  0.917   2.751   1.00 0.00 ? 538 ILE A C    18 
ATOM   10424 O  O    . ILE A 1 10 ? -3.451  -0.178  3.297   1.00 0.00 ? 538 ILE A O    18 
ATOM   10425 C  CB   . ILE A 1 10 ? -5.763  1.474   1.654   1.00 0.00 ? 538 ILE A CB   18 
ATOM   10426 C  CG1  . ILE A 1 10 ? -6.566  1.403   0.354   1.00 0.00 ? 538 ILE A CG1  18 
ATOM   10427 C  CG2  . ILE A 1 10 ? -5.803  2.880   2.233   1.00 0.00 ? 538 ILE A CG2  18 
ATOM   10428 C  CD1  . ILE A 1 10 ? -7.348  0.118   0.195   1.00 0.00 ? 538 ILE A CD1  18 
ATOM   10429 H  H    . ILE A 1 10 ? -4.577  -1.041  1.097   1.00 0.00 ? 538 ILE A H    18 
ATOM   10430 H  HA   . ILE A 1 10 ? -3.817  1.794   0.817   1.00 0.00 ? 538 ILE A HA   18 
ATOM   10431 H  HB   . ILE A 1 10 ? -6.201  0.802   2.377   1.00 0.00 ? 538 ILE A HB   18 
ATOM   10432 H  HG12 . ILE A 1 10 ? -7.268  2.223   0.327   1.00 0.00 ? 538 ILE A HG12 18 
ATOM   10433 H  HG13 . ILE A 1 10 ? -5.889  1.487   -0.484  1.00 0.00 ? 538 ILE A HG13 18 
ATOM   10434 H  HG21 . ILE A 1 10 ? -4.955  3.443   1.871   1.00 0.00 ? 538 ILE A HG21 18 
ATOM   10435 H  HG22 . ILE A 1 10 ? -5.766  2.827   3.311   1.00 0.00 ? 538 ILE A HG22 18 
ATOM   10436 H  HG23 . ILE A 1 10 ? -6.716  3.370   1.927   1.00 0.00 ? 538 ILE A HG23 18 
ATOM   10437 H  HD11 . ILE A 1 10 ? -8.385  0.295   0.436   1.00 0.00 ? 538 ILE A HD11 18 
ATOM   10438 H  HD12 . ILE A 1 10 ? -6.947  -0.632  0.861   1.00 0.00 ? 538 ILE A HD12 18 
ATOM   10439 H  HD13 . ILE A 1 10 ? -7.269  -0.228  -0.825  1.00 0.00 ? 538 ILE A HD13 18 
ATOM   10440 N  N    . CYS A 1 11 ? -3.141  2.051   3.280   1.00 0.00 ? 539 CYS A N    18 
ATOM   10441 C  CA   . CYS A 1 11 ? -2.440  2.071   4.559   1.00 0.00 ? 539 CYS A CA   18 
ATOM   10442 C  C    . CYS A 1 11 ? -3.319  1.503   5.668   1.00 0.00 ? 539 CYS A C    18 
ATOM   10443 O  O    . CYS A 1 11 ? -4.432  1.976   5.897   1.00 0.00 ? 539 CYS A O    18 
ATOM   10444 C  CB   . CYS A 1 11 ? -2.012  3.498   4.909   1.00 0.00 ? 539 CYS A CB   18 
ATOM   10445 S  SG   . CYS A 1 11 ? -0.384  3.607   5.688   1.00 0.00 ? 539 CYS A SG   18 
ATOM   10446 H  H    . CYS A 1 11 ? -3.282  2.893   2.798   1.00 0.00 ? 539 CYS A H    18 
ATOM   10447 H  HA   . CYS A 1 11 ? -1.559  1.454   4.463   1.00 0.00 ? 539 CYS A HA   18 
ATOM   10448 H  HB2  . CYS A 1 11 ? -1.984  4.090   4.007   1.00 0.00 ? 539 CYS A HB2  18 
ATOM   10449 H  HB3  . CYS A 1 11 ? -2.733  3.926   5.592   1.00 0.00 ? 539 CYS A HB3  18 
ATOM   10450 N  N    . HIS A 1 12 ? -2.812  0.483   6.353   1.00 0.00 ? 540 HIS A N    18 
ATOM   10451 C  CA   . HIS A 1 12 ? -3.551  -0.152  7.437   1.00 0.00 ? 540 HIS A CA   18 
ATOM   10452 C  C    . HIS A 1 12 ? -3.778  0.821   8.589   1.00 0.00 ? 540 HIS A C    18 
ATOM   10453 O  O    . HIS A 1 12 ? -4.775  0.729   9.305   1.00 0.00 ? 540 HIS A O    18 
ATOM   10454 C  CB   . HIS A 1 12 ? -2.802  -1.388  7.937   1.00 0.00 ? 540 HIS A CB   18 
ATOM   10455 C  CG   . HIS A 1 12 ? -3.095  -2.625  7.146   1.00 0.00 ? 540 HIS A CG   18 
ATOM   10456 N  ND1  . HIS A 1 12 ? -2.365  -3.027  6.050   1.00 0.00 ? 540 HIS A ND1  18 
ATOM   10457 C  CD2  . HIS A 1 12 ? -4.066  -3.560  7.313   1.00 0.00 ? 540 HIS A CD2  18 
ATOM   10458 C  CE1  . HIS A 1 12 ? -2.903  -4.167  5.593   1.00 0.00 ? 540 HIS A CE1  18 
ATOM   10459 N  NE2  . HIS A 1 12 ? -3.937  -4.533  6.326   1.00 0.00 ? 540 HIS A NE2  18 
ATOM   10460 H  H    . HIS A 1 12 ? -1.920  0.149   6.123   1.00 0.00 ? 540 HIS A H    18 
ATOM   10461 H  HA   . HIS A 1 12 ? -4.511  -0.458  7.047   1.00 0.00 ? 540 HIS A HA   18 
ATOM   10462 H  HB2  . HIS A 1 12 ? -1.740  -1.204  7.882   1.00 0.00 ? 540 HIS A HB2  18 
ATOM   10463 H  HB3  . HIS A 1 12 ? -3.077  -1.576  8.965   1.00 0.00 ? 540 HIS A HB3  18 
ATOM   10464 H  HD1  . HIS A 1 12 ? -1.591  -2.562  5.670   1.00 0.00 ? 540 HIS A HD1  18 
ATOM   10465 H  HD2  . HIS A 1 12 ? -4.822  -3.559  8.084   1.00 0.00 ? 540 HIS A HD2  18 
ATOM   10466 H  HE1  . HIS A 1 12 ? -2.536  -4.715  4.738   1.00 0.00 ? 540 HIS A HE1  18 
ATOM   10467 N  N    . ILE A 1 13 ? -2.847  1.754   8.765   1.00 0.00 ? 541 ILE A N    18 
ATOM   10468 C  CA   . ILE A 1 13 ? -2.950  2.742   9.832   1.00 0.00 ? 541 ILE A CA   18 
ATOM   10469 C  C    . ILE A 1 13 ? -3.899  3.872   9.448   1.00 0.00 ? 541 ILE A C    18 
ATOM   10470 O  O    . ILE A 1 13 ? -4.108  4.147   8.266   1.00 0.00 ? 541 ILE A O    18 
ATOM   10471 C  CB   . ILE A 1 13 ? -1.573  3.335   10.190  1.00 0.00 ? 541 ILE A CB   18 
ATOM   10472 C  CG1  . ILE A 1 13 ? -0.969  4.057   8.984   1.00 0.00 ? 541 ILE A CG1  18 
ATOM   10473 C  CG2  . ILE A 1 13 ? -0.638  2.242   10.683  1.00 0.00 ? 541 ILE A CG2  18 
ATOM   10474 C  CD1  . ILE A 1 13 ? -0.289  5.360   9.344   1.00 0.00 ? 541 ILE A CD1  18 
ATOM   10475 H  H    . ILE A 1 13 ? -2.074  1.779   8.163   1.00 0.00 ? 541 ILE A H    18 
ATOM   10476 H  HA   . ILE A 1 13 ? -3.341  2.243   10.708  1.00 0.00 ? 541 ILE A HA   18 
ATOM   10477 H  HB   . ILE A 1 13 ? -1.710  4.045   10.992  1.00 0.00 ? 541 ILE A HB   18 
ATOM   10478 H  HG12 . ILE A 1 13 ? -0.234  3.417   8.521   1.00 0.00 ? 541 ILE A HG12 18 
ATOM   10479 H  HG13 . ILE A 1 13 ? -1.751  4.274   8.272   1.00 0.00 ? 541 ILE A HG13 18 
ATOM   10480 H  HG21 . ILE A 1 13 ? -1.054  1.784   11.569  1.00 0.00 ? 541 ILE A HG21 18 
ATOM   10481 H  HG22 . ILE A 1 13 ? 0.325   2.670   10.918  1.00 0.00 ? 541 ILE A HG22 18 
ATOM   10482 H  HG23 . ILE A 1 13 ? -0.521  1.494   9.913   1.00 0.00 ? 541 ILE A HG23 18 
ATOM   10483 H  HD11 . ILE A 1 13 ? -0.471  6.087   8.566   1.00 0.00 ? 541 ILE A HD11 18 
ATOM   10484 H  HD12 . ILE A 1 13 ? 0.773   5.197   9.443   1.00 0.00 ? 541 ILE A HD12 18 
ATOM   10485 H  HD13 . ILE A 1 13 ? -0.686  5.727   10.279  1.00 0.00 ? 541 ILE A HD13 18 
ATOM   10486 N  N    . GLN A 1 14 ? -4.472  4.521   10.455  1.00 0.00 ? 542 GLN A N    18 
ATOM   10487 C  CA   . GLN A 1 14 ? -5.402  5.619   10.231  1.00 0.00 ? 542 GLN A CA   18 
ATOM   10488 C  C    . GLN A 1 14 ? -4.669  6.887   9.796   1.00 0.00 ? 542 GLN A C    18 
ATOM   10489 O  O    . GLN A 1 14 ? -5.264  7.783   9.198   1.00 0.00 ? 542 GLN A O    18 
ATOM   10490 C  CB   . GLN A 1 14 ? -6.210  5.895   11.499  1.00 0.00 ? 542 GLN A CB   18 
ATOM   10491 C  CG   . GLN A 1 14 ? -7.281  4.853   11.776  1.00 0.00 ? 542 GLN A CG   18 
ATOM   10492 C  CD   . GLN A 1 14 ? -7.503  4.625   13.259  1.00 0.00 ? 542 GLN A CD   18 
ATOM   10493 O  OE1  . GLN A 1 14 ? -7.101  5.438   14.091  1.00 0.00 ? 542 GLN A OE1  18 
ATOM   10494 N  NE2  . GLN A 1 14 ? -8.146  3.513   13.597  1.00 0.00 ? 542 GLN A NE2  18 
ATOM   10495 H  H    . GLN A 1 14 ? -4.268  4.253   11.372  1.00 0.00 ? 542 GLN A H    18 
ATOM   10496 H  HA   . GLN A 1 14 ? -6.075  5.321   9.446   1.00 0.00 ? 542 GLN A HA   18 
ATOM   10497 H  HB2  . GLN A 1 14 ? -5.537  5.921   12.343  1.00 0.00 ? 542 GLN A HB2  18 
ATOM   10498 H  HB3  . GLN A 1 14 ? -6.691  6.858   11.404  1.00 0.00 ? 542 GLN A HB3  18 
ATOM   10499 H  HG2  . GLN A 1 14 ? -8.210  5.183   11.336  1.00 0.00 ? 542 GLN A HG2  18 
ATOM   10500 H  HG3  . GLN A 1 14 ? -6.981  3.919   11.324  1.00 0.00 ? 542 GLN A HG3  18 
ATOM   10501 H  HE21 . GLN A 1 14 ? -8.437  2.910   12.880  1.00 0.00 ? 542 GLN A HE21 18 
ATOM   10502 H  HE22 . GLN A 1 14 ? -8.303  3.340   14.548  1.00 0.00 ? 542 GLN A HE22 18 
ATOM   10503 N  N    . GLY A 1 15 ? -3.375  6.957   10.102  1.00 0.00 ? 543 GLY A N    18 
ATOM   10504 C  CA   . GLY A 1 15 ? -2.586  8.122   9.738   1.00 0.00 ? 543 GLY A CA   18 
ATOM   10505 C  C    . GLY A 1 15 ? -2.739  8.506   8.278   1.00 0.00 ? 543 GLY A C    18 
ATOM   10506 O  O    . GLY A 1 15 ? -3.121  9.633   7.963   1.00 0.00 ? 543 GLY A O    18 
ATOM   10507 H  H    . GLY A 1 15 ? -2.953  6.215   10.583  1.00 0.00 ? 543 GLY A H    18 
ATOM   10508 H  HA2  . GLY A 1 15 ? -2.894  8.956   10.351  1.00 0.00 ? 543 GLY A HA2  18 
ATOM   10509 H  HA3  . GLY A 1 15 ? -1.545  7.911   9.936   1.00 0.00 ? 543 GLY A HA3  18 
ATOM   10510 N  N    . CYS A 1 16 ? -2.439  7.568   7.385   1.00 0.00 ? 544 CYS A N    18 
ATOM   10511 C  CA   . CYS A 1 16 ? -2.544  7.818   5.952   1.00 0.00 ? 544 CYS A CA   18 
ATOM   10512 C  C    . CYS A 1 16 ? -3.931  7.455   5.433   1.00 0.00 ? 544 CYS A C    18 
ATOM   10513 O  O    . CYS A 1 16 ? -4.813  7.071   6.202   1.00 0.00 ? 544 CYS A O    18 
ATOM   10514 C  CB   . CYS A 1 16 ? -1.482  7.018   5.196   1.00 0.00 ? 544 CYS A CB   18 
ATOM   10515 S  SG   . CYS A 1 16 ? 0.214   7.566   5.501   1.00 0.00 ? 544 CYS A SG   18 
ATOM   10516 H  H    . CYS A 1 16 ? -2.139  6.689   7.696   1.00 0.00 ? 544 CYS A H    18 
ATOM   10517 H  HA   . CYS A 1 16 ? -2.374  8.871   5.786   1.00 0.00 ? 544 CYS A HA   18 
ATOM   10518 H  HB2  . CYS A 1 16 ? -1.548  5.982   5.489   1.00 0.00 ? 544 CYS A HB2  18 
ATOM   10519 H  HB3  . CYS A 1 16 ? -1.668  7.099   4.135   1.00 0.00 ? 544 CYS A HB3  18 
ATOM   10520 N  N    . GLY A 1 17 ? -4.116  7.580   4.123   1.00 0.00 ? 545 GLY A N    18 
ATOM   10521 C  CA   . GLY A 1 17 ? -5.396  7.262   3.519   1.00 0.00 ? 545 GLY A CA   18 
ATOM   10522 C  C    . GLY A 1 17 ? -5.351  7.331   2.005   1.00 0.00 ? 545 GLY A C    18 
ATOM   10523 O  O    . GLY A 1 17 ? -6.304  7.777   1.368   1.00 0.00 ? 545 GLY A O    18 
ATOM   10524 H  H    . GLY A 1 17 ? -3.376  7.890   3.561   1.00 0.00 ? 545 GLY A H    18 
ATOM   10525 H  HA2  . GLY A 1 17 ? -5.685  6.264   3.815   1.00 0.00 ? 545 GLY A HA2  18 
ATOM   10526 H  HA3  . GLY A 1 17 ? -6.136  7.961   3.878   1.00 0.00 ? 545 GLY A HA3  18 
ATOM   10527 N  N    . LYS A 1 18 ? -4.237  6.889   1.429   1.00 0.00 ? 546 LYS A N    18 
ATOM   10528 C  CA   . LYS A 1 18 ? -4.066  6.904   -0.019  1.00 0.00 ? 546 LYS A CA   18 
ATOM   10529 C  C    . LYS A 1 18 ? -4.509  5.579   -0.634  1.00 0.00 ? 546 LYS A C    18 
ATOM   10530 O  O    . LYS A 1 18 ? -5.089  4.732   0.045   1.00 0.00 ? 546 LYS A O    18 
ATOM   10531 C  CB   . LYS A 1 18 ? -2.605  7.186   -0.377  1.00 0.00 ? 546 LYS A CB   18 
ATOM   10532 C  CG   . LYS A 1 18 ? -1.648  6.087   0.056   1.00 0.00 ? 546 LYS A CG   18 
ATOM   10533 C  CD   . LYS A 1 18 ? -0.313  6.656   0.510   1.00 0.00 ? 546 LYS A CD   18 
ATOM   10534 C  CE   . LYS A 1 18 ? 0.736   6.559   -0.586  1.00 0.00 ? 546 LYS A CE   18 
ATOM   10535 N  NZ   . LYS A 1 18 ? 1.796   7.592   -0.433  1.00 0.00 ? 546 LYS A NZ   18 
ATOM   10536 H  H    . LYS A 1 18 ? -3.511  6.546   1.993   1.00 0.00 ? 546 LYS A H    18 
ATOM   10537 H  HA   . LYS A 1 18 ? -4.683  7.695   -0.417  1.00 0.00 ? 546 LYS A HA   18 
ATOM   10538 H  HB2  . LYS A 1 18 ? -2.524  7.302   -1.447  1.00 0.00 ? 546 LYS A HB2  18 
ATOM   10539 H  HB3  . LYS A 1 18 ? -2.301  8.106   0.100   1.00 0.00 ? 546 LYS A HB3  18 
ATOM   10540 H  HG2  . LYS A 1 18 ? -2.091  5.539   0.874   1.00 0.00 ? 546 LYS A HG2  18 
ATOM   10541 H  HG3  . LYS A 1 18 ? -1.481  5.420   -0.777  1.00 0.00 ? 546 LYS A HG3  18 
ATOM   10542 H  HD2  . LYS A 1 18 ? -0.447  7.694   0.775   1.00 0.00 ? 546 LYS A HD2  18 
ATOM   10543 H  HD3  . LYS A 1 18 ? 0.028   6.103   1.373   1.00 0.00 ? 546 LYS A HD3  18 
ATOM   10544 H  HE2  . LYS A 1 18 ? 1.191   5.580   -0.545  1.00 0.00 ? 546 LYS A HE2  18 
ATOM   10545 H  HE3  . LYS A 1 18 ? 0.251   6.690   -1.543  1.00 0.00 ? 546 LYS A HE3  18 
ATOM   10546 H  HZ1  . LYS A 1 18 ? 2.087   7.662   0.563   1.00 0.00 ? 546 LYS A HZ1  18 
ATOM   10547 H  HZ2  . LYS A 1 18 ? 1.440   8.519   -0.745  1.00 0.00 ? 546 LYS A HZ2  18 
ATOM   10548 H  HZ3  . LYS A 1 18 ? 2.626   7.341   -1.009  1.00 0.00 ? 546 LYS A HZ3  18 
ATOM   10549 N  N    . VAL A 1 19 ? -4.232  5.408   -1.923  1.00 0.00 ? 547 VAL A N    18 
ATOM   10550 C  CA   . VAL A 1 19 ? -4.601  4.187   -2.628  1.00 0.00 ? 547 VAL A CA   18 
ATOM   10551 C  C    . VAL A 1 19 ? -3.516  3.775   -3.618  1.00 0.00 ? 547 VAL A C    18 
ATOM   10552 O  O    . VAL A 1 19 ? -2.951  4.613   -4.320  1.00 0.00 ? 547 VAL A O    18 
ATOM   10553 C  CB   . VAL A 1 19 ? -5.932  4.356   -3.386  1.00 0.00 ? 547 VAL A CB   18 
ATOM   10554 C  CG1  . VAL A 1 19 ? -6.399  3.023   -3.948  1.00 0.00 ? 547 VAL A CG1  18 
ATOM   10555 C  CG2  . VAL A 1 19 ? -6.991  4.962   -2.477  1.00 0.00 ? 547 VAL A CG2  18 
ATOM   10556 H  H    . VAL A 1 19 ? -3.768  6.120   -2.410  1.00 0.00 ? 547 VAL A H    18 
ATOM   10557 H  HA   . VAL A 1 19 ? -4.725  3.403   -1.896  1.00 0.00 ? 547 VAL A HA   18 
ATOM   10558 H  HB   . VAL A 1 19 ? -5.769  5.032   -4.213  1.00 0.00 ? 547 VAL A HB   18 
ATOM   10559 H  HG11 . VAL A 1 19 ? -6.999  3.194   -4.830  1.00 0.00 ? 547 VAL A HG11 18 
ATOM   10560 H  HG12 . VAL A 1 19 ? -6.990  2.506   -3.206  1.00 0.00 ? 547 VAL A HG12 18 
ATOM   10561 H  HG13 . VAL A 1 19 ? -5.541  2.421   -4.208  1.00 0.00 ? 547 VAL A HG13 18 
ATOM   10562 H  HG21 . VAL A 1 19 ? -6.925  6.039   -2.516  1.00 0.00 ? 547 VAL A HG21 18 
ATOM   10563 H  HG22 . VAL A 1 19 ? -6.828  4.628   -1.463  1.00 0.00 ? 547 VAL A HG22 18 
ATOM   10564 H  HG23 . VAL A 1 19 ? -7.970  4.648   -2.807  1.00 0.00 ? 547 VAL A HG23 18 
ATOM   10565 N  N    . TYR A 1 20 ? -3.231  2.478   -3.668  1.00 0.00 ? 548 TYR A N    18 
ATOM   10566 C  CA   . TYR A 1 20 ? -2.213  1.953   -4.571  1.00 0.00 ? 548 TYR A CA   18 
ATOM   10567 C  C    . TYR A 1 20 ? -2.448  0.473   -4.853  1.00 0.00 ? 548 TYR A C    18 
ATOM   10568 O  O    . TYR A 1 20 ? -2.541  -0.338  -3.931  1.00 0.00 ? 548 TYR A O    18 
ATOM   10569 C  CB   . TYR A 1 20 ? -0.819  2.156   -3.976  1.00 0.00 ? 548 TYR A CB   18 
ATOM   10570 C  CG   . TYR A 1 20 ? -0.727  1.797   -2.510  1.00 0.00 ? 548 TYR A CG   18 
ATOM   10571 C  CD1  . TYR A 1 20 ? -1.242  2.642   -1.535  1.00 0.00 ? 548 TYR A CD1  18 
ATOM   10572 C  CD2  . TYR A 1 20 ? -0.126  0.614   -2.103  1.00 0.00 ? 548 TYR A CD2  18 
ATOM   10573 C  CE1  . TYR A 1 20 ? -1.160  2.316   -0.194  1.00 0.00 ? 548 TYR A CE1  18 
ATOM   10574 C  CE2  . TYR A 1 20 ? -0.041  0.281   -0.764  1.00 0.00 ? 548 TYR A CE2  18 
ATOM   10575 C  CZ   . TYR A 1 20 ? -0.559  1.135   0.186   1.00 0.00 ? 548 TYR A CZ   18 
ATOM   10576 O  OH   . TYR A 1 20 ? -0.476  0.807   1.519   1.00 0.00 ? 548 TYR A OH   18 
ATOM   10577 H  H    . TYR A 1 20 ? -3.716  1.859   -3.083  1.00 0.00 ? 548 TYR A H    18 
ATOM   10578 H  HA   . TYR A 1 20 ? -2.282  2.499   -5.500  1.00 0.00 ? 548 TYR A HA   18 
ATOM   10579 H  HB2  . TYR A 1 20 ? -0.113  1.540   -4.512  1.00 0.00 ? 548 TYR A HB2  18 
ATOM   10580 H  HB3  . TYR A 1 20 ? -0.537  3.194   -4.083  1.00 0.00 ? 548 TYR A HB3  18 
ATOM   10581 H  HD1  . TYR A 1 20 ? -1.713  3.566   -1.836  1.00 0.00 ? 548 TYR A HD1  18 
ATOM   10582 H  HD2  . TYR A 1 20 ? 0.279   -0.054  -2.849  1.00 0.00 ? 548 TYR A HD2  18 
ATOM   10583 H  HE1  . TYR A 1 20 ? -1.567  2.986   0.549   1.00 0.00 ? 548 TYR A HE1  18 
ATOM   10584 H  HE2  . TYR A 1 20 ? 0.430   -0.644  -0.468  1.00 0.00 ? 548 TYR A HE2  18 
ATOM   10585 H  HH   . TYR A 1 20 ? -0.087  1.538   2.005   1.00 0.00 ? 548 TYR A HH   18 
ATOM   10586 N  N    . GLY A 1 21 ? -2.543  0.126   -6.132  1.00 0.00 ? 549 GLY A N    18 
ATOM   10587 C  CA   . GLY A 1 21 ? -2.766  -1.257  -6.512  1.00 0.00 ? 549 GLY A CA   18 
ATOM   10588 C  C    . GLY A 1 21 ? -1.479  -1.980  -6.853  1.00 0.00 ? 549 GLY A C    18 
ATOM   10589 O  O    . GLY A 1 21 ? -1.401  -2.679  -7.864  1.00 0.00 ? 549 GLY A O    18 
ATOM   10590 H  H    . GLY A 1 21 ? -2.461  0.815   -6.824  1.00 0.00 ? 549 GLY A H    18 
ATOM   10591 H  HA2  . GLY A 1 21 ? -3.248  -1.770  -5.693  1.00 0.00 ? 549 GLY A HA2  18 
ATOM   10592 H  HA3  . GLY A 1 21 ? -3.419  -1.281  -7.372  1.00 0.00 ? 549 GLY A HA3  18 
ATOM   10593 N  N    . LYS A 1 22 ? -0.466  -1.814  -6.009  1.00 0.00 ? 550 LYS A N    18 
ATOM   10594 C  CA   . LYS A 1 22 ? 0.825   -2.457  -6.227  1.00 0.00 ? 550 LYS A CA   18 
ATOM   10595 C  C    . LYS A 1 22 ? 1.510   -2.765  -4.900  1.00 0.00 ? 550 LYS A C    18 
ATOM   10596 O  O    . LYS A 1 22 ? 1.763   -1.867  -4.097  1.00 0.00 ? 550 LYS A O    18 
ATOM   10597 C  CB   . LYS A 1 22 ? 1.724   -1.564  -7.084  1.00 0.00 ? 550 LYS A CB   18 
ATOM   10598 C  CG   . LYS A 1 22 ? 1.437   -1.662  -8.573  1.00 0.00 ? 550 LYS A CG   18 
ATOM   10599 C  CD   . LYS A 1 22 ? 2.520   -0.981  -9.395  1.00 0.00 ? 550 LYS A CD   18 
ATOM   10600 C  CE   . LYS A 1 22 ? 2.843   -1.768  -10.655 1.00 0.00 ? 550 LYS A CE   18 
ATOM   10601 N  NZ   . LYS A 1 22 ? 3.064   -0.877  -11.828 1.00 0.00 ? 550 LYS A NZ   18 
ATOM   10602 H  H    . LYS A 1 22 ? -0.590  -1.245  -5.220  1.00 0.00 ? 550 LYS A H    18 
ATOM   10603 H  HA   . LYS A 1 22 ? 0.648   -3.384  -6.751  1.00 0.00 ? 550 LYS A HA   18 
ATOM   10604 H  HB2  . LYS A 1 22 ? 1.588   -0.537  -6.779  1.00 0.00 ? 550 LYS A HB2  18 
ATOM   10605 H  HB3  . LYS A 1 22 ? 2.754   -1.845  -6.918  1.00 0.00 ? 550 LYS A HB3  18 
ATOM   10606 H  HG2  . LYS A 1 22 ? 1.389   -2.703  -8.853  1.00 0.00 ? 550 LYS A HG2  18 
ATOM   10607 H  HG3  . LYS A 1 22 ? 0.489   -1.187  -8.779  1.00 0.00 ? 550 LYS A HG3  18 
ATOM   10608 H  HD2  . LYS A 1 22 ? 2.179   0.004   -9.676  1.00 0.00 ? 550 LYS A HD2  18 
ATOM   10609 H  HD3  . LYS A 1 22 ? 3.414   -0.896  -8.795  1.00 0.00 ? 550 LYS A HD3  18 
ATOM   10610 H  HE2  . LYS A 1 22 ? 3.737   -2.349  -10.483 1.00 0.00 ? 550 LYS A HE2  18 
ATOM   10611 H  HE3  . LYS A 1 22 ? 2.019   -2.434  -10.869 1.00 0.00 ? 550 LYS A HE3  18 
ATOM   10612 H  HZ1  . LYS A 1 22 ? 3.180   0.107   -11.514 1.00 0.00 ? 550 LYS A HZ1  18 
ATOM   10613 H  HZ2  . LYS A 1 22 ? 2.251   -0.929  -12.475 1.00 0.00 ? 550 LYS A HZ2  18 
ATOM   10614 H  HZ3  . LYS A 1 22 ? 3.920   -1.170  -12.343 1.00 0.00 ? 550 LYS A HZ3  18 
ATOM   10615 N  N    . THR A 1 23 ? 1.810   -4.041  -4.676  1.00 0.00 ? 551 THR A N    18 
ATOM   10616 C  CA   . THR A 1 23 ? 2.467   -4.466  -3.446  1.00 0.00 ? 551 THR A CA   18 
ATOM   10617 C  C    . THR A 1 23 ? 3.864   -3.864  -3.342  1.00 0.00 ? 551 THR A C    18 
ATOM   10618 O  O    . THR A 1 23 ? 4.275   -3.407  -2.275  1.00 0.00 ? 551 THR A O    18 
ATOM   10619 C  CB   . THR A 1 23 ? 2.549   -5.992  -3.386  1.00 0.00 ? 551 THR A CB   18 
ATOM   10620 O  OG1  . THR A 1 23 ? 1.274   -6.571  -3.602  1.00 0.00 ? 551 THR A OG1  18 
ATOM   10621 C  CG2  . THR A 1 23 ? 3.072   -6.512  -2.064  1.00 0.00 ? 551 THR A CG2  18 
ATOM   10622 H  H    . THR A 1 23 ? 1.584   -4.711  -5.354  1.00 0.00 ? 551 THR A H    18 
ATOM   10623 H  HA   . THR A 1 23 ? 1.875   -4.112  -2.614  1.00 0.00 ? 551 THR A HA   18 
ATOM   10624 H  HB   . THR A 1 23 ? 3.215   -6.337  -4.164  1.00 0.00 ? 551 THR A HB   18 
ATOM   10625 H  HG1  . THR A 1 23 ? 1.009   -6.431  -4.514  1.00 0.00 ? 551 THR A HG1  18 
ATOM   10626 H  HG21 . THR A 1 23 ? 3.789   -5.813  -1.661  1.00 0.00 ? 551 THR A HG21 18 
ATOM   10627 H  HG22 . THR A 1 23 ? 3.548   -7.469  -2.217  1.00 0.00 ? 551 THR A HG22 18 
ATOM   10628 H  HG23 . THR A 1 23 ? 2.251   -6.625  -1.372  1.00 0.00 ? 551 THR A HG23 18 
ATOM   10629 N  N    . SER A 1 24 ? 4.590   -3.860  -4.457  1.00 0.00 ? 552 SER A N    18 
ATOM   10630 C  CA   . SER A 1 24 ? 5.939   -3.305  -4.486  1.00 0.00 ? 552 SER A CA   18 
ATOM   10631 C  C    . SER A 1 24 ? 5.935   -1.864  -3.988  1.00 0.00 ? 552 SER A C    18 
ATOM   10632 O  O    . SER A 1 24 ? 6.904   -1.399  -3.389  1.00 0.00 ? 552 SER A O    18 
ATOM   10633 C  CB   . SER A 1 24 ? 6.513   -3.369  -5.903  1.00 0.00 ? 552 SER A CB   18 
ATOM   10634 O  OG   . SER A 1 24 ? 7.890   -3.702  -5.881  1.00 0.00 ? 552 SER A OG   18 
ATOM   10635 H  H    . SER A 1 24 ? 4.208   -4.233  -5.279  1.00 0.00 ? 552 SER A H    18 
ATOM   10636 H  HA   . SER A 1 24 ? 6.556   -3.899  -3.827  1.00 0.00 ? 552 SER A HA   18 
ATOM   10637 H  HB2  . SER A 1 24 ? 5.984   -4.121  -6.470  1.00 0.00 ? 552 SER A HB2  18 
ATOM   10638 H  HB3  . SER A 1 24 ? 6.394   -2.408  -6.381  1.00 0.00 ? 552 SER A HB3  18 
ATOM   10639 H  HG   . SER A 1 24 ? 8.263   -3.578  -6.757  1.00 0.00 ? 552 SER A HG   18 
ATOM   10640 N  N    . HIS A 1 25 ? 4.830   -1.167  -4.228  1.00 0.00 ? 553 HIS A N    18 
ATOM   10641 C  CA   . HIS A 1 25 ? 4.693   0.214   -3.789  1.00 0.00 ? 553 HIS A CA   18 
ATOM   10642 C  C    . HIS A 1 25 ? 4.425   0.263   -2.289  1.00 0.00 ? 553 HIS A C    18 
ATOM   10643 O  O    . HIS A 1 25 ? 4.796   1.221   -1.611  1.00 0.00 ? 553 HIS A O    18 
ATOM   10644 C  CB   . HIS A 1 25 ? 3.564   0.910   -4.552  1.00 0.00 ? 553 HIS A CB   18 
ATOM   10645 C  CG   . HIS A 1 25 ? 3.952   2.243   -5.110  1.00 0.00 ? 553 HIS A CG   18 
ATOM   10646 N  ND1  . HIS A 1 25 ? 3.816   3.431   -4.428  1.00 0.00 ? 553 HIS A ND1  18 
ATOM   10647 C  CD2  . HIS A 1 25 ? 4.487   2.564   -6.316  1.00 0.00 ? 553 HIS A CD2  18 
ATOM   10648 C  CE1  . HIS A 1 25 ? 4.261   4.415   -5.221  1.00 0.00 ? 553 HIS A CE1  18 
ATOM   10649 N  NE2  . HIS A 1 25 ? 4.680   3.941   -6.379  1.00 0.00 ? 553 HIS A NE2  18 
ATOM   10650 H  H    . HIS A 1 25 ? 4.086   -1.595  -4.702  1.00 0.00 ? 553 HIS A H    18 
ATOM   10651 H  HA   . HIS A 1 25 ? 5.625   0.722   -3.993  1.00 0.00 ? 553 HIS A HA   18 
ATOM   10652 H  HB2  . HIS A 1 25 ? 3.256   0.283   -5.375  1.00 0.00 ? 553 HIS A HB2  18 
ATOM   10653 H  HB3  . HIS A 1 25 ? 2.725   1.059   -3.887  1.00 0.00 ? 553 HIS A HB3  18 
ATOM   10654 H  HD1  . HIS A 1 25 ? 3.456   3.539   -3.522  1.00 0.00 ? 553 HIS A HD1  18 
ATOM   10655 H  HD2  . HIS A 1 25 ? 4.728   1.870   -7.108  1.00 0.00 ? 553 HIS A HD2  18 
ATOM   10656 H  HE1  . HIS A 1 25 ? 4.276   5.460   -4.948  1.00 0.00 ? 553 HIS A HE1  18 
ATOM   10657 N  N    . LEU A 1 26 ? 3.785   -0.786  -1.778  1.00 0.00 ? 554 LEU A N    18 
ATOM   10658 C  CA   . LEU A 1 26 ? 3.473   -0.874  -0.359  1.00 0.00 ? 554 LEU A CA   18 
ATOM   10659 C  C    . LEU A 1 26 ? 4.746   -1.084  0.453   1.00 0.00 ? 554 LEU A C    18 
ATOM   10660 O  O    . LEU A 1 26 ? 4.894   -0.541  1.548   1.00 0.00 ? 554 LEU A O    18 
ATOM   10661 C  CB   . LEU A 1 26 ? 2.492   -2.018  -0.098  1.00 0.00 ? 554 LEU A CB   18 
ATOM   10662 C  CG   . LEU A 1 26 ? 1.723   -1.924  1.221   1.00 0.00 ? 554 LEU A CG   18 
ATOM   10663 C  CD1  . LEU A 1 26 ? 0.368   -2.606  1.100   1.00 0.00 ? 554 LEU A CD1  18 
ATOM   10664 C  CD2  . LEU A 1 26 ? 2.531   -2.537  2.355   1.00 0.00 ? 554 LEU A CD2  18 
ATOM   10665 H  H    . LEU A 1 26 ? 3.521   -1.520  -2.370  1.00 0.00 ? 554 LEU A H    18 
ATOM   10666 H  HA   . LEU A 1 26 ? 3.016   0.057   -0.061  1.00 0.00 ? 554 LEU A HA   18 
ATOM   10667 H  HB2  . LEU A 1 26 ? 1.777   -2.042  -0.908  1.00 0.00 ? 554 LEU A HB2  18 
ATOM   10668 H  HB3  . LEU A 1 26 ? 3.044   -2.946  -0.100  1.00 0.00 ? 554 LEU A HB3  18 
ATOM   10669 H  HG   . LEU A 1 26 ? 1.551   -0.883  1.456   1.00 0.00 ? 554 LEU A HG   18 
ATOM   10670 H  HD11 . LEU A 1 26 ? 0.404   -3.338  0.307   1.00 0.00 ? 554 LEU A HD11 18 
ATOM   10671 H  HD12 . LEU A 1 26 ? -0.387  -1.868  0.874   1.00 0.00 ? 554 LEU A HD12 18 
ATOM   10672 H  HD13 . LEU A 1 26 ? 0.127   -3.095  2.031   1.00 0.00 ? 554 LEU A HD13 18 
ATOM   10673 H  HD21 . LEU A 1 26 ? 3.514   -2.092  2.378   1.00 0.00 ? 554 LEU A HD21 18 
ATOM   10674 H  HD22 . LEU A 1 26 ? 2.622   -3.602  2.197   1.00 0.00 ? 554 LEU A HD22 18 
ATOM   10675 H  HD23 . LEU A 1 26 ? 2.030   -2.354  3.294   1.00 0.00 ? 554 LEU A HD23 18 
ATOM   10676 N  N    . ARG A 1 27 ? 5.665   -1.874  -0.095  1.00 0.00 ? 555 ARG A N    18 
ATOM   10677 C  CA   . ARG A 1 27 ? 6.927   -2.155  0.575   1.00 0.00 ? 555 ARG A CA   18 
ATOM   10678 C  C    . ARG A 1 27 ? 7.769   -0.889  0.690   1.00 0.00 ? 555 ARG A C    18 
ATOM   10679 O  O    . ARG A 1 27 ? 8.454   -0.674  1.690   1.00 0.00 ? 555 ARG A O    18 
ATOM   10680 C  CB   . ARG A 1 27 ? 7.698   -3.250  -0.172  1.00 0.00 ? 555 ARG A CB   18 
ATOM   10681 C  CG   . ARG A 1 27 ? 8.267   -2.819  -1.516  1.00 0.00 ? 555 ARG A CG   18 
ATOM   10682 C  CD   . ARG A 1 27 ? 9.665   -3.377  -1.735  1.00 0.00 ? 555 ARG A CD   18 
ATOM   10683 N  NE   . ARG A 1 27 ? 9.635   -4.762  -2.197  1.00 0.00 ? 555 ARG A NE   18 
ATOM   10684 C  CZ   . ARG A 1 27 ? 10.709  -5.425  -2.620  1.00 0.00 ? 555 ARG A CZ   18 
ATOM   10685 N  NH1  . ARG A 1 27 ? 11.897  -4.834  -2.642  1.00 0.00 ? 555 ARG A NH1  18 
ATOM   10686 N  NH2  . ARG A 1 27 ? 10.595  -6.684  -3.023  1.00 0.00 ? 555 ARG A NH2  18 
ATOM   10687 H  H    . ARG A 1 27 ? 5.489   -2.276  -0.970  1.00 0.00 ? 555 ARG A H    18 
ATOM   10688 H  HA   . ARG A 1 27 ? 6.696   -2.507  1.568   1.00 0.00 ? 555 ARG A HA   18 
ATOM   10689 H  HB2  . ARG A 1 27 ? 8.516   -3.579  0.447   1.00 0.00 ? 555 ARG A HB2  18 
ATOM   10690 H  HB3  . ARG A 1 27 ? 7.033   -4.082  -0.344  1.00 0.00 ? 555 ARG A HB3  18 
ATOM   10691 H  HG2  . ARG A 1 27 ? 7.622   -3.182  -2.301  1.00 0.00 ? 555 ARG A HG2  18 
ATOM   10692 H  HG3  . ARG A 1 27 ? 8.311   -1.743  -1.554  1.00 0.00 ? 555 ARG A HG3  18 
ATOM   10693 H  HD2  . ARG A 1 27 ? 10.169  -2.772  -2.474  1.00 0.00 ? 555 ARG A HD2  18 
ATOM   10694 H  HD3  . ARG A 1 27 ? 10.207  -3.329  -0.802  1.00 0.00 ? 555 ARG A HD3  18 
ATOM   10695 H  HE   . ARG A 1 27 ? 8.770   -5.223  -2.191  1.00 0.00 ? 555 ARG A HE   18 
ATOM   10696 H  HH11 . ARG A 1 27 ? 11.990  -3.885  -2.340  1.00 0.00 ? 555 ARG A HH11 18 
ATOM   10697 H  HH12 . ARG A 1 27 ? 12.700  -5.337  -2.961  1.00 0.00 ? 555 ARG A HH12 18 
ATOM   10698 H  HH21 . ARG A 1 27 ? 9.702   -7.134  -3.008  1.00 0.00 ? 555 ARG A HH21 18 
ATOM   10699 H  HH22 . ARG A 1 27 ? 11.401  -7.182  -3.341  1.00 0.00 ? 555 ARG A HH22 18 
ATOM   10700 N  N    . ALA A 1 28 ? 7.707   -0.054  -0.340  1.00 0.00 ? 556 ALA A N    18 
ATOM   10701 C  CA   . ALA A 1 28 ? 8.455   1.193   -0.360  1.00 0.00 ? 556 ALA A CA   18 
ATOM   10702 C  C    . ALA A 1 28 ? 7.795   2.232   0.536   1.00 0.00 ? 556 ALA A C    18 
ATOM   10703 O  O    . ALA A 1 28 ? 8.469   3.064   1.144   1.00 0.00 ? 556 ALA A O    18 
ATOM   10704 C  CB   . ALA A 1 28 ? 8.574   1.716   -1.783  1.00 0.00 ? 556 ALA A CB   18 
ATOM   10705 H  H    . ALA A 1 28 ? 7.142   -0.282  -1.103  1.00 0.00 ? 556 ALA A H    18 
ATOM   10706 H  HA   . ALA A 1 28 ? 9.446   0.988   0.009   1.00 0.00 ? 556 ALA A HA   18 
ATOM   10707 H  HB1  . ALA A 1 28 ? 7.595   1.980   -2.154  1.00 0.00 ? 556 ALA A HB1  18 
ATOM   10708 H  HB2  . ALA A 1 28 ? 9.003   0.950   -2.413  1.00 0.00 ? 556 ALA A HB2  18 
ATOM   10709 H  HB3  . ALA A 1 28 ? 9.210   2.589   -1.794  1.00 0.00 ? 556 ALA A HB3  18 
ATOM   10710 N  N    . HIS A 1 29 ? 6.471   2.176   0.615   1.00 0.00 ? 557 HIS A N    18 
ATOM   10711 C  CA   . HIS A 1 29 ? 5.715   3.105   1.438   1.00 0.00 ? 557 HIS A CA   18 
ATOM   10712 C  C    . HIS A 1 29 ? 5.769   2.691   2.906   1.00 0.00 ? 557 HIS A C    18 
ATOM   10713 O  O    . HIS A 1 29 ? 5.710   3.534   3.802   1.00 0.00 ? 557 HIS A O    18 
ATOM   10714 C  CB   . HIS A 1 29 ? 4.260   3.174   0.961   1.00 0.00 ? 557 HIS A CB   18 
ATOM   10715 C  CG   . HIS A 1 29 ? 3.358   3.932   1.886   1.00 0.00 ? 557 HIS A CG   18 
ATOM   10716 N  ND1  . HIS A 1 29 ? 3.666   5.165   2.417   1.00 0.00 ? 557 HIS A ND1  18 
ATOM   10717 C  CD2  . HIS A 1 29 ? 2.139   3.604   2.383   1.00 0.00 ? 557 HIS A CD2  18 
ATOM   10718 C  CE1  . HIS A 1 29 ? 2.649   5.537   3.205   1.00 0.00 ? 557 HIS A CE1  18 
ATOM   10719 N  NE2  . HIS A 1 29 ? 1.696   4.625   3.219   1.00 0.00 ? 557 HIS A NE2  18 
ATOM   10720 H  H    . HIS A 1 29 ? 5.991   1.493   0.109   1.00 0.00 ? 557 HIS A H    18 
ATOM   10721 H  HA   . HIS A 1 29 ? 6.165   4.076   1.331   1.00 0.00 ? 557 HIS A HA   18 
ATOM   10722 H  HB2  . HIS A 1 29 ? 4.228   3.658   -0.004  1.00 0.00 ? 557 HIS A HB2  18 
ATOM   10723 H  HB3  . HIS A 1 29 ? 3.872   2.170   0.866   1.00 0.00 ? 557 HIS A HB3  18 
ATOM   10724 H  HD1  . HIS A 1 29 ? 4.483   5.678   2.249   1.00 0.00 ? 557 HIS A HD1  18 
ATOM   10725 H  HD2  . HIS A 1 29 ? 1.590   2.698   2.171   1.00 0.00 ? 557 HIS A HD2  18 
ATOM   10726 H  HE1  . HIS A 1 29 ? 2.613   6.464   3.758   1.00 0.00 ? 557 HIS A HE1  18 
ATOM   10727 N  N    . LEU A 1 30 ? 5.879   1.388   3.145   1.00 0.00 ? 558 LEU A N    18 
ATOM   10728 C  CA   . LEU A 1 30 ? 5.937   0.862   4.503   1.00 0.00 ? 558 LEU A CA   18 
ATOM   10729 C  C    . LEU A 1 30 ? 7.219   1.302   5.206   1.00 0.00 ? 558 LEU A C    18 
ATOM   10730 O  O    . LEU A 1 30 ? 7.207   1.624   6.394   1.00 0.00 ? 558 LEU A O    18 
ATOM   10731 C  CB   . LEU A 1 30 ? 5.845   -0.666  4.485   1.00 0.00 ? 558 LEU A CB   18 
ATOM   10732 C  CG   . LEU A 1 30 ? 4.471   -1.236  4.841   1.00 0.00 ? 558 LEU A CG   18 
ATOM   10733 C  CD1  . LEU A 1 30 ? 4.463   -2.748  4.682   1.00 0.00 ? 558 LEU A CD1  18 
ATOM   10734 C  CD2  . LEU A 1 30 ? 4.085   -0.845  6.260   1.00 0.00 ? 558 LEU A CD2  18 
ATOM   10735 H  H    . LEU A 1 30 ? 5.919   0.764   2.391   1.00 0.00 ? 558 LEU A H    18 
ATOM   10736 H  HA   . LEU A 1 30 ? 5.092   1.258   5.044   1.00 0.00 ? 558 LEU A HA   18 
ATOM   10737 H  HB2  . LEU A 1 30 ? 6.109   -1.009  3.496   1.00 0.00 ? 558 LEU A HB2  18 
ATOM   10738 H  HB3  . LEU A 1 30 ? 6.565   -1.059  5.188   1.00 0.00 ? 558 LEU A HB3  18 
ATOM   10739 H  HG   . LEU A 1 30 ? 3.733   -0.825  4.167   1.00 0.00 ? 558 LEU A HG   18 
ATOM   10740 H  HD11 . LEU A 1 30 ? 3.443   -3.097  4.615   1.00 0.00 ? 558 LEU A HD11 18 
ATOM   10741 H  HD12 . LEU A 1 30 ? 4.944   -3.202  5.535   1.00 0.00 ? 558 LEU A HD12 18 
ATOM   10742 H  HD13 . LEU A 1 30 ? 4.995   -3.018  3.782   1.00 0.00 ? 558 LEU A HD13 18 
ATOM   10743 H  HD21 . LEU A 1 30 ? 4.639   0.033   6.555   1.00 0.00 ? 558 LEU A HD21 18 
ATOM   10744 H  HD22 . LEU A 1 30 ? 4.314   -1.658  6.932   1.00 0.00 ? 558 LEU A HD22 18 
ATOM   10745 H  HD23 . LEU A 1 30 ? 3.026   -0.633  6.299   1.00 0.00 ? 558 LEU A HD23 18 
ATOM   10746 N  N    . ARG A 1 31 ? 8.323   1.312   4.465   1.00 0.00 ? 559 ARG A N    18 
ATOM   10747 C  CA   . ARG A 1 31 ? 9.610   1.712   5.021   1.00 0.00 ? 559 ARG A CA   18 
ATOM   10748 C  C    . ARG A 1 31 ? 9.551   3.138   5.561   1.00 0.00 ? 559 ARG A C    18 
ATOM   10749 O  O    . ARG A 1 31 ? 10.258  3.484   6.508   1.00 0.00 ? 559 ARG A O    18 
ATOM   10750 C  CB   . ARG A 1 31 ? 10.711  1.592   3.963   1.00 0.00 ? 559 ARG A CB   18 
ATOM   10751 C  CG   . ARG A 1 31 ? 10.549  2.555   2.798   1.00 0.00 ? 559 ARG A CG   18 
ATOM   10752 C  CD   . ARG A 1 31 ? 11.831  3.325   2.520   1.00 0.00 ? 559 ARG A CD   18 
ATOM   10753 N  NE   . ARG A 1 31 ? 12.254  4.122   3.671   1.00 0.00 ? 559 ARG A NE   18 
ATOM   10754 C  CZ   . ARG A 1 31 ? 13.203  3.752   4.531   1.00 0.00 ? 559 ARG A CZ   18 
ATOM   10755 N  NH1  . ARG A 1 31 ? 13.832  2.591   4.388   1.00 0.00 ? 559 ARG A NH1  18 
ATOM   10756 N  NH2  . ARG A 1 31 ? 13.524  4.548   5.542   1.00 0.00 ? 559 ARG A NH2  18 
ATOM   10757 H  H    . ARG A 1 31 ? 8.270   1.044   3.524   1.00 0.00 ? 559 ARG A H    18 
ATOM   10758 H  HA   . ARG A 1 31 ? 9.837   1.043   5.838   1.00 0.00 ? 559 ARG A HA   18 
ATOM   10759 H  HB2  . ARG A 1 31 ? 11.664  1.783   4.431   1.00 0.00 ? 559 ARG A HB2  18 
ATOM   10760 H  HB3  . ARG A 1 31 ? 10.708  0.585   3.572   1.00 0.00 ? 559 ARG A HB3  18 
ATOM   10761 H  HG2  . ARG A 1 31 ? 10.282  1.994   1.915   1.00 0.00 ? 559 ARG A HG2  18 
ATOM   10762 H  HG3  . ARG A 1 31 ? 9.762   3.257   3.030   1.00 0.00 ? 559 ARG A HG3  18 
ATOM   10763 H  HD2  . ARG A 1 31 ? 12.611  2.623   2.271   1.00 0.00 ? 559 ARG A HD2  18 
ATOM   10764 H  HD3  . ARG A 1 31 ? 11.663  3.984   1.681   1.00 0.00 ? 559 ARG A HD3  18 
ATOM   10765 H  HE   . ARG A 1 31 ? 11.807  4.983   3.810   1.00 0.00 ? 559 ARG A HE   18 
ATOM   10766 H  HH11 . ARG A 1 31 ? 13.597  1.982   3.632   1.00 0.00 ? 559 ARG A HH11 18 
ATOM   10767 H  HH12 . ARG A 1 31 ? 14.543  2.325   5.039   1.00 0.00 ? 559 ARG A HH12 18 
ATOM   10768 H  HH21 . ARG A 1 31 ? 13.054  5.423   5.658   1.00 0.00 ? 559 ARG A HH21 18 
ATOM   10769 H  HH22 . ARG A 1 31 ? 14.235  4.273   6.189   1.00 0.00 ? 559 ARG A HH22 18 
ATOM   10770 N  N    . TRP A 1 32 ? 8.699   3.961   4.956   1.00 0.00 ? 560 TRP A N    18 
ATOM   10771 C  CA   . TRP A 1 32 ? 8.545   5.348   5.379   1.00 0.00 ? 560 TRP A CA   18 
ATOM   10772 C  C    . TRP A 1 32 ? 7.863   5.424   6.741   1.00 0.00 ? 560 TRP A C    18 
ATOM   10773 O  O    . TRP A 1 32 ? 8.168   6.300   7.552   1.00 0.00 ? 560 TRP A O    18 
ATOM   10774 C  CB   . TRP A 1 32 ? 7.732   6.131   4.347   1.00 0.00 ? 560 TRP A CB   18 
ATOM   10775 C  CG   . TRP A 1 32 ? 8.573   6.739   3.266   1.00 0.00 ? 560 TRP A CG   18 
ATOM   10776 C  CD1  . TRP A 1 32 ? 9.216   6.080   2.259   1.00 0.00 ? 560 TRP A CD1  18 
ATOM   10777 C  CD2  . TRP A 1 32 ? 8.863   8.130   3.086   1.00 0.00 ? 560 TRP A CD2  18 
ATOM   10778 N  NE1  . TRP A 1 32 ? 9.888   6.976   1.462   1.00 0.00 ? 560 TRP A NE1  18 
ATOM   10779 C  CE2  . TRP A 1 32 ? 9.687   8.241   1.950   1.00 0.00 ? 560 TRP A CE2  18 
ATOM   10780 C  CE3  . TRP A 1 32 ? 8.506   9.293   3.774   1.00 0.00 ? 560 TRP A CE3  18 
ATOM   10781 C  CZ2  . TRP A 1 32 ? 10.158  9.467   1.488   1.00 0.00 ? 560 TRP A CZ2  18 
ATOM   10782 C  CZ3  . TRP A 1 32 ? 8.974   10.510  3.315   1.00 0.00 ? 560 TRP A CZ3  18 
ATOM   10783 C  CH2  . TRP A 1 32 ? 9.792   10.589  2.181   1.00 0.00 ? 560 TRP A CH2  18 
ATOM   10784 H  H    . TRP A 1 32 ? 8.161   3.627   4.209   1.00 0.00 ? 560 TRP A H    18 
ATOM   10785 H  HA   . TRP A 1 32 ? 9.529   5.783   5.457   1.00 0.00 ? 560 TRP A HA   18 
ATOM   10786 H  HB2  . TRP A 1 32 ? 7.020   5.467   3.881   1.00 0.00 ? 560 TRP A HB2  18 
ATOM   10787 H  HB3  . TRP A 1 32 ? 7.200   6.928   4.847   1.00 0.00 ? 560 TRP A HB3  18 
ATOM   10788 H  HD1  . TRP A 1 32 ? 9.192   5.009   2.120   1.00 0.00 ? 560 TRP A HD1  18 
ATOM   10789 H  HE1  . TRP A 1 32 ? 10.423  6.746   0.674   1.00 0.00 ? 560 TRP A HE1  18 
ATOM   10790 H  HE3  . TRP A 1 32 ? 7.876   9.252   4.651   1.00 0.00 ? 560 TRP A HE3  18 
ATOM   10791 H  HZ2  . TRP A 1 32 ? 10.789  9.545   0.615   1.00 0.00 ? 560 TRP A HZ2  18 
ATOM   10792 H  HZ3  . TRP A 1 32 ? 8.709   11.419  3.834   1.00 0.00 ? 560 TRP A HZ3  18 
ATOM   10793 H  HH2  . TRP A 1 32 ? 10.135  11.560  1.858   1.00 0.00 ? 560 TRP A HH2  18 
ATOM   10794 N  N    . HIS A 1 33 ? 6.940   4.500   6.986   1.00 0.00 ? 561 HIS A N    18 
ATOM   10795 C  CA   . HIS A 1 33 ? 6.213   4.460   8.248   1.00 0.00 ? 561 HIS A CA   18 
ATOM   10796 C  C    . HIS A 1 33 ? 7.101   3.937   9.372   1.00 0.00 ? 561 HIS A C    18 
ATOM   10797 O  O    . HIS A 1 33 ? 7.082   4.459   10.487  1.00 0.00 ? 561 HIS A O    18 
ATOM   10798 C  CB   . HIS A 1 33 ? 4.968   3.581   8.115   1.00 0.00 ? 561 HIS A CB   18 
ATOM   10799 C  CG   . HIS A 1 33 ? 3.801   4.287   7.497   1.00 0.00 ? 561 HIS A CG   18 
ATOM   10800 N  ND1  . HIS A 1 33 ? 2.957   5.125   8.190   1.00 0.00 ? 561 HIS A ND1  18 
ATOM   10801 C  CD2  . HIS A 1 33 ? 3.344   4.270   6.218   1.00 0.00 ? 561 HIS A CD2  18 
ATOM   10802 C  CE1  . HIS A 1 33 ? 2.033   5.580   7.333   1.00 0.00 ? 561 HIS A CE1  18 
ATOM   10803 N  NE2  . HIS A 1 33 ? 2.224   5.091   6.122   1.00 0.00 ? 561 HIS A NE2  18 
ATOM   10804 H  H    . HIS A 1 33 ? 6.742   3.829   6.299   1.00 0.00 ? 561 HIS A H    18 
ATOM   10805 H  HA   . HIS A 1 33 ? 5.907   5.468   8.487   1.00 0.00 ? 561 HIS A HA   18 
ATOM   10806 H  HB2  . HIS A 1 33 ? 5.204   2.727   7.497   1.00 0.00 ? 561 HIS A HB2  18 
ATOM   10807 H  HB3  . HIS A 1 33 ? 4.670   3.239   9.095   1.00 0.00 ? 561 HIS A HB3  18 
ATOM   10808 H  HD1  . HIS A 1 33 ? 3.019   5.348   9.142   1.00 0.00 ? 561 HIS A HD1  18 
ATOM   10809 H  HD2  . HIS A 1 33 ? 3.773   3.712   5.399   1.00 0.00 ? 561 HIS A HD2  18 
ATOM   10810 H  HE1  . HIS A 1 33 ? 1.237   6.260   7.597   1.00 0.00 ? 561 HIS A HE1  18 
ATOM   10811 N  N    . THR A 1 34 ? 7.881   2.903   9.072   1.00 0.00 ? 562 THR A N    18 
ATOM   10812 C  CA   . THR A 1 34 ? 8.777   2.310   10.057  1.00 0.00 ? 562 THR A CA   18 
ATOM   10813 C  C    . THR A 1 34 ? 10.129  3.015   10.056  1.00 0.00 ? 562 THR A C    18 
ATOM   10814 O  O    . THR A 1 34 ? 10.956  2.793   9.171   1.00 0.00 ? 562 THR A O    18 
ATOM   10815 C  CB   . THR A 1 34 ? 8.966   0.819   9.774   1.00 0.00 ? 562 THR A CB   18 
ATOM   10816 O  OG1  . THR A 1 34 ? 9.463   0.617   8.463   1.00 0.00 ? 562 THR A OG1  18 
ATOM   10817 C  CG2  . THR A 1 34 ? 7.690   0.018   9.910   1.00 0.00 ? 562 THR A CG2  18 
ATOM   10818 H  H    . THR A 1 34 ? 7.852   2.530   8.166   1.00 0.00 ? 562 THR A H    18 
ATOM   10819 H  HA   . THR A 1 34 ? 8.324   2.428   11.030  1.00 0.00 ? 562 THR A HA   18 
ATOM   10820 H  HB   . THR A 1 34 ? 9.685   0.419   10.475  1.00 0.00 ? 562 THR A HB   18 
ATOM   10821 H  HG1  . THR A 1 34 ? 10.240  1.165   8.327   1.00 0.00 ? 562 THR A HG1  18 
ATOM   10822 H  HG21 . THR A 1 34 ? 7.793   -0.690  10.719  1.00 0.00 ? 562 THR A HG21 18 
ATOM   10823 H  HG22 . THR A 1 34 ? 7.499   -0.513  8.989   1.00 0.00 ? 562 THR A HG22 18 
ATOM   10824 H  HG23 . THR A 1 34 ? 6.866   0.685   10.119  1.00 0.00 ? 562 THR A HG23 18 
ATOM   10825 N  N    . GLY A 1 35 ? 10.348  3.866   11.053  1.00 0.00 ? 563 GLY A N    18 
ATOM   10826 C  CA   . GLY A 1 35 ? 11.602  4.590   11.148  1.00 0.00 ? 563 GLY A CA   18 
ATOM   10827 C  C    . GLY A 1 35 ? 11.511  5.986   10.562  1.00 0.00 ? 563 GLY A C    18 
ATOM   10828 O  O    . GLY A 1 35 ? 11.952  6.224   9.438   1.00 0.00 ? 563 GLY A O    18 
ATOM   10829 H  H    . GLY A 1 35 ? 9.653   4.003   11.730  1.00 0.00 ? 563 GLY A H    18 
ATOM   10830 H  HA2  . GLY A 1 35 ? 11.884  4.666   12.188  1.00 0.00 ? 563 GLY A HA2  18 
ATOM   10831 H  HA3  . GLY A 1 35 ? 12.365  4.039   10.619  1.00 0.00 ? 563 GLY A HA3  18 
ATOM   10832 N  N    . GLU A 1 36 ? 10.937  6.910   11.326  1.00 0.00 ? 564 GLU A N    18 
ATOM   10833 C  CA   . GLU A 1 36 ? 10.790  8.289   10.876  1.00 0.00 ? 564 GLU A CA   18 
ATOM   10834 C  C    . GLU A 1 36 ? 10.676  9.240   12.062  1.00 0.00 ? 564 GLU A C    18 
ATOM   10835 O  O    . GLU A 1 36 ? 11.327  10.284  12.098  1.00 0.00 ? 564 GLU A O    18 
ATOM   10836 C  CB   . GLU A 1 36 ? 9.559   8.426   9.977   1.00 0.00 ? 564 GLU A CB   18 
ATOM   10837 C  CG   . GLU A 1 36 ? 8.317   7.752   10.536  1.00 0.00 ? 564 GLU A CG   18 
ATOM   10838 C  CD   . GLU A 1 36 ? 7.295   8.747   11.050  1.00 0.00 ? 564 GLU A CD   18 
ATOM   10839 O  OE1  . GLU A 1 36 ? 7.366   9.110   12.243  1.00 0.00 ? 564 GLU A OE1  18 
ATOM   10840 O  OE2  . GLU A 1 36 ? 6.423   9.165   10.259  1.00 0.00 ? 564 GLU A OE2  18 
ATOM   10841 H  H    . GLU A 1 36 ? 10.606  6.658   12.213  1.00 0.00 ? 564 GLU A H    18 
ATOM   10842 H  HA   . GLU A 1 36 ? 11.670  8.547   10.307  1.00 0.00 ? 564 GLU A HA   18 
ATOM   10843 H  HB2  . GLU A 1 36 ? 9.343   9.476   9.840   1.00 0.00 ? 564 GLU A HB2  18 
ATOM   10844 H  HB3  . GLU A 1 36 ? 9.779   7.985   9.015   1.00 0.00 ? 564 GLU A HB3  18 
ATOM   10845 H  HG2  . GLU A 1 36 ? 7.860   7.162   9.756   1.00 0.00 ? 564 GLU A HG2  18 
ATOM   10846 H  HG3  . GLU A 1 36 ? 8.609   7.105   11.350  1.00 0.00 ? 564 GLU A HG3  18 
ATOM   10847 N  N    . ARG A 1 37 ? 9.846   8.872   13.033  1.00 0.00 ? 565 ARG A N    18 
ATOM   10848 C  CA   . ARG A 1 37 ? 9.647   9.693   14.222  1.00 0.00 ? 565 ARG A CA   18 
ATOM   10849 C  C    . ARG A 1 37 ? 8.767   8.972   15.239  1.00 0.00 ? 565 ARG A C    18 
ATOM   10850 O  O    . ARG A 1 37 ? 7.528   9.080   15.130  1.00 0.00 ? 565 ARG A O    18 
ATOM   10851 C  CB   . ARG A 1 37 ? 9.019   11.036  13.841  1.00 0.00 ? 565 ARG A CB   18 
ATOM   10852 C  CG   . ARG A 1 37 ? 9.969   12.214  13.981  1.00 0.00 ? 565 ARG A CG   18 
ATOM   10853 C  CD   . ARG A 1 37 ? 10.224  12.557  15.440  1.00 0.00 ? 565 ARG A CD   18 
ATOM   10854 N  NE   . ARG A 1 37 ? 9.621   13.835  15.815  1.00 0.00 ? 565 ARG A NE   18 
ATOM   10855 C  CZ   . ARG A 1 37 ? 9.971   14.531  16.894  1.00 0.00 ? 565 ARG A CZ   18 
ATOM   10856 N  NH1  . ARG A 1 37 ? 10.918  14.078  17.707  1.00 0.00 ? 565 ARG A NH1  18 
ATOM   10857 N  NH2  . ARG A 1 37 ? 9.373   15.684  17.161  1.00 0.00 ? 565 ARG A NH2  18 
ATOM   10858 O  OXT  . ARG A 1 37 ? 9.325   8.305   16.135  1.00 0.00 ? 565 ARG A OXT  18 
ATOM   10859 H  H    . ARG A 1 37 ? 9.355   8.028   12.948  1.00 0.00 ? 565 ARG A H    18 
ATOM   10860 H  HA   . ARG A 1 37 ? 10.615  9.872   14.665  1.00 0.00 ? 565 ARG A HA   18 
ATOM   10861 H  HB2  . ARG A 1 37 ? 8.690   10.987  12.813  1.00 0.00 ? 565 ARG A HB2  18 
ATOM   10862 H  HB3  . ARG A 1 37 ? 8.162   11.215  14.475  1.00 0.00 ? 565 ARG A HB3  18 
ATOM   10863 H  HG2  . ARG A 1 37 ? 10.909  11.963  13.512  1.00 0.00 ? 565 ARG A HG2  18 
ATOM   10864 H  HG3  . ARG A 1 37 ? 9.537   13.073  13.488  1.00 0.00 ? 565 ARG A HG3  18 
ATOM   10865 H  HD2  . ARG A 1 37 ? 9.806   11.778  16.060  1.00 0.00 ? 565 ARG A HD2  18 
ATOM   10866 H  HD3  . ARG A 1 37 ? 11.290  12.612  15.603  1.00 0.00 ? 565 ARG A HD3  18 
ATOM   10867 H  HE   . ARG A 1 37 ? 8.919   14.192  15.232  1.00 0.00 ? 565 ARG A HE   18 
ATOM   10868 H  HH11 . ARG A 1 37 ? 11.373  13.210  17.511  1.00 0.00 ? 565 ARG A HH11 18 
ATOM   10869 H  HH12 . ARG A 1 37 ? 11.176  14.607  18.515  1.00 0.00 ? 565 ARG A HH12 18 
ATOM   10870 H  HH21 . ARG A 1 37 ? 8.660   16.030  16.552  1.00 0.00 ? 565 ARG A HH21 18 
ATOM   10871 H  HH22 . ARG A 1 37 ? 9.636   16.208  17.971  1.00 0.00 ? 565 ARG A HH22 18 
HETATM 10872 ZN ZN   . ZN  B 2 .  ? 0.736   5.425   4.796   1.00 0.00 ? 100 ZN  A ZN   18 
ATOM   10873 N  N    . MET A 1 1  ? -6.711  -9.537  -18.255 1.00 0.00 ? 1   MET A N    19 
ATOM   10874 C  CA   . MET A 1 1  ? -5.271  -9.761  -18.549 1.00 0.00 ? 1   MET A CA   19 
ATOM   10875 C  C    . MET A 1 1  ? -4.482  -10.022 -17.270 1.00 0.00 ? 1   MET A C    19 
ATOM   10876 O  O    . MET A 1 1  ? -3.882  -11.084 -17.105 1.00 0.00 ? 1   MET A O    19 
ATOM   10877 C  CB   . MET A 1 1  ? -4.722  -8.526  -19.266 1.00 0.00 ? 1   MET A CB   19 
ATOM   10878 C  CG   . MET A 1 1  ? -4.977  -8.529  -20.765 1.00 0.00 ? 1   MET A CG   19 
ATOM   10879 S  SD   . MET A 1 1  ? -6.295  -7.398  -21.250 1.00 0.00 ? 1   MET A SD   19 
ATOM   10880 C  CE   . MET A 1 1  ? -5.385  -6.229  -22.256 1.00 0.00 ? 1   MET A CE   19 
ATOM   10881 H  H1   . MET A 1 1  ? -7.011  -10.260 -17.572 1.00 0.00 ? 1   MET A H1   19 
ATOM   10882 H  H2   . MET A 1 1  ? -7.233  -9.625  -19.151 1.00 0.00 ? 1   MET A H2   19 
ATOM   10883 H  H3   . MET A 1 1  ? -6.808  -8.582  -17.856 1.00 0.00 ? 1   MET A H3   19 
ATOM   10884 H  HA   . MET A 1 1  ? -5.182  -10.619 -19.199 1.00 0.00 ? 1   MET A HA   19 
ATOM   10885 H  HB2  . MET A 1 1  ? -5.183  -7.645  -18.845 1.00 0.00 ? 1   MET A HB2  19 
ATOM   10886 H  HB3  . MET A 1 1  ? -3.655  -8.475  -19.104 1.00 0.00 ? 1   MET A HB3  19 
ATOM   10887 H  HG2  . MET A 1 1  ? -4.069  -8.238  -21.271 1.00 0.00 ? 1   MET A HG2  19 
ATOM   10888 H  HG3  . MET A 1 1  ? -5.250  -9.529  -21.067 1.00 0.00 ? 1   MET A HG3  19 
ATOM   10889 H  HE1  . MET A 1 1  ? -4.408  -6.067  -21.825 1.00 0.00 ? 1   MET A HE1  19 
ATOM   10890 H  HE2  . MET A 1 1  ? -5.921  -5.293  -22.295 1.00 0.00 ? 1   MET A HE2  19 
ATOM   10891 H  HE3  . MET A 1 1  ? -5.276  -6.624  -23.256 1.00 0.00 ? 1   MET A HE3  19 
ATOM   10892 N  N    . ASP A 1 2  ? -4.485  -9.045  -16.369 1.00 0.00 ? 530 ASP A N    19 
ATOM   10893 C  CA   . ASP A 1 2  ? -3.769  -9.169  -15.105 1.00 0.00 ? 530 ASP A CA   19 
ATOM   10894 C  C    . ASP A 1 2  ? -4.446  -10.191 -14.193 1.00 0.00 ? 530 ASP A C    19 
ATOM   10895 O  O    . ASP A 1 2  ? -5.672  -10.299 -14.174 1.00 0.00 ? 530 ASP A O    19 
ATOM   10896 C  CB   . ASP A 1 2  ? -3.694  -7.813  -14.402 1.00 0.00 ? 530 ASP A CB   19 
ATOM   10897 C  CG   . ASP A 1 2  ? -5.046  -7.132  -14.311 1.00 0.00 ? 530 ASP A CG   19 
ATOM   10898 O  OD1  . ASP A 1 2  ? -5.641  -6.851  -15.372 1.00 0.00 ? 530 ASP A OD1  19 
ATOM   10899 O  OD2  . ASP A 1 2  ? -5.509  -6.881  -13.178 1.00 0.00 ? 530 ASP A OD2  19 
ATOM   10900 H  H    . ASP A 1 2  ? -4.981  -8.221  -16.558 1.00 0.00 ? 530 ASP A H    19 
ATOM   10901 H  HA   . ASP A 1 2  ? -2.768  -9.507  -15.325 1.00 0.00 ? 530 ASP A HA   19 
ATOM   10902 H  HB2  . ASP A 1 2  ? -3.315  -7.953  -13.401 1.00 0.00 ? 530 ASP A HB2  19 
ATOM   10903 H  HB3  . ASP A 1 2  ? -3.022  -7.167  -14.949 1.00 0.00 ? 530 ASP A HB3  19 
ATOM   10904 N  N    . PRO A 1 3  ? -3.654  -10.956 -13.422 1.00 0.00 ? 531 PRO A N    19 
ATOM   10905 C  CA   . PRO A 1 3  ? -4.186  -11.970 -12.508 1.00 0.00 ? 531 PRO A CA   19 
ATOM   10906 C  C    . PRO A 1 3  ? -4.809  -11.355 -11.259 1.00 0.00 ? 531 PRO A C    19 
ATOM   10907 O  O    . PRO A 1 3  ? -4.314  -10.359 -10.732 1.00 0.00 ? 531 PRO A O    19 
ATOM   10908 C  CB   . PRO A 1 3  ? -2.950  -12.790 -12.139 1.00 0.00 ? 531 PRO A CB   19 
ATOM   10909 C  CG   . PRO A 1 3  ? -1.815  -11.833 -12.262 1.00 0.00 ? 531 PRO A CG   19 
ATOM   10910 C  CD   . PRO A 1 3  ? -2.179  -10.894 -13.381 1.00 0.00 ? 531 PRO A CD   19 
ATOM   10911 H  HA   . PRO A 1 3  ? -4.910  -12.604 -12.997 1.00 0.00 ? 531 PRO A HA   19 
ATOM   10912 H  HB2  . PRO A 1 3  ? -3.048  -13.162 -11.130 1.00 0.00 ? 531 PRO A HB2  19 
ATOM   10913 H  HB3  . PRO A 1 3  ? -2.844  -13.617 -12.826 1.00 0.00 ? 531 PRO A HB3  19 
ATOM   10914 H  HG2  . PRO A 1 3  ? -1.695  -11.286 -11.338 1.00 0.00 ? 531 PRO A HG2  19 
ATOM   10915 H  HG3  . PRO A 1 3  ? -0.909  -12.368 -12.503 1.00 0.00 ? 531 PRO A HG3  19 
ATOM   10916 H  HD2  . PRO A 1 3  ? -1.843  -9.892  -13.157 1.00 0.00 ? 531 PRO A HD2  19 
ATOM   10917 H  HD3  . PRO A 1 3  ? -1.754  -11.236 -14.313 1.00 0.00 ? 531 PRO A HD3  19 
ATOM   10918 N  N    . GLY A 1 4  ? -5.898  -11.956 -10.790 1.00 0.00 ? 532 GLY A N    19 
ATOM   10919 C  CA   . GLY A 1 4  ? -6.571  -11.454 -9.607  1.00 0.00 ? 532 GLY A CA   19 
ATOM   10920 C  C    . GLY A 1 4  ? -7.634  -10.424 -9.935  1.00 0.00 ? 532 GLY A C    19 
ATOM   10921 O  O    . GLY A 1 4  ? -7.954  -10.204 -11.103 1.00 0.00 ? 532 GLY A O    19 
ATOM   10922 H  H    . GLY A 1 4  ? -6.247  -12.747 -11.251 1.00 0.00 ? 532 GLY A H    19 
ATOM   10923 H  HA2  . GLY A 1 4  ? -7.034  -12.282 -9.091  1.00 0.00 ? 532 GLY A HA2  19 
ATOM   10924 H  HA3  . GLY A 1 4  ? -5.838  -11.002 -8.954  1.00 0.00 ? 532 GLY A HA3  19 
ATOM   10925 N  N    . LYS A 1 5  ? -8.182  -9.793  -8.902  1.00 0.00 ? 533 LYS A N    19 
ATOM   10926 C  CA   . LYS A 1 5  ? -9.216  -8.780  -9.084  1.00 0.00 ? 533 LYS A CA   19 
ATOM   10927 C  C    . LYS A 1 5  ? -8.787  -7.449  -8.474  1.00 0.00 ? 533 LYS A C    19 
ATOM   10928 O  O    . LYS A 1 5  ? -7.796  -7.379  -7.747  1.00 0.00 ? 533 LYS A O    19 
ATOM   10929 C  CB   . LYS A 1 5  ? -10.530 -9.244  -8.454  1.00 0.00 ? 533 LYS A CB   19 
ATOM   10930 C  CG   . LYS A 1 5  ? -11.279 -10.268 -9.291  1.00 0.00 ? 533 LYS A CG   19 
ATOM   10931 C  CD   . LYS A 1 5  ? -12.303 -11.027 -8.461  1.00 0.00 ? 533 LYS A CD   19 
ATOM   10932 C  CE   . LYS A 1 5  ? -13.635 -11.140 -9.185  1.00 0.00 ? 533 LYS A CE   19 
ATOM   10933 N  NZ   . LYS A 1 5  ? -14.419 -12.320 -8.726  1.00 0.00 ? 533 LYS A NZ   19 
ATOM   10934 H  H    . LYS A 1 5  ? -7.884  -10.013 -7.995  1.00 0.00 ? 533 LYS A H    19 
ATOM   10935 H  HA   . LYS A 1 5  ? -9.364  -8.645  -10.145 1.00 0.00 ? 533 LYS A HA   19 
ATOM   10936 H  HB2  . LYS A 1 5  ? -10.319 -9.684  -7.490  1.00 0.00 ? 533 LYS A HB2  19 
ATOM   10937 H  HB3  . LYS A 1 5  ? -11.172 -8.386  -8.315  1.00 0.00 ? 533 LYS A HB3  19 
ATOM   10938 H  HG2  . LYS A 1 5  ? -11.789 -9.758  -10.095 1.00 0.00 ? 533 LYS A HG2  19 
ATOM   10939 H  HG3  . LYS A 1 5  ? -10.569 -10.971 -9.702  1.00 0.00 ? 533 LYS A HG3  19 
ATOM   10940 H  HD2  . LYS A 1 5  ? -11.927 -12.020 -8.264  1.00 0.00 ? 533 LYS A HD2  19 
ATOM   10941 H  HD3  . LYS A 1 5  ? -12.453 -10.506 -7.527  1.00 0.00 ? 533 LYS A HD3  19 
ATOM   10942 H  HE2  . LYS A 1 5  ? -14.208 -10.245 -8.998  1.00 0.00 ? 533 LYS A HE2  19 
ATOM   10943 H  HE3  . LYS A 1 5  ? -13.448 -11.233 -10.244 1.00 0.00 ? 533 LYS A HE3  19 
ATOM   10944 H  HZ1  . LYS A 1 5  ? -14.817 -12.140 -7.782  1.00 0.00 ? 533 LYS A HZ1  19 
ATOM   10945 H  HZ2  . LYS A 1 5  ? -13.806 -13.159 -8.676  1.00 0.00 ? 533 LYS A HZ2  19 
ATOM   10946 H  HZ3  . LYS A 1 5  ? -15.197 -12.512 -9.388  1.00 0.00 ? 533 LYS A HZ3  19 
ATOM   10947 N  N    . LYS A 1 6  ? -9.541  -6.397  -8.774  1.00 0.00 ? 534 LYS A N    19 
ATOM   10948 C  CA   . LYS A 1 6  ? -9.239  -5.068  -8.254  1.00 0.00 ? 534 LYS A CA   19 
ATOM   10949 C  C    . LYS A 1 6  ? -9.805  -4.892  -6.849  1.00 0.00 ? 534 LYS A C    19 
ATOM   10950 O  O    . LYS A 1 6  ? -10.991 -5.124  -6.613  1.00 0.00 ? 534 LYS A O    19 
ATOM   10951 C  CB   . LYS A 1 6  ? -9.807  -3.993  -9.183  1.00 0.00 ? 534 LYS A CB   19 
ATOM   10952 C  CG   . LYS A 1 6  ? -9.073  -3.887  -10.510 1.00 0.00 ? 534 LYS A CG   19 
ATOM   10953 C  CD   . LYS A 1 6  ? -10.028 -3.580  -11.652 1.00 0.00 ? 534 LYS A CD   19 
ATOM   10954 C  CE   . LYS A 1 6  ? -10.298 -2.088  -11.767 1.00 0.00 ? 534 LYS A CE   19 
ATOM   10955 N  NZ   . LYS A 1 6  ? -10.540 -1.675  -13.177 1.00 0.00 ? 534 LYS A NZ   19 
ATOM   10956 H  H    . LYS A 1 6  ? -10.318 -6.516  -9.358  1.00 0.00 ? 534 LYS A H    19 
ATOM   10957 H  HA   . LYS A 1 6  ? -8.165  -4.964  -8.212  1.00 0.00 ? 534 LYS A HA   19 
ATOM   10958 H  HB2  . LYS A 1 6  ? -10.843 -4.220  -9.386  1.00 0.00 ? 534 LYS A HB2  19 
ATOM   10959 H  HB3  . LYS A 1 6  ? -9.747  -3.036  -8.686  1.00 0.00 ? 534 LYS A HB3  19 
ATOM   10960 H  HG2  . LYS A 1 6  ? -8.341  -3.096  -10.444 1.00 0.00 ? 534 LYS A HG2  19 
ATOM   10961 H  HG3  . LYS A 1 6  ? -8.575  -4.825  -10.711 1.00 0.00 ? 534 LYS A HG3  19 
ATOM   10962 H  HD2  . LYS A 1 6  ? -9.593  -3.928  -12.577 1.00 0.00 ? 534 LYS A HD2  19 
ATOM   10963 H  HD3  . LYS A 1 6  ? -10.962 -4.093  -11.475 1.00 0.00 ? 534 LYS A HD3  19 
ATOM   10964 H  HE2  . LYS A 1 6  ? -11.169 -1.846  -11.176 1.00 0.00 ? 534 LYS A HE2  19 
ATOM   10965 H  HE3  . LYS A 1 6  ? -9.443  -1.550  -11.384 1.00 0.00 ? 534 LYS A HE3  19 
ATOM   10966 H  HZ1  . LYS A 1 6  ? -11.562 -1.645  -13.371 1.00 0.00 ? 534 LYS A HZ1  19 
ATOM   10967 H  HZ2  . LYS A 1 6  ? -10.094 -2.350  -13.829 1.00 0.00 ? 534 LYS A HZ2  19 
ATOM   10968 H  HZ3  . LYS A 1 6  ? -10.139 -0.730  -13.346 1.00 0.00 ? 534 LYS A HZ3  19 
ATOM   10969 N  N    . LYS A 1 7  ? -8.950  -4.480  -5.919  1.00 0.00 ? 535 LYS A N    19 
ATOM   10970 C  CA   . LYS A 1 7  ? -9.365  -4.273  -4.537  1.00 0.00 ? 535 LYS A CA   19 
ATOM   10971 C  C    . LYS A 1 7  ? -8.856  -2.935  -4.009  1.00 0.00 ? 535 LYS A C    19 
ATOM   10972 O  O    . LYS A 1 7  ? -8.351  -2.109  -4.769  1.00 0.00 ? 535 LYS A O    19 
ATOM   10973 C  CB   . LYS A 1 7  ? -8.854  -5.415  -3.653  1.00 0.00 ? 535 LYS A CB   19 
ATOM   10974 C  CG   . LYS A 1 7  ? -9.964  -6.262  -3.052  1.00 0.00 ? 535 LYS A CG   19 
ATOM   10975 C  CD   . LYS A 1 7  ? -10.220 -7.512  -3.879  1.00 0.00 ? 535 LYS A CD   19 
ATOM   10976 C  CE   . LYS A 1 7  ? -10.967 -8.566  -3.078  1.00 0.00 ? 535 LYS A CE   19 
ATOM   10977 N  NZ   . LYS A 1 7  ? -12.430 -8.542  -3.357  1.00 0.00 ? 535 LYS A NZ   19 
ATOM   10978 H  H    . LYS A 1 7  ? -8.017  -4.312  -6.168  1.00 0.00 ? 535 LYS A H    19 
ATOM   10979 H  HA   . LYS A 1 7  ? -10.445 -4.268  -4.513  1.00 0.00 ? 535 LYS A HA   19 
ATOM   10980 H  HB2  . LYS A 1 7  ? -8.222  -6.058  -4.248  1.00 0.00 ? 535 LYS A HB2  19 
ATOM   10981 H  HB3  . LYS A 1 7  ? -8.271  -4.999  -2.845  1.00 0.00 ? 535 LYS A HB3  19 
ATOM   10982 H  HG2  . LYS A 1 7  ? -9.678  -6.556  -2.054  1.00 0.00 ? 535 LYS A HG2  19 
ATOM   10983 H  HG3  . LYS A 1 7  ? -10.870 -5.675  -3.012  1.00 0.00 ? 535 LYS A HG3  19 
ATOM   10984 H  HD2  . LYS A 1 7  ? -10.811 -7.245  -4.743  1.00 0.00 ? 535 LYS A HD2  19 
ATOM   10985 H  HD3  . LYS A 1 7  ? -9.273  -7.920  -4.200  1.00 0.00 ? 535 LYS A HD3  19 
ATOM   10986 H  HE2  . LYS A 1 7  ? -10.577 -9.539  -3.335  1.00 0.00 ? 535 LYS A HE2  19 
ATOM   10987 H  HE3  . LYS A 1 7  ? -10.807 -8.381  -2.026  1.00 0.00 ? 535 LYS A HE3  19 
ATOM   10988 H  HZ1  . LYS A 1 7  ? -12.750 -7.564  -3.505  1.00 0.00 ? 535 LYS A HZ1  19 
ATOM   10989 H  HZ2  . LYS A 1 7  ? -12.953 -8.949  -2.556  1.00 0.00 ? 535 LYS A HZ2  19 
ATOM   10990 H  HZ3  . LYS A 1 7  ? -12.639 -9.097  -4.212  1.00 0.00 ? 535 LYS A HZ3  19 
ATOM   10991 N  N    . GLN A 1 8  ? -8.992  -2.730  -2.703  1.00 0.00 ? 536 GLN A N    19 
ATOM   10992 C  CA   . GLN A 1 8  ? -8.545  -1.493  -2.073  1.00 0.00 ? 536 GLN A CA   19 
ATOM   10993 C  C    . GLN A 1 8  ? -7.694  -1.787  -0.842  1.00 0.00 ? 536 GLN A C    19 
ATOM   10994 O  O    . GLN A 1 8  ? -8.175  -2.363  0.134   1.00 0.00 ? 536 GLN A O    19 
ATOM   10995 C  CB   . GLN A 1 8  ? -9.748  -0.631  -1.683  1.00 0.00 ? 536 GLN A CB   19 
ATOM   10996 C  CG   . GLN A 1 8  ? -10.777 -1.368  -0.842  1.00 0.00 ? 536 GLN A CG   19 
ATOM   10997 C  CD   . GLN A 1 8  ? -12.079 -0.602  -0.711  1.00 0.00 ? 536 GLN A CD   19 
ATOM   10998 O  OE1  . GLN A 1 8  ? -12.263 0.177   0.224   1.00 0.00 ? 536 GLN A OE1  19 
ATOM   10999 N  NE2  . GLN A 1 8  ? -12.991 -0.820  -1.652  1.00 0.00 ? 536 GLN A NE2  19 
ATOM   11000 H  H    . GLN A 1 8  ? -9.402  -3.427  -2.150  1.00 0.00 ? 536 GLN A H    19 
ATOM   11001 H  HA   . GLN A 1 8  ? -7.945  -0.954  -2.790  1.00 0.00 ? 536 GLN A HA   19 
ATOM   11002 H  HB2  . GLN A 1 8  ? -9.397  0.221   -1.120  1.00 0.00 ? 536 GLN A HB2  19 
ATOM   11003 H  HB3  . GLN A 1 8  ? -10.233 -0.282  -2.583  1.00 0.00 ? 536 GLN A HB3  19 
ATOM   11004 H  HG2  . GLN A 1 8  ? -10.984 -2.322  -1.303  1.00 0.00 ? 536 GLN A HG2  19 
ATOM   11005 H  HG3  . GLN A 1 8  ? -10.369 -1.527  0.146   1.00 0.00 ? 536 GLN A HG3  19 
ATOM   11006 H  HE21 . GLN A 1 8  ? -12.776 -1.454  -2.367  1.00 0.00 ? 536 GLN A HE21 19 
ATOM   11007 H  HE22 . GLN A 1 8  ? -13.842 -0.337  -1.592  1.00 0.00 ? 536 GLN A HE22 19 
ATOM   11008 N  N    . HIS A 1 9  ? -6.428  -1.388  -0.895  1.00 0.00 ? 537 HIS A N    19 
ATOM   11009 C  CA   . HIS A 1 9  ? -5.509  -1.609  0.216   1.00 0.00 ? 537 HIS A CA   19 
ATOM   11010 C  C    . HIS A 1 9  ? -5.300  -0.325  1.012   1.00 0.00 ? 537 HIS A C    19 
ATOM   11011 O  O    . HIS A 1 9  ? -4.523  0.544   0.615   1.00 0.00 ? 537 HIS A O    19 
ATOM   11012 C  CB   . HIS A 1 9  ? -4.167  -2.129  -0.301  1.00 0.00 ? 537 HIS A CB   19 
ATOM   11013 C  CG   . HIS A 1 9  ? -4.302  -3.221  -1.317  1.00 0.00 ? 537 HIS A CG   19 
ATOM   11014 N  ND1  . HIS A 1 9  ? -5.450  -3.958  -1.504  1.00 0.00 ? 537 HIS A ND1  19 
ATOM   11015 C  CD2  . HIS A 1 9  ? -3.402  -3.697  -2.216  1.00 0.00 ? 537 HIS A CD2  19 
ATOM   11016 C  CE1  . HIS A 1 9  ? -5.219  -4.838  -2.487  1.00 0.00 ? 537 HIS A CE1  19 
ATOM   11017 N  NE2  . HIS A 1 9  ? -3.990  -4.721  -2.953  1.00 0.00 ? 537 HIS A NE2  19 
ATOM   11018 H  H    . HIS A 1 9  ? -6.103  -0.934  -1.700  1.00 0.00 ? 537 HIS A H    19 
ATOM   11019 H  HA   . HIS A 1 9  ? -5.948  -2.352  0.865   1.00 0.00 ? 537 HIS A HA   19 
ATOM   11020 H  HB2  . HIS A 1 9  ? -3.625  -1.315  -0.759  1.00 0.00 ? 537 HIS A HB2  19 
ATOM   11021 H  HB3  . HIS A 1 9  ? -3.594  -2.515  0.529   1.00 0.00 ? 537 HIS A HB3  19 
ATOM   11022 H  HD1  . HIS A 1 9  ? -6.288  -3.856  -1.006  1.00 0.00 ? 537 HIS A HD1  19 
ATOM   11023 H  HD2  . HIS A 1 9  ? -2.390  -3.344  -2.346  1.00 0.00 ? 537 HIS A HD2  19 
ATOM   11024 H  HE1  . HIS A 1 9  ? -5.944  -5.551  -2.851  1.00 0.00 ? 537 HIS A HE1  19 
ATOM   11025 N  N    . ILE A 1 10 ? -5.999  -0.212  2.137   1.00 0.00 ? 538 ILE A N    19 
ATOM   11026 C  CA   . ILE A 1 10 ? -5.892  0.965   2.990   1.00 0.00 ? 538 ILE A CA   19 
ATOM   11027 C  C    . ILE A 1 10 ? -4.647  0.900   3.867   1.00 0.00 ? 538 ILE A C    19 
ATOM   11028 O  O    . ILE A 1 10 ? -4.197  -0.182  4.244   1.00 0.00 ? 538 ILE A O    19 
ATOM   11029 C  CB   . ILE A 1 10 ? -7.132  1.120   3.890   1.00 0.00 ? 538 ILE A CB   19 
ATOM   11030 C  CG1  . ILE A 1 10 ? -8.411  0.991   3.061   1.00 0.00 ? 538 ILE A CG1  19 
ATOM   11031 C  CG2  . ILE A 1 10 ? -7.098  2.456   4.617   1.00 0.00 ? 538 ILE A CG2  19 
ATOM   11032 C  CD1  . ILE A 1 10 ? -9.661  0.833   3.898   1.00 0.00 ? 538 ILE A CD1  19 
ATOM   11033 H  H    . ILE A 1 10 ? -6.602  -0.938  2.399   1.00 0.00 ? 538 ILE A H    19 
ATOM   11034 H  HA   . ILE A 1 10 ? -5.826  1.835   2.352   1.00 0.00 ? 538 ILE A HA   19 
ATOM   11035 H  HB   . ILE A 1 10 ? -7.111  0.335   4.631   1.00 0.00 ? 538 ILE A HB   19 
ATOM   11036 H  HG12 . ILE A 1 10 ? -8.529  1.875   2.453   1.00 0.00 ? 538 ILE A HG12 19 
ATOM   11037 H  HG13 . ILE A 1 10 ? -8.329  0.126   2.419   1.00 0.00 ? 538 ILE A HG13 19 
ATOM   11038 H  HG21 . ILE A 1 10 ? -6.939  3.250   3.902   1.00 0.00 ? 538 ILE A HG21 19 
ATOM   11039 H  HG22 . ILE A 1 10 ? -6.293  2.454   5.337   1.00 0.00 ? 538 ILE A HG22 19 
ATOM   11040 H  HG23 . ILE A 1 10 ? -8.036  2.613   5.127   1.00 0.00 ? 538 ILE A HG23 19 
ATOM   11041 H  HD11 . ILE A 1 10 ? -9.509  1.295   4.863   1.00 0.00 ? 538 ILE A HD11 19 
ATOM   11042 H  HD12 . ILE A 1 10 ? -9.875  -0.217  4.032   1.00 0.00 ? 538 ILE A HD12 19 
ATOM   11043 H  HD13 . ILE A 1 10 ? -10.492 1.309   3.398   1.00 0.00 ? 538 ILE A HD13 19 
ATOM   11044 N  N    . CYS A 1 11 ? -4.094  2.065   4.189   1.00 0.00 ? 539 CYS A N    19 
ATOM   11045 C  CA   . CYS A 1 11 ? -2.901  2.141   5.023   1.00 0.00 ? 539 CYS A CA   19 
ATOM   11046 C  C    . CYS A 1 11 ? -3.155  1.521   6.393   1.00 0.00 ? 539 CYS A C    19 
ATOM   11047 O  O    . CYS A 1 11 ? -4.270  1.574   6.913   1.00 0.00 ? 539 CYS A O    19 
ATOM   11048 C  CB   . CYS A 1 11 ? -2.456  3.596   5.180   1.00 0.00 ? 539 CYS A CB   19 
ATOM   11049 S  SG   . CYS A 1 11 ? -0.698  3.794   5.552   1.00 0.00 ? 539 CYS A SG   19 
ATOM   11050 H  H    . CYS A 1 11 ? -4.500  2.894   3.858   1.00 0.00 ? 539 CYS A H    19 
ATOM   11051 H  HA   . CYS A 1 11 ? -2.117  1.586   4.530   1.00 0.00 ? 539 CYS A HA   19 
ATOM   11052 H  HB2  . CYS A 1 11 ? -2.658  4.126   4.262   1.00 0.00 ? 539 CYS A HB2  19 
ATOM   11053 H  HB3  . CYS A 1 11 ? -3.016  4.052   5.984   1.00 0.00 ? 539 CYS A HB3  19 
ATOM   11054 N  N    . HIS A 1 12 ? -2.114  0.930   6.971   1.00 0.00 ? 540 HIS A N    19 
ATOM   11055 C  CA   . HIS A 1 12 ? -2.224  0.297   8.280   1.00 0.00 ? 540 HIS A CA   19 
ATOM   11056 C  C    . HIS A 1 12 ? -2.470  1.333   9.372   1.00 0.00 ? 540 HIS A C    19 
ATOM   11057 O  O    . HIS A 1 12 ? -3.397  1.199   10.171  1.00 0.00 ? 540 HIS A O    19 
ATOM   11058 C  CB   . HIS A 1 12 ? -0.954  -0.496  8.592   1.00 0.00 ? 540 HIS A CB   19 
ATOM   11059 C  CG   . HIS A 1 12 ? -0.865  -1.797  7.857   1.00 0.00 ? 540 HIS A CG   19 
ATOM   11060 N  ND1  . HIS A 1 12 ? -0.681  -1.899  6.496   1.00 0.00 ? 540 HIS A ND1  19 
ATOM   11061 C  CD2  . HIS A 1 12 ? -0.936  -3.071  8.321   1.00 0.00 ? 540 HIS A CD2  19 
ATOM   11062 C  CE1  . HIS A 1 12 ? -0.648  -3.201  6.181   1.00 0.00 ? 540 HIS A CE1  19 
ATOM   11063 N  NE2  . HIS A 1 12 ? -0.798  -3.955  7.254   1.00 0.00 ? 540 HIS A NE2  19 
ATOM   11064 H  H    . HIS A 1 12 ? -1.252  0.919   6.506   1.00 0.00 ? 540 HIS A H    19 
ATOM   11065 H  HA   . HIS A 1 12 ? -3.063  -0.382  8.250   1.00 0.00 ? 540 HIS A HA   19 
ATOM   11066 H  HB2  . HIS A 1 12 ? -0.092  0.096   8.323   1.00 0.00 ? 540 HIS A HB2  19 
ATOM   11067 H  HB3  . HIS A 1 12 ? -0.922  -0.709  9.651   1.00 0.00 ? 540 HIS A HB3  19 
ATOM   11068 H  HD1  . HIS A 1 12 ? -0.592  -1.152  5.868   1.00 0.00 ? 540 HIS A HD1  19 
ATOM   11069 H  HD2  . HIS A 1 12 ? -1.076  -3.364  9.351   1.00 0.00 ? 540 HIS A HD2  19 
ATOM   11070 H  HE1  . HIS A 1 12 ? -0.515  -3.584  5.180   1.00 0.00 ? 540 HIS A HE1  19 
ATOM   11071 N  N    . ILE A 1 13 ? -1.634  2.366   9.401   1.00 0.00 ? 541 ILE A N    19 
ATOM   11072 C  CA   . ILE A 1 13 ? -1.761  3.423   10.397  1.00 0.00 ? 541 ILE A CA   19 
ATOM   11073 C  C    . ILE A 1 13 ? -3.017  4.255   10.163  1.00 0.00 ? 541 ILE A C    19 
ATOM   11074 O  O    . ILE A 1 13 ? -3.522  4.334   9.043   1.00 0.00 ? 541 ILE A O    19 
ATOM   11075 C  CB   . ILE A 1 13 ? -0.533  4.354   10.390  1.00 0.00 ? 541 ILE A CB   19 
ATOM   11076 C  CG1  . ILE A 1 13 ? -0.370  5.011   9.019   1.00 0.00 ? 541 ILE A CG1  19 
ATOM   11077 C  CG2  . ILE A 1 13 ? 0.721   3.580   10.766  1.00 0.00 ? 541 ILE A CG2  19 
ATOM   11078 C  CD1  . ILE A 1 13 ? 0.100   6.448   9.090   1.00 0.00 ? 541 ILE A CD1  19 
ATOM   11079 H  H    . ILE A 1 13 ? -0.913  2.417   8.739   1.00 0.00 ? 541 ILE A H    19 
ATOM   11080 H  HA   . ILE A 1 13 ? -1.827  2.957   11.370  1.00 0.00 ? 541 ILE A HA   19 
ATOM   11081 H  HB   . ILE A 1 13 ? -0.688  5.122   11.134  1.00 0.00 ? 541 ILE A HB   19 
ATOM   11082 H  HG12 . ILE A 1 13 ? 0.354   4.454   8.445   1.00 0.00 ? 541 ILE A HG12 19 
ATOM   11083 H  HG13 . ILE A 1 13 ? -1.319  4.996   8.504   1.00 0.00 ? 541 ILE A HG13 19 
ATOM   11084 H  HG21 . ILE A 1 13 ? 1.096   3.059   9.897   1.00 0.00 ? 541 ILE A HG21 19 
ATOM   11085 H  HG22 . ILE A 1 13 ? 0.484   2.864   11.540  1.00 0.00 ? 541 ILE A HG22 19 
ATOM   11086 H  HG23 . ILE A 1 13 ? 1.473   4.265   11.127  1.00 0.00 ? 541 ILE A HG23 19 
ATOM   11087 H  HD11 . ILE A 1 13 ? -0.314  6.919   9.969   1.00 0.00 ? 541 ILE A HD11 19 
ATOM   11088 H  HD12 . ILE A 1 13 ? -0.230  6.978   8.208   1.00 0.00 ? 541 ILE A HD12 19 
ATOM   11089 H  HD13 . ILE A 1 13 ? 1.178   6.472   9.142   1.00 0.00 ? 541 ILE A HD13 19 
ATOM   11090 N  N    . GLN A 1 14 ? -3.516  4.873   11.227  1.00 0.00 ? 542 GLN A N    19 
ATOM   11091 C  CA   . GLN A 1 14 ? -4.710  5.698   11.144  1.00 0.00 ? 542 GLN A CA   19 
ATOM   11092 C  C    . GLN A 1 14 ? -4.357  7.132   10.757  1.00 0.00 ? 542 GLN A C    19 
ATOM   11093 O  O    . GLN A 1 14 ? -4.693  8.079   11.469  1.00 0.00 ? 542 GLN A O    19 
ATOM   11094 C  CB   . GLN A 1 14 ? -5.459  5.683   12.478  1.00 0.00 ? 542 GLN A CB   19 
ATOM   11095 C  CG   . GLN A 1 14 ? -4.613  6.138   13.656  1.00 0.00 ? 542 GLN A CG   19 
ATOM   11096 C  CD   . GLN A 1 14 ? -5.420  6.285   14.932  1.00 0.00 ? 542 GLN A CD   19 
ATOM   11097 O  OE1  . GLN A 1 14 ? -6.474  5.669   15.088  1.00 0.00 ? 542 GLN A OE1  19 
ATOM   11098 N  NE2  . GLN A 1 14 ? -4.927  7.106   15.852  1.00 0.00 ? 542 GLN A NE2  19 
ATOM   11099 H  H    . GLN A 1 14 ? -3.071  4.771   12.088  1.00 0.00 ? 542 GLN A H    19 
ATOM   11100 H  HA   . GLN A 1 14 ? -5.341  5.276   10.384  1.00 0.00 ? 542 GLN A HA   19 
ATOM   11101 H  HB2  . GLN A 1 14 ? -6.315  6.337   12.404  1.00 0.00 ? 542 GLN A HB2  19 
ATOM   11102 H  HB3  . GLN A 1 14 ? -5.801  4.678   12.675  1.00 0.00 ? 542 GLN A HB3  19 
ATOM   11103 H  HG2  . GLN A 1 14 ? -3.833  5.411   13.825  1.00 0.00 ? 542 GLN A HG2  19 
ATOM   11104 H  HG3  . GLN A 1 14 ? -4.168  7.092   13.416  1.00 0.00 ? 542 GLN A HG3  19 
ATOM   11105 H  HE21 . GLN A 1 14 ? -4.082  7.564   15.659  1.00 0.00 ? 542 GLN A HE21 19 
ATOM   11106 H  HE22 . GLN A 1 14 ? -5.428  7.220   16.686  1.00 0.00 ? 542 GLN A HE22 19 
ATOM   11107 N  N    . GLY A 1 15 ? -3.677  7.285   9.626   1.00 0.00 ? 543 GLY A N    19 
ATOM   11108 C  CA   . GLY A 1 15 ? -3.291  8.606   9.167   1.00 0.00 ? 543 GLY A CA   19 
ATOM   11109 C  C    . GLY A 1 15 ? -3.309  8.728   7.656   1.00 0.00 ? 543 GLY A C    19 
ATOM   11110 O  O    . GLY A 1 15 ? -3.949  9.625   7.107   1.00 0.00 ? 543 GLY A O    19 
ATOM   11111 H  H    . GLY A 1 15 ? -3.435  6.495   9.099   1.00 0.00 ? 543 GLY A H    19 
ATOM   11112 H  HA2  . GLY A 1 15 ? -3.973  9.333   9.584   1.00 0.00 ? 543 GLY A HA2  19 
ATOM   11113 H  HA3  . GLY A 1 15 ? -2.294  8.821   9.523   1.00 0.00 ? 543 GLY A HA3  19 
ATOM   11114 N  N    . CYS A 1 16 ? -2.605  7.823   6.983   1.00 0.00 ? 544 CYS A N    19 
ATOM   11115 C  CA   . CYS A 1 16 ? -2.542  7.833   5.527   1.00 0.00 ? 544 CYS A CA   19 
ATOM   11116 C  C    . CYS A 1 16 ? -3.914  7.552   4.922   1.00 0.00 ? 544 CYS A C    19 
ATOM   11117 O  O    . CYS A 1 16 ? -4.932  7.606   5.613   1.00 0.00 ? 544 CYS A O    19 
ATOM   11118 C  CB   . CYS A 1 16 ? -1.530  6.796   5.039   1.00 0.00 ? 544 CYS A CB   19 
ATOM   11119 S  SG   . CYS A 1 16 ? -0.346  7.430   3.831   1.00 0.00 ? 544 CYS A SG   19 
ATOM   11120 H  H    . CYS A 1 16 ? -2.116  7.133   7.477   1.00 0.00 ? 544 CYS A H    19 
ATOM   11121 H  HA   . CYS A 1 16 ? -2.218  8.815   5.216   1.00 0.00 ? 544 CYS A HA   19 
ATOM   11122 H  HB2  . CYS A 1 16 ? -0.968  6.427   5.884   1.00 0.00 ? 544 CYS A HB2  19 
ATOM   11123 H  HB3  . CYS A 1 16 ? -2.059  5.974   4.580   1.00 0.00 ? 544 CYS A HB3  19 
ATOM   11124 N  N    . GLY A 1 17 ? -3.934  7.251   3.627   1.00 0.00 ? 545 GLY A N    19 
ATOM   11125 C  CA   . GLY A 1 17 ? -5.186  6.965   2.952   1.00 0.00 ? 545 GLY A CA   19 
ATOM   11126 C  C    . GLY A 1 17 ? -5.073  7.087   1.445   1.00 0.00 ? 545 GLY A C    19 
ATOM   11127 O  O    . GLY A 1 17 ? -5.911  7.717   0.801   1.00 0.00 ? 545 GLY A O    19 
ATOM   11128 H  H    . GLY A 1 17 ? -3.092  7.222   3.127   1.00 0.00 ? 545 GLY A H    19 
ATOM   11129 H  HA2  . GLY A 1 17 ? -5.494  5.960   3.200   1.00 0.00 ? 545 GLY A HA2  19 
ATOM   11130 H  HA3  . GLY A 1 17 ? -5.937  7.657   3.303   1.00 0.00 ? 545 GLY A HA3  19 
ATOM   11131 N  N    . LYS A 1 18 ? -4.031  6.482   0.882   1.00 0.00 ? 546 LYS A N    19 
ATOM   11132 C  CA   . LYS A 1 18 ? -3.808  6.525   -0.559  1.00 0.00 ? 546 LYS A CA   19 
ATOM   11133 C  C    . LYS A 1 18 ? -4.602  5.433   -1.268  1.00 0.00 ? 546 LYS A C    19 
ATOM   11134 O  O    . LYS A 1 18 ? -5.124  5.643   -2.363  1.00 0.00 ? 546 LYS A O    19 
ATOM   11135 C  CB   . LYS A 1 18 ? -2.319  6.368   -0.870  1.00 0.00 ? 546 LYS A CB   19 
ATOM   11136 C  CG   . LYS A 1 18 ? -1.718  5.074   -0.344  1.00 0.00 ? 546 LYS A CG   19 
ATOM   11137 C  CD   . LYS A 1 18 ? -0.339  5.301   0.253   1.00 0.00 ? 546 LYS A CD   19 
ATOM   11138 C  CE   . LYS A 1 18 ? 0.744   5.262   -0.813  1.00 0.00 ? 546 LYS A CE   19 
ATOM   11139 N  NZ   . LYS A 1 18 ? 1.782   6.305   -0.588  1.00 0.00 ? 546 LYS A NZ   19 
ATOM   11140 H  H    . LYS A 1 18 ? -3.397  5.996   1.450   1.00 0.00 ? 546 LYS A H    19 
ATOM   11141 H  HA   . LYS A 1 18 ? -4.142  7.487   -0.917  1.00 0.00 ? 546 LYS A HA   19 
ATOM   11142 H  HB2  . LYS A 1 18 ? -2.184  6.392   -1.941  1.00 0.00 ? 546 LYS A HB2  19 
ATOM   11143 H  HB3  . LYS A 1 18 ? -1.783  7.195   -0.430  1.00 0.00 ? 546 LYS A HB3  19 
ATOM   11144 H  HG2  . LYS A 1 18 ? -2.367  4.671   0.418   1.00 0.00 ? 546 LYS A HG2  19 
ATOM   11145 H  HG3  . LYS A 1 18 ? -1.636  4.370   -1.159  1.00 0.00 ? 546 LYS A HG3  19 
ATOM   11146 H  HD2  . LYS A 1 18 ? -0.321  6.267   0.735   1.00 0.00 ? 546 LYS A HD2  19 
ATOM   11147 H  HD3  . LYS A 1 18 ? -0.143  4.529   0.982   1.00 0.00 ? 546 LYS A HD3  19 
ATOM   11148 H  HE2  . LYS A 1 18 ? 1.214   4.290   -0.795  1.00 0.00 ? 546 LYS A HE2  19 
ATOM   11149 H  HE3  . LYS A 1 18 ? 0.288   5.422   -1.778  1.00 0.00 ? 546 LYS A HE3  19 
ATOM   11150 H  HZ1  . LYS A 1 18 ? 2.340   6.078   0.260   1.00 0.00 ? 546 LYS A HZ1  19 
ATOM   11151 H  HZ2  . LYS A 1 18 ? 1.333   7.234   -0.455  1.00 0.00 ? 546 LYS A HZ2  19 
ATOM   11152 H  HZ3  . LYS A 1 18 ? 2.421   6.356   -1.407  1.00 0.00 ? 546 LYS A HZ3  19 
ATOM   11153 N  N    . VAL A 1 19 ? -4.690  4.269   -0.635  1.00 0.00 ? 547 VAL A N    19 
ATOM   11154 C  CA   . VAL A 1 19 ? -5.420  3.143   -1.200  1.00 0.00 ? 547 VAL A CA   19 
ATOM   11155 C  C    . VAL A 1 19 ? -4.879  2.774   -2.580  1.00 0.00 ? 547 VAL A C    19 
ATOM   11156 O  O    . VAL A 1 19 ? -5.216  3.407   -3.580  1.00 0.00 ? 547 VAL A O    19 
ATOM   11157 C  CB   . VAL A 1 19 ? -6.924  3.463   -1.301  1.00 0.00 ? 547 VAL A CB   19 
ATOM   11158 C  CG1  . VAL A 1 19 ? -7.666  2.386   -2.081  1.00 0.00 ? 547 VAL A CG1  19 
ATOM   11159 C  CG2  . VAL A 1 19 ? -7.524  3.631   0.087   1.00 0.00 ? 547 VAL A CG2  19 
ATOM   11160 H  H    . VAL A 1 19 ? -4.257  4.167   0.233   1.00 0.00 ? 547 VAL A H    19 
ATOM   11161 H  HA   . VAL A 1 19 ? -5.296  2.299   -0.537  1.00 0.00 ? 547 VAL A HA   19 
ATOM   11162 H  HB   . VAL A 1 19 ? -7.030  4.398   -1.827  1.00 0.00 ? 547 VAL A HB   19 
ATOM   11163 H  HG11 . VAL A 1 19 ? -7.739  2.678   -3.118  1.00 0.00 ? 547 VAL A HG11 19 
ATOM   11164 H  HG12 . VAL A 1 19 ? -8.658  2.264   -1.671  1.00 0.00 ? 547 VAL A HG12 19 
ATOM   11165 H  HG13 . VAL A 1 19 ? -7.129  1.452   -2.007  1.00 0.00 ? 547 VAL A HG13 19 
ATOM   11166 H  HG21 . VAL A 1 19 ? -6.948  3.059   0.800   1.00 0.00 ? 547 VAL A HG21 19 
ATOM   11167 H  HG22 . VAL A 1 19 ? -8.545  3.278   0.083   1.00 0.00 ? 547 VAL A HG22 19 
ATOM   11168 H  HG23 . VAL A 1 19 ? -7.505  4.675   0.363   1.00 0.00 ? 547 VAL A HG23 19 
ATOM   11169 N  N    . TYR A 1 20 ? -4.038  1.745   -2.623  1.00 0.00 ? 548 TYR A N    19 
ATOM   11170 C  CA   . TYR A 1 20 ? -3.449  1.289   -3.877  1.00 0.00 ? 548 TYR A CA   19 
ATOM   11171 C  C    . TYR A 1 20 ? -4.116  0.003   -4.354  1.00 0.00 ? 548 TYR A C    19 
ATOM   11172 O  O    . TYR A 1 20 ? -4.664  -0.757  -3.556  1.00 0.00 ? 548 TYR A O    19 
ATOM   11173 C  CB   . TYR A 1 20 ? -1.946  1.065   -3.707  1.00 0.00 ? 548 TYR A CB   19 
ATOM   11174 C  CG   . TYR A 1 20 ? -1.110  2.282   -4.035  1.00 0.00 ? 548 TYR A CG   19 
ATOM   11175 C  CD1  . TYR A 1 20 ? -1.501  3.549   -3.623  1.00 0.00 ? 548 TYR A CD1  19 
ATOM   11176 C  CD2  . TYR A 1 20 ? 0.071   2.162   -4.758  1.00 0.00 ? 548 TYR A CD2  19 
ATOM   11177 C  CE1  . TYR A 1 20 ? -0.739  4.663   -3.922  1.00 0.00 ? 548 TYR A CE1  19 
ATOM   11178 C  CE2  . TYR A 1 20 ? 0.838   3.271   -5.060  1.00 0.00 ? 548 TYR A CE2  19 
ATOM   11179 C  CZ   . TYR A 1 20 ? 0.429   4.519   -4.640  1.00 0.00 ? 548 TYR A CZ   19 
ATOM   11180 O  OH   . TYR A 1 20 ? 1.190   5.625   -4.939  1.00 0.00 ? 548 TYR A OH   19 
ATOM   11181 H  H    . TYR A 1 20 ? -3.808  1.280   -1.791  1.00 0.00 ? 548 TYR A H    19 
ATOM   11182 H  HA   . TYR A 1 20 ? -3.608  2.059   -4.617  1.00 0.00 ? 548 TYR A HA   19 
ATOM   11183 H  HB2  . TYR A 1 20 ? -1.744  0.792   -2.682  1.00 0.00 ? 548 TYR A HB2  19 
ATOM   11184 H  HB3  . TYR A 1 20 ? -1.633  0.261   -4.357  1.00 0.00 ? 548 TYR A HB3  19 
ATOM   11185 H  HD1  . TYR A 1 20 ? -2.416  3.659   -3.061  1.00 0.00 ? 548 TYR A HD1  19 
ATOM   11186 H  HD2  . TYR A 1 20 ? 0.389   1.183   -5.086  1.00 0.00 ? 548 TYR A HD2  19 
ATOM   11187 H  HE1  . TYR A 1 20 ? -1.060  5.640   -3.592  1.00 0.00 ? 548 TYR A HE1  19 
ATOM   11188 H  HE2  . TYR A 1 20 ? 1.753   3.157   -5.623  1.00 0.00 ? 548 TYR A HE2  19 
ATOM   11189 H  HH   . TYR A 1 20 ? 1.389   6.105   -4.132  1.00 0.00 ? 548 TYR A HH   19 
ATOM   11190 N  N    . GLY A 1 21 ? -4.065  -0.235  -5.661  1.00 0.00 ? 549 GLY A N    19 
ATOM   11191 C  CA   . GLY A 1 21 ? -4.669  -1.431  -6.220  1.00 0.00 ? 549 GLY A CA   19 
ATOM   11192 C  C    . GLY A 1 21 ? -3.690  -2.586  -6.329  1.00 0.00 ? 549 GLY A C    19 
ATOM   11193 O  O    . GLY A 1 21 ? -3.938  -3.549  -7.055  1.00 0.00 ? 549 GLY A O    19 
ATOM   11194 H  H    . GLY A 1 21 ? -3.615  0.406   -6.250  1.00 0.00 ? 549 GLY A H    19 
ATOM   11195 H  HA2  . GLY A 1 21 ? -5.493  -1.731  -5.590  1.00 0.00 ? 549 GLY A HA2  19 
ATOM   11196 H  HA3  . GLY A 1 21 ? -5.048  -1.201  -7.205  1.00 0.00 ? 549 GLY A HA3  19 
ATOM   11197 N  N    . LYS A 1 22 ? -2.576  -2.493  -5.607  1.00 0.00 ? 550 LYS A N    19 
ATOM   11198 C  CA   . LYS A 1 22 ? -1.563  -3.542  -5.630  1.00 0.00 ? 550 LYS A CA   19 
ATOM   11199 C  C    . LYS A 1 22 ? -0.838  -3.628  -4.290  1.00 0.00 ? 550 LYS A C    19 
ATOM   11200 O  O    . LYS A 1 22 ? -0.320  -2.630  -3.789  1.00 0.00 ? 550 LYS A O    19 
ATOM   11201 C  CB   . LYS A 1 22 ? -0.558  -3.286  -6.757  1.00 0.00 ? 550 LYS A CB   19 
ATOM   11202 C  CG   . LYS A 1 22 ? -0.376  -4.472  -7.690  1.00 0.00 ? 550 LYS A CG   19 
ATOM   11203 C  CD   . LYS A 1 22 ? 0.059   -5.717  -6.933  1.00 0.00 ? 550 LYS A CD   19 
ATOM   11204 C  CE   . LYS A 1 22 ? -0.675  -6.954  -7.425  1.00 0.00 ? 550 LYS A CE   19 
ATOM   11205 N  NZ   . LYS A 1 22 ? -0.434  -7.204  -8.873  1.00 0.00 ? 550 LYS A NZ   19 
ATOM   11206 H  H    . LYS A 1 22 ? -2.433  -1.704  -5.046  1.00 0.00 ? 550 LYS A H    19 
ATOM   11207 H  HA   . LYS A 1 22 ? -2.064  -4.481  -5.814  1.00 0.00 ? 550 LYS A HA   19 
ATOM   11208 H  HB2  . LYS A 1 22 ? -0.899  -2.444  -7.342  1.00 0.00 ? 550 LYS A HB2  19 
ATOM   11209 H  HB3  . LYS A 1 22 ? 0.402   -3.046  -6.323  1.00 0.00 ? 550 LYS A HB3  19 
ATOM   11210 H  HG2  . LYS A 1 22 ? -1.314  -4.674  -8.186  1.00 0.00 ? 550 LYS A HG2  19 
ATOM   11211 H  HG3  . LYS A 1 22 ? 0.376   -4.227  -8.425  1.00 0.00 ? 550 LYS A HG3  19 
ATOM   11212 H  HD2  . LYS A 1 22 ? 1.120   -5.860  -7.074  1.00 0.00 ? 550 LYS A HD2  19 
ATOM   11213 H  HD3  . LYS A 1 22 ? -0.150  -5.579  -5.882  1.00 0.00 ? 550 LYS A HD3  19 
ATOM   11214 H  HE2  . LYS A 1 22 ? -0.332  -7.808  -6.860  1.00 0.00 ? 550 LYS A HE2  19 
ATOM   11215 H  HE3  . LYS A 1 22 ? -1.734  -6.817  -7.262  1.00 0.00 ? 550 LYS A HE3  19 
ATOM   11216 H  HZ1  . LYS A 1 22 ? -0.974  -6.524  -9.447  1.00 0.00 ? 550 LYS A HZ1  19 
ATOM   11217 H  HZ2  . LYS A 1 22 ? -0.734  -8.167  -9.124  1.00 0.00 ? 550 LYS A HZ2  19 
ATOM   11218 H  HZ3  . LYS A 1 22 ? 0.577   -7.100  -9.090  1.00 0.00 ? 550 LYS A HZ3  19 
ATOM   11219 N  N    . THR A 1 23 ? -0.806  -4.826  -3.715  1.00 0.00 ? 551 THR A N    19 
ATOM   11220 C  CA   . THR A 1 23 ? -0.145  -5.041  -2.433  1.00 0.00 ? 551 THR A CA   19 
ATOM   11221 C  C    . THR A 1 23 ? 1.371   -4.939  -2.574  1.00 0.00 ? 551 THR A C    19 
ATOM   11222 O  O    . THR A 1 23 ? 2.069   -4.576  -1.627  1.00 0.00 ? 551 THR A O    19 
ATOM   11223 C  CB   . THR A 1 23 ? -0.524  -6.409  -1.863  1.00 0.00 ? 551 THR A CB   19 
ATOM   11224 O  OG1  . THR A 1 23 ? 0.068   -6.604  -0.591  1.00 0.00 ? 551 THR A OG1  19 
ATOM   11225 C  CG2  . THR A 1 23 ? -0.105  -7.564  -2.746  1.00 0.00 ? 551 THR A CG2  19 
ATOM   11226 H  H    . THR A 1 23 ? -1.237  -5.583  -4.164  1.00 0.00 ? 551 THR A H    19 
ATOM   11227 H  HA   . THR A 1 23 ? -0.482  -4.272  -1.754  1.00 0.00 ? 551 THR A HA   19 
ATOM   11228 H  HB   . THR A 1 23 ? -1.598  -6.453  -1.747  1.00 0.00 ? 551 THR A HB   19 
ATOM   11229 H  HG1  . THR A 1 23 ? -0.303  -5.977  0.035   1.00 0.00 ? 551 THR A HG1  19 
ATOM   11230 H  HG21 . THR A 1 23 ? 0.965   -7.696  -2.682  1.00 0.00 ? 551 THR A HG21 19 
ATOM   11231 H  HG22 . THR A 1 23 ? -0.382  -7.354  -3.769  1.00 0.00 ? 551 THR A HG22 19 
ATOM   11232 H  HG23 . THR A 1 23 ? -0.599  -8.466  -2.417  1.00 0.00 ? 551 THR A HG23 19 
ATOM   11233 N  N    . SER A 1 24 ? 1.876   -5.261  -3.761  1.00 0.00 ? 552 SER A N    19 
ATOM   11234 C  CA   . SER A 1 24 ? 3.311   -5.204  -4.022  1.00 0.00 ? 552 SER A CA   19 
ATOM   11235 C  C    . SER A 1 24 ? 3.852   -3.799  -3.780  1.00 0.00 ? 552 SER A C    19 
ATOM   11236 O  O    . SER A 1 24 ? 4.999   -3.629  -3.370  1.00 0.00 ? 552 SER A O    19 
ATOM   11237 C  CB   . SER A 1 24 ? 3.607   -5.638  -5.459  1.00 0.00 ? 552 SER A CB   19 
ATOM   11238 O  OG   . SER A 1 24 ? 4.806   -6.390  -5.528  1.00 0.00 ? 552 SER A OG   19 
ATOM   11239 H  H    . SER A 1 24 ? 1.271   -5.544  -4.478  1.00 0.00 ? 552 SER A H    19 
ATOM   11240 H  HA   . SER A 1 24 ? 3.799   -5.886  -3.341  1.00 0.00 ? 552 SER A HA   19 
ATOM   11241 H  HB2  . SER A 1 24 ? 2.794   -6.246  -5.824  1.00 0.00 ? 552 SER A HB2  19 
ATOM   11242 H  HB3  . SER A 1 24 ? 3.709   -4.762  -6.083  1.00 0.00 ? 552 SER A HB3  19 
ATOM   11243 H  HG   . SER A 1 24 ? 5.292   -6.146  -6.319  1.00 0.00 ? 552 SER A HG   19 
ATOM   11244 N  N    . HIS A 1 25 ? 3.018   -2.796  -4.034  1.00 0.00 ? 553 HIS A N    19 
ATOM   11245 C  CA   . HIS A 1 25 ? 3.415   -1.407  -3.840  1.00 0.00 ? 553 HIS A CA   19 
ATOM   11246 C  C    . HIS A 1 25 ? 3.416   -1.048  -2.358  1.00 0.00 ? 553 HIS A C    19 
ATOM   11247 O  O    . HIS A 1 25 ? 4.198   -0.207  -1.912  1.00 0.00 ? 553 HIS A O    19 
ATOM   11248 C  CB   . HIS A 1 25 ? 2.476   -0.473  -4.608  1.00 0.00 ? 553 HIS A CB   19 
ATOM   11249 C  CG   . HIS A 1 25 ? 3.161   0.309   -5.686  1.00 0.00 ? 553 HIS A CG   19 
ATOM   11250 N  ND1  . HIS A 1 25 ? 2.564   0.665   -6.874  1.00 0.00 ? 553 HIS A ND1  19 
ATOM   11251 C  CD2  . HIS A 1 25 ? 4.423   0.807   -5.737  1.00 0.00 ? 553 HIS A CD2  19 
ATOM   11252 C  CE1  . HIS A 1 25 ? 3.460   1.352   -7.595  1.00 0.00 ? 553 HIS A CE1  19 
ATOM   11253 N  NE2  . HIS A 1 25 ? 4.605   1.467   -6.949  1.00 0.00 ? 553 HIS A NE2  19 
ATOM   11254 H  H    . HIS A 1 25 ? 2.115   -2.995  -4.358  1.00 0.00 ? 553 HIS A H    19 
ATOM   11255 H  HA   . HIS A 1 25 ? 4.418   -1.292  -4.224  1.00 0.00 ? 553 HIS A HA   19 
ATOM   11256 H  HB2  . HIS A 1 25 ? 1.695   -1.059  -5.069  1.00 0.00 ? 553 HIS A HB2  19 
ATOM   11257 H  HB3  . HIS A 1 25 ? 2.031   0.230   -3.918  1.00 0.00 ? 553 HIS A HB3  19 
ATOM   11258 H  HD1  . HIS A 1 25 ? 1.646   0.453   -7.145  1.00 0.00 ? 553 HIS A HD1  19 
ATOM   11259 H  HD2  . HIS A 1 25 ? 5.173   0.713   -4.966  1.00 0.00 ? 553 HIS A HD2  19 
ATOM   11260 H  HE1  . HIS A 1 25 ? 3.270   1.761   -8.577  1.00 0.00 ? 553 HIS A HE1  19 
ATOM   11261 N  N    . LEU A 1 26 ? 2.537   -1.693  -1.597  1.00 0.00 ? 554 LEU A N    19 
ATOM   11262 C  CA   . LEU A 1 26 ? 2.440   -1.443  -0.164  1.00 0.00 ? 554 LEU A CA   19 
ATOM   11263 C  C    . LEU A 1 26 ? 3.775   -1.712  0.523   1.00 0.00 ? 554 LEU A C    19 
ATOM   11264 O  O    . LEU A 1 26 ? 4.106   -1.082  1.528   1.00 0.00 ? 554 LEU A O    19 
ATOM   11265 C  CB   . LEU A 1 26 ? 1.343   -2.315  0.455   1.00 0.00 ? 554 LEU A CB   19 
ATOM   11266 C  CG   . LEU A 1 26 ? 0.041   -1.581  0.780   1.00 0.00 ? 554 LEU A CG   19 
ATOM   11267 C  CD1  . LEU A 1 26 ? -0.610  -1.062  -0.493  1.00 0.00 ? 554 LEU A CD1  19 
ATOM   11268 C  CD2  . LEU A 1 26 ? -0.912  -2.498  1.533   1.00 0.00 ? 554 LEU A CD2  19 
ATOM   11269 H  H    . LEU A 1 26 ? 1.942   -2.353  -2.009  1.00 0.00 ? 554 LEU A H    19 
ATOM   11270 H  HA   . LEU A 1 26 ? 2.181   -0.404  -0.026  1.00 0.00 ? 554 LEU A HA   19 
ATOM   11271 H  HB2  . LEU A 1 26 ? 1.119   -3.116  -0.233  1.00 0.00 ? 554 LEU A HB2  19 
ATOM   11272 H  HB3  . LEU A 1 26 ? 1.724   -2.745  1.369   1.00 0.00 ? 554 LEU A HB3  19 
ATOM   11273 H  HG   . LEU A 1 26 ? 0.261   -0.733  1.412   1.00 0.00 ? 554 LEU A HG   19 
ATOM   11274 H  HD11 . LEU A 1 26 ? -0.724  -1.873  -1.196  1.00 0.00 ? 554 LEU A HD11 19 
ATOM   11275 H  HD12 . LEU A 1 26 ? 0.012   -0.293  -0.927  1.00 0.00 ? 554 LEU A HD12 19 
ATOM   11276 H  HD13 . LEU A 1 26 ? -1.581  -0.650  -0.258  1.00 0.00 ? 554 LEU A HD13 19 
ATOM   11277 H  HD21 . LEU A 1 26 ? -1.204  -3.317  0.893   1.00 0.00 ? 554 LEU A HD21 19 
ATOM   11278 H  HD22 . LEU A 1 26 ? -1.789  -1.941  1.828   1.00 0.00 ? 554 LEU A HD22 19 
ATOM   11279 H  HD23 . LEU A 1 26 ? -0.419  -2.886  2.412   1.00 0.00 ? 554 LEU A HD23 19 
ATOM   11280 N  N    . ARG A 1 27 ? 4.540   -2.651  -0.027  1.00 0.00 ? 555 ARG A N    19 
ATOM   11281 C  CA   . ARG A 1 27 ? 5.840   -3.000  0.533   1.00 0.00 ?